data_1EKF
# 
_entry.id   1EKF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EKF         
RCSB  RCSB010672   
WWPDB D_1000010672 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EKP '1EKP CONTAINS THE SAME PROTEIN IN MONOCLINIC FORM COMPLEXED WITH PYRIDOXAL PHOSPHATE' unspecified 
PDB 1EKV 
;1EKV CONTAINS THE SAME PROTEIN INACTIVATED BY TRIS BOUND TO THE PYRIDOXAL PHOSPHATE ON ONE END AND ACTIVE SITE LYS202 NZ ON THE OTHER
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EKF 
_pdbx_database_status.recvd_initial_deposition_date   2000-03-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yennawar, N.H.' 1 
'Dunbar, J.H.'   2 
'Conway, M.'     3 
'Hutson, S.M.'   4 
'Farber, G.K.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The structure of human mitochondrial branched-chain aminotransferase.'               'Acta Crystallogr.,Sect.D' 57   506 
515 2001 ABCRE6 DK 0907-4449 0766 ? 11264579 10.1107/S0907444901001925       
1       'Cloning of the Rat and Human Mitochondrial Branched Chain Aminotransferases (BCATm)' BIOCHIM.BIOPHYS.ACTA       1339 9   
13  1997 BBACAQ NE 0006-3002 0113 ? ?        '10.1016/S0167-4838(97)00044-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yennawar, N.'  1 
primary 'Dunbar, J.'    2 
primary 'Conway, M.'    3 
primary 'Hutson, S.'    4 
primary 'Farber, G.'    5 
1       'Bledsoe, R.K.' 6 
1       'Dawson, P.A.'  7 
1       'Hutson, S.M.'  8 
# 
_cell.entry_id           1EKF 
_cell.length_a           69.385 
_cell.length_b           105.032 
_cell.length_c           107.016 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EKF 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL)' 41368.016 2   2.6.1.42 ? ? ? 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"                                     247.142   2   ?        ? ? ? 
3 water       nat water                                                        18.015    273 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BCAT(M)' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKA
FKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRR
ALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGT
MNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPV
HRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKA
FKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRR
ALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGT
MNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPV
HRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   SER n 
1 4   SER n 
1 5   PHE n 
1 6   LYS n 
1 7   ALA n 
1 8   ALA n 
1 9   ASP n 
1 10  LEU n 
1 11  GLN n 
1 12  LEU n 
1 13  GLU n 
1 14  MET n 
1 15  THR n 
1 16  GLN n 
1 17  LYS n 
1 18  PRO n 
1 19  HIS n 
1 20  LYS n 
1 21  LYS n 
1 22  PRO n 
1 23  GLY n 
1 24  PRO n 
1 25  GLY n 
1 26  GLU n 
1 27  PRO n 
1 28  LEU n 
1 29  VAL n 
1 30  PHE n 
1 31  GLY n 
1 32  LYS n 
1 33  THR n 
1 34  PHE n 
1 35  THR n 
1 36  ASP n 
1 37  HIS n 
1 38  MET n 
1 39  LEU n 
1 40  MET n 
1 41  VAL n 
1 42  GLU n 
1 43  TRP n 
1 44  ASN n 
1 45  ASP n 
1 46  LYS n 
1 47  GLY n 
1 48  TRP n 
1 49  GLY n 
1 50  GLN n 
1 51  PRO n 
1 52  ARG n 
1 53  ILE n 
1 54  GLN n 
1 55  PRO n 
1 56  PHE n 
1 57  GLN n 
1 58  ASN n 
1 59  LEU n 
1 60  THR n 
1 61  LEU n 
1 62  HIS n 
1 63  PRO n 
1 64  ALA n 
1 65  SER n 
1 66  SER n 
1 67  SER n 
1 68  LEU n 
1 69  HIS n 
1 70  TYR n 
1 71  SER n 
1 72  LEU n 
1 73  GLN n 
1 74  LEU n 
1 75  PHE n 
1 76  GLU n 
1 77  GLY n 
1 78  MET n 
1 79  LYS n 
1 80  ALA n 
1 81  PHE n 
1 82  LYS n 
1 83  GLY n 
1 84  LYS n 
1 85  ASP n 
1 86  GLN n 
1 87  GLN n 
1 88  VAL n 
1 89  ARG n 
1 90  LEU n 
1 91  PHE n 
1 92  ARG n 
1 93  PRO n 
1 94  TRP n 
1 95  LEU n 
1 96  ASN n 
1 97  MET n 
1 98  ASP n 
1 99  ARG n 
1 100 MET n 
1 101 LEU n 
1 102 ARG n 
1 103 SER n 
1 104 ALA n 
1 105 MET n 
1 106 ARG n 
1 107 LEU n 
1 108 CYS n 
1 109 LEU n 
1 110 PRO n 
1 111 SER n 
1 112 PHE n 
1 113 ASP n 
1 114 LYS n 
1 115 LEU n 
1 116 GLU n 
1 117 LEU n 
1 118 LEU n 
1 119 GLU n 
1 120 CYS n 
1 121 ILE n 
1 122 ARG n 
1 123 ARG n 
1 124 LEU n 
1 125 ILE n 
1 126 GLU n 
1 127 VAL n 
1 128 ASP n 
1 129 LYS n 
1 130 ASP n 
1 131 TRP n 
1 132 VAL n 
1 133 PRO n 
1 134 ASP n 
1 135 ALA n 
1 136 ALA n 
1 137 GLY n 
1 138 THR n 
1 139 SER n 
1 140 LEU n 
1 141 TYR n 
1 142 VAL n 
1 143 ARG n 
1 144 PRO n 
1 145 VAL n 
1 146 LEU n 
1 147 ILE n 
1 148 GLY n 
1 149 ASN n 
1 150 GLU n 
1 151 PRO n 
1 152 SER n 
1 153 LEU n 
1 154 GLY n 
1 155 VAL n 
1 156 SER n 
1 157 GLN n 
1 158 PRO n 
1 159 ARG n 
1 160 ARG n 
1 161 ALA n 
1 162 LEU n 
1 163 LEU n 
1 164 PHE n 
1 165 VAL n 
1 166 ILE n 
1 167 LEU n 
1 168 CYS n 
1 169 PRO n 
1 170 VAL n 
1 171 GLY n 
1 172 ALA n 
1 173 TYR n 
1 174 PHE n 
1 175 PRO n 
1 176 GLY n 
1 177 GLY n 
1 178 SER n 
1 179 VAL n 
1 180 THR n 
1 181 PRO n 
1 182 VAL n 
1 183 SER n 
1 184 LEU n 
1 185 LEU n 
1 186 ALA n 
1 187 ASP n 
1 188 PRO n 
1 189 ALA n 
1 190 PHE n 
1 191 ILE n 
1 192 ARG n 
1 193 ALA n 
1 194 TRP n 
1 195 VAL n 
1 196 GLY n 
1 197 GLY n 
1 198 VAL n 
1 199 GLY n 
1 200 ASN n 
1 201 TYR n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 GLY n 
1 206 ASN n 
1 207 TYR n 
1 208 GLY n 
1 209 PRO n 
1 210 THR n 
1 211 VAL n 
1 212 LEU n 
1 213 VAL n 
1 214 GLN n 
1 215 GLN n 
1 216 GLU n 
1 217 ALA n 
1 218 LEU n 
1 219 LYS n 
1 220 ARG n 
1 221 GLY n 
1 222 CYS n 
1 223 GLU n 
1 224 GLN n 
1 225 VAL n 
1 226 LEU n 
1 227 TRP n 
1 228 LEU n 
1 229 TYR n 
1 230 GLY n 
1 231 PRO n 
1 232 ASP n 
1 233 HIS n 
1 234 GLN n 
1 235 LEU n 
1 236 THR n 
1 237 GLU n 
1 238 VAL n 
1 239 GLY n 
1 240 THR n 
1 241 MET n 
1 242 ASN n 
1 243 ILE n 
1 244 PHE n 
1 245 VAL n 
1 246 TYR n 
1 247 TRP n 
1 248 THR n 
1 249 HIS n 
1 250 GLU n 
1 251 ASP n 
1 252 GLY n 
1 253 VAL n 
1 254 LEU n 
1 255 GLU n 
1 256 LEU n 
1 257 VAL n 
1 258 THR n 
1 259 PRO n 
1 260 PRO n 
1 261 LEU n 
1 262 ASN n 
1 263 GLY n 
1 264 VAL n 
1 265 ILE n 
1 266 LEU n 
1 267 PRO n 
1 268 GLY n 
1 269 VAL n 
1 270 VAL n 
1 271 ARG n 
1 272 GLN n 
1 273 SER n 
1 274 LEU n 
1 275 LEU n 
1 276 ASP n 
1 277 MET n 
1 278 ALA n 
1 279 GLN n 
1 280 THR n 
1 281 TRP n 
1 282 GLY n 
1 283 GLU n 
1 284 PHE n 
1 285 ARG n 
1 286 VAL n 
1 287 VAL n 
1 288 GLU n 
1 289 ARG n 
1 290 THR n 
1 291 ILE n 
1 292 THR n 
1 293 MET n 
1 294 LYS n 
1 295 GLN n 
1 296 LEU n 
1 297 LEU n 
1 298 ARG n 
1 299 ALA n 
1 300 LEU n 
1 301 GLU n 
1 302 GLU n 
1 303 GLY n 
1 304 ARG n 
1 305 VAL n 
1 306 ARG n 
1 307 GLU n 
1 308 VAL n 
1 309 PHE n 
1 310 GLY n 
1 311 SER n 
1 312 GLY n 
1 313 THR n 
1 314 ALA n 
1 315 CYS n 
1 316 GLN n 
1 317 VAL n 
1 318 CYS n 
1 319 PRO n 
1 320 VAL n 
1 321 HIS n 
1 322 ARG n 
1 323 ILE n 
1 324 LEU n 
1 325 TYR n 
1 326 LYS n 
1 327 ASP n 
1 328 ARG n 
1 329 ASN n 
1 330 LEU n 
1 331 HIS n 
1 332 ILE n 
1 333 PRO n 
1 334 THR n 
1 335 MET n 
1 336 GLU n 
1 337 ASN n 
1 338 GLY n 
1 339 PRO n 
1 340 GLU n 
1 341 LEU n 
1 342 ILE n 
1 343 LEU n 
1 344 ARG n 
1 345 PHE n 
1 346 GLN n 
1 347 LYS n 
1 348 GLU n 
1 349 LEU n 
1 350 LYS n 
1 351 GLU n 
1 352 ILE n 
1 353 GLN n 
1 354 TYR n 
1 355 GLY n 
1 356 ILE n 
1 357 ARG n 
1 358 ALA n 
1 359 HIS n 
1 360 GLU n 
1 361 TRP n 
1 362 MET n 
1 363 PHE n 
1 364 PRO n 
1 365 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BCAT2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          O15382 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EKF A 1 ? 365 ? O15382 28 ? 392 ? 1 365 
2 1 1EKF B 1 ? 365 ? O15382 28 ? 392 ? 1 365 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?                      'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                      'C9 H11 N O2'    165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'  247.142 
PRO 'L-peptide linking' y PROLINE                  ?                      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?                      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ?                      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EKF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.519 
_exptl_crystal.density_percent_sol   51 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG1500, HEPES, DTT, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           223 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1999-04-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111) double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0721203 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             1.0721203 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EKF 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             24.29 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   48329 
_reflns.number_all                   57217 
_reflns.percent_possible_obs         83.8 
_reflns.pdbx_Rmerge_I_obs            0.0650000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.34 
_reflns.B_iso_Wilson_estimate        15.4 
_reflns.pdbx_redundancy              4.81 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   63.8 
_reflns_shell.Rmerge_I_obs           0.4140000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1EKF 
_refine.ls_number_reflns_obs                     48329 
_refine.ls_number_reflns_all                     57217 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               199264.81 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             24.29 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    83.8 
_refine.ls_R_factor_obs                          0.2320000 
_refine.ls_R_factor_all                          0.2420000 
_refine.ls_R_factor_R_work                       0.2220000 
_refine.ls_R_factor_R_free                       0.2600000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.2 
_refine.ls_number_reflns_R_free                  3985 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               33.7 
_refine.aniso_B[1][1]                            -8.11 
_refine.aniso_B[2][2]                            -0.38 
_refine.aniso_B[3][3]                            8.49 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.331 
_refine.solvent_model_param_bsol                 42.13 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'THE DENSITY FOR LOOP 172 TO 179 IN MONOMER A IS WEAK. THE DENSITY FOR THE SAME LOOP IN MONOMER B IS GOOD.' 
_refine.pdbx_starting_model                      'E. COLI BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE.' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh and Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1EKF 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.30 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5820 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             273 
_refine_hist.number_atoms_total               6123 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        24.29 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.2  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.07  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.95 
_refine_ls_shell.d_res_low                        2.07 
_refine_ls_shell.number_reflns_R_work             5517 
_refine_ls_shell.R_factor_R_work                  0.2640000 
_refine_ls_shell.percent_reflns_obs               63.8 
_refine_ls_shell.R_factor_R_free                  0.3170000 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            8.7 
_refine_ls_shell.number_reflns_R_free             525 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARA    ?           'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1EKF 
_struct.title                     
;CRYSTALLOGRAPHIC STRUCTURE OF HUMAN BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL) COMPLEXED WITH PYRIDOXAL-5'-PHOSPHATE AT 1.95 ANGSTROMS (ORTHORHOMBIC FORM)
;
_struct.pdbx_descriptor           'BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL)(E.C. 2.6.1.42)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EKF 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'fold type IV, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a dimer constructed from chain A and chain B.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 6   ? LEU A 10  ? LYS A 6   LEU A 10  5 ? 5  
HELX_P HELX_P2  2  SER A 65  ? TYR A 70  ? SER A 65  TYR A 70  1 ? 6  
HELX_P HELX_P3  3  ARG A 92  ? LEU A 107 ? ARG A 92  LEU A 107 1 ? 16 
HELX_P HELX_P4  4  ASP A 113 ? ASP A 128 ? ASP A 113 ASP A 128 1 ? 16 
HELX_P HELX_P5  5  LYS A 129 ? VAL A 132 ? LYS A 129 VAL A 132 5 ? 4  
HELX_P HELX_P6  6  GLY A 204 ? GLY A 208 ? GLY A 204 GLY A 208 5 ? 5  
HELX_P HELX_P7  7  PRO A 209 ? LYS A 219 ? PRO A 209 LYS A 219 1 ? 11 
HELX_P HELX_P8  8  GLY A 268 ? GLY A 282 ? GLY A 268 GLY A 282 1 ? 15 
HELX_P HELX_P9  9  THR A 292 ? GLU A 301 ? THR A 292 GLU A 301 1 ? 10 
HELX_P HELX_P10 10 PRO A 339 ? TYR A 354 ? PRO A 339 TYR A 354 1 ? 16 
HELX_P HELX_P11 11 LYS B 6   ? LEU B 10  ? LYS B 6   LEU B 10  5 ? 5  
HELX_P HELX_P12 12 SER B 65  ? TYR B 70  ? SER B 65  TYR B 70  1 ? 6  
HELX_P HELX_P13 13 ARG B 92  ? LEU B 107 ? ARG B 92  LEU B 107 1 ? 16 
HELX_P HELX_P14 14 ASP B 113 ? ASP B 128 ? ASP B 113 ASP B 128 1 ? 16 
HELX_P HELX_P15 15 LYS B 129 ? VAL B 132 ? LYS B 129 VAL B 132 5 ? 4  
HELX_P HELX_P16 16 GLY B 204 ? GLY B 208 ? GLY B 204 GLY B 208 5 ? 5  
HELX_P HELX_P17 17 PRO B 209 ? ARG B 220 ? PRO B 209 ARG B 220 1 ? 12 
HELX_P HELX_P18 18 GLY B 268 ? GLY B 282 ? GLY B 268 GLY B 282 1 ? 15 
HELX_P HELX_P19 19 THR B 292 ? GLU B 302 ? THR B 292 GLU B 302 1 ? 11 
HELX_P HELX_P20 20 PRO B 339 ? TYR B 354 ? PRO B 339 TYR B 354 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LYS 202 NZ ? ? ? 1_555 C PLP . C4A ? ? A LYS 202 A PLP 370 1_555 ? ? ? ? ? ? ? 1.385 ? 
covale2 covale ? ? B LYS 202 NZ ? ? ? 1_555 D PLP . C4A ? ? B LYS 202 B PLP 370 1_555 ? ? ? ? ? ? ? 1.384 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 2  ? 
C ? 11 ? 
D ? 12 ? 
E ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
B 1  2  ? anti-parallel 
C 1  2  ? parallel      
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
C 4  5  ? anti-parallel 
C 5  6  ? anti-parallel 
C 6  7  ? anti-parallel 
C 7  8  ? parallel      
C 8  9  ? parallel      
C 9  10 ? anti-parallel 
C 10 11 ? anti-parallel 
D 1  2  ? parallel      
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? anti-parallel 
D 6  7  ? anti-parallel 
D 7  8  ? anti-parallel 
D 8  9  ? anti-parallel 
D 9  10 ? anti-parallel 
D 10 11 ? anti-parallel 
D 11 12 ? anti-parallel 
E 1  2  ? parallel      
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? anti-parallel 
E 5  6  ? anti-parallel 
E 6  7  ? anti-parallel 
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? anti-parallel 
E 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLN A 11  ? LEU A 12  ? GLN A 11  LEU A 12  
A 2  ARG A 52  ? PRO A 55  ? ARG A 52  PRO A 55  
A 3  HIS A 37  ? TRP A 43  ? HIS A 37  TRP A 43  
A 4  ALA A 161 ? VAL A 170 ? ALA A 161 VAL A 170 
A 5  SER A 139 ? GLY A 148 ? SER A 139 GLY A 148 
A 6  GLN A 73  ? PHE A 75  ? GLN A 73  PHE A 75  
A 7  SER A 139 ? GLY A 148 ? SER A 139 GLY A 148 
A 8  MET A 78  ? LYS A 82  ? MET A 78  LYS A 82  
A 9  VAL A 88  ? PHE A 91  ? VAL A 88  PHE A 91  
A 10 MET A 362 ? PRO A 364 ? MET A 362 PRO A 364 
B 1  LEU A 59  ? LEU A 61  ? LEU A 59  LEU A 61  
B 2  LEU B 59  ? LEU B 61  ? LEU B 59  LEU B 61  
C 1  ARG A 285 ? GLU A 288 ? ARG A 285 GLU A 288 
C 2  LEU A 254 ? THR A 258 ? LEU A 254 THR A 258 
C 3  MET A 241 ? THR A 248 ? MET A 241 THR A 248 
C 4  VAL A 305 ? SER A 311 ? VAL A 305 SER A 311 
C 5  CYS A 318 ? LEU A 324 ? CYS A 318 LEU A 324 
C 6  ASN A 329 ? HIS A 331 ? ASN A 329 HIS A 331 
C 7  CYS A 318 ? LEU A 324 ? CYS A 318 LEU A 324 
C 8  VAL A 182 ? LEU A 185 ? VAL A 182 LEU A 185 
C 9  GLN A 224 ? TYR A 229 ? GLN A 224 TYR A 229 
C 10 GLN A 234 ? VAL A 238 ? GLN A 234 VAL A 238 
C 11 MET A 241 ? THR A 248 ? MET A 241 THR A 248 
D 1  GLN B 11  ? LEU B 12  ? GLN B 11  LEU B 12  
D 2  ARG B 52  ? PRO B 55  ? ARG B 52  PRO B 55  
D 3  HIS B 37  ? ASN B 44  ? HIS B 37  ASN B 44  
D 4  GLY B 47  ? TRP B 48  ? GLY B 47  TRP B 48  
D 5  HIS B 37  ? ASN B 44  ? HIS B 37  ASN B 44  
D 6  ALA B 161 ? VAL B 170 ? ALA B 161 VAL B 170 
D 7  SER B 139 ? GLY B 148 ? SER B 139 GLY B 148 
D 8  GLN B 73  ? PHE B 75  ? GLN B 73  PHE B 75  
D 9  SER B 139 ? GLY B 148 ? SER B 139 GLY B 148 
D 10 MET B 78  ? LYS B 82  ? MET B 78  LYS B 82  
D 11 VAL B 88  ? PHE B 91  ? VAL B 88  PHE B 91  
D 12 MET B 362 ? PRO B 364 ? MET B 362 PRO B 364 
E 1  ARG B 285 ? GLU B 288 ? ARG B 285 GLU B 288 
E 2  LEU B 254 ? THR B 258 ? LEU B 254 THR B 258 
E 3  MET B 241 ? THR B 248 ? MET B 241 THR B 248 
E 4  VAL B 305 ? SER B 311 ? VAL B 305 SER B 311 
E 5  VAL B 317 ? LEU B 324 ? VAL B 317 LEU B 324 
E 6  ASN B 329 ? HIS B 331 ? ASN B 329 HIS B 331 
E 7  VAL B 317 ? LEU B 324 ? VAL B 317 LEU B 324 
E 8  VAL B 182 ? LEU B 185 ? VAL B 182 LEU B 185 
E 9  GLN B 224 ? TYR B 229 ? GLN B 224 TYR B 229 
E 10 GLN B 234 ? VAL B 238 ? GLN B 234 VAL B 238 
E 11 MET B 241 ? THR B 248 ? MET B 241 THR B 248 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O GLN A 11  ? O GLN A 11  N ILE A 53  ? N ILE A 53  
A 2  3  N GLN A 54  ? N GLN A 54  O MET A 38  ? O MET A 38  
A 3  4  N TRP A 43  ? N TRP A 43  O ALA A 161 ? O ALA A 161 
A 4  5  N VAL A 170 ? N VAL A 170 O SER A 139 ? O SER A 139 
A 5  6  N LEU A 146 ? N LEU A 146 O LEU A 74  ? O LEU A 74  
A 6  7  O LEU A 74  ? O LEU A 74  N LEU A 146 ? N LEU A 146 
A 7  8  N VAL A 142 ? N VAL A 142 O MET A 78  ? O MET A 78  
A 8  9  N PHE A 81  ? N PHE A 81  O ARG A 89  ? O ARG A 89  
A 9  10 O LEU A 90  ? O LEU A 90  N PHE A 363 ? N PHE A 363 
B 1  2  O LEU A 61  ? O LEU A 61  N LEU B 59  ? N LEU B 59  
C 1  2  N ARG A 285 ? N ARG A 285 O LEU A 254 ? O LEU A 254 
C 2  3  N VAL A 257 ? N VAL A 257 O VAL A 245 ? O VAL A 245 
C 3  4  O TYR A 246 ? O TYR A 246 N ARG A 306 ? N ARG A 306 
C 4  5  O GLY A 310 ? O GLY A 310 N CYS A 318 ? N CYS A 318 
C 5  6  O ILE A 323 ? O ILE A 323 N LEU A 330 ? N LEU A 330 
C 6  7  N LEU A 330 ? N LEU A 330 O ILE A 323 ? O ILE A 323 
C 7  8  O PRO A 319 ? O PRO A 319 N VAL A 182 ? N VAL A 182 
C 8  9  N LEU A 185 ? N LEU A 185 O GLN A 224 ? O GLN A 224 
C 9  10 O TYR A 229 ? O TYR A 229 N GLN A 234 ? N GLN A 234 
C 10 11 N VAL A 238 ? N VAL A 238 O MET A 241 ? O MET A 241 
D 1  2  O GLN B 11  ? O GLN B 11  N ILE B 53  ? N ILE B 53  
D 2  3  N GLN B 54  ? N GLN B 54  O MET B 38  ? O MET B 38  
D 3  4  O ASN B 44  ? O ASN B 44  N GLY B 47  ? N GLY B 47  
D 4  5  N GLY B 47  ? N GLY B 47  O ASN B 44  ? O ASN B 44  
D 5  6  N TRP B 43  ? N TRP B 43  O ALA B 161 ? O ALA B 161 
D 6  7  N VAL B 170 ? N VAL B 170 O SER B 139 ? O SER B 139 
D 7  8  N LEU B 146 ? N LEU B 146 O LEU B 74  ? O LEU B 74  
D 8  9  O LEU B 74  ? O LEU B 74  N LEU B 146 ? N LEU B 146 
D 9  10 N VAL B 142 ? N VAL B 142 O MET B 78  ? O MET B 78  
D 10 11 N PHE B 81  ? N PHE B 81  O ARG B 89  ? O ARG B 89  
D 11 12 N LEU B 90  ? N LEU B 90  O PHE B 363 ? O PHE B 363 
E 1  2  N ARG B 285 ? N ARG B 285 O LEU B 254 ? O LEU B 254 
E 2  3  O VAL B 257 ? O VAL B 257 N VAL B 245 ? N VAL B 245 
E 3  4  O TYR B 246 ? O TYR B 246 N ARG B 306 ? N ARG B 306 
E 4  5  O GLY B 310 ? O GLY B 310 N CYS B 318 ? N CYS B 318 
E 5  6  O ILE B 323 ? O ILE B 323 N LEU B 330 ? N LEU B 330 
E 6  7  N LEU B 330 ? N LEU B 330 O ILE B 323 ? O ILE B 323 
E 7  8  O PRO B 319 ? O PRO B 319 N VAL B 182 ? N VAL B 182 
E 8  9  N LEU B 185 ? N LEU B 185 O GLN B 224 ? O GLN B 224 
E 9  10 O TYR B 229 ? O TYR B 229 N GLN B 234 ? N GLN B 234 
E 10 11 N VAL B 238 ? N VAL B 238 O MET B 241 ? O MET B 241 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE PLP A 370' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE PLP B 370' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 ARG A 99  ? ARG A 99  . ? 1_555 ? 
