data_1EJ9
# 
_entry.id   1EJ9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1EJ9         pdb_00001ej9 10.2210/pdb1ej9/pdb 
NDB   PD0125       ?            ?                   
RCSB  RCSB010631   ?            ?                   
WWPDB D_1000010631 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1a36 . unspecified 
PDB 1a35 . unspecified 
PDB 1a31 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EJ9 
_pdbx_database_status.recvd_initial_deposition_date   2000-03-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Redinbo, M.R.'  1 
'Champoux, J.J.' 2 
'Hol, W.G.'      3 
# 
_citation.id                        primary 
_citation.title                     
'Novel insights into catalytic mechanism from a crystal structure of human topoisomerase I in complex with DNA.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            39 
_citation.page_first                6832 
_citation.page_last                 6840 
_citation.year                      2000 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10841763 
_citation.pdbx_database_id_DOI      10.1021/bi992690t 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Redinbo, M.R.'  1 ? 
primary 'Champoux, J.J.' 2 ? 
primary 'Hol, W.G.'      3 ? 
# 
_cell.entry_id           1EJ9 
_cell.length_a           56.98 
_cell.length_b           124.92 
_cell.length_c           72.29 
_cell.angle_alpha        90.0 
_cell.angle_beta         93.84 
_cell.angle_gamma        90.0 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EJ9 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     monoclinic 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*C*AP*AP*AP*AP*AP*GP*AP*CP*TP*CP*AP*GP*AP*AP*AP*AP*AP*TP*TP*TP*TP*T)-3')
;
7064.639  1   ?        ?     ?                                     ? 
2 polymer syn 
;DNA (5'-D(*C*AP*AP*AP*AP*AP*TP*TP*TP*TP*TP*CP*TP*GP*AP*GP*TP*CP*TP*TP*TP*TP*T)-3')
;
7010.554  1   ?        ?     ?                                     ? 
3 polymer man 'DNA TOPOISOMERASE I'                                                                66593.836 1   5.99.1.2 Y723F 
'C-TERMINAL DOMAIN, RESIDUES 203-765' ? 
4 water   nat water                                                                                18.015    353 ?        ?     ? 
? 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        E.C.5.99.1.2 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DC)(DA)(DA)(DA)(DA)(DA)(DG)(DA)(DC)(DT)(DC)(DA)(DG)(DA)(DA)(DA)(DA)(DA)(DT)(DT)
(DT)(DT)(DT)
;
CAAAAAGACTCAGAAAAATTTTT C ? 
2 polydeoxyribonucleotide no no 
;(DC)(DA)(DA)(DA)(DA)(DA)(DT)(DT)(DT)(DT)(DT)(DC)(DT)(DG)(DA)(DG)(DT)(DC)(DT)(DT)
(DT)(DT)(DT)
;
CAAAAATTTTTCTGAGTCTTTTT D ? 
3 'polypeptide(L)'        no no 
;WKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDW
RKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFR
GRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQ
KYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQE
YVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQL
KELTAPDENIPAKILSYNRANRAVAILCNHQIAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKK
VVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNFLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADED
YEF
;
;WKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDW
RKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFR
GRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQ
KYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQE
YVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQL
KELTAPDENIPAKILSYNRANRAVAILCNHQIAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKK
VVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNFLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADED
YEF
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DA  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DG  n 
1 8   DA  n 
1 9   DC  n 
1 10  DT  n 
1 11  DC  n 
1 12  DA  n 
1 13  DG  n 
1 14  DA  n 
1 15  DA  n 
1 16  DA  n 
1 17  DA  n 
1 18  DA  n 
1 19  DT  n 
1 20  DT  n 
1 21  DT  n 
1 22  DT  n 
1 23  DT  n 
2 1   DC  n 
2 2   DA  n 
2 3   DA  n 
2 4   DA  n 
2 5   DA  n 
2 6   DA  n 
2 7   DT  n 
2 8   DT  n 
2 9   DT  n 
2 10  DT  n 
2 11  DT  n 
2 12  DC  n 
2 13  DT  n 
2 14  DG  n 
2 15  DA  n 
2 16  DG  n 
2 17  DT  n 
2 18  DC  n 
2 19  DT  n 
2 20  DT  n 
2 21  DT  n 
2 22  DT  n 
2 23  DT  n 
3 1   TRP n 
3 2   LYS n 
3 3   TRP n 
3 4   TRP n 
3 5   GLU n 
3 6   GLU n 
3 7   GLU n 
3 8   ARG n 
3 9   TYR n 
3 10  PRO n 
3 11  GLU n 
3 12  GLY n 
3 13  ILE n 
3 14  LYS n 
3 15  TRP n 
3 16  LYS n 
3 17  PHE n 
3 18  LEU n 
3 19  GLU n 
3 20  HIS n 
3 21  LYS n 
3 22  GLY n 
3 23  PRO n 
3 24  VAL n 
3 25  PHE n 
3 26  ALA n 
3 27  PRO n 
3 28  PRO n 
3 29  TYR n 
3 30  GLU n 
3 31  PRO n 
3 32  LEU n 
3 33  PRO n 
3 34  GLU n 
3 35  ASN n 
3 36  VAL n 
3 37  LYS n 
3 38  PHE n 
3 39  TYR n 
3 40  TYR n 
3 41  ASP n 
3 42  GLY n 
3 43  LYS n 
3 44  VAL n 
3 45  MET n 
3 46  LYS n 
3 47  LEU n 
3 48  SER n 
3 49  PRO n 
3 50  LYS n 
3 51  ALA n 
3 52  GLU n 
3 53  GLU n 
3 54  VAL n 
3 55  ALA n 
3 56  THR n 
3 57  PHE n 
3 58  PHE n 
3 59  ALA n 
3 60  LYS n 
3 61  MET n 
3 62  LEU n 
3 63  ASP n 
3 64  HIS n 
3 65  GLU n 
3 66  TYR n 
3 67  THR n 
3 68  THR n 
3 69  LYS n 
3 70  GLU n 
3 71  ILE n 
3 72  PHE n 
3 73  ARG n 
3 74  LYS n 
3 75  ASN n 
3 76  PHE n 
3 77  PHE n 
3 78  LYS n 
3 79  ASP n 
3 80  TRP n 
3 81  ARG n 
3 82  LYS n 
3 83  GLU n 
3 84  MET n 
3 85  THR n 
3 86  ASN n 
3 87  GLU n 
3 88  GLU n 
3 89  LYS n 
3 90  ASN n 
3 91  ILE n 
3 92  ILE n 
3 93  THR n 
3 94  ASN n 
3 95  LEU n 
3 96  SER n 
3 97  LYS n 
3 98  CYS n 
3 99  ASP n 
3 100 PHE n 
3 101 THR n 
3 102 GLN n 
3 103 MET n 
3 104 SER n 
3 105 GLN n 
3 106 TYR n 
3 107 PHE n 
3 108 LYS n 
3 109 ALA n 
3 110 GLN n 
3 111 THR n 
3 112 GLU n 
3 113 ALA n 
3 114 ARG n 
3 115 LYS n 
3 116 GLN n 
3 117 MET n 
3 118 SER n 
3 119 LYS n 
3 120 GLU n 
3 121 GLU n 
3 122 LYS n 
3 123 LEU n 
3 124 LYS n 
3 125 ILE n 
3 126 LYS n 
3 127 GLU n 
3 128 GLU n 
3 129 ASN n 
3 130 GLU n 
3 131 LYS n 
3 132 LEU n 
3 133 LEU n 
3 134 LYS n 
3 135 GLU n 
3 136 TYR n 
3 137 GLY n 
3 138 PHE n 
3 139 CYS n 
3 140 ILE n 
3 141 MET n 
3 142 ASP n 
3 143 ASN n 
3 144 HIS n 
3 145 LYS n 
3 146 GLU n 
3 147 ARG n 
3 148 ILE n 
3 149 ALA n 
3 150 ASN n 
3 151 PHE n 
3 152 LYS n 
3 153 ILE n 
3 154 GLU n 
3 155 PRO n 
3 156 PRO n 
3 157 GLY n 
3 158 LEU n 
3 159 PHE n 
3 160 ARG n 
3 161 GLY n 
3 162 ARG n 
3 163 GLY n 
3 164 ASN n 
3 165 HIS n 
3 166 PRO n 
3 167 LYS n 
3 168 MET n 
3 169 GLY n 
3 170 MET n 
3 171 LEU n 
3 172 LYS n 
3 173 ARG n 
3 174 ARG n 
3 175 ILE n 
3 176 MET n 
3 177 PRO n 
3 178 GLU n 
3 179 ASP n 
3 180 ILE n 
3 181 ILE n 
3 182 ILE n 
3 183 ASN n 
3 184 CYS n 
3 185 SER n 
3 186 LYS n 
3 187 ASP n 
3 188 ALA n 
3 189 LYS n 
3 190 VAL n 
3 191 PRO n 
3 192 SER n 
3 193 PRO n 
3 194 PRO n 
3 195 PRO n 
3 196 GLY n 
3 197 HIS n 
3 198 LYS n 
3 199 TRP n 
3 200 LYS n 
3 201 GLU n 
3 202 VAL n 
3 203 ARG n 
3 204 HIS n 
3 205 ASP n 
3 206 ASN n 
3 207 LYS n 
3 208 VAL n 
3 209 THR n 
3 210 TRP n 
3 211 LEU n 
3 212 VAL n 
3 213 SER n 
3 214 TRP n 
3 215 THR n 
3 216 GLU n 
3 217 ASN n 
3 218 ILE n 
3 219 GLN n 
3 220 GLY n 
3 221 SER n 
3 222 ILE n 
3 223 LYS n 
3 224 TYR n 
3 225 ILE n 
3 226 MET n 
3 227 LEU n 
3 228 ASN n 
3 229 PRO n 
3 230 SER n 
3 231 SER n 
3 232 ARG n 
3 233 ILE n 
3 234 LYS n 
3 235 GLY n 
3 236 GLU n 
3 237 LYS n 
3 238 ASP n 
3 239 TRP n 
3 240 GLN n 
3 241 LYS n 
3 242 TYR n 
3 243 GLU n 
3 244 THR n 
3 245 ALA n 
3 246 ARG n 
3 247 ARG n 
3 248 LEU n 
3 249 LYS n 
3 250 LYS n 
3 251 CYS n 
3 252 VAL n 
3 253 ASP n 
3 254 LYS n 
3 255 ILE n 
3 256 ARG n 
3 257 ASN n 
3 258 GLN n 
3 259 TYR n 
3 260 ARG n 
3 261 GLU n 
3 262 ASP n 
3 263 TRP n 
3 264 LYS n 
3 265 SER n 
3 266 LYS n 
3 267 GLU n 
3 268 MET n 
3 269 LYS n 
3 270 VAL n 
3 271 ARG n 
3 272 GLN n 
3 273 ARG n 
3 274 ALA n 
3 275 VAL n 
3 276 ALA n 
3 277 LEU n 
3 278 TYR n 
3 279 PHE n 
3 280 ILE n 
3 281 ASP n 
3 282 LYS n 
3 283 LEU n 
3 284 ALA n 
3 285 LEU n 
3 286 ARG n 
3 287 ALA n 
3 288 GLY n 
3 289 ASN n 
3 290 GLU n 
3 291 LYS n 
3 292 GLU n 
3 293 GLU n 
3 294 GLY n 
3 295 GLU n 
3 296 THR n 
3 297 ALA n 
3 298 ASP n 
3 299 THR n 
3 300 VAL n 
3 301 GLY n 
3 302 CYS n 
3 303 CYS n 
3 304 SER n 
3 305 LEU n 
3 306 ARG n 
3 307 VAL n 
3 308 GLU n 
3 309 HIS n 
3 310 ILE n 
3 311 ASN n 
3 312 LEU n 
3 313 HIS n 
3 314 PRO n 
3 315 GLU n 
3 316 LEU n 
3 317 ASP n 
3 318 GLY n 
3 319 GLN n 
3 320 GLU n 
3 321 TYR n 
3 322 VAL n 
3 323 VAL n 
3 324 GLU n 
3 325 PHE n 
3 326 ASP n 
3 327 PHE n 
3 328 LEU n 
3 329 GLY n 
3 330 LYS n 
3 331 ASP n 
3 332 SER n 
3 333 ILE n 
3 334 ARG n 
3 335 TYR n 
3 336 TYR n 
3 337 ASN n 
3 338 LYS n 
3 339 VAL n 
3 340 PRO n 
3 341 VAL n 
3 342 GLU n 
3 343 LYS n 
3 344 ARG n 
3 345 VAL n 
3 346 PHE n 
3 347 LYS n 
3 348 ASN n 
3 349 LEU n 
3 350 GLN n 
3 351 LEU n 
3 352 PHE n 
3 353 MET n 
3 354 GLU n 
3 355 ASN n 
3 356 LYS n 
3 357 GLN n 
3 358 PRO n 
3 359 GLU n 
3 360 ASP n 
3 361 ASP n 
3 362 LEU n 
3 363 PHE n 
3 364 ASP n 
3 365 ARG n 
3 366 LEU n 
3 367 ASN n 
3 368 THR n 
3 369 GLY n 
3 370 ILE n 
3 371 LEU n 
3 372 ASN n 
3 373 LYS n 
3 374 HIS n 
3 375 LEU n 
3 376 GLN n 
3 377 ASP n 
3 378 LEU n 
3 379 MET n 
3 380 GLU n 
3 381 GLY n 
3 382 LEU n 
3 383 THR n 
3 384 ALA n 
3 385 LYS n 
3 386 VAL n 
3 387 PHE n 
3 388 ARG n 
3 389 THR n 
3 390 TYR n 
3 391 ASN n 
3 392 ALA n 
3 393 SER n 
3 394 ILE n 
3 395 THR n 
3 396 LEU n 
3 397 GLN n 
3 398 GLN n 
3 399 GLN n 
3 400 LEU n 
3 401 LYS n 
3 402 GLU n 
3 403 LEU n 
3 404 THR n 
3 405 ALA n 
3 406 PRO n 
3 407 ASP n 
3 408 GLU n 
3 409 ASN n 
3 410 ILE n 
3 411 PRO n 
3 412 ALA n 
3 413 LYS n 
3 414 ILE n 
3 415 LEU n 
3 416 SER n 
3 417 TYR n 
3 418 ASN n 
3 419 ARG n 
3 420 ALA n 
3 421 ASN n 
3 422 ARG n 
3 423 ALA n 
3 424 VAL n 
3 425 ALA n 
3 426 ILE n 
3 427 LEU n 
3 428 CYS n 
3 429 ASN n 
3 430 HIS n 
3 431 GLN n 
3 432 ILE n 
3 433 ALA n 
3 434 PRO n 
3 435 PRO n 
3 436 LYS n 
3 437 THR n 
3 438 PHE n 
3 439 GLU n 
3 440 LYS n 
3 441 SER n 
3 442 MET n 
3 443 MET n 
3 444 ASN n 
3 445 LEU n 
3 446 GLN n 
3 447 THR n 
3 448 LYS n 
3 449 ILE n 
3 450 ASP n 
3 451 ALA n 
3 452 LYS n 
3 453 LYS n 
3 454 GLU n 
3 455 GLN n 
3 456 LEU n 
3 457 ALA n 
3 458 ASP n 
3 459 ALA n 
3 460 ARG n 
3 461 ARG n 
3 462 ASP n 
3 463 LEU n 
3 464 LYS n 
3 465 SER n 
3 466 ALA n 
3 467 LYS n 
3 468 ALA n 
3 469 ASP n 
3 470 ALA n 
3 471 LYS n 
3 472 VAL n 
3 473 MET n 
3 474 LYS n 
3 475 ASP n 
3 476 ALA n 
3 477 LYS n 
3 478 THR n 
3 479 LYS n 
3 480 LYS n 
3 481 VAL n 
3 482 VAL n 
3 483 GLU n 
3 484 SER n 
3 485 LYS n 
3 486 LYS n 
3 487 LYS n 
3 488 ALA n 
3 489 VAL n 
3 490 GLN n 
3 491 ARG n 
3 492 LEU n 
3 493 GLU n 
3 494 GLU n 
3 495 GLN n 
3 496 LEU n 
3 497 MET n 
3 498 LYS n 
3 499 LEU n 
3 500 GLU n 
3 501 VAL n 
3 502 GLN n 
3 503 ALA n 
3 504 THR n 
3 505 ASP n 
3 506 ARG n 
3 507 GLU n 
3 508 GLU n 
3 509 ASN n 
3 510 LYS n 
3 511 GLN n 
3 512 ILE n 
3 513 ALA n 
3 514 LEU n 
3 515 GLY n 
3 516 THR n 
3 517 SER n 
3 518 LYS n 
3 519 LEU n 
3 520 ASN n 
3 521 PHE n 
3 522 LEU n 
3 523 ASP n 
3 524 PRO n 
3 525 ARG n 
3 526 ILE n 
3 527 THR n 
3 528 VAL n 
3 529 ALA n 
3 530 TRP n 
3 531 CYS n 
3 532 LYS n 
3 533 LYS n 
3 534 TRP n 
3 535 GLY n 
3 536 VAL n 
3 537 PRO n 
3 538 ILE n 
3 539 GLU n 
3 540 LYS n 
3 541 ILE n 
3 542 TYR n 
3 543 ASN n 
3 544 LYS n 
3 545 THR n 
3 546 GLN n 
3 547 ARG n 
3 548 GLU n 
3 549 LYS n 
3 550 PHE n 
3 551 ALA n 
3 552 TRP n 
3 553 ALA n 
3 554 ILE n 
3 555 ASP n 
3 556 MET n 
3 557 ALA n 
3 558 ASP n 
3 559 GLU n 
3 560 ASP n 
3 561 TYR n 
3 562 GLU n 
3 563 PHE n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'SF9 INSECT CELLS' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP TOP1_HUMAN P11387 3 203 ? ? 
2 PDB 1EJ9       1EJ9   1 ?   ? ? 
3 PDB 1EJ9       1EJ9   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EJ9 A 1 ? 563 ? P11387 203 ? 765 ? 203 765 
2 2 1EJ9 C 1 ? 23  ? 1EJ9   0   ? 22  ? 0   22  
3 3 1EJ9 D 1 ? 23  ? 1EJ9   100 ? 122 ? 100 122 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1EJ9 ILE A 432 ? UNP P11387 ARG 634 'engineered mutation' 634 1 
1 1EJ9 PHE A 521 ? UNP P11387 TYR 723 'engineered mutation' 723 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1EJ9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   61.12 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'27% PEG 400, 145 mM MgCl2, 20 mM MES pH 6.8, 5 mM Tris pH 8.0, 30 mM DTT, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 MES       ? ? ? 
1 2 1 Tris      ? ? ? 
1 3 1 DTT       ? ? ? 
1 4 1 'PEG 400' ? ? ? 
1 5 1 MgCl2     ? ? ? 
1 6 2 'PEG 400' ? ? ? 
1 7 2 MgCl2     ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   OTHER 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_wavelength             1.000 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EJ9 
_reflns.observed_criterion_sigma_F   2 
_reflns.observed_criterion_sigma_I   1 
_reflns.d_resolution_high            2.6 
_reflns.d_resolution_low             15.0 
_reflns.number_all                   105936 
_reflns.number_obs                   29834 
_reflns.percent_possible_obs         0.968 
_reflns.pdbx_Rmerge_I_obs            0.0680000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.1 
_reflns.B_iso_Wilson_estimate        56.2 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.6 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   0.87 
_reflns_shell.Rmerge_I_obs           0.2880000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        3 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1EJ9 
_refine.ls_d_res_high                            2.6 
_refine.ls_d_res_low                             15 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_ls_sigma_I                          1 
_refine.ls_number_reflns_all                     29834 
_refine.ls_number_reflns_obs                     29616 
_refine.ls_number_reflns_R_free                  2139 
_refine.ls_percent_reflns_obs                    98.68 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2140000 
_refine.ls_R_factor_R_free                       0.2810000 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 7.0 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.details                                  ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3966 
_refine_hist.pdbx_number_atoms_nucleic_acid   896 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             353 
_refine_hist.number_atoms_total               5215 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        1.74  ? ? ? 'X-RAY DIFFRACTION' ? 
x_torsion_deg      22.1  ? ? ? 'X-RAY DIFFRACTION' ? 
x_torsion_impr_deg 1.58  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1EJ9 
_struct.title                     'CRYSTAL STRUCTURE OF HUMAN TOPOISOMERASE I DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EJ9 
_struct_keywords.pdbx_keywords   ISOMERASE/DNA 
_struct_keywords.text            'protein-dna complex, type I topoisomerase, human, ISOMERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS C 2   ? GLU C 6   ? LYS A 204 GLU A 208 5 ? 5  
HELX_P HELX_P2  2  SER C 48  ? LYS C 60  ? SER A 250 LYS A 262 1 ? 13 
HELX_P HELX_P3  3  GLU C 65  ? THR C 68  ? GLU A 267 THR A 270 5 ? 4  
HELX_P HELX_P4  4  LYS C 69  ? GLU C 83  ? LYS A 271 GLU A 285 1 ? 15 
HELX_P HELX_P5  5  THR C 85  ? ILE C 92  ? THR A 287 ILE A 294 1 ? 8  
HELX_P HELX_P6  6  PHE C 100 ? MET C 117 ? PHE A 302 MET A 319 1 ? 18 
HELX_P HELX_P7  7  SER C 118 ? GLY C 137 ? SER A 320 GLY A 339 1 ? 20 
HELX_P HELX_P8  8  MET C 176 ? ASP C 179 ? MET A 378 ASP A 381 5 ? 4  
HELX_P HELX_P9  9  SER C 231 ? TRP C 263 ? SER A 433 TRP A 465 1 ? 33 
HELX_P HELX_P10 10 GLU C 267 ? ALA C 284 ? GLU A 469 ALA A 486 1 ? 18 
HELX_P HELX_P11 11 LYS C 330 ? SER C 332 ? LYS A 532 SER A 534 5 ? 3  
HELX_P HELX_P12 12 GLU C 342 ? MET C 353 ? GLU A 544 MET A 555 1 ? 12 
HELX_P HELX_P13 13 ASN C 367 ? MET C 379 ? ASN A 569 MET A 581 1 ? 13 
HELX_P HELX_P14 14 THR C 383 ? THR C 404 ? THR A 585 THR A 606 1 ? 22 
HELX_P HELX_P15 15 ASN C 409 ? ASN C 429 ? ASN A 611 ASN A 631 1 ? 21 
HELX_P HELX_P16 16 LEU C 514 ? PHE C 521 ? LEU A 716 PHE A 723 1 ? 8  
HELX_P HELX_P17 17 ASP C 523 ? TRP C 534 ? ASP A 725 TRP A 736 1 ? 12 
HELX_P HELX_P18 18 PRO C 537 ? ILE C 541 ? PRO A 739 ILE A 743 5 ? 5  
HELX_P HELX_P19 19 ASN C 543 ? ALA C 551 ? ASN A 745 ALA A 753 1 ? 9  
HELX_P HELX_P20 20 PHE C 550 ? MET C 556 ? PHE A 752 MET A 758 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 23 N3 ? ? C DA 1  D DT 122 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 23 O4 ? ? C DA 1  D DT 122 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 22 N3 ? ? C DA 2  D DT 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 22 O4 ? ? C DA 2  D DT 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 21 N3 ? ? C DA 3  D DT 120 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 21 O4 ? ? C DA 3  D DT 120 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 20 N3 ? ? C DA 4  D DT 119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 20 O4 ? ? C DA 4  D DT 119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT 19 N3 ? ? C DA 5  D DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DA 6  N6 ? ? ? 1_555 B DT 19 O4 ? ? C DA 5  D DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DG 7  N1 ? ? ? 1_555 B DC 18 N3 ? ? C DG 6  D DC 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DG 7  N2 ? ? ? 1_555 B DC 18 O2 ? ? C DG 6  D DC 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DG 7  O6 ? ? ? 1_555 B DC 18 N4 ? ? C DG 6  D DC 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 17 N3 ? ? C DA 7  D DT 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 17 O4 ? ? C DA 7  D DT 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 16 N1 ? ? C DC 8  D DG 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 16 O6 ? ? C DC 8  D DG 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 16 N2 ? ? C DC 8  D DG 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 15 N1 ? ? C DT 9  D DA 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 15 N6 ? ? C DT 9  D DA 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DC 11 N3 ? ? ? 1_555 B DG 14 N1 ? ? C DC 10 D DG 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DC 11 N4 ? ? ? 1_555 B DG 14 O6 ? ? C DC 10 D DG 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DC 11 O2 ? ? ? 1_555 B DG 14 N2 ? ? C DC 10 D DG 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 13 N3 ? ? C DA 11 D DT 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 13 O4 ? ? C DA 11 D DT 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 12 N3 ? ? C DG 12 D DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 12 O2 ? ? C DG 12 D DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 12 N4 ? ? C DG 12 D DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 11 N3 ? ? C DA 13 D DT 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 11 O4 ? ? C DA 13 D DT 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 10 N3 ? ? C DA 14 D DT 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 10 O4 ? ? C DA 14 D DT 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 9  N3 ? ? C DA 15 D DT 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT 9  O4 ? ? C DA 15 D DT 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35 hydrog ? ? A DA 17 N1 ? ? ? 1_555 B DT 8  N3 ? ? C DA 16 D DT 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? A DA 17 N6 ? ? ? 1_555 B DT 8  O4 ? ? C DA 16 D DT 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37 hydrog ? ? A DA 18 N1 ? ? ? 1_555 B DT 7  N3 ? ? C DA 17 D DT 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38 hydrog ? ? A DA 18 N6 ? ? ? 1_555 B DT 7  O4 ? ? C DA 17 D DT 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39 hydrog ? ? A DT 19 N3 ? ? ? 1_555 B DA 6  N1 ? ? C DT 18 D DA 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40 hydrog ? ? A DT 19 O4 ? ? ? 1_555 B DA 6  N6 ? ? C DT 18 D DA 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog41 hydrog ? ? A DT 20 N3 ? ? ? 1_555 B DA 5  N1 ? ? C DT 19 D DA 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog42 hydrog ? ? A DT 20 O4 ? ? ? 1_555 B DA 5  N6 ? ? C DT 19 D DA 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog43 hydrog ? ? A DT 21 N3 ? ? ? 1_555 B DA 4  N1 ? ? C DT 20 D DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog44 hydrog ? ? A DT 21 O4 ? ? ? 1_555 B DA 4  N6 ? ? C DT 20 D DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog45 hydrog ? ? A DT 22 N3 ? ? ? 1_555 B DA 3  N1 ? ? C DT 21 D DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog46 hydrog ? ? A DT 22 O4 ? ? ? 1_555 B DA 3  N6 ? ? C DT 21 D DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog47 hydrog ? ? A DT 23 N3 ? ? ? 1_555 B DA 2  N1 ? ? C DT 22 D DA 101 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU C 18  ? GLU C 19  ? LEU A 220 GLU A 221 
A 2 PHE C 138 ? MET C 141 ? PHE A 340 MET A 343 
A 3 HIS C 144 ? ARG C 147 ? HIS A 346 ARG A 349 
B 1 LYS C 43  ? VAL C 44  ? LYS A 245 VAL A 246 
B 2 TYR C 39  ? TYR C 40  ? TYR A 241 TYR A 242 
B 3 CYS C 98  ? ASP C 99  ? CYS A 300 ASP A 301 
C 1 GLY C 157 ? LEU C 158 ? GLY A 359 LEU A 360 
C 2 LEU C 171 ? LYS C 172 ? LEU A 373 LYS A 374 
D 1 GLU C 201 ? ARG C 203 ? GLU A 403 ARG A 405 
D 2 ILE C 181 ? ASN C 183 ? ILE A 383 ASN A 385 
D 3 VAL C 212 ? GLU C 216 ? VAL A 414 GLU A 418 
D 4 SER C 221 ? ILE C 225 ? SER A 423 ILE A 427 
E 1 ILE C 310 ? LEU C 316 ? ILE A 512 LEU A 518 
E 2 GLN C 319 ? LEU C 328 ? GLN A 521 LEU A 530 
E 3 ARG C 334 ? PRO C 340 ? ARG A 536 PRO A 542 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU C 19  ? O GLU A 221 N ILE C 140 ? N ILE A 342 
A 2 3 O MET C 141 ? O MET A 343 N HIS C 144 ? N HIS A 346 
B 1 2 O LYS C 43  ? O LYS A 245 N TYR C 40  ? N TYR A 242 
B 2 3 O TYR C 39  ? O TYR A 241 N ASP C 99  ? N ASP A 301 
C 1 2 O GLY C 157 ? O GLY A 359 N LYS C 172 ? N LYS A 374 
D 1 2 N ARG C 203 ? N ARG A 405 O ILE C 182 ? O ILE A 384 
D 2 3 N ILE C 181 ? N ILE A 383 O SER C 213 ? O SER A 415 
D 3 4 N GLU C 216 ? N GLU A 418 O SER C 221 ? O SER A 423 
E 1 2 N LEU C 316 ? N LEU A 518 O GLN C 319 ? O GLN A 521 
E 2 3 O PHE C 327 ? O PHE A 529 N TYR C 335 ? N TYR A 537 
# 
_database_PDB_matrix.entry_id          1EJ9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EJ9 
_atom_sites.fract_transf_matrix[1][1]   0.017550 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001178 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008005 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013864 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 2   ? 5.294   5.422   -1.778 1.00 68.68  ? 1    DA  C "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 2   ? 4.452   5.575   -2.911 1.00 67.00  ? 1    DA  C "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 2   ? 3.105   5.129   -2.399 1.00 66.39  ? 1    DA  C "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 2   ? 3.185   3.718   -2.108 1.00 62.10  ? 1    DA  C "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 2   ? 2.814   5.801   -1.067 1.00 67.69  ? 1    DA  C "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 2   ? 1.411   5.860   -0.851 1.00 74.97  ? 1    DA  C "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 2   ? 3.481   4.883   -0.066 1.00 63.50  ? 1    DA  C "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 2   ? 3.345   3.512   -0.710 1.00 59.14  ? 1    DA  C "C1'" 1 
ATOM   9    N N9    . DA  A 1 2   ? 4.561   2.740   -0.527 1.00 52.79  ? 1    DA  C N9    1 
ATOM   10   C C8    . DA  A 1 2   ? 5.816   3.241   -0.302 1.00 51.08  ? 1    DA  C C8    1 
ATOM   11   N N7    . DA  A 1 2   ? 6.732   2.315   -0.177 1.00 51.63  ? 1    DA  C N7    1 
ATOM   12   C C5    . DA  A 1 2   ? 6.028   1.129   -0.336 1.00 45.86  ? 1    DA  C C5    1 
ATOM   13   C C6    . DA  A 1 2   ? 6.430   -0.209  -0.328 1.00 46.96  ? 1    DA  C C6    1 
ATOM   14   N N6    . DA  A 1 2   ? 7.699   -0.592  -0.140 1.00 47.83  ? 1    DA  C N6    1 
ATOM   15   N N1    . DA  A 1 2   ? 5.486   -1.152  -0.523 1.00 43.00  ? 1    DA  C N1    1 
ATOM   16   C C2    . DA  A 1 2   ? 4.232   -0.758  -0.706 1.00 45.43  ? 1    DA  C C2    1 
ATOM   17   N N3    . DA  A 1 2   ? 3.731   0.474   -0.737 1.00 45.97  ? 1    DA  C N3    1 
ATOM   18   C C4    . DA  A 1 2   ? 4.694   1.378   -0.546 1.00 46.87  ? 1    DA  C C4    1 
ATOM   19   P P     . DA  A 1 3   ? 0.845   6.105   0.636  1.00 78.06  ? 2    DA  C P     1 
ATOM   20   O OP1   . DA  A 1 3   ? -0.558  6.648   0.491  1.00 77.06  ? 2    DA  C OP1   1 
ATOM   21   O OP2   . DA  A 1 3   ? 1.864   6.868   1.430  1.00 78.36  ? 2    DA  C OP2   1 
ATOM   22   O "O5'" . DA  A 1 3   ? 0.739   4.624   1.213  1.00 76.18  ? 2    DA  C "O5'" 1 
ATOM   23   C "C5'" . DA  A 1 3   ? 0.058   3.623   0.447  1.00 74.56  ? 2    DA  C "C5'" 1 
ATOM   24   C "C4'" . DA  A 1 3   ? -0.108  2.357   1.252  1.00 73.23  ? 2    DA  C "C4'" 1 
ATOM   25   O "O4'" . DA  A 1 3   ? 1.115   1.579   1.296  1.00 71.85  ? 2    DA  C "O4'" 1 
ATOM   26   C "C3'" . DA  A 1 3   ? -0.567  2.520   2.700  1.00 71.82  ? 2    DA  C "C3'" 1 
ATOM   27   O "O3'" . DA  A 1 3   ? -1.425  1.414   2.959  1.00 74.74  ? 2    DA  C "O3'" 1 
ATOM   28   C "C2'" . DA  A 1 3   ? 0.727   2.327   3.476  1.00 68.26  ? 2    DA  C "C2'" 1 
ATOM   29   C "C1'" . DA  A 1 3   ? 1.407   1.241   2.641  1.00 63.87  ? 2    DA  C "C1'" 1 
ATOM   30   N N9    . DA  A 1 3   ? 2.859   1.168   2.758  1.00 55.20  ? 2    DA  C N9    1 
ATOM   31   C C8    . DA  A 1 3   ? 3.719   2.224   2.898  1.00 54.00  ? 2    DA  C C8    1 
ATOM   32   N N7    . DA  A 1 3   ? 4.978   1.872   2.967  1.00 55.09  ? 2    DA  C N7    1 
ATOM   33   C C5    . DA  A 1 3   ? 4.942   0.489   2.872  1.00 47.47  ? 2    DA  C C5    1 
ATOM   34   C C6    . DA  A 1 3   ? 5.950   -0.466  2.890  1.00 42.68  ? 2    DA  C C6    1 
ATOM   35   N N6    . DA  A 1 3   ? 7.238   -0.156  3.006  1.00 41.49  ? 2    DA  C N6    1 
ATOM   36   N N1    . DA  A 1 3   ? 5.593   -1.763  2.775  1.00 42.75  ? 2    DA  C N1    1 
ATOM   37   C C2    . DA  A 1 3   ? 4.294   -2.057  2.633  1.00 46.45  ? 2    DA  C C2    1 
ATOM   38   N N3    . DA  A 1 3   ? 3.246   -1.237  2.598  1.00 47.71  ? 2    DA  C N3    1 
ATOM   39   C C4    . DA  A 1 3   ? 3.645   0.040   2.734  1.00 50.55  ? 2    DA  C C4    1 
ATOM   40   P P     . DA  A 1 4   ? -2.683  1.564   3.945  1.00 74.99  ? 3    DA  C P     1 
ATOM   41   O OP1   . DA  A 1 4   ? -3.914  1.642   3.066  1.00 76.33  ? 3    DA  C OP1   1 
ATOM   42   O OP2   . DA  A 1 4   ? -2.397  2.655   4.923  1.00 74.82  ? 3    DA  C OP2   1 
ATOM   43   O "O5'" . DA  A 1 4   ? -2.674  0.147   4.683  1.00 71.90  ? 3    DA  C "O5'" 1 
ATOM   44   C "C5'" . DA  A 1 4   ? -2.537  -1.053  3.893  1.00 68.28  ? 3    DA  C "C5'" 1 
ATOM   45   C "C4'" . DA  A 1 4   ? -1.708  -2.086  4.615  1.00 66.51  ? 3    DA  C "C4'" 1 
ATOM   46   O "O4'" . DA  A 1 4   ? -0.281  -1.836  4.571  1.00 66.36  ? 3    DA  C "O4'" 1 
ATOM   47   C "C3'" . DA  A 1 4   ? -2.054  -2.284  6.084  1.00 67.35  ? 3    DA  C "C3'" 1 
ATOM   48   O "O3'" . DA  A 1 4   ? -2.098  -3.690  6.297  1.00 69.80  ? 3    DA  C "O3'" 1 
ATOM   49   C "C2'" . DA  A 1 4   ? -0.857  -1.679  6.804  1.00 63.60  ? 3    DA  C "C2'" 1 
ATOM   50   C "C1'" . DA  A 1 4   ? 0.258   -2.087  5.862  1.00 59.42  ? 3    DA  C "C1'" 1 
ATOM   51   N N9    . DA  A 1 4   ? 1.522   -1.358  5.981  1.00 53.44  ? 3    DA  C N9    1 
ATOM   52   C C8    . DA  A 1 4   ? 1.677   -0.013  6.179  1.00 51.28  ? 3    DA  C C8    1 
ATOM   53   N N7    . DA  A 1 4   ? 2.930   0.377   6.203  1.00 51.92  ? 3    DA  C N7    1 
ATOM   54   C C5    . DA  A 1 4   ? 3.654   -0.795  6.029  1.00 47.17  ? 3    DA  C C5    1 
ATOM   55   C C6    . DA  A 1 4   ? 5.043   -1.050  5.972  1.00 46.00  ? 3    DA  C C6    1 
ATOM   56   N N6    . DA  A 1 4   ? 5.968   -0.101  6.087  1.00 45.92  ? 3    DA  C N6    1 
ATOM   57   N N1    . DA  A 1 4   ? 5.443   -2.323  5.795  1.00 40.67  ? 3    DA  C N1    1 
ATOM   58   C C2    . DA  A 1 4   ? 4.504   -3.270  5.683  1.00 48.91  ? 3    DA  C C2    1 
ATOM   59   N N3    . DA  A 1 4   ? 3.165   -3.156  5.721  1.00 45.37  ? 3    DA  C N3    1 
ATOM   60   C C4    . DA  A 1 4   ? 2.802   -1.875  5.898  1.00 48.07  ? 3    DA  C C4    1 
ATOM   61   P P     . DA  A 1 5   ? -3.199  -4.323  7.277  1.00 71.47  ? 4    DA  C P     1 
ATOM   62   O OP1   . DA  A 1 5   ? -4.424  -4.690  6.467  1.00 71.34  ? 4    DA  C OP1   1 
ATOM   63   O OP2   . DA  A 1 5   ? -3.338  -3.390  8.446  1.00 70.05  ? 4    DA  C OP2   1 
ATOM   64   O "O5'" . DA  A 1 5   ? -2.456  -5.663  7.735  1.00 71.23  ? 4    DA  C "O5'" 1 
ATOM   65   C "C5'" . DA  A 1 5   ? -1.611  -6.395  6.807  1.00 67.71  ? 4    DA  C "C5'" 1 
ATOM   66   C "C4'" . DA  A 1 5   ? -0.312  -6.831  7.460  1.00 64.37  ? 4    DA  C "C4'" 1 
ATOM   67   O "O4'" . DA  A 1 5   ? 0.702   -5.788  7.434  1.00 61.79  ? 4    DA  C "O4'" 1 
ATOM   68   C "C3'" . DA  A 1 5   ? -0.374  -7.343  8.905  1.00 64.06  ? 4    DA  C "C3'" 1 
ATOM   69   O "O3'" . DA  A 1 5   ? 0.372   -8.572  9.029  1.00 65.96  ? 4    DA  C "O3'" 1 
ATOM   70   C "C2'" . DA  A 1 5   ? 0.325   -6.240  9.686  1.00 61.26  ? 4    DA  C "C2'" 1 
ATOM   71   C "C1'" . DA  A 1 5   ? 1.367   -5.761  8.686  1.00 56.76  ? 4    DA  C "C1'" 1 
ATOM   72   N N9    . DA  A 1 5   ? 1.874   -4.403  8.911  1.00 48.83  ? 4    DA  C N9    1 
ATOM   73   C C8    . DA  A 1 5   ? 1.147   -3.262  9.159  1.00 44.46  ? 4    DA  C C8    1 
ATOM   74   N N7    . DA  A 1 5   ? 1.884   -2.197  9.318  1.00 42.30  ? 4    DA  C N7    1 
ATOM   75   C C5    . DA  A 1 5   ? 3.184   -2.661  9.171  1.00 39.55  ? 4    DA  C C5    1 
ATOM   76   C C6    . DA  A 1 5   ? 4.427   -2.015  9.228  1.00 39.18  ? 4    DA  C C6    1 
ATOM   77   N N6    . DA  A 1 5   ? 4.581   -0.703  9.432  1.00 34.88  ? 4    DA  C N6    1 
ATOM   78   N N1    . DA  A 1 5   ? 5.529   -2.770  9.055  1.00 35.10  ? 4    DA  C N1    1 
ATOM   79   C C2    . DA  A 1 5   ? 5.383   -4.076  8.828  1.00 38.03  ? 4    DA  C C2    1 
ATOM   80   N N3    . DA  A 1 5   ? 4.274   -4.793  8.739  1.00 39.43  ? 4    DA  C N3    1 
ATOM   81   C C4    . DA  A 1 5   ? 3.194   -4.015  8.924  1.00 40.83  ? 4    DA  C C4    1 
ATOM   82   P P     . DA  A 1 6   ? 0.408   -9.369  10.438 1.00 66.59  ? 5    DA  C P     1 
ATOM   83   O OP1   . DA  A 1 6   ? -0.096  -10.737 10.127 1.00 66.75  ? 5    DA  C OP1   1 
ATOM   84   O OP2   . DA  A 1 6   ? -0.203  -8.588  11.563 1.00 68.54  ? 5    DA  C OP2   1 
ATOM   85   O "O5'" . DA  A 1 6   ? 1.957   -9.445  10.753 1.00 63.38  ? 5    DA  C "O5'" 1 
ATOM   86   C "C5'" . DA  A 1 6   ? 2.878   -9.627  9.692  1.00 57.21  ? 5    DA  C "C5'" 1 
ATOM   87   C "C4'" . DA  A 1 6   ? 4.270   -9.380  10.201 1.00 55.26  ? 5    DA  C "C4'" 1 
ATOM   88   O "O4'" . DA  A 1 6   ? 4.477   -7.958  10.360 1.00 54.98  ? 5    DA  C "O4'" 1 
ATOM   89   C "C3'" . DA  A 1 6   ? 4.499   -10.001 11.574 1.00 53.39  ? 5    DA  C "C3'" 1 
ATOM   90   O "O3'" . DA  A 1 6   ? 5.788   -10.603 11.594 1.00 54.00  ? 5    DA  C "O3'" 1 
ATOM   91   C "C2'" . DA  A 1 6   ? 4.377   -8.825  12.534 1.00 52.21  ? 5    DA  C "C2'" 1 
ATOM   92   C "C1'" . DA  A 1 6   ? 4.876   -7.654  11.696 1.00 52.36  ? 5    DA  C "C1'" 1 
ATOM   93   N N9    . DA  A 1 6   ? 4.353   -6.316  12.021 1.00 47.76  ? 5    DA  C N9    1 
ATOM   94   C C8    . DA  A 1 6   ? 3.035   -5.946  12.182 1.00 46.68  ? 5    DA  C C8    1 
ATOM   95   N N7    . DA  A 1 6   ? 2.865   -4.656  12.382 1.00 44.00  ? 5    DA  C N7    1 
ATOM   96   C C5    . DA  A 1 6   ? 4.154   -4.143  12.379 1.00 41.64  ? 5    DA  C C5    1 
ATOM   97   C C6    . DA  A 1 6   ? 4.650   -2.839  12.537 1.00 37.97  ? 5    DA  C C6    1 
ATOM   98   N N6    . DA  A 1 6   ? 3.880   -1.791  12.763 1.00 30.37  ? 5    DA  C N6    1 
ATOM   99   N N1    . DA  A 1 6   ? 5.986   -2.655  12.461 1.00 40.29  ? 5    DA  C N1    1 
ATOM   100  C C2    . DA  A 1 6   ? 6.762   -3.719  12.259 1.00 43.15  ? 5    DA  C C2    1 
ATOM   101  N N3    . DA  A 1 6   ? 6.417   -5.002  12.109 1.00 44.23  ? 5    DA  C N3    1 
ATOM   102  C C4    . DA  A 1 6   ? 5.084   -5.153  12.174 1.00 45.14  ? 5    DA  C C4    1 
ATOM   103  P P     . DG  A 1 7   ? 6.348   -11.214 12.960 1.00 55.14  ? 6    DG  C P     1 
ATOM   104  O OP1   . DG  A 1 7   ? 7.282   -12.314 12.633 1.00 57.42  ? 6    DG  C OP1   1 
ATOM   105  O OP2   . DG  A 1 7   ? 5.188   -11.461 13.860 1.00 58.76  ? 6    DG  C OP2   1 
ATOM   106  O "O5'" . DG  A 1 7   ? 7.192   -10.003 13.505 1.00 49.16  ? 6    DG  C "O5'" 1 
ATOM   107  C "C5'" . DG  A 1 7   ? 8.171   -9.462  12.668 1.00 42.19  ? 6    DG  C "C5'" 1 
ATOM   108  C "C4'" . DG  A 1 7   ? 9.109   -8.629  13.481 1.00 39.29  ? 6    DG  C "C4'" 1 
ATOM   109  O "O4'" . DG  A 1 7   ? 8.515   -7.338  13.629 1.00 40.39  ? 6    DG  C "O4'" 1 
ATOM   110  C "C3'" . DG  A 1 7   ? 9.342   -9.163  14.882 1.00 38.76  ? 6    DG  C "C3'" 1 
ATOM   111  O "O3'" . DG  A 1 7   ? 10.714  -9.017  15.164 1.00 41.53  ? 6    DG  C "O3'" 1 
ATOM   112  C "C2'" . DG  A 1 7   ? 8.505   -8.247  15.748 1.00 37.97  ? 6    DG  C "C2'" 1 
ATOM   113  C "C1'" . DG  A 1 7   ? 8.507   -6.953  14.966 1.00 34.37  ? 6    DG  C "C1'" 1 
ATOM   114  N N9    . DG  A 1 7   ? 7.324   -6.134  15.153 1.00 35.11  ? 6    DG  C N9    1 
ATOM   115  C C8    . DG  A 1 7   ? 6.024   -6.557  15.125 1.00 33.84  ? 6    DG  C C8    1 
ATOM   116  N N7    . DG  A 1 7   ? 5.170   -5.601  15.332 1.00 33.30  ? 6    DG  C N7    1 
ATOM   117  C C5    . DG  A 1 7   ? 5.958   -4.476  15.509 1.00 34.51  ? 6    DG  C C5    1 
ATOM   118  C C6    . DG  A 1 7   ? 5.594   -3.131  15.773 1.00 37.50  ? 6    DG  C C6    1 
ATOM   119  O O6    . DG  A 1 7   ? 4.458   -2.646  15.929 1.00 35.77  ? 6    DG  C O6    1 
ATOM   120  N N1    . DG  A 1 7   ? 6.711   -2.314  15.848 1.00 36.96  ? 6    DG  C N1    1 
ATOM   121  C C2    . DG  A 1 7   ? 8.000   -2.719  15.682 1.00 34.17  ? 6    DG  C C2    1 
ATOM   122  N N2    . DG  A 1 7   ? 8.922   -1.752  15.738 1.00 32.02  ? 6    DG  C N2    1 
ATOM   123  N N3    . DG  A 1 7   ? 8.351   -3.964  15.465 1.00 32.63  ? 6    DG  C N3    1 
ATOM   124  C C4    . DG  A 1 7   ? 7.287   -4.782  15.387 1.00 31.92  ? 6    DG  C C4    1 
ATOM   125  P P     . DA  A 1 8   ? 11.267  -9.411  16.590 1.00 45.10  ? 7    DA  C P     1 
ATOM   126  O OP1   . DA  A 1 8   ? 12.673  -9.828  16.396 1.00 44.13  ? 7    DA  C OP1   1 
ATOM   127  O OP2   . DA  A 1 8   ? 10.326  -10.296 17.304 1.00 45.75  ? 7    DA  C OP2   1 
ATOM   128  O "O5'" . DA  A 1 8   ? 11.312  -8.006  17.330 1.00 48.28  ? 7    DA  C "O5'" 1 
ATOM   129  C "C5'" . DA  A 1 8   ? 12.247  -7.003  16.893 1.00 48.71  ? 7    DA  C "C5'" 1 
ATOM   130  C "C4'" . DA  A 1 8   ? 12.398  -5.928  17.941 1.00 47.58  ? 7    DA  C "C4'" 1 
ATOM   131  O "O4'" . DA  A 1 8   ? 11.237  -5.090  17.967 1.00 45.49  ? 7    DA  C "O4'" 1 
ATOM   132  C "C3'" . DA  A 1 8   ? 12.584  -6.401  19.377 1.00 47.52  ? 7    DA  C "C3'" 1 
ATOM   133  O "O3'" . DA  A 1 8   ? 13.368  -5.398  20.005 1.00 48.26  ? 7    DA  C "O3'" 1 
ATOM   134  C "C2'" . DA  A 1 8   ? 11.172  -6.332  19.928 1.00 44.60  ? 7    DA  C "C2'" 1 
ATOM   135  C "C1'" . DA  A 1 8   ? 10.710  -5.057  19.264 1.00 43.61  ? 7    DA  C "C1'" 1 
ATOM   136  N N9    . DA  A 1 8   ? 9.288   -4.867  19.122 1.00 42.17  ? 7    DA  C N9    1 
ATOM   137  C C8    . DA  A 1 8   ? 8.303   -5.772  18.915 1.00 40.31  ? 7    DA  C C8    1 
ATOM   138  N N7    . DA  A 1 8   ? 7.120   -5.237  18.828 1.00 45.23  ? 7    DA  C N7    1 
ATOM   139  C C5    . DA  A 1 8   ? 7.349   -3.883  18.994 1.00 44.13  ? 7    DA  C C5    1 
ATOM   140  C C6    . DA  A 1 8   ? 6.498   -2.769  19.024 1.00 44.70  ? 7    DA  C C6    1 
ATOM   141  N N6    . DA  A 1 8   ? 5.183   -2.839  18.911 1.00 43.38  ? 7    DA  C N6    1 
ATOM   142  N N1    . DA  A 1 8   ? 7.058   -1.557  19.186 1.00 48.00  ? 7    DA  C N1    1 
ATOM   143  C C2    . DA  A 1 8   ? 8.388   -1.479  19.319 1.00 49.92  ? 7    DA  C C2    1 
ATOM   144  N N3    . DA  A 1 8   ? 9.285   -2.456  19.329 1.00 50.27  ? 7    DA  C N3    1 
ATOM   145  C C4    . DA  A 1 8   ? 8.685   -3.644  19.161 1.00 45.25  ? 7    DA  C C4    1 
ATOM   146  P P     . DC  A 1 9   ? 14.741  -5.775  20.718 1.00 48.07  ? 8    DC  C P     1 
ATOM   147  O OP1   . DC  A 1 9   ? 15.846  -5.541  19.776 1.00 46.17  ? 8    DC  C OP1   1 
ATOM   148  O OP2   . DC  A 1 9   ? 14.549  -7.124  21.287 1.00 49.63  ? 8    DC  C OP2   1 
ATOM   149  O "O5'" . DC  A 1 9   ? 14.761  -4.643  21.830 1.00 45.76  ? 8    DC  C "O5'" 1 
ATOM   150  C "C5'" . DC  A 1 9   ? 14.713  -3.257  21.429 1.00 46.73  ? 8    DC  C "C5'" 1 
ATOM   151  C "C4'" . DC  A 1 9   ? 13.658  -2.464  22.185 1.00 45.96  ? 8    DC  C "C4'" 1 
ATOM   152  O "O4'" . DC  A 1 9   ? 12.295  -2.665  21.715 1.00 41.76  ? 8    DC  C "O4'" 1 
ATOM   153  C "C3'" . DC  A 1 9   ? 13.606  -2.554  23.715 1.00 42.87  ? 8    DC  C "C3'" 1 
ATOM   154  O "O3'" . DC  A 1 9   ? 13.718  -1.260  24.301 1.00 41.94  ? 8    DC  C "O3'" 1 
ATOM   155  C "C2'" . DC  A 1 9   ? 12.186  -2.996  23.979 1.00 44.46  ? 8    DC  C "C2'" 1 
ATOM   156  C "C1'" . DC  A 1 9   ? 11.479  -2.357  22.814 1.00 41.52  ? 8    DC  C "C1'" 1 
ATOM   157  N N1    . DC  A 1 9   ? 10.161  -2.947  22.618 1.00 40.73  ? 8    DC  C N1    1 
ATOM   158  C C2    . DC  A 1 9   ? 9.077   -2.096  22.527 1.00 38.52  ? 8    DC  C C2    1 
ATOM   159  O O2    . DC  A 1 9   ? 9.290   -0.885  22.473 1.00 40.64  ? 8    DC  C O2    1 
ATOM   160  N N3    . DC  A 1 9   ? 7.833   -2.608  22.512 1.00 34.47  ? 8    DC  C N3    1 
ATOM   161  C C4    . DC  A 1 9   ? 7.660   -3.926  22.566 1.00 39.59  ? 8    DC  C C4    1 
ATOM   162  N N4    . DC  A 1 9   ? 6.420   -4.382  22.607 1.00 33.34  ? 8    DC  C N4    1 
ATOM   163  C C5    . DC  A 1 9   ? 8.760   -4.828  22.591 1.00 34.71  ? 8    DC  C C5    1 
ATOM   164  C C6    . DC  A 1 9   ? 9.983   -4.300  22.599 1.00 37.91  ? 8    DC  C C6    1 
ATOM   165  P P     . DT  A 1 10  ? 13.966  -1.115  25.891 1.00 42.18  ? 9    DT  C P     1 
ATOM   166  O OP1   . DT  A 1 10  ? 15.373  -0.814  26.154 1.00 39.60  ? 9    DT  C OP1   1 
ATOM   167  O OP2   . DT  A 1 10  ? 13.345  -2.282  26.544 1.00 42.42  ? 9    DT  C OP2   1 
ATOM   168  O "O5'" . DT  A 1 10  ? 13.075  0.164   26.227 1.00 46.76  ? 9    DT  C "O5'" 1 
ATOM   169  C "C5'" . DT  A 1 10  ? 13.139  1.332   25.383 1.00 43.88  ? 9    DT  C "C5'" 1 
ATOM   170  C "C4'" . DT  A 1 10  ? 11.940  2.221   25.603 1.00 39.83  ? 9    DT  C "C4'" 1 
ATOM   171  O "O4'" . DT  A 1 10  ? 10.771  1.458   25.248 1.00 38.90  ? 9    DT  C "O4'" 1 
ATOM   172  C "C3'" . DT  A 1 10  ? 11.702  2.740   27.028 1.00 37.18  ? 9    DT  C "C3'" 1 
ATOM   173  O "O3'" . DT  A 1 10  ? 11.111  4.048   26.914 1.00 38.66  ? 9    DT  C "O3'" 1 
ATOM   174  C "C2'" . DT  A 1 10  ? 10.682  1.760   27.562 1.00 34.69  ? 9    DT  C "C2'" 1 
ATOM   175  C "C1'" . DT  A 1 10  ? 9.849   1.517   26.323 1.00 39.43  ? 9    DT  C "C1'" 1 
ATOM   176  N N1    . DT  A 1 10  ? 9.114   0.262   26.337 1.00 40.59  ? 9    DT  C N1    1 
ATOM   177  C C2    . DT  A 1 10  ? 7.731   0.268   26.311 1.00 40.13  ? 9    DT  C C2    1 
ATOM   178  O O2    . DT  A 1 10  ? 7.063   1.275   26.323 1.00 44.08  ? 9    DT  C O2    1 
ATOM   179  N N3    . DT  A 1 10  ? 7.161   -0.961  26.289 1.00 36.22  ? 9    DT  C N3    1 
ATOM   180  C C4    . DT  A 1 10  ? 7.805   -2.164  26.300 1.00 37.76  ? 9    DT  C C4    1 
ATOM   181  O O4    . DT  A 1 10  ? 7.159   -3.169  26.275 1.00 37.68  ? 9    DT  C O4    1 
ATOM   182  C C5    . DT  A 1 10  ? 9.255   -2.103  26.348 1.00 39.96  ? 9    DT  C C5    1 
ATOM   183  C C7    . DT  A 1 10  ? 10.050  -3.365  26.382 1.00 38.71  ? 9    DT  C C7    1 
ATOM   184  C C6    . DT  A 1 10  ? 9.823   -0.906  26.357 1.00 40.96  ? 9    DT  C C6    1 
ATOM   185  P P     . DC  A 1 11  ? 10.984  5.026   28.188 1.00 42.24  ? 10   DC  C P     1 
ATOM   186  O OP1   . DC  A 1 11  ? 11.088  6.355   27.612 1.00 41.98  ? 10   DC  C OP1   1 
ATOM   187  O OP2   . DC  A 1 11  ? 11.909  4.664   29.217 1.00 42.99  ? 10   DC  C OP2   1 
ATOM   188  O "O5'" . DC  A 1 11  ? 9.495   4.774   28.731 1.00 39.21  ? 10   DC  C "O5'" 1 
ATOM   189  C "C5'" . DC  A 1 11  ? 8.345   5.386   28.097 1.00 33.01  ? 10   DC  C "C5'" 1 
ATOM   190  C "C4'" . DC  A 1 11  ? 7.048   4.908   28.717 1.00 36.44  ? 10   DC  C "C4'" 1 
ATOM   191  O "O4'" . DC  A 1 11  ? 6.869   3.490   28.463 1.00 36.56  ? 10   DC  C "O4'" 1 
ATOM   192  C "C3'" . DC  A 1 11  ? 6.894   5.085   30.237 1.00 36.19  ? 10   DC  C "C3'" 1 
ATOM   193  O "O3'" . DC  A 1 11  ? 5.512   5.089   30.665 1.00 43.40  ? 10   DC  C "O3'" 1 
ATOM   194  C "C2'" . DC  A 1 11  ? 7.285   3.705   30.726 1.00 37.32  ? 10   DC  C "C2'" 1 
ATOM   195  C "C1'" . DC  A 1 11  ? 6.489   2.918   29.701 1.00 36.29  ? 10   DC  C "C1'" 1 
ATOM   196  N N1    . DC  A 1 11  ? 6.591   1.447   29.617 1.00 34.47  ? 10   DC  C N1    1 
ATOM   197  C C2    . DC  A 1 11  ? 5.412   0.711   29.430 1.00 32.59  ? 10   DC  C C2    1 
ATOM   198  O O2    . DC  A 1 11  ? 4.345   1.306   29.356 1.00 42.54  ? 10   DC  C O2    1 
ATOM   199  N N3    . DC  A 1 11  ? 5.464   -0.615  29.338 1.00 31.05  ? 10   DC  C N3    1 
ATOM   200  C C4    . DC  A 1 11  ? 6.630   -1.232  29.418 1.00 34.70  ? 10   DC  C C4    1 
ATOM   201  N N4    . DC  A 1 11  ? 6.635   -2.544  29.299 1.00 33.23  ? 10   DC  C N4    1 
ATOM   202  C C5    . DC  A 1 11  ? 7.852   -0.523  29.619 1.00 35.13  ? 10   DC  C C5    1 
ATOM   203  C C6    . DC  A 1 11  ? 7.788   0.805   29.714 1.00 32.16  ? 10   DC  C C6    1 
ATOM   204  P P     . DA  A 1 12  ? 4.483   6.241   30.236 1.00 44.12  ? 11   DA  C P     1 
ATOM   205  O OP1   . DA  A 1 12  ? 4.257   6.172   28.784 1.00 43.12  ? 11   DA  C OP1   1 
ATOM   206  O OP2   . DA  A 1 12  ? 4.795   7.513   30.897 1.00 45.79  ? 11   DA  C OP2   1 
ATOM   207  O "O5'" . DA  A 1 12  ? 3.122   5.746   30.866 1.00 43.74  ? 11   DA  C "O5'" 1 
ATOM   208  C "C5'" . DA  A 1 12  ? 2.759   4.387   30.731 1.00 46.31  ? 11   DA  C "C5'" 1 
ATOM   209  C "C4'" . DA  A 1 12  ? 1.617   4.040   31.648 1.00 45.47  ? 11   DA  C "C4'" 1 
ATOM   210  O "O4'" . DA  A 1 12  ? 1.604   2.596   31.648 1.00 45.66  ? 11   DA  C "O4'" 1 
ATOM   211  C "C3'" . DA  A 1 12  ? 1.800   4.469   33.106 1.00 44.42  ? 11   DA  C "C3'" 1 
ATOM   212  O "O3'" . DA  A 1 12  ? 0.540   4.812   33.691 1.00 43.98  ? 11   DA  C "O3'" 1 
ATOM   213  C "C2'" . DA  A 1 12  ? 2.364   3.233   33.773 1.00 43.95  ? 11   DA  C "C2'" 1 
ATOM   214  C "C1'" . DA  A 1 12  ? 1.883   2.071   32.931 1.00 42.87  ? 11   DA  C "C1'" 1 
ATOM   215  N N9    . DA  A 1 12  ? 2.958   1.093   32.789 1.00 40.32  ? 11   DA  C N9    1 
ATOM   216  C C8    . DA  A 1 12  ? 4.280   1.413   32.706 1.00 32.59  ? 11   DA  C C8    1 
ATOM   217  N N7    . DA  A 1 12  ? 5.067   0.376   32.686 1.00 40.62  ? 11   DA  C N7    1 
ATOM   218  C C5    . DA  A 1 12  ? 4.205   -0.704  32.735 1.00 31.11  ? 11   DA  C C5    1 
ATOM   219  C C6    . DA  A 1 12  ? 4.438   -2.062  32.757 1.00 32.40  ? 11   DA  C C6    1 
ATOM   220  N N6    . DA  A 1 12  ? 5.654   -2.583  32.730 1.00 35.15  ? 11   DA  C N6    1 
ATOM   221  N N1    . DA  A 1 12  ? 3.382   -2.882  32.810 1.00 32.43  ? 11   DA  C N1    1 
ATOM   222  C C2    . DA  A 1 12  ? 2.172   -2.352  32.837 1.00 36.52  ? 11   DA  C C2    1 
ATOM   223  N N3    . DA  A 1 12  ? 1.820   -1.072  32.824 1.00 39.57  ? 11   DA  C N3    1 
ATOM   224  C C4    . DA  A 1 12  ? 2.903   -0.284  32.774 1.00 33.71  ? 11   DA  C C4    1 
ATOM   225  P P     . DG  A 1 13  ? 0.477   5.623   35.078 1.00 42.77  ? 12   DG  C P     1 
ATOM   226  O OP1   . DG  A 1 13  ? -0.125  6.924   34.829 1.00 45.85  ? 12   DG  C OP1   1 
ATOM   227  O OP2   . DG  A 1 13  ? 1.743   5.547   35.771 1.00 44.46  ? 12   DG  C OP2   1 
ATOM   228  O "O5'" . DG  A 1 13  ? -0.613  4.815   35.894 1.00 47.79  ? 12   DG  C "O5'" 1 
ATOM   229  C "C5'" . DG  A 1 13  ? -1.807  4.413   35.237 1.00 45.78  ? 12   DG  C "C5'" 1 
ATOM   230  C "C4'" . DG  A 1 13  ? -2.285  3.090   35.773 1.00 44.03  ? 12   DG  C "C4'" 1 
ATOM   231  O "O4'" . DG  A 1 13  ? -1.370  2.011   35.485 1.00 45.62  ? 12   DG  C "O4'" 1 
ATOM   232  C "C3'" . DG  A 1 13  ? -2.526  3.047   37.269 1.00 44.99  ? 12   DG  C "C3'" 1 
ATOM   233  O "O3'" . DG  A 1 13  ? -3.742  2.330   37.402 1.00 50.70  ? 12   DG  C "O3'" 1 
ATOM   234  C "C2'" . DG  A 1 13  ? -1.346  2.246   37.791 1.00 43.75  ? 12   DG  C "C2'" 1 
ATOM   235  C "C1'" . DG  A 1 13  ? -1.089  1.271   36.659 1.00 42.10  ? 12   DG  C "C1'" 1 
ATOM   236  N N9    . DG  A 1 13  ? 0.305   0.858   36.590 1.00 41.44  ? 12   DG  C N9    1 
ATOM   237  C C8    . DG  A 1 13  ? 1.383   1.685   36.758 1.00 38.09  ? 12   DG  C C8    1 
ATOM   238  N N7    . DG  A 1 13  ? 2.526   1.067   36.668 1.00 37.30  ? 12   DG  C N7    1 
ATOM   239  C C5    . DG  A 1 13  ? 2.189   -0.251  36.417 1.00 36.44  ? 12   DG  C C5    1 
ATOM   240  C C6    . DG  A 1 13  ? 3.020   -1.383  36.237 1.00 35.19  ? 12   DG  C C6    1 
ATOM   241  O O6    . DG  A 1 13  ? 4.242   -1.442  36.225 1.00 41.89  ? 12   DG  C O6    1 
ATOM   242  N N1    . DG  A 1 13  ? 2.283   -2.527  36.041 1.00 33.24  ? 12   DG  C N1    1 
ATOM   243  C C2    . DG  A 1 13  ? 0.929   -2.578  35.995 1.00 36.88  ? 12   DG  C C2    1 
ATOM   244  N N2    . DG  A 1 13  ? 0.430   -3.783  35.803 1.00 42.85  ? 12   DG  C N2    1 
ATOM   245  N N3    . DG  A 1 13  ? 0.128   -1.528  36.134 1.00 35.48  ? 12   DG  C N3    1 
ATOM   246  C C4    . DG  A 1 13  ? 0.827   -0.408  36.354 1.00 35.89  ? 12   DG  C C4    1 
ATOM   247  P P     . DA  A 1 14  ? -4.372  2.061   38.843 1.00 51.05  ? 13   DA  C P     1 
ATOM   248  O OP1   . DA  A 1 14  ? -5.761  2.544   38.820 1.00 55.64  ? 13   DA  C OP1   1 
ATOM   249  O OP2   . DA  A 1 14  ? -3.443  2.560   39.880 1.00 55.14  ? 13   DA  C OP2   1 
ATOM   250  O "O5'" . DA  A 1 14  ? -4.437  0.466   38.904 1.00 51.45  ? 13   DA  C "O5'" 1 
ATOM   251  C "C5'" . DA  A 1 14  ? -5.091  -0.262  37.849 1.00 50.10  ? 13   DA  C "C5'" 1 
ATOM   252  C "C4'" . DA  A 1 14  ? -5.014  -1.747  38.102 1.00 51.79  ? 13   DA  C "C4'" 1 
ATOM   253  O "O4'" . DA  A 1 14  ? -3.657  -2.201  37.955 1.00 48.90  ? 13   DA  C "O4'" 1 
ATOM   254  C "C3'" . DA  A 1 14  ? -5.458  -2.189  39.490 1.00 53.51  ? 13   DA  C "C3'" 1 
ATOM   255  O "O3'" . DA  A 1 14  ? -6.280  -3.365  39.386 1.00 59.47  ? 13   DA  C "O3'" 1 
ATOM   256  C "C2'" . DA  A 1 14  ? -4.155  -2.421  40.233 1.00 46.86  ? 13   DA  C "C2'" 1 
ATOM   257  C "C1'" . DA  A 1 14  ? -3.181  -2.796  39.143 1.00 47.18  ? 13   DA  C "C1'" 1 
ATOM   258  N N9    . DA  A 1 14  ? -1.856  -2.246  39.379 1.00 46.89  ? 13   DA  C N9    1 
ATOM   259  C C8    . DA  A 1 14  ? -1.560  -0.952  39.706 1.00 44.80  ? 13   DA  C C8    1 
ATOM   260  N N7    . DA  A 1 14  ? -0.273  -0.712  39.792 1.00 48.63  ? 13   DA  C N7    1 
ATOM   261  C C5    . DA  A 1 14  ? 0.320   -1.943  39.521 1.00 44.61  ? 13   DA  C C5    1 
ATOM   262  C C6    . DA  A 1 14  ? 1.676   -2.362  39.441 1.00 41.17  ? 13   DA  C C6    1 
ATOM   263  N N6    . DA  A 1 14  ? 2.731   -1.556  39.605 1.00 40.13  ? 13   DA  C N6    1 
ATOM   264  N N1    . DA  A 1 14  ? 1.906   -3.653  39.168 1.00 41.20  ? 13   DA  C N1    1 
ATOM   265  C C2    . DA  A 1 14  ? 0.859   -4.465  38.968 1.00 41.02  ? 13   DA  C C2    1 
ATOM   266  N N3    . DA  A 1 14  ? -0.442  -4.195  38.997 1.00 42.58  ? 13   DA  C N3    1 
ATOM   267  C C4    . DA  A 1 14  ? -0.648  -2.901  39.283 1.00 45.02  ? 13   DA  C C4    1 
ATOM   268  P P     . DA  A 1 15  ? -6.658  -4.202  40.708 1.00 64.33  ? 14   DA  C P     1 
ATOM   269  O OP1   . DA  A 1 15  ? -7.795  -5.115  40.333 1.00 61.90  ? 14   DA  C OP1   1 
ATOM   270  O OP2   . DA  A 1 15  ? -6.760  -3.322  41.912 1.00 62.88  ? 14   DA  C OP2   1 
ATOM   271  O "O5'" . DA  A 1 15  ? -5.344  -5.052  40.929 1.00 64.27  ? 14   DA  C "O5'" 1 
ATOM   272  C "C5'" . DA  A 1 15  ? -4.898  -5.938  39.912 1.00 64.33  ? 14   DA  C "C5'" 1 
ATOM   273  C "C4'" . DA  A 1 15  ? -4.041  -6.998  40.542 1.00 64.05  ? 14   DA  C "C4'" 1 
ATOM   274  O "O4'" . DA  A 1 15  ? -2.735  -6.459  40.830 1.00 61.41  ? 14   DA  C "O4'" 1 
ATOM   275  C "C3'" . DA  A 1 15  ? -4.601  -7.444  41.885 1.00 64.88  ? 14   DA  C "C3'" 1 
ATOM   276  O "O3'" . DA  A 1 15  ? -4.281  -8.830  42.027 1.00 70.37  ? 14   DA  C "O3'" 1 
ATOM   277  C "C2'" . DA  A 1 15  ? -3.884  -6.534  42.872 1.00 58.90  ? 14   DA  C "C2'" 1 
ATOM   278  C "C1'" . DA  A 1 15  ? -2.520  -6.406  42.226 1.00 55.56  ? 14   DA  C "C1'" 1 
ATOM   279  N N9    . DA  A 1 15  ? -1.786  -5.181  42.480 1.00 48.01  ? 14   DA  C N9    1 
ATOM   280  C C8    . DA  A 1 15  ? -2.242  -3.920  42.688 1.00 41.43  ? 14   DA  C C8    1 
ATOM   281  N N7    . DA  A 1 15  ? -1.283  -3.031  42.795 1.00 44.02  ? 14   DA  C N7    1 
ATOM   282  C C5    . DA  A 1 15  ? -0.118  -3.773  42.675 1.00 39.05  ? 14   DA  C C5    1 
ATOM   283  C C6    . DA  A 1 15  ? 1.246   -3.424  42.690 1.00 39.00  ? 14   DA  C C6    1 
ATOM   284  N N6    . DA  A 1 15  ? 1.705   -2.183  42.837 1.00 37.93  ? 14   DA  C N6    1 
ATOM   285  N N1    . DA  A 1 15  ? 2.140   -4.407  42.539 1.00 34.64  ? 14   DA  C N1    1 
ATOM   286  C C2    . DA  A 1 15  ? 1.696   -5.649  42.369 1.00 37.21  ? 14   DA  C C2    1 
ATOM   287  N N3    . DA  A 1 15  ? 0.448   -6.099  42.327 1.00 38.37  ? 14   DA  C N3    1 
ATOM   288  C C4    . DA  A 1 15  ? -0.417  -5.098  42.492 1.00 41.93  ? 14   DA  C C4    1 
ATOM   289  P P     . DA  A 1 16  ? -4.510  -9.574  43.430 1.00 72.30  ? 15   DA  C P     1 
ATOM   290  O OP1   . DA  A 1 16  ? -4.966  -10.953 43.089 1.00 73.92  ? 15   DA  C OP1   1 
ATOM   291  O OP2   . DA  A 1 16  ? -5.324  -8.732  44.367 1.00 71.92  ? 15   DA  C OP2   1 
ATOM   292  O "O5'" . DA  A 1 16  ? -3.024  -9.683  43.992 1.00 69.36  ? 15   DA  C "O5'" 1 
ATOM   293  C "C5'" . DA  A 1 16  ? -1.975  -10.110 43.116 1.00 65.30  ? 15   DA  C "C5'" 1 
ATOM   294  C "C4'" . DA  A 1 16  ? -0.645  -9.986  43.809 1.00 63.57  ? 15   DA  C "C4'" 1 
ATOM   295  O "O4'" . DA  A 1 16  ? -0.219  -8.607  43.956 1.00 61.76  ? 15   DA  C "O4'" 1 
ATOM   296  C "C3'" . DA  A 1 16  ? -0.691  -10.556 45.214 1.00 63.68  ? 15   DA  C "C3'" 1 
ATOM   297  O "O3'" . DA  A 1 16  ? 0.510   -11.273 45.399 1.00 66.95  ? 15   DA  C "O3'" 1 
ATOM   298  C "C2'" . DA  A 1 16  ? -0.719  -9.320  46.095 1.00 61.61  ? 15   DA  C "C2'" 1 
ATOM   299  C "C1'" . DA  A 1 16  ? 0.165   -8.389  45.297 1.00 58.05  ? 15   DA  C "C1'" 1 
ATOM   300  N N9    . DA  A 1 16  ? 0.038   -6.956  45.579 1.00 55.34  ? 15   DA  C N9    1 
ATOM   301  C C8    . DA  A 1 16  ? -1.088  -6.214  45.850 1.00 52.08  ? 15   DA  C C8    1 
ATOM   302  N N7    . DA  A 1 16  ? -0.843  -4.935  46.025 1.00 51.48  ? 15   DA  C N7    1 
ATOM   303  C C5    . DA  A 1 16  ? 0.533   -4.829  45.861 1.00 44.88  ? 15   DA  C C5    1 
ATOM   304  C C6    . DA  A 1 16  ? 1.407   -3.741  45.913 1.00 45.79  ? 15   DA  C C6    1 
ATOM   305  N N6    . DA  A 1 16  ? 1.022   -2.498  46.146 1.00 48.18  ? 15   DA  C N6    1 
ATOM   306  N N1    . DA  A 1 16  ? 2.715   -3.974  45.714 1.00 48.59  ? 15   DA  C N1    1 
ATOM   307  C C2    . DA  A 1 16  ? 3.111   -5.225  45.482 1.00 50.81  ? 15   DA  C C2    1 
ATOM   308  N N3    . DA  A 1 16  ? 2.385   -6.335  45.408 1.00 48.28  ? 15   DA  C N3    1 
ATOM   309  C C4    . DA  A 1 16  ? 1.088   -6.064  45.604 1.00 49.95  ? 15   DA  C C4    1 
ATOM   310  P P     . DA  A 1 17  ? 0.579   -12.422 46.510 1.00 69.86  ? 16   DA  C P     1 
ATOM   311  O OP1   . DA  A 1 17  ? 0.734   -13.753 45.809 1.00 68.43  ? 16   DA  C OP1   1 
ATOM   312  O OP2   . DA  A 1 17  ? -0.516  -12.201 47.501 1.00 66.60  ? 16   DA  C OP2   1 
ATOM   313  O "O5'" . DA  A 1 17  ? 1.955   -12.094 47.208 1.00 67.06  ? 16   DA  C "O5'" 1 
ATOM   314  C "C5'" . DA  A 1 17  ? 3.032   -11.690 46.398 1.00 62.39  ? 16   DA  C "C5'" 1 
ATOM   315  C "C4'" . DA  A 1 17  ? 3.895   -10.742 47.173 1.00 60.97  ? 16   DA  C "C4'" 1 
ATOM   316  O "O4'" . DA  A 1 17  ? 3.300   -9.428  47.270 1.00 60.53  ? 16   DA  C "O4'" 1 
ATOM   317  C "C3'" . DA  A 1 17  ? 4.070   -11.228 48.599 1.00 61.79  ? 16   DA  C "C3'" 1 
ATOM   318  O "O3'" . DA  A 1 17  ? 5.455   -11.323 48.797 1.00 64.20  ? 16   DA  C "O3'" 1 
ATOM   319  C "C2'" . DA  A 1 17  ? 3.430   -10.136 49.452 1.00 60.35  ? 16   DA  C "C2'" 1 
ATOM   320  C "C1'" . DA  A 1 17  ? 3.571   -8.927  48.557 1.00 57.44  ? 16   DA  C "C1'" 1 
ATOM   321  N N9    . DA  A 1 17  ? 2.649   -7.822  48.807 1.00 54.68  ? 16   DA  C N9    1 
ATOM   322  C C8    . DA  A 1 17  ? 1.313   -7.891  49.095 1.00 52.23  ? 16   DA  C C8    1 
ATOM   323  N N7    . DA  A 1 17  ? 0.747   -6.715  49.248 1.00 49.66  ? 16   DA  C N7    1 
ATOM   324  C C5    . DA  A 1 17  ? 1.786   -5.812  49.058 1.00 48.84  ? 16   DA  C C5    1 
ATOM   325  C C6    . DA  A 1 17  ? 1.840   -4.400  49.079 1.00 46.79  ? 16   DA  C C6    1 
ATOM   326  N N6    . DA  A 1 17  ? 0.789   -3.621  49.299 1.00 42.38  ? 16   DA  C N6    1 
ATOM   327  N N1    . DA  A 1 17  ? 3.030   -3.813  48.848 1.00 44.29  ? 16   DA  C N1    1 
ATOM   328  C C2    . DA  A 1 17  ? 4.079   -4.585  48.596 1.00 42.76  ? 16   DA  C C2    1 
ATOM   329  N N3    . DA  A 1 17  ? 4.154   -5.913  48.540 1.00 50.43  ? 16   DA  C N3    1 
ATOM   330  C C4    . DA  A 1 17  ? 2.961   -6.476  48.785 1.00 50.02  ? 16   DA  C C4    1 
ATOM   331  P P     . DA  A 1 18  ? 6.017   -11.908 50.165 1.00 67.55  ? 17   DA  C P     1 
ATOM   332  O OP1   . DA  A 1 18  ? 7.101   -12.889 49.770 1.00 65.45  ? 17   DA  C OP1   1 
ATOM   333  O OP2   . DA  A 1 18  ? 4.840   -12.361 50.995 1.00 63.59  ? 17   DA  C OP2   1 
ATOM   334  O "O5'" . DA  A 1 18  ? 6.757   -10.630 50.763 1.00 66.30  ? 17   DA  C "O5'" 1 
ATOM   335  C "C5'" . DA  A 1 18  ? 7.761   -9.984  49.959 1.00 65.08  ? 17   DA  C "C5'" 1 
ATOM   336  C "C4'" . DA  A 1 18  ? 8.090   -8.605  50.477 1.00 63.14  ? 17   DA  C "C4'" 1 
ATOM   337  O "O4'" . DA  A 1 18  ? 6.923   -7.750  50.482 1.00 60.23  ? 17   DA  C "O4'" 1 
ATOM   338  C "C3'" . DA  A 1 18  ? 8.717   -8.505  51.869 1.00 63.21  ? 17   DA  C "C3'" 1 
ATOM   339  O "O3'" . DA  A 1 18  ? 9.845   -7.623  51.711 1.00 64.97  ? 17   DA  C "O3'" 1 
ATOM   340  C "C2'" . DA  A 1 18  ? 7.582   -7.940  52.727 1.00 61.52  ? 17   DA  C "C2'" 1 
ATOM   341  C "C1'" . DA  A 1 18  ? 6.818   -7.075  51.722 1.00 56.97  ? 17   DA  C "C1'" 1 
ATOM   342  N N9    . DA  A 1 18  ? 5.396   -6.798  51.937 1.00 50.42  ? 17   DA  C N9    1 
ATOM   343  C C8    . DA  A 1 18  ? 4.347   -7.684  51.985 1.00 48.96  ? 17   DA  C C8    1 
ATOM   344  N N7    . DA  A 1 18  ? 3.177   -7.102  52.039 1.00 44.73  ? 17   DA  C N7    1 
ATOM   345  C C5    . DA  A 1 18  ? 3.476   -5.749  52.069 1.00 41.24  ? 17   DA  C C5    1 
ATOM   346  C C6    . DA  A 1 18  ? 2.675   -4.613  52.123 1.00 42.15  ? 17   DA  C C6    1 
ATOM   347  N N6    . DA  A 1 18  ? 1.353   -4.654  52.140 1.00 43.23  ? 17   DA  C N6    1 
ATOM   348  N N1    . DA  A 1 18  ? 3.283   -3.411  52.155 1.00 39.85  ? 17   DA  C N1    1 
ATOM   349  C C2    . DA  A 1 18  ? 4.609   -3.371  52.132 1.00 44.29  ? 17   DA  C C2    1 
ATOM   350  N N3    . DA  A 1 18  ? 5.472   -4.368  52.077 1.00 46.49  ? 17   DA  C N3    1 
ATOM   351  C C4    . DA  A 1 18  ? 4.834   -5.549  52.042 1.00 45.48  ? 17   DA  C C4    1 
ATOM   352  P P     . DT  A 1 19  ? 10.977  -7.528  52.841 1.00 67.63  ? 18   DT  C P     1 
ATOM   353  O OP1   . DT  A 1 19  ? 12.338  -7.624  52.219 1.00 66.29  ? 18   DT  C OP1   1 
ATOM   354  O OP2   . DT  A 1 19  ? 10.567  -8.519  53.900 1.00 68.42  ? 18   DT  C OP2   1 
ATOM   355  O "O5'" . DT  A 1 19  ? 10.751  -6.041  53.360 1.00 62.25  ? 18   DT  C "O5'" 1 
ATOM   356  C "C5'" . DT  A 1 19  ? 9.425   -5.509  53.342 1.00 58.76  ? 18   DT  C "C5'" 1 
ATOM   357  C "C4'" . DT  A 1 19  ? 9.408   -4.131  53.936 1.00 58.69  ? 18   DT  C "C4'" 1 
ATOM   358  O "O4'" . DT  A 1 19  ? 8.035   -3.687  53.941 1.00 59.55  ? 18   DT  C "O4'" 1 
ATOM   359  C "C3'" . DT  A 1 19  ? 9.877   -4.088  55.385 1.00 61.30  ? 18   DT  C "C3'" 1 
ATOM   360  O "O3'" . DT  A 1 19  ? 10.686  -2.917  55.572 1.00 65.19  ? 18   DT  C "O3'" 1 
ATOM   361  C "C2'" . DT  A 1 19  ? 8.582   -4.106  56.188 1.00 57.77  ? 18   DT  C "C2'" 1 
ATOM   362  C "C1'" . DT  A 1 19  ? 7.572   -3.462  55.251 1.00 53.78  ? 18   DT  C "C1'" 1 
ATOM   363  N N1    . DT  A 1 19  ? 6.233   -4.029  55.321 1.00 45.61  ? 18   DT  C N1    1 
ATOM   364  C C2    . DT  A 1 19  ? 5.183   -3.164  55.329 1.00 41.59  ? 18   DT  C C2    1 
ATOM   365  O O2    . DT  A 1 19  ? 5.323   -1.958  55.272 1.00 43.42  ? 18   DT  C O2    1 
ATOM   366  N N3    . DT  A 1 19  ? 3.967   -3.749  55.414 1.00 34.14  ? 18   DT  C N3    1 
ATOM   367  C C4    . DT  A 1 19  ? 3.699   -5.083  55.499 1.00 35.02  ? 18   DT  C C4    1 
ATOM   368  O O4    . DT  A 1 19  ? 2.543   -5.443  55.597 1.00 36.74  ? 18   DT  C O4    1 
ATOM   369  C C5    . DT  A 1 19  ? 4.863   -5.946  55.471 1.00 32.07  ? 18   DT  C C5    1 
ATOM   370  C C7    . DT  A 1 19  ? 4.697   -7.424  55.545 1.00 35.52  ? 18   DT  C C7    1 
ATOM   371  C C6    . DT  A 1 19  ? 6.052   -5.382  55.379 1.00 36.27  ? 18   DT  C C6    1 
ATOM   372  P P     . DT  A 1 20  ? 11.200  -2.509  57.043 1.00 69.78  ? 19   DT  C P     1 
ATOM   373  O OP1   . DT  A 1 20  ? 12.605  -2.013  56.880 1.00 66.68  ? 19   DT  C OP1   1 
ATOM   374  O OP2   . DT  A 1 20  ? 10.909  -3.602  58.030 1.00 71.56  ? 19   DT  C OP2   1 
ATOM   375  O "O5'" . DT  A 1 20  ? 10.236  -1.298  57.405 1.00 68.59  ? 19   DT  C "O5'" 1 
ATOM   376  C "C5'" . DT  A 1 20  ? 9.627   -0.546  56.352 1.00 66.22  ? 19   DT  C "C5'" 1 
ATOM   377  C "C4'" . DT  A 1 20  ? 8.537   0.320   56.914 1.00 64.81  ? 19   DT  C "C4'" 1 
ATOM   378  O "O4'" . DT  A 1 20  ? 7.251   -0.342  56.919 1.00 63.04  ? 19   DT  C "O4'" 1 
ATOM   379  C "C3'" . DT  A 1 20  ? 8.821   0.723   58.349 1.00 65.94  ? 19   DT  C "C3'" 1 
ATOM   380  O "O3'" . DT  A 1 20  ? 8.627   2.123   58.434 1.00 68.44  ? 19   DT  C "O3'" 1 
ATOM   381  C "C2'" . DT  A 1 20  ? 7.790   -0.061  59.149 1.00 63.89  ? 19   DT  C "C2'" 1 
ATOM   382  C "C1'" . DT  A 1 20  ? 6.635   -0.165  58.174 1.00 57.96  ? 19   DT  C "C1'" 1 
ATOM   383  N N1    . DT  A 1 20  ? 5.797   -1.326  58.401 1.00 51.83  ? 19   DT  C N1    1 
ATOM   384  C C2    . DT  A 1 20  ? 4.421   -1.184  58.531 1.00 51.09  ? 19   DT  C C2    1 
ATOM   385  O O2    . DT  A 1 20  ? 3.835   -0.120  58.476 1.00 51.52  ? 19   DT  C O2    1 
ATOM   386  N N3    . DT  A 1 20  ? 3.751   -2.350  58.721 1.00 50.00  ? 19   DT  C N3    1 
ATOM   387  C C4    . DT  A 1 20  ? 4.295   -3.615  58.780 1.00 53.09  ? 19   DT  C C4    1 
ATOM   388  O O4    . DT  A 1 20  ? 3.557   -4.578  58.938 1.00 54.41  ? 19   DT  C O4    1 
ATOM   389  C C5    . DT  A 1 20  ? 5.743   -3.679  58.637 1.00 50.09  ? 19   DT  C C5    1 
ATOM   390  C C7    . DT  A 1 20  ? 6.434   -5.002  58.677 1.00 53.74  ? 19   DT  C C7    1 
ATOM   391  C C6    . DT  A 1 20  ? 6.404   -2.547  58.464 1.00 48.62  ? 19   DT  C C6    1 
ATOM   392  P P     . DT  A 1 21  ? 8.810   2.867   59.838 1.00 72.40  ? 20   DT  C P     1 
ATOM   393  O OP1   . DT  A 1 21  ? 9.617   4.092   59.490 1.00 70.73  ? 20   DT  C OP1   1 
ATOM   394  O OP2   . DT  A 1 21  ? 9.343   1.890   60.842 1.00 71.60  ? 20   DT  C OP2   1 
ATOM   395  O "O5'" . DT  A 1 21  ? 7.295   3.237   60.198 1.00 71.12  ? 20   DT  C "O5'" 1 
ATOM   396  C "C5'" . DT  A 1 21  ? 6.370   3.634   59.154 1.00 70.04  ? 20   DT  C "C5'" 1 
ATOM   397  C "C4'" . DT  A 1 21  ? 4.981   3.779   59.724 1.00 68.53  ? 20   DT  C "C4'" 1 
ATOM   398  O "O4'" . DT  A 1 21  ? 4.306   2.507   59.875 1.00 69.01  ? 20   DT  C "O4'" 1 
ATOM   399  C "C3'" . DT  A 1 21  ? 5.051   4.352   61.124 1.00 69.01  ? 20   DT  C "C3'" 1 
ATOM   400  O "O3'" . DT  A 1 21  ? 3.894   5.111   61.357 1.00 73.03  ? 20   DT  C "O3'" 1 
ATOM   401  C "C2'" . DT  A 1 21  ? 5.010   3.121   61.999 1.00 66.13  ? 20   DT  C "C2'" 1 
ATOM   402  C "C1'" . DT  A 1 21  ? 3.986   2.306   61.249 1.00 63.11  ? 20   DT  C "C1'" 1 
ATOM   403  N N1    . DT  A 1 21  ? 4.061   0.867   61.532 1.00 57.32  ? 20   DT  C N1    1 
ATOM   404  C C2    . DT  A 1 21  ? 2.878   0.157   61.703 1.00 56.95  ? 20   DT  C C2    1 
ATOM   405  O O2    . DT  A 1 21  ? 1.771   0.664   61.672 1.00 61.21  ? 20   DT  C O2    1 
ATOM   406  N N3    . DT  A 1 21  ? 3.042   -1.175  61.925 1.00 52.43  ? 20   DT  C N3    1 
ATOM   407  C C4    . DT  A 1 21  ? 4.232   -1.859  62.002 1.00 51.09  ? 20   DT  C C4    1 
ATOM   408  O O4    . DT  A 1 21  ? 4.216   -3.063  62.200 1.00 48.90  ? 20   DT  C O4    1 
ATOM   409  C C5    . DT  A 1 21  ? 5.434   -1.051  61.830 1.00 48.23  ? 20   DT  C C5    1 
ATOM   410  C C7    . DT  A 1 21  ? 6.776   -1.709  61.895 1.00 47.11  ? 20   DT  C C7    1 
ATOM   411  C C6    . DT  A 1 21  ? 5.285   0.253   61.612 1.00 49.70  ? 20   DT  C C6    1 
ATOM   412  P P     . DT  A 1 22  ? 4.005   6.398   62.282 1.00 76.37  ? 21   DT  C P     1 
ATOM   413  O OP1   . DT  A 1 22  ? 3.767   7.554   61.359 1.00 79.41  ? 21   DT  C OP1   1 
ATOM   414  O OP2   . DT  A 1 22  ? 5.262   6.328   63.107 1.00 74.40  ? 21   DT  C OP2   1 
ATOM   415  O "O5'" . DT  A 1 22  ? 2.803   6.195   63.278 1.00 73.35  ? 21   DT  C "O5'" 1 
ATOM   416  C "C5'" . DT  A 1 22  ? 2.447   4.895   63.620 1.00 69.72  ? 21   DT  C "C5'" 1 
ATOM   417  C "C4'" . DT  A 1 22  ? 0.955   4.766   63.562 1.00 67.22  ? 21   DT  C "C4'" 1 
ATOM   418  O "O4'" . DT  A 1 22  ? 0.699   3.378   63.347 1.00 64.63  ? 21   DT  C "O4'" 1 
ATOM   419  C "C3'" . DT  A 1 22  ? 0.296   5.133   64.884 1.00 68.57  ? 21   DT  C "C3'" 1 
ATOM   420  O "O3'" . DT  A 1 22  ? -1.004  5.682   64.650 1.00 71.75  ? 21   DT  C "O3'" 1 
ATOM   421  C "C2'" . DT  A 1 22  ? 0.301   3.817   65.643 1.00 65.54  ? 21   DT  C "C2'" 1 
ATOM   422  C "C1'" . DT  A 1 22  ? 0.254   2.769   64.537 1.00 60.34  ? 21   DT  C "C1'" 1 
ATOM   423  N N1    . DT  A 1 22  ? 1.100   1.599   64.754 1.00 52.45  ? 21   DT  C N1    1 
ATOM   424  C C2    . DT  A 1 22  ? 0.467   0.389   64.848 1.00 50.22  ? 21   DT  C C2    1 
ATOM   425  O O2    . DT  A 1 22  ? -0.744  0.275   64.813 1.00 56.23  ? 21   DT  C O2    1 
ATOM   426  N N3    . DT  A 1 22  ? 1.297   -0.681  64.988 1.00 43.64  ? 21   DT  C N3    1 
ATOM   427  C C4    . DT  A 1 22  ? 2.671   -0.659  65.048 1.00 47.47  ? 21   DT  C C4    1 
ATOM   428  O O4    . DT  A 1 22  ? 3.290   -1.700  65.143 1.00 54.12  ? 21   DT  C O4    1 
ATOM   429  C C5    . DT  A 1 22  ? 3.275   0.644   64.980 1.00 44.87  ? 21   DT  C C5    1 
ATOM   430  C C7    . DT  A 1 22  ? 4.761   0.746   65.078 1.00 36.23  ? 21   DT  C C7    1 
ATOM   431  C C6    . DT  A 1 22  ? 2.469   1.705   64.835 1.00 47.68  ? 21   DT  C C6    1 
ATOM   432  P P     . DT  A 1 23  ? -2.026  5.876   65.879 1.00 74.66  ? 22   DT  C P     1 
ATOM   433  O OP1   . DT  A 1 23  ? -3.267  6.448   65.279 1.00 74.03  ? 22   DT  C OP1   1 
ATOM   434  O OP2   . DT  A 1 23  ? -1.376  6.569   67.025 1.00 75.38  ? 22   DT  C OP2   1 
ATOM   435  O "O5'" . DT  A 1 23  ? -2.371  4.380   66.274 1.00 71.61  ? 22   DT  C "O5'" 1 
ATOM   436  C "C5'" . DT  A 1 23  ? -3.116  3.597   65.353 1.00 70.09  ? 22   DT  C "C5'" 1 
ATOM   437  C "C4'" . DT  A 1 23  ? -4.087  2.729   66.105 1.00 70.21  ? 22   DT  C "C4'" 1 
ATOM   438  O "O4'" . DT  A 1 23  ? -3.424  1.485   66.426 1.00 66.60  ? 22   DT  C "O4'" 1 
ATOM   439  C "C3'" . DT  A 1 23  ? -4.539  3.339   67.435 1.00 71.33  ? 22   DT  C "C3'" 1 
ATOM   440  O "O3'" . DT  A 1 23  ? -5.848  2.928   67.887 1.00 74.27  ? 22   DT  C "O3'" 1 
ATOM   441  C "C2'" . DT  A 1 23  ? -3.547  2.754   68.422 1.00 67.99  ? 22   DT  C "C2'" 1 
ATOM   442  C "C1'" . DT  A 1 23  ? -3.211  1.388   67.820 1.00 63.40  ? 22   DT  C "C1'" 1 
ATOM   443  N N1    . DT  A 1 23  ? -1.813  1.077   67.998 1.00 56.23  ? 22   DT  C N1    1 
ATOM   444  C C2    . DT  A 1 23  ? -1.413  -0.233  68.095 1.00 52.37  ? 22   DT  C C2    1 
ATOM   445  O O2    . DT  A 1 23  ? -2.181  -1.179  68.044 1.00 49.88  ? 22   DT  C O2    1 
ATOM   446  N N3    . DT  A 1 23  ? -0.070  -0.395  68.263 1.00 49.54  ? 22   DT  C N3    1 
ATOM   447  C C4    . DT  A 1 23  ? 0.881   0.604   68.339 1.00 49.32  ? 22   DT  C C4    1 
ATOM   448  O O4    . DT  A 1 23  ? 2.053   0.310   68.500 1.00 50.88  ? 22   DT  C O4    1 
ATOM   449  C C5    . DT  A 1 23  ? 0.381   1.947   68.219 1.00 45.64  ? 22   DT  C C5    1 
ATOM   450  C C7    . DT  A 1 23  ? 1.335   3.086   68.272 1.00 45.95  ? 22   DT  C C7    1 
ATOM   451  C C6    . DT  A 1 23  ? -0.920  2.114   68.056 1.00 51.08  ? 22   DT  C C6    1 
ATOM   452  O "O5'" . DA  B 2 2   ? 3.770   -12.474 67.862 1.00 87.12  ? 101  DA  D "O5'" 1 
ATOM   453  C "C5'" . DA  B 2 2   ? 3.609   -11.074 68.121 1.00 86.76  ? 101  DA  D "C5'" 1 
ATOM   454  C "C4'" . DA  B 2 2   ? 2.206   -10.711 68.580 1.00 85.75  ? 101  DA  D "C4'" 1 
ATOM   455  O "O4'" . DA  B 2 2   ? 2.184   -9.382  69.132 1.00 81.21  ? 101  DA  D "O4'" 1 
ATOM   456  C "C3'" . DA  B 2 2   ? 1.051   -10.742 67.593 1.00 87.73  ? 101  DA  D "C3'" 1 
ATOM   457  O "O3'" . DA  B 2 2   ? -0.176  -11.081 68.297 1.00 92.25  ? 101  DA  D "O3'" 1 
ATOM   458  C "C2'" . DA  B 2 2   ? 1.016   -9.295  67.138 1.00 83.68  ? 101  DA  D "C2'" 1 
ATOM   459  C "C1'" . DA  B 2 2   ? 1.316   -8.542  68.435 1.00 77.34  ? 101  DA  D "C1'" 1 
ATOM   460  N N9    . DA  B 2 2   ? 2.065   -7.313  68.258 1.00 69.55  ? 101  DA  D N9    1 
ATOM   461  C C8    . DA  B 2 2   ? 3.433   -7.207  68.029 1.00 66.92  ? 101  DA  D C8    1 
ATOM   462  N N7    . DA  B 2 2   ? 3.858   -5.970  67.967 1.00 65.77  ? 101  DA  D N7    1 
ATOM   463  C C5    . DA  B 2 2   ? 2.696   -5.213  68.165 1.00 64.99  ? 101  DA  D C5    1 
ATOM   464  C C6    . DA  B 2 2   ? 2.459   -3.809  68.226 1.00 63.28  ? 101  DA  D C6    1 
ATOM   465  N N6    . DA  B 2 2   ? 3.433   -2.887  68.136 1.00 62.50  ? 101  DA  D N6    1 
ATOM   466  N N1    . DA  B 2 2   ? 1.177   -3.389  68.405 1.00 56.89  ? 101  DA  D N1    1 
ATOM   467  C C2    . DA  B 2 2   ? 0.218   -4.313  68.542 1.00 55.17  ? 101  DA  D C2    1 
ATOM   468  N N3    . DA  B 2 2   ? 0.317   -5.644  68.529 1.00 57.94  ? 101  DA  D N3    1 
ATOM   469  C C4    . DA  B 2 2   ? 1.590   -6.032  68.330 1.00 64.40  ? 101  DA  D C4    1 
ATOM   470  P P     . DA  B 2 3   ? -1.410  -11.690 67.463 1.00 94.19  ? 102  DA  D P     1 
ATOM   471  O OP1   . DA  B 2 3   ? -2.357  -12.485 68.319 1.00 93.92  ? 102  DA  D OP1   1 
ATOM   472  O OP2   . DA  B 2 3   ? -0.790  -12.308 66.205 1.00 94.41  ? 102  DA  D OP2   1 
ATOM   473  O "O5'" . DA  B 2 3   ? -2.208  -10.410 67.005 1.00 90.26  ? 102  DA  D "O5'" 1 
ATOM   474  C "C5'" . DA  B 2 3   ? -3.303  -10.540 66.126 1.00 85.27  ? 102  DA  D "C5'" 1 
ATOM   475  C "C4'" . DA  B 2 3   ? -3.983  -9.206  65.997 1.00 81.17  ? 102  DA  D "C4'" 1 
ATOM   476  O "O4'" . DA  B 2 3   ? -3.091  -8.115  66.325 1.00 77.34  ? 102  DA  D "O4'" 1 
ATOM   477  C "C3'" . DA  B 2 3   ? -4.478  -8.921  64.598 1.00 79.41  ? 102  DA  D "C3'" 1 
ATOM   478  O "O3'" . DA  B 2 3   ? -5.640  -8.151  64.764 1.00 84.72  ? 102  DA  D "O3'" 1 
ATOM   479  C "C2'" . DA  B 2 3   ? -3.371  -8.079  63.991 1.00 75.24  ? 102  DA  D "C2'" 1 
ATOM   480  C "C1'" . DA  B 2 3   ? -2.888  -7.282  65.193 1.00 70.80  ? 102  DA  D "C1'" 1 
ATOM   481  N N9    . DA  B 2 3   ? -1.471  -6.912  65.170 1.00 62.67  ? 102  DA  D N9    1 
ATOM   482  C C8    . DA  B 2 3   ? -0.353  -7.717  65.164 1.00 59.67  ? 102  DA  D C8    1 
ATOM   483  N N7    . DA  B 2 3   ? 0.780   -7.045  65.175 1.00 52.88  ? 102  DA  D N7    1 
ATOM   484  C C5    . DA  B 2 3   ? 0.379   -5.716  65.181 1.00 48.89  ? 102  DA  D C5    1 
ATOM   485  C C6    . DA  B 2 3   ? 1.100   -4.499  65.202 1.00 47.96  ? 102  DA  D C6    1 
ATOM   486  N N6    . DA  B 2 3   ? 2.422   -4.412  65.204 1.00 40.58  ? 102  DA  D N6    1 
ATOM   487  N N1    . DA  B 2 3   ? 0.394   -3.351  65.219 1.00 50.15  ? 102  DA  D N1    1 
ATOM   488  C C2    . DA  B 2 3   ? -0.950  -3.424  65.205 1.00 56.24  ? 102  DA  D C2    1 
ATOM   489  N N3    . DA  B 2 3   ? -1.738  -4.501  65.179 1.00 56.63  ? 102  DA  D N3    1 
ATOM   490  C C4    . DA  B 2 3   ? -1.002  -5.624  65.172 1.00 55.32  ? 102  DA  D C4    1 
ATOM   491  P P     . DA  B 2 4   ? -6.753  -8.196  63.640 1.00 87.76  ? 103  DA  D P     1 
ATOM   492  O OP1   . DA  B 2 4   ? -8.121  -8.254  64.270 1.00 88.87  ? 103  DA  D OP1   1 
ATOM   493  O OP2   . DA  B 2 4   ? -6.293  -9.308  62.726 1.00 88.69  ? 103  DA  D OP2   1 
ATOM   494  O "O5'" . DA  B 2 4   ? -6.559  -6.791  62.935 1.00 83.07  ? 103  DA  D "O5'" 1 
ATOM   495  C "C5'" . DA  B 2 4   ? -6.734  -5.584  63.668 1.00 74.92  ? 103  DA  D "C5'" 1 
ATOM   496  C "C4'" . DA  B 2 4   ? -6.110  -4.463  62.887 1.00 72.52  ? 103  DA  D "C4'" 1 
ATOM   497  O "O4'" . DA  B 2 4   ? -4.676  -4.522  63.058 1.00 69.86  ? 103  DA  D "O4'" 1 
ATOM   498  C "C3'" . DA  B 2 4   ? -6.359  -4.620  61.378 1.00 72.58  ? 103  DA  D "C3'" 1 
ATOM   499  O "O3'" . DA  B 2 4   ? -6.466  -3.320  60.801 1.00 74.84  ? 103  DA  D "O3'" 1 
ATOM   500  C "C2'" . DA  B 2 4   ? -5.068  -5.255  60.886 1.00 68.68  ? 103  DA  D "C2'" 1 
ATOM   501  C "C1'" . DA  B 2 4   ? -4.119  -4.461  61.762 1.00 65.47  ? 103  DA  D "C1'" 1 
ATOM   502  N N9    . DA  B 2 4   ? -2.712  -4.836  61.835 1.00 55.52  ? 103  DA  D N9    1 
ATOM   503  C C8    . DA  B 2 4   ? -2.107  -6.064  61.787 1.00 55.11  ? 103  DA  D C8    1 
ATOM   504  N N7    . DA  B 2 4   ? -0.795  -6.002  61.825 1.00 49.48  ? 103  DA  D N7    1 
ATOM   505  C C5    . DA  B 2 4   ? -0.528  -4.643  61.919 1.00 42.70  ? 103  DA  D C5    1 
ATOM   506  C C6    . DA  B 2 4   ? 0.668   -3.915  61.990 1.00 41.10  ? 103  DA  D C6    1 