2  AC1 15 ARG A 192 ? ARG A 192 . ? 1_555 ? 
3  AC1 15 LYS A 202 ? LYS A 202 . ? 1_555 ? 
4  AC1 15 TYR A 207 ? TYR A 207 . ? 1_555 ? 
5  AC1 15 GLU A 237 ? GLU A 237 . ? 1_555 ? 
6  AC1 15 THR A 240 ? THR A 240 . ? 1_555 ? 
7  AC1 15 ASN A 242 ? ASN A 242 . ? 1_555 ? 
8  AC1 15 LEU A 266 ? LEU A 266 . ? 1_555 ? 
9  AC1 15 GLY A 268 ? GLY A 268 . ? 1_555 ? 
10 AC1 15 VAL A 269 ? VAL A 269 . ? 1_555 ? 
11 AC1 15 VAL A 270 ? VAL A 270 . ? 1_555 ? 
12 AC1 15 THR A 313 ? THR A 313 . ? 1_555 ? 
13 AC1 15 HOH E .   ? HOH A 371 . ? 1_555 ? 
14 AC1 15 HOH E .   ? HOH A 381 . ? 1_555 ? 
15 AC1 15 HOH E .   ? HOH A 385 . ? 1_555 ? 
16 AC2 15 ARG B 99  ? ARG B 99  . ? 1_555 ? 
17 AC2 15 LYS B 202 ? LYS B 202 . ? 1_555 ? 
18 AC2 15 TYR B 207 ? TYR B 207 . ? 1_555 ? 
19 AC2 15 GLU B 237 ? GLU B 237 . ? 1_555 ? 
20 AC2 15 THR B 240 ? THR B 240 . ? 1_555 ? 
21 AC2 15 ASN B 242 ? ASN B 242 . ? 1_555 ? 
22 AC2 15 LEU B 266 ? LEU B 266 . ? 1_555 ? 
23 AC2 15 GLY B 268 ? GLY B 268 . ? 1_555 ? 
24 AC2 15 VAL B 269 ? VAL B 269 . ? 1_555 ? 
25 AC2 15 VAL B 270 ? VAL B 270 . ? 1_555 ? 
26 AC2 15 GLY B 312 ? GLY B 312 . ? 1_555 ? 
27 AC2 15 THR B 313 ? THR B 313 . ? 1_555 ? 
28 AC2 15 HOH F .   ? HOH B 375 . ? 1_555 ? 
29 AC2 15 HOH F .   ? HOH B 400 . ? 1_555 ? 
30 AC2 15 HOH F .   ? HOH B 448 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EKF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EKF 
_atom_sites.fract_transf_matrix[1][1]   0.014412 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009521 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009344 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 19.687  18.407 13.787 1.00 60.56 ? 1   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 18.440  17.800 14.340 1.00 58.86 ? 1   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 17.561  17.197 13.247 1.00 60.69 ? 1   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 17.694  17.527 12.066 1.00 60.97 ? 1   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 17.647  18.854 15.111 1.00 59.97 ? 1   ALA A CB  1 
ATOM   6    N N   . SER A 1 2   ? 16.667  16.300 13.648 1.00 62.90 ? 2   SER A N   1 
ATOM   7    C CA  . SER A 1 2   ? 15.755  15.665 12.703 1.00 64.98 ? 2   SER A CA  1 
ATOM   8    C C   . SER A 1 2   ? 14.656  16.672 12.361 1.00 65.28 ? 2   SER A C   1 
ATOM   9    O O   . SER A 1 2   ? 14.032  17.257 13.259 1.00 67.59 ? 2   SER A O   1 
ATOM   10   C CB  . SER A 1 2   ? 15.141  14.408 13.325 1.00 63.83 ? 2   SER A CB  1 
ATOM   11   O OG  . SER A 1 2   ? 14.571  14.713 14.588 1.00 64.99 ? 2   SER A OG  1 
ATOM   12   N N   . SER A 1 3   ? 14.439  16.869 11.060 1.00 62.42 ? 3   SER A N   1 
ATOM   13   C CA  . SER A 1 3   ? 13.438  17.798 10.536 1.00 57.78 ? 3   SER A CA  1 
ATOM   14   C C   . SER A 1 3   ? 12.724  18.638 11.595 1.00 56.00 ? 3   SER A C   1 
ATOM   15   O O   . SER A 1 3   ? 13.269  19.629 12.092 1.00 56.64 ? 3   SER A O   1 
ATOM   16   C CB  . SER A 1 3   ? 12.400  17.027 9.707  1.00 57.90 ? 3   SER A CB  1 
ATOM   17   O OG  . SER A 1 3   ? 13.003  16.401 8.585  1.00 60.97 ? 3   SER A OG  1 
ATOM   18   N N   . SER A 1 4   ? 11.502  18.222 11.918 1.00 49.90 ? 4   SER A N   1 
ATOM   19   C CA  . SER A 1 4   ? 10.647  18.876 12.892 1.00 45.49 ? 4   SER A CA  1 
ATOM   20   C C   . SER A 1 4   ? 9.545   17.875 13.259 1.00 39.26 ? 4   SER A C   1 
ATOM   21   O O   . SER A 1 4   ? 9.426   16.853 12.596 1.00 39.47 ? 4   SER A O   1 
ATOM   22   C CB  . SER A 1 4   ? 10.115  20.174 12.290 1.00 52.49 ? 4   SER A CB  1 
ATOM   23   O OG  . SER A 1 4   ? 11.214  21.055 12.030 1.00 49.96 ? 4   SER A OG  1 
ATOM   24   N N   . PHE A 1 5   ? 8.739   18.140 14.288 1.00 34.26 ? 5   PHE A N   1 
ATOM   25   C CA  . PHE A 1 5   ? 7.759   17.139 14.731 1.00 28.80 ? 5   PHE A CA  1 
ATOM   26   C C   . PHE A 1 5   ? 6.666   16.712 13.771 1.00 27.88 ? 5   PHE A C   1 
ATOM   27   O O   . PHE A 1 5   ? 6.212   17.491 12.947 1.00 27.83 ? 5   PHE A O   1 
ATOM   28   C CB  . PHE A 1 5   ? 7.152   17.549 16.082 1.00 37.48 ? 5   PHE A CB  1 
ATOM   29   C CG  . PHE A 1 5   ? 6.317   18.795 16.027 1.00 37.39 ? 5   PHE A CG  1 
ATOM   30   C CD1 . PHE A 1 5   ? 4.988   18.739 15.608 1.00 35.56 ? 5   PHE A CD1 1 
ATOM   31   C CD2 . PHE A 1 5   ? 6.861   20.029 16.397 1.00 34.77 ? 5   PHE A CD2 1 
ATOM   32   C CE1 . PHE A 1 5   ? 4.204   19.895 15.558 1.00 36.53 ? 5   PHE A CE1 1 
ATOM   33   C CE2 . PHE A 1 5   ? 6.083   21.193 16.352 1.00 34.46 ? 5   PHE A CE2 1 
ATOM   34   C CZ  . PHE A 1 5   ? 4.756   21.128 15.934 1.00 34.84 ? 5   PHE A CZ  1 
ATOM   35   N N   . LYS A 1 6   ? 6.227   15.463 13.906 1.00 30.52 ? 6   LYS A N   1 
ATOM   36   C CA  . LYS A 1 6   ? 5.218   14.899 13.012 1.00 32.05 ? 6   LYS A CA  1 
ATOM   37   C C   . LYS A 1 6   ? 3.937   14.376 13.633 1.00 28.38 ? 6   LYS A C   1 
ATOM   38   O O   . LYS A 1 6   ? 3.949   13.710 14.664 1.00 32.58 ? 6   LYS A O   1 
ATOM   39   C CB  . LYS A 1 6   ? 5.873   13.810 12.156 1.00 29.03 ? 6   LYS A CB  1 
ATOM   40   C CG  . LYS A 1 6   ? 6.964   14.416 11.316 1.00 36.17 ? 6   LYS A CG  1 
ATOM   41   C CD  . LYS A 1 6   ? 8.007   13.435 10.862 1.00 42.12 ? 6   LYS A CD  1 
ATOM   42   C CE  . LYS A 1 6   ? 9.333   14.178 10.680 1.00 43.86 ? 6   LYS A CE  1 
ATOM   43   N NZ  . LYS A 1 6   ? 9.104   15.566 10.158 1.00 42.09 ? 6   LYS A NZ  1 
ATOM   44   N N   . ALA A 1 7   ? 2.832   14.676 12.963 1.00 29.42 ? 7   ALA A N   1 
ATOM   45   C CA  . ALA A 1 7   ? 1.497   14.281 13.403 1.00 29.29 ? 7   ALA A CA  1 
ATOM   46   C C   . ALA A 1 7   ? 1.336   12.770 13.540 1.00 29.35 ? 7   ALA A C   1 
ATOM   47   O O   . ALA A 1 7   ? 0.527   12.300 14.340 1.00 26.40 ? 7   ALA A O   1 
ATOM   48   C CB  . ALA A 1 7   ? 0.460   14.821 12.420 1.00 33.00 ? 7   ALA A CB  1 
ATOM   49   N N   . ALA A 1 8   ? 2.107   12.024 12.751 1.00 33.84 ? 8   ALA A N   1 
ATOM   50   C CA  . ALA A 1 8   ? 2.055   10.566 12.758 1.00 33.76 ? 8   ALA A CA  1 
ATOM   51   C C   . ALA A 1 8   ? 2.626   9.967  14.033 1.00 32.17 ? 8   ALA A C   1 
ATOM   52   O O   . ALA A 1 8   ? 2.311   8.831  14.379 1.00 34.21 ? 8   ALA A O   1 
ATOM   53   C CB  . ALA A 1 8   ? 2.802   10.010 11.541 1.00 36.10 ? 8   ALA A CB  1 
ATOM   54   N N   . ASP A 1 9   ? 3.451   10.733 14.740 1.00 29.13 ? 9   ASP A N   1 
ATOM   55   C CA  . ASP A 1 9   ? 4.068   10.250 15.973 1.00 29.04 ? 9   ASP A CA  1 
ATOM   56   C C   . ASP A 1 9   ? 3.329   10.719 17.211 1.00 30.13 ? 9   ASP A C   1 
ATOM   57   O O   . ASP A 1 9   ? 3.840   10.599 18.322 1.00 29.16 ? 9   ASP A O   1 
ATOM   58   C CB  . ASP A 1 9   ? 5.523   10.723 16.080 1.00 32.09 ? 9   ASP A CB  1 
ATOM   59   C CG  . ASP A 1 9   ? 6.377   10.299 14.892 1.00 38.60 ? 9   ASP A CG  1 
ATOM   60   O OD1 . ASP A 1 9   ? 6.222   9.163  14.414 1.00 42.32 ? 9   ASP A OD1 1 
ATOM   61   O OD2 . ASP A 1 9   ? 7.225   11.097 14.444 1.00 38.59 ? 9   ASP A OD2 1 
ATOM   62   N N   . LEU A 1 10  ? 2.136   11.266 17.022 1.00 30.06 ? 10  LEU A N   1 
ATOM   63   C CA  . LEU A 1 10  ? 1.337   11.754 18.132 1.00 30.61 ? 10  LEU A CA  1 
ATOM   64   C C   . LEU A 1 10  ? 1.068   10.686 19.159 1.00 32.71 ? 10  LEU A C   1 
ATOM   65   O O   . LEU A 1 10  ? 0.764   9.550  18.813 1.00 29.02 ? 10  LEU A O   1 
ATOM   66   C CB  . LEU A 1 10  ? -0.001  12.290 17.628 1.00 29.43 ? 10  LEU A CB  1 
ATOM   67   C CG  . LEU A 1 10  ? -0.114  13.803 17.494 1.00 32.78 ? 10  LEU A CG  1 
ATOM   68   C CD1 . LEU A 1 10  ? -1.296  14.171 16.625 1.00 35.73 ? 10  LEU A CD1 1 
ATOM   69   C CD2 . LEU A 1 10  ? -0.271  14.396 18.887 1.00 41.62 ? 10  LEU A CD2 1 
ATOM   70   N N   . GLN A 1 11  ? 1.192   11.049 20.428 1.00 32.05 ? 11  GLN A N   1 
ATOM   71   C CA  . GLN A 1 11  ? 0.911   10.121 21.509 1.00 31.24 ? 11  GLN A CA  1 
ATOM   72   C C   . GLN A 1 11  ? -0.318  10.676 22.188 1.00 32.58 ? 11  GLN A C   1 
ATOM   73   O O   . GLN A 1 11  ? -0.367  11.871 22.492 1.00 36.14 ? 11  GLN A O   1 
ATOM   74   C CB  . GLN A 1 11  ? 2.058   10.086 22.515 1.00 41.18 ? 11  GLN A CB  1 
ATOM   75   C CG  . GLN A 1 11  ? 1.730   9.291  23.787 1.00 47.00 ? 11  GLN A CG  1 
ATOM   76   C CD  . GLN A 1 11  ? 1.788   7.785  23.577 1.00 50.47 ? 11  GLN A CD  1 
ATOM   77   O OE1 . GLN A 1 11  ? 2.874   7.198  23.491 1.00 55.27 ? 11  GLN A OE1 1 
ATOM   78   N NE2 . GLN A 1 11  ? 0.618   7.154  23.481 1.00 51.45 ? 11  GLN A NE2 1 
ATOM   79   N N   . LEU A 1 12  ? -1.309  9.825  22.423 1.00 29.23 ? 12  LEU A N   1 
ATOM   80   C CA  . LEU A 1 12  ? -2.538  10.258 23.069 1.00 33.59 ? 12  LEU A CA  1 
ATOM   81   C C   . LEU A 1 12  ? -2.670  9.794  24.511 1.00 31.99 ? 12  LEU A C   1 
ATOM   82   O O   . LEU A 1 12  ? -2.548  8.605  24.815 1.00 28.80 ? 12  LEU A O   1 
ATOM   83   C CB  . LEU A 1 12  ? -3.769  9.777  22.287 1.00 36.79 ? 12  LEU A CB  1 
ATOM   84   C CG  . LEU A 1 12  ? -3.888  10.193 20.817 1.00 46.43 ? 12  LEU A CG  1 
ATOM   85   C CD1 . LEU A 1 12  ? -5.239  9.742  20.281 1.00 46.08 ? 12  LEU A CD1 1 
ATOM   86   C CD2 . LEU A 1 12  ? -3.744  11.708 20.669 1.00 48.65 ? 12  LEU A CD2 1 
ATOM   87   N N   . GLU A 1 13  ? -2.907  10.749 25.398 1.00 30.10 ? 13  GLU A N   1 
ATOM   88   C CA  . GLU A 1 13  ? -3.109  10.445 26.806 1.00 28.87 ? 13  GLU A CA  1 
ATOM   89   C C   . GLU A 1 13  ? -4.420  11.102 27.203 1.00 30.81 ? 13  GLU A C   1 
ATOM   90   O O   . GLU A 1 13  ? -4.482  12.311 27.401 1.00 33.49 ? 13  GLU A O   1 
ATOM   91   C CB  . GLU A 1 13  ? -1.974  10.990 27.667 1.00 32.53 ? 13  GLU A CB  1 
ATOM   92   C CG  . GLU A 1 13  ? -2.206  10.737 29.151 1.00 35.34 ? 13  GLU A CG  1 
ATOM   93   C CD  . GLU A 1 13  ? -1.195  11.443 30.038 1.00 35.68 ? 13  GLU A CD  1 
ATOM   94   O OE1 . GLU A 1 13  ? -0.304  12.151 29.515 1.00 34.41 ? 13  GLU A OE1 1 
ATOM   95   O OE2 . GLU A 1 13  ? -1.303  11.283 31.262 1.00 35.17 ? 13  GLU A OE2 1 
ATOM   96   N N   . MET A 1 14  ? -5.467  10.290 27.308 1.00 28.38 ? 14  MET A N   1 
ATOM   97   C CA  . MET A 1 14  ? -6.803  10.750 27.649 1.00 28.55 ? 14  MET A CA  1 
ATOM   98   C C   . MET A 1 14  ? -6.941  11.147 29.098 1.00 32.74 ? 14  MET A C   1 
ATOM   99   O O   . MET A 1 14  ? -6.297  10.583 29.977 1.00 34.11 ? 14  MET A O   1 
ATOM   100  C CB  . MET A 1 14  ? -7.823  9.657  27.325 1.00 31.32 ? 14  MET A CB  1 
ATOM   101  C CG  . MET A 1 14  ? -7.953  9.389  25.838 1.00 35.62 ? 14  MET A CG  1 
ATOM   102  S SD  . MET A 1 14  ? -8.415  10.888 24.916 1.00 41.80 ? 14  MET A SD  1 
ATOM   103  C CE  . MET A 1 14  ? -10.111 11.112 25.499 1.00 39.51 ? 14  MET A CE  1 
ATOM   104  N N   . THR A 1 15  ? -7.794  12.125 29.353 1.00 28.68 ? 15  THR A N   1 
ATOM   105  C CA  . THR A 1 15  ? -7.979  12.557 30.721 1.00 31.06 ? 15  THR A CA  1 
ATOM   106  C C   . THR A 1 15  ? -8.772  11.545 31.541 1.00 32.01 ? 15  THR A C   1 
ATOM   107  O O   . THR A 1 15  ? -9.687  10.887 31.031 1.00 34.90 ? 15  THR A O   1 
ATOM   108  C CB  . THR A 1 15  ? -8.712  13.901 30.806 1.00 22.32 ? 15  THR A CB  1 
ATOM   109  O OG1 . THR A 1 15  ? -8.828  14.258 32.187 1.00 28.90 ? 15  THR A OG1 1 
ATOM   110  C CG2 . THR A 1 15  ? -10.123 13.805 30.186 1.00 28.07 ? 15  THR A CG2 1 
ATOM   111  N N   . GLN A 1 16  ? -8.410  11.420 32.811 1.00 33.60 ? 16  GLN A N   1 
ATOM   112  C CA  . GLN A 1 16  ? -9.118  10.521 33.729 1.00 41.83 ? 16  GLN A CA  1 
ATOM   113  C C   . GLN A 1 16  ? -9.981  11.369 34.660 1.00 42.71 ? 16  GLN A C   1 
ATOM   114  O O   . GLN A 1 16  ? -10.794 10.843 35.421 1.00 45.92 ? 16  GLN A O   1 
ATOM   115  C CB  . GLN A 1 16  ? -8.141  9.713  34.576 1.00 36.94 ? 16  GLN A CB  1 
ATOM   116  C CG  . GLN A 1 16  ? -7.254  8.783  33.788 1.00 41.34 ? 16  GLN A CG  1 
ATOM   117  C CD  . GLN A 1 16  ? -6.313  8.026  34.691 1.00 52.24 ? 16  GLN A CD  1 
ATOM   118  O OE1 . GLN A 1 16  ? -6.747  7.309  35.596 1.00 57.21 ? 16  GLN A OE1 1 
ATOM   119  N NE2 . GLN A 1 16  ? -5.012  8.186  34.460 1.00 56.75 ? 16  GLN A NE2 1 
ATOM   120  N N   . LYS A 1 17  ? -9.798  12.685 34.578 1.00 46.53 ? 17  LYS A N   1 
ATOM   121  C CA  . LYS A 1 17  ? -10.528 13.645 35.408 1.00 44.43 ? 17  LYS A CA  1 
ATOM   122  C C   . LYS A 1 17  ? -11.284 14.694 34.566 1.00 42.81 ? 17  LYS A C   1 
ATOM   123  O O   . LYS A 1 17  ? -11.061 15.892 34.719 1.00 42.67 ? 17  LYS A O   1 
ATOM   124  C CB  . LYS A 1 17  ? -9.538  14.366 36.330 1.00 48.39 ? 17  LYS A CB  1 
ATOM   125  C CG  . LYS A 1 17  ? -8.849  13.497 37.389 1.00 51.57 ? 17  LYS A CG  1 
ATOM   126  C CD  . LYS A 1 17  ? -7.742  14.294 38.094 1.00 49.63 ? 17  LYS A CD  1 
ATOM   127  C CE  . LYS A 1 17  ? -7.232  13.616 39.364 1.00 55.63 ? 17  LYS A CE  1 
ATOM   128  N NZ  . LYS A 1 17  ? -8.212  13.554 40.490 1.00 56.28 ? 17  LYS A NZ  1 
ATOM   129  N N   . PRO A 1 18  ? -12.201 14.257 33.687 1.00 41.40 ? 18  PRO A N   1 
ATOM   130  C CA  . PRO A 1 18  ? -12.976 15.162 32.829 1.00 42.11 ? 18  PRO A CA  1 
ATOM   131  C C   . PRO A 1 18  ? -13.354 16.463 33.532 1.00 45.96 ? 18  PRO A C   1 
ATOM   132  O O   . PRO A 1 18  ? -13.512 16.495 34.749 1.00 49.31 ? 18  PRO A O   1 
ATOM   133  C CB  . PRO A 1 18  ? -14.216 14.342 32.491 1.00 39.79 ? 18  PRO A CB  1 
ATOM   134  C CG  . PRO A 1 18  ? -13.695 12.955 32.488 1.00 40.96 ? 18  PRO A CG  1 
ATOM   135  C CD  . PRO A 1 18  ? -12.811 12.917 33.708 1.00 39.59 ? 18  PRO A CD  1 
ATOM   136  N N   . HIS A 1 19  ? -13.490 17.535 32.761 1.00 42.93 ? 19  HIS A N   1 
ATOM   137  C CA  . HIS A 1 19  ? -13.884 18.824 33.311 1.00 43.89 ? 19  HIS A CA  1 
ATOM   138  C C   . HIS A 1 19  ? -15.392 18.941 33.109 1.00 45.35 ? 19  HIS A C   1 
ATOM   139  O O   . HIS A 1 19  ? -15.957 18.379 32.171 1.00 45.37 ? 19  HIS A O   1 
ATOM   140  C CB  . HIS A 1 19  ? -13.219 19.984 32.553 1.00 48.29 ? 19  HIS A CB  1 
ATOM   141  C CG  . HIS A 1 19  ? -11.781 20.227 32.902 1.00 48.91 ? 19  HIS A CG  1 
ATOM   142  N ND1 . HIS A 1 19  ? -11.002 21.140 32.218 1.00 50.93 ? 19  HIS A ND1 1 
ATOM   143  C CD2 . HIS A 1 19  ? -10.995 19.724 33.882 1.00 50.85 ? 19  HIS A CD2 1 
ATOM   144  C CE1 . HIS A 1 19  ? -9.801  21.190 32.764 1.00 50.72 ? 19  HIS A CE1 1 
ATOM   145  N NE2 . HIS A 1 19  ? -9.770  20.341 33.776 1.00 50.62 ? 19  HIS A NE2 1 
ATOM   146  N N   . LYS A 1 20  ? -16.050 19.672 33.991 1.00 46.61 ? 20  LYS A N   1 
ATOM   147  C CA  . LYS A 1 20  ? -17.481 19.883 33.855 1.00 47.65 ? 20  LYS A CA  1 
ATOM   148  C C   . LYS A 1 20  ? -17.678 20.822 32.650 1.00 45.68 ? 20  LYS A C   1 
ATOM   149  O O   . LYS A 1 20  ? -17.053 21.878 32.591 1.00 41.29 ? 20  LYS A O   1 
ATOM   150  C CB  . LYS A 1 20  ? -18.009 20.536 35.132 1.00 49.49 ? 20  LYS A CB  1 
ATOM   151  C CG  . LYS A 1 20  ? -19.491 20.851 35.128 1.00 52.36 ? 20  LYS A CG  1 
ATOM   152  C CD  . LYS A 1 20  ? -19.847 21.740 36.321 1.00 52.92 ? 20  LYS A CD  1 
ATOM   153  C CE  . LYS A 1 20  ? -19.286 23.155 36.161 1.00 54.17 ? 20  LYS A CE  1 
ATOM   154  N NZ  . LYS A 1 20  ? -17.795 23.208 36.129 1.00 47.27 ? 20  LYS A NZ  1 
ATOM   155  N N   . LYS A 1 21  ? -18.519 20.438 31.690 1.00 41.64 ? 21  LYS A N   1 
ATOM   156  C CA  . LYS A 1 21  ? -18.777 21.275 30.517 1.00 44.01 ? 21  LYS A CA  1 
ATOM   157  C C   . LYS A 1 21  ? -19.649 22.480 30.899 1.00 47.31 ? 21  LYS A C   1 
ATOM   158  O O   . LYS A 1 21  ? -20.569 22.362 31.714 1.00 51.16 ? 21  LYS A O   1 
ATOM   159  C CB  . LYS A 1 21  ? -19.492 20.477 29.430 1.00 46.99 ? 21  LYS A CB  1 
ATOM   160  C CG  . LYS A 1 21  ? -18.709 20.274 28.132 1.00 47.78 ? 21  LYS A CG  1 
ATOM   161  C CD  . LYS A 1 21  ? -17.818 19.050 28.199 1.00 46.17 ? 21  LYS A CD  1 
ATOM   162  C CE  . LYS A 1 21  ? -17.444 18.576 26.805 1.00 45.65 ? 21  LYS A CE  1 
ATOM   163  N NZ  . LYS A 1 21  ? -16.689 17.295 26.867 1.00 50.75 ? 21  LYS A NZ  1 
ATOM   164  N N   . PRO A 1 22  ? -19.389 23.650 30.295 1.00 47.14 ? 22  PRO A N   1 
ATOM   165  C CA  . PRO A 1 22  ? -20.164 24.855 30.604 1.00 47.75 ? 22  PRO A CA  1 
ATOM   166  C C   . PRO A 1 22  ? -21.660 24.581 30.623 1.00 49.71 ? 22  PRO A C   1 
ATOM   167  O O   . PRO A 1 22  ? -22.253 24.230 29.601 1.00 44.29 ? 22  PRO A O   1 
ATOM   168  C CB  . PRO A 1 22  ? -19.764 25.818 29.486 1.00 48.49 ? 22  PRO A CB  1 
ATOM   169  C CG  . PRO A 1 22  ? -18.377 25.400 29.174 1.00 43.09 ? 22  PRO A CG  1 
ATOM   170  C CD  . PRO A 1 22  ? -18.502 23.895 29.147 1.00 46.27 ? 22  PRO A CD  1 
ATOM   171  N N   . GLY A 1 23  ? -22.268 24.738 31.794 1.00 52.20 ? 23  GLY A N   1 
ATOM   172  C CA  . GLY A 1 23  ? -23.693 24.494 31.901 1.00 57.54 ? 23  GLY A CA  1 
ATOM   173  C C   . GLY A 1 23  ? -24.515 25.488 32.710 1.00 62.70 ? 23  GLY A C   1 
ATOM   174  O O   . GLY A 1 23  ? -25.734 25.306 32.806 1.00 62.96 ? 23  GLY A O   1 
ATOM   175  N N   . PRO A 1 24  ? -23.910 26.543 33.302 1.00 65.07 ? 24  PRO A N   1 
ATOM   176  C CA  . PRO A 1 24  ? -24.748 27.476 34.076 1.00 66.88 ? 24  PRO A CA  1 
ATOM   177  C C   . PRO A 1 24  ? -25.778 28.183 33.179 1.00 68.11 ? 24  PRO A C   1 
ATOM   178  O O   . PRO A 1 24  ? -26.396 27.558 32.300 1.00 63.94 ? 24  PRO A O   1 
ATOM   179  C CB  . PRO A 1 24  ? -23.727 28.457 34.672 1.00 64.94 ? 24  PRO A CB  1 
ATOM   180  C CG  . PRO A 1 24  ? -22.433 27.663 34.695 1.00 64.10 ? 24  PRO A CG  1 
ATOM   181  C CD  . PRO A 1 24  ? -22.488 26.929 33.377 1.00 63.38 ? 24  PRO A CD  1 
ATOM   182  N N   . GLY A 1 25  ? -25.970 29.483 33.408 1.00 67.42 ? 25  GLY A N   1 
ATOM   183  C CA  . GLY A 1 25  ? -26.895 30.235 32.580 1.00 62.39 ? 25  GLY A CA  1 
ATOM   184  C C   . GLY A 1 25  ? -26.198 30.415 31.245 1.00 64.73 ? 25  GLY A C   1 
ATOM   185  O O   . GLY A 1 25  ? -26.471 31.359 30.498 1.00 66.25 ? 25  GLY A O   1 
ATOM   186  N N   . GLU A 1 26  ? -25.281 29.489 30.963 1.00 64.09 ? 26  GLU A N   1 
ATOM   187  C CA  . GLU A 1 26  ? -24.485 29.494 29.745 1.00 61.86 ? 26  GLU A CA  1 
ATOM   188  C C   . GLU A 1 26  ? -23.556 30.725 29.742 1.00 60.02 ? 26  GLU A C   1 
ATOM   189  O O   . GLU A 1 26  ? -23.390 31.378 28.709 1.00 59.15 ? 26  GLU A O   1 
ATOM   190  C CB  . GLU A 1 26  ? -25.414 29.526 28.522 1.00 62.17 ? 26  GLU A CB  1 
ATOM   191  C CG  . GLU A 1 26  ? -24.989 28.613 27.379 1.00 61.92 ? 26  GLU A CG  1 
ATOM   192  C CD  . GLU A 1 26  ? -23.499 28.695 27.095 1.00 65.29 ? 26  GLU A CD  1 
ATOM   193  O OE1 . GLU A 1 26  ? -23.008 29.810 26.797 1.00 64.78 ? 26  GLU A OE1 1 
ATOM   194  O OE2 . GLU A 1 26  ? -22.820 27.643 27.174 1.00 61.84 ? 26  GLU A OE2 1 
ATOM   195  N N   . PRO A 1 27  ? -22.932 31.054 30.899 1.00 57.35 ? 27  PRO A N   1 
ATOM   196  C CA  . PRO A 1 27  ? -22.039 32.220 30.966 1.00 55.33 ? 27  PRO A CA  1 
ATOM   197  C C   . PRO A 1 27  ? -20.591 31.972 30.519 1.00 53.03 ? 27  PRO A C   1 
ATOM   198  O O   . PRO A 1 27  ? -19.717 31.724 31.351 1.00 58.04 ? 27  PRO A O   1 
ATOM   199  C CB  . PRO A 1 27  ? -22.105 32.633 32.448 1.00 54.70 ? 27  PRO A CB  1 
ATOM   200  C CG  . PRO A 1 27  ? -23.277 31.867 33.015 1.00 55.58 ? 27  PRO A CG  1 
ATOM   201  C CD  . PRO A 1 27  ? -23.216 30.571 32.257 1.00 56.58 ? 27  PRO A CD  1 
ATOM   202  N N   . LEU A 1 28  ? -20.341 32.038 29.213 1.00 50.34 ? 28  LEU A N   1 
ATOM   203  C CA  . LEU A 1 28  ? -18.995 31.842 28.674 1.00 45.45 ? 28  LEU A CA  1 
ATOM   204  C C   . LEU A 1 28  ? -18.241 33.162 28.666 1.00 42.96 ? 28  LEU A C   1 
ATOM   205  O O   . LEU A 1 28  ? -18.617 34.089 27.963 1.00 46.23 ? 28  LEU A O   1 
ATOM   206  C CB  . LEU A 1 28  ? -19.044 31.323 27.233 1.00 48.13 ? 28  LEU A CB  1 
ATOM   207  C CG  . LEU A 1 28  ? -19.491 29.897 26.918 1.00 51.08 ? 28  LEU A CG  1 
ATOM   208  C CD1 . LEU A 1 28  ? -19.569 29.723 25.392 1.00 49.87 ? 28  LEU A CD1 1 
ATOM   209  C CD2 . LEU A 1 28  ? -18.517 28.899 27.528 1.00 48.94 ? 28  LEU A CD2 1 
ATOM   210  N N   . VAL A 1 29  ? -17.177 33.242 29.453 1.00 42.52 ? 29  VAL A N   1 
ATOM   211  C CA  . VAL A 1 29  ? -16.351 34.433 29.524 1.00 38.05 ? 29  VAL A CA  1 
ATOM   212  C C   . VAL A 1 29  ? -15.019 34.081 28.872 1.00 40.19 ? 29  VAL A C   1 
ATOM   213  O O   . VAL A 1 29  ? -14.361 33.114 29.266 1.00 36.09 ? 29  VAL A O   1 
ATOM   214  C CB  . VAL A 1 29  ? -16.120 34.841 30.967 1.00 39.71 ? 29  VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 29  ? -15.082 35.946 31.029 1.00 40.64 ? 29  VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 29  ? -17.437 35.301 31.576 1.00 40.68 ? 29  VAL A CG2 1 
ATOM   217  N N   . PHE A 1 30  ? -14.634 34.868 27.868 1.00 38.11 ? 30  PHE A N   1 
ATOM   218  C CA  . PHE A 1 30  ? -13.407 34.634 27.112 1.00 36.07 ? 30  PHE A CA  1 
ATOM   219  C C   . PHE A 1 30  ? -12.179 34.276 27.957 1.00 36.33 ? 30  PHE A C   1 
ATOM   220  O O   . PHE A 1 30  ? -11.939 34.882 28.998 1.00 37.52 ? 30  PHE A O   1 
ATOM   221  C CB  . PHE A 1 30  ? -13.082 35.865 26.258 1.00 35.59 ? 30  PHE A CB  1 
ATOM   222  C CG  . PHE A 1 30  ? -12.019 35.616 25.227 1.00 35.02 ? 30  PHE A CG  1 
ATOM   223  C CD1 . PHE A 1 30  ? -12.350 35.057 23.994 1.00 35.94 ? 30  PHE A CD1 1 
ATOM   224  C CD2 . PHE A 1 30  ? -10.683 35.896 25.510 1.00 32.74 ? 30  PHE A CD2 1 
ATOM   225  C CE1 . PHE A 1 30  ? -11.360 34.777 23.050 1.00 41.86 ? 30  PHE A CE1 1 
ATOM   226  C CE2 . PHE A 1 30  ? -9.682  35.623 24.582 1.00 43.39 ? 30  PHE A CE2 1 
ATOM   227  C CZ  . PHE A 1 30  ? -10.021 35.058 23.342 1.00 41.55 ? 30  PHE A CZ  1 
ATOM   228  N N   . GLY A 1 31  ? -11.425 33.277 27.495 1.00 37.65 ? 31  GLY A N   1 
ATOM   229  C CA  . GLY A 1 31  ? -10.194 32.843 28.155 1.00 38.01 ? 31  GLY A CA  1 
ATOM   230  C C   . GLY A 1 31  ? -10.203 32.368 29.599 1.00 35.77 ? 31  GLY A C   1 
ATOM   231  O O   . GLY A 1 31  ? -9.145  32.279 30.220 1.00 36.31 ? 31  GLY A O   1 
ATOM   232  N N   . LYS A 1 32  ? -11.380 32.056 30.134 1.00 34.77 ? 32  LYS A N   1 
ATOM   233  C CA  . LYS A 1 32  ? -11.504 31.595 31.514 1.00 36.49 ? 32  LYS A CA  1 
ATOM   234  C C   . LYS A 1 32  ? -11.686 30.086 31.597 1.00 34.94 ? 32  LYS A C   1 
ATOM   235  O O   . LYS A 1 32  ? -11.202 29.449 32.519 1.00 35.98 ? 32  LYS A O   1 
ATOM   236  C CB  . LYS A 1 32  ? -12.720 32.249 32.182 1.00 37.30 ? 32  LYS A CB  1 
ATOM   237  C CG  . LYS A 1 32  ? -12.617 33.737 32.401 1.00 46.75 ? 32  LYS A CG  1 
ATOM   238  C CD  . LYS A 1 32  ? -12.120 34.071 33.807 1.00 42.43 ? 32  LYS A CD  1 
ATOM   239  C CE  . LYS A 1 32  ? -12.096 35.576 34.007 1.00 45.07 ? 32  LYS A CE  1 
ATOM   240  N NZ  . LYS A 1 32  ? -11.294 36.226 32.926 1.00 42.45 ? 32  LYS A NZ  1 
ATOM   241  N N   . THR A 1 33  ? -12.395 29.525 30.625 1.00 35.90 ? 33  THR A N   1 
ATOM   242  C CA  . THR A 1 33  ? -12.700 28.098 30.601 1.00 33.32 ? 33  THR A CA  1 
ATOM   243  C C   . THR A 1 33  ? -11.863 27.326 29.605 1.00 31.70 ? 33  THR A C   1 
ATOM   244  O O   . THR A 1 33  ? -11.771 27.702 28.431 1.00 33.27 ? 33  THR A O   1 
ATOM   245  C CB  . THR A 1 33  ? -14.175 27.898 30.265 1.00 35.21 ? 33  THR A CB  1 
ATOM   246  O OG1 . THR A 1 33  ? -14.953 28.695 31.159 1.00 37.93 ? 33  THR A OG1 1 
ATOM   247  C CG2 . THR A 1 33  ? -14.576 26.423 30.405 1.00 36.77 ? 33  THR A CG2 1 
ATOM   248  N N   . PHE A 1 34  ? -11.266 26.231 30.066 1.00 25.23 ? 34  PHE A N   1 
ATOM   249  C CA  . PHE A 1 34  ? -10.431 25.423 29.201 1.00 27.10 ? 34  PHE A CA  1 
ATOM   250  C C   . PHE A 1 34  ? -10.996 24.025 29.006 1.00 27.22 ? 34  PHE A C   1 
ATOM   251  O O   . PHE A 1 34  ? -11.719 23.523 29.862 1.00 30.78 ? 34  PHE A O   1 
ATOM   252  C CB  . PHE A 1 34  ? -9.023  25.368 29.802 1.00 22.10 ? 34  PHE A CB  1 
ATOM   253  C CG  . PHE A 1 34  ? -8.449  26.719 30.050 1.00 26.00 ? 34  PHE A CG  1 
ATOM   254  C CD1 . PHE A 1 34  ? -8.594  27.320 31.286 1.00 29.39 ? 34  PHE A CD1 1 
ATOM   255  C CD2 . PHE A 1 34  ? -7.871  27.453 29.007 1.00 26.82 ? 34  PHE A CD2 1 
ATOM   256  C CE1 . PHE A 1 34  ? -8.185  28.636 31.493 1.00 27.82 ? 34  PHE A CE1 1 
ATOM   257  C CE2 . PHE A 1 34  ? -7.457  28.774 29.210 1.00 26.61 ? 34  PHE A CE2 1 
ATOM   258  C CZ  . PHE A 1 34  ? -7.623  29.361 30.462 1.00 21.08 ? 34  PHE A CZ  1 
ATOM   259  N N   . THR A 1 35  ? -10.680 23.402 27.878 1.00 28.60 ? 35  THR A N   1 
ATOM   260  C CA  . THR A 1 35  ? -11.162 22.039 27.628 1.00 31.37 ? 35  THR A CA  1 
ATOM   261  C C   . THR A 1 35  ? -10.288 21.003 28.351 1.00 31.13 ? 35  THR A C   1 
ATOM   262  O O   . THR A 1 35  ? -9.328  21.371 29.032 1.00 29.87 ? 35  THR A O   1 
ATOM   263  C CB  . THR A 1 35  ? -11.192 21.713 26.123 1.00 26.46 ? 35  THR A CB  1 
ATOM   264  O OG1 . THR A 1 35  ? -9.863  21.654 25.616 1.00 23.32 ? 35  THR A OG1 1 
ATOM   265  C CG2 . THR A 1 35  ? -11.963 22.786 25.367 1.00 28.73 ? 35  THR A CG2 1 
ATOM   266  N N   . ASP A 1 36  ? -10.626 19.721 28.181 1.00 33.00 ? 36  ASP A N   1 
ATOM   267  C CA  . ASP A 1 36  ? -9.939  18.594 28.825 1.00 28.99 ? 36  ASP A CA  1 
ATOM   268  C C   . ASP A 1 36  ? -8.516  18.260 28.403 1.00 31.74 ? 36  ASP A C   1 
ATOM   269  O O   . ASP A 1 36  ? -7.719  17.786 29.229 1.00 25.86 ? 36  ASP A O   1 
ATOM   270  C CB  . ASP A 1 36  ? -10.780 17.311 28.681 1.00 29.27 ? 36  ASP A CB  1 
ATOM   271  C CG  . ASP A 1 36  ? -12.096 17.391 29.416 1.00 30.21 ? 36  ASP A CG  1 
ATOM   272  O OD1 . ASP A 1 36  ? -12.095 17.839 30.578 1.00 36.41 ? 36  ASP A OD1 1 
ATOM   273  O OD2 . ASP A 1 36  ? -13.129 16.993 28.841 1.00 36.62 ? 36  ASP A OD2 1 
ATOM   274  N N   . HIS A 1 37  ? -8.184  18.476 27.132 1.00 30.18 ? 37  HIS A N   1 
ATOM   275  C CA  . HIS A 1 37  ? -6.840  18.146 26.664 1.00 28.96 ? 37  HIS A CA  1 
ATOM   276  C C   . HIS A 1 37  ? -6.063  19.337 26.112 1.00 30.14 ? 37  HIS A C   1 
ATOM   277  O O   . HIS A 1 37  ? -6.629  20.414 25.911 1.00 27.20 ? 37  HIS A O   1 
ATOM   278  C CB  . HIS A 1 37  ? -6.917  17.035 25.607 1.00 29.21 ? 37  HIS A CB  1 
ATOM   279  C CG  . HIS A 1 37  ? -7.693  15.840 26.064 1.00 24.35 ? 37  HIS A CG  1 
ATOM   280  N ND1 . HIS A 1 37  ? -9.057  15.869 26.248 1.00 24.47 ? 37  HIS A ND1 1 
ATOM   281  C CD2 . HIS A 1 37  ? -7.289  14.604 26.442 1.00 29.98 ? 37  HIS A CD2 1 
ATOM   282  C CE1 . HIS A 1 37  ? -9.464  14.703 26.721 1.00 29.21 ? 37  HIS A CE1 1 
ATOM   283  N NE2 . HIS A 1 37  ? -8.410  13.918 26.849 1.00 27.20 ? 37  HIS A NE2 1 
ATOM   284  N N   . MET A 1 38  ? -4.769  19.115 25.874 1.00 25.25 ? 38  MET A N   1 
ATOM   285  C CA  . MET A 1 38  ? -3.861  20.123 25.346 1.00 25.16 ? 38  MET A CA  1 
ATOM   286  C C   . MET A 1 38  ? -2.784  19.454 24.519 1.00 25.74 ? 38  MET A C   1 
ATOM   287  O O   . MET A 1 38  ? -2.511  18.249 24.679 1.00 26.48 ? 38  MET A O   1 
ATOM   288  C CB  . MET A 1 38  ? -3.188  20.880 26.496 1.00 26.76 ? 38  MET A CB  1 
ATOM   289  C CG  . MET A 1 38  ? -2.097  20.071 27.191 1.00 30.94 ? 38  MET A CG  1 
ATOM   290  S SD  . MET A 1 38  ? -1.542  20.770 28.770 1.00 27.48 ? 38  MET A SD  1 
ATOM   291  C CE  . MET A 1 38  ? -0.644  22.292 28.191 1.00 23.26 ? 38  MET A CE  1 
ATOM   292  N N   . LEU A 1 39  ? -2.167  20.223 23.629 1.00 21.66 ? 39  LEU A N   1 
ATOM   293  C CA  . LEU A 1 39  ? -1.077  19.702 22.818 1.00 23.70 ? 39  LEU A CA  1 
ATOM   294  C C   . LEU A 1 39  ? 0.242   20.100 23.498 1.00 26.23 ? 39  LEU A C   1 
ATOM   295  O O   . LEU A 1 39  ? 0.347   21.175 24.076 1.00 25.13 ? 39  LEU A O   1 
ATOM   296  C CB  . LEU A 1 39  ? -1.114  20.293 21.411 1.00 27.84 ? 39  LEU A CB  1 
ATOM   297  C CG  . LEU A 1 39  ? -0.013  19.838 20.448 1.00 24.33 ? 39  LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 39  ? -0.153  18.355 20.210 1.00 28.63 ? 39  LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 39  ? -0.124  20.569 19.129 1.00 30.99 ? 39  LEU A CD2 1 
ATOM   300  N N   . MET A 1 40  ? 1.250   19.246 23.413 1.00 24.67 ? 40  MET A N   1 
ATOM   301  C CA  . MET A 1 40  ? 2.537   19.543 24.027 1.00 27.65 ? 40  MET A CA  1 
ATOM   302  C C   . MET A 1 40  ? 3.677   18.950 23.200 1.00 31.62 ? 40  MET A C   1 
ATOM   303  O O   . MET A 1 40  ? 3.677   17.753 22.905 1.00 29.04 ? 40  MET A O   1 
ATOM   304  C CB  . MET A 1 40  ? 2.552   18.974 25.445 1.00 28.78 ? 40  MET A CB  1 
ATOM   305  C CG  . MET A 1 40  ? 3.876   19.065 26.174 1.00 38.32 ? 40  MET A CG  1 
ATOM   306  S SD  . MET A 1 40  ? 4.269   20.756 26.607 1.00 53.85 ? 40  MET A SD  1 
ATOM   307  C CE  . MET A 1 40  ? 2.999   21.075 27.833 1.00 45.08 ? 40  MET A CE  1 
ATOM   308  N N   . VAL A 1 41  ? 4.632   19.790 22.799 1.00 28.61 ? 41  VAL A N   1 
ATOM   309  C CA  . VAL A 1 41  ? 5.790   19.316 22.032 1.00 29.76 ? 41  VAL A CA  1 
ATOM   310  C C   . VAL A 1 41  ? 7.041   20.014 22.563 1.00 29.29 ? 41  VAL A C   1 
ATOM   311  O O   . VAL A 1 41  ? 7.069   21.235 22.669 1.00 25.44 ? 41  VAL A O   1 
ATOM   312  C CB  . VAL A 1 41  ? 5.689   19.640 20.515 1.00 29.86 ? 41  VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 41  ? 6.635   18.729 19.733 1.00 26.03 ? 41  VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 41  ? 4.264   19.476 20.033 1.00 33.78 ? 41  VAL A CG2 1 
ATOM   315  N N   . GLU A 1 42  ? 8.074   19.243 22.885 1.00 28.04 ? 42  GLU A N   1 
ATOM   316  C CA  . GLU A 1 42  ? 9.320   19.808 23.398 1.00 28.78 ? 42  GLU A CA  1 
ATOM   317  C C   . GLU A 1 42  ? 10.442  19.841 22.367 1.00 29.23 ? 42  GLU A C   1 
ATOM   318  O O   . GLU A 1 42  ? 10.523  18.967 21.509 1.00 34.22 ? 42  GLU A O   1 
ATOM   319  C CB  . GLU A 1 42  ? 9.765   19.013 24.626 1.00 30.88 ? 42  GLU A CB  1 
ATOM   320  C CG  . GLU A 1 42  ? 8.619   18.757 25.598 1.00 40.33 ? 42  GLU A CG  1 
ATOM   321  C CD  . GLU A 1 42  ? 9.066   18.687 27.039 1.00 40.80 ? 42  GLU A CD  1 
ATOM   322  O OE1 . GLU A 1 42  ? 9.829   19.590 27.443 1.00 40.59 ? 42  GLU A OE1 1 
ATOM   323  O OE2 . GLU A 1 42  ? 8.645   17.752 27.767 1.00 40.47 ? 42  GLU A OE2 1 
ATOM   324  N N   . TRP A 1 43  ? 11.304  20.862 22.436 1.00 30.26 ? 43  TRP A N   1 
ATOM   325  C CA  . TRP A 1 43  ? 12.443  20.974 21.513 1.00 26.40 ? 43  TRP A CA  1 
ATOM   326  C C   . TRP A 1 43  ? 13.763  21.084 22.294 1.00 33.03 ? 43  TRP A C   1 
ATOM   327  O O   . TRP A 1 43  ? 13.863  21.862 23.249 1.00 29.24 ? 43  TRP A O   1 
ATOM   328  C CB  . TRP A 1 43  ? 12.277  22.179 20.597 1.00 27.15 ? 43  TRP A CB  1 
ATOM   329  C CG  . TRP A 1 43  ? 13.401  22.379 19.607 1.00 26.69 ? 43  TRP A CG  1 
ATOM   330  C CD1 . TRP A 1 43  ? 13.551  21.768 18.388 1.00 27.86 ? 43  TRP A CD1 1 
ATOM   331  C CD2 . TRP A 1 43  ? 14.517  23.271 19.744 1.00 23.95 ? 43  TRP A CD2 1 
ATOM   332  N NE1 . TRP A 1 43  ? 14.682  22.231 17.763 1.00 27.82 ? 43  TRP A NE1 1 
ATOM   333  C CE2 . TRP A 1 43  ? 15.296  23.153 18.572 1.00 26.24 ? 43  TRP A CE2 1 
ATOM   334  C CE3 . TRP A 1 43  ? 14.929  24.164 20.743 1.00 29.58 ? 43  TRP A CE3 1 
ATOM   335  C CZ2 . TRP A 1 43  ? 16.468  23.894 18.369 1.00 25.27 ? 43  TRP A CZ2 1 
ATOM   336  C CZ3 . TRP A 1 43  ? 16.090  24.903 20.540 1.00 30.07 ? 43  TRP A CZ3 1 
ATOM   337  C CH2 . TRP A 1 43  ? 16.846  24.762 19.362 1.00 30.92 ? 43  TRP A CH2 1 
ATOM   338  N N   . ASN A 1 44  ? 14.743  20.273 21.877 1.00 37.44 ? 44  ASN A N   1 
ATOM   339  C CA  . ASN A 1 44  ? 16.086  20.162 22.468 1.00 42.04 ? 44  ASN A CA  1 
ATOM   340  C C   . ASN A 1 44  ? 17.101  20.414 21.387 1.00 46.58 ? 44  ASN A C   1 
ATOM   341  O O   . ASN A 1 44  ? 16.788  20.935 20.319 1.00 46.31 ? 44  ASN A O   1 
ATOM   342  C CB  . ASN A 1 44  ? 16.385  18.728 22.906 1.00 42.22 ? 44  ASN A CB  1 
ATOM   343  C CG  . ASN A 1 44  ? 15.697  18.340 24.161 1.00 49.15 ? 44  ASN A CG  1 
ATOM   344  O OD1 . ASN A 1 44  ? 15.461  17.160 24.391 1.00 50.13 ? 44  ASN A OD1 1 
ATOM   345  N ND2 . ASN A 1 44  ? 15.388  19.316 25.005 1.00 54.66 ? 44  ASN A ND2 1 
ATOM   346  N N   . ASP A 1 45  ? 18.325  19.978 21.677 1.00 50.66 ? 45  ASP A N   1 
ATOM   347  C CA  . ASP A 1 45  ? 19.417  20.071 20.724 1.00 52.33 ? 45  ASP A CA  1 
ATOM   348  C C   . ASP A 1 45  ? 19.272  18.804 19.882 1.00 51.37 ? 45  ASP A C   1 
ATOM   349  O O   . ASP A 1 45  ? 19.806  18.705 18.778 1.00 53.71 ? 45  ASP A O   1 
ATOM   350  C CB  . ASP A 1 45  ? 20.774  20.123 21.444 1.00 51.74 ? 45  ASP A CB  1 
ATOM   351  C CG  . ASP A 1 45  ? 20.913  19.070 22.535 1.00 57.52 ? 45  ASP A CG  1 
ATOM   352  O OD1 . ASP A 1 45  ? 19.971  18.268 22.729 1.00 62.24 ? 45  ASP A OD1 1 
ATOM   353  O OD2 . ASP A 1 45  ? 21.974  19.049 23.199 1.00 52.17 ? 45  ASP A OD2 1 
ATOM   354  N N   . LYS A 1 46  ? 18.529  17.839 20.418 1.00 49.88 ? 46  LYS A N   1 
ATOM   355  C CA  . LYS A 1 46  ? 18.262  16.598 19.703 1.00 47.88 ? 46  LYS A CA  1 
ATOM   356  C C   . LYS A 1 46  ? 17.141  16.933 18.725 1.00 48.29 ? 46  LYS A C   1 
ATOM   357  O O   . LYS A 1 46  ? 16.783  16.125 17.862 1.00 48.02 ? 46  LYS A O   1 
ATOM   358  C CB  . LYS A 1 46  ? 17.801  15.501 20.662 1.00 48.50 ? 46  LYS A CB  1 
ATOM   359  C CG  . LYS A 1 46  ? 18.867  15.078 21.651 1.00 54.04 ? 46  LYS A CG  1 
ATOM   360  C CD  . LYS A 1 46  ? 18.380  13.974 22.568 1.00 57.25 ? 46  LYS A CD  1 
ATOM   361  C CE  . LYS A 1 46  ? 19.504  13.495 23.489 1.00 60.23 ? 46  LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 46  ? 19.038  12.495 24.496 1.00 59.06 ? 46  LYS A NZ  1 
ATOM   363  N N   . GLY A 1 47  ? 16.599  18.144 18.861 1.00 42.57 ? 47  GLY A N   1 
ATOM   364  C CA  . GLY A 1 47  ? 15.530  18.575 17.982 1.00 39.21 ? 47  GLY A CA  1 
ATOM   365  C C   . GLY A 1 47  ? 14.160  18.407 18.605 1.00 36.90 ? 47  GLY A C   1 
ATOM   366  O O   . GLY A 1 47  ? 14.031  18.355 19.833 1.00 35.02 ? 47  GLY A O   1 
ATOM   367  N N   . TRP A 1 48  ? 13.128  18.319 17.771 1.00 33.13 ? 48  TRP A N   1 
ATOM   368  C CA  . TRP A 1 48  ? 11.771  18.168 18.288 1.00 29.58 ? 48  TRP A CA  1 
ATOM   369  C C   . TRP A 1 48  ? 11.457  16.761 18.811 1.00 32.42 ? 48  TRP A C   1 
ATOM   370  O O   . TRP A 1 48  ? 11.833  15.766 18.202 1.00 35.71 ? 48  TRP A O   1 
ATOM   371  C CB  . TRP A 1 48  ? 10.734  18.517 17.206 1.00 26.39 ? 48  TRP A CB  1 
ATOM   372  C CG  . TRP A 1 48  ? 10.617  19.981 16.859 1.00 30.38 ? 48  TRP A CG  1 
ATOM   373  C CD1 . TRP A 1 48  ? 11.066  20.594 15.719 1.00 23.26 ? 48  TRP A CD1 1 
ATOM   374  C CD2 . TRP A 1 48  ? 9.974   21.003 17.635 1.00 23.39 ? 48  TRP A CD2 1 
ATOM   375  N NE1 . TRP A 1 48  ? 10.741  21.928 15.733 1.00 23.17 ? 48  TRP A NE1 1 
ATOM   376  C CE2 . TRP A 1 48  ? 10.075  22.213 16.898 1.00 27.88 ? 48  TRP A CE2 1 
ATOM   377  C CE3 . TRP A 1 48  ? 9.321   21.017 18.877 1.00 29.44 ? 48  TRP A CE3 1 
ATOM   378  C CZ2 . TRP A 1 48  ? 9.555   23.427 17.368 1.00 23.70 ? 48  TRP A CZ2 1 
ATOM   379  C CZ3 . TRP A 1 48  ? 8.792   22.236 19.348 1.00 26.49 ? 48  TRP A CZ3 1 
ATOM   380  C CH2 . TRP A 1 48  ? 8.918   23.421 18.592 1.00 24.47 ? 48  TRP A CH2 1 
ATOM   381  N N   . GLY A 1 49  ? 10.773  16.687 19.947 1.00 29.22 ? 49  GLY A N   1 
ATOM   382  C CA  . GLY A 1 49  ? 10.373  15.404 20.483 1.00 33.27 ? 49  GLY A CA  1 
ATOM   383  C C   . GLY A 1 49  ? 9.058   14.986 19.827 1.00 36.40 ? 49  GLY A C   1 
ATOM   384  O O   . GLY A 1 49  ? 8.615   15.604 18.854 1.00 39.19 ? 49  GLY A O   1 
ATOM   385  N N   . GLN A 1 50  ? 8.415   13.946 20.341 1.00 36.58 ? 50  GLN A N   1 
ATOM   386  C CA  . GLN A 1 50  ? 7.160   13.528 19.730 1.00 41.37 ? 50  GLN A CA  1 
ATOM   387  C C   . GLN A 1 50  ? 6.015   14.407 20.209 1.00 34.14 ? 50  GLN A C   1 
ATOM   388  O O   . GLN A 1 50  ? 5.977   14.793 21.377 1.00 36.45 ? 50  GLN A O   1 
ATOM   389  C CB  . GLN A 1 50  ? 6.843   12.069 20.074 1.00 44.00 ? 50  GLN A CB  1 
ATOM   390  C CG  . GLN A 1 50  ? 7.692   11.043 19.336 1.00 49.31 ? 50  GLN A CG  1 
ATOM   391  C CD  . GLN A 1 50  ? 7.391   9.616  19.779 1.00 51.82 ? 50  GLN A CD  1 
ATOM   392  O OE1 . GLN A 1 50  ? 6.259   9.142  19.666 1.00 49.95 ? 50  GLN A OE1 1 
ATOM   393  N NE2 . GLN A 1 50  ? 8.408   8.929  20.292 1.00 54.90 ? 50  GLN A NE2 1 
ATOM   394  N N   . PRO A 1 51  ? 5.064   14.732 19.312 1.00 31.30 ? 51  PRO A N   1 
ATOM   395  C CA  . PRO A 1 51  ? 3.911   15.565 19.665 1.00 29.53 ? 51  PRO A CA  1 
ATOM   396  C C   . PRO A 1 51  ? 3.043   14.774 20.630 1.00 30.13 ? 51  PRO A C   1 
ATOM   397  O O   . PRO A 1 51  ? 3.007   13.545 20.584 1.00 33.39 ? 51  PRO A O   1 
ATOM   398  C CB  . PRO A 1 51  ? 3.197   15.765 18.333 1.00 33.34 ? 51  PRO A CB  1 
ATOM   399  C CG  . PRO A 1 51  ? 4.269   15.572 17.317 1.00 39.19 ? 51  PRO A CG  1 
ATOM   400  C CD  . PRO A 1 51  ? 5.068   14.432 17.870 1.00 35.24 ? 51  PRO A CD  1 
ATOM   401  N N   . ARG A 1 52  ? 2.329   15.464 21.498 1.00 31.85 ? 52  ARG A N   1 
ATOM   402  C CA  . ARG A 1 52  ? 1.474   14.770 22.422 1.00 33.94 ? 52  ARG A CA  1 
ATOM   403  C C   . ARG A 1 52  ? 0.202   15.500 22.816 1.00 33.15 ? 52  ARG A C   1 
ATOM   404  O O   . ARG A 1 52  ? 0.202   16.702 23.102 1.00 26.94 ? 52  ARG A O   1 
ATOM   405  C CB  . ARG A 1 52  ? 2.280   14.383 23.675 1.00 42.32 ? 52  ARG A CB  1 
ATOM   406  C CG  . ARG A 1 52  ? 1.432   14.020 24.885 1.00 48.09 ? 52  ARG A CG  1 
ATOM   407  C CD  . ARG A 1 52  ? 2.260   13.341 25.968 1.00 52.48 ? 52  ARG A CD  1 
ATOM   408  N NE  . ARG A 1 52  ? 3.621   13.863 26.027 1.00 54.87 ? 52  ARG A NE  1 
ATOM   409  C CZ  . ARG A 1 52  ? 3.957   15.100 26.397 1.00 59.85 ? 52  ARG A CZ  1 
ATOM   410  N NH1 . ARG A 1 52  ? 3.024   15.970 26.750 1.00 59.00 ? 52  ARG A NH1 1 
ATOM   411  N NH2 . ARG A 1 52  ? 5.237   15.469 26.412 1.00 60.98 ? 52  ARG A NH2 1 
ATOM   412  N N   . ILE A 1 53  ? -0.897  14.757 22.796 1.00 27.99 ? 53  ILE A N   1 
ATOM   413  C CA  . ILE A 1 53  ? -2.173  15.287 23.222 1.00 29.06 ? 53  ILE A CA  1 
ATOM   414  C C   . ILE A 1 53  ? -2.272  14.683 24.599 1.00 31.31 ? 53  ILE A C   1 
ATOM   415  O O   . ILE A 1 53  ? -2.191  13.455 24.758 1.00 33.24 ? 53  ILE A O   1 
ATOM   416  C CB  . ILE A 1 53  ? -3.323  14.818 22.322 1.00 29.20 ? 53  ILE A CB  1 
ATOM   417  C CG1 . ILE A 1 53  ? -3.252  15.568 20.990 1.00 25.88 ? 53  ILE A CG1 1 
ATOM   418  C CG2 . ILE A 1 53  ? -4.662  15.082 23.001 1.00 35.74 ? 53  ILE A CG2 1 
ATOM   419  C CD1 . ILE A 1 53  ? -4.257  15.104 19.961 1.00 33.02 ? 53  ILE A CD1 1 
ATOM   420  N N   . GLN A 1 54  ? -2.388  15.546 25.599 1.00 28.72 ? 54  GLN A N   1 
ATOM   421  C CA  . GLN A 1 54  ? -2.453  15.096 26.978 1.00 29.52 ? 54  GLN A CA  1 
ATOM   422  C C   . GLN A 1 54  ? -3.479  15.868 27.779 1.00 29.95 ? 54  GLN A C   1 
ATOM   423  O O   . GLN A 1 54  ? -3.980  16.898 27.338 1.00 30.79 ? 54  GLN A O   1 
ATOM   424  C CB  . GLN A 1 54  ? -1.079  15.241 27.634 1.00 34.36 ? 54  GLN A CB  1 
ATOM   425  C CG  . GLN A 1 54  ? -0.634  16.687 27.841 1.00 32.98 ? 54  GLN A CG  1 
ATOM   426  C CD  . GLN A 1 54  ? 0.774   16.779 28.406 1.00 36.22 ? 54  GLN A CD  1 
ATOM   427  O OE1 . GLN A 1 54  ? 1.262   17.864 28.734 1.00 32.45 ? 54  GLN A OE1 1 
ATOM   428  N NE2 . GLN A 1 54  ? 1.437   15.630 28.522 1.00 36.49 ? 54  GLN A NE2 1 
ATOM   429  N N   . PRO A 1 55  ? -3.821  15.361 28.972 1.00 32.32 ? 55  PRO A N   1 
ATOM   430  C CA  . PRO A 1 55  ? -4.798  16.015 29.837 1.00 29.40 ? 55  PRO A CA  1 
ATOM   431  C C   . PRO A 1 55  ? -4.318  17.423 30.168 1.00 32.53 ? 55  PRO A C   1 
ATOM   432  O O   . PRO A 1 55  ? -3.119  17.651 30.351 1.00 27.04 ? 55  PRO A O   1 
ATOM   433  C CB  . PRO A 1 55  ? -4.822  15.117 31.070 1.00 29.69 ? 55  PRO A CB  1 
ATOM   434  C CG  . PRO A 1 55  ? -4.508  13.754 30.495 1.00 33.31 ? 55  PRO A CG  1 
ATOM   435  C CD  . PRO A 1 55  ? -3.408  14.053 29.522 1.00 31.53 ? 55  PRO A CD  1 
ATOM   436  N N   . PHE A 1 56  ? -5.252  18.366 30.231 1.00 29.80 ? 56  PHE A N   1 
ATOM   437  C CA  . PHE A 1 56  ? -4.902  19.737 30.561 1.00 27.65 ? 56  PHE A CA  1 
ATOM   438  C C   . PHE A 1 56  ? -4.129  19.634 31.873 1.00 27.17 ? 56  PHE A C   1 
ATOM   439  O O   . PHE A 1 56  ? -4.558  18.927 32.773 1.00 23.80 ? 56  PHE A O   1 
ATOM   440  C CB  . PHE A 1 56  ? -6.172  20.568 30.775 1.00 28.93 ? 56  PHE A CB  1 
ATOM   441  C CG  . PHE A 1 56  ? -5.930  22.051 30.776 1.00 28.38 ? 56  PHE A CG  1 
ATOM   442  C CD1 . PHE A 1 56  ? -5.848  22.761 29.570 1.00 31.93 ? 56  PHE A CD1 1 
ATOM   443  C CD2 . PHE A 1 56  ? -5.787  22.744 31.973 1.00 27.60 ? 56  PHE A CD2 1 
ATOM   444  C CE1 . PHE A 1 56  ? -5.629  24.151 29.562 1.00 25.78 ? 56  PHE A CE1 1 
ATOM   445  C CE2 . PHE A 1 56  ? -5.564  24.144 31.974 1.00 30.35 ? 56  PHE A CE2 1 
ATOM   446  C CZ  . PHE A 1 56  ? -5.489  24.836 30.761 1.00 20.62 ? 56  PHE A CZ  1 
ATOM   447  N N   . GLN A 1 57  ? -2.987  20.314 31.985 1.00 26.43 ? 57  GLN A N   1 
ATOM   448  C CA  . GLN A 1 57  ? -2.198  20.240 33.217 1.00 31.16 ? 57  GLN A CA  1 
ATOM   449  C C   . GLN A 1 57  ? -1.222  21.409 33.289 1.00 31.67 ? 57  GLN A C   1 
ATOM   450  O O   . GLN A 1 57  ? -0.898  22.017 32.271 1.00 27.37 ? 57  GLN A O   1 
ATOM   451  C CB  . GLN A 1 57  ? -1.411  18.919 33.262 1.00 29.75 ? 57  GLN A CB  1 
ATOM   452  C CG  . GLN A 1 57  ? -0.402  18.775 32.141 1.00 29.98 ? 57  GLN A CG  1 
ATOM   453  C CD  . GLN A 1 57  ? 0.076   17.353 31.976 1.00 35.26 ? 57  GLN A CD  1 
ATOM   454  O OE1 . GLN A 1 57  ? -0.703  16.463 31.626 1.00 35.90 ? 57  GLN A OE1 1 
ATOM   455  N NE2 . GLN A 1 57  ? 1.363   17.126 32.235 1.00 26.83 ? 57  GLN A NE2 1 
ATOM   456  N N   . ASN A 1 58  ? -0.740  21.708 34.490 1.00 33.40 ? 58  ASN A N   1 
ATOM   457  C CA  . ASN A 1 58  ? 0.202   22.804 34.674 1.00 26.94 ? 58  ASN A CA  1 
ATOM   458  C C   . ASN A 1 58  ? 1.525   22.542 34.002 1.00 26.46 ? 58  ASN A C   1 
ATOM   459  O O   . ASN A 1 58  ? 1.857   21.406 33.663 1.00 29.87 ? 58  ASN A O   1 
ATOM   460  C CB  . ASN A 1 58  ? 0.445   23.059 36.158 1.00 32.56 ? 58  ASN A CB  1 
ATOM   461  C CG  . ASN A 1 58  ? -0.813  23.452 36.879 1.00 37.38 ? 58  ASN A CG  1 
ATOM   462  O OD1 . ASN A 1 58  ? -1.552  24.308 36.406 1.00 36.26 ? 58  ASN A OD1 1 