ATOM   507  N N6    . DA  B 2 4   ? 1.860   -4.470  61.996 1.00 39.49  ? 103  DA  D N6    1 
ATOM   508  N N1    . DA  B 2 4   ? 0.594   -2.572  62.064 1.00 41.19  ? 103  DA  D N1    1 
ATOM   509  C C2    . DA  B 2 4   ? -0.615  -2.009  62.084 1.00 47.55  ? 103  DA  D C2    1 
ATOM   510  N N3    . DA  B 2 4   ? -1.819  -2.588  62.033 1.00 45.17  ? 103  DA  D N3    1 
ATOM   511  C C4    . DA  B 2 4   ? -1.698  -3.920  61.942 1.00 45.97  ? 103  DA  D C4    1 
ATOM   512  P P     . DA  B 2 5   ? -7.911  -2.624  60.635 1.00 77.24  ? 104  DA  D P     1 
ATOM   513  O OP1   . DA  B 2 5   ? -8.580  -2.514  61.985 1.00 76.45  ? 104  DA  D OP1   1 
ATOM   514  O OP2   . DA  B 2 5   ? -8.648  -3.284  59.498 1.00 79.25  ? 104  DA  D OP2   1 
ATOM   515  O "O5'" . DA  B 2 5   ? -7.504  -1.159  60.171 1.00 75.38  ? 104  DA  D "O5'" 1 
ATOM   516  C "C5'" . DA  B 2 5   ? -6.716  -0.332  61.035 1.00 75.21  ? 104  DA  D "C5'" 1 
ATOM   517  C "C4'" . DA  B 2 5   ? -5.467  0.167   60.338 1.00 73.75  ? 104  DA  D "C4'" 1 
ATOM   518  O "O4'" . DA  B 2 5   ? -4.379  -0.789  60.374 1.00 74.31  ? 104  DA  D "O4'" 1 
ATOM   519  C "C3'" . DA  B 2 5   ? -5.587  0.618   58.881 1.00 73.01  ? 104  DA  D "C3'" 1 
ATOM   520  O "O3'" . DA  B 2 5   ? -4.962  1.885   58.751 1.00 74.21  ? 104  DA  D "O3'" 1 
ATOM   521  C "C2'" . DA  B 2 5   ? -4.751  -0.396  58.114 1.00 71.02  ? 104  DA  D "C2'" 1 
ATOM   522  C "C1'" . DA  B 2 5   ? -3.678  -0.693  59.143 1.00 68.45  ? 104  DA  D "C1'" 1 
ATOM   523  N N9    . DA  B 2 5   ? -2.929  -1.931  58.955 1.00 62.35  ? 104  DA  D N9    1 
ATOM   524  C C8    . DA  B 2 5   ? -3.408  -3.212  58.825 1.00 60.08  ? 104  DA  D C8    1 
ATOM   525  N N7    . DA  B 2 5   ? -2.464  -4.115  58.696 1.00 59.59  ? 104  DA  D N7    1 
ATOM   526  C C5    . DA  B 2 5   ? -1.284  -3.379  58.739 1.00 54.95  ? 104  DA  D C5    1 
ATOM   527  C C6    . DA  B 2 5   ? 0.076   -3.753  58.662 1.00 55.10  ? 104  DA  D C6    1 
ATOM   528  N N6    . DA  B 2 5   ? 0.487   -5.018  58.518 1.00 54.66  ? 104  DA  D N6    1 
ATOM   529  N N1    . DA  B 2 5   ? 1.009   -2.767  58.741 1.00 50.24  ? 104  DA  D N1    1 
ATOM   530  C C2    . DA  B 2 5   ? 0.592   -1.499  58.891 1.00 51.20  ? 104  DA  D C2    1 
ATOM   531  N N3    . DA  B 2 5   ? -0.660  -1.026  58.977 1.00 53.59  ? 104  DA  D N3    1 
ATOM   532  C C4    . DA  B 2 5   ? -1.557  -2.030  58.892 1.00 57.50  ? 104  DA  D C4    1 
ATOM   533  P P     . DA  B 2 6   ? -5.476  2.903   57.620 1.00 75.29  ? 105  DA  D P     1 
ATOM   534  O OP1   . DA  B 2 6   ? -6.570  3.737   58.232 1.00 74.60  ? 105  DA  D OP1   1 
ATOM   535  O OP2   . DA  B 2 6   ? -5.748  2.080   56.385 1.00 73.79  ? 105  DA  D OP2   1 
ATOM   536  O "O5'" . DA  B 2 6   ? -4.213  3.847   57.396 1.00 73.50  ? 105  DA  D "O5'" 1 
ATOM   537  C "C5'" . DA  B 2 6   ? -3.070  3.724   58.263 1.00 73.09  ? 105  DA  D "C5'" 1 
ATOM   538  C "C4'" . DA  B 2 6   ? -1.791  3.752   57.458 1.00 72.49  ? 105  DA  D "C4'" 1 
ATOM   539  O "O4'" . DA  B 2 6   ? -1.129  2.462   57.408 1.00 72.27  ? 105  DA  D "O4'" 1 
ATOM   540  C "C3'" . DA  B 2 6   ? -1.932  4.223   56.011 1.00 72.89  ? 105  DA  D "C3'" 1 
ATOM   541  O "O3'" . DA  B 2 6   ? -1.035  5.306   55.802 1.00 74.23  ? 105  DA  D "O3'" 1 
ATOM   542  C "C2'" . DA  B 2 6   ? -1.539  3.006   55.178 1.00 69.06  ? 105  DA  D "C2'" 1 
ATOM   543  C "C1'" . DA  B 2 6   ? -0.610  2.236   56.103 1.00 65.04  ? 105  DA  D "C1'" 1 
ATOM   544  N N9    . DA  B 2 6   ? -0.581  0.787   55.881 1.00 57.52  ? 105  DA  D N9    1 
ATOM   545  C C8    . DA  B 2 6   ? -1.662  -0.049  55.706 1.00 52.88  ? 105  DA  D C8    1 
ATOM   546  N N7    . DA  B 2 6   ? -1.335  -1.306  55.513 1.00 49.01  ? 105  DA  D N7    1 
ATOM   547  C C5    . DA  B 2 6   ? 0.052   -1.302  55.565 1.00 44.52  ? 105  DA  D C5    1 
ATOM   548  C C6    . DA  B 2 6   ? 0.989   -2.323  55.425 1.00 40.59  ? 105  DA  D C6    1 
ATOM   549  N N6    . DA  B 2 6   ? 0.661   -3.590  55.188 1.00 35.93  ? 105  DA  D N6    1 
ATOM   550  N N1    . DA  B 2 6   ? 2.293   -1.997  55.539 1.00 38.70  ? 105  DA  D N1    1 
ATOM   551  C C2    . DA  B 2 6   ? 2.618   -0.716  55.777 1.00 47.01  ? 105  DA  D C2    1 
ATOM   552  N N3    . DA  B 2 6   ? 1.823   0.342   55.922 1.00 47.91  ? 105  DA  D N3    1 
ATOM   553  C C4    . DA  B 2 6   ? 0.533   -0.024  55.803 1.00 50.71  ? 105  DA  D C4    1 
ATOM   554  P P     . DT  B 2 7   ? -0.920  5.972   54.348 1.00 76.45  ? 106  DT  D P     1 
ATOM   555  O OP1   . DT  B 2 7   ? -0.859  7.468   54.516 1.00 76.34  ? 106  DT  D OP1   1 
ATOM   556  O OP2   . DT  B 2 7   ? -1.995  5.368   53.465 1.00 75.84  ? 106  DT  D OP2   1 
ATOM   557  O "O5'" . DT  B 2 7   ? 0.510   5.438   53.907 1.00 72.25  ? 106  DT  D "O5'" 1 
ATOM   558  C "C5'" . DT  B 2 7   ? 1.527   5.301   54.893 1.00 66.75  ? 106  DT  D "C5'" 1 
ATOM   559  C "C4'" . DT  B 2 7   ? 2.742   4.666   54.278 1.00 63.85  ? 106  DT  D "C4'" 1 
ATOM   560  O "O4'" . DT  B 2 7   ? 2.594   3.230   54.208 1.00 62.84  ? 106  DT  D "O4'" 1 
ATOM   561  C "C3'" . DT  B 2 7   ? 3.024   5.128   52.856 1.00 61.97  ? 106  DT  D "C3'" 1 
ATOM   562  O "O3'" . DT  B 2 7   ? 4.427   5.254   52.730 1.00 64.56  ? 106  DT  D "O3'" 1 
ATOM   563  C "C2'" . DT  B 2 7   ? 2.548   3.960   52.009 1.00 59.74  ? 106  DT  D "C2'" 1 
ATOM   564  C "C1'" . DT  B 2 7   ? 2.933   2.797   52.902 1.00 56.54  ? 106  DT  D "C1'" 1 
ATOM   565  N N1    . DT  B 2 7   ? 2.248   1.506   52.661 1.00 50.77  ? 106  DT  D N1    1 
ATOM   566  C C2    . DT  B 2 7   ? 3.006   0.349   52.660 1.00 46.68  ? 106  DT  D C2    1 
ATOM   567  O O2    . DT  B 2 7   ? 4.224   0.340   52.790 1.00 51.89  ? 106  DT  D O2    1 
ATOM   568  N N3    . DT  B 2 7   ? 2.286   -0.798  52.495 1.00 39.67  ? 106  DT  D N3    1 
ATOM   569  C C4    . DT  B 2 7   ? 0.917   -0.910  52.327 1.00 42.76  ? 106  DT  D C4    1 
ATOM   570  O O4    . DT  B 2 7   ? 0.400   -2.023  52.224 1.00 42.96  ? 106  DT  D O4    1 
ATOM   571  C C5    . DT  B 2 7   ? 0.198   0.343   52.296 1.00 42.66  ? 106  DT  D C5    1 
ATOM   572  C C7    . DT  B 2 7   ? -1.279  0.334   52.068 1.00 45.45  ? 106  DT  D C7    1 
ATOM   573  C C6    . DT  B 2 7   ? 0.887   1.469   52.468 1.00 44.50  ? 106  DT  D C6    1 
ATOM   574  P P     . DT  B 2 8   ? 5.040   5.919   51.413 1.00 68.33  ? 107  DT  D P     1 
ATOM   575  O OP1   . DT  B 2 8   ? 5.892   7.058   51.868 1.00 68.75  ? 107  DT  D OP1   1 
ATOM   576  O OP2   . DT  B 2 8   ? 3.953   6.133   50.397 1.00 68.66  ? 107  DT  D OP2   1 
ATOM   577  O "O5'" . DT  B 2 8   ? 5.994   4.791   50.846 1.00 66.33  ? 107  DT  D "O5'" 1 
ATOM   578  C "C5'" . DT  B 2 8   ? 6.887   4.123   51.709 1.00 61.42  ? 107  DT  D "C5'" 1 
ATOM   579  C "C4'" . DT  B 2 8   ? 7.383   2.871   51.042 1.00 57.41  ? 107  DT  D "C4'" 1 
ATOM   580  O "O4'" . DT  B 2 8   ? 6.353   1.868   50.990 1.00 55.88  ? 107  DT  D "O4'" 1 
ATOM   581  C "C3'" . DT  B 2 8   ? 7.832   3.088   49.607 1.00 55.68  ? 107  DT  D "C3'" 1 
ATOM   582  O "O3'" . DT  B 2 8   ? 9.074   2.451   49.468 1.00 56.93  ? 107  DT  D "O3'" 1 
ATOM   583  C "C2'" . DT  B 2 8   ? 6.785   2.373   48.775 1.00 54.88  ? 107  DT  D "C2'" 1 
ATOM   584  C "C1'" . DT  B 2 8   ? 6.402   1.265   49.718 1.00 54.32  ? 107  DT  D "C1'" 1 
ATOM   585  N N1    . DT  B 2 8   ? 5.102   0.630   49.478 1.00 53.41  ? 107  DT  D N1    1 
ATOM   586  C C2    . DT  B 2 8   ? 5.105   -0.748  49.341 1.00 53.82  ? 107  DT  D C2    1 
ATOM   587  O O2    . DT  B 2 8   ? 6.130   -1.410  49.298 1.00 54.36  ? 107  DT  D O2    1 
ATOM   588  N N3    . DT  B 2 8   ? 3.862   -1.320  49.223 1.00 50.66  ? 107  DT  D N3    1 
ATOM   589  C C4    . DT  B 2 8   ? 2.651   -0.667  49.156 1.00 47.47  ? 107  DT  D C4    1 
ATOM   590  O O4    . DT  B 2 8   ? 1.616   -1.324  49.040 1.00 46.10  ? 107  DT  D O4    1 
ATOM   591  C C5    . DT  B 2 8   ? 2.728   0.791   49.229 1.00 44.56  ? 107  DT  D C5    1 
ATOM   592  C C7    . DT  B 2 8   ? 1.475   1.588   49.078 1.00 44.03  ? 107  DT  D C7    1 
ATOM   593  C C6    . DT  B 2 8   ? 3.931   1.358   49.406 1.00 45.16  ? 107  DT  D C6    1 
ATOM   594  P P     . DT  B 2 9   ? 9.692   2.261   48.020 1.00 59.53  ? 108  DT  D P     1 
ATOM   595  O OP1   . DT  B 2 9   ? 11.171  2.522   48.172 1.00 58.08  ? 108  DT  D OP1   1 
ATOM   596  O OP2   . DT  B 2 9   ? 8.874   3.077   47.101 1.00 58.82  ? 108  DT  D OP2   1 
ATOM   597  O "O5'" . DT  B 2 9   ? 9.417   0.721   47.790 1.00 59.01  ? 108  DT  D "O5'" 1 
ATOM   598  C "C5'" . DT  B 2 9   ? 9.857   -0.214  48.764 1.00 54.98  ? 108  DT  D "C5'" 1 
ATOM   599  C "C4'" . DT  B 2 9   ? 9.834   -1.589  48.163 1.00 54.63  ? 108  DT  D "C4'" 1 
ATOM   600  O "O4'" . DT  B 2 9   ? 8.451   -1.943  47.964 1.00 52.50  ? 108  DT  D "O4'" 1 
ATOM   601  C "C3'" . DT  B 2 9   ? 10.494  -1.656  46.788 1.00 53.04  ? 108  DT  D "C3'" 1 
ATOM   602  O "O3'" . DT  B 2 9   ? 11.135  -2.923  46.680 1.00 56.10  ? 108  DT  D "O3'" 1 
ATOM   603  C "C2'" . DT  B 2 9   ? 9.320   -1.534  45.835 1.00 49.61  ? 108  DT  D "C2'" 1 
ATOM   604  C "C1'" . DT  B 2 9   ? 8.205   -2.217  46.608 1.00 47.62  ? 108  DT  D "C1'" 1 
ATOM   605  N N1    . DT  B 2 9   ? 6.843   -1.760  46.326 1.00 43.40  ? 108  DT  D N1    1 
ATOM   606  C C2    . DT  B 2 9   ? 5.882   -2.716  46.146 1.00 44.10  ? 108  DT  D C2    1 
ATOM   607  O O2    . DT  B 2 9   ? 6.115   -3.904  46.217 1.00 47.84  ? 108  DT  D O2    1 
ATOM   608  N N3    . DT  B 2 9   ? 4.634   -2.233  45.884 1.00 41.72  ? 108  DT  D N3    1 
ATOM   609  C C4    . DT  B 2 9   ? 4.257   -0.915  45.795 1.00 43.11  ? 108  DT  D C4    1 
ATOM   610  O O4    . DT  B 2 9   ? 3.073   -0.624  45.561 1.00 43.72  ? 108  DT  D O4    1 
ATOM   611  C C5    . DT  B 2 9   ? 5.326   0.042   46.005 1.00 38.66  ? 108  DT  D C5    1 
ATOM   612  C C7    . DT  B 2 9   ? 5.019   1.505   45.943 1.00 38.91  ? 108  DT  D C7    1 
ATOM   613  C C6    . DT  B 2 9   ? 6.548   -0.427  46.251 1.00 38.55  ? 108  DT  D C6    1 
ATOM   614  P P     . DT  B 2 10  ? 11.900  -3.325  45.335 1.00 59.16  ? 109  DT  D P     1 
ATOM   615  O OP1   . DT  B 2 10  ? 13.240  -3.825  45.777 1.00 58.94  ? 109  DT  D OP1   1 
ATOM   616  O OP2   . DT  B 2 10  ? 11.814  -2.173  44.385 1.00 57.02  ? 109  DT  D OP2   1 
ATOM   617  O "O5'" . DT  B 2 10  ? 11.018  -4.537  44.795 1.00 55.13  ? 109  DT  D "O5'" 1 
ATOM   618  C "C5'" . DT  B 2 10  ? 10.308  -5.384  45.713 1.00 55.91  ? 109  DT  D "C5'" 1 
ATOM   619  C "C4'" . DT  B 2 10  ? 9.278   -6.215  44.981 1.00 55.20  ? 109  DT  D "C4'" 1 
ATOM   620  O "O4'" . DT  B 2 10  ? 8.047   -5.489  44.752 1.00 55.58  ? 109  DT  D "O4'" 1 
ATOM   621  C "C3'" . DT  B 2 10  ? 9.710   -6.732  43.613 1.00 56.88  ? 109  DT  D "C3'" 1 
ATOM   622  O "O3'" . DT  B 2 10  ? 9.353   -8.113  43.490 1.00 60.12  ? 109  DT  D "O3'" 1 
ATOM   623  C "C2'" . DT  B 2 10  ? 8.892   -5.890  42.637 1.00 53.99  ? 109  DT  D "C2'" 1 
ATOM   624  C "C1'" . DT  B 2 10  ? 7.614   -5.699  43.417 1.00 50.40  ? 109  DT  D "C1'" 1 
ATOM   625  N N1    . DT  B 2 10  ? 6.763   -4.558  43.049 1.00 42.69  ? 109  DT  D N1    1 
ATOM   626  C C2    . DT  B 2 10  ? 5.390   -4.748  42.993 1.00 42.00  ? 109  DT  D C2    1 
ATOM   627  O O2    . DT  B 2 10  ? 4.855   -5.832  43.115 1.00 44.34  ? 109  DT  D O2    1 
ATOM   628  N N3    . DT  B 2 10  ? 4.663   -3.612  42.777 1.00 36.02  ? 109  DT  D N3    1 
ATOM   629  C C4    . DT  B 2 10  ? 5.150   -2.353  42.592 1.00 37.04  ? 109  DT  D C4    1 
ATOM   630  O O4    . DT  B 2 10  ? 4.381   -1.440  42.441 1.00 43.20  ? 109  DT  D O4    1 
ATOM   631  C C5    . DT  B 2 10  ? 6.589   -2.235  42.604 1.00 36.44  ? 109  DT  D C5    1 
ATOM   632  C C7    . DT  B 2 10  ? 7.203   -0.898  42.381 1.00 32.57  ? 109  DT  D C7    1 
ATOM   633  C C6    . DT  B 2 10  ? 7.316   -3.329  42.821 1.00 36.52  ? 109  DT  D C6    1 
ATOM   634  P P     . DT  B 2 11  ? 10.029  -9.008  42.338 1.00 61.91  ? 110  DT  D P     1 
ATOM   635  O OP1   . DT  B 2 11  ? 10.734  -10.108 43.058 1.00 63.53  ? 110  DT  D OP1   1 
ATOM   636  O OP2   . DT  B 2 11  ? 10.797  -8.133  41.418 1.00 64.81  ? 110  DT  D OP2   1 
ATOM   637  O "O5'" . DT  B 2 11  ? 8.793   -9.576  41.522 1.00 62.01  ? 110  DT  D "O5'" 1 
ATOM   638  C "C5'" . DT  B 2 11  ? 7.682   -10.127 42.213 1.00 61.87  ? 110  DT  D "C5'" 1 
ATOM   639  C "C4'" . DT  B 2 11  ? 6.427   -10.011 41.381 1.00 62.37  ? 110  DT  D "C4'" 1 
ATOM   640  O "O4'" . DT  B 2 11  ? 5.998   -8.622  41.301 1.00 62.05  ? 110  DT  D "O4'" 1 
ATOM   641  C "C3'" . DT  B 2 11  ? 6.486   -10.547 39.942 1.00 59.53  ? 110  DT  D "C3'" 1 
ATOM   642  O "O3'" . DT  B 2 11  ? 5.444   -11.538 39.814 1.00 58.53  ? 110  DT  D "O3'" 1 
ATOM   643  C "C2'" . DT  B 2 11  ? 6.251   -9.294  39.089 1.00 58.40  ? 110  DT  D "C2'" 1 
ATOM   644  C "C1'" . DT  B 2 11  ? 5.454   -8.381  40.024 1.00 55.46  ? 110  DT  D "C1'" 1 
ATOM   645  N N1    . DT  B 2 11  ? 5.462   -6.913  39.799 1.00 48.82  ? 110  DT  D N1    1 
ATOM   646  C C2    . DT  B 2 11  ? 4.243   -6.284  39.693 1.00 45.87  ? 110  DT  D C2    1 
ATOM   647  O O2    . DT  B 2 11  ? 3.199   -6.883  39.690 1.00 46.90  ? 110  DT  D O2    1 
ATOM   648  N N3    . DT  B 2 11  ? 4.294   -4.923  39.570 1.00 46.25  ? 110  DT  D N3    1 
ATOM   649  C C4    . DT  B 2 11  ? 5.420   -4.134  39.523 1.00 51.96  ? 110  DT  D C4    1 
ATOM   650  O O4    . DT  B 2 11  ? 5.302   -2.904  39.470 1.00 51.56  ? 110  DT  D O4    1 
ATOM   651  C C5    . DT  B 2 11  ? 6.680   -4.867  39.562 1.00 51.61  ? 110  DT  D C5    1 
ATOM   652  C C7    . DT  B 2 11  ? 7.962   -4.116  39.398 1.00 51.46  ? 110  DT  D C7    1 
ATOM   653  C C6    . DT  B 2 11  ? 6.635   -6.201  39.722 1.00 49.25  ? 110  DT  D C6    1 
ATOM   654  P P     . DC  B 2 12  ? 5.434   -12.583 38.583 1.00 56.74  ? 111  DC  D P     1 
ATOM   655  O OP1   . DC  B 2 12  ? 4.942   -13.850 39.200 1.00 56.12  ? 111  DC  D OP1   1 
ATOM   656  O OP2   . DC  B 2 12  ? 6.722   -12.564 37.854 1.00 57.93  ? 111  DC  D OP2   1 
ATOM   657  O "O5'" . DC  B 2 12  ? 4.310   -11.973 37.644 1.00 56.25  ? 111  DC  D "O5'" 1 
ATOM   658  C "C5'" . DC  B 2 12  ? 3.085   -11.497 38.208 1.00 50.03  ? 111  DC  D "C5'" 1 
ATOM   659  C "C4'" . DC  B 2 12  ? 2.330   -10.653 37.208 1.00 47.74  ? 111  DC  D "C4'" 1 
ATOM   660  O "O4'" . DC  B 2 12  ? 2.592   -9.232  37.317 1.00 46.52  ? 111  DC  D "O4'" 1 
ATOM   661  C "C3'" . DC  B 2 12  ? 2.533   -11.019 35.749 1.00 44.78  ? 111  DC  D "C3'" 1 
ATOM   662  O "O3'" . DC  B 2 12  ? 1.287   -11.379 35.226 1.00 45.17  ? 111  DC  D "O3'" 1 
ATOM   663  C "C2'" . DC  B 2 12  ? 3.019   -9.732  35.101 1.00 43.70  ? 111  DC  D "C2'" 1 
ATOM   664  C "C1'" . DC  B 2 12  ? 2.535   -8.640  36.036 1.00 43.79  ? 111  DC  D "C1'" 1 
ATOM   665  N N1    . DC  B 2 12  ? 3.382   -7.418  36.058 1.00 44.75  ? 111  DC  D N1    1 
ATOM   666  C C2    . DC  B 2 12  ? 2.775   -6.137  36.183 1.00 43.91  ? 111  DC  D C2    1 
ATOM   667  O O2    . DC  B 2 12  ? 1.546   -6.055  36.263 1.00 41.75  ? 111  DC  D O2    1 
ATOM   668  N N3    . DC  B 2 12  ? 3.562   -5.031  36.201 1.00 38.84  ? 111  DC  D N3    1 
ATOM   669  C C4    . DC  B 2 12  ? 4.890   -5.157  36.100 1.00 39.06  ? 111  DC  D C4    1 
ATOM   670  N N4    . DC  B 2 12  ? 5.627   -4.051  36.110 1.00 34.81  ? 111  DC  D N4    1 
ATOM   671  C C5    . DC  B 2 12  ? 5.523   -6.431  35.977 1.00 34.08  ? 111  DC  D C5    1 
ATOM   672  C C6    . DC  B 2 12  ? 4.743   -7.520  35.962 1.00 42.11  ? 111  DC  D C6    1 
ATOM   673  P P     . DT  B 2 13  ? 1.210   -12.490 34.101 1.00 46.40  ? 112  DT  D P     1 
ATOM   674  O OP1   . DT  B 2 13  ? 0.143   -13.358 34.576 1.00 46.70  ? 112  DT  D OP1   1 
ATOM   675  O OP2   . DT  B 2 13  ? 2.535   -13.050 33.829 1.00 44.77  ? 112  DT  D OP2   1 
ATOM   676  O "O5'" . DT  B 2 13  ? 0.718   -11.627 32.868 1.00 46.97  ? 112  DT  D "O5'" 1 
ATOM   677  C "C5'" . DT  B 2 13  ? -0.368  -10.708 33.023 1.00 39.29  ? 112  DT  D "C5'" 1 
ATOM   678  C "C4'" . DT  B 2 13  ? -0.167  -9.494  32.147 1.00 38.63  ? 112  DT  D "C4'" 1 
ATOM   679  O "O4'" . DT  B 2 13  ? 0.760   -8.558  32.730 1.00 38.98  ? 112  DT  D "O4'" 1 
ATOM   680  C "C3'" . DT  B 2 13  ? 0.336   -9.729  30.716 1.00 38.90  ? 112  DT  D "C3'" 1 
ATOM   681  O "O3'" . DT  B 2 13  ? -0.299  -8.804  29.846 1.00 43.54  ? 112  DT  D "O3'" 1 
ATOM   682  C "C2'" . DT  B 2 13  ? 1.756   -9.227  30.778 1.00 36.64  ? 112  DT  D "C2'" 1 
ATOM   683  C "C1'" . DT  B 2 13  ? 1.454   -8.023  31.620 1.00 38.75  ? 112  DT  D "C1'" 1 
ATOM   684  N N1    . DT  B 2 13  ? 2.608   -7.275  32.086 1.00 38.98  ? 112  DT  D N1    1 
ATOM   685  C C2    . DT  B 2 13  ? 2.508   -5.906  32.245 1.00 42.67  ? 112  DT  D C2    1 
ATOM   686  O O2    . DT  B 2 13  ? 1.475   -5.271  32.111 1.00 46.58  ? 112  DT  D O2    1 
ATOM   687  N N3    . DT  B 2 13  ? 3.679   -5.298  32.575 1.00 45.78  ? 112  DT  D N3    1 
ATOM   688  C C4    . DT  B 2 13  ? 4.895   -5.898  32.775 1.00 43.46  ? 112  DT  D C4    1 
ATOM   689  O O4    . DT  B 2 13  ? 5.878   -5.206  33.027 1.00 48.26  ? 112  DT  D O4    1 
ATOM   690  C C5    . DT  B 2 13  ? 4.896   -7.337  32.654 1.00 38.20  ? 112  DT  D C5    1 
ATOM   691  C C7    . DT  B 2 13  ? 6.147   -8.094  32.922 1.00 39.92  ? 112  DT  D C7    1 
ATOM   692  C C6    . DT  B 2 13  ? 3.774   -7.937  32.313 1.00 37.32  ? 112  DT  D C6    1 
ATOM   693  P P     . DG  B 2 14  ? -1.597  -9.254  29.047 1.00 45.90  ? 113  DG  D P     1 
ATOM   694  O OP1   . DG  B 2 14  ? -2.300  -10.112 30.031 1.00 46.57  ? 113  DG  D OP1   1 
ATOM   695  O OP2   . DG  B 2 14  ? -1.264  -9.784  27.697 1.00 42.07  ? 113  DG  D OP2   1 
ATOM   696  O "O5'" . DG  B 2 14  ? -2.410  -7.901  28.868 1.00 47.72  ? 113  DG  D "O5'" 1 
ATOM   697  C "C5'" . DG  B 2 14  ? -3.054  -7.262  29.982 1.00 41.30  ? 113  DG  D "C5'" 1 
ATOM   698  C "C4'" . DG  B 2 14  ? -2.979  -5.766  29.816 1.00 40.63  ? 113  DG  D "C4'" 1 
ATOM   699  O "O4'" . DG  B 2 14  ? -1.641  -5.317  30.110 1.00 37.03  ? 113  DG  D "O4'" 1 
ATOM   700  C "C3'" . DG  B 2 14  ? -3.292  -5.264  28.407 1.00 44.16  ? 113  DG  D "C3'" 1 
ATOM   701  O "O3'" . DG  B 2 14  ? -4.067  -4.067  28.527 1.00 46.83  ? 113  DG  D "O3'" 1 
ATOM   702  C "C2'" . DG  B 2 14  ? -1.918  -4.982  27.814 1.00 41.11  ? 113  DG  D "C2'" 1 
ATOM   703  C "C1'" . DG  B 2 14  ? -1.144  -4.539  29.039 1.00 38.87  ? 113  DG  D "C1'" 1 
ATOM   704  N N9    . DG  B 2 14  ? 0.296   -4.733  28.991 1.00 41.05  ? 113  DG  D N9    1 
ATOM   705  C C8    . DG  B 2 14  ? 0.973   -5.915  28.820 1.00 39.07  ? 113  DG  D C8    1 
ATOM   706  N N7    . DG  B 2 14  ? 2.267   -5.770  28.875 1.00 38.29  ? 113  DG  D N7    1 
ATOM   707  C C5    . DG  B 2 14  ? 2.453   -4.413  29.085 1.00 34.43  ? 113  DG  D C5    1 
ATOM   708  C C6    . DG  B 2 14  ? 3.642   -3.663  29.232 1.00 30.42  ? 113  DG  D C6    1 
ATOM   709  O O6    . DG  B 2 14  ? 4.776   -4.052  29.252 1.00 25.87  ? 113  DG  D O6    1 
ATOM   710  N N1    . DG  B 2 14  ? 3.388   -2.316  29.390 1.00 34.98  ? 113  DG  D N1    1 
ATOM   711  C C2    . DG  B 2 14  ? 2.146   -1.755  29.430 1.00 38.16  ? 113  DG  D C2    1 
ATOM   712  N N2    . DG  B 2 14  ? 2.122   -0.435  29.600 1.00 38.10  ? 113  DG  D N2    1 
ATOM   713  N N3    . DG  B 2 14  ? 1.018   -2.440  29.311 1.00 33.31  ? 113  DG  D N3    1 
ATOM   714  C C4    . DG  B 2 14  ? 1.252   -3.757  29.142 1.00 36.99  ? 113  DG  D C4    1 
ATOM   715  P P     . DA  B 2 15  ? -4.620  -3.327  27.218 1.00 43.67  ? 114  DA  D P     1 
ATOM   716  O OP1   . DA  B 2 15  ? -5.887  -2.729  27.635 1.00 40.74  ? 114  DA  D OP1   1 
ATOM   717  O OP2   . DA  B 2 15  ? -4.587  -4.266  26.076 1.00 44.45  ? 114  DA  D OP2   1 
ATOM   718  O "O5'" . DA  B 2 15  ? -3.539  -2.197  26.950 1.00 44.29  ? 114  DA  D "O5'" 1 
ATOM   719  C "C5'" . DA  B 2 15  ? -3.392  -1.100  27.859 1.00 43.35  ? 114  DA  D "C5'" 1 
ATOM   720  C "C4'" . DA  B 2 15  ? -2.438  -0.072  27.300 1.00 44.72  ? 114  DA  D "C4'" 1 
ATOM   721  O "O4'" . DA  B 2 15  ? -1.077  -0.568  27.344 1.00 43.79  ? 114  DA  D "O4'" 1 
ATOM   722  C "C3'" . DA  B 2 15  ? -2.696  0.338   25.853 1.00 44.58  ? 114  DA  D "C3'" 1 
ATOM   723  O "O3'" . DA  B 2 15  ? -2.591  1.751   25.729 1.00 43.77  ? 114  DA  D "O3'" 1 
ATOM   724  C "C2'" . DA  B 2 15  ? -1.595  -0.363  25.072 1.00 44.36  ? 114  DA  D "C2'" 1 
ATOM   725  C "C1'" . DA  B 2 15  ? -0.461  -0.375  26.084 1.00 45.74  ? 114  DA  D "C1'" 1 
ATOM   726  N N9    . DA  B 2 15  ? 0.570   -1.407  25.921 1.00 46.68  ? 114  DA  D N9    1 
ATOM   727  C C8    . DA  B 2 15  ? 0.394   -2.752  25.739 1.00 43.47  ? 114  DA  D C8    1 
ATOM   728  N N7    . DA  B 2 15  ? 1.514   -3.423  25.677 1.00 38.41  ? 114  DA  D N7    1 
ATOM   729  C C5    . DA  B 2 15  ? 2.497   -2.454  25.807 1.00 41.52  ? 114  DA  D C5    1 
ATOM   730  C C6    . DA  B 2 15  ? 3.892   -2.526  25.830 1.00 40.90  ? 114  DA  D C6    1 
ATOM   731  N N6    . DA  B 2 15  ? 4.563   -3.643  25.677 1.00 40.59  ? 114  DA  D N6    1 
ATOM   732  N N1    . DA  B 2 15  ? 4.581   -1.391  26.010 1.00 40.87  ? 114  DA  D N1    1 
ATOM   733  C C2    . DA  B 2 15  ? 3.909   -0.259  26.131 1.00 41.83  ? 114  DA  D C2    1 
ATOM   734  N N3    . DA  B 2 15  ? 2.599   -0.054  26.107 1.00 41.39  ? 114  DA  D N3    1 
ATOM   735  C C4    . DA  B 2 15  ? 1.937   -1.210  25.949 1.00 44.06  ? 114  DA  D C4    1 
ATOM   736  P P     . DG  B 2 16  ? -3.533  2.522   24.681 1.00 43.49  ? 115  DG  D P     1 
ATOM   737  O OP1   . DG  B 2 16  ? -4.556  3.244   25.437 1.00 39.04  ? 115  DG  D OP1   1 
ATOM   738  O OP2   . DG  B 2 16  ? -3.920  1.534   23.690 1.00 44.29  ? 115  DG  D OP2   1 
ATOM   739  O "O5'" . DG  B 2 16  ? -2.534  3.516   23.958 1.00 43.39  ? 115  DG  D "O5'" 1 
ATOM   740  C "C5'" . DG  B 2 16  ? -1.476  2.993   23.156 1.00 41.38  ? 115  DG  D "C5'" 1 
ATOM   741  C "C4'" . DG  B 2 16  ? -0.173  3.663   23.512 1.00 41.33  ? 115  DG  D "C4'" 1 
ATOM   742  O "O4'" . DG  B 2 16  ? 0.705   2.656   24.074 1.00 40.30  ? 115  DG  D "O4'" 1 
ATOM   743  C "C3'" . DG  B 2 16  ? 0.538   4.217   22.285 1.00 40.13  ? 115  DG  D "C3'" 1 
ATOM   744  O "O3'" . DG  B 2 16  ? 0.973   5.554   22.419 1.00 37.99  ? 115  DG  D "O3'" 1 
ATOM   745  C "C2'" . DG  B 2 16  ? 1.738   3.317   22.084 1.00 41.80  ? 115  DG  D "C2'" 1 
ATOM   746  C "C1'" . DG  B 2 16  ? 1.948   2.600   23.397 1.00 40.24  ? 115  DG  D "C1'" 1 
ATOM   747  N N9    . DG  B 2 16  ? 2.222   1.193   23.120 1.00 40.84  ? 115  DG  D N9    1 
ATOM   748  C C8    . DG  B 2 16  ? 1.273   0.244   22.849 1.00 40.25  ? 115  DG  D C8    1 
ATOM   749  N N7    . DG  B 2 16  ? 1.786   -0.915  22.554 1.00 37.40  ? 115  DG  D N7    1 
ATOM   750  C C5    . DG  B 2 16  ? 3.158   -0.729  22.655 1.00 35.96  ? 115  DG  D C5    1 
ATOM   751  C C6    . DG  B 2 16  ? 4.206   -1.627  22.447 1.00 34.28  ? 115  DG  D C6    1 
ATOM   752  O O6    . DG  B 2 16  ? 4.148   -2.794  22.114 1.00 33.54  ? 115  DG  D O6    1 
ATOM   753  N N1    . DG  B 2 16  ? 5.429   -1.041  22.671 1.00 33.35  ? 115  DG  D N1    1 
ATOM   754  C C2    . DG  B 2 16  ? 5.619   0.241   23.054 1.00 34.15  ? 115  DG  D C2    1 
ATOM   755  N N2    . DG  B 2 16  ? 6.879   0.576   23.245 1.00 34.97  ? 115  DG  D N2    1 
ATOM   756  N N3    . DG  B 2 16  ? 4.650   1.111   23.242 1.00 35.81  ? 115  DG  D N3    1 
ATOM   757  C C4    . DG  B 2 16  ? 3.444   0.565   23.026 1.00 37.93  ? 115  DG  D C4    1 
ATOM   758  P P     . DT  B 2 17  ? 1.328   6.360   21.101 1.00 37.16  ? 116  DT  D P     1 
ATOM   759  O OP1   . DT  B 2 17  ? 1.097   7.791   21.306 1.00 39.46  ? 116  DT  D OP1   1 
ATOM   760  O OP2   . DT  B 2 17  ? 0.693   5.685   20.005 1.00 34.27  ? 116  DT  D OP2   1 
ATOM   761  O "O5'" . DT  B 2 17  ? 2.879   6.115   20.911 1.00 32.39  ? 116  DT  D "O5'" 1 
ATOM   762  C "C5'" . DT  B 2 17  ? 3.809   6.673   21.822 1.00 32.16  ? 116  DT  D "C5'" 1 
ATOM   763  C "C4'" . DT  B 2 17  ? 5.216   6.282   21.435 1.00 34.85  ? 116  DT  D "C4'" 1 
ATOM   764  O "O4'" . DT  B 2 17  ? 5.369   4.844   21.459 1.00 34.86  ? 116  DT  D "O4'" 1 
ATOM   765  C "C3'" . DT  B 2 17  ? 5.685   6.724   20.058 1.00 34.52  ? 116  DT  D "C3'" 1 
ATOM   766  O "O3'" . DT  B 2 17  ? 7.008   7.241   20.181 1.00 37.33  ? 116  DT  D "O3'" 1 
ATOM   767  C "C2'" . DT  B 2 17  ? 5.662   5.446   19.237 1.00 34.48  ? 116  DT  D "C2'" 1 
ATOM   768  C "C1'" . DT  B 2 17  ? 5.947   4.370   20.262 1.00 32.63  ? 116  DT  D "C1'" 1 
ATOM   769  N N1    . DT  B 2 17  ? 5.342   3.044   19.973 1.00 34.69  ? 116  DT  D N1    1 
ATOM   770  C C2    . DT  B 2 17  ? 6.156   1.916   19.901 1.00 37.90  ? 116  DT  D C2    1 
ATOM   771  O O2    . DT  B 2 17  ? 7.368   1.948   19.985 1.00 41.81  ? 116  DT  D O2    1 
ATOM   772  N N3    . DT  B 2 17  ? 5.474   0.732   19.708 1.00 33.27  ? 116  DT  D N3    1 
ATOM   773  C C4    . DT  B 2 17  ? 4.114   0.576   19.557 1.00 29.57  ? 116  DT  D C4    1 
ATOM   774  O O4    . DT  B 2 17  ? 3.627   -0.531  19.418 1.00 33.37  ? 116  DT  D O4    1 
ATOM   775  C C5    . DT  B 2 17  ? 3.352   1.778   19.585 1.00 23.83  ? 116  DT  D C5    1 
ATOM   776  C C7    . DT  B 2 17  ? 1.887   1.680   19.355 1.00 20.93  ? 116  DT  D C7    1 
ATOM   777  C C6    . DT  B 2 17  ? 3.982   2.938   19.801 1.00 25.56  ? 116  DT  D C6    1 
ATOM   778  P P     . DC  B 2 18  ? 7.573   8.224   19.057 1.00 40.10  ? 117  DC  D P     1 
ATOM   779  O OP1   . DC  B 2 18  ? 8.464   9.203   19.703 1.00 39.30  ? 117  DC  D OP1   1 
ATOM   780  O OP2   . DC  B 2 18  ? 6.463   8.691   18.229 1.00 39.55  ? 117  DC  D OP2   1 
ATOM   781  O "O5'" . DC  B 2 18  ? 8.460   7.247   18.208 1.00 39.17  ? 117  DC  D "O5'" 1 
ATOM   782  C "C5'" . DC  B 2 18  ? 9.404   6.462   18.872 1.00 40.46  ? 117  DC  D "C5'" 1 
ATOM   783  C "C4'" . DC  B 2 18  ? 9.805   5.312   17.995 1.00 41.68  ? 117  DC  D "C4'" 1 
ATOM   784  O "O4'" . DC  B 2 18  ? 8.824   4.255   17.978 1.00 44.11  ? 117  DC  D "O4'" 1 
ATOM   785  C "C3'" . DC  B 2 18  ? 10.045  5.685   16.542 1.00 42.58  ? 117  DC  D "C3'" 1 
ATOM   786  O "O3'" . DC  B 2 18  ? 11.344  5.239   16.239 1.00 47.12  ? 117  DC  D "O3'" 1 
ATOM   787  C "C2'" . DC  B 2 18  ? 9.011   4.872   15.779 1.00 39.62  ? 117  DC  D "C2'" 1 
ATOM   788  C "C1'" . DC  B 2 18  ? 8.840   3.691   16.698 1.00 40.02  ? 117  DC  D "C1'" 1 
ATOM   789  N N1    . DC  B 2 18  ? 7.617   2.896   16.536 1.00 40.79  ? 117  DC  D N1    1 
ATOM   790  C C2    . DC  B 2 18  ? 7.740   1.515   16.464 1.00 38.08  ? 117  DC  D C2    1 
ATOM   791  O O2    . DC  B 2 18  ? 8.862   1.017   16.522 1.00 44.21  ? 117  DC  D O2    1 
ATOM   792  N N3    . DC  B 2 18  ? 6.639   0.756   16.314 1.00 35.32  ? 117  DC  D N3    1 
ATOM   793  C C4    . DC  B 2 18  ? 5.443   1.328   16.195 1.00 40.06  ? 117  DC  D C4    1 
ATOM   794  N N4    . DC  B 2 18  ? 4.381   0.526   16.007 1.00 30.94  ? 117  DC  D N4    1 
ATOM   795  C C5    . DC  B 2 18  ? 5.282   2.741   16.261 1.00 40.61  ? 117  DC  D C5    1 
ATOM   796  C C6    . DC  B 2 18  ? 6.388   3.483   16.444 1.00 41.42  ? 117  DC  D C6    1 
ATOM   797  P P     . DT  B 2 19  ? 11.799  5.115   14.731 1.00 49.51  ? 118  DT  D P     1 
ATOM   798  O OP1   . DT  B 2 19  ? 13.234  5.514   14.757 1.00 50.63  ? 118  DT  D OP1   1 
ATOM   799  O OP2   . DT  B 2 19  ? 10.866  5.786   13.834 1.00 47.69  ? 118  DT  D OP2   1 
ATOM   800  O "O5'" . DT  B 2 19  ? 11.682  3.558   14.481 1.00 51.43  ? 118  DT  D "O5'" 1 
ATOM   801  C "C5'" . DT  B 2 19  ? 12.269  2.668   15.416 1.00 51.02  ? 118  DT  D "C5'" 1 
ATOM   802  C "C4'" . DT  B 2 19  ? 12.522  1.337   14.762 1.00 49.37  ? 118  DT  D "C4'" 1 
ATOM   803  O "O4'" . DT  B 2 19  ? 11.280  0.647   14.592 1.00 45.54  ? 118  DT  D "O4'" 1 
ATOM   804  C "C3'" . DT  B 2 19  ? 13.134  1.434   13.374 1.00 49.43  ? 118  DT  D "C3'" 1 
ATOM   805  O "O3'" . DT  B 2 19  ? 13.934  0.281   13.193 1.00 54.91  ? 118  DT  D "O3'" 1 
ATOM   806  C "C2'" . DT  B 2 19  ? 11.929  1.337   12.472 1.00 47.68  ? 118  DT  D "C2'" 1 
ATOM   807  C "C1'" . DT  B 2 19  ? 11.102  0.335   13.238 1.00 46.27  ? 118  DT  D "C1'" 1 
ATOM   808  N N1    . DT  B 2 19  ? 9.685   0.442   12.975 1.00 48.48  ? 118  DT  D N1    1 
ATOM   809  C C2    . DT  B 2 19  ? 8.981   -0.712  12.740 1.00 48.07  ? 118  DT  D C2    1 
ATOM   810  O O2    . DT  B 2 19  ? 9.503   -1.790  12.663 1.00 52.09  ? 118  DT  D O2    1 
ATOM   811  N N3    . DT  B 2 19  ? 7.646   -0.549  12.585 1.00 42.12  ? 118  DT  D N3    1 
ATOM   812  C C4    . DT  B 2 19  ? 6.966   0.627   12.616 1.00 42.53  ? 118  DT  D C4    1 
ATOM   813  O O4    . DT  B 2 19  ? 5.766   0.608   12.517 1.00 46.64  ? 118  DT  D O4    1 
ATOM   814  C C5    . DT  B 2 19  ? 7.775   1.815   12.794 1.00 40.92  ? 118  DT  D C5    1 
ATOM   815  C C7    . DT  B 2 19  ? 7.125   3.155   12.747 1.00 46.52  ? 118  DT  D C7    1 
ATOM   816  C C6    . DT  B 2 19  ? 9.077   1.664   12.977 1.00 42.59  ? 118  DT  D C6    1 
ATOM   817  P P     . DT  B 2 20  ? 15.031  0.236   12.026 1.00 56.42  ? 119  DT  D P     1 
ATOM   818  O OP1   . DT  B 2 20  ? 16.321  0.136   12.768 1.00 55.70  ? 119  DT  D OP1   1 
ATOM   819  O OP2   . DT  B 2 20  ? 14.844  1.323   11.034 1.00 54.43  ? 119  DT  D OP2   1 
ATOM   820  O "O5'" . DT  B 2 20  ? 14.668  -1.147  11.351 1.00 54.67  ? 119  DT  D "O5'" 1 
ATOM   821  C "C5'" . DT  B 2 20  ? 14.255  -2.236  12.163 1.00 53.03  ? 119  DT  D "C5'" 1 
ATOM   822  C "C4'" . DT  B 2 20  ? 13.420  -3.195  11.356 1.00 52.32  ? 119  DT  D "C4'" 1 
ATOM   823  O "O4'" . DT  B 2 20  ? 12.079  -2.684  11.221 1.00 51.09  ? 119  DT  D "O4'" 1 
ATOM   824  C "C3'" . DT  B 2 20  ? 13.918  -3.468  9.935  1.00 53.16  ? 119  DT  D "C3'" 1 
ATOM   825  O "O3'" . DT  B 2 20  ? 13.995  -4.884  9.744  1.00 53.71  ? 119  DT  D "O3'" 1 
ATOM   826  C "C2'" . DT  B 2 20  ? 12.850  -2.825  9.053  1.00 52.17  ? 119  DT  D "C2'" 1 
ATOM   827  C "C1'" . DT  B 2 20  ? 11.625  -2.975  9.923  1.00 50.02  ? 119  DT  D "C1'" 1 
ATOM   828  N N1    . DT  B 2 20  ? 10.460  -2.122  9.660  1.00 47.06  ? 119  DT  D N1    1 
ATOM   829  C C2    . DT  B 2 20  ? 9.246   -2.750  9.485  1.00 47.50  ? 119  DT  D C2    1 
ATOM   830  O O2    . DT  B 2 20  ? 9.135   -3.951  9.416  1.00 49.05  ? 119  DT  D O2    1 
ATOM   831  N N3    . DT  B 2 20  ? 8.166   -1.914  9.374  1.00 44.82  ? 119  DT  D N3    1 
ATOM   832  C C4    . DT  B 2 20  ? 8.183   -0.548  9.398  1.00 46.95  ? 119  DT  D C4    1 
ATOM   833  O O4    . DT  B 2 20  ? 7.135   0.077   9.316  1.00 45.13  ? 119  DT  D O4    1 
ATOM   834  C C5    . DT  B 2 20  ? 9.497   0.047   9.526  1.00 49.35  ? 119  DT  D C5    1 
ATOM   835  C C7    . DT  B 2 20  ? 9.609   1.539   9.526  1.00 52.56  ? 119  DT  D C7    1 
ATOM   836  C C6    . DT  B 2 20  ? 10.562  -0.761  9.648  1.00 44.53  ? 119  DT  D C6    1 
ATOM   837  P P     . DT  B 2 21  ? 14.538  -5.484  8.354  1.00 52.28  ? 120  DT  D P     1 
ATOM   838  O OP1   . DT  B 2 21  ? 15.608  -6.459  8.682  1.00 54.85  ? 120  DT  D OP1   1 
ATOM   839  O OP2   . DT  B 2 21  ? 14.833  -4.379  7.422  1.00 51.68  ? 120  DT  D OP2   1 
ATOM   840  O "O5'" . DT  B 2 21  ? 13.300  -6.343  7.873  1.00 48.17  ? 120  DT  D "O5'" 1 
ATOM   841  C "C5'" . DT  B 2 21  ? 12.587  -7.103  8.819  1.00 44.71  ? 120  DT  D "C5'" 1 
ATOM   842  C "C4'" . DT  B 2 21  ? 11.266  -7.507  8.234  1.00 47.88  ? 120  DT  D "C4'" 1 
ATOM   843  O "O4'" . DT  B 2 21  ? 10.413  -6.353  8.075  1.00 48.16  ? 120  DT  D "O4'" 1 
ATOM   844  C "C3'" . DT  B 2 21  ? 11.392  -8.112  6.842  1.00 50.77  ? 120  DT  D "C3'" 1 
ATOM   845  O "O3'" . DT  B 2 21  ? 10.540  -9.248  6.801  1.00 53.85  ? 120  DT  D "O3'" 1 
ATOM   846  C "C2'" . DT  B 2 21  ? 10.881  -7.009  5.919  1.00 50.13  ? 120  DT  D "C2'" 1 
ATOM   847  C "C1'" . DT  B 2 21  ? 9.812   -6.408  6.793  1.00 46.65  ? 120  DT  D "C1'" 1 
ATOM   848  N N1    . DT  B 2 21  ? 9.336   -5.056  6.458  1.00 43.11  ? 120  DT  D N1    1 
ATOM   849  C C2    . DT  B 2 21  ? 7.974   -4.844  6.272  1.00 39.82  ? 120  DT  D C2    1 
ATOM   850  O O2    . DT  B 2 21  ? 7.141   -5.717  6.327  1.00 43.62  ? 120  DT  D O2    1 
ATOM   851  N N3    . DT  B 2 21  ? 7.628   -3.560  6.025  1.00 34.49  ? 120  DT  D N3    1 
ATOM   852  C C4    . DT  B 2 21  ? 8.469   -2.479  5.943  1.00 38.89  ? 120  DT  D C4    1 
ATOM   853  O O4    . DT  B 2 21  ? 8.008   -1.373  5.732  1.00 36.66  ? 120  DT  D O4    1 
ATOM   854  C C5    . DT  B 2 21  ? 9.874   -2.768  6.130  1.00 39.57  ? 120  DT  D C5    1 
ATOM   855  C C7    . DT  B 2 21  ? 10.859  -1.649  6.060  1.00 41.12  ? 120  DT  D C7    1 
ATOM   856  C C6    . DT  B 2 21  ? 10.234  -4.028  6.364  1.00 40.27  ? 120  DT  D C6    1 
ATOM   857  P P     . DT  B 2 22  ? 10.470  -10.132 5.476  1.00 55.81  ? 121  DT  D P     1 
ATOM   858  O OP1   . DT  B 2 22  ? 10.232  -11.526 5.936  1.00 58.14  ? 121  DT  D OP1   1 
ATOM   859  O OP2   . DT  B 2 22  ? 11.689  -9.811  4.686  1.00 55.26  ? 121  DT  D OP2   1 
ATOM   860  O "O5'" . DT  B 2 22  ? 9.132   -9.626  4.769  1.00 57.55  ? 121  DT  D "O5'" 1 
ATOM   861  C "C5'" . DT  B 2 22  ? 7.836   -9.860  5.367  1.00 54.73  ? 121  DT  D "C5'" 1 
ATOM   862  C "C4'" . DT  B 2 22  ? 6.744   -9.304  4.483  1.00 58.53  ? 121  DT  D "C4'" 1 
ATOM   863  O "O4'" . DT  B 2 22  ? 6.763   -7.851  4.494  1.00 56.33  ? 121  DT  D "O4'" 1 
ATOM   864  C "C3'" . DT  B 2 22  ? 6.849   -9.704  3.005  1.00 63.09  ? 121  DT  D "C3'" 1 
ATOM   865  O "O3'" . DT  B 2 22  ? 5.537   -9.651  2.433  1.00 72.08  ? 121  DT  D "O3'" 1 
ATOM   866  C "C2'" . DT  B 2 22  ? 7.537   -8.489  2.406  1.00 60.31  ? 121  DT  D "C2'" 1 
ATOM   867  C "C1'" . DT  B 2 22  ? 6.774   -7.400  3.149  1.00 54.70  ? 121  DT  D "C1'" 1 
ATOM   868  N N1    . DT  B 2 22  ? 7.401   -6.066  3.105  1.00 51.52  ? 121  DT  D N1    1 
ATOM   869  C C2    . DT  B 2 22  ? 6.602   -4.933  2.991  1.00 49.44  ? 121  DT  D C2    1 
ATOM   870  O O2    . DT  B 2 22  ? 5.388   -4.963  2.922  1.00 46.45  ? 121  DT  D O2    1 
ATOM   871  N N3    . DT  B 2 22  ? 7.295   -3.757  2.944  1.00 47.25  ? 121  DT  D N3    1 
ATOM   872  C C4    . DT  B 2 22  ? 8.665   -3.598  2.985  1.00 50.02  ? 121  DT  D C4    1 
ATOM   873  O O4    . DT  B 2 22  ? 9.145   -2.472  2.911  1.00 54.70  ? 121  DT  D O4    1 
ATOM   874  C C5    . DT  B 2 22  ? 9.432   -4.824  3.109  1.00 48.17  ? 121  DT  D C5    1 
ATOM   875  C C7    . DT  B 2 22  ? 10.924  -4.757  3.178  1.00 51.92  ? 121  DT  D C7    1 
ATOM   876  C C6    . DT  B 2 22  ? 8.770   -5.973  3.163  1.00 48.86  ? 121  DT  D C6    1 
ATOM   877  P P     . DT  B 2 23  ? 4.742   -10.991 1.982  1.00 75.98  ? 122  DT  D P     1 
ATOM   878  O OP1   . DT  B 2 23  ? 4.441   -11.784 3.214  1.00 78.03  ? 122  DT  D OP1   1 
ATOM   879  O OP2   . DT  B 2 23  ? 5.386   -11.663 0.813  1.00 75.93  ? 122  DT  D OP2   1 
ATOM   880  O "O5'" . DT  B 2 23  ? 3.363   -10.324 1.513  1.00 75.32  ? 122  DT  D "O5'" 1 
ATOM   881  C "C5'" . DT  B 2 23  ? 3.062   -8.946  1.937  1.00 73.24  ? 122  DT  D "C5'" 1 
ATOM   882  C "C4'" . DT  B 2 23  ? 2.503   -8.127  0.795  1.00 70.11  ? 122  DT  D "C4'" 1 
ATOM   883  O "O4'" . DT  B 2 23  ? 3.153   -6.820  0.732  1.00 64.55  ? 122  DT  D "O4'" 1 
ATOM   884  C "C3'" . DT  B 2 23  ? 2.701   -8.755  -0.586 1.00 68.84  ? 122  DT  D "C3'" 1 
ATOM   885  O "O3'" . DT  B 2 23  ? 1.549   -8.289  -1.319 1.00 70.19  ? 122  DT  D "O3'" 1 
ATOM   886  C "C2'" . DT  B 2 23  ? 3.957   -8.065  -1.080 1.00 65.25  ? 122  DT  D "C2'" 1 
ATOM   887  C "C1'" . DT  B 2 23  ? 3.698   -6.657  -0.565 1.00 59.37  ? 122  DT  D "C1'" 1 
ATOM   888  N N1    . DT  B 2 23  ? 4.920   -5.872  -0.465 1.00 54.05  ? 122  DT  D N1    1 
ATOM   889  C C2    . DT  B 2 23  ? 4.856   -4.494  -0.415 1.00 54.74  ? 122  DT  D C2    1 
ATOM   890  O O2    . DT  B 2 23  ? 3.813   -3.875  -0.332 1.00 59.58  ? 122  DT  D O2    1 
ATOM   891  N N3    . DT  B 2 23  ? 6.068   -3.860  -0.462 1.00 52.53  ? 122  DT  D N3    1 
ATOM   892  C C4    . DT  B 2 23  ? 7.315   -4.459  -0.529 1.00 56.80  ? 122  DT  D C4    1 
ATOM   893  O O4    . DT  B 2 23  ? 8.345   -3.761  -0.604 1.00 56.24  ? 122  DT  D O4    1 
ATOM   894  C C5    . DT  B 2 23  ? 7.298   -5.916  -0.511 1.00 57.03  ? 122  DT  D C5    1 
ATOM   895  C C7    . DT  B 2 23  ? 8.601   -6.660  -0.525 1.00 60.89  ? 122  DT  D C7    1 
ATOM   896  C C6    . DT  B 2 23  ? 6.115   -6.534  -0.477 1.00 52.74  ? 122  DT  D C6    1 
ATOM   897  N N     . TRP C 3 1   ? 30.156  -4.908  37.767 1.00 50.81  ? 203  TRP A N     1 
ATOM   898  C CA    . TRP C 3 1   ? 30.797  -4.667  36.431 1.00 49.96  ? 203  TRP A CA    1 
ATOM   899  C C     . TRP C 3 1   ? 30.369  -3.337  35.766 1.00 49.18  ? 203  TRP A C     1 
ATOM   900  O O     . TRP C 3 1   ? 29.315  -3.238  35.147 1.00 49.27  ? 203  TRP A O     1 
ATOM   901  C CB    . TRP C 3 1   ? 30.518  -5.863  35.513 1.00 46.77  ? 203  TRP A CB    1 
ATOM   902  C CG    . TRP C 3 1   ? 30.847  -5.651  34.081 1.00 44.60  ? 203  TRP A CG    1 
ATOM   903  C CD1   . TRP C 3 1   ? 32.028  -5.234  33.553 1.00 49.72  ? 203  TRP A CD1   1 
ATOM   904  C CD2   . TRP C 3 1   ? 29.980  -5.876  32.984 1.00 43.73  ? 203  TRP A CD2   1 
ATOM   905  N NE1   . TRP C 3 1   ? 31.956  -5.191  32.177 1.00 45.45  ? 203  TRP A NE1   1 
ATOM   906  C CE2   . TRP C 3 1   ? 30.704  -5.582  31.805 1.00 45.23  ? 203  TRP A CE2   1 
ATOM   907  C CE3   . TRP C 3 1   ? 28.657  -6.305  32.877 1.00 46.48  ? 203  TRP A CE3   1 
ATOM   908  C CZ2   . TRP C 3 1   ? 30.149  -5.705  30.539 1.00 46.06  ? 203  TRP A CZ2   1 
ATOM   909  C CZ3   . TRP C 3 1   ? 28.101  -6.431  31.622 1.00 43.08  ? 203  TRP A CZ3   1 
ATOM   910  C CH2   . TRP C 3 1   ? 28.849  -6.131  30.463 1.00 45.77  ? 203  TRP A CH2   1 
ATOM   911  N N     . LYS C 3 2   ? 31.205  -2.317  35.868 1.00 47.93  ? 204  LYS A N     1 
ATOM   912  C CA    . LYS C 3 2   ? 30.881  -1.044  35.273 1.00 49.02  ? 204  LYS A CA    1 
ATOM   913  C C     . LYS C 3 2   ? 30.877  -1.121  33.738 1.00 48.98  ? 204  LYS A C     1 
ATOM   914  O O     . LYS C 3 2   ? 31.762  -0.581  33.076 1.00 52.09  ? 204  LYS A O     1 
ATOM   915  C CB    . LYS C 3 2   ? 31.860  -0.007  35.800 1.00 48.89  ? 204  LYS A CB    1 
ATOM   916  C CG    . LYS C 3 2   ? 31.935  -0.029  37.324 1.00 51.14  ? 204  LYS A CG    1 
ATOM   917  C CD    . LYS C 3 2   ? 33.270  0.476   37.772 1.00 57.06  ? 204  LYS A CD    1 
ATOM   918  C CE    . LYS C 3 2   ? 33.492  0.345   39.257 1.00 60.12  ? 204  LYS A CE    1 
ATOM   919  N NZ    . LYS C 3 2   ? 34.968  0.191   39.516 1.00 67.45  ? 204  LYS A NZ    1 
ATOM   920  N N     . TRP C 3 3   ? 29.854  -1.767  33.182 1.00 45.13  ? 205  TRP A N     1 
ATOM   921  C CA    . TRP C 3 3   ? 29.715  -1.928  31.743 1.00 41.77  ? 205  TRP A CA    1 
ATOM   922  C C     . TRP C 3 3   ? 29.744  -0.595  31.010 1.00 42.22  ? 205  TRP A C     1 
ATOM   923  O O     . TRP C 3 3   ? 30.050  -0.529  29.822 1.00 44.72  ? 205  TRP A O     1 
ATOM   924  C CB    . TRP C 3 3   ? 28.413  -2.678  31.410 1.00 42.36  ? 205  TRP A CB    1 
ATOM   925  C CG    . TRP C 3 3   ? 27.143  -2.020  31.883 1.00 42.93  ? 205  TRP A CG    1 
ATOM   926  C CD1   . TRP C 3 3   ? 26.377  -2.401  32.933 1.00 46.34  ? 205  TRP A CD1   1 
ATOM   927  C CD2   . TRP C 3 3   ? 26.532  -0.838  31.354 1.00 40.30  ? 205  TRP A CD2   1 
ATOM   928  N NE1   . TRP C 3 3   ? 25.334  -1.525  33.103 1.00 41.65  ? 205  TRP A NE1   1 
ATOM   929  C CE2   . TRP C 3 3   ? 25.411  -0.554  32.147 1.00 40.42  ? 205  TRP A CE2   1 
ATOM   930  C CE3   . TRP C 3 3   ? 26.832  0.015   30.294 1.00 46.91  ? 205  TRP A CE3   1 
ATOM   931  C CZ2   . TRP C 3 3   ? 24.592  0.546   31.918 1.00 41.02  ? 205  TRP A CZ2   1 
ATOM   932  C CZ3   . TRP C 3 3   ? 26.024  1.107   30.066 1.00 45.06  ? 205  TRP A CZ3   1 
ATOM   933  C CH2   . TRP C 3 3   ? 24.916  1.365   30.877 1.00 42.90  ? 205  TRP A CH2   1 
ATOM   934  N N     . TRP C 3 4   ? 29.353  0.460   31.708 1.00 42.15  ? 206  TRP A N     1 
ATOM   935  C CA    . TRP C 3 4   ? 29.321  1.782   31.122 1.00 43.53  ? 206  TRP A CA    1 
ATOM   936  C C     . TRP C 3 4   ? 30.701  2.249   30.747 1.00 48.33  ? 206  TRP A C     1 
ATOM   937  O O     . TRP C 3 4   ? 30.887  3.159   29.914 1.00 47.74  ? 206  TRP A O     1 
ATOM   938  C CB    . TRP C 3 4   ? 28.687  2.750   32.091 1.00 43.00  ? 206  TRP A CB    1 
ATOM   939  C CG    . TRP C 3 4   ? 29.149  2.632   33.488 1.00 40.52  ? 206  TRP A CG    1 
ATOM   940  C CD1   . TRP C 3 4   ? 30.038  3.436   34.118 1.00 42.29  ? 206  TRP A CD1   1 
ATOM   941  C CD2   . TRP C 3 4   ? 28.638  1.743   34.484 1.00 45.15  ? 206  TRP A CD2   1 
ATOM   942  N NE1   . TRP C 3 4   ? 30.105  3.125   35.449 1.00 47.88  ? 206  TRP A NE1   1 
ATOM   943  C CE2   . TRP C 3 4   ? 29.250  2.085   35.706 1.00 47.43  ? 206  TRP A CE2   1 
ATOM   944  C CE3   . TRP C 3 4   ? 27.710  0.691   34.466 1.00 46.97  ? 206  TRP A CE3   1 
ATOM   945  C CZ2   . TRP C 3 4   ? 28.966  1.418   36.909 1.00 45.26  ? 206  TRP A CZ2   1 
ATOM   946  C CZ3   . TRP C 3 4   ? 27.426  0.026   35.658 1.00 44.53  ? 206  TRP A CZ3   1 
ATOM   947  C CH2   . TRP C 3 4   ? 28.054  0.396   36.864 1.00 44.59  ? 206  TRP A CH2   1 
ATOM   948  N N     . GLU C 3 5   ? 31.672  1.664   31.430 1.00 53.91  ? 207  GLU A N     1 
ATOM   949  C CA    . GLU C 3 5   ? 33.051  1.980   31.169 1.00 61.21  ? 207  GLU A CA    1 
ATOM   950  C C     . GLU C 3 5   ? 33.596  1.091   30.038 1.00 63.19  ? 207  GLU A C     1 
ATOM   951  O O     . GLU C 3 5   ? 34.797  0.848   29.980 1.00 68.34  ? 207  GLU A O     1 
ATOM   952  C CB    . GLU C 3 5   ? 33.870  1.812   32.453 1.00 62.26  ? 207  GLU A CB    1 
ATOM   953  C CG    . GLU C 3 5   ? 33.459  2.767   33.585 1.00 71.67  ? 207  GLU A CG    1 
ATOM   954  C CD    . GLU C 3 5   ? 34.229  2.560   34.916 1.00 75.10  ? 207  GLU A CD    1 
ATOM   955  O OE1   . GLU C 3 5   ? 35.106  1.655   34.999 1.00 76.57  ? 207  GLU A OE1   1 
ATOM   956  O OE2   . GLU C 3 5   ? 33.948  3.318   35.890 1.00 76.59  ? 207  GLU A OE2   1 
ATOM   957  N N     . GLU C 3 6   ? 32.741  0.610   29.140 1.00 61.68  ? 208  GLU A N     1 
ATOM   958  C CA    . GLU C 3 6   ? 33.219  -0.242  28.055 1.00 62.50  ? 208  GLU A CA    1 
ATOM   959  C C     . GLU C 3 6   ? 32.957  0.401   26.706 1.00 65.10  ? 208  GLU A C     1 
ATOM   960  O O     . GLU C 3 6   ? 32.554  1.560   26.638 1.00 68.51  ? 208  GLU A O     1 
ATOM   961  C CB    . GLU C 3 6   ? 32.536  -1.612  28.106 1.00 63.51  ? 208  GLU A CB    1 
ATOM   962  C CG    . GLU C 3 6   ? 32.708  -2.391  29.424 1.00 67.68  ? 208  GLU A CG    1 
ATOM   963  C CD    . GLU C 3 6   ? 34.001  -3.250  29.535 1.00 68.88  ? 208  GLU A CD    1 
ATOM   964  O OE1   . GLU C 3 6   ? 34.925  -3.119  28.674 1.00 68.68  ? 208  GLU A OE1   1 
ATOM   965  O OE2   . GLU C 3 6   ? 34.082  -4.049  30.516 1.00 59.14  ? 208  GLU A OE2   1 
ATOM   966  N N     . GLU C 3 7   ? 33.214  -0.343  25.633 1.00 64.34  ? 209  GLU A N     1 
ATOM   967  C CA    . GLU C 3 7   ? 32.993  0.147   24.277 1.00 64.06  ? 209  GLU A CA    1 
ATOM   968  C C     . GLU C 3 7   ? 31.663  -0.387  23.785 1.00 64.57  ? 209  GLU A C     1 
ATOM   969  O O     . GLU C 3 7   ? 31.447  -1.600  23.779 1.00 64.97  ? 209  GLU A O     1 
ATOM   970  C CB    . GLU C 3 7   ? 34.113  -0.323  23.335 1.00 63.75  ? 209  GLU A CB    1 
ATOM   971  N N     . ARG C 3 8   ? 30.767  0.515   23.394 1.00 66.55  ? 210  ARG A N     1 
ATOM   972  C CA    . ARG C 3 8   ? 29.455  0.116   22.884 1.00 67.83  ? 210  ARG A CA    1 
ATOM   973  C C     . ARG C 3 8   ? 29.701  -0.690  21.600 1.00 69.90  ? 210  ARG A C     1 
ATOM   974  O O     . ARG C 3 8   ? 30.698  -0.457  20.916 1.00 70.49  ? 210  ARG A O     1 
ATOM   975  C CB    . ARG C 3 8   ? 28.607  1.361   22.598 1.00 66.06  ? 210  ARG A CB    1 
ATOM   976  N N     . TYR C 3 9   ? 28.839  -1.660  21.307 1.00 74.19  ? 211  TYR A N     1 
ATOM   977  C CA    . TYR C 3 9   ? 28.956  -2.502  20.108 1.00 78.10  ? 211  TYR A CA    1 
ATOM   978  C C     . TYR C 3 9   ? 28.527  -1.735  18.868 1.00 78.54  ? 211  TYR A C     1 
ATOM   979  O O     . TYR C 3 9   ? 27.975  -0.621  18.975 1.00 78.20  ? 211  TYR A O     1 
ATOM   980  C CB    . TYR C 3 9   ? 28.050  -3.738  20.236 1.00 82.83  ? 211  TYR A CB    1 
ATOM   981  C CG    . TYR C 3 9   ? 28.678  -4.911  20.959 1.00 91.33  ? 211  TYR A CG    1 
ATOM   982  C CD1   . TYR C 3 9   ? 27.904  -6.026  21.333 1.00 91.01  ? 211  TYR A CD1   1 
ATOM   983  C CD2   . TYR C 3 9   ? 30.062  -4.933  21.237 1.00 95.72  ? 211  TYR A CD2   1 
ATOM   984  C CE1   . TYR C 3 9   ? 28.490  -7.145  21.957 1.00 95.51  ? 211  TYR A CE1   1 
ATOM   985  C CE2   . TYR C 3 9   ? 30.658  -6.048  21.867 1.00 99.11  ? 211  TYR A CE2   1 
ATOM   986  C CZ    . TYR C 3 9   ? 29.863  -7.153  22.216 1.00 98.35  ? 211  TYR A CZ    1 
ATOM   987  O OH    . TYR C 3 9   ? 30.439  -8.280  22.767 1.00 99.79  ? 211  TYR A OH    1 
ATOM   988  N N     . PRO C 3 10  ? 28.798  -2.296  17.664 1.00 79.33  ? 212  PRO A N     1 
ATOM   989  C CA    . PRO C 3 10  ? 28.368  -1.559  16.472 1.00 80.65  ? 212  PRO A CA    1 
ATOM   990  C C     . PRO C 3 10  ? 26.857  -1.470  16.577 1.00 83.90  ? 212  PRO A C     1 
ATOM   991  O O     . PRO C 3 10  ? 26.257  -1.942  17.547 1.00 84.90  ? 212  PRO A O     1 
ATOM   992  C CB    . PRO C 3 10  ? 28.754  -2.492  15.321 1.00 78.38  ? 212  PRO A CB    1 
ATOM   993  C CG    . PRO C 3 10  ? 29.947  -3.226  15.855 1.00 81.35  ? 212  PRO A CG    1 
ATOM   994  C CD    . PRO C 3 10  ? 29.522  -3.525  17.286 1.00 80.51  ? 212  PRO A CD    1 
ATOM   995  N N     . GLU C 3 11  ? 26.228  -0.850  15.595 1.00 87.16  ? 213  GLU A N     1 
ATOM   996  C CA    . GLU C 3 11  ? 24.774  -0.769  15.653 1.00 88.17  ? 213  GLU A CA    1 
ATOM   997  C C     . GLU C 3 11  ? 24.236  -2.083  15.099 1.00 85.70  ? 213  GLU A C     1 
ATOM   998  O O     . GLU C 3 11  ? 24.807  -2.650  14.132 1.00 85.75  ? 213  GLU A O     1 
ATOM   999  C CB    . GLU C 3 11  ? 24.236  0.425   14.844 1.00 89.27  ? 213  GLU A CB    1 
ATOM   1000 N N     . GLY C 3 12  ? 23.132  -2.540  15.694 1.00 82.00  ? 214  GLY A N     1 
ATOM   1001 C CA    . GLY C 3 12  ? 22.508  -3.781  15.272 1.00 78.59  ? 214  GLY A CA    1 
ATOM   1002 C C     . GLY C 3 12  ? 22.934  -4.959  16.123 1.00 74.02  ? 214  GLY A C     1 
ATOM   1003 O O     . GLY C 3 12  ? 22.094  -5.752  16.555 1.00 77.08  ? 214  GLY A O     1 
ATOM   1004 N N     . ILE C 3 13  ? 24.239  -5.111  16.316 1.00 68.64  ? 215  ILE A N     1 
ATOM   1005 C CA    . ILE C 3 13  ? 24.755  -6.197  17.116 1.00 60.78  ? 215  ILE A CA    1 
ATOM   1006 C C     . ILE C 3 13  ? 24.464  -5.929  18.586 1.00 57.77  ? 215  ILE A C     1 
ATOM   1007 O O     . ILE C 3 13  ? 24.964  -4.965  19.167 1.00 55.34  ? 215  ILE A O     1 
ATOM   1008 C CB    . ILE C 3 13  ? 26.253  -6.400  16.844 1.00 62.19  ? 215  ILE A CB    1 
ATOM   1009 C CG1   . ILE C 3 13  ? 26.431  -7.072  15.488 1.00 64.21  ? 215  ILE A CG1   1 
ATOM   1010 C CG2   . ILE C 3 13  ? 26.900  -7.280  17.909 1.00 59.80  ? 215  ILE A CG2   1 
ATOM   1011 C CD1   . ILE C 3 13  ? 27.873  -7.122  15.033 1.00 75.03  ? 215  ILE A CD1   1 
ATOM   1012 N N     . LYS C 3 14  ? 23.640  -6.800  19.169 1.00 55.05  ? 216  LYS A N     1 
ATOM   1013 C CA    . LYS C 3 14  ? 23.235  -6.705  20.565 1.00 52.13  ? 216  LYS A CA    1 
ATOM   1014 C C     . LYS C 3 14  ? 24.114  -7.529  21.531 1.00 50.61  ? 216  LYS A C     1 
ATOM   1015 O O     . LYS C 3 14  ? 24.218  -7.195  22.715 1.00 52.19  ? 216  LYS A O     1 
ATOM   1016 C CB    . LYS C 3 14  ? 21.757  -7.100  20.702 1.00 54.76  ? 216  LYS A CB    1 
ATOM   1017 C CG    . LYS C 3 14  ? 20.787  -6.331  19.797 1.00 54.38  ? 216  LYS A CG    1 
ATOM   1018 C CD    . LYS C 3 14  ? 20.933  -4.812  19.952 1.00 59.48  ? 216  LYS A CD    1 
ATOM   1019 C CE    . LYS C 3 14  ? 19.872  -4.010  19.159 1.00 62.02  ? 216  LYS A CE    1 
ATOM   1020 N NZ    . LYS C 3 14  ? 18.616  -3.781  19.943 1.00 65.47  ? 216  LYS A NZ    1 
ATOM   1021 N N     . TRP C 3 15  ? 24.704  -8.621  21.047 1.00 47.45  ? 217  TRP A N     1 
ATOM   1022 C CA    . TRP C 3 15  ? 25.590  -9.467  21.851 1.00 47.97  ? 217  TRP A CA    1 
ATOM   1023 C C     . TRP C 3 15  ? 26.251  -10.467 20.927 1.00 47.91  ? 217  TRP A C     1 
ATOM   1024 O O     . TRP C 3 15  ? 25.845  -10.621 19.781 1.00 48.87  ? 217  TRP A O     1 
ATOM   1025 C CB    . TRP C 3 15  ? 24.828  -10.223 22.935 1.00 45.30  ? 217  TRP A CB    1 
ATOM   1026 C CG    . TRP C 3 15  ? 23.609  -10.854 22.406 1.00 48.98  ? 217  TRP A CG    1 
ATOM   1027 C CD1   . TRP C 3 15  ? 22.345  -10.381 22.541 1.00 53.25  ? 217  TRP A CD1   1 
ATOM   1028 C CD2   . TRP C 3 15  ? 23.509  -12.031 21.577 1.00 49.84  ? 217  TRP A CD2   1 
ATOM   1029 N NE1   . TRP C 3 15  ? 21.456  -11.173 21.842 1.00 53.58  ? 217  TRP A NE1   1 
ATOM   1030 C CE2   . TRP C 3 15  ? 22.146  -12.195 21.248 1.00 51.12  ? 217  TRP A CE2   1 
ATOM   1031 C CE3   . TRP C 3 15  ? 24.430  -12.957 21.085 1.00 45.97  ? 217  TRP A CE3   1 
ATOM   1032 C CZ2   . TRP C 3 15  ? 21.686  -13.252 20.449 1.00 49.36  ? 217  TRP A CZ2   1 
ATOM   1033 C CZ3   . TRP C 3 15  ? 23.971  -14.002 20.292 1.00 41.06  ? 217  TRP A CZ3   1 
ATOM   1034 C CH2   . TRP C 3 15  ? 22.615  -14.141 19.984 1.00 42.80  ? 217  TRP A CH2   1 
ATOM   1035 N N     . LYS C 3 16  ? 27.245  -11.175 21.442 1.00 47.67  ? 218  LYS A N     1 
ATOM   1036 C CA    . LYS C 3 16  ? 27.944  -12.179 20.654 1.00 48.55  ? 218  LYS A CA    1 
ATOM   1037 C C     . LYS C 3 16  ? 27.604  -13.586 21.110 1.00 45.39  ? 218  LYS A C     1 
ATOM   1038 O O     . LYS C 3 16  ? 27.523  -14.484 20.296 1.00 42.46  ? 218  LYS A O     1 
ATOM   1039 C CB    . LYS C 3 16  ? 29.440  -11.944 20.735 1.00 51.48  ? 218  LYS A CB    1 
ATOM   1040 C CG    . LYS C 3 16  ? 29.811  -10.506 20.422 1.00 60.34  ? 218  LYS A CG    1 
ATOM   1041 C CD    . LYS C 3 16  ? 31.089  -10.386 19.559 1.00 71.29  ? 218  LYS A CD    1 
ATOM   1042 C CE    . LYS C 3 16  ? 30.997  -11.116 18.192 1.00 73.96  ? 218  LYS A CE    1 
ATOM   1043 N NZ    . LYS C 3 16  ? 29.875  -10.673 17.283 1.00 78.44  ? 218  LYS A NZ    1 
ATOM   1044 N N     . PHE C 3 17  ? 27.359  -13.734 22.413 1.00 43.88  ? 219  PHE A N     1 
ATOM   1045 C CA    . PHE C 3 17  ? 27.024  -15.010 23.043 1.00 42.92  ? 219  PHE A CA    1 
ATOM   1046 C C     . PHE C 3 17  ? 25.855  -14.763 23.956 1.00 43.60  ? 219  PHE A C     1 
ATOM   1047 O O     . PHE C 3 17  ? 25.697  -13.666 24.498 1.00 42.68  ? 219  PHE A O     1 
ATOM   1048 C CB    . PHE C 3 17  ? 28.196  -15.527 23.904 1.00 43.60  ? 219  PHE A CB    1 
ATOM   1049 C CG    . PHE C 3 17  ? 27.948  -16.881 24.574 1.00 44.82  ? 219  PHE A CG    1 
ATOM   1050 C CD1   . PHE C 3 17  ? 28.260  -18.077 23.910 1.00 40.30  ? 219  PHE A CD1   1 
ATOM   1051 C CD2   . PHE C 3 17  ? 27.441  -16.957 25.880 1.00 43.79  ? 219  PHE A CD2   1 
ATOM   1052 C CE1   . PHE C 3 17  ? 28.077  -19.319 24.523 1.00 33.93  ? 219  PHE A CE1   1 
ATOM   1053 C CE2   . PHE C 3 17  ? 27.255  -18.204 26.503 1.00 36.26  ? 219  PHE A CE2   1 
ATOM   1054 C CZ    . PHE C 3 17  ? 27.578  -19.382 25.811 1.00 34.42  ? 219  PHE A CZ    1 
ATOM   1055 N N     . LEU C 3 18  ? 25.065  -15.805 24.156 1.00 43.54  ? 220  LEU A N     1 
ATOM   1056 C CA    . LEU C 3 18  ? 23.895  -15.746 25.016 1.00 46.31  ? 220  LEU A CA    1 
ATOM   1057 C C     . LEU C 3 18  ? 23.416  -17.143 25.317 1.00 45.69  ? 220  LEU A C     1 
ATOM   1058 O O     . LEU C 3 18  ? 23.157  -17.918 24.395 1.00 43.55  ? 220  LEU A O     1 
ATOM   1059 C CB    . LEU C 3 18  ? 22.748  -14.978 24.351 1.00 45.39  ? 220  LEU A CB    1 
ATOM   1060 C CG    . LEU C 3 18  ? 21.404  -15.076 25.082 1.00 44.59  ? 220  LEU A CG    1 
ATOM   1061 C CD1   . LEU C 3 18  ? 21.474  -14.447 26.495 1.00 39.76  ? 220  LEU A CD1   1 
ATOM   1062 C CD2   . LEU C 3 18  ? 20.338  -14.442 24.219 1.00 40.84  ? 220  LEU A CD2   1 
ATOM   1063 N N     . GLU C 3 19  ? 23.179  -17.402 26.602 1.00 43.97  ? 221  GLU A N     1 
ATOM   1064 C CA    . GLU C 3 19  ? 22.728  -18.706 27.050 1.00 44.11  ? 221  GLU A CA    1 
ATOM   1065 C C     . GLU C 3 19  ? 21.736  -18.603 28.220 1.00 42.71  ? 221  GLU A C     1 
ATOM   1066 O O     . GLU C 3 19  ? 22.026  -17.943 29.211 1.00 41.52  ? 221  GLU A O     1 
ATOM   1067 C CB    . GLU C 3 19  ? 23.953  -19.551 27.446 1.00 43.68  ? 221  GLU A CB    1 
ATOM   1068 C CG    . GLU C 3 19  ? 23.671  -21.044 27.567 1.00 46.69  ? 221  GLU A CG    1 
ATOM   1069 C CD    . GLU C 3 19  ? 24.920  -21.885 27.658 1.00 44.92  ? 221  GLU A CD    1 
ATOM   1070 O OE1   . GLU C 3 19  ? 25.283  -22.298 28.774 1.00 41.42  ? 221  GLU A OE1   1 
ATOM   1071 O OE2   . GLU C 3 19  ? 25.536  -22.144 26.609 1.00 45.77  ? 221  GLU A OE2   1 
ATOM   1072 N N     . HIS C 3 20  ? 20.543  -19.174 28.058 1.00 42.23  ? 222  HIS A N     1 
ATOM   1073 C CA    . HIS C 3 20  ? 19.530  -19.171 29.119 1.00 43.23  ? 222  HIS A CA    1 
ATOM   1074 C C     . HIS C 3 20  ? 18.901  -20.558 29.260 1.00 43.31  ? 222  HIS A C     1 
ATOM   1075 O O     . HIS C 3 20  ? 19.107  -21.430 28.439 1.00 41.59  ? 222  HIS A O     1 
ATOM   1076 C CB    . HIS C 3 20  ? 18.454  -18.110 28.858 1.00 36.05  ? 222  HIS A CB    1 
ATOM   1077 C CG    . HIS C 3 20  ? 17.938  -18.108 27.457 1.00 38.68  ? 222  HIS A CG    1 
ATOM   1078 N ND1   . HIS C 3 20  ? 16.769  -18.731 27.089 1.00 35.24  ? 222  HIS A ND1   1 
ATOM   1079 C CD2   . HIS C 3 20  ? 18.433  -17.546 26.322 1.00 38.25  ? 222  HIS A CD2   1 
ATOM   1080 C CE1   . HIS C 3 20  ? 16.560  -18.555 25.795 1.00 37.55  ? 222  HIS A CE1   1 
ATOM   1081 N NE2   . HIS C 3 20  ? 17.557  -17.837 25.313 1.00 39.53  ? 222  HIS A NE2   1 
ATOM   1082 N N     . LYS C 3 21  ? 18.069  -20.738 30.262 1.00 45.29  ? 223  LYS A N     1 
ATOM   1083 C CA    . LYS C 3 21  ? 17.462  -22.031 30.478 1.00 50.00  ? 223  LYS A CA    1 
ATOM   1084 C C     . LYS C 3 21  ? 16.037  -22.071 30.011 1.00 47.93  ? 223  LYS A C     1 
ATOM   1085 O O     . LYS C 3 21  ? 15.333  -23.026 30.279 1.00 48.26  ? 223  LYS A O     1 
ATOM   1086 C CB    . LYS C 3 21  ? 17.498  -22.363 31.961 1.00 57.27  ? 223  LYS A CB    1 
ATOM   1087 C CG    . LYS C 3 21  ? 18.868  -22.149 32.573 1.00 70.25  ? 223  LYS A CG    1 
ATOM   1088 C CD    . LYS C 3 21  ? 19.065  -22.917 33.902 1.00 80.97  ? 223  LYS A CD    1 
ATOM   1089 C CE    . LYS C 3 21  ? 19.104  -24.449 33.711 1.00 86.17  ? 223  LYS A CE    1 
ATOM   1090 N NZ    . LYS C 3 21  ? 19.558  -25.195 34.940 1.00 90.68  ? 223  LYS A NZ    1 
ATOM   1091 N N     . GLY C 3 22  ? 15.619  -21.039 29.295 1.00 49.65  ? 224  GLY A N     1 
ATOM   1092 C CA    . GLY C 3 22  ? 14.249  -20.979 28.841 1.00 45.48  ? 224  GLY A CA    1 
ATOM   1093 C C     . GLY C 3 22  ? 13.318  -20.579 29.969 1.00 44.79  ? 224  GLY A C     1 
ATOM   1094 O O     . GLY C 3 22  ? 13.737  -20.364 31.095 1.00 45.73  ? 224  GLY A O     1 
ATOM   1095 N N     . PRO C 3 23  ? 12.022  -20.479 29.678 1.00 43.06  ? 225  PRO A N     1 
ATOM   1096 C CA    . PRO C 3 23  ? 10.944  -20.106 30.602 1.00 39.64  ? 225  PRO A CA    1 
ATOM   1097 C C     . PRO C 3 23  ? 10.448  -21.167 31.567 1.00 38.50  ? 225  PRO A C     1 
ATOM   1098 O O     . PRO C 3 23  ? 10.477  -22.357 31.289 1.00 36.48  ? 225  PRO A O     1 
ATOM   1099 C CB    . PRO C 3 23  ? 9.821   -19.767 29.655 1.00 41.36  ? 225  PRO A CB    1 
ATOM   1100 C CG    . PRO C 3 23  ? 10.021  -20.793 28.558 1.00 43.95  ? 225  PRO A CG    1 
ATOM   1101 C CD    . PRO C 3 23  ? 11.500  -20.707 28.320 1.00 38.43  ? 225  PRO A CD    1 
ATOM   1102 N N     . VAL C 3 24  ? 9.918   -20.700 32.680 1.00 37.00  ? 226  VAL A N     1 
ATOM   1103 C CA    . VAL C 3 24  ? 9.342   -21.591 33.647 1.00 38.37  ? 226  VAL A CA    1 
ATOM   1104 C C     . VAL C 3 24  ? 7.902   -21.625 33.195 1.00 41.00  ? 226  VAL A C     1 
ATOM   1105 O O     . VAL C 3 24  ? 7.255   -20.598 33.195 1.00 41.05  ? 226  VAL A O     1 
ATOM   1106 C CB    . VAL C 3 24  ? 9.364   -20.974 35.010 1.00 37.39  ? 226  VAL A CB    1 
ATOM   1107 C CG1   . VAL C 3 24  ? 8.560   -21.805 35.973 1.00 40.52  ? 226  VAL A CG1   1 
ATOM   1108 C CG2   . VAL C 3 24  ? 10.774  -20.839 35.472 1.00 38.96  ? 226  VAL A CG2   1 
ATOM   1109 N N     . PHE C 3 25  ? 7.414   -22.772 32.747 1.00 42.02  ? 227  PHE A N     1 
ATOM   1110 C CA    . PHE C 3 25  ? 6.025   -22.868 32.309 1.00 41.09  ? 227  PHE A CA    1 
ATOM   1111 C C     . PHE C 3 25  ? 5.110   -22.873 33.497 1.00 42.25  ? 227  PHE A C     1 
ATOM   1112 O O     . PHE C 3 25  ? 5.552   -23.131 34.619 1.00 45.39  ? 227  PHE A O     1 
ATOM   1113 C CB    . PHE C 3 25  ? 5.793   -24.117 31.486 1.00 39.38  ? 227  PHE A CB    1 
ATOM   1114 C CG    . PHE C 3 25  ? 6.521   -24.104 30.181 1.00 46.94  ? 227  PHE A CG    1 
ATOM   1115 C CD1   . PHE C 3 25  ? 5.861   -23.755 29.008 1.00 44.83  ? 227  PHE A CD1   1 
ATOM   1116 C CD2   . PHE C 3 25  ? 7.892   -24.379 30.132 1.00 48.98  ? 227  PHE A CD2   1 
ATOM   1117 C CE1   . PHE C 3 25  ? 6.547   -23.673 27.805 1.00 48.06  ? 227  PHE A CE1   1 
ATOM   1118 C CE2   . PHE C 3 25  ? 8.591   -24.301 28.933 1.00 51.41  ? 227  PHE A CE2   1 
ATOM   1119 C CZ    . PHE C 3 25  ? 7.916   -23.945 27.763 1.00 48.85  ? 227  PHE A CZ    1 
ATOM   1120 N N     . ALA C 3 26  ? 3.846   -22.538 33.277 1.00 42.87  ? 228  ALA A N     1 
ATOM   1121 C CA    . ALA C 3 26  ? 2.909   -22.520 34.387 1.00 43.02  ? 228  ALA A CA    1 
ATOM   1122 C C     . ALA C 3 26  ? 2.656   -23.962 34.837 1.00 45.06  ? 228  ALA A C     1 
ATOM   1123 O O     . ALA C 3 26  ? 2.569   -24.877 34.019 1.00 45.10  ? 228  ALA A O     1 
ATOM   1124 C CB    . ALA C 3 26  ? 1.634   -21.831 34.003 1.00 41.12  ? 228  ALA A CB    1 
ATOM   1125 N N     . PRO C 3 27  ? 2.596   -24.195 36.161 1.00 45.17  ? 229  PRO A N     1 
ATOM   1126 C CA    . PRO C 3 27  ? 2.367   -25.556 36.624 1.00 46.55  ? 229  PRO A CA    1 
ATOM   1127 C C     . PRO C 3 27  ? 1.044   -26.065 36.175 1.00 49.64  ? 229  PRO A C     1 
ATOM   1128 O O     . PRO C 3 27  ? 0.147   -25.317 35.799 1.00 51.06  ? 229  PRO A O     1 
ATOM   1129 C CB    . PRO C 3 27  ? 2.406   -25.430 38.143 1.00 45.04  ? 229  PRO A CB    1 
ATOM   1130 C CG    . PRO C 3 27  ? 1.828   -24.145 38.352 1.00 45.61  ? 229  PRO A CG    1 
ATOM   1131 C CD    . PRO C 3 27  ? 2.509   -23.272 37.296 1.00 46.61  ? 229  PRO A CD    1 
ATOM   1132 N N     . PRO C 3 28  ? 0.916   -27.366 36.212 1.00 52.79  ? 230  PRO A N     1 
ATOM   1133 C CA    . PRO C 3 28  ? -0.300  -28.039 35.808 1.00 52.51  ? 230  PRO A CA    1 
ATOM   1134 C C     . PRO C 3 28  ? -1.483  -27.661 36.662 1.00 51.01  ? 230  PRO A C     1 
ATOM   1135 O O     . PRO C 3 28  ? -1.373  -27.081 37.737 1.00 48.12  ? 230  PRO A O     1 
ATOM   1136 C CB    . PRO C 3 28  ? 0.068   -29.506 35.958 1.00 56.66  ? 230  PRO A CB    1 
ATOM   1137 C CG    . PRO C 3 28  ? 1.597   -29.489 35.767 1.00 59.46  ? 230  PRO A CG    1 
ATOM   1138 C CD    . PRO C 3 28  ? 1.964   -28.323 36.597 1.00 57.44  ? 230  PRO A CD    1 
ATOM   1139 N N     . TYR C 3 29  ? -2.629  -27.910 36.066 1.00 52.39  ? 231  TYR A N     1 
ATOM   1140 C CA    . TYR C 3 29  ? -3.910  -27.646 36.661 1.00 52.83  ? 231  TYR A CA    1 
ATOM   1141 C C     . TYR C 3 29  ? -4.361  -28.839 37.530 1.00 53.25  ? 231  TYR A C     1 
ATOM   1142 O O     . TYR C 3 29  ? -4.445  -29.982 37.059 1.00 55.59  ? 231  TYR A O     1 
ATOM   1143 C CB    . TYR C 3 29  ? -4.902  -27.383 35.527 1.00 47.16  ? 231  TYR A CB    1 
ATOM   1144 C CG    . TYR C 3 29  ? -6.298  -27.341 36.009 1.00 47.70  ? 231  TYR A CG    1 
ATOM   1145 C CD1   . TYR C 3 29  ? -6.736  -26.293 36.804 1.00 46.19  ? 231  TYR A CD1   1 
ATOM   1146 C CD2   . TYR C 3 29  ? -7.165  -28.396 35.756 1.00 46.33  ? 231  TYR A CD2   1 
ATOM   1147 C CE1   . TYR C 3 29  ? -7.997  -26.301 37.345 1.00 47.13  ? 231  TYR A CE1   1 
ATOM   1148 C CE2   . TYR C 3 29  ? -8.422  -28.413 36.288 1.00 49.99  ? 231  TYR A CE2   1 
ATOM   1149 C CZ    . TYR C 3 29  ? -8.837  -27.366 37.084 1.00 50.76  ? 231  TYR A CZ    1 
ATOM   1150 O OH    . TYR C 3 29  ? -10.111 -27.403 37.610 1.00 55.54  ? 231  TYR A OH    1 
ATOM   1151 N N     . GLU C 3 30  ? -4.640  -28.574 38.796 1.00 52.23  ? 232  GLU A N     1 
ATOM   1152 C CA    . GLU C 3 30  ? -5.099  -29.613 39.693 1.00 55.32  ? 232  GLU A CA    1 
ATOM   1153 C C     . GLU C 3 30  ? -6.594  -29.414 39.729 1.00 55.56  ? 232  GLU A C     1 
ATOM   1154 O O     . GLU C 3 30  ? -7.057  -28.303 39.900 1.00 58.22  ? 232  GLU A O     1 
ATOM   1155 C CB    . GLU C 3 30  ? -4.535  -29.398 41.093 1.00 60.91  ? 232  GLU A CB    1 
ATOM   1156 C CG    . GLU C 3 30  ? -3.030  -29.321 41.125 1.00 70.74  ? 232  GLU A CG    1 
ATOM   1157 C CD    . GLU C 3 30  ? -2.503  -28.395 42.214 1.00 74.40  ? 232  GLU A CD    1 
ATOM   1158 O OE1   . GLU C 3 30  ? -3.078  -27.282 42.399 1.00 75.42  ? 232  GLU A OE1   1 
ATOM   1159 O OE2   . GLU C 3 30  ? -1.489  -28.780 42.854 1.00 76.16  ? 232  GLU A OE2   1 
ATOM   1160 N N     . PRO C 3 31  ? -7.370  -30.471 39.484 1.00 54.96  ? 233  PRO A N     1 
ATOM   1161 C CA    . PRO C 3 31  ? -8.823  -30.338 39.509 1.00 53.54  ? 233  PRO A CA    1 
ATOM   1162 C C     . PRO C 3 31  ? -9.358  -30.043 40.904 1.00 55.37  ? 233  PRO A C     1 
ATOM   1163 O O     . PRO C 3 31  ? -8.649  -30.193 41.911 1.00 58.99  ? 233  PRO A O     1 
ATOM   1164 C CB    . PRO C 3 31  ? -9.281  -31.694 39.023 1.00 52.20  ? 233  PRO A CB    1 
ATOM   1165 C CG    . PRO C 3 31  ? -8.207  -32.076 38.083 1.00 52.48  ? 233  PRO A CG    1 
ATOM   1166 C CD    . PRO C 3 31  ? -6.989  -31.754 38.881 1.00 56.08  ? 233  PRO A CD    1 
ATOM   1167 N N     . LEU C 3 32  ? -10.615 -29.622 40.960 1.00 54.47  ? 234  LEU A N     1 
ATOM   1168 C CA    . LEU C 3 32  ? -11.245 -29.307 42.215 1.00 51.62  ? 234  LEU A CA    1 
ATOM   1169 C C     . LEU C 3 32  ? -11.489 -30.537 43.039 1.00 54.06  ? 234  LEU A C     1 
ATOM   1170 O O     . LEU C 3 32  ? -11.599 -31.666 42.535 1.00 53.39  ? 234  LEU A O     1 
ATOM   1171 C CB    . LEU C 3 32  ? -12.567 -28.594 41.994 1.00 50.20  ? 234  LEU A CB    1 
ATOM   1172 C CG    . LEU C 3 32  ? -12.414 -27.145 41.588 1.00 47.83  ? 234  LEU A CG    1 
ATOM   1173 C CD1   . LEU C 3 32  ? -13.750 -26.527 41.581 1.00 50.07  ? 234  LEU A CD1   1 
ATOM   1174 C CD2   . LEU C 3 32  ? -11.566 -26.428 42.571 1.00 46.80  ? 234  LEU A CD2   1 
ATOM   1175 N N     . PRO C 3 33  ? -11.481 -30.349 44.350 1.00 55.57  ? 235  PRO A N     1 
ATOM   1176 C CA    . PRO C 3 33  ? -11.720 -31.466 45.249 1.00 56.50  ? 235  PRO A CA    1 
ATOM   1177 C C     . PRO C 3 33  ? -13.141 -31.846 44.938 1.00 56.54  ? 235  PRO A C     1 
ATOM   1178 O O     . PRO C 3 33  ? -13.951 -30.980 44.590 1.00 55.76  ? 235  PRO A O     1 
ATOM   1179 C CB    . PRO C 3 33  ? -11.630 -30.813 46.621 1.00 60.81  ? 235  PRO A CB    1 
ATOM   1180 C CG    . PRO C 3 33  ? -10.657 -29.677 46.396 1.00 58.04  ? 235  PRO A CG    1 
ATOM   1181 C CD    . PRO C 3 33  ? -11.156 -29.122 45.091 1.00 57.09  ? 235  PRO A CD    1 
ATOM   1182 N N     . GLU C 3 34  ? -13.426 -33.137 45.037 1.00 58.21  ? 236  GLU A N     1 
ATOM   1183 C CA    . GLU C 3 34  ? -14.757 -33.663 44.747 1.00 59.62  ? 236  GLU A CA    1 
ATOM   1184 C C     . GLU C 3 34  ? -15.872 -32.984 45.543 1.00 59.04  ? 236  GLU A C     1 
ATOM   1185 O O     . GLU C 3 34  ? -17.029 -32.999 45.138 1.00 61.58  ? 236  GLU A O     1 
ATOM   1186 C CB    . GLU C 3 34  ? -14.788 -35.178 44.985 1.00 59.59  ? 236  GLU A CB    1 
ATOM   1187 C CG    . GLU C 3 34  ? -13.735 -35.988 44.212 1.00 65.40  ? 236  GLU A CG    1 
ATOM   1188 C CD    . GLU C 3 34  ? -13.758 -35.731 42.697 1.00 69.92  ? 236  GLU A CD    1 
ATOM   1189 O OE1   . GLU C 3 34  ? -12.661 -35.477 42.114 1.00 71.27  ? 236  GLU A OE1   1 
ATOM   1190 O OE2   . GLU C 3 34  ? -14.868 -35.792 42.098 1.00 69.40  ? 236  GLU A OE2   1 
ATOM   1191 N N     . ASN C 3 35  ? -15.518 -32.440 46.695 1.00 57.17  ? 237  ASN A N     1 
ATOM   1192 C CA    . ASN C 3 35  ? -16.463 -31.760 47.558 1.00 58.28  ? 237  ASN A CA    1 
ATOM   1193 C C     . ASN C 3 35  ? -16.809 -30.385 47.016 1.00 57.15  ? 237  ASN A C     1 
ATOM   1194 O O     . ASN C 3 35  ? -17.840 -29.817 47.370 1.00 57.01  ? 237  ASN A O     1 
ATOM   1195 C CB    . ASN C 3 35  ? -15.855 -31.611 48.950 1.00 64.19  ? 237  ASN A CB    1 
ATOM   1196 C CG    . ASN C 3 35  ? -14.342 -31.355 48.901 1.00 69.01  ? 237  ASN A CG    1 
ATOM   1197 O OD1   . ASN C 3 35  ? -13.553 -32.292 48.737 1.00 73.41  ? 237  ASN A OD1   1 
ATOM   1198 N ND2   . ASN C 3 35  ? -13.938 -30.093 48.993 1.00 68.70  ? 237  ASN A ND2   1 
ATOM   1199 N N     . VAL C 3 36  ? -15.921 -29.821 46.202 1.00 58.46  ? 238  VAL A N     1 
ATOM   1200 C CA    . VAL C 3 36  ? -16.145 -28.485 45.639 1.00 59.69  ? 238  VAL A CA    1 
ATOM   1201 C C     . VAL C 3 36  ? -17.024 -28.651 44.404 1.00 61.55  ? 238  VAL A C     1 
ATOM   1202 O O     . VAL C 3 36  ? -16.578 -29.227 43.415 1.00 62.58  ? 238  VAL A O     1 
ATOM   1203 C CB    . VAL C 3 36  ? -14.832 -27.839 45.281 1.00 58.27  ? 238  VAL A CB    1 
ATOM   1204 C CG1   . VAL C 3 36  ? -15.064 -26.416 44.894 1.00 62.49  ? 238  VAL A CG1   1 
ATOM   1205 C CG2   . VAL C 3 36  ? -13.908 -27.905 46.462 1.00 60.95  ? 238  VAL A CG2   1 
ATOM   1206 N N     . LYS C 3 37  ? -18.228 -28.070 44.449 1.00 60.73  ? 239  LYS A N     1 
ATOM   1207 C CA    . LYS C 3 37  ? -19.236 -28.253 43.396 1.00 58.41  ? 239  LYS A CA    1 
ATOM   1208 C C     . LYS C 3 37  ? -19.638 -27.164 42.445 1.00 55.70  ? 239  LYS A C     1 
ATOM   1209 O O     . LYS C 3 37  ? -19.777 -25.999 42.822 1.00 55.27  ? 239  LYS A O     1 
ATOM   1210 C CB    . LYS C 3 37  ? -20.567 -28.733 44.009 1.00 60.80  ? 239  LYS A CB    1 
ATOM   1211 C CG    . LYS C 3 37  ? -20.717 -30.222 44.220 1.00 63.84  ? 239  LYS A CG    1 
ATOM   1212 C CD    . LYS C 3 37  ? -20.298 -30.667 45.619 1.00 65.86  ? 239  LYS A CD    1 
ATOM   1213 C CE    . LYS C 3 37  ? -20.207 -32.199 45.694 1.00 68.49  ? 239  LYS A CE    1 
ATOM   1214 N NZ    . LYS C 3 37  ? -19.398 -32.768 44.560 1.00 68.21  ? 239  LYS A NZ    1 
ATOM   1215 N N     . PHE C 3 38  ? -20.020 -27.613 41.255 1.00 50.91  ? 240  PHE A N     1 
ATOM   1216 C CA    . PHE C 3 38  ? -20.533 -26.720 40.250 1.00 50.10  ? 240  PHE A CA    1 
ATOM   1217 C C     . PHE C 3 38  ? -21.970 -27.119 39.972 1.00 48.77  ? 240  PHE A C     1 
ATOM   1218 O O     . PHE C 3 38  ? -22.348 -28.281 40.068 1.00 44.23  ? 240  PHE A O     1 
ATOM   1219 C CB    . PHE C 3 38  ? -19.750 -26.779 38.950 1.00 50.64  ? 240  PHE A CB    1 
ATOM   1220 C CG    . PHE C 3 38  ? -20.286 -25.829 37.885 1.00 53.12  ? 240  PHE A CG    1 
ATOM   1221 C CD1   . PHE C 3 38  ? -19.984 -24.456 37.926 1.00 49.01  ? 240  PHE A CD1   1 
ATOM   1222 C CD2   . PHE C 3 38  ? -21.125 -26.299 36.866 1.00 49.96  ? 240  PHE A CD2   1 
ATOM   1223 C CE1   . PHE C 3 38  ? -20.507 -23.573 36.975 1.00 48.14  ? 240  PHE A CE1   1 
ATOM   1224 C CE2   . PHE C 3 38  ? -21.651 -25.421 35.913 1.00 44.17  ? 240  PHE A CE2   1 
ATOM   1225 C CZ    . PHE C 3 38  ? -21.340 -24.056 35.971 1.00 47.25  ? 240  PHE A CZ    1 
ATOM   1226 N N     . TYR C 3 39  ? -22.788 -26.129 39.667 1.00 47.79  ? 241  TYR A N     1 
ATOM   1227 C CA    . TYR C 3 39  ? -24.160 -26.398 39.360 1.00 47.63  ? 241  TYR A CA    1 
ATOM   1228 C C     . TYR C 3 39  ? -24.578 -25.648 38.138 1.00 47.89  ? 241  TYR A C     1 
ATOM   1229 O O     . TYR C 3 39  ? -24.077 -24.558 37.859 1.00 44.98  ? 241  TYR A O     1 
ATOM   1230 C CB    . TYR C 3 39  ? -25.053 -25.961 40.496 1.00 51.06  ? 241  TYR A CB    1 
ATOM   1231 C CG    . TYR C 3 39  ? -24.837 -26.712 41.770 1.00 58.61  ? 241  TYR A CG    1 
ATOM   1232 C CD1   . TYR C 3 39  ? -23.967 -26.221 42.747 1.00 60.87  ? 241  TYR A CD1   1 
ATOM   1233 C CD2   . TYR C 3 39  ? -25.545 -27.893 42.035 1.00 59.88  ? 241  TYR A CD2   1 
ATOM   1234 C CE1   . TYR C 3 39  ? -23.806 -26.884 43.976 1.00 66.23  ? 241  TYR A CE1   1 
ATOM   1235 C CE2   . TYR C 3 39  ? -25.400 -28.570 43.260 1.00 62.47  ? 241  TYR A CE2   1 
ATOM   1236 C CZ    . TYR C 3 39  ? -24.528 -28.059 44.236 1.00 66.84  ? 241  TYR A CZ    1 
ATOM   1237 O OH    . TYR C 3 39  ? -24.404 -28.687 45.478 1.00 69.39  ? 241  TYR A OH    1 
ATOM   1238 N N     . TYR C 3 40  ? -25.350 -26.337 37.317 1.00 49.67  ? 242  TYR A N     1 
ATOM   1239 C CA    . TYR C 3 40  ? -25.931 -25.725 36.145 1.00 51.92  ? 242  TYR A CA    1 
ATOM   1240 C C     . TYR C 3 40  ? -27.432 -25.974 36.284 1.00 51.30  ? 242  TYR A C     1 
ATOM   1241 O O     . TYR C 3 40  ? -27.894 -27.109 36.454 1.00 47.76  ? 242  TYR A O     1 
ATOM   1242 C CB    . TYR C 3 40  ? -25.402 -26.284 34.823 1.00 51.87  ? 242  TYR A CB    1 
ATOM   1243 C CG    . TYR C 3 40  ? -25.991 -25.541 33.630 1.00 50.93  ? 242  TYR A CG    1 
ATOM   1244 C CD1   . TYR C 3 40  ? -25.525 -24.273 33.280 1.00 50.11  ? 242  TYR A CD1   1 
ATOM   1245 C CD2   . TYR C 3 40  ? -27.056 -26.074 32.904 1.00 49.32  ? 242  TYR A CD2   1 
ATOM   1246 C CE1   . TYR C 3 40  ? -26.100 -23.556 32.256 1.00 51.49  ? 242  TYR A CE1   1 
ATOM   1247 C CE2   . TYR C 3 40  ? -27.637 -25.365 31.877 1.00 53.85  ? 242  TYR A CE2   1 
ATOM   1248 C CZ    . TYR C 3 40  ? -27.151 -24.099 31.555 1.00 52.93  ? 242  TYR A CZ    1 
ATOM   1249 O OH    . TYR C 3 40  ? -27.679 -23.358 30.532 1.00 47.91  ? 242  TYR A OH    1 
ATOM   1250 N N     . ASP C 3 41  ? -28.180 -24.888 36.198 1.00 52.92  ? 243  ASP A N     1 
ATOM   1251 C CA    . ASP C 3 41  ? -29.605 -24.924 36.339 1.00 55.18  ? 243  ASP A CA    1 
ATOM   1252 C C     . ASP C 3 41  ? -29.968 -25.600 37.647 1.00 55.52  ? 243  ASP A C     1 
ATOM   1253 O O     . ASP C 3 41  ? -30.975 -26.300 37.748 1.00 57.55  ? 243  ASP A O     1 
ATOM   1254 C CB    . ASP C 3 41  ? -30.217 -25.648 35.162 1.00 57.02  ? 243  ASP A CB    1 
ATOM   1255 C CG    . ASP C 3 41  ? -31.673 -25.367 35.038 1.00 62.09  ? 243  ASP A CG    1 
ATOM   1256 O OD1   . ASP C 3 41  ? -32.447 -26.353 34.993 1.00 67.26  ? 243  ASP A OD1   1 