ATOM   463  N ND2 . ASN A 1 58  ? -1.071  22.830 38.035 1.00 39.63 ? 58  ASN A ND2 1 
ATOM   464  N N   . LEU A 1 59  ? 2.288   23.612 33.792 1.00 26.78 ? 59  LEU A N   1 
ATOM   465  C CA  . LEU A 1 59  ? 3.597   23.488 33.173 1.00 26.46 ? 59  LEU A CA  1 
ATOM   466  C C   . LEU A 1 59  ? 4.617   23.451 34.295 1.00 26.63 ? 59  LEU A C   1 
ATOM   467  O O   . LEU A 1 59  ? 4.392   24.025 35.350 1.00 27.75 ? 59  LEU A O   1 
ATOM   468  C CB  . LEU A 1 59  ? 3.876   24.698 32.270 1.00 28.42 ? 59  LEU A CB  1 
ATOM   469  C CG  . LEU A 1 59  ? 2.937   24.825 31.070 1.00 34.87 ? 59  LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 59  ? 2.988   26.224 30.515 1.00 29.01 ? 59  LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 59  ? 3.310   23.786 30.021 1.00 30.42 ? 59  LEU A CD2 1 
ATOM   472  N N   . THR A 1 60  ? 5.719   22.753 34.078 1.00 29.66 ? 60  THR A N   1 
ATOM   473  C CA  . THR A 1 60  ? 6.800   22.700 35.067 1.00 34.10 ? 60  THR A CA  1 
ATOM   474  C C   . THR A 1 60  ? 7.972   23.385 34.382 1.00 30.34 ? 60  THR A C   1 
ATOM   475  O O   . THR A 1 60  ? 8.469   22.892 33.371 1.00 33.40 ? 60  THR A O   1 
ATOM   476  C CB  . THR A 1 60  ? 7.233   21.260 35.404 1.00 30.01 ? 60  THR A CB  1 
ATOM   477  O OG1 . THR A 1 60  ? 6.092   20.480 35.750 1.00 39.00 ? 60  THR A OG1 1 
ATOM   478  C CG2 . THR A 1 60  ? 8.172   21.268 36.588 1.00 37.30 ? 60  THR A CG2 1 
ATOM   479  N N   . LEU A 1 61  ? 8.400   24.519 34.924 1.00 34.67 ? 61  LEU A N   1 
ATOM   480  C CA  . LEU A 1 61  ? 9.490   25.288 34.332 1.00 31.48 ? 61  LEU A CA  1 
ATOM   481  C C   . LEU A 1 61  ? 10.646  25.601 35.287 1.00 29.81 ? 61  LEU A C   1 
ATOM   482  O O   . LEU A 1 61  ? 10.451  25.896 36.459 1.00 27.21 ? 61  LEU A O   1 
ATOM   483  C CB  . LEU A 1 61  ? 8.965   26.628 33.795 1.00 29.88 ? 61  LEU A CB  1 
ATOM   484  C CG  . LEU A 1 61  ? 7.893   26.704 32.707 1.00 26.16 ? 61  LEU A CG  1 
ATOM   485  C CD1 . LEU A 1 61  ? 7.644   28.164 32.393 1.00 29.16 ? 61  LEU A CD1 1 
ATOM   486  C CD2 . LEU A 1 61  ? 8.328   25.973 31.454 1.00 27.68 ? 61  LEU A CD2 1 
ATOM   487  N N   . HIS A 1 62  ? 11.856  25.542 34.759 1.00 27.68 ? 62  HIS A N   1 
ATOM   488  C CA  . HIS A 1 62  ? 13.032  25.876 35.537 1.00 27.92 ? 62  HIS A CA  1 
ATOM   489  C C   . HIS A 1 62  ? 12.859  27.376 35.889 1.00 28.66 ? 62  HIS A C   1 
ATOM   490  O O   . HIS A 1 62  ? 12.327  28.147 35.088 1.00 24.15 ? 62  HIS A O   1 
ATOM   491  C CB  . HIS A 1 62  ? 14.258  25.641 34.666 1.00 30.71 ? 62  HIS A CB  1 
ATOM   492  C CG  . HIS A 1 62  ? 15.554  25.792 35.389 1.00 34.78 ? 62  HIS A CG  1 
ATOM   493  N ND1 . HIS A 1 62  ? 16.015  27.009 35.839 1.00 35.09 ? 62  HIS A ND1 1 
ATOM   494  C CD2 . HIS A 1 62  ? 16.497  24.881 35.725 1.00 37.41 ? 62  HIS A CD2 1 
ATOM   495  C CE1 . HIS A 1 62  ? 17.190  26.842 36.419 1.00 37.76 ? 62  HIS A CE1 1 
ATOM   496  N NE2 . HIS A 1 62  ? 17.505  25.560 36.363 1.00 40.98 ? 62  HIS A NE2 1 
ATOM   497  N N   . PRO A 1 63  ? 13.280  27.798 37.095 1.00 28.51 ? 63  PRO A N   1 
ATOM   498  C CA  . PRO A 1 63  ? 13.149  29.199 37.527 1.00 30.63 ? 63  PRO A CA  1 
ATOM   499  C C   . PRO A 1 63  ? 13.895  30.209 36.658 1.00 23.36 ? 63  PRO A C   1 
ATOM   500  O O   . PRO A 1 63  ? 13.566  31.388 36.655 1.00 23.77 ? 63  PRO A O   1 
ATOM   501  C CB  . PRO A 1 63  ? 13.685  29.181 38.976 1.00 30.12 ? 63  PRO A CB  1 
ATOM   502  C CG  . PRO A 1 63  ? 13.451  27.771 39.411 1.00 37.12 ? 63  PRO A CG  1 
ATOM   503  C CD  . PRO A 1 63  ? 13.850  26.975 38.178 1.00 31.61 ? 63  PRO A CD  1 
ATOM   504  N N   . ALA A 1 64  ? 14.896  29.747 35.925 1.00 24.28 ? 64  ALA A N   1 
ATOM   505  C CA  . ALA A 1 64  ? 15.653  30.655 35.076 1.00 28.28 ? 64  ALA A CA  1 
ATOM   506  C C   . ALA A 1 64  ? 15.177  30.601 33.615 1.00 22.72 ? 64  ALA A C   1 
ATOM   507  O O   . ALA A 1 64  ? 15.802  31.184 32.727 1.00 26.71 ? 64  ALA A O   1 
ATOM   508  C CB  . ALA A 1 64  ? 17.123  30.323 35.160 1.00 24.49 ? 64  ALA A CB  1 
ATOM   509  N N   . SER A 1 65  ? 14.060  29.915 33.383 1.00 25.31 ? 65  SER A N   1 
ATOM   510  C CA  . SER A 1 65  ? 13.511  29.763 32.030 1.00 25.96 ? 65  SER A CA  1 
ATOM   511  C C   . SER A 1 65  ? 13.469  31.094 31.266 1.00 23.54 ? 65  SER A C   1 
ATOM   512  O O   . SER A 1 65  ? 12.845  32.043 31.718 1.00 22.00 ? 65  SER A O   1 
ATOM   513  C CB  . SER A 1 65  ? 12.107  29.152 32.117 1.00 28.76 ? 65  SER A CB  1 
ATOM   514  O OG  . SER A 1 65  ? 11.549  28.967 30.823 1.00 33.59 ? 65  SER A OG  1 
ATOM   515  N N   . SER A 1 66  ? 14.130  31.173 30.112 1.00 24.67 ? 66  SER A N   1 
ATOM   516  C CA  . SER A 1 66  ? 14.134  32.427 29.363 1.00 24.70 ? 66  SER A CA  1 
ATOM   517  C C   . SER A 1 66  ? 12.747  32.942 28.959 1.00 23.99 ? 66  SER A C   1 
ATOM   518  O O   . SER A 1 66  ? 12.603  34.100 28.581 1.00 26.62 ? 66  SER A O   1 
ATOM   519  C CB  . SER A 1 66  ? 15.046  32.319 28.129 1.00 26.76 ? 66  SER A CB  1 
ATOM   520  O OG  . SER A 1 66  ? 14.754  31.171 27.355 1.00 30.74 ? 66  SER A OG  1 
ATOM   521  N N   . SER A 1 67  ? 11.730  32.098 29.062 1.00 25.57 ? 67  SER A N   1 
ATOM   522  C CA  . SER A 1 67  ? 10.369  32.509 28.711 1.00 26.14 ? 67  SER A CA  1 
ATOM   523  C C   . SER A 1 67  ? 9.861   33.495 29.742 1.00 26.32 ? 67  SER A C   1 
ATOM   524  O O   . SER A 1 67  ? 9.005   34.338 29.439 1.00 21.94 ? 67  SER A O   1 
ATOM   525  C CB  . SER A 1 67  ? 9.420   31.307 28.697 1.00 24.96 ? 67  SER A CB  1 
ATOM   526  O OG  . SER A 1 67  ? 9.392   30.697 29.968 1.00 23.75 ? 67  SER A OG  1 
ATOM   527  N N   . LEU A 1 68  ? 10.395  33.383 30.961 1.00 25.50 ? 68  LEU A N   1 
ATOM   528  C CA  . LEU A 1 68  ? 9.972   34.238 32.078 1.00 24.35 ? 68  LEU A CA  1 
ATOM   529  C C   . LEU A 1 68  ? 10.863  35.442 32.372 1.00 22.36 ? 68  LEU A C   1 
ATOM   530  O O   . LEU A 1 68  ? 10.413  36.392 33.007 1.00 21.48 ? 68  LEU A O   1 
ATOM   531  C CB  . LEU A 1 68  ? 9.840   33.401 33.365 1.00 23.29 ? 68  LEU A CB  1 
ATOM   532  C CG  . LEU A 1 68  ? 8.863   32.213 33.340 1.00 24.76 ? 68  LEU A CG  1 
ATOM   533  C CD1 . LEU A 1 68  ? 8.991   31.391 34.638 1.00 25.43 ? 68  LEU A CD1 1 
ATOM   534  C CD2 . LEU A 1 68  ? 7.432   32.727 33.183 1.00 20.02 ? 68  LEU A CD2 1 
ATOM   535  N N   . HIS A 1 69  ? 12.110  35.397 31.910 1.00 24.52 ? 69  HIS A N   1 
ATOM   536  C CA  . HIS A 1 69  ? 13.093  36.465 32.153 1.00 24.71 ? 69  HIS A CA  1 
ATOM   537  C C   . HIS A 1 69  ? 13.265  37.417 30.973 1.00 23.19 ? 69  HIS A C   1 
ATOM   538  O O   . HIS A 1 69  ? 13.362  38.637 31.143 1.00 20.82 ? 69  HIS A O   1 
ATOM   539  C CB  . HIS A 1 69  ? 14.472  35.850 32.503 1.00 19.02 ? 69  HIS A CB  1 
ATOM   540  C CG  . HIS A 1 69  ? 14.497  35.125 33.814 1.00 26.34 ? 69  HIS A CG  1 
ATOM   541  N ND1 . HIS A 1 69  ? 15.052  35.667 34.957 1.00 25.21 ? 69  HIS A ND1 1 
ATOM   542  C CD2 . HIS A 1 69  ? 14.004  33.915 34.175 1.00 22.60 ? 69  HIS A CD2 1 
ATOM   543  C CE1 . HIS A 1 69  ? 14.894  34.824 35.964 1.00 31.13 ? 69  HIS A CE1 1 
ATOM   544  N NE2 . HIS A 1 69  ? 14.261  33.753 35.516 1.00 24.53 ? 69  HIS A NE2 1 
ATOM   545  N N   . TYR A 1 70  ? 13.303  36.874 29.765 1.00 25.60 ? 70  TYR A N   1 
ATOM   546  C CA  . TYR A 1 70  ? 13.499  37.726 28.600 1.00 22.10 ? 70  TYR A CA  1 
ATOM   547  C C   . TYR A 1 70  ? 12.403  37.653 27.562 1.00 22.41 ? 70  TYR A C   1 
ATOM   548  O O   . TYR A 1 70  ? 12.642  37.901 26.385 1.00 23.52 ? 70  TYR A O   1 
ATOM   549  C CB  . TYR A 1 70  ? 14.857  37.406 27.980 1.00 22.10 ? 70  TYR A CB  1 
ATOM   550  C CG  . TYR A 1 70  ? 15.943  37.397 29.032 1.00 23.92 ? 70  TYR A CG  1 
ATOM   551  C CD1 . TYR A 1 70  ? 16.152  38.503 29.843 1.00 25.57 ? 70  TYR A CD1 1 
ATOM   552  C CD2 . TYR A 1 70  ? 16.726  36.267 29.250 1.00 25.35 ? 70  TYR A CD2 1 
ATOM   553  C CE1 . TYR A 1 70  ? 17.114  38.487 30.860 1.00 30.38 ? 70  TYR A CE1 1 
ATOM   554  C CE2 . TYR A 1 70  ? 17.690  36.236 30.262 1.00 28.33 ? 70  TYR A CE2 1 
ATOM   555  C CZ  . TYR A 1 70  ? 17.879  37.343 31.062 1.00 29.67 ? 70  TYR A CZ  1 
ATOM   556  O OH  . TYR A 1 70  ? 18.816  37.314 32.070 1.00 36.31 ? 70  TYR A OH  1 
ATOM   557  N N   . SER A 1 71  ? 11.205  37.301 28.012 1.00 19.01 ? 71  SER A N   1 
ATOM   558  C CA  . SER A 1 71  ? 10.033  37.244 27.162 1.00 18.01 ? 71  SER A CA  1 
ATOM   559  C C   . SER A 1 71  ? 10.194  36.467 25.845 1.00 22.81 ? 71  SER A C   1 
ATOM   560  O O   . SER A 1 71  ? 9.761   36.940 24.790 1.00 20.74 ? 71  SER A O   1 
ATOM   561  C CB  . SER A 1 71  ? 9.578   38.673 26.851 1.00 17.30 ? 71  SER A CB  1 
ATOM   562  O OG  . SER A 1 71  ? 8.211   38.694 26.510 1.00 19.90 ? 71  SER A OG  1 
ATOM   563  N N   . LEU A 1 72  ? 10.831  35.304 25.883 1.00 17.10 ? 72  LEU A N   1 
ATOM   564  C CA  . LEU A 1 72  ? 10.931  34.512 24.656 1.00 22.59 ? 72  LEU A CA  1 
ATOM   565  C C   . LEU A 1 72  ? 9.622   33.727 24.634 1.00 24.00 ? 72  LEU A C   1 
ATOM   566  O O   . LEU A 1 72  ? 9.533   32.578 25.078 1.00 26.78 ? 72  LEU A O   1 
ATOM   567  C CB  . LEU A 1 72  ? 12.140  33.579 24.689 1.00 21.40 ? 72  LEU A CB  1 
ATOM   568  C CG  . LEU A 1 72  ? 13.452  34.348 24.511 1.00 29.32 ? 72  LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 72  ? 14.651  33.456 24.769 1.00 35.22 ? 72  LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 72  ? 13.516  34.911 23.093 1.00 23.39 ? 72  LEU A CD2 1 
ATOM   571  N N   . GLN A 1 73  ? 8.592   34.384 24.135 1.00 19.57 ? 73  GLN A N   1 
ATOM   572  C CA  . GLN A 1 73  ? 7.285   33.788 24.084 1.00 19.03 ? 73  GLN A CA  1 
ATOM   573  C C   . GLN A 1 73  ? 6.483   34.434 22.962 1.00 21.88 ? 73  GLN A C   1 
ATOM   574  O O   . GLN A 1 73  ? 6.602   35.647 22.705 1.00 19.91 ? 73  GLN A O   1 
ATOM   575  C CB  . GLN A 1 73  ? 6.567   34.049 25.414 1.00 21.60 ? 73  GLN A CB  1 
ATOM   576  C CG  . GLN A 1 73  ? 6.454   35.557 25.750 1.00 15.20 ? 73  GLN A CG  1 
ATOM   577  C CD  . GLN A 1 73  ? 5.806   35.832 27.115 1.00 24.35 ? 73  GLN A CD  1 
ATOM   578  O OE1 . GLN A 1 73  ? 6.290   35.388 28.154 1.00 25.42 ? 73  GLN A OE1 1 
ATOM   579  N NE2 . GLN A 1 73  ? 4.723   36.567 27.109 1.00 14.74 ? 73  GLN A NE2 1 
ATOM   580  N N   . LEU A 1 74  ? 5.693   33.616 22.284 1.00 22.78 ? 74  LEU A N   1 
ATOM   581  C CA  . LEU A 1 74  ? 4.796   34.104 21.237 1.00 24.46 ? 74  LEU A CA  1 
ATOM   582  C C   . LEU A 1 74  ? 3.541   33.243 21.255 1.00 20.98 ? 74  LEU A C   1 
ATOM   583  O O   . LEU A 1 74  ? 3.543   32.144 21.812 1.00 19.00 ? 74  LEU A O   1 
ATOM   584  C CB  . LEU A 1 74  ? 5.463   34.096 19.847 1.00 22.98 ? 74  LEU A CB  1 
ATOM   585  C CG  . LEU A 1 74  ? 5.837   32.934 18.897 1.00 29.52 ? 74  LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 74  ? 7.230   32.455 19.172 1.00 30.54 ? 74  LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 74  ? 4.808   31.815 18.925 1.00 25.60 ? 74  LEU A CD2 1 
ATOM   588  N N   . PHE A 1 75  ? 2.459   33.739 20.666 1.00 20.43 ? 75  PHE A N   1 
ATOM   589  C CA  . PHE A 1 75  ? 1.230   32.977 20.662 1.00 19.78 ? 75  PHE A CA  1 
ATOM   590  C C   . PHE A 1 75  ? 0.416   33.259 19.411 1.00 18.85 ? 75  PHE A C   1 
ATOM   591  O O   . PHE A 1 75  ? 0.763   34.094 18.587 1.00 21.34 ? 75  PHE A O   1 
ATOM   592  C CB  . PHE A 1 75  ? 0.370   33.328 21.884 1.00 17.67 ? 75  PHE A CB  1 
ATOM   593  C CG  . PHE A 1 75  ? -0.118  34.754 21.889 1.00 17.49 ? 75  PHE A CG  1 
ATOM   594  C CD1 . PHE A 1 75  ? 0.730   35.797 22.264 1.00 21.28 ? 75  PHE A CD1 1 
ATOM   595  C CD2 . PHE A 1 75  ? -1.430  35.055 21.520 1.00 18.17 ? 75  PHE A CD2 1 
ATOM   596  C CE1 . PHE A 1 75  ? 0.277   37.128 22.281 1.00 18.32 ? 75  PHE A CE1 1 
ATOM   597  C CE2 . PHE A 1 75  ? -1.895  36.377 21.527 1.00 18.60 ? 75  PHE A CE2 1 
ATOM   598  C CZ  . PHE A 1 75  ? -1.046  37.418 21.910 1.00 23.26 ? 75  PHE A CZ  1 
ATOM   599  N N   . GLU A 1 76  ? -0.671  32.522 19.285 1.00 20.26 ? 76  GLU A N   1 
ATOM   600  C CA  . GLU A 1 76  ? -1.576  32.695 18.169 1.00 21.98 ? 76  GLU A CA  1 
ATOM   601  C C   . GLU A 1 76  ? -2.990  32.607 18.715 1.00 22.96 ? 76  GLU A C   1 
ATOM   602  O O   . GLU A 1 76  ? -3.213  32.274 19.891 1.00 18.83 ? 76  GLU A O   1 
ATOM   603  C CB  . GLU A 1 76  ? -1.316  31.643 17.076 1.00 23.02 ? 76  GLU A CB  1 
ATOM   604  C CG  . GLU A 1 76  ? -0.352  32.161 16.024 1.00 20.07 ? 76  GLU A CG  1 
ATOM   605  C CD  . GLU A 1 76  ? -0.884  33.429 15.369 1.00 20.88 ? 76  GLU A CD  1 
ATOM   606  O OE1 . GLU A 1 76  ? -0.070  34.228 14.873 1.00 24.95 ? 76  GLU A OE1 1 
ATOM   607  O OE2 . GLU A 1 76  ? -2.123  33.628 15.359 1.00 19.26 ? 76  GLU A OE2 1 
ATOM   608  N N   . GLY A 1 77  ? -3.942  32.950 17.864 1.00 20.90 ? 77  GLY A N   1 
ATOM   609  C CA  . GLY A 1 77  ? -5.329  32.923 18.253 1.00 25.66 ? 77  GLY A CA  1 
ATOM   610  C C   . GLY A 1 77  ? -6.173  32.740 17.006 1.00 27.59 ? 77  GLY A C   1 
ATOM   611  O O   . GLY A 1 77  ? -6.117  33.547 16.068 1.00 23.10 ? 77  GLY A O   1 
ATOM   612  N N   . MET A 1 78  ? -6.940  31.659 16.991 1.00 28.41 ? 78  MET A N   1 
ATOM   613  C CA  . MET A 1 78  ? -7.804  31.377 15.851 1.00 29.26 ? 78  MET A CA  1 
ATOM   614  C C   . MET A 1 78  ? -9.006  30.622 16.362 1.00 30.95 ? 78  MET A C   1 
ATOM   615  O O   . MET A 1 78  ? -8.999  30.139 17.504 1.00 26.69 ? 78  MET A O   1 
ATOM   616  C CB  . MET A 1 78  ? -7.063  30.567 14.792 1.00 30.68 ? 78  MET A CB  1 
ATOM   617  C CG  . MET A 1 78  ? -6.556  29.217 15.241 1.00 30.27 ? 78  MET A CG  1 
ATOM   618  S SD  . MET A 1 78  ? -5.572  28.473 13.911 1.00 34.18 ? 78  MET A SD  1 
ATOM   619  C CE  . MET A 1 78  ? -5.164  26.850 14.652 1.00 33.70 ? 78  MET A CE  1 
ATOM   620  N N   . LYS A 1 79  ? -10.027 30.519 15.515 1.00 29.55 ? 79  LYS A N   1 
ATOM   621  C CA  . LYS A 1 79  ? -11.273 29.872 15.897 1.00 28.69 ? 79  LYS A CA  1 
ATOM   622  C C   . LYS A 1 79  ? -11.748 28.672 15.074 1.00 30.63 ? 79  LYS A C   1 
ATOM   623  O O   . LYS A 1 79  ? -11.467 28.554 13.871 1.00 29.48 ? 79  LYS A O   1 
ATOM   624  C CB  . LYS A 1 79  ? -12.397 30.913 15.927 1.00 26.27 ? 79  LYS A CB  1 
ATOM   625  C CG  . LYS A 1 79  ? -12.426 31.774 17.192 1.00 23.83 ? 79  LYS A CG  1 
ATOM   626  C CD  . LYS A 1 79  ? -13.518 32.823 17.108 1.00 24.55 ? 79  LYS A CD  1 
ATOM   627  C CE  . LYS A 1 79  ? -13.701 33.513 18.441 1.00 21.13 ? 79  LYS A CE  1 
ATOM   628  N NZ  . LYS A 1 79  ? -14.742 34.558 18.373 1.00 27.15 ? 79  LYS A NZ  1 
ATOM   629  N N   . ALA A 1 80  ? -12.464 27.785 15.761 1.00 31.35 ? 80  ALA A N   1 
ATOM   630  C CA  . ALA A 1 80  ? -13.066 26.594 15.155 1.00 28.90 ? 80  ALA A CA  1 
ATOM   631  C C   . ALA A 1 80  ? -14.568 26.784 15.360 1.00 28.86 ? 80  ALA A C   1 
ATOM   632  O O   . ALA A 1 80  ? -15.031 27.070 16.473 1.00 29.19 ? 80  ALA A O   1 
ATOM   633  C CB  . ALA A 1 80  ? -12.593 25.332 15.857 1.00 32.68 ? 80  ALA A CB  1 
ATOM   634  N N   . PHE A 1 81  ? -15.330 26.633 14.287 1.00 24.77 ? 81  PHE A N   1 
ATOM   635  C CA  . PHE A 1 81  ? -16.771 26.829 14.354 1.00 28.72 ? 81  PHE A CA  1 
ATOM   636  C C   . PHE A 1 81  ? -17.498 25.533 14.058 1.00 28.99 ? 81  PHE A C   1 
ATOM   637  O O   . PHE A 1 81  ? -17.065 24.785 13.181 1.00 26.24 ? 81  PHE A O   1 
ATOM   638  C CB  . PHE A 1 81  ? -17.228 27.873 13.325 1.00 23.84 ? 81  PHE A CB  1 
ATOM   639  C CG  . PHE A 1 81  ? -16.491 29.175 13.398 1.00 24.51 ? 81  PHE A CG  1 
ATOM   640  C CD1 . PHE A 1 81  ? -15.176 29.284 12.929 1.00 25.98 ? 81  PHE A CD1 1 
ATOM   641  C CD2 . PHE A 1 81  ? -17.110 30.302 13.928 1.00 24.01 ? 81  PHE A CD2 1 
ATOM   642  C CE1 . PHE A 1 81  ? -14.488 30.509 12.981 1.00 25.60 ? 81  PHE A CE1 1 
ATOM   643  C CE2 . PHE A 1 81  ? -16.431 31.535 13.990 1.00 27.24 ? 81  PHE A CE2 1 
ATOM   644  C CZ  . PHE A 1 81  ? -15.119 31.635 13.513 1.00 22.86 ? 81  PHE A CZ  1 
ATOM   645  N N   . LYS A 1 82  ? -18.608 25.294 14.766 1.00 25.11 ? 82  LYS A N   1 
ATOM   646  C CA  . LYS A 1 82  ? -19.426 24.086 14.550 1.00 30.54 ? 82  LYS A CA  1 
ATOM   647  C C   . LYS A 1 82  ? -20.699 24.452 13.762 1.00 31.05 ? 82  LYS A C   1 
ATOM   648  O O   . LYS A 1 82  ? -21.513 25.248 14.223 1.00 34.76 ? 82  LYS A O   1 
ATOM   649  C CB  . LYS A 1 82  ? -19.815 23.452 15.894 1.00 28.30 ? 82  LYS A CB  1 
ATOM   650  C CG  . LYS A 1 82  ? -20.390 22.027 15.799 1.00 34.96 ? 82  LYS A CG  1 
ATOM   651  C CD  . LYS A 1 82  ? -20.828 21.492 17.178 1.00 36.19 ? 82  LYS A CD  1 
ATOM   652  C CE  . LYS A 1 82  ? -21.277 20.032 17.089 1.00 45.20 ? 82  LYS A CE  1 
ATOM   653  N NZ  . LYS A 1 82  ? -21.789 19.469 18.386 1.00 47.04 ? 82  LYS A NZ  1 
ATOM   654  N N   . GLY A 1 83  ? -20.865 23.887 12.568 1.00 35.36 ? 83  GLY A N   1 
ATOM   655  C CA  . GLY A 1 83  ? -22.048 24.190 11.774 1.00 36.70 ? 83  GLY A CA  1 
ATOM   656  C C   . GLY A 1 83  ? -23.238 23.332 12.185 1.00 43.36 ? 83  GLY A C   1 
ATOM   657  O O   . GLY A 1 83  ? -23.084 22.380 12.950 1.00 41.52 ? 83  GLY A O   1 
ATOM   658  N N   . LYS A 1 84  ? -24.426 23.665 11.683 1.00 48.71 ? 84  LYS A N   1 
ATOM   659  C CA  . LYS A 1 84  ? -25.643 22.911 12.006 1.00 48.70 ? 84  LYS A CA  1 
ATOM   660  C C   . LYS A 1 84  ? -25.390 21.400 11.869 1.00 48.67 ? 84  LYS A C   1 
ATOM   661  O O   . LYS A 1 84  ? -25.787 20.607 12.729 1.00 44.56 ? 84  LYS A O   1 
ATOM   662  C CB  . LYS A 1 84  ? -26.781 23.343 11.073 1.00 49.98 ? 84  LYS A CB  1 
ATOM   663  C CG  . LYS A 1 84  ? -28.175 22.865 11.477 1.00 53.96 ? 84  LYS A CG  1 
ATOM   664  C CD  . LYS A 1 84  ? -28.685 23.601 12.713 1.00 54.48 ? 84  LYS A CD  1 
ATOM   665  C CE  . LYS A 1 84  ? -30.186 23.376 12.911 1.00 57.64 ? 84  LYS A CE  1 
ATOM   666  N NZ  . LYS A 1 84  ? -30.721 24.039 14.142 1.00 55.44 ? 84  LYS A NZ  1 
ATOM   667  N N   . ASP A 1 85  ? -24.701 21.021 10.793 1.00 47.62 ? 85  ASP A N   1 
ATOM   668  C CA  . ASP A 1 85  ? -24.378 19.623 10.517 1.00 46.65 ? 85  ASP A CA  1 
ATOM   669  C C   . ASP A 1 85  ? -23.563 18.951 11.618 1.00 50.35 ? 85  ASP A C   1 
ATOM   670  O O   . ASP A 1 85  ? -23.465 17.723 11.648 1.00 51.98 ? 85  ASP A O   1 
ATOM   671  C CB  . ASP A 1 85  ? -23.607 19.517 9.201  1.00 45.91 ? 85  ASP A CB  1 
ATOM   672  C CG  . ASP A 1 85  ? -22.355 20.392 9.183  1.00 48.73 ? 85  ASP A CG  1 
ATOM   673  O OD1 . ASP A 1 85  ? -21.731 20.508 8.108  1.00 45.92 ? 85  ASP A OD1 1 
ATOM   674  O OD2 . ASP A 1 85  ? -21.992 20.960 10.239 1.00 44.76 ? 85  ASP A OD2 1 
ATOM   675  N N   . GLN A 1 86  ? -22.991 19.758 12.513 1.00 48.94 ? 86  GLN A N   1 
ATOM   676  C CA  . GLN A 1 86  ? -22.162 19.277 13.622 1.00 45.42 ? 86  GLN A CA  1 
ATOM   677  C C   . GLN A 1 86  ? -20.698 19.293 13.203 1.00 42.11 ? 86  GLN A C   1 
ATOM   678  O O   . GLN A 1 86  ? -19.808 19.071 14.016 1.00 40.19 ? 86  GLN A O   1 
ATOM   679  C CB  . GLN A 1 86  ? -22.591 17.863 14.060 1.00 48.03 ? 86  GLN A CB  1 
ATOM   680  C CG  . GLN A 1 86  ? -21.476 16.808 14.112 1.00 53.96 ? 86  GLN A CG  1 
ATOM   681  C CD  . GLN A 1 86  ? -20.776 16.568 12.763 1.00 60.73 ? 86  GLN A CD  1 
ATOM   682  O OE1 . GLN A 1 86  ? -21.422 16.334 11.736 1.00 59.58 ? 86  GLN A OE1 1 
ATOM   683  N NE2 . GLN A 1 86  ? -19.444 16.619 12.774 1.00 58.65 ? 86  GLN A NE2 1 
ATOM   684  N N   . GLN A 1 87  ? -20.460 19.558 11.921 1.00 39.61 ? 87  GLN A N   1 
ATOM   685  C CA  . GLN A 1 87  ? -19.103 19.616 11.368 1.00 40.32 ? 87  GLN A CA  1 
ATOM   686  C C   . GLN A 1 87  ? -18.338 20.818 11.928 1.00 34.86 ? 87  GLN A C   1 
ATOM   687  O O   . GLN A 1 87  ? -18.819 21.939 11.864 1.00 37.51 ? 87  GLN A O   1 
ATOM   688  C CB  . GLN A 1 87  ? -19.167 19.772 9.851  1.00 43.41 ? 87  GLN A CB  1 
ATOM   689  C CG  . GLN A 1 87  ? -18.184 18.917 9.080  1.00 49.84 ? 87  GLN A CG  1 
ATOM   690  C CD  . GLN A 1 87  ? -18.487 17.443 9.226  1.00 52.55 ? 87  GLN A CD  1 
ATOM   691  O OE1 . GLN A 1 87  ? -19.654 17.041 9.286  1.00 52.64 ? 87  GLN A OE1 1 
ATOM   692  N NE2 . GLN A 1 87  ? -17.440 16.624 9.278  1.00 52.84 ? 87  GLN A NE2 1 
ATOM   693  N N   . VAL A 1 88  ? -17.150 20.579 12.465 1.00 36.86 ? 88  VAL A N   1 
ATOM   694  C CA  . VAL A 1 88  ? -16.308 21.653 13.007 1.00 33.13 ? 88  VAL A CA  1 
ATOM   695  C C   . VAL A 1 88  ? -15.291 22.054 11.943 1.00 33.51 ? 88  VAL A C   1 
ATOM   696  O O   . VAL A 1 88  ? -14.710 21.198 11.286 1.00 32.18 ? 88  VAL A O   1 
ATOM   697  C CB  . VAL A 1 88  ? -15.554 21.171 14.277 1.00 33.13 ? 88  VAL A CB  1 
ATOM   698  C CG1 . VAL A 1 88  ? -14.602 22.260 14.795 1.00 30.78 ? 88  VAL A CG1 1 
ATOM   699  C CG2 . VAL A 1 88  ? -16.561 20.792 15.343 1.00 29.90 ? 88  VAL A CG2 1 
ATOM   700  N N   . ARG A 1 89  ? -15.080 23.355 11.776 1.00 30.85 ? 89  ARG A N   1 
ATOM   701  C CA  . ARG A 1 89  ? -14.130 23.854 10.796 1.00 29.95 ? 89  ARG A CA  1 
ATOM   702  C C   . ARG A 1 89  ? -13.313 25.023 11.354 1.00 29.60 ? 89  ARG A C   1 