ATOM   1257 O OD2   . ASP C 3 41  ? -32.041 -24.160 35.014 1.00 62.30  ? 243  ASP A OD2   1 
ATOM   1258 N N     . GLY C 3 42  ? -29.136 -25.378 38.652 1.00 55.74  ? 244  GLY A N     1 
ATOM   1259 C CA    . GLY C 3 42  ? -29.367 -25.963 39.953 1.00 54.31  ? 244  GLY A CA    1 
ATOM   1260 C C     . GLY C 3 42  ? -29.157 -27.456 39.963 1.00 54.31  ? 244  GLY A C     1 
ATOM   1261 O O     . GLY C 3 42  ? -29.707 -28.164 40.805 1.00 54.93  ? 244  GLY A O     1 
ATOM   1262 N N     . LYS C 3 43  ? -28.365 -27.952 39.024 1.00 59.17  ? 245  LYS A N     1 
ATOM   1263 C CA    . LYS C 3 43  ? -28.075 -29.385 38.963 1.00 65.38  ? 245  LYS A CA    1 
ATOM   1264 C C     . LYS C 3 43  ? -26.543 -29.658 38.974 1.00 64.33  ? 245  LYS A C     1 
ATOM   1265 O O     . LYS C 3 43  ? -25.819 -29.208 38.064 1.00 64.32  ? 245  LYS A O     1 
ATOM   1266 C CB    . LYS C 3 43  ? -28.745 -30.010 37.721 1.00 71.49  ? 245  LYS A CB    1 
ATOM   1267 C CG    . LYS C 3 43  ? -30.252 -30.342 37.872 1.00 79.78  ? 245  LYS A CG    1 
ATOM   1268 C CD    . LYS C 3 43  ? -30.971 -30.267 36.508 1.00 89.99  ? 245  LYS A CD    1 
ATOM   1269 C CE    . LYS C 3 43  ? -32.092 -31.318 36.324 1.00 93.38  ? 245  LYS A CE    1 
ATOM   1270 N NZ    . LYS C 3 43  ? -31.617 -32.641 35.770 1.00 96.48  ? 245  LYS A NZ    1 
ATOM   1271 N N     . VAL C 3 44  ? -26.069 -30.385 40.000 1.00 60.59  ? 246  VAL A N     1 
ATOM   1272 C CA    . VAL C 3 44  ? -24.653 -30.719 40.143 1.00 58.11  ? 246  VAL A CA    1 
ATOM   1273 C C     . VAL C 3 44  ? -24.191 -31.238 38.827 1.00 57.76  ? 246  VAL A C     1 
ATOM   1274 O O     . VAL C 3 44  ? -24.880 -32.017 38.165 1.00 59.54  ? 246  VAL A O     1 
ATOM   1275 C CB    . VAL C 3 44  ? -24.366 -31.851 41.133 1.00 59.52  ? 246  VAL A CB    1 
ATOM   1276 C CG1   . VAL C 3 44  ? -23.040 -31.579 41.854 1.00 59.51  ? 246  VAL A CG1   1 
ATOM   1277 C CG2   . VAL C 3 44  ? -25.526 -32.048 42.095 1.00 62.58  ? 246  VAL A CG2   1 
ATOM   1278 N N     . MET C 3 45  ? -23.009 -30.813 38.448 1.00 56.16  ? 247  MET A N     1 
ATOM   1279 C CA    . MET C 3 45  ? -22.481 -31.232 37.182 1.00 53.76  ? 247  MET A CA    1 
ATOM   1280 C C     . MET C 3 45  ? -20.999 -31.201 37.308 1.00 51.81  ? 247  MET A C     1 
ATOM   1281 O O     . MET C 3 45  ? -20.443 -30.170 37.654 1.00 50.90  ? 247  MET A O     1 
ATOM   1282 C CB    . MET C 3 45  ? -22.934 -30.246 36.135 1.00 52.35  ? 247  MET A CB    1 
ATOM   1283 C CG    . MET C 3 45  ? -22.409 -30.502 34.782 1.00 50.07  ? 247  MET A CG    1 
ATOM   1284 S SD    . MET C 3 45  ? -23.328 -29.341 33.831 1.00 57.82  ? 247  MET A SD    1 
ATOM   1285 C CE    . MET C 3 45  ? -23.221 -30.038 32.270 1.00 54.78  ? 247  MET A CE    1 
ATOM   1286 N N     . LYS C 3 46  ? -20.366 -32.343 37.078 1.00 54.49  ? 248  LYS A N     1 
ATOM   1287 C CA    . LYS C 3 46  ? -18.931 -32.392 37.175 1.00 57.07  ? 248  LYS A CA    1 
ATOM   1288 C C     . LYS C 3 46  ? -18.440 -32.025 35.785 1.00 55.32  ? 248  LYS A C     1 
ATOM   1289 O O     . LYS C 3 46  ? -18.887 -32.598 34.790 1.00 55.34  ? 248  LYS A O     1 
ATOM   1290 C CB    . LYS C 3 46  ? -18.450 -33.787 37.562 1.00 61.57  ? 248  LYS A CB    1 
ATOM   1291 C CG    . LYS C 3 46  ? -16.919 -33.833 37.627 1.00 69.52  ? 248  LYS A CG    1 
ATOM   1292 C CD    . LYS C 3 46  ? -16.402 -35.183 38.014 1.00 78.72  ? 248  LYS A CD    1 
ATOM   1293 C CE    . LYS C 3 46  ? -14.889 -35.279 38.045 1.00 78.21  ? 248  LYS A CE    1 
ATOM   1294 N NZ    . LYS C 3 46  ? -14.444 -36.696 38.403 1.00 87.81  ? 248  LYS A NZ    1 
ATOM   1295 N N     . LEU C 3 47  ? -17.455 -31.131 35.713 1.00 51.14  ? 249  LEU A N     1 
ATOM   1296 C CA    . LEU C 3 47  ? -16.963 -30.712 34.420 1.00 48.56  ? 249  LEU A CA    1 
ATOM   1297 C C     . LEU C 3 47  ? -15.733 -31.347 33.904 1.00 48.95  ? 249  LEU A C     1 
ATOM   1298 O O     . LEU C 3 47  ? -14.863 -31.797 34.638 1.00 48.57  ? 249  LEU A O     1 
ATOM   1299 C CB    . LEU C 3 47  ? -16.740 -29.213 34.378 1.00 46.96  ? 249  LEU A CB    1 
ATOM   1300 C CG    . LEU C 3 47  ? -18.018 -28.434 34.641 1.00 49.96  ? 249  LEU A CG    1 
ATOM   1301 C CD1   . LEU C 3 47  ? -17.637 -27.025 35.050 1.00 46.89  ? 249  LEU A CD1   1 
ATOM   1302 C CD2   . LEU C 3 47  ? -18.958 -28.464 33.432 1.00 48.18  ? 249  LEU A CD2   1 
ATOM   1303 N N     . SER C 3 48  ? -15.649 -31.255 32.594 1.00 48.76  ? 250  SER A N     1 
ATOM   1304 C CA    . SER C 3 48  ? -14.514 -31.705 31.858 1.00 48.66  ? 250  SER A CA    1 
ATOM   1305 C C     . SER C 3 48  ? -13.356 -30.931 32.500 1.00 48.90  ? 250  SER A C     1 
ATOM   1306 O O     . SER C 3 48  ? -13.551 -29.846 33.079 1.00 49.81  ? 250  SER A O     1 
ATOM   1307 C CB    . SER C 3 48  ? -14.705 -31.272 30.413 1.00 48.99  ? 250  SER A CB    1 
ATOM   1308 O OG    . SER C 3 48  ? -13.473 -31.117 29.751 1.00 63.44  ? 250  SER A OG    1 
ATOM   1309 N N     . PRO C 3 49  ? -12.152 -31.508 32.488 1.00 50.81  ? 251  PRO A N     1 
ATOM   1310 C CA    . PRO C 3 49  ? -11.025 -30.795 33.093 1.00 48.32  ? 251  PRO A CA    1 
ATOM   1311 C C     . PRO C 3 49  ? -10.791 -29.394 32.521 1.00 45.88  ? 251  PRO A C     1 
ATOM   1312 O O     . PRO C 3 49  ? -10.700 -28.418 33.268 1.00 48.52  ? 251  PRO A O     1 
ATOM   1313 C CB    . PRO C 3 49  ? -9.853  -31.748 32.853 1.00 49.67  ? 251  PRO A CB    1 
ATOM   1314 C CG    . PRO C 3 49  ? -10.339 -32.654 31.721 1.00 52.52  ? 251  PRO A CG    1 
ATOM   1315 C CD    . PRO C 3 49  ? -11.762 -32.857 32.055 1.00 48.93  ? 251  PRO A CD    1 
ATOM   1316 N N     . LYS C 3 50  ? -10.759 -29.285 31.201 1.00 42.65  ? 252  LYS A N     1 
ATOM   1317 C CA    . LYS C 3 50  ? -10.544 -27.992 30.591 1.00 41.37  ? 252  LYS A CA    1 
ATOM   1318 C C     . LYS C 3 50  ? -11.664 -27.053 30.968 1.00 41.63  ? 252  LYS A C     1 
ATOM   1319 O O     . LYS C 3 50  ? -11.430 -25.929 31.368 1.00 46.67  ? 252  LYS A O     1 
ATOM   1320 C CB    . LYS C 3 50  ? -10.428 -28.125 29.086 1.00 43.04  ? 252  LYS A CB    1 
ATOM   1321 C CG    . LYS C 3 50  ? -9.303  -29.041 28.692 1.00 52.80  ? 252  LYS A CG    1 
ATOM   1322 C CD    . LYS C 3 50  ? -9.081  -29.049 27.194 1.00 61.66  ? 252  LYS A CD    1 
ATOM   1323 C CE    . LYS C 3 50  ? -8.242  -27.855 26.728 1.00 69.87  ? 252  LYS A CE    1 
ATOM   1324 N NZ    . LYS C 3 50  ? -7.979  -27.902 25.249 1.00 72.26  ? 252  LYS A NZ    1 
ATOM   1325 N N     . ALA C 3 51  ? -12.887 -27.533 30.915 1.00 41.36  ? 253  ALA A N     1 
ATOM   1326 C CA    . ALA C 3 51  ? -14.000 -26.681 31.254 1.00 41.13  ? 253  ALA A CA    1 
ATOM   1327 C C     . ALA C 3 51  ? -13.948 -26.241 32.700 1.00 39.78  ? 253  ALA A C     1 
ATOM   1328 O O     . ALA C 3 51  ? -14.167 -25.071 33.024 1.00 37.52  ? 253  ALA A O     1 
ATOM   1329 C CB    . ALA C 3 51  ? -15.290 -27.387 30.976 1.00 44.93  ? 253  ALA A CB    1 
ATOM   1330 N N     . GLU C 3 52  ? -13.643 -27.175 33.578 1.00 38.48  ? 254  GLU A N     1 
ATOM   1331 C CA    . GLU C 3 52  ? -13.610 -26.837 34.982 1.00 41.91  ? 254  GLU A CA    1 
ATOM   1332 C C     . GLU C 3 52  ? -12.670 -25.688 35.289 1.00 41.67  ? 254  GLU A C     1 
ATOM   1333 O O     . GLU C 3 52  ? -13.032 -24.739 35.984 1.00 36.41  ? 254  GLU A O     1 
ATOM   1334 C CB    . GLU C 3 52  ? -13.225 -28.051 35.800 1.00 42.43  ? 254  GLU A CB    1 
ATOM   1335 C CG    . GLU C 3 52  ? -13.398 -27.808 37.271 1.00 47.39  ? 254  GLU A CG    1 
ATOM   1336 C CD    . GLU C 3 52  ? -13.110 -29.039 38.074 1.00 50.51  ? 254  GLU A CD    1 
ATOM   1337 O OE1   . GLU C 3 52  ? -14.036 -29.839 38.297 1.00 55.58  ? 254  GLU A OE1   1 
ATOM   1338 O OE2   . GLU C 3 52  ? -11.949 -29.223 38.474 1.00 51.11  ? 254  GLU A OE2   1 
ATOM   1339 N N     . GLU C 3 53  ? -11.476 -25.782 34.715 1.00 43.78  ? 255  GLU A N     1 
ATOM   1340 C CA    . GLU C 3 53  ? -10.426 -24.798 34.922 1.00 43.27  ? 255  GLU A CA    1 
ATOM   1341 C C     . GLU C 3 53  ? -10.861 -23.419 34.512 1.00 40.21  ? 255  GLU A C     1 
ATOM   1342 O O     . GLU C 3 53  ? -10.600 -22.421 35.185 1.00 33.97  ? 255  GLU A O     1 
ATOM   1343 C CB    . GLU C 3 53  ? -9.163  -25.178 34.153 1.00 43.72  ? 255  GLU A CB    1 
ATOM   1344 C CG    . GLU C 3 53  ? -8.021  -24.239 34.492 1.00 52.50  ? 255  GLU A CG    1 
ATOM   1345 C CD    . GLU C 3 53  ? -6.721  -24.573 33.798 1.00 57.51  ? 255  GLU A CD    1 
ATOM   1346 O OE1   . GLU C 3 53  ? -6.712  -25.291 32.778 1.00 57.29  ? 255  GLU A OE1   1 
ATOM   1347 O OE2   . GLU C 3 53  ? -5.683  -24.085 34.273 1.00 66.14  ? 255  GLU A OE2   1 
ATOM   1348 N N     . VAL C 3 54  ? -11.438 -23.352 33.332 1.00 37.75  ? 256  VAL A N     1 
ATOM   1349 C CA    . VAL C 3 54  ? -11.894 -22.080 32.872 1.00 40.80  ? 256  VAL A CA    1 
ATOM   1350 C C     . VAL C 3 54  ? -12.915 -21.538 33.844 1.00 40.54  ? 256  VAL A C     1 
ATOM   1351 O O     . VAL C 3 54  ? -12.849 -20.386 34.238 1.00 42.50  ? 256  VAL A O     1 
ATOM   1352 C CB    . VAL C 3 54  ? -12.484 -22.203 31.530 1.00 41.22  ? 256  VAL A CB    1 
ATOM   1353 C CG1   . VAL C 3 54  ? -12.839 -20.854 31.042 1.00 42.74  ? 256  VAL A CG1   1 
ATOM   1354 C CG2   . VAL C 3 54  ? -11.483 -22.866 30.608 1.00 42.15  ? 256  VAL A CG2   1 
ATOM   1355 N N     . ALA C 3 55  ? -13.835 -22.389 34.266 1.00 38.23  ? 257  ALA A N     1 
ATOM   1356 C CA    . ALA C 3 55  ? -14.850 -21.958 35.202 1.00 37.76  ? 257  ALA A CA    1 
ATOM   1357 C C     . ALA C 3 55  ? -14.187 -21.441 36.445 1.00 37.34  ? 257  ALA A C     1 
ATOM   1358 O O     . ALA C 3 55  ? -14.730 -20.602 37.148 1.00 38.12  ? 257  ALA A O     1 
ATOM   1359 C CB    . ALA C 3 55  ? -15.743 -23.102 35.549 1.00 37.52  ? 257  ALA A CB    1 
ATOM   1360 N N     . THR C 3 56  ? -13.032 -21.991 36.751 1.00 38.14  ? 258  THR A N     1 
ATOM   1361 C CA    . THR C 3 56  ? -12.333 -21.560 37.941 1.00 43.56  ? 258  THR A CA    1 
ATOM   1362 C C     . THR C 3 56  ? -11.855 -20.127 37.799 1.00 42.46  ? 258  THR A C     1 
ATOM   1363 O O     . THR C 3 56  ? -11.824 -19.378 38.774 1.00 41.68  ? 258  THR A O     1 
ATOM   1364 C CB    . THR C 3 56  ? -11.115 -22.465 38.292 1.00 46.64  ? 258  THR A CB    1 
ATOM   1365 O OG1   . THR C 3 56  ? -10.050 -22.208 37.378 1.00 48.52  ? 258  THR A OG1   1 
ATOM   1366 C CG2   . THR C 3 56  ? -11.487 -23.941 38.226 1.00 46.69  ? 258  THR A CG2   1 
ATOM   1367 N N     . PHE C 3 57  ? -11.472 -19.739 36.591 1.00 38.23  ? 259  PHE A N     1 
ATOM   1368 C CA    . PHE C 3 57  ? -10.997 -18.384 36.402 1.00 39.32  ? 259  PHE A CA    1 
ATOM   1369 C C     . PHE C 3 57  ? -12.091 -17.422 36.776 1.00 41.87  ? 259  PHE A C     1 
ATOM   1370 O O     . PHE C 3 57  ? -11.898 -16.471 37.545 1.00 43.02  ? 259  PHE A O     1 
ATOM   1371 C CB    . PHE C 3 57  ? -10.650 -18.165 34.960 1.00 37.77  ? 259  PHE A CB    1 
ATOM   1372 C CG    . PHE C 3 57  ? -9.553  -19.025 34.478 1.00 40.52  ? 259  PHE A CG    1 
ATOM   1373 C CD1   . PHE C 3 57  ? -8.600  -19.495 35.357 1.00 35.44  ? 259  PHE A CD1   1 
ATOM   1374 C CD2   . PHE C 3 57  ? -9.457  -19.363 33.135 1.00 40.91  ? 259  PHE A CD2   1 
ATOM   1375 C CE1   . PHE C 3 57  ? -7.572  -20.285 34.910 1.00 35.41  ? 259  PHE A CE1   1 
ATOM   1376 C CE2   . PHE C 3 57  ? -8.432  -20.151 32.687 1.00 36.01  ? 259  PHE A CE2   1 
ATOM   1377 C CZ    . PHE C 3 57  ? -7.491  -20.612 33.572 1.00 33.12  ? 259  PHE A CZ    1 
ATOM   1378 N N     . PHE C 3 58  ? -13.238 -17.675 36.174 1.00 40.37  ? 260  PHE A N     1 
ATOM   1379 C CA    . PHE C 3 58  ? -14.399 -16.872 36.395 1.00 43.70  ? 260  PHE A CA    1 
ATOM   1380 C C     . PHE C 3 58  ? -14.744 -16.922 37.868 1.00 44.20  ? 260  PHE A C     1 
ATOM   1381 O O     . PHE C 3 58  ? -14.897 -15.883 38.514 1.00 42.07  ? 260  PHE A O     1 
ATOM   1382 C CB    . PHE C 3 58  ? -15.550 -17.409 35.558 1.00 46.78  ? 260  PHE A CB    1 
ATOM   1383 C CG    . PHE C 3 58  ? -16.721 -16.499 35.519 1.00 47.50  ? 260  PHE A CG    1 
ATOM   1384 C CD1   . PHE C 3 58  ? -16.778 -15.461 34.607 1.00 48.08  ? 260  PHE A CD1   1 
ATOM   1385 C CD2   . PHE C 3 58  ? -17.748 -16.641 36.427 1.00 48.71  ? 260  PHE A CD2   1 
ATOM   1386 C CE1   . PHE C 3 58  ? -17.846 -14.572 34.613 1.00 50.90  ? 260  PHE A CE1   1 
ATOM   1387 C CE2   . PHE C 3 58  ? -18.813 -15.753 36.432 1.00 48.72  ? 260  PHE A CE2   1 
ATOM   1388 C CZ    . PHE C 3 58  ? -18.860 -14.718 35.524 1.00 44.36  ? 260  PHE A CZ    1 
ATOM   1389 N N     . ALA C 3 59  ? -14.888 -18.140 38.380 1.00 46.51  ? 261  ALA A N     1 
ATOM   1390 C CA    . ALA C 3 59  ? -15.218 -18.351 39.780 1.00 48.40  ? 261  ALA A CA    1 
ATOM   1391 C C     . ALA C 3 59  ? -14.296 -17.561 40.709 1.00 50.71  ? 261  ALA A C     1 
ATOM   1392 O O     . ALA C 3 59  ? -14.757 -17.031 41.714 1.00 48.49  ? 261  ALA A O     1 
ATOM   1393 C CB    . ALA C 3 59  ? -15.154 -19.815 40.103 1.00 48.28  ? 261  ALA A CB    1 
ATOM   1394 N N     . LYS C 3 60  ? -13.008 -17.491 40.352 1.00 53.52  ? 262  LYS A N     1 
ATOM   1395 C CA    . LYS C 3 60  ? -11.987 -16.769 41.114 1.00 54.32  ? 262  LYS A CA    1 
ATOM   1396 C C     . LYS C 3 60  ? -12.112 -15.260 41.095 1.00 58.11  ? 262  LYS A C     1 
ATOM   1397 O O     . LYS C 3 60  ? -11.405 -14.584 41.848 1.00 59.77  ? 262  LYS A O     1 
ATOM   1398 C CB    . LYS C 3 60  ? -10.606 -17.088 40.585 1.00 53.28  ? 262  LYS A CB    1 
ATOM   1399 C CG    . LYS C 3 60  ? -10.106 -18.395 41.037 1.00 55.12  ? 262  LYS A CG    1 
ATOM   1400 C CD    . LYS C 3 60  ? -8.658  -18.513 40.745 1.00 54.43  ? 262  LYS A CD    1 
ATOM   1401 C CE    . LYS C 3 60  ? -8.350  -19.912 40.300 1.00 57.86  ? 262  LYS A CE    1 
ATOM   1402 N NZ    . LYS C 3 60  ? -7.026  -20.350 40.844 1.00 64.98  ? 262  LYS A NZ    1 
ATOM   1403 N N     . MET C 3 61  ? -12.844 -14.736 40.110 1.00 61.03  ? 263  MET A N     1 
ATOM   1404 C CA    . MET C 3 61  ? -13.045 -13.291 39.968 1.00 62.15  ? 263  MET A CA    1 
ATOM   1405 C C     . MET C 3 61  ? -14.462 -12.861 40.282 1.00 64.30  ? 263  MET A C     1 
ATOM   1406 O O     . MET C 3 61  ? -14.790 -11.674 40.165 1.00 64.15  ? 263  MET A O     1 
ATOM   1407 C CB    . MET C 3 61  ? -12.778 -12.857 38.539 1.00 60.26  ? 263  MET A CB    1 
ATOM   1408 C CG    . MET C 3 61  ? -11.369 -12.832 38.114 1.00 61.45  ? 263  MET A CG    1 
ATOM   1409 S SD    . MET C 3 61  ? -11.473 -12.348 36.391 1.00 66.67  ? 263  MET A SD    1 
ATOM   1410 C CE    . MET C 3 61  ? -11.699 -10.542 36.549 1.00 67.69  ? 263  MET A CE    1 
ATOM   1411 N N     . LEU C 3 62  ? -15.321 -13.839 40.534 1.00 69.18  ? 264  LEU A N     1 
ATOM   1412 C CA    . LEU C 3 62  ? -16.726 -13.581 40.828 1.00 75.13  ? 264  LEU A CA    1 
ATOM   1413 C C     . LEU C 3 62  ? -17.097 -12.301 41.585 1.00 78.43  ? 264  LEU A C     1 
ATOM   1414 O O     . LEU C 3 62  ? -18.168 -11.734 41.365 1.00 80.40  ? 264  LEU A O     1 
ATOM   1415 C CB    . LEU C 3 62  ? -17.368 -14.776 41.556 1.00 72.86  ? 264  LEU A CB    1 
ATOM   1416 C CG    . LEU C 3 62  ? -18.252 -15.700 40.708 1.00 71.48  ? 264  LEU A CG    1 
ATOM   1417 C CD1   . LEU C 3 62  ? -19.329 -16.318 41.595 1.00 68.58  ? 264  LEU A CD1   1 
ATOM   1418 C CD2   . LEU C 3 62  ? -18.912 -14.910 39.579 1.00 69.57  ? 264  LEU A CD2   1 
ATOM   1419 N N     . ASP C 3 63  ? -16.265 -11.892 42.530 1.00 82.40  ? 265  ASP A N     1 
ATOM   1420 C CA    . ASP C 3 63  ? -16.570 -10.706 43.320 1.00 85.73  ? 265  ASP A CA    1 
ATOM   1421 C C     . ASP C 3 63  ? -16.264 -9.360  42.647 1.00 85.89  ? 265  ASP A C     1 
ATOM   1422 O O     . ASP C 3 63  ? -16.831 -8.339  43.030 1.00 89.09  ? 265  ASP A O     1 
ATOM   1423 C CB    . ASP C 3 63  ? -15.934 -10.813 44.725 1.00 90.49  ? 265  ASP A CB    1 
ATOM   1424 C CG    . ASP C 3 63  ? -16.808 -11.624 45.731 1.00 92.83  ? 265  ASP A CG    1 
ATOM   1425 O OD1   . ASP C 3 63  ? -17.474 -12.622 45.346 1.00 92.97  ? 265  ASP A OD1   1 
ATOM   1426 O OD2   . ASP C 3 63  ? -16.819 -11.256 46.934 1.00 98.37  ? 265  ASP A OD2   1 
ATOM   1427 N N     . HIS C 3 64  ? -15.333 -9.332  41.697 1.00 84.03  ? 266  HIS A N     1 
ATOM   1428 C CA    . HIS C 3 64  ? -15.026 -8.090  40.999 1.00 81.23  ? 266  HIS A CA    1 
ATOM   1429 C C     . HIS C 3 64  ? -16.329 -7.712  40.290 1.00 79.00  ? 266  HIS A C     1 
ATOM   1430 O O     . HIS C 3 64  ? -17.144 -8.588  40.021 1.00 78.04  ? 266  HIS A O     1 
ATOM   1431 C CB    . HIS C 3 64  ? -13.948 -8.364  39.962 1.00 87.36  ? 266  HIS A CB    1 
ATOM   1432 C CG    . HIS C 3 64  ? -12.666 -7.623  40.193 1.00 96.55  ? 266  HIS A CG    1 
ATOM   1433 N ND1   . HIS C 3 64  ? -12.566 -6.250  40.090 1.00 100.82 ? 266  HIS A ND1   1 
ATOM   1434 C CD2   . HIS C 3 64  ? -11.405 -8.070  40.449 1.00 99.85  ? 266  HIS A CD2   1 
ATOM   1435 C CE1   . HIS C 3 64  ? -11.304 -5.884  40.265 1.00 102.16 ? 266  HIS A CE1   1 
ATOM   1436 N NE2   . HIS C 3 64  ? -10.581 -6.971  40.482 1.00 100.81 ? 266  HIS A NE2   1 
ATOM   1437 N N     . GLU C 3 65  ? -16.560 -6.427  40.031 1.00 78.85  ? 267  GLU A N     1 
ATOM   1438 C CA    . GLU C 3 65  ? -17.793 -6.048  39.322 1.00 77.01  ? 267  GLU A CA    1 
ATOM   1439 C C     . GLU C 3 65  ? -17.510 -6.284  37.835 1.00 71.09  ? 267  GLU A C     1 
ATOM   1440 O O     . GLU C 3 65  ? -18.367 -6.130  36.967 1.00 63.52  ? 267  GLU A O     1 
ATOM   1441 C CB    . GLU C 3 65  ? -18.167 -4.593  39.583 1.00 84.60  ? 267  GLU A CB    1 
ATOM   1442 C CG    . GLU C 3 65  ? -19.442 -4.159  38.844 1.00 95.00  ? 267  GLU A CG    1 
ATOM   1443 C CD    . GLU C 3 65  ? -19.809 -2.687  39.079 1.00 102.23 ? 267  GLU A CD    1 
ATOM   1444 O OE1   . GLU C 3 65  ? -19.055 -2.008  39.837 1.00 107.18 ? 267  GLU A OE1   1 
ATOM   1445 O OE2   . GLU C 3 65  ? -20.847 -2.239  38.507 1.00 101.36 ? 267  GLU A OE2   1 
ATOM   1446 N N     . TYR C 3 66  ? -16.239 -6.569  37.584 1.00 71.54  ? 268  TYR A N     1 
ATOM   1447 C CA    . TYR C 3 66  ? -15.694 -6.905  36.272 1.00 72.64  ? 268  TYR A CA    1 
ATOM   1448 C C     . TYR C 3 66  ? -16.712 -7.868  35.624 1.00 68.03  ? 268  TYR A C     1 
ATOM   1449 O O     . TYR C 3 66  ? -17.276 -7.634  34.545 1.00 64.85  ? 268  TYR A O     1 
ATOM   1450 C CB    . TYR C 3 66  ? -14.369 -7.669  36.541 1.00 75.16  ? 268  TYR A CB    1 
ATOM   1451 C CG    . TYR C 3 66  ? -13.204 -7.333  35.646 1.00 83.97  ? 268  TYR A CG    1 
ATOM   1452 C CD1   . TYR C 3 66  ? -11.888 -7.316  36.142 1.00 88.95  ? 268  TYR A CD1   1 
ATOM   1453 C CD2   . TYR C 3 66  ? -13.400 -7.059  34.289 1.00 89.96  ? 268  TYR A CD2   1 
ATOM   1454 C CE1   . TYR C 3 66  ? -10.778 -7.032  35.289 1.00 94.90  ? 268  TYR A CE1   1 
ATOM   1455 C CE2   . TYR C 3 66  ? -12.308 -6.776  33.419 1.00 95.68  ? 268  TYR A CE2   1 
ATOM   1456 C CZ    . TYR C 3 66  ? -10.997 -6.768  33.924 1.00 97.41  ? 268  TYR A CZ    1 
ATOM   1457 O OH    . TYR C 3 66  ? -9.921  -6.544  33.072 1.00 99.83  ? 268  TYR A OH    1 
ATOM   1458 N N     . THR C 3 67  ? -16.956 -8.933  36.378 1.00 63.71  ? 269  THR A N     1 
ATOM   1459 C CA    . THR C 3 67  ? -17.827 -10.043 36.025 1.00 59.12  ? 269  THR A CA    1 
ATOM   1460 C C     . THR C 3 67  ? -19.295 -9.752  35.821 1.00 56.19  ? 269  THR A C     1 
ATOM   1461 O O     . THR C 3 67  ? -20.063 -10.643 35.494 1.00 53.10  ? 269  THR A O     1 
ATOM   1462 C CB    . THR C 3 67  ? -17.705 -11.130 37.093 1.00 58.29  ? 269  THR A CB    1 
ATOM   1463 O OG1   . THR C 3 67  ? -18.237 -10.644 38.330 1.00 61.26  ? 269  THR A OG1   1 
ATOM   1464 C CG2   . THR C 3 67  ? -16.240 -11.477 37.315 1.00 59.14  ? 269  THR A CG2   1 
ATOM   1465 N N     . THR C 3 68  ? -19.681 -8.504  35.974 1.00 58.64  ? 270  THR A N     1 
ATOM   1466 C CA    . THR C 3 68  ? -21.076 -8.155  35.823 1.00 60.48  ? 270  THR A CA    1 
ATOM   1467 C C     . THR C 3 68  ? -21.352 -7.618  34.419 1.00 58.37  ? 270  THR A C     1 
ATOM   1468 O O     . THR C 3 68  ? -22.434 -7.863  33.859 1.00 56.69  ? 270  THR A O     1 
ATOM   1469 C CB    . THR C 3 68  ? -21.478 -7.101  36.877 1.00 64.53  ? 270  THR A CB    1 
ATOM   1470 O OG1   . THR C 3 68  ? -20.977 -5.822  36.471 1.00 71.32  ? 270  THR A OG1   1 
ATOM   1471 C CG2   . THR C 3 68  ? -20.854 -7.442  38.247 1.00 68.56  ? 270  THR A CG2   1 
ATOM   1472 N N     . LYS C 3 69  ? -20.336 -6.979  33.830 1.00 56.44  ? 271  LYS A N     1 
ATOM   1473 C CA    . LYS C 3 69  ? -20.423 -6.348  32.512 1.00 54.23  ? 271  LYS A CA    1 
ATOM   1474 C C     . LYS C 3 69  ? -20.714 -7.212  31.312 1.00 50.98  ? 271  LYS A C     1 
ATOM   1475 O O     . LYS C 3 69  ? -20.325 -8.369  31.263 1.00 55.19  ? 271  LYS A O     1 
ATOM   1476 C CB    . LYS C 3 69  ? -19.177 -5.526  32.256 1.00 59.68  ? 271  LYS A CB    1 
ATOM   1477 C CG    . LYS C 3 69  ? -19.129 -4.248  33.094 1.00 64.50  ? 271  LYS A CG    1 
ATOM   1478 C CD    . LYS C 3 69  ? -17.803 -3.496  32.901 1.00 71.20  ? 271  LYS A CD    1 
ATOM   1479 C CE    . LYS C 3 69  ? -17.737 -2.209  33.728 1.00 73.22  ? 271  LYS A CE    1 
ATOM   1480 N NZ    . LYS C 3 69  ? -17.970 -2.437  35.197 1.00 74.90  ? 271  LYS A NZ    1 
ATOM   1481 N N     . GLU C 3 70  ? -21.388 -6.638  30.326 1.00 48.23  ? 272  GLU A N     1 
ATOM   1482 C CA    . GLU C 3 70  ? -21.741 -7.379  29.123 1.00 49.81  ? 272  GLU A CA    1 
ATOM   1483 C C     . GLU C 3 70  ? -20.613 -7.901  28.265 1.00 48.99  ? 272  GLU A C     1 
ATOM   1484 O O     . GLU C 3 70  ? -20.684 -9.053  27.831 1.00 48.43  ? 272  GLU A O     1 
ATOM   1485 C CB    . GLU C 3 70  ? -22.716 -6.591  28.253 1.00 54.30  ? 272  GLU A CB    1 
ATOM   1486 C CG    . GLU C 3 70  ? -24.150 -6.690  28.715 1.00 61.20  ? 272  GLU A CG    1 
ATOM   1487 C CD    . GLU C 3 70  ? -24.826 -7.955  28.232 1.00 64.80  ? 272  GLU A CD    1 
ATOM   1488 O OE1   . GLU C 3 70  ? -24.605 -8.331  27.057 1.00 67.25  ? 272  GLU A OE1   1 
ATOM   1489 O OE2   . GLU C 3 70  ? -25.577 -8.564  29.017 1.00 63.72  ? 272  GLU A OE2   1 
ATOM   1490 N N     . ILE C 3 71  ? -19.600 -7.084  27.977 1.00 45.91  ? 273  ILE A N     1 
ATOM   1491 C CA    . ILE C 3 71  ? -18.535 -7.604  27.128 1.00 47.61  ? 273  ILE A CA    1 
ATOM   1492 C C     . ILE C 3 71  ? -17.870 -8.812  27.779 1.00 42.34  ? 273  ILE A C     1 
ATOM   1493 O O     . ILE C 3 71  ? -17.774 -9.878  27.182 1.00 41.46  ? 273  ILE A O     1 
ATOM   1494 C CB    . ILE C 3 71  ? -17.453 -6.559  26.745 1.00 51.84  ? 273  ILE A CB    1 
ATOM   1495 C CG1   . ILE C 3 71  ? -18.074 -5.371  26.003 1.00 51.35  ? 273  ILE A CG1   1 
ATOM   1496 C CG2   . ILE C 3 71  ? -16.399 -7.203  25.846 1.00 45.70  ? 273  ILE A CG2   1 
ATOM   1497 C CD1   . ILE C 3 71  ? -18.559 -4.275  26.907 1.00 61.45  ? 273  ILE A CD1   1 
ATOM   1498 N N     . PHE C 3 72  ? -17.511 -8.651  29.037 1.00 37.57  ? 274  PHE A N     1 
ATOM   1499 C CA    . PHE C 3 72  ? -16.859 -9.687  29.803 1.00 38.88  ? 274  PHE A CA    1 
ATOM   1500 C C     . PHE C 3 72  ? -17.515 -11.053 29.768 1.00 43.12  ? 274  PHE A C     1 
ATOM   1501 O O     . PHE C 3 72  ? -16.848 -12.085 29.686 1.00 45.65  ? 274  PHE A O     1 
ATOM   1502 C CB    . PHE C 3 72  ? -16.789 -9.262  31.255 1.00 38.29  ? 274  PHE A CB    1 
ATOM   1503 C CG    . PHE C 3 72  ? -15.855 -10.071 32.046 1.00 44.08  ? 274  PHE A CG    1 
ATOM   1504 C CD1   . PHE C 3 72  ? -14.548 -9.639  32.223 1.00 46.10  ? 274  PHE A CD1   1 
ATOM   1505 C CD2   . PHE C 3 72  ? -16.247 -11.290 32.585 1.00 45.62  ? 274  PHE A CD2   1 
ATOM   1506 C CE1   . PHE C 3 72  ? -13.638 -10.409 32.929 1.00 49.40  ? 274  PHE A CE1   1 
ATOM   1507 C CE2   . PHE C 3 72  ? -15.352 -12.077 33.294 1.00 44.97  ? 274  PHE A CE2   1 
ATOM   1508 C CZ    . PHE C 3 72  ? -14.049 -11.642 33.469 1.00 49.30  ? 274  PHE A CZ    1 
ATOM   1509 N N     . ARG C 3 73  ? -18.818 -11.056 29.977 1.00 44.45  ? 275  ARG A N     1 
ATOM   1510 C CA    . ARG C 3 73  ? -19.559 -12.296 30.044 1.00 41.23  ? 275  ARG A CA    1 
ATOM   1511 C C     . ARG C 3 73  ? -19.696 -12.941 28.699 1.00 39.16  ? 275  ARG A C     1 
ATOM   1512 O O     . ARG C 3 73  ? -19.529 -14.155 28.559 1.00 36.56  ? 275  ARG A O     1 
ATOM   1513 C CB    . ARG C 3 73  ? -20.940 -12.031 30.642 1.00 46.57  ? 275  ARG A CB    1 
ATOM   1514 C CG    . ARG C 3 73  ? -20.943 -11.628 32.118 1.00 51.29  ? 275  ARG A CG    1 
ATOM   1515 C CD    . ARG C 3 73  ? -22.337 -11.185 32.625 1.00 57.07  ? 275  ARG A CD    1 
ATOM   1516 N NE    . ARG C 3 73  ? -23.249 -12.282 32.974 1.00 64.25  ? 275  ARG A NE    1 
ATOM   1517 C CZ    . ARG C 3 73  ? -23.326 -12.865 34.174 1.00 62.90  ? 275  ARG A CZ    1 
ATOM   1518 N NH1   . ARG C 3 73  ? -22.543 -12.473 35.179 1.00 59.59  ? 275  ARG A NH1   1 
ATOM   1519 N NH2   . ARG C 3 73  ? -24.192 -13.854 34.370 1.00 64.29  ? 275  ARG A NH2   1 
ATOM   1520 N N     . LYS C 3 74  ? -20.007 -12.102 27.724 1.00 35.66  ? 276  LYS A N     1 
ATOM   1521 C CA    . LYS C 3 74  ? -20.193 -12.538 26.377 1.00 36.71  ? 276  LYS A CA    1 
ATOM   1522 C C     . LYS C 3 74  ? -18.909 -13.139 25.894 1.00 40.77  ? 276  LYS A C     1 
ATOM   1523 O O     . LYS C 3 74  ? -18.897 -14.217 25.303 1.00 42.57  ? 276  LYS A O     1 
ATOM   1524 C CB    . LYS C 3 74  ? -20.522 -11.354 25.503 1.00 38.61  ? 276  LYS A CB    1 
ATOM   1525 C CG    . LYS C 3 74  ? -20.712 -11.788 24.074 1.00 45.00  ? 276  LYS A CG    1 
ATOM   1526 C CD    . LYS C 3 74  ? -20.957 -10.639 23.149 1.00 53.64  ? 276  LYS A CD    1 
ATOM   1527 C CE    . LYS C 3 74  ? -19.728 -9.749  23.064 1.00 59.39  ? 276  LYS A CE    1 
ATOM   1528 N NZ    . LYS C 3 74  ? -20.131 -8.457  22.404 1.00 71.92  ? 276  LYS A NZ    1 
ATOM   1529 N N     . ASN C 3 75  ? -17.839 -12.378 26.098 1.00 43.63  ? 277  ASN A N     1 
ATOM   1530 C CA    . ASN C 3 75  ? -16.499 -12.770 25.704 1.00 42.51  ? 277  ASN A CA    1 
ATOM   1531 C C     . ASN C 3 75  ? -16.148 -14.012 26.462 1.00 42.33  ? 277  ASN A C     1 
ATOM   1532 O O     . ASN C 3 75  ? -15.721 -15.000 25.887 1.00 41.57  ? 277  ASN A O     1 
ATOM   1533 C CB    . ASN C 3 75  ? -15.484 -11.676 26.046 1.00 44.33  ? 277  ASN A CB    1 
ATOM   1534 C CG    . ASN C 3 75  ? -15.418 -10.564 24.997 1.00 52.24  ? 277  ASN A CG    1 
ATOM   1535 O OD1   . ASN C 3 75  ? -16.014 -10.644 23.920 1.00 55.78  ? 277  ASN A OD1   1 
ATOM   1536 N ND2   . ASN C 3 75  ? -14.660 -9.523  25.312 1.00 52.07  ? 277  ASN A ND2   1 
ATOM   1537 N N     . PHE C 3 76  ? -16.376 -13.974 27.768 1.00 42.16  ? 278  PHE A N     1 
ATOM   1538 C CA    . PHE C 3 76  ? -16.060 -15.114 28.609 1.00 42.46  ? 278  PHE A CA    1 
ATOM   1539 C C     . PHE C 3 76  ? -16.775 -16.395 28.246 1.00 44.36  ? 278  PHE A C     1 
ATOM   1540 O O     . PHE C 3 76  ? -16.147 -17.437 28.051 1.00 46.64  ? 278  PHE A O     1 
ATOM   1541 C CB    . PHE C 3 76  ? -16.349 -14.835 30.070 1.00 42.69  ? 278  PHE A CB    1 
ATOM   1542 C CG    . PHE C 3 76  ? -16.386 -16.080 30.911 1.00 46.28  ? 278  PHE A CG    1 
ATOM   1543 C CD1   . PHE C 3 76  ? -15.236 -16.808 31.158 1.00 46.11  ? 278  PHE A CD1   1 
ATOM   1544 C CD2   . PHE C 3 76  ? -17.570 -16.532 31.446 1.00 50.25  ? 278  PHE A CD2   1 
ATOM   1545 C CE1   . PHE C 3 76  ? -15.266 -17.969 31.936 1.00 47.04  ? 278  PHE A CE1   1 
ATOM   1546 C CE2   . PHE C 3 76  ? -17.601 -17.691 32.219 1.00 50.17  ? 278  PHE A CE2   1 
ATOM   1547 C CZ    . PHE C 3 76  ? -16.440 -18.408 32.463 1.00 44.29  ? 278  PHE A CZ    1 
ATOM   1548 N N     . PHE C 3 77  ? -18.092 -16.359 28.318 1.00 42.02  ? 279  PHE A N     1 
ATOM   1549 C CA    . PHE C 3 77  ? -18.845 -17.546 28.026 1.00 40.92  ? 279  PHE A CA    1 
ATOM   1550 C C     . PHE C 3 77  ? -18.541 -18.160 26.660 1.00 41.03  ? 279  PHE A C     1 
ATOM   1551 O O     . PHE C 3 77  ? -18.477 -19.388 26.520 1.00 38.28  ? 279  PHE A O     1 
ATOM   1552 C CB    . PHE C 3 77  ? -20.318 -17.251 28.142 1.00 42.69  ? 279  PHE A CB    1 
ATOM   1553 C CG    . PHE C 3 77  ? -21.182 -18.468 28.026 1.00 46.08  ? 279  PHE A CG    1 
ATOM   1554 C CD1   . PHE C 3 77  ? -21.308 -19.343 29.094 1.00 47.62  ? 279  PHE A CD1   1 
ATOM   1555 C CD2   . PHE C 3 77  ? -21.864 -18.756 26.849 1.00 45.01  ? 279  PHE A CD2   1 
ATOM   1556 C CE1   . PHE C 3 77  ? -22.098 -20.491 28.994 1.00 50.05  ? 279  PHE A CE1   1 
ATOM   1557 C CE2   . PHE C 3 77  ? -22.658 -19.907 26.746 1.00 46.32  ? 279  PHE A CE2   1 
ATOM   1558 C CZ    . PHE C 3 77  ? -22.772 -20.772 27.816 1.00 46.43  ? 279  PHE A CZ    1 
ATOM   1559 N N     . LYS C 3 78  ? -18.375 -17.321 25.647 1.00 39.36  ? 280  LYS A N     1 
ATOM   1560 C CA    . LYS C 3 78  ? -18.101 -17.845 24.322 1.00 38.92  ? 280  LYS A CA    1 
ATOM   1561 C C     . LYS C 3 78  ? -16.892 -18.741 24.320 1.00 40.41  ? 280  LYS A C     1 
ATOM   1562 O O     . LYS C 3 78  ? -16.945 -19.879 23.880 1.00 41.63  ? 280  LYS A O     1 
ATOM   1563 C CB    . LYS C 3 78  ? -17.866 -16.729 23.320 1.00 41.61  ? 280  LYS A CB    1 
ATOM   1564 C CG    . LYS C 3 78  ? -17.351 -17.269 21.976 1.00 47.69  ? 280  LYS A CG    1 
ATOM   1565 C CD    . LYS C 3 78  ? -17.167 -16.190 20.903 1.00 50.39  ? 280  LYS A CD    1 
ATOM   1566 C CE    . LYS C 3 78  ? -16.774 -16.779 19.532 1.00 53.84  ? 280  LYS A CE    1 
ATOM   1567 N NZ    . LYS C 3 78  ? -16.456 -15.730 18.501 1.00 57.72  ? 280  LYS A NZ    1 
ATOM   1568 N N     . ASP C 3 79  ? -15.803 -18.202 24.840 1.00 42.58  ? 281  ASP A N     1 
ATOM   1569 C CA    . ASP C 3 79  ? -14.535 -18.892 24.895 1.00 42.68  ? 281  ASP A CA    1 
ATOM   1570 C C     . ASP C 3 79  ? -14.575 -20.164 25.692 1.00 40.74  ? 281  ASP A C     1 
ATOM   1571 O O     . ASP C 3 79  ? -13.852 -21.119 25.405 1.00 41.49  ? 281  ASP A O     1 
ATOM   1572 C CB    . ASP C 3 79  ? -13.485 -17.955 25.480 1.00 40.36  ? 281  ASP A CB    1 
ATOM   1573 C CG    . ASP C 3 79  ? -12.800 -17.097 24.422 1.00 43.26  ? 281  ASP A CG    1 
ATOM   1574 O OD1   . ASP C 3 79  ? -12.054 -16.168 24.806 1.00 46.64  ? 281  ASP A OD1   1 
ATOM   1575 O OD2   . ASP C 3 79  ? -12.979 -17.355 23.212 1.00 38.11  ? 281  ASP A OD2   1 
ATOM   1576 N N     . TRP C 3 80  ? -15.402 -20.155 26.720 1.00 40.16  ? 282  TRP A N     1 
ATOM   1577 C CA    . TRP C 3 80  ? -15.526 -21.295 27.603 1.00 43.44  ? 282  TRP A CA    1 
ATOM   1578 C C     . TRP C 3 80  ? -16.134 -22.497 26.892 1.00 42.35  ? 282  TRP A C     1 
ATOM   1579 O O     . TRP C 3 80  ? -15.697 -23.640 27.047 1.00 42.38  ? 282  TRP A O     1 
ATOM   1580 C CB    . TRP C 3 80  ? -16.372 -20.891 28.819 1.00 44.99  ? 282  TRP A CB    1 
ATOM   1581 C CG    . TRP C 3 80  ? -16.498 -21.943 29.898 1.00 45.61  ? 282  TRP A CG    1 
ATOM   1582 C CD1   . TRP C 3 80  ? -15.658 -22.993 30.128 1.00 44.49  ? 282  TRP A CD1   1 
ATOM   1583 C CD2   . TRP C 3 80  ? -17.512 -22.014 30.910 1.00 47.90  ? 282  TRP A CD2   1 
ATOM   1584 N NE1   . TRP C 3 80  ? -16.077 -23.703 31.222 1.00 46.69  ? 282  TRP A NE1   1 
ATOM   1585 C CE2   . TRP C 3 80  ? -17.212 -23.127 31.725 1.00 45.40  ? 282  TRP A CE2   1 
ATOM   1586 C CE3   . TRP C 3 80  ? -18.645 -21.240 31.212 1.00 45.80  ? 282  TRP A CE3   1 
ATOM   1587 C CZ2   . TRP C 3 80  ? -18.002 -23.489 32.831 1.00 42.54  ? 282  TRP A CZ2   1 
ATOM   1588 C CZ3   . TRP C 3 80  ? -19.439 -21.607 32.328 1.00 44.99  ? 282  TRP A CZ3   1 
ATOM   1589 C CH2   . TRP C 3 80  ? -19.103 -22.720 33.117 1.00 38.62  ? 282  TRP A CH2   1 
ATOM   1590 N N     . ARG C 3 81  ? -17.170 -22.233 26.128 1.00 40.55  ? 283  ARG A N     1 
ATOM   1591 C CA    . ARG C 3 81  ? -17.833 -23.296 25.438 1.00 42.06  ? 283  ARG A CA    1 
ATOM   1592 C C     . ARG C 3 81  ? -16.873 -24.026 24.557 1.00 40.44  ? 283  ARG A C     1 
ATOM   1593 O O     . ARG C 3 81  ? -16.959 -25.223 24.417 1.00 40.61  ? 283  ARG A O     1 
ATOM   1594 C CB    . ARG C 3 81  ? -18.939 -22.722 24.612 1.00 43.81  ? 283  ARG A CB    1 
ATOM   1595 C CG    . ARG C 3 81  ? -19.785 -21.735 25.351 1.00 46.48  ? 283  ARG A CG    1 
ATOM   1596 C CD    . ARG C 3 81  ? -21.018 -21.435 24.507 1.00 51.62  ? 283  ARG A CD    1 
ATOM   1597 N NE    . ARG C 3 81  ? -22.120 -22.325 24.858 1.00 53.80  ? 283  ARG A NE    1 
ATOM   1598 C CZ    . ARG C 3 81  ? -22.628 -23.272 24.079 1.00 44.98  ? 283  ARG A CZ    1 
ATOM   1599 N NH1   . ARG C 3 81  ? -22.168 -23.491 22.856 1.00 33.46  ? 283  ARG A NH1   1 
ATOM   1600 N NH2   . ARG C 3 81  ? -23.567 -24.045 24.578 1.00 43.75  ? 283  ARG A NH2   1 
ATOM   1601 N N     . LYS C 3 82  ? -15.959 -23.275 23.960 1.00 46.18  ? 284  LYS A N     1 
ATOM   1602 C CA    . LYS C 3 82  ? -14.926 -23.807 23.065 1.00 49.78  ? 284  LYS A CA    1 
ATOM   1603 C C     . LYS C 3 82  ? -14.166 -24.866 23.806 1.00 52.30  ? 284  LYS A C     1 
ATOM   1604 O O     . LYS C 3 82  ? -13.741 -25.853 23.240 1.00 55.56  ? 284  LYS A O     1 
ATOM   1605 C CB    . LYS C 3 82  ? -13.928 -22.715 22.664 1.00 47.12  ? 284  LYS A CB    1 
ATOM   1606 C CG    . LYS C 3 82  ? -14.495 -21.677 21.710 1.00 54.69  ? 284  LYS A CG    1 
ATOM   1607 C CD    . LYS C 3 82  ? -13.548 -20.507 21.484 1.00 57.96  ? 284  LYS A CD    1 
ATOM   1608 C CE    . LYS C 3 82  ? -13.993 -19.647 20.294 1.00 63.97  ? 284  LYS A CE    1 
ATOM   1609 N NZ    . LYS C 3 82  ? -13.101 -18.441 20.075 1.00 70.24  ? 284  LYS A NZ    1 
ATOM   1610 N N     . GLU C 3 83  ? -13.988 -24.629 25.093 1.00 52.13  ? 285  GLU A N     1 
ATOM   1611 C CA    . GLU C 3 83  ? -13.261 -25.553 25.918 1.00 52.93  ? 285  GLU A CA    1 
ATOM   1612 C C     . GLU C 3 83  ? -14.151 -26.641 26.451 1.00 52.14  ? 285  GLU A C     1 
ATOM   1613 O O     . GLU C 3 83  ? -13.724 -27.445 27.259 1.00 56.83  ? 285  GLU A O     1 
ATOM   1614 C CB    . GLU C 3 83  ? -12.601 -24.780 27.053 1.00 56.58  ? 285  GLU A CB    1 
ATOM   1615 C CG    . GLU C 3 83  ? -11.714 -23.632 26.539 1.00 60.59  ? 285  GLU A CG    1 
ATOM   1616 C CD    . GLU C 3 83  ? -10.647 -24.089 25.524 1.00 61.58  ? 285  GLU A CD    1 
ATOM   1617 O OE1   . GLU C 3 83  ? -9.941  -25.086 25.788 1.00 61.78  ? 285  GLU A OE1   1 
ATOM   1618 O OE2   . GLU C 3 83  ? -10.500 -23.440 24.462 1.00 65.29  ? 285  GLU A OE2   1 
ATOM   1619 N N     . MET C 3 84  ? -15.406 -26.644 26.042 1.00 49.91  ? 286  MET A N     1 
ATOM   1620 C CA    . MET C 3 84  ? -16.312 -27.653 26.540 1.00 44.43  ? 286  MET A CA    1 
ATOM   1621 C C     . MET C 3 84  ? -16.401 -28.831 25.629 1.00 42.77  ? 286  MET A C     1 
ATOM   1622 O O     . MET C 3 84  ? -16.157 -28.719 24.443 1.00 42.51  ? 286  MET A O     1 
ATOM   1623 C CB    . MET C 3 84  ? -17.699 -27.066 26.693 1.00 42.94  ? 286  MET A CB    1 
ATOM   1624 C CG    . MET C 3 84  ? -17.792 -25.947 27.693 1.00 40.59  ? 286  MET A CG    1 
ATOM   1625 S SD    . MET C 3 84  ? -19.520 -25.560 27.858 1.00 37.41  ? 286  MET A SD    1 
ATOM   1626 C CE    . MET C 3 84  ? -19.422 -24.105 28.838 1.00 35.39  ? 286  MET A CE    1 
ATOM   1627 N N     . THR C 3 85  ? -16.750 -29.974 26.188 1.00 41.05  ? 287  THR A N     1 
ATOM   1628 C CA    . THR C 3 85  ? -16.933 -31.143 25.357 1.00 42.66  ? 287  THR A CA    1 
ATOM   1629 C C     . THR C 3 85  ? -18.260 -30.873 24.655 1.00 44.80  ? 287  THR A C     1 
ATOM   1630 O O     . THR C 3 85  ? -19.035 -29.989 25.059 1.00 42.78  ? 287  THR A O     1 
ATOM   1631 C CB    . THR C 3 85  ? -17.039 -32.443 26.175 1.00 41.76  ? 287  THR A CB    1 
ATOM   1632 O OG1   . THR C 3 85  ? -18.240 -32.440 26.957 1.00 36.96  ? 287  THR A OG1   1 
ATOM   1633 C CG2   . THR C 3 85  ? -15.879 -32.553 27.112 1.00 36.76  ? 287  THR A CG2   1 
ATOM   1634 N N     . ASN C 3 86  ? -18.496 -31.594 23.580 1.00 45.77  ? 288  ASN A N     1 
ATOM   1635 C CA    . ASN C 3 86  ? -19.709 -31.431 22.817 1.00 47.43  ? 288  ASN A CA    1 
ATOM   1636 C C     . ASN C 3 86  ? -20.949 -31.459 23.660 1.00 47.09  ? 288  ASN A C     1 
ATOM   1637 O O     . ASN C 3 86  ? -21.735 -30.513 23.645 1.00 49.36  ? 288  ASN A O     1 
ATOM   1638 C CB    . ASN C 3 86  ? -19.783 -32.490 21.737 1.00 51.05  ? 288  ASN A CB    1 
ATOM   1639 C CG    . ASN C 3 86  ? -19.218 -31.994 20.410 1.00 62.06  ? 288  ASN A CG    1 
ATOM   1640 O OD1   . ASN C 3 86  ? -18.639 -30.888 20.314 1.00 65.35  ? 288  ASN A OD1   1 
ATOM   1641 N ND2   . ASN C 3 86  ? -19.412 -32.783 19.364 1.00 64.36  ? 288  ASN A ND2   1 
ATOM   1642 N N     . GLU C 3 87  ? -21.072 -32.494 24.476 1.00 46.68  ? 289  GLU A N     1 
ATOM   1643 C CA    . GLU C 3 87  ? -22.217 -32.634 25.330 1.00 43.41  ? 289  GLU A CA    1 
ATOM   1644 C C     . GLU C 3 87  ? -22.361 -31.513 26.332 1.00 43.55  ? 289  GLU A C     1 
ATOM   1645 O O     . GLU C 3 87  ? -23.463 -31.141 26.699 1.00 41.52  ? 289  GLU A O     1 
ATOM   1646 C CB    . GLU C 3 87  ? -22.207 -33.985 26.018 1.00 43.97  ? 289  GLU A CB    1 
ATOM   1647 C CG    . GLU C 3 87  ? -23.556 -34.328 26.648 1.00 54.92  ? 289  GLU A CG    1 
ATOM   1648 C CD    . GLU C 3 87  ? -24.765 -34.159 25.684 1.00 58.48  ? 289  GLU A CD    1 
ATOM   1649 O OE1   . GLU C 3 87  ? -24.535 -33.831 24.495 1.00 61.09  ? 289  GLU A OE1   1 
ATOM   1650 O OE2   . GLU C 3 87  ? -25.945 -34.356 26.111 1.00 58.89  ? 289  GLU A OE2   1 
ATOM   1651 N N     . GLU C 3 88  ? -21.250 -30.962 26.779 1.00 44.42  ? 290  GLU A N     1 
ATOM   1652 C CA    . GLU C 3 88  ? -21.315 -29.871 27.724 1.00 41.76  ? 290  GLU A CA    1 
ATOM   1653 C C     . GLU C 3 88  ? -21.861 -28.696 26.957 1.00 40.91  ? 290  GLU A C     1 
ATOM   1654 O O     . GLU C 3 88  ? -22.711 -27.969 27.453 1.00 39.88  ? 290  GLU A O     1 
ATOM   1655 C CB    . GLU C 3 88  ? -19.927 -29.573 28.283 1.00 45.52  ? 290  GLU A CB    1 
ATOM   1656 C CG    . GLU C 3 88  ? -19.342 -30.768 29.033 1.00 48.89  ? 290  GLU A CG    1 
ATOM   1657 C CD    . GLU C 3 88  ? -17.926 -30.569 29.531 1.00 47.37  ? 290  GLU A CD    1 
ATOM   1658 O OE1   . GLU C 3 88  ? -17.681 -30.886 30.712 1.00 45.10  ? 290  GLU A OE1   1 
ATOM   1659 O OE2   . GLU C 3 88  ? -17.057 -30.117 28.748 1.00 49.87  ? 290  GLU A OE2   1 
ATOM   1660 N N     . LYS C 3 89  ? -21.386 -28.524 25.729 1.00 42.52  ? 291  LYS A N     1 
ATOM   1661 C CA    . LYS C 3 89  ? -21.865 -27.434 24.896 1.00 46.02  ? 291  LYS A CA    1 
ATOM   1662 C C     . LYS C 3 89  ? -23.366 -27.522 24.735 1.00 50.58  ? 291  LYS A C     1 
ATOM   1663 O O     . LYS C 3 89  ? -24.054 -26.518 24.621 1.00 54.39  ? 291  LYS A O     1 
ATOM   1664 C CB    . LYS C 3 89  ? -21.208 -27.453 23.531 1.00 42.53  ? 291  LYS A CB    1 
ATOM   1665 C CG    . LYS C 3 89  ? -19.809 -26.970 23.571 1.00 43.40  ? 291  LYS A CG    1 
ATOM   1666 C CD    . LYS C 3 89  ? -19.076 -27.391 22.338 1.00 48.24  ? 291  LYS A CD    1 
ATOM   1667 C CE    . LYS C 3 89  ? -17.599 -27.202 22.576 1.00 54.04  ? 291  LYS A CE    1 
ATOM   1668 N NZ    . LYS C 3 89  ? -16.770 -27.543 21.405 1.00 55.49  ? 291  LYS A NZ    1 
ATOM   1669 N N     . ASN C 3 90  ? -23.892 -28.728 24.766 1.00 52.67  ? 292  ASN A N     1 
ATOM   1670 C CA    . ASN C 3 90  ? -25.326 -28.887 24.619 1.00 54.42  ? 292  ASN A CA    1 
ATOM   1671 C C     . ASN C 3 90  ? -26.144 -28.415 25.825 1.00 51.52  ? 292  ASN A C     1 
ATOM   1672 O O     . ASN C 3 90  ? -27.167 -27.769 25.660 1.00 55.25  ? 292  ASN A O     1 
ATOM   1673 C CB    . ASN C 3 90  ? -25.661 -30.336 24.245 1.00 58.64  ? 292  ASN A CB    1 
ATOM   1674 C CG    . ASN C 3 90  ? -25.117 -30.716 22.870 1.00 65.30  ? 292  ASN A CG    1 
ATOM   1675 O OD1   . ASN C 3 90  ? -24.658 -29.848 22.104 1.00 71.63  ? 292  ASN A OD1   1 
ATOM   1676 N ND2   . ASN C 3 90  ? -25.163 -32.010 22.545 1.00 65.60  ? 292  ASN A ND2   1 
ATOM   1677 N N     . ILE C 3 91  ? -25.618 -28.610 27.026 1.00 48.88  ? 293  ILE A N     1 
ATOM   1678 C CA    . ILE C 3 91  ? -26.334 -28.253 28.242 1.00 45.51  ? 293  ILE A CA    1 
ATOM   1679 C C     . ILE C 3 91  ? -26.167 -26.867 28.773 1.00 45.78  ? 293  ILE A C     1 
ATOM   1680 O O     . ILE C 3 91  ? -27.095 -26.299 29.304 1.00 50.11  ? 293  ILE A O     1 
ATOM   1681 C CB    . ILE C 3 91  ? -25.987 -29.230 29.348 1.00 47.33  ? 293  ILE A CB    1 
ATOM   1682 C CG1   . ILE C 3 91  ? -26.526 -30.596 28.950 1.00 51.30  ? 293  ILE A CG1   1 
ATOM   1683 C CG2   . ILE C 3 91  ? -26.507 -28.751 30.708 1.00 40.84  ? 293  ILE A CG2   1 
ATOM   1684 C CD1   . ILE C 3 91  ? -26.029 -31.702 29.810 1.00 62.38  ? 293  ILE A CD1   1 
ATOM   1685 N N     . ILE C 3 92  ? -24.942 -26.391 28.816 1.00 43.42  ? 294  ILE A N     1 
ATOM   1686 C CA    . ILE C 3 92  ? -24.750 -25.055 29.313 1.00 43.85  ? 294  ILE A CA    1 
ATOM   1687 C C     . ILE C 3 92  ? -24.958 -24.130 28.129 1.00 42.91  ? 294  ILE A C     1 
ATOM   1688 O O     . ILE C 3 92  ? -24.045 -23.920 27.323 1.00 41.90  ? 294  ILE A O     1 
ATOM   1689 C CB    . ILE C 3 92  ? -23.363 -24.900 29.950 1.00 44.80  ? 294  ILE A CB    1 
ATOM   1690 C CG1   . ILE C 3 92  ? -23.232 -25.915 31.082 1.00 44.66  ? 294  ILE A CG1   1 
ATOM   1691 C CG2   . ILE C 3 92  ? -23.205 -23.502 30.563 1.00 46.38  ? 294  ILE A CG2   1 
ATOM   1692 C CD1   . ILE C 3 92  ? -21.880 -26.514 31.200 1.00 39.78  ? 294  ILE A CD1   1 
ATOM   1693 N N     . THR C 3 93  ? -26.183 -23.641 27.990 1.00 37.80  ? 295  THR A N     1 
ATOM   1694 C CA    . THR C 3 93  ? -26.486 -22.766 26.885 1.00 38.36  ? 295  THR A CA    1 
ATOM   1695 C C     . THR C 3 93  ? -26.179 -21.335 27.249 1.00 37.36  ? 295  THR A C     1 
ATOM   1696 O O     . THR C 3 93  ? -25.971 -20.509 26.385 1.00 37.23  ? 295  THR A O     1 
ATOM   1697 C CB    . THR C 3 93  ? -27.947 -22.865 26.469 1.00 36.98  ? 295  THR A CB    1 
ATOM   1698 O OG1   . THR C 3 93  ? -28.761 -22.574 27.596 1.00 36.68  ? 295  THR A OG1   1 
ATOM   1699 C CG2   . THR C 3 93  ? -28.284 -24.248 25.973 1.00 39.68  ? 295  THR A CG2   1 
ATOM   1700 N N     . ASN C 3 94  ? -26.118 -21.036 28.534 1.00 36.20  ? 296  ASN A N     1 
ATOM   1701 C CA    . ASN C 3 94  ? -25.854 -19.679 28.940 1.00 32.95  ? 296  ASN A CA    1 
ATOM   1702 C C     . ASN C 3 94  ? -25.114 -19.691 30.236 1.00 33.73  ? 296  ASN A C     1 
ATOM   1703 O O     . ASN C 3 94  ? -25.073 -20.692 30.943 1.00 28.34  ? 296  ASN A O     1 
ATOM   1704 C CB    . ASN C 3 94  ? -27.153 -18.882 29.086 1.00 35.74  ? 296  ASN A CB    1 
ATOM   1705 C CG    . ASN C 3 94  ? -28.014 -19.356 30.251 1.00 41.77  ? 296  ASN A CG    1 
ATOM   1706 O OD1   . ASN C 3 94  ? -27.925 -18.821 31.356 1.00 44.99  ? 296  ASN A OD1   1 
ATOM   1707 N ND2   . ASN C 3 94  ? -28.885 -20.338 29.999 1.00 34.05  ? 296  ASN A ND2   1 
ATOM   1708 N N     . LEU C 3 95  ? -24.461 -18.577 30.505 1.00 37.82  ? 297  LEU A N     1 
ATOM   1709 C CA    . LEU C 3 95  ? -23.674 -18.394 31.698 1.00 41.25  ? 297  LEU A CA    1 
ATOM   1710 C C     . LEU C 3 95  ? -24.524 -18.108 32.887 1.00 43.08  ? 297  LEU A C     1 
ATOM   1711 O O     . LEU C 3 95  ? -24.164 -18.445 34.009 1.00 44.56  ? 297  LEU A O     1 
ATOM   1712 C CB    . LEU C 3 95  ? -22.720 -17.223 31.483 1.00 44.47  ? 297  LEU A CB    1 
ATOM   1713 C CG    . LEU C 3 95  ? -21.934 -16.572 32.630 1.00 44.68  ? 297  LEU A CG    1 
ATOM   1714 C CD1   . LEU C 3 95  ? -21.105 -17.587 33.380 1.00 44.30  ? 297  LEU A CD1   1 
ATOM   1715 C CD2   . LEU C 3 95  ? -21.043 -15.507 32.068 1.00 41.29  ? 297  LEU A CD2   1 
ATOM   1716 N N     . SER C 3 96  ? -25.654 -17.478 32.636 1.00 46.11  ? 298  SER A N     1 
ATOM   1717 C CA    . SER C 3 96  ? -26.549 -17.082 33.704 1.00 47.99  ? 298  SER A CA    1 
ATOM   1718 C C     . SER C 3 96  ? -27.167 -18.192 34.547 1.00 47.94  ? 298  SER A C     1 
ATOM   1719 O O     . SER C 3 96  ? -27.716 -17.924 35.620 1.00 51.31  ? 298  SER A O     1 
ATOM   1720 C CB    . SER C 3 96  ? -27.605 -16.130 33.159 1.00 47.43  ? 298  SER A CB    1 
ATOM   1721 O OG    . SER C 3 96  ? -26.985 -15.043 32.490 1.00 44.19  ? 298  SER A OG    1 
ATOM   1722 N N     . LYS C 3 97  ? -27.088 -19.433 34.081 1.00 46.90  ? 299  LYS A N     1 
ATOM   1723 C CA    . LYS C 3 97  ? -27.629 -20.543 34.859 1.00 49.06  ? 299  LYS A CA    1 
ATOM   1724 C C     . LYS C 3 97  ? -26.553 -21.315 35.614 1.00 51.41  ? 299  LYS A C     1 
ATOM   1725 O O     . LYS C 3 97  ? -26.858 -22.311 36.246 1.00 50.22  ? 299  LYS A O     1 
ATOM   1726 C CB    . LYS C 3 97  ? -28.431 -21.498 33.974 1.00 49.68  ? 299  LYS A CB    1 
ATOM   1727 C CG    . LYS C 3 97  ? -29.696 -20.876 33.496 1.00 52.44  ? 299  LYS A CG    1 
ATOM   1728 C CD    . LYS C 3 97  ? -30.575 -21.807 32.756 1.00 53.90  ? 299  LYS A CD    1 
ATOM   1729 C CE    . LYS C 3 97  ? -31.738 -20.990 32.270 1.00 53.79  ? 299  LYS A CE    1 
ATOM   1730 N NZ    . LYS C 3 97  ? -32.628 -21.742 31.374 1.00 51.52  ? 299  LYS A NZ    1 
ATOM   1731 N N     . CYS C 3 98  ? -25.307 -20.839 35.544 1.00 51.43  ? 300  CYS A N     1 
ATOM   1732 C CA    . CYS C 3 98  ? -24.176 -21.488 36.191 1.00 49.94  ? 300  CYS A CA    1 
ATOM   1733 C C     . CYS C 3 98  ? -23.962 -21.015 37.613 1.00 52.13  ? 300  CYS A C     1 
ATOM   1734 O O     . CYS C 3 98  ? -24.046 -19.820 37.876 1.00 52.22  ? 300  CYS A O     1 
ATOM   1735 C CB    . CYS C 3 98  ? -22.917 -21.236 35.370 1.00 45.02  ? 300  CYS A CB    1 
ATOM   1736 S SG    . CYS C 3 98  ? -22.965 -21.902 33.698 1.00 44.68  ? 300  CYS A SG    1 
ATOM   1737 N N     . ASP C 3 99  ? -23.625 -21.945 38.505 1.00 53.49  ? 301  ASP A N     1 
ATOM   1738 C CA    . ASP C 3 99  ? -23.377 -21.619 39.905 1.00 56.15  ? 301  ASP A CA    1 
ATOM   1739 C C     . ASP C 3 99  ? -21.908 -21.827 40.260 1.00 58.23  ? 301  ASP A C     1 
ATOM   1740 O O     . ASP C 3 99  ? -21.461 -22.976 40.388 1.00 60.56  ? 301  ASP A O     1 
ATOM   1741 C CB    . ASP C 3 99  ? -24.241 -22.491 40.807 1.00 59.60  ? 301  ASP A CB    1 
ATOM   1742 C CG    . ASP C 3 99  ? -24.388 -21.911 42.198 1.00 61.55  ? 301  ASP A CG    1 
ATOM   1743 O OD1   . ASP C 3 99  ? -23.918 -20.775 42.410 1.00 62.13  ? 301  ASP A OD1   1 
ATOM   1744 O OD2   . ASP C 3 99  ? -24.974 -22.582 43.074 1.00 62.89  ? 301  ASP A OD2   1 
ATOM   1745 N N     . PHE C 3 100 ? -21.164 -20.725 40.382 1.00 55.21  ? 302  PHE A N     1 
ATOM   1746 C CA    . PHE C 3 100 ? -19.734 -20.770 40.693 1.00 53.68  ? 302  PHE A CA    1 
ATOM   1747 C C     . PHE C 3 100 ? -19.443 -20.485 42.134 1.00 55.46  ? 302  PHE A C     1 
ATOM   1748 O O     . PHE C 3 100 ? -18.290 -20.301 42.517 1.00 55.81  ? 302  PHE A O     1 
ATOM   1749 C CB    . PHE C 3 100 ? -18.993 -19.728 39.889 1.00 51.07  ? 302  PHE A CB    1 
ATOM   1750 C CG    . PHE C 3 100 ? -19.067 -19.938 38.422 1.00 53.42  ? 302  PHE A CG    1 
ATOM   1751 C CD1   . PHE C 3 100 ? -18.272 -20.904 37.802 1.00 54.54  ? 302  PHE A CD1   1 
ATOM   1752 C CD2   . PHE C 3 100 ? -19.903 -19.148 37.643 1.00 47.75  ? 302  PHE A CD2   1 
ATOM   1753 C CE1   . PHE C 3 100 ? -18.306 -21.075 36.424 1.00 50.61  ? 302  PHE A CE1   1 
ATOM   1754 C CE2   . PHE C 3 100 ? -19.947 -19.307 36.271 1.00 45.42  ? 302  PHE A CE2   1 
ATOM   1755 C CZ    . PHE C 3 100 ? -19.145 -20.273 35.657 1.00 49.35  ? 302  PHE A CZ    1 
ATOM   1756 N N     . THR C 3 101 ? -20.496 -20.349 42.915 1.00 58.79  ? 303  THR A N     1 
ATOM   1757 C CA    . THR C 3 101 ? -20.347 -20.047 44.322 1.00 61.59  ? 303  THR A CA    1 
ATOM   1758 C C     . THR C 3 101 ? -19.467 -20.994 45.145 1.00 58.85  ? 303  THR A C     1 
ATOM   1759 O O     . THR C 3 101 ? -18.530 -20.529 45.806 1.00 58.03  ? 303  THR A O     1 
ATOM   1760 C CB    . THR C 3 101 ? -21.730 -19.853 44.983 1.00 66.40  ? 303  THR A CB    1 
ATOM   1761 O OG1   . THR C 3 101 ? -22.538 -21.024 44.783 1.00 76.71  ? 303  THR A OG1   1 
ATOM   1762 C CG2   . THR C 3 101 ? -22.449 -18.632 44.363 1.00 67.64  ? 303  THR A CG2   1 
ATOM   1763 N N     . GLN C 3 102 ? -19.801 -22.287 45.179 1.00 58.87  ? 304  GLN A N     1 
ATOM   1764 C CA    . GLN C 3 102 ? -18.997 -23.260 45.932 1.00 60.55  ? 304  GLN A CA    1 
ATOM   1765 C C     . GLN C 3 102 ? -17.577 -23.072 45.449 1.00 61.12  ? 304  GLN A C     1 
ATOM   1766 O O     . GLN C 3 102 ? -16.608 -23.206 46.212 1.00 61.52  ? 304  GLN A O     1 
ATOM   1767 C CB    . GLN C 3 102 ? -19.404 -24.704 45.639 1.00 65.40  ? 304  GLN A CB    1 
ATOM   1768 C CG    . GLN C 3 102 ? -20.764 -25.110 46.163 1.00 73.14  ? 304  GLN A CG    1 
ATOM   1769 C CD    . GLN C 3 102 ? -20.755 -26.474 46.859 1.00 73.08  ? 304  GLN A CD    1 
ATOM   1770 O OE1   . GLN C 3 102 ? -19.946 -27.337 46.549 1.00 71.01  ? 304  GLN A OE1   1 
ATOM   1771 N NE2   . GLN C 3 102 ? -21.656 -26.653 47.823 1.00 79.26  ? 304  GLN A NE2   1 
ATOM   1772 N N     . MET C 3 103 ? -17.467 -22.795 44.154 1.00 58.83  ? 305  MET A N     1 
ATOM   1773 C CA    . MET C 3 103 ? -16.188 -22.547 43.561 1.00 58.89  ? 305  MET A CA    1 
ATOM   1774 C C     . MET C 3 103 ? -15.634 -21.270 44.145 1.00 58.56  ? 305  MET A C     1 
ATOM   1775 O O     . MET C 3 103 ? -14.497 -21.254 44.604 1.00 59.55  ? 305  MET A O     1 
ATOM   1776 C CB    . MET C 3 103 ? -16.312 -22.450 42.053 1.00 60.34  ? 305  MET A CB    1 
ATOM   1777 C CG    . MET C 3 103 ? -16.290 -23.811 41.404 1.00 61.00  ? 305  MET A CG    1 
ATOM   1778 S SD    . MET C 3 103 ? -16.484 -23.770 39.619 1.00 62.02  ? 305  MET A SD    1 
ATOM   1779 C CE    . MET C 3 103 ? -14.851 -23.366 39.039 1.00 61.75  ? 305  MET A CE    1 
ATOM   1780 N N     . SER C 3 104 ? -16.442 -20.219 44.164 1.00 58.31  ? 306  SER A N     1 
ATOM   1781 C CA    . SER C 3 104 ? -15.999 -18.951 44.716 1.00 59.64  ? 306  SER A CA    1 
ATOM   1782 C C     . SER C 3 104 ? -15.602 -19.127 46.196 1.00 61.62  ? 306  SER A C     1 
ATOM   1783 O O     . SER C 3 104 ? -14.487 -18.768 46.611 1.00 63.88  ? 306  SER A O     1 
ATOM   1784 C CB    . SER C 3 104 ? -17.099 -17.901 44.548 1.00 58.94  ? 306  SER A CB    1 
ATOM   1785 O OG    . SER C 3 104 ? -16.740 -16.636 45.099 1.00 60.49  ? 306  SER A OG    1 
ATOM   1786 N N     . GLN C 3 105 ? -16.468 -19.758 46.978 1.00 60.73  ? 307  GLN A N     1 
ATOM   1787 C CA    . GLN C 3 105 ? -16.165 -19.947 48.385 1.00 61.03  ? 307  GLN A CA    1 
ATOM   1788 C C     . GLN C 3 105 ? -14.863 -20.667 48.625 1.00 58.20  ? 307  GLN A C     1 
ATOM   1789 O O     . GLN C 3 105 ? -14.052 -20.251 49.452 1.00 55.39  ? 307  GLN A O     1 
ATOM   1790 C CB    . GLN C 3 105 ? -17.293 -20.699 49.072 1.00 67.00  ? 307  GLN A CB    1 
ATOM   1791 C CG    . GLN C 3 105 ? -18.568 -19.867 49.205 1.00 78.19  ? 307  GLN A CG    1 
ATOM   1792 C CD    . GLN C 3 105 ? -19.594 -20.484 50.162 1.00 84.91  ? 307  GLN A CD    1 
ATOM   1793 O OE1   . GLN C 3 105 ? -20.675 -19.907 50.400 1.00 85.19  ? 307  GLN A OE1   1 
ATOM   1794 N NE2   . GLN C 3 105 ? -19.257 -21.656 50.729 1.00 90.45  ? 307  GLN A NE2   1 
ATOM   1795 N N     . TYR C 3 106 ? -14.669 -21.741 47.875 1.00 58.55  ? 308  TYR A N     1 
ATOM   1796 C CA    . TYR C 3 106 ? -13.486 -22.561 48.007 1.00 60.61  ? 308  TYR A CA    1 
ATOM   1797 C C     . TYR C 3 106 ? -12.200 -21.786 47.984 1.00 63.02  ? 308  TYR A C     1 
ATOM   1798 O O     . TYR C 3 106 ? -11.355 -21.932 48.863 1.00 64.92  ? 308  TYR A O     1 
ATOM   1799 C CB    . TYR C 3 106 ? -13.408 -23.573 46.886 1.00 62.59  ? 308  TYR A CB    1 
ATOM   1800 C CG    . TYR C 3 106 ? -12.108 -24.336 46.914 1.00 65.22  ? 308  TYR A CG    1 
ATOM   1801 C CD1   . TYR C 3 106 ? -11.723 -25.047 48.055 1.00 67.46  ? 308  TYR A CD1   1 
ATOM   1802 C CD2   . TYR C 3 106 ? -11.275 -24.377 45.798 1.00 66.44  ? 308  TYR A CD2   1 
ATOM   1803 C CE1   . TYR C 3 106 ? -10.537 -25.792 48.084 1.00 70.04  ? 308  TYR A CE1   1 
ATOM   1804 C CE2   . TYR C 3 106 ? -10.086 -25.115 45.812 1.00 68.88  ? 308  TYR A CE2   1 
ATOM   1805 C CZ    . TYR C 3 106 ? -9.728  -25.829 46.955 1.00 70.87  ? 308  TYR A CZ    1 
ATOM   1806 O OH    . TYR C 3 106 ? -8.597  -26.621 46.936 1.00 75.29  ? 308  TYR A OH    1 
ATOM   1807 N N     . PHE C 3 107 ? -11.994 -21.097 46.873 1.00 65.02  ? 309  PHE A N     1 
ATOM   1808 C CA    . PHE C 3 107 ? -10.795 -20.310 46.668 1.00 64.87  ? 309  PHE A CA    1 
ATOM   1809 C C     . PHE C 3 107 ? -10.559 -19.245 47.733 1.00 66.46  ? 309  PHE A C     1 
ATOM   1810 O O     . PHE C 3 107 ? -9.425  -19.068 48.195 1.00 66.57  ? 309  PHE A O     1 
ATOM   1811 C CB    . PHE C 3 107 ? -10.822 -19.735 45.257 1.00 62.74  ? 309  PHE A CB    1 
ATOM   1812 C CG    . PHE C 3 107 ? -10.720 -20.794 44.188 1.00 60.78  ? 309  PHE A CG    1 
ATOM   1813 C CD1   . PHE C 3 107 ? -9.596  -21.622 44.119 1.00 59.99  ? 309  PHE A CD1   1 
ATOM   1814 C CD2   . PHE C 3 107 ? -11.753 -20.997 43.283 1.00 62.15  ? 309  PHE A CD2   1 
ATOM   1815 C CE1   . PHE C 3 107 ? -9.506  -22.638 43.169 1.00 59.85  ? 309  PHE A CE1   1 
ATOM   1816 C CE2   . PHE C 3 107 ? -11.674 -22.010 42.324 1.00 62.87  ? 309  PHE A CE2   1 
ATOM   1817 C CZ    . PHE C 3 107 ? -10.548 -22.834 42.268 1.00 61.52  ? 309  PHE A CZ    1 
ATOM   1818 N N     . LYS C 3 108 ? -11.636 -18.564 48.127 1.00 67.63  ? 310  LYS A N     1 
ATOM   1819 C CA    . LYS C 3 108 ? -11.589 -17.518 49.159 1.00 68.77  ? 310  LYS A CA    1 
ATOM   1820 C C     . LYS C 3 108 ? -10.987 -18.143 50.410 1.00 65.50  ? 310  LYS A C     1 
ATOM   1821 O O     . LYS C 3 108 ? -10.206 -17.523 51.155 1.00 61.33  ? 310  LYS A O     1 
ATOM   1822 C CB    . LYS C 3 108 ? -13.019 -17.020 49.448 1.00 74.29  ? 310  LYS A CB    1 
ATOM   1823 C CG    . LYS C 3 108 ? -13.646 -16.250 48.264 1.00 82.76  ? 310  LYS A CG    1 
ATOM   1824 C CD    . LYS C 3 108 ? -15.203 -16.183 48.256 1.00 86.91  ? 310  LYS A CD    1 
ATOM   1825 C CE    . LYS C 3 108 ? -15.776 -14.877 48.834 1.00 91.49  ? 310  LYS A CE    1 
ATOM   1826 N NZ    . LYS C 3 108 ? -15.053 -13.623 48.408 1.00 97.74  ? 310  LYS A NZ    1 
ATOM   1827 N N     . ALA C 3 109 ? -11.410 -19.378 50.634 1.00 63.28  ? 311  ALA A N     1 
ATOM   1828 C CA    . ALA C 3 109 ? -10.941 -20.161 51.747 1.00 66.76  ? 311  ALA A CA    1 
ATOM   1829 C C     . ALA C 3 109 ? -9.433  -20.252 51.586 1.00 67.48  ? 311  ALA A C     1 
ATOM   1830 O O     . ALA C 3 109 ? -8.679  -19.756 52.430 1.00 70.53  ? 311  ALA A O     1 
ATOM   1831 C CB    . ALA C 3 109 ? -11.573 -21.555 51.701 1.00 66.16  ? 311  ALA A CB    1 
ATOM   1832 N N     . GLN C 3 110 ? -9.020  -20.862 50.478 1.00 66.88  ? 312  GLN A N     1 
ATOM   1833 C CA    . GLN C 3 110 ? -7.616  -21.040 50.124 1.00 64.92  ? 312  GLN A CA    1 
ATOM   1834 C C     . GLN C 3 110 ? -6.862  -19.747 50.311 1.00 65.10  ? 312  GLN A C     1 
ATOM   1835 O O     . GLN C 3 110 ? -5.681  -19.729 50.663 1.00 65.62  ? 312  GLN A O     1 
ATOM   1836 C CB    . GLN C 3 110 ? -7.530  -21.388 48.663 1.00 67.49  ? 312  GLN A CB    1 
ATOM   1837 C CG    . GLN C 3 110 ? -8.284  -22.615 48.336 1.00 74.52  ? 312  GLN A CG    1 
ATOM   1838 C CD    . GLN C 3 110 ? -7.355  -23.781 48.189 1.00 78.60  ? 312  GLN A CD    1 
ATOM   1839 O OE1   . GLN C 3 110 ? -6.516  -23.804 47.269 1.00 81.66  ? 312  GLN A OE1   1 
ATOM   1840 N NE2   . GLN C 3 110 ? -7.467  -24.758 49.104 1.00 78.34  ? 312  GLN A NE2   1 
ATOM   1841 N N     . THR C 3 111 ? -7.558  -18.663 50.035 1.00 64.47  ? 313  THR A N     1 
ATOM   1842 C CA    . THR C 3 111 ? -6.976  -17.367 50.151 1.00 65.61  ? 313  THR A CA    1 
ATOM   1843 C C     . THR C 3 111 ? -6.639  -17.042 51.584 1.00 65.42  ? 313  THR A C     1 
ATOM   1844 O O     . THR C 3 111 ? -5.468  -16.873 51.920 1.00 66.04  ? 313  THR A O     1 
ATOM   1845 C CB    . THR C 3 111 ? -7.910  -16.326 49.569 1.00 68.51  ? 313  THR A CB    1 
ATOM   1846 O OG1   . THR C 3 111 ? -8.122  -16.617 48.176 1.00 67.76  ? 313  THR A OG1   1 
ATOM   1847 C CG2   . THR C 3 111 ? -7.318  -14.931 49.714 1.00 65.52  ? 313  THR A CG2   1 
ATOM   1848 N N     . GLU C 3 112 ? -7.650  -16.917 52.428 1.00 67.11  ? 314  GLU A N     1 
ATOM   1849 C CA    . GLU C 3 112 ? -7.369  -16.593 53.807 1.00 70.35  ? 314  GLU A CA    1 
ATOM   1850 C C     . GLU C 3 112 ? -6.368  -17.604 54.365 1.00 69.28  ? 314  GLU A C     1 
ATOM   1851 O O     . GLU C 3 112 ? -5.375  -17.222 54.995 1.00 71.08  ? 314  GLU A O     1 
ATOM   1852 C CB    . GLU C 3 112 ? -8.655  -16.570 54.614 1.00 72.39  ? 314  GLU A CB    1 
ATOM   1853 C CG    . GLU C 3 112 ? -8.545  -15.738 55.860 1.00 79.34  ? 314  GLU A CG    1 
ATOM   1854 C CD    . GLU C 3 112 ? -8.202  -16.558 57.103 1.00 86.01  ? 314  GLU A CD    1 
ATOM   1855 O OE1   . GLU C 3 112 ? -7.520  -17.617 56.990 1.00 91.95  ? 314  GLU A OE1   1 
ATOM   1856 O OE2   . GLU C 3 112 ? -8.625  -16.132 58.210 1.00 89.28  ? 314  GLU A OE2   1 
ATOM   1857 N N     . ALA C 3 113 ? -6.628  -18.882 54.110 1.00 68.18  ? 315  ALA A N     1 
ATOM   1858 C CA    . ALA C 3 113 ? -5.743  -19.950 54.553 1.00 70.20  ? 315  ALA A CA    1 
ATOM   1859 C C     . ALA C 3 113 ? -4.301  -19.535 54.286 1.00 71.70  ? 315  ALA A C     1 
ATOM   1860 O O     . ALA C 3 113 ? -3.449  -19.572 55.180 1.00 74.27  ? 315  ALA A O     1 
ATOM   1861 C CB    . ALA C 3 113 ? -6.047  -21.220 53.809 1.00 73.75  ? 315  ALA A CB    1 
ATOM   1862 N N     . ARG C 3 114 ? -4.011  -19.163 53.049 1.00 71.39  ? 316  ARG A N     1 
ATOM   1863 C CA    . ARG C 3 114 ? -2.668  -18.714 52.765 1.00 71.20  ? 316  ARG A CA    1 
ATOM   1864 C C     . ARG C 3 114 ? -2.367  -17.447 53.585 1.00 69.65  ? 316  ARG A C     1 
ATOM   1865 O O     . ARG C 3 114 ? -1.388  -17.420 54.326 1.00 70.06  ? 316  ARG A O     1 
ATOM   1866 C CB    . ARG C 3 114 ? -2.447  -18.513 51.266 1.00 74.23  ? 316  ARG A CB    1 
ATOM   1867 C CG    . ARG C 3 114 ? -2.214  -19.857 50.544 1.00 84.54  ? 316  ARG A CG    1 
ATOM   1868 C CD    . ARG C 3 114 ? -1.377  -19.755 49.237 1.00 89.95  ? 316  ARG A CD    1 
ATOM   1869 N NE    . ARG C 3 114 ? -0.657  -21.012 48.932 1.00 95.49  ? 316  ARG A NE    1 
ATOM   1870 C CZ    . ARG C 3 114 ? 0.488   -21.108 48.236 1.00 98.16  ? 316  ARG A CZ    1 
ATOM   1871 N NH1   . ARG C 3 114 ? 1.079   -20.019 47.736 1.00 103.99 ? 316  ARG A NH1   1 
ATOM   1872 N NH2   . ARG C 3 114 ? 1.076   -22.298 48.068 1.00 97.29  ? 316  ARG A NH2   1 
ATOM   1873 N N     . LYS C 3 115 ? -3.246  -16.449 53.541 1.00 67.21  ? 317  LYS A N     1 
ATOM   1874 C CA    . LYS C 3 115 ? -3.045  -15.210 54.295 1.00 66.32  ? 317  LYS A CA    1 
ATOM   1875 C C     . LYS C 3 115 ? -2.709  -15.381 55.788 1.00 68.07  ? 317  LYS A C     1 
ATOM   1876 O O     . LYS C 3 115 ? -2.219  -14.442 56.423 1.00 71.47  ? 317  LYS A O     1 
ATOM   1877 C CB    . LYS C 3 115 ? -4.280  -14.309 54.162 1.00 66.61  ? 317  LYS A CB    1 
ATOM   1878 N N     . GLN C 3 116 ? -2.896  -16.582 56.328 1.00 69.37  ? 318  GLN A N     1 
ATOM   1879 C CA    . GLN C 3 116 ? -2.659  -16.846 57.751 1.00 70.67  ? 318  GLN A CA    1 
ATOM   1880 C C     . GLN C 3 116 ? -1.527  -17.808 58.060 1.00 71.68  ? 318  GLN A C     1 
ATOM   1881 O O     . GLN C 3 116 ? -1.219  -18.060 59.225 1.00 72.99  ? 318  GLN A O     1 
ATOM   1882 C CB    . GLN C 3 116 ? -3.908  -17.484 58.332 1.00 72.27  ? 318  GLN A CB    1 
ATOM   1883 C CG    . GLN C 3 116 ? -4.092  -18.914 57.865 1.00 77.37  ? 318  GLN A CG    1 
ATOM   1884 C CD    . GLN C 3 116 ? -5.355  -19.553 58.404 1.00 83.61  ? 318  GLN A CD    1 
ATOM   1885 O OE1   . GLN C 3 116 ? -5.792  -19.237 59.513 1.00 89.12  ? 318  GLN A OE1   1 
ATOM   1886 N NE2   . GLN C 3 116 ? -5.948  -20.478 57.633 1.00 85.37  ? 318  GLN A NE2   1 
ATOM   1887 N N     . MET C 3 117 ? -1.000  -18.431 57.022 1.00 73.74  ? 319  MET A N     1 
ATOM   1888 C CA    . MET C 3 117 ? 0.051   -19.430 57.143 1.00 76.62  ? 319  MET A CA    1 
ATOM   1889 C C     . MET C 3 117 ? 1.180   -19.251 58.183 1.00 77.13  ? 319  MET A C     1 
ATOM   1890 O O     . MET C 3 117 ? 1.509   -18.124 58.593 1.00 75.29  ? 319  MET A O     1 
ATOM   1891 C CB    . MET C 3 117 ? 0.651   -19.691 55.763 1.00 79.13  ? 319  MET A CB    1 
ATOM   1892 C CG    . MET C 3 117 ? 1.437   -18.547 55.184 1.00 84.61  ? 319  MET A CG    1 
ATOM   1893 S SD    . MET C 3 117 ? 2.424   -19.042 53.743 1.00 93.56  ? 319  MET A SD    1 
ATOM   1894 C CE    . MET C 3 117 ? 2.619   -17.385 52.816 1.00 92.74  ? 319  MET A CE    1 
ATOM   1895 N N     . SER C 3 118 ? 1.747   -20.389 58.617 1.00 78.10  ? 320  SER A N     1 
ATOM   1896 C CA    . SER C 3 118 ? 2.862   -20.425 59.581 1.00 78.66  ? 320  SER A CA    1 
ATOM   1897 C C     . SER C 3 118 ? 4.068   -19.683 59.016 1.00 79.49  ? 320  SER A C     1 
ATOM   1898 O O     . SER C 3 118 ? 4.212   -19.549 57.799 1.00 83.05  ? 320  SER A O     1 
ATOM   1899 C CB    . SER C 3 118 ? 3.259   -21.877 59.963 1.00 78.60  ? 320  SER A CB    1 
ATOM   1900 O OG    . SER C 3 118 ? 3.115   -22.819 58.900 1.00 80.17  ? 320  SER A OG    1 
ATOM   1901 N N     . LYS C 3 119 ? 4.922   -19.154 59.881 1.00 78.86  ? 321  LYS A N     1 
ATOM   1902 C CA    . LYS C 3 119 ? 6.088   -18.445 59.370 1.00 77.12  ? 321  LYS A CA    1 
ATOM   1903 C C     . LYS C 3 119 ? 7.008   -19.398 58.609 1.00 77.01  ? 321  LYS A C     1 
ATOM   1904 O O     . LYS C 3 119 ? 7.557   -19.025 57.570 1.00 76.61  ? 321  LYS A O     1 
ATOM   1905 C CB    . LYS C 3 119 ? 6.853   -17.757 60.500 1.00 79.48  ? 321  LYS A CB    1 
ATOM   1906 N N     . GLU C 3 120 ? 7.196   -20.606 59.150 1.00 76.77  ? 322  GLU A N     1 
ATOM   1907 C CA    . GLU C 3 120 ? 8.045   -21.629 58.522 1.00 77.06  ? 322  GLU A CA    1 
ATOM   1908 C C     . GLU C 3 120 ? 7.561   -21.827 57.085 1.00 77.00  ? 322  GLU A C     1 
ATOM   1909 O O     . GLU C 3 120 ? 8.360   -21.893 56.138 1.00 76.58  ? 322  GLU A O     1 
ATOM   1910 C CB    . GLU C 3 120 ? 7.957   -22.955 59.295 1.00 79.54  ? 322  GLU A CB    1 
ATOM   1911 N N     . GLU C 3 121 ? 6.244   -21.950 56.945 1.00 76.39  ? 323  GLU A N     1 
ATOM   1912 C CA    . GLU C 3 121 ? 5.636   -22.098 55.637 1.00 76.11  ? 323  GLU A CA    1 
ATOM   1913 C C     . GLU C 3 121 ? 6.004   -20.889 54.800 1.00 73.78  ? 323  GLU A C     1 
ATOM   1914 O O     . GLU C 3 121 ? 6.400   -21.036 53.639 1.00 76.25  ? 323  GLU A O     1 
ATOM   1915 C CB    . GLU C 3 121 ? 4.123   -22.199 55.752 1.00 79.56  ? 323  GLU A CB    1 
ATOM   1916 C CG    . GLU C 3 121 ? 3.627   -23.612 56.007 1.00 86.48  ? 323  GLU A CG    1 
ATOM   1917 C CD    . GLU C 3 121 ? 2.119   -23.678 56.175 1.00 90.53  ? 323  GLU A CD    1 
ATOM   1918 O OE1   . GLU C 3 121 ? 1.450   -22.624 56.178 1.00 94.89  ? 323  GLU A OE1   1 
ATOM   1919 O OE2   . GLU C 3 121 ? 1.586   -24.790 56.315 1.00 96.61  ? 323  GLU A OE2   1 
ATOM   1920 N N     . LYS C 3 122 ? 5.894   -19.702 55.396 1.00 68.67  ? 324  LYS A N     1 
ATOM   1921 C CA    . LYS C 3 122 ? 6.237   -18.473 54.699 1.00 66.02  ? 324  LYS A CA    1 
ATOM   1922 C C     . LYS C 3 122 ? 7.662   -18.528 54.162 1.00 65.32  ? 324  LYS A C     1 
ATOM   1923 O O     . LYS C 3 122 ? 7.916   -18.104 53.036 1.00 63.33  ? 324  LYS A O     1 
ATOM   1924 C CB    . LYS C 3 122 ? 6.047   -17.254 55.610 1.00 66.84  ? 324  LYS A CB    1 
ATOM   1925 C CG    . LYS C 3 122 ? 4.675   -16.613 55.438 1.00 70.68  ? 324  LYS A CG    1 
ATOM   1926 C CD    . LYS C 3 122 ? 4.302   -15.585 56.510 1.00 76.78  ? 324  LYS A CD    1 
ATOM   1927 C CE    . LYS C 3 122 ? 3.747   -16.276 57.783 1.00 86.23  ? 324  LYS A CE    1 
ATOM   1928 N NZ    . LYS C 3 122 ? 3.007   -15.404 58.780 1.00 84.74  ? 324  LYS A NZ    1 
ATOM   1929 N N     . LEU C 3 123 ? 8.585   -19.064 54.956 1.00 64.17  ? 325  LEU A N     1 
ATOM   1930 C CA    . LEU C 3 123 ? 9.975   -19.159 54.540 1.00 61.92  ? 325  LEU A CA    1 
ATOM   1931 C C     . LEU C 3 123 ? 10.191  -20.261 53.528 1.00 60.34  ? 325  LEU A C     1 
ATOM   1932 O O     . LEU C 3 123 ? 10.981  -20.104 52.600 1.00 63.93  ? 325  LEU A O     1 
ATOM   1933 C CB    . LEU C 3 123 ? 10.898  -19.384 55.746 1.00 66.15  ? 325  LEU A CB    1 
ATOM   1934 C CG    . LEU C 3 123 ? 12.371  -19.784 55.493 1.00 72.46  ? 325  LEU A CG    1 
ATOM   1935 C CD1   . LEU C 3 123 ? 13.142  -18.668 54.764 1.00 74.36  ? 325  LEU A CD1   1 
ATOM   1936 C CD2   . LEU C 3 123 ? 13.098  -20.145 56.805 1.00 74.35  ? 325  LEU A CD2   1 
ATOM   1937 N N     . LYS C 3 124 ? 9.548   -21.398 53.730 1.00 55.33  ? 326  LYS A N     1 
ATOM   1938 C CA    . LYS C 3 124 ? 9.726   -22.493 52.807 1.00 53.30  ? 326  LYS A CA    1 
ATOM   1939 C C     . LYS C 3 124 ? 9.445   -22.047 51.368 1.00 53.93  ? 326  LYS A C     1 
ATOM   1940 O O     . LYS C 3 124 ? 10.193  -22.380 50.434 1.00 50.97  ? 326  LYS A O     1 
ATOM   1941 C CB    . LYS C 3 124 ? 8.802   -23.642 53.196 1.00 55.98  ? 326  LYS A CB    1 
ATOM   1942 N N     . ILE C 3 125 ? 8.391   -21.259 51.191 1.00 53.22  ? 327  ILE A N     1 
ATOM   1943 C CA    . ILE C 3 125 ? 8.051   -20.844 49.849 1.00 57.44  ? 327  ILE A CA    1 
ATOM   1944 C C     . ILE C 3 125 ? 9.006   -19.801 49.319 1.00 57.65  ? 327  ILE A C     1 
ATOM   1945 O O     . ILE C 3 125 ? 9.132   -19.634 48.110 1.00 60.31  ? 327  ILE A O     1 
ATOM   1946 C CB    . ILE C 3 125 ? 6.584   -20.388 49.716 1.00 59.60  ? 327  ILE A CB    1 
ATOM   1947 C CG1   . ILE C 3 125 ? 6.396   -19.010 50.323 1.00 63.02  ? 327  ILE A CG1   1 
ATOM   1948 C CG2   . ILE C 3 125 ? 5.641   -21.392 50.394 1.00 58.94  ? 327  ILE A CG2   1 
ATOM   1949 C CD1   . ILE C 3 125 ? 4.963   -18.536 50.234 1.00 67.26  ? 327  ILE A CD1   1 
ATOM   1950 N N     . LYS C 3 126 ? 9.695   -19.110 50.217 1.00 58.13  ? 328  LYS A N     1 
ATOM   1951 C CA    . LYS C 3 126 ? 10.663  -18.105 49.793 1.00 58.90  ? 328  LYS A CA    1 
ATOM   1952 C C     . LYS C 3 126 ? 11.919  -18.778 49.276 1.00 56.70  ? 328  LYS A C     1 
ATOM   1953 O O     . LYS C 3 126 ? 12.513  -18.378 48.268 1.00 54.55  ? 328  LYS A O     1 
ATOM   1954 C CB    . LYS C 3 126 ? 11.038  -17.217 50.949 1.00 62.01  ? 328  LYS A CB    1 
ATOM   1955 C CG    . LYS C 3 126 ? 11.590  -15.888 50.493 1.00 74.08  ? 328  LYS A CG    1 
ATOM   1956 C CD    . LYS C 3 126 ? 11.400  -14.850 51.600 1.00 82.96  ? 328  LYS A CD    1 
ATOM   1957 C CE    . LYS C 3 126 ? 11.507  -13.403 51.092 1.00 86.04  ? 328  LYS A CE    1 
ATOM   1958 N NZ    . LYS C 3 126 ? 11.211  -12.460 52.228 1.00 90.74  ? 328  LYS A NZ    1 
ATOM   1959 N N     . GLU C 3 127 ? 12.353  -19.761 50.039 1.00 56.88  ? 329  GLU A N     1 
ATOM   1960 C CA    . GLU C 3 127 ? 13.512  -20.531 49.680 1.00 59.42  ? 329  GLU A CA    1 
ATOM   1961 C C     . GLU C 3 127 ? 13.152  -21.185 48.373 1.00 55.17  ? 329  GLU A C     1 
ATOM   1962 O O     . GLU C 3 127 ? 13.958  -21.278 47.474 1.00 54.84  ? 329  GLU A O     1 
ATOM   1963 C CB    . GLU C 3 127 ? 13.802  -21.569 50.765 1.00 66.96  ? 329  GLU A CB    1 
ATOM   1964 C CG    . GLU C 3 127 ? 13.997  -20.938 52.167 1.00 78.83  ? 329  GLU A CG    1 
ATOM   1965 C CD    . GLU C 3 127 ? 14.602  -21.895 53.222 1.00 86.95  ? 329  GLU A CD    1 
ATOM   1966 O OE1   . GLU C 3 127 ? 13.860  -22.379 54.122 1.00 88.48  ? 329  GLU A OE1   1 
ATOM   1967 O OE2   . GLU C 3 127 ? 15.835  -22.142 53.167 1.00 94.71  ? 329  GLU A OE2   1 
ATOM   1968 N N     . GLU C 3 128 ? 11.908  -21.600 48.265 1.00 55.96  ? 330  GLU A N     1 
ATOM   1969 C CA    . GLU C 3 128 ? 11.441  -22.217 47.050 1.00 56.09  ? 330  GLU A CA    1 
ATOM   1970 C C     . GLU C 3 128 ? 11.582  -21.199 45.938 1.00 52.11  ? 330  GLU A C     1 
ATOM   1971 O O     . GLU C 3 128 ? 12.212  -21.455 44.912 1.00 50.71  ? 330  GLU A O     1 
ATOM   1972 C CB    . GLU C 3 128 ? 9.977   -22.598 47.216 1.00 58.20  ? 330  GLU A CB    1 
ATOM   1973 C CG    . GLU C 3 128 ? 9.739   -24.071 47.154 1.00 66.87  ? 330  GLU A CG    1 
ATOM   1974 C CD    . GLU C 3 128 ? 8.726   -24.535 48.179 1.00 72.24  ? 330  GLU A CD    1 
ATOM   1975 O OE1   . GLU C 3 128 ? 9.125   -25.251 49.116 1.00 75.92  ? 330  GLU A OE1   1 
ATOM   1976 O OE2   . GLU C 3 128 ? 7.534   -24.194 48.070 1.00 72.41  ? 330  GLU A OE2   1 
ATOM   1977 N N     . ASN C 3 129 ? 11.056  -20.015 46.196 1.00 49.15  ? 331  ASN A N     1 
ATOM   1978 C CA    . ASN C 3 129 ? 11.077  -18.946 45.216 1.00 52.12  ? 331  ASN A CA    1 
ATOM   1979 C C     . ASN C 3 129 ? 12.459  -18.612 44.814 1.00 51.81  ? 331  ASN A C     1 
ATOM   1980 O O     . ASN C 3 129 ? 12.773  -18.480 43.639 1.00 50.25  ? 331  ASN A O     1 
ATOM   1981 C CB    . ASN C 3 129 ? 10.445  -17.691 45.782 1.00 56.58  ? 331  ASN A CB    1 
ATOM   1982 C CG    . ASN C 3 129 ? 8.943   -17.744 45.753 1.00 58.42  ? 331  ASN A CG    1 
ATOM   1983 O OD1   . ASN C 3 129 ? 8.336   -18.612 45.120 1.00 60.55  ? 331  ASN A OD1   1 
ATOM   1984 N ND2   . ASN C 3 129 ? 8.325   -16.797 46.431 1.00 62.08  ? 331  ASN A ND2   1 
ATOM   1985 N N     . GLU C 3 130 ? 13.278  -18.403 45.823 1.00 54.46  ? 332  GLU A N     1 
ATOM   1986 C CA    . GLU C 3 130 ? 14.660  -18.067 45.591 1.00 57.14  ? 332  GLU A CA    1 
ATOM   1987 C C     . GLU C 3 130 ? 15.363  -19.085 44.711 1.00 54.90  ? 332  GLU A C     1 
ATOM   1988 O O     . GLU C 3 130 ? 16.192  -18.724 43.881 1.00 53.32  ? 332  GLU A O     1 
ATOM   1989 C CB    . GLU C 3 130 ? 15.372  -17.964 46.915 1.00 58.54  ? 332  GLU A CB    1 
ATOM   1990 C CG    . GLU C 3 130 ? 14.832  -16.874 47.807 1.00 67.57  ? 332  GLU A CG    1 
ATOM   1991 C CD    . GLU C 3 130 ? 15.722  -16.660 49.021 1.00 76.67  ? 332  GLU A CD    1 
ATOM   1992 O OE1   . GLU C 3 130 ? 16.549  -17.568 49.336 1.00 83.51  ? 332  GLU A OE1   1 
ATOM   1993 O OE2   . GLU C 3 130 ? 15.608  -15.578 49.654 1.00 81.00  ? 332  GLU A OE2   1 
ATOM   1994 N N     . LYS C 3 131 ? 15.072  -20.358 44.946 1.00 54.79  ? 333  LYS A N     1 
ATOM   1995 C CA    . LYS C 3 131 ? 15.667  -21.443 44.186 1.00 55.80  ? 333  LYS A CA    1 
ATOM   1996 C C     . LYS C 3 131 ? 15.286  -21.314 42.726 1.00 57.73  ? 333  LYS A C     1 
ATOM   1997 O O     . LYS C 3 131 ? 16.061  -21.664 41.826 1.00 61.36  ? 333  LYS A O     1 
ATOM   1998 C CB    . LYS C 3 131 ? 15.186  -22.796 44.709 1.00 58.03  ? 333  LYS A CB    1 
ATOM   1999 N N     . LEU C 3 132 ? 14.077  -20.831 42.490 1.00 56.28  ? 334  LEU A N     1 
ATOM   2000 C CA    . LEU C 3 132 ? 13.603  -20.658 41.136 1.00 53.13  ? 334  LEU A CA    1 
ATOM   2001 C C     . LEU C 3 132 ? 14.456  -19.591 40.432 1.00 53.79  ? 334  LEU A C     1 
ATOM   2002 O O     . LEU C 3 132 ? 14.939  -19.769 39.301 1.00 51.95  ? 334  LEU A O     1 
ATOM   2003 C CB    . LEU C 3 132 ? 12.145  -20.232 41.192 1.00 52.88  ? 334  LEU A CB    1 
ATOM   2004 C CG    . LEU C 3 132 ? 11.370  -20.264 39.884 1.00 51.99  ? 334  LEU A CG    1 
ATOM   2005 C CD1   . LEU C 3 132 ? 11.252  -21.683 39.389 1.00 53.63  ? 334  LEU A CD1   1 
ATOM   2006 C CD2   . LEU C 3 132 ? 10.012  -19.674 40.108 1.00 57.02  ? 334  LEU A CD2   1 
ATOM   2007 N N     . LEU C 3 133 ? 14.674  -18.500 41.140 1.00 51.34  ? 335  LEU A N     1 
ATOM   2008 C CA    . LEU C 3 133 ? 15.430  -17.405 40.613 1.00 50.51  ? 335  LEU A CA    1 
ATOM   2009 C C     . LEU C 3 133 ? 16.828  -17.836 40.233 1.00 49.81  ? 335  LEU A C     1 
ATOM   2010 O O     . LEU C 3 133 ? 17.341  -17.474 39.176 1.00 52.89  ? 335  LEU A O     1 
ATOM   2011 C CB    . LEU C 3 133 ? 15.470  -16.312 41.663 1.00 53.47  ? 335  LEU A CB    1 
ATOM   2012 C CG    . LEU C 3 133 ? 16.236  -15.027 41.380 1.00 55.17  ? 335  LEU A CG    1 
ATOM   2013 C CD1   . LEU C 3 133 ? 15.850  -14.420 40.040 1.00 52.41  ? 335  LEU A CD1   1 
ATOM   2014 C CD2   . LEU C 3 133 ? 15.929  -14.078 42.521 1.00 60.60  ? 335  LEU A CD2   1 
ATOM   2015 N N     . LYS C 3 134 ? 17.459  -18.584 41.113 1.00 47.62  ? 336  LYS A N     1 
ATOM   2016 C CA    . LYS C 3 134 ? 18.801  -19.031 40.855 1.00 48.03  ? 336  LYS A CA    1 
ATOM   2017 C C     . LYS C 3 134 ? 18.830  -19.895 39.619 1.00 47.57  ? 336  LYS A C     1 
ATOM   2018 O O     . LYS C 3 134 ? 19.740  -19.792 38.807 1.00 50.08  ? 336  LYS A O     1 
ATOM   2019 C CB    . LYS C 3 134 ? 19.304  -19.809 42.057 1.00 50.94  ? 336  LYS A CB    1 
ATOM   2020 C CG    . LYS C 3 134 ? 20.653  -20.462 41.870 1.00 60.00  ? 336  LYS A CG    1 
ATOM   2021 C CD    . LYS C 3 134 ? 20.962  -21.353 43.064 1.00 64.99  ? 336  LYS A CD    1 
ATOM   2022 C CE    . LYS C 3 134 ? 22.447  -21.528 43.258 1.00 67.09  ? 336  LYS A CE    1 
ATOM   2023 N NZ    . LYS C 3 134 ? 22.704  -21.762 44.710 1.00 68.62  ? 336  LYS A NZ    1 
ATOM   2024 N N     . GLU C 3 135 ? 17.812  -20.716 39.441 1.00 44.42  ? 337  GLU A N     1 
ATOM   2025 C CA    . GLU C 3 135 ? 17.824  -21.585 38.289 1.00 46.56  ? 337  GLU A CA    1 
ATOM   2026 C C     . GLU C 3 135 ? 17.367  -21.004 36.939 1.00 45.97  ? 337  GLU A C     1 
ATOM   2027 O O     . GLU C 3 135 ? 17.957  -21.334 35.913 1.00 43.00  ? 337  GLU A O     1 
ATOM   2028 C CB    . GLU C 3 135 ? 17.097  -22.898 38.600 1.00 50.57  ? 337  GLU A CB    1 
ATOM   2029 C CG    . GLU C 3 135 ? 17.363  -24.022 37.559 1.00 60.71  ? 337  GLU A CG    1 
ATOM   2030 C CD    . GLU C 3 135 ? 16.525  -25.317 37.774 1.00 71.21  ? 337  GLU A CD    1 
ATOM   2031 O OE1   . GLU C 3 135 ? 15.670  -25.326 38.712 1.00 75.10  ? 337  GLU A OE1   1 
ATOM   2032 O OE2   . GLU C 3 135 ? 16.723  -26.315 36.995 1.00 70.58  ? 337  GLU A OE2   1 
ATOM   2033 N N     . TYR C 3 136 ? 16.336  -20.156 36.926 1.00 44.06  ? 338  TYR A N     1 
ATOM   2034 C CA    . TYR C 3 136 ? 15.841  -19.615 35.662 1.00 42.71  ? 338  TYR A CA    1 
ATOM   2035 C C     . TYR C 3 136 ? 15.861  -18.121 35.558 1.00 42.19  ? 338  TYR A C     1 
ATOM   2036 O O     . TYR C 3 136 ? 15.510  -17.580 34.525 1.00 38.12  ? 338  TYR A O     1 
ATOM   2037 C CB    . TYR C 3 136 ? 14.395  -20.060 35.424 1.00 45.73  ? 338  TYR A CB    1 
ATOM   2038 C CG    . TYR C 3 136 ? 14.221  -21.538 35.224 1.00 39.95  ? 338  TYR A CG    1 
ATOM   2039 C CD1   . TYR C 3 136 ? 14.071  -22.367 36.312 1.00 37.87  ? 338  TYR A CD1   1 
ATOM   2040 C CD2   . TYR C 3 136 ? 14.270  -22.107 33.948 1.00 40.20  ? 338  TYR A CD2   1 
ATOM   2041 C CE1   . TYR C 3 136 ? 13.979  -23.719 36.158 1.00 42.83  ? 338  TYR A CE1   1 
ATOM   2042 C CE2   . TYR C 3 136 ? 14.176  -23.477 33.774 1.00 44.10  ? 338  TYR A CE2   1 
ATOM   2043 C CZ    . TYR C 3 136 ? 14.039  -24.282 34.903 1.00 45.36  ? 338  TYR A CZ    1 
ATOM   2044 O OH    . TYR C 3 136 ? 13.992  -25.660 34.872 1.00 48.36  ? 338  TYR A OH    1 
ATOM   2045 N N     . GLY C 3 137 ? 16.195  -17.449 36.652 1.00 44.01  ? 339  GLY A N     1 
ATOM   2046 C CA    . GLY C 3 137 ? 16.195  -15.993 36.661 1.00 41.31  ? 339  GLY A CA    1 
ATOM   2047 C C     . GLY C 3 137 ? 17.415  -15.271 36.141 1.00 42.41  ? 339  GLY A C     1 
ATOM   2048 O O     . GLY C 3 137 ? 17.514  -14.057 36.260 1.00 43.73  ? 339  GLY A O     1 
ATOM   2049 N N     . PHE C 3 138 ? 18.360  -16.006 35.586 1.00 42.55  ? 340  PHE A N     1 
ATOM   2050 C CA    . PHE C 3 138 ? 19.569  -15.396 35.059 1.00 45.57  ? 340  PHE A CA    1 
ATOM   2051 C C     . PHE C 3 138 ? 19.992  -16.043 33.769 1.00 45.10  ? 340  PHE A C     1 
ATOM   2052 O O     . PHE C 3 138 ? 19.703  -17.207 33.525 1.00 44.87  ? 340  PHE A O     1 
ATOM   2053 C CB    . PHE C 3 138 ? 20.737  -15.588 36.022 1.00 50.44  ? 340  PHE A CB    1 
ATOM   2054 C CG    . PHE C 3 138 ? 20.512  -15.016 37.380 1.00 49.65  ? 340  PHE A CG    1 
ATOM   2055 C CD1   . PHE C 3 138 ? 21.007  -13.762 37.699 1.00 50.17  ? 340  PHE A CD1   1 
ATOM   2056 C CD2   . PHE C 3 138 ? 19.846  -15.750 38.356 1.00 50.67  ? 340  PHE A CD2   1 
ATOM   2057 C CE1   . PHE C 3 138 ? 20.848  -13.249 38.972 1.00 47.15  ? 340  PHE A CE1   1 
ATOM   2058 C CE2   . PHE C 3 138 ? 19.680  -15.243 39.641 1.00 48.10  ? 340  PHE A CE2   1 
ATOM   2059 C CZ    . PHE C 3 138 ? 20.180  -13.994 39.950 1.00 46.49  ? 340  PHE A CZ    1 
ATOM   2060 N N     . CYS C 3 139 ? 20.752  -15.296 32.986 1.00 43.68  ? 341  CYS A N     1 
ATOM   2061 C CA    . CYS C 3 139 ? 21.268  -15.809 31.740 1.00 45.48  ? 341  CYS A CA    1 
ATOM   2062 C C     . CYS C 3 139 ? 22.692  -15.311 31.651 1.00 47.76  ? 341  CYS A C     1 
ATOM   2063 O O     . CYS C 3 139 ? 23.151  -14.558 32.526 1.00 47.97  ? 341  CYS A O     1 
ATOM   2064 C CB    . CYS C 3 139 ? 20.469  -15.282 30.562 1.00 45.17  ? 341  CYS A CB    1 
ATOM   2065 S SG    . CYS C 3 139 ? 20.844  -13.605 30.118 1.00 43.45  ? 341  CYS A SG    1 
ATOM   2066 N N     . ILE C 3 140 ? 23.387  -15.747 30.605 1.00 47.16  ? 342  ILE A N     1 
ATOM   2067 C CA    . ILE C 3 140 ? 24.766  -15.354 30.350 1.00 46.87  ? 342  ILE A CA    1 
ATOM   2068 C C     . ILE C 3 140 ? 24.809  -14.641 28.999 1.00 46.46  ? 342  ILE A C     1 
ATOM   2069 O O     . ILE C 3 140 ? 24.638  -15.274 27.957 1.00 47.22  ? 342  ILE A O     1 
ATOM   2070 C CB    . ILE C 3 140 ? 25.731  -16.591 30.231 1.00 46.93  ? 342  ILE A CB    1 
ATOM   2071 C CG1   . ILE C 3 140 ? 25.595  -17.549 31.424 1.00 44.35  ? 342  ILE A CG1   1 
ATOM   2072 C CG2   . ILE C 3 140 ? 27.174  -16.129 30.048 1.00 48.99  ? 342  ILE A CG2   1 
ATOM   2073 C CD1   . ILE C 3 140 ? 26.188  -17.097 32.704 1.00 39.98  ? 342  ILE A CD1   1 
ATOM   2074 N N     . MET C 3 141 ? 24.986  -13.329 29.005 1.00 45.33  ? 343  MET A N     1 
ATOM   2075 C CA    . MET C 3 141 ? 25.089  -12.602 27.752 1.00 42.57  ? 343  MET A CA    1 
ATOM   2076 C C     . MET C 3 141 ? 26.535  -12.199 27.595 1.00 41.81  ? 343  MET A C     1 
ATOM   2077 O O     . MET C 3 141 ? 27.113  -11.579 28.472 1.00 43.56  ? 343  MET A O     1 
ATOM   2078 C CB    . MET C 3 141 ? 24.216  -11.362 27.759 1.00 41.26  ? 343  MET A CB    1 
ATOM   2079 C CG    . MET C 3 141 ? 24.167  -10.679 26.422 1.00 41.12  ? 343  MET A CG    1 
ATOM   2080 S SD    . MET C 3 141 ? 22.846  -9.476  26.401 1.00 49.02  ? 343  MET A SD    1 
ATOM   2081 C CE    . MET C 3 141 ? 21.316  -10.510 26.012 1.00 42.95  ? 343  MET A CE    1 
ATOM   2082 N N     . ASP C 3 142 ? 27.135  -12.598 26.490 1.00 43.41  ? 344  ASP A N     1 
ATOM   2083 C CA    . ASP C 3 142 ? 28.516  -12.257 26.275 1.00 45.69  ? 344  ASP A CA    1 
ATOM   2084 C C     . ASP C 3 142 ? 29.354  -12.778 27.410 1.00 45.90  ? 344  ASP A C     1 
ATOM   2085 O O     . ASP C 3 142 ? 29.296  -13.956 27.693 1.00 49.73  ? 344  ASP A O     1 
ATOM   2086 C CB    . ASP C 3 142 ? 28.669  -10.756 26.107 1.00 43.97  ? 344  ASP A CB    1 
ATOM   2087 C CG    . ASP C 3 142 ? 28.068  -10.276 24.834 1.00 44.57  ? 344  ASP A CG    1 
ATOM   2088 O OD1   . ASP C 3 142 ? 27.912  -9.063  24.677 1.00 48.22  ? 344  ASP A OD1   1 
ATOM   2089 O OD2   . ASP C 3 142 ? 27.742  -11.117 23.985 1.00 46.25  ? 344  ASP A OD2   1 
ATOM   2090 N N     . ASN C 3 143 ? 30.000  -11.896 28.150 1.00 44.09  ? 345  ASN A N     1 
ATOM   2091 C CA    . ASN C 3 143 ? 30.887  -12.347 29.202 1.00 45.79  ? 345  ASN A CA    1 
ATOM   2092 C C     . ASN C 3 143 ? 30.426  -12.299 30.648 1.00 46.19  ? 345  ASN A C     1 
ATOM   2093 O O     . ASN C 3 143 ? 31.265  -12.385 31.546 1.00 45.74  ? 345  ASN A O     1 
ATOM   2094 C CB    . ASN C 3 143 ? 32.226  -11.610 29.072 1.00 45.86  ? 345  ASN A CB    1 
ATOM   2095 C CG    . ASN C 3 143 ? 32.870  -11.789 27.694 1.00 48.70  ? 345  ASN A CG    1 
ATOM   2096 O OD1   . ASN C 3 143 ? 33.329  -12.869 27.322 1.00 46.92  ? 345  ASN A OD1   1 
ATOM   2097 N ND2   . ASN C 3 143 ? 32.934  -10.708 26.948 1.00 51.74  ? 345  ASN A ND2   1 
ATOM   2098 N N     . HIS C 3 144 ? 29.135  -12.092 30.910 1.00 48.65  ? 346  HIS A N     1 
ATOM   2099 C CA    . HIS C 3 144 ? 28.671  -12.027 32.301 1.00 47.83  ? 346  HIS A CA    1 
ATOM   2100 C C     . HIS C 3 144 ? 27.300  -12.645 32.595 1.00 48.55  ? 346  HIS A C     1 
ATOM   2101 O O     . HIS C 3 144 ? 26.507  -12.912 31.704 1.00 48.24  ? 346  HIS A O     1 
ATOM   2102 C CB    . HIS C 3 144 ? 28.634  -10.575 32.803 1.00 48.91  ? 346  HIS A CB    1 
ATOM   2103 C CG    . HIS C 3 144 ? 29.904  -9.808  32.605 1.00 49.00  ? 346  HIS A CG    1 
ATOM   2104 N ND1   . HIS C 3 144 ? 30.769  -9.503  33.634 1.00 43.78  ? 346  HIS A ND1   1 
ATOM   2105 C CD2   . HIS C 3 144 ? 30.425  -9.231  31.492 1.00 47.49  ? 346  HIS A CD2   1 
ATOM   2106 C CE1   . HIS C 3 144 ? 31.769  -8.773  33.163 1.00 47.31  ? 346  HIS A CE1   1 
ATOM   2107 N NE2   . HIS C 3 144 ? 31.578  -8.596  31.864 1.00 44.48  ? 346  HIS A NE2   1 
ATOM   2108 N N     . LYS C 3 145 ? 27.034  -12.858 33.883 1.00 49.68  ? 347  LYS A N     1 
ATOM   2109 C CA    . LYS C 3 145 ? 25.757  -13.396 34.348 1.00 47.93  ? 347  LYS A CA    1 
ATOM   2110 C C     . LYS C 3 145 ? 24.785  -12.211 34.435 1.00 46.60  ? 347  LYS A C     1 
ATOM   2111 O O     . LYS C 3 145 ? 25.071  -11.165 35.038 1.00 45.43  ? 347  LYS A O     1 
ATOM   2112 C CB    . LYS C 3 145 ? 25.920  -14.051 35.728 1.00 47.82  ? 347  LYS A CB    1 
ATOM   2113 C CG    . LYS C 3 145 ? 24.675  -14.752 36.276 1.00 56.96  ? 347  LYS A CG    1 
ATOM   2114 C CD    . LYS C 3 145 ? 24.651  -14.770 37.823 1.00 64.80  ? 347  LYS A CD    1 
ATOM   2115 C CE    . LYS C 3 145 ? 24.604  -16.197 38.429 1.00 70.85  ? 347  LYS A CE    1 
ATOM   2116 N NZ    . LYS C 3 145 ? 24.153  -16.246 39.899 1.00 67.45  ? 347  LYS A NZ    1 
ATOM   2117 N N     . GLU C 3 146 ? 23.664  -12.345 33.770 1.00 46.48  ? 348  GLU A N     1 
ATOM   2118 C CA    . GLU C 3 146 ? 22.705  -11.282 33.807 1.00 45.59  ? 348  GLU A CA    1 
ATOM   2119 C C     . GLU C 3 146 ? 21.351  -11.815 34.166 1.00 43.92  ? 348  GLU A C     1 
ATOM   2120 O O     . GLU C 3 146 ? 20.959  -12.917 33.800 1.00 40.74  ? 348  GLU A O     1 
ATOM   2121 C CB    . GLU C 3 146 ? 22.664  -10.549 32.483 1.00 49.70  ? 348  GLU A CB    1 
ATOM   2122 C CG    . GLU C 3 146 ? 24.010  -9.940  32.105 1.00 55.98  ? 348  GLU A CG    1 
ATOM   2123 C CD    . GLU C 3 146 ? 24.002  -8.416  32.018 1.00 59.82  ? 348  GLU A CD    1 
ATOM   2124 O OE1   . GLU C 3 146 ? 24.504  -7.883  31.004 1.00 61.73  ? 348  GLU A OE1   1 
ATOM   2125 O OE2   . GLU C 3 146 ? 23.507  -7.749  32.961 1.00 66.68  ? 348  GLU A OE2   1 
ATOM   2126 N N     . ARG C 3 147 ? 20.661  -11.014 34.943 1.00 44.30  ? 349  ARG A N     1 
ATOM   2127 C CA    . ARG C 3 147 ? 19.350  -11.338 35.406 1.00 46.23  ? 349  ARG A CA    1 
ATOM   2128 C C     . ARG C 3 147 ? 18.262  -11.101 34.381 1.00 44.61  ? 349  ARG A C     1 
ATOM   2129 O O     . ARG C 3 147 ? 18.257  -10.106 33.671 1.00 44.13  ? 349  ARG A O     1 
ATOM   2130 C CB    . ARG C 3 147 ? 19.068  -10.532 36.649 1.00 51.11  ? 349  ARG A CB    1 
ATOM   2131 C CG    . ARG C 3 147 ? 17.715  -10.781 37.206 1.00 61.68  ? 349  ARG A CG    1 
ATOM   2132 C CD    . ARG C 3 147 ? 17.764  -10.995 38.708 1.00 70.24  ? 349  ARG A CD    1 
ATOM   2133 N NE    . ARG C 3 147 ? 16.429  -10.972 39.322 1.00 77.90  ? 349  ARG A NE    1 
ATOM   2134 C CZ    . ARG C 3 147 ? 15.343  -11.573 38.825 1.00 82.34  ? 349  ARG A CZ    1 
ATOM   2135 N NH1   . ARG C 3 147 ? 15.392  -12.276 37.683 1.00 85.46  ? 349  ARG A NH1   1 
ATOM   2136 N NH2   . ARG C 3 147 ? 14.190  -11.478 39.483 1.00 83.36  ? 349  ARG A NH2   1 
ATOM   2137 N N     . ILE C 3 148 ? 17.354  -12.058 34.303 1.00 43.71  ? 350  ILE A N     1 
ATOM   2138 C CA    . ILE C 3 148 ? 16.232  -11.991 33.401 1.00 40.99  ? 350  ILE A CA    1 
ATOM   2139 C C     . ILE C 3 148 ? 15.059  -11.335 34.127 1.00 42.55  ? 350  ILE A C     1 
ATOM   2140 O O     . ILE C 3 148 ? 14.694  -11.697 35.258 1.00 38.86  ? 350  ILE A O     1 
ATOM   2141 C CB    . ILE C 3 148 ? 15.839  -13.371 32.973 1.00 41.24  ? 350  ILE A CB    1 
ATOM   2142 C CG1   . ILE C 3 148 ? 17.005  -14.001 32.232 1.00 42.33  ? 350  ILE A CG1   1 
ATOM   2143 C CG2   . ILE C 3 148 ? 14.567  -13.318 32.147 1.00 40.27  ? 350  ILE A CG2   1 
ATOM   2144 C CD1   . ILE C 3 148 ? 16.834  -15.469 31.991 1.00 42.66  ? 350  ILE A CD1   1 
ATOM   2145 N N     . ALA C 3 149 ? 14.449  -10.385 33.448 1.00 40.50  ? 351  ALA A N     1 
ATOM   2146 C CA    . ALA C 3 149 ? 13.354  -9.669  34.034 1.00 41.39  ? 351  ALA A CA    1 
ATOM   2147 C C     . ALA C 3 149 ? 12.162  -10.551 34.333 1.00 41.02  ? 351  ALA A C     1 
ATOM   2148 O O     . ALA C 3 149 ? 11.880  -10.874 35.468 1.00 46.74  ? 351  ALA A O     1 
ATOM   2149 C CB    . ALA C 3 149 ? 12.952  -8.522  33.117 1.00 39.69  ? 351  ALA A CB    1 
ATOM   2150 N N     . ASN C 3 150 ? 11.533  -11.012 33.278 1.00 39.05  ? 352  ASN A N     1 
ATOM   2151 C CA    . ASN C 3 150 ? 10.321  -11.794 33.340 1.00 41.33  ? 352  ASN A CA    1 
ATOM   2152 C C     . ASN C 3 150 ? 10.518  -13.238 32.904 1.00 44.17  ? 352  ASN A C     1 
ATOM   2153 O O     . ASN C 3 150 ? 10.266  -13.582 31.758 1.00 43.79  ? 352  ASN A O     1 
ATOM   2154 C CB    . ASN C 3 150 ? 9.352   -11.113 32.387 1.00 45.32  ? 352  ASN A CB    1 
ATOM   2155 C CG    . ASN C 3 150 ? 9.979   -10.842 31.011 1.00 47.03  ? 352  ASN A CG    1 
ATOM   2156 O OD1   . ASN C 3 150 ? 11.205  -10.804 30.858 1.00 45.88  ? 352  ASN A OD1   1 
ATOM   2157 N ND2   . ASN C 3 150 ? 9.138   -10.665 30.011 1.00 46.30  ? 352  ASN A ND2   1 
ATOM   2158 N N     . PHE C 3 151 ? 10.947  -14.112 33.793 1.00 45.50  ? 353  PHE A N     1 
ATOM   2159 C CA    . PHE C 3 151 ? 11.178  -15.477 33.334 1.00 48.90  ? 353  PHE A CA    1 
ATOM   2160 C C     . PHE C 3 151 ? 10.046  -16.485 33.469 1.00 48.89  ? 353  PHE A C     1 
ATOM   2161 O O     . PHE C 3 151 ? 10.142  -17.608 32.947 1.00 49.65  ? 353  PHE A O     1 
ATOM   2162 C CB    . PHE C 3 151 ? 12.497  -16.026 33.898 1.00 52.28  ? 353  PHE A CB    1 
ATOM   2163 C CG    . PHE C 3 151 ? 12.574  -16.015 35.396 1.00 54.34  ? 353  PHE A CG    1 
ATOM   2164 C CD1   . PHE C 3 151 ? 13.003  -14.879 36.081 1.00 54.56  ? 353  PHE A CD1   1 
ATOM   2165 C CD2   . PHE C 3 151 ? 12.200  -17.140 36.126 1.00 54.24  ? 353  PHE A CD2   1 
ATOM   2166 C CE1   . PHE C 3 151 ? 13.050  -14.866 37.464 1.00 53.67  ? 353  PHE A CE1   1 
ATOM   2167 C CE2   . PHE C 3 151 ? 12.246  -17.131 37.516 1.00 56.47  ? 353  PHE A CE2   1 
ATOM   2168 C CZ    . PHE C 3 151 ? 12.670  -15.994 38.183 1.00 54.48  ? 353  PHE A CZ    1 
ATOM   2169 N N     . LYS C 3 152 ? 8.987   -16.082 34.161 1.00 48.30  ? 354  LYS A N     1 
ATOM   2170 C CA    . LYS C 3 152 ? 7.817   -16.920 34.369 1.00 46.75  ? 354  LYS A CA    1 
ATOM   2171 C C     . LYS C 3 152 ? 6.792   -16.693 33.289 1.00 48.10  ? 354  LYS A C     1 
ATOM   2172 O O     . LYS C 3 152 ? 6.266   -15.603 33.151 1.00 51.20  ? 354  LYS A O     1 
ATOM   2173 C CB    . LYS C 3 152 ? 7.156   -16.620 35.703 1.00 49.63  ? 354  LYS A CB    1 
ATOM   2174 C CG    . LYS C 3 152 ? 7.925   -17.072 36.870 1.00 52.31  ? 354  LYS A CG    1 
ATOM   2175 C CD    . LYS C 3 152 ? 7.207   -16.673 38.108 1.00 58.53  ? 354  LYS A CD    1 
ATOM   2176 C CE    . LYS C 3 152 ? 8.085   -16.946 39.303 1.00 66.53  ? 354  LYS A CE    1 
ATOM   2177 N NZ    . LYS C 3 152 ? 7.468   -16.645 40.630 1.00 68.75  ? 354  LYS A NZ    1 
ATOM   2178 N N     . ILE C 3 153 ? 6.549   -17.735 32.503 1.00 48.43  ? 355  ILE A N     1 
ATOM   2179 C CA    . ILE C 3 153 ? 5.562   -17.743 31.431 1.00 45.98  ? 355  ILE A CA    1 
ATOM   2180 C C     . ILE C 3 153 ? 4.214   -17.188 31.925 1.00 44.43  ? 355  ILE A C     1 
ATOM   2181 O O     . ILE C 3 153 ? 3.798   -17.440 33.061 1.00 43.08  ? 355  ILE A O     1 
ATOM   2182 C CB    . ILE C 3 153 ? 5.360   -19.217 30.960 1.00 49.25  ? 355  ILE A CB    1 
ATOM   2183 C CG1   . ILE C 3 153 ? 6.346   -19.576 29.859 1.00 45.05  ? 355  ILE A CG1   1 
ATOM   2184 C CG2   . ILE C 3 153 ? 3.912   -19.493 30.565 1.00 52.53  ? 355  ILE A CG2   1 
ATOM   2185 C CD1   . ILE C 3 153 ? 6.106   -18.819 28.615 1.00 40.31  ? 355  ILE A CD1   1 
ATOM   2186 N N     . GLU C 3 154 ? 3.546   -16.429 31.060 1.00 42.84  ? 356  GLU A N     1 
ATOM   2187 C CA    . GLU C 3 154 ? 2.235   -15.874 31.382 1.00 46.56  ? 356  GLU A CA    1 
ATOM   2188 C C     . GLU C 3 154 ? 1.252   -17.035 31.529 1.00 46.13  ? 356  GLU A C     1 
ATOM   2189 O O     . GLU C 3 154 ? 1.050   -17.808 30.599 1.00 46.18  ? 356  GLU A O     1 
ATOM   2190 C CB    . GLU C 3 154 ? 1.767   -14.906 30.296 1.00 47.12  ? 356  GLU A CB    1 
ATOM   2191 C CG    . GLU C 3 154 ? 2.129   -13.469 30.594 1.00 49.09  ? 356  GLU A CG    1 
ATOM   2192 C CD    . GLU C 3 154 ? 1.908   -12.544 29.408 1.00 54.44  ? 356  GLU A CD    1 
ATOM   2193 O OE1   . GLU C 3 154 ? 2.693   -11.587 29.234 1.00 53.07  ? 356  GLU A OE1   1 
ATOM   2194 O OE2   . GLU C 3 154 ? 0.939   -12.752 28.651 1.00 55.79  ? 356  GLU A OE2   1 
ATOM   2195 N N     . PRO C 3 155 ? 0.666   -17.185 32.725 1.00 45.77  ? 357  PRO A N     1 
ATOM   2196 C CA    . PRO C 3 155 ? -0.296  -18.226 33.096 1.00 46.24  ? 357  PRO A CA    1 
ATOM   2197 C C     . PRO C 3 155 ? -1.632  -18.075 32.390 1.00 47.42  ? 357  PRO A C     1 
ATOM   2198 O O     . PRO C 3 155 ? -2.113  -16.954 32.225 1.00 52.06  ? 357  PRO A O     1 
ATOM   2199 C CB    . PRO C 3 155 ? -0.502  -17.987 34.599 1.00 40.65  ? 357  PRO A CB    1 
ATOM   2200 C CG    . PRO C 3 155 ? 0.579   -17.014 35.004 1.00 45.05  ? 357  PRO A CG    1 
ATOM   2201 C CD    . PRO C 3 155 ? 0.792   -16.191 33.801 1.00 46.15  ? 357  PRO A CD    1 
ATOM   2202 N N     . PRO C 3 156 ? -2.269  -19.193 31.994 1.00 46.69  ? 358  PRO A N     1 
ATOM   2203 C CA    . PRO C 3 156 ? -3.568  -19.050 31.329 1.00 46.89  ? 358  PRO A CA    1 
ATOM   2204 C C     . PRO C 3 156 ? -4.555  -18.391 32.306 1.00 46.19  ? 358  PRO A C     1 
ATOM   2205 O O     . PRO C 3 156 ? -4.375  -18.473 33.519 1.00 47.22  ? 358  PRO A O     1 
ATOM   2206 C CB    . PRO C 3 156 ? -3.953  -20.499 31.025 1.00 45.00  ? 358  PRO A CB    1 
ATOM   2207 C CG    . PRO C 3 156 ? -3.201  -21.290 32.065 1.00 44.41  ? 358  PRO A CG    1 
ATOM   2208 C CD    . PRO C 3 156 ? -1.874  -20.609 32.061 1.00 45.26  ? 358  PRO A CD    1 
ATOM   2209 N N     . GLY C 3 157 ? -5.564  -17.700 31.776 1.00 49.96  ? 359  GLY A N     1 
ATOM   2210 C CA    . GLY C 3 157 ? -6.557  -17.026 32.610 1.00 46.62  ? 359  GLY A CA    1 
ATOM   2211 C C     . GLY C 3 157 ? -7.495  -16.202 31.747 1.00 46.82  ? 359  GLY A C     1 
ATOM   2212 O O     . GLY C 3 157 ? -7.680  -16.499 30.561 1.00 50.85  ? 359  GLY A O     1 
ATOM   2213 N N     . LEU C 3 158 ? -8.070  -15.147 32.317 1.00 44.38  ? 360  LEU A N     1 
ATOM   2214 C CA    . LEU C 3 158 ? -8.994  -14.294 31.557 1.00 43.58  ? 360  LEU A CA    1 
ATOM   2215 C C     . LEU C 3 158 ? -8.411  -12.923 31.262 1.00 40.85  ? 360  LEU A C     1 
ATOM   2216 O O     . LEU C 3 158 ? -7.998  -12.224 32.181 1.00 38.96  ? 360  LEU A O     1 
ATOM   2217 C CB    . LEU C 3 158 ? -10.317 -14.122 32.308 1.00 44.28  ? 360  LEU A CB    1 
ATOM   2218 C CG    . LEU C 3 158 ? -11.159 -15.334 32.700 1.00 40.04  ? 360  LEU A CG    1 
ATOM   2219 C CD1   . LEU C 3 158 ? -12.438 -14.838 33.334 1.00 39.54  ? 360  LEU A CD1   1 
ATOM   2220 C CD2   . LEU C 3 158 ? -11.465 -16.221 31.512 1.00 31.06  ? 360  LEU A CD2   1 
ATOM   2221 N N     . PHE C 3 159 ? -8.428  -12.531 29.995 1.00 40.33  ? 361  PHE A N     1 
ATOM   2222 C CA    . PHE C 3 159 ? -7.877  -11.256 29.604 1.00 43.97  ? 361  PHE A CA    1 
ATOM   2223 C C     . PHE C 3 159 ? -8.449  -10.087 30.389 1.00 48.97  ? 361  PHE A C     1 
ATOM   2224 O O     . PHE C 3 159 ? -9.653  -9.984  30.567 1.00 46.65  ? 361  PHE A O     1 
ATOM   2225 C CB    . PHE C 3 159 ? -8.084  -11.005 28.123 1.00 45.11  ? 361  PHE A CB    1 
ATOM   2226 C CG    . PHE C 3 159 ? -7.554  -9.684  27.678 1.00 46.62  ? 361  PHE A CG    1 
ATOM   2227 C CD1   . PHE C 3 159 ? -6.220  -9.544  27.352 1.00 44.03  ? 361  PHE A CD1   1 
ATOM   2228 C CD2   . PHE C 3 159 ? -8.374  -8.563  27.661 1.00 45.78  ? 361  PHE A CD2   1 
ATOM   2229 C CE1   . PHE C 3 159 ? -5.707  -8.303  27.021 1.00 46.12  ? 361  PHE A CE1   1 
ATOM   2230 C CE2   . PHE C 3 159 ? -7.870  -7.321  27.329 1.00 44.91  ? 361  PHE A CE2   1 
ATOM   2231 C CZ    . PHE C 3 159 ? -6.532  -7.184  27.009 1.00 45.17  ? 361  PHE A CZ    1 
ATOM   2232 N N     . ARG C 3 160 ? -7.569  -9.174  30.780 1.00 56.49  ? 362  ARG A N     1 
ATOM   2233 C CA    . ARG C 3 160 ? -7.924  -7.982  31.544 1.00 61.36  ? 362  ARG A CA    1 
ATOM   2234 C C     . ARG C 3 160 ? -7.335  -6.706  30.898 1.00 64.79  ? 362  ARG A C     1 
ATOM   2235 O O     . ARG C 3 160 ? -6.242  -6.260  31.267 1.00 62.62  ? 362  ARG A O     1 
ATOM   2236 C CB    . ARG C 3 160 ? -7.374  -8.092  32.967 1.00 67.07  ? 362  ARG A CB    1 
ATOM   2237 C CG    . ARG C 3 160 ? -8.106  -9.039  33.893 1.00 79.50  ? 362  ARG A CG    1 
ATOM   2238 C CD    . ARG C 3 160 ? -7.471  -9.027  35.309 1.00 89.96  ? 362  ARG A CD    1 
ATOM   2239 N NE    . ARG C 3 160 ? -8.452  -8.791  36.383 1.00 100.11 ? 362  ARG A NE    1 
ATOM   2240 C CZ    . ARG C 3 160 ? -8.489  -9.451  37.548 1.00 103.34 ? 362  ARG A CZ    1 
ATOM   2241 N NH1   . ARG C 3 160 ? -7.593  -10.408 37.803 1.00 105.18 ? 362  ARG A NH1   1 
ATOM   2242 N NH2   . ARG C 3 160 ? -9.414  -9.144  38.468 1.00 103.52 ? 362  ARG A NH2   1 
ATOM   2243 N N     . GLY C 3 161 ? -8.019  -6.141  29.901 1.00 64.78  ? 363  GLY A N     1 
ATOM   2244 C CA    . GLY C 3 161 ? -7.497  -4.929  29.281 1.00 63.21  ? 363  GLY A CA    1 
ATOM   2245 C C     . GLY C 3 161 ? -7.752  -3.727  30.169 1.00 61.72  ? 363  GLY A C     1 
ATOM   2246 O O     . GLY C 3 161 ? -8.211  -3.887  31.299 1.00 63.67  ? 363  GLY A O     1 
ATOM   2247 N N     . ARG C 3 162 ? -7.394  -2.534  29.704 1.00 59.17  ? 364  ARG A N     1 
ATOM   2248 C CA    . ARG C 3 162 ? -7.655  -1.320  30.486 1.00 57.06  ? 364  ARG A CA    1 
ATOM   2249 C C     . ARG C 3 162 ? -8.899  -0.652  29.902 1.00 54.97  ? 364  ARG A C     1 
ATOM   2250 O O     . ARG C 3 162 ? -9.244  -0.862  28.727 1.00 53.72  ? 364  ARG A O     1 
ATOM   2251 C CB    . ARG C 3 162 ? -6.465  -0.326  30.455 1.00 59.97  ? 364  ARG A CB    1 
ATOM   2252 C CG    . ARG C 3 162 ? -5.192  -0.747  31.213 1.00 59.83  ? 364  ARG A CG    1 
ATOM   2253 C CD    . ARG C 3 162 ? -5.386  -0.856  32.745 1.00 60.86  ? 364  ARG A CD    1 
ATOM   2254 N NE    . ARG C 3 162 ? -4.313  -1.644  33.365 1.00 59.37  ? 364  ARG A NE    1 
ATOM   2255 C CZ    . ARG C 3 162 ? -3.293  -1.153  34.071 1.00 58.06  ? 364  ARG A CZ    1 
ATOM   2256 N NH1   . ARG C 3 162 ? -3.179  0.148   34.287 1.00 54.63  ? 364  ARG A NH1   1 
ATOM   2257 N NH2   . ARG C 3 162 ? -2.341  -1.974  34.512 1.00 61.95  ? 364  ARG A NH2   1 
ATOM   2258 N N     . GLY C 3 163 ? -9.589  0.105   30.749 1.00 52.69  ? 365  GLY A N     1 
ATOM   2259 C CA    . GLY C 3 163 ? -10.794 0.823   30.344 1.00 50.92  ? 365  GLY A CA    1 
ATOM   2260 C C     . GLY C 3 163 ? -11.942 0.045   29.724 1.00 46.94  ? 365  GLY A C     1 
ATOM   2261 O O     . GLY C 3 163 ? -12.339 -1.015  30.202 1.00 43.43  ? 365  GLY A O     1 
ATOM   2262 N N     . ASN C 3 164 ? -12.564 0.635   28.719 1.00 46.66  ? 366  ASN A N     1 
ATOM   2263 C CA    . ASN C 3 164 ? -13.634 -0.054  28.061 1.00 48.44  ? 366  ASN A CA    1 
ATOM   2264 C C     . ASN C 3 164 ? -13.006 -0.868  26.962 1.00 46.50  ? 366  ASN A C     1 
ATOM   2265 O O     . ASN C 3 164 ? -12.985 -0.479  25.792 1.00 42.92  ? 366  ASN A O     1 
ATOM   2266 C CB    . ASN C 3 164 ? -14.650 0.885   27.463 1.00 54.31  ? 366  ASN A CB    1 
ATOM   2267 C CG    . ASN C 3 164 ? -15.678 0.133   26.689 1.00 59.19  ? 366  ASN A CG    1 
ATOM   2268 O OD1   . ASN C 3 164 ? -15.640 0.077   25.453 1.00 65.63  ? 366  ASN A OD1   1 
ATOM   2269 N ND2   . ASN C 3 164 ? -16.506 -0.602  27.413 1.00 62.98  ? 366  ASN A ND2   1 
ATOM   2270 N N     . HIS C 3 165 ? -12.464 -2.006  27.359 1.00 47.16  ? 367  HIS A N     1 
ATOM   2271 C CA    . HIS C 3 165 ? -11.803 -2.892  26.425 1.00 46.87  ? 367  HIS A CA    1 
ATOM   2272 C C     . HIS C 3 165 ? -12.723 -3.937  25.793 1.00 44.65  ? 367  HIS A C     1 
ATOM   2273 O O     . HIS C 3 165 ? -13.435 -4.676  26.478 1.00 42.64  ? 367  HIS A O     1 
ATOM   2274 C CB    . HIS C 3 165 ? -10.596 -3.574  27.072 1.00 44.46  ? 367  HIS A CB    1 
ATOM   2275 C CG    . HIS C 3 165 ? -9.652  -4.139  26.070 1.00 45.59  ? 367  HIS A CG    1 
ATOM   2276 N ND1   . HIS C 3 165 ? -8.321  -3.788  26.021 1.00 49.21  ? 367  HIS A ND1   1 
ATOM   2277 C CD2   . HIS C 3 165 ? -9.869  -4.940  25.002 1.00 44.33  ? 367  HIS A CD2   1 
ATOM   2278 C CE1   . HIS C 3 165 ? -7.761  -4.340  24.959 1.00 47.24  ? 367  HIS A CE1   1 
ATOM   2279 N NE2   . HIS C 3 165 ? -8.682  -5.044  24.324 1.00 49.63  ? 367  HIS A NE2   1 
ATOM   2280 N N     . PRO C 3 166 ? -12.718 -3.999  24.457 1.00 43.50  ? 368  PRO A N     1 
ATOM   2281 C CA    . PRO C 3 166 ? -13.551 -4.957  23.729 1.00 41.70  ? 368  PRO A CA    1 
ATOM   2282 C C     . PRO C 3 166 ? -13.178 -6.426  23.858 1.00 43.56  ? 368  PRO A C     1 
ATOM   2283 O O     . PRO C 3 166 ? -13.947 -7.287  23.475 1.00 47.89  ? 368  PRO A O     1 
ATOM   2284 C CB    . PRO C 3 166 ? -13.448 -4.474  22.284 1.00 35.92  ? 368  PRO A CB    1 
ATOM   2285 C CG    . PRO C 3 166 ? -12.179 -3.716  22.246 1.00 38.51  ? 368  PRO A CG    1 
ATOM   2286 C CD    . PRO C 3 166 ? -12.185 -2.976  23.540 1.00 40.16  ? 368  PRO A CD    1 
ATOM   2287 N N     . LYS C 3 167 ? -11.998 -6.738  24.363 1.00 42.67  ? 369  LYS A N     1 
ATOM   2288 C CA    . LYS C 3 167 ? -11.667 -8.141  24.468 1.00 41.41  ? 369  LYS A CA    1 
ATOM   2289 C C     . LYS C 3 167 ? -11.655 -8.588  25.909 1.00 46.31  ? 369  LYS A C     1 
ATOM   2290 O O     . LYS C 3 167 ? -11.079 -9.624  26.233 1.00 48.35  ? 369  LYS A O     1 
ATOM   2291 C CB    . LYS C 3 167 ? -10.344 -8.430  23.773 1.00 36.46  ? 369  LYS A CB    1 
ATOM   2292 C CG    . LYS C 3 167 ? -10.276 -7.811  22.391 1.00 35.61  ? 369  LYS A CG    1 
ATOM   2293 C CD    . LYS C 3 167 ? -9.539  -8.677  21.436 1.00 30.23  ? 369  LYS A CD    1 
ATOM   2294 C CE    . LYS C 3 167 ? -9.701  -8.156  20.059 1.00 36.87  ? 369  LYS A CE    1 
ATOM   2295 N NZ    . LYS C 3 167 ? -9.627  -9.297  19.145 1.00 45.17  ? 369  LYS A NZ    1 
ATOM   2296 N N     . MET C 3 168 ? -12.282 -7.796  26.778 1.00 47.55  ? 370  MET A N     1 
ATOM   2297 C CA    . MET C 3 168 ? -12.339 -8.126  28.197 1.00 49.51  ? 370  MET A CA    1 
ATOM   2298 C C     . MET C 3 168 ? -13.031 -9.462  28.448 1.00 46.77  ? 370  MET A C     1 
ATOM   2299 O O     . MET C 3 168 ? -14.087 -9.735  27.892 1.00 47.00  ? 370  MET A O     1 
ATOM   2300 C CB    . MET C 3 168 ? -12.994 -6.991  29.010 1.00 54.80  ? 370  MET A CB    1 
ATOM   2301 C CG    . MET C 3 168 ? -14.474 -6.699  28.695 1.00 63.91  ? 370  MET A CG    1 
ATOM   2302 S SD    . MET C 3 168 ? -15.294 -5.302  29.687 1.00 67.75  ? 370  MET A SD    1 
ATOM   2303 C CE    . MET C 3 168 ? -14.371 -3.839  29.087 1.00 65.46  ? 370  MET A CE    1 
ATOM   2304 N N     . GLY C 3 169 ? -12.400 -10.299 29.264 1.00 44.53  ? 371  GLY A N     1 
ATOM   2305 C CA    . GLY C 3 169 ? -12.956 -11.603 29.581 1.00 44.57  ? 371  GLY A CA    1 
ATOM   2306 C C     . GLY C 3 169 ? -12.498 -12.772 28.725 1.00 45.39  ? 371  GLY A C     1 
ATOM   2307 O O     . GLY C 3 169 ? -12.712 -13.909 29.120 1.00 45.09  ? 371  GLY A O     1 
ATOM   2308 N N     . MET C 3 170 ? -11.913 -12.511 27.553 1.00 43.09  ? 372  MET A N     1 
ATOM   2309 C CA    . MET C 3 170 ? -11.439 -13.567 26.674 1.00 36.80  ? 372  MET A CA    1 
ATOM   2310 C C     . MET C 3 170 ? -10.370 -14.376 27.385 1.00 38.23  ? 372  MET A C     1 
ATOM   2311 O O     . MET C 3 170 ? -9.583  -13.851 28.178 1.00 40.70  ? 372  MET A O     1 
ATOM   2312 C CB    . MET C 3 170 ? -10.922 -12.997 25.352 1.00 35.69  ? 372  MET A CB    1 
ATOM   2313 C CG    . MET C 3 170 ? -11.990 -12.246 24.583 1.00 36.20  ? 372  MET A CG    1 
ATOM   2314 S SD    . MET C 3 170 ? -11.658 -11.797 22.898 1.00 40.97  ? 372  MET A SD    1 
ATOM   2315 C CE    . MET C 3 170 ? -10.570 -13.086 22.426 1.00 32.10  ? 372  MET A CE    1 
ATOM   2316 N N     . LEU C 3 171 ? -10.363 -15.668 27.108 1.00 36.23  ? 373  LEU A N     1 
ATOM   2317 C CA    . LEU C 3 171 ? -9.436  -16.578 27.740 1.00 33.57  ? 373  LEU A CA    1 
ATOM   2318 C C     . LEU C 3 171 ? -8.036  -16.541 27.211 1.00 34.97  ? 373  LEU A C     1 
ATOM   2319 O O     . LEU C 3 171 ? -7.822  -16.544 26.021 1.00 33.91  ? 373  LEU A O     1 
ATOM   2320 C CB    . LEU C 3 171 ? -9.949  -17.991 27.565 1.00 30.00  ? 373  LEU A CB    1 
ATOM   2321 C CG    . LEU C 3 171 ? -8.997  -19.061 28.074 1.00 33.41  ? 373  LEU A CG    1 
ATOM   2322 C CD1   . LEU C 3 171 ? -8.935  -19.033 29.571 1.00 30.32  ? 373  LEU A CD1   1 
ATOM   2323 C CD2   . LEU C 3 171 ? -9.439  -20.402 27.600 1.00 26.29  ? 373  LEU A CD2   1 
ATOM   2324 N N     . LYS C 3 172 ? -7.069  -16.504 28.101 1.00 38.21  ? 374  LYS A N     1 
ATOM   2325 C CA    . LYS C 3 172 ? -5.698  -16.578 27.656 1.00 40.67  ? 374  LYS A CA    1 
ATOM   2326 C C     . LYS C 3 172 ? -5.444  -18.065 27.771 1.00 45.33  ? 374  LYS A C     1 
ATOM   2327 O O     . LYS C 3 172 ? -5.786  -18.675 28.789 1.00 44.42  ? 374  LYS A O     1 
ATOM   2328 C CB    . LYS C 3 172 ? -4.793  -15.873 28.622 1.00 42.19  ? 374  LYS A CB    1 
ATOM   2329 C CG    . LYS C 3 172 ? -5.168  -14.460 28.861 1.00 47.40  ? 374  LYS A CG    1 
ATOM   2330 C CD    . LYS C 3 172 ? -4.173  -13.847 29.820 1.00 53.16  ? 374  LYS A CD    1 
ATOM   2331 C CE    . LYS C 3 172 ? -2.739  -14.002 29.290 1.00 53.79  ? 374  LYS A CE    1 
ATOM   2332 N NZ    . LYS C 3 172 ? -1.717  -13.225 30.066 1.00 51.69  ? 374  LYS A NZ    1 
ATOM   2333 N N     . ARG C 3 173 ? -4.938  -18.670 26.704 1.00 50.40  ? 375  ARG A N     1 
ATOM   2334 C CA    . ARG C 3 173 ? -4.631  -20.110 26.682 1.00 54.33  ? 375  ARG A CA    1 
ATOM   2335 C C     . ARG C 3 173 ? -3.319  -20.419 27.426 1.00 51.54  ? 375  ARG A C     1 
ATOM   2336 O O     . ARG C 3 173 ? -2.591  -19.528 27.838 1.00 51.52  ? 375  ARG A O     1 
ATOM   2337 C CB    . ARG C 3 173 ? -4.448  -20.578 25.238 1.00 59.81  ? 375  ARG A CB    1 
ATOM   2338 C CG    . ARG C 3 173 ? -3.061  -20.215 24.710 1.00 72.11  ? 375  ARG A CG    1 
ATOM   2339 C CD    . ARG C 3 173 ? -2.828  -20.591 23.253 1.00 80.44  ? 375  ARG A CD    1 
ATOM   2340 N NE    . ARG C 3 173 ? -1.470  -20.232 22.801 1.00 86.90  ? 375  ARG A NE    1 
ATOM   2341 C CZ    . ARG C 3 173 ? -0.923  -19.009 22.870 1.00 88.50  ? 375  ARG A CZ    1 
ATOM   2342 N NH1   . ARG C 3 173 ? -1.592  -17.979 23.390 1.00 88.37  ? 375  ARG A NH1   1 
ATOM   2343 N NH2   . ARG C 3 173 ? 0.288   -18.797 22.356 1.00 91.49  ? 375  ARG A NH2   1 
ATOM   2344 N N     . ARG C 3 174 ? -3.017  -21.701 27.559 1.00 50.43  ? 376  ARG A N     1 
ATOM   2345 C CA    . ARG C 3 174 ? -1.787  -22.126 28.204 1.00 48.22  ? 376  ARG A CA    1 
ATOM   2346 C C     . ARG C 3 174 ? -0.780  -22.181 27.095 1.00 48.20  ? 376  ARG A C     1 
ATOM   2347 O O     . ARG C 3 174 ? -1.077  -22.730 26.019 1.00 48.79  ? 376  ARG A O     1 
ATOM   2348 C CB    . ARG C 3 174 ? -1.949  -23.513 28.787 1.00 48.35  ? 376  ARG A CB    1 
ATOM   2349 C CG    . ARG C 3 174 ? -0.730  -24.047 29.459 1.00 47.78  ? 376  ARG A CG    1 
ATOM   2350 C CD    . ARG C 3 174 ? -1.099  -25.290 30.245 1.00 43.24  ? 376  ARG A CD    1 
ATOM   2351 N NE    . ARG C 3 174 ? -2.116  -25.020 31.254 1.00 38.16  ? 376  ARG A NE    1 
ATOM   2352 C CZ    . ARG C 3 174 ? -1.892  -25.030 32.565 1.00 39.99  ? 376  ARG A CZ    1 
ATOM   2353 N NH1   . ARG C 3 174 ? -0.677  -25.291 33.036 1.00 36.78  ? 376  ARG A NH1   1 
ATOM   2354 N NH2   . ARG C 3 174 ? -2.889  -24.820 33.416 1.00 30.64  ? 376  ARG A NH2   1 
ATOM   2355 N N     . ILE C 3 175 ? 0.385   -21.590 27.334 1.00 48.68  ? 377  ILE A N     1 
ATOM   2356 C CA    . ILE C 3 175 ? 1.440   -21.567 26.337 1.00 50.97  ? 377  ILE A CA    1 
ATOM   2357 C C     . ILE C 3 175 ? 2.211   -22.857 26.437 1.00 49.20  ? 377  ILE A C     1 
ATOM   2358 O O     . ILE C 3 175 ? 2.682   -23.234 27.502 1.00 52.00  ? 377  ILE A O     1 
ATOM   2359 C CB    . ILE C 3 175 ? 2.465   -20.377 26.533 1.00 54.64  ? 377  ILE A CB    1 
ATOM   2360 C CG1   . ILE C 3 175 ? 1.733   -19.039 26.770 1.00 53.05  ? 377  ILE A CG1   1 
ATOM   2361 C CG2   . ILE C 3 175 ? 3.405   -20.263 25.289 1.00 53.17  ? 377  ILE A CG2   1 
ATOM   2362 C CD1   . ILE C 3 175 ? 0.908   -18.566 25.572 1.00 53.12  ? 377  ILE A CD1   1 
ATOM   2363 N N     . MET C 3 176 ? 2.291   -23.565 25.327 1.00 47.27  ? 378  MET A N     1 
ATOM   2364 C CA    . MET C 3 176 ? 3.055   -24.797 25.305 1.00 49.41  ? 378  MET A CA    1 
ATOM   2365 C C     . MET C 3 176 ? 4.417   -24.477 24.717 1.00 45.98  ? 378  MET A C     1 
ATOM   2366 O O     . MET C 3 176 ? 4.614   -23.440 24.080 1.00 37.35  ? 378  MET A O     1 
ATOM   2367 C CB    . MET C 3 176 ? 2.368   -25.843 24.434 1.00 52.14  ? 378  MET A CB    1 
ATOM   2368 C CG    . MET C 3 176 ? 1.004   -26.140 24.909 1.00 54.28  ? 378  MET A CG    1 
ATOM   2369 S SD    . MET C 3 176 ? 1.155   -26.662 26.609 1.00 63.29  ? 378  MET A SD    1 
ATOM   2370 C CE    . MET C 3 176 ? 0.704   -28.402 26.430 1.00 58.19  ? 378  MET A CE    1 
ATOM   2371 N N     . PRO C 3 177 ? 5.389   -25.344 24.985 1.00 44.70  ? 379  PRO A N     1 
ATOM   2372 C CA    . PRO C 3 177 ? 6.770   -25.235 24.509 1.00 45.83  ? 379  PRO A CA    1 
ATOM   2373 C C     . PRO C 3 177 ? 6.750   -25.135 22.991 1.00 45.59  ? 379  PRO A C     1 
ATOM   2374 O O     . PRO C 3 177 ? 7.633   -24.525 22.373 1.00 42.71  ? 379  PRO A O     1 
ATOM   2375 C CB    . PRO C 3 177 ? 7.381   -26.548 24.977 1.00 46.80  ? 379  PRO A CB    1 
ATOM   2376 C CG    . PRO C 3 177 ? 6.702   -26.745 26.306 1.00 47.59  ? 379  PRO A CG    1 
ATOM   2377 C CD    . PRO C 3 177 ? 5.253   -26.395 26.009 1.00 43.88  ? 379  PRO A CD    1 
ATOM   2378 N N     . GLU C 3 178 ? 5.721   -25.735 22.403 1.00 45.89  ? 380  GLU A N     1 
ATOM   2379 C CA    . GLU C 3 178 ? 5.551   -25.696 20.967 1.00 47.44  ? 380  GLU A CA    1 
ATOM   2380 C C     . GLU C 3 178 ? 5.152   -24.292 20.506 1.00 49.84  ? 380  GLU A C     1 
ATOM   2381 O O     . GLU C 3 178 ? 5.091   -24.024 19.306 1.00 55.08  ? 380  GLU A O     1 
ATOM   2382 C CB    . GLU C 3 178 ? 4.518   -26.723 20.512 1.00 46.97  ? 380  GLU A CB    1 
ATOM   2383 C CG    . GLU C 3 178 ? 5.020   -28.164 20.444 1.00 49.02  ? 380  GLU A CG    1 
ATOM   2384 C CD    . GLU C 3 178 ? 5.159   -28.823 21.800 1.00 51.86  ? 380  GLU A CD    1 
ATOM   2385 O OE1   . GLU C 3 178 ? 5.871   -29.855 21.886 1.00 51.74  ? 380  GLU A OE1   1 
ATOM   2386 O OE2   . GLU C 3 178 ? 4.549   -28.315 22.772 1.00 51.50  ? 380  GLU A OE2   1 
ATOM   2387 N N     . ASP C 3 179 ? 4.884   -23.395 21.446 1.00 48.97  ? 381  ASP A N     1 
ATOM   2388 C CA    . ASP C 3 179 ? 4.525   -22.021 21.103 1.00 52.03  ? 381  ASP A CA    1 
ATOM   2389 C C     . ASP C 3 179 ? 5.712   -21.065 21.262 1.00 50.23  ? 381  ASP A C     1 
ATOM   2390 O O     . ASP C 3 179 ? 5.684   -19.929 20.786 1.00 51.23  ? 381  ASP A O     1 
ATOM   2391 C CB    . ASP C 3 179 ? 3.425   -21.520 22.041 1.00 57.19  ? 381  ASP A CB    1 
ATOM   2392 C CG    . ASP C 3 179 ? 2.166   -22.359 21.979 1.00 62.13  ? 381  ASP A CG    1 
ATOM   2393 O OD1   . ASP C 3 179 ? 1.576   -22.644 23.040 1.00 61.59  ? 381  ASP A OD1   1 
ATOM   2394 O OD2   . ASP C 3 179 ? 1.732   -22.704 20.864 1.00 67.32  ? 381  ASP A OD2   1 
ATOM   2395 N N     . ILE C 3 180 ? 6.704   -21.509 22.021 1.00 47.11  ? 382  ILE A N     1 
ATOM   2396 C CA    . ILE C 3 180 ? 7.866   -20.722 22.353 1.00 42.35  ? 382  ILE A CA    1 
ATOM   2397 C C     . ILE C 3 180 ? 8.976   -20.745 21.334 1.00 44.75  ? 382  ILE A C     1 
ATOM   2398 O O     . ILE C 3 180 ? 9.329   -21.782 20.763 1.00 44.59  ? 382  ILE A O     1 
ATOM   2399 C CB    . ILE C 3 180 ? 8.484   -21.236 23.659 1.00 41.82  ? 382  ILE A CB    1 
ATOM   2400 C CG1   . ILE C 3 180 ? 7.425   -21.354 24.760 1.00 38.74  ? 382  ILE A CG1   1 
ATOM   2401 C CG2   . ILE C 3 180 ? 9.665   -20.397 24.062 1.00 39.09  ? 382  ILE A CG2   1 
ATOM   2402 C CD1   . ILE C 3 180 ? 7.150   -20.122 25.559 1.00 35.01  ? 382  ILE A CD1   1 
ATOM   2403 N N     . ILE C 3 181 ? 9.582   -19.586 21.179 1.00 44.43  ? 383  ILE A N     1 
ATOM   2404 C CA    . ILE C 3 181 ? 10.713  -19.444 20.304 1.00 45.27  ? 383  ILE A CA    1 
ATOM   2405 C C     . ILE C 3 181 ? 11.868  -19.132 21.208 1.00 45.88  ? 383  ILE A C     1 
ATOM   2406 O O     . ILE C 3 181 ? 11.743  -18.305 22.119 1.00 48.88  ? 383  ILE A O     1 
ATOM   2407 C CB    . ILE C 3 181 ? 10.566  -18.291 19.364 1.00 46.74  ? 383  ILE A CB    1 
ATOM   2408 C CG1   . ILE C 3 181 ? 9.530   -18.635 18.317 1.00 45.24  ? 383  ILE A CG1   1 
ATOM   2409 C CG2   . ILE C 3 181 ? 11.906  -17.973 18.726 1.00 44.71  ? 383  ILE A CG2   1 
ATOM   2410 C CD1   . ILE C 3 181 ? 9.357   -17.570 17.335 1.00 43.75  ? 383  ILE A CD1   1 
ATOM   2411 N N     . ILE C 3 182 ? 12.981  -19.808 20.964 1.00 43.97  ? 384  ILE A N     1 
ATOM   2412 C CA    . ILE C 3 182 ? 14.167  -19.601 21.758 1.00 44.93  ? 384  ILE A CA    1 
ATOM   2413 C C     . ILE C 3 182 ? 15.178  -18.744 21.014 1.00 42.68  ? 384  ILE A C     1 
ATOM   2414 O O     . ILE C 3 182 ? 15.400  -18.944 19.825 1.00 44.33  ? 384  ILE A O     1 
ATOM   2415 C CB    . ILE C 3 182 ? 14.824  -20.937 22.116 1.00 44.19  ? 384  ILE A CB    1 
ATOM   2416 C CG1   . ILE C 3 182 ? 13.816  -21.848 22.820 1.00 44.58  ? 384  ILE A CG1   1 
ATOM   2417 C CG2   . ILE C 3 182 ? 16.067  -20.694 22.961 1.00 45.99  ? 384  ILE A CG2   1 
ATOM   2418 C CD1   . ILE C 3 182 ? 13.275  -21.331 24.168 1.00 34.60  ? 384  ILE A CD1   1 
ATOM   2419 N N     . ASN C 3 183 ? 15.727  -17.744 21.686 1.00 38.18  ? 385  ASN A N     1 
ATOM   2420 C CA    . ASN C 3 183 ? 16.748  -16.945 21.055 1.00 39.24  ? 385  ASN A CA    1 
ATOM   2421 C C     . ASN C 3 183 ? 18.013  -17.132 21.878 1.00 41.04  ? 385  ASN A C     1 
ATOM   2422 O O     . ASN C 3 183 ? 17.976  -16.942 23.084 1.00 41.54  ? 385  ASN A O     1 
ATOM   2423 C CB    . ASN C 3 183 ? 16.367  -15.476 21.006 1.00 39.82  ? 385  ASN A CB    1 
ATOM   2424 C CG    . ASN C 3 183 ? 17.232  -14.687 20.031 1.00 44.43  ? 385  ASN A CG    1 
ATOM   2425 O OD1   . ASN C 3 183 ? 17.531  -15.149 18.931 1.00 43.43  ? 385  ASN A OD1   1 
ATOM   2426 N ND2   . ASN C 3 183 ? 17.623  -13.487 20.425 1.00 45.35  ? 385  ASN A ND2   1 
ATOM   2427 N N     . CYS C 3 184 ? 19.097  -17.591 21.252 1.00 38.13  ? 386  CYS A N     1 
ATOM   2428 C CA    . CYS C 3 184 ? 20.370  -17.777 21.953 1.00 42.44  ? 386  CYS A CA    1 
ATOM   2429 C C     . CYS C 3 184 ? 21.521  -17.910 20.953 1.00 42.65  ? 386  CYS A C     1 
ATOM   2430 O O     . CYS C 3 184 ? 21.296  -18.083 19.760 1.00 38.66  ? 386  CYS A O     1 
ATOM   2431 C CB    . CYS C 3 184 ? 20.322  -19.017 22.832 1.00 43.89  ? 386  CYS A CB    1 
ATOM   2432 S SG    . CYS C 3 184 ? 20.182  -20.528 21.856 1.00 50.72  ? 386  CYS A SG    1 
ATOM   2433 N N     . SER C 3 185 ? 22.750  -17.766 21.431 1.00 43.51  ? 387  SER A N     1 
ATOM   2434 C CA    . SER C 3 185 ? 23.904  -17.881 20.553 1.00 46.69  ? 387  SER A CA    1 
ATOM   2435 C C     . SER C 3 185 ? 24.125  -19.326 20.121 1.00 49.33  ? 387  SER A C     1 
ATOM   2436 O O     . SER C 3 185 ? 24.016  -20.253 20.921 1.00 49.59  ? 387  SER A O     1 
ATOM   2437 C CB    . SER C 3 185 ? 25.149  -17.329 21.230 1.00 43.12  ? 387  SER A CB    1 
ATOM   2438 O OG    . SER C 3 185 ? 25.360  -17.965 22.470 1.00 45.66  ? 387  SER A OG    1 
ATOM   2439 N N     . LYS C 3 186 ? 24.460  -19.502 18.852 1.00 50.78  ? 388  LYS A N     1 
ATOM   2440 C CA    . LYS C 3 186 ? 24.668  -20.823 18.266 1.00 54.25  ? 388  LYS A CA    1 
ATOM   2441 C C     . LYS C 3 186 ? 25.557  -21.779 19.066 1.00 51.54  ? 388  LYS A C     1 
ATOM   2442 O O     . LYS C 3 186 ? 25.407  -22.999 19.032 1.00 53.92  ? 388  LYS A O     1 
ATOM   2443 C CB    . LYS C 3 186 ? 25.273  -20.660 16.871 1.00 59.77  ? 388  LYS A CB    1 
ATOM   2444 C CG    . LYS C 3 186 ? 24.564  -19.660 15.944 1.00 70.11  ? 388  LYS A CG    1 
ATOM   2445 C CD    . LYS C 3 186 ? 25.151  -19.700 14.509 1.00 78.20  ? 388  LYS A CD    1 
ATOM   2446 C CE    . LYS C 3 186 ? 24.310  -18.929 13.465 1.00 80.96  ? 388  LYS A CE    1 
ATOM   2447 N NZ    . LYS C 3 186 ? 24.751  -19.247 12.061 1.00 85.07  ? 388  LYS A NZ    1 
ATOM   2448 N N     . ASP C 3 187 ? 26.590  -21.205 19.644 1.00 46.80  ? 389  ASP A N     1 
ATOM   2449 C CA    . ASP C 3 187 ? 27.558  -21.944 20.414 1.00 42.87  ? 389  ASP A CA    1 
ATOM   2450 C C     . ASP C 3 187 ? 27.096  -22.183 21.814 1.00 40.11  ? 389  ASP A C     1 
ATOM   2451 O O     . ASP C 3 187 ? 27.824  -22.716 22.630 1.00 43.35  ? 389  ASP A O     1 
ATOM   2452 C CB    . ASP C 3 187 ? 28.848  -21.140 20.473 1.00 46.17  ? 389  ASP A CB    1 
ATOM   2453 C CG    . ASP C 3 187 ? 28.631  -19.698 20.970 1.00 48.38  ? 389  ASP A CG    1 
ATOM   2454 O OD1   . ASP C 3 187 ? 29.639  -19.048 21.283 1.00 47.24  ? 389  ASP A OD1   1 
ATOM   2455 O OD2   . ASP C 3 187 ? 27.478  -19.205 21.047 1.00 52.06  ? 389  ASP A OD2   1 
ATOM   2456 N N     . ALA C 3 188 ? 25.943  -21.649 22.151 1.00 39.14  ? 390  ALA A N     1 
ATOM   2457 C CA    . ALA C 3 188 ? 25.466  -21.852 23.493 1.00 39.45  ? 390  ALA A CA    1 
ATOM   2458 C C     . ALA C 3 188 ? 24.687  -23.163 23.625 1.00 40.91  ? 390  ALA A C     1 
ATOM   2459 O O     . ALA C 3 188 ? 24.306  -23.790 22.641 1.00 40.65  ? 390  ALA A O     1 
ATOM   2460 C CB    . ALA C 3 188 ? 24.645  -20.676 23.926 1.00 39.34  ? 390  ALA A CB    1 
ATOM   2461 N N     . LYS C 3 189 ? 24.596  -23.643 24.855 1.00 43.54  ? 391  LYS A N     1 
ATOM   2462 C CA    . LYS C 3 189 ? 23.858  -24.856 25.160 1.00 46.25  ? 391  LYS A CA    1 
ATOM   2463 C C     . LYS C 3 189 ? 22.382  -24.491 25.087 1.00 46.52  ? 391  LYS A C     1 
ATOM   2464 O O     . LYS C 3 189 ? 21.932  -23.516 25.693 1.00 43.57  ? 391  LYS A O     1 
ATOM   2465 C CB    . LYS C 3 189 ? 24.194  -25.354 26.566 1.00 49.86  ? 391  LYS A CB    1 
ATOM   2466 C CG    . LYS C 3 189 ? 23.467  -26.642 26.980 1.00 54.54  ? 391  LYS A CG    1 
ATOM   2467 C CD    . LYS C 3 189 ? 23.645  -26.925 28.493 1.00 60.74  ? 391  LYS A CD    1 
ATOM   2468 C CE    . LYS C 3 189 ? 22.876  -28.180 28.983 1.00 67.05  ? 391  LYS A CE    1 
ATOM   2469 N NZ    . LYS C 3 189 ? 23.021  -28.473 30.466 1.00 70.04  ? 391  LYS A NZ    1 
ATOM   2470 N N     . VAL C 3 190 ? 21.647  -25.284 24.322 1.00 45.46  ? 392  VAL A N     1 
ATOM   2471 C CA    . VAL C 3 190 ? 20.236  -25.062 24.131 1.00 41.97  ? 392  VAL A CA    1 
ATOM   2472 C C     . VAL C 3 190 ? 19.449  -25.630 25.266 1.00 40.80  ? 392  VAL A C     1 
ATOM   2473 O O     . VAL C 3 190 ? 19.635  -26.779 25.651 1.00 40.75  ? 392  VAL A O     1 
ATOM   2474 C CB    . VAL C 3 190 ? 19.762  -25.710 22.845 1.00 41.86  ? 392  VAL A CB    1 
ATOM   2475 C CG1   . VAL C 3 190 ? 18.301  -25.465 22.642 1.00 45.20  ? 392  VAL A CG1   1 
ATOM   2476 C CG2   . VAL C 3 190 ? 20.532  -25.154 21.691 1.00 43.60  ? 392  VAL A CG2   1 
ATOM   2477 N N     . PRO C 3 191 ? 18.546  -24.830 25.815 1.00 40.20  ? 393  PRO A N     1 
ATOM   2478 C CA    . PRO C 3 191 ? 17.769  -25.366 26.908 1.00 41.77  ? 393  PRO A CA    1 
ATOM   2479 C C     . PRO C 3 191 ? 16.918  -26.473 26.317 1.00 45.39  ? 393  PRO A C     1 
ATOM   2480 O O     . PRO C 3 191 ? 16.581  -26.501 25.127 1.00 41.13  ? 393  PRO A O     1 
ATOM   2481 C CB    . PRO C 3 191 ? 16.969  -24.163 27.378 1.00 42.92  ? 393  PRO A CB    1 
ATOM   2482 C CG    . PRO C 3 191 ? 16.808  -23.372 26.131 1.00 42.17  ? 393  PRO A CG    1 
ATOM   2483 C CD    . PRO C 3 191 ? 18.148  -23.454 25.505 1.00 37.78  ? 393  PRO A CD    1 
ATOM   2484 N N     . SER C 3 192 ? 16.663  -27.444 27.157 1.00 51.19  ? 394  SER A N     1 
ATOM   2485 C CA    . SER C 3 192 ? 15.912  -28.607 26.788 1.00 53.66  ? 394  SER A CA    1 
ATOM   2486 C C     . SER C 3 192 ? 14.467  -28.369 27.102 1.00 50.64  ? 394  SER A C     1 
ATOM   2487 O O     . SER C 3 192 ? 14.140  -27.934 28.195 1.00 53.59  ? 394  SER A O     1 
ATOM   2488 C CB    . SER C 3 192 ? 16.382  -29.792 27.635 1.00 57.28  ? 394  SER A CB    1 
ATOM   2489 O OG    . SER C 3 192 ? 17.787  -29.764 27.863 1.00 65.80  ? 394  SER A OG    1 
ATOM   2490 N N     . PRO C 3 193 ? 13.585  -28.577 26.124 1.00 46.97  ? 395  PRO A N     1 
ATOM   2491 C CA    . PRO C 3 193 ? 12.174  -28.374 26.418 1.00 43.95  ? 395  PRO A CA    1 
ATOM   2492 C C     . PRO C 3 193 ? 11.730  -29.465 27.375 1.00 45.87  ? 395  PRO A C     1 
ATOM   2493 O O     . PRO C 3 193 ? 12.420  -30.456 27.561 1.00 46.38  ? 395  PRO A O     1 
ATOM   2494 C CB    . PRO C 3 193 ? 11.525  -28.560 25.066 1.00 41.77  ? 395  PRO A CB    1 
ATOM   2495 C CG    . PRO C 3 193 ? 12.476  -29.449 24.348 1.00 45.46  ? 395  PRO A CG    1 
ATOM   2496 C CD    . PRO C 3 193 ? 13.787  -28.842 24.697 1.00 44.52  ? 395  PRO A CD    1 
ATOM   2497 N N     . PRO C 3 194 ? 10.594  -29.267 28.044 1.00 49.32  ? 396  PRO A N     1 
ATOM   2498 C CA    . PRO C 3 194 ? 10.076  -30.259 28.984 1.00 51.38  ? 396  PRO A CA    1 
ATOM   2499 C C     . PRO C 3 194 ? 9.887   -31.571 28.243 1.00 52.37  ? 396  PRO A C     1 
ATOM   2500 O O     . PRO C 3 194 ? 9.577   -31.580 27.044 1.00 51.08  ? 396  PRO A O     1 
ATOM   2501 C CB    . PRO C 3 194 ? 8.722   -29.679 29.377 1.00 50.96  ? 396  PRO A CB    1 
ATOM   2502 C CG    . PRO C 3 194 ? 8.965   -28.233 29.332 1.00 56.70  ? 396  PRO A CG    1 
ATOM   2503 C CD    . PRO C 3 194 ? 9.724   -28.082 28.018 1.00 54.44  ? 396  PRO A CD    1 
ATOM   2504 N N     . PRO C 3 195 ? 10.001  -32.692 28.973 1.00 55.65  ? 397  PRO A N     1 
ATOM   2505 C CA    . PRO C 3 195 ? 9.855   -34.047 28.436 1.00 58.66  ? 397  PRO A CA    1 
ATOM   2506 C C     . PRO C 3 195 ? 8.569   -34.233 27.625 1.00 60.05  ? 397  PRO A C     1 
ATOM   2507 O O     . PRO C 3 195 ? 7.457   -33.975 28.115 1.00 59.48  ? 397  PRO A O     1 
ATOM   2508 C CB    . PRO C 3 195 ? 9.867   -34.914 29.699 1.00 58.72  ? 397  PRO A CB    1 
ATOM   2509 C CG    . PRO C 3 195 ? 10.765  -34.143 30.617 1.00 55.32  ? 397  PRO A CG    1 
ATOM   2510 C CD    . PRO C 3 195 ? 10.242  -32.738 30.428 1.00 55.47  ? 397  PRO A CD    1 
ATOM   2511 N N     . GLY C 3 196 ? 8.759   -34.707 26.393 1.00 62.81  ? 398  GLY A N     1 
ATOM   2512 C CA    . GLY C 3 196 ? 7.666   -34.957 25.471 1.00 61.98  ? 398  GLY A CA    1 
ATOM   2513 C C     . GLY C 3 196 ? 7.380   -33.766 24.593 1.00 63.49  ? 398  GLY A C     1 
ATOM   2514 O O     . GLY C 3 196 ? 6.424   -33.786 23.816 1.00 66.10  ? 398  GLY A O     1 
ATOM   2515 N N     . HIS C 3 197 ? 8.243   -32.754 24.643 1.00 64.68  ? 399  HIS A N     1 
ATOM   2516 C CA    . HIS C 3 197 ? 8.000   -31.556 23.848 1.00 65.02  ? 399  HIS A CA    1 
ATOM   2517 C C     . HIS C 3 197 ? 9.082   -31.078 22.890 1.00 63.63  ? 399  HIS A C     1 
ATOM   2518 O O     . HIS C 3 197 ? 10.113  -31.735 22.723 1.00 66.76  ? 399  HIS A O     1 
ATOM   2519 C CB    . HIS C 3 197 ? 7.551   -30.438 24.783 1.00 66.85  ? 399  HIS A CB    1 
ATOM   2520 C CG    . HIS C 3 197 ? 6.172   -30.646 25.323 1.00 68.36  ? 399  HIS A CG    1 
ATOM   2521 N ND1   . HIS C 3 197 ? 5.908   -31.416 26.435 1.00 67.71  ? 399  HIS A ND1   1 
ATOM   2522 C CD2   . HIS C 3 197 ? 4.959   -30.240 24.852 1.00 65.90  ? 399  HIS A CD2   1 
ATOM   2523 C CE1   . HIS C 3 197 ? 4.597   -31.486 26.625 1.00 69.54  ? 399  HIS A CE1   1 
ATOM   2524 N NE2   . HIS C 3 197 ? 4.006   -30.777 25.674 1.00 69.01  ? 399  HIS A NE2   1 
ATOM   2525 N N     . LYS C 3 198 ? 8.781   -29.994 22.178 1.00 59.86  ? 400  LYS A N     1 
ATOM   2526 C CA    . LYS C 3 198 ? 9.717   -29.383 21.234 1.00 60.78  ? 400  LYS A CA    1 
ATOM   2527 C C     . LYS C 3 198 ? 9.483   -27.881 21.232 1.00 56.52  ? 400  LYS A C     1 
ATOM   2528 O O     . LYS C 3 198 ? 8.378   -27.452 21.534 1.00 61.71  ? 400  LYS A O     1 
ATOM   2529 C CB    . LYS C 3 198 ? 9.523   -29.945 19.822 1.00 67.48  ? 400  LYS A CB    1 
ATOM   2530 C CG    . LYS C 3 198 ? 10.089  -31.364 19.642 1.00 77.67  ? 400  LYS A CG    1 
ATOM   2531 C CD    . LYS C 3 198 ? 10.048  -31.863 18.184 1.00 86.74  ? 400  LYS A CD    1 
ATOM   2532 C CE    . LYS C 3 198 ? 10.379  -33.386 18.072 1.00 92.70  ? 400  LYS A CE    1 
ATOM   2533 N NZ    . LYS C 3 198 ? 10.233  -33.986 16.676 1.00 95.10  ? 400  LYS A NZ    1 
ATOM   2534 N N     . TRP C 3 199 ? 10.526  -27.084 21.010 1.00 51.97  ? 401  TRP A N     1 
ATOM   2535 C CA    . TRP C 3 199 ? 10.386  -25.627 20.972 1.00 46.90  ? 401  TRP A CA    1 
ATOM   2536 C C     . TRP C 3 199 ? 9.754   -25.360 19.640 1.00 46.94  ? 401  TRP A C     1 
ATOM   2537 O O     . TRP C 3 199 ? 9.810   -26.218 18.752 1.00 45.86  ? 401  TRP A O     1 
ATOM   2538 C CB    . TRP C 3 199 ? 11.748  -24.921 20.986 1.00 43.04  ? 401  TRP A CB    1 
ATOM   2539 C CG    . TRP C 3 199 ? 12.544  -25.152 22.204 1.00 38.49  ? 401  TRP A CG    1 
ATOM   2540 C CD1   . TRP C 3 199 ? 13.778  -25.720 22.285 1.00 40.47  ? 401  TRP A CD1   1 
ATOM   2541 C CD2   . TRP C 3 199 ? 12.166  -24.832 23.533 1.00 37.64  ? 401  TRP A CD2   1 
ATOM   2542 N NE1   . TRP C 3 199 ? 14.198  -25.778 23.594 1.00 39.10  ? 401  TRP A NE1   1 
ATOM   2543 C CE2   . TRP C 3 199 ? 13.221  -25.236 24.380 1.00 40.81  ? 401  TRP A CE2   1 
ATOM   2544 C CE3   . TRP C 3 199 ? 11.037  -24.242 24.096 1.00 39.39  ? 401  TRP A CE3   1 
ATOM   2545 C CZ2   . TRP C 3 199 ? 13.177  -25.069 25.756 1.00 44.30  ? 401  TRP A CZ2   1 
ATOM   2546 C CZ3   . TRP C 3 199 ? 10.993  -24.078 25.470 1.00 42.39  ? 401  TRP A CZ3   1 
ATOM   2547 C CH2   . TRP C 3 199 ? 12.056  -24.490 26.286 1.00 42.82  ? 401  TRP A CH2   1 
ATOM   2548 N N     . LYS C 3 200 ? 9.146   -24.194 19.488 1.00 45.72  ? 402  LYS A N     1 
ATOM   2549 C CA    . LYS C 3 200 ? 8.556   -23.873 18.204 1.00 48.22  ? 402  LYS A CA    1 
ATOM   2550 C C     . LYS C 3 200 ? 9.742   -23.655 17.288 1.00 49.38  ? 402  LYS A C     1 
ATOM   2551 O O     . LYS C 3 200 ? 9.814   -24.172 16.175 1.00 52.34  ? 402  LYS A O     1 
ATOM   2552 C CB    . LYS C 3 200 ? 7.715   -22.590 18.264 1.00 52.54  ? 402  LYS A CB    1 
ATOM   2553 C CG    . LYS C 3 200 ? 7.307   -22.094 16.879 1.00 57.84  ? 402  LYS A CG    1 
ATOM   2554 C CD    . LYS C 3 200 ? 6.355   -20.886 16.832 1.00 62.39  ? 402  LYS A CD    1 
ATOM   2555 C CE    . LYS C 3 200 ? 5.881   -20.683 15.362 1.00 67.42  ? 402  LYS A CE    1 
ATOM   2556 N NZ    . LYS C 3 200 ? 4.833   -19.645 15.099 1.00 71.58  ? 402  LYS A NZ    1 
ATOM   2557 N N     . GLU C 3 201 ? 10.716  -22.926 17.795 1.00 49.55  ? 403  GLU A N     1 
ATOM   2558 C CA    . GLU C 3 201 ? 11.876  -22.636 17.005 1.00 45.73  ? 403  GLU A CA    1 
ATOM   2559 C C     . GLU C 3 201 ? 13.001  -22.288 17.919 1.00 46.60  ? 403  GLU A C     1 
ATOM   2560 O O     . GLU C 3 201 ? 12.823  -22.020 19.105 1.00 46.53  ? 403  GLU A O     1 
ATOM   2561 C CB    . GLU C 3 201 ? 11.590  -21.452 16.110 1.00 43.07  ? 403  GLU A CB    1 
ATOM   2562 C CG    . GLU C 3 201 ? 12.751  -21.018 15.291 1.00 42.21  ? 403  GLU A CG    1 
ATOM   2563 C CD    . GLU C 3 201 ? 12.584  -19.629 14.718 1.00 46.21  ? 403  GLU A CD    1 
ATOM   2564 O OE1   . GLU C 3 201 ? 11.448  -19.094 14.686 1.00 43.57  ? 403  GLU A OE1   1 
ATOM   2565 O OE2   . GLU C 3 201 ? 13.612  -19.065 14.295 1.00 48.57  ? 403  GLU A OE2   1 
ATOM   2566 N N     . VAL C 3 202 ? 14.191  -22.411 17.380 1.00 47.30  ? 404  VAL A N     1 
ATOM   2567 C CA    . VAL C 3 202 ? 15.359  -22.050 18.133 1.00 47.89  ? 404  VAL A CA    1 
ATOM   2568 C C     . VAL C 3 202 ? 16.101  -21.150 17.181 1.00 48.82  ? 404  VAL A C     1 
ATOM   2569 O O     . VAL C 3 202 ? 16.421  -21.578 16.086 1.00 51.62  ? 404  VAL A O     1 
ATOM   2570 C CB    . VAL C 3 202 ? 16.236  -23.267 18.490 1.00 43.09  ? 404  VAL A CB    1 
ATOM   2571 C CG1   . VAL C 3 202 ? 17.615  -22.787 18.919 1.00 41.88  ? 404  VAL A CG1   1 
ATOM   2572 C CG2   . VAL C 3 202 ? 15.597  -24.066 19.613 1.00 39.42  ? 404  VAL A CG2   1 
ATOM   2573 N N     . ARG C 3 203 ? 16.263  -19.881 17.538 1.00 46.58  ? 405  ARG A N     1 
ATOM   2574 C CA    . ARG C 3 203 ? 17.007  -18.999 16.669 1.00 47.33  ? 405  ARG A CA    1 
ATOM   2575 C C     . ARG C 3 203 ? 18.208  -18.401 17.360 1.00 46.56  ? 405  ARG A C     1 
ATOM   2576 O O     . ARG C 3 203 ? 18.360  -18.470 18.574 1.00 46.56  ? 405  ARG A O     1 
ATOM   2577 C CB    . ARG C 3 203 ? 16.118  -17.937 16.035 1.00 47.33  ? 405  ARG A CB    1 
ATOM   2578 C CG    . ARG C 3 203 ? 15.556  -16.937 16.960 1.00 48.11  ? 405  ARG A CG    1 
ATOM   2579 C CD    . ARG C 3 203 ? 14.810  -15.892 16.155 1.00 49.05  ? 405  ARG A CD    1 
ATOM   2580 N NE    . ARG C 3 203 ? 13.581  -16.435 15.571 1.00 49.91  ? 405  ARG A NE    1 
ATOM   2581 C CZ    . ARG C 3 203 ? 12.534  -15.707 15.178 1.00 49.81  ? 405  ARG A CZ    1 
ATOM   2582 N NH1   . ARG C 3 203 ? 12.552  -14.389 15.291 1.00 51.17  ? 405  ARG A NH1   1 
ATOM   2583 N NH2   . ARG C 3 203 ? 11.445  -16.297 14.691 1.00 50.00  ? 405  ARG A NH2   1 
ATOM   2584 N N     . HIS C 3 204 ? 19.130  -17.919 16.553 1.00 48.73  ? 406  HIS A N     1 
ATOM   2585 C CA    . HIS C 3 204 ? 20.355  -17.318 17.051 1.00 51.75  ? 406  HIS A CA    1 
ATOM   2586 C C     . HIS C 3 204 ? 20.427  -15.963 16.354 1.00 52.90  ? 406  HIS A C     1 
ATOM   2587 O O     . HIS C 3 204 ? 21.178  -15.772 15.394 1.00 58.73  ? 406  HIS A O     1 
ATOM   2588 C CB    . HIS C 3 204 ? 21.545  -18.205 16.673 1.00 48.45  ? 406  HIS A CB    1 
ATOM   2589 C CG    . HIS C 3 204 ? 21.238  -19.669 16.716 1.00 47.22  ? 406  HIS A CG    1 
ATOM   2590 N ND1   . HIS C 3 204 ? 21.093  -20.364 17.893 1.00 49.48  ? 406  HIS A ND1   1 
ATOM   2591 C CD2   . HIS C 3 204 ? 21.031  -20.569 15.725 1.00 48.91  ? 406  HIS A CD2   1 
ATOM   2592 C CE1   . HIS C 3 204 ? 20.814  -21.628 17.630 1.00 47.99  ? 406  HIS A CE1   1 
ATOM   2593 N NE2   . HIS C 3 204 ? 20.773  -21.777 16.320 1.00 50.31  ? 406  HIS A NE2   1 
ATOM   2594 N N     . ASP C 3 205 ? 19.626  -15.024 16.833 1.00 50.82  ? 407  ASP A N     1 
ATOM   2595 C CA    . ASP C 3 205 ? 19.563  -13.712 16.233 1.00 48.03  ? 407  ASP A CA    1 
ATOM   2596 C C     . ASP C 3 205 ? 20.149  -12.683 17.171 1.00 48.13  ? 407  ASP A C     1 
ATOM   2597 O O     . ASP C 3 205 ? 19.504  -12.316 18.143 1.00 49.95  ? 407  ASP A O     1 
ATOM   2598 C CB    . ASP C 3 205 ? 18.095  -13.411 15.960 1.00 49.10  ? 407  ASP A CB    1 
ATOM   2599 C CG    . ASP C 3 205 ? 17.879  -12.113 15.233 1.00 48.29  ? 407  ASP A CG    1 
ATOM   2600 O OD1   . ASP C 3 205 ? 18.848  -11.443 14.817 1.00 52.39  ? 407  ASP A OD1   1 
ATOM   2601 O OD2   . ASP C 3 205 ? 16.703  -11.771 15.061 1.00 47.01  ? 407  ASP A OD2   1 
ATOM   2602 N N     . ASN C 3 206 ? 21.351  -12.191 16.867 1.00 49.63  ? 408  ASN A N     1 
ATOM   2603 C CA    . ASN C 3 206 ? 22.014  -11.178 17.724 1.00 48.91  ? 408  ASN A CA    1 
ATOM   2604 C C     . ASN C 3 206 ? 21.759  -9.711  17.370 1.00 47.33  ? 408  ASN A C     1 
ATOM   2605 O O     . ASN C 3 206 ? 22.506  -8.813  17.729 1.00 43.75  ? 408  ASN A O     1 
ATOM   2606 C CB    . ASN C 3 206 ? 23.517  -11.442 17.873 1.00 48.26  ? 408  ASN A CB    1 
ATOM   2607 C CG    . ASN C 3 206 ? 24.297  -11.172 16.604 1.00 51.03  ? 408  ASN A CG    1 
ATOM   2608 O OD1   . ASN C 3 206 ? 23.764  -11.263 15.473 1.00 49.30  ? 408  ASN A OD1   1 
ATOM   2609 N ND2   . ASN C 3 206 ? 25.576  -10.824 16.774 1.00 52.86  ? 408  ASN A ND2   1 
ATOM   2610 N N     . LYS C 3 207 ? 20.700  -9.488  16.621 1.00 48.92  ? 409  LYS A N     1 
ATOM   2611 C CA    . LYS C 3 207 ? 20.297  -8.155  16.276 1.00 49.70  ? 409  LYS A CA    1 
ATOM   2612 C C     . LYS C 3 207 ? 19.163  -7.788  17.262 1.00 49.94  ? 409  LYS A C     1 
ATOM   2613 O O     . LYS C 3 207 ? 18.808  -6.613  17.404 1.00 55.28  ? 409  LYS A O     1 
ATOM   2614 C CB    . LYS C 3 207 ? 19.805  -8.120  14.838 1.00 53.42  ? 409  LYS A CB    1 
ATOM   2615 C CG    . LYS C 3 207 ? 20.752  -8.751  13.841 1.00 59.62  ? 409  LYS A CG    1 
ATOM   2616 C CD    . LYS C 3 207 ? 22.040  -7.957  13.668 1.00 64.89  ? 409  LYS A CD    1 
ATOM   2617 C CE    . LYS C 3 207 ? 22.958  -8.642  12.636 1.00 67.38  ? 409  LYS A CE    1 
ATOM   2618 N NZ    . LYS C 3 207 ? 23.344  -10.068 13.009 1.00 70.04  ? 409  LYS A NZ    1 
ATOM   2619 N N     . VAL C 3 208 ? 18.574  -8.788  17.919 1.00 46.59  ? 410  VAL A N     1 
ATOM   2620 C CA    . VAL C 3 208 ? 17.526  -8.536  18.898 1.00 43.57  ? 410  VAL A CA    1 
ATOM   2621 C C     . VAL C 3 208 ? 17.985  -8.786  20.320 1.00 42.43  ? 410  VAL A C     1 
ATOM   2622 O O     . VAL C 3 208 ? 19.034  -9.364  20.563 1.00 40.66  ? 410  VAL A O     1 
ATOM   2623 C CB    . VAL C 3 208 ? 16.246  -9.322  18.625 1.00 46.99  ? 410  VAL A CB    1 
ATOM   2624 C CG1   . VAL C 3 208 ? 15.610  -8.813  17.371 1.00 40.37  ? 410  VAL A CG1   1 
ATOM   2625 C CG2   . VAL C 3 208 ? 16.526  -10.813 18.549 1.00 46.10  ? 410  VAL A CG2   1 
ATOM   2626 N N     . THR C 3 209 ? 17.159  -8.382  21.264 1.00 41.41  ? 411  THR A N     1 
ATOM   2627 C CA    . THR C 3 209 ? 17.518  -8.507  22.666 1.00 40.06  ? 411  THR A CA    1 
ATOM   2628 C C     . THR C 3 209 ? 16.828  -9.605  23.485 1.00 37.05  ? 411  THR A C     1 
ATOM   2629 O O     . THR C 3 209 ? 17.325  -10.012 24.525 1.00 34.57  ? 411  THR A O     1 
ATOM   2630 C CB    . THR C 3 209 ? 17.312  -7.135  23.400 1.00 42.11  ? 411  THR A CB    1 
ATOM   2631 O OG1   . THR C 3 209 ? 15.912  -6.852  23.530 1.00 38.54  ? 411  THR A OG1   1 
ATOM   2632 C CG2   . THR C 3 209 ? 17.988  -5.993  22.636 1.00 40.59  ? 411  THR A CG2   1 
ATOM   2633 N N     . TRP C 3 210 ? 15.696  -10.099 23.019 1.00 35.49  ? 412  TRP A N     1 
ATOM   2634 C CA    . TRP C 3 210 ? 14.979  -11.096 23.788 1.00 36.15  ? 412  TRP A CA    1 
ATOM   2635 C C     . TRP C 3 210 ? 15.575  -12.504 23.794 1.00 34.53  ? 412  TRP A C     1 
ATOM   2636 O O     . TRP C 3 210 ? 16.356  -12.854 22.932 1.00 34.29  ? 412  TRP A O     1 
ATOM   2637 C CB    . TRP C 3 210 ? 13.531  -11.112 23.334 1.00 33.27  ? 412  TRP A CB    1 
ATOM   2638 C CG    . TRP C 3 210 ? 13.432  -11.192 21.888 1.00 31.55  ? 412  TRP A CG    1 
ATOM   2639 C CD1   . TRP C 3 210 ? 13.497  -10.158 21.011 1.00 36.03  ? 412  TRP A CD1   1 
ATOM   2640 C CD2   . TRP C 3 210 ? 13.233  -12.378 21.111 1.00 29.76  ? 412  TRP A CD2   1 
ATOM   2641 N NE1   . TRP C 3 210 ? 13.339  -10.628 19.728 1.00 38.51  ? 412  TRP A NE1   1 
ATOM   2642 C CE2   . TRP C 3 210 ? 13.173  -11.988 19.767 1.00 34.21  ? 412  TRP A CE2   1 
ATOM   2643 C CE3   . TRP C 3 210 ? 13.103  -13.730 21.427 1.00 30.32  ? 412  TRP A CE3   1 
ATOM   2644 C CZ2   . TRP C 3 210 ? 12.985  -12.904 18.735 1.00 38.39  ? 412  TRP A CZ2   1 
ATOM   2645 C CZ3   . TRP C 3 210 ? 12.921  -14.631 20.416 1.00 29.84  ? 412  TRP A CZ3   1 
ATOM   2646 C CH2   . TRP C 3 210 ? 12.862  -14.220 19.079 1.00 33.82  ? 412  TRP A CH2   1 
ATOM   2647 N N     . LEU C 3 211 ? 15.195  -13.310 24.779 1.00 35.56  ? 413  LEU A N     1 
ATOM   2648 C CA    . LEU C 3 211 ? 15.686  -14.676 24.867 1.00 37.53  ? 413  LEU A CA    1 
ATOM   2649 C C     . LEU C 3 211 ? 14.586  -15.675 24.539 1.00 37.40  ? 413  LEU A C     1 
ATOM   2650 O O     . LEU C 3 211 ? 14.867  -16.830 24.244 1.00 33.35  ? 413  LEU A O     1 
ATOM   2651 C CB    . LEU C 3 211 ? 16.209  -14.989 26.262 1.00 38.86  ? 413  LEU A CB    1 
ATOM   2652 C CG    . LEU C 3 211 ? 16.618  -13.851 27.192 1.00 46.59  ? 413  LEU A CG    1 
ATOM   2653 C CD1   . LEU C 3 211 ? 17.413  -14.403 28.384 1.00 41.63  ? 413  LEU A CD1   1 
ATOM   2654 C CD2   . LEU C 3 211 ? 17.452  -12.829 26.420 1.00 50.68  ? 413  LEU A CD2   1 
ATOM   2655 N N     . VAL C 3 212 ? 13.337  -15.233 24.664 1.00 37.59  ? 414  VAL A N     1 
ATOM   2656 C CA    . VAL C 3 212 ? 12.155  -16.048 24.406 1.00 35.03  ? 414  VAL A CA    1 
ATOM   2657 C C     . VAL C 3 212 ? 10.979  -15.184 23.955 1.00 37.40  ? 414  VAL A C     1 
ATOM   2658 O O     . VAL C 3 212 ? 10.817  -14.045 24.413 1.00 37.11  ? 414  VAL A O     1 
ATOM   2659 C CB    . VAL C 3 212 ? 11.652  -16.700 25.692 1.00 35.33  ? 414  VAL A CB    1 
ATOM   2660 C CG1   . VAL C 3 212 ? 10.608  -17.728 25.383 1.00 38.58  ? 414  VAL A CG1   1 
ATOM   2661 C CG2   . VAL C 3 212 ? 12.768  -17.263 26.482 1.00 36.31  ? 414  VAL A CG2   1 
ATOM   2662 N N     . SER C 3 213 ? 10.116  -15.749 23.122 1.00 37.03  ? 415  SER A N     1 
ATOM   2663 C CA    . SER C 3 213 ? 8.925   -15.034 22.692 1.00 39.64  ? 415  SER A CA    1 
ATOM   2664 C C     . SER C 3 213 ? 7.918   -16.009 22.184 1.00 35.11  ? 415  SER A C     1 
ATOM   2665 O O     . SER C 3 213 ? 8.202   -17.193 22.050 1.00 35.14  ? 415  SER A O     1 
ATOM   2666 C CB    . SER C 3 213 ? 9.220   -14.042 21.586 1.00 39.72  ? 415  SER A CB    1 
ATOM   2667 O OG    . SER C 3 213 ? 9.668   -14.739 20.452 1.00 51.88  ? 415  SER A OG    1 
ATOM   2668 N N     . TRP C 3 214 ? 6.711   -15.511 22.000 1.00 33.54  ? 416  TRP A N     1 
ATOM   2669 C CA    . TRP C 3 214 ? 5.613   -16.309 21.479 1.00 36.66  ? 416  TRP A CA    1 
ATOM   2670 C C     . TRP C 3 214 ? 4.544   -15.294 21.216 1.00 38.75  ? 416  TRP A C     1 
ATOM   2671 O O     . TRP C 3 214 ? 4.725   -14.123 21.562 1.00 35.72  ? 416  TRP A O     1 
ATOM   2672 C CB    . TRP C 3 214 ? 5.115   -17.299 22.514 1.00 33.56  ? 416  TRP A CB    1 
ATOM   2673 C CG    . TRP C 3 214 ? 4.572   -16.639 23.713 1.00 39.28  ? 416  TRP A CG    1 
ATOM   2674 C CD1   . TRP C 3 214 ? 3.265   -16.383 23.980 1.00 44.05  ? 416  TRP A CD1   1 
ATOM   2675 C CD2   . TRP C 3 214 ? 5.313   -16.137 24.823 1.00 42.58  ? 416  TRP A CD2   1 
ATOM   2676 N NE1   . TRP C 3 214 ? 3.141   -15.751 25.191 1.00 43.41  ? 416  TRP A NE1   1 
ATOM   2677 C CE2   . TRP C 3 214 ? 4.383   -15.591 25.736 1.00 45.43  ? 416  TRP A CE2   1 
ATOM   2678 C CE3   . TRP C 3 214 ? 6.674   -16.099 25.141 1.00 48.55  ? 416  TRP A CE3   1 
ATOM   2679 C CZ2   . TRP C 3 214 ? 4.764   -15.015 26.951 1.00 47.53  ? 416  TRP A CZ2   1 
ATOM   2680 C CZ3   . TRP C 3 214 ? 7.062   -15.525 26.350 1.00 52.39  ? 416  TRP A CZ3   1 
ATOM   2681 C CH2   . TRP C 3 214 ? 6.103   -14.990 27.243 1.00 51.50  ? 416  TRP A CH2   1 
ATOM   2682 N N     . THR C 3 215 ? 3.444   -15.707 20.595 1.00 40.80  ? 417  THR A N     1 
ATOM   2683 C CA    . THR C 3 215 ? 2.374   -14.744 20.374 1.00 45.25  ? 417  THR A CA    1 
ATOM   2684 C C     . THR C 3 215 ? 1.169   -14.954 21.253 1.00 44.91  ? 417  THR A C     1 
ATOM   2685 O O     . THR C 3 215 ? 0.670   -16.050 21.439 1.00 47.76  ? 417  THR A O     1 
ATOM   2686 C CB    . THR C 3 215 ? 1.945   -14.539 18.902 1.00 45.10  ? 417  THR A CB    1 
ATOM   2687 O OG1   . THR C 3 215 ? 1.252   -15.686 18.413 1.00 52.04  ? 417  THR A OG1   1 
ATOM   2688 C CG2   . THR C 3 215 ? 3.145   -14.234 18.028 1.00 46.21  ? 417  THR A CG2   1 
ATOM   2689 N N     . GLU C 3 216 ? 0.835   -13.882 21.936 1.00 50.31  ? 418  GLU A N     1 
ATOM   2690 C CA    . GLU C 3 216 ? -0.293  -13.845 22.821 1.00 53.91  ? 418  GLU A CA    1 
ATOM   2691 C C     . GLU C 3 216 ? -1.546  -13.953 21.925 1.00 58.49  ? 418  GLU A C     1 
ATOM   2692 O O     . GLU C 3 216 ? -1.796  -13.119 21.046 1.00 60.63  ? 418  GLU A O     1 
ATOM   2693 C CB    . GLU C 3 216 ? -0.215  -12.536 23.618 1.00 54.57  ? 418  GLU A CB    1 
ATOM   2694 C CG    . GLU C 3 216 ? -1.280  -12.335 24.640 1.00 58.86  ? 418  GLU A CG    1 
ATOM   2695 C CD    . GLU C 3 216 ? -2.615  -12.114 23.991 1.00 61.27  ? 418  GLU A CD    1 
ATOM   2696 O OE1   . GLU C 3 216 ? -2.682  -11.328 23.023 1.00 61.22  ? 418  GLU A OE1   1 
ATOM   2697 O OE2   . GLU C 3 216 ? -3.583  -12.767 24.415 1.00 64.89  ? 418  GLU A OE2   1 
ATOM   2698 N N     . ASN C 3 217 ? -2.318  -14.997 22.177 1.00 62.18  ? 419  ASN A N     1 
ATOM   2699 C CA    . ASN C 3 217 ? -3.540  -15.337 21.455 1.00 64.71  ? 419  ASN A CA    1 
ATOM   2700 C C     . ASN C 3 217 ? -4.683  -14.288 21.223 1.00 66.42  ? 419  ASN A C     1 
ATOM   2701 O O     . ASN C 3 217 ? -5.225  -14.172 20.111 1.00 66.46  ? 419  ASN A O     1 
ATOM   2702 C CB    . ASN C 3 217 ? -4.107  -16.640 22.072 1.00 65.27  ? 419  ASN A CB    1 
ATOM   2703 C CG    . ASN C 3 217 ? -4.479  -16.507 23.581 1.00 63.52  ? 419  ASN A CG    1 
ATOM   2704 O OD1   . ASN C 3 217 ? -3.642  -16.224 24.435 1.00 56.75  ? 419  ASN A OD1   1 
ATOM   2705 N ND2   . ASN C 3 217 ? -5.751  -16.754 23.889 1.00 60.08  ? 419  ASN A ND2   1 
ATOM   2706 N N     . ILE C 3 218 ? -5.041  -13.520 22.254 1.00 63.51  ? 420  ILE A N     1 
ATOM   2707 C CA    . ILE C 3 218 ? -6.129  -12.526 22.182 1.00 61.37  ? 420  ILE A CA    1 
ATOM   2708 C C     . ILE C 3 218 ? -5.924  -11.247 21.319 1.00 62.12  ? 420  ILE A C     1 
ATOM   2709 O O     . ILE C 3 218 ? -6.882  -10.735 20.733 1.00 59.61  ? 420  ILE A O     1 
ATOM   2710 C CB    . ILE C 3 218 ? -6.542  -12.155 23.620 1.00 58.58  ? 420  ILE A CB    1 
ATOM   2711 C CG1   . ILE C 3 218 ? -7.165  -13.377 24.293 1.00 55.46  ? 420  ILE A CG1   1 
ATOM   2712 C CG2   . ILE C 3 218 ? -7.469  -10.965 23.644 1.00 56.87  ? 420  ILE A CG2   1 
ATOM   2713 C CD1   . ILE C 3 218 ? -6.932  -13.435 25.774 1.00 55.30  ? 420  ILE A CD1   1 
ATOM   2714 N N     . GLN C 3 219 ? -4.698  -10.708 21.305 1.00 62.85  ? 421  GLN A N     1 
ATOM   2715 C CA    . GLN C 3 219 ? -4.348  -9.507  20.528 1.00 60.81  ? 421  GLN A CA    1 
ATOM   2716 C C     . GLN C 3 219 ? -3.317  -9.837  19.445 1.00 59.30  ? 421  GLN A C     1 
ATOM   2717 O O     . GLN C 3 219 ? -2.963  -8.986  18.626 1.00 60.32  ? 421  GLN A O     1 
ATOM   2718 C CB    . GLN C 3 219 ? -3.777  -8.416  21.434 1.00 62.74  ? 421  GLN A CB    1 
ATOM   2719 C CG    . GLN C 3 219 ? -4.667  -8.065  22.613 1.00 71.09  ? 421  GLN A CG    1 
ATOM   2720 C CD    . GLN C 3 219 ? -5.300  -6.675  22.505 1.00 78.09  ? 421  GLN A CD    1 
ATOM   2721 O OE1   . GLN C 3 219 ? -5.080  -5.809  23.371 1.00 80.64  ? 421  GLN A OE1   1 
ATOM   2722 N NE2   . GLN C 3 219 ? -6.122  -6.464  21.462 1.00 81.22  ? 421  GLN A NE2   1 
ATOM   2723 N N     . GLY C 3 220 ? -2.860  -11.083 19.422 1.00 55.83  ? 422  GLY A N     1 
ATOM   2724 C CA    . GLY C 3 220 ? -1.877  -11.468 18.435 1.00 55.75  ? 422  GLY A CA    1 
ATOM   2725 C C     . GLY C 3 220 ? -0.590  -10.674 18.585 1.00 57.49  ? 422  GLY A C     1 
ATOM   2726 O O     . GLY C 3 220 ? 0.163   -10.518 17.617 1.00 61.36  ? 422  GLY A O     1 
ATOM   2727 N N     . SER C 3 221 ? -0.359  -10.133 19.776 1.00 53.54  ? 423  SER A N     1 
ATOM   2728 C CA    . SER C 3 221 ? 0.858   -9.377  20.037 1.00 54.77  ? 423  SER A CA    1 
ATOM   2729 C C     . SER C 3 221 ? 1.974   -10.365 20.423 1.00 54.47  ? 423  SER A C     1 
ATOM   2730 O O     . SER C 3 221 ? 1.684   -11.422 20.995 1.00 54.47  ? 423  SER A O     1 
ATOM   2731 C CB    . SER C 3 221 ? 0.624   -8.358  21.165 1.00 57.01  ? 423  SER A CB    1 
ATOM   2732 O OG    . SER C 3 221 ? -0.661  -8.516  21.749 1.00 60.72  ? 423  SER A OG    1 
ATOM   2733 N N     . ILE C 3 222 ? 3.229   -10.061 20.071 1.00 52.69  ? 424  ILE A N     1 
ATOM   2734 C CA    . ILE C 3 222 ? 4.372   -10.925 20.398 1.00 49.88  ? 424  ILE A CA    1 
ATOM   2735 C C     . ILE C 3 222 ? 4.873   -10.599 21.780 1.00 46.33  ? 424  ILE A C     1 
ATOM   2736 O O     . ILE C 3 222 ? 5.145   -9.461  22.042 1.00 46.75  ? 424  ILE A O     1 
ATOM   2737 C CB    . ILE C 3 222 ? 5.555   -10.697 19.448 1.00 49.98  ? 424  ILE A CB    1 
ATOM   2738 C CG1   . ILE C 3 222 ? 5.110   -10.881 17.994 1.00 52.11  ? 424  ILE A CG1   1 
ATOM   2739 C CG2   . ILE C 3 222 ? 6.666   -11.666 19.790 1.00 42.43  ? 424  ILE A CG2   1 
ATOM   2740 C CD1   . ILE C 3 222 ? 6.158   -10.477 16.969 1.00 55.50  ? 424  ILE A CD1   1 
ATOM   2741 N N     . LYS C 3 223 ? 4.970   -11.591 22.659 1.00 45.36  ? 425  LYS A N     1 
ATOM   2742 C CA    . LYS C 3 223 ? 5.458   -11.368 24.018 1.00 43.00  ? 425  LYS A CA    1 
ATOM   2743 C C     . LYS C 3 223 ? 6.908   -11.786 24.050 1.00 43.87  ? 425  LYS A C     1 
ATOM   2744 O O     . LYS C 3 223 ? 7.318   -12.703 23.338 1.00 42.47  ? 425  LYS A O     1 
ATOM   2745 C CB    . LYS C 3 223 ? 4.695   -12.217 25.022 1.00 46.81  ? 425  LYS A CB    1 
ATOM   2746 C CG    . LYS C 3 223 ? 3.196   -11.982 25.069 1.00 49.00  ? 425  LYS A CG    1 
ATOM   2747 C CD    . LYS C 3 223 ? 2.878   -10.599 25.592 1.00 51.02  ? 425  LYS A CD    1 
ATOM   2748 C CE    . LYS C 3 223 ? 1.387   -10.432 25.869 1.00 52.85  ? 425  LYS A CE    1 
ATOM   2749 N NZ    . LYS C 3 223 ? 1.042   -10.543 27.316 1.00 44.47  ? 425  LYS A NZ    1 
ATOM   2750 N N     . TYR C 3 224 ? 7.685   -11.125 24.888 1.00 43.12  ? 426  TYR A N     1 
ATOM   2751 C CA    . TYR C 3 224 ? 9.097   -11.439 25.002 1.00 41.83  ? 426  TYR A CA    1 
ATOM   2752 C C     . TYR C 3 224 ? 9.541   -11.529 26.452 1.00 43.08  ? 426  TYR A C     1 
ATOM   2753 O O     . TYR C 3 224 ? 8.842   -11.122 27.371 1.00 41.40  ? 426  TYR A O     1 
ATOM   2754 C CB    . TYR C 3 224 ? 9.940   -10.344 24.362 1.00 35.04  ? 426  TYR A CB    1 
ATOM   2755 C CG    . TYR C 3 224 ? 9.617   -10.040 22.935 1.00 37.66  ? 426  TYR A CG    1 
ATOM   2756 C CD1   . TYR C 3 224 ? 8.799   -8.971  22.605 1.00 39.11  ? 426  TYR A CD1   1 