ATOM   703  O O   . ARG A 1 89  ? -13.827 25.830 12.115 1.00 31.24 ? 89  ARG A O   1 
ATOM   704  C CB  . ARG A 1 89  ? -14.884 24.303 9.548  1.00 32.47 ? 89  ARG A CB  1 
ATOM   705  C CG  . ARG A 1 89  ? -15.766 23.204 8.946  1.00 39.73 ? 89  ARG A CG  1 
ATOM   706  C CD  . ARG A 1 89  ? -16.592 23.721 7.767  1.00 43.57 ? 89  ARG A CD  1 
ATOM   707  N NE  . ARG A 1 89  ? -18.013 23.779 8.091  1.00 48.90 ? 89  ARG A NE  1 
ATOM   708  C CZ  . ARG A 1 89  ? -18.859 22.766 7.935  1.00 49.28 ? 89  ARG A CZ  1 
ATOM   709  N NH1 . ARG A 1 89  ? -18.427 21.612 7.446  1.00 56.05 ? 89  ARG A NH1 1 
ATOM   710  N NH2 . ARG A 1 89  ? -20.128 22.894 8.297  1.00 49.31 ? 89  ARG A NH2 1 
ATOM   711  N N   . LEU A 1 90  ? -12.040 25.097 10.981 1.00 29.12 ? 90  LEU A N   1 
ATOM   712  C CA  . LEU A 1 90  ? -11.167 26.174 11.428 1.00 28.76 ? 90  LEU A CA  1 
ATOM   713  C C   . LEU A 1 90  ? -11.136 27.200 10.292 1.00 28.68 ? 90  LEU A C   1 
ATOM   714  O O   . LEU A 1 90  ? -11.082 26.819 9.127  1.00 27.78 ? 90  LEU A O   1 
ATOM   715  C CB  . LEU A 1 90  ? -9.748  25.639 11.684 1.00 25.62 ? 90  LEU A CB  1 
ATOM   716  C CG  . LEU A 1 90  ? -9.429  24.898 12.986 1.00 28.00 ? 90  LEU A CG  1 
ATOM   717  C CD1 . LEU A 1 90  ? -8.087  24.184 12.882 1.00 21.28 ? 90  LEU A CD1 1 
ATOM   718  C CD2 . LEU A 1 90  ? -9.405  25.897 14.130 1.00 20.63 ? 90  LEU A CD2 1 
ATOM   719  N N   . PHE A 1 91  ? -11.186 28.485 10.643 1.00 27.44 ? 91  PHE A N   1 
ATOM   720  C CA  . PHE A 1 91  ? -11.151 29.597 9.684  1.00 23.94 ? 91  PHE A CA  1 
ATOM   721  C C   . PHE A 1 91  ? -9.712  30.022 9.338  1.00 25.49 ? 91  PHE A C   1 
ATOM   722  O O   . PHE A 1 91  ? -8.994  30.517 10.209 1.00 26.26 ? 91  PHE A O   1 
ATOM   723  C CB  . PHE A 1 91  ? -11.890 30.796 10.285 1.00 23.22 ? 91  PHE A CB  1 
ATOM   724  C CG  . PHE A 1 91  ? -11.912 32.013 9.406  1.00 25.18 ? 91  PHE A CG  1 
ATOM   725  C CD1 . PHE A 1 91  ? -12.729 32.060 8.282  1.00 20.64 ? 91  PHE A CD1 1 
ATOM   726  C CD2 . PHE A 1 91  ? -11.147 33.127 9.721  1.00 26.37 ? 91  PHE A CD2 1 
ATOM   727  C CE1 . PHE A 1 91  ? -12.791 33.201 7.483  1.00 23.50 ? 91  PHE A CE1 1 
ATOM   728  C CE2 . PHE A 1 91  ? -11.198 34.272 8.930  1.00 24.51 ? 91  PHE A CE2 1 
ATOM   729  C CZ  . PHE A 1 91  ? -12.030 34.307 7.808  1.00 28.07 ? 91  PHE A CZ  1 
ATOM   730  N N   . ARG A 1 92  ? -9.319  29.832 8.072  1.00 25.03 ? 92  ARG A N   1 
ATOM   731  C CA  . ARG A 1 92  ? -8.000  30.182 7.514  1.00 24.27 ? 92  ARG A CA  1 
ATOM   732  C C   . ARG A 1 92  ? -6.807  29.898 8.450  1.00 28.70 ? 92  ARG A C   1 
ATOM   733  O O   . ARG A 1 92  ? -5.918  30.730 8.619  1.00 21.02 ? 92  ARG A O   1 
ATOM   734  C CB  . ARG A 1 92  ? -7.984  31.669 7.103  1.00 24.13 ? 92  ARG A CB  1 
ATOM   735  C CG  . ARG A 1 92  ? -9.234  32.105 6.314  1.00 27.48 ? 92  ARG A CG  1 
ATOM   736  C CD  . ARG A 1 92  ? -9.080  33.489 5.683  1.00 21.22 ? 92  ARG A CD  1 
ATOM   737  N NE  . ARG A 1 92  ? -8.163  33.449 4.552  1.00 20.13 ? 92  ARG A NE  1 
ATOM   738  C CZ  . ARG A 1 92  ? -7.850  34.485 3.788  1.00 23.77 ? 92  ARG A CZ  1 
ATOM   739  N NH1 . ARG A 1 92  ? -8.366  35.690 4.020  1.00 23.48 ? 92  ARG A NH1 1 
ATOM   740  N NH2 . ARG A 1 92  ? -7.039  34.301 2.761  1.00 25.99 ? 92  ARG A NH2 1 
ATOM   741  N N   . PRO A 1 93  ? -6.753  28.696 9.032  1.00 28.34 ? 93  PRO A N   1 
ATOM   742  C CA  . PRO A 1 93  ? -5.680  28.305 9.953  1.00 27.07 ? 93  PRO A CA  1 
ATOM   743  C C   . PRO A 1 93  ? -4.289  28.527 9.399  1.00 26.33 ? 93  PRO A C   1 
ATOM   744  O O   . PRO A 1 93  ? -3.379  28.917 10.125 1.00 30.70 ? 93  PRO A O   1 
ATOM   745  C CB  . PRO A 1 93  ? -5.944  26.822 10.200 1.00 30.34 ? 93  PRO A CB  1 
ATOM   746  C CG  . PRO A 1 93  ? -7.387  26.636 9.819  1.00 37.07 ? 93  PRO A CG  1 
ATOM   747  C CD  . PRO A 1 93  ? -7.564  27.532 8.642  1.00 28.88 ? 93  PRO A CD  1 
ATOM   748  N N   . TRP A 1 94  ? -4.131  28.249 8.108  1.00 26.69 ? 94  TRP A N   1 
ATOM   749  C CA  . TRP A 1 94  ? -2.861  28.397 7.436  1.00 23.10 ? 94  TRP A CA  1 
ATOM   750  C C   . TRP A 1 94  ? -2.224  29.758 7.686  1.00 18.88 ? 94  TRP A C   1 
ATOM   751  O O   . TRP A 1 94  ? -1.021  29.840 7.908  1.00 23.59 ? 94  TRP A O   1 
ATOM   752  C CB  . TRP A 1 94  ? -3.037  28.177 5.933  1.00 24.77 ? 94  TRP A CB  1 
ATOM   753  C CG  . TRP A 1 94  ? -3.802  26.930 5.608  1.00 29.66 ? 94  TRP A CG  1 
ATOM   754  C CD1 . TRP A 1 94  ? -3.314  25.654 5.538  1.00 26.92 ? 94  TRP A CD1 1 
ATOM   755  C CD2 . TRP A 1 94  ? -5.196  26.845 5.312  1.00 24.96 ? 94  TRP A CD2 1 
ATOM   756  N NE1 . TRP A 1 94  ? -4.326  24.777 5.211  1.00 27.30 ? 94  TRP A NE1 1 
ATOM   757  C CE2 . TRP A 1 94  ? -5.491  25.484 5.066  1.00 30.02 ? 94  TRP A CE2 1 
ATOM   758  C CE3 . TRP A 1 94  ? -6.226  27.786 5.228  1.00 24.06 ? 94  TRP A CE3 1 
ATOM   759  C CZ2 . TRP A 1 94  ? -6.782  25.045 4.742  1.00 27.77 ? 94  TRP A CZ2 1 
ATOM   760  C CZ3 . TRP A 1 94  ? -7.508  27.354 4.908  1.00 26.24 ? 94  TRP A CZ3 1 
ATOM   761  C CH2 . TRP A 1 94  ? -7.775  25.991 4.669  1.00 28.26 ? 94  TRP A CH2 1 
ATOM   762  N N   . LEU A 1 95  ? -3.016  30.822 7.641  1.00 24.62 ? 95  LEU A N   1 
ATOM   763  C CA  . LEU A 1 95  ? -2.459  32.151 7.870  1.00 22.67 ? 95  LEU A CA  1 
ATOM   764  C C   . LEU A 1 95  ? -1.885  32.259 9.289  1.00 24.16 ? 95  LEU A C   1 
ATOM   765  O O   . LEU A 1 95  ? -0.851  32.887 9.493  1.00 24.46 ? 95  LEU A O   1 
ATOM   766  C CB  . LEU A 1 95  ? -3.526  33.223 7.632  1.00 23.08 ? 95  LEU A CB  1 
ATOM   767  C CG  . LEU A 1 95  ? -4.127  33.190 6.220  1.00 29.89 ? 95  LEU A CG  1 
ATOM   768  C CD1 . LEU A 1 95  ? -4.915  34.464 5.958  1.00 26.27 ? 95  LEU A CD1 1 
ATOM   769  C CD2 . LEU A 1 95  ? -3.007  33.055 5.200  1.00 28.53 ? 95  LEU A CD2 1 
ATOM   770  N N   . ASN A 1 96  ? -2.551  31.641 10.264 1.00 24.26 ? 96  ASN A N   1 
ATOM   771  C CA  . ASN A 1 96  ? -2.061  31.677 11.638 1.00 27.46 ? 96  ASN A CA  1 
ATOM   772  C C   . ASN A 1 96  ? -0.752  30.902 11.771 1.00 27.53 ? 96  ASN A C   1 
ATOM   773  O O   . ASN A 1 96  ? 0.141   31.314 12.508 1.00 29.56 ? 96  ASN A O   1 
ATOM   774  C CB  . ASN A 1 96  ? -3.117  31.124 12.590 1.00 25.57 ? 96  ASN A CB  1 
ATOM   775  C CG  . ASN A 1 96  ? -4.328  32.030 12.696 1.00 26.97 ? 96  ASN A CG  1 
ATOM   776  O OD1 . ASN A 1 96  ? -4.315  33.013 13.430 1.00 33.82 ? 96  ASN A OD1 1 
ATOM   777  N ND2 . ASN A 1 96  ? -5.370  31.718 11.934 1.00 24.31 ? 96  ASN A ND2 1 
ATOM   778  N N   . MET A 1 97  ? -0.631  29.781 11.064 1.00 23.24 ? 97  MET A N   1 
ATOM   779  C CA  . MET A 1 97  ? 0.603   29.011 11.116 1.00 27.27 ? 97  MET A CA  1 
ATOM   780  C C   . MET A 1 97  ? 1.734   29.839 10.490 1.00 25.40 ? 97  MET A C   1 
ATOM   781  O O   . MET A 1 97  ? 2.856   29.849 11.001 1.00 25.84 ? 97  MET A O   1 
ATOM   782  C CB  . MET A 1 97  ? 0.443   27.676 10.368 1.00 26.70 ? 97  MET A CB  1 
ATOM   783  C CG  . MET A 1 97  ? -0.684  26.805 10.904 1.00 25.97 ? 97  MET A CG  1 
ATOM   784  S SD  . MET A 1 97  ? -0.468  26.203 12.587 1.00 28.14 ? 97  MET A SD  1 
ATOM   785  C CE  . MET A 1 97  ? -1.388  27.434 13.533 1.00 32.43 ? 97  MET A CE  1 
ATOM   786  N N   . ASP A 1 98  ? 1.443   30.527 9.384  1.00 23.48 ? 98  ASP A N   1 
ATOM   787  C CA  . ASP A 1 98  ? 2.448   31.368 8.729  1.00 24.19 ? 98  ASP A CA  1 
ATOM   788  C C   . ASP A 1 98  ? 2.929   32.436 9.711  1.00 24.66 ? 98  ASP A C   1 
ATOM   789  O O   . ASP A 1 98  ? 4.131   32.632 9.884  1.00 23.61 ? 98  ASP A O   1 
ATOM   790  C CB  . ASP A 1 98  ? 1.871   32.107 7.520  1.00 24.90 ? 98  ASP A CB  1 
ATOM   791  C CG  . ASP A 1 98  ? 1.614   31.202 6.338  1.00 29.89 ? 98  ASP A CG  1 
ATOM   792  O OD1 . ASP A 1 98  ? 0.814   31.608 5.465  1.00 32.91 ? 98  ASP A OD1 1 
ATOM   793  O OD2 . ASP A 1 98  ? 2.203   30.106 6.264  1.00 35.23 ? 98  ASP A OD2 1 
ATOM   794  N N   . ARG A 1 99  ? 1.976   33.132 10.336 1.00 23.67 ? 99  ARG A N   1 
ATOM   795  C CA  . ARG A 1 99  ? 2.292   34.201 11.278 1.00 23.13 ? 99  ARG A CA  1 
ATOM   796  C C   . ARG A 1 99  ? 3.053   33.679 12.490 1.00 24.83 ? 99  ARG A C   1 
ATOM   797  O O   . ARG A 1 99  ? 4.008   34.312 12.964 1.00 21.18 ? 99  ARG A O   1 
ATOM   798  C CB  . ARG A 1 99  ? 1.005   34.903 11.717 1.00 23.15 ? 99  ARG A CB  1 
ATOM   799  C CG  . ARG A 1 99  ? 1.220   36.166 12.509 1.00 21.58 ? 99  ARG A CG  1 
ATOM   800  C CD  . ARG A 1 99  ? -0.069  36.965 12.630 1.00 18.00 ? 99  ARG A CD  1 
ATOM   801  N NE  . ARG A 1 99  ? -1.042  36.387 13.547 1.00 19.00 ? 99  ARG A NE  1 
ATOM   802  C CZ  . ARG A 1 99  ? -2.317  36.775 13.629 1.00 23.84 ? 99  ARG A CZ  1 
ATOM   803  N NH1 . ARG A 1 99  ? -2.779  37.747 12.847 1.00 26.72 ? 99  ARG A NH1 1 
ATOM   804  N NH2 . ARG A 1 99  ? -3.136  36.198 14.491 1.00 14.67 ? 99  ARG A NH2 1 
ATOM   805  N N   . MET A 1 100 ? 2.641   32.517 12.984 1.00 23.10 ? 100 MET A N   1 
ATOM   806  C CA  . MET A 1 100 ? 3.303   31.912 14.126 1.00 21.94 ? 100 MET A CA  1 
ATOM   807  C C   . MET A 1 100 ? 4.765   31.609 13.804 1.00 24.08 ? 100 MET A C   1 
ATOM   808  O O   . MET A 1 100 ? 5.639   31.857 14.618 1.00 22.53 ? 100 MET A O   1 
ATOM   809  C CB  . MET A 1 100 ? 2.596   30.624 14.542 1.00 19.17 ? 100 MET A CB  1 
ATOM   810  C CG  . MET A 1 100 ? 3.143   30.018 15.833 1.00 19.46 ? 100 MET A CG  1 
ATOM   811  S SD  . MET A 1 100 ? 2.125   28.634 16.408 1.00 22.65 ? 100 MET A SD  1 
ATOM   812  C CE  . MET A 1 100 ? 3.019   28.135 17.982 1.00 20.50 ? 100 MET A CE  1 
ATOM   813  N N   . LEU A 1 101 ? 5.029   31.072 12.619 1.00 25.75 ? 101 LEU A N   1 
ATOM   814  C CA  . LEU A 1 101 ? 6.394   30.771 12.225 1.00 25.26 ? 101 LEU A CA  1 
ATOM   815  C C   . LEU A 1 101 ? 7.200   32.072 12.079 1.00 19.45 ? 101 LEU A C   1 
ATOM   816  O O   . LEU A 1 101 ? 8.376   32.116 12.433 1.00 21.16 ? 101 LEU A O   1 
ATOM   817  C CB  . LEU A 1 101 ? 6.411   29.986 10.910 1.00 28.34 ? 101 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 101 ? 7.697   29.187 10.671 1.00 38.70 ? 101 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 101 ? 7.690   27.979 11.600 1.00 35.12 ? 101 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 101 ? 7.795   28.723 9.209  1.00 37.33 ? 101 LEU A CD2 1 
ATOM   821  N N   . ARG A 1 102 ? 6.577   33.132 11.566 1.00 20.95 ? 102 ARG A N   1 
ATOM   822  C CA  . ARG A 1 102 ? 7.288   34.399 11.453 1.00 21.20 ? 102 ARG A CA  1 
ATOM   823  C C   . ARG A 1 102 ? 7.718   34.879 12.846 1.00 21.41 ? 102 ARG A C   1 
ATOM   824  O O   . ARG A 1 102 ? 8.856   35.322 13.040 1.00 20.76 ? 102 ARG A O   1 
ATOM   825  C CB  . ARG A 1 102 ? 6.425   35.464 10.790 1.00 24.16 ? 102 ARG A CB  1 
ATOM   826  C CG  . ARG A 1 102 ? 6.399   35.395 9.253  1.00 34.13 ? 102 ARG A CG  1 
ATOM   827  C CD  . ARG A 1 102 ? 5.784   36.674 8.652  1.00 32.14 ? 102 ARG A CD  1 
ATOM   828  N NE  . ARG A 1 102 ? 4.328   36.665 8.698  1.00 36.30 ? 102 ARG A NE  1 
ATOM   829  C CZ  . ARG A 1 102 ? 3.575   37.514 9.389  1.00 42.00 ? 102 ARG A CZ  1 
ATOM   830  N NH1 . ARG A 1 102 ? 4.123   38.480 10.136 1.00 42.98 ? 102 ARG A NH1 1 
ATOM   831  N NH2 . ARG A 1 102 ? 2.255   37.412 9.301  1.00 35.68 ? 102 ARG A NH2 1 
ATOM   832  N N   . SER A 1 103 ? 6.800   34.793 13.807 1.00 21.96 ? 103 SER A N   1 
ATOM   833  C CA  . SER A 1 103 ? 7.085   35.201 15.174 1.00 20.10 ? 103 SER A CA  1 
ATOM   834  C C   . SER A 1 103 ? 8.225   34.354 15.715 1.00 16.85 ? 103 SER A C   1 
ATOM   835  O O   . SER A 1 103 ? 9.140   34.860 16.329 1.00 19.91 ? 103 SER A O   1 
ATOM   836  C CB  . SER A 1 103 ? 5.852   34.998 16.071 1.00 22.98 ? 103 SER A CB  1 
ATOM   837  O OG  . SER A 1 103 ? 4.805   35.862 15.707 1.00 20.47 ? 103 SER A OG  1 
ATOM   838  N N   . ALA A 1 104 ? 8.156   33.046 15.500 1.00 19.86 ? 104 ALA A N   1 
ATOM   839  C CA  . ALA A 1 104 ? 9.208   32.156 15.966 1.00 23.01 ? 104 ALA A CA  1 
ATOM   840  C C   . ALA A 1 104 ? 10.595  32.612 15.492 1.00 22.58 ? 104 ALA A C   1 
ATOM   841  O O   . ALA A 1 104 ? 11.546  32.684 16.291 1.00 22.34 ? 104 ALA A O   1 
ATOM   842  C CB  . ALA A 1 104 ? 8.932   30.711 15.503 1.00 23.50 ? 104 ALA A CB  1 
ATOM   843  N N   . MET A 1 105 ? 10.720  32.915 14.205 1.00 24.14 ? 105 MET A N   1 
ATOM   844  C CA  . MET A 1 105 ? 12.004  33.347 13.671 1.00 22.77 ? 105 MET A CA  1 
ATOM   845  C C   . MET A 1 105 ? 12.502  34.672 14.235 1.00 28.36 ? 105 MET A C   1 
ATOM   846  O O   . MET A 1 105 ? 13.700  34.849 14.451 1.00 25.30 ? 105 MET A O   1 
ATOM   847  C CB  . MET A 1 105 ? 11.946  33.446 12.155 1.00 26.68 ? 105 MET A CB  1 
ATOM   848  C CG  . MET A 1 105 ? 12.945  32.520 11.492 1.00 41.48 ? 105 MET A CG  1 
ATOM   849  S SD  . MET A 1 105 ? 12.544  30.763 11.673 1.00 47.07 ? 105 MET A SD  1 
ATOM   850  C CE  . MET A 1 105 ? 12.807  30.386 13.421 1.00 43.43 ? 105 MET A CE  1 
ATOM   851  N N   . ARG A 1 106 ? 11.573  35.589 14.477 1.00 22.68 ? 106 ARG A N   1 
ATOM   852  C CA  . ARG A 1 106 ? 11.911  36.902 14.999 1.00 25.33 ? 106 ARG A CA  1 
ATOM   853  C C   . ARG A 1 106 ? 12.565  36.751 16.383 1.00 19.74 ? 106 ARG A C   1 
ATOM   854  O O   . ARG A 1 106 ? 13.496  37.490 16.696 1.00 18.12 ? 106 ARG A O   1 
ATOM   855  C CB  . ARG A 1 106 ? 10.630  37.772 15.033 1.00 16.42 ? 106 ARG A CB  1 
ATOM   856  C CG  . ARG A 1 106 ? 10.752  39.253 15.473 1.00 18.43 ? 106 ARG A CG  1 
ATOM   857  C CD  . ARG A 1 106 ? 11.898  40.047 14.857 1.00 19.24 ? 106 ARG A CD  1 
ATOM   858  N NE  . ARG A 1 106 ? 13.003  39.896 15.787 1.00 37.32 ? 106 ARG A NE  1 
ATOM   859  C CZ  . ARG A 1 106 ? 13.633  40.878 16.397 1.00 21.22 ? 106 ARG A CZ  1 
ATOM   860  N NH1 . ARG A 1 106 ? 13.315  42.153 16.194 1.00 25.02 ? 106 ARG A NH1 1 
ATOM   861  N NH2 . ARG A 1 106 ? 14.572  40.561 17.248 1.00 36.27 ? 106 ARG A NH2 1 
ATOM   862  N N   . LEU A 1 107 ? 12.097  35.776 17.168 1.00 21.02 ? 107 LEU A N   1 
ATOM   863  C CA  . LEU A 1 107 ? 12.621  35.492 18.522 1.00 20.82 ? 107 LEU A CA  1 
ATOM   864  C C   . LEU A 1 107 ? 13.657  34.345 18.587 1.00 24.51 ? 107 LEU A C   1 
ATOM   865  O O   . LEU A 1 107 ? 13.996  33.865 19.675 1.00 24.01 ? 107 LEU A O   1 
ATOM   866  C CB  . LEU A 1 107 ? 11.468  35.166 19.494 1.00 17.75 ? 107 LEU A CB  1 
ATOM   867  C CG  . LEU A 1 107 ? 10.472  36.293 19.786 1.00 24.76 ? 107 LEU A CG  1 
ATOM   868  C CD1 . LEU A 1 107 ? 9.492   35.874 20.863 1.00 25.66 ? 107 LEU A CD1 1 
ATOM   869  C CD2 . LEU A 1 107 ? 11.265  37.544 20.218 1.00 22.36 ? 107 LEU A CD2 1 
ATOM   870  N N   . CYS A 1 108 ? 14.157  33.908 17.432 1.00 24.42 ? 108 CYS A N   1 
ATOM   871  C CA  . CYS A 1 108 ? 15.151  32.837 17.380 1.00 23.43 ? 108 CYS A CA  1 
ATOM   872  C C   . CYS A 1 108 ? 14.683  31.562 18.048 1.00 27.20 ? 108 CYS A C   1 
ATOM   873  O O   . CYS A 1 108 ? 15.470  30.860 18.674 1.00 29.38 ? 108 CYS A O   1 
ATOM   874  C CB  . CYS A 1 108 ? 16.472  33.298 18.020 1.00 23.70 ? 108 CYS A CB  1 
ATOM   875  S SG  . CYS A 1 108 ? 17.166  34.773 17.177 1.00 30.14 ? 108 CYS A SG  1 
ATOM   876  N N   . LEU A 1 109 ? 13.394  31.266 17.924 1.00 27.08 ? 109 LEU A N   1 
ATOM   877  C CA  . LEU A 1 109 ? 12.835  30.042 18.496 1.00 19.89 ? 109 LEU A CA  1 
ATOM   878  C C   . LEU A 1 109 ? 12.791  29.032 17.347 1.00 24.55 ? 109 LEU A C   1 
ATOM   879  O O   . LEU A 1 109 ? 12.792  29.425 16.178 1.00 24.65 ? 109 LEU A O   1 
ATOM   880  C CB  . LEU A 1 109 ? 11.438  30.320 19.066 1.00 19.37 ? 109 LEU A CB  1 
ATOM   881  C CG  . LEU A 1 109 ? 11.494  30.975 20.458 1.00 25.87 ? 109 LEU A CG  1 
ATOM   882  C CD1 . LEU A 1 109 ? 10.103  31.316 20.966 1.00 24.29 ? 109 LEU A CD1 1 
ATOM   883  C CD2 . LEU A 1 109 ? 12.179  29.999 21.422 1.00 26.58 ? 109 LEU A CD2 1 
ATOM   884  N N   . PRO A 1 110 ? 12.722  27.728 17.657 1.00 30.96 ? 110 PRO A N   1 
ATOM   885  C CA  . PRO A 1 110 ? 12.694  26.627 16.682 1.00 30.70 ? 110 PRO A CA  1 
ATOM   886  C C   . PRO A 1 110 ? 11.616  26.640 15.608 1.00 27.97 ? 110 PRO A C   1 
ATOM   887  O O   . PRO A 1 110 ? 10.424  26.730 15.899 1.00 29.71 ? 110 PRO A O   1 
ATOM   888  C CB  . PRO A 1 110 ? 12.556  25.378 17.557 1.00 29.10 ? 110 PRO A CB  1 
ATOM   889  C CG  . PRO A 1 110 ? 12.870  25.822 18.912 1.00 36.37 ? 110 PRO A CG  1 
ATOM   890  C CD  . PRO A 1 110 ? 12.373  27.219 18.989 1.00 31.65 ? 110 PRO A CD  1 
ATOM   891  N N   . SER A 1 111 ? 12.050  26.532 14.364 1.00 27.40 ? 111 SER A N   1 
ATOM   892  C CA  . SER A 1 111 ? 11.138  26.470 13.239 1.00 27.59 ? 111 SER A CA  1 
ATOM   893  C C   . SER A 1 111 ? 10.460  25.096 13.281 1.00 26.36 ? 111 SER A C   1 
ATOM   894  O O   . SER A 1 111 ? 10.988  24.158 13.876 1.00 30.78 ? 111 SER A O   1 
ATOM   895  C CB  . SER A 1 111 ? 11.918  26.617 11.935 1.00 27.32 ? 111 SER A CB  1 
ATOM   896  O OG  . SER A 1 111 ? 11.071  26.332 10.834 1.00 39.59 ? 111 SER A OG  1 
ATOM   897  N N   . PHE A 1 112 ? 9.286   24.981 12.673 1.00 30.46 ? 112 PHE A N   1 
ATOM   898  C CA  . PHE A 1 112 ? 8.557   23.726 12.639 1.00 28.94 ? 112 PHE A CA  1 
ATOM   899  C C   . PHE A 1 112 ? 7.769   23.658 11.337 1.00 29.14 ? 112 PHE A C   1 
ATOM   900  O O   . PHE A 1 112 ? 7.706   24.639 10.594 1.00 30.08 ? 112 PHE A O   1 
ATOM   901  C CB  . PHE A 1 112 ? 7.616   23.625 13.854 1.00 32.52 ? 112 PHE A CB  1 
ATOM   902  C CG  . PHE A 1 112 ? 6.663   24.780 13.988 1.00 32.28 ? 112 PHE A CG  1 
ATOM   903  C CD1 . PHE A 1 112 ? 5.481   24.809 13.259 1.00 30.30 ? 112 PHE A CD1 1 
ATOM   904  C CD2 . PHE A 1 112 ? 6.975   25.868 14.796 1.00 29.53 ? 112 PHE A CD2 1 
ATOM   905  C CE1 . PHE A 1 112 ? 4.631   25.902 13.326 1.00 25.21 ? 112 PHE A CE1 1 
ATOM   906  C CE2 . PHE A 1 112 ? 6.125   26.970 14.869 1.00 27.74 ? 112 PHE A CE2 1 
ATOM   907  C CZ  . PHE A 1 112 ? 4.948   26.984 14.125 1.00 27.22 ? 112 PHE A CZ  1 
ATOM   908  N N   . ASP A 1 113 ? 7.183   22.503 11.045 1.00 26.87 ? 113 ASP A N   1 
ATOM   909  C CA  . ASP A 1 113 ? 6.391   22.349 9.826  1.00 30.25 ? 113 ASP A CA  1 
ATOM   910  C C   . ASP A 1 113 ? 4.971   22.823 10.118 1.00 28.68 ? 113 ASP A C   1 
ATOM   911  O O   . ASP A 1 113 ? 4.293   22.255 10.970 1.00 27.83 ? 113 ASP A O   1 
ATOM   912  C CB  . ASP A 1 113 ? 6.359   20.884 9.395  1.00 36.31 ? 113 ASP A CB  1 
ATOM   913  C CG  . ASP A 1 113 ? 5.783   20.702 8.002  1.00 41.56 ? 113 ASP A CG  1 
ATOM   914  O OD1 . ASP A 1 113 ? 4.651   21.170 7.760  1.00 40.06 ? 113 ASP A OD1 1 
ATOM   915  O OD2 . ASP A 1 113 ? 6.468   20.090 7.149  1.00 42.00 ? 113 ASP A OD2 1 
ATOM   916  N N   . LYS A 1 114 ? 4.518   23.852 9.410  1.00 29.30 ? 114 LYS A N   1 
ATOM   917  C CA  . LYS A 1 114 ? 3.192   24.407 9.652  1.00 31.33 ? 114 LYS A CA  1 
ATOM   918  C C   . LYS A 1 114 ? 2.046   23.447 9.365  1.00 32.61 ? 114 LYS A C   1 
ATOM   919  O O   . LYS A 1 114 ? 1.004   23.502 10.024 1.00 28.34 ? 114 LYS A O   1 
ATOM   920  C CB  . LYS A 1 114 ? 3.015   25.705 8.859  1.00 33.05 ? 114 LYS A CB  1 
ATOM   921  C CG  . LYS A 1 114 ? 4.017   26.793 9.276  1.00 40.42 ? 114 LYS A CG  1 
ATOM   922  C CD  . LYS A 1 114 ? 3.975   28.012 8.364  1.00 42.50 ? 114 LYS A CD  1 
ATOM   923  C CE  . LYS A 1 114 ? 4.435   27.678 6.943  1.00 47.74 ? 114 LYS A CE  1 
ATOM   924  N NZ  . LYS A 1 114 ? 4.295   28.856 6.035  1.00 46.11 ? 114 LYS A NZ  1 
ATOM   925  N N   . LEU A 1 115 ? 2.217   22.568 8.382  1.00 31.96 ? 115 LEU A N   1 
ATOM   926  C CA  . LEU A 1 115 ? 1.149   21.630 8.096  1.00 32.35 ? 115 LEU A CA  1 
ATOM   927  C C   . LEU A 1 115 ? 1.128   20.544 9.167  1.00 32.58 ? 115 LEU A C   1 
ATOM   928  O O   . LEU A 1 115 ? 0.062   20.029 9.510  1.00 33.25 ? 115 LEU A O   1 
ATOM   929  C CB  . LEU A 1 115 ? 1.302   21.050 6.684  1.00 30.12 ? 115 LEU A CB  1 
ATOM   930  C CG  . LEU A 1 115 ? 1.046   22.117 5.598  1.00 32.96 ? 115 LEU A CG  1 
ATOM   931  C CD1 . LEU A 1 115 ? 1.318   21.548 4.226  1.00 33.44 ? 115 LEU A CD1 1 
ATOM   932  C CD2 . LEU A 1 115 ? -0.386  22.633 5.679  1.00 28.13 ? 115 LEU A CD2 1 
ATOM   933  N N   . GLU A 1 116 ? 2.294   20.215 9.724  1.00 30.43 ? 116 GLU A N   1 
ATOM   934  C CA  . GLU A 1 116 ? 2.343   19.205 10.784 1.00 30.90 ? 116 GLU A CA  1 
ATOM   935  C C   . GLU A 1 116 ? 1.655   19.776 12.031 1.00 28.33 ? 116 GLU A C   1 
ATOM   936  O O   . GLU A 1 116 ? 0.900   19.077 12.695 1.00 28.77 ? 116 GLU A O   1 
ATOM   937  C CB  . GLU A 1 116 ? 3.782   18.818 11.124 1.00 33.55 ? 116 GLU A CB  1 
ATOM   938  C CG  . GLU A 1 116 ? 4.577   18.170 9.994  1.00 38.30 ? 116 GLU A CG  1 
ATOM   939  C CD  . GLU A 1 116 ? 4.056   16.796 9.599  1.00 38.27 ? 116 GLU A CD  1 
ATOM   940  O OE1 . GLU A 1 116 ? 3.403   16.122 10.424 1.00 37.42 ? 116 GLU A OE1 1 
ATOM   941  O OE2 . GLU A 1 116 ? 4.321   16.382 8.453  1.00 44.29 ? 116 GLU A OE2 1 
ATOM   942  N N   . LEU A 1 117 ? 1.908   21.048 12.349 1.00 24.82 ? 117 LEU A N   1 
ATOM   943  C CA  . LEU A 1 117 ? 1.260   21.644 13.517 1.00 26.74 ? 117 LEU A CA  1 