ATOM   2757 C CD2   . TYR C 3 224 ? 10.185  -10.779 21.899 1.00 36.96  ? 426  TYR A CD2   1 
ATOM   2758 C CE1   . TYR C 3 224 ? 8.562   -8.644  21.279 1.00 43.77  ? 426  TYR A CE1   1 
ATOM   2759 C CE2   . TYR C 3 224 ? 9.963   -10.461 20.576 1.00 36.95  ? 426  TYR A CE2   1 
ATOM   2760 C CZ    . TYR C 3 224 ? 9.153   -9.391  20.272 1.00 42.35  ? 426  TYR A CZ    1 
ATOM   2761 O OH    . TYR C 3 224 ? 8.949   -9.018  18.970 1.00 43.88  ? 426  TYR A OH    1 
ATOM   2762 N N     . ILE C 3 225 ? 10.710  -12.106 26.640 1.00 40.27  ? 427  ILE A N     1 
ATOM   2763 C CA    . ILE C 3 225 ? 11.289  -12.161 27.948 1.00 36.59  ? 427  ILE A CA    1 
ATOM   2764 C C     . ILE C 3 225 ? 12.628  -11.510 27.718 1.00 37.79  ? 427  ILE A C     1 
ATOM   2765 O O     . ILE C 3 225 ? 13.384  -11.937 26.848 1.00 35.16  ? 427  ILE A O     1 
ATOM   2766 C CB    . ILE C 3 225 ? 11.504  -13.562 28.403 1.00 35.96  ? 427  ILE A CB    1 
ATOM   2767 C CG1   . ILE C 3 225 ? 10.151  -14.245 28.583 1.00 34.75  ? 427  ILE A CG1   1 
ATOM   2768 C CG2   . ILE C 3 225 ? 12.329  -13.549 29.657 1.00 36.10  ? 427  ILE A CG2   1 
ATOM   2769 C CD1   . ILE C 3 225 ? 10.224  -15.642 29.136 1.00 22.93  ? 427  ILE A CD1   1 
ATOM   2770 N N     . MET C 3 226 ? 12.889  -10.426 28.423 1.00 36.94  ? 428  MET A N     1 
ATOM   2771 C CA    . MET C 3 226 ? 14.135  -9.723  28.269 1.00 34.13  ? 428  MET A CA    1 
ATOM   2772 C C     . MET C 3 226 ? 14.763  -9.572  29.628 1.00 37.55  ? 428  MET A C     1 
ATOM   2773 O O     . MET C 3 226 ? 14.218  -10.041 30.629 1.00 38.60  ? 428  MET A O     1 
ATOM   2774 C CB    . MET C 3 226 ? 13.855  -8.391  27.614 1.00 35.25  ? 428  MET A CB    1 
ATOM   2775 C CG    . MET C 3 226 ? 13.034  -8.572  26.337 1.00 47.80  ? 428  MET A CG    1 
ATOM   2776 S SD    . MET C 3 226 ? 12.397  -7.091  25.446 1.00 53.10  ? 428  MET A SD    1 
ATOM   2777 C CE    . MET C 3 226 ? 12.847  -7.482  23.789 1.00 55.55  ? 428  MET A CE    1 
ATOM   2778 N N     . LEU C 3 227 ? 15.931  -8.952  29.679 1.00 40.13  ? 429  LEU A N     1 
ATOM   2779 C CA    . LEU C 3 227 ? 16.633  -8.806  30.940 1.00 42.39  ? 429  LEU A CA    1 
ATOM   2780 C C     . LEU C 3 227 ? 16.198  -7.666  31.813 1.00 43.25  ? 429  LEU A C     1 
ATOM   2781 O O     . LEU C 3 227 ? 15.331  -6.860  31.462 1.00 42.36  ? 429  LEU A O     1 
ATOM   2782 C CB    . LEU C 3 227 ? 18.130  -8.719  30.721 1.00 37.99  ? 429  LEU A CB    1 
ATOM   2783 C CG    . LEU C 3 227 ? 18.708  -9.738  29.757 1.00 39.65  ? 429  LEU A CG    1 
ATOM   2784 C CD1   . LEU C 3 227 ? 20.152  -9.401  29.514 1.00 37.07  ? 429  LEU A CD1   1 
ATOM   2785 C CD2   . LEU C 3 227 ? 18.537  -11.140 30.284 1.00 44.03  ? 429  LEU A CD2   1 
ATOM   2786 N N     . ASN C 3 228 ? 16.806  -7.669  32.989 1.00 45.87  ? 430  ASN A N     1 
ATOM   2787 C CA    . ASN C 3 228 ? 16.599  -6.700  34.045 1.00 46.40  ? 430  ASN A CA    1 
ATOM   2788 C C     . ASN C 3 228 ? 17.076  -5.304  33.660 1.00 42.81  ? 430  ASN A C     1 
ATOM   2789 O O     . ASN C 3 228 ? 17.930  -5.147  32.809 1.00 40.78  ? 430  ASN A O     1 
ATOM   2790 C CB    . ASN C 3 228 ? 17.378  -7.161  35.275 1.00 50.72  ? 430  ASN A CB    1 
ATOM   2791 C CG    . ASN C 3 228 ? 16.668  -6.826  36.559 1.00 60.00  ? 430  ASN A CG    1 
ATOM   2792 O OD1   . ASN C 3 228 ? 15.846  -7.607  37.052 1.00 66.27  ? 430  ASN A OD1   1 
ATOM   2793 N ND2   . ASN C 3 228 ? 16.921  -5.630  37.084 1.00 65.78  ? 430  ASN A ND2   1 
ATOM   2794 N N     . PRO C 3 229 ? 16.453  -4.268  34.219 1.00 42.74  ? 431  PRO A N     1 
ATOM   2795 C CA    . PRO C 3 229 ? 16.835  -2.889  33.933 1.00 43.78  ? 431  PRO A CA    1 
ATOM   2796 C C     . PRO C 3 229 ? 18.305  -2.680  34.213 1.00 42.91  ? 431  PRO A C     1 
ATOM   2797 O O     . PRO C 3 229 ? 18.951  -1.895  33.575 1.00 44.32  ? 431  PRO A O     1 
ATOM   2798 C CB    . PRO C 3 229 ? 15.971  -2.109  34.905 1.00 42.17  ? 431  PRO A CB    1 
ATOM   2799 C CG    . PRO C 3 229 ? 14.715  -2.857  34.856 1.00 39.86  ? 431  PRO A CG    1 
ATOM   2800 C CD    . PRO C 3 229 ? 15.167  -4.299  34.928 1.00 43.30  ? 431  PRO A CD    1 
ATOM   2801 N N     . SER C 3 230 ? 18.803  -3.407  35.189 1.00 43.79  ? 432  SER A N     1 
ATOM   2802 C CA    . SER C 3 230 ? 20.201  -3.368  35.575 1.00 42.81  ? 432  SER A CA    1 
ATOM   2803 C C     . SER C 3 230 ? 21.115  -3.883  34.466 1.00 40.84  ? 432  SER A C     1 
ATOM   2804 O O     . SER C 3 230 ? 22.317  -3.858  34.573 1.00 42.51  ? 432  SER A O     1 
ATOM   2805 C CB    . SER C 3 230 ? 20.372  -4.265  36.784 1.00 47.18  ? 432  SER A CB    1 
ATOM   2806 O OG    . SER C 3 230 ? 19.766  -5.532  36.530 1.00 56.66  ? 432  SER A OG    1 
ATOM   2807 N N     . SER C 3 231 ? 20.538  -4.460  33.435 1.00 42.37  ? 433  SER A N     1 
ATOM   2808 C CA    . SER C 3 231 ? 21.349  -4.958  32.343 1.00 42.27  ? 433  SER A CA    1 
ATOM   2809 C C     . SER C 3 231 ? 22.197  -3.907  31.674 1.00 40.70  ? 433  SER A C     1 
ATOM   2810 O O     . SER C 3 231 ? 21.907  -2.729  31.681 1.00 41.90  ? 433  SER A O     1 
ATOM   2811 C CB    . SER C 3 231 ? 20.472  -5.548  31.258 1.00 44.09  ? 433  SER A CB    1 
ATOM   2812 O OG    . SER C 3 231 ? 20.106  -6.857  31.603 1.00 60.77  ? 433  SER A OG    1 
ATOM   2813 N N     . ARG C 3 232 ? 23.205  -4.370  30.974 1.00 36.83  ? 434  ARG A N     1 
ATOM   2814 C CA    . ARG C 3 232 ? 24.026  -3.453  30.275 1.00 36.94  ? 434  ARG A CA    1 
ATOM   2815 C C     . ARG C 3 232 ? 23.196  -3.111  29.084 1.00 36.35  ? 434  ARG A C     1 
ATOM   2816 O O     . ARG C 3 232 ? 23.043  -1.961  28.720 1.00 38.51  ? 434  ARG A O     1 
ATOM   2817 C CB    . ARG C 3 232 ? 25.315  -4.120  29.846 1.00 38.41  ? 434  ARG A CB    1 
ATOM   2818 C CG    . ARG C 3 232 ? 25.882  -3.511  28.605 1.00 42.77  ? 434  ARG A CG    1 
ATOM   2819 C CD    . ARG C 3 232 ? 25.794  -4.525  27.544 1.00 53.81  ? 434  ARG A CD    1 
ATOM   2820 N NE    . ARG C 3 232 ? 25.208  -4.107  26.273 1.00 60.72  ? 434  ARG A NE    1 
ATOM   2821 C CZ    . ARG C 3 232 ? 24.882  -4.930  25.263 1.00 62.11  ? 434  ARG A CZ    1 
ATOM   2822 N NH1   . ARG C 3 232 ? 25.063  -6.248  25.328 1.00 58.43  ? 434  ARG A NH1   1 
ATOM   2823 N NH2   . ARG C 3 232 ? 24.363  -4.417  24.150 1.00 62.38  ? 434  ARG A NH2   1 
ATOM   2824 N N     . ILE C 3 233 ? 22.640  -4.143  28.489 1.00 37.00  ? 435  ILE A N     1 
ATOM   2825 C CA    . ILE C 3 233 ? 21.830  -4.000  27.298 1.00 37.12  ? 435  ILE A CA    1 
ATOM   2826 C C     . ILE C 3 233 ? 20.640  -3.084  27.564 1.00 34.90  ? 435  ILE A C     1 
ATOM   2827 O O     . ILE C 3 233 ? 20.190  -2.385  26.688 1.00 34.86  ? 435  ILE A O     1 
ATOM   2828 C CB    . ILE C 3 233 ? 21.428  -5.406  26.754 1.00 34.00  ? 435  ILE A CB    1 
ATOM   2829 C CG1   . ILE C 3 233 ? 20.905  -5.333  25.323 1.00 41.59  ? 435  ILE A CG1   1 
ATOM   2830 C CG2   . ILE C 3 233 ? 20.423  -6.045  27.644 1.00 34.26  ? 435  ILE A CG2   1 
ATOM   2831 C CD1   . ILE C 3 233 ? 21.107  -6.617  24.547 1.00 43.25  ? 435  ILE A CD1   1 
ATOM   2832 N N     . LYS C 3 234 ? 20.180  -3.033  28.800 1.00 36.16  ? 436  LYS A N     1 
ATOM   2833 C CA    . LYS C 3 234 ? 19.066  -2.156  29.108 1.00 40.14  ? 436  LYS A CA    1 
ATOM   2834 C C     . LYS C 3 234 ? 19.583  -0.794  29.483 1.00 42.88  ? 436  LYS A C     1 
ATOM   2835 O O     . LYS C 3 234 ? 19.220  0.217   28.890 1.00 43.77  ? 436  LYS A O     1 
ATOM   2836 C CB    . LYS C 3 234 ? 18.235  -2.702  30.267 1.00 39.86  ? 436  LYS A CB    1 
ATOM   2837 C CG    . LYS C 3 234 ? 17.308  -3.842  29.874 1.00 44.74  ? 436  LYS A CG    1 
ATOM   2838 C CD    . LYS C 3 234 ? 16.269  -3.417  28.843 1.00 43.88  ? 436  LYS A CD    1 
ATOM   2839 C CE    . LYS C 3 234 ? 15.391  -4.572  28.339 1.00 47.06  ? 436  LYS A CE    1 
ATOM   2840 N NZ    . LYS C 3 234 ? 15.627  -4.869  26.867 1.00 57.42  ? 436  LYS A NZ    1 
ATOM   2841 N N     . GLY C 3 235 ? 20.492  -0.788  30.439 1.00 45.14  ? 437  GLY A N     1 
ATOM   2842 C CA    . GLY C 3 235 ? 21.027  0.459   30.912 1.00 45.04  ? 437  GLY A CA    1 
ATOM   2843 C C     . GLY C 3 235 ? 21.719  1.233   29.836 1.00 47.20  ? 437  GLY A C     1 
ATOM   2844 O O     . GLY C 3 235 ? 21.853  2.440   29.934 1.00 52.43  ? 437  GLY A O     1 
ATOM   2845 N N     . GLU C 3 236 ? 22.189  0.569   28.798 1.00 48.77  ? 438  GLU A N     1 
ATOM   2846 C CA    . GLU C 3 236 ? 22.892  1.315   27.772 1.00 50.50  ? 438  GLU A CA    1 
ATOM   2847 C C     . GLU C 3 236 ? 21.887  2.096   26.926 1.00 49.63  ? 438  GLU A C     1 
ATOM   2848 O O     . GLU C 3 236 ? 22.063  3.278   26.666 1.00 50.92  ? 438  GLU A O     1 
ATOM   2849 C CB    . GLU C 3 236 ? 23.802  0.387   26.932 1.00 56.56  ? 438  GLU A CB    1 
ATOM   2850 C CG    . GLU C 3 236 ? 25.106  1.077   26.406 1.00 64.98  ? 438  GLU A CG    1 
ATOM   2851 C CD    . GLU C 3 236 ? 26.062  0.151   25.593 1.00 70.92  ? 438  GLU A CD    1 
ATOM   2852 O OE1   . GLU C 3 236 ? 27.331  0.288   25.739 1.00 69.01  ? 438  GLU A OE1   1 
ATOM   2853 O OE2   . GLU C 3 236 ? 25.531  -0.684  24.796 1.00 70.46  ? 438  GLU A OE2   1 
ATOM   2854 N N     . LYS C 3 237 ? 20.789  1.450   26.570 1.00 50.06  ? 439  LYS A N     1 
ATOM   2855 C CA    . LYS C 3 237 ? 19.750  2.069   25.756 1.00 46.39  ? 439  LYS A CA    1 
ATOM   2856 C C     . LYS C 3 237 ? 19.135  3.265   26.467 1.00 43.41  ? 439  LYS A C     1 
ATOM   2857 O O     . LYS C 3 237 ? 18.875  4.294   25.870 1.00 38.59  ? 439  LYS A O     1 
ATOM   2858 C CB    . LYS C 3 237 ? 18.690  1.021   25.450 1.00 49.86  ? 439  LYS A CB    1 
ATOM   2859 C CG    . LYS C 3 237 ? 17.466  1.548   24.774 1.00 58.65  ? 439  LYS A CG    1 
ATOM   2860 C CD    . LYS C 3 237 ? 17.609  1.619   23.264 1.00 61.13  ? 439  LYS A CD    1 
ATOM   2861 C CE    . LYS C 3 237 ? 16.351  2.284   22.706 1.00 65.94  ? 439  LYS A CE    1 
ATOM   2862 N NZ    . LYS C 3 237 ? 16.316  2.401   21.228 1.00 67.16  ? 439  LYS A NZ    1 
ATOM   2863 N N     . ASP C 3 238 ? 19.029  3.156   27.777 1.00 40.76  ? 440  ASP A N     1 
ATOM   2864 C CA    . ASP C 3 238 ? 18.430  4.208   28.566 1.00 44.31  ? 440  ASP A CA    1 
ATOM   2865 C C     . ASP C 3 238 ? 19.335  5.418   28.674 1.00 44.93  ? 440  ASP A C     1 
ATOM   2866 O O     . ASP C 3 238 ? 18.862  6.559   28.685 1.00 45.67  ? 440  ASP A O     1 
ATOM   2867 C CB    . ASP C 3 238 ? 18.078  3.681   29.956 1.00 43.33  ? 440  ASP A CB    1 
ATOM   2868 C CG    . ASP C 3 238 ? 16.853  4.360   30.546 1.00 46.24  ? 440  ASP A CG    1 
ATOM   2869 O OD1   . ASP C 3 238 ? 15.870  4.547   29.810 1.00 44.82  ? 440  ASP A OD1   1 
ATOM   2870 O OD2   . ASP C 3 238 ? 16.861  4.690   31.750 1.00 39.63  ? 440  ASP A OD2   1 
ATOM   2871 N N     . TRP C 3 239 ? 20.628  5.158   28.813 1.00 40.57  ? 441  TRP A N     1 
ATOM   2872 C CA    . TRP C 3 239 ? 21.641  6.195   28.924 1.00 41.77  ? 441  TRP A CA    1 
ATOM   2873 C C     . TRP C 3 239 ? 21.606  6.958   27.622 1.00 39.40  ? 441  TRP A C     1 
ATOM   2874 O O     . TRP C 3 239 ? 21.733  8.175   27.585 1.00 38.03  ? 441  TRP A O     1 
ATOM   2875 C CB    . TRP C 3 239 ? 22.987  5.500   29.112 1.00 45.71  ? 441  TRP A CB    1 
ATOM   2876 C CG    . TRP C 3 239 ? 24.227  6.328   29.093 1.00 54.08  ? 441  TRP A CG    1 
ATOM   2877 C CD1   . TRP C 3 239 ? 24.325  7.686   29.152 1.00 53.85  ? 441  TRP A CD1   1 
ATOM   2878 C CD2   . TRP C 3 239 ? 25.574  5.827   29.017 1.00 58.41  ? 441  TRP A CD2   1 
ATOM   2879 N NE1   . TRP C 3 239 ? 25.648  8.064   29.118 1.00 57.69  ? 441  TRP A NE1   1 
ATOM   2880 C CE2   . TRP C 3 239 ? 26.436  6.945   29.033 1.00 60.27  ? 441  TRP A CE2   1 
ATOM   2881 C CE3   . TRP C 3 239 ? 26.132  4.541   28.941 1.00 59.03  ? 441  TRP A CE3   1 
ATOM   2882 C CZ2   . TRP C 3 239 ? 27.843  6.816   28.974 1.00 63.14  ? 441  TRP A CZ2   1 
ATOM   2883 C CZ3   . TRP C 3 239 ? 27.532  4.409   28.883 1.00 61.81  ? 441  TRP A CZ3   1 
ATOM   2884 C CH2   . TRP C 3 239 ? 28.368  5.541   28.899 1.00 62.72  ? 441  TRP A CH2   1 
ATOM   2885 N N     . GLN C 3 240 ? 21.398  6.215   26.555 1.00 37.05  ? 442  GLN A N     1 
ATOM   2886 C CA    . GLN C 3 240 ? 21.339  6.778   25.241 1.00 39.96  ? 442  GLN A CA    1 
ATOM   2887 C C     . GLN C 3 240 ? 20.069  7.540   25.064 1.00 41.64  ? 442  GLN A C     1 
ATOM   2888 O O     . GLN C 3 240 ? 20.036  8.517   24.330 1.00 42.48  ? 442  GLN A O     1 
ATOM   2889 C CB    . GLN C 3 240 ? 21.358  5.678   24.246 1.00 42.83  ? 442  GLN A CB    1 
ATOM   2890 C CG    . GLN C 3 240 ? 21.246  6.164   22.867 1.00 54.11  ? 442  GLN A CG    1 
ATOM   2891 C CD    . GLN C 3 240 ? 21.216  5.002   21.905 1.00 67.39  ? 442  GLN A CD    1 
ATOM   2892 O OE1   . GLN C 3 240 ? 21.463  3.839   22.293 1.00 68.47  ? 442  GLN A OE1   1 
ATOM   2893 N NE2   . GLN C 3 240 ? 20.982  5.298   20.623 1.00 75.41  ? 442  GLN A NE2   1 
ATOM   2894 N N     . LYS C 3 241 ? 19.021  7.053   25.713 1.00 41.37  ? 443  LYS A N     1 
ATOM   2895 C CA    . LYS C 3 241 ? 17.728  7.695   25.661 1.00 40.65  ? 443  LYS A CA    1 
ATOM   2896 C C     . LYS C 3 241 ? 17.896  9.102   26.221 1.00 44.62  ? 443  LYS A C     1 
ATOM   2897 O O     . LYS C 3 241 ? 17.516  10.083  25.597 1.00 48.01  ? 443  LYS A O     1 
ATOM   2898 C CB    . LYS C 3 241 ? 16.727  6.937   26.529 1.00 42.80  ? 443  LYS A CB    1 
ATOM   2899 C CG    . LYS C 3 241 ? 15.325  7.555   26.561 1.00 36.72  ? 443  LYS A CG    1 
ATOM   2900 C CD    . LYS C 3 241 ? 14.405  6.857   27.575 1.00 30.49  ? 443  LYS A CD    1 
ATOM   2901 C CE    . LYS C 3 241 ? 14.775  7.187   29.004 1.00 32.67  ? 443  LYS A CE    1 
ATOM   2902 N NZ    . LYS C 3 241 ? 13.962  6.391   29.983 1.00 36.32  ? 443  LYS A NZ    1 
ATOM   2903 N N     . TYR C 3 242 ? 18.443  9.219   27.425 1.00 45.70  ? 444  TYR A N     1 
ATOM   2904 C CA    . TYR C 3 242 ? 18.614  10.549  27.990 1.00 45.67  ? 444  TYR A CA    1 
ATOM   2905 C C     . TYR C 3 242 ? 19.586  11.400  27.147 1.00 46.07  ? 444  TYR A C     1 
ATOM   2906 O O     . TYR C 3 242 ? 19.360  12.587  26.918 1.00 48.58  ? 444  TYR A O     1 
ATOM   2907 C CB    . TYR C 3 242 ? 19.007  10.469  29.480 1.00 45.08  ? 444  TYR A CB    1 
ATOM   2908 C CG    . TYR C 3 242 ? 17.886  9.963   30.369 1.00 44.28  ? 444  TYR A CG    1 
ATOM   2909 C CD1   . TYR C 3 242 ? 17.946  8.712   30.945 1.00 44.41  ? 444  TYR A CD1   1 
ATOM   2910 C CD2   . TYR C 3 242 ? 16.739  10.725  30.584 1.00 46.04  ? 444  TYR A CD2   1 
ATOM   2911 C CE1   . TYR C 3 242 ? 16.883  8.220   31.712 1.00 50.42  ? 444  TYR A CE1   1 
ATOM   2912 C CE2   . TYR C 3 242 ? 15.675  10.248  31.340 1.00 44.20  ? 444  TYR A CE2   1 
ATOM   2913 C CZ    . TYR C 3 242 ? 15.748  8.996   31.903 1.00 49.02  ? 444  TYR A CZ    1 
ATOM   2914 O OH    . TYR C 3 242 ? 14.700  8.530   32.644 1.00 42.87  ? 444  TYR A OH    1 
ATOM   2915 N N     . GLU C 3 243 ? 20.643  10.780  26.650 1.00 45.65  ? 445  GLU A N     1 
ATOM   2916 C CA    . GLU C 3 243 ? 21.605  11.490  25.833 1.00 44.79  ? 445  GLU A CA    1 
ATOM   2917 C C     . GLU C 3 243 ? 20.907  12.237  24.714 1.00 44.64  ? 445  GLU A C     1 
ATOM   2918 O O     . GLU C 3 243 ? 21.142  13.403  24.487 1.00 48.11  ? 445  GLU A O     1 
ATOM   2919 C CB    . GLU C 3 243 ? 22.646  10.508  25.277 1.00 48.07  ? 445  GLU A CB    1 
ATOM   2920 C CG    . GLU C 3 243 ? 23.789  10.285  26.231 1.00 44.99  ? 445  GLU A CG    1 
ATOM   2921 C CD    . GLU C 3 243 ? 24.407  11.608  26.647 1.00 50.00  ? 445  GLU A CD    1 
ATOM   2922 O OE1   . GLU C 3 243 ? 25.092  12.221  25.802 1.00 52.92  ? 445  GLU A OE1   1 
ATOM   2923 O OE2   . GLU C 3 243 ? 24.180  12.061  27.792 1.00 47.52  ? 445  GLU A OE2   1 
ATOM   2924 N N     . THR C 3 244 ? 20.029  11.553  24.025 1.00 42.98  ? 446  THR A N     1 
ATOM   2925 C CA    . THR C 3 244 ? 19.288  12.148  22.938 1.00 47.58  ? 446  THR A CA    1 
ATOM   2926 C C     . THR C 3 244 ? 18.445  13.381  23.326 1.00 48.42  ? 446  THR A C     1 
ATOM   2927 O O     . THR C 3 244 ? 18.385  14.378  22.587 1.00 45.78  ? 446  THR A O     1 
ATOM   2928 C CB    . THR C 3 244 ? 18.402  11.063  22.323 1.00 47.04  ? 446  THR A CB    1 
ATOM   2929 O OG1   . THR C 3 244 ? 19.244  10.090  21.694 1.00 53.04  ? 446  THR A OG1   1 
ATOM   2930 C CG2   . THR C 3 244 ? 17.437  11.645  21.311 1.00 50.81  ? 446  THR A CG2   1 
ATOM   2931 N N     . ALA C 3 245 ? 17.774  13.281  24.467 1.00 48.71  ? 447  ALA A N     1 
ATOM   2932 C CA    . ALA C 3 245 ? 16.919  14.337  24.984 1.00 48.61  ? 447  ALA A CA    1 
ATOM   2933 C C     . ALA C 3 245 ? 17.683  15.621  25.301 1.00 50.05  ? 447  ALA A C     1 
ATOM   2934 O O     . ALA C 3 245 ? 17.091  16.707  25.329 1.00 52.47  ? 447  ALA A O     1 
ATOM   2935 C CB    . ALA C 3 245 ? 16.192  13.839  26.216 1.00 44.63  ? 447  ALA A CB    1 
ATOM   2936 N N     . ARG C 3 246 ? 18.969  15.474  25.623 1.00 50.52  ? 448  ARG A N     1 
ATOM   2937 C CA    . ARG C 3 246 ? 19.840  16.605  25.928 1.00 49.95  ? 448  ARG A CA    1 
ATOM   2938 C C     . ARG C 3 246 ? 20.194  17.227  24.579 1.00 51.03  ? 448  ARG A C     1 
ATOM   2939 O O     . ARG C 3 246 ? 20.376  18.437  24.464 1.00 53.18  ? 448  ARG A O     1 
ATOM   2940 C CB    . ARG C 3 246 ? 21.104  16.138  26.661 1.00 45.88  ? 448  ARG A CB    1 
ATOM   2941 C CG    . ARG C 3 246 ? 20.833  15.272  27.862 1.00 47.47  ? 448  ARG A CG    1 
ATOM   2942 C CD    . ARG C 3 246 ? 22.102  14.750  28.480 1.00 50.29  ? 448  ARG A CD    1 
ATOM   2943 N NE    . ARG C 3 246 ? 22.818  15.774  29.244 1.00 58.11  ? 448  ARG A NE    1 
ATOM   2944 C CZ    . ARG C 3 246 ? 24.103  15.697  29.616 1.00 56.41  ? 448  ARG A CZ    1 
ATOM   2945 N NH1   . ARG C 3 246 ? 24.841  14.643  29.300 1.00 57.37  ? 448  ARG A NH1   1 
ATOM   2946 N NH2   . ARG C 3 246 ? 24.654  16.672  30.330 1.00 55.04  ? 448  ARG A NH2   1 
ATOM   2947 N N     . ARG C 3 247 ? 20.252  16.401  23.541 1.00 47.82  ? 449  ARG A N     1 
ATOM   2948 C CA    . ARG C 3 247 ? 20.551  16.938  22.238 1.00 49.22  ? 449  ARG A CA    1 
ATOM   2949 C C     . ARG C 3 247 ? 19.395  17.802  21.810 1.00 49.45  ? 449  ARG A C     1 
ATOM   2950 O O     . ARG C 3 247 ? 19.569  18.830  21.159 1.00 53.53  ? 449  ARG A O     1 
ATOM   2951 C CB    . ARG C 3 247 ? 20.825  15.837  21.249 1.00 47.33  ? 449  ARG A CB    1 
ATOM   2952 C CG    . ARG C 3 247 ? 22.226  15.320  21.419 1.00 49.02  ? 449  ARG A CG    1 
ATOM   2953 C CD    . ARG C 3 247 ? 22.625  14.491  20.244 1.00 51.93  ? 449  ARG A CD    1 
ATOM   2954 N NE    . ARG C 3 247 ? 22.007  13.173  20.288 1.00 53.02  ? 449  ARG A NE    1 
ATOM   2955 C CZ    . ARG C 3 247 ? 21.163  12.710  19.372 1.00 57.19  ? 449  ARG A CZ    1 
ATOM   2956 N NH1   . ARG C 3 247 ? 20.817  13.454  18.327 1.00 59.78  ? 449  ARG A NH1   1 
ATOM   2957 N NH2   . ARG C 3 247 ? 20.687  11.480  19.482 1.00 61.12  ? 449  ARG A NH2   1 
ATOM   2958 N N     . LEU C 3 248 ? 18.208  17.407  22.222 1.00 47.76  ? 450  LEU A N     1 
ATOM   2959 C CA    . LEU C 3 248 ? 17.044  18.185  21.906 1.00 46.94  ? 450  LEU A CA    1 
ATOM   2960 C C     . LEU C 3 248 ? 17.161  19.488  22.665 1.00 47.08  ? 450  LEU A C     1 
ATOM   2961 O O     . LEU C 3 248 ? 16.867  20.548  22.134 1.00 46.90  ? 450  LEU A O     1 
ATOM   2962 C CB    . LEU C 3 248 ? 15.796  17.438  22.339 1.00 47.64  ? 450  LEU A CB    1 
ATOM   2963 C CG    . LEU C 3 248 ? 14.458  18.168  22.288 1.00 45.26  ? 450  LEU A CG    1 
ATOM   2964 C CD1   . LEU C 3 248 ? 14.230  18.759  20.935 1.00 40.30  ? 450  LEU A CD1   1 
ATOM   2965 C CD2   . LEU C 3 248 ? 13.355  17.196  22.628 1.00 43.52  ? 450  LEU A CD2   1 
ATOM   2966 N N     . LYS C 3 249 ? 17.563  19.400  23.921 1.00 44.49  ? 451  LYS A N     1 
ATOM   2967 C CA    . LYS C 3 249 ? 17.703  20.588  24.728 1.00 47.91  ? 451  LYS A CA    1 
ATOM   2968 C C     . LYS C 3 249 ? 18.459  21.609  23.914 1.00 50.29  ? 451  LYS A C     1 
ATOM   2969 O O     . LYS C 3 249 ? 18.032  22.757  23.751 1.00 50.71  ? 451  LYS A O     1 
ATOM   2970 C CB    . LYS C 3 249 ? 18.479  20.270  25.997 1.00 46.69  ? 451  LYS A CB    1 
ATOM   2971 C CG    . LYS C 3 249 ? 18.978  21.493  26.740 1.00 52.54  ? 451  LYS A CG    1 
ATOM   2972 C CD    . LYS C 3 249 ? 19.649  21.156  28.083 1.00 57.74  ? 451  LYS A CD    1 
ATOM   2973 C CE    . LYS C 3 249 ? 20.205  22.419  28.772 1.00 61.08  ? 451  LYS A CE    1 
ATOM   2974 N NZ    . LYS C 3 249 ? 20.406  22.299  30.267 1.00 62.51  ? 451  LYS A NZ    1 
ATOM   2975 N N     . LYS C 3 250 ? 19.526  21.127  23.301 1.00 54.16  ? 452  LYS A N     1 
ATOM   2976 C CA    . LYS C 3 250 ? 20.400  21.963  22.508 1.00 57.67  ? 452  LYS A CA    1 
ATOM   2977 C C     . LYS C 3 250 ? 19.836  22.516  21.229 1.00 59.76  ? 452  LYS A C     1 
ATOM   2978 O O     . LYS C 3 250 ? 20.505  23.313  20.591 1.00 68.02  ? 452  LYS A O     1 
ATOM   2979 C CB    . LYS C 3 250 ? 21.700  21.238  22.190 1.00 60.56  ? 452  LYS A CB    1 
ATOM   2980 C CG    . LYS C 3 250 ? 22.604  21.013  23.387 1.00 64.94  ? 452  LYS A CG    1 
ATOM   2981 C CD    . LYS C 3 250 ? 23.749  20.133  22.967 1.00 71.01  ? 452  LYS A CD    1 
ATOM   2982 C CE    . LYS C 3 250 ? 24.539  19.647  24.149 1.00 76.21  ? 452  LYS A CE    1 
ATOM   2983 N NZ    . LYS C 3 250 ? 25.032  18.257  23.869 1.00 80.82  ? 452  LYS A NZ    1 
ATOM   2984 N N     . CYS C 3 251 ? 18.667  22.081  20.786 1.00 55.37  ? 453  CYS A N     1 
ATOM   2985 C CA    . CYS C 3 251 ? 18.142  22.659  19.553 1.00 52.91  ? 453  CYS A CA    1 
ATOM   2986 C C     . CYS C 3 251 ? 16.644  22.851  19.639 1.00 53.21  ? 453  CYS A C     1 
ATOM   2987 O O     . CYS C 3 251 ? 15.962  23.051  18.632 1.00 48.35  ? 453  CYS A O     1 
ATOM   2988 C CB    . CYS C 3 251 ? 18.491  21.773  18.378 1.00 52.95  ? 453  CYS A CB    1 
ATOM   2989 S SG    . CYS C 3 251 ? 17.783  20.134  18.560 1.00 60.01  ? 453  CYS A SG    1 
ATOM   2990 N N     . VAL C 3 252 ? 16.142  22.813  20.864 1.00 51.08  ? 454  VAL A N     1 
ATOM   2991 C CA    . VAL C 3 252 ? 14.729  22.966  21.086 1.00 49.78  ? 454  VAL A CA    1 
ATOM   2992 C C     . VAL C 3 252 ? 14.277  24.348  20.648 1.00 48.35  ? 454  VAL A C     1 
ATOM   2993 O O     . VAL C 3 252 ? 13.453  24.465  19.756 1.00 47.65  ? 454  VAL A O     1 
ATOM   2994 C CB    . VAL C 3 252 ? 14.345  22.654  22.559 1.00 50.61  ? 454  VAL A CB    1 
ATOM   2995 C CG1   . VAL C 3 252 ? 14.922  23.676  23.498 1.00 52.38  ? 454  VAL A CG1   1 
ATOM   2996 C CG2   . VAL C 3 252 ? 12.843  22.552  22.709 1.00 48.39  ? 454  VAL A CG2   1 
ATOM   2997 N N     . ASP C 3 253 ? 14.872  25.398  21.193 1.00 50.61  ? 455  ASP A N     1 
ATOM   2998 C CA    . ASP C 3 253 ? 14.448  26.738  20.805 1.00 56.27  ? 455  ASP A CA    1 
ATOM   2999 C C     . ASP C 3 253 ? 14.467  26.950  19.290 1.00 55.29  ? 455  ASP A C     1 
ATOM   3000 O O     . ASP C 3 253 ? 13.714  27.736  18.757 1.00 60.57  ? 455  ASP A O     1 
ATOM   3001 C CB    . ASP C 3 253 ? 15.234  27.820  21.567 1.00 60.21  ? 455  ASP A CB    1 
ATOM   3002 C CG    . ASP C 3 253 ? 14.706  28.036  23.027 1.00 66.41  ? 455  ASP A CG    1 
ATOM   3003 O OD1   . ASP C 3 253 ? 15.514  27.926  23.995 1.00 67.58  ? 455  ASP A OD1   1 
ATOM   3004 O OD2   . ASP C 3 253 ? 13.490  28.323  23.211 1.00 61.19  ? 455  ASP A OD2   1 
ATOM   3005 N N     . LYS C 3 254 ? 15.241  26.159  18.575 1.00 57.10  ? 456  LYS A N     1 
ATOM   3006 C CA    . LYS C 3 254 ? 15.294  26.306  17.125 1.00 57.98  ? 456  LYS A CA    1 
ATOM   3007 C C     . LYS C 3 254 ? 14.071  25.689  16.491 1.00 54.00  ? 456  LYS A C     1 
ATOM   3008 O O     . LYS C 3 254 ? 13.441  26.249  15.588 1.00 51.58  ? 456  LYS A O     1 
ATOM   3009 C CB    . LYS C 3 254 ? 16.572  25.638  16.590 1.00 65.19  ? 456  LYS A CB    1 
ATOM   3010 C CG    . LYS C 3 254 ? 16.500  25.090  15.160 1.00 74.64  ? 456  LYS A CG    1 
ATOM   3011 C CD    . LYS C 3 254 ? 16.097  26.140  14.126 1.00 85.82  ? 456  LYS A CD    1 
ATOM   3012 C CE    . LYS C 3 254 ? 15.767  25.482  12.771 1.00 91.50  ? 456  LYS A CE    1 
ATOM   3013 N NZ    . LYS C 3 254 ? 14.725  24.397  12.890 1.00 96.14  ? 456  LYS A NZ    1 
ATOM   3014 N N     . ILE C 3 255 ? 13.824  24.466  16.916 1.00 52.64  ? 457  ILE A N     1 
ATOM   3015 C CA    . ILE C 3 255 ? 12.705  23.704  16.435 1.00 53.17  ? 457  ILE A CA    1 
ATOM   3016 C C     . ILE C 3 255 ? 11.452  24.541  16.697 1.00 51.89  ? 457  ILE A C     1 
ATOM   3017 O O     . ILE C 3 255 ? 10.627  24.752  15.810 1.00 52.05  ? 457  ILE A O     1 
ATOM   3018 C CB    . ILE C 3 255 ? 12.672  22.328  17.178 1.00 53.22  ? 457  ILE A CB    1 
ATOM   3019 C CG1   . ILE C 3 255 ? 14.034  21.636  16.999 1.00 51.22  ? 457  ILE A CG1   1 
ATOM   3020 C CG2   . ILE C 3 255 ? 11.526  21.448  16.666 1.00 53.37  ? 457  ILE A CG2   1 
ATOM   3021 C CD1   . ILE C 3 255 ? 14.096  20.173  17.392 1.00 44.86  ? 457  ILE A CD1   1 
ATOM   3022 N N     . ARG C 3 256 ? 11.376  25.072  17.907 1.00 49.19  ? 458  ARG A N     1 
ATOM   3023 C CA    . ARG C 3 256 ? 10.258  25.875  18.340 1.00 51.03  ? 458  ARG A CA    1 
ATOM   3024 C C     . ARG C 3 256 ? 9.991   27.017  17.386 1.00 56.44  ? 458  ARG A C     1 
ATOM   3025 O O     . ARG C 3 256 ? 8.861   27.215  16.914 1.00 59.21  ? 458  ARG A O     1 
ATOM   3026 C CB    . ARG C 3 256 ? 10.528  26.406  19.744 1.00 46.76  ? 458  ARG A CB    1 
ATOM   3027 C CG    . ARG C 3 256 ? 10.424  25.327  20.778 1.00 47.25  ? 458  ARG A CG    1 
ATOM   3028 C CD    . ARG C 3 256 ? 10.759  25.797  22.139 1.00 42.30  ? 458  ARG A CD    1 
ATOM   3029 N NE    . ARG C 3 256 ? 10.395  24.754  23.089 1.00 47.13  ? 458  ARG A NE    1 
ATOM   3030 C CZ    . ARG C 3 256 ? 10.920  24.636  24.302 1.00 48.18  ? 458  ARG A CZ    1 
ATOM   3031 N NH1   . ARG C 3 256 ? 11.849  25.493  24.699 1.00 48.98  ? 458  ARG A NH1   1 
ATOM   3032 N NH2   . ARG C 3 256 ? 10.465  23.712  25.142 1.00 49.25  ? 458  ARG A NH2   1 
ATOM   3033 N N     . ASN C 3 257 ? 11.042  27.768  17.090 1.00 60.93  ? 459  ASN A N     1 
ATOM   3034 C CA    . ASN C 3 257 ? 10.917  28.910  16.198 1.00 62.04  ? 459  ASN A CA    1 
ATOM   3035 C C     . ASN C 3 257 ? 10.361  28.495  14.863 1.00 58.93  ? 459  ASN A C     1 
ATOM   3036 O O     . ASN C 3 257 ? 9.531   29.194  14.274 1.00 58.98  ? 459  ASN A O     1 
ATOM   3037 C CB    . ASN C 3 257 ? 12.268  29.615  16.037 1.00 68.80  ? 459  ASN A CB    1 
ATOM   3038 C CG    . ASN C 3 257 ? 12.433  30.789  17.015 1.00 77.62  ? 459  ASN A CG    1 
ATOM   3039 O OD1   . ASN C 3 257 ? 11.986  30.725  18.178 1.00 81.93  ? 459  ASN A OD1   1 
ATOM   3040 N ND2   . ASN C 3 257 ? 13.003  31.900  16.523 1.00 79.83  ? 459  ASN A ND2   1 
ATOM   3041 N N     . GLN C 3 258 ? 10.774  27.316  14.428 1.00 55.73  ? 460  GLN A N     1 
ATOM   3042 C CA    . GLN C 3 258 ? 10.330  26.800  13.160 1.00 56.75  ? 460  GLN A CA    1 
ATOM   3043 C C     . GLN C 3 258 ? 8.841   26.519  13.144 1.00 56.15  ? 460  GLN A C     1 
ATOM   3044 O O     . GLN C 3 258 ? 8.110   26.992  12.268 1.00 54.26  ? 460  GLN A O     1 
ATOM   3045 C CB    . GLN C 3 258 ? 11.082  25.528  12.836 1.00 58.27  ? 460  GLN A CB    1 
ATOM   3046 C CG    . GLN C 3 258 ? 11.686  25.555  11.476 1.00 65.04  ? 460  GLN A CG    1 
ATOM   3047 C CD    . GLN C 3 258 ? 11.658  24.190  10.834 1.00 72.11  ? 460  GLN A CD    1 
ATOM   3048 O OE1   . GLN C 3 258 ? 10.585  23.653  10.526 1.00 75.86  ? 460  GLN A OE1   1 
ATOM   3049 N NE2   . GLN C 3 258 ? 12.834  23.610  10.639 1.00 77.00  ? 460  GLN A NE2   1 
ATOM   3050 N N     . TYR C 3 259 ? 8.394   25.717  14.099 1.00 55.80  ? 461  TYR A N     1 
ATOM   3051 C CA    . TYR C 3 259 ? 6.994   25.384  14.125 1.00 55.67  ? 461  TYR A CA    1 
ATOM   3052 C C     . TYR C 3 259 ? 6.156   26.628  14.281 1.00 54.69  ? 461  TYR A C     1 
ATOM   3053 O O     . TYR C 3 259 ? 5.182   26.787  13.566 1.00 56.04  ? 461  TYR A O     1 
ATOM   3054 C CB    . TYR C 3 259 ? 6.657   24.256  15.128 1.00 53.70  ? 461  TYR A CB    1 
ATOM   3055 C CG    . TYR C 3 259 ? 6.718   24.535  16.625 1.00 49.98  ? 461  TYR A CG    1 
ATOM   3056 C CD1   . TYR C 3 259 ? 7.455   23.697  17.464 1.00 45.08  ? 461  TYR A CD1   1 
ATOM   3057 C CD2   . TYR C 3 259 ? 5.964   25.548  17.212 1.00 46.69  ? 461  TYR A CD2   1 
ATOM   3058 C CE1   . TYR C 3 259 ? 7.434   23.841  18.833 1.00 45.19  ? 461  TYR A CE1   1 
ATOM   3059 C CE2   . TYR C 3 259 ? 5.939   25.705  18.581 1.00 46.35  ? 461  TYR A CE2   1 
ATOM   3060 C CZ    . TYR C 3 259 ? 6.681   24.846  19.391 1.00 49.56  ? 461  TYR A CZ    1 
ATOM   3061 O OH    . TYR C 3 259 ? 6.688   25.003  20.763 1.00 49.66  ? 461  TYR A OH    1 
ATOM   3062 N N     . ARG C 3 260 ? 6.567   27.544  15.144 1.00 54.56  ? 462  ARG A N     1 
ATOM   3063 C CA    . ARG C 3 260 ? 5.792   28.757  15.283 1.00 59.36  ? 462  ARG A CA    1 
ATOM   3064 C C     . ARG C 3 260 ? 5.637   29.374  13.901 1.00 60.33  ? 462  ARG A C     1 
ATOM   3065 O O     . ARG C 3 260 ? 4.553   29.826  13.517 1.00 61.21  ? 462  ARG A O     1 
ATOM   3066 C CB    . ARG C 3 260 ? 6.445   29.725  16.262 1.00 63.94  ? 462  ARG A CB    1 
ATOM   3067 C CG    . ARG C 3 260 ? 6.385   29.212  17.696 1.00 73.36  ? 462  ARG A CG    1 
ATOM   3068 C CD    . ARG C 3 260 ? 6.667   30.290  18.771 1.00 81.80  ? 462  ARG A CD    1 
ATOM   3069 N NE    . ARG C 3 260 ? 6.255   29.869  20.130 1.00 90.80  ? 462  ARG A NE    1 
ATOM   3070 C CZ    . ARG C 3 260 ? 6.883   28.953  20.888 1.00 94.67  ? 462  ARG A CZ    1 
ATOM   3071 N NH1   . ARG C 3 260 ? 7.983   28.336  20.445 1.00 100.35 ? 462  ARG A NH1   1 
ATOM   3072 N NH2   . ARG C 3 260 ? 6.387   28.610  22.083 1.00 93.44  ? 462  ARG A NH2   1 
ATOM   3073 N N     . GLU C 3 261 ? 6.703   29.313  13.116 1.00 61.05  ? 463  GLU A N     1 
ATOM   3074 C CA    . GLU C 3 261 ? 6.641   29.844  11.763 1.00 59.95  ? 463  GLU A CA    1 
ATOM   3075 C C     . GLU C 3 261 ? 5.700   29.014  10.883 1.00 59.87  ? 463  GLU A C     1 
ATOM   3076 O O     . GLU C 3 261 ? 4.931   29.567  10.099 1.00 59.67  ? 463  GLU A O     1 
ATOM   3077 C CB    . GLU C 3 261 ? 8.035   29.881  11.144 1.00 57.06  ? 463  GLU A CB    1 
ATOM   3078 N N     . ASP C 3 262 ? 5.780   27.692  10.991 1.00 57.90  ? 464  ASP A N     1 
ATOM   3079 C CA    . ASP C 3 262 ? 4.937   26.831  10.186 1.00 57.30  ? 464  ASP A CA    1 
ATOM   3080 C C     . ASP C 3 262 ? 3.476   27.052  10.404 1.00 58.17  ? 464  ASP A C     1 
ATOM   3081 O O     . ASP C 3 262 ? 2.678   26.755  9.519  1.00 57.86  ? 464  ASP A O     1 
ATOM   3082 C CB    . ASP C 3 262 ? 5.246   25.378  10.452 1.00 60.17  ? 464  ASP A CB    1 
ATOM   3083 C CG    . ASP C 3 262 ? 6.637   25.033  10.101 1.00 62.81  ? 464  ASP A CG    1 
ATOM   3084 O OD1   . ASP C 3 262 ? 7.109   25.547  9.080  1.00 68.73  ? 464  ASP A OD1   1 
ATOM   3085 O OD2   . ASP C 3 262 ? 7.266   24.265  10.838 1.00 63.63  ? 464  ASP A OD2   1 
ATOM   3086 N N     . TRP C 3 263 ? 3.110   27.508  11.597 1.00 59.81  ? 465  TRP A N     1 
ATOM   3087 C CA    . TRP C 3 263 ? 1.703   27.752  11.893 1.00 64.29  ? 465  TRP A CA    1 
ATOM   3088 C C     . TRP C 3 263 ? 1.159   28.664  10.819 1.00 66.38  ? 465  TRP A C     1 
ATOM   3089 O O     . TRP C 3 263 ? -0.035  28.679  10.534 1.00 67.93  ? 465  TRP A O     1 
ATOM   3090 C CB    . TRP C 3 263 ? 1.531   28.451  13.238 1.00 62.74  ? 465  TRP A CB    1 
ATOM   3091 C CG    . TRP C 3 263 ? 1.886   27.631  14.429 1.00 61.48  ? 465  TRP A CG    1 
ATOM   3092 C CD1   . TRP C 3 263 ? 1.901   26.268  14.521 1.00 60.26  ? 465  TRP A CD1   1 
ATOM   3093 C CD2   . TRP C 3 263 ? 2.323   28.125  15.694 1.00 60.90  ? 465  TRP A CD2   1 
ATOM   3094 N NE1   . TRP C 3 263 ? 2.336   25.882  15.763 1.00 59.48  ? 465  TRP A NE1   1 
ATOM   3095 C CE2   . TRP C 3 263 ? 2.604   27.001  16.503 1.00 59.80  ? 465  TRP A CE2   1 
ATOM   3096 C CE3   . TRP C 3 263 ? 2.510   29.410  16.220 1.00 61.97  ? 465  TRP A CE3   1 
ATOM   3097 C CZ2   . TRP C 3 263 ? 3.067   27.124  17.817 1.00 60.58  ? 465  TRP A CZ2   1 
ATOM   3098 C CZ3   . TRP C 3 263 ? 2.970   29.535  17.528 1.00 64.15  ? 465  TRP A CZ3   1 
ATOM   3099 C CH2   . TRP C 3 263 ? 3.245   28.392  18.312 1.00 65.16  ? 465  TRP A CH2   1 
ATOM   3100 N N     . LYS C 3 264 ? 2.071   29.443  10.253 1.00 69.37  ? 466  LYS A N     1 
ATOM   3101 C CA    . LYS C 3 264 ? 1.781   30.405  9.205  1.00 70.14  ? 466  LYS A CA    1 
ATOM   3102 C C     . LYS C 3 264 ? 1.718   29.798  7.801  1.00 70.57  ? 466  LYS A C     1 
ATOM   3103 O O     . LYS C 3 264 ? 1.139   30.403  6.908  1.00 72.60  ? 466  LYS A O     1 
ATOM   3104 C CB    . LYS C 3 264 ? 2.852   31.502  9.241  1.00 71.28  ? 466  LYS A CB    1 
ATOM   3105 C CG    . LYS C 3 264 ? 2.364   32.896  9.636  1.00 76.51  ? 466  LYS A CG    1 
ATOM   3106 C CD    . LYS C 3 264 ? 0.966   32.911  10.300 1.00 81.23  ? 466  LYS A CD    1 
ATOM   3107 C CE    . LYS C 3 264 ? 0.454   34.359  10.497 1.00 84.36  ? 466  LYS A CE    1 
ATOM   3108 N NZ    . LYS C 3 264 ? -1.034  34.428  10.659 1.00 87.28  ? 466  LYS A NZ    1 
ATOM   3109 N N     . SER C 3 265 ? 2.282   28.603  7.625  1.00 72.06  ? 467  SER A N     1 
ATOM   3110 C CA    . SER C 3 265 ? 2.350   27.904  6.332  1.00 70.62  ? 467  SER A CA    1 
ATOM   3111 C C     . SER C 3 265 ? 1.149   27.907  5.395  1.00 71.84  ? 467  SER A C     1 
ATOM   3112 O O     . SER C 3 265 ? -0.012  28.057  5.794  1.00 71.17  ? 467  SER A O     1 
ATOM   3113 C CB    . SER C 3 265 ? 2.792   26.453  6.538  1.00 68.86  ? 467  SER A CB    1 
ATOM   3114 O OG    . SER C 3 265 ? 3.406   25.934  5.369  1.00 71.10  ? 467  SER A OG    1 
ATOM   3115 N N     . LYS C 3 266 ? 1.456   27.710  4.123  1.00 75.81  ? 468  LYS A N     1 
ATOM   3116 C CA    . LYS C 3 266 ? 0.438   27.658  3.076  1.00 80.08  ? 468  LYS A CA    1 
ATOM   3117 C C     . LYS C 3 266 ? -0.236  26.290  3.078  1.00 81.15  ? 468  LYS A C     1 
ATOM   3118 O O     . LYS C 3 266 ? -1.473  26.168  3.064  1.00 80.51  ? 468  LYS A O     1 
ATOM   3119 C CB    . LYS C 3 266 ? 1.102   27.882  1.711  1.00 82.80  ? 468  LYS A CB    1 
ATOM   3120 N N     . GLU C 3 267 ? 0.613   25.271  2.995  1.00 82.94  ? 469  GLU A N     1 
ATOM   3121 C CA    . GLU C 3 267 ? 0.182   23.887  2.993  1.00 85.20  ? 469  GLU A CA    1 
ATOM   3122 C C     . GLU C 3 267 ? -0.329  23.615  4.413  1.00 82.16  ? 469  GLU A C     1 
ATOM   3123 O O     . GLU C 3 267 ? 0.435   23.737  5.377  1.00 80.88  ? 469  GLU A O     1 
ATOM   3124 C CB    . GLU C 3 267 ? 1.398   23.007  2.665  1.00 91.06  ? 469  GLU A CB    1 
ATOM   3125 C CG    . GLU C 3 267 ? 1.094   21.592  2.111  1.00 100.17 ? 469  GLU A CG    1 
ATOM   3126 C CD    . GLU C 3 267 ? 2.382   20.754  1.806  1.00 105.47 ? 469  GLU A CD    1 
ATOM   3127 O OE1   . GLU C 3 267 ? 3.521   21.256  2.028  1.00 108.51 ? 469  GLU A OE1   1 
ATOM   3128 O OE2   . GLU C 3 267 ? 2.261   19.582  1.344  1.00 109.07 ? 469  GLU A OE2   1 
ATOM   3129 N N     . MET C 3 268 ? -1.625  23.307  4.529  1.00 79.04  ? 470  MET A N     1 
ATOM   3130 C CA    . MET C 3 268 ? -2.263  23.026  5.823  1.00 76.97  ? 470  MET A CA    1 
ATOM   3131 C C     . MET C 3 268 ? -1.626  21.852  6.596  1.00 75.60  ? 470  MET A C     1 
ATOM   3132 O O     . MET C 3 268 ? -1.651  21.790  7.832  1.00 73.64  ? 470  MET A O     1 
ATOM   3133 C CB    . MET C 3 268 ? -3.760  22.769  5.632  1.00 76.54  ? 470  MET A CB    1 
ATOM   3134 C CG    . MET C 3 268 ? -4.408  22.224  6.885  1.00 76.81  ? 470  MET A CG    1 
ATOM   3135 S SD    . MET C 3 268 ? -6.158  21.927  6.777  1.00 80.92  ? 470  MET A SD    1 
ATOM   3136 C CE    . MET C 3 268 ? -6.726  23.292  7.724  1.00 73.96  ? 470  MET A CE    1 
ATOM   3137 N N     . LYS C 3 269 ? -1.144  20.881  5.840  1.00 74.31  ? 471  LYS A N     1 
ATOM   3138 C CA    . LYS C 3 269 ? -0.473  19.719  6.390  1.00 73.24  ? 471  LYS A CA    1 
ATOM   3139 C C     . LYS C 3 269 ? 0.656   20.228  7.312  1.00 70.39  ? 471  LYS A C     1 
ATOM   3140 O O     . LYS C 3 269 ? 0.780   19.822  8.476  1.00 69.31  ? 471  LYS A O     1 
ATOM   3141 C CB    . LYS C 3 269 ? 0.077   18.927  5.197  1.00 80.00  ? 471  LYS A CB    1 
ATOM   3142 C CG    . LYS C 3 269 ? 1.141   17.868  5.480  1.00 88.49  ? 471  LYS A CG    1 
ATOM   3143 C CD    . LYS C 3 269 ? 1.594   17.125  4.178  1.00 95.51  ? 471  LYS A CD    1 
ATOM   3144 C CE    . LYS C 3 269 ? 2.644   16.013  4.494  1.00 100.61 ? 471  LYS A CE    1 
ATOM   3145 N NZ    . LYS C 3 269 ? 3.140   15.135  3.352  1.00 101.96 ? 471  LYS A NZ    1 
ATOM   3146 N N     . VAL C 3 270 ? 1.456   21.144  6.777  1.00 64.97  ? 472  VAL A N     1 
ATOM   3147 C CA    . VAL C 3 270 ? 2.556   21.737  7.521  1.00 62.20  ? 472  VAL A CA    1 
ATOM   3148 C C     . VAL C 3 270 ? 2.018   22.414  8.780  1.00 59.98  ? 472  VAL A C     1 
ATOM   3149 O O     . VAL C 3 270 ? 2.699   22.496  9.810  1.00 60.78  ? 472  VAL A O     1 
ATOM   3150 C CB    . VAL C 3 270 ? 3.276   22.797  6.667  1.00 61.11  ? 472  VAL A CB    1 
ATOM   3151 C CG1   . VAL C 3 270 ? 4.415   23.451  7.457  1.00 61.22  ? 472  VAL A CG1   1 
ATOM   3152 C CG2   . VAL C 3 270 ? 3.790   22.163  5.407  1.00 58.68  ? 472  VAL A CG2   1 
ATOM   3153 N N     . ARG C 3 271 ? 0.802   22.917  8.685  1.00 56.50  ? 473  ARG A N     1 
ATOM   3154 C CA    . ARG C 3 271 ? 0.207   23.588  9.817  1.00 56.81  ? 473  ARG A CA    1 
ATOM   3155 C C     . ARG C 3 271 ? -0.213  22.582  10.890 1.00 55.45  ? 473  ARG A C     1 
ATOM   3156 O O     . ARG C 3 271 ? 0.087   22.750  12.069 1.00 53.88  ? 473  ARG A O     1 
ATOM   3157 C CB    . ARG C 3 271 ? -0.992  24.454  9.370  1.00 59.75  ? 473  ARG A CB    1 
ATOM   3158 C CG    . ARG C 3 271 ? -0.655  25.738  8.561  1.00 61.03  ? 473  ARG A CG    1 
ATOM   3159 C CD    . ARG C 3 271 ? -1.884  26.690  8.433  1.00 63.74  ? 473  ARG A CD    1 
ATOM   3160 N NE    . ARG C 3 271 ? -1.622  27.943  7.691  1.00 68.06  ? 473  ARG A NE    1 
ATOM   3161 C CZ    . ARG C 3 271 ? -1.923  29.176  8.120  1.00 65.60  ? 473  ARG A CZ    1 
ATOM   3162 N NH1   . ARG C 3 271 ? -2.503  29.362  9.302  1.00 65.26  ? 473  ARG A NH1   1 
ATOM   3163 N NH2   . ARG C 3 271 ? -1.637  30.236  7.368  1.00 66.46  ? 473  ARG A NH2   1 
ATOM   3164 N N     . GLN C 3 272 ? -0.913  21.536  10.474 1.00 52.98  ? 474  GLN A N     1 
ATOM   3165 C CA    . GLN C 3 272 ? -1.375  20.519  11.411 1.00 53.99  ? 474  GLN A CA    1 
ATOM   3166 C C     . GLN C 3 272 ? -0.201  19.934  12.142 1.00 52.26  ? 474  GLN A C     1 
ATOM   3167 O O     . GLN C 3 272 ? -0.217  19.773  13.366 1.00 51.25  ? 474  GLN A O     1 
ATOM   3168 C CB    . GLN C 3 272 ? -2.146  19.437  10.667 1.00 56.05  ? 474  GLN A CB    1 
ATOM   3169 C CG    . GLN C 3 272 ? -3.436  19.997  10.117 1.00 57.20  ? 474  GLN A CG    1 
ATOM   3170 C CD    . GLN C 3 272 ? -4.243  19.000  9.341  1.00 59.08  ? 474  GLN A CD    1 
ATOM   3171 O OE1   . GLN C 3 272 ? -3.752  18.414  8.377  1.00 64.83  ? 474  GLN A OE1   1 
ATOM   3172 N NE2   . GLN C 3 272 ? -5.513  18.847  9.711  1.00 57.37  ? 474  GLN A NE2   1 
ATOM   3173 N N     . ARG C 3 273 ? 0.829   19.663  11.361 1.00 50.98  ? 475  ARG A N     1 
ATOM   3174 C CA    . ARG C 3 273 ? 2.057   19.125  11.870 1.00 53.19  ? 475  ARG A CA    1 
ATOM   3175 C C     . ARG C 3 273 ? 2.561   20.049  12.967 1.00 51.25  ? 475  ARG A C     1 
ATOM   3176 O O     . ARG C 3 273 ? 2.696   19.649  14.126 1.00 51.59  ? 475  ARG A O     1 
ATOM   3177 C CB    . ARG C 3 273 ? 3.085   19.069  10.738 1.00 56.53  ? 475  ARG A CB    1 
ATOM   3178 C CG    . ARG C 3 273 ? 4.291   18.183  11.023 1.00 57.47  ? 475  ARG A CG    1 
ATOM   3179 C CD    . ARG C 3 273 ? 5.282   18.254  9.878  1.00 60.53  ? 475  ARG A CD    1 
ATOM   3180 N NE    . ARG C 3 273 ? 5.887   19.586  9.776  1.00 71.03  ? 475  ARG A NE    1 
ATOM   3181 C CZ    . ARG C 3 273 ? 6.444   20.093  8.672  1.00 73.32  ? 475  ARG A CZ    1 
ATOM   3182 N NH1   . ARG C 3 273 ? 6.473   19.384  7.553  1.00 77.09  ? 475  ARG A NH1   1 
ATOM   3183 N NH2   . ARG C 3 273 ? 7.005   21.303  8.690  1.00 76.91  ? 475  ARG A NH2   1 
ATOM   3184 N N     . ALA C 3 274 ? 2.754   21.307  12.605 1.00 48.16  ? 476  ALA A N     1 
ATOM   3185 C CA    . ALA C 3 274 ? 3.279   22.285  13.534 1.00 47.79  ? 476  ALA A CA    1 
ATOM   3186 C C     . ALA C 3 274 ? 2.483   22.493  14.838 1.00 48.39  ? 476  ALA A C     1 
ATOM   3187 O O     . ALA C 3 274 ? 3.058   22.701  15.928 1.00 46.40  ? 476  ALA A O     1 
ATOM   3188 C CB    . ALA C 3 274 ? 3.479   23.584  12.814 1.00 47.15  ? 476  ALA A CB    1 
ATOM   3189 N N     . VAL C 3 275 ? 1.165   22.467  14.723 1.00 45.12  ? 477  VAL A N     1 
ATOM   3190 C CA    . VAL C 3 275 ? 0.322   22.660  15.878 1.00 45.54  ? 477  VAL A CA    1 
ATOM   3191 C C     . VAL C 3 275 ? 0.457   21.448  16.737 1.00 45.99  ? 477  VAL A C     1 
ATOM   3192 O O     . VAL C 3 275 ? 0.458   21.528  17.973 1.00 43.45  ? 477  VAL A O     1 
ATOM   3193 C CB    . VAL C 3 275 ? -1.109  22.763  15.464 1.00 46.20  ? 477  VAL A CB    1 
ATOM   3194 C CG1   . VAL C 3 275 ? -2.022  22.586  16.661 1.00 44.47  ? 477  VAL A CG1   1 
ATOM   3195 C CG2   . VAL C 3 275 ? -1.322  24.092  14.825 1.00 47.72  ? 477  VAL A CG2   1 
ATOM   3196 N N     . ALA C 3 276 ? 0.420   20.309  16.064 1.00 44.36  ? 478  ALA A N     1 
ATOM   3197 C CA    . ALA C 3 276 ? 0.552   19.070  16.748 1.00 40.79  ? 478  ALA A CA    1 
ATOM   3198 C C     . ALA C 3 276 ? 1.831   19.159  17.595 1.00 40.35  ? 478  ALA A C     1 
ATOM   3199 O O     . ALA C 3 276 ? 1.774   19.044  18.821 1.00 39.64  ? 478  ALA A O     1 
ATOM   3200 C CB    . ALA C 3 276 ? 0.618   17.969  15.754 1.00 36.87  ? 478  ALA A CB    1 
ATOM   3201 N N     . LEU C 3 277 ? 2.948   19.509  16.969 1.00 35.44  ? 479  LEU A N     1 
ATOM   3202 C CA    . LEU C 3 277 ? 4.209   19.588  17.702 1.00 44.15  ? 479  LEU A CA    1 
ATOM   3203 C C     . LEU C 3 277 ? 4.207   20.598  18.816 1.00 46.79  ? 479  LEU A C     1 
ATOM   3204 O O     . LEU C 3 277 ? 4.987   20.500  19.771 1.00 48.88  ? 479  LEU A O     1 
ATOM   3205 C CB    . LEU C 3 277 ? 5.386   19.860  16.762 1.00 47.44  ? 479  LEU A CB    1 
ATOM   3206 C CG    . LEU C 3 277 ? 6.803   19.836  17.364 1.00 47.99  ? 479  LEU A CG    1 
ATOM   3207 C CD1   . LEU C 3 277 ? 6.978   18.692  18.328 1.00 48.69  ? 479  LEU A CD1   1 
ATOM   3208 C CD2   . LEU C 3 277 ? 7.816   19.731  16.252 1.00 50.74  ? 479  LEU A CD2   1 
ATOM   3209 N N     . TYR C 3 278 ? 3.418   21.635  18.625 1.00 48.82  ? 480  TYR A N     1 
ATOM   3210 C CA    . TYR C 3 278 ? 3.298   22.655  19.630 1.00 48.69  ? 480  TYR A CA    1 
ATOM   3211 C C     . TYR C 3 278 ? 2.851   21.949  20.895 1.00 46.79  ? 480  TYR A C     1 
ATOM   3212 O O     . TYR C 3 278 ? 3.462   22.087  21.942 1.00 41.89  ? 480  TYR A O     1 
ATOM   3213 C CB    . TYR C 3 278 ? 2.217   23.626  19.191 1.00 52.58  ? 480  TYR A CB    1 
ATOM   3214 C CG    . TYR C 3 278 ? 1.835   24.642  20.232 1.00 53.35  ? 480  TYR A CG    1 
ATOM   3215 C CD1   . TYR C 3 278 ? 2.810   25.389  20.892 1.00 55.38  ? 480  TYR A CD1   1 
ATOM   3216 C CD2   . TYR C 3 278 ? 0.501   24.881  20.542 1.00 54.61  ? 480  TYR A CD2   1 
ATOM   3217 C CE1   . TYR C 3 278 ? 2.468   26.357  21.839 1.00 54.86  ? 480  TYR A CE1   1 
ATOM   3218 C CE2   . TYR C 3 278 ? 0.144   25.849  21.492 1.00 56.68  ? 480  TYR A CE2   1 
ATOM   3219 C CZ    . TYR C 3 278 ? 1.132   26.587  22.137 1.00 54.97  ? 480  TYR A CZ    1 
ATOM   3220 O OH    . TYR C 3 278 ? 0.802   27.554  23.079 1.00 56.07  ? 480  TYR A OH    1 
ATOM   3221 N N     . PHE C 3 279 ? 1.782   21.169  20.759 1.00 47.77  ? 481  PHE A N     1 
ATOM   3222 C CA    . PHE C 3 279 ? 1.190   20.420  21.857 1.00 48.63  ? 481  PHE A CA    1 
ATOM   3223 C C     . PHE C 3 279 ? 2.115   19.457  22.488 1.00 48.15  ? 481  PHE A C     1 
ATOM   3224 O O     . PHE C 3 279 ? 2.135   19.325  23.699 1.00 50.10  ? 481  PHE A O     1 
ATOM   3225 C CB    . PHE C 3 279 ? 0.007   19.651  21.358 1.00 50.15  ? 481  PHE A CB    1 
ATOM   3226 C CG    . PHE C 3 279 ? -1.090  20.512  20.946 1.00 54.29  ? 481  PHE A CG    1 
ATOM   3227 C CD1   . PHE C 3 279 ? -2.021  20.075  20.021 1.00 55.21  ? 481  PHE A CD1   1 
ATOM   3228 C CD2   . PHE C 3 279 ? -1.218  21.769  21.512 1.00 52.07  ? 481  PHE A CD2   1 
ATOM   3229 C CE1   . PHE C 3 279 ? -3.074  20.881  19.672 1.00 54.79  ? 481  PHE A CE1   1 
ATOM   3230 C CE2   . PHE C 3 279 ? -2.256  22.582  21.174 1.00 51.28  ? 481  PHE A CE2   1 
ATOM   3231 C CZ    . PHE C 3 279 ? -3.197  22.144  20.252 1.00 54.09  ? 481  PHE A CZ    1 
ATOM   3232 N N     . ILE C 3 280 ? 2.755   18.663  21.650 1.00 46.08  ? 482  ILE A N     1 
ATOM   3233 C CA    . ILE C 3 280 ? 3.705   17.696  22.139 1.00 45.36  ? 482  ILE A CA    1 
ATOM   3234 C C     . ILE C 3 280 ? 4.741   18.449  22.933 1.00 44.29  ? 482  ILE A C     1 
ATOM   3235 O O     . ILE C 3 280 ? 4.929   18.174  24.102 1.00 42.98  ? 482  ILE A O     1 
ATOM   3236 C CB    . ILE C 3 280 ? 4.315   16.945  20.979 1.00 45.21  ? 482  ILE A CB    1 
ATOM   3237 C CG1   . ILE C 3 280 ? 3.274   15.937  20.493 1.00 44.17  ? 482  ILE A CG1   1 
ATOM   3238 C CG2   . ILE C 3 280 ? 5.655   16.325  21.369 1.00 39.21  ? 482  ILE A CG2   1 
ATOM   3239 C CD1   . ILE C 3 280 ? 3.573   15.334  19.189 1.00 40.30  ? 482  ILE A CD1   1 
ATOM   3240 N N     . ASP C 3 281 ? 5.343   19.450  22.307 1.00 42.77  ? 483  ASP A N     1 
ATOM   3241 C CA    . ASP C 3 281 ? 6.341   20.261  22.970 1.00 45.92  ? 483  ASP A CA    1 
ATOM   3242 C C     . ASP C 3 281 ? 5.749   20.873  24.260 1.00 50.40  ? 483  ASP A C     1 
ATOM   3243 O O     . ASP C 3 281 ? 6.206   20.576  25.351 1.00 51.85  ? 483  ASP A O     1 
ATOM   3244 C CB    . ASP C 3 281 ? 6.870   21.348  21.988 1.00 46.94  ? 483  ASP A CB    1 
ATOM   3245 C CG    . ASP C 3 281 ? 8.022   22.214  22.569 1.00 48.93  ? 483  ASP A CG    1 
ATOM   3246 O OD1   . ASP C 3 281 ? 8.142   23.399  22.194 1.00 45.29  ? 483  ASP A OD1   1 
ATOM   3247 O OD2   . ASP C 3 281 ? 8.826   21.725  23.374 1.00 44.54  ? 483  ASP A OD2   1 
ATOM   3248 N N     . LYS C 3 282 ? 4.642   21.600  24.159 1.00 50.84  ? 484  LYS A N     1 
ATOM   3249 C CA    . LYS C 3 282 ? 4.101   22.283  25.329 1.00 49.07  ? 484  LYS A CA    1 
ATOM   3250 C C     . LYS C 3 282 ? 3.366   21.516  26.384 1.00 49.82  ? 484  LYS A C     1 
ATOM   3251 O O     . LYS C 3 282 ? 3.406   21.889  27.562 1.00 50.96  ? 484  LYS A O     1 
ATOM   3252 C CB    . LYS C 3 282 ? 3.211   23.445  24.880 1.00 52.40  ? 484  LYS A CB    1 
ATOM   3253 C CG    . LYS C 3 282 ? 2.649   24.304  26.014 1.00 52.77  ? 484  LYS A CG    1 
ATOM   3254 C CD    . LYS C 3 282 ? 1.754   25.430  25.486 1.00 57.57  ? 484  LYS A CD    1 
ATOM   3255 C CE    . LYS C 3 282 ? 1.078   26.221  26.618 1.00 62.85  ? 484  LYS A CE    1 
ATOM   3256 N NZ    . LYS C 3 282 ? 0.224   27.340  26.078 1.00 67.78  ? 484  LYS A NZ    1 
ATOM   3257 N N     . LEU C 3 283 ? 2.615   20.511  25.961 1.00 51.52  ? 485  LEU A N     1 
ATOM   3258 C CA    . LEU C 3 283 ? 1.788   19.749  26.887 1.00 51.02  ? 485  LEU A CA    1 
ATOM   3259 C C     . LEU C 3 283 ? 2.271   18.375  27.182 1.00 50.00  ? 485  LEU A C     1 
ATOM   3260 O O     . LEU C 3 283 ? 1.752   17.737  28.082 1.00 49.00  ? 485  LEU A O     1 
ATOM   3261 C CB    . LEU C 3 283 ? 0.360   19.658  26.356 1.00 50.45  ? 485  LEU A CB    1 
ATOM   3262 C CG    . LEU C 3 283 ? -0.225  21.025  25.984 1.00 48.93  ? 485  LEU A CG    1 
ATOM   3263 C CD1   . LEU C 3 283 ? -1.575  20.866  25.301 1.00 48.23  ? 485  LEU A CD1   1 
ATOM   3264 C CD2   . LEU C 3 283 ? -0.299  21.893  27.233 1.00 41.42  ? 485  LEU A CD2   1 
ATOM   3265 N N     . ALA C 3 284 ? 3.237   17.920  26.392 1.00 49.28  ? 486  ALA A N     1 
ATOM   3266 C CA    . ALA C 3 284 ? 3.807   16.588  26.547 1.00 47.88  ? 486  ALA A CA    1 
ATOM   3267 C C     . ALA C 3 284 ? 2.861   15.529  26.012 1.00 44.86  ? 486  ALA A C     1 
ATOM   3268 O O     . ALA C 3 284 ? 2.773   14.444  26.573 1.00 44.46  ? 486  ALA A O     1 
ATOM   3269 C CB    . ALA C 3 284 ? 4.132   16.308  28.031 1.00 44.81  ? 486  ALA A CB    1 
ATOM   3270 N N     . LEU C 3 285 ? 2.189   15.829  24.909 1.00 40.82  ? 487  LEU A N     1 
ATOM   3271 C CA    . LEU C 3 285 ? 1.248   14.869  24.348 1.00 42.10  ? 487  LEU A CA    1 
ATOM   3272 C C     . LEU C 3 285 ? 1.947   13.753  23.611 1.00 40.35  ? 487  LEU A C     1 
ATOM   3273 O O     . LEU C 3 285 ? 2.935   13.985  22.950 1.00 39.92  ? 487  LEU A O     1 
ATOM   3274 C CB    . LEU C 3 285 ? 0.222   15.552  23.434 1.00 40.18  ? 487  LEU A CB    1 
ATOM   3275 C CG    . LEU C 3 285 ? -0.606  16.671  24.086 1.00 41.98  ? 487  LEU A CG    1 
ATOM   3276 C CD1   . LEU C 3 285 ? -1.747  17.098  23.180 1.00 37.57  ? 487  LEU A CD1   1 
ATOM   3277 C CD2   . LEU C 3 285 ? -1.151  16.208  25.404 1.00 38.17  ? 487  LEU A CD2   1 
ATOM   3278 N N     . ARG C 3 286 ? 1.417   12.546  23.730 1.00 41.48  ? 488  ARG A N     1 
ATOM   3279 C CA    . ARG C 3 286 ? 1.985   11.388  23.076 1.00 43.04  ? 488  ARG A CA    1 
ATOM   3280 C C     . ARG C 3 286 ? 1.747   11.448  21.587 1.00 43.03  ? 488  ARG A C     1 
ATOM   3281 O O     . ARG C 3 286 ? 0.900   12.200  21.105 1.00 48.11  ? 488  ARG A O     1 
ATOM   3282 C CB    . ARG C 3 286 ? 1.387   10.100  23.625 1.00 40.34  ? 488  ARG A CB    1 
ATOM   3283 C CG    . ARG C 3 286 ? 1.708   9.829   25.041 1.00 38.23  ? 488  ARG A CG    1 
ATOM   3284 C CD    . ARG C 3 286 ? 1.575   8.354   25.286 1.00 42.02  ? 488  ARG A CD    1 
ATOM   3285 N NE    . ARG C 3 286 ? 2.212   7.954   26.540 1.00 43.61  ? 488  ARG A NE    1 
ATOM   3286 C CZ    . ARG C 3 286 ? 1.658   8.145   27.723 1.00 43.85  ? 488  ARG A CZ    1 
ATOM   3287 N NH1   . ARG C 3 286 ? 0.486   8.728   27.775 1.00 53.09  ? 488  ARG A NH1   1 
ATOM   3288 N NH2   . ARG C 3 286 ? 2.222   7.720   28.837 1.00 41.41  ? 488  ARG A NH2   1 
ATOM   3289 N N     . ALA C 3 287 ? 2.469   10.606  20.870 1.00 43.43  ? 489  ALA A N     1 
ATOM   3290 C CA    . ALA C 3 287 ? 2.396   10.524  19.436 1.00 42.67  ? 489  ALA A CA    1 
ATOM   3291 C C     . ALA C 3 287 ? 0.955   10.481  18.998 1.00 41.64  ? 489  ALA A C     1 
ATOM   3292 O O     . ALA C 3 287 ? 0.498   11.343  18.254 1.00 36.94  ? 489  ALA A O     1 
ATOM   3293 C CB    . ALA C 3 287 ? 3.136   9.273   18.960 1.00 44.56  ? 489  ALA A CB    1 
ATOM   3294 N N     . GLY C 3 288 ? 0.230   9.516   19.538 1.00 39.19  ? 490  GLY A N     1 
ATOM   3295 C CA    . GLY C 3 288 ? -1.155  9.346   19.172 1.00 42.29  ? 490  GLY A CA    1 
ATOM   3296 C C     . GLY C 3 288 ? -1.263  8.613   17.850 1.00 44.09  ? 490  GLY A C     1 
ATOM   3297 O O     . GLY C 3 288 ? -1.776  9.154   16.884 1.00 43.35  ? 490  GLY A O     1 
ATOM   3298 N N     . ASN C 3 289 ? -0.669  7.421   17.800 1.00 47.18  ? 491  ASN A N     1 
ATOM   3299 C CA    . ASN C 3 289 ? -0.656  6.537   16.620 1.00 48.67  ? 491  ASN A CA    1 
ATOM   3300 C C     . ASN C 3 289 ? -2.047  6.064   16.288 1.00 49.82  ? 491  ASN A C     1 
ATOM   3301 O O     . ASN C 3 289 ? -2.888  5.979   17.167 1.00 51.30  ? 491  ASN A O     1 
ATOM   3302 C CB    . ASN C 3 289 ? 0.161   5.281   16.915 1.00 47.79  ? 491  ASN A CB    1 
ATOM   3303 C CG    . ASN C 3 289 ? 1.580   5.402   16.496 1.00 48.35  ? 491  ASN A CG    1 
ATOM   3304 O OD1   . ASN C 3 289 ? 1.915   5.116   15.363 1.00 50.50  ? 491  ASN A OD1   1 
ATOM   3305 N ND2   . ASN C 3 289 ? 2.442   5.808   17.426 1.00 46.97  ? 491  ASN A ND2   1 
ATOM   3306 N N     . GLU C 3 290 ? -2.265  5.646   15.053 1.00 49.54  ? 492  GLU A N     1 
ATOM   3307 C CA    . GLU C 3 290 ? -3.569  5.155   14.690 1.00 51.51  ? 492  GLU A CA    1 
ATOM   3308 C C     . GLU C 3 290 ? -3.708  3.710   15.156 1.00 52.63  ? 492  GLU A C     1 
ATOM   3309 O O     . GLU C 3 290 ? -3.009  2.818   14.675 1.00 55.02  ? 492  GLU A O     1 
ATOM   3310 C CB    . GLU C 3 290 ? -3.791  5.241   13.187 1.00 56.52  ? 492  GLU A CB    1 
ATOM   3311 C CG    . GLU C 3 290 ? -5.205  4.826   12.786 1.00 64.83  ? 492  GLU A CG    1 
ATOM   3312 C CD    . GLU C 3 290 ? -5.545  5.122   11.329 1.00 70.17  ? 492  GLU A CD    1 
ATOM   3313 O OE1   . GLU C 3 290 ? -5.647  6.318   10.985 1.00 76.20  ? 492  GLU A OE1   1 
ATOM   3314 O OE2   . GLU C 3 290 ? -5.742  4.170   10.531 1.00 74.58  ? 492  GLU A OE2   1 
ATOM   3315 N N     . LYS C 3 291 ? -4.642  3.494   16.079 1.00 52.32  ? 493  LYS A N     1 
ATOM   3316 C CA    . LYS C 3 291 ? -4.960  2.182   16.666 1.00 52.83  ? 493  LYS A CA    1 
ATOM   3317 C C     . LYS C 3 291 ? -5.885  1.348   15.770 1.00 56.34  ? 493  LYS A C     1 
ATOM   3318 O O     . LYS C 3 291 ? -6.772  1.893   15.094 1.00 56.39  ? 493  LYS A O     1 
ATOM   3319 C CB    . LYS C 3 291 ? -5.732  2.366   17.969 1.00 49.88  ? 493  LYS A CB    1 
ATOM   3320 C CG    . LYS C 3 291 ? -4.958  2.544   19.240 1.00 42.30  ? 493  LYS A CG    1 
ATOM   3321 C CD    . LYS C 3 291 ? -5.934  2.337   20.345 1.00 40.71  ? 493  LYS A CD    1 
ATOM   3322 C CE    . LYS C 3 291 ? -5.299  2.576   21.629 1.00 42.54  ? 493  LYS A CE    1 
ATOM   3323 N NZ    . LYS C 3 291 ? -6.251  2.054   22.620 1.00 46.51  ? 493  LYS A NZ    1 
ATOM   3324 N N     . GLU C 3 292 ? -5.763  0.026   15.830 1.00 58.83  ? 494  GLU A N     1 
ATOM   3325 C CA    . GLU C 3 292 ? -6.641  -0.809  15.022 1.00 62.65  ? 494  GLU A CA    1 
ATOM   3326 C C     . GLU C 3 292 ? -8.017  -0.870  15.655 1.00 63.14  ? 494  GLU A C     1 
ATOM   3327 O O     . GLU C 3 292 ? -8.148  -1.179  16.839 1.00 64.82  ? 494  GLU A O     1 
ATOM   3328 C CB    . GLU C 3 292 ? -6.110  -2.226  14.873 1.00 66.92  ? 494  GLU A CB    1 
ATOM   3329 C CG    . GLU C 3 292 ? -7.043  -3.077  13.992 1.00 77.69  ? 494  GLU A CG    1 
ATOM   3330 C CD    . GLU C 3 292 ? -6.642  -4.560  13.882 1.00 84.84  ? 494  GLU A CD    1 
ATOM   3331 O OE1   . GLU C 3 292 ? -5.519  -4.935  14.337 1.00 89.12  ? 494  GLU A OE1   1 
ATOM   3332 O OE2   . GLU C 3 292 ? -7.467  -5.351  13.331 1.00 85.59  ? 494  GLU A OE2   1 
ATOM   3333 N N     . GLU C 3 293 ? -9.049  -0.596  14.865 1.00 63.10  ? 495  GLU A N     1 
ATOM   3334 C CA    . GLU C 3 293 ? -10.412 -0.637  15.400 1.00 66.18  ? 495  GLU A CA    1 
ATOM   3335 C C     . GLU C 3 293 ? -10.797 -1.999  16.008 1.00 67.85  ? 495  GLU A C     1 
ATOM   3336 O O     . GLU C 3 293 ? -10.332 -3.069  15.570 1.00 71.11  ? 495  GLU A O     1 
ATOM   3337 C CB    . GLU C 3 293 ? -11.431 -0.237  14.336 1.00 65.55  ? 495  GLU A CB    1 
ATOM   3338 N N     . GLY C 3 294 ? -11.639 -1.930  17.036 1.00 68.07  ? 496  GLY A N     1 
ATOM   3339 C CA    . GLY C 3 294 ? -12.113 -3.115  17.734 1.00 65.44  ? 496  GLY A CA    1 
ATOM   3340 C C     . GLY C 3 294 ? -11.077 -3.920  18.495 1.00 64.64  ? 496  GLY A C     1 
ATOM   3341 O O     . GLY C 3 294 ? -11.407 -4.925  19.117 1.00 67.33  ? 496  GLY A O     1 
ATOM   3342 N N     . GLU C 3 295 ? -9.832  -3.484  18.494 1.00 64.80  ? 497  GLU A N     1 
ATOM   3343 C CA    . GLU C 3 295 ? -8.809  -4.255  19.179 1.00 63.91  ? 497  GLU A CA    1 
ATOM   3344 C C     . GLU C 3 295 ? -8.602  -3.844  20.604 1.00 62.02  ? 497  GLU A C     1 
ATOM   3345 O O     . GLU C 3 295 ? -8.508  -4.695  21.483 1.00 60.35  ? 497  GLU A O     1 
ATOM   3346 C CB    . GLU C 3 295 ? -7.503  -4.172  18.409 1.00 71.47  ? 497  GLU A CB    1 
ATOM   3347 C CG    . GLU C 3 295 ? -7.624  -4.755  17.012 1.00 77.52  ? 497  GLU A CG    1 
ATOM   3348 C CD    . GLU C 3 295 ? -8.147  -6.186  17.034 1.00 82.89  ? 497  GLU A CD    1 
ATOM   3349 O OE1   . GLU C 3 295 ? -7.432  -7.062  17.600 1.00 84.15  ? 497  GLU A OE1   1 
ATOM   3350 O OE2   . GLU C 3 295 ? -9.275  -6.419  16.507 1.00 85.53  ? 497  GLU A OE2   1 
ATOM   3351 N N     . THR C 3 296 ? -8.577  -2.532  20.826 1.00 60.70  ? 498  THR A N     1 
ATOM   3352 C CA    . THR C 3 296 ? -8.381  -1.951  22.160 1.00 59.36  ? 498  THR A CA    1 
ATOM   3353 C C     . THR C 3 296 ? -9.527  -1.021  22.520 1.00 54.11  ? 498  THR A C     1 
ATOM   3354 O O     . THR C 3 296 ? -10.537 -0.960  21.813 1.00 53.67  ? 498  THR A O     1 
ATOM   3355 C CB    . THR C 3 296 ? -7.104  -1.074  22.214 1.00 65.25  ? 498  THR A CB    1 
ATOM   3356 O OG1   . THR C 3 296 ? -6.600  -0.865  20.876 1.00 68.26  ? 498  THR A OG1   1 
ATOM   3357 C CG2   . THR C 3 296 ? -6.056  -1.684  23.157 1.00 60.06  ? 498  THR A CG2   1 
ATOM   3358 N N     . ALA C 3 297 ? -9.381  -0.349  23.658 1.00 48.14  ? 499  ALA A N     1 
ATOM   3359 C CA    . ALA C 3 297 ? -10.347 0.634   24.121 1.00 47.29  ? 499  ALA A CA    1 
ATOM   3360 C C     . ALA C 3 297 ? -10.057 1.912   23.328 1.00 49.95  ? 499  ALA A C     1 
ATOM   3361 O O     . ALA C 3 297 ? -8.966  2.066   22.734 1.00 50.21  ? 499  ALA A O     1 
ATOM   3362 C CB    . ALA C 3 297 ? -10.170 0.898   25.590 1.00 40.85  ? 499  ALA A CB    1 
ATOM   3363 N N     . ASP C 3 298 ? -11.048 2.805   23.281 1.00 49.23  ? 500  ASP A N     1 
ATOM   3364 C CA    . ASP C 3 298 ? -10.911 4.068   22.573 1.00 44.27  ? 500  ASP A CA    1 
ATOM   3365 C C     . ASP C 3 298 ? -10.038 5.083   23.334 1.00 40.57  ? 500  ASP A C     1 
ATOM   3366 O O     . ASP C 3 298 ? -10.493 5.739   24.271 1.00 38.39  ? 500  ASP A O     1 
ATOM   3367 C CB    . ASP C 3 298 ? -12.296 4.642   22.301 1.00 46.98  ? 500  ASP A CB    1 
ATOM   3368 C CG    . ASP C 3 298 ? -12.298 5.688   21.206 1.00 52.67  ? 500  ASP A CG    1 
ATOM   3369 O OD1   . ASP C 3 298 ? -11.224 6.114   20.736 1.00 55.37  ? 500  ASP A OD1   1 
ATOM   3370 O OD2   . ASP C 3 298 ? -13.401 6.079   20.792 1.00 60.08  ? 500  ASP A OD2   1 
ATOM   3371 N N     . THR C 3 299 ? -8.765  5.174   22.975 1.00 34.87  ? 501  THR A N     1 
ATOM   3372 C CA    . THR C 3 299 ? -7.891  6.141   23.622 1.00 34.98  ? 501  THR A CA    1 
ATOM   3373 C C     . THR C 3 299 ? -7.191  6.834   22.487 1.00 36.67  ? 501  THR A C     1 
ATOM   3374 O O     . THR C 3 299 ? -7.030  6.211   21.463 1.00 37.82  ? 501  THR A O     1 
ATOM   3375 C CB    . THR C 3 299 ? -6.861  5.483   24.509 1.00 34.60  ? 501  THR A CB    1 
ATOM   3376 O OG1   . THR C 3 299 ? -6.095  4.574   23.735 1.00 36.09  ? 501  THR A OG1   1 
ATOM   3377 C CG2   . THR C 3 299 ? -7.519  4.739   25.655 1.00 36.89  ? 501  THR A CG2   1 
ATOM   3378 N N     . VAL C 3 300 ? -6.878  8.132   22.612 1.00 36.07  ? 502  VAL A N     1 
ATOM   3379 C CA    . VAL C 3 300 ? -6.213  8.867   21.524 1.00 35.40  ? 502  VAL A CA    1 
ATOM   3380 C C     . VAL C 3 300 ? -4.968  9.573   21.990 1.00 38.53  ? 502  VAL A C     1 
ATOM   3381 O O     . VAL C 3 300 ? -4.805  9.802   23.181 1.00 38.15  ? 502  VAL A O     1 
ATOM   3382 C CB    . VAL C 3 300 ? -7.122  9.964   20.879 1.00 34.22  ? 502  VAL A CB    1 
ATOM   3383 C CG1   . VAL C 3 300 ? -8.342  9.347   20.215 1.00 28.43  ? 502  VAL A CG1   1 
ATOM   3384 C CG2   . VAL C 3 300 ? -7.515  11.003  21.917 1.00 26.37  ? 502  VAL A CG2   1 
ATOM   3385 N N     . GLY C 3 301 ? -4.178  10.036  21.027 1.00 38.09  ? 503  GLY A N     1 
ATOM   3386 C CA    . GLY C 3 301 ? -2.953  10.742  21.323 1.00 39.25  ? 503  GLY A CA    1 
ATOM   3387 C C     . GLY C 3 301 ? -2.936  12.011  20.505 1.00 44.18  ? 503  GLY A C     1 
ATOM   3388 O O     . GLY C 3 301 ? -3.945  12.331  19.867 1.00 42.80  ? 503  GLY A O     1 
ATOM   3389 N N     . CYS C 3 302 ? -1.795  12.700  20.440 1.00 44.21  ? 504  CYS A N     1 
ATOM   3390 C CA    . CYS C 3 302 ? -1.757  13.950  19.705 1.00 44.87  ? 504  CYS A CA    1 
ATOM   3391 C C     . CYS C 3 302 ? -2.172  13.888  18.255 1.00 46.18  ? 504  CYS A C     1 
ATOM   3392 O O     . CYS C 3 302 ? -3.043  14.641  17.839 1.00 48.27  ? 504  CYS A O     1 
ATOM   3393 C CB    . CYS C 3 302 ? -0.425  14.657  19.823 1.00 43.19  ? 504  CYS A CB    1 
ATOM   3394 S SG    . CYS C 3 302 ? -0.602  16.350  19.256 1.00 48.46  ? 504  CYS A SG    1 
ATOM   3395 N N     . CYS C 3 303 ? -1.546  13.017  17.478 1.00 47.23  ? 505  CYS A N     1 
ATOM   3396 C CA    . CYS C 3 303 ? -1.887  12.910  16.064 1.00 45.78  ? 505  CYS A CA    1 
ATOM   3397 C C     . CYS C 3 303 ? -3.258  12.286  15.808 1.00 46.14  ? 505  CYS A C     1 
ATOM   3398 O O     . CYS C 3 303 ? -3.818  12.472  14.733 1.00 47.67  ? 505  CYS A O     1 
ATOM   3399 C CB    . CYS C 3 303 ? -0.809  12.132  15.307 1.00 42.79  ? 505  CYS A CB    1 
ATOM   3400 S SG    . CYS C 3 303 ? 0.827   12.865  15.399 1.00 45.79  ? 505  CYS A SG    1 
ATOM   3401 N N     . SER C 3 304 ? -3.817  11.620  16.816 1.00 45.33  ? 506  SER A N     1 
ATOM   3402 C CA    . SER C 3 304 ? -5.105  10.947  16.659 1.00 45.80  ? 506  SER A CA    1 
ATOM   3403 C C     . SER C 3 304 ? -6.291  11.628  17.336 1.00 45.65  ? 506  SER A C     1 
ATOM   3404 O O     . SER C 3 304 ? -7.329  11.018  17.577 1.00 46.16  ? 506  SER A O     1 
ATOM   3405 C CB    . SER C 3 304 ? -4.990  9.492   17.135 1.00 42.66  ? 506  SER A CB    1 
ATOM   3406 O OG    . SER C 3 304 ? -4.456  9.413   18.452 1.00 43.77  ? 506  SER A OG    1 
ATOM   3407 N N     . LEU C 3 305 ? -6.124  12.876  17.722 1.00 43.87  ? 507  LEU A N     1 
ATOM   3408 C CA    . LEU C 3 305 ? -7.213  13.555  18.366 1.00 44.35  ? 507  LEU A CA    1 
ATOM   3409 C C     . LEU C 3 305 ? -8.386  13.772  17.406 1.00 44.49  ? 507  LEU A C     1 
ATOM   3410 O O     . LEU C 3 305 ? -8.210  14.209  16.269 1.00 41.44  ? 507  LEU A O     1 
ATOM   3411 C CB    . LEU C 3 305 ? -6.731  14.900  18.889 1.00 47.55  ? 507  LEU A CB    1 
ATOM   3412 C CG    . LEU C 3 305 ? -5.855  15.006  20.141 1.00 48.17  ? 507  LEU A CG    1 
ATOM   3413 C CD1   . LEU C 3 305 ? -5.009  16.292  20.139 1.00 46.24  ? 507  LEU A CD1   1 
ATOM   3414 C CD2   . LEU C 3 305 ? -6.749  14.950  21.365 1.00 49.45  ? 507  LEU A CD2   1 
ATOM   3415 N N     . ARG C 3 306 ? -9.589  13.439  17.862 1.00 43.47  ? 508  ARG A N     1 
ATOM   3416 C CA    . ARG C 3 306 ? -10.772 13.678  17.053 1.00 42.04  ? 508  ARG A CA    1 
ATOM   3417 C C     . ARG C 3 306 ? -11.241 15.034  17.526 1.00 43.66  ? 508  ARG A C     1 
ATOM   3418 O O     . ARG C 3 306 ? -11.002 15.415  18.686 1.00 40.40  ? 508  ARG A O     1 
ATOM   3419 C CB    . ARG C 3 306 ? -11.791 12.592  17.269 1.00 37.96  ? 508  ARG A CB    1 
ATOM   3420 C CG    . ARG C 3 306 ? -11.161 11.266  16.961 1.00 38.83  ? 508  ARG A CG    1 
ATOM   3421 C CD    . ARG C 3 306 ? -12.166 10.207  16.782 1.00 39.89  ? 508  ARG A CD    1 
ATOM   3422 N NE    . ARG C 3 306 ? -13.047 10.086  17.932 1.00 47.62  ? 508  ARG A NE    1 
ATOM   3423 C CZ    . ARG C 3 306 ? -12.890 9.209   18.918 1.00 50.08  ? 508  ARG A CZ    1 
ATOM   3424 N NH1   . ARG C 3 306 ? -11.858 8.373   18.909 1.00 51.66  ? 508  ARG A NH1   1 
ATOM   3425 N NH2   . ARG C 3 306 ? -13.812 9.112   19.872 1.00 47.16  ? 508  ARG A NH2   1 
ATOM   3426 N N     . VAL C 3 307 ? -11.831 15.799  16.618 1.00 42.28  ? 509  VAL A N     1 
ATOM   3427 C CA    . VAL C 3 307 ? -12.251 17.153  16.940 1.00 43.88  ? 509  VAL A CA    1 
ATOM   3428 C C     . VAL C 3 307 ? -13.029 17.293  18.220 1.00 44.51  ? 509  VAL A C     1 
ATOM   3429 O O     . VAL C 3 307 ? -12.965 18.340  18.850 1.00 45.23  ? 509  VAL A O     1 
ATOM   3430 C CB    . VAL C 3 307 ? -13.031 17.806  15.804 1.00 43.93  ? 509  VAL A CB    1 
ATOM   3431 C CG1   . VAL C 3 307 ? -12.290 17.636  14.504 1.00 46.12  ? 509  VAL A CG1   1 
ATOM   3432 C CG2   . VAL C 3 307 ? -14.393 17.215  15.699 1.00 46.54  ? 509  VAL A CG2   1 
ATOM   3433 N N     . GLU C 3 308 ? -13.721 16.221  18.610 1.00 44.05  ? 510  GLU A N     1 
ATOM   3434 C CA    . GLU C 3 308 ? -14.530 16.198  19.834 1.00 42.55  ? 510  GLU A CA    1 
ATOM   3435 C C     . GLU C 3 308 ? -13.709 16.153  21.119 1.00 42.41  ? 510  GLU A C     1 
ATOM   3436 O O     . GLU C 3 308 ? -14.271 16.157  22.198 1.00 43.04  ? 510  GLU A O     1 
ATOM   3437 C CB    . GLU C 3 308 ? -15.499 15.015  19.823 1.00 37.36  ? 510  GLU A CB    1 
ATOM   3438 C CG    . GLU C 3 308 ? -14.825 13.674  19.851 1.00 44.45  ? 510  GLU A CG    1 
ATOM   3439 C CD    . GLU C 3 308 ? -15.815 12.548  19.750 1.00 48.46  ? 510  GLU A CD    1 
ATOM   3440 O OE1   . GLU C 3 308 ? -15.456 11.462  19.254 1.00 46.98  ? 510  GLU A OE1   1 
ATOM   3441 O OE2   . GLU C 3 308 ? -16.968 12.744  20.170 1.00 51.65  ? 510  GLU A OE2   1 
ATOM   3442 N N     . HIS C 3 309 ? -12.391 16.105  20.990 1.00 42.41  ? 511  HIS A N     1 
ATOM   3443 C CA    . HIS C 3 309 ? -11.523 16.040  22.142 1.00 44.53  ? 511  HIS A CA    1 
ATOM   3444 C C     . HIS C 3 309 ? -11.071 17.358  22.663 1.00 46.89  ? 511  HIS A C     1 
ATOM   3445 O O     . HIS C 3 309 ? -10.427 17.442  23.714 1.00 46.18  ? 511  HIS A O     1 
ATOM   3446 C CB    . HIS C 3 309 ? -10.316 15.225  21.793 1.00 46.69  ? 511  HIS A CB    1 
ATOM   3447 C CG    . HIS C 3 309 ? -10.654 13.804  21.534 1.00 45.53  ? 511  HIS A CG    1 
ATOM   3448 N ND1   . HIS C 3 309 ? -10.254 13.139  20.396 1.00 48.06  ? 511  HIS A ND1   1 
ATOM   3449 C CD2   . HIS C 3 309 ? -11.418 12.939  22.237 1.00 40.88  ? 511  HIS A CD2   1 
ATOM   3450 C CE1   . HIS C 3 309 ? -10.761 11.921  20.411 1.00 47.91  ? 511  HIS A CE1   1 
ATOM   3451 N NE2   . HIS C 3 309 ? -11.471 11.775  21.516 1.00 42.88  ? 511  HIS A NE2   1 
ATOM   3452 N N     . ILE C 3 310 ? -11.287 18.381  21.863 1.00 48.92  ? 512  ILE A N     1 
ATOM   3453 C CA    . ILE C 3 310 ? -10.896 19.701  22.275 1.00 52.36  ? 512  ILE A CA    1 
ATOM   3454 C C     . ILE C 3 310 ? -12.113 20.613  22.154 1.00 54.99  ? 512  ILE A C     1 
ATOM   3455 O O     . ILE C 3 310 ? -12.998 20.369  21.340 1.00 51.42  ? 512  ILE A O     1 
ATOM   3456 C CB    . ILE C 3 310 ? -9.737  20.223  21.391 1.00 51.58  ? 512  ILE A CB    1 
ATOM   3457 C CG1   . ILE C 3 310 ? -10.226 20.474  19.965 1.00 48.79  ? 512  ILE A CG1   1 
ATOM   3458 C CG2   . ILE C 3 310 ? -8.617  19.195  21.336 1.00 46.24  ? 512  ILE A CG2   1 
ATOM   3459 C CD1   . ILE C 3 310 ? -9.472  21.582  19.288 1.00 46.86  ? 512  ILE A CD1   1 
ATOM   3460 N N     . ASN C 3 311 ? -12.184 21.627  23.003 1.00 57.84  ? 513  ASN A N     1 
ATOM   3461 C CA    . ASN C 3 311 ? -13.283 22.569  22.916 1.00 60.99  ? 513  ASN A CA    1 
ATOM   3462 C C     . ASN C 3 311 ? -12.624 23.948  22.943 1.00 58.52  ? 513  ASN A C     1 
ATOM   3463 O O     . ASN C 3 311 ? -11.836 24.247  23.849 1.00 59.51  ? 513  ASN A O     1 
ATOM   3464 C CB    . ASN C 3 311 ? -14.283 22.370  24.073 1.00 70.12  ? 513  ASN A CB    1 
ATOM   3465 C CG    . ASN C 3 311 ? -15.666 22.996  23.785 1.00 77.62  ? 513  ASN A CG    1 
ATOM   3466 O OD1   . ASN C 3 311 ? -16.097 23.072  22.627 1.00 85.65  ? 513  ASN A OD1   1 
ATOM   3467 N ND2   . ASN C 3 311 ? -16.358 23.462  24.843 1.00 81.32  ? 513  ASN A ND2   1 
ATOM   3468 N N     . LEU C 3 312 ? -12.873 24.737  21.897 1.00 56.05  ? 514  LEU A N     1 
ATOM   3469 C CA    . LEU C 3 312 ? -12.299 26.079  21.767 1.00 56.17  ? 514  LEU A CA    1 
ATOM   3470 C C     . LEU C 3 312 ? -13.095 27.207  22.439 1.00 56.86  ? 514  LEU A C     1 
ATOM   3471 O O     . LEU C 3 312 ? -14.287 27.391  22.182 1.00 53.33  ? 514  LEU A O     1 
ATOM   3472 C CB    . LEU C 3 312 ? -12.075 26.429  20.293 1.00 54.57  ? 514  LEU A CB    1 
ATOM   3473 C CG    . LEU C 3 312 ? -11.211 25.540  19.389 1.00 54.85  ? 514  LEU A CG    1 
ATOM   3474 C CD1   . LEU C 3 312 ? -10.947 26.273  18.098 1.00 56.89  ? 514  LEU A CD1   1 
ATOM   3475 C CD2   . LEU C 3 312 ? -9.898  25.184  20.053 1.00 57.61  ? 514  LEU A CD2   1 
ATOM   3476 N N     . HIS C 3 313 ? -12.396 27.991  23.261 1.00 60.79  ? 515  HIS A N     1 
ATOM   3477 C CA    . HIS C 3 313 ? -12.972 29.120  24.012 1.00 60.75  ? 515  HIS A CA    1 
ATOM   3478 C C     . HIS C 3 313 ? -12.191 30.391  23.710 1.00 59.71  ? 515  HIS A C     1 
ATOM   3479 O O     . HIS C 3 313 ? -11.100 30.597  24.248 1.00 59.62  ? 515  HIS A O     1 
ATOM   3480 C CB    . HIS C 3 313 ? -12.901 28.868  25.536 1.00 59.46  ? 515  HIS A CB    1 
ATOM   3481 C CG    . HIS C 3 313 ? -13.733 27.713  26.009 1.00 56.92  ? 515  HIS A CG    1 
ATOM   3482 N ND1   . HIS C 3 313 ? -13.713 26.475  25.405 1.00 56.79  ? 515  HIS A ND1   1 
ATOM   3483 C CD2   . HIS C 3 313 ? -14.605 27.608  27.040 1.00 56.01  ? 515  HIS A CD2   1 
ATOM   3484 C CE1   . HIS C 3 313 ? -14.533 25.658  26.038 1.00 53.96  ? 515  HIS A CE1   1 
ATOM   3485 N NE2   . HIS C 3 313 ? -15.086 26.324  27.035 1.00 55.67  ? 515  HIS A NE2   1 
ATOM   3486 N N     . PRO C 3 314 ? -12.772 31.291  22.900 1.00 58.13  ? 516  PRO A N     1 
ATOM   3487 C CA    . PRO C 3 314 ? -12.151 32.565  22.512 1.00 59.86  ? 516  PRO A CA    1 
ATOM   3488 C C     . PRO C 3 314 ? -11.643 33.227  23.765 1.00 60.26  ? 516  PRO A C     1 
ATOM   3489 O O     . PRO C 3 314 ? -10.650 33.948  23.759 1.00 63.18  ? 516  PRO A O     1 
ATOM   3490 C CB    . PRO C 3 314 ? -13.321 33.355  21.943 1.00 57.25  ? 516  PRO A CB    1 
ATOM   3491 C CG    . PRO C 3 314 ? -14.183 32.290  21.401 1.00 57.63  ? 516  PRO A CG    1 
ATOM   3492 C CD    . PRO C 3 314 ? -14.182 31.270  22.502 1.00 57.00  ? 516  PRO A CD    1 
ATOM   3493 N N     . GLU C 3 315 ? -12.368 32.973  24.839 1.00 61.85  ? 517  GLU A N     1 
ATOM   3494 C CA    . GLU C 3 315 ? -12.022 33.497  26.131 1.00 65.09  ? 517  GLU A CA    1 
ATOM   3495 C C     . GLU C 3 315 ? -12.726 32.670  27.190 1.00 63.97  ? 517  GLU A C     1 
ATOM   3496 O O     . GLU C 3 315 ? -13.781 32.082  26.928 1.00 67.08  ? 517  GLU A O     1 
ATOM   3497 C CB    . GLU C 3 315 ? -12.451 34.940  26.248 1.00 69.33  ? 517  GLU A CB    1 
ATOM   3498 C CG    . GLU C 3 315 ? -11.514 35.687  27.127 1.00 79.29  ? 517  GLU A CG    1 
ATOM   3499 C CD    . GLU C 3 315 ? -12.228 36.545  28.108 1.00 83.45  ? 517  GLU A CD    1 
ATOM   3500 O OE1   . GLU C 3 315 ? -12.120 37.785  27.970 1.00 89.39  ? 517  GLU A OE1   1 
ATOM   3501 O OE2   . GLU C 3 315 ? -12.904 35.979  29.008 1.00 87.44  ? 517  GLU A OE2   1 
ATOM   3502 N N     . LEU C 3 316 ? -12.146 32.635  28.384 1.00 61.06  ? 518  LEU A N     1 
ATOM   3503 C CA    . LEU C 3 316 ? -12.685 31.870  29.489 1.00 56.70  ? 518  LEU A CA    1 
ATOM   3504 C C     . LEU C 3 316 ? -11.903 32.174  30.756 1.00 56.59  ? 518  LEU A C     1 
ATOM   3505 O O     . LEU C 3 316 ? -10.684 32.344  30.729 1.00 57.22  ? 518  LEU A O     1 
ATOM   3506 C CB    . LEU C 3 316 ? -12.619 30.367  29.160 1.00 56.70  ? 518  LEU A CB    1 
ATOM   3507 C CG    . LEU C 3 316 ? -12.959 29.257  30.172 1.00 57.12  ? 518  LEU A CG    1 
ATOM   3508 C CD1   . LEU C 3 316 ? -14.444 29.189  30.542 1.00 49.93  ? 518  LEU A CD1   1 
ATOM   3509 C CD2   . LEU C 3 316 ? -12.534 27.954  29.539 1.00 59.63  ? 518  LEU A CD2   1 
ATOM   3510 N N     . ASP C 3 317 ? -12.665 32.365  31.830 1.00 58.27  ? 519  ASP A N     1 
ATOM   3511 C CA    . ASP C 3 317 ? -12.181 32.625  33.194 1.00 59.76  ? 519  ASP A CA    1 
ATOM   3512 C C     . ASP C 3 317 ? -10.985 33.588  33.333 1.00 59.70  ? 519  ASP A C     1 
ATOM   3513 O O     . ASP C 3 317 ? -10.157 33.472  34.239 1.00 61.45  ? 519  ASP A O     1 
ATOM   3514 C CB    . ASP C 3 317 ? -11.956 31.286  33.960 1.00 60.16  ? 519  ASP A CB    1 
ATOM   3515 C CG    . ASP C 3 317 ? -13.253 30.426  34.103 1.00 58.74  ? 519  ASP A CG    1 
ATOM   3516 O OD1   . ASP C 3 317 ? -14.265 30.915  34.633 1.00 60.69  ? 519  ASP A OD1   1 
ATOM   3517 O OD2   . ASP C 3 317 ? -13.261 29.244  33.693 1.00 64.86  ? 519  ASP A OD2   1 
ATOM   3518 N N     . GLY C 3 318 ? -10.965 34.609  32.484 1.00 59.29  ? 520  GLY A N     1 
ATOM   3519 C CA    . GLY C 3 318 ? -9.893  35.586  32.534 1.00 59.19  ? 520  GLY A CA    1 
ATOM   3520 C C     . GLY C 3 318 ? -8.956  35.546  31.345 1.00 60.39  ? 520  GLY A C     1 
ATOM   3521 O O     . GLY C 3 318 ? -8.550  36.593  30.820 1.00 60.55  ? 520  GLY A O     1 
ATOM   3522 N N     . GLN C 3 319 ? -8.641  34.341  30.899 1.00 60.75  ? 521  GLN A N     1 
ATOM   3523 C CA    . GLN C 3 319 ? -7.732  34.191  29.792 1.00 62.82  ? 521  GLN A CA    1 
ATOM   3524 C C     . GLN C 3 319 ? -8.468  34.124  28.485 1.00 62.03  ? 521  GLN A C     1 
ATOM   3525 O O     . GLN C 3 319 ? -9.651  33.835  28.449 1.00 58.24  ? 521  GLN A O     1 
ATOM   3526 C CB    . GLN C 3 319 ? -6.923  32.921  29.968 1.00 68.40  ? 521  GLN A CB    1 
ATOM   3527 C CG    . GLN C 3 319 ? -6.670  32.513  31.436 1.00 71.40  ? 521  GLN A CG    1 
ATOM   3528 C CD    . GLN C 3 319 ? -6.814  31.010  31.661 1.00 74.27  ? 521  GLN A CD    1 
ATOM   3529 O OE1   . GLN C 3 319 ? -7.681  30.346  31.063 1.00 77.40  ? 521  GLN A OE1   1 
ATOM   3530 N NE2   . GLN C 3 319 ? -5.937  30.458  32.502 1.00 78.01  ? 521  GLN A NE2   1 
ATOM   3531 N N     . GLU C 3 320 ? -7.749  34.398  27.407 1.00 65.72  ? 522  GLU A N     1 
ATOM   3532 C CA    . GLU C 3 320 ? -8.304  34.356  26.067 1.00 67.37  ? 522  GLU A CA    1 
ATOM   3533 C C     . GLU C 3 320 ? -7.627  33.220  25.296 1.00 66.54  ? 522  GLU A C     1 
ATOM   3534 O O     . GLU C 3 320 ? -6.578  32.737  25.710 1.00 69.05  ? 522  GLU A O     1 
ATOM   3535 C CB    . GLU C 3 320 ? -8.092  35.705  25.365 1.00 73.72  ? 522  GLU A CB    1 
ATOM   3536 C CG    . GLU C 3 320 ? -9.436  36.317  24.955 1.00 82.81  ? 522  GLU A CG    1 
ATOM   3537 C CD    . GLU C 3 320 ? -9.344  37.603  24.152 1.00 86.76  ? 522  GLU A CD    1 
ATOM   3538 O OE1   . GLU C 3 320 ? -9.968  37.647  23.060 1.00 85.08  ? 522  GLU A OE1   1 
ATOM   3539 O OE2   . GLU C 3 320 ? -8.676  38.563  24.620 1.00 90.06  ? 522  GLU A OE2   1 
ATOM   3540 N N     . TYR C 3 321 ? -8.257  32.751  24.218 1.00 63.52  ? 523  TYR A N     1 
ATOM   3541 C CA    . TYR C 3 321 ? -7.700  31.667  23.403 1.00 60.36  ? 523  TYR A CA    1 
ATOM   3542 C C     . TYR C 3 321 ? -7.358  30.386  24.191 1.00 56.86  ? 523  TYR A C     1 
ATOM   3543 O O     . TYR C 3 321 ? -6.241  29.846  24.124 1.00 52.62  ? 523  TYR A O     1 
ATOM   3544 C CB    . TYR C 3 321 ? -6.496  32.178  22.602 1.00 64.17  ? 523  TYR A CB    1 
ATOM   3545 C CG    . TYR C 3 321 ? -6.794  33.431  21.793 1.00 68.29  ? 523  TYR A CG    1 
ATOM   3546 C CD1   . TYR C 3 321 ? -5.887  34.491  21.767 1.00 71.16  ? 523  TYR A CD1   1 
ATOM   3547 C CD2   . TYR C 3 321 ? -7.965  33.546  21.034 1.00 69.92  ? 523  TYR A CD2   1 
ATOM   3548 C CE1   . TYR C 3 321 ? -6.129  35.631  21.006 1.00 74.23  ? 523  TYR A CE1   1 
ATOM   3549 C CE2   . TYR C 3 321 ? -8.222  34.682  20.264 1.00 73.52  ? 523  TYR A CE2   1 
ATOM   3550 C CZ    . TYR C 3 321 ? -7.295  35.726  20.249 1.00 75.73  ? 523  TYR A CZ    1 
ATOM   3551 O OH    . TYR C 3 321 ? -7.491  36.849  19.453 1.00 76.09  ? 523  TYR A OH    1 
ATOM   3552 N N     . VAL C 3 322 ? -8.367  29.899  24.909 1.00 53.86  ? 524  VAL A N     1 
ATOM   3553 C CA    . VAL C 3 322 ? -8.256  28.700  25.719 1.00 52.27  ? 524  VAL A CA    1 
ATOM   3554 C C     . VAL C 3 322 ? -8.776  27.479  24.984 1.00 53.07  ? 524  VAL A C     1 
ATOM   3555 O O     . VAL C 3 322 ? -9.859  27.506  24.380 1.00 47.44  ? 524  VAL A O     1 
ATOM   3556 C CB    . VAL C 3 322 ? -9.034  28.816  27.052 1.00 52.94  ? 524  VAL A CB    1 
ATOM   3557 C CG1   . VAL C 3 322 ? -8.964  27.507  27.828 1.00 51.32  ? 524  VAL A CG1   1 
ATOM   3558 C CG2   . VAL C 3 322 ? -8.452  29.912  27.899 1.00 54.31  ? 524  VAL A CG2   1 
ATOM   3559 N N     . VAL C 3 323 ? -7.969  26.415  25.045 1.00 55.58  ? 525  VAL A N     1 
ATOM   3560 C CA    . VAL C 3 323 ? -8.285  25.125  24.435 1.00 54.18  ? 525  VAL A CA    1 
ATOM   3561 C C     . VAL C 3 323 ? -8.614  24.187  25.577 1.00 52.14  ? 525  VAL A C     1 
ATOM   3562 O O     . VAL C 3 323 ? -7.852  24.057  26.539 1.00 51.27  ? 525  VAL A O     1 
ATOM   3563 C CB    . VAL C 3 323 ? -7.090  24.505  23.638 1.00 55.16  ? 525  VAL A CB    1 
ATOM   3564 C CG1   . VAL C 3 323 ? -7.558  23.251  22.886 1.00 52.18  ? 525  VAL A CG1   1 
ATOM   3565 C CG2   . VAL C 3 323 ? -6.487  25.516  22.657 1.00 55.43  ? 525  VAL A CG2   1 
ATOM   3566 N N     . GLU C 3 324 ? -9.779  23.579  25.505 1.00 47.58  ? 526  GLU A N     1 
ATOM   3567 C CA    . GLU C 3 324 ? -10.135 22.677  26.544 1.00 46.38  ? 526  GLU A CA    1 
ATOM   3568 C C     . GLU C 3 324 ? -9.999  21.293  25.958 1.00 46.66  ? 526  GLU A C     1 
ATOM   3569 O O     . GLU C 3 324 ? -10.586 21.005  24.912 1.00 42.57  ? 526  GLU A O     1 
ATOM   3570 C CB    . GLU C 3 324 ? -11.539 22.945  26.964 1.00 46.80  ? 526  GLU A CB    1 
ATOM   3571 C CG    . GLU C 3 324 ? -11.901 22.315  28.258 1.00 52.54  ? 526  GLU A CG    1 
ATOM   3572 C CD    . GLU C 3 324 ? -13.365 22.554  28.604 1.00 60.05  ? 526  GLU A CD    1 
ATOM   3573 O OE1   . GLU C 3 324 ? -14.138 22.990  27.708 1.00 60.72  ? 526  GLU A OE1   1 
ATOM   3574 O OE2   . GLU C 3 324 ? -13.758 22.305  29.770 1.00 61.89  ? 526  GLU A OE2   1 
ATOM   3575 N N     . PHE C 3 325 ? -9.104  20.512  26.566 1.00 46.63  ? 527  PHE A N     1 
ATOM   3576 C CA    . PHE C 3 325 ? -8.827  19.127  26.179 1.00 45.45  ? 527  PHE A CA    1 
ATOM   3577 C C     . PHE C 3 325 ? -9.545  18.181  27.124 1.00 43.93  ? 527  PHE A C     1 
ATOM   3578 O O     . PHE C 3 325 ? -9.594  18.413  28.331 1.00 37.98  ? 527  PHE A O     1 
ATOM   3579 C CB    . PHE C 3 325 ? -7.335  18.796  26.298 1.00 40.58  ? 527  PHE A CB    1 
ATOM   3580 C CG    . PHE C 3 325 ? -6.458  19.534  25.344 1.00 40.73  ? 527  PHE A CG    1 
ATOM   3581 C CD1   . PHE C 3 325 ? -5.931  20.778  25.685 1.00 40.75  ? 527  PHE A CD1   1 
ATOM   3582 C CD2   . PHE C 3 325 ? -6.090  18.956  24.123 1.00 38.93  ? 527  PHE A CD2   1 
ATOM   3583 C CE1   . PHE C 3 325 ? -5.033  21.440  24.816 1.00 38.15  ? 527  PHE A CE1   1 
ATOM   3584 C CE2   . PHE C 3 325 ? -5.199  19.600  23.249 1.00 32.77  ? 527  PHE A CE2   1 
ATOM   3585 C CZ    . PHE C 3 325 ? -4.670  20.839  23.594 1.00 32.94  ? 527  PHE A CZ    1 
ATOM   3586 N N     . ASP C 3 326 ? -10.029 17.077  26.587 1.00 46.17  ? 528  ASP A N     1 
ATOM   3587 C CA    . ASP C 3 326 ? -10.684 16.081  27.413 1.00 51.21  ? 528  ASP A CA    1 
ATOM   3588 C C     . ASP C 3 326 ? -10.751 14.739  26.681 1.00 53.03  ? 528  ASP A C     1 
ATOM   3589 O O     . ASP C 3 326 ? -11.666 14.496  25.893 1.00 54.28  ? 528  ASP A O     1 
ATOM   3590 C CB    . ASP C 3 326 ? -12.081 16.555  27.809 1.00 53.87  ? 528  ASP A CB    1 
ATOM   3591 C CG    . ASP C 3 326 ? -12.669 15.754  28.962 1.00 54.65  ? 528  ASP A CG    1 
ATOM   3592 O OD1   . ASP C 3 326 ? -13.576 16.296  29.630 1.00 54.29  ? 528  ASP A OD1   1 
ATOM   3593 O OD2   . ASP C 3 326 ? -12.225 14.602  29.209 1.00 56.69  ? 528  ASP A OD2   1 
ATOM   3594 N N     . PHE C 3 327 ? -9.778  13.866  26.928 1.00 51.66  ? 529  PHE A N     1 
ATOM   3595 C CA    . PHE C 3 327 ? -9.772  12.565  26.250 1.00 51.27  ? 529  PHE A CA    1 
ATOM   3596 C C     . PHE C 3 327 ? -9.067  11.533  27.096 1.00 50.08  ? 529  PHE A C     1 
ATOM   3597 O O     . PHE C 3 327 ? -8.491  11.860  28.146 1.00 47.60  ? 529  PHE A O     1 
ATOM   3598 C CB    . PHE C 3 327 ? -9.088  12.658  24.876 1.00 47.30  ? 529  PHE A CB    1 
ATOM   3599 C CG    . PHE C 3 327 ? -7.680  13.137  24.946 1.00 48.34  ? 529  PHE A CG    1 
ATOM   3600 C CD1   . PHE C 3 327 ? -6.642  12.237  25.099 1.00 47.31  ? 529  PHE A CD1   1 
ATOM   3601 C CD2   . PHE C 3 327 ? -7.397  14.492  24.961 1.00 51.98  ? 529  PHE A CD2   1 
ATOM   3602 C CE1   . PHE C 3 327 ? -5.352  12.673  25.276 1.00 45.99  ? 529  PHE A CE1   1 
ATOM   3603 C CE2   . PHE C 3 327 ? -6.106  14.945  25.139 1.00 50.41  ? 529  PHE A CE2   1 
ATOM   3604 C CZ    . PHE C 3 327 ? -5.076  14.031  25.300 1.00 48.14  ? 529  PHE A CZ    1 
ATOM   3605 N N     . LEU C 3 328 ? -9.124  10.287  26.632 1.00 49.20  ? 530  LEU A N     1 
ATOM   3606 C CA    . LEU C 3 328 ? -8.480  9.182   27.329 1.00 46.89  ? 530  LEU A CA    1 
ATOM   3607 C C     . LEU C 3 328 ? -7.217  8.801   26.626 1.00 45.10  ? 530  LEU A C     1 
ATOM   3608 O O     . LEU C 3 328 ? -7.212  8.583   25.425 1.00 43.53  ? 530  LEU A O     1 
ATOM   3609 C CB    . LEU C 3 328 ? -9.396  7.984   27.384 1.00 46.36  ? 530  LEU A CB    1 
ATOM   3610 C CG    . LEU C 3 328 ? -10.624 8.323   28.207 1.00 46.05  ? 530  LEU A CG    1 
ATOM   3611 C CD1   . LEU C 3 328 ? -11.573 7.163   28.170 1.00 47.16  ? 530  LEU A CD1   1 
ATOM   3612 C CD2   . LEU C 3 328 ? -10.214 8.649   29.641 1.00 46.88  ? 530  LEU A CD2   1 
ATOM   3613 N N     . GLY C 3 329 ? -6.141  8.733   27.379 1.00 43.85  ? 531  GLY A N     1 
ATOM   3614 C CA    . GLY C 3 329 ? -4.874  8.391   26.774 1.00 46.43  ? 531  GLY A CA    1 
ATOM   3615 C C     . GLY C 3 329 ? -4.463  6.971   27.043 1.00 45.23  ? 531  GLY A C     1 
ATOM   3616 O O     . GLY C 3 329 ? -5.295  6.156   27.434 1.00 46.33  ? 531  GLY A O     1 
ATOM   3617 N N     . LYS C 3 330 ? -3.180  6.693   26.832 1.00 39.46  ? 532  LYS A N     1 
ATOM   3618 C CA    . LYS C 3 330 ? -2.622  5.374   27.045 1.00 40.00  ? 532  LYS A CA    1 
ATOM   3619 C C     . LYS C 3 330 ? -3.135  4.848   28.366 1.00 39.98  ? 532  LYS A C     1 
ATOM   3620 O O     . LYS C 3 330 ? -3.269  5.599   29.326 1.00 40.84  ? 532  LYS A O     1 
ATOM   3621 C CB    . LYS C 3 330 ? -1.110  5.476   27.042 1.00 39.38  ? 532  LYS A CB    1 
ATOM   3622 C CG    . LYS C 3 330 ? -0.395  4.197   27.317 1.00 46.31  ? 532  LYS A CG    1 
ATOM   3623 C CD    . LYS C 3 330 ? 1.100   4.397   27.199 1.00 43.58  ? 532  LYS A CD    1 
ATOM   3624 C CE    . LYS C 3 330 ? 1.816   3.214   27.775 1.00 45.22  ? 532  LYS A CE    1 
ATOM   3625 N NZ    . LYS C 3 330 ? 3.283   3.377   27.642 1.00 52.03  ? 532  LYS A NZ    1 
ATOM   3626 N N     . ASP C 3 331 ? -3.461  3.565   28.398 1.00 39.53  ? 533  ASP A N     1 
ATOM   3627 C CA    . ASP C 3 331 ? -4.014  2.963   29.608 1.00 41.36  ? 533  ASP A CA    1 
ATOM   3628 C C     . ASP C 3 331 ? -5.317  3.616   29.989 1.00 38.29  ? 533  ASP A C     1 
ATOM   3629 O O     . ASP C 3 331 ? -5.742  3.561   31.124 1.00 36.46  ? 533  ASP A O     1 
ATOM   3630 C CB    . ASP C 3 331 ? -3.033  3.075   30.760 1.00 45.05  ? 533  ASP A CB    1 
ATOM   3631 C CG    . ASP C 3 331 ? -1.995  1.996   30.722 1.00 47.82  ? 533  ASP A CG    1 
ATOM   3632 O OD1   . ASP C 3 331 ? -2.001  1.206   29.771 1.00 50.20  ? 533  ASP A OD1   1 
ATOM   3633 O OD2   . ASP C 3 331 ? -1.181  1.909   31.647 1.00 52.62  ? 533  ASP A OD2   1 
ATOM   3634 N N     . SER C 3 332 ? -5.913  4.300   29.031 1.00 38.23  ? 534  SER A N     1 
ATOM   3635 C CA    . SER C 3 332 ? -7.154  4.985   29.246 1.00 39.05  ? 534  SER A CA    1 
ATOM   3636 C C     . SER C 3 332 ? -7.099  6.009   30.346 1.00 37.94  ? 534  SER A C     1 
ATOM   3637 O O     . SER C 3 332 ? -8.106  6.286   30.980 1.00 38.70  ? 534  SER A O     1 
ATOM   3638 C CB    . SER C 3 332 ? -8.245  3.988   29.496 1.00 38.38  ? 534  SER A CB    1 
ATOM   3639 O OG    . SER C 3 332 ? -8.376  3.209   28.341 1.00 46.29  ? 534  SER A OG    1 
ATOM   3640 N N     . ILE C 3 333 ? -5.928  6.587   30.577 1.00 37.61  ? 535  ILE A N     1 
ATOM   3641 C CA    . ILE C 3 333 ? -5.827  7.626   31.595 1.00 38.75  ? 535  ILE A CA    1 
ATOM   3642 C C     . ILE C 3 333 ? -6.365  8.934   30.971 1.00 43.49  ? 535  ILE A C     1 
ATOM   3643 O O     . ILE C 3 333 ? -5.972  9.338   29.855 1.00 41.04  ? 535  ILE A O     1 
ATOM   3644 C CB    . ILE C 3 333 ? -4.388  7.786   32.137 1.00 32.71  ? 535  ILE A CB    1 
ATOM   3645 C CG1   . ILE C 3 333 ? -3.857  6.446   32.628 1.00 30.79  ? 535  ILE A CG1   1 
ATOM   3646 C CG2   . ILE C 3 333 ? -4.364  8.726   33.324 1.00 33.41  ? 535  ILE A CG2   1 
ATOM   3647 C CD1   . ILE C 3 333 ? -4.512  5.948   33.881 1.00 26.14  ? 535  ILE A CD1   1 
ATOM   3648 N N     . ARG C 3 334 ? -7.336  9.530   31.666 1.00 45.85  ? 536  ARG A N     1 
ATOM   3649 C CA    . ARG C 3 334 ? -7.987  10.768  31.229 1.00 47.68  ? 536  ARG A CA    1 
ATOM   3650 C C     . ARG C 3 334 ? -7.157  12.010  31.173 1.00 47.33  ? 536  ARG A C     1 
ATOM   3651 O O     . ARG C 3 334 ? -6.491  12.383  32.124 1.00 47.45  ? 536  ARG A O     1 
ATOM   3652 C CB    . ARG C 3 334 ? -9.193  11.101  32.094 1.00 48.64  ? 536  ARG A CB    1 
ATOM   3653 C CG    . ARG C 3 334 ? -9.860  12.440  31.739 1.00 50.56  ? 536  ARG A CG    1 
ATOM   3654 C CD    . ARG C 3 334 ? -10.896 12.841  32.786 1.00 57.09  ? 536  ARG A CD    1 
ATOM   3655 N NE    . ARG C 3 334 ? -12.130 13.365  32.197 1.00 63.65  ? 536  ARG A NE    1 
ATOM   3656 C CZ    . ARG C 3 334 ? -12.942 14.258  32.779 1.00 66.22  ? 536  ARG A CZ    1 
ATOM   3657 N NH1   . ARG C 3 334 ? -12.665 14.750  33.987 1.00 70.31  ? 536  ARG A NH1   1 
ATOM   3658 N NH2   . ARG C 3 334 ? -14.029 14.682  32.139 1.00 66.60  ? 536  ARG A NH2   1 
ATOM   3659 N N     . TYR C 3 335 ? -7.295  12.698  30.064 1.00 44.52  ? 537  TYR A N     1 
ATOM   3660 C CA    . TYR C 3 335 ? -6.586  13.908  29.927 1.00 43.44  ? 537  TYR A CA    1 
ATOM   3661 C C     . TYR C 3 335 ? -7.530  15.061  29.767 1.00 45.14  ? 537  TYR A C     1 
ATOM   3662 O O     . TYR C 3 335 ? -8.238  15.187  28.778 1.00 41.70  ? 537  TYR A O     1 
ATOM   3663 C CB    . TYR C 3 335 ? -5.649  13.853  28.780 1.00 46.06  ? 537  TYR A CB    1 
ATOM   3664 C CG    . TYR C 3 335 ? -4.828  15.089  28.780 1.00 49.26  ? 537  TYR A CG    1 
ATOM   3665 C CD1   . TYR C 3 335 ? -3.732  15.208  29.627 1.00 49.60  ? 537  TYR A CD1   1 
ATOM   3666 C CD2   . TYR C 3 335 ? -5.176  16.160  27.976 1.00 50.46  ? 537  TYR A CD2   1 
ATOM   3667 C CE1   . TYR C 3 335 ? -2.994  16.371  29.672 1.00 55.65  ? 537  TYR A CE1   1 
ATOM   3668 C CE2   . TYR C 3 335 ? -4.463  17.326  28.006 1.00 55.52  ? 537  TYR A CE2   1 
ATOM   3669 C CZ    . TYR C 3 335 ? -3.367  17.439  28.852 1.00 57.95  ? 537  TYR A CZ    1 
ATOM   3670 O OH    . TYR C 3 335 ? -2.672  18.632  28.845 1.00 56.49  ? 537  TYR A OH    1 
ATOM   3671 N N     . TYR C 3 336 ? -7.488  15.929  30.759 1.00 50.12  ? 538  TYR A N     1 
ATOM   3672 C CA    . TYR C 3 336 ? -8.325  17.102  30.805 1.00 51.42  ? 538  TYR A CA    1 
ATOM   3673 C C     . TYR C 3 336 ? -7.508  18.348  31.121 1.00 48.21  ? 538  TYR A C     1 
ATOM   3674 O O     . TYR C 3 336 ? -6.837  18.408  32.130 1.00 45.04  ? 538  TYR A O     1 
ATOM   3675 C CB    . TYR C 3 336 ? -9.416  16.917  31.859 1.00 51.51  ? 538  TYR A CB    1 
ATOM   3676 C CG    . TYR C 3 336 ? -10.262 18.143  31.975 1.00 57.38  ? 538  TYR A CG    1 
ATOM   3677 C CD1   . TYR C 3 336 ? -11.095 18.530  30.925 1.00 61.70  ? 538  TYR A CD1   1 
ATOM   3678 C CD2   . TYR C 3 336 ? -10.160 18.985  33.078 1.00 59.74  ? 538  TYR A CD2   1 
ATOM   3679 C CE1   . TYR C 3 336 ? -11.805 19.745  30.966 1.00 64.39  ? 538  TYR A CE1   1 
ATOM   3680 C CE2   . TYR C 3 336 ? -10.864 20.201  33.135 1.00 63.61  ? 538  TYR A CE2   1 
ATOM   3681 C CZ    . TYR C 3 336 ? -11.682 20.578  32.074 1.00 62.85  ? 538  TYR A CZ    1 
ATOM   3682 O OH    . TYR C 3 336 ? -12.357 21.784  32.116 1.00 63.93  ? 538  TYR A OH    1 
ATOM   3683 N N     . ASN C 3 337 ? -7.613  19.367  30.284 1.00 49.26  ? 539  ASN A N     1 
ATOM   3684 C CA    . ASN C 3 337 ? -6.850  20.580  30.530 1.00 52.24  ? 539  ASN A CA    1 
ATOM   3685 C C     . ASN C 3 337 ? -7.295  21.792  29.692 1.00 52.25  ? 539  ASN A C     1 
ATOM   3686 O O     . ASN C 3 337 ? -7.508  21.698  28.475 1.00 50.46  ? 539  ASN A O     1 
ATOM   3687 C CB    . ASN C 3 337 ? -5.338  20.282  30.325 1.00 52.55  ? 539  ASN A CB    1 
ATOM   3688 C CG    . ASN C 3 337 ? -4.398  21.412  30.847 1.00 54.00  ? 539  ASN A CG    1 
ATOM   3689 O OD1   . ASN C 3 337 ? -4.722  22.171  31.758 1.00 57.91  ? 539  ASN A OD1   1 
ATOM   3690 N ND2   . ASN C 3 337 ? -3.215  21.483  30.277 1.00 52.51  ? 539  ASN A ND2   1 
ATOM   3691 N N     . LYS C 3 338 ? -7.512  22.910  30.373 1.00 52.28  ? 540  LYS A N     1 
ATOM   3692 C CA    . LYS C 3 338 ? -7.874  24.143  29.697 1.00 53.70  ? 540  LYS A CA    1 
ATOM   3693 C C     . LYS C 3 338 ? -6.582  24.916  29.443 1.00 53.32  ? 540  LYS A C     1 
ATOM   3694 O O     . LYS C 3 338 ? -5.922  25.418  30.365 1.00 53.30  ? 540  LYS A O     1 
ATOM   3695 C CB    . LYS C 3 338 ? -8.831  24.928  30.542 1.00 52.51  ? 540  LYS A CB    1 
ATOM   3696 C CG    . LYS C 3 338 ? -10.124 24.222  30.640 1.00 60.06  ? 540  LYS A CG    1 
ATOM   3697 C CD    . LYS C 3 338 ? -11.074 24.995  31.498 1.00 66.77  ? 540  LYS A CD    1 
ATOM   3698 C CE    . LYS C 3 338 ? -10.532 25.130  32.890 1.00 70.94  ? 540  LYS A CE    1 
ATOM   3699 N NZ    . LYS C 3 338 ? -10.169 23.770  33.371 1.00 79.51  ? 540  LYS A NZ    1 
ATOM   3700 N N     . VAL C 3 339 ? -6.263  25.079  28.171 1.00 50.61  ? 541  VAL A N     1 
ATOM   3701 C CA    . VAL C 3 339 ? -5.015  25.700  27.815 1.00 46.27  ? 541  VAL A CA    1 
ATOM   3702 C C     . VAL C 3 339 ? -5.049  26.898  26.915 1.00 45.13  ? 541  VAL A C     1 
ATOM   3703 O O     . VAL C 3 339 ? -5.540  26.839  25.796 1.00 42.17  ? 541  VAL A O     1 
ATOM   3704 C CB    . VAL C 3 339 ? -4.108  24.648  27.177 1.00 47.80  ? 541  VAL A CB    1 
ATOM   3705 C CG1   . VAL C 3 339 ? -2.715  25.200  26.926 1.00 41.99  ? 541  VAL A CG1   1 
ATOM   3706 C CG2   . VAL C 3 339 ? -4.079  23.409  28.070 1.00 46.21  ? 541  VAL A CG2   1 
ATOM   3707 N N     . PRO C 3 340 ? -4.508  28.014  27.408 1.00 46.88  ? 542  PRO A N     1 
ATOM   3708 C CA    . PRO C 3 340 ? -4.435  29.276  26.670 1.00 47.41  ? 542  PRO A CA    1 
ATOM   3709 C C     . PRO C 3 340 ? -3.324  29.043  25.680 1.00 48.97  ? 542  PRO A C     1 
ATOM   3710 O O     . PRO C 3 340 ? -2.202  28.702  26.049 1.00 47.54  ? 542  PRO A O     1 
ATOM   3711 C CB    . PRO C 3 340 ? -3.998  30.288  27.737 1.00 43.77  ? 542  PRO A CB    1 
ATOM   3712 C CG    . PRO C 3 340 ? -4.440  29.658  29.021 1.00 43.10  ? 542  PRO A CG    1 
ATOM   3713 C CD    . PRO C 3 340 ? -4.107  28.203  28.811 1.00 46.49  ? 542  PRO A CD    1 
ATOM   3714 N N     . VAL C 3 341 ? -3.654  29.100  24.412 1.00 50.59  ? 543  VAL A N     1 
ATOM   3715 C CA    . VAL C 3 341 ? -2.624  28.880  23.440 1.00 53.54  ? 543  VAL A CA    1 
ATOM   3716 C C     . VAL C 3 341 ? -2.311  30.159  22.675 1.00 58.52  ? 543  VAL A C     1 
ATOM   3717 O O     . VAL C 3 341 ? -2.846  31.237  22.959 1.00 58.75  ? 543  VAL A O     1 
ATOM   3718 C CB    . VAL C 3 341 ? -3.066  27.790  22.485 1.00 52.96  ? 543  VAL A CB    1 
ATOM   3719 C CG1   . VAL C 3 341 ? -3.223  26.485  23.242 1.00 50.60  ? 543  VAL A CG1   1 
ATOM   3720 C CG2   . VAL C 3 341 ? -4.380  28.179  21.847 1.00 51.55  ? 543  VAL A CG2   1 
ATOM   3721 N N     . GLU C 3 342 ? -1.403  30.049  21.716 1.00 61.85  ? 544  GLU A N     1 
ATOM   3722 C CA    . GLU C 3 342 ? -1.061  31.186  20.879 1.00 62.51  ? 544  GLU A CA    1 
ATOM   3723 C C     . GLU C 3 342 ? -2.271  31.495  20.030 1.00 62.00  ? 544  GLU A C     1 
ATOM   3724 O O     . GLU C 3 342 ? -2.898  30.583  19.481 1.00 62.05  ? 544  GLU A O     1 
ATOM   3725 C CB    . GLU C 3 342 ? 0.074   30.810  19.953 1.00 65.72  ? 544  GLU A CB    1 
ATOM   3726 C CG    . GLU C 3 342 ? 1.430   30.899  20.591 1.00 71.67  ? 544  GLU A CG    1 
ATOM   3727 C CD    . GLU C 3 342 ? 1.878   32.331  20.748 1.00 76.28  ? 544  GLU A CD    1 
ATOM   3728 O OE1   . GLU C 3 342 ? 2.607   32.626  21.726 1.00 84.75  ? 544  GLU A OE1   1 
ATOM   3729 O OE2   . GLU C 3 342 ? 1.491   33.163  19.892 1.00 80.33  ? 544  GLU A OE2   1 
ATOM   3730 N N     . LYS C 3 343 ? -2.583  32.775  19.907 1.00 61.98  ? 545  LYS A N     1 
ATOM   3731 C CA    . LYS C 3 343 ? -3.720  33.196  19.111 1.00 61.80  ? 545  LYS A CA    1 
ATOM   3732 C C     . LYS C 3 343 ? -3.684  32.477  17.760 1.00 60.48  ? 545  LYS A C     1 
ATOM   3733 O O     . LYS C 3 343 ? -4.713  31.992  17.263 1.00 57.54  ? 545  LYS A O     1 
ATOM   3734 C CB    . LYS C 3 343 ? -3.647  34.699  18.910 1.00 61.57  ? 545  LYS A CB    1 
ATOM   3735 C CG    . LYS C 3 343 ? -4.739  35.277  18.050 1.00 66.52  ? 545  LYS A CG    1 
ATOM   3736 C CD    . LYS C 3 343 ? -4.459  36.745  17.817 1.00 72.01  ? 545  LYS A CD    1 
ATOM   3737 C CE    . LYS C 3 343 ? -4.426  37.516  19.127 1.00 76.84  ? 545  LYS A CE    1 
ATOM   3738 N NZ    . LYS C 3 343 ? -3.921  38.898  18.900 1.00 84.11  ? 545  LYS A NZ    1 
ATOM   3739 N N     . ARG C 3 344 ? -2.486  32.380  17.191 1.00 59.21  ? 546  ARG A N     1 
ATOM   3740 C CA    . ARG C 3 344 ? -2.330  31.713  15.905 1.00 60.34  ? 546  ARG A CA    1 
ATOM   3741 C C     . ARG C 3 344 ? -2.819  30.255  15.971 1.00 60.25  ? 546  ARG A C     1 
ATOM   3742 O O     . ARG C 3 344 ? -3.642  29.829  15.142 1.00 62.74  ? 546  ARG A O     1 
ATOM   3743 C CB    . ARG C 3 344 ? -0.875  31.794  15.441 1.00 61.21  ? 546  ARG A CB    1 
ATOM   3744 N N     . VAL C 3 345 ? -2.361  29.523  16.990 1.00 56.56  ? 547  VAL A N     1 
ATOM   3745 C CA    . VAL C 3 345 ? -2.739  28.123  17.180 1.00 52.10  ? 547  VAL A CA    1 
ATOM   3746 C C     . VAL C 3 345 ? -4.259  28.034  17.197 1.00 51.78  ? 547  VAL A C     1 
ATOM   3747 O O     . VAL C 3 345 ? -4.900  27.300  16.425 1.00 49.76  ? 547  VAL A O     1 
ATOM   3748 C CB    . VAL C 3 345 ? -2.197  27.564  18.547 1.00 49.10  ? 547  VAL A CB    1 
ATOM   3749 C CG1   . VAL C 3 345 ? -2.571  26.114  18.726 1.00 44.47  ? 547  VAL A CG1   1 
ATOM   3750 C CG2   . VAL C 3 345 ? -0.710  27.692  18.624 1.00 46.09  ? 547  VAL A CG2   1 
ATOM   3751 N N     . PHE C 3 346 ? -4.810  28.783  18.128 1.00 51.40  ? 548  PHE A N     1 
ATOM   3752 C CA    . PHE C 3 346 ? -6.229  28.833  18.338 1.00 52.91  ? 548  PHE A CA    1 
ATOM   3753 C C     . PHE C 3 346 ? -6.977  28.992  17.013 1.00 52.80  ? 548  PHE A C     1 
ATOM   3754 O O     . PHE C 3 346 ? -7.919  28.242  16.697 1.00 47.07  ? 548  PHE A O     1 
ATOM   3755 C CB    . PHE C 3 346 ? -6.514  29.985  19.284 1.00 52.62  ? 548  PHE A CB    1 
ATOM   3756 C CG    . PHE C 3 346 ? -7.914  30.027  19.759 1.00 59.87  ? 548  PHE A CG    1 
ATOM   3757 C CD1   . PHE C 3 346 ? -8.262  29.475  20.989 1.00 63.28  ? 548  PHE A CD1   1 
ATOM   3758 C CD2   . PHE C 3 346 ? -8.903  30.615  18.982 1.00 62.50  ? 548  PHE A CD2   1 
ATOM   3759 C CE1   . PHE C 3 346 ? -9.588  29.510  21.448 1.00 62.59  ? 548  PHE A CE1   1 
ATOM   3760 C CE2   . PHE C 3 346 ? -10.219 30.657  19.420 1.00 62.84  ? 548  PHE A CE2   1 
ATOM   3761 C CZ    . PHE C 3 346 ? -10.565 30.102  20.661 1.00 62.66  ? 548  PHE A CZ    1 
ATOM   3762 N N     . LYS C 3 347 ? -6.517  29.959  16.235 1.00 55.85  ? 549  LYS A N     1 
ATOM   3763 C CA    . LYS C 3 347 ? -7.113  30.237  14.942 1.00 59.33  ? 549  LYS A CA    1 
ATOM   3764 C C     . LYS C 3 347 ? -7.000  29.047  14.023 1.00 56.37  ? 549  LYS A C     1 
ATOM   3765 O O     . LYS C 3 347 ? -7.884  28.768  13.222 1.00 54.60  ? 549  LYS A O     1 
ATOM   3766 C CB    . LYS C 3 347 ? -6.441  31.439  14.291 1.00 68.11  ? 549  LYS A CB    1 
ATOM   3767 C CG    . LYS C 3 347 ? -6.727  32.747  15.011 1.00 76.80  ? 549  LYS A CG    1 
ATOM   3768 C CD    . LYS C 3 347 ? -6.648  33.947  14.046 1.00 85.04  ? 549  LYS A CD    1 
ATOM   3769 C CE    . LYS C 3 347 ? -7.573  35.094  14.506 1.00 88.70  ? 549  LYS A CE    1 
ATOM   3770 N NZ    . LYS C 3 347 ? -7.567  36.304  13.592 1.00 91.23  ? 549  LYS A NZ    1 
ATOM   3771 N N     . ASN C 3 348 ? -5.884  28.352  14.111 1.00 56.41  ? 550  ASN A N     1 
ATOM   3772 C CA    . ASN C 3 348 ? -5.722  27.198  13.264 1.00 55.28  ? 550  ASN A CA    1 
ATOM   3773 C C     . ASN C 3 348 ? -6.685  26.089  13.657 1.00 52.28  ? 550  ASN A C     1 
ATOM   3774 O O     . ASN C 3 348 ? -7.305  25.450  12.806 1.00 47.21  ? 550  ASN A O     1 
ATOM   3775 C CB    . ASN C 3 348 ? -4.272  26.751  13.288 1.00 58.81  ? 550  ASN A CB    1 
ATOM   3776 C CG    . ASN C 3 348 ? -3.381  27.652  12.432 1.00 63.29  ? 550  ASN A CG    1 
ATOM   3777 O OD1   . ASN C 3 348 ? -3.636  27.847  11.238 1.00 67.26  ? 550  ASN A OD1   1 
ATOM   3778 N ND2   . ASN C 3 348 ? -2.334  28.199  13.032 1.00 66.28  ? 550  ASN A ND2   1 
ATOM   3779 N N     . LEU C 3 349 ? -6.868  25.919  14.955 1.00 48.73  ? 551  LEU A N     1 
ATOM   3780 C CA    . LEU C 3 349 ? -7.757  24.902  15.440 1.00 45.54  ? 551  LEU A CA    1 
ATOM   3781 C C     . LEU C 3 349 ? -9.194  25.093  14.984 1.00 45.86  ? 551  LEU A C     1 
ATOM   3782 O O     . LEU C 3 349 ? -9.877  24.131  14.687 1.00 43.87  ? 551  LEU A O     1 
ATOM   3783 C CB    . LEU C 3 349 ? -7.659  24.867  16.945 1.00 46.87  ? 551  LEU A CB    1 
ATOM   3784 C CG    . LEU C 3 349 ? -6.251  24.454  17.334 1.00 47.06  ? 551  LEU A CG    1 
ATOM   3785 C CD1   . LEU C 3 349 ? -5.992  24.735  18.790 1.00 44.48  ? 551  LEU A CD1   1 
ATOM   3786 C CD2   . LEU C 3 349 ? -6.126  22.988  17.034 1.00 45.38  ? 551  LEU A CD2   1 
ATOM   3787 N N     . GLN C 3 350 ? -9.670  26.329  14.952 1.00 48.12  ? 552  GLN A N     1 
ATOM   3788 C CA    . GLN C 3 350 ? -11.055 26.576  14.526 1.00 50.84  ? 552  GLN A CA    1 
ATOM   3789 C C     . GLN C 3 350 ? -11.161 26.089  13.121 1.00 48.94  ? 552  GLN A C     1 
ATOM   3790 O O     . GLN C 3 350 ? -12.133 25.487  12.712 1.00 48.43  ? 552  GLN A O     1 
ATOM   3791 C CB    . GLN C 3 350 ? -11.358 28.060  14.506 1.00 53.04  ? 552  GLN A CB    1 
ATOM   3792 C CG    . GLN C 3 350 ? -10.846 28.759  15.705 1.00 58.98  ? 552  GLN A CG    1 
ATOM   3793 C CD    . GLN C 3 350 ? -11.024 30.247  15.614 1.00 61.94  ? 552  GLN A CD    1 
ATOM   3794 O OE1   . GLN C 3 350 ? -10.307 30.929  14.876 1.00 65.83  ? 552  GLN A OE1   1 
ATOM   3795 N NE2   . GLN C 3 350 ? -11.946 30.780  16.417 1.00 62.17  ? 552  GLN A NE2   1 
ATOM   3796 N N     . LEU C 3 351 ? -10.137 26.418  12.367 1.00 50.55  ? 553  LEU A N     1 
ATOM   3797 C CA    . LEU C 3 351 ? -10.072 26.018  11.000 1.00 56.02  ? 553  LEU A CA    1 
ATOM   3798 C C     . LEU C 3 351 ? -10.010 24.497  10.926 1.00 58.25  ? 553  LEU A C     1 
ATOM   3799 O O     . LEU C 3 351 ? -10.744 23.887  10.145 1.00 58.27  ? 553  LEU A O     1 
ATOM   3800 C CB    . LEU C 3 351 ? -8.848  26.650  10.361 1.00 59.28  ? 553  LEU A CB    1 
ATOM   3801 C CG    . LEU C 3 351 ? -8.271  26.070  9.065  1.00 67.84  ? 553  LEU A CG    1 
ATOM   3802 C CD1   . LEU C 3 351 ? -9.335  25.913  7.960  1.00 70.83  ? 553  LEU A CD1   1 
ATOM   3803 C CD2   . LEU C 3 351 ? -7.126  26.975  8.597  1.00 71.10  ? 553  LEU A CD2   1 
ATOM   3804 N N     . PHE C 3 352 ? -9.135  23.868  11.709 1.00 58.85  ? 554  PHE A N     1 
ATOM   3805 C CA    . PHE C 3 352 ? -9.063  22.410  11.641 1.00 57.74  ? 554  PHE A CA    1 
ATOM   3806 C C     . PHE C 3 352 ? -10.409 21.838  12.069 1.00 57.62  ? 554  PHE A C     1 
ATOM   3807 O O     . PHE C 3 352 ? -10.830 20.803  11.582 1.00 56.72  ? 554  PHE A O     1 
ATOM   3808 C CB    . PHE C 3 352 ? -7.954  21.831  12.542 1.00 59.42  ? 554  PHE A CB    1 
ATOM   3809 C CG    . PHE C 3 352 ? -6.554  22.320  12.218 1.00 61.72  ? 554  PHE A CG    1 
ATOM   3810 C CD1   . PHE C 3 352 ? -5.610  22.474  13.238 1.00 60.74  ? 554  PHE A CD1   1 
ATOM   3811 C CD2   . PHE C 3 352 ? -6.180  22.652  10.916 1.00 62.73  ? 554  PHE A CD2   1 
ATOM   3812 C CE1   . PHE C 3 352 ? -4.309  22.958  12.975 1.00 60.20  ? 554  PHE A CE1   1 
ATOM   3813 C CE2   . PHE C 3 352 ? -4.887  23.135  10.639 1.00 62.83  ? 554  PHE A CE2   1 
ATOM   3814 C CZ    . PHE C 3 352 ? -3.948  23.289  11.678 1.00 60.58  ? 554  PHE A CZ    1 
ATOM   3815 N N     . MET C 3 353 ? -11.106 22.552  12.940 1.00 57.41  ? 555  MET A N     1 
ATOM   3816 C CA    . MET C 3 353 ? -12.378 22.087  13.460 1.00 59.00  ? 555  MET A CA    1 
ATOM   3817 C C     . MET C 3 353 ? -13.657 22.376  12.690 1.00 61.14  ? 555  MET A C     1 
ATOM   3818 O O     . MET C 3 353 ? -14.753 21.969  13.116 1.00 61.21  ? 555  MET A O     1 
ATOM   3819 C CB    . MET C 3 353 ? -12.534 22.595  14.877 1.00 59.03  ? 555  MET A CB    1 
ATOM   3820 C CG    . MET C 3 353 ? -11.648 21.871  15.828 1.00 61.52  ? 555  MET A CG    1 
ATOM   3821 S SD    . MET C 3 353 ? -11.926 22.499  17.474 1.00 68.28  ? 555  MET A SD    1 
ATOM   3822 C CE    . MET C 3 353 ? -13.554 21.836  17.789 1.00 66.14  ? 555  MET A CE    1 
ATOM   3823 N N     . GLU C 3 354 ? -13.547 23.031  11.547 1.00 62.25  ? 556  GLU A N     1 
ATOM   3824 C CA    . GLU C 3 354 ? -14.756 23.356  10.829 1.00 63.81  ? 556  GLU A CA    1 
ATOM   3825 C C     . GLU C 3 354 ? -15.176 22.353  9.778  1.00 63.59  ? 556  GLU A C     1 
ATOM   3826 O O     . GLU C 3 354 ? -14.358 21.623  9.208  1.00 62.84  ? 556  GLU A O     1 
ATOM   3827 C CB    . GLU C 3 354 ? -14.635 24.736  10.225 1.00 64.17  ? 556  GLU A CB    1 
ATOM   3828 C CG    . GLU C 3 354 ? -13.406 24.870  9.414  1.00 72.94  ? 556  GLU A CG    1 
ATOM   3829 C CD    . GLU C 3 354 ? -13.422 26.115  8.582  1.00 79.64  ? 556  GLU A CD    1 
ATOM   3830 O OE1   . GLU C 3 354 ? -13.560 27.202  9.181  1.00 83.68  ? 556  GLU A OE1   1 
ATOM   3831 O OE2   . GLU C 3 354 ? -13.311 26.016  7.333  1.00 86.53  ? 556  GLU A OE2   1 
ATOM   3832 N N     . ASN C 3 355 ? -16.481 22.330  9.530  1.00 64.27  ? 557  ASN A N     1 
ATOM   3833 C CA    . ASN C 3 355 ? -17.062 21.448  8.536  1.00 63.74  ? 557  ASN A CA    1 
ATOM   3834 C C     . ASN C 3 355 ? -16.888 20.006  8.886  1.00 63.33  ? 557  ASN A C     1 
ATOM   3835 O O     . ASN C 3 355 ? -16.946 19.148  8.011  1.00 66.41  ? 557  ASN A O     1 
ATOM   3836 C CB    . ASN C 3 355 ? -16.405 21.645  7.174  1.00 68.69  ? 557  ASN A CB    1 
ATOM   3837 C CG    . ASN C 3 355 ? -16.606 23.040  6.617  1.00 76.50  ? 557  ASN A CG    1 
ATOM   3838 O OD1   . ASN C 3 355 ? -17.643 23.691  6.856  1.00 78.59  ? 557  ASN A OD1   1 
ATOM   3839 N ND2   . ASN C 3 355 ? -15.613 23.511  5.847  1.00 79.22  ? 557  ASN A ND2   1 
ATOM   3840 N N     . LYS C 3 356 ? -16.628 19.709  10.142 1.00 62.77  ? 558  LYS A N     1 
ATOM   3841 C CA    . LYS C 3 356 ? -16.449 18.321  10.492 1.00 59.24  ? 558  LYS A CA    1 
ATOM   3842 C C     . LYS C 3 356 ? -17.415 17.846  11.535 1.00 58.17  ? 558  LYS A C     1 
ATOM   3843 O O     . LYS C 3 356 ? -18.096 18.641  12.188 1.00 57.10  ? 558  LYS A O     1 
ATOM   3844 C CB    . LYS C 3 356 ? -15.051 18.082  11.022 1.00 57.54  ? 558  LYS A CB    1 
ATOM   3845 C CG    . LYS C 3 356 ? -13.941 18.225  10.024 1.00 57.75  ? 558  LYS A CG    1 
ATOM   3846 C CD    . LYS C 3 356 ? -12.623 17.955  10.756 1.00 60.21  ? 558  LYS A CD    1 
ATOM   3847 C CE    . LYS C 3 356 ? -11.384 18.212  9.903  1.00 62.00  ? 558  LYS A CE    1 
ATOM   3848 N NZ    . LYS C 3 356 ? -10.124 18.099  10.705 1.00 62.94  ? 558  LYS A NZ    1 
ATOM   3849 N N     . GLN C 3 357 ? -17.453 16.524  11.673 1.00 58.78  ? 559  GLN A N     1 
ATOM   3850 C CA    . GLN C 3 357 ? -18.260 15.840  12.670 1.00 58.36  ? 559  GLN A CA    1 
ATOM   3851 C C     . GLN C 3 357 ? -17.324 15.530  13.823 1.00 57.55  ? 559  GLN A C     1 
ATOM   3852 O O     . GLN C 3 357 ? -16.139 15.251  13.600 1.00 56.54  ? 559  GLN A O     1 
ATOM   3853 C CB    . GLN C 3 357 ? -18.833 14.556  12.105 1.00 62.43  ? 559  GLN A CB    1 
ATOM   3854 C CG    . GLN C 3 357 ? -19.971 14.830  11.173 1.00 73.01  ? 559  GLN A CG    1 
ATOM   3855 C CD    . GLN C 3 357 ? -20.999 15.764  11.819 1.00 78.49  ? 559  GLN A CD    1 
ATOM   3856 O OE1   . GLN C 3 357 ? -21.621 15.418  12.843 1.00 82.81  ? 559  GLN A OE1   1 
ATOM   3857 N NE2   . GLN C 3 357 ? -21.144 16.974  11.256 1.00 81.85  ? 559  GLN A NE2   1 
ATOM   3858 N N     . PRO C 3 358 ? -17.856 15.532  15.066 1.00 56.97  ? 560  PRO A N     1 
ATOM   3859 C CA    . PRO C 3 358 ? -17.193 15.283  16.356 1.00 54.62  ? 560  PRO A CA    1 
ATOM   3860 C C     . PRO C 3 358 ? -16.217 14.143  16.329 1.00 53.86  ? 560  PRO A C     1 
ATOM   3861 O O     . PRO C 3 358 ? -15.229 14.133  17.048 1.00 53.19  ? 560  PRO A O     1 
ATOM   3862 C CB    . PRO C 3 358 ? -18.356 14.931  17.278 1.00 52.41  ? 560  PRO A CB    1 
ATOM   3863 C CG    . PRO C 3 358 ? -19.457 15.732  16.745 1.00 55.84  ? 560  PRO A CG    1 
ATOM   3864 C CD    . PRO C 3 358 ? -19.320 15.544  15.249 1.00 58.55  ? 560  PRO A CD    1 
ATOM   3865 N N     . GLU C 3 359 ? -16.537 13.159  15.515 1.00 55.47  ? 561  GLU A N     1 
ATOM   3866 C CA    . GLU C 3 359 ? -15.727 11.975  15.406 1.00 56.70  ? 561  GLU A CA    1 
ATOM   3867 C C     . GLU C 3 359 ? -14.579 12.158  14.427 1.00 55.72  ? 561  GLU A C     1 
ATOM   3868 O O     . GLU C 3 359 ? -13.629 11.390  14.436 1.00 57.42  ? 561  GLU A O     1 
ATOM   3869 C CB    . GLU C 3 359 ? -16.617 10.808  14.988 1.00 61.36  ? 561  GLU A CB    1 
ATOM   3870 C CG    . GLU C 3 359 ? -18.017 10.777  15.680 1.00 71.40  ? 561  GLU A CG    1 
ATOM   3871 C CD    . GLU C 3 359 ? -19.068 11.736  15.043 1.00 78.26  ? 561  GLU A CD    1 
ATOM   3872 O OE1   . GLU C 3 359 ? -18.997 12.016  13.813 1.00 77.76  ? 561  GLU A OE1   1 
ATOM   3873 O OE2   . GLU C 3 359 ? -19.980 12.199  15.786 1.00 82.49  ? 561  GLU A OE2   1 
ATOM   3874 N N     . ASP C 3 360 ? -14.647 13.181  13.592 1.00 53.01  ? 562  ASP A N     1 
ATOM   3875 C CA    . ASP C 3 360 ? -13.578 13.361  12.639 1.00 52.99  ? 562  ASP A CA    1 
ATOM   3876 C C     . ASP C 3 360 ? -12.236 13.644  13.310 1.00 51.67  ? 562  ASP A C     1 
ATOM   3877 O O     . ASP C 3 360 ? -12.185 14.012  14.480 1.00 50.19  ? 562  ASP A O     1 
ATOM   3878 C CB    . ASP C 3 360 ? -13.974 14.416  11.603 1.00 55.97  ? 562  ASP A CB    1 
ATOM   3879 C CG    . ASP C 3 360 ? -15.121 13.944  10.690 1.00 57.69  ? 562  ASP A CG    1 
ATOM   3880 O OD1   . ASP C 3 360 ? -15.105 12.767  10.257 1.00 57.48  ? 562  ASP A OD1   1 
ATOM   3881 O OD2   . ASP C 3 360 ? -16.029 14.752  10.389 1.00 61.56  ? 562  ASP A OD2   1 
ATOM   3882 N N     . ASP C 3 361 ? -11.155 13.371  12.587 1.00 53.57  ? 563  ASP A N     1 
ATOM   3883 C CA    . ASP C 3 361 ? -9.803  13.593  13.100 1.00 54.35  ? 563  ASP A CA    1 
ATOM   3884 C C     . ASP C 3 361 ? -9.393  15.035  12.987 1.00 52.49  ? 563  ASP A C     1 
ATOM   3885 O O     . ASP C 3 361 ? -9.354  15.596  11.896 1.00 51.90  ? 563  ASP A O     1 
ATOM   3886 C CB    . ASP C 3 361 ? -8.770  12.748  12.356 1.00 55.37  ? 563  ASP A CB    1 
ATOM   3887 C CG    . ASP C 3 361 ? -8.697  11.331  12.868 1.00 57.09  ? 563  ASP A CG    1 
ATOM   3888 O OD1   . ASP C 3 361 ? -7.912  10.540  12.306 1.00 59.97  ? 563  ASP A OD1   1 
ATOM   3889 O OD2   . ASP C 3 361 ? -9.415  11.000  13.834 1.00 57.06  ? 563  ASP A OD2   1 
ATOM   3890 N N     . LEU C 3 362 ? -9.086  15.630  14.126 1.00 51.24  ? 564  LEU A N     1 
ATOM   3891 C CA    . LEU C 3 362 ? -8.661  17.006  14.165 1.00 47.81  ? 564  LEU A CA    1 
ATOM   3892 C C     . LEU C 3 362 ? -7.546  17.248  13.171 1.00 46.31  ? 564  LEU A C     1 
ATOM   3893 O O     . LEU C 3 362 ? -7.654  18.099  12.305 1.00 46.01  ? 564  LEU A O     1 
ATOM   3894 C CB    . LEU C 3 362 ? -8.188  17.341  15.568 1.00 48.87  ? 564  LEU A CB    1 
ATOM   3895 C CG    . LEU C 3 362 ? -7.689  18.756  15.869 1.00 50.70  ? 564  LEU A CG    1 
ATOM   3896 C CD1   . LEU C 3 362 ? -8.764  19.795  15.581 1.00 53.47  ? 564  LEU A CD1   1 
ATOM   3897 C CD2   . LEU C 3 362 ? -7.297  18.825  17.324 1.00 50.89  ? 564  LEU A CD2   1 
ATOM   3898 N N     . PHE C 3 363 ? -6.456  16.519  13.319 1.00 48.30  ? 565  PHE A N     1 
ATOM   3899 C CA    . PHE C 3 363 ? -5.331  16.682  12.430 1.00 49.68  ? 565  PHE A CA    1 
ATOM   3900 C C     . PHE C 3 363 ? -5.377  15.673  11.336 1.00 51.80  ? 565  PHE A C     1 
ATOM   3901 O O     . PHE C 3 363 ? -4.405  14.930  11.145 1.00 54.44  ? 565  PHE A O     1 
ATOM   3902 C CB    . PHE C 3 363 ? -4.000  16.526  13.153 1.00 50.56  ? 565  PHE A CB    1 
ATOM   3903 C CG    . PHE C 3 363 ? -3.769  17.521  14.241 1.00 54.60  ? 565  PHE A CG    1 
ATOM   3904 C CD1   . PHE C 3 363 ? -3.684  17.102  15.559 1.00 58.15  ? 565  PHE A CD1   1 
ATOM   3905 C CD2   . PHE C 3 363 ? -3.574  18.862  13.962 1.00 54.94  ? 565  PHE A CD2   1 
ATOM   3906 C CE1   . PHE C 3 363 ? -3.402  18.014  16.592 1.00 58.66  ? 565  PHE A CE1   1 
ATOM   3907 C CE2   . PHE C 3 363 ? -3.290  19.773  14.985 1.00 56.70  ? 565  PHE A CE2   1 
ATOM   3908 C CZ    . PHE C 3 363 ? -3.204  19.346  16.299 1.00 56.25  ? 565  PHE A CZ    1 
ATOM   3909 N N     . ASP C 3 364 ? -6.489  15.624  10.605 1.00 54.53  ? 566  ASP A N     1 
ATOM   3910 C CA    . ASP C 3 364 ? -6.563  14.715  9.461  1.00 60.58  ? 566  ASP A CA    1 
ATOM   3911 C C     . ASP C 3 364 ? -5.360  15.202  8.632  1.00 63.08  ? 566  ASP A C     1 
ATOM   3912 O O     . ASP C 3 364 ? -4.745  16.215  8.984  1.00 67.79  ? 566  ASP A O     1 
ATOM   3913 C CB    . ASP C 3 364 ? -7.855  14.947  8.681  1.00 62.37  ? 566  ASP A CB    1 
ATOM   3914 C CG    . ASP C 3 364 ? -7.862  16.295  7.958  1.00 71.22  ? 566  ASP A CG    1 
ATOM   3915 O OD1   . ASP C 3 364 ? -7.886  17.355  8.643  1.00 74.11  ? 566  ASP A OD1   1 
ATOM   3916 O OD2   . ASP C 3 364 ? -7.816  16.293  6.703  1.00 70.41  ? 566  ASP A OD2   1 
ATOM   3917 N N     . ARG C 3 365 ? -5.049  14.587  7.502  1.00 62.94  ? 567  ARG A N     1 
ATOM   3918 C CA    . ARG C 3 365 ? -3.861  15.054  6.752  1.00 67.52  ? 567  ARG A CA    1 
ATOM   3919 C C     . ARG C 3 365 ? -2.578  15.006  7.644  1.00 62.98  ? 567  ARG A C     1 
ATOM   3920 O O     . ARG C 3 365 ? -1.620  15.719  7.393  1.00 62.42  ? 567  ARG A O     1 
ATOM   3921 C CB    . ARG C 3 365 ? -4.013  16.514  6.193  1.00 72.91  ? 567  ARG A CB    1 
ATOM   3922 C CG    . ARG C 3 365 ? -5.261  16.886  5.359  1.00 83.09  ? 567  ARG A CG    1 
ATOM   3923 C CD    . ARG C 3 365 ? -5.606  15.865  4.235  1.00 93.94  ? 567  ARG A CD    1 
ATOM   3924 N NE    . ARG C 3 365 ? -7.064  15.664  4.112  1.00 102.01 ? 567  ARG A NE    1 
ATOM   3925 C CZ    . ARG C 3 365 ? -7.662  14.571  3.618  1.00 105.38 ? 567  ARG A CZ    1 
ATOM   3926 N NH1   . ARG C 3 365 ? -6.937  13.543  3.168  1.00 105.85 ? 567  ARG A NH1   1 
ATOM   3927 N NH2   . ARG C 3 365 ? -8.997  14.472  3.639  1.00 108.05 ? 567  ARG A NH2   1 
ATOM   3928 N N     . LEU C 3 366 ? -2.558  14.191  8.690  1.00 61.14  ? 568  LEU A N     1 
ATOM   3929 C CA    . LEU C 3 366 ? -1.373  14.119  9.542  1.00 57.00  ? 568  LEU A CA    1 
ATOM   3930 C C     . LEU C 3 366 ? -1.325  12.805  10.296 1.00 55.25  ? 568  LEU A C     1 
ATOM   3931 O O     . LEU C 3 366 ? -2.360  12.298  10.684 1.00 55.93  ? 568  LEU A O     1 
ATOM   3932 C CB    . LEU C 3 366 ? -1.398  15.241  10.574 1.00 55.96  ? 568  LEU A CB    1 
ATOM   3933 C CG    . LEU C 3 366 ? -0.076  15.789  11.144 1.00 58.70  ? 568  LEU A CG    1 
ATOM   3934 C CD1   . LEU C 3 366 ? -0.349  16.457  12.480 1.00 57.13  ? 568  LEU A CD1   1 
ATOM   3935 C CD2   . LEU C 3 366 ? 0.991   14.737  11.322 1.00 54.04  ? 568  LEU A CD2   1 
ATOM   3936 N N     . ASN C 3 367 ? -0.124  12.259  10.484 1.00 52.75  ? 569  ASN A N     1 
ATOM   3937 C CA    . ASN C 3 367 ? 0.063   11.029  11.241 1.00 45.74  ? 569  ASN A CA    1 
ATOM   3938 C C     . ASN C 3 367 ? 1.422   11.005  11.869 1.00 42.98  ? 569  ASN A C     1 
ATOM   3939 O O     . ASN C 3 367 ? 2.296   11.813  11.571 1.00 41.92  ? 569  ASN A O     1 
ATOM   3940 C CB    . ASN C 3 367 ? -0.139  9.787   10.397 1.00 46.93  ? 569  ASN A CB    1 
ATOM   3941 C CG    . ASN C 3 367 ? 0.885   9.646   9.328  1.00 47.53  ? 569  ASN A CG    1 
ATOM   3942 O OD1   . ASN C 3 367 ? 2.055   9.975   9.510  1.00 49.68  ? 569  ASN A OD1   1 
ATOM   3943 N ND2   . ASN C 3 367 ? 0.451   9.184   8.170  1.00 48.36  ? 569  ASN A ND2   1 
ATOM   3944 N N     . THR C 3 368 ? 1.585   10.088  12.783 1.00 40.89  ? 570  THR A N     1 
ATOM   3945 C CA    . THR C 3 368 ? 2.823   9.982   13.497 1.00 44.37  ? 570  THR A CA    1 
ATOM   3946 C C     . THR C 3 368 ? 4.006   9.801   12.582 1.00 42.60  ? 570  THR A C     1 
ATOM   3947 O O     . THR C 3 368 ? 5.033   10.437  12.771 1.00 43.69  ? 570  THR A O     1 
ATOM   3948 C CB    . THR C 3 368 ? 2.732   8.853   14.460 1.00 47.51  ? 570  THR A CB    1 
ATOM   3949 O OG1   . THR C 3 368 ? 2.425   7.673   13.725 1.00 53.64  ? 570  THR A OG1   1 
ATOM   3950 C CG2   . THR C 3 368 ? 1.600   9.112   15.451 1.00 43.66  ? 570  THR A CG2   1 
ATOM   3951 N N     . GLY C 3 369 ? 3.836   9.005   11.542 1.00 42.12  ? 571  GLY A N     1 
ATOM   3952 C CA    . GLY C 3 369 ? 4.933   8.793   10.625 1.00 43.68  ? 571  GLY A CA    1 
ATOM   3953 C C     . GLY C 3 369 ? 5.374   10.108  10.009 1.00 46.58  ? 571  GLY A C     1 
ATOM   3954 O O     . GLY C 3 369 ? 6.553   10.449  9.997  1.00 47.46  ? 571  GLY A O     1 
ATOM   3955 N N     . ILE C 3 370 ? 4.417   10.832  9.452  1.00 43.13  ? 572  ILE A N     1 
ATOM   3956 C CA    . ILE C 3 370 ? 4.677   12.117  8.844  1.00 41.32  ? 572  ILE A CA    1 
ATOM   3957 C C     . ILE C 3 370 ? 5.403   12.997  9.853  1.00 41.89  ? 572  ILE A C     1 
ATOM   3958 O O     . ILE C 3 370 ? 6.417   13.638  9.560  1.00 42.15  ? 572  ILE A O     1 
ATOM   3959 C CB    . ILE C 3 370 ? 3.352   12.784  8.514  1.00 42.89  ? 572  ILE A CB    1 
ATOM   3960 C CG1   . ILE C 3 370 ? 2.595   11.953  7.497  1.00 43.40  ? 572  ILE A CG1   1 
ATOM   3961 C CG2   . ILE C 3 370 ? 3.567   14.166  7.983  1.00 44.86  ? 572  ILE A CG2   1 
ATOM   3962 C CD1   . ILE C 3 370 ? 1.156   12.358  7.345  1.00 45.99  ? 572  ILE A CD1   1 
ATOM   3963 N N     . LEU C 3 371 ? 4.852   13.041  11.048 1.00 39.86  ? 573  LEU A N     1 
ATOM   3964 C CA    . LEU C 3 371 ? 5.427   13.847  12.086 1.00 44.18  ? 573  LEU A CA    1 
ATOM   3965 C C     . LEU C 3 371 ? 6.902   13.544  12.369 1.00 46.64  ? 573  LEU A C     1 
ATOM   3966 O O     . LEU C 3 371 ? 7.769   14.428  12.308 1.00 47.38  ? 573  LEU A O     1 
ATOM   3967 C CB    . LEU C 3 371 ? 4.629   13.641  13.354 1.00 45.90  ? 573  LEU A CB    1 
ATOM   3968 C CG    . LEU C 3 371 ? 5.296   14.332  14.539 1.00 49.30  ? 573  LEU A CG    1 
ATOM   3969 C CD1   . LEU C 3 371 ? 5.000   15.824  14.504 1.00 47.98  ? 573  LEU A CD1   1 
ATOM   3970 C CD2   . LEU C 3 371 ? 4.835   13.704  15.823 1.00 50.92  ? 573  LEU A CD2   1 
ATOM   3971 N N     . ASN C 3 372 ? 7.147   12.310  12.790 1.00 49.16  ? 574  ASN A N     1 
ATOM   3972 C CA    . ASN C 3 372 ? 8.480   11.849  13.138 1.00 52.33  ? 574  ASN A CA    1 
ATOM   3973 C C     . ASN C 3 372 ? 9.509   11.982  12.018 1.00 55.81  ? 574  ASN A C     1 
ATOM   3974 O O     . ASN C 3 372 ? 10.697  12.257  12.259 1.00 52.84  ? 574  ASN A O     1 
ATOM   3975 C CB    . ASN C 3 372 ? 8.393   10.428  13.670 1.00 46.50  ? 574  ASN A CB    1 
ATOM   3976 C CG    . ASN C 3 372 ? 8.022   10.400  15.126 1.00 45.72  ? 574  ASN A CG    1 
ATOM   3977 O OD1   . ASN C 3 372 ? 8.596   11.135  15.934 1.00 46.50  ? 574  ASN A OD1   1 
ATOM   3978 N ND2   . ASN C 3 372 ? 7.038   9.606   15.472 1.00 41.46  ? 574  ASN A ND2   1 
ATOM   3979 N N     . LYS C 3 373 ? 9.023   11.853  10.787 1.00 59.42  ? 575  LYS A N     1 
ATOM   3980 C CA    . LYS C 3 373 ? 9.854   11.980  9.602  1.00 60.35  ? 575  LYS A CA    1 
ATOM   3981 C C     . LYS C 3 373 ? 10.499  13.363  9.656  1.00 58.39  ? 575  LYS A C     1 
ATOM   3982 O O     . LYS C 3 373 ? 11.727  13.518  9.648  1.00 56.37  ? 575  LYS A O     1 
ATOM   3983 C CB    . LYS C 3 373 ? 8.968   11.834  8.355  1.00 65.77  ? 575  LYS A CB    1 
ATOM   3984 C CG    . LYS C 3 373 ? 9.696   11.994  7.022  1.00 74.18  ? 575  LYS A CG    1 
ATOM   3985 C CD    . LYS C 3 373 ? 11.012  11.204  6.990  1.00 83.30  ? 575  LYS A CD    1 
ATOM   3986 C CE    . LYS C 3 373 ? 10.857  9.674   7.127  1.00 86.94  ? 575  LYS A CE    1 
ATOM   3987 N NZ    . LYS C 3 373 ? 12.187  8.985   7.351  1.00 86.86  ? 575  LYS A NZ    1 
ATOM   3988 N N     . HIS C 3 374 ? 9.648   14.363  9.814  1.00 56.41  ? 576  HIS A N     1 
ATOM   3989 C CA    . HIS C 3 374 ? 10.099  15.728  9.892  1.00 55.35  ? 576  HIS A CA    1 
ATOM   3990 C C     . HIS C 3 374 ? 11.025  15.957  11.081 1.00 50.52  ? 576  HIS A C     1 
ATOM   3991 O O     . HIS C 3 374 ? 11.985  16.723  11.000 1.00 49.93  ? 576  HIS A O     1 
ATOM   3992 C CB    . HIS C 3 374 ? 8.890   16.644  9.999  1.00 64.05  ? 576  HIS A CB    1 
ATOM   3993 C CG    . HIS C 3 374 ? 9.249   18.096  10.137 1.00 79.57  ? 576  HIS A CG    1 
ATOM   3994 N ND1   . HIS C 3 374 ? 8.528   18.977  10.922 1.00 84.55  ? 576  HIS A ND1   1 
ATOM   3995 C CD2   . HIS C 3 374 ? 10.253  18.825  9.586  1.00 82.75  ? 576  HIS A CD2   1 
ATOM   3996 C CE1   . HIS C 3 374 ? 9.069   20.182  10.846 1.00 84.03  ? 576  HIS A CE1   1 
ATOM   3997 N NE2   . HIS C 3 374 ? 10.117  20.116  10.041 1.00 85.14  ? 576  HIS A NE2   1 
ATOM   3998 N N     . LEU C 3 375 ? 10.692  15.345  12.201 1.00 45.15  ? 577  LEU A N     1 
ATOM   3999 C CA    . LEU C 3 375 ? 11.492  15.504  13.380 1.00 46.19  ? 577  LEU A CA    1 
ATOM   4000 C C     . LEU C 3 375 ? 12.903  14.993  13.212 1.00 47.69  ? 577  LEU A C     1 
ATOM   4001 O O     . LEU C 3 375 ? 13.856  15.669  13.592 1.00 47.89  ? 577  LEU A O     1 
ATOM   4002 C CB    . LEU C 3 375 ? 10.821  14.828  14.568 1.00 46.33  ? 577  LEU A CB    1 
ATOM   4003 C CG    . LEU C 3 375 ? 9.592   15.540  15.150 1.00 44.40  ? 577  LEU A CG    1 
ATOM   4004 C CD1   . LEU C 3 375 ? 9.042   14.718  16.307 1.00 42.00  ? 577  LEU A CD1   1 
ATOM   4005 C CD2   . LEU C 3 375 ? 9.940   16.960  15.623 1.00 38.19  ? 577  LEU A CD2   1 
ATOM   4006 N N     . GLN C 3 376 ? 13.047  13.807  12.643 1.00 51.65  ? 578  GLN A N     1 
ATOM   4007 C CA    . GLN C 3 376 ? 14.381  13.247  12.467 1.00 57.59  ? 578  GLN A CA    1 
ATOM   4008 C C     . GLN C 3 376 ? 15.195  14.188  11.588 1.00 60.00  ? 578  GLN A C     1 
ATOM   4009 O O     . GLN C 3 376 ? 16.375  14.450  11.843 1.00 57.38  ? 578  GLN A O     1 
ATOM   4010 C CB    . GLN C 3 376 ? 14.316  11.838  11.864 1.00 61.65  ? 578  GLN A CB    1 
ATOM   4011 C CG    . GLN C 3 376 ? 15.427  10.889  12.365 1.00 65.64  ? 578  GLN A CG    1 
ATOM   4012 C CD    . GLN C 3 376 ? 16.682  10.976  11.546 1.00 70.45  ? 578  GLN A CD    1 
ATOM   4013 O OE1   . GLN C 3 376 ? 16.631  11.351  10.368 1.00 75.61  ? 578  GLN A OE1   1 
ATOM   4014 N NE2   . GLN C 3 376 ? 17.815  10.566  12.130 1.00 76.00  ? 578  GLN A NE2   1 
ATOM   4015 N N     . ASP C 3 377 ? 14.543  14.742  10.574 1.00 62.85  ? 579  ASP A N     1 
ATOM   4016 C CA    . ASP C 3 377 ? 15.222  15.681  9.705  1.00 65.19  ? 579  ASP A CA    1 
ATOM   4017 C C     . ASP C 3 377 ? 15.805  16.795  10.544 1.00 65.86  ? 579  ASP A C     1 
ATOM   4018 O O     . ASP C 3 377 ? 16.975  17.142  10.386 1.00 68.43  ? 579  ASP A O     1 
ATOM   4019 C CB    . ASP C 3 377 ? 14.239  16.246  8.710  1.00 69.61  ? 579  ASP A CB    1 
ATOM   4020 C CG    . ASP C 3 377 ? 13.773  15.207  7.742  1.00 76.64  ? 579  ASP A CG    1 
ATOM   4021 O OD1   . ASP C 3 377 ? 14.397  14.108  7.730  1.00 81.51  ? 579  ASP A OD1   1 
ATOM   4022 O OD2   . ASP C 3 377 ? 12.799  15.485  6.997  1.00 81.22  ? 579  ASP A OD2   1 
ATOM   4023 N N     . LEU C 3 378 ? 14.977  17.354  11.430 1.00 62.66  ? 580  LEU A N     1 
ATOM   4024 C CA    . LEU C 3 378 ? 15.416  18.422  12.321 1.00 60.95  ? 580  LEU A CA    1 
ATOM   4025 C C     . LEU C 3 378 ? 16.534  17.926  13.213 1.00 58.23  ? 580  LEU A C     1 
ATOM   4026 O O     . LEU C 3 378 ? 17.471  18.657  13.484 1.00 59.90  ? 580  LEU A O     1 
ATOM   4027 C CB    . LEU C 3 378 ? 14.282  18.936  13.217 1.00 62.98  ? 580  LEU A CB    1 
ATOM   4028 C CG    . LEU C 3 378 ? 13.021  19.498  12.555 1.00 67.85  ? 580  LEU A CG    1 
ATOM   4029 C CD1   . LEU C 3 378 ? 12.242  20.263  13.586 1.00 68.24  ? 580  LEU A CD1   1 
ATOM   4030 C CD2   . LEU C 3 378 ? 13.367  20.430  11.418 1.00 69.90  ? 580  LEU A CD2   1 
ATOM   4031 N N     . MET C 3 379 ? 16.419  16.702  13.707 1.00 55.00  ? 581  MET A N     1 
ATOM   4032 C CA    . MET C 3 379 ? 17.456  16.173  14.570 1.00 53.44  ? 581  MET A CA    1 
ATOM   4033 C C     . MET C 3 379 ? 17.517  14.687  14.383 1.00 53.64  ? 581  MET A C     1 
ATOM   4034 O O     . MET C 3 379 ? 16.498  14.017  14.485 1.00 52.93  ? 581  MET A O     1 
ATOM   4035 C CB    . MET C 3 379 ? 17.172  16.509  16.045 1.00 56.53  ? 581  MET A CB    1 
ATOM   4036 C CG    . MET C 3 379 ? 18.210  15.964  17.057 1.00 55.05  ? 581  MET A CG    1 
ATOM   4037 S SD    . MET C 3 379 ? 17.900  16.363  18.800 1.00 53.94  ? 581  MET A SD    1 
ATOM   4038 C CE    . MET C 3 379 ? 17.856  14.685  19.503 1.00 56.40  ? 581  MET A CE    1 
ATOM   4039 N N     . GLU C 3 380 ? 18.720  14.180  14.120 1.00 53.59  ? 582  GLU A N     1 
ATOM   4040 C CA    . GLU C 3 380 ? 18.900  12.757  13.920 1.00 53.77  ? 582  GLU A CA    1 
ATOM   4041 C C     . GLU C 3 380 ? 18.346  12.042  15.137 1.00 55.42  ? 582  GLU A C     1 
ATOM   4042 O O     . GLU C 3 380 ? 18.609  12.430  16.294 1.00 55.94  ? 582  GLU A O     1 
ATOM   4043 C CB    . GLU C 3 380 ? 20.374  12.382  13.693 1.00 50.16  ? 582  GLU A CB    1 
ATOM   4044 N N     . GLY C 3 381 ? 17.489  11.067  14.851 1.00 54.27  ? 583  GLY A N     1 
ATOM   4045 C CA    . GLY C 3 381 ? 16.878  10.262  15.884 1.00 54.01  ? 583  GLY A CA    1 
ATOM   4046 C C     . GLY C 3 381 ? 15.932  11.002  16.791 1.00 53.94  ? 583  GLY A C     1 
ATOM   4047 O O     . GLY C 3 381 ? 15.852  10.694  17.975 1.00 56.85  ? 583  GLY A O     1 
ATOM   4048 N N     . LEU C 3 382 ? 15.236  11.993  16.260 1.00 51.87  ? 584  LEU A N     1 
ATOM   4049 C CA    . LEU C 3 382 ? 14.290  12.747  17.061 1.00 49.48  ? 584  LEU A CA    1 
ATOM   4050 C C     . LEU C 3 382 ? 12.832  12.256  16.829 1.00 49.77  ? 584  LEU A C     1 
ATOM   4051 O O     . LEU C 3 382 ? 12.346  12.262  15.687 1.00 53.96  ? 584  LEU A O     1 
ATOM   4052 C CB    . LEU C 3 382 ? 14.457  14.240  16.745 1.00 47.12  ? 584  LEU A CB    1 
ATOM   4053 C CG    . LEU C 3 382 ? 13.549  15.329  17.318 1.00 46.96  ? 584  LEU A CG    1 
ATOM   4054 C CD1   . LEU C 3 382 ? 13.706  15.407  18.824 1.00 44.36  ? 584  LEU A CD1   1 
ATOM   4055 C CD2   . LEU C 3 382 ? 13.881  16.662  16.677 1.00 44.64  ? 584  LEU A CD2   1 
ATOM   4056 N N     . THR C 3 383 ? 12.157  11.816  17.907 1.00 45.04  ? 585  THR A N     1 
ATOM   4057 C CA    . THR C 3 383 ? 10.760  11.365  17.849 1.00 36.38  ? 585  THR A CA    1 
ATOM   4058 C C     . THR C 3 383 ? 9.932   12.081  18.895 1.00 35.29  ? 585  THR A C     1 
ATOM   4059 O O     . THR C 3 383 ? 10.445  12.644  19.856 1.00 32.24  ? 585  THR A O     1 
ATOM   4060 C CB    . THR C 3 383 ? 10.580  9.845   18.084 1.00 33.58  ? 585  THR A CB    1 
ATOM   4061 O OG1   . THR C 3 383 ? 10.955  9.497   19.421 1.00 37.21  ? 585  THR A OG1   1 
ATOM   4062 C CG2   . THR C 3 383 ? 11.370  9.033   17.108 1.00 32.24  ? 585  THR A CG2   1 
ATOM   4063 N N     . ALA C 3 384 ? 8.632   12.049  18.699 1.00 35.28  ? 586  ALA A N     1 
ATOM   4064 C CA    . ALA C 3 384 ? 7.717   12.679  19.610 1.00 33.51  ? 586  ALA A CA    1 
ATOM   4065 C C     . ALA C 3 384 ? 8.017   12.330  21.045 1.00 34.60  ? 586  ALA A C     1 
ATOM   4066 O O     . ALA C 3 384 ? 8.016   13.190  21.913 1.00 36.20  ? 586  ALA A O     1 
ATOM   4067 C CB    . ALA C 3 384 ? 6.343   12.266  19.284 1.00 34.27  ? 586  ALA A CB    1 
ATOM   4068 N N     . LYS C 3 385 ? 8.361   11.082  21.285 1.00 36.19  ? 587  LYS A N     1 
ATOM   4069 C CA    . LYS C 3 385 ? 8.615   10.665  22.645 1.00 37.94  ? 587  LYS A CA    1 
ATOM   4070 C C     . LYS C 3 385 ? 9.805   11.350  23.306 1.00 39.07  ? 587  LYS A C     1 
ATOM   4071 O O     . LYS C 3 385 ? 9.764   11.642  24.499 1.00 37.60  ? 587  LYS A O     1 
ATOM   4072 C CB    . LYS C 3 385 ? 8.664   9.139   22.745 1.00 38.82  ? 587  LYS A CB    1 
ATOM   4073 C CG    . LYS C 3 385 ? 10.015  8.505   22.660 1.00 42.97  ? 587  LYS A CG    1 
ATOM   4074 C CD    . LYS C 3 385 ? 9.879   6.996   22.865 1.00 41.52  ? 587  LYS A CD    1 
ATOM   4075 C CE    . LYS C 3 385 ? 10.215  6.560   24.290 1.00 38.73  ? 587  LYS A CE    1 
ATOM   4076 N NZ    . LYS C 3 385 ? 11.617  6.893   24.666 1.00 43.32  ? 587  LYS A NZ    1 
ATOM   4077 N N     . VAL C 3 386 ? 10.794  11.740  22.516 1.00 38.81  ? 588  VAL A N     1 
ATOM   4078 C CA    . VAL C 3 386 ? 11.971  12.401  23.086 1.00 40.68  ? 588  VAL A CA    1 
ATOM   4079 C C     . VAL C 3 386 ? 11.568  13.649  23.866 1.00 39.51  ? 588  VAL A C     1 
ATOM   4080 O O     . VAL C 3 386 ? 12.200  14.029  24.876 1.00 34.06  ? 588  VAL A O     1 
ATOM   4081 C CB    . VAL C 3 386 ? 12.920  12.823  21.975 1.00 44.53  ? 588  VAL A CB    1 
ATOM   4082 C CG1   . VAL C 3 386 ? 14.218  13.378  22.548 1.00 45.84  ? 588  VAL A CG1   1 
ATOM   4083 C CG2   . VAL C 3 386 ? 13.169  11.657  21.062 1.00 44.61  ? 588  VAL A CG2   1 
ATOM   4084 N N     . PHE C 3 387 ? 10.574  14.336  23.306 1.00 35.92  ? 589  PHE A N     1 
ATOM   4085 C CA    . PHE C 3 387 ? 10.027  15.545  23.904 1.00 39.33  ? 589  PHE A CA    1 
ATOM   4086 C C     . PHE C 3 387 ? 9.624   15.326  25.378 1.00 41.61  ? 589  PHE A C     1 
ATOM   4087 O O     . PHE C 3 387 ? 10.070  16.060  26.269 1.00 40.94  ? 589  PHE A O     1 
ATOM   4088 C CB    . PHE C 3 387 ? 8.860   16.070  23.050 1.00 39.87  ? 589  PHE A CB    1 
ATOM   4089 C CG    . PHE C 3 387 ? 9.298   16.877  21.842 1.00 42.76  ? 589  PHE A CG    1 
ATOM   4090 C CD1   . PHE C 3 387 ? 9.592   16.253  20.626 1.00 42.52  ? 589  PHE A CD1   1 
ATOM   4091 C CD2   . PHE C 3 387 ? 9.422   18.269  21.929 1.00 44.45  ? 589  PHE A CD2   1 
ATOM   4092 C CE1   . PHE C 3 387 ? 10.001  17.008  19.519 1.00 45.23  ? 589  PHE A CE1   1 
ATOM   4093 C CE2   . PHE C 3 387 ? 9.830   19.040  20.825 1.00 46.93  ? 589  PHE A CE2   1 
ATOM   4094 C CZ    . PHE C 3 387 ? 10.120  18.414  19.621 1.00 46.80  ? 589  PHE A CZ    1 
ATOM   4095 N N     . ARG C 3 388 ? 8.882   14.249  25.640 1.00 42.82  ? 590  ARG A N     1 
ATOM   4096 C CA    . ARG C 3 388 ? 8.445   13.912  26.997 1.00 42.69  ? 590  ARG A CA    1 
ATOM   4097 C C     . ARG C 3 388 ? 9.611   13.744  27.977 1.00 43.45  ? 590  ARG A C     1 
ATOM   4098 O O     . ARG C 3 388 ? 9.535   14.199  29.133 1.00 43.50  ? 590  ARG A O     1 
ATOM   4099 C CB    . ARG C 3 388 ? 7.560   12.637  27.018 1.00 44.21  ? 590  ARG A CB    1 
ATOM   4100 C CG    . ARG C 3 388 ? 6.193   12.757  26.282 1.00 46.24  ? 590  ARG A CG    1 
ATOM   4101 C CD    . ARG C 3 388 ? 5.145   11.637  26.594 1.00 44.83  ? 590  ARG A CD    1 
ATOM   4102 N NE    . ARG C 3 388 ? 4.316   11.935  27.767 1.00 44.15  ? 590  ARG A NE    1 
ATOM   4103 C CZ    . ARG C 3 388 ? 3.919   11.040  28.665 1.00 44.75  ? 590  ARG A CZ    1 
ATOM   4104 N NH1   . ARG C 3 388 ? 4.238   9.765   28.552 1.00 44.34  ? 590  ARG A NH1   1 
ATOM   4105 N NH2   . ARG C 3 388 ? 3.286   11.443  29.743 1.00 43.88  ? 590  ARG A NH2   1 
ATOM   4106 N N     . THR C 3 389 ? 10.685  13.105  27.523 1.00 41.47  ? 591  THR A N     1 
ATOM   4107 C CA    . THR C 3 389 ? 11.833  12.888  28.388 1.00 40.99  ? 591  THR A CA    1 
ATOM   4108 C C     . THR C 3 389 ? 12.504  14.199  28.664 1.00 42.89  ? 591  THR A C     1 
ATOM   4109 O O     . THR C 3 389 ? 12.779  14.562  29.810 1.00 46.01  ? 591  THR A O     1 
ATOM   4110 C CB    . THR C 3 389 ? 12.860  12.008  27.757 1.00 35.98  ? 591  THR A CB    1 
ATOM   4111 O OG1   . THR C 3 389 ? 12.216  10.906  27.146 1.00 30.33  ? 591  THR A OG1   1 
ATOM   4112 C CG2   . THR C 3 389 ? 13.766  11.488  28.804 1.00 31.41  ? 591  THR A CG2   1 
ATOM   4113 N N     . TYR C 3 390 ? 12.769  14.906  27.584 1.00 41.50  ? 592  TYR A N     1 
ATOM   4114 C CA    . TYR C 3 390 ? 13.404  16.188  27.672 1.00 43.31  ? 592  TYR A CA    1 
ATOM   4115 C C     . TYR C 3 390 ? 12.718  17.098  28.679 1.00 42.20  ? 592  TYR A C     1 
ATOM   4116 O O     . TYR C 3 390 ? 13.355  17.642  29.576 1.00 42.08  ? 592  TYR A O     1 
ATOM   4117 C CB    . TYR C 3 390 ? 13.407  16.804  26.286 1.00 46.18  ? 592  TYR A CB    1 
ATOM   4118 C CG    . TYR C 3 390 ? 13.482  18.282  26.294 1.00 48.01  ? 592  TYR A CG    1 
ATOM   4119 C CD1   . TYR C 3 390 ? 14.668  18.942  26.590 1.00 51.11  ? 592  TYR A CD1   1 
ATOM   4120 C CD2   . TYR C 3 390 ? 12.358  19.024  26.021 1.00 50.08  ? 592  TYR A CD2   1 
ATOM   4121 C CE1   . TYR C 3 390 ? 14.723  20.314  26.613 1.00 54.60  ? 592  TYR A CE1   1 
ATOM   4122 C CE2   . TYR C 3 390 ? 12.390  20.381  26.037 1.00 54.85  ? 592  TYR A CE2   1 
ATOM   4123 C CZ    . TYR C 3 390 ? 13.568  21.029  26.331 1.00 60.46  ? 592  TYR A CZ    1 
ATOM   4124 O OH    . TYR C 3 390 ? 13.589  22.405  26.326 1.00 70.71  ? 592  TYR A OH    1 
ATOM   4125 N N     . ASN C 3 391 ? 11.406  17.198  28.554 1.00 42.62  ? 593  ASN A N     1 
ATOM   4126 C CA    . ASN C 3 391 ? 10.580  18.045  29.414 1.00 44.98  ? 593  ASN A CA    1 
ATOM   4127 C C     . ASN C 3 391 ? 10.615  17.648  30.882 1.00 43.86  ? 593  ASN A C     1 
ATOM   4128 O O     . ASN C 3 391 ? 10.829  18.486  31.766 1.00 41.62  ? 593  ASN A O     1 
ATOM   4129 C CB    . ASN C 3 391 ? 9.141   17.977  28.917 1.00 54.58  ? 593  ASN A CB    1 
ATOM   4130 C CG    . ASN C 3 391 ? 8.478   19.343  28.799 1.00 57.67  ? 593  ASN A CG    1 
ATOM   4131 O OD1   . ASN C 3 391 ? 7.731   19.592  27.847 1.00 60.14  ? 593  ASN A OD1   1 
ATOM   4132 N ND2   . ASN C 3 391 ? 8.675   20.202  29.806 1.00 60.75  ? 593  ASN A ND2   1 
ATOM   4133 N N     . ALA C 3 392 ? 10.353  16.367  31.130 1.00 41.45  ? 594  ALA A N     1 
ATOM   4134 C CA    . ALA C 3 392 ? 10.351  15.845  32.476 1.00 43.18  ? 594  ALA A CA    1 
ATOM   4135 C C     . ALA C 3 392 ? 11.664  16.223  33.106 1.00 44.30  ? 594  ALA A C     1 
ATOM   4136 O O     . ALA C 3 392 ? 11.698  17.059  34.004 1.00 44.96  ? 594  ALA A O     1 
ATOM   4137 C CB    . ALA C 3 392 ? 10.202  14.357  32.449 1.00 44.24  ? 594  ALA A CB    1 
ATOM   4138 N N     . SER C 3 393 ? 12.736  15.653  32.564 1.00 44.04  ? 595  SER A N     1 
ATOM   4139 C CA    . SER C 3 393 ? 14.094  15.880  33.044 1.00 46.76  ? 595  SER A CA    1 
ATOM   4140 C C     . SER C 3 393 ? 14.486  17.345  33.207 1.00 46.15  ? 595  SER A C     1 
ATOM   4141 O O     . SER C 3 393 ? 15.131  17.721  34.199 1.00 42.79  ? 595  SER A O     1 
ATOM   4142 C CB    . SER C 3 393 ? 15.108  15.198  32.116 1.00 48.56  ? 595  SER A CB    1 
ATOM   4143 O OG    . SER C 3 393 ? 14.991  13.784  32.146 1.00 51.12  ? 595  SER A OG    1 
ATOM   4144 N N     . ILE C 3 394 ? 14.137  18.163  32.224 1.00 43.34  ? 596  ILE A N     1 
ATOM   4145 C CA    . ILE C 3 394 ? 14.492  19.555  32.312 1.00 45.57  ? 596  ILE A CA    1 
ATOM   4146 C C     . ILE C 3 394 ? 13.669  20.238  33.378 1.00 48.26  ? 596  ILE A C     1 
ATOM   4147 O O     . ILE C 3 394 ? 14.148  21.123  34.077 1.00 46.98  ? 596  ILE A O     1 
ATOM   4148 C CB    . ILE C 3 394 ? 14.341  20.254  30.965 1.00 53.21  ? 596  ILE A CB    1 
ATOM   4149 C CG1   . ILE C 3 394 ? 15.294  21.445  30.906 1.00 57.24  ? 596  ILE A CG1   1 
ATOM   4150 C CG2   . ILE C 3 394 ? 12.908  20.708  30.738 1.00 53.67  ? 596  ILE A CG2   1 
ATOM   4151 C CD1   . ILE C 3 394 ? 16.760  21.077  31.190 1.00 59.02  ? 596  ILE A CD1   1 
ATOM   4152 N N     . THR C 3 395 ? 12.422  19.808  33.508 1.00 49.00  ? 597  THR A N     1 
ATOM   4153 C CA    . THR C 3 395 ? 11.544  20.365  34.518 1.00 47.11  ? 597  THR A CA    1 
ATOM   4154 C C     . THR C 3 395 ? 12.108  20.026  35.868 1.00 45.95  ? 597  THR A C     1 
ATOM   4155 O O     . THR C 3 395 ? 12.136  20.869  36.748 1.00 50.35  ? 597  THR A O     1 
ATOM   4156 C CB    . THR C 3 395 ? 10.167  19.789  34.407 1.00 47.92  ? 597  THR A CB    1 
ATOM   4157 O OG1   . THR C 3 395 ? 9.583   20.281  33.204 1.00 47.16  ? 597  THR A OG1   1 
ATOM   4158 C CG2   . THR C 3 395 ? 9.310   20.181  35.602 1.00 42.28  ? 597  THR A CG2   1 
ATOM   4159 N N     . LEU C 3 396 ? 12.546  18.788  36.037 1.00 41.41  ? 598  LEU A N     1 
ATOM   4160 C CA    . LEU C 3 396 ? 13.125  18.381  37.299 1.00 44.32  ? 598  LEU A CA    1 
ATOM   4161 C C     . LEU C 3 396 ? 14.311  19.263  37.607 1.00 44.86  ? 598  LEU A C     1 
ATOM   4162 O O     . LEU C 3 396 ? 14.454  19.737  38.715 1.00 45.86  ? 598  LEU A O     1 
ATOM   4163 C CB    . LEU C 3 396 ? 13.613  16.928  37.268 1.00 45.04  ? 598  LEU A CB    1 
ATOM   4164 C CG    . LEU C 3 396 ? 14.085  16.350  38.623 1.00 46.00  ? 598  LEU A CG    1 
ATOM   4165 C CD1   . LEU C 3 396 ? 12.893  16.105  39.526 1.00 45.13  ? 598  LEU A CD1   1 
ATOM   4166 C CD2   . LEU C 3 396 ? 14.877  15.048  38.473 1.00 42.87  ? 598  LEU A CD2   1 
ATOM   4167 N N     . GLN C 3 397 ? 15.150  19.516  36.622 1.00 44.28  ? 599  GLN A N     1 
ATOM   4168 C CA    . GLN C 3 397 ? 16.336  20.314  36.876 1.00 46.81  ? 599  GLN A CA    1 
ATOM   4169 C C     . GLN C 3 397 ? 16.083  21.693  37.469 1.00 47.55  ? 599  GLN A C     1 
ATOM   4170 O O     . GLN C 3 397 ? 16.563  21.997  38.549 1.00 47.79  ? 599  GLN A O     1 
ATOM   4171 C CB    . GLN C 3 397 ? 17.227  20.366  35.633 1.00 49.10  ? 599  GLN A CB    1 
ATOM   4172 C CG    . GLN C 3 397 ? 18.673  20.739  35.913 1.00 45.31  ? 599  GLN A CG    1 
ATOM   4173 C CD    . GLN C 3 397 ? 19.587  20.366  34.772 1.00 47.59  ? 599  GLN A CD    1 
ATOM   4174 O OE1   . GLN C 3 397 ? 19.401  20.786  33.648 1.00 48.46  ? 599  GLN A OE1   1 
ATOM   4175 N NE2   . GLN C 3 397 ? 20.581  19.562  35.060 1.00 51.65  ? 599  GLN A NE2   1 
ATOM   4176 N N     . GLN C 3 398 ? 15.273  22.507  36.821 1.00 51.57  ? 600  GLN A N     1 
ATOM   4177 C CA    . GLN C 3 398 ? 15.011  23.843  37.372 1.00 58.01  ? 600  GLN A CA    1 
ATOM   4178 C C     . GLN C 3 398 ? 14.262  23.854  38.664 1.00 57.38  ? 600  GLN A C     1 
ATOM   4179 O O     . GLN C 3 398 ? 14.558  24.619  39.557 1.00 62.10  ? 600  GLN A O     1 
ATOM   4180 C CB    . GLN C 3 398 ? 14.287  24.738  36.383 1.00 61.92  ? 600  GLN A CB    1 
ATOM   4181 C CG    . GLN C 3 398 ? 13.752  23.955  35.193 1.00 72.09  ? 600  GLN A CG    1 
ATOM   4182 C CD    . GLN C 3 398 ? 13.551  24.783  33.904 1.00 76.89  ? 600  GLN A CD    1 
ATOM   4183 O OE1   . GLN C 3 398 ? 12.424  24.829  33.355 1.00 76.98  ? 600  GLN A OE1   1 
ATOM   4184 N NE2   . GLN C 3 398 ? 14.640  25.397  33.387 1.00 80.57  ? 600  GLN A NE2   1 
ATOM   4185 N N     . GLN C 3 399 ? 13.248  23.023  38.732 1.00 53.21  ? 601  GLN A N     1 
ATOM   4186 C CA    . GLN C 3 399 ? 12.443  22.910  39.930 1.00 50.94  ? 601  GLN A CA    1 
ATOM   4187 C C     . GLN C 3 399 ? 13.291  22.691  41.126 1.00 50.50  ? 601  GLN A C     1 
ATOM   4188 O O     . GLN C 3 399 ? 13.222  23.446  42.077 1.00 53.92  ? 601  GLN A O     1 
ATOM   4189 C CB    . GLN C 3 399 ? 11.454  21.776  39.812 1.00 51.10  ? 601  GLN A CB    1 
ATOM   4190 C CG    . GLN C 3 399 ? 10.249  22.180  39.028 1.00 61.17  ? 601  GLN A CG    1 
ATOM   4191 C CD    . GLN C 3 399 ? 9.442   23.227  39.753 1.00 64.92  ? 601  GLN A CD    1 
ATOM   4192 O OE1   . GLN C 3 399 ? 8.784   22.939  40.766 1.00 66.98  ? 601  GLN A OE1   1 
ATOM   4193 N NE2   . GLN C 3 399 ? 9.484   24.453  39.248 1.00 67.52  ? 601  GLN A NE2   1 
ATOM   4194 N N     . LEU C 3 400 ? 14.114  21.660  41.074 1.00 53.23  ? 602  LEU A N     1 
ATOM   4195 C CA    . LEU C 3 400 ? 15.000  21.382  42.192 1.00 55.47  ? 602  LEU A CA    1 
ATOM   4196 C C     . LEU C 3 400 ? 15.891  22.593  42.394 1.00 55.24  ? 602  LEU A C     1 
ATOM   4197 O O     . LEU C 3 400 ? 16.151  22.977  43.526 1.00 54.37  ? 602  LEU A O     1 
ATOM   4198 C CB    . LEU C 3 400 ? 15.861  20.130  41.942 1.00 55.38  ? 602  LEU A CB    1 
ATOM   4199 C CG    . LEU C 3 400 ? 15.242  18.717  41.945 1.00 54.87  ? 602  LEU A CG    1 
ATOM   4200 C CD1   . LEU C 3 400 ? 16.220  17.730  41.324 1.00 47.61  ? 602  LEU A CD1   1 
ATOM   4201 C CD2   . LEU C 3 400 ? 14.844  18.289  43.360 1.00 53.53  ? 602  LEU A CD2   1 
ATOM   4202 N N     . LYS C 3 401 ? 16.335  23.202  41.292 1.00 54.06  ? 603  LYS A N     1 
ATOM   4203 C CA    . LYS C 3 401 ? 17.191  24.379  41.384 1.00 55.60  ? 603  LYS A CA    1 
ATOM   4204 C C     . LYS C 3 401 ? 16.558  25.444  42.262 1.00 57.11  ? 603  LYS A C     1 
ATOM   4205 O O     . LYS C 3 401 ? 17.050  25.753  43.354 1.00 59.31  ? 603  LYS A O     1 
ATOM   4206 C CB    . LYS C 3 401 ? 17.497  24.973  40.003 1.00 55.96  ? 603  LYS A CB    1 
ATOM   4207 C CG    . LYS C 3 401 ? 18.562  24.201  39.216 1.00 61.01  ? 603  LYS A CG    1 
ATOM   4208 C CD    . LYS C 3 401 ? 19.148  25.053  38.080 1.00 65.20  ? 603  LYS A CD    1 
ATOM   4209 C CE    . LYS C 3 401 ? 19.935  24.212  37.037 1.00 69.42  ? 603  LYS A CE    1 
ATOM   4210 N NZ    . LYS C 3 401 ? 20.312  24.952  35.741 1.00 67.88  ? 603  LYS A NZ    1 
ATOM   4211 N N     . GLU C 3 402 ? 15.423  25.952  41.817 1.00 56.87  ? 604  GLU A N     1 
ATOM   4212 C CA    . GLU C 3 402 ? 14.759  26.986  42.567 1.00 57.40  ? 604  GLU A CA    1 
ATOM   4213 C C     . GLU C 3 402 ? 14.215  26.523  43.902 1.00 56.56  ? 604  GLU A C     1 
ATOM   4214 O O     . GLU C 3 402 ? 13.960  27.332  44.773 1.00 59.26  ? 604  GLU A O     1 
ATOM   4215 C CB    . GLU C 3 402 ? 13.641  27.578  41.740 1.00 56.93  ? 604  GLU A CB    1 
ATOM   4216 C CG    . GLU C 3 402 ? 12.551  26.622  41.421 1.00 53.56  ? 604  GLU A CG    1 
ATOM   4217 C CD    . GLU C 3 402 ? 11.499  27.269  40.551 1.00 57.07  ? 604  GLU A CD    1 
ATOM   4218 O OE1   . GLU C 3 402 ? 11.848  27.795  39.472 1.00 55.65  ? 604  GLU A OE1   1 
ATOM   4219 O OE2   . GLU C 3 402 ? 10.318  27.263  40.946 1.00 58.53  ? 604  GLU A OE2   1 
ATOM   4220 N N     . LEU C 3 403 ? 14.005  25.231  44.060 1.00 53.01  ? 605  LEU A N     1 
ATOM   4221 C CA    . LEU C 3 403 ? 13.457  24.760  45.310 1.00 52.74  ? 605  LEU A CA    1 
ATOM   4222 C C     . LEU C 3 403 ? 14.447  24.335  46.330 1.00 56.39  ? 605  LEU A C     1 
ATOM   4223 O O     . LEU C 3 403 ? 14.074  24.161  47.487 1.00 57.12  ? 605  LEU A O     1 
ATOM   4224 C CB    . LEU C 3 403 ? 12.583  23.555  45.083 1.00 51.33  ? 605  LEU A CB    1 
ATOM   4225 C CG    . LEU C 3 403 ? 11.237  23.905  44.539 1.00 50.96  ? 605  LEU A CG    1 
ATOM   4226 C CD1   . LEU C 3 403 ? 10.388  22.628  44.435 1.00 53.48  ? 605  LEU A CD1   1 
ATOM   4227 C CD2   . LEU C 3 403 ? 10.657  24.934  45.489 1.00 46.63  ? 605  LEU A CD2   1 
ATOM   4228 N N     . THR C 3 404 ? 15.666  24.015  45.903 1.00 59.70  ? 606  THR A N     1 
ATOM   4229 C CA    . THR C 3 404 ? 16.614  23.518  46.888 1.00 59.53  ? 606  THR A CA    1 
ATOM   4230 C C     . THR C 3 404 ? 17.214  24.515  47.870 1.00 62.71  ? 606  THR A C     1 
ATOM   4231 O O     . THR C 3 404 ? 18.006  25.412  47.533 1.00 60.44  ? 606  THR A O     1 
ATOM   4232 C CB    . THR C 3 404 ? 17.627  22.499  46.339 1.00 55.70  ? 606  THR A CB    1 
ATOM   4233 O OG1   . THR C 3 404 ? 16.955  21.596  45.456 1.00 50.54  ? 606  THR A OG1   1 
ATOM   4234 C CG2   . THR C 3 404 ? 18.165  21.656  47.489 1.00 49.74  ? 606  THR A CG2   1 
ATOM   4235 N N     . ALA C 3 405 ? 16.882  24.197  49.120 1.00 65.47  ? 607  ALA A N     1 
ATOM   4236 C CA    . ALA C 3 405 ? 17.187  24.922  50.342 1.00 66.13  ? 607  ALA A CA    1 
ATOM   4237 C C     . ALA C 3 405 ? 18.519  24.656  51.035 1.00 64.17  ? 607  ALA A C     1 
ATOM   4238 O O     . ALA C 3 405 ? 18.687  23.657  51.731 1.00 65.58  ? 607  ALA A O     1 
ATOM   4239 C CB    . ALA C 3 405 ? 16.047  24.656  51.335 1.00 67.92  ? 607  ALA A CB    1 
ATOM   4240 N N     . PRO C 3 406 ? 19.474  25.566  50.885 1.00 61.67  ? 608  PRO A N     1 
ATOM   4241 C CA    . PRO C 3 406 ? 20.800  25.448  51.504 1.00 61.68  ? 608  PRO A CA    1 
ATOM   4242 C C     . PRO C 3 406 ? 20.666  25.381  53.018 1.00 62.15  ? 608  PRO A C     1 
ATOM   4243 O O     . PRO C 3 406 ? 21.228  24.514  53.672 1.00 63.35  ? 608  PRO A O     1 
ATOM   4244 C CB    . PRO C 3 406 ? 21.482  26.737  51.090 1.00 58.03  ? 608  PRO A CB    1 
ATOM   4245 C CG    . PRO C 3 406 ? 20.886  26.972  49.757 1.00 62.86  ? 608  PRO A CG    1 
ATOM   4246 C CD    . PRO C 3 406 ? 19.423  26.680  49.938 1.00 59.80  ? 608  PRO A CD    1 
ATOM   4247 N N     . ASP C 3 407 ? 19.931  26.310  53.592 1.00 61.86  ? 609  ASP A N     1 
ATOM   4248 C CA    . ASP C 3 407 ? 19.782  26.258  55.024 1.00 64.42  ? 609  ASP A CA    1 
ATOM   4249 C C     . ASP C 3 407 ? 18.712  25.219  55.400 1.00 66.47  ? 609  ASP A C     1 
ATOM   4250 O O     . ASP C 3 407 ? 17.976  25.368  56.391 1.00 64.29  ? 609  ASP A O     1 
ATOM   4251 C CB    . ASP C 3 407 ? 19.474  27.654  55.570 1.00 65.60  ? 609  ASP A CB    1 
ATOM   4252 N N     . GLU C 3 408 ? 18.672  24.124  54.639 1.00 69.41  ? 610  GLU A N     1 
ATOM   4253 C CA    . GLU C 3 408 ? 17.694  23.065  54.913 1.00 70.74  ? 610  GLU A CA    1 
ATOM   4254 C C     . GLU C 3 408 ? 18.262  21.712  55.370 1.00 69.42  ? 610  GLU A C     1 
ATOM   4255 O O     . GLU C 3 408 ? 19.381  21.319  55.011 1.00 66.56  ? 610  GLU A O     1 
ATOM   4256 C CB    . GLU C 3 408 ? 16.760  22.848  53.717 1.00 70.57  ? 610  GLU A CB    1 