ATOM   944  C C   . LEU A 1 117 ? -0.269  21.711 13.305 1.00 28.29 ? 117 LEU A C   1 
ATOM   945  O O   . LEU A 1 117 ? -1.058  21.390 14.206 1.00 24.81 ? 117 LEU A O   1 
ATOM   946  C CB  . LEU A 1 117 ? 1.819   23.056 13.808 1.00 21.55 ? 117 LEU A CB  1 
ATOM   947  C CG  . LEU A 1 117 ? 1.089   23.736 14.975 1.00 25.94 ? 117 LEU A CG  1 
ATOM   948  C CD1 . LEU A 1 117 ? 1.152   22.844 16.205 1.00 24.15 ? 117 LEU A CD1 1 
ATOM   949  C CD2 . LEU A 1 117 ? 1.701   25.112 15.278 1.00 27.86 ? 117 LEU A CD2 1 
ATOM   950  N N   . LEU A 1 118 ? -0.696  22.122 12.113 1.00 29.09 ? 118 LEU A N   1 
ATOM   951  C CA  . LEU A 1 118 ? -2.122  22.194 11.846 1.00 29.46 ? 118 LEU A CA  1 
ATOM   952  C C   . LEU A 1 118 ? -2.783  20.823 12.055 1.00 27.00 ? 118 LEU A C   1 
ATOM   953  O O   . LEU A 1 118 ? -3.873  20.749 12.641 1.00 26.86 ? 118 LEU A O   1 
ATOM   954  C CB  . LEU A 1 118 ? -2.383  22.725 10.428 1.00 27.99 ? 118 LEU A CB  1 
ATOM   955  C CG  . LEU A 1 118 ? -3.843  22.856 9.958  1.00 31.68 ? 118 LEU A CG  1 
ATOM   956  C CD1 . LEU A 1 118 ? -4.660  23.657 10.965 1.00 21.18 ? 118 LEU A CD1 1 
ATOM   957  C CD2 . LEU A 1 118 ? -3.893  23.534 8.582  1.00 22.14 ? 118 LEU A CD2 1 
ATOM   958  N N   . GLU A 1 119 ? -2.124  19.743 11.613 1.00 25.31 ? 119 GLU A N   1 
ATOM   959  C CA  . GLU A 1 119 ? -2.678  18.389 11.792 1.00 26.10 ? 119 GLU A CA  1 
ATOM   960  C C   . GLU A 1 119 ? -2.830  18.076 13.278 1.00 25.79 ? 119 GLU A C   1 
ATOM   961  O O   . GLU A 1 119 ? -3.891  17.630 13.713 1.00 30.96 ? 119 GLU A O   1 
ATOM   962  C CB  . GLU A 1 119 ? -1.761  17.320 11.194 1.00 28.64 ? 119 GLU A CB  1 
ATOM   963  C CG  . GLU A 1 119 ? -2.401  16.283 10.255 1.00 31.07 ? 119 GLU A CG  1 
ATOM   964  C CD  . GLU A 1 119 ? -3.813  15.804 10.614 1.00 35.04 ? 119 GLU A CD  1 
ATOM   965  O OE1 . GLU A 1 119 ? -3.968  14.859 11.405 1.00 36.96 ? 119 GLU A OE1 1 
ATOM   966  O OE2 . GLU A 1 119 ? -4.791  16.358 10.075 1.00 33.21 ? 119 GLU A OE2 1 
ATOM   967  N N   . CYS A 1 120 ? -1.766  18.294 14.053 1.00 24.45 ? 120 CYS A N   1 
ATOM   968  C CA  . CYS A 1 120 ? -1.811  18.029 15.493 1.00 21.86 ? 120 CYS A CA  1 
ATOM   969  C C   . CYS A 1 120 ? -2.923  18.832 16.127 1.00 23.37 ? 120 CYS A C   1 
ATOM   970  O O   . CYS A 1 120 ? -3.606  18.345 17.033 1.00 25.77 ? 120 CYS A O   1 
ATOM   971  C CB  . CYS A 1 120 ? -0.492  18.400 16.177 1.00 24.03 ? 120 CYS A CB  1 
ATOM   972  S SG  . CYS A 1 120 ? 0.920   17.362 15.780 1.00 28.87 ? 120 CYS A SG  1 
ATOM   973  N N   . ILE A 1 121 ? -3.098  20.072 15.660 1.00 23.89 ? 121 ILE A N   1 
ATOM   974  C CA  . ILE A 1 121 ? -4.152  20.924 16.189 1.00 21.05 ? 121 ILE A CA  1 
ATOM   975  C C   . ILE A 1 121 ? -5.503  20.340 15.812 1.00 22.78 ? 121 ILE A C   1 
ATOM   976  O O   . ILE A 1 121 ? -6.419  20.305 16.631 1.00 22.57 ? 121 ILE A O   1 
ATOM   977  C CB  . ILE A 1 121 ? -4.026  22.379 15.678 1.00 22.47 ? 121 ILE A CB  1 
ATOM   978  C CG1 . ILE A 1 121 ? -2.873  23.079 16.428 1.00 23.13 ? 121 ILE A CG1 1 
ATOM   979  C CG2 . ILE A 1 121 ? -5.328  23.121 15.920 1.00 17.77 ? 121 ILE A CG2 1 
ATOM   980  C CD1 . ILE A 1 121 ? -2.483  24.407 15.881 1.00 21.93 ? 121 ILE A CD1 1 
ATOM   981  N N   . ARG A 1 122 ? -5.612  19.854 14.576 1.00 24.55 ? 122 ARG A N   1 
ATOM   982  C CA  . ARG A 1 122 ? -6.854  19.252 14.113 1.00 27.07 ? 122 ARG A CA  1 
ATOM   983  C C   . ARG A 1 122 ? -7.168  18.032 15.013 1.00 29.42 ? 122 ARG A C   1 
ATOM   984  O O   . ARG A 1 122 ? -8.312  17.847 15.444 1.00 27.21 ? 122 ARG A O   1 
ATOM   985  C CB  . ARG A 1 122 ? -6.714  18.802 12.648 1.00 26.85 ? 122 ARG A CB  1 
ATOM   986  C CG  . ARG A 1 122 ? -8.012  18.260 12.066 1.00 30.38 ? 122 ARG A CG  1 
ATOM   987  C CD  . ARG A 1 122 ? -7.797  17.549 10.709 1.00 31.63 ? 122 ARG A CD  1 
ATOM   988  N NE  . ARG A 1 122 ? -8.035  16.113 10.820 1.00 36.03 ? 122 ARG A NE  1 
ATOM   989  C CZ  . ARG A 1 122 ? -7.452  15.324 11.715 1.00 43.63 ? 122 ARG A CZ  1 
ATOM   990  N NH1 . ARG A 1 122 ? -6.590  15.831 12.586 1.00 56.74 ? 122 ARG A NH1 1 
ATOM   991  N NH2 . ARG A 1 122 ? -7.721  14.030 11.745 1.00 48.08 ? 122 ARG A NH2 1 
ATOM   992  N N   . ARG A 1 123 ? -6.146  17.225 15.306 1.00 28.73 ? 123 ARG A N   1 
ATOM   993  C CA  . ARG A 1 123 ? -6.321  16.039 16.148 1.00 29.62 ? 123 ARG A CA  1 
ATOM   994  C C   . ARG A 1 123 ? -6.747  16.428 17.557 1.00 26.41 ? 123 ARG A C   1 
ATOM   995  O O   . ARG A 1 123 ? -7.565  15.760 18.170 1.00 27.12 ? 123 ARG A O   1 
ATOM   996  C CB  . ARG A 1 123 ? -5.024  15.223 16.205 1.00 30.52 ? 123 ARG A CB  1 
ATOM   997  C CG  . ARG A 1 123 ? -4.542  14.795 14.831 1.00 38.59 ? 123 ARG A CG  1 
ATOM   998  C CD  . ARG A 1 123 ? -5.264  13.546 14.357 1.00 35.44 ? 123 ARG A CD  1 
ATOM   999  N NE  . ARG A 1 123 ? -4.783  12.369 15.075 1.00 46.50 ? 123 ARG A NE  1 
ATOM   1000 C CZ  . ARG A 1 123 ? -5.334  11.882 16.181 1.00 44.55 ? 123 ARG A CZ  1 
ATOM   1001 N NH1 . ARG A 1 123 ? -6.413  12.461 16.710 1.00 45.84 ? 123 ARG A NH1 1 
ATOM   1002 N NH2 . ARG A 1 123 ? -4.782  10.828 16.772 1.00 45.06 ? 123 ARG A NH2 1 
ATOM   1003 N N   . LEU A 1 124 ? -6.188  17.511 18.078 1.00 27.38 ? 124 LEU A N   1 
ATOM   1004 C CA  . LEU A 1 124 ? -6.562  17.986 19.419 1.00 24.40 ? 124 LEU A CA  1 
ATOM   1005 C C   . LEU A 1 124 ? -8.026  18.455 19.445 1.00 22.95 ? 124 LEU A C   1 
ATOM   1006 O O   . LEU A 1 124 ? -8.786  18.163 20.392 1.00 24.33 ? 124 LEU A O   1 
ATOM   1007 C CB  . LEU A 1 124 ? -5.640  19.147 19.835 1.00 21.87 ? 124 LEU A CB  1 
ATOM   1008 C CG  . LEU A 1 124 ? -5.916  19.886 21.149 1.00 20.69 ? 124 LEU A CG  1 
ATOM   1009 C CD1 . LEU A 1 124 ? -5.806  18.951 22.362 1.00 20.63 ? 124 LEU A CD1 1 
ATOM   1010 C CD2 . LEU A 1 124 ? -4.900  21.008 21.275 1.00 28.28 ? 124 LEU A CD2 1 
ATOM   1011 N N   . ILE A 1 125 ? -8.422  19.199 18.419 1.00 19.53 ? 125 ILE A N   1 
ATOM   1012 C CA  . ILE A 1 125 ? -9.789  19.665 18.376 1.00 24.88 ? 125 ILE A CA  1 
ATOM   1013 C C   . ILE A 1 125 ? -10.733 18.467 18.230 1.00 25.15 ? 125 ILE A C   1 
ATOM   1014 O O   . ILE A 1 125 ? -11.802 18.438 18.833 1.00 25.30 ? 125 ILE A O   1 
ATOM   1015 C CB  . ILE A 1 125 ? -10.022 20.697 17.250 1.00 27.72 ? 125 ILE A CB  1 
ATOM   1016 C CG1 . ILE A 1 125 ? -9.086  21.900 17.460 1.00 29.75 ? 125 ILE A CG1 1 
ATOM   1017 C CG2 . ILE A 1 125 ? -11.503 21.127 17.261 1.00 22.24 ? 125 ILE A CG2 1 
ATOM   1018 C CD1 . ILE A 1 125 ? -9.333  23.111 16.560 1.00 23.12 ? 125 ILE A CD1 1 
ATOM   1019 N N   . GLU A 1 126 ? -10.311 17.460 17.478 1.00 30.70 ? 126 GLU A N   1 
ATOM   1020 C CA  . GLU A 1 126 ? -11.129 16.268 17.310 1.00 30.23 ? 126 GLU A CA  1 
ATOM   1021 C C   . GLU A 1 126 ? -11.376 15.668 18.696 1.00 32.47 ? 126 GLU A C   1 
ATOM   1022 O O   . GLU A 1 126 ? -12.519 15.441 19.107 1.00 33.23 ? 126 GLU A O   1 
ATOM   1023 C CB  . GLU A 1 126 ? -10.399 15.262 16.418 1.00 32.91 ? 126 GLU A CB  1 
ATOM   1024 C CG  . GLU A 1 126 ? -11.261 14.115 15.909 1.00 37.88 ? 126 GLU A CG  1 
ATOM   1025 C CD  . GLU A 1 126 ? -10.686 13.512 14.643 1.00 40.69 ? 126 GLU A CD  1 
ATOM   1026 O OE1 . GLU A 1 126 ? -9.600  12.901 14.711 1.00 42.25 ? 126 GLU A OE1 1 
ATOM   1027 O OE2 . GLU A 1 126 ? -11.314 13.664 13.572 1.00 46.07 ? 126 GLU A OE2 1 
ATOM   1028 N N   . VAL A 1 127 ? -10.299 15.451 19.438 1.00 32.42 ? 127 VAL A N   1 
ATOM   1029 C CA  . VAL A 1 127 ? -10.414 14.878 20.773 1.00 29.52 ? 127 VAL A CA  1 
ATOM   1030 C C   . VAL A 1 127 ? -11.373 15.663 21.684 1.00 28.28 ? 127 VAL A C   1 
ATOM   1031 O O   . VAL A 1 127 ? -12.187 15.073 22.380 1.00 25.10 ? 127 VAL A O   1 
ATOM   1032 C CB  . VAL A 1 127 ? -9.016  14.782 21.434 1.00 28.72 ? 127 VAL A CB  1 
ATOM   1033 C CG1 . VAL A 1 127 ? -9.151  14.354 22.881 1.00 28.87 ? 127 VAL A CG1 1 
ATOM   1034 C CG2 . VAL A 1 127 ? -8.158  13.796 20.663 1.00 29.35 ? 127 VAL A CG2 1 
ATOM   1035 N N   . ASP A 1 128 ? -11.287 16.991 21.678 1.00 29.41 ? 128 ASP A N   1 
ATOM   1036 C CA  . ASP A 1 128 ? -12.180 17.796 22.509 1.00 32.94 ? 128 ASP A CA  1 
ATOM   1037 C C   . ASP A 1 128 ? -13.381 18.392 21.752 1.00 32.69 ? 128 ASP A C   1 
ATOM   1038 O O   . ASP A 1 128 ? -13.974 19.374 22.198 1.00 34.30 ? 128 ASP A O   1 
ATOM   1039 C CB  . ASP A 1 128 ? -11.392 18.929 23.189 1.00 32.27 ? 128 ASP A CB  1 
ATOM   1040 C CG  . ASP A 1 128 ? -10.561 18.436 24.382 1.00 39.27 ? 128 ASP A CG  1 
ATOM   1041 O OD1 . ASP A 1 128 ? -10.867 17.333 24.892 1.00 34.10 ? 128 ASP A OD1 1 
ATOM   1042 O OD2 . ASP A 1 128 ? -9.616  19.146 24.818 1.00 28.21 ? 128 ASP A OD2 1 
ATOM   1043 N N   . LYS A 1 129 ? -13.759 17.790 20.628 1.00 34.98 ? 129 LYS A N   1 
ATOM   1044 C CA  . LYS A 1 129 ? -14.877 18.298 19.820 1.00 37.28 ? 129 LYS A CA  1 
ATOM   1045 C C   . LYS A 1 129 ? -16.159 18.593 20.594 1.00 38.22 ? 129 LYS A C   1 
ATOM   1046 O O   . LYS A 1 129 ? -16.894 19.521 20.259 1.00 37.49 ? 129 LYS A O   1 
ATOM   1047 C CB  . LYS A 1 129 ? -15.204 17.323 18.690 1.00 41.61 ? 129 LYS A CB  1 
ATOM   1048 C CG  . LYS A 1 129 ? -15.670 15.937 19.150 1.00 45.81 ? 129 LYS A CG  1 
ATOM   1049 C CD  . LYS A 1 129 ? -16.014 15.089 17.934 1.00 50.87 ? 129 LYS A CD  1 
ATOM   1050 C CE  . LYS A 1 129 ? -16.103 13.606 18.250 1.00 47.82 ? 129 LYS A CE  1 
ATOM   1051 N NZ  . LYS A 1 129 ? -15.798 12.824 17.006 1.00 45.34 ? 129 LYS A NZ  1 
ATOM   1052 N N   . ASP A 1 130 ? -16.434 17.811 21.629 1.00 36.66 ? 130 ASP A N   1 
ATOM   1053 C CA  . ASP A 1 130 ? -17.630 18.028 22.416 1.00 38.90 ? 130 ASP A CA  1 
ATOM   1054 C C   . ASP A 1 130 ? -17.612 19.342 23.162 1.00 36.22 ? 130 ASP A C   1 
ATOM   1055 O O   . ASP A 1 130 ? -18.616 19.734 23.756 1.00 38.52 ? 130 ASP A O   1 
ATOM   1056 C CB  . ASP A 1 130 ? -17.841 16.880 23.398 1.00 44.44 ? 130 ASP A CB  1 
ATOM   1057 C CG  . ASP A 1 130 ? -18.343 15.630 22.710 1.00 55.70 ? 130 ASP A CG  1 
ATOM   1058 O OD1 . ASP A 1 130 ? -19.340 15.746 21.955 1.00 60.81 ? 130 ASP A OD1 1 
ATOM   1059 O OD2 . ASP A 1 130 ? -17.749 14.543 22.912 1.00 60.03 ? 130 ASP A OD2 1 
ATOM   1060 N N   . TRP A 1 131 ? -16.481 20.032 23.141 1.00 32.63 ? 131 TRP A N   1 
ATOM   1061 C CA  . TRP A 1 131 ? -16.414 21.318 23.830 1.00 29.57 ? 131 TRP A CA  1 
ATOM   1062 C C   . TRP A 1 131 ? -16.766 22.465 22.884 1.00 26.41 ? 131 TRP A C   1 
ATOM   1063 O O   . TRP A 1 131 ? -16.933 23.602 23.321 1.00 30.07 ? 131 TRP A O   1 
ATOM   1064 C CB  . TRP A 1 131 ? -15.008 21.557 24.399 1.00 26.84 ? 131 TRP A CB  1 
ATOM   1065 C CG  . TRP A 1 131 ? -14.659 20.745 25.597 1.00 26.34 ? 131 TRP A CG  1 
ATOM   1066 C CD1 . TRP A 1 131 ? -14.155 19.476 25.618 1.00 24.14 ? 131 TRP A CD1 1 
ATOM   1067 C CD2 . TRP A 1 131 ? -14.771 21.160 26.963 1.00 25.26 ? 131 TRP A CD2 1 
ATOM   1068 N NE1 . TRP A 1 131 ? -13.943 19.078 26.924 1.00 27.34 ? 131 TRP A NE1 1 
ATOM   1069 C CE2 . TRP A 1 131 ? -14.320 20.092 27.765 1.00 20.85 ? 131 TRP A CE2 1 
ATOM   1070 C CE3 . TRP A 1 131 ? -15.210 22.338 27.586 1.00 20.04 ? 131 TRP A CE3 1 
ATOM   1071 C CZ2 . TRP A 1 131 ? -14.297 20.162 29.157 1.00 21.33 ? 131 TRP A CZ2 1 
ATOM   1072 C CZ3 . TRP A 1 131 ? -15.185 22.409 28.974 1.00 24.06 ? 131 TRP A CZ3 1 
ATOM   1073 C CH2 . TRP A 1 131 ? -14.733 21.326 29.742 1.00 22.35 ? 131 TRP A CH2 1 
ATOM   1074 N N   . VAL A 1 132 ? -16.881 22.162 21.594 1.00 26.38 ? 132 VAL A N   1 
ATOM   1075 C CA  . VAL A 1 132 ? -17.183 23.174 20.594 1.00 28.83 ? 132 VAL A CA  1 
ATOM   1076 C C   . VAL A 1 132 ? -18.654 23.501 20.604 1.00 30.35 ? 132 VAL A C   1 
ATOM   1077 O O   . VAL A 1 132 ? -19.473 22.712 20.144 1.00 32.37 ? 132 VAL A O   1 
ATOM   1078 C CB  . VAL A 1 132 ? -16.798 22.713 19.166 1.00 27.13 ? 132 VAL A CB  1 
ATOM   1079 C CG1 . VAL A 1 132 ? -16.914 23.890 18.175 1.00 25.87 ? 132 VAL A CG1 1 
ATOM   1080 C CG2 . VAL A 1 132 ? -15.398 22.162 19.156 1.00 28.48 ? 132 VAL A CG2 1 
ATOM   1081 N N   . PRO A 1 133 ? -19.010 24.689 21.114 1.00 31.56 ? 133 PRO A N   1 
ATOM   1082 C CA  . PRO A 1 133 ? -20.403 25.132 21.183 1.00 29.27 ? 133 PRO A CA  1 
ATOM   1083 C C   . PRO A 1 133 ? -20.989 25.336 19.784 1.00 32.53 ? 133 PRO A C   1 
ATOM   1084 O O   . PRO A 1 133 ? -20.257 25.369 18.797 1.00 29.62 ? 133 PRO A O   1 
ATOM   1085 C CB  . PRO A 1 133 ? -20.299 26.434 21.969 1.00 30.68 ? 133 PRO A CB  1 
ATOM   1086 C CG  . PRO A 1 133 ? -18.982 26.991 21.478 1.00 31.12 ? 133 PRO A CG  1 
ATOM   1087 C CD  . PRO A 1 133 ? -18.090 25.778 21.495 1.00 30.46 ? 133 PRO A CD  1 
ATOM   1088 N N   . ASP A 1 134 ? -22.310 25.456 19.688 1.00 36.95 ? 134 ASP A N   1 
ATOM   1089 C CA  . ASP A 1 134 ? -22.924 25.672 18.382 1.00 39.44 ? 134 ASP A CA  1 
ATOM   1090 C C   . ASP A 1 134 ? -23.993 26.746 18.419 1.00 39.10 ? 134 ASP A C   1 
ATOM   1091 O O   . ASP A 1 134 ? -24.578 27.072 17.394 1.00 41.57 ? 134 ASP A O   1 
ATOM   1092 C CB  . ASP A 1 134 ? -23.515 24.377 17.828 1.00 41.63 ? 134 ASP A CB  1 
ATOM   1093 C CG  . ASP A 1 134 ? -24.475 23.725 18.782 1.00 46.35 ? 134 ASP A CG  1 
ATOM   1094 O OD1 . ASP A 1 134 ? -25.266 24.454 19.418 1.00 49.33 ? 134 ASP A OD1 1 
ATOM   1095 O OD2 . ASP A 1 134 ? -24.443 22.480 18.883 1.00 49.32 ? 134 ASP A OD2 1 
ATOM   1096 N N   . ALA A 1 135 ? -24.253 27.285 19.604 1.00 36.83 ? 135 ALA A N   1 
ATOM   1097 C CA  . ALA A 1 135 ? -25.238 28.341 19.734 1.00 37.41 ? 135 ALA A CA  1 
ATOM   1098 C C   . ALA A 1 135 ? -24.751 29.441 18.819 1.00 38.95 ? 135 ALA A C   1 
ATOM   1099 O O   . ALA A 1 135 ? -23.541 29.582 18.590 1.00 35.84 ? 135 ALA A O   1 
ATOM   1100 C CB  . ALA A 1 135 ? -25.302 28.850 21.157 1.00 33.18 ? 135 ALA A CB  1 
ATOM   1101 N N   . ALA A 1 136 ? -25.686 30.216 18.290 1.00 38.62 ? 136 ALA A N   1 
ATOM   1102 C CA  . ALA A 1 136 ? -25.326 31.303 17.401 1.00 38.79 ? 136 ALA A CA  1 
ATOM   1103 C C   . ALA A 1 136 ? -24.259 32.176 18.061 1.00 40.11 ? 136 ALA A C   1 
ATOM   1104 O O   . ALA A 1 136 ? -24.342 32.489 19.246 1.00 36.80 ? 136 ALA A O   1 
ATOM   1105 C CB  . ALA A 1 136 ? -26.558 32.130 17.069 1.00 42.28 ? 136 ALA A CB  1 
ATOM   1106 N N   . GLY A 1 137 ? -23.237 32.534 17.289 1.00 42.43 ? 137 GLY A N   1 
ATOM   1107 C CA  . GLY A 1 137 ? -22.173 33.386 17.797 1.00 38.68 ? 137 GLY A CA  1 
ATOM   1108 C C   . GLY A 1 137 ? -21.134 32.719 18.677 1.00 38.50 ? 137 GLY A C   1 
ATOM   1109 O O   . GLY A 1 137 ? -20.204 33.374 19.125 1.00 37.37 ? 137 GLY A O   1 
ATOM   1110 N N   . THR A 1 138 ? -21.272 31.425 18.934 1.00 37.77 ? 138 THR A N   1 
ATOM   1111 C CA  . THR A 1 138 ? -20.298 30.736 19.780 1.00 34.39 ? 138 THR A CA  1 
ATOM   1112 C C   . THR A 1 138 ? -19.255 30.041 18.917 1.00 29.07 ? 138 THR A C   1 
ATOM   1113 O O   . THR A 1 138 ? -19.460 29.837 17.717 1.00 35.01 ? 138 THR A O   1 
ATOM   1114 C CB  . THR A 1 138 ? -20.989 29.694 20.710 1.00 32.12 ? 138 THR A CB  1 
ATOM   1115 O OG1 . THR A 1 138 ? -21.433 28.568 19.946 1.00 27.38 ? 138 THR A OG1 1 
ATOM   1116 C CG2 . THR A 1 138 ? -22.178 30.324 21.402 1.00 37.07 ? 138 THR A CG2 1 
ATOM   1117 N N   . SER A 1 139 ? -18.130 29.686 19.525 1.00 29.41 ? 139 SER A N   1 
ATOM   1118 C CA  . SER A 1 139 ? -17.054 29.011 18.808 1.00 24.13 ? 139 SER A CA  1 
ATOM   1119 C C   . SER A 1 139 ? -15.992 28.529 19.788 1.00 28.96 ? 139 SER A C   1 
ATOM   1120 O O   . SER A 1 139 ? -16.090 28.771 21.002 1.00 27.37 ? 139 SER A O   1 
ATOM   1121 C CB  . SER A 1 139 ? -16.398 29.974 17.829 1.00 33.24 ? 139 SER A CB  1 
ATOM   1122 O OG  . SER A 1 139 ? -15.723 31.015 18.530 1.00 32.78 ? 139 SER A OG  1 
ATOM   1123 N N   . LEU A 1 140 ? -14.976 27.848 19.256 1.00 27.20 ? 140 LEU A N   1 
ATOM   1124 C CA  . LEU A 1 140 ? -13.881 27.365 20.084 1.00 26.83 ? 140 LEU A CA  1 
ATOM   1125 C C   . LEU A 1 140 ? -12.652 28.197 19.768 1.00 25.02 ? 140 LEU A C   1 
ATOM   1126 O O   . LEU A 1 140 ? -12.286 28.328 18.603 1.00 25.57 ? 140 LEU A O   1 
ATOM   1127 C CB  . LEU A 1 140 ? -13.572 25.904 19.788 1.00 25.75 ? 140 LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 140 ? -12.557 25.298 20.757 1.00 29.05 ? 140 LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 140 ? -13.288 24.984 22.063 1.00 24.31 ? 140 LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 140 ? -11.918 24.055 20.162 1.00 31.73 ? 140 LEU A CD2 1 
ATOM   1131 N N   . TYR A 1 141 ? -12.021 28.757 20.802 1.00 26.15 ? 141 TYR A N   1 
ATOM   1132 C CA  . TYR A 1 141 ? -10.810 29.572 20.621 1.00 25.92 ? 141 TYR A CA  1 
ATOM   1133 C C   . TYR A 1 141 ? -9.600  28.674 20.816 1.00 23.38 ? 141 TYR A C   1 
ATOM   1134 O O   . TYR A 1 141 ? -9.485  27.966 21.829 1.00 26.49 ? 141 TYR A O   1 
ATOM   1135 C CB  . TYR A 1 141 ? -10.776 30.725 21.645 1.00 23.86 ? 141 TYR A CB  1 
ATOM   1136 C CG  . TYR A 1 141 ? -9.654  31.725 21.434 1.00 25.03 ? 141 TYR A CG  1 
ATOM   1137 C CD1 . TYR A 1 141 ? -9.697  32.644 20.383 1.00 26.66 ? 141 TYR A CD1 1 
ATOM   1138 C CD2 . TYR A 1 141 ? -8.539  31.743 22.285 1.00 20.82 ? 141 TYR A CD2 1 
ATOM   1139 C CE1 . TYR A 1 141 ? -8.650  33.564 20.173 1.00 19.60 ? 141 TYR A CE1 1 
ATOM   1140 C CE2 . TYR A 1 141 ? -7.498  32.651 22.096 1.00 20.44 ? 141 TYR A CE2 1 
ATOM   1141 C CZ  . TYR A 1 141 ? -7.558  33.557 21.037 1.00 27.40 ? 141 TYR A CZ  1 
ATOM   1142 O OH  . TYR A 1 141 ? -6.524  34.436 20.856 1.00 23.53 ? 141 TYR A OH  1 
ATOM   1143 N N   . VAL A 1 142 ? -8.701  28.709 19.847 1.00 24.41 ? 142 VAL A N   1 
ATOM   1144 C CA  . VAL A 1 142 ? -7.485  27.896 19.872 1.00 22.15 ? 142 VAL A CA  1 
ATOM   1145 C C   . VAL A 1 142 ? -6.308  28.800 20.201 1.00 25.18 ? 142 VAL A C   1 
ATOM   1146 O O   . VAL A 1 142 ? -6.101  29.814 19.527 1.00 23.43 ? 142 VAL A O   1 
ATOM   1147 C CB  . VAL A 1 142 ? -7.262  27.256 18.512 1.00 21.80 ? 142 VAL A CB  1 
ATOM   1148 C CG1 . VAL A 1 142 ? -6.017  26.390 18.535 1.00 28.99 ? 142 VAL A CG1 1 
ATOM   1149 C CG2 . VAL A 1 142 ? -8.501  26.444 18.122 1.00 21.51 ? 142 VAL A CG2 1 
ATOM   1150 N N   . ARG A 1 143 ? -5.522  28.421 21.205 1.00 17.39 ? 143 ARG A N   1 
ATOM   1151 C CA  . ARG A 1 143 ? -4.388  29.230 21.642 1.00 21.42 ? 143 ARG A CA  1 
ATOM   1152 C C   . ARG A 1 143 ? -3.059  28.494 21.637 1.00 22.62 ? 143 ARG A C   1 
ATOM   1153 O O   . ARG A 1 143 ? -2.679  27.882 22.632 1.00 20.02 ? 143 ARG A O   1 
ATOM   1154 C CB  . ARG A 1 143 ? -4.662  29.777 23.048 1.00 19.10 ? 143 ARG A CB  1 
ATOM   1155 C CG  . ARG A 1 143 ? -3.444  30.416 23.778 1.00 20.36 ? 143 ARG A CG  1 
ATOM   1156 C CD  . ARG A 1 143 ? -2.819  31.569 22.987 1.00 18.96 ? 143 ARG A CD  1 
ATOM   1157 N NE  . ARG A 1 143 ? -3.733  32.682 22.708 1.00 21.78 ? 143 ARG A NE  1 
ATOM   1158 C CZ  . ARG A 1 143 ? -3.891  33.757 23.480 1.00 19.22 ? 143 ARG A CZ  1 
ATOM   1159 N NH1 . ARG A 1 143 ? -3.203  33.888 24.602 1.00 18.52 ? 143 ARG A NH1 1 
ATOM   1160 N NH2 . ARG A 1 143 ? -4.736  34.716 23.116 1.00 24.74 ? 143 ARG A NH2 1 
ATOM   1161 N N   . PRO A 1 144 ? -2.353  28.522 20.493 1.00 17.91 ? 144 PRO A N   1 
ATOM   1162 C CA  . PRO A 1 144 ? -1.051  27.875 20.335 1.00 17.56 ? 144 PRO A CA  1 
ATOM   1163 C C   . PRO A 1 144 ? -0.064  28.830 21.019 1.00 22.95 ? 144 PRO A C   1 
ATOM   1164 O O   . PRO A 1 144 ? -0.308  30.034 21.076 1.00 22.98 ? 144 PRO A O   1 
ATOM   1165 C CB  . PRO A 1 144 ? -0.842  27.868 18.821 1.00 21.05 ? 144 PRO A CB  1 
ATOM   1166 C CG  . PRO A 1 144 ? -2.201  28.010 18.266 1.00 21.87 ? 144 PRO A CG  1 
ATOM   1167 C CD  . PRO A 1 144 ? -2.863  28.983 19.191 1.00 17.28 ? 144 PRO A CD  1 
ATOM   1168 N N   . VAL A 1 145 ? 1.035   28.293 21.523 1.00 23.15 ? 145 VAL A N   1 
ATOM   1169 C CA  . VAL A 1 145 ? 2.052   29.076 22.211 1.00 21.84 ? 145 VAL A CA  1 
ATOM   1170 C C   . VAL A 1 145 ? 3.417   28.429 22.024 1.00 22.34 ? 145 VAL A C   1 
ATOM   1171 O O   . VAL A 1 145 ? 3.551   27.208 22.081 1.00 24.59 ? 145 VAL A O   1 
ATOM   1172 C CB  . VAL A 1 145 ? 1.774   29.120 23.738 1.00 24.01 ? 145 VAL A CB  1 
ATOM   1173 C CG1 . VAL A 1 145 ? 2.835   29.945 24.447 1.00 26.25 ? 145 VAL A CG1 1 
ATOM   1174 C CG2 . VAL A 1 145 ? 0.397   29.701 24.011 1.00 23.52 ? 145 VAL A CG2 1 
ATOM   1175 N N   . LEU A 1 146 ? 4.439   29.245 21.811 1.00 19.01 ? 146 LEU A N   1 
ATOM   1176 C CA  . LEU A 1 146 ? 5.793   28.732 21.685 1.00 20.58 ? 146 LEU A CA  1 
ATOM   1177 C C   . LEU A 1 146 ? 6.657   29.576 22.615 1.00 22.18 ? 146 LEU A C   1 
ATOM   1178 O O   . LEU A 1 146 ? 6.650   30.821 22.531 1.00 23.41 ? 146 LEU A O   1 
ATOM   1179 C CB  . LEU A 1 146 ? 6.298   28.849 20.241 1.00 21.93 ? 146 LEU A CB  1 
ATOM   1180 C CG  . LEU A 1 146 ? 7.716   28.345 19.927 1.00 23.31 ? 146 LEU A CG  1 
ATOM   1181 C CD1 . LEU A 1 146 ? 7.890   26.910 20.407 1.00 23.52 ? 146 LEU A CD1 1 
ATOM   1182 C CD2 . LEU A 1 146 ? 7.967   28.444 18.414 1.00 19.39 ? 146 LEU A CD2 1 
ATOM   1183 N N   . ILE A 1 147 ? 7.365   28.916 23.530 1.00 22.99 ? 147 ILE A N   1 
ATOM   1184 C CA  . ILE A 1 147 ? 8.228   29.644 24.455 1.00 23.49 ? 147 ILE A CA  1 