ATOM   4257 N N     . ASN C 3 409 ? 17.450  21.027  56.178 1.00 67.69  ? 611  ASN A N     1 
ATOM   4258 C CA    . ASN C 3 409 ? 17.766  19.714  56.732 1.00 65.96  ? 611  ASN A CA    1 
ATOM   4259 C C     . ASN C 3 409 ? 17.597  18.679  55.640 1.00 65.80  ? 611  ASN A C     1 
ATOM   4260 O O     . ASN C 3 409 ? 16.845  18.895  54.691 1.00 67.36  ? 611  ASN A O     1 
ATOM   4261 C CB    . ASN C 3 409 ? 16.768  19.388  57.847 1.00 61.91  ? 611  ASN A CB    1 
ATOM   4262 N N     . ILE C 3 410 ? 18.229  17.528  55.802 1.00 63.83  ? 612  ILE A N     1 
ATOM   4263 C CA    . ILE C 3 410 ? 18.067  16.484  54.813 1.00 64.41  ? 612  ILE A CA    1 
ATOM   4264 C C     . ILE C 3 410 ? 16.577  16.200  54.611 1.00 65.38  ? 612  ILE A C     1 
ATOM   4265 O O     . ILE C 3 410 ? 16.097  16.157  53.478 1.00 67.90  ? 612  ILE A O     1 
ATOM   4266 C CB    . ILE C 3 410 ? 18.763  15.190  55.224 1.00 66.03  ? 612  ILE A CB    1 
ATOM   4267 C CG1   . ILE C 3 410 ? 20.268  15.422  55.407 1.00 66.64  ? 612  ILE A CG1   1 
ATOM   4268 C CG2   . ILE C 3 410 ? 18.507  14.130  54.177 1.00 67.13  ? 612  ILE A CG2   1 
ATOM   4269 C CD1   . ILE C 3 410 ? 20.989  15.952  54.159 1.00 71.29  ? 612  ILE A CD1   1 
ATOM   4270 N N     . PRO C 3 411 ? 15.824  16.012  55.706 1.00 65.21  ? 613  PRO A N     1 
ATOM   4271 C CA    . PRO C 3 411 ? 14.380  15.735  55.643 1.00 65.26  ? 613  PRO A CA    1 
ATOM   4272 C C     . PRO C 3 411 ? 13.676  16.759  54.790 1.00 64.41  ? 613  PRO A C     1 
ATOM   4273 O O     . PRO C 3 411 ? 12.790  16.453  53.990 1.00 64.47  ? 613  PRO A O     1 
ATOM   4274 C CB    . PRO C 3 411 ? 13.955  15.891  57.086 1.00 66.53  ? 613  PRO A CB    1 
ATOM   4275 C CG    . PRO C 3 411 ? 15.172  15.364  57.820 1.00 67.52  ? 613  PRO A CG    1 
ATOM   4276 C CD    . PRO C 3 411 ? 16.287  16.045  57.103 1.00 63.25  ? 613  PRO A CD    1 
ATOM   4277 N N     . ALA C 3 412 ? 14.058  17.997  55.016 1.00 65.09  ? 614  ALA A N     1 
ATOM   4278 C CA    . ALA C 3 412 ? 13.506  19.092  54.257 1.00 66.15  ? 614  ALA A CA    1 
ATOM   4279 C C     . ALA C 3 412 ? 13.871  19.011  52.752 1.00 65.85  ? 614  ALA A C     1 
ATOM   4280 O O     . ALA C 3 412 ? 13.000  19.143  51.889 1.00 68.15  ? 614  ALA A O     1 
ATOM   4281 C CB    . ALA C 3 412 ? 13.991  20.404  54.862 1.00 68.20  ? 614  ALA A CB    1 
ATOM   4282 N N     . LYS C 3 413 ? 15.148  18.764  52.449 1.00 63.70  ? 615  LYS A N     1 
ATOM   4283 C CA    . LYS C 3 413 ? 15.636  18.689  51.067 1.00 60.09  ? 615  LYS A CA    1 
ATOM   4284 C C     . LYS C 3 413 ? 14.972  17.593  50.253 1.00 56.78  ? 615  LYS A C     1 
ATOM   4285 O O     . LYS C 3 413 ? 14.840  17.675  49.022 1.00 53.21  ? 615  LYS A O     1 
ATOM   4286 C CB    . LYS C 3 413 ? 17.139  18.471  51.073 1.00 59.90  ? 615  LYS A CB    1 
ATOM   4287 C CG    . LYS C 3 413 ? 17.897  19.560  51.805 1.00 64.63  ? 615  LYS A CG    1 
ATOM   4288 C CD    . LYS C 3 413 ? 19.398  19.299  51.794 1.00 67.88  ? 615  LYS A CD    1 
ATOM   4289 C CE    . LYS C 3 413 ? 20.191  20.490  52.307 1.00 69.77  ? 615  LYS A CE    1 
ATOM   4290 N NZ    . LYS C 3 413 ? 21.642  20.380  51.971 1.00 72.87  ? 615  LYS A NZ    1 
ATOM   4291 N N     . ILE C 3 414 ? 14.573  16.553  50.954 1.00 53.22  ? 616  ILE A N     1 
ATOM   4292 C CA    . ILE C 3 414 ? 13.940  15.447  50.311 1.00 55.51  ? 616  ILE A CA    1 
ATOM   4293 C C     . ILE C 3 414 ? 12.586  15.861  49.785 1.00 54.69  ? 616  ILE A C     1 
ATOM   4294 O O     . ILE C 3 414 ? 12.201  15.485  48.681 1.00 55.00  ? 616  ILE A O     1 
ATOM   4295 C CB    . ILE C 3 414 ? 13.877  14.293  51.276 1.00 58.10  ? 616  ILE A CB    1 
ATOM   4296 C CG1   . ILE C 3 414 ? 15.319  13.824  51.532 1.00 58.80  ? 616  ILE A CG1   1 
ATOM   4297 C CG2   . ILE C 3 414 ? 12.980  13.192  50.725 1.00 60.30  ? 616  ILE A CG2   1 
ATOM   4298 C CD1   . ILE C 3 414 ? 15.476  12.774  52.586 1.00 60.91  ? 616  ILE A CD1   1 
ATOM   4299 N N     . LEU C 3 415 ? 11.880  16.667  50.561 1.00 52.78  ? 617  LEU A N     1 
ATOM   4300 C CA    . LEU C 3 415 ? 10.582  17.138  50.131 1.00 55.29  ? 617  LEU A CA    1 
ATOM   4301 C C     . LEU C 3 415 ? 10.764  18.039  48.940 1.00 54.61  ? 617  LEU A C     1 
ATOM   4302 O O     . LEU C 3 415 ? 9.976   17.996  47.989 1.00 55.70  ? 617  LEU A O     1 
ATOM   4303 C CB    . LEU C 3 415 ? 9.871   17.931  51.222 1.00 64.46  ? 617  LEU A CB    1 
ATOM   4304 C CG    . LEU C 3 415 ? 8.760   18.864  50.664 1.00 71.37  ? 617  LEU A CG    1 
ATOM   4305 C CD1   . LEU C 3 415 ? 7.589   18.048  50.088 1.00 72.03  ? 617  LEU A CD1   1 
ATOM   4306 C CD2   . LEU C 3 415 ? 8.250   19.868  51.718 1.00 71.96  ? 617  LEU A CD2   1 
ATOM   4307 N N     . SER C 3 416 ? 11.738  18.929  49.024 1.00 52.15  ? 618  SER A N     1 
ATOM   4308 C CA    . SER C 3 416 ? 11.972  19.806  47.903 1.00 53.25  ? 618  SER A CA    1 
ATOM   4309 C C     . SER C 3 416 ? 12.066  18.898  46.699 1.00 52.87  ? 618  SER A C     1 
ATOM   4310 O O     . SER C 3 416 ? 11.393  19.119  45.696 1.00 49.76  ? 618  SER A O     1 
ATOM   4311 C CB    . SER C 3 416 ? 13.281  20.544  48.082 1.00 55.94  ? 618  SER A CB    1 
ATOM   4312 O OG    . SER C 3 416 ? 13.151  21.505  49.103 1.00 66.04  ? 618  SER A OG    1 
ATOM   4313 N N     . TYR C 3 417 ? 12.836  17.821  46.861 1.00 53.18  ? 619  TYR A N     1 
ATOM   4314 C CA    . TYR C 3 417 ? 13.028  16.858  45.798 1.00 51.80  ? 619  TYR A CA    1 
ATOM   4315 C C     . TYR C 3 417 ? 11.731  16.276  45.319 1.00 50.55  ? 619  TYR A C     1 
ATOM   4316 O O     . TYR C 3 417 ? 11.534  16.076  44.124 1.00 48.56  ? 619  TYR A O     1 
ATOM   4317 C CB    . TYR C 3 417 ? 13.892  15.693  46.241 1.00 50.16  ? 619  TYR A CB    1 
ATOM   4318 C CG    . TYR C 3 417 ? 14.047  14.657  45.146 1.00 48.59  ? 619  TYR A CG    1 
ATOM   4319 C CD1   . TYR C 3 417 ? 15.081  14.756  44.216 1.00 49.09  ? 619  TYR A CD1   1 
ATOM   4320 C CD2   . TYR C 3 417 ? 13.173  13.573  45.044 1.00 47.77  ? 619  TYR A CD2   1 
ATOM   4321 C CE1   . TYR C 3 417 ? 15.249  13.806  43.229 1.00 48.32  ? 619  TYR A CE1   1 
ATOM   4322 C CE2   . TYR C 3 417 ? 13.332  12.625  44.059 1.00 47.13  ? 619  TYR A CE2   1 
ATOM   4323 C CZ    . TYR C 3 417 ? 14.378  12.746  43.161 1.00 50.32  ? 619  TYR A CZ    1 
ATOM   4324 O OH    . TYR C 3 417 ? 14.625  11.779  42.233 1.00 49.14  ? 619  TYR A OH    1 
ATOM   4325 N N     . ASN C 3 418 ? 10.890  15.908  46.262 1.00 49.93  ? 620  ASN A N     1 
ATOM   4326 C CA    . ASN C 3 418 ? 9.638   15.311  45.898 1.00 52.81  ? 620  ASN A CA    1 
ATOM   4327 C C     . ASN C 3 418 ? 8.637   16.259  45.271 1.00 56.54  ? 620  ASN A C     1 
ATOM   4328 O O     . ASN C 3 418 ? 7.776   15.849  44.485 1.00 59.62  ? 620  ASN A O     1 
ATOM   4329 C CB    . ASN C 3 418 ? 9.068   14.575  47.078 1.00 52.26  ? 620  ASN A CB    1 
ATOM   4330 C CG    . ASN C 3 418 ? 9.835   13.331  47.366 1.00 57.11  ? 620  ASN A CG    1 
ATOM   4331 O OD1   . ASN C 3 418 ? 10.721  12.956  46.598 1.00 62.21  ? 620  ASN A OD1   1 
ATOM   4332 N ND2   . ASN C 3 418 ? 9.518   12.677  48.480 1.00 58.34  ? 620  ASN A ND2   1 
ATOM   4333 N N     . ARG C 3 419 ? 8.721   17.532  45.616 1.00 56.85  ? 621  ARG A N     1 
ATOM   4334 C CA    . ARG C 3 419 ? 7.819   18.488  45.005 1.00 58.83  ? 621  ARG A CA    1 
ATOM   4335 C C     . ARG C 3 419 ? 8.233   18.628  43.546 1.00 55.02  ? 621  ARG A C     1 
ATOM   4336 O O     . ARG C 3 419 ? 7.390   18.596  42.653 1.00 53.59  ? 621  ARG A O     1 
ATOM   4337 C CB    . ARG C 3 419 ? 7.928   19.835  45.698 1.00 67.23  ? 621  ARG A CB    1 
ATOM   4338 C CG    . ARG C 3 419 ? 7.162   19.944  47.010 1.00 78.14  ? 621  ARG A CG    1 
ATOM   4339 C CD    . ARG C 3 419 ? 7.541   21.271  47.680 1.00 90.62  ? 621  ARG A CD    1 
ATOM   4340 N NE    . ARG C 3 419 ? 6.656   21.708  48.766 1.00 96.79  ? 621  ARG A NE    1 
ATOM   4341 C CZ    . ARG C 3 419 ? 6.940   22.719  49.591 1.00 99.71  ? 621  ARG A CZ    1 
ATOM   4342 N NH1   . ARG C 3 419 ? 8.086   23.389  49.451 1.00 99.81  ? 621  ARG A NH1   1 
ATOM   4343 N NH2   . ARG C 3 419 ? 6.076   23.067  50.550 1.00 103.42 ? 621  ARG A NH2   1 
ATOM   4344 N N     . ALA C 3 420 ? 9.541   18.794  43.327 1.00 52.88  ? 622  ALA A N     1 
ATOM   4345 C CA    . ALA C 3 420 ? 10.124  18.923  41.995 1.00 48.85  ? 622  ALA A CA    1 
ATOM   4346 C C     . ALA C 3 420 ? 9.643   17.746  41.164 1.00 48.46  ? 622  ALA A C     1 
ATOM   4347 O O     . ALA C 3 420 ? 9.448   17.839  39.948 1.00 49.18  ? 622  ALA A O     1 
ATOM   4348 C CB    . ALA C 3 420 ? 11.638  18.908  42.092 1.00 41.48  ? 622  ALA A CB    1 
ATOM   4349 N N     . ASN C 3 421 ? 9.433   16.632  41.839 1.00 46.45  ? 623  ASN A N     1 
ATOM   4350 C CA    . ASN C 3 421 ? 8.984   15.453  41.158 1.00 48.12  ? 623  ASN A CA    1 
ATOM   4351 C C     . ASN C 3 421 ? 7.531   15.580  40.748 1.00 48.83  ? 623  ASN A C     1 
ATOM   4352 O O     . ASN C 3 421 ? 7.173   15.274  39.603 1.00 47.06  ? 623  ASN A O     1 
ATOM   4353 C CB    . ASN C 3 421 ? 9.194   14.227  42.030 1.00 49.61  ? 623  ASN A CB    1 
ATOM   4354 C CG    . ASN C 3 421 ? 9.399   12.968  41.206 1.00 52.88  ? 623  ASN A CG    1 
ATOM   4355 O OD1   . ASN C 3 421 ? 9.982   12.007  41.676 1.00 53.59  ? 623  ASN A OD1   1 
ATOM   4356 N ND2   . ASN C 3 421 ? 8.924   12.978  39.960 1.00 51.28  ? 623  ASN A ND2   1 
ATOM   4357 N N     . ARG C 3 422 ? 6.702   16.065  41.670 1.00 48.31  ? 624  ARG A N     1 
ATOM   4358 C CA    . ARG C 3 422 ? 5.275   16.228  41.391 1.00 49.91  ? 624  ARG A CA    1 
ATOM   4359 C C     . ARG C 3 422 ? 5.060   17.040  40.147 1.00 48.69  ? 624  ARG A C     1 
ATOM   4360 O O     . ARG C 3 422 ? 4.203   16.722  39.325 1.00 47.59  ? 624  ARG A O     1 
ATOM   4361 C CB    . ARG C 3 422 ? 4.557   16.887  42.553 1.00 51.59  ? 624  ARG A CB    1 
ATOM   4362 C CG    . ARG C 3 422 ? 4.579   16.030  43.761 1.00 63.99  ? 624  ARG A CG    1 
ATOM   4363 C CD    . ARG C 3 422 ? 4.245   16.812  44.991 1.00 73.89  ? 624  ARG A CD    1 
ATOM   4364 N NE    . ARG C 3 422 ? 4.915   16.240  46.158 1.00 81.42  ? 624  ARG A NE    1 
ATOM   4365 C CZ    . ARG C 3 422 ? 5.224   16.927  47.256 1.00 85.25  ? 624  ARG A CZ    1 
ATOM   4366 N NH1   . ARG C 3 422 ? 4.919   18.216  47.338 1.00 88.54  ? 624  ARG A NH1   1 
ATOM   4367 N NH2   . ARG C 3 422 ? 5.847   16.329  48.268 1.00 89.56  ? 624  ARG A NH2   1 
ATOM   4368 N N     . ALA C 3 423 ? 5.839   18.103  40.023 1.00 46.54  ? 625  ALA A N     1 
ATOM   4369 C CA    . ALA C 3 423 ? 5.747   18.964  38.868 1.00 47.74  ? 625  ALA A CA    1 
ATOM   4370 C C     . ALA C 3 423 ? 5.933   18.139  37.594 1.00 49.97  ? 625  ALA A C     1 
ATOM   4371 O O     . ALA C 3 423 ? 5.296   18.370  36.576 1.00 53.18  ? 625  ALA A O     1 
ATOM   4372 C CB    . ALA C 3 423 ? 6.806   20.040  38.956 1.00 43.80  ? 625  ALA A CB    1 
ATOM   4373 N N     . VAL C 3 424 ? 6.814   17.161  37.654 1.00 49.12  ? 626  VAL A N     1 
ATOM   4374 C CA    . VAL C 3 424 ? 7.068   16.349  36.487 1.00 46.44  ? 626  VAL A CA    1 
ATOM   4375 C C     . VAL C 3 424 ? 5.913   15.393  36.256 1.00 43.64  ? 626  VAL A C     1 
ATOM   4376 O O     . VAL C 3 424 ? 5.328   15.332  35.176 1.00 40.83  ? 626  VAL A O     1 
ATOM   4377 C CB    . VAL C 3 424 ? 8.381   15.587  36.665 1.00 45.20  ? 626  VAL A CB    1 
ATOM   4378 C CG1   . VAL C 3 424 ? 8.703   14.786  35.400 1.00 40.33  ? 626  VAL A CG1   1 
ATOM   4379 C CG2   . VAL C 3 424 ? 9.496   16.578  37.016 1.00 40.83  ? 626  VAL A CG2   1 
ATOM   4380 N N     . ALA C 3 425 ? 5.568   14.683  37.311 1.00 41.15  ? 627  ALA A N     1 
ATOM   4381 C CA    . ALA C 3 425 ? 4.500   13.706  37.271 1.00 46.60  ? 627  ALA A CA    1 
ATOM   4382 C C     . ALA C 3 425 ? 3.238   14.371  36.754 1.00 50.85  ? 627  ALA A C     1 
ATOM   4383 O O     . ALA C 3 425 ? 2.396   13.788  36.044 1.00 49.18  ? 627  ALA A O     1 
ATOM   4384 C CB    . ALA C 3 425 ? 4.275   13.180  38.667 1.00 47.52  ? 627  ALA A CB    1 
ATOM   4385 N N     . ILE C 3 426 ? 3.108   15.616  37.164 1.00 52.92  ? 628  ILE A N     1 
ATOM   4386 C CA    . ILE C 3 426 ? 1.988   16.403  36.780 1.00 53.31  ? 628  ILE A CA    1 
ATOM   4387 C C     . ILE C 3 426 ? 2.005   16.577  35.274 1.00 51.49  ? 628  ILE A C     1 
ATOM   4388 O O     . ILE C 3 426 ? 1.024   16.268  34.631 1.00 52.64  ? 628  ILE A O     1 
ATOM   4389 C CB    . ILE C 3 426 ? 2.034   17.755  37.514 1.00 57.14  ? 628  ILE A CB    1 
ATOM   4390 C CG1   . ILE C 3 426 ? 0.680   18.079  38.106 1.00 57.64  ? 628  ILE A CG1   1 
ATOM   4391 C CG2   . ILE C 3 426 ? 2.441   18.881  36.601 1.00 63.99  ? 628  ILE A CG2   1 
ATOM   4392 C CD1   . ILE C 3 426 ? 0.714   18.122  39.608 1.00 57.62  ? 628  ILE A CD1   1 
ATOM   4393 N N     . LEU C 3 427 ? 3.139   16.972  34.704 1.00 48.28  ? 629  LEU A N     1 
ATOM   4394 C CA    . LEU C 3 427 ? 3.156   17.199  33.272 1.00 49.82  ? 629  LEU A CA    1 
ATOM   4395 C C     . LEU C 3 427 ? 3.039   15.936  32.497 1.00 48.26  ? 629  LEU A C     1 
ATOM   4396 O O     . LEU C 3 427 ? 2.572   15.951  31.382 1.00 48.07  ? 629  LEU A O     1 
ATOM   4397 C CB    . LEU C 3 427 ? 4.387   17.986  32.811 1.00 52.47  ? 629  LEU A CB    1 
ATOM   4398 C CG    . LEU C 3 427 ? 5.734   17.289  32.575 1.00 54.79  ? 629  LEU A CG    1 
ATOM   4399 C CD1   . LEU C 3 427 ? 5.750   16.527  31.271 1.00 58.49  ? 629  LEU A CD1   1 
ATOM   4400 C CD2   . LEU C 3 427 ? 6.791   18.340  32.486 1.00 58.38  ? 629  LEU A CD2   1 
ATOM   4401 N N     . CYS C 3 428 ? 3.584   14.857  33.028 1.00 49.52  ? 630  CYS A N     1 
ATOM   4402 C CA    . CYS C 3 428 ? 3.489   13.602  32.311 1.00 53.08  ? 630  CYS A CA    1 
ATOM   4403 C C     . CYS C 3 428 ? 2.115   12.978  32.458 1.00 55.27  ? 630  CYS A C     1 
ATOM   4404 O O     . CYS C 3 428 ? 1.833   11.982  31.813 1.00 55.30  ? 630  CYS A O     1 
ATOM   4405 C CB    . CYS C 3 428 ? 4.528   12.637  32.819 1.00 52.77  ? 630  CYS A CB    1 
ATOM   4406 S SG    . CYS C 3 428 ? 6.152   13.201  32.474 1.00 54.05  ? 630  CYS A SG    1 
ATOM   4407 N N     . ASN C 3 429 ? 1.332   13.501  33.405 1.00 55.60  ? 631  ASN A N     1 
ATOM   4408 C CA    . ASN C 3 429 ? -0.031  13.037  33.711 1.00 52.83  ? 631  ASN A CA    1 
ATOM   4409 C C     . ASN C 3 429 ? -0.054  11.638  34.299 1.00 50.02  ? 631  ASN A C     1 
ATOM   4410 O O     . ASN C 3 429 ? -0.989  10.869  34.073 1.00 47.78  ? 631  ASN A O     1 
ATOM   4411 C CB    . ASN C 3 429 ? -0.971  13.117  32.485 1.00 50.55  ? 631  ASN A CB    1 
ATOM   4412 C CG    . ASN C 3 429 ? -2.448  12.837  32.843 1.00 52.26  ? 631  ASN A CG    1 
ATOM   4413 O OD1   . ASN C 3 429 ? -3.167  12.142  32.104 1.00 47.71  ? 631  ASN A OD1   1 
ATOM   4414 N ND2   . ASN C 3 429 ? -2.888  13.357  33.996 1.00 44.49  ? 631  ASN A ND2   1 
ATOM   4415 N N     . HIS C 3 430 ? 0.960   11.302  35.087 1.00 49.10  ? 632  HIS A N     1 
ATOM   4416 C CA    . HIS C 3 430 ? 0.951   9.971   35.664 1.00 49.78  ? 632  HIS A CA    1 
ATOM   4417 C C     . HIS C 3 430 ? -0.021  9.951   36.832 1.00 51.08  ? 632  HIS A C     1 
ATOM   4418 O O     . HIS C 3 430 ? -0.075  10.882  37.663 1.00 49.43  ? 632  HIS A O     1 
ATOM   4419 C CB    . HIS C 3 430 ? 2.357   9.471   36.021 1.00 46.12  ? 632  HIS A CB    1 
ATOM   4420 C CG    . HIS C 3 430 ? 3.270   9.362   34.840 1.00 41.60  ? 632  HIS A CG    1 
ATOM   4421 N ND1   . HIS C 3 430 ? 4.502   9.969   34.799 1.00 41.23  ? 632  HIS A ND1   1 
ATOM   4422 C CD2   . HIS C 3 430 ? 3.118   8.737   33.652 1.00 37.68  ? 632  HIS A CD2   1 
ATOM   4423 C CE1   . HIS C 3 430 ? 5.072   9.720   33.639 1.00 43.82  ? 632  HIS A CE1   1 
ATOM   4424 N NE2   . HIS C 3 430 ? 4.252   8.975   32.924 1.00 40.39  ? 632  HIS A NE2   1 
ATOM   4425 N N     . GLN C 3 431 ? -0.910  8.972   36.770 1.00 48.24  ? 633  GLN A N     1 
ATOM   4426 C CA    . GLN C 3 431 ? -1.912  8.807   37.779 1.00 48.50  ? 633  GLN A CA    1 
ATOM   4427 C C     . GLN C 3 431 ? -1.937  7.333   38.135 1.00 51.20  ? 633  GLN A C     1 
ATOM   4428 O O     . GLN C 3 431 ? -2.091  7.102   39.344 1.00 57.13  ? 633  GLN A O     1 
ATOM   4429 C CB    . GLN C 3 431 ? -3.266  9.242   37.236 1.00 48.78  ? 633  GLN A CB    1 
ATOM   4430 C CG    . GLN C 3 431 ? -3.352  10.675  36.737 1.00 46.33  ? 633  GLN A CG    1 
ATOM   4431 C CD    . GLN C 3 431 ? -4.723  10.971  36.174 1.00 49.84  ? 633  GLN A CD    1 
ATOM   4432 O OE1   . GLN C 3 431 ? -5.608  10.112  36.186 1.00 52.75  ? 633  GLN A OE1   1 
ATOM   4433 N NE2   . GLN C 3 431 ? -4.915  12.174  35.696 1.00 47.90  ? 633  GLN A NE2   1 
ATOM   4434 N N     . ILE C 3 512 ? -2.293  11.286  41.581 1.00 47.69  ? 714  ILE A N     1 
ATOM   4435 C CA    . ILE C 3 512 ? -0.872  11.547  41.136 1.00 54.28  ? 714  ILE A CA    1 
ATOM   4436 C C     . ILE C 3 512 ? 0.151   10.517  41.642 1.00 53.49  ? 714  ILE A C     1 
ATOM   4437 O O     . ILE C 3 512 ? 0.243   10.263  42.838 1.00 50.81  ? 714  ILE A O     1 
ATOM   4438 C CB    . ILE C 3 512 ? -0.343  12.946  41.575 1.00 57.53  ? 714  ILE A CB    1 
ATOM   4439 C CG1   . ILE C 3 512 ? -1.388  14.036  41.320 1.00 56.69  ? 714  ILE A CG1   1 
ATOM   4440 C CG2   . ILE C 3 512 ? 0.972   13.263  40.826 1.00 54.41  ? 714  ILE A CG2   1 
ATOM   4441 C CD1   . ILE C 3 512 ? -1.712  14.232  39.868 1.00 61.91  ? 714  ILE A CD1   1 
ATOM   4442 N N     . ALA C 3 513 ? 1.034   10.098  40.741 1.00 53.48  ? 715  ALA A N     1 
ATOM   4443 C CA    . ALA C 3 513 ? 2.039   9.089   41.049 1.00 53.14  ? 715  ALA A CA    1 
ATOM   4444 C C     . ALA C 3 513 ? 3.400   9.519   40.524 1.00 51.44  ? 715  ALA A C     1 
ATOM   4445 O O     . ALA C 3 513 ? 3.535   9.832   39.348 1.00 52.71  ? 715  ALA A O     1 
ATOM   4446 C CB    . ALA C 3 513 ? 1.621   7.760   40.413 1.00 53.70  ? 715  ALA A CB    1 
ATOM   4447 N N     . LEU C 3 514 ? 4.403   9.565   41.391 1.00 51.28  ? 716  LEU A N     1 
ATOM   4448 C CA    . LEU C 3 514 ? 5.727   9.985   40.945 1.00 52.63  ? 716  LEU A CA    1 
ATOM   4449 C C     . LEU C 3 514 ? 6.552   8.814   40.389 1.00 51.28  ? 716  LEU A C     1 
ATOM   4450 O O     . LEU C 3 514 ? 7.603   9.014   39.781 1.00 55.42  ? 716  LEU A O     1 
ATOM   4451 C CB    . LEU C 3 514 ? 6.475   10.709  42.086 1.00 54.70  ? 716  LEU A CB    1 
ATOM   4452 C CG    . LEU C 3 514 ? 5.749   11.792  42.918 1.00 56.16  ? 716  LEU A CG    1 
ATOM   4453 C CD1   . LEU C 3 514 ? 6.724   12.539  43.821 1.00 57.41  ? 716  LEU A CD1   1 
ATOM   4454 C CD2   . LEU C 3 514 ? 5.077   12.793  41.993 1.00 59.43  ? 716  LEU A CD2   1 
ATOM   4455 N N     . GLY C 3 515 ? 6.072   7.592   40.599 1.00 48.02  ? 717  GLY A N     1 
ATOM   4456 C CA    . GLY C 3 515 ? 6.773   6.414   40.129 1.00 44.21  ? 717  GLY A CA    1 
ATOM   4457 C C     . GLY C 3 515 ? 7.280   6.370   38.694 1.00 47.08  ? 717  GLY A C     1 
ATOM   4458 O O     . GLY C 3 515 ? 8.485   6.265   38.472 1.00 51.49  ? 717  GLY A O     1 
ATOM   4459 N N     . THR C 3 516 ? 6.379   6.432   37.726 1.00 44.42  ? 718  THR A N     1 
ATOM   4460 C CA    . THR C 3 516 ? 6.731   6.340   36.313 1.00 42.11  ? 718  THR A CA    1 
ATOM   4461 C C     . THR C 3 516 ? 7.789   7.287   35.828 1.00 40.05  ? 718  THR A C     1 
ATOM   4462 O O     . THR C 3 516 ? 8.648   6.917   35.030 1.00 39.23  ? 718  THR A O     1 
ATOM   4463 C CB    . THR C 3 516 ? 5.515   6.580   35.432 1.00 43.99  ? 718  THR A CB    1 
ATOM   4464 O OG1   . THR C 3 516 ? 4.424   5.833   35.948 1.00 45.53  ? 718  THR A OG1   1 
ATOM   4465 C CG2   . THR C 3 516 ? 5.772   6.133   33.992 1.00 41.05  ? 718  THR A CG2   1 
ATOM   4466 N N     . SER C 3 517 ? 7.627   8.547   36.176 1.00 37.19  ? 719  SER A N     1 
ATOM   4467 C CA    . SER C 3 517 ? 8.573   9.532   35.750 1.00 39.90  ? 719  SER A CA    1 
ATOM   4468 C C     . SER C 3 517 ? 9.900   9.316   36.468 1.00 42.59  ? 719  SER A C     1 
ATOM   4469 O O     . SER C 3 517 ? 10.951  9.342   35.833 1.00 40.37  ? 719  SER A O     1 
ATOM   4470 C CB    . SER C 3 517 ? 8.026   10.923  36.010 1.00 43.63  ? 719  SER A CB    1 
ATOM   4471 O OG    . SER C 3 517 ? 7.818   11.131  37.390 1.00 41.50  ? 719  SER A OG    1 
ATOM   4472 N N     . LYS C 3 518 ? 9.847   9.052   37.772 1.00 39.72  ? 720  LYS A N     1 
ATOM   4473 C CA    . LYS C 3 518 ? 11.078  8.839   38.533 1.00 44.27  ? 720  LYS A CA    1 
ATOM   4474 C C     . LYS C 3 518 ? 11.800  7.700   37.887 1.00 44.35  ? 720  LYS A C     1 
ATOM   4475 O O     . LYS C 3 518 ? 12.989  7.761   37.650 1.00 42.88  ? 720  LYS A O     1 
ATOM   4476 C CB    . LYS C 3 518 ? 10.801  8.462   39.998 1.00 46.66  ? 720  LYS A CB    1 
ATOM   4477 C CG    . LYS C 3 518 ? 12.072  8.206   40.851 1.00 49.11  ? 720  LYS A CG    1 
ATOM   4478 C CD    . LYS C 3 518 ? 11.738  7.934   42.333 1.00 49.17  ? 720  LYS A CD    1 
ATOM   4479 C CE    . LYS C 3 518 ? 12.960  7.983   43.267 1.00 50.78  ? 720  LYS A CE    1 
ATOM   4480 N NZ    . LYS C 3 518 ? 12.552  8.041   44.714 1.00 49.15  ? 720  LYS A NZ    1 
ATOM   4481 N N     . LEU C 3 519 ? 11.049  6.640   37.640 1.00 43.97  ? 721  LEU A N     1 
ATOM   4482 C CA    . LEU C 3 519 ? 11.582  5.452   37.034 1.00 41.76  ? 721  LEU A CA    1 
ATOM   4483 C C     . LEU C 3 519 ? 11.886  5.527   35.533 1.00 42.38  ? 721  LEU A C     1 
ATOM   4484 O O     . LEU C 3 519 ? 12.838  4.906   35.098 1.00 41.87  ? 721  LEU A O     1 
ATOM   4485 C CB    . LEU C 3 519 ? 10.641  4.284   37.311 1.00 40.88  ? 721  LEU A CB    1 
ATOM   4486 C CG    . LEU C 3 519 ? 11.205  2.918   36.913 1.00 43.35  ? 721  LEU A CG    1 
ATOM   4487 C CD1   . LEU C 3 519 ? 12.426  2.624   37.753 1.00 43.55  ? 721  LEU A CD1   1 
ATOM   4488 C CD2   . LEU C 3 519 ? 10.183  1.828   37.047 1.00 38.16  ? 721  LEU A CD2   1 
ATOM   4489 N N     . ASN C 3 520 ? 11.119  6.274   34.744 1.00 39.90  ? 722  ASN A N     1 
ATOM   4490 C CA    . ASN C 3 520 ? 11.388  6.267   33.311 1.00 40.75  ? 722  ASN A CA    1 
ATOM   4491 C C     . ASN C 3 520 ? 11.617  7.560   32.581 1.00 42.14  ? 722  ASN A C     1 
ATOM   4492 O O     . ASN C 3 520 ? 11.892  7.543   31.385 1.00 40.28  ? 722  ASN A O     1 
ATOM   4493 C CB    . ASN C 3 520 ? 10.265  5.569   32.574 1.00 44.25  ? 722  ASN A CB    1 
ATOM   4494 C CG    . ASN C 3 520 ? 9.857   4.286   33.227 1.00 46.30  ? 722  ASN A CG    1 
ATOM   4495 O OD1   . ASN C 3 520 ? 9.026   4.285   34.139 1.00 44.63  ? 722  ASN A OD1   1 
ATOM   4496 N ND2   . ASN C 3 520 ? 10.405  3.177   32.750 1.00 45.45  ? 722  ASN A ND2   1 
ATOM   4497 N N     . PHE C 3 521 ? 11.407  8.687   33.241 1.00 41.68  ? 723  PHE A N     1 
ATOM   4498 C CA    . PHE C 3 521 ? 11.579  9.959   32.546 1.00 41.03  ? 723  PHE A CA    1 
ATOM   4499 C C     . PHE C 3 521 ? 12.736  10.850  32.965 1.00 40.59  ? 723  PHE A C     1 
ATOM   4500 O O     . PHE C 3 521 ? 13.208  11.699  32.191 1.00 38.59  ? 723  PHE A O     1 
ATOM   4501 C CB    . PHE C 3 521 ? 10.291  10.748  32.664 1.00 40.03  ? 723  PHE A CB    1 
ATOM   4502 C CG    . PHE C 3 521 ? 9.203   10.200  31.849 1.00 35.52  ? 723  PHE A CG    1 
ATOM   4503 C CD1   . PHE C 3 521 ? 8.436   9.150   32.316 1.00 35.39  ? 723  PHE A CD1   1 
ATOM   4504 C CD2   . PHE C 3 521 ? 8.963   10.711  30.593 1.00 34.82  ? 723  PHE A CD2   1 
ATOM   4505 C CE1   . PHE C 3 521 ? 7.444   8.617   31.535 1.00 36.47  ? 723  PHE A CE1   1 
ATOM   4506 C CE2   . PHE C 3 521 ? 7.971   10.187  29.799 1.00 38.04  ? 723  PHE A CE2   1 
ATOM   4507 C CZ    . PHE C 3 521 ? 7.206   9.136   30.269 1.00 38.42  ? 723  PHE A CZ    1 
ATOM   4508 N N     . LEU C 3 522 ? 13.152  10.685  34.210 1.00 39.39  ? 724  LEU A N     1 
ATOM   4509 C CA    . LEU C 3 522 ? 14.188  11.503  34.763 1.00 35.05  ? 724  LEU A CA    1 
ATOM   4510 C C     . LEU C 3 522 ? 15.567  10.945  34.706 1.00 37.25  ? 724  LEU A C     1 
ATOM   4511 O O     . LEU C 3 522 ? 15.851  9.866   35.198 1.00 37.72  ? 724  LEU A O     1 
ATOM   4512 C CB    . LEU C 3 522 ? 13.813  11.898  36.172 1.00 34.68  ? 724  LEU A CB    1 
ATOM   4513 C CG    . LEU C 3 522 ? 12.372  12.446  36.223 1.00 36.83  ? 724  LEU A CG    1 
ATOM   4514 C CD1   . LEU C 3 522 ? 11.923  12.676  37.671 1.00 28.40  ? 724  LEU A CD1   1 
ATOM   4515 C CD2   . LEU C 3 522 ? 12.237  13.721  35.381 1.00 35.29  ? 724  LEU A CD2   1 
ATOM   4516 N N     . ASP C 3 523 ? 16.399  11.683  33.984 1.00 37.54  ? 725  ASP A N     1 
ATOM   4517 C CA    . ASP C 3 523 ? 17.786  11.374  33.812 1.00 35.77  ? 725  ASP A CA    1 
ATOM   4518 C C     . ASP C 3 523 ? 18.263  11.301  35.237 1.00 34.22  ? 725  ASP A C     1 
ATOM   4519 O O     . ASP C 3 523 ? 18.358  12.330  35.884 1.00 34.16  ? 725  ASP A O     1 
ATOM   4520 C CB    . ASP C 3 523 ? 18.437  12.540  33.096 1.00 40.68  ? 725  ASP A CB    1 
ATOM   4521 C CG    . ASP C 3 523 ? 19.891  12.323  32.853 1.00 46.18  ? 725  ASP A CG    1 
ATOM   4522 O OD1   . ASP C 3 523 ? 20.564  11.782  33.755 1.00 44.98  ? 725  ASP A OD1   1 
ATOM   4523 O OD2   . ASP C 3 523 ? 20.358  12.689  31.755 1.00 43.59  ? 725  ASP A OD2   1 
ATOM   4524 N N     . PRO C 3 524 ? 18.651  10.100  35.705 1.00 31.28  ? 726  PRO A N     1 
ATOM   4525 C CA    . PRO C 3 524 ? 19.126  9.849   37.068 1.00 32.02  ? 726  PRO A CA    1 
ATOM   4526 C C     . PRO C 3 524 ? 20.376  10.611  37.482 1.00 35.66  ? 726  PRO A C     1 
ATOM   4527 O O     . PRO C 3 524 ? 20.679  10.756  38.667 1.00 33.74  ? 726  PRO A O     1 
ATOM   4528 C CB    . PRO C 3 524 ? 19.362  8.346   37.059 1.00 26.61  ? 726  PRO A CB    1 
ATOM   4529 C CG    . PRO C 3 524 ? 19.648  8.065   35.656 1.00 18.36  ? 726  PRO A CG    1 
ATOM   4530 C CD    . PRO C 3 524 ? 18.663  8.851   34.931 1.00 25.31  ? 726  PRO A CD    1 
ATOM   4531 N N     . ARG C 3 525 ? 21.157  11.010  36.489 1.00 40.79  ? 727  ARG A N     1 
ATOM   4532 C CA    . ARG C 3 525 ? 22.389  11.735  36.746 1.00 44.23  ? 727  ARG A CA    1 
ATOM   4533 C C     . ARG C 3 525 ? 22.045  13.057  37.431 1.00 48.79  ? 727  ARG A C     1 
ATOM   4534 O O     . ARG C 3 525 ? 22.833  13.617  38.228 1.00 48.89  ? 727  ARG A O     1 
ATOM   4535 C CB    . ARG C 3 525 ? 23.130  11.966  35.423 1.00 43.52  ? 727  ARG A CB    1 
ATOM   4536 C CG    . ARG C 3 525 ? 23.578  10.666  34.717 1.00 44.37  ? 727  ARG A CG    1 
ATOM   4537 C CD    . ARG C 3 525 ? 24.306  10.902  33.376 1.00 40.95  ? 727  ARG A CD    1 
ATOM   4538 N NE    . ARG C 3 525 ? 23.407  11.348  32.317 1.00 43.43  ? 727  ARG A NE    1 
ATOM   4539 C CZ    . ARG C 3 525 ? 23.712  11.383  31.025 1.00 41.17  ? 727  ARG A CZ    1 
ATOM   4540 N NH1   . ARG C 3 525 ? 24.906  11.008  30.608 1.00 40.64  ? 727  ARG A NH1   1 
ATOM   4541 N NH2   . ARG C 3 525 ? 22.794  11.737  30.143 1.00 46.66  ? 727  ARG A NH2   1 
ATOM   4542 N N     . ILE C 3 526 ? 20.856  13.546  37.102 1.00 47.90  ? 728  ILE A N     1 
ATOM   4543 C CA    . ILE C 3 526 ? 20.373  14.786  37.659 1.00 47.58  ? 728  ILE A CA    1 
ATOM   4544 C C     . ILE C 3 526 ? 20.169  14.586  39.134 1.00 45.37  ? 728  ILE A C     1 
ATOM   4545 O O     . ILE C 3 526 ? 20.500  15.425  39.939 1.00 51.30  ? 728  ILE A O     1 
ATOM   4546 C CB    . ILE C 3 526 ? 19.026  15.201  37.036 1.00 48.35  ? 728  ILE A CB    1 
ATOM   4547 C CG1   . ILE C 3 526 ? 19.158  15.372  35.521 1.00 45.73  ? 728  ILE A CG1   1 
ATOM   4548 C CG2   . ILE C 3 526 ? 18.530  16.488  37.676 1.00 48.30  ? 728  ILE A CG2   1 
ATOM   4549 C CD1   . ILE C 3 526 ? 17.940  15.950  34.888 1.00 45.69  ? 728  ILE A CD1   1 
ATOM   4550 N N     . THR C 3 527 ? 19.652  13.444  39.501 1.00 42.13  ? 729  THR A N     1 
ATOM   4551 C CA    . THR C 3 527 ? 19.405  13.217  40.896 1.00 43.39  ? 729  THR A CA    1 
ATOM   4552 C C     . THR C 3 527 ? 20.697  12.924  41.641 1.00 42.87  ? 729  THR A C     1 
ATOM   4553 O O     . THR C 3 527 ? 20.879  13.307  42.804 1.00 41.18  ? 729  THR A O     1 
ATOM   4554 C CB    . THR C 3 527 ? 18.356  12.143  41.019 1.00 42.63  ? 729  THR A CB    1 
ATOM   4555 O OG1   . THR C 3 527 ? 17.215  12.571  40.277 1.00 44.86  ? 729  THR A OG1   1 
ATOM   4556 C CG2   . THR C 3 527 ? 17.947  11.955  42.424 1.00 46.09  ? 729  THR A CG2   1 
ATOM   4557 N N     . VAL C 3 528 ? 21.618  12.280  40.942 1.00 45.71  ? 730  VAL A N     1 
ATOM   4558 C CA    . VAL C 3 528 ? 22.910  11.959  41.517 1.00 46.61  ? 730  VAL A CA    1 
ATOM   4559 C C     . VAL C 3 528 ? 23.679  13.256  41.770 1.00 43.84  ? 730  VAL A C     1 
ATOM   4560 O O     . VAL C 3 528 ? 24.265  13.404  42.828 1.00 47.11  ? 730  VAL A O     1 
ATOM   4561 C CB    . VAL C 3 528 ? 23.710  10.998  40.611 1.00 51.01  ? 730  VAL A CB    1 
ATOM   4562 C CG1   . VAL C 3 528 ? 25.135  10.921  41.077 1.00 49.34  ? 730  VAL A CG1   1 
ATOM   4563 C CG2   . VAL C 3 528 ? 23.089  9.597   40.634 1.00 51.91  ? 730  VAL A CG2   1 
ATOM   4564 N N     . ALA C 3 529 ? 23.657  14.196  40.825 1.00 41.25  ? 731  ALA A N     1 
ATOM   4565 C CA    . ALA C 3 529 ? 24.337  15.482  41.012 1.00 40.70  ? 731  ALA A CA    1 
ATOM   4566 C C     . ALA C 3 529 ? 23.800  16.156  42.262 1.00 42.11  ? 731  ALA A C     1 
ATOM   4567 O O     . ALA C 3 529 ? 24.541  16.466  43.183 1.00 45.76  ? 731  ALA A O     1 
ATOM   4568 C CB    . ALA C 3 529 ? 24.113  16.368  39.827 1.00 35.77  ? 731  ALA A CB    1 
ATOM   4569 N N     . TRP C 3 530 ? 22.486  16.294  42.305 1.00 44.41  ? 732  TRP A N     1 
ATOM   4570 C CA    . TRP C 3 530 ? 21.756  16.911  43.402 1.00 45.18  ? 732  TRP A CA    1 
ATOM   4571 C C     . TRP C 3 530 ? 22.134  16.326  44.754 1.00 43.52  ? 732  TRP A C     1 
ATOM   4572 O O     . TRP C 3 530 ? 22.482  17.058  45.684 1.00 43.65  ? 732  TRP A O     1 
ATOM   4573 C CB    . TRP C 3 530 ? 20.245  16.755  43.143 1.00 44.04  ? 732  TRP A CB    1 
ATOM   4574 C CG    . TRP C 3 530 ? 19.302  17.481  44.103 1.00 47.48  ? 732  TRP A CG    1 
ATOM   4575 C CD1   . TRP C 3 530 ? 18.873  18.783  44.018 1.00 45.77  ? 732  TRP A CD1   1 
ATOM   4576 C CD2   . TRP C 3 530 ? 18.648  16.927  45.261 1.00 49.17  ? 732  TRP A CD2   1 
ATOM   4577 N NE1   . TRP C 3 530 ? 18.000  19.068  45.041 1.00 42.14  ? 732  TRP A NE1   1 
ATOM   4578 C CE2   . TRP C 3 530 ? 17.843  17.955  45.821 1.00 46.50  ? 732  TRP A CE2   1 
ATOM   4579 C CE3   . TRP C 3 530 ? 18.672  15.666  45.885 1.00 48.47  ? 732  TRP A CE3   1 
ATOM   4580 C CZ2   . TRP C 3 530 ? 17.063  17.761  46.984 1.00 49.91  ? 732  TRP A CZ2   1 
ATOM   4581 C CZ3   . TRP C 3 530 ? 17.895  15.474  47.052 1.00 52.00  ? 732  TRP A CZ3   1 
ATOM   4582 C CH2   . TRP C 3 530 ? 17.101  16.523  47.586 1.00 51.28  ? 732  TRP A CH2   1 
ATOM   4583 N N     . CYS C 3 531 ? 22.011  15.014  44.880 1.00 44.16  ? 733  CYS A N     1 
ATOM   4584 C CA    . CYS C 3 531 ? 22.341  14.355  46.134 1.00 47.45  ? 733  CYS A CA    1 
ATOM   4585 C C     . CYS C 3 531 ? 23.730  14.714  46.569 1.00 47.81  ? 733  CYS A C     1 
ATOM   4586 O O     . CYS C 3 531 ? 23.995  14.969  47.733 1.00 43.89  ? 733  CYS A O     1 
ATOM   4587 C CB    . CYS C 3 531 ? 22.240  12.859  45.965 1.00 46.81  ? 733  CYS A CB    1 
ATOM   4588 S SG    . CYS C 3 531 ? 20.562  12.313  46.249 1.00 51.92  ? 733  CYS A SG    1 
ATOM   4589 N N     . LYS C 3 532 ? 24.612  14.748  45.590 1.00 48.10  ? 734  LYS A N     1 
ATOM   4590 C CA    . LYS C 3 532 ? 25.981  15.083  45.850 1.00 54.51  ? 734  LYS A CA    1 
ATOM   4591 C C     . LYS C 3 532 ? 26.080  16.530  46.267 1.00 56.93  ? 734  LYS A C     1 
ATOM   4592 O O     . LYS C 3 532 ? 26.679  16.836  47.305 1.00 57.39  ? 734  LYS A O     1 
ATOM   4593 C CB    . LYS C 3 532 ? 26.826  14.796  44.617 1.00 56.05  ? 734  LYS A CB    1 
ATOM   4594 C CG    . LYS C 3 532 ? 26.966  13.301  44.362 1.00 62.78  ? 734  LYS A CG    1 
ATOM   4595 C CD    . LYS C 3 532 ? 27.807  12.962  43.121 1.00 70.55  ? 734  LYS A CD    1 
ATOM   4596 C CE    . LYS C 3 532 ? 27.933  11.426  42.940 1.00 75.60  ? 734  LYS A CE    1 
ATOM   4597 N NZ    . LYS C 3 532 ? 28.755  10.859  41.787 1.00 72.33  ? 734  LYS A NZ    1 
ATOM   4598 N N     . LYS C 3 533 ? 25.497  17.409  45.451 1.00 58.88  ? 735  LYS A N     1 
ATOM   4599 C CA    . LYS C 3 533 ? 25.499  18.838  45.726 1.00 60.53  ? 735  LYS A CA    1 
ATOM   4600 C C     . LYS C 3 533 ? 25.001  19.104  47.121 1.00 59.51  ? 735  LYS A C     1 
ATOM   4601 O O     . LYS C 3 533 ? 25.663  19.770  47.909 1.00 62.09  ? 735  LYS A O     1 
ATOM   4602 C CB    . LYS C 3 533 ? 24.613  19.598  44.742 1.00 63.25  ? 735  LYS A CB    1 
ATOM   4603 C CG    . LYS C 3 533 ? 24.620  21.097  44.981 1.00 66.75  ? 735  LYS A CG    1 
ATOM   4604 C CD    . LYS C 3 533 ? 23.923  21.836  43.856 1.00 75.27  ? 735  LYS A CD    1 
ATOM   4605 C CE    . LYS C 3 533 ? 24.021  23.355  44.020 1.00 79.25  ? 735  LYS A CE    1 
ATOM   4606 N NZ    . LYS C 3 533 ? 23.234  24.106  42.988 1.00 83.50  ? 735  LYS A NZ    1 
ATOM   4607 N N     . TRP C 3 534 ? 23.833  18.582  47.430 1.00 57.02  ? 736  TRP A N     1 
ATOM   4608 C CA    . TRP C 3 534 ? 23.303  18.816  48.739 1.00 57.90  ? 736  TRP A CA    1 
ATOM   4609 C C     . TRP C 3 534 ? 23.722  17.836  49.804 1.00 55.91  ? 736  TRP A C     1 
ATOM   4610 O O     . TRP C 3 534 ? 23.119  17.797  50.861 1.00 57.13  ? 736  TRP A O     1 
ATOM   4611 C CB    . TRP C 3 534 ? 21.802  18.970  48.650 1.00 62.56  ? 736  TRP A CB    1 
ATOM   4612 C CG    . TRP C 3 534 ? 21.534  20.079  47.763 1.00 67.05  ? 736  TRP A CG    1 
ATOM   4613 C CD1   . TRP C 3 534 ? 21.391  20.016  46.413 1.00 66.99  ? 736  TRP A CD1   1 
ATOM   4614 C CD2   . TRP C 3 534 ? 21.590  21.472  48.105 1.00 71.93  ? 736  TRP A CD2   1 
ATOM   4615 N NE1   . TRP C 3 534 ? 21.382  21.285  45.875 1.00 70.51  ? 736  TRP A NE1   1 
ATOM   4616 C CE2   . TRP C 3 534 ? 21.503  22.201  46.888 1.00 70.54  ? 736  TRP A CE2   1 
ATOM   4617 C CE3   . TRP C 3 534 ? 21.715  22.178  49.320 1.00 70.40  ? 736  TRP A CE3   1 
ATOM   4618 C CZ2   . TRP C 3 534 ? 21.540  23.606  46.844 1.00 68.92  ? 736  TRP A CZ2   1 
ATOM   4619 C CZ3   . TRP C 3 534 ? 21.752  23.577  49.278 1.00 72.64  ? 736  TRP A CZ3   1 
ATOM   4620 C CH2   . TRP C 3 534 ? 21.665  24.276  48.038 1.00 71.35  ? 736  TRP A CH2   1 
ATOM   4621 N N     . GLY C 3 535 ? 24.792  17.092  49.568 1.00 55.29  ? 737  GLY A N     1 
ATOM   4622 C CA    . GLY C 3 535 ? 25.240  16.144  50.574 1.00 57.65  ? 737  GLY A CA    1 
ATOM   4623 C C     . GLY C 3 535 ? 24.109  15.289  51.126 1.00 58.73  ? 737  GLY A C     1 
ATOM   4624 O O     . GLY C 3 535 ? 23.963  15.158  52.362 1.00 58.91  ? 737  GLY A O     1 
ATOM   4625 N N     . VAL C 3 536 ? 23.276  14.779  50.205 1.00 58.85  ? 738  VAL A N     1 
ATOM   4626 C CA    . VAL C 3 536 ? 22.129  13.928  50.509 1.00 54.19  ? 738  VAL A CA    1 
ATOM   4627 C C     . VAL C 3 536 ? 22.429  12.579  49.937 1.00 52.35  ? 738  VAL A C     1 
ATOM   4628 O O     . VAL C 3 536 ? 22.621  12.451  48.738 1.00 50.40  ? 738  VAL A O     1 
ATOM   4629 C CB    . VAL C 3 536 ? 20.853  14.379  49.789 1.00 56.37  ? 738  VAL A CB    1 
ATOM   4630 C CG1   . VAL C 3 536 ? 19.664  13.515  50.231 1.00 56.99  ? 738  VAL A CG1   1 
ATOM   4631 C CG2   . VAL C 3 536 ? 20.583  15.842  50.028 1.00 54.11  ? 738  VAL A CG2   1 
ATOM   4632 N N     . PRO C 3 537 ? 22.431  11.547  50.785 1.00 51.16  ? 739  PRO A N     1 
ATOM   4633 C CA    . PRO C 3 537 ? 22.703  10.165  50.397 1.00 50.68  ? 739  PRO A CA    1 
ATOM   4634 C C     . PRO C 3 537 ? 21.676  9.634   49.469 1.00 48.24  ? 739  PRO A C     1 
ATOM   4635 O O     . PRO C 3 537 ? 20.483  9.611   49.773 1.00 48.31  ? 739  PRO A O     1 
ATOM   4636 C CB    . PRO C 3 537 ? 22.687  9.410   51.721 1.00 50.26  ? 739  PRO A CB    1 
ATOM   4637 C CG    . PRO C 3 537 ? 21.849  10.239  52.581 1.00 54.63  ? 739  PRO A CG    1 
ATOM   4638 C CD    . PRO C 3 537 ? 22.289  11.643  52.239 1.00 53.41  ? 739  PRO A CD    1 
ATOM   4639 N N     . ILE C 3 538 ? 22.181  9.159   48.346 1.00 48.73  ? 740  ILE A N     1 
ATOM   4640 C CA    . ILE C 3 538 ? 21.352  8.608   47.306 1.00 55.41  ? 740  ILE A CA    1 
ATOM   4641 C C     . ILE C 3 538 ? 20.298  7.695   47.896 1.00 54.52  ? 740  ILE A C     1 
ATOM   4642 O O     . ILE C 3 538 ? 19.132  7.779   47.567 1.00 55.61  ? 740  ILE A O     1 
ATOM   4643 C CB    . ILE C 3 538 ? 22.199  7.842   46.289 1.00 57.15  ? 740  ILE A CB    1 
ATOM   4644 C CG1   . ILE C 3 538 ? 23.337  8.723   45.802 1.00 63.08  ? 740  ILE A CG1   1 
ATOM   4645 C CG2   . ILE C 3 538 ? 21.377  7.527   45.066 1.00 60.60  ? 740  ILE A CG2   1 
ATOM   4646 C CD1   . ILE C 3 538 ? 23.962  8.208   44.529 1.00 70.23  ? 740  ILE A CD1   1 
ATOM   4647 N N     . GLU C 3 539 ? 20.733  6.861   48.820 1.00 58.21  ? 741  GLU A N     1 
ATOM   4648 C CA    . GLU C 3 539 ? 19.873  5.907   49.507 1.00 61.60  ? 741  GLU A CA    1 
ATOM   4649 C C     . GLU C 3 539 ? 18.568  6.556   49.956 1.00 61.49  ? 741  GLU A C     1 
ATOM   4650 O O     . GLU C 3 539 ? 17.549  5.869   50.140 1.00 61.41  ? 741  GLU A O     1 
ATOM   4651 C CB    . GLU C 3 539 ? 20.607  5.401   50.752 1.00 67.90  ? 741  GLU A CB    1 
ATOM   4652 C CG    . GLU C 3 539 ? 22.138  5.445   50.642 1.00 72.33  ? 741  GLU A CG    1 
ATOM   4653 C CD    . GLU C 3 539 ? 22.812  5.932   51.926 1.00 76.83  ? 741  GLU A CD    1 
ATOM   4654 O OE1   . GLU C 3 539 ? 22.281  5.674   53.050 1.00 78.04  ? 741  GLU A OE1   1 
ATOM   4655 O OE2   . GLU C 3 539 ? 23.882  6.580   51.796 1.00 77.61  ? 741  GLU A OE2   1 
ATOM   4656 N N     . LYS C 3 540 ? 18.651  7.855   50.244 1.00 60.33  ? 742  LYS A N     1 
ATOM   4657 C CA    . LYS C 3 540 ? 17.495  8.616   50.695 1.00 60.99  ? 742  LYS A CA    1 
ATOM   4658 C C     . LYS C 3 540 ? 16.480  8.873   49.570 1.00 57.60  ? 742  LYS A C     1 
ATOM   4659 O O     . LYS C 3 540 ? 15.309  9.134   49.813 1.00 57.25  ? 742  LYS A O     1 
ATOM   4660 C CB    . LYS C 3 540 ? 17.953  9.928   51.351 1.00 63.18  ? 742  LYS A CB    1 
ATOM   4661 C CG    . LYS C 3 540 ? 18.304  9.793   52.842 1.00 65.00  ? 742  LYS A CG    1 
ATOM   4662 C CD    . LYS C 3 540 ? 17.071  9.363   53.691 1.00 70.56  ? 742  LYS A CD    1 
ATOM   4663 C CE    . LYS C 3 540 ? 17.297  9.482   55.219 1.00 72.67  ? 742  LYS A CE    1 
ATOM   4664 N NZ    . LYS C 3 540 ? 16.053  9.255   56.059 1.00 72.53  ? 742  LYS A NZ    1 
ATOM   4665 N N     . ILE C 3 541 ? 16.930  8.765   48.331 1.00 53.96  ? 743  ILE A N     1 
ATOM   4666 C CA    . ILE C 3 541 ? 16.051  8.992   47.205 1.00 50.23  ? 743  ILE A CA    1 
ATOM   4667 C C     . ILE C 3 541 ? 15.791  7.735   46.409 1.00 51.45  ? 743  ILE A C     1 
ATOM   4668 O O     . ILE C 3 541 ? 14.649  7.413   46.099 1.00 53.20  ? 743  ILE A O     1 
ATOM   4669 C CB    . ILE C 3 541 ? 16.619  10.111  46.325 1.00 49.06  ? 743  ILE A CB    1 
ATOM   4670 C CG1   . ILE C 3 541 ? 16.199  11.425  46.925 1.00 50.43  ? 743  ILE A CG1   1 
ATOM   4671 C CG2   . ILE C 3 541 ? 16.099  10.076  44.929 1.00 41.83  ? 743  ILE A CG2   1 
ATOM   4672 C CD1   . ILE C 3 541 ? 17.350  12.270  47.213 1.00 65.58  ? 743  ILE A CD1   1 
ATOM   4673 N N     . TYR C 3 542 ? 16.856  7.019   46.075 1.00 53.42  ? 744  TYR A N     1 
ATOM   4674 C CA    . TYR C 3 542 ? 16.720  5.798   45.293 1.00 52.37  ? 744  TYR A CA    1 
ATOM   4675 C C     . TYR C 3 542 ? 16.735  4.552   46.124 1.00 50.58  ? 744  TYR A C     1 
ATOM   4676 O O     . TYR C 3 542 ? 17.561  4.401   47.020 1.00 51.13  ? 744  TYR A O     1 
ATOM   4677 C CB    . TYR C 3 542 ? 17.807  5.701   44.237 1.00 50.51  ? 744  TYR A CB    1 
ATOM   4678 C CG    . TYR C 3 542 ? 17.588  6.578   43.017 1.00 52.52  ? 744  TYR A CG    1 
ATOM   4679 C CD1   . TYR C 3 542 ? 18.681  6.994   42.242 1.00 54.97  ? 744  TYR A CD1   1 
ATOM   4680 C CD2   . TYR C 3 542 ? 16.310  6.993   42.631 1.00 46.91  ? 744  TYR A CD2   1 
ATOM   4681 C CE1   . TYR C 3 542 ? 18.520  7.792   41.123 1.00 51.13  ? 744  TYR A CE1   1 
ATOM   4682 C CE2   . TYR C 3 542 ? 16.138  7.803   41.499 1.00 47.01  ? 744  TYR A CE2   1 
ATOM   4683 C CZ    . TYR C 3 542 ? 17.256  8.200   40.751 1.00 49.13  ? 744  TYR A CZ    1 
ATOM   4684 O OH    . TYR C 3 542 ? 17.173  8.999   39.635 1.00 45.18  ? 744  TYR A OH    1 
ATOM   4685 N N     . ASN C 3 543 ? 15.805  3.663   45.827 1.00 52.48  ? 745  ASN A N     1 
ATOM   4686 C CA    . ASN C 3 543 ? 15.730  2.422   46.554 1.00 56.11  ? 745  ASN A CA    1 
ATOM   4687 C C     . ASN C 3 543 ? 16.746  1.459   45.971 1.00 56.58  ? 745  ASN A C     1 
ATOM   4688 O O     . ASN C 3 543 ? 17.394  1.733   44.967 1.00 55.27  ? 745  ASN A O     1 
ATOM   4689 C CB    . ASN C 3 543 ? 14.287  1.837   46.566 1.00 59.74  ? 745  ASN A CB    1 
ATOM   4690 C CG    . ASN C 3 543 ? 13.879  1.154   45.246 1.00 64.78  ? 745  ASN A CG    1 
ATOM   4691 O OD1   . ASN C 3 543 ? 14.709  0.641   44.491 1.00 66.99  ? 745  ASN A OD1   1 
ATOM   4692 N ND2   . ASN C 3 543 ? 12.576  1.109   44.995 1.00 69.33  ? 745  ASN A ND2   1 
ATOM   4693 N N     . LYS C 3 544 ? 16.931  0.363   46.670 1.00 58.98  ? 746  LYS A N     1 
ATOM   4694 C CA    . LYS C 3 544 ? 17.830  -0.700  46.272 1.00 62.85  ? 746  LYS A CA    1 
ATOM   4695 C C     . LYS C 3 544 ? 17.696  -0.973  44.788 1.00 59.99  ? 746  LYS A C     1 
ATOM   4696 O O     . LYS C 3 544 ? 18.638  -0.827  44.020 1.00 61.70  ? 746  LYS A O     1 
ATOM   4697 C CB    . LYS C 3 544 ? 17.411  -1.948  47.021 1.00 72.24  ? 746  LYS A CB    1 
ATOM   4698 C CG    . LYS C 3 544 ? 16.295  -1.641  48.037 1.00 84.50  ? 746  LYS A CG    1 
ATOM   4699 C CD    . LYS C 3 544 ? 15.369  -2.827  48.298 1.00 90.95  ? 746  LYS A CD    1 
ATOM   4700 C CE    . LYS C 3 544 ? 14.295  -2.460  49.332 1.00 93.10  ? 746  LYS A CE    1 
ATOM   4701 N NZ    . LYS C 3 544 ? 13.404  -3.624  49.635 1.00 96.03  ? 746  LYS A NZ    1 
ATOM   4702 N N     . THR C 3 545 ? 16.528  -1.453  44.411 1.00 57.81  ? 747  THR A N     1 
ATOM   4703 C CA    . THR C 3 545 ? 16.239  -1.758  43.020 1.00 58.03  ? 747  THR A CA    1 
ATOM   4704 C C     . THR C 3 545 ? 16.665  -0.635  42.029 1.00 58.00  ? 747  THR A C     1 
ATOM   4705 O O     . THR C 3 545 ? 17.400  -0.879  41.055 1.00 59.08  ? 747  THR A O     1 
ATOM   4706 C CB    . THR C 3 545 ? 14.732  -2.088  42.887 1.00 57.16  ? 747  THR A CB    1 
ATOM   4707 O OG1   . THR C 3 545 ? 14.487  -3.385  43.438 1.00 59.75  ? 747  THR A OG1   1 
ATOM   4708 C CG2   . THR C 3 545 ? 14.294  -2.071  41.471 1.00 57.18  ? 747  THR A CG2   1 
ATOM   4709 N N     . GLN C 3 546 ? 16.201  0.583   42.296 1.00 57.23  ? 748  GLN A N     1 
ATOM   4710 C CA    . GLN C 3 546 ? 16.473  1.765   41.467 1.00 55.74  ? 748  GLN A CA    1 
ATOM   4711 C C     . GLN C 3 546 ? 17.955  2.074   41.321 1.00 51.31  ? 748  GLN A C     1 
ATOM   4712 O O     . GLN C 3 546 ? 18.412  2.567   40.282 1.00 45.79  ? 748  GLN A O     1 
ATOM   4713 C CB    . GLN C 3 546 ? 15.784  2.983   42.086 1.00 56.05  ? 748  GLN A CB    1 
ATOM   4714 C CG    . GLN C 3 546 ? 14.350  2.760   42.520 1.00 55.88  ? 748  GLN A CG    1 
ATOM   4715 C CD    . GLN C 3 546 ? 13.784  3.996   43.155 1.00 58.84  ? 748  GLN A CD    1 
ATOM   4716 O OE1   . GLN C 3 546 ? 13.516  4.975   42.457 1.00 63.08  ? 748  GLN A OE1   1 
ATOM   4717 N NE2   . GLN C 3 546 ? 13.677  4.003   44.478 1.00 57.41  ? 748  GLN A NE2   1 
ATOM   4718 N N     . ARG C 3 547 ? 18.667  1.887   42.418 1.00 48.64  ? 749  ARG A N     1 
ATOM   4719 C CA    . ARG C 3 547 ? 20.087  2.132   42.445 1.00 54.52  ? 749  ARG A CA    1 
ATOM   4720 C C     . ARG C 3 547 ? 20.768  1.187   41.487 1.00 53.27  ? 749  ARG A C     1 
ATOM   4721 O O     . ARG C 3 547 ? 21.673  1.571   40.753 1.00 54.53  ? 749  ARG A O     1 
ATOM   4722 C CB    . ARG C 3 547 ? 20.621  1.927   43.856 1.00 59.44  ? 749  ARG A CB    1 
ATOM   4723 C CG    . ARG C 3 547 ? 20.094  2.952   44.851 1.00 64.78  ? 749  ARG A CG    1 
ATOM   4724 C CD    . ARG C 3 547 ? 21.021  3.114   46.059 1.00 66.91  ? 749  ARG A CD    1 
ATOM   4725 N NE    . ARG C 3 547 ? 21.032  1.930   46.918 1.00 67.68  ? 749  ARG A NE    1 
ATOM   4726 C CZ    . ARG C 3 547 ? 20.059  1.618   47.773 1.00 67.25  ? 749  ARG A CZ    1 
ATOM   4727 N NH1   . ARG C 3 547 ? 18.991  2.409   47.888 1.00 67.43  ? 749  ARG A NH1   1 
ATOM   4728 N NH2   . ARG C 3 547 ? 20.149  0.511   48.509 1.00 66.74  ? 749  ARG A NH2   1 
ATOM   4729 N N     . GLU C 3 548 ? 20.320  -0.059  41.511 1.00 52.43  ? 750  GLU A N     1 
ATOM   4730 C CA    . GLU C 3 548 ? 20.865  -1.060  40.627 1.00 50.90  ? 750  GLU A CA    1 
ATOM   4731 C C     . GLU C 3 548 ? 20.529  -0.609  39.226 1.00 48.89  ? 750  GLU A C     1 
ATOM   4732 O O     . GLU C 3 548 ? 21.357  -0.670  38.350 1.00 50.37  ? 750  GLU A O     1 
ATOM   4733 C CB    . GLU C 3 548 ? 20.247  -2.415  40.937 1.00 53.25  ? 750  GLU A CB    1 
ATOM   4734 C CG    . GLU C 3 548 ? 20.687  -2.950  42.290 1.00 59.32  ? 750  GLU A CG    1 
ATOM   4735 C CD    . GLU C 3 548 ? 19.844  -4.118  42.795 1.00 63.02  ? 750  GLU A CD    1 
ATOM   4736 O OE1   . GLU C 3 548 ? 19.151  -4.781  41.975 1.00 63.66  ? 750  GLU A OE1   1 
ATOM   4737 O OE2   . GLU C 3 548 ? 19.887  -4.367  44.027 1.00 67.34  ? 750  GLU A OE2   1 
ATOM   4738 N N     . LYS C 3 549 ? 19.335  -0.074  39.035 1.00 47.45  ? 751  LYS A N     1 
ATOM   4739 C CA    . LYS C 3 549 ? 18.978  0.373   37.715 1.00 46.98  ? 751  LYS A CA    1 
ATOM   4740 C C     . LYS C 3 549 ? 19.807  1.565   37.257 1.00 47.82  ? 751  LYS A C     1 
ATOM   4741 O O     . LYS C 3 549 ? 20.272  1.602   36.134 1.00 46.98  ? 751  LYS A O     1 
ATOM   4742 C CB    . LYS C 3 549 ? 17.501  0.706   37.671 1.00 48.15  ? 751  LYS A CB    1 
ATOM   4743 C CG    . LYS C 3 549 ? 16.993  1.005   36.293 1.00 48.33  ? 751  LYS A CG    1 
ATOM   4744 C CD    . LYS C 3 549 ? 15.522  1.306   36.319 1.00 49.78  ? 751  LYS A CD    1 
ATOM   4745 C CE    . LYS C 3 549 ? 15.167  1.868   34.932 1.00 42.72  ? 751  LYS A CE    1 
ATOM   4746 N NZ    . LYS C 3 549 ? 13.799  2.379   34.781 1.00 48.10  ? 751  LYS A NZ    1 
ATOM   4747 N N     . PHE C 3 550 ? 20.015  2.532   38.139 1.00 47.99  ? 752  PHE A N     1 
ATOM   4748 C CA    . PHE C 3 550 ? 20.757  3.719   37.759 1.00 43.50  ? 752  PHE A CA    1 
ATOM   4749 C C     . PHE C 3 550 ? 22.213  3.725   38.099 1.00 39.15  ? 752  PHE A C     1 
ATOM   4750 O O     . PHE C 3 550 ? 22.845  4.761   38.020 1.00 37.93  ? 752  PHE A O     1 
ATOM   4751 C CB    . PHE C 3 550 ? 20.092  4.930   38.373 1.00 44.82  ? 752  PHE A CB    1 
ATOM   4752 C CG    . PHE C 3 550 ? 18.700  5.142   37.890 1.00 45.67  ? 752  PHE A CG    1 
ATOM   4753 C CD1   . PHE C 3 550 ? 17.659  5.355   38.787 1.00 45.81  ? 752  PHE A CD1   1 
ATOM   4754 C CD2   . PHE C 3 550 ? 18.426  5.168   36.528 1.00 44.90  ? 752  PHE A CD2   1 
ATOM   4755 C CE1   . PHE C 3 550 ? 16.350  5.601   38.331 1.00 37.50  ? 752  PHE A CE1   1 
ATOM   4756 C CE2   . PHE C 3 550 ? 17.131  5.414   36.066 1.00 42.21  ? 752  PHE A CE2   1 
ATOM   4757 C CZ    . PHE C 3 550 ? 16.096  5.633   36.974 1.00 41.18  ? 752  PHE A CZ    1 
ATOM   4758 N N     . ALA C 3 551 ? 22.758  2.568   38.432 1.00 37.52  ? 753  ALA A N     1 
ATOM   4759 C CA    . ALA C 3 551 ? 24.164  2.464   38.814 1.00 38.86  ? 753  ALA A CA    1 
ATOM   4760 C C     . ALA C 3 551 ? 25.157  3.175   37.905 1.00 38.89  ? 753  ALA A C     1 
ATOM   4761 O O     . ALA C 3 551 ? 26.189  3.644   38.366 1.00 41.07  ? 753  ALA A O     1 
ATOM   4762 C CB    . ALA C 3 551 ? 24.553  1.041   38.975 1.00 38.91  ? 753  ALA A CB    1 
ATOM   4763 N N     . TRP C 3 552 ? 24.892  3.196   36.608 1.00 36.38  ? 754  TRP A N     1 
ATOM   4764 C CA    . TRP C 3 552 ? 25.775  3.885   35.700 1.00 36.93  ? 754  TRP A CA    1 
ATOM   4765 C C     . TRP C 3 552 ? 25.730  5.325   36.149 1.00 40.09  ? 754  TRP A C     1 
ATOM   4766 O O     . TRP C 3 552 ? 26.730  5.862   36.580 1.00 40.04  ? 754  TRP A O     1 
ATOM   4767 C CB    . TRP C 3 552 ? 25.278  3.768   34.265 1.00 39.41  ? 754  TRP A CB    1 
ATOM   4768 C CG    . TRP C 3 552 ? 23.844  4.134   34.086 1.00 46.86  ? 754  TRP A CG    1 
ATOM   4769 C CD1   . TRP C 3 552 ? 22.767  3.400   34.468 1.00 50.15  ? 754  TRP A CD1   1 
ATOM   4770 C CD2   . TRP C 3 552 ? 23.327  5.319   33.480 1.00 47.61  ? 754  TRP A CD2   1 
ATOM   4771 N NE1   . TRP C 3 552 ? 21.608  4.049   34.140 1.00 53.10  ? 754  TRP A NE1   1 
ATOM   4772 C CE2   . TRP C 3 552 ? 21.919  5.229   33.528 1.00 49.37  ? 754  TRP A CE2   1 
ATOM   4773 C CE3   . TRP C 3 552 ? 23.914  6.445   32.898 1.00 46.67  ? 754  TRP A CE3   1 
ATOM   4774 C CZ2   . TRP C 3 552 ? 21.084  6.220   33.015 1.00 49.81  ? 754  TRP A CZ2   1 
ATOM   4775 C CZ3   . TRP C 3 552 ? 23.089  7.430   32.388 1.00 51.00  ? 754  TRP A CZ3   1 
ATOM   4776 C CH2   . TRP C 3 552 ? 21.682  7.311   32.449 1.00 51.96  ? 754  TRP A CH2   1 
ATOM   4777 N N     . ALA C 3 553 ? 24.528  5.896   36.131 1.00 41.51  ? 755  ALA A N     1 
ATOM   4778 C CA    . ALA C 3 553 ? 24.277  7.272   36.527 1.00 41.13  ? 755  ALA A CA    1 
ATOM   4779 C C     . ALA C 3 553 ? 24.909  7.504   37.873 1.00 41.98  ? 755  ALA A C     1 
ATOM   4780 O O     . ALA C 3 553 ? 25.597  8.491   38.105 1.00 43.96  ? 755  ALA A O     1 
ATOM   4781 C CB    . ALA C 3 553 ? 22.794  7.520   36.608 1.00 33.24  ? 755  ALA A CB    1 
ATOM   4782 N N     . ILE C 3 554 ? 24.677  6.576   38.768 1.00 41.16  ? 756  ILE A N     1 
ATOM   4783 C CA    . ILE C 3 554 ? 25.237  6.714   40.073 1.00 44.47  ? 756  ILE A CA    1 
ATOM   4784 C C     . ILE C 3 554 ? 26.761  6.758   40.035 1.00 48.88  ? 756  ILE A C     1 
ATOM   4785 O O     . ILE C 3 554 ? 27.354  7.706   40.529 1.00 51.80  ? 756  ILE A O     1 
ATOM   4786 C CB    . ILE C 3 554 ? 24.754  5.605   40.958 1.00 42.37  ? 756  ILE A CB    1 
ATOM   4787 C CG1   . ILE C 3 554 ? 23.257  5.738   41.141 1.00 43.06  ? 756  ILE A CG1   1 
ATOM   4788 C CG2   . ILE C 3 554 ? 25.426  5.666   42.263 1.00 42.04  ? 756  ILE A CG2   1 
ATOM   4789 C CD1   . ILE C 3 554 ? 22.743  4.863   42.200 1.00 47.33  ? 756  ILE A CD1   1 
ATOM   4790 N N     . ASP C 3 555 ? 27.404  5.785   39.401 1.00 51.36  ? 757  ASP A N     1 
ATOM   4791 C CA    . ASP C 3 555 ? 28.869  5.764   39.391 1.00 53.30  ? 757  ASP A CA    1 
ATOM   4792 C C     . ASP C 3 555 ? 29.578  6.808   38.560 1.00 54.09  ? 757  ASP A C     1 
ATOM   4793 O O     . ASP C 3 555 ? 30.716  7.151   38.847 1.00 57.48  ? 757  ASP A O     1 
ATOM   4794 C CB    . ASP C 3 555 ? 29.410  4.373   39.018 1.00 56.32  ? 757  ASP A CB    1 
ATOM   4795 C CG    . ASP C 3 555 ? 30.929  4.269   39.171 1.00 55.04  ? 757  ASP A CG    1 
ATOM   4796 O OD1   . ASP C 3 555 ? 31.448  4.406   40.307 1.00 55.73  ? 757  ASP A OD1   1 
ATOM   4797 O OD2   . ASP C 3 555 ? 31.599  4.061   38.141 1.00 50.93  ? 757  ASP A OD2   1 
ATOM   4798 N N     . MET C 3 556 ? 28.900  7.378   37.590 1.00 52.37  ? 758  MET A N     1 
ATOM   4799 C CA    . MET C 3 556 ? 29.577  8.326   36.746 1.00 51.26  ? 758  MET A CA    1 
ATOM   4800 C C     . MET C 3 556 ? 28.905  9.655   36.706 1.00 52.93  ? 758  MET A C     1 
ATOM   4801 O O     . MET C 3 556 ? 28.436  10.090  35.661 1.00 54.76  ? 758  MET A O     1 
ATOM   4802 C CB    . MET C 3 556 ? 29.653  7.760   35.339 1.00 54.84  ? 758  MET A CB    1 
ATOM   4803 C CG    . MET C 3 556 ? 28.310  7.423   34.747 1.00 56.21  ? 758  MET A CG    1 
ATOM   4804 S SD    . MET C 3 556 ? 28.162  8.160   33.136 1.00 63.90  ? 758  MET A SD    1 
ATOM   4805 C CE    . MET C 3 556 ? 28.866  6.847   32.197 1.00 50.84  ? 758  MET A CE    1 
ATOM   4806 N N     . ALA C 3 557 ? 28.853  10.336  37.827 1.00 53.97  ? 759  ALA A N     1 
ATOM   4807 C CA    . ALA C 3 557 ? 28.199  11.615  37.764 1.00 57.39  ? 759  ALA A CA    1 
ATOM   4808 C C     . ALA C 3 557 ? 28.763  12.608  38.757 1.00 58.63  ? 759  ALA A C     1 
ATOM   4809 O O     . ALA C 3 557 ? 29.009  12.275  39.920 1.00 55.36  ? 759  ALA A O     1 
ATOM   4810 C CB    . ALA C 3 557 ? 26.693  11.446  37.936 1.00 59.55  ? 759  ALA A CB    1 
ATOM   4811 N N     . ASP C 3 558 ? 29.024  13.820  38.278 1.00 58.17  ? 760  ASP A N     1 
ATOM   4812 C CA    . ASP C 3 558 ? 29.557  14.856  39.144 1.00 59.02  ? 760  ASP A CA    1 
ATOM   4813 C C     . ASP C 3 558 ? 28.434  15.533  39.918 1.00 57.14  ? 760  ASP A C     1 
ATOM   4814 O O     . ASP C 3 558 ? 27.253  15.341  39.645 1.00 53.53  ? 760  ASP A O     1 
ATOM   4815 C CB    . ASP C 3 558 ? 30.335  15.908  38.324 1.00 57.92  ? 760  ASP A CB    1 
ATOM   4816 N N     . GLU C 3 559 ? 28.833  16.233  40.965 1.00 59.46  ? 761  GLU A N     1 
ATOM   4817 C CA    . GLU C 3 559 ? 27.922  17.024  41.766 1.00 63.62  ? 761  GLU A CA    1 
ATOM   4818 C C     . GLU C 3 559 ? 27.446  18.050  40.741 1.00 65.00  ? 761  GLU A C     1 
ATOM   4819 O O     . GLU C 3 559 ? 26.278  18.446  40.705 1.00 66.73  ? 761  GLU A O     1 
ATOM   4820 C CB    . GLU C 3 559 ? 28.734  17.741  42.857 1.00 68.86  ? 761  GLU A CB    1 
ATOM   4821 C CG    . GLU C 3 559 ? 28.074  18.967  43.503 1.00 76.50  ? 761  GLU A CG    1 
ATOM   4822 C CD    . GLU C 3 559 ? 29.022  19.812  44.406 1.00 82.68  ? 761  GLU A CD    1 
ATOM   4823 O OE1   . GLU C 3 559 ? 29.787  19.242  45.245 1.00 84.38  ? 761  GLU A OE1   1 
ATOM   4824 O OE2   . GLU C 3 559 ? 28.963  21.069  44.288 1.00 87.09  ? 761  GLU A OE2   1 
ATOM   4825 N N     . ASP C 3 560 ? 28.382  18.426  39.871 1.00 66.79  ? 762  ASP A N     1 
ATOM   4826 C CA    . ASP C 3 560 ? 28.167  19.412  38.814 1.00 65.94  ? 762  ASP A CA    1 
ATOM   4827 C C     . ASP C 3 560 ? 27.558  18.927  37.482 1.00 62.89  ? 762  ASP A C     1 
ATOM   4828 O O     . ASP C 3 560 ? 27.722  19.583  36.450 1.00 61.41  ? 762  ASP A O     1 
ATOM   4829 C CB    . ASP C 3 560 ? 29.479  20.150  38.548 1.00 63.99  ? 762  ASP A CB    1 
ATOM   4830 N N     . TYR C 3 561 ? 26.897  17.775  37.485 1.00 60.62  ? 763  TYR A N     1 
ATOM   4831 C CA    . TYR C 3 561 ? 26.277  17.337  36.251 1.00 55.32  ? 763  TYR A CA    1 
ATOM   4832 C C     . TYR C 3 561 ? 25.140  18.331  36.046 1.00 53.38  ? 763  TYR A C     1 
ATOM   4833 O O     . TYR C 3 561 ? 24.574  18.857  37.004 1.00 50.37  ? 763  TYR A O     1 
ATOM   4834 C CB    . TYR C 3 561 ? 25.751  15.896  36.347 1.00 52.85  ? 763  TYR A CB    1 
ATOM   4835 C CG    . TYR C 3 561 ? 24.851  15.503  35.193 1.00 49.07  ? 763  TYR A CG    1 
ATOM   4836 C CD1   . TYR C 3 561 ? 25.368  15.134  33.959 1.00 47.17  ? 763  TYR A CD1   1 
ATOM   4837 C CD2   . TYR C 3 561 ? 23.468  15.518  35.340 1.00 51.59  ? 763  TYR A CD2   1 
ATOM   4838 C CE1   . TYR C 3 561 ? 24.516  14.789  32.902 1.00 47.99  ? 763  TYR A CE1   1 
ATOM   4839 C CE2   . TYR C 3 561 ? 22.611  15.176  34.289 1.00 52.12  ? 763  TYR A CE2   1 
ATOM   4840 C CZ    . TYR C 3 561 ? 23.137  14.810  33.081 1.00 50.67  ? 763  TYR A CZ    1 
ATOM   4841 O OH    . TYR C 3 561 ? 22.268  14.445  32.077 1.00 51.76  ? 763  TYR A OH    1 
ATOM   4842 N N     . GLU C 3 562 ? 24.873  18.629  34.789 1.00 53.63  ? 764  GLU A N     1 
ATOM   4843 C CA    . GLU C 3 562 ? 23.838  19.558  34.410 1.00 56.26  ? 764  GLU A CA    1 
ATOM   4844 C C     . GLU C 3 562 ? 23.271  19.012  33.108 1.00 53.92  ? 764  GLU A C     1 
ATOM   4845 O O     . GLU C 3 562 ? 23.981  18.926  32.109 1.00 47.81  ? 764  GLU A O     1 
ATOM   4846 C CB    . GLU C 3 562 ? 24.472  20.933  34.199 1.00 65.26  ? 764  GLU A CB    1 
ATOM   4847 C CG    . GLU C 3 562 ? 23.711  22.087  34.845 1.00 75.82  ? 764  GLU A CG    1 
ATOM   4848 C CD    . GLU C 3 562 ? 22.553  22.554  33.976 1.00 84.64  ? 764  GLU A CD    1 
ATOM   4849 O OE1   . GLU C 3 562 ? 22.793  22.875  32.780 1.00 88.96  ? 764  GLU A OE1   1 
ATOM   4850 O OE2   . GLU C 3 562 ? 21.407  22.598  34.485 1.00 89.22  ? 764  GLU A OE2   1 
ATOM   4851 N N     . PHE C 3 563 ? 22.021  18.565  33.169 1.00 52.37  ? 765  PHE A N     1 
ATOM   4852 C CA    . PHE C 3 563 ? 21.302  17.993  32.039 1.00 49.82  ? 765  PHE A CA    1 
ATOM   4853 C C     . PHE C 3 563 ? 21.340  18.876  30.809 1.00 49.66  ? 765  PHE A C     1 
ATOM   4854 O O     . PHE C 3 563 ? 21.554  18.352  29.701 1.00 48.97  ? 765  PHE A O     1 
ATOM   4855 C CB    . PHE C 3 563 ? 19.849  17.792  32.431 1.00 51.25  ? 765  PHE A CB    1 
ATOM   4856 C CG    . PHE C 3 563 ? 18.997  17.205  31.341 1.00 51.76  ? 765  PHE A CG    1 
ATOM   4857 C CD1   . PHE C 3 563 ? 18.992  15.843  31.116 1.00 51.55  ? 765  PHE A CD1   1 
ATOM   4858 C CD2   . PHE C 3 563 ? 18.170  18.007  30.565 1.00 47.43  ? 765  PHE A CD2   1 
ATOM   4859 C CE1   . PHE C 3 563 ? 18.174  15.297  30.142 1.00 48.78  ? 765  PHE A CE1   1 
ATOM   4860 C CE2   . PHE C 3 563 ? 17.353  17.456  29.592 1.00 45.01  ? 765  PHE A CE2   1 
ATOM   4861 C CZ    . PHE C 3 563 ? 17.354  16.109  29.382 1.00 42.40  ? 765  PHE A CZ    1 
ATOM   4862 O OXT   . PHE C 3 563 ? 21.066  20.074  30.967 1.00 48.30  ? 765  PHE A OXT   1 
HETATM 4863 O O     . HOH D 4 .   ? -2.928  -2.513  46.388 1.00 52.50  ? 1020 HOH C O     1 
HETATM 4864 O O     . HOH D 4 .   ? -2.494  -3.842  11.127 1.00 62.38  ? 1034 HOH C O     1 
HETATM 4865 O O     . HOH D 4 .   ? 12.218  -1.587  29.335 1.00 59.85  ? 1050 HOH C O     1 
HETATM 4866 O O     . HOH D 4 .   ? 17.387  -2.704  25.731 1.00 47.15  ? 1063 HOH C O     1 
HETATM 4867 O O     . HOH D 4 .   ? 7.222   -0.712  36.214 1.00 50.55  ? 1070 HOH C O     1 
HETATM 4868 O O     . HOH D 4 .   ? 6.757   -5.149  62.404 1.00 62.96  ? 1087 HOH C O     1 
HETATM 4869 O O     . HOH D 4 .   ? -7.049  -9.137  41.057 1.00 80.81  ? 1098 HOH C O     1 
HETATM 4870 O O     . HOH D 4 .   ? 4.535   -6.327  19.264 1.00 66.31  ? 1111 HOH C O     1 
HETATM 4871 O O     . HOH D 4 .   ? -6.369  2.390   36.426 1.00 59.98  ? 1133 HOH C O     1 
HETATM 4872 O O     . HOH D 4 .   ? -2.431  -5.787  49.438 1.00 71.59  ? 1145 HOH C O     1 
HETATM 4873 O O     . HOH D 4 .   ? 8.496   -6.071  26.336 1.00 60.45  ? 1146 HOH C O     1 
HETATM 4874 O O     . HOH D 4 .   ? -2.629  -4.357  36.676 1.00 47.39  ? 1165 HOH C O     1 
HETATM 4875 O O     . HOH D 4 .   ? 0.638   2.042   59.772 1.00 68.41  ? 1166 HOH C O     1 
HETATM 4876 O O     . HOH D 4 .   ? 5.333   -3.480  65.616 1.00 77.35  ? 1180 HOH C O     1 
HETATM 4877 O O     . HOH D 4 .   ? 0.428   -8.593  40.769 1.00 81.60  ? 1196 HOH C O     1 
HETATM 4878 O O     . HOH D 4 .   ? -0.728  8.157   32.905 1.00 51.91  ? 1197 HOH C O     1 
HETATM 4879 O O     . HOH D 4 .   ? 7.806   1.667   62.804 1.00 62.22  ? 1205 HOH C O     1 
HETATM 4880 O O     . HOH D 4 .   ? 2.706   1.615   9.415  1.00 65.63  ? 1229 HOH C O     1 
HETATM 4881 O O     . HOH D 4 .   ? -9.210  -2.729  43.937 1.00 69.48  ? 1244 HOH C O     1 
HETATM 4882 O O     . HOH D 4 .   ? 4.622   -7.393  58.930 1.00 82.95  ? 1254 HOH C O     1 
HETATM 4883 O O     . HOH D 4 .   ? 9.716   -12.591 15.694 1.00 59.16  ? 1256 HOH C O     1 
HETATM 4884 O O     . HOH D 4 .   ? 5.329   -10.403 53.342 1.00 57.66  ? 1257 HOH C O     1 
HETATM 4885 O O     . HOH D 4 .   ? 0.464   -0.421  10.263 1.00 64.22  ? 1261 HOH C O     1 
HETATM 4886 O O     . HOH D 4 .   ? -0.607  -0.971  31.271 1.00 70.28  ? 1268 HOH C O     1 
HETATM 4887 O O     . HOH D 4 .   ? 0.170   -8.005  52.803 1.00 83.99  ? 1284 HOH C O     1 
HETATM 4888 O O     . HOH D 4 .   ? 10.052  -4.283  13.799 1.00 66.18  ? 1291 HOH C O     1 
HETATM 4889 O O     . HOH D 4 .   ? 11.602  -2.399  16.255 1.00 91.94  ? 1293 HOH C O     1 
HETATM 4890 O O     . HOH D 4 .   ? 2.204   -5.866  4.139  1.00 80.14  ? 1310 HOH C O     1 
HETATM 4891 O O     . HOH D 4 .   ? 1.207   -1.484  13.224 1.00 51.41  ? 1324 HOH C O     1 
HETATM 4892 O O     . HOH D 4 .   ? 1.372   5.157   38.521 1.00 86.26  ? 1350 HOH C O     1 
HETATM 4893 O O     . HOH D 4 .   ? 2.156   -7.995  55.370 1.00 80.59  ? 1351 HOH C O     1 
HETATM 4894 O O     . HOH D 4 .   ? 0.852   -4.043  14.966 1.00 73.12  ? 1356 HOH C O     1 
HETATM 4895 O O     . HOH D 4 .   ? 6.274   6.933   -0.191 1.00 97.20  ? 1359 HOH C O     1 
HETATM 4896 O O     . HOH E 4 .   ? 10.308  2.331   21.510 1.00 42.87  ? 1002 HOH D O     1 
HETATM 4897 O O     . HOH E 4 .   ? -1.821  -8.050  24.936 1.00 47.74  ? 1008 HOH D O     1 
HETATM 4898 O O     . HOH E 4 .   ? 1.295   1.713   15.594 1.00 54.89  ? 1013 HOH D O     1 
HETATM 4899 O O     . HOH E 4 .   ? 4.972   6.748   17.047 1.00 63.34  ? 1016 HOH D O     1 
HETATM 4900 O O     . HOH E 4 .   ? -3.653  5.643   22.386 1.00 37.78  ? 1017 HOH D O     1 
HETATM 4901 O O     . HOH E 4 .   ? -1.291  7.762   22.509 1.00 39.65  ? 1024 HOH D O     1 
HETATM 4902 O O     . HOH E 4 .   ? 3.401   -6.563  25.564 1.00 49.88  ? 1037 HOH D O     1 
HETATM 4903 O O     . HOH E 4 .   ? -1.438  -5.022  33.010 1.00 64.54  ? 1041 HOH D O     1 
HETATM 4904 O O     . HOH E 4 .   ? -1.249  4.214   19.757 1.00 60.31  ? 1052 HOH D O     1 
HETATM 4905 O O     . HOH E 4 .   ? 0.785   -8.532  61.295 1.00 70.08  ? 1060 HOH D O     1 
HETATM 4906 O O     . HOH E 4 .   ? -0.910  -7.793  67.943 1.00 74.67  ? 1064 HOH D O     1 
HETATM 4907 O O     . HOH E 4 .   ? -4.847  -10.374 31.191 1.00 66.64  ? 1065 HOH D O     1 
HETATM 4908 O O     . HOH E 4 .   ? 2.334   -4.957  21.330 1.00 58.81  ? 1066 HOH D O     1 
HETATM 4909 O O     . HOH E 4 .   ? 10.001  1.339   5.779  1.00 60.41  ? 1072 HOH D O     1 
HETATM 4910 O O     . HOH E 4 .   ? -0.694  -14.134 32.339 1.00 64.48  ? 1077 HOH D O     1 
HETATM 4911 O O     . HOH E 4 .   ? 11.038  1.334   18.201 1.00 57.67  ? 1083 HOH D O     1 
HETATM 4912 O O     . HOH E 4 .   ? -7.301  -0.567  26.390 1.00 45.59  ? 1090 HOH D O     1 
HETATM 4913 O O     . HOH E 4 .   ? 7.072   -0.785  39.406 1.00 60.02  ? 1093 HOH D O     1 
HETATM 4914 O O     . HOH E 4 .   ? 4.108   -10.941 32.645 1.00 54.76  ? 1094 HOH D O     1 
HETATM 4915 O O     . HOH E 4 .   ? -8.516  -6.171  66.772 1.00 69.53  ? 1104 HOH D O     1 
HETATM 4916 O O     . HOH E 4 .   ? 13.851  0.862   8.630  1.00 79.00  ? 1105 HOH D O     1 
HETATM 4917 O O     . HOH E 4 .   ? -1.382  0.153   48.655 1.00 89.35  ? 1116 HOH D O     1 
HETATM 4918 O O     . HOH E 4 .   ? -2.323  0.238   21.627 1.00 66.34  ? 1129 HOH D O     1 
HETATM 4919 O O     . HOH E 4 .   ? 15.914  -1.691  7.096  1.00 52.59  ? 1147 HOH D O     1 
HETATM 4920 O O     . HOH E 4 .   ? 4.632   1.278   42.336 1.00 61.79  ? 1148 HOH D O     1 
HETATM 4921 O O     . HOH E 4 .   ? 10.300  -2.928  41.721 1.00 60.21  ? 1153 HOH D O     1 
HETATM 4922 O O     . HOH E 4 .   ? 6.358   -10.405 35.755 1.00 87.80  ? 1161 HOH D O     1 
HETATM 4923 O O     . HOH E 4 .   ? -2.043  -2.063  51.769 1.00 59.31  ? 1162 HOH D O     1 
HETATM 4924 O O     . HOH E 4 .   ? 8.445   -6.410  10.599 1.00 50.01  ? 1169 HOH D O     1 
HETATM 4925 O O     . HOH E 4 .   ? 6.691   -6.515  47.051 1.00 65.13  ? 1186 HOH D O     1 
HETATM 4926 O O     . HOH E 4 .   ? 11.209  -6.172  11.680 1.00 42.44  ? 1199 HOH D O     1 
HETATM 4927 O O     . HOH E 4 .   ? 0.379   -6.095  24.834 1.00 61.46  ? 1206 HOH D O     1 
HETATM 4928 O O     . HOH E 4 .   ? 13.710  -5.210  5.071  1.00 60.77  ? 1208 HOH D O     1 
HETATM 4929 O O     . HOH E 4 .   ? 8.879   6.784   13.195 1.00 53.28  ? 1217 HOH D O     1 
HETATM 4930 O O     . HOH E 4 .   ? 0.820   7.167   56.512 1.00 78.85  ? 1222 HOH D O     1 
HETATM 4931 O O     . HOH E 4 .   ? 3.943   2.776   12.303 1.00 64.83  ? 1228 HOH D O     1 
HETATM 4932 O O     . HOH E 4 .   ? 10.009  -7.748  38.814 1.00 81.85  ? 1230 HOH D O     1 
HETATM 4933 O O     . HOH E 4 .   ? -4.305  -3.968  65.601 1.00 80.87  ? 1233 HOH D O     1 
HETATM 4934 O O     . HOH E 4 .   ? 3.313   -8.031  28.309 1.00 69.30  ? 1236 HOH D O     1 
HETATM 4935 O O     . HOH E 4 .   ? 3.047   -15.662 37.655 1.00 77.55  ? 1238 HOH D O     1 
HETATM 4936 O O     . HOH E 4 .   ? 4.365   -8.244  44.085 1.00 89.82  ? 1241 HOH D O     1 
HETATM 4937 O O     . HOH E 4 .   ? 7.546   3.396   23.265 1.00 61.55  ? 1245 HOH D O     1 
HETATM 4938 O O     . HOH E 4 .   ? 8.568   1.749   45.065 1.00 70.71  ? 1252 HOH D O     1 
HETATM 4939 O O     . HOH E 4 .   ? 6.397   -5.981  29.553 1.00 74.88  ? 1280 HOH D O     1 
HETATM 4940 O O     . HOH E 4 .   ? -1.306  4.353   50.538 1.00 79.52  ? 1299 HOH D O     1 
HETATM 4941 O O     . HOH E 4 .   ? 8.737   4.569   20.839 1.00 91.25  ? 1309 HOH D O     1 
HETATM 4942 O O     . HOH E 4 .   ? -5.189  -5.653  57.596 1.00 75.03  ? 1315 HOH D O     1 
HETATM 4943 O O     . HOH E 4 .   ? 10.371  -8.276  2.419  1.00 80.43  ? 1323 HOH D O     1 
HETATM 4944 O O     . HOH E 4 .   ? -1.467  -6.783  57.672 1.00 94.89  ? 1332 HOH D O     1 
HETATM 4945 O O     . HOH E 4 .   ? 7.858   -2.161  50.645 1.00 78.85  ? 1339 HOH D O     1 
HETATM 4946 O O     . HOH F 4 .   ? -0.760  6.937   12.893 1.00 40.81  ? 1001 HOH A O     1 
HETATM 4947 O O     . HOH F 4 .   ? 24.901  -16.750 17.294 1.00 33.76  ? 1003 HOH A O     1 
HETATM 4948 O O     . HOH F 4 .   ? 5.419   9.910   37.421 1.00 48.02  ? 1004 HOH A O     1 
HETATM 4949 O O     . HOH F 4 .   ? 4.796   3.403   25.351 1.00 36.41  ? 1005 HOH A O     1 
HETATM 4950 O O     . HOH F 4 .   ? 11.381  8.548   29.063 1.00 51.07  ? 1006 HOH A O     1 
HETATM 4951 O O     . HOH F 4 .   ? 22.151  -19.164 32.923 1.00 61.80  ? 1007 HOH A O     1 
HETATM 4952 O O     . HOH F 4 .   ? 32.638  -14.753 24.809 1.00 62.36  ? 1009 HOH A O     1 
HETATM 4953 O O     . HOH F 4 .   ? 1.719   -25.057 31.622 1.00 38.80  ? 1010 HOH A O     1 
HETATM 4954 O O     . HOH F 4 .   ? 3.440   8.715   44.105 1.00 46.91  ? 1011 HOH A O     1 
HETATM 4955 O O     . HOH F 4 .   ? 12.107  -0.018  34.890 1.00 40.84  ? 1012 HOH A O     1 
HETATM 4956 O O     . HOH F 4 .   ? -16.509 -29.389 38.030 1.00 51.33  ? 1014 HOH A O     1 
HETATM 4957 O O     . HOH F 4 .   ? -5.922  2.207   27.644 1.00 43.76  ? 1015 HOH A O     1 
HETATM 4958 O O     . HOH F 4 .   ? -5.250  11.309  11.959 1.00 54.22  ? 1018 HOH A O     1 
HETATM 4959 O O     . HOH F 4 .   ? -19.484 -32.229 32.349 1.00 55.70  ? 1019 HOH A O     1 
HETATM 4960 O O     . HOH F 4 .   ? 16.852  27.309  54.540 1.00 45.91  ? 1021 HOH A O     1 
HETATM 4961 O O     . HOH F 4 .   ? -1.788  6.112   41.832 1.00 59.92  ? 1022 HOH A O     1 
HETATM 4962 O O     . HOH F 4 .   ? 1.027   3.573   13.380 1.00 50.55  ? 1025 HOH A O     1 
HETATM 4963 O O     . HOH F 4 .   ? 22.997  -7.011  28.813 1.00 52.11  ? 1026 HOH A O     1 
HETATM 4964 O O     . HOH F 4 .   ? -7.672  -28.570 32.219 1.00 61.27  ? 1027 HOH A O     1 
HETATM 4965 O O     . HOH F 4 .   ? -26.305 -15.691 30.095 1.00 44.13  ? 1028 HOH A O     1 
HETATM 4966 O O     . HOH F 4 .   ? -14.810 -14.783 23.068 1.00 50.42  ? 1029 HOH A O     1 
HETATM 4967 O O     . HOH F 4 .   ? -24.753 -16.826 28.134 1.00 53.52  ? 1030 HOH A O     1 
HETATM 4968 O O     . HOH F 4 .   ? 2.723   -22.232 30.732 1.00 57.64  ? 1031 HOH A O     1 
HETATM 4969 O O     . HOH F 4 .   ? 5.250   -11.298 29.610 1.00 82.13  ? 1032 HOH A O     1 
HETATM 4970 O O     . HOH F 4 .   ? -7.591  -22.205 38.631 1.00 54.76  ? 1033 HOH A O     1 
HETATM 4971 O O     . HOH F 4 .   ? -2.162  10.112  25.022 1.00 53.37  ? 1035 HOH A O     1 
HETATM 4972 O O     . HOH F 4 .   ? 7.003   21.543  12.062 1.00 71.34  ? 1036 HOH A O     1 
HETATM 4973 O O     . HOH F 4 .   ? -3.485  -1.627  17.509 1.00 67.80  ? 1038 HOH A O     1 
HETATM 4974 O O     . HOH F 4 .   ? 12.062  9.700   24.741 1.00 57.75  ? 1039 HOH A O     1 
HETATM 4975 O O     . HOH F 4 .   ? 26.940  -4.223  35.567 1.00 62.56  ? 1040 HOH A O     1 
HETATM 4976 O O     . HOH F 4 .   ? -24.624 -21.220 24.150 1.00 41.62  ? 1042 HOH A O     1 
HETATM 4977 O O     . HOH F 4 .   ? -13.343 16.468  24.696 1.00 67.67  ? 1043 HOH A O     1 
HETATM 4978 O O     . HOH F 4 .   ? 7.965   -13.911 17.702 1.00 76.30  ? 1044 HOH A O     1 
HETATM 4979 O O     . HOH F 4 .   ? 24.865  -6.274  35.099 1.00 61.34  ? 1045 HOH A O     1 
HETATM 4980 O O     . HOH F 4 .   ? 0.430   -20.530 30.337 1.00 48.86  ? 1046 HOH A O     1 
HETATM 4981 O O     . HOH F 4 .   ? 16.587  0.567   28.480 1.00 43.48  ? 1047 HOH A O     1 
HETATM 4982 O O     . HOH F 4 .   ? 6.149   8.884   27.281 1.00 62.81  ? 1048 HOH A O     1 
HETATM 4983 O O     . HOH F 4 .   ? 3.979   -18.994 35.361 1.00 50.89  ? 1049 HOH A O     1 
HETATM 4984 O O     . HOH F 4 .   ? 15.210  -18.635 32.226 1.00 49.56  ? 1051 HOH A O     1 
HETATM 4985 O O     . HOH F 4 .   ? 27.692  11.113  31.863 1.00 61.16  ? 1053 HOH A O     1 
HETATM 4986 O O     . HOH F 4 .   ? 17.471  -2.390  22.025 1.00 55.12  ? 1054 HOH A O     1 
HETATM 4987 O O     . HOH F 4 .   ? -27.608 -23.552 41.052 1.00 71.22  ? 1055 HOH A O     1 
HETATM 4988 O O     . HOH F 4 .   ? -6.240  14.300  14.649 1.00 47.52  ? 1056 HOH A O     1 
HETATM 4989 O O     . HOH F 4 .   ? 4.022   21.002  35.490 1.00 62.67  ? 1057 HOH A O     1 
HETATM 4990 O O     . HOH F 4 .   ? -1.248  -17.447 28.661 1.00 40.61  ? 1058 HOH A O     1 
HETATM 4991 O O     . HOH F 4 .   ? 14.188  -12.335 15.255 1.00 54.01  ? 1059 HOH A O     1 
HETATM 4992 O O     . HOH F 4 .   ? -12.434 4.287   25.287 1.00 55.14  ? 1061 HOH A O     1 
HETATM 4993 O O     . HOH F 4 .   ? -9.950  29.322  31.163 1.00 68.45  ? 1062 HOH A O     1 
HETATM 4994 O O     . HOH F 4 .   ? 13.393  4.828   23.795 1.00 59.23  ? 1067 HOH A O     1 
HETATM 4995 O O     . HOH F 4 .   ? -13.652 -15.204 19.101 1.00 74.07  ? 1069 HOH A O     1 
HETATM 4996 O O     . HOH F 4 .   ? -8.210  9.289   15.536 1.00 50.21  ? 1071 HOH A O     1 
HETATM 4997 O O     . HOH F 4 .   ? 19.197  3.494   33.019 1.00 64.53  ? 1073 HOH A O     1 
HETATM 4998 O O     . HOH F 4 .   ? 14.668  5.939   32.582 1.00 46.12  ? 1074 HOH A O     1 
HETATM 4999 O O     . HOH F 4 .   ? -13.950 -15.556 44.244 1.00 76.12  ? 1076 HOH A O     1 
HETATM 5000 O O     . HOH F 4 .   ? 13.795  10.249  14.540 1.00 62.81  ? 1078 HOH A O     1 
HETATM 5001 O O     . HOH F 4 .   ? 8.382   -13.898 35.476 1.00 43.35  ? 1079 HOH A O     1 
HETATM 5002 O O     . HOH F 4 .   ? 0.152   13.085  27.916 1.00 40.52  ? 1080 HOH A O     1 
HETATM 5003 O O     . HOH F 4 .   ? 0.243   18.597  30.361 1.00 46.17  ? 1081 HOH A O     1 
HETATM 5004 O O     . HOH F 4 .   ? 12.532  -23.317 30.094 1.00 51.67  ? 1082 HOH A O     1 
HETATM 5005 O O     . HOH F 4 .   ? 16.417  -26.098 41.395 1.00 64.35  ? 1084 HOH A O     1 
HETATM 5006 O O     . HOH F 4 .   ? -5.701  -12.362 38.864 1.00 76.20  ? 1085 HOH A O     1 
HETATM 5007 O O     . HOH F 4 .   ? 21.958  26.266  42.299 1.00 46.26  ? 1086 HOH A O     1 
HETATM 5008 O O     . HOH F 4 .   ? 35.283  -2.298  26.081 1.00 59.72  ? 1088 HOH A O     1 
HETATM 5009 O O     . HOH F 4 .   ? 15.517  -26.275 31.916 1.00 70.80  ? 1089 HOH A O     1 
HETATM 5010 O O     . HOH F 4 .   ? -12.158 -28.020 50.767 1.00 70.92  ? 1091 HOH A O     1 
HETATM 5011 O O     . HOH F 4 .   ? 4.626   9.927   21.860 1.00 58.04  ? 1092 HOH A O     1 
HETATM 5012 O O     . HOH F 4 .   ? -19.930 -30.701 40.562 1.00 57.76  ? 1095 HOH A O     1 
HETATM 5013 O O     . HOH F 4 .   ? 31.686  -6.444  40.679 1.00 53.37  ? 1096 HOH A O     1 
HETATM 5014 O O     . HOH F 4 .   ? 5.388   13.021  22.783 1.00 58.37  ? 1097 HOH A O     1 
HETATM 5015 O O     . HOH F 4 .   ? -19.971 -23.492 42.423 1.00 48.65  ? 1099 HOH A O     1 
HETATM 5016 O O     . HOH F 4 .   ? 17.708  0.204   32.412 1.00 50.86  ? 1100 HOH A O     1 
HETATM 5017 O O     . HOH F 4 .   ? -14.753 -34.796 34.443 1.00 62.22  ? 1101 HOH A O     1 
HETATM 5018 O O     . HOH F 4 .   ? -1.163  7.524   29.899 1.00 58.12  ? 1102 HOH A O     1 
HETATM 5019 O O     . HOH F 4 .   ? 18.939  -24.086 15.779 1.00 66.02  ? 1103 HOH A O     1 
HETATM 5020 O O     . HOH F 4 .   ? 12.610  10.670  47.775 1.00 49.71  ? 1106 HOH A O     1 
HETATM 5021 O O     . HOH F 4 .   ? 21.965  19.848  26.557 1.00 69.44  ? 1107 HOH A O     1 
HETATM 5022 O O     . HOH F 4 .   ? -19.526 -4.673  29.466 1.00 53.57  ? 1108 HOH A O     1 
HETATM 5023 O O     . HOH F 4 .   ? -4.786  2.160   33.219 1.00 62.99  ? 1109 HOH A O     1 
HETATM 5024 O O     . HOH F 4 .   ? 22.979  25.114  21.999 1.00 68.64  ? 1110 HOH A O     1 
HETATM 5025 O O     . HOH F 4 .   ? -12.440 -28.871 23.772 1.00 73.04  ? 1112 HOH A O     1 
HETATM 5026 O O     . HOH F 4 .   ? 19.243  16.457  58.379 1.00 65.41  ? 1113 HOH A O     1 
HETATM 5027 O O     . HOH F 4 .   ? -19.554 -7.407  41.457 1.00 61.93  ? 1114 HOH A O     1 
HETATM 5028 O O     . HOH F 4 .   ? 26.234  -8.924  29.069 1.00 64.18  ? 1115 HOH A O     1 
HETATM 5029 O O     . HOH F 4 .   ? 13.307  -28.758 20.542 1.00 54.41  ? 1117 HOH A O     1 
HETATM 5030 O O     . HOH F 4 .   ? -10.440 7.615   16.859 1.00 65.14  ? 1118 HOH A O     1 
HETATM 5031 O O     . HOH F 4 .   ? -15.457 18.428  30.684 1.00 55.25  ? 1119 HOH A O     1 
HETATM 5032 O O     . HOH F 4 .   ? -8.750  0.347   33.301 1.00 53.31  ? 1120 HOH A O     1 
HETATM 5033 O O     . HOH F 4 .   ? -21.446 -11.585 38.548 1.00 58.52  ? 1121 HOH A O     1 
HETATM 5034 O O     . HOH F 4 .   ? 7.478   14.882  7.004  1.00 77.69  ? 1122 HOH A O     1 
HETATM 5035 O O     . HOH F 4 .   ? 32.559  -19.501 21.528 1.00 71.97  ? 1123 HOH A O     1 
HETATM 5036 O O     . HOH F 4 .   ? 9.797   22.875  27.672 1.00 61.92  ? 1124 HOH A O     1 
HETATM 5037 O O     . HOH F 4 .   ? -16.534 -7.320  22.458 1.00 64.10  ? 1125 HOH A O     1 
HETATM 5038 O O     . HOH F 4 .   ? -5.282  6.532   19.409 1.00 95.75  ? 1126 HOH A O     1 
HETATM 5039 O O     . HOH F 4 .   ? 10.569  -17.163 41.802 1.00 84.70  ? 1127 HOH A O     1 
HETATM 5040 O O     . HOH F 4 .   ? -34.777 -26.993 32.829 1.00 71.69  ? 1128 HOH A O     1 
HETATM 5041 O O     . HOH F 4 .   ? 26.751  18.454  26.695 1.00 85.06  ? 1130 HOH A O     1 
HETATM 5042 O O     . HOH F 4 .   ? -5.293  15.566  33.001 1.00 59.17  ? 1131 HOH A O     1 
HETATM 5043 O O     . HOH F 4 .   ? 9.659   20.787  25.677 1.00 66.31  ? 1132 HOH A O     1 
HETATM 5044 O O     . HOH F 4 .   ? -11.897 3.450   28.250 1.00 64.67  ? 1134 HOH A O     1 
HETATM 5045 O O     . HOH F 4 .   ? -15.690 -5.695  33.300 1.00 66.89  ? 1135 HOH A O     1 
HETATM 5046 O O     . HOH F 4 .   ? 27.747  -2.296  23.594 1.00 72.43  ? 1136 HOH A O     1 
HETATM 5047 O O     . HOH F 4 .   ? 24.532  1.191   42.432 1.00 84.62  ? 1137 HOH A O     1 
HETATM 5048 O O     . HOH F 4 .   ? 21.235  -0.312  33.769 1.00 69.25  ? 1138 HOH A O     1 
HETATM 5049 O O     . HOH F 4 .   ? 30.287  -23.635 22.339 1.00 62.77  ? 1139 HOH A O     1 
HETATM 5050 O O     . HOH F 4 .   ? 21.871  18.731  37.078 1.00 49.30  ? 1140 HOH A O     1 
HETATM 5051 O O     . HOH F 4 .   ? -10.285 30.760  11.862 1.00 80.10  ? 1141 HOH A O     1 
HETATM 5052 O O     . HOH F 4 .   ? -17.193 8.836   19.717 1.00 74.94  ? 1142 HOH A O     1 
HETATM 5053 O O     . HOH F 4 .   ? 15.001  10.506  24.217 1.00 78.32  ? 1143 HOH A O     1 
HETATM 5054 O O     . HOH F 4 .   ? 14.764  9.606   38.639 1.00 51.37  ? 1144 HOH A O     1 
HETATM 5055 O O     . HOH F 4 .   ? -11.409 -3.247  31.738 1.00 57.73  ? 1149 HOH A O     1 
HETATM 5056 O O     . HOH F 4 .   ? 1.003   -14.316 26.805 1.00 60.18  ? 1150 HOH A O     1 
HETATM 5057 O O     . HOH F 4 .   ? 12.519  11.208  40.551 1.00 58.34  ? 1151 HOH A O     1 
HETATM 5058 O O     . HOH F 4 .   ? -16.629 -24.533 48.900 1.00 69.52  ? 1152 HOH A O     1 
HETATM 5059 O O     . HOH F 4 .   ? 20.735  24.590  31.945 1.00 75.66  ? 1154 HOH A O     1 
HETATM 5060 O O     . HOH F 4 .   ? -17.704 -20.862 21.350 1.00 65.31  ? 1155 HOH A O     1 
HETATM 5061 O O     . HOH F 4 .   ? 20.961  -24.197 28.244 1.00 57.12  ? 1156 HOH A O     1 
HETATM 5062 O O     . HOH F 4 .   ? -15.034 25.252  13.599 1.00 62.89  ? 1157 HOH A O     1 
HETATM 5063 O O     . HOH F 4 .   ? 8.664   8.336   10.456 1.00 63.92  ? 1158 HOH A O     1 
HETATM 5064 O O     . HOH F 4 .   ? -4.093  -20.142 36.255 1.00 74.29  ? 1159 HOH A O     1 
HETATM 5065 O O     . HOH F 4 .   ? -13.581 -12.199 43.220 1.00 76.94  ? 1160 HOH A O     1 
HETATM 5066 O O     . HOH F 4 .   ? -5.612  -15.442 58.742 1.00 78.13  ? 1163 HOH A O     1 
HETATM 5067 O O     . HOH F 4 .   ? 3.555   -34.701 24.639 1.00 87.72  ? 1164 HOH A O     1 
HETATM 5068 O O     . HOH F 4 .   ? -13.689 -30.525 27.099 1.00 55.60  ? 1167 HOH A O     1 
HETATM 5069 O O     . HOH F 4 .   ? 23.612  -2.548  36.359 1.00 57.70  ? 1168 HOH A O     1 
HETATM 5070 O O     . HOH F 4 .   ? 26.977  10.546  28.585 1.00 55.38  ? 1170 HOH A O     1 
HETATM 5071 O O     . HOH F 4 .   ? 23.068  -23.322 19.980 1.00 50.48  ? 1171 HOH A O     1 
HETATM 5072 O O     . HOH F 4 .   ? 25.277  12.351  49.435 1.00 83.31  ? 1172 HOH A O     1 
HETATM 5073 O O     . HOH F 4 .   ? -30.410 -24.734 30.219 1.00 75.58  ? 1173 HOH A O     1 
HETATM 5074 O O     . HOH F 4 .   ? 23.748  -2.747  39.405 1.00 82.73  ? 1174 HOH A O     1 
HETATM 5075 O O     . HOH F 4 .   ? -14.485 -26.208 19.910 1.00 72.86  ? 1175 HOH A O     1 
HETATM 5076 O O     . HOH F 4 .   ? 14.229  7.699   35.499 1.00 69.54  ? 1177 HOH A O     1 
HETATM 5077 O O     . HOH F 4 .   ? -1.937  -17.080 19.774 1.00 70.81  ? 1178 HOH A O     1 
HETATM 5078 O O     . HOH F 4 .   ? 9.553   9.152   26.824 1.00 53.48  ? 1179 HOH A O     1 
HETATM 5079 O O     . HOH F 4 .   ? 20.487  -20.685 25.610 1.00 64.18  ? 1181 HOH A O     1 
HETATM 5080 O O     . HOH F 4 .   ? 29.106  -9.347  29.129 1.00 63.25  ? 1182 HOH A O     1 
HETATM 5081 O O     . HOH F 4 .   ? -16.310 -33.672 23.219 1.00 77.34  ? 1183 HOH A O     1 
HETATM 5082 O O     . HOH F 4 .   ? -8.919  4.691   19.409 1.00 85.52  ? 1184 HOH A O     1 
HETATM 5083 O O     . HOH F 4 .   ? 17.654  22.773  33.430 1.00 54.43  ? 1185 HOH A O     1 
HETATM 5084 O O     . HOH F 4 .   ? 12.029  -24.228 43.303 1.00 58.17  ? 1187 HOH A O     1 
HETATM 5085 O O     . HOH F 4 .   ? 9.814   -25.162 33.192 1.00 47.74  ? 1188 HOH A O     1 
HETATM 5086 O O     . HOH F 4 .   ? -4.581  5.927   40.976 1.00 68.48  ? 1189 HOH A O     1 
HETATM 5087 O O     . HOH F 4 .   ? -0.751  14.473  4.435  1.00 90.16  ? 1190 HOH A O     1 
HETATM 5088 O O     . HOH F 4 .   ? 11.708  -26.370 29.615 1.00 67.79  ? 1191 HOH A O     1 
HETATM 5089 O O     . HOH F 4 .   ? 7.217   -13.650 30.930 1.00 55.00  ? 1192 HOH A O     1 
HETATM 5090 O O     . HOH F 4 .   ? 26.919  -14.377 17.488 1.00 57.49  ? 1193 HOH A O     1 
HETATM 5091 O O     . HOH F 4 .   ? 16.683  11.675  37.808 1.00 49.44  ? 1194 HOH A O     1 
HETATM 5092 O O     . HOH F 4 .   ? 0.671   15.233  29.511 1.00 47.05  ? 1195 HOH A O     1 
HETATM 5093 O O     . HOH F 4 .   ? 15.301  3.373   27.624 1.00 47.63  ? 1198 HOH A O     1 
HETATM 5094 O O     . HOH F 4 .   ? 25.159  15.972  24.857 1.00 60.34  ? 1200 HOH A O     1 
HETATM 5095 O O     . HOH F 4 .   ? -30.100 -27.335 23.434 1.00 70.58  ? 1201 HOH A O     1 
HETATM 5096 O O     . HOH F 4 .   ? 21.693  -1.927  23.920 1.00 64.17  ? 1202 HOH A O     1 
HETATM 5097 O O     . HOH F 4 .   ? -22.864 -18.104 41.007 1.00 60.42  ? 1203 HOH A O     1 
HETATM 5098 O O     . HOH F 4 .   ? -14.789 19.591  28.053 1.00 77.11  ? 1204 HOH A O     1 
HETATM 5099 O O     . HOH F 4 .   ? 18.367  -18.966 31.997 1.00 54.23  ? 1207 HOH A O     1 
HETATM 5100 O O     . HOH F 4 .   ? -2.358  8.965   14.216 1.00 55.05  ? 1209 HOH A O     1 
HETATM 5101 O O     . HOH F 4 .   ? 1.745   6.288   10.665 1.00 48.67  ? 1210 HOH A O     1 
HETATM 5102 O O     . HOH F 4 .   ? -1.104  -26.575 40.382 1.00 58.81  ? 1211 HOH A O     1 
HETATM 5103 O O     . HOH F 4 .   ? 5.345   -13.924 35.048 1.00 71.89  ? 1212 HOH A O     1 
HETATM 5104 O O     . HOH F 4 .   ? -9.611  -16.649 24.040 1.00 69.33  ? 1213 HOH A O     1 
HETATM 5105 O O     . HOH F 4 .   ? -0.746  12.524  25.033 1.00 61.68  ? 1214 HOH A O     1 
HETATM 5106 O O     . HOH F 4 .   ? 21.480  -8.134  35.209 1.00 60.05  ? 1215 HOH A O     1 
HETATM 5107 O O     . HOH F 4 .   ? 34.381  5.209   40.043 1.00 64.06  ? 1216 HOH A O     1 
HETATM 5108 O O     . HOH F 4 .   ? 3.775   5.551   41.589 1.00 74.30  ? 1218 HOH A O     1 
HETATM 5109 O O     . HOH F 4 .   ? -7.200  22.816  33.863 1.00 72.03  ? 1219 HOH A O     1 
HETATM 5110 O O     . HOH F 4 .   ? 2.571   -8.485  17.156 1.00 73.10  ? 1220 HOH A O     1 
HETATM 5111 O O     . HOH F 4 .   ? -1.102  28.659  28.362 1.00 60.12  ? 1221 HOH A O     1 
HETATM 5112 O O     . HOH F 4 .   ? -5.210  35.083  28.130 1.00 80.45  ? 1223 HOH A O     1 
HETATM 5113 O O     . HOH F 4 .   ? -16.719 -12.741 21.468 1.00 77.32  ? 1224 HOH A O     1 
HETATM 5114 O O     . HOH F 4 .   ? 7.455   17.383  26.008 1.00 77.57  ? 1225 HOH A O     1 
HETATM 5115 O O     . HOH F 4 .   ? -7.871  11.618  9.307  1.00 68.31  ? 1226 HOH A O     1 
HETATM 5116 O O     . HOH F 4 .   ? -2.443  -28.617 33.133 1.00 63.75  ? 1227 HOH A O     1 
HETATM 5117 O O     . HOH F 4 .   ? 17.751  4.839   23.630 1.00 63.25  ? 1231 HOH A O     1 
HETATM 5118 O O     . HOH F 4 .   ? 21.390  18.909  55.073 1.00 67.09  ? 1234 HOH A O     1 
HETATM 5119 O O     . HOH F 4 .   ? -19.256 -0.447  26.555 1.00 70.88  ? 1235 HOH A O     1 
HETATM 5120 O O     . HOH F 4 .   ? -1.845  -16.332 25.757 1.00 56.17  ? 1237 HOH A O     1 
HETATM 5121 O O     . HOH F 4 .   ? 15.217  30.899  23.004 1.00 71.19  ? 1239 HOH A O     1 
HETATM 5122 O O     . HOH F 4 .   ? 5.900   -7.699  24.017 1.00 71.58  ? 1240 HOH A O     1 
HETATM 5123 O O     . HOH F 4 .   ? 3.097   20.155  46.685 1.00 94.94  ? 1242 HOH A O     1 
HETATM 5124 O O     . HOH F 4 .   ? 2.272   -19.183 50.610 1.00 85.26  ? 1243 HOH A O     1 
HETATM 5125 O O     . HOH F 4 .   ? -22.180 -14.558 28.772 1.00 68.58  ? 1246 HOH A O     1 
HETATM 5126 O O     . HOH F 4 .   ? 18.113  7.221   22.153 1.00 60.43  ? 1247 HOH A O     1 
HETATM 5127 O O     . HOH F 4 .   ? -29.743 -27.225 28.199 1.00 64.41  ? 1248 HOH A O     1 
HETATM 5128 O O     . HOH F 4 .   ? -4.681  -5.394  17.993 1.00 85.59  ? 1249 HOH A O     1 
HETATM 5129 O O     . HOH F 4 .   ? 17.574  22.718  13.485 1.00 87.36  ? 1250 HOH A O     1 
HETATM 5130 O O     . HOH F 4 .   ? 0.823   10.641  30.002 1.00 82.50  ? 1251 HOH A O     1 
HETATM 5131 O O     . HOH F 4 .   ? -9.296  -26.549 40.665 1.00 75.84  ? 1253 HOH A O     1 
HETATM 5132 O O     . HOH F 4 .   ? -15.619 19.875  20.231 1.00 87.86  ? 1255 HOH A O     1 
HETATM 5133 O O     . HOH F 4 .   ? -0.242  8.441   44.725 1.00 66.90  ? 1258 HOH A O     1 
HETATM 5134 O O     . HOH F 4 .   ? -5.932  -21.024 45.448 1.00 64.82  ? 1259 HOH A O     1 
HETATM 5135 O O     . HOH F 4 .   ? -9.463  -12.196 19.352 1.00 68.55  ? 1260 HOH A O     1 
HETATM 5136 O O     . HOH F 4 .   ? 5.370   32.468  20.445 1.00 85.51  ? 1262 HOH A O     1 
HETATM 5137 O O     . HOH F 4 .   ? 16.947  -8.270  27.029 1.00 61.96  ? 1263 HOH A O     1 
HETATM 5138 O O     . HOH F 4 .   ? 20.817  18.203  39.871 1.00 77.95  ? 1264 HOH A O     1 
HETATM 5139 O O     . HOH F 4 .   ? 29.189  14.855  35.608 1.00 65.83  ? 1265 HOH A O     1 
HETATM 5140 O O     . HOH F 4 .   ? -15.466 5.391   22.699 1.00 61.19  ? 1266 HOH A O     1 
HETATM 5141 O O     . HOH F 4 .   ? -4.492  33.164  33.198 1.00 79.84  ? 1267 HOH A O     1 
HETATM 5142 O O     . HOH F 4 .   ? 32.655  -10.165 24.148 1.00 63.43  ? 1269 HOH A O     1 
HETATM 5143 O O     . HOH F 4 .   ? -3.012  7.154   10.688 1.00 90.78  ? 1270 HOH A O     1 
HETATM 5144 O O     . HOH F 4 .   ? -14.273 29.383  11.414 1.00 81.93  ? 1271 HOH A O     1 
HETATM 5145 O O     . HOH F 4 .   ? -27.362 -15.175 37.455 1.00 60.10  ? 1272 HOH A O     1 
HETATM 5146 O O     . HOH F 4 .   ? 27.613  18.370  33.506 1.00 80.94  ? 1273 HOH A O     1 
HETATM 5147 O O     . HOH F 4 .   ? -2.231  39.194  21.234 1.00 78.00  ? 1274 HOH A O     1 
HETATM 5148 O O     . HOH F 4 .   ? -9.528  -30.099 24.564 1.00 73.21  ? 1275 HOH A O     1 
HETATM 5149 O O     . HOH F 4 .   ? 13.536  -17.152 11.759 1.00 85.29  ? 1276 HOH A O     1 
HETATM 5150 O O     . HOH F 4 .   ? -14.872 0.688   31.303 1.00 78.89  ? 1277 HOH A O     1 
HETATM 5151 O O     . HOH F 4 .   ? 13.087  21.722  8.380  1.00 83.11  ? 1278 HOH A O     1 
HETATM 5152 O O     . HOH F 4 .   ? 16.287  -20.858 13.629 1.00 76.96  ? 1279 HOH A O     1 
HETATM 5153 O O     . HOH F 4 .   ? 4.653   8.084   24.544 1.00 29.54  ? 1282 HOH A O     1 
HETATM 5154 O O     . HOH F 4 .   ? -16.911 -29.450 40.761 1.00 63.45  ? 1283 HOH A O     1 
HETATM 5155 O O     . HOH F 4 .   ? 9.755   -7.532  29.025 1.00 69.28  ? 1285 HOH A O     1 
HETATM 5156 O O     . HOH F 4 .   ? 22.916  -18.437 39.513 1.00 53.63  ? 1286 HOH A O     1 
HETATM 5157 O O     . HOH F 4 .   ? -11.308 39.481  25.846 1.00 76.72  ? 1287 HOH A O     1 
HETATM 5158 O O     . HOH F 4 .   ? -12.720 -31.914 39.791 1.00 89.53  ? 1288 HOH A O     1 
HETATM 5159 O O     . HOH F 4 .   ? -5.943  8.688   13.732 1.00 71.60  ? 1289 HOH A O     1 
HETATM 5160 O O     . HOH F 4 .   ? -6.137  40.862  18.374 1.00 89.04  ? 1290 HOH A O     1 
HETATM 5161 O O     . HOH F 4 .   ? -30.121 -28.918 25.949 1.00 88.80  ? 1292 HOH A O     1 
HETATM 5162 O O     . HOH F 4 .   ? 32.409  -3.946  38.681 1.00 76.53  ? 1294 HOH A O     1 
HETATM 5163 O O     . HOH F 4 .   ? -5.335  -5.164  33.454 1.00 70.72  ? 1295 HOH A O     1 
HETATM 5164 O O     . HOH F 4 .   ? 13.119  7.850   19.771 1.00 73.08  ? 1296 HOH A O     1 
HETATM 5165 O O     . HOH F 4 .   ? 4.439   3.058   36.194 1.00 93.67  ? 1297 HOH A O     1 
HETATM 5166 O O     . HOH F 4 .   ? 5.887   6.791   14.000 1.00 60.95  ? 1298 HOH A O     1 
HETATM 5167 O O     . HOH F 4 .   ? 18.114  -18.137 13.505 1.00 87.65  ? 1300 HOH A O     1 
HETATM 5168 O O     . HOH F 4 .   ? 17.214  -27.030 29.618 1.00 72.28  ? 1301 HOH A O     1 
HETATM 5169 O O     . HOH F 4 .   ? -19.233 -34.592 24.733 1.00 74.23  ? 1302 HOH A O     1 
HETATM 5170 O O     . HOH F 4 .   ? 9.809   11.180  44.472 1.00 75.42  ? 1303 HOH A O     1 
HETATM 5171 O O     . HOH F 4 .   ? -3.805  32.582  25.385 1.00 66.88  ? 1304 HOH A O     1 
HETATM 5172 O O     . HOH F 4 .   ? 27.692  13.326  27.264 1.00 88.41  ? 1305 HOH A O     1 
HETATM 5173 O O     . HOH F 4 .   ? -0.773  16.583  32.359 1.00 60.32  ? 1306 HOH A O     1 
HETATM 5174 O O     . HOH F 4 .   ? -10.212 31.222  36.545 1.00 92.83  ? 1307 HOH A O     1 
HETATM 5175 O O     . HOH F 4 .   ? 14.465  8.764   52.183 1.00 79.68  ? 1308 HOH A O     1 
HETATM 5176 O O     . HOH F 4 .   ? 13.586  30.277  20.679 1.00 91.80  ? 1311 HOH A O     1 
HETATM 5177 O O     . HOH F 4 .   ? -27.137 -23.787 38.282 1.00 83.57  ? 1312 HOH A O     1 
HETATM 5178 O O     . HOH F 4 .   ? 12.994  12.770  5.958  1.00 73.30  ? 1313 HOH A O     1 
HETATM 5179 O O     . HOH F 4 .   ? 17.773  -0.280  50.517 1.00 68.15  ? 1314 HOH A O     1 
HETATM 5180 O O     . HOH F 4 .   ? 32.543  6.752   36.047 1.00 93.76  ? 1316 HOH A O     1 
HETATM 5181 O O     . HOH F 4 .   ? -27.668 -6.789  26.954 1.00 66.56  ? 1317 HOH A O     1 
HETATM 5182 O O     . HOH F 4 .   ? 13.102  -32.711 26.321 1.00 75.08  ? 1318 HOH A O     1 
HETATM 5183 O O     . HOH F 4 .   ? 11.127  21.952  52.302 1.00 80.99  ? 1319 HOH A O     1 
HETATM 5184 O O     . HOH F 4 .   ? 8.746   -19.999 14.500 1.00 85.18  ? 1320 HOH A O     1 
HETATM 5185 O O     . HOH F 4 .   ? -12.156 9.667   13.307 1.00 82.16  ? 1321 HOH A O     1 
HETATM 5186 O O     . HOH F 4 .   ? -22.250 -31.256 20.932 1.00 85.58  ? 1322 HOH A O     1 
HETATM 5187 O O     . HOH F 4 .   ? 19.077  13.757  10.608 1.00 77.06  ? 1325 HOH A O     1 
HETATM 5188 O O     . HOH F 4 .   ? 17.593  -23.799 54.623 1.00 75.35  ? 1326 HOH A O     1 
HETATM 5189 O O     . HOH F 4 .   ? -22.504 -3.378  35.030 1.00 76.76  ? 1327 HOH A O     1 
HETATM 5190 O O     . HOH F 4 .   ? 29.747  -16.034 21.007 1.00 69.98  ? 1328 HOH A O     1 
HETATM 5191 O O     . HOH F 4 .   ? 17.566  24.553  35.487 1.00 74.65  ? 1329 HOH A O     1 
HETATM 5192 O O     . HOH F 4 .   ? 0.975   -25.193 20.181 1.00 77.17  ? 1330 HOH A O     1 
HETATM 5193 O O     . HOH F 4 .   ? 16.354  -12.892 49.613 1.00 92.71  ? 1331 HOH A O     1 
HETATM 5194 O O     . HOH F 4 .   ? -14.139 5.135   17.659 1.00 84.80  ? 1333 HOH A O     1 
HETATM 5195 O O     . HOH F 4 .   ? 25.678  -14.768 41.373 1.00 85.29  ? 1334 HOH A O     1 
HETATM 5196 O O     . HOH F 4 .   ? 13.810  1.037   20.721 1.00 77.89  ? 1335 HOH A O     1 
HETATM 5197 O O     . HOH F 4 .   ? -6.124  9.231   10.101 1.00 83.53  ? 1336 HOH A O     1 
HETATM 5198 O O     . HOH F 4 .   ? 29.322  2.299   26.963 1.00 71.20  ? 1337 HOH A O     1 
HETATM 5199 O O     . HOH F 4 .   ? 23.725  0.158   35.199 1.00 78.38  ? 1338 HOH A O     1 
HETATM 5200 O O     . HOH F 4 .   ? 22.399  -22.669 30.460 1.00 81.07  ? 1340 HOH A O     1 
HETATM 5201 O O     . HOH F 4 .   ? 11.005  5.844   44.906 1.00 71.63  ? 1341 HOH A O     1 
HETATM 5202 O O     . HOH F 4 .   ? 29.697  -4.170  41.089 1.00 83.03  ? 1342 HOH A O     1 
HETATM 5203 O O     . HOH F 4 .   ? 24.025  -1.883  19.245 1.00 82.11  ? 1343 HOH A O     1 
HETATM 5204 O O     . HOH F 4 .   ? 7.470   1.934   34.536 1.00 62.00  ? 1344 HOH A O     1 
HETATM 5205 O O     . HOH F 4 .   ? 11.432  -5.853  49.676 1.00 68.86  ? 1345 HOH A O     1 
HETATM 5206 O O     . HOH F 4 .   ? -10.956 15.745  35.602 1.00 78.69  ? 1346 HOH A O     1 
HETATM 5207 O O     . HOH F 4 .   ? 19.065  19.805  15.266 1.00 88.27  ? 1347 HOH A O     1 
HETATM 5208 O O     . HOH F 4 .   ? -31.672 -26.956 42.962 1.00 82.24  ? 1348 HOH A O     1 
HETATM 5209 O O     . HOH F 4 .   ? -7.281  14.052  35.059 1.00 70.56  ? 1349 HOH A O     1 
HETATM 5210 O O     . HOH F 4 .   ? 5.322   -16.116 18.252 1.00 83.83  ? 1352 HOH A O     1 
HETATM 5211 O O     . HOH F 4 .   ? -4.798  -16.663 19.080 1.00 93.69  ? 1353 HOH A O     1 
HETATM 5212 O O     . HOH F 4 .   ? 14.062  2.671   31.901 1.00 43.61  ? 1354 HOH A O     1 
HETATM 5213 O O     . HOH F 4 .   ? 25.770  -7.088  27.368 1.00 69.27  ? 1357 HOH A O     1 
HETATM 5214 O O     . HOH F 4 .   ? -32.369 -25.155 32.181 1.00 93.42  ? 1358 HOH A O     1 
HETATM 5215 O O     . HOH F 4 .   ? -9.325  -26.909 22.954 1.00 91.39  ? 1360 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   0   ?   ?   ?   C . n 
A 1 2   DA  2   1   1   DA  A   C . n 
A 1 3   DA  3   2   2   DA  A   C . n 
A 1 4   DA  4   3   3   DA  A   C . n 
A 1 5   DA  5   4   4   DA  A   C . n 
A 1 6   DA  6   5   5   DA  A   C . n 
A 1 7   DG  7   6   6   DG  G   C . n 
A 1 8   DA  8   7   7   DA  A   C . n 
A 1 9   DC  9   8   8   DC  C   C . n 
A 1 10  DT  10  9   9   DT  T   C . n 
A 1 11  DC  11  10  10  DC  C   C . n 
A 1 12  DA  12  11  11  DA  A   C . n 
A 1 13  DG  13  12  12  DG  G   C . n 
A 1 14  DA  14  13  13  DA  A   C . n 
A 1 15  DA  15  14  14  DA  A   C . n 
A 1 16  DA  16  15  15  DA  A   C . n 
A 1 17  DA  17  16  16  DA  A   C . n 
A 1 18  DA  18  17  17  DA  A   C . n 
A 1 19  DT  19  18  18  DT  T   C . n 
A 1 20  DT  20  19  19  DT  T   C . n 
A 1 21  DT  21  20  20  DT  T   C . n 
A 1 22  DT  22  21  21  DT  T   C . n 
A 1 23  DT  23  22  22  DT  T   C . n 
B 2 1   DC  1   100 ?   ?   ?   D . n 
B 2 2   DA  2   101 101 DA  A   D . n 
B 2 3   DA  3   102 102 DA  A   D . n 
B 2 4   DA  4   103 103 DA  A   D . n 
B 2 5   DA  5   104 104 DA  A   D . n 
B 2 6   DA  6   105 105 DA  A   D . n 
B 2 7   DT  7   106 106 DT  T   D . n 
B 2 8   DT  8   107 107 DT  T   D . n 
B 2 9   DT  9   108 108 DT  T   D . n 
B 2 10  DT  10  109 109 DT  T   D . n 
B 2 11  DT  11  110 110 DT  T   D . n 
B 2 12  DC  12  111 111 DC  C   D . n 
B 2 13  DT  13  112 112 DT  T   D . n 
B 2 14  DG  14  113 113 DG  G   D . n 
B 2 15  DA  15  114 114 DA  A   D . n 
B 2 16  DG  16  115 115 DG  G   D . n 
B 2 17  DT  17  116 116 DT  T   D . n 
B 2 18  DC  18  117 117 DC  C   D . n 
B 2 19  DT  19  118 118 DT  T   D . n 
B 2 20  DT  20  119 119 DT  T   D . n 
B 2 21  DT  21  120 120 DT  T   D . n 
B 2 22  DT  22  121 121 DT  T   D . n 
B 2 23  DT  23  122 122 DT  T   D . n 
C 3 1   TRP 1   203 203 TRP TRP A . n 
C 3 2   LYS 2   204 204 LYS LYS A . n 
C 3 3   TRP 3   205 205 TRP TRP A . n 
C 3 4   TRP 4   206 206 TRP TRP A . n 
C 3 5   GLU 5   207 207 GLU GLU A . n 
C 3 6   GLU 6   208 208 GLU GLU A . n 
C 3 7   GLU 7   209 209 GLU GLU A . n 
C 3 8   ARG 8   210 210 ARG ARG A . n 
C 3 9   TYR 9   211 211 TYR TYR A . n 
C 3 10  PRO 10  212 212 PRO PRO A . n 
C 3 11  GLU 11  213 213 GLU GLU A . n 
C 3 12  GLY 12  214 214 GLY GLY A . n 
C 3 13  ILE 13  215 215 ILE ILE A . n 
C 3 14  LYS 14  216 216 LYS LYS A . n 
C 3 15  TRP 15  217 217 TRP TRP A . n 
C 3 16  LYS 16  218 218 LYS LYS A . n 
C 3 17  PHE 17  219 219 PHE PHE A . n 
C 3 18  LEU 18  220 220 LEU LEU A . n 
C 3 19  GLU 19  221 221 GLU GLU A . n 
C 3 20  HIS 20  222 222 HIS HIS A . n 
C 3 21  LYS 21  223 223 LYS LYS A . n 
C 3 22  GLY 22  224 224 GLY GLY A . n 
C 3 23  PRO 23  225 225 PRO PRO A . n 
C 3 24  VAL 24  226 226 VAL VAL A . n 
C 3 25  PHE 25  227 227 PHE PHE A . n 
C 3 26  ALA 26  228 228 ALA ALA A . n 
C 3 27  PRO 27  229 229 PRO PRO A . n 
C 3 28  PRO 28  230 230 PRO PRO A . n 
C 3 29  TYR 29  231 231 TYR TYR A . n 
C 3 30  GLU 30  232 232 GLU GLU A . n 
C 3 31  PRO 31  233 233 PRO PRO A . n 
C 3 32  LEU 32  234 234 LEU LEU A . n 
C 3 33  PRO 33  235 235 PRO PRO A . n 
C 3 34  GLU 34  236 236 GLU GLU A . n 
C 3 35  ASN 35  237 237 ASN ASN A . n 
C 3 36  VAL 36  238 238 VAL VAL A . n 
C 3 37  LYS 37  239 239 LYS LYS A . n 
C 3 38  PHE 38  240 240 PHE PHE A . n 
C 3 39  TYR 39  241 241 TYR TYR A . n 
C 3 40  TYR 40  242 242 TYR TYR A . n 
C 3 41  ASP 41  243 243 ASP ASP A . n 
C 3 42  GLY 42  244 244 GLY GLY A . n 
C 3 43  LYS 43  245 245 LYS LYS A . n 
C 3 44  VAL 44  246 246 VAL VAL A . n 
C 3 45  MET 45  247 247 MET MET A . n 
C 3 46  LYS 46  248 248 LYS LYS A . n 
C 3 47  LEU 47  249 249 LEU LEU A . n 
C 3 48  SER 48  250 250 SER SER A . n 
C 3 49  PRO 49  251 251 PRO PRO A . n 
C 3 50  LYS 50  252 252 LYS LYS A . n 
C 3 51  ALA 51  253 253 ALA ALA A . n 
C 3 52  GLU 52  254 254 GLU GLU A . n 
C 3 53  GLU 53  255 255 GLU GLU A . n 
C 3 54  VAL 54  256 256 VAL VAL A . n 
C 3 55  ALA 55  257 257 ALA ALA A . n 
C 3 56  THR 56  258 258 THR THR A . n 
C 3 57  PHE 57  259 259 PHE PHE A . n 
C 3 58  PHE 58  260 260 PHE PHE A . n 
C 3 59  ALA 59  261 261 ALA ALA A . n 
C 3 60  LYS 60  262 262 LYS LYS A . n 
C 3 61  MET 61  263 263 MET MET A . n 
C 3 62  LEU 62  264 264 LEU LEU A . n 
C 3 63  ASP 63  265 265 ASP ASP A . n 
C 3 64  HIS 64  266 266 HIS HIS A . n 
C 3 65  GLU 65  267 267 GLU GLU A . n 
C 3 66  TYR 66  268 268 TYR TYR A . n 
C 3 67  THR 67  269 269 THR THR A . n 
C 3 68  THR 68  270 270 THR THR A . n 
C 3 69  LYS 69  271 271 LYS LYS A . n 
C 3 70  GLU 70  272 272 GLU GLU A . n 
C 3 71  ILE 71  273 273 ILE ILE A . n 
C 3 72  PHE 72  274 274 PHE PHE A . n 
C 3 73  ARG 73  275 275 ARG ARG A . n 
C 3 74  LYS 74  276 276 LYS LYS A . n 
C 3 75  ASN 75  277 277 ASN ASN A . n 
C 3 76  PHE 76  278 278 PHE PHE A . n 
C 3 77  PHE 77  279 279 PHE PHE A . n 
C 3 78  LYS 78  280 280 LYS LYS A . n 
C 3 79  ASP 79  281 281 ASP ASP A . n 
C 3 80  TRP 80  282 282 TRP TRP A . n 
C 3 81  ARG 81  283 283 ARG ARG A . n 
C 3 82  LYS 82  284 284 LYS LYS A . n 
C 3 83  GLU 83  285 285 GLU GLU A . n 
C 3 84  MET 84  286 286 MET MET A . n 
C 3 85  THR 85  287 287 THR THR A . n 
C 3 86  ASN 86  288 288 ASN ASN A . n 
C 3 87  GLU 87  289 289 GLU GLU A . n 
C 3 88  GLU 88  290 290 GLU GLU A . n 
C 3 89  LYS 89  291 291 LYS LYS A . n 
C 3 90  ASN 90  292 292 ASN ASN A . n 
C 3 91  ILE 91  293 293 ILE ILE A . n 
C 3 92  ILE 92  294 294 ILE ILE A . n 
C 3 93  THR 93  295 295 THR THR A . n 
C 3 94  ASN 94  296 296 ASN ASN A . n 
C 3 95  LEU 95  297 297 LEU LEU A . n 
C 3 96  SER 96  298 298 SER SER A . n 
C 3 97  LYS 97  299 299 LYS LYS A . n 
C 3 98  CYS 98  300 300 CYS CYS A . n 
C 3 99  ASP 99  301 301 ASP ASP A . n 
C 3 100 PHE 100 302 302 PHE PHE A . n 
C 3 101 THR 101 303 303 THR THR A . n 
C 3 102 GLN 102 304 304 GLN GLN A . n 
C 3 103 MET 103 305 305 MET MET A . n 
C 3 104 SER 104 306 306 SER SER A . n 
C 3 105 GLN 105 307 307 GLN GLN A . n 
C 3 106 TYR 106 308 308 TYR TYR A . n 
C 3 107 PHE 107 309 309 PHE PHE A . n 
C 3 108 LYS 108 310 310 LYS LYS A . n 
C 3 109 ALA 109 311 311 ALA ALA A . n 
C 3 110 GLN 110 312 312 GLN GLN A . n 
C 3 111 THR 111 313 313 THR THR A . n 
C 3 112 GLU 112 314 314 GLU GLU A . n 
C 3 113 ALA 113 315 315 ALA ALA A . n 
C 3 114 ARG 114 316 316 ARG ARG A . n 
C 3 115 LYS 115 317 317 LYS LYS A . n 
C 3 116 GLN 116 318 318 GLN GLN A . n 
C 3 117 MET 117 319 319 MET MET A . n 
C 3 118 SER 118 320 320 SER SER A . n 
C 3 119 LYS 119 321 321 LYS LYS A . n 
C 3 120 GLU 120 322 322 GLU GLU A . n 
C 3 121 GLU 121 323 323 GLU GLU A . n 
C 3 122 LYS 122 324 324 LYS LYS A . n 
C 3 123 LEU 123 325 325 LEU LEU A . n 
C 3 124 LYS 124 326 326 LYS LYS A . n 
C 3 125 ILE 125 327 327 ILE ILE A . n 
C 3 126 LYS 126 328 328 LYS LYS A . n 
C 3 127 GLU 127 329 329 GLU GLU A . n 
C 3 128 GLU 128 330 330 GLU GLU A . n 
C 3 129 ASN 129 331 331 ASN ASN A . n 
C 3 130 GLU 130 332 332 GLU GLU A . n 
C 3 131 LYS 131 333 333 LYS LYS A . n 
C 3 132 LEU 132 334 334 LEU LEU A . n 
C 3 133 LEU 133 335 335 LEU LEU A . n 
C 3 134 LYS 134 336 336 LYS LYS A . n 
C 3 135 GLU 135 337 337 GLU GLU A . n 
C 3 136 TYR 136 338 338 TYR TYR A . n 
C 3 137 GLY 137 339 339 GLY GLY A . n 
C 3 138 PHE 138 340 340 PHE PHE A . n 
C 3 139 CYS 139 341 341 CYS CYS A . n 
C 3 140 ILE 140 342 342 ILE ILE A . n 
C 3 141 MET 141 343 343 MET MET A . n 
C 3 142 ASP 142 344 344 ASP ASP A . n 
C 3 143 ASN 143 345 345 ASN ASN A . n 
C 3 144 HIS 144 346 346 HIS HIS A . n 
C 3 145 LYS 145 347 347 LYS LYS A . n 
C 3 146 GLU 146 348 348 GLU GLU A . n 
C 3 147 ARG 147 349 349 ARG ARG A . n 
C 3 148 ILE 148 350 350 ILE ILE A . n 
C 3 149 ALA 149 351 351 ALA ALA A . n 
C 3 150 ASN 150 352 352 ASN ASN A . n 
C 3 151 PHE 151 353 353 PHE PHE A . n 
C 3 152 LYS 152 354 354 LYS LYS A . n 
C 3 153 ILE 153 355 355 ILE ILE A . n 
C 3 154 GLU 154 356 356 GLU GLU A . n 
C 3 155 PRO 155 357 357 PRO PRO A . n 
C 3 156 PRO 156 358 358 PRO PRO A . n 
C 3 157 GLY 157 359 359 GLY GLY A . n 
C 3 158 LEU 158 360 360 LEU LEU A . n 
C 3 159 PHE 159 361 361 PHE PHE A . n 
C 3 160 ARG 160 362 362 ARG ARG A . n 
C 3 161 GLY 161 363 363 GLY GLY A . n 
C 3 162 ARG 162 364 364 ARG ARG A . n 
C 3 163 GLY 163 365 365 GLY GLY A . n 
C 3 164 ASN 164 366 366 ASN ASN A . n 
C 3 165 HIS 165 367 367 HIS HIS A . n 
C 3 166 PRO 166 368 368 PRO PRO A . n 
C 3 167 LYS 167 369 369 LYS LYS A . n 
C 3 168 MET 168 370 370 MET MET A . n 
C 3 169 GLY 169 371 371 GLY GLY A . n 
C 3 170 MET 170 372 372 MET MET A . n 
C 3 171 LEU 171 373 373 LEU LEU A . n 
C 3 172 LYS 172 374 374 LYS LYS A . n 
C 3 173 ARG 173 375 375 ARG ARG A . n 
C 3 174 ARG 174 376 376 ARG ARG A . n 
C 3 175 ILE 175 377 377 ILE ILE A . n 
C 3 176 MET 176 378 378 MET MET A . n 
C 3 177 PRO 177 379 379 PRO PRO A . n 
C 3 178 GLU 178 380 380 GLU GLU A . n 
C 3 179 ASP 179 381 381 ASP ASP A . n 
C 3 180 ILE 180 382 382 ILE ILE A . n 
C 3 181 ILE 181 383 383 ILE ILE A . n 
C 3 182 ILE 182 384 384 ILE ILE A . n 
C 3 183 ASN 183 385 385 ASN ASN A . n 
C 3 184 CYS 184 386 386 CYS CYS A . n 
C 3 185 SER 185 387 387 SER SER A . n 
C 3 186 LYS 186 388 388 LYS LYS A . n 
C 3 187 ASP 187 389 389 ASP ASP A . n 
C 3 188 ALA 188 390 390 ALA ALA A . n 
C 3 189 LYS 189 391 391 LYS LYS A . n 
C 3 190 VAL 190 392 392 VAL VAL A . n 
C 3 191 PRO 191 393 393 PRO PRO A . n 
C 3 192 SER 192 394 394 SER SER A . n 
C 3 193 PRO 193 395 395 PRO PRO A . n 
C 3 194 PRO 194 396 396 PRO PRO A . n 
C 3 195 PRO 195 397 397 PRO PRO A . n 
C 3 196 GLY 196 398 398 GLY GLY A . n 
C 3 197 HIS 197 399 399 HIS HIS A . n 
C 3 198 LYS 198 400 400 LYS LYS A . n 
C 3 199 TRP 199 401 401 TRP TRP A . n 
C 3 200 LYS 200 402 402 LYS LYS A . n 
C 3 201 GLU 201 403 403 GLU GLU A . n 
C 3 202 VAL 202 404 404 VAL VAL A . n 
C 3 203 ARG 203 405 405 ARG ARG A . n 
C 3 204 HIS 204 406 406 HIS HIS A . n 
C 3 205 ASP 205 407 407 ASP ASP A . n 
C 3 206 ASN 206 408 408 ASN ASN A . n 
C 3 207 LYS 207 409 409 LYS LYS A . n 
C 3 208 VAL 208 410 410 VAL VAL A . n 
C 3 209 THR 209 411 411 THR THR A . n 
C 3 210 TRP 210 412 412 TRP TRP A . n 
C 3 211 LEU 211 413 413 LEU LEU A . n 
C 3 212 VAL 212 414 414 VAL VAL A . n 
C 3 213 SER 213 415 415 SER SER A . n 
C 3 214 TRP 214 416 416 TRP TRP A . n 
C 3 215 THR 215 417 417 THR THR A . n 
C 3 216 GLU 216 418 418 GLU GLU A . n 
C 3 217 ASN 217 419 419 ASN ASN A . n 
C 3 218 ILE 218 420 420 ILE ILE A . n 
C 3 219 GLN 219 421 421 GLN GLN A . n 
C 3 220 GLY 220 422 422 GLY GLY A . n 
C 3 221 SER 221 423 423 SER SER A . n 
C 3 222 ILE 222 424 424 ILE ILE A . n 
C 3 223 LYS 223 425 425 LYS LYS A . n 
C 3 224 TYR 224 426 426 TYR TYR A . n 
C 3 225 ILE 225 427 427 ILE ILE A . n 
C 3 226 MET 226 428 428 MET MET A . n 
C 3 227 LEU 227 429 429 LEU LEU A . n 
C 3 228 ASN 228 430 430 ASN ASN A . n 
C 3 229 PRO 229 431 431 PRO PRO A . n 
C 3 230 SER 230 432 432 SER SER A . n 
C 3 231 SER 231 433 433 SER SER A . n 
C 3 232 ARG 232 434 434 ARG ARG A . n 
C 3 233 ILE 233 435 435 ILE ILE A . n 
C 3 234 LYS 234 436 436 LYS LYS A . n 
C 3 235 GLY 235 437 437 GLY GLY A . n 
C 3 236 GLU 236 438 438 GLU GLU A . n 
C 3 237 LYS 237 439 439 LYS LYS A . n 
C 3 238 ASP 238 440 440 ASP ASP A . n 
C 3 239 TRP 239 441 441 TRP TRP A . n 
C 3 240 GLN 240 442 442 GLN GLN A . n 
C 3 241 LYS 241 443 443 LYS LYS A . n 
C 3 242 TYR 242 444 444 TYR TYR A . n 
C 3 243 GLU 243 445 445 GLU GLU A . n 
C 3 244 THR 244 446 446 THR THR A . n 
C 3 245 ALA 245 447 447 ALA ALA A . n 
C 3 246 ARG 246 448 448 ARG ARG A . n 
C 3 247 ARG 247 449 449 ARG ARG A . n 
C 3 248 LEU 248 450 450 LEU LEU A . n 
C 3 249 LYS 249 451 451 LYS LYS A . n 
C 3 250 LYS 250 452 452 LYS LYS A . n 
C 3 251 CYS 251 453 453 CYS CYS A . n 
C 3 252 VAL 252 454 454 VAL VAL A . n 
C 3 253 ASP 253 455 455 ASP ASP A . n 
C 3 254 LYS 254 456 456 LYS LYS A . n 
C 3 255 ILE 255 457 457 ILE ILE A . n 
C 3 256 ARG 256 458 458 ARG ARG A . n 
C 3 257 ASN 257 459 459 ASN ASN A . n 
C 3 258 GLN 258 460 460 GLN GLN A . n 
C 3 259 TYR 259 461 461 TYR TYR A . n 
C 3 260 ARG 260 462 462 ARG ARG A . n 
C 3 261 GLU 261 463 463 GLU GLU A . n 
C 3 262 ASP 262 464 464 ASP ASP A . n 
C 3 263 TRP 263 465 465 TRP TRP A . n 
C 3 264 LYS 264 466 466 LYS LYS A . n 
C 3 265 SER 265 467 467 SER SER A . n 
C 3 266 LYS 266 468 468 LYS LYS A . n 
C 3 267 GLU 267 469 469 GLU GLU A . n 
C 3 268 MET 268 470 470 MET MET A . n 
C 3 269 LYS 269 471 471 LYS LYS A . n 
C 3 270 VAL 270 472 472 VAL VAL A . n 
C 3 271 ARG 271 473 473 ARG ARG A . n 
C 3 272 GLN 272 474 474 GLN GLN A . n 
C 3 273 ARG 273 475 475 ARG ARG A . n 
C 3 274 ALA 274 476 476 ALA ALA A . n 
C 3 275 VAL 275 477 477 VAL VAL A . n 
C 3 276 ALA 276 478 478 ALA ALA A . n 
C 3 277 LEU 277 479 479 LEU LEU A . n 
C 3 278 TYR 278 480 480 TYR TYR A . n 
C 3 279 PHE 279 481 481 PHE PHE A . n 
C 3 280 ILE 280 482 482 ILE ILE A . n 
C 3 281 ASP 281 483 483 ASP ASP A . n 
C 3 282 LYS 282 484 484 LYS LYS A . n 
C 3 283 LEU 283 485 485 LEU LEU A . n 
C 3 284 ALA 284 486 486 ALA ALA A . n 
C 3 285 LEU 285 487 487 LEU LEU A . n 
C 3 286 ARG 286 488 488 ARG ARG A . n 
C 3 287 ALA 287 489 489 ALA ALA A . n 
C 3 288 GLY 288 490 490 GLY GLY A . n 
C 3 289 ASN 289 491 491 ASN ASN A . n 
C 3 290 GLU 290 492 492 GLU GLU A . n 
C 3 291 LYS 291 493 493 LYS LYS A . n 
C 3 292 GLU 292 494 494 GLU GLU A . n 
C 3 293 GLU 293 495 495 GLU GLU A . n 
C 3 294 GLY 294 496 496 GLY GLY A . n 
C 3 295 GLU 295 497 497 GLU GLU A . n 
C 3 296 THR 296 498 498 THR THR A . n 
C 3 297 ALA 297 499 499 ALA ALA A . n 
C 3 298 ASP 298 500 500 ASP ASP A . n 
C 3 299 THR 299 501 501 THR THR A . n 
C 3 300 VAL 300 502 502 VAL VAL A . n 
C 3 301 GLY 301 503 503 GLY GLY A . n 
C 3 302 CYS 302 504 504 CYS CYS A . n 
C 3 303 CYS 303 505 505 CYS CYS A . n 
C 3 304 SER 304 506 506 SER SER A . n 
C 3 305 LEU 305 507 507 LEU LEU A . n 
C 3 306 ARG 306 508 508 ARG ARG A . n 
C 3 307 VAL 307 509 509 VAL VAL A . n 
C 3 308 GLU 308 510 510 GLU GLU A . n 
C 3 309 HIS 309 511 511 HIS HIS A . n 
C 3 310 ILE 310 512 512 ILE ILE A . n 
C 3 311 ASN 311 513 513 ASN ASN A . n 
C 3 312 LEU 312 514 514 LEU LEU A . n 
C 3 313 HIS 313 515 515 HIS HIS A . n 
C 3 314 PRO 314 516 516 PRO PRO A . n 
C 3 315 GLU 315 517 517 GLU GLU A . n 
C 3 316 LEU 316 518 518 LEU LEU A . n 
C 3 317 ASP 317 519 519 ASP ASP A . n 
C 3 318 GLY 318 520 520 GLY GLY A . n 
C 3 319 GLN 319 521 521 GLN GLN A . n 
C 3 320 GLU 320 522 522 GLU GLU A . n 
C 3 321 TYR 321 523 523 TYR TYR A . n 
C 3 322 VAL 322 524 524 VAL VAL A . n 
C 3 323 VAL 323 525 525 VAL VAL A . n 
C 3 324 GLU 324 526 526 GLU GLU A . n 
C 3 325 PHE 325 527 527 PHE PHE A . n 
C 3 326 ASP 326 528 528 ASP ASP A . n 
C 3 327 PHE 327 529 529 PHE PHE A . n 
C 3 328 LEU 328 530 530 LEU LEU A . n 
C 3 329 GLY 329 531 531 GLY GLY A . n 
C 3 330 LYS 330 532 532 LYS LYS A . n 
C 3 331 ASP 331 533 533 ASP ASP A . n 
C 3 332 SER 332 534 534 SER SER A . n 
C 3 333 ILE 333 535 535 ILE ILE A . n 
C 3 334 ARG 334 536 536 ARG ARG A . n 
C 3 335 TYR 335 537 537 TYR TYR A . n 
C 3 336 TYR 336 538 538 TYR TYR A . n 
C 3 337 ASN 337 539 539 ASN ASN A . n 
C 3 338 LYS 338 540 540 LYS LYS A . n 
C 3 339 VAL 339 541 541 VAL VAL A . n 
C 3 340 PRO 340 542 542 PRO PRO A . n 
C 3 341 VAL 341 543 543 VAL VAL A . n 
C 3 342 GLU 342 544 544 GLU GLU A . n 
C 3 343 LYS 343 545 545 LYS LYS A . n 
C 3 344 ARG 344 546 546 ARG ARG A . n 
C 3 345 VAL 345 547 547 VAL VAL A . n 
C 3 346 PHE 346 548 548 PHE PHE A . n 
C 3 347 LYS 347 549 549 LYS LYS A . n 
C 3 348 ASN 348 550 550 ASN ASN A . n 
C 3 349 LEU 349 551 551 LEU LEU A . n 
C 3 350 GLN 350 552 552 GLN GLN A . n 
C 3 351 LEU 351 553 553 LEU LEU A . n 
C 3 352 PHE 352 554 554 PHE PHE A . n 
C 3 353 MET 353 555 555 MET MET A . n 
C 3 354 GLU 354 556 556 GLU GLU A . n 
C 3 355 ASN 355 557 557 ASN ASN A . n 
C 3 356 LYS 356 558 558 LYS LYS A . n 
C 3 357 GLN 357 559 559 GLN GLN A . n 
C 3 358 PRO 358 560 560 PRO PRO A . n 
C 3 359 GLU 359 561 561 GLU GLU A . n 
C 3 360 ASP 360 562 562 ASP ASP A . n 
C 3 361 ASP 361 563 563 ASP ASP A . n 
C 3 362 LEU 362 564 564 LEU LEU A . n 
C 3 363 PHE 363 565 565 PHE PHE A . n 
C 3 364 ASP 364 566 566 ASP ASP A . n 
C 3 365 ARG 365 567 567 ARG ARG A . n 
C 3 366 LEU 366 568 568 LEU LEU A . n 
C 3 367 ASN 367 569 569 ASN ASN A . n 
C 3 368 THR 368 570 570 THR THR A . n 
C 3 369 GLY 369 571 571 GLY GLY A . n 
C 3 370 ILE 370 572 572 ILE ILE A . n 
C 3 371 LEU 371 573 573 LEU LEU A . n 
C 3 372 ASN 372 574 574 ASN ASN A . n 
C 3 373 LYS 373 575 575 LYS LYS A . n 
C 3 374 HIS 374 576 576 HIS HIS A . n 
C 3 375 LEU 375 577 577 LEU LEU A . n 
C 3 376 GLN 376 578 578 GLN GLN A . n 
C 3 377 ASP 377 579 579 ASP ASP A . n 
C 3 378 LEU 378 580 580 LEU LEU A . n 
C 3 379 MET 379 581 581 MET MET A . n 
C 3 380 GLU 380 582 582 GLU GLU A . n 
C 3 381 GLY 381 583 583 GLY GLY A . n 
C 3 382 LEU 382 584 584 LEU LEU A . n 
C 3 383 THR 383 585 585 THR THR A . n 
C 3 384 ALA 384 586 586 ALA ALA A . n 
C 3 385 LYS 385 587 587 LYS LYS A . n 
C 3 386 VAL 386 588 588 VAL VAL A . n 
C 3 387 PHE 387 589 589 PHE PHE A . n 
C 3 388 ARG 388 590 590 ARG ARG A . n 
C 3 389 THR 389 591 591 THR THR A . n 
C 3 390 TYR 390 592 592 TYR TYR A . n 
C 3 391 ASN 391 593 593 ASN ASN A . n 
C 3 392 ALA 392 594 594 ALA ALA A . n 
C 3 393 SER 393 595 595 SER SER A . n 
C 3 394 ILE 394 596 596 ILE ILE A . n 
C 3 395 THR 395 597 597 THR THR A . n 
C 3 396 LEU 396 598 598 LEU LEU A . n 
C 3 397 GLN 397 599 599 GLN GLN A . n 
C 3 398 GLN 398 600 600 GLN GLN A . n 
C 3 399 GLN 399 601 601 GLN GLN A . n 
C 3 400 LEU 400 602 602 LEU LEU A . n 
C 3 401 LYS 401 603 603 LYS LYS A . n 
C 3 402 GLU 402 604 604 GLU GLU A . n 
C 3 403 LEU 403 605 605 LEU LEU A . n 
C 3 404 THR 404 606 606 THR THR A . n 
C 3 405 ALA 405 607 607 ALA ALA A . n 
C 3 406 PRO 406 608 608 PRO PRO A . n 
C 3 407 ASP 407 609 609 ASP ASP A . n 
C 3 408 GLU 408 610 610 GLU GLU A . n 
C 3 409 ASN 409 611 611 ASN ASN A . n 
C 3 410 ILE 410 612 612 ILE ILE A . n 
C 3 411 PRO 411 613 613 PRO PRO A . n 
C 3 412 ALA 412 614 614 ALA ALA A . n 
C 3 413 LYS 413 615 615 LYS LYS A . n 
C 3 414 ILE 414 616 616 ILE ILE A . n 
C 3 415 LEU 415 617 617 LEU LEU A . n 
C 3 416 SER 416 618 618 SER SER A . n 
C 3 417 TYR 417 619 619 TYR TYR A . n 
C 3 418 ASN 418 620 620 ASN ASN A . n 
C 3 419 ARG 419 621 621 ARG ARG A . n 
C 3 420 ALA 420 622 622 ALA ALA A . n 
C 3 421 ASN 421 623 623 ASN ASN A . n 
C 3 422 ARG 422 624 624 ARG ARG A . n 
C 3 423 ALA 423 625 625 ALA ALA A . n 
C 3 424 VAL 424 626 626 VAL VAL A . n 
C 3 425 ALA 425 627 627 ALA ALA A . n 
C 3 426 ILE 426 628 628 ILE ILE A . n 
C 3 427 LEU 427 629 629 LEU LEU A . n 
C 3 428 CYS 428 630 630 CYS CYS A . n 
C 3 429 ASN 429 631 631 ASN ASN A . n 
C 3 430 HIS 430 632 632 HIS HIS A . n 
C 3 431 GLN 431 633 633 GLN GLN A . n 
C 3 432 ILE 432 634 ?   ?   ?   A . n 
C 3 433 ALA 433 635 ?   ?   ?   A . n 
C 3 434 PRO 434 636 ?   ?   ?   A . n 
C 3 435 PRO 435 637 ?   ?   ?   A . n 
C 3 436 LYS 436 638 ?   ?   ?   A . n 
C 3 437 THR 437 639 ?   ?   ?   A . n 
C 3 438 PHE 438 640 ?   ?   ?   A . n 
C 3 439 GLU 439 641 ?   ?   ?   A . n 
C 3 440 LYS 440 642 ?   ?   ?   A . n 
C 3 441 SER 441 643 ?   ?   ?   A . n 
C 3 442 MET 442 644 ?   ?   ?   A . n 
C 3 443 MET 443 645 ?   ?   ?   A . n 
C 3 444 ASN 444 646 ?   ?   ?   A . n 
C 3 445 LEU 445 647 ?   ?   ?   A . n 
C 3 446 GLN 446 648 ?   ?   ?   A . n 
C 3 447 THR 447 649 ?   ?   ?   A . n 
C 3 448 LYS 448 650 ?   ?   ?   A . n 
C 3 449 ILE 449 651 ?   ?   ?   A . n 
C 3 450 ASP 450 652 ?   ?   ?   A . n 
C 3 451 ALA 451 653 ?   ?   ?   A . n 
C 3 452 LYS 452 654 ?   ?   ?   A . n 
C 3 453 LYS 453 655 ?   ?   ?   A . n 
C 3 454 GLU 454 656 ?   ?   ?   A . n 
C 3 455 GLN 455 657 ?   ?   ?   A . n 
C 3 456 LEU 456 658 ?   ?   ?   A . n 
C 3 457 ALA 457 659 ?   ?   ?   A . n 
C 3 458 ASP 458 660 ?   ?   ?   A . n 
C 3 459 ALA 459 661 ?   ?   ?   A . n 
C 3 460 ARG 460 662 ?   ?   ?   A . n 
C 3 461 ARG 461 663 ?   ?   ?   A . n 
C 3 462 ASP 462 664 ?   ?   ?   A . n 
C 3 463 LEU 463 665 ?   ?   ?   A . n 
C 3 464 LYS 464 666 ?   ?   ?   A . n 
C 3 465 SER 465 667 ?   ?   ?   A . n 
C 3 466 ALA 466 668 ?   ?   ?   A . n 
C 3 467 LYS 467 669 ?   ?   ?   A . n 
C 3 468 ALA 468 670 ?   ?   ?   A . n 
C 3 469 ASP 469 671 ?   ?   ?   A . n 
C 3 470 ALA 470 672 ?   ?   ?   A . n 
C 3 471 LYS 471 673 ?   ?   ?   A . n 
C 3 472 VAL 472 674 ?   ?   ?   A . n 
C 3 473 MET 473 675 ?   ?   ?   A . n 
C 3 474 LYS 474 676 ?   ?   ?   A . n 
C 3 475 ASP 475 677 ?   ?   ?   A . n 
C 3 476 ALA 476 678 ?   ?   ?   A . n 
C 3 477 LYS 477 679 ?   ?   ?   A . n 
C 3 478 THR 478 680 ?   ?   ?   A . n 
C 3 479 LYS 479 681 ?   ?   ?   A . n 
C 3 480 LYS 480 682 ?   ?   ?   A . n 
C 3 481 VAL 481 683 ?   ?   ?   A . n 
C 3 482 VAL 482 684 ?   ?   ?   A . n 
C 3 483 GLU 483 685 ?   ?   ?   A . n 
C 3 484 SER 484 686 ?   ?   ?   A . n 
C 3 485 LYS 485 687 ?   ?   ?   A . n 
C 3 486 LYS 486 688 ?   ?   ?   A . n 
C 3 487 LYS 487 689 ?   ?   ?   A . n 
C 3 488 ALA 488 690 ?   ?   ?   A . n 
C 3 489 VAL 489 691 ?   ?   ?   A . n 
C 3 490 GLN 490 692 ?   ?   ?   A . n 
C 3 491 ARG 491 693 ?   ?   ?   A . n 
C 3 492 LEU 492 694 ?   ?   ?   A . n 
C 3 493 GLU 493 695 ?   ?   ?   A . n 
C 3 494 GLU 494 696 ?   ?   ?   A . n 
C 3 495 GLN 495 697 ?   ?   ?   A . n 
C 3 496 LEU 496 698 ?   ?   ?   A . n 
C 3 497 MET 497 699 ?   ?   ?   A . n 
C 3 498 LYS 498 700 ?   ?   ?   A . n 
C 3 499 LEU 499 701 ?   ?   ?   A . n 
C 3 500 GLU 500 702 ?   ?   ?   A . n 
C 3 501 VAL 501 703 ?   ?   ?   A . n 
C 3 502 GLN 502 704 ?   ?   ?   A . n 
C 3 503 ALA 503 705 ?   ?   ?   A . n 
C 3 504 THR 504 706 ?   ?   ?   A . n 
C 3 505 ASP 505 707 ?   ?   ?   A . n 
C 3 506 ARG 506 708 ?   ?   ?   A . n 
C 3 507 GLU 507 709 ?   ?   ?   A . n 
C 3 508 GLU 508 710 ?   ?   ?   A . n 
C 3 509 ASN 509 711 ?   ?   ?   A . n 
C 3 510 LYS 510 712 ?   ?   ?   A . n 
C 3 511 GLN 511 713 ?   ?   ?   A . n 
C 3 512 ILE 512 714 714 ILE ILE A . n 
C 3 513 ALA 513 715 715 ALA ALA A . n 
C 3 514 LEU 514 716 716 LEU LEU A . n 
C 3 515 GLY 515 717 717 GLY GLY A . n 
C 3 516 THR 516 718 718 THR THR A . n 
C 3 517 SER 517 719 719 SER SER A . n 
C 3 518 LYS 518 720 720 LYS LYS A . n 
C 3 519 LEU 519 721 721 LEU LEU A . n 
C 3 520 ASN 520 722 722 ASN ASN A . n 
C 3 521 PHE 521 723 723 PHE PHE A . n 
C 3 522 LEU 522 724 724 LEU LEU A . n 
C 3 523 ASP 523 725 725 ASP ASP A . n 
C 3 524 PRO 524 726 726 PRO PRO A . n 
C 3 525 ARG 525 727 727 ARG ARG A . n 
C 3 526 ILE 526 728 728 ILE ILE A . n 
C 3 527 THR 527 729 729 THR THR A . n 
C 3 528 VAL 528 730 730 VAL VAL A . n 
C 3 529 ALA 529 731 731 ALA ALA A . n 
C 3 530 TRP 530 732 732 TRP TRP A . n 
C 3 531 CYS 531 733 733 CYS CYS A . n 
C 3 532 LYS 532 734 734 LYS LYS A . n 
C 3 533 LYS 533 735 735 LYS LYS A . n 
C 3 534 TRP 534 736 736 TRP TRP A . n 
C 3 535 GLY 535 737 737 GLY GLY A . n 
C 3 536 VAL 536 738 738 VAL VAL A . n 
C 3 537 PRO 537 739 739 PRO PRO A . n 
C 3 538 ILE 538 740 740 ILE ILE A . n 
C 3 539 GLU 539 741 741 GLU GLU A . n 
C 3 540 LYS 540 742 742 LYS LYS A . n 
C 3 541 ILE 541 743 743 ILE ILE A . n 
C 3 542 TYR 542 744 744 TYR TYR A . n 
C 3 543 ASN 543 745 745 ASN ASN A . n 
C 3 544 LYS 544 746 746 LYS LYS A . n 
C 3 545 THR 545 747 747 THR THR A . n 
C 3 546 GLN 546 748 748 GLN GLN A . n 
C 3 547 ARG 547 749 749 ARG ARG A . n 
C 3 548 GLU 548 750 750 GLU GLU A . n 
C 3 549 LYS 549 751 751 LYS LYS A . n 
C 3 550 PHE 550 752 752 PHE PHE A . n 
C 3 551 ALA 551 753 753 ALA ALA A . n 
C 3 552 TRP 552 754 754 TRP TRP A . n 
C 3 553 ALA 553 755 755 ALA ALA A . n 
C 3 554 ILE 554 756 756 ILE ILE A . n 
C 3 555 ASP 555 757 757 ASP ASP A . n 
C 3 556 MET 556 758 758 MET MET A . n 
C 3 557 ALA 557 759 759 ALA ALA A . n 
C 3 558 ASP 558 760 760 ASP ASP A . n 
C 3 559 GLU 559 761 761 GLU GLU A . n 
C 3 560 ASP 560 762 762 ASP ASP A . n 
C 3 561 TYR 561 763 763 TYR TYR A . n 
C 3 562 GLU 562 764 764 GLU GLU A . n 
C 3 563 PHE 563 765 765 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   1020 1020 HOH WAT C . 
D 4 HOH 2   1034 1034 HOH WAT C . 
D 4 HOH 3   1050 1050 HOH WAT C . 
D 4 HOH 4   1063 1063 HOH WAT C . 
D 4 HOH 5   1070 1070 HOH WAT C . 
D 4 HOH 6   1087 1087 HOH WAT C . 
D 4 HOH 7   1098 1098 HOH WAT C . 
D 4 HOH 8   1111 1111 HOH WAT C . 
D 4 HOH 9   1133 1133 HOH WAT C . 
D 4 HOH 10  1145 1145 HOH WAT C . 
D 4 HOH 11  1146 1146 HOH WAT C . 
D 4 HOH 12  1165 1165 HOH WAT C . 
D 4 HOH 13  1166 1166 HOH WAT C . 
D 4 HOH 14  1180 1180 HOH WAT C . 
D 4 HOH 15  1196 1196 HOH WAT C . 
D 4 HOH 16  1197 1197 HOH WAT C . 
D 4 HOH 17  1205 1205 HOH WAT C . 
D 4 HOH 18  1229 1229 HOH WAT C . 
D 4 HOH 19  1244 1244 HOH WAT C . 
D 4 HOH 20  1254 1254 HOH WAT C . 
D 4 HOH 21  1256 1256 HOH WAT C . 
D 4 HOH 22  1257 1257 HOH WAT C . 
D 4 HOH 23  1261 1261 HOH WAT C . 
D 4 HOH 24  1268 1268 HOH WAT C . 
D 4 HOH 25  1284 1284 HOH WAT C . 
D 4 HOH 26  1291 1291 HOH WAT C . 
D 4 HOH 27  1293 1293 HOH WAT C . 
D 4 HOH 28  1310 1310 HOH WAT C . 
D 4 HOH 29  1324 1324 HOH WAT C . 
D 4 HOH 30  1350 1350 HOH WAT C . 
D 4 HOH 31  1351 1351 HOH WAT C . 
D 4 HOH 32  1356 1356 HOH WAT C . 
D 4 HOH 33  1359 1359 HOH WAT C . 
E 4 HOH 1   1002 1002 HOH WAT D . 
E 4 HOH 2   1008 1008 HOH WAT D . 
E 4 HOH 3   1013 1013 HOH WAT D . 
E 4 HOH 4   1016 1016 HOH WAT D . 
E 4 HOH 5   1017 1017 HOH WAT D . 
E 4 HOH 6   1024 1024 HOH WAT D . 
E 4 HOH 7   1037 1037 HOH WAT D . 
E 4 HOH 8   1041 1041 HOH WAT D . 
E 4 HOH 9   1052 1052 HOH WAT D . 
E 4 HOH 10  1060 1060 HOH WAT D . 
E 4 HOH 11  1064 1064 HOH WAT D . 
E 4 HOH 12  1065 1065 HOH WAT D . 
E 4 HOH 13  1066 1066 HOH WAT D . 
E 4 HOH 14  1072 1072 HOH WAT D . 
E 4 HOH 15  1077 1077 HOH WAT D . 
E 4 HOH 16  1083 1083 HOH WAT D . 
E 4 HOH 17  1090 1090 HOH WAT D . 
E 4 HOH 18  1093 1093 HOH WAT D . 
E 4 HOH 19  1094 1094 HOH WAT D . 
E 4 HOH 20  1104 1104 HOH WAT D . 
E 4 HOH 21  1105 1105 HOH WAT D . 
E 4 HOH 22  1116 1116 HOH WAT D . 
E 4 HOH 23  1129 1129 HOH WAT D . 
E 4 HOH 24  1147 1147 HOH WAT D . 
E 4 HOH 25  1148 1148 HOH WAT D . 
E 4 HOH 26  1153 1153 HOH WAT D . 
E 4 HOH 27  1161 1161 HOH WAT D . 
E 4 HOH 28  1162 1162 HOH WAT D . 
E 4 HOH 29  1169 1169 HOH WAT D . 
E 4 HOH 30  1186 1186 HOH WAT D . 
E 4 HOH 31  1199 1199 HOH WAT D . 
E 4 HOH 32  1206 1206 HOH WAT D . 
E 4 HOH 33  1208 1208 HOH WAT D . 
E 4 HOH 34  1217 1217 HOH WAT D . 
E 4 HOH 35  1222 1222 HOH WAT D . 
E 4 HOH 36  1228 1228 HOH WAT D . 
E 4 HOH 37  1230 1230 HOH WAT D . 
E 4 HOH 38  1233 1233 HOH WAT D . 
E 4 HOH 39  1236 1236 HOH WAT D . 
E 4 HOH 40  1238 1238 HOH WAT D . 
E 4 HOH 41  1241 1241 HOH WAT D . 
E 4 HOH 42  1245 1245 HOH WAT D . 
E 4 HOH 43  1252 1252 HOH WAT D . 
E 4 HOH 44  1280 1280 HOH WAT D . 
E 4 HOH 45  1299 1299 HOH WAT D . 
E 4 HOH 46  1309 1309 HOH WAT D . 
E 4 HOH 47  1315 1315 HOH WAT D . 
E 4 HOH 48  1323 1323 HOH WAT D . 
E 4 HOH 49  1332 1332 HOH WAT D . 
E 4 HOH 50  1339 1339 HOH WAT D . 
F 4 HOH 1   1001 1001 HOH WAT A . 
F 4 HOH 2   1003 1003 HOH WAT A . 
F 4 HOH 3   1004 1004 HOH WAT A . 
F 4 HOH 4   1005 1005 HOH WAT A . 
F 4 HOH 5   1006 1006 HOH WAT A . 
F 4 HOH 6   1007 1007 HOH WAT A . 
F 4 HOH 7   1009 1009 HOH WAT A . 
F 4 HOH 8   1010 1010 HOH WAT A . 
F 4 HOH 9   1011 1011 HOH WAT A . 
F 4 HOH 10  1012 1012 HOH WAT A . 
F 4 HOH 11  1014 1014 HOH WAT A . 
F 4 HOH 12  1015 1015 HOH WAT A . 
F 4 HOH 13  1018 1018 HOH WAT A . 
F 4 HOH 14  1019 1019 HOH WAT A . 
F 4 HOH 15  1021 1021 HOH WAT A . 
F 4 HOH 16  1022 1022 HOH WAT A . 
F 4 HOH 17  1025 1025 HOH WAT A . 
F 4 HOH 18  1026 1026 HOH WAT A . 
F 4 HOH 19  1027 1027 HOH WAT A . 
F 4 HOH 20  1028 1028 HOH WAT A . 
F 4 HOH 21  1029 1029 HOH WAT A . 
F 4 HOH 22  1030 1030 HOH WAT A . 
F 4 HOH 23  1031 1031 HOH WAT A . 
F 4 HOH 24  1032 1032 HOH WAT A . 
F 4 HOH 25  1033 1033 HOH WAT A . 
F 4 HOH 26  1035 1035 HOH WAT A . 
F 4 HOH 27  1036 1036 HOH WAT A . 
F 4 HOH 28  1038 1038 HOH WAT A . 
F 4 HOH 29  1039 1039 HOH WAT A . 
F 4 HOH 30  1040 1040 HOH WAT A . 
F 4 HOH 31  1042 1042 HOH WAT A . 
F 4 HOH 32  1043 1043 HOH WAT A . 
F 4 HOH 33  1044 1044 HOH WAT A . 
F 4 HOH 34  1045 1045 HOH WAT A . 
F 4 HOH 35  1046 1046 HOH WAT A . 
F 4 HOH 36  1047 1047 HOH WAT A . 
F 4 HOH 37  1048 1048 HOH WAT A . 
F 4 HOH 38  1049 1049 HOH WAT A . 
F 4 HOH 39  1051 1051 HOH WAT A . 
F 4 HOH 40  1053 1053 HOH WAT A . 
F 4 HOH 41  1054 1054 HOH WAT A . 
F 4 HOH 42  1055 1055 HOH WAT A . 
F 4 HOH 43  1056 1056 HOH WAT A . 
F 4 HOH 44  1057 1057 HOH WAT A . 
F 4 HOH 45  1058 1058 HOH WAT A . 
F 4 HOH 46  1059 1059 HOH WAT A . 
F 4 HOH 47  1061 1061 HOH WAT A . 
F 4 HOH 48  1062 1062 HOH WAT A . 
F 4 HOH 49  1067 1067 HOH WAT A . 
F 4 HOH 50  1069 1069 HOH WAT A . 
F 4 HOH 51  1071 1071 HOH WAT A . 
F 4 HOH 52  1073 1073 HOH WAT A . 
F 4 HOH 53  1074 1074 HOH WAT A . 
F 4 HOH 54  1076 1076 HOH WAT A . 
F 4 HOH 55  1078 1078 HOH WAT A . 
F 4 HOH 56  1079 1079 HOH WAT A . 
F 4 HOH 57  1080 1080 HOH WAT A . 
F 4 HOH 58  1081 1081 HOH WAT A . 
F 4 HOH 59  1082 1082 HOH WAT A . 
F 4 HOH 60  1084 1084 HOH WAT A . 
F 4 HOH 61  1085 1085 HOH WAT A . 
F 4 HOH 62  1086 1086 HOH WAT A . 
F 4 HOH 63  1088 1088 HOH WAT A . 
F 4 HOH 64  1089 1089 HOH WAT A . 
F 4 HOH 65  1091 1091 HOH WAT A . 
F 4 HOH 66  1092 1092 HOH WAT A . 
F 4 HOH 67  1095 1095 HOH WAT A . 
F 4 HOH 68  1096 1096 HOH WAT A . 
F 4 HOH 69  1097 1097 HOH WAT A . 
F 4 HOH 70  1099 1099 HOH WAT A . 
F 4 HOH 71  1100 1100 HOH WAT A . 
F 4 HOH 72  1101 1101 HOH WAT A . 
F 4 HOH 73  1102 1102 HOH WAT A . 
F 4 HOH 74  1103 1103 HOH WAT A . 
F 4 HOH 75  1106 1106 HOH WAT A . 
F 4 HOH 76  1107 1107 HOH WAT A . 
F 4 HOH 77  1108 1108 HOH WAT A . 
F 4 HOH 78  1109 1109 HOH WAT A . 
F 4 HOH 79  1110 1110 HOH WAT A . 
F 4 HOH 80  1112 1112 HOH WAT A . 
F 4 HOH 81  1113 1113 HOH WAT A . 
F 4 HOH 82  1114 1114 HOH WAT A . 
F 4 HOH 83  1115 1115 HOH WAT A . 
F 4 HOH 84  1117 1117 HOH WAT A . 
F 4 HOH 85  1118 1118 HOH WAT A . 
F 4 HOH 86  1119 1119 HOH WAT A . 
F 4 HOH 87  1120 1120 HOH WAT A . 
F 4 HOH 88  1121 1121 HOH WAT A . 
F 4 HOH 89  1122 1122 HOH WAT A . 
F 4 HOH 90  1123 1123 HOH WAT A . 
F 4 HOH 91  1124 1124 HOH WAT A . 
F 4 HOH 92  1125 1125 HOH WAT A . 
F 4 HOH 93  1126 1126 HOH WAT A . 
F 4 HOH 94  1127 1127 HOH WAT A . 
F 4 HOH 95  1128 1128 HOH WAT A . 
F 4 HOH 96  1130 1130 HOH WAT A . 
F 4 HOH 97  1131 1131 HOH WAT A . 
F 4 HOH 98  1132 1132 HOH WAT A . 
F 4 HOH 99  1134 1134 HOH WAT A . 
F 4 HOH 100 1135 1135 HOH WAT A . 
F 4 HOH 101 1136 1136 HOH WAT A . 
F 4 HOH 102 1137 1137 HOH WAT A . 
F 4 HOH 103 1138 1138 HOH WAT A . 
F 4 HOH 104 1139 1139 HOH WAT A . 
F 4 HOH 105 1140 1140 HOH WAT A . 
F 4 HOH 106 1141 1141 HOH WAT A . 
F 4 HOH 107 1142 1142 HOH WAT A . 
F 4 HOH 108 1143 1143 HOH WAT A . 
F 4 HOH 109 1144 1144 HOH WAT A . 
F 4 HOH 110 1149 1149 HOH WAT A . 
F 4 HOH 111 1150 1150 HOH WAT A . 
F 4 HOH 112 1151 1151 HOH WAT A . 
F 4 HOH 113 1152 1152 HOH WAT A . 
F 4 HOH 114 1154 1154 HOH WAT A . 
F 4 HOH 115 1155 1155 HOH WAT A . 
F 4 HOH 116 1156 1156 HOH WAT A . 
F 4 HOH 117 1157 1157 HOH WAT A . 
F 4 HOH 118 1158 1158 HOH WAT A . 
F 4 HOH 119 1159 1159 HOH WAT A . 
F 4 HOH 120 1160 1160 HOH WAT A . 
F 4 HOH 121 1163 1163 HOH WAT A . 
F 4 HOH 122 1164 1164 HOH WAT A . 
F 4 HOH 123 1167 1167 HOH WAT A . 
F 4 HOH 124 1168 1168 HOH WAT A . 
F 4 HOH 125 1170 1170 HOH WAT A . 
F 4 HOH 126 1171 1171 HOH WAT A . 
F 4 HOH 127 1172 1172 HOH WAT A . 
F 4 HOH 128 1173 1173 HOH WAT A . 
F 4 HOH 129 1174 1174 HOH WAT A . 
F 4 HOH 130 1175 1175 HOH WAT A . 
F 4 HOH 131 1177 1177 HOH WAT A . 
F 4 HOH 132 1178 1178 HOH WAT A . 
F 4 HOH 133 1179 1179 HOH WAT A . 
F 4 HOH 134 1181 1181 HOH WAT A . 
F 4 HOH 135 1182 1182 HOH WAT A . 
F 4 HOH 136 1183 1183 HOH WAT A . 
F 4 HOH 137 1184 1184 HOH WAT A . 
F 4 HOH 138 1185 1185 HOH WAT A . 
F 4 HOH 139 1187 1187 HOH WAT A . 
F 4 HOH 140 1188 1188 HOH WAT A . 
F 4 HOH 141 1189 1189 HOH WAT A . 
F 4 HOH 142 1190 1190 HOH WAT A . 
F 4 HOH 143 1191 1191 HOH WAT A . 
F 4 HOH 144 1192 1192 HOH WAT A . 
F 4 HOH 145 1193 1193 HOH WAT A . 
F 4 HOH 146 1194 1194 HOH WAT A . 
F 4 HOH 147 1195 1195 HOH WAT A . 
F 4 HOH 148 1198 1198 HOH WAT A . 
F 4 HOH 149 1200 1200 HOH WAT A . 
F 4 HOH 150 1201 1201 HOH WAT A . 
F 4 HOH 151 1202 1202 HOH WAT A . 
F 4 HOH 152 1203 1203 HOH WAT A . 
F 4 HOH 153 1204 1204 HOH WAT A . 
F 4 HOH 154 1207 1207 HOH WAT A . 
F 4 HOH 155 1209 1209 HOH WAT A . 
F 4 HOH 156 1210 1210 HOH WAT A . 
F 4 HOH 157 1211 1211 HOH WAT A . 
F 4 HOH 158 1212 1212 HOH WAT A . 
F 4 HOH 159 1213 1213 HOH WAT A . 
F 4 HOH 160 1214 1214 HOH WAT A . 
F 4 HOH 161 1215 1215 HOH WAT A . 
F 4 HOH 162 1216 1216 HOH WAT A . 
F 4 HOH 163 1218 1218 HOH WAT A . 
F 4 HOH 164 1219 1219 HOH WAT A . 
F 4 HOH 165 1220 1220 HOH WAT A . 
F 4 HOH 166 1221 1221 HOH WAT A . 
F 4 HOH 167 1223 1223 HOH WAT A . 
F 4 HOH 168 1224 1224 HOH WAT A . 
F 4 HOH 169 1225 1225 HOH WAT A . 
F 4 HOH 170 1226 1226 HOH WAT A . 
F 4 HOH 171 1227 1227 HOH WAT A . 
F 4 HOH 172 1231 1231 HOH WAT A . 
F 4 HOH 173 1234 1234 HOH WAT A . 
F 4 HOH 174 1235 1235 HOH WAT A . 
F 4 HOH 175 1237 1237 HOH WAT A . 
F 4 HOH 176 1239 1239 HOH WAT A . 
F 4 HOH 177 1240 1240 HOH WAT A . 
F 4 HOH 178 1242 1242 HOH WAT A . 
F 4 HOH 179 1243 1243 HOH WAT A . 
F 4 HOH 180 1246 1246 HOH WAT A . 
F 4 HOH 181 1247 1247 HOH WAT A . 
F 4 HOH 182 1248 1248 HOH WAT A . 
F 4 HOH 183 1249 1249 HOH WAT A . 
F 4 HOH 184 1250 1250 HOH WAT A . 
F 4 HOH 185 1251 1251 HOH WAT A . 
F 4 HOH 186 1253 1253 HOH WAT A . 
F 4 HOH 187 1255 1255 HOH WAT A . 
F 4 HOH 188 1258 1258 HOH WAT A . 
F 4 HOH 189 1259 1259 HOH WAT A . 
F 4 HOH 190 1260 1260 HOH WAT A . 
F 4 HOH 191 1262 1262 HOH WAT A . 
F 4 HOH 192 1263 1263 HOH WAT A . 
F 4 HOH 193 1264 1264 HOH WAT A . 
F 4 HOH 194 1265 1265 HOH WAT A . 
F 4 HOH 195 1266 1266 HOH WAT A . 
F 4 HOH 196 1267 1267 HOH WAT A . 
F 4 HOH 197 1269 1269 HOH WAT A . 
F 4 HOH 198 1270 1270 HOH WAT A . 
F 4 HOH 199 1271 1271 HOH WAT A . 
F 4 HOH 200 1272 1272 HOH WAT A . 
F 4 HOH 201 1273 1273 HOH WAT A . 
F 4 HOH 202 1274 1274 HOH WAT A . 
F 4 HOH 203 1275 1275 HOH WAT A . 
F 4 HOH 204 1276 1276 HOH WAT A . 
F 4 HOH 205 1277 1277 HOH WAT A . 
F 4 HOH 206 1278 1278 HOH WAT A . 
F 4 HOH 207 1279 1279 HOH WAT A . 
F 4 HOH 208 1282 1282 HOH WAT A . 
F 4 HOH 209 1283 1283 HOH WAT A . 
F 4 HOH 210 1285 1285 HOH WAT A . 
F 4 HOH 211 1286 1286 HOH WAT A . 
F 4 HOH 212 1287 1287 HOH WAT A . 
F 4 HOH 213 1288 1288 HOH WAT A . 
F 4 HOH 214 1289 1289 HOH WAT A . 
F 4 HOH 215 1290 1290 HOH WAT A . 
F 4 HOH 216 1292 1292 HOH WAT A . 
F 4 HOH 217 1294 1294 HOH WAT A . 
F 4 HOH 218 1295 1295 HOH WAT A . 
F 4 HOH 219 1296 1296 HOH WAT A . 
F 4 HOH 220 1297 1297 HOH WAT A . 
F 4 HOH 221 1298 1298 HOH WAT A . 
F 4 HOH 222 1300 1300 HOH WAT A . 
F 4 HOH 223 1301 1301 HOH WAT A . 
F 4 HOH 224 1302 1302 HOH WAT A . 
F 4 HOH 225 1303 1303 HOH WAT A . 
F 4 HOH 226 1304 1304 HOH WAT A . 
F 4 HOH 227 1305 1305 HOH WAT A . 
F 4 HOH 228 1306 1306 HOH WAT A . 
F 4 HOH 229 1307 1307 HOH WAT A . 
F 4 HOH 230 1308 1308 HOH WAT A . 
F 4 HOH 231 1311 1311 HOH WAT A . 
F 4 HOH 232 1312 1312 HOH WAT A . 
F 4 HOH 233 1313 1313 HOH WAT A . 
F 4 HOH 234 1314 1314 HOH WAT A . 
F 4 HOH 235 1316 1316 HOH WAT A . 
F 4 HOH 236 1317 1317 HOH WAT A . 
F 4 HOH 237 1318 1318 HOH WAT A . 
F 4 HOH 238 1319 1319 HOH WAT A . 
F 4 HOH 239 1320 1320 HOH WAT A . 
F 4 HOH 240 1321 1321 HOH WAT A . 
F 4 HOH 241 1322 1322 HOH WAT A . 
F 4 HOH 242 1325 1325 HOH WAT A . 
F 4 HOH 243 1326 1326 HOH WAT A . 
F 4 HOH 244 1327 1327 HOH WAT A . 
F 4 HOH 245 1328 1328 HOH WAT A . 
F 4 HOH 246 1329 1329 HOH WAT A . 
F 4 HOH 247 1330 1330 HOH WAT A . 
F 4 HOH 248 1331 1331 HOH WAT A . 
F 4 HOH 249 1333 1333 HOH WAT A . 
F 4 HOH 250 1334 1334 HOH WAT A . 
F 4 HOH 251 1335 1335 HOH WAT A . 
F 4 HOH 252 1336 1336 HOH WAT A . 
F 4 HOH 253 1337 1337 HOH WAT A . 
F 4 HOH 254 1338 1338 HOH WAT A . 
F 4 HOH 255 1340 1340 HOH WAT A . 
F 4 HOH 256 1341 1341 HOH WAT A . 
F 4 HOH 257 1342 1342 HOH WAT A . 
F 4 HOH 258 1343 1343 HOH WAT A . 
F 4 HOH 259 1344 1344 HOH WAT A . 
F 4 HOH 260 1345 1345 HOH WAT A . 
F 4 HOH 261 1346 1346 HOH WAT A . 
F 4 HOH 262 1347 1347 HOH WAT A . 
F 4 HOH 263 1348 1348 HOH WAT A . 
F 4 HOH 264 1349 1349 HOH WAT A . 
F 4 HOH 265 1352 1352 HOH WAT A . 
F 4 HOH 266 1353 1353 HOH WAT A . 
F 4 HOH 267 1354 1354 HOH WAT A . 
F 4 HOH 268 1357 1357 HOH WAT A . 
F 4 HOH 269 1358 1358 HOH WAT A . 
F 4 HOH 270 1360 1360 HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-08-03 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O5'" C DA  1   ? ? "C5'" C DA  1   ? ? "C4'" C DA  1   ? ? 103.11 109.40 -6.29 0.80 N 
2 1 "C3'" C DC  10  ? ? "C2'" C DC  10  ? ? "C1'" C DC  10  ? ? 96.83  102.40 -5.57 0.80 N 
3 1 "C3'" D DA  103 ? ? "C2'" D DA  103 ? ? "C1'" D DA  103 ? ? 97.23  102.40 -5.17 0.80 N 
4 1 "C3'" D DT  112 ? ? "C2'" D DT  112 ? ? "C1'" D DT  112 ? ? 95.78  102.40 -6.62 0.80 N 
5 1 C     A GLN 559 ? ? N     A PRO 560 ? ? CA    A PRO 560 ? ? 128.93 119.30 9.63  1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 204 ? ? -67.70  72.78   
2  1 PRO A 212 ? ? -61.79  -179.39 
3  1 LEU A 264 ? ? -33.26  -36.42  
4  1 THR A 269 ? ? -62.96  0.25    
5  1 MET A 319 ? ? -38.25  153.34  
6  1 ASP A 344 ? ? 57.49   -117.65 
7  1 CYS A 453 ? ? -141.56 16.97   
8  1 SER A 467 ? ? -41.38  156.01  
9  1 ALA A 486 ? ? 75.69   38.27   
10 1 LEU A 518 ? ? -172.75 135.72  
11 1 ASP A 528 ? ? -161.87 94.61   
12 1 PHE A 565 ? ? -96.15  55.13   
13 1 ASP A 566 ? ? -57.43  177.82  
14 1 ASP A 609 ? ? -80.34  36.32   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DC C 8  ? ? 0.066 'SIDE CHAIN' 
2 1 DA C 17 ? ? 0.051 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C DA  1   ? P   ? A DA  2   P   
2  1 Y 1 C DA  1   ? OP1 ? A DA  2   OP1 
3  1 Y 1 C DA  1   ? OP2 ? A DA  2   OP2 
4  1 Y 1 D DA  101 ? P   ? B DA  2   P   
5  1 Y 1 D DA  101 ? OP1 ? B DA  2   OP1 
6  1 Y 1 D DA  101 ? OP2 ? B DA  2   OP2 
7  1 Y 1 A GLU 209 ? CG  ? C GLU 7   CG  
8  1 Y 1 A GLU 209 ? CD  ? C GLU 7   CD  
9  1 Y 1 A GLU 209 ? OE1 ? C GLU 7   OE1 
10 1 Y 1 A GLU 209 ? OE2 ? C GLU 7   OE2 
11 1 Y 1 A ARG 210 ? CG  ? C ARG 8   CG  
12 1 Y 1 A ARG 210 ? CD  ? C ARG 8   CD  
13 1 Y 1 A ARG 210 ? NE  ? C ARG 8   NE  
14 1 Y 1 A ARG 210 ? CZ  ? C ARG 8   CZ  
15 1 Y 1 A ARG 210 ? NH1 ? C ARG 8   NH1 
16 1 Y 1 A ARG 210 ? NH2 ? C ARG 8   NH2 
17 1 Y 1 A GLU 213 ? CG  ? C GLU 11  CG  
18 1 Y 1 A GLU 213 ? CD  ? C GLU 11  CD  
19 1 Y 1 A GLU 213 ? OE1 ? C GLU 11  OE1 
20 1 Y 1 A GLU 213 ? OE2 ? C GLU 11  OE2 
21 1 Y 1 A LYS 317 ? CG  ? C LYS 115 CG  
22 1 Y 1 A LYS 317 ? CD  ? C LYS 115 CD  
23 1 Y 1 A LYS 317 ? CE  ? C LYS 115 CE  
24 1 Y 1 A LYS 317 ? NZ  ? C LYS 115 NZ  
25 1 Y 1 A LYS 321 ? CG  ? C LYS 119 CG  
26 1 Y 1 A LYS 321 ? CD  ? C LYS 119 CD  
27 1 Y 1 A LYS 321 ? CE  ? C LYS 119 CE  
28 1 Y 1 A LYS 321 ? NZ  ? C LYS 119 NZ  
29 1 Y 1 A GLU 322 ? CG  ? C GLU 120 CG  
30 1 Y 1 A GLU 322 ? CD  ? C GLU 120 CD  
31 1 Y 1 A GLU 322 ? OE1 ? C GLU 120 OE1 
32 1 Y 1 A GLU 322 ? OE2 ? C GLU 120 OE2 
33 1 Y 1 A LYS 326 ? CG  ? C LYS 124 CG  
34 1 Y 1 A LYS 326 ? CD  ? C LYS 124 CD  
35 1 Y 1 A LYS 326 ? CE  ? C LYS 124 CE  
36 1 Y 1 A LYS 326 ? NZ  ? C LYS 124 NZ  
37 1 Y 1 A LYS 333 ? CG  ? C LYS 131 CG  
38 1 Y 1 A LYS 333 ? CD  ? C LYS 131 CD  
39 1 Y 1 A LYS 333 ? CE  ? C LYS 131 CE  
40 1 Y 1 A LYS 333 ? NZ  ? C LYS 131 NZ  
41 1 Y 1 A GLU 463 ? CG  ? C GLU 261 CG  
42 1 Y 1 A GLU 463 ? CD  ? C GLU 261 CD  
43 1 Y 1 A GLU 463 ? OE1 ? C GLU 261 OE1 
44 1 Y 1 A GLU 463 ? OE2 ? C GLU 261 OE2 
45 1 Y 1 A LYS 468 ? CG  ? C LYS 266 CG  
46 1 Y 1 A LYS 468 ? CD  ? C LYS 266 CD  
47 1 Y 1 A LYS 468 ? CE  ? C LYS 266 CE  
48 1 Y 1 A LYS 468 ? NZ  ? C LYS 266 NZ  
49 1 Y 1 A GLU 495 ? CG  ? C GLU 293 CG  
50 1 Y 1 A GLU 495 ? CD  ? C GLU 293 CD  
51 1 Y 1 A GLU 495 ? OE1 ? C GLU 293 OE1 
52 1 Y 1 A GLU 495 ? OE2 ? C GLU 293 OE2 
53 1 Y 1 A ARG 546 ? CG  ? C ARG 344 CG  
54 1 Y 1 A ARG 546 ? CD  ? C ARG 344 CD  
55 1 Y 1 A ARG 546 ? NE  ? C ARG 344 NE  
56 1 Y 1 A ARG 546 ? CZ  ? C ARG 344 CZ  
57 1 Y 1 A ARG 546 ? NH1 ? C ARG 344 NH1 
58 1 Y 1 A ARG 546 ? NH2 ? C ARG 344 NH2 
59 1 Y 1 A GLU 582 ? CG  ? C GLU 380 CG  
60 1 Y 1 A GLU 582 ? CD  ? C GLU 380 CD  
61 1 Y 1 A GLU 582 ? OE1 ? C GLU 380 OE1 
62 1 Y 1 A GLU 582 ? OE2 ? C GLU 380 OE2 
63 1 Y 1 A ASP 609 ? CG  ? C ASP 407 CG  
64 1 Y 1 A ASP 609 ? OD1 ? C ASP 407 OD1 
65 1 Y 1 A ASP 609 ? OD2 ? C ASP 407 OD2 
66 1 Y 1 A GLU 610 ? CG  ? C GLU 408 CG  
67 1 Y 1 A GLU 610 ? CD  ? C GLU 408 CD  
68 1 Y 1 A GLU 610 ? OE1 ? C GLU 408 OE1 
69 1 Y 1 A GLU 610 ? OE2 ? C GLU 408 OE2 
70 1 Y 1 A ASN 611 ? CG  ? C ASN 409 CG  
71 1 Y 1 A ASN 611 ? OD1 ? C ASN 409 OD1 
72 1 Y 1 A ASN 611 ? ND2 ? C ASN 409 ND2 
73 1 Y 1 A ASP 760 ? CG  ? C ASP 558 CG  
74 1 Y 1 A ASP 760 ? OD1 ? C ASP 558 OD1 
75 1 Y 1 A ASP 760 ? OD2 ? C ASP 558 OD2 
76 1 Y 1 A ASP 762 ? CG  ? C ASP 560 CG  
77 1 Y 1 A ASP 762 ? OD1 ? C ASP 560 OD1 
78 1 Y 1 A ASP 762 ? OD2 ? C ASP 560 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C DC  0   ? A DC  1   
2  1 Y 1 D DC  100 ? B DC  1   
3  1 Y 1 A ILE 634 ? C ILE 432 
4  1 Y 1 A ALA 635 ? C ALA 433 
5  1 Y 1 A PRO 636 ? C PRO 434 
6  1 Y 1 A PRO 637 ? C PRO 435 
7  1 Y 1 A LYS 638 ? C LYS 436 
8  1 Y 1 A THR 639 ? C THR 437 
9  1 Y 1 A PHE 640 ? C PHE 438 
10 1 Y 1 A GLU 641 ? C GLU 439 
11 1 Y 1 A LYS 642 ? C LYS 440 
12 1 Y 1 A SER 643 ? C SER 441 
13 1 Y 1 A MET 644 ? C MET 442 
14 1 Y 1 A MET 645 ? C MET 443 
15 1 Y 1 A ASN 646 ? C ASN 444 
16 1 Y 1 A LEU 647 ? C LEU 445 
17 1 Y 1 A GLN 648 ? C GLN 446 
18 1 Y 1 A THR 649 ? C THR 447 
19 1 Y 1 A LYS 650 ? C LYS 448 
20 1 Y 1 A ILE 651 ? C ILE 449 
21 1 Y 1 A ASP 652 ? C ASP 450 
22 1 Y 1 A ALA 653 ? C ALA 451 
23 1 Y 1 A LYS 654 ? C LYS 452 
24 1 Y 1 A LYS 655 ? C LYS 453 
25 1 Y 1 A GLU 656 ? C GLU 454 
26 1 Y 1 A GLN 657 ? C GLN 455 
27 1 Y 1 A LEU 658 ? C LEU 456 
28 1 Y 1 A ALA 659 ? C ALA 457 
29 1 Y 1 A ASP 660 ? C ASP 458 
30 1 Y 1 A ALA 661 ? C ALA 459 
31 1 Y 1 A ARG 662 ? C ARG 460 
32 1 Y 1 A ARG 663 ? C ARG 461 
33 1 Y 1 A ASP 664 ? C ASP 462 
34 1 Y 1 A LEU 665 ? C LEU 463 
35 1 Y 1 A LYS 666 ? C LYS 464 
36 1 Y 1 A SER 667 ? C SER 465 
37 1 Y 1 A ALA 668 ? C ALA 466 
38 1 Y 1 A LYS 669 ? C LYS 467 
39 1 Y 1 A ALA 670 ? C ALA 468 
40 1 Y 1 A ASP 671 ? C ASP 469 
41 1 Y 1 A ALA 672 ? C ALA 470 
42 1 Y 1 A LYS 673 ? C LYS 471 
43 1 Y 1 A VAL 674 ? C VAL 472 
44 1 Y 1 A MET 675 ? C MET 473 
45 1 Y 1 A LYS 676 ? C LYS 474 
46 1 Y 1 A ASP 677 ? C ASP 475 
47 1 Y 1 A ALA 678 ? C ALA 476 
48 1 Y 1 A LYS 679 ? C LYS 477 
49 1 Y 1 A THR 680 ? C THR 478 
50 1 Y 1 A LYS 681 ? C LYS 479 
51 1 Y 1 A LYS 682 ? C LYS 480 
52 1 Y 1 A VAL 683 ? C VAL 481 
53 1 Y 1 A VAL 684 ? C VAL 482 
54 1 Y 1 A GLU 685 ? C GLU 483 
55 1 Y 1 A SER 686 ? C SER 484 
56 1 Y 1 A LYS 687 ? C LYS 485 
57 1 Y 1 A LYS 688 ? C LYS 486 
58 1 Y 1 A LYS 689 ? C LYS 487 
59 1 Y 1 A ALA 690 ? C ALA 488 
60 1 Y 1 A VAL 691 ? C VAL 489 
61 1 Y 1 A GLN 692 ? C GLN 490 
62 1 Y 1 A ARG 693 ? C ARG 491 
63 1 Y 1 A LEU 694 ? C LEU 492 
64 1 Y 1 A GLU 695 ? C GLU 493 
65 1 Y 1 A GLU 696 ? C GLU 494 
66 1 Y 1 A GLN 697 ? C GLN 495 
67 1 Y 1 A LEU 698 ? C LEU 496 
68 1 Y 1 A MET 699 ? C MET 497 
69 1 Y 1 A LYS 700 ? C LYS 498 
70 1 Y 1 A LEU 701 ? C LEU 499 
71 1 Y 1 A GLU 702 ? C GLU 500 
72 1 Y 1 A VAL 703 ? C VAL 501 
73 1 Y 1 A GLN 704 ? C GLN 502 
74 1 Y 1 A ALA 705 ? C ALA 503 
75 1 Y 1 A THR 706 ? C THR 504 
76 1 Y 1 A ASP 707 ? C ASP 505 
77 1 Y 1 A ARG 708 ? C ARG 506 
78 1 Y 1 A GLU 709 ? C GLU 507 
79 1 Y 1 A GLU 710 ? C GLU 508 
80 1 Y 1 A ASN 711 ? C ASN 509 
81 1 Y 1 A LYS 712 ? C LYS 510 
82 1 Y 1 A GLN 713 ? C GLN 511 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1EJ9 'double helix'        
1EJ9 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 B DT 23 1_555 -0.379 -0.142 0.075  1.784   -11.175 9.446  1  C_DA1:DT122_D  C 1  ? D 122 ? 20 1 
1 A DA 3  1_555 B DT 22 1_555 -0.182 -0.292 0.089  5.817   -6.112  6.239  2  C_DA2:DT121_D  C 2  ? D 121 ? 20 1 
1 A DA 4  1_555 B DT 21 1_555 0.907  -0.482 0.165  12.077  -13.745 -6.528 3  C_DA3:DT120_D  C 3  ? D 120 ? 20 1 
1 A DA 5  1_555 B DT 20 1_555 0.435  -0.194 0.025  5.511   -12.329 -5.237 4  C_DA4:DT119_D  C 4  ? D 119 ? 20 1 
1 A DA 6  1_555 B DT 19 1_555 0.392  -0.207 0.367  3.984   -11.359 5.742  5  C_DA5:DT118_D  C 5  ? D 118 ? 20 1 
1 A DG 7  1_555 B DC 18 1_555 0.158  0.127  -0.098 -6.457  -9.581  2.648  6  C_DG6:DC117_D  C 6  ? D 117 ? 19 1 
1 A DA 8  1_555 B DT 17 1_555 0.107  -0.189 -0.428 1.001   -0.594  -2.986 7  C_DA7:DT116_D  C 7  ? D 116 ? 20 1 
1 A DC 9  1_555 B DG 16 1_555 -0.108 -0.169 -0.020 7.082   -15.227 -3.093 8  C_DC8:DG115_D  C 8  ? D 115 ? 19 1 
1 A DT 10 1_555 B DA 15 1_555 -0.473 -0.341 0.275  -0.751  -7.034  -1.868 9  C_DT9:DA114_D  C 9  ? D 114 ? 20 1 
1 A DC 11 1_555 B DG 14 1_555 -0.232 -0.407 -0.360 1.232   -6.023  -7.237 10 C_DC10:DG113_D C 10 ? D 113 ? 19 1 
1 A DA 12 1_555 B DT 13 1_555 -0.089 -0.540 -0.112 -7.766  14.913  1.803  11 C_DA11:DT112_D C 11 ? D 112 ? 20 1 
1 A DG 13 1_555 B DC 12 1_555 -0.120 -0.194 -0.364 4.275   -7.086  3.851  12 C_DG12:DC111_D C 12 ? D 111 ? 19 1 
1 A DA 14 1_555 B DT 11 1_555 0.086  -0.196 -0.144 9.058   -16.139 4.685  13 C_DA13:DT110_D C 13 ? D 110 ? 20 1 
1 A DA 15 1_555 B DT 10 1_555 -0.387 -0.382 -0.021 2.675   -18.226 2.038  14 C_DA14:DT109_D C 14 ? D 109 ? 20 1 
1 A DA 16 1_555 B DT 9  1_555 0.168  -0.339 0.339  8.767   -18.670 1.589  15 C_DA15:DT108_D C 15 ? D 108 ? 20 1 
1 A DA 17 1_555 B DT 8  1_555 0.826  -0.362 -0.093 5.425   -16.698 -7.141 16 C_DA16:DT107_D C 16 ? D 107 ? 20 1 
1 A DA 18 1_555 B DT 7  1_555 0.602  -0.172 -0.213 -2.211  -8.930  -2.756 17 C_DA17:DT106_D C 17 ? D 106 ? 20 1 
1 A DT 19 1_555 B DA 6  1_555 0.227  -0.558 0.075  2.298   -13.102 3.173  18 C_DT18:DA105_D C 18 ? D 105 ? 20 1 
1 A DT 20 1_555 B DA 5  1_555 -0.731 -0.143 0.338  -4.069  -11.793 5.023  19 C_DT19:DA104_D C 19 ? D 104 ? 20 1 
1 A DT 21 1_555 B DA 4  1_555 0.107  -0.186 0.175  -11.209 -8.213  -4.396 20 C_DT20:DA103_D C 20 ? D 103 ? 20 1 
1 A DT 22 1_555 B DA 3  1_555 -0.431 -0.123 -0.035 -4.558  -4.549  -1.422 21 C_DT21:DA102_D C 21 ? D 102 ? 20 1 
1 A DT 23 1_555 B DA 2  1_555 -0.283 0.355  0.152  -8.738  -13.217 3.182  22 C_DT22:DA101_D C 22 ? D 101 ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 B DT 23 1_555 A DA 3  1_555 B DT 22 1_555 0.246  -0.135 3.221 -1.175 0.363  31.056 -0.321 -0.681 3.208 0.677  
2.193   31.080 1  CC_DA1DA2:DT121DT122_DD   C 1  ? D 122 ? C 2  ? D 121 ? 
1 A DA 3  1_555 B DT 22 1_555 A DA 4  1_555 B DT 21 1_555 -0.784 -0.017 2.982 0.425  1.374  39.409 -0.173 1.208  2.971 2.037  
-0.630  39.434 2  CC_DA2DA3:DT120DT121_DD   C 2  ? D 121 ? C 3  ? D 120 ? 
1 A DA 4  1_555 B DT 21 1_555 A DA 5  1_555 B DT 20 1_555 0.173  -0.175 3.390 0.496  -5.961 37.332 0.530  -0.200 3.379 -9.239 
-0.769  37.791 3  CC_DA3DA4:DT119DT120_DD   C 3  ? D 120 ? C 4  ? D 119 ? 
1 A DA 5  1_555 B DT 20 1_555 A DA 6  1_555 B DT 19 1_555 0.376  -0.378 3.226 -0.871 -1.208 36.460 -0.439 -0.720 3.227 -1.930 
1.391   36.489 4  CC_DA4DA5:DT118DT119_DD   C 4  ? D 119 ? C 5  ? D 118 ? 
1 A DA 6  1_555 B DT 19 1_555 A DG 7  1_555 B DC 18 1_555 -0.096 -0.913 3.562 0.129  -0.324 34.938 -1.467 0.181  3.570 -0.540 
-0.215  34.940 5  CC_DA5DG6:DC117DT118_DD   C 5  ? D 118 ? C 6  ? D 117 ? 
1 A DG 7  1_555 B DC 18 1_555 A DA 8  1_555 B DT 17 1_555 -0.549 -0.439 3.215 1.692  4.065  27.791 -1.827 1.514  3.082 8.397  
-3.495  28.131 6  CC_DG6DA7:DT116DC117_DD   C 6  ? D 117 ? C 7  ? D 116 ? 
1 A DA 8  1_555 B DT 17 1_555 A DC 9  1_555 B DG 16 1_555 0.338  -0.248 3.177 -3.549 -2.083 34.310 -0.106 -1.101 3.137 -3.516 
5.989   34.549 7  CC_DA7DC8:DG115DT116_DD   C 7  ? D 116 ? C 8  ? D 115 ? 
1 A DC 9  1_555 B DG 16 1_555 A DT 10 1_555 B DA 15 1_555 -0.322 -0.599 3.634 -0.100 -3.524 36.948 -0.414 0.490  3.674 -5.544 
0.157   37.110 8  CC_DC8DT9:DA114DG115_DD   C 8  ? D 115 ? C 9  ? D 114 ? 
1 A DT 10 1_555 B DA 15 1_555 A DC 11 1_555 B DG 14 1_555 -0.023 -0.808 3.216 3.539  1.081  34.909 -1.498 0.557  3.173 1.796  
-5.879  35.099 9  CC_DT9DC10:DG113DA114_DD  C 9  ? D 114 ? C 10 ? D 113 ? 
1 A DC 11 1_555 B DG 14 1_555 A DA 12 1_555 B DT 13 1_555 0.471  -0.400 3.682 -2.507 -2.791 43.515 -0.236 -0.904 3.669 -3.757 
3.374   43.668 10 CC_DC10DA11:DT112DG113_DD C 10 ? D 113 ? C 11 ? D 112 ? 
1 A DA 12 1_555 B DT 13 1_555 A DG 13 1_555 B DC 12 1_555 -0.651 0.789  3.305 5.105  6.140  22.867 -0.110 3.210  3.187 14.914 
-12.400 24.204 11 CC_DA11DG12:DC111DT112_DD C 11 ? D 112 ? C 12 ? D 111 ? 
1 A DG 13 1_555 B DC 12 1_555 A DA 14 1_555 B DT 11 1_555 -0.649 0.180  3.184 -3.959 0.448  38.436 0.218  0.502  3.234 0.678  
5.993   38.634 12 CC_DG12DA13:DT110DC111_DD C 12 ? D 111 ? C 13 ? D 110 ? 
1 A DA 14 1_555 B DT 11 1_555 A DA 15 1_555 B DT 10 1_555 -0.142 0.055  3.314 -0.912 4.283  33.466 -0.610 0.094  3.298 7.398  
1.575   33.743 13 CC_DA13DA14:DT109DT110_DD C 13 ? D 110 ? C 14 ? D 109 ? 
1 A DA 15 1_555 B DT 10 1_555 A DA 16 1_555 B DT 9  1_555 0.224  -0.358 3.016 -3.190 -4.146 36.739 -0.050 -0.747 3.008 -6.536 
5.029   37.096 14 CC_DA14DA15:DT108DT109_DD C 14 ? D 109 ? C 15 ? D 108 ? 
1 A DA 16 1_555 B DT 9  1_555 A DA 17 1_555 B DT 8  1_555 -0.138 -0.189 3.324 4.038  -4.119 40.903 0.182  0.637  3.299 -5.858 
-5.743  41.290 15 CC_DA15DA16:DT107DT108_DD C 15 ? D 108 ? C 16 ? D 107 ? 
1 A DA 17 1_555 B DT 8  1_555 A DA 18 1_555 B DT 7  1_555 0.102  -0.441 3.315 0.531  6.209  35.353 -1.608 -0.089 3.196 10.126 
-0.867  35.881 16 CC_DA16DA17:DT106DT107_DD C 16 ? D 107 ? C 17 ? D 106 ? 
1 A DA 18 1_555 B DT 7  1_555 A DT 19 1_555 B DA 6  1_555 0.134  -0.818 3.114 -2.413 -2.030 31.802 -1.134 -0.662 3.140 -3.694 
4.391   31.954 17 CC_DA17DT18:DA105DT106_DD C 17 ? D 106 ? C 18 ? D 105 ? 
1 A DT 19 1_555 B DA 6  1_555 A DT 20 1_555 B DA 5  1_555 0.415  -0.652 3.364 -2.449 -4.085 33.013 -0.433 -1.144 3.379 -7.142 
4.282   33.345 18 CC_DT18DT19:DA104DA105_DD C 18 ? D 105 ? C 19 ? D 104 ? 
1 A DT 20 1_555 B DA 5  1_555 A DT 21 1_555 B DA 4  1_555 -0.261 -0.062 3.358 2.214  -4.414 41.627 0.386  0.602  3.329 -6.185 
-3.103  41.906 19 CC_DT19DT20:DA103DA104_DD C 19 ? D 104 ? C 20 ? D 103 ? 
1 A DT 21 1_555 B DA 4  1_555 A DT 22 1_555 B DA 3  1_555 -0.100 -0.552 3.005 1.722  -1.246 29.466 -0.839 0.533  3.015 -2.446 
-3.380  29.541 20 CC_DT20DT21:DA102DA103_DD C 20 ? D 103 ? C 21 ? D 102 ? 
1 A DT 22 1_555 B DA 3  1_555 A DT 23 1_555 B DA 2  1_555 0.478  0.391  3.241 1.401  2.712  42.796 0.266  -0.514 3.272 3.712  
-1.917  42.899 21 CC_DT21DT22:DA101DA102_DD C 21 ? D 102 ? C 22 ? D 101 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#