ATOM   1185 C C   . ILE A 1 147 ? 9.631   29.083 24.541 1.00 25.19 ? 147 ILE A C   1 
ATOM   1186 O O   . ILE A 1 147 ? 9.844   27.882 24.379 1.00 23.55 ? 147 ILE A O   1 
ATOM   1187 C CB  . ILE A 1 147 ? 7.669   29.657 25.897 1.00 20.95 ? 147 ILE A CB  1 
ATOM   1188 C CG1 . ILE A 1 147 ? 7.587   28.225 26.435 1.00 30.09 ? 147 ILE A CG1 1 
ATOM   1189 C CG2 . ILE A 1 147 ? 6.337   30.320 25.932 1.00 20.36 ? 147 ILE A CG2 1 
ATOM   1190 C CD1 . ILE A 1 147 ? 7.098   28.153 27.869 1.00 30.14 ? 147 ILE A CD1 1 
ATOM   1191 N N   . GLY A 1 148 ? 10.591  29.973 24.782 1.00 24.54 ? 148 GLY A N   1 
ATOM   1192 C CA  . GLY A 1 148 ? 11.964  29.547 24.953 1.00 23.16 ? 148 GLY A CA  1 
ATOM   1193 C C   . GLY A 1 148 ? 11.951  28.921 26.328 1.00 24.53 ? 148 GLY A C   1 
ATOM   1194 O O   . GLY A 1 148 ? 11.131  29.288 27.168 1.00 27.63 ? 148 GLY A O   1 
ATOM   1195 N N   . ASN A 1 149 ? 12.840  27.977 26.581 1.00 22.24 ? 149 ASN A N   1 
ATOM   1196 C CA  . ASN A 1 149 ? 12.837  27.328 27.859 1.00 26.04 ? 149 ASN A CA  1 
ATOM   1197 C C   . ASN A 1 149 ? 14.242  26.945 28.294 1.00 29.15 ? 149 ASN A C   1 
ATOM   1198 O O   . ASN A 1 149 ? 14.482  25.833 28.739 1.00 31.55 ? 149 ASN A O   1 
ATOM   1199 C CB  . ASN A 1 149 ? 11.947  26.104 27.769 1.00 28.32 ? 149 ASN A CB  1 
ATOM   1200 C CG  . ASN A 1 149 ? 11.518  25.605 29.105 1.00 29.74 ? 149 ASN A CG  1 
ATOM   1201 O OD1 . ASN A 1 149 ? 11.469  26.357 30.072 1.00 32.66 ? 149 ASN A OD1 1 
ATOM   1202 N ND2 . ASN A 1 149 ? 11.172  24.332 29.170 1.00 26.14 ? 149 ASN A ND2 1 
ATOM   1203 N N   . GLU A 1 150 ? 15.160  27.890 28.162 1.00 33.17 ? 150 GLU A N   1 
ATOM   1204 C CA  . GLU A 1 150 ? 16.555  27.698 28.544 1.00 32.89 ? 150 GLU A CA  1 
ATOM   1205 C C   . GLU A 1 150 ? 16.761  27.965 30.031 1.00 32.13 ? 150 GLU A C   1 
ATOM   1206 O O   . GLU A 1 150 ? 16.341  28.985 30.538 1.00 34.52 ? 150 GLU A O   1 
ATOM   1207 C CB  . GLU A 1 150 ? 17.415  28.668 27.762 1.00 35.77 ? 150 GLU A CB  1 
ATOM   1208 C CG  . GLU A 1 150 ? 17.915  28.123 26.483 1.00 43.12 ? 150 GLU A CG  1 
ATOM   1209 C CD  . GLU A 1 150 ? 19.331  27.660 26.601 1.00 39.89 ? 150 GLU A CD  1 
ATOM   1210 O OE1 . GLU A 1 150 ? 19.601  26.860 27.518 1.00 39.61 ? 150 GLU A OE1 1 
ATOM   1211 O OE2 . GLU A 1 150 ? 20.162  28.101 25.776 1.00 40.31 ? 150 GLU A OE2 1 
ATOM   1212 N N   . PRO A 1 151 ? 17.434  27.054 30.743 1.00 36.40 ? 151 PRO A N   1 
ATOM   1213 C CA  . PRO A 1 151 ? 17.698  27.206 32.178 1.00 33.44 ? 151 PRO A CA  1 
ATOM   1214 C C   . PRO A 1 151 ? 18.946  28.071 32.315 1.00 34.25 ? 151 PRO A C   1 
ATOM   1215 O O   . PRO A 1 151 ? 19.939  27.638 32.894 1.00 36.03 ? 151 PRO A O   1 
ATOM   1216 C CB  . PRO A 1 151 ? 17.982  25.767 32.640 1.00 33.36 ? 151 PRO A CB  1 
ATOM   1217 C CG  . PRO A 1 151 ? 17.484  24.906 31.526 1.00 37.05 ? 151 PRO A CG  1 
ATOM   1218 C CD  . PRO A 1 151 ? 17.808  25.708 30.299 1.00 38.14 ? 151 PRO A CD  1 
ATOM   1219 N N   . SER A 1 152 ? 18.901  29.285 31.770 1.00 28.24 ? 152 SER A N   1 
ATOM   1220 C CA  . SER A 1 152 ? 20.064  30.163 31.791 1.00 33.13 ? 152 SER A CA  1 
ATOM   1221 C C   . SER A 1 152 ? 19.692  31.649 31.732 1.00 32.38 ? 152 SER A C   1 
ATOM   1222 O O   . SER A 1 152 ? 18.807  32.042 30.972 1.00 34.62 ? 152 SER A O   1 
ATOM   1223 C CB  . SER A 1 152 ? 20.973  29.807 30.613 1.00 31.37 ? 152 SER A CB  1 
ATOM   1224 O OG  . SER A 1 152 ? 21.740  30.926 30.208 1.00 40.12 ? 152 SER A OG  1 
ATOM   1225 N N   . LEU A 1 153 ? 20.370  32.464 32.536 1.00 31.24 ? 153 LEU A N   1 
ATOM   1226 C CA  . LEU A 1 153 ? 20.103  33.892 32.596 1.00 30.66 ? 153 LEU A CA  1 
ATOM   1227 C C   . LEU A 1 153 ? 20.778  34.658 31.464 1.00 28.96 ? 153 LEU A C   1 
ATOM   1228 O O   . LEU A 1 153 ? 20.684  35.882 31.387 1.00 30.27 ? 153 LEU A O   1 
ATOM   1229 C CB  . LEU A 1 153 ? 20.551  34.453 33.948 1.00 31.08 ? 153 LEU A CB  1 
ATOM   1230 C CG  . LEU A 1 153 ? 19.864  33.816 35.157 1.00 29.05 ? 153 LEU A CG  1 
ATOM   1231 C CD1 . LEU A 1 153 ? 20.227  34.590 36.421 1.00 25.34 ? 153 LEU A CD1 1 
ATOM   1232 C CD2 . LEU A 1 153 ? 18.355  33.819 34.936 1.00 27.11 ? 153 LEU A CD2 1 
ATOM   1233 N N   . GLY A 1 154 ? 21.469  33.945 30.587 1.00 28.08 ? 154 GLY A N   1 
ATOM   1234 C CA  . GLY A 1 154 ? 22.105  34.621 29.474 1.00 26.65 ? 154 GLY A CA  1 
ATOM   1235 C C   . GLY A 1 154 ? 21.026  35.035 28.478 1.00 31.52 ? 154 GLY A C   1 
ATOM   1236 O O   . GLY A 1 154 ? 20.107  34.267 28.214 1.00 34.55 ? 154 GLY A O   1 
ATOM   1237 N N   . VAL A 1 155 ? 21.095  36.252 27.948 1.00 29.18 ? 155 VAL A N   1 
ATOM   1238 C CA  . VAL A 1 155 ? 20.099  36.675 26.978 1.00 27.38 ? 155 VAL A CA  1 
ATOM   1239 C C   . VAL A 1 155 ? 20.585  36.083 25.659 1.00 30.89 ? 155 VAL A C   1 
ATOM   1240 O O   . VAL A 1 155 ? 21.503  36.612 25.038 1.00 35.62 ? 155 VAL A O   1 
ATOM   1241 C CB  . VAL A 1 155 ? 20.046  38.217 26.877 1.00 32.50 ? 155 VAL A CB  1 
ATOM   1242 C CG1 . VAL A 1 155 ? 19.199  38.649 25.667 1.00 22.73 ? 155 VAL A CG1 1 
ATOM   1243 C CG2 . VAL A 1 155 ? 19.477  38.802 28.183 1.00 27.37 ? 155 VAL A CG2 1 
ATOM   1244 N N   . SER A 1 156 ? 19.991  34.983 25.220 1.00 28.02 ? 156 SER A N   1 
ATOM   1245 C CA  . SER A 1 156 ? 20.470  34.379 23.985 1.00 29.04 ? 156 SER A CA  1 
ATOM   1246 C C   . SER A 1 156 ? 19.501  33.371 23.378 1.00 27.71 ? 156 SER A C   1 
ATOM   1247 O O   . SER A 1 156 ? 18.463  33.064 23.957 1.00 29.92 ? 156 SER A O   1 
ATOM   1248 C CB  . SER A 1 156 ? 21.796  33.681 24.267 1.00 32.69 ? 156 SER A CB  1 
ATOM   1249 O OG  . SER A 1 156 ? 21.606  32.736 25.295 1.00 34.89 ? 156 SER A OG  1 
ATOM   1250 N N   . GLN A 1 157 ? 19.848  32.858 22.204 1.00 29.58 ? 157 GLN A N   1 
ATOM   1251 C CA  . GLN A 1 157 ? 19.006  31.871 21.533 1.00 32.31 ? 157 GLN A CA  1 
ATOM   1252 C C   . GLN A 1 157 ? 18.870  30.631 22.398 1.00 33.55 ? 157 GLN A C   1 
ATOM   1253 O O   . GLN A 1 157 ? 19.867  30.012 22.762 1.00 35.04 ? 157 GLN A O   1 
ATOM   1254 C CB  . GLN A 1 157 ? 19.603  31.476 20.186 1.00 31.89 ? 157 GLN A CB  1 
ATOM   1255 C CG  . GLN A 1 157 ? 18.715  30.512 19.421 1.00 37.28 ? 157 GLN A CG  1 
ATOM   1256 C CD  . GLN A 1 157 ? 19.160  30.291 17.989 1.00 36.35 ? 157 GLN A CD  1 
ATOM   1257 O OE1 . GLN A 1 157 ? 19.272  31.232 17.202 1.00 41.84 ? 157 GLN A OE1 1 
ATOM   1258 N NE2 . GLN A 1 157 ? 19.411  29.044 17.642 1.00 43.14 ? 157 GLN A NE2 1 
ATOM   1259 N N   . PRO A 1 158 ? 17.629  30.244 22.730 1.00 33.25 ? 158 PRO A N   1 
ATOM   1260 C CA  . PRO A 1 158 ? 17.404  29.063 23.565 1.00 33.51 ? 158 PRO A CA  1 
ATOM   1261 C C   . PRO A 1 158 ? 17.802  27.778 22.856 1.00 34.14 ? 158 PRO A C   1 
ATOM   1262 O O   . PRO A 1 158 ? 17.707  27.679 21.632 1.00 35.27 ? 158 PRO A O   1 
ATOM   1263 C CB  . PRO A 1 158 ? 15.890  29.097 23.837 1.00 27.08 ? 158 PRO A CB  1 
ATOM   1264 C CG  . PRO A 1 158 ? 15.492  30.491 23.534 1.00 36.75 ? 158 PRO A CG  1 
ATOM   1265 C CD  . PRO A 1 158 ? 16.346  30.846 22.346 1.00 33.55 ? 158 PRO A CD  1 
ATOM   1266 N N   . ARG A 1 159 ? 18.253  26.802 23.632 1.00 33.03 ? 159 ARG A N   1 
ATOM   1267 C CA  . ARG A 1 159 ? 18.624  25.508 23.079 1.00 34.92 ? 159 ARG A CA  1 
ATOM   1268 C C   . ARG A 1 159 ? 17.562  24.489 23.499 1.00 31.50 ? 159 ARG A C   1 
ATOM   1269 O O   . ARG A 1 159 ? 17.698  23.288 23.259 1.00 31.77 ? 159 ARG A O   1 
ATOM   1270 C CB  . ARG A 1 159 ? 20.024  25.105 23.551 1.00 37.82 ? 159 ARG A CB  1 
ATOM   1271 C CG  . ARG A 1 159 ? 21.089  26.114 23.106 1.00 41.14 ? 159 ARG A CG  1 
ATOM   1272 C CD  . ARG A 1 159 ? 22.514  25.573 23.190 1.00 47.84 ? 159 ARG A CD  1 
ATOM   1273 N NE  . ARG A 1 159 ? 22.843  25.044 24.510 1.00 54.32 ? 159 ARG A NE  1 
ATOM   1274 C CZ  . ARG A 1 159 ? 24.057  24.629 24.858 1.00 60.38 ? 159 ARG A CZ  1 
ATOM   1275 N NH1 . ARG A 1 159 ? 25.056  24.686 23.981 1.00 62.24 ? 159 ARG A NH1 1 
ATOM   1276 N NH2 . ARG A 1 159 ? 24.272  24.154 26.078 1.00 66.08 ? 159 ARG A NH2 1 
ATOM   1277 N N   . ARG A 1 160 ? 16.508  24.992 24.144 1.00 25.79 ? 160 ARG A N   1 
ATOM   1278 C CA  . ARG A 1 160 ? 15.364  24.176 24.560 1.00 27.68 ? 160 ARG A CA  1 
ATOM   1279 C C   . ARG A 1 160 ? 14.149  25.091 24.417 1.00 30.09 ? 160 ARG A C   1 
ATOM   1280 O O   . ARG A 1 160 ? 14.235  26.291 24.699 1.00 31.98 ? 160 ARG A O   1 
ATOM   1281 C CB  . ARG A 1 160 ? 15.462  23.738 26.016 1.00 29.08 ? 160 ARG A CB  1 
ATOM   1282 C CG  . ARG A 1 160 ? 16.723  23.040 26.407 1.00 38.51 ? 160 ARG A CG  1 
ATOM   1283 C CD  . ARG A 1 160 ? 16.942  23.268 27.897 1.00 50.23 ? 160 ARG A CD  1 
ATOM   1284 N NE  . ARG A 1 160 ? 18.294  22.960 28.359 1.00 50.46 ? 160 ARG A NE  1 
ATOM   1285 C CZ  . ARG A 1 160 ? 19.402  23.194 27.663 1.00 54.50 ? 160 ARG A CZ  1 
ATOM   1286 N NH1 . ARG A 1 160 ? 19.339  23.734 26.450 1.00 51.47 ? 160 ARG A NH1 1 
ATOM   1287 N NH2 . ARG A 1 160 ? 20.586  22.908 28.192 1.00 58.71 ? 160 ARG A NH2 1 
ATOM   1288 N N   . ALA A 1 161 ? 13.026  24.538 23.972 1.00 27.33 ? 161 ALA A N   1 
ATOM   1289 C CA  . ALA A 1 161 ? 11.814  25.321 23.795 1.00 27.65 ? 161 ALA A CA  1 
ATOM   1290 C C   . ALA A 1 161 ? 10.625  24.416 24.045 1.00 28.92 ? 161 ALA A C   1 
ATOM   1291 O O   . ALA A 1 161 ? 10.769  23.192 24.113 1.00 27.70 ? 161 ALA A O   1 
ATOM   1292 C CB  . ALA A 1 161 ? 11.751  25.920 22.367 1.00 26.99 ? 161 ALA A CB  1 
ATOM   1293 N N   . LEU A 1 162 ? 9.452   25.023 24.173 1.00 25.85 ? 162 LEU A N   1 
ATOM   1294 C CA  . LEU A 1 162 ? 8.250   24.278 24.439 1.00 24.14 ? 162 LEU A CA  1 
ATOM   1295 C C   . LEU A 1 162 ? 7.094   24.869 23.631 1.00 26.74 ? 162 LEU A C   1 
ATOM   1296 O O   . LEU A 1 162 ? 6.853   26.084 23.661 1.00 24.65 ? 162 LEU A O   1 
ATOM   1297 C CB  . LEU A 1 162 ? 7.974   24.336 25.948 1.00 36.11 ? 162 LEU A CB  1 
ATOM   1298 C CG  . LEU A 1 162 ? 7.208   23.258 26.720 1.00 42.45 ? 162 LEU A CG  1 
ATOM   1299 C CD1 . LEU A 1 162 ? 5.765   23.648 26.869 1.00 42.04 ? 162 LEU A CD1 1 
ATOM   1300 C CD2 . LEU A 1 162 ? 7.383   21.908 26.030 1.00 45.96 ? 162 LEU A CD2 1 
ATOM   1301 N N   . LEU A 1 163 ? 6.403   24.011 22.885 1.00 23.96 ? 163 LEU A N   1 
ATOM   1302 C CA  . LEU A 1 163 ? 5.260   24.428 22.089 1.00 21.82 ? 163 LEU A CA  1 
ATOM   1303 C C   . LEU A 1 163 ? 4.017   23.699 22.588 1.00 24.19 ? 163 LEU A C   1 
ATOM   1304 O O   . LEU A 1 163 ? 4.002   22.475 22.663 1.00 29.31 ? 163 LEU A O   1 
ATOM   1305 C CB  . LEU A 1 163 ? 5.496   24.118 20.601 1.00 18.88 ? 163 LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 163 ? 4.433   24.660 19.619 1.00 25.80 ? 163 LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 163 ? 4.939   24.544 18.196 1.00 24.62 ? 163 LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 163 ? 3.113   23.910 19.762 1.00 18.62 ? 163 LEU A CD2 1 
ATOM   1309 N N   . PHE A 1 164 ? 2.980   24.449 22.960 1.00 26.88 ? 164 PHE A N   1 
ATOM   1310 C CA  . PHE A 1 164 ? 1.741   23.843 23.423 1.00 22.37 ? 164 PHE A CA  1 
ATOM   1311 C C   . PHE A 1 164 ? 0.526   24.594 22.919 1.00 20.68 ? 164 PHE A C   1 
ATOM   1312 O O   . PHE A 1 164 ? 0.623   25.745 22.491 1.00 22.49 ? 164 PHE A O   1 
ATOM   1313 C CB  . PHE A 1 164 ? 1.696   23.754 24.959 1.00 21.65 ? 164 PHE A CB  1 
ATOM   1314 C CG  . PHE A 1 164 ? 1.732   25.085 25.668 1.00 19.60 ? 164 PHE A CG  1 
ATOM   1315 C CD1 . PHE A 1 164 ? 2.937   25.701 25.955 1.00 23.08 ? 164 PHE A CD1 1 
ATOM   1316 C CD2 . PHE A 1 164 ? 0.559   25.691 26.089 1.00 22.73 ? 164 PHE A CD2 1 
ATOM   1317 C CE1 . PHE A 1 164 ? 2.972   26.898 26.655 1.00 22.91 ? 164 PHE A CE1 1 
ATOM   1318 C CE2 . PHE A 1 164 ? 0.583   26.889 26.792 1.00 21.94 ? 164 PHE A CE2 1 
ATOM   1319 C CZ  . PHE A 1 164 ? 1.797   27.491 27.074 1.00 21.28 ? 164 PHE A CZ  1 
ATOM   1320 N N   . VAL A 1 165 ? -0.622  23.930 22.965 1.00 23.43 ? 165 VAL A N   1 
ATOM   1321 C CA  . VAL A 1 165 ? -1.881  24.509 22.515 1.00 21.51 ? 165 VAL A CA  1 
ATOM   1322 C C   . VAL A 1 165 ? -2.981  24.175 23.503 1.00 23.01 ? 165 VAL A C   1 
ATOM   1323 O O   . VAL A 1 165 ? -3.117  23.019 23.897 1.00 24.13 ? 165 VAL A O   1 
ATOM   1324 C CB  . VAL A 1 165 ? -2.312  23.928 21.147 1.00 24.90 ? 165 VAL A CB  1 
ATOM   1325 C CG1 . VAL A 1 165 ? -3.588  24.592 20.702 1.00 24.59 ? 165 VAL A CG1 1 
ATOM   1326 C CG2 . VAL A 1 165 ? -1.202  24.077 20.129 1.00 24.84 ? 165 VAL A CG2 1 
ATOM   1327 N N   . ILE A 1 166 ? -3.734  25.189 23.928 1.00 21.85 ? 166 ILE A N   1 
ATOM   1328 C CA  . ILE A 1 166 ? -4.864  25.008 24.823 1.00 20.22 ? 166 ILE A CA  1 
ATOM   1329 C C   . ILE A 1 166 ? -6.125  25.556 24.126 1.00 22.25 ? 166 ILE A C   1 
ATOM   1330 O O   . ILE A 1 166 ? -6.020  26.410 23.216 1.00 24.19 ? 166 ILE A O   1 
ATOM   1331 C CB  . ILE A 1 166 ? -4.648  25.692 26.188 1.00 23.45 ? 166 ILE A CB  1 
ATOM   1332 C CG1 . ILE A 1 166 ? -4.311  27.172 26.010 1.00 22.78 ? 166 ILE A CG1 1 
ATOM   1333 C CG2 . ILE A 1 166 ? -3.524  24.983 26.949 1.00 23.12 ? 166 ILE A CG2 1 
ATOM   1334 C CD1 . ILE A 1 166 ? -4.187  27.914 27.347 1.00 22.83 ? 166 ILE A CD1 1 
ATOM   1335 N N   . LEU A 1 167 ? -7.294  25.060 24.532 1.00 17.36 ? 167 LEU A N   1 
ATOM   1336 C CA  . LEU A 1 167 ? -8.575  25.442 23.927 1.00 20.05 ? 167 LEU A CA  1 
ATOM   1337 C C   . LEU A 1 167 ? -9.598  25.993 24.905 1.00 18.38 ? 167 LEU A C   1 
ATOM   1338 O O   . LEU A 1 167 ? -9.721  25.506 26.028 1.00 25.16 ? 167 LEU A O   1 
ATOM   1339 C CB  . LEU A 1 167 ? -9.193  24.230 23.214 1.00 20.64 ? 167 LEU A CB  1 
ATOM   1340 C CG  . LEU A 1 167 ? -8.229  23.412 22.340 1.00 26.43 ? 167 LEU A CG  1 
ATOM   1341 C CD1 . LEU A 1 167 ? -8.864  22.083 21.954 1.00 20.77 ? 167 LEU A CD1 1 
ATOM   1342 C CD2 . LEU A 1 167 ? -7.844  24.211 21.107 1.00 25.90 ? 167 LEU A CD2 1 
ATOM   1343 N N   . CYS A 1 168 ? -10.352 26.993 24.454 1.00 20.13 ? 168 CYS A N   1 
ATOM   1344 C CA  . CYS A 1 168 ? -11.383 27.626 25.275 1.00 25.55 ? 168 CYS A CA  1 
ATOM   1345 C C   . CYS A 1 168 ? -12.692 27.754 24.513 1.00 28.59 ? 168 CYS A C   1 
ATOM   1346 O O   . CYS A 1 168 ? -12.690 28.224 23.379 1.00 29.54 ? 168 CYS A O   1 
ATOM   1347 C CB  . CYS A 1 168 ? -11.004 29.064 25.651 1.00 25.55 ? 168 CYS A CB  1 
ATOM   1348 S SG  . CYS A 1 168 ? -9.597  29.300 26.693 1.00 36.22 ? 168 CYS A SG  1 
ATOM   1349 N N   . PRO A 1 169 ? -13.816 27.325 25.111 1.00 26.04 ? 169 PRO A N   1 
ATOM   1350 C CA  . PRO A 1 169 ? -15.085 27.477 24.394 1.00 25.74 ? 169 PRO A CA  1 
ATOM   1351 C C   . PRO A 1 169 ? -15.415 28.953 24.609 1.00 28.00 ? 169 PRO A C   1 
ATOM   1352 O O   . PRO A 1 169 ? -15.239 29.472 25.721 1.00 26.89 ? 169 PRO A O   1 
ATOM   1353 C CB  . PRO A 1 169 ? -16.047 26.589 25.179 1.00 26.07 ? 169 PRO A CB  1 
ATOM   1354 C CG  . PRO A 1 169 ? -15.138 25.590 25.845 1.00 33.15 ? 169 PRO A CG  1 
ATOM   1355 C CD  . PRO A 1 169 ? -13.967 26.420 26.262 1.00 27.54 ? 169 PRO A CD  1 
ATOM   1356 N N   . VAL A 1 170 ? -15.888 29.643 23.581 1.00 29.79 ? 170 VAL A N   1 
ATOM   1357 C CA  . VAL A 1 170 ? -16.219 31.054 23.751 1.00 33.55 ? 170 VAL A CA  1 
ATOM   1358 C C   . VAL A 1 170 ? -17.645 31.331 23.297 1.00 41.46 ? 170 VAL A C   1 
ATOM   1359 O O   . VAL A 1 170 ? -18.213 30.575 22.516 1.00 38.70 ? 170 VAL A O   1 
ATOM   1360 C CB  . VAL A 1 170 ? -15.269 31.957 22.944 1.00 36.29 ? 170 VAL A CB  1 
ATOM   1361 C CG1 . VAL A 1 170 ? -15.425 33.397 23.389 1.00 41.41 ? 170 VAL A CG1 1 
ATOM   1362 C CG2 . VAL A 1 170 ? -13.847 31.500 23.120 1.00 35.66 ? 170 VAL A CG2 1 
ATOM   1363 N N   . GLY A 1 171 ? -18.226 32.429 23.764 1.00 49.54 ? 171 GLY A N   1 
ATOM   1364 C CA  . GLY A 1 171 ? -19.586 32.737 23.365 1.00 51.61 ? 171 GLY A CA  1 
ATOM   1365 C C   . GLY A 1 171 ? -19.710 34.087 22.694 1.00 57.07 ? 171 GLY A C   1 
ATOM   1366 O O   . GLY A 1 171 ? -20.786 34.698 22.734 1.00 61.73 ? 171 GLY A O   1 
ATOM   1367 N N   . ALA A 1 172 ? -18.621 34.547 22.073 1.00 56.98 ? 172 ALA A N   1 
ATOM   1368 C CA  . ALA A 1 172 ? -18.580 35.848 21.394 1.00 60.24 ? 172 ALA A CA  1 
ATOM   1369 C C   . ALA A 1 172 ? -18.772 37.010 22.385 1.00 62.05 ? 172 ALA A C   1 
ATOM   1370 O O   . ALA A 1 172 ? -19.898 37.345 22.779 1.00 60.13 ? 172 ALA A O   1 
ATOM   1371 C CB  . ALA A 1 172 ? -19.646 35.915 20.287 1.00 58.52 ? 172 ALA A CB  1 
ATOM   1372 N N   . TYR A 1 173 ? -17.645 37.607 22.769 1.00 64.44 ? 173 TYR A N   1 
ATOM   1373 C CA  . TYR A 1 173 ? -17.539 38.735 23.708 1.00 67.11 ? 173 TYR A CA  1 
ATOM   1374 C C   . TYR A 1 173 ? -18.698 39.153 24.643 1.00 66.93 ? 173 TYR A C   1 
ATOM   1375 O O   . TYR A 1 173 ? -18.778 38.659 25.777 1.00 65.62 ? 173 TYR A O   1 
ATOM   1376 C CB  . TYR A 1 173 ? -17.034 39.977 22.955 1.00 65.97 ? 173 TYR A CB  1 
ATOM   1377 C CG  . TYR A 1 173 ? -16.464 41.046 23.870 1.00 67.49 ? 173 TYR A CG  1 
ATOM   1378 C CD1 . TYR A 1 173 ? -15.403 40.758 24.735 1.00 65.43 ? 173 TYR A CD1 1 
ATOM   1379 C CD2 . TYR A 1 173 ? -16.973 42.345 23.864 1.00 66.12 ? 173 TYR A CD2 1 
ATOM   1380 C CE1 . TYR A 1 173 ? -14.864 41.735 25.563 1.00 64.14 ? 173 TYR A CE1 1 
ATOM   1381 C CE2 . TYR A 1 173 ? -16.442 43.330 24.692 1.00 65.51 ? 173 TYR A CE2 1 
ATOM   1382 C CZ  . TYR A 1 173 ? -15.387 43.019 25.538 1.00 67.58 ? 173 TYR A CZ  1 
ATOM   1383 O OH  . TYR A 1 173 ? -14.848 43.996 26.357 1.00 67.76 ? 173 TYR A OH  1 
ATOM   1384 N N   . PHE A 1 174 ? -19.580 40.056 24.197 1.00 67.26 ? 174 PHE A N   1 
ATOM   1385 C CA  . PHE A 1 174 ? -20.656 40.532 25.083 1.00 68.25 ? 174 PHE A CA  1 
ATOM   1386 C C   . PHE A 1 174 ? -22.101 40.678 24.561 1.00 70.20 ? 174 PHE A C   1 
ATOM   1387 O O   . PHE A 1 174 ? -23.007 39.978 25.036 1.00 70.40 ? 174 PHE A O   1 
ATOM   1388 C CB  . PHE A 1 174 ? -20.225 41.870 25.707 1.00 67.94 ? 174 PHE A CB  1 
ATOM   1389 C CG  . PHE A 1 174 ? -21.082 42.311 26.862 1.00 66.64 ? 174 PHE A CG  1 
ATOM   1390 C CD1 . PHE A 1 174 ? -21.011 41.649 28.086 1.00 61.98 ? 174 PHE A CD1 1 
ATOM   1391 C CD2 . PHE A 1 174 ? -21.949 43.395 26.729 1.00 65.43 ? 174 PHE A CD2 1 
ATOM   1392 C CE1 . PHE A 1 174 ? -21.788 42.059 29.169 1.00 63.45 ? 174 PHE A CE1 1 
ATOM   1393 C CE2 . PHE A 1 174 ? -22.737 43.819 27.806 1.00 65.86 ? 174 PHE A CE2 1 
ATOM   1394 C CZ  . PHE A 1 174 ? -22.655 43.148 29.032 1.00 64.52 ? 174 PHE A CZ  1 
ATOM   1395 N N   . PRO A 1 175 ? -22.337 41.590 23.587 1.00 72.72 ? 175 PRO A N   1 
ATOM   1396 C CA  . PRO A 1 175 ? -23.690 41.804 23.040 1.00 72.48 ? 175 PRO A CA  1 
ATOM   1397 C C   . PRO A 1 175 ? -24.542 40.563 22.754 1.00 71.81 ? 175 PRO A C   1 
ATOM   1398 O O   . PRO A 1 175 ? -25.776 40.635 22.767 1.00 72.37 ? 175 PRO A O   1 
ATOM   1399 C CB  . PRO A 1 175 ? -23.435 42.651 21.783 1.00 73.01 ? 175 PRO A CB  1 
ATOM   1400 C CG  . PRO A 1 175 ? -22.014 42.297 21.398 1.00 73.61 ? 175 PRO A CG  1 
ATOM   1401 C CD  . PRO A 1 175 ? -21.327 42.265 22.746 1.00 72.47 ? 175 PRO A CD  1 
ATOM   1402 N N   . GLY A 1 176 ? -23.893 39.429 22.506 1.00 70.39 ? 176 GLY A N   1 
ATOM   1403 C CA  . GLY A 1 176 ? -24.635 38.216 22.223 1.00 68.98 ? 176 GLY A CA  1 
ATOM   1404 C C   . GLY A 1 176 ? -25.307 38.276 20.865 1.00 68.96 ? 176 GLY A C   1 
ATOM   1405 O O   . GLY A 1 176 ? -24.662 38.027 19.841 1.00 68.29 ? 176 GLY A O   1 
ATOM   1406 N N   . GLY A 1 177 ? -26.596 38.620 20.849 1.00 69.21 ? 177 GLY A N   1 
ATOM   1407 C CA  . GLY A 1 177 ? -27.334 38.693 19.596 1.00 67.37 ? 177 GLY A CA  1 
ATOM   1408 C C   . GLY A 1 177 ? -27.030 39.885 18.693 1.00 69.92 ? 177 GLY A C   1 
ATOM   1409 O O   . GLY A 1 177 ? -26.752 39.719 17.492 1.00 68.82 ? 177 GLY A O   1 
ATOM   1410 N N   . SER A 1 178 ? -27.086 41.090 19.261 1.00 67.09 ? 178 SER A N   1 
ATOM   1411 C CA  . SER A 1 178 ? -26.839 42.315 18.503 1.00 62.91 ? 178 SER A CA  1 
ATOM   1412 C C   . SER A 1 178 ? -25.357 42.580 18.219 1.00 61.62 ? 178 SER A C   1 
ATOM   1413 O O   . SER A 1 178 ? -24.504 41.689 18.325 1.00 62.88 ? 178 SER A O   1 
ATOM   1414 C CB  . SER A 1 178 ? -27.432 43.518 19.247 1.00 62.53 ? 178 SER A CB  1 
ATOM   1415 O OG  . SER A 1 178 ? -28.731 43.230 19.734 1.00 59.76 ? 178 SER A OG  1 
ATOM   1416 N N   . VAL A 1 179 ? -25.071 43.831 17.871 1.00 57.90 ? 179 VAL A N   1 
ATOM   1417 C CA  . VAL A 1 179 ? -23.727 44.288 17.543 1.00 54.21 ? 179 VAL A CA  1 
ATOM   1418 C C   . VAL A 1 179 ? -23.577 45.709 18.100 1.00 50.89 ? 179 VAL A C   1 
ATOM   1419 O O   . VAL A 1 179 ? -23.751 46.706 17.388 1.00 48.90 ? 179 VAL A O   1 
ATOM   1420 C CB  . VAL A 1 179 ? -23.536 44.248 16.003 1.00 56.79 ? 179 VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 179 ? -22.439 45.186 15.562 1.00 59.16 ? 179 VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 179 ? -23.206 42.824 15.575 1.00 57.69 ? 179 VAL A CG2 1 
ATOM   1423 N N   . THR A 1 180 ? -23.244 45.793 19.384 1.00 43.55 ? 180 THR A N   1 
ATOM   1424 C CA  . THR A 1 180 ? -23.121 47.084 20.049 1.00 41.84 ? 180 THR A CA  1 
ATOM   1425 C C   . THR A 1 180 ? -21.749 47.703 19.820 1.00 33.47 ? 180 THR A C   1 
ATOM   1426 O O   . THR A 1 180 ? -20.739 47.008 19.825 1.00 36.79 ? 180 THR A O   1 
ATOM   1427 C CB  . THR A 1 180 ? -23.387 46.917 21.553 1.00 42.73 ? 180 THR A CB  1 
ATOM   1428 O OG1 . THR A 1 180 ? -22.238 46.333 22.179 1.00 50.35 ? 180 THR A OG1 1 
ATOM   1429 C CG2 . THR A 1 180 ? -24.563 45.978 21.764 1.00 42.00 ? 180 THR A CG2 1 
ATOM   1430 N N   . PRO A 1 181 ? -21.696 49.026 19.623 1.00 34.30 ? 181 PRO A N   1 
ATOM   1431 C CA  . PRO A 1 181 ? -20.442 49.742 19.384 1.00 34.67 ? 181 PRO A CA  1 
ATOM   1432 C C   . PRO A 1 181 ? -19.637 50.032 20.646 1.00 33.84 ? 181 PRO A C   1 
ATOM   1433 O O   . PRO A 1 181 ? -20.176 49.996 21.751 1.00 29.09 ? 181 PRO A O   1 
ATOM   1434 C CB  . PRO A 1 181 ? -20.916 51.014 18.704 1.00 34.67 ? 181 PRO A CB  1 
ATOM   1435 C CG  . PRO A 1 181 ? -22.176 51.303 19.461 1.00 38.48 ? 181 PRO A CG  1 
ATOM   1436 C CD  . PRO A 1 181 ? -22.844 49.947 19.537 1.00 32.31 ? 181 PRO A CD  1 
ATOM   1437 N N   . VAL A 1 182 ? -18.346 50.318 20.465 1.00 28.98 ? 182 VAL A N   1 
ATOM   1438 C CA  . VAL A 1 182 ? -17.452 50.623 21.577 1.00 28.16 ? 182 VAL A CA  1 
ATOM   1439 C C   . VAL A 1 182 ? -16.917 52.032 21.454 1.00 24.46 ? 182 VAL A C   1 
ATOM   1440 O O   . VAL A 1 182 ? -16.887 52.604 20.362 1.00 26.24 ? 182 VAL A O   1 
ATOM   1441 C CB  . VAL A 1 182 ? -16.249 49.660 21.623 1.00 28.34 ? 182 VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 182 ? -16.737 48.232 21.717 1.00 29.67 ? 182 VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 182 ? -15.385 49.842 20.372 1.00 26.50 ? 182 VAL A CG2 1 
ATOM   1444 N N   . SER A 1 183 ? -16.505 52.604 22.579 1.00 26.07 ? 183 SER A N   1 
ATOM   1445 C CA  . SER A 1 183 ? -15.943 53.946 22.580 1.00 26.20 ? 183 SER A CA  1 
ATOM   1446 C C   . SER A 1 183 ? -14.440 53.742 22.766 1.00 27.90 ? 183 SER A C   1 
ATOM   1447 O O   . SER A 1 183 ? -14.021 52.770 23.398 1.00 30.34 ? 183 SER A O   1 
ATOM   1448 C CB  . SER A 1 183 ? -16.529 54.770 23.730 1.00 27.21 ? 183 SER A CB  1 
ATOM   1449 O OG  . SER A 1 183 ? -16.209 54.185 24.972 1.00 23.39 ? 183 SER A OG  1 
ATOM   1450 N N   . LEU A 1 184 ? -13.634 54.655 22.225 1.00 30.35 ? 184 LEU A N   1 
ATOM   1451 C CA  . LEU A 1 184 ? -12.174 54.529 22.306 1.00 28.11 ? 184 LEU A CA  1 
ATOM   1452 C C   . LEU A 1 184 ? -11.472 55.754 22.856 1.00 24.01 ? 184 LEU A C   1 
ATOM   1453 O O   . LEU A 1 184 ? -11.912 56.882 22.665 1.00 26.10 ? 184 LEU A O   1 
ATOM   1454 C CB  . LEU A 1 184 ? -11.613 54.269 20.915 1.00 26.86 ? 184 LEU A CB  1 
ATOM   1455 C CG  . LEU A 1 184 ? -12.266 53.181 20.080 1.00 32.11 ? 184 LEU A CG  1 
ATOM   1456 C CD1 . LEU A 1 184 ? -11.776 53.273 18.626 1.00 32.14 ? 184 LEU A CD1 1 
ATOM   1457 C CD2 . LEU A 1 184 ? -11.925 51.829 20.695 1.00 32.22 ? 184 LEU A CD2 1 
ATOM   1458 N N   . LEU A 1 185 ? -10.357 55.522 23.529 1.00 26.32 ? 185 LEU A N   1 
ATOM   1459 C CA  . LEU A 1 185 ? -9.562  56.617 24.060 1.00 26.76 ? 185 LEU A CA  1 
ATOM   1460 C C   . LEU A 1 185 ? -8.410  56.784 23.065 1.00 26.40 ? 185 LEU A C   1 
ATOM   1461 O O   . LEU A 1 185 ? -7.742  55.808 22.738 1.00 25.86 ? 185 LEU A O   1 
ATOM   1462 C CB  . LEU A 1 185 ? -9.002  56.261 25.447 1.00 27.18 ? 185 LEU A CB  1 
ATOM   1463 C CG  . LEU A 1 185 ? -8.027  57.297 26.020 1.00 27.79 ? 185 LEU A CG  1 
ATOM   1464 C CD1 . LEU A 1 185 ? -8.683  58.675 26.055 1.00 33.10 ? 185 LEU A CD1 1 
ATOM   1465 C CD2 . LEU A 1 185 ? -7.591  56.869 27.416 1.00 28.79 ? 185 LEU A CD2 1 
ATOM   1466 N N   . ALA A 1 186 ? -8.208  57.999 22.570 1.00 25.85 ? 186 ALA A N   1 
ATOM   1467 C CA  . ALA A 1 186 ? -7.120  58.281 21.643 1.00 27.11 ? 186 ALA A CA  1 
ATOM   1468 C C   . ALA A 1 186 ? -6.227  59.365 22.251 1.00 28.79 ? 186 ALA A C   1 
ATOM   1469 O O   . ALA A 1 186 ? -6.496  60.562 22.105 1.00 31.45 ? 186 ALA A O   1 
ATOM   1470 C CB  . ALA A 1 186 ? -7.662  58.743 20.304 1.00 22.73 ? 186 ALA A CB  1 
ATOM   1471 N N   . ASP A 1 187 ? -5.175  58.922 22.942 1.00 32.14 ? 187 ASP A N   1 
ATOM   1472 C CA  . ASP A 1 187 ? -4.208  59.815 23.574 1.00 32.89 ? 187 ASP A CA  1 
ATOM   1473 C C   . ASP A 1 187 ? -2.830  59.471 23.002 1.00 29.72 ? 187 ASP A C   1 
ATOM   1474 O O   . ASP A 1 187 ? -2.329  58.368 23.205 1.00 27.78 ? 187 ASP A O   1 
ATOM   1475 C CB  . ASP A 1 187 ? -4.202  59.597 25.080 1.00 35.41 ? 187 ASP A CB  1 
ATOM   1476 C CG  . ASP A 1 187 ? -3.310  60.587 25.806 1.00 40.67 ? 187 ASP A CG  1 
ATOM   1477 O OD1 . ASP A 1 187 ? -2.304  61.028 25.213 1.00 34.69 ? 187 ASP A OD1 1 
ATOM   1478 O OD2 . ASP A 1 187 ? -3.613  60.912 26.974 1.00 39.14 ? 187 ASP A OD2 1 
ATOM   1479 N N   . PRO A 1 188 ? -2.196  60.425 22.299 1.00 30.94 ? 188 PRO A N   1 
ATOM   1480 C CA  . PRO A 1 188 ? -0.882  60.253 21.675 1.00 31.35 ? 188 PRO A CA  1 
ATOM   1481 C C   . PRO A 1 188 ? 0.253   59.871 22.627 1.00 28.53 ? 188 PRO A C   1 
ATOM   1482 O O   . PRO A 1 188 ? 1.325   59.499 22.187 1.00 34.52 ? 188 PRO A O   1 
ATOM   1483 C CB  . PRO A 1 188 ? -0.628  61.605 21.006 1.00 34.66 ? 188 PRO A CB  1 
ATOM   1484 C CG  . PRO A 1 188 ? -1.958  62.295 21.000 1.00 32.96 ? 188 PRO A CG  1 
ATOM   1485 C CD  . PRO A 1 188 ? -2.604  61.838 22.254 1.00 30.13 ? 188 PRO A CD  1 
ATOM   1486 N N   . ALA A 1 189 ? 0.020   59.958 23.924 1.00 24.99 ? 189 ALA A N   1 
ATOM   1487 C CA  . ALA A 1 189 ? 1.042   59.613 24.901 1.00 29.67 ? 189 ALA A CA  1 
ATOM   1488 C C   . ALA A 1 189 ? 1.324   58.108 24.978 1.00 31.89 ? 189 ALA A C   1 
ATOM   1489 O O   . ALA A 1 189 ? 2.402   57.680 25.401 1.00 29.88 ? 189 ALA A O   1 
ATOM   1490 C CB  . ALA A 1 189 ? 0.623   60.107 26.261 1.00 29.36 ? 189 ALA A CB  1 
ATOM   1491 N N   . PHE A 1 190 ? 0.335   57.320 24.573 1.00 28.93 ? 190 PHE A N   1 
ATOM   1492 C CA  . PHE A 1 190 ? 0.451   55.872 24.624 1.00 32.13 ? 190 PHE A CA  1 
ATOM   1493 C C   . PHE A 1 190 ? 0.950   55.339 23.301 1.00 24.94 ? 190 PHE A C   1 
ATOM   1494 O O   . PHE A 1 190 ? 0.400   55.665 22.255 1.00 28.42 ? 190 PHE A O   1 
ATOM   1495 C CB  . PHE A 1 190 ? -0.915  55.271 24.954 1.00 33.47 ? 190 PHE A CB  1 
ATOM   1496 C CG  . PHE A 1 190 ? -1.548  55.873 26.171 1.00 37.77 ? 190 PHE A CG  1 
ATOM   1497 C CD1 . PHE A 1 190 ? -2.827  56.428 26.105 1.00 35.64 ? 190 PHE A CD1 1 
ATOM   1498 C CD2 . PHE A 1 190 ? -0.865  55.879 27.387 1.00 35.79 ? 190 PHE A CD2 1 
ATOM   1499 C CE1 . PHE A 1 190 ? -3.418  56.981 27.240 1.00 32.03 ? 190 PHE A CE1 1 
ATOM   1500 C CE2 . PHE A 1 190 ? -1.440  56.425 28.524 1.00 38.02 ? 190 PHE A CE2 1 
ATOM   1501 C CZ  . PHE A 1 190 ? -2.721  56.978 28.452 1.00 34.74 ? 190 PHE A CZ  1 
ATOM   1502 N N   . ILE A 1 191 ? 1.988   54.518 23.370 1.00 30.87 ? 191 ILE A N   1 
ATOM   1503 C CA  . ILE A 1 191 ? 2.625   53.919 22.196 1.00 33.76 ? 191 ILE A CA  1 
ATOM   1504 C C   . ILE A 1 191 ? 2.633   52.388 22.303 1.00 29.87 ? 191 ILE A C   1 
ATOM   1505 O O   . ILE A 1 191 ? 3.148   51.829 23.267 1.00 35.93 ? 191 ILE A O   1 
ATOM   1506 C CB  . ILE A 1 191 ? 4.082   54.424 22.072 1.00 32.06 ? 191 ILE A CB  1 
ATOM   1507 C CG1 . ILE A 1 191 ? 4.797   53.721 20.925 1.00 32.64 ? 191 ILE A CG1 1 
ATOM   1508 C CG2 . ILE A 1 191 ? 4.840   54.116 23.329 1.00 38.82 ? 191 ILE A CG2 1 
ATOM   1509 C CD1 . ILE A 1 191 ? 4.071   53.832 19.652 1.00 32.65 ? 191 ILE A CD1 1 
ATOM   1510 N N   . ARG A 1 192 ? 2.079   51.713 21.306 1.00 32.12 ? 192 ARG A N   1 
ATOM   1511 C CA  . ARG A 1 192 ? 2.007   50.253 21.319 1.00 28.87 ? 192 ARG A CA  1 
ATOM   1512 C C   . ARG A 1 192 ? 3.181   49.606 20.592 1.00 32.31 ? 192 ARG A C   1 
ATOM   1513 O O   . ARG A 1 192 ? 3.708   48.577 21.039 1.00 33.41 ? 192 ARG A O   1 
ATOM   1514 C CB  . ARG A 1 192 ? 0.685   49.796 20.679 1.00 32.19 ? 192 ARG A CB  1 
ATOM   1515 C CG  . ARG A 1 192 ? 0.510   48.283 20.566 1.00 36.81 ? 192 ARG A CG  1 
ATOM   1516 C CD  . ARG A 1 192 ? -0.523  47.937 19.497 1.00 39.91 ? 192 ARG A CD  1 
ATOM   1517 N NE  . ARG A 1 192 ? -0.352  46.584 18.973 1.00 45.07 ? 192 ARG A NE  1 
ATOM   1518 C CZ  . ARG A 1 192 ? 0.354   46.276 17.891 1.00 43.60 ? 192 ARG A CZ  1 
ATOM   1519 N NH1 . ARG A 1 192 ? 0.969   47.225 17.199 1.00 51.20 ? 192 ARG A NH1 1 
ATOM   1520 N NH2 . ARG A 1 192 ? 0.433   45.014 17.489 1.00 49.64 ? 192 ARG A NH2 1 
ATOM   1521 N N   . ALA A 1 193 ? 3.588   50.218 19.480 1.00 29.75 ? 193 ALA A N   1 
ATOM   1522 C CA  . ALA A 1 193 ? 4.680   49.700 18.658 1.00 28.93 ? 193 ALA A CA  1 
ATOM   1523 C C   . ALA A 1 193 ? 5.348   50.824 17.844 1.00 26.57 ? 193 ALA A C   1 
ATOM   1524 O O   . ALA A 1 193 ? 4.790   51.908 17.667 1.00 25.76 ? 193 ALA A O   1 
ATOM   1525 C CB  . ALA A 1 193 ? 4.133   48.624 17.705 1.00 24.66 ? 193 ALA A CB  1 
ATOM   1526 N N   . TRP A 1 194 ? 6.536   50.557 17.328 1.00 24.55 ? 194 TRP A N   1 
ATOM   1527 C CA  . TRP A 1 194 ? 7.227   51.562 16.550 1.00 23.71 ? 194 TRP A CA  1 
ATOM   1528 C C   . TRP A 1 194 ? 7.870   50.945 15.317 1.00 25.87 ? 194 TRP A C   1 
ATOM   1529 O O   . TRP A 1 194 ? 8.118   49.745 15.257 1.00 30.24 ? 194 TRP A O   1 
ATOM   1530 C CB  . TRP A 1 194 ? 8.270   52.238 17.422 1.00 29.23 ? 194 TRP A CB  1 
ATOM   1531 C CG  . TRP A 1 194 ? 9.153   51.258 18.141 1.00 32.90 ? 194 TRP A CG  1 
ATOM   1532 C CD1 . TRP A 1 194 ? 10.369  50.798 17.728 1.00 35.29 ? 194 TRP A CD1 1 
ATOM   1533 C CD2 . TRP A 1 194 ? 8.896   50.630 19.411 1.00 32.99 ? 194 TRP A CD2 1 
ATOM   1534 N NE1 . TRP A 1 194 ? 10.891  49.932 18.664 1.00 34.19 ? 194 TRP A NE1 1 
ATOM   1535 C CE2 . TRP A 1 194 ? 10.006  49.812 19.705 1.00 33.19 ? 194 TRP A CE2 1 
ATOM   1536 C CE3 . TRP A 1 194 ? 7.835   50.680 20.327 1.00 37.60 ? 194 TRP A CE3 1 
ATOM   1537 C CZ2 . TRP A 1 194 ? 10.088  49.053 20.876 1.00 27.87 ? 194 TRP A CZ2 1 
ATOM   1538 C CZ3 . TRP A 1 194 ? 7.921   49.917 21.495 1.00 26.94 ? 194 TRP A CZ3 1 
ATOM   1539 C CH2 . TRP A 1 194 ? 9.042   49.119 21.751 1.00 23.75 ? 194 TRP A CH2 1 
ATOM   1540 N N   . VAL A 1 195 ? 8.120   51.772 14.321 1.00 25.15 ? 195 VAL A N   1 
ATOM   1541 C CA  . VAL A 1 195 ? 8.737   51.295 13.102 1.00 27.56 ? 195 VAL A CA  1 
ATOM   1542 C C   . VAL A 1 195 ? 10.118  50.779 13.476 1.00 26.69 ? 195 VAL A C   1 
ATOM   1543 O O   . VAL A 1 195 ? 10.889  51.481 14.105 1.00 31.80 ? 195 VAL A O   1 
ATOM   1544 C CB  . VAL A 1 195 ? 8.842   52.432 12.096 1.00 26.68 ? 195 VAL A CB  1 
ATOM   1545 C CG1 . VAL A 1 195 ? 9.642   51.996 10.894 1.00 30.70 ? 195 VAL A CG1 1 
ATOM   1546 C CG2 . VAL A 1 195 ? 7.454   52.852 11.675 1.00 29.53 ? 195 VAL A CG2 1 
ATOM   1547 N N   . GLY A 1 196 ? 10.411  49.537 13.117 1.00 27.04 ? 196 GLY A N   1 
ATOM   1548 C CA  . GLY A 1 196 ? 11.694  48.958 13.461 1.00 31.85 ? 196 GLY A CA  1 
ATOM   1549 C C   . GLY A 1 196 ? 11.584  48.098 14.712 1.00 34.31 ? 196 GLY A C   1 
ATOM   1550 O O   . GLY A 1 196 ? 12.567  47.475 15.137 1.00 35.70 ? 196 GLY A O   1 
ATOM   1551 N N   . GLY A 1 197 ? 10.387  48.075 15.303 1.00 31.54 ? 197 GLY A N   1 
ATOM   1552 C CA  . GLY A 1 197 ? 10.135  47.295 16.505 1.00 29.75 ? 197 GLY A CA  1 
ATOM   1553 C C   . GLY A 1 197 ? 9.559   45.928 16.159 1.00 28.44 ? 197 GLY A C   1 
ATOM   1554 O O   . GLY A 1 197 ? 9.885   45.384 15.107 1.00 31.74 ? 197 GLY A O   1 
ATOM   1555 N N   . VAL A 1 198 ? 8.696   45.374 17.012 1.00 26.90 ? 198 VAL A N   1 
ATOM   1556 C CA  . VAL A 1 198 ? 8.109   44.058 16.738 1.00 20.92 ? 198 VAL A CA  1 
ATOM   1557 C C   . VAL A 1 198 ? 6.588   44.011 16.846 1.00 20.88 ? 198 VAL A C   1 
ATOM   1558 O O   . VAL A 1 198 ? 6.001   42.945 17.091 1.00 18.40 ? 198 VAL A O   1 
ATOM   1559 C CB  . VAL A 1 198 ? 8.684   42.969 17.677 1.00 23.40 ? 198 VAL A CB  1 
ATOM   1560 C CG1 . VAL A 1 198 ? 10.109  42.592 17.239 1.00 24.89 ? 198 VAL A CG1 1 
ATOM   1561 C CG2 . VAL A 1 198 ? 8.654   43.458 19.116 1.00 19.02 ? 198 VAL A CG2 1 
ATOM   1562 N N   . GLY A 1 199 ? 5.962   45.166 16.656 1.00 20.89 ? 199 GLY A N   1 
ATOM   1563 C CA  . GLY A 1 199 ? 4.520   45.269 16.732 1.00 22.31 ? 199 GLY A CA  1 
ATOM   1564 C C   . GLY A 1 199 ? 3.806   44.416 15.717 1.00 24.82 ? 199 GLY A C   1 
ATOM   1565 O O   . GLY A 1 199 ? 2.638   44.061 15.911 1.00 23.66 ? 199 GLY A O   1 
ATOM   1566 N N   . ASN A 1 200 ? 4.500   44.066 14.636 1.00 24.16 ? 200 ASN A N   1 
ATOM   1567 C CA  . ASN A 1 200 ? 3.886   43.248 13.594 1.00 23.49 ? 200 ASN A CA  1 
ATOM   1568 C C   . ASN A 1 200 ? 3.992   41.752 13.831 1.00 23.11 ? 200 ASN A C   1 
ATOM   1569 O O   . ASN A 1 200 ? 3.731   40.970 12.937 1.00 24.81 ? 200 ASN A O   1 
ATOM   1570 C CB  . ASN A 1 200 ? 4.445   43.601 12.197 1.00 22.60 ? 200 ASN A CB  1 
ATOM   1571 C CG  . ASN A 1 200 ? 5.973   43.543 12.111 1.00 24.44 ? 200 ASN A CG  1 
ATOM   1572 O OD1 . ASN A 1 200 ? 6.522   43.217 11.060 1.00 28.86 ? 200 ASN A OD1 1 
ATOM   1573 N ND2 . ASN A 1 200 ? 6.657   43.880 13.191 1.00 17.36 ? 200 ASN A ND2 1 
ATOM   1574 N N   . TYR A 1 201 ? 4.380   41.361 15.043 1.00 25.66 ? 201 TYR A N   1 
ATOM   1575 C CA  . TYR A 1 201 ? 4.512   39.950 15.413 1.00 20.27 ? 201 TYR A CA  1 
ATOM   1576 C C   . TYR A 1 201 ? 3.634   39.740 16.648 1.00 21.09 ? 201 TYR A C   1 
ATOM   1577 O O   . TYR A 1 201 ? 3.466   40.652 17.439 1.00 18.34 ? 201 TYR A O   1 
ATOM   1578 C CB  . TYR A 1 201 ? 5.987   39.614 15.746 1.00 17.94 ? 201 TYR A CB  1 
ATOM   1579 C CG  . TYR A 1 201 ? 6.951   39.825 14.598 1.00 22.17 ? 201 TYR A CG  1 
ATOM   1580 C CD1 . TYR A 1 201 ? 7.104   38.865 13.592 1.00 20.65 ? 201 TYR A CD1 1 
ATOM   1581 C CD2 . TYR A 1 201 ? 7.709   40.984 14.516 1.00 23.35 ? 201 TYR A CD2 1 
ATOM   1582 C CE1 . TYR A 1 201 ? 7.999   39.062 12.554 1.00 26.16 ? 201 TYR A CE1 1 
ATOM   1583 C CE2 . TYR A 1 201 ? 8.591   41.195 13.483 1.00 25.09 ? 201 TYR A CE2 1 
ATOM   1584 C CZ  . TYR A 1 201 ? 8.741   40.232 12.508 1.00 27.42 ? 201 TYR A CZ  1 
ATOM   1585 O OH  . TYR A 1 201 ? 9.667   40.434 11.515 1.00 29.36 ? 201 TYR A OH  1 
ATOM   1586 N N   . LYS A 1 202 ? 3.056   38.552 16.812 1.00 21.89 ? 202 LYS A N   1 
ATOM   1587 C CA  . LYS A 1 202 ? 2.211   38.317 17.981 1.00 22.14 ? 202 LYS A CA  1 
ATOM   1588 C C   . LYS A 1 202 ? 3.082   37.760 19.113 1.00 23.07 ? 202 LYS A C   1 
ATOM   1589 O O   . LYS A 1 202 ? 3.042   36.575 19.443 1.00 25.83 ? 202 LYS A O   1 
ATOM   1590 C CB  . LYS A 1 202 ? 1.050   37.368 17.642 1.00 24.74 ? 202 LYS A CB  1 
ATOM   1591 C CG  . LYS A 1 202 ? -0.330  37.896 18.125 1.00 30.03 ? 202 LYS A CG  1 
ATOM   1592 C CD  . LYS A 1 202 ? -1.535  37.061 17.665 1.00 32.44 ? 202 LYS A CD  1 
ATOM   1593 C CE  . LYS A 1 202 ? -2.903  37.649 18.124 1.00 28.49 ? 202 LYS A CE  1 
ATOM   1594 N NZ  . LYS A 1 202 ? -3.372  38.756 17.272 1.00 41.91 ? 202 LYS A NZ  1 
ATOM   1595 N N   . LEU A 1 203 ? 3.872   38.647 19.697 1.00 22.97 ? 203 LEU A N   1 
ATOM   1596 C CA  . LEU A 1 203 ? 4.785   38.306 20.783 1.00 17.89 ? 203 LEU A CA  1 
ATOM   1597 C C   . LEU A 1 203 ? 4.217   38.828 22.094 1.00 19.82 ? 203 LEU A C   1 
ATOM   1598 O O   . LEU A 1 203 ? 3.759   39.980 22.156 1.00 16.15 ? 203 LEU A O   1 
ATOM   1599 C CB  . LEU A 1 203 ? 6.144   38.974 20.541 1.00 23.57 ? 203 LEU A CB  1 
ATOM   1600 C CG  . LEU A 1 203 ? 6.720   38.883 19.125 1.00 24.41 ? 203 LEU A CG  1 
ATOM   1601 C CD1 . LEU A 1 203 ? 8.098   39.537 19.087 1.00 27.31 ? 203 LEU A CD1 1 
ATOM   1602 C CD2 . LEU A 1 203 ? 6.829   37.425 18.733 1.00 27.24 ? 203 LEU A CD2 1 
ATOM   1603 N N   . GLY A 1 204 ? 4.258   37.993 23.131 1.00 16.99 ? 204 GLY A N   1 
ATOM   1604 C CA  . GLY A 1 204 ? 3.743   38.392 24.426 1.00 20.37 ? 204 GLY A CA  1 
ATOM   1605 C C   . GLY A 1 204 ? 4.169   39.785 24.870 1.00 15.87 ? 204 GLY A C   1 
ATOM   1606 O O   . GLY A 1 204 ? 3.377   40.518 25.468 1.00 19.49 ? 204 GLY A O   1 
ATOM   1607 N N   . GLY A 1 205 ? 5.424   40.141 24.585 1.00 20.09 ? 205 GLY A N   1 
ATOM   1608 C CA  . GLY A 1 205 ? 5.960   41.430 24.982 1.00 20.45 ? 205 GLY A CA  1 
ATOM   1609 C C   . GLY A 1 205 ? 5.186   42.644 24.524 1.00 22.55 ? 205 GLY A C   1 
ATOM   1610 O O   . GLY A 1 205 ? 5.300   43.718 25.126 1.00 20.71 ? 205 GLY A O   1 
ATOM   1611 N N   . ASN A 1 206 ? 4.412   42.496 23.451 1.00 21.88 ? 206 ASN A N   1 
ATOM   1612 C CA  . ASN A 1 206 ? 3.638   43.611 22.936 1.00 20.49 ? 206 ASN A CA  1 
ATOM   1613 C C   . ASN A 1 206 ? 2.419   43.928 23.781 1.00 19.26 ? 206 ASN A C   1 
ATOM   1614 O O   . ASN A 1 206 ? 1.905   45.040 23.734 1.00 24.19 ? 206 ASN A O   1 
ATOM   1615 C CB  . ASN A 1 206 ? 3.155   43.318 21.517 1.00 20.93 ? 206 ASN A CB  1 
ATOM   1616 C CG  . ASN A 1 206 ? 4.282   43.259 20.527 1.00 20.64 ? 206 ASN A CG  1 
ATOM   1617 O OD1 . ASN A 1 206 ? 4.196   42.554 19.520 1.00 31.25 ? 206 ASN A OD1 1 
ATOM   1618 N ND2 . ASN A 1 206 ? 5.340   44.011 20.787 1.00 13.11 ? 206 ASN A ND2 1 
ATOM   1619 N N   . TYR A 1 207 ? 1.956   42.955 24.549 1.00 20.32 ? 207 TYR A N   1 
ATOM   1620 C CA  . TYR A 1 207 ? 0.730   43.137 25.319 1.00 18.36 ? 207 TYR A CA  1 
ATOM   1621 C C   . TYR A 1 207 ? 0.852   43.586 26.761 1.00 15.80 ? 207 TYR A C   1 
ATOM   1622 O O   . TYR A 1 207 ? 0.047   44.403 27.214 1.00 19.87 ? 207 TYR A O   1 
ATOM   1623 C CB  . TYR A 1 207 ? -0.097  41.860 25.229 1.00 21.11 ? 207 TYR A CB  1 
ATOM   1624 C CG  . TYR A 1 207 ? -0.333  41.499 23.793 1.00 24.60 ? 207 TYR A CG  1 
ATOM   1625 C CD1 . TYR A 1 207 ? 0.639   40.816 23.066 1.00 24.69 ? 207 TYR A CD1 1 
ATOM   1626 C CD2 . TYR A 1 207 ? -1.439  41.986 23.111 1.00 21.02 ? 207 TYR A CD2 1 
ATOM   1627 C CE1 . TYR A 1 207 ? 0.528   40.646 21.697 1.00 17.37 ? 207 TYR A CE1 1 
ATOM   1628 C CE2 . TYR A 1 207 ? -1.558  41.820 21.749 1.00 26.70 ? 207 TYR A CE2 1 
ATOM   1629 C CZ  . TYR A 1 207 ? -0.558  41.156 21.052 1.00 20.71 ? 207 TYR A CZ  1 
ATOM   1630 O OH  . TYR A 1 207 ? -0.609  41.065 19.691 1.00 30.98 ? 207 TYR A OH  1 
ATOM   1631 N N   . GLY A 1 208 ? 1.851   43.068 27.462 1.00 18.75 ? 208 GLY A N   1 
ATOM   1632 C CA  . GLY A 1 208 ? 2.038   43.417 28.857 1.00 22.45 ? 208 GLY A CA  1 
ATOM   1633 C C   . GLY A 1 208 ? 1.933   44.914 29.121 1.00 17.41 ? 208 GLY A C   1 
ATOM   1634 O O   . GLY A 1 208 ? 1.219   45.337 30.022 1.00 21.97 ? 208 GLY A O   1 
ATOM   1635 N N   . PRO A 1 209 ? 2.637   45.740 28.345 1.00 20.74 ? 209 PRO A N   1 
ATOM   1636 C CA  . PRO A 1 209 ? 2.568   47.187 28.574 1.00 22.48 ? 209 PRO A CA  1 
ATOM   1637 C C   . PRO A 1 209 ? 1.217   47.854 28.301 1.00 22.26 ? 209 PRO A C   1 
ATOM   1638 O O   . PRO A 1 209 ? 1.023   49.021 28.661 1.00 20.60 ? 209 PRO A O   1 
ATOM   1639 C CB  . PRO A 1 209 ? 3.672   47.735 27.666 1.00 20.56 ? 209 PRO A CB  1 
ATOM   1640 C CG  . PRO A 1 209 ? 4.650   46.563 27.556 1.00 16.75 ? 209 PRO A CG  1 
ATOM   1641 C CD  . PRO A 1 209 ? 3.700   45.416 27.372 1.00 14.77 ? 209 PRO A CD  1 
ATOM   1642 N N   . THR A 1 210 ? 0.281   47.140 27.691 1.00 20.11 ? 210 THR A N   1 
ATOM   1643 C CA  . THR A 1 210 ? -1.014  47.754 27.404 1.00 21.37 ? 210 THR A CA  1 
ATOM   1644 C C   . THR A 1 210 ? -2.024  47.639 28.565 1.00 22.50 ? 210 THR A C   1 
ATOM   1645 O O   . THR A 1 210 ? -3.032  48.346 28.575 1.00 21.78 ? 210 THR A O   1 
ATOM   1646 C CB  . THR A 1 210 ? -1.681  47.125 26.157 1.00 23.97 ? 210 THR A CB  1 
ATOM   1647 O OG1 . THR A 1 210 ? -2.145  45.811 26.499 1.00 20.32 ? 210 THR A OG1 1 
ATOM   1648 C CG2 . THR A 1 210 ? -0.694  47.030 24.987 1.00 19.71 ? 210 THR A CG2 1 
ATOM   1649 N N   . VAL A 1 211 ? -1.763  46.762 29.528 1.00 19.56 ? 211 VAL A N   1 
ATOM   1650 C CA  . VAL A 1 211 ? -2.696  46.596 30.646 1.00 20.21 ? 211 VAL A CA  1 
ATOM   1651 C C   . VAL A 1 211 ? -2.971  47.931 31.343 1.00 19.40 ? 211 VAL A C   1 
ATOM   1652 O O   . VAL A 1 211 ? -4.126  48.297 31.536 1.00 21.44 ? 211 VAL A O   1 
ATOM   1653 C CB  . VAL A 1 211 ? -2.185  45.593 31.703 1.00 16.01 ? 211 VAL A CB  1 
ATOM   1654 C CG1 . VAL A 1 211 ? -3.237  45.426 32.794 1.00 17.97 ? 211 VAL A CG1 1 
ATOM   1655 C CG2 . VAL A 1 211 ? -1.885  44.235 31.058 1.00 23.61 ? 211 VAL A CG2 1 
ATOM   1656 N N   . LEU A 1 212 ? -1.921  48.656 31.702 1.00 21.24 ? 212 LEU A N   1 
ATOM   1657 C CA  . LEU A 1 212 ? -2.077  49.944 32.389 1.00 22.12 ? 212 LEU A CA  1 
ATOM   1658 C C   . LEU A 1 212 ? -2.811  50.940 31.514 1.00 24.72 ? 212 LEU A C   1 
ATOM   1659 O O   . LEU A 1 212 ? -3.637  51.719 31.992 1.00 21.38 ? 212 LEU A O   1 
ATOM   1660 C CB  . LEU A 1 212 ? -0.702  50.536 32.764 1.00 25.29 ? 212 LEU A CB  1 
ATOM   1661 C CG  . LEU A 1 212 ? -0.720  51.887 33.500 1.00 26.08 ? 212 LEU A CG  1 
ATOM   1662 C CD1 . LEU A 1 212 ? -1.342  51.708 34.889 1.00 28.09 ? 212 LEU A CD1 1 
ATOM   1663 C CD2 . LEU A 1 212 ? 0.677   52.423 33.653 1.00 27.65 ? 212 LEU A CD2 1 
ATOM   1664 N N   . VAL A 1 213 ? -2.500  50.930 30.222 1.00 23.40 ? 213 VAL A N   1 
ATOM   1665 C CA  . VAL A 1 213 ? -3.145  51.866 29.316 1.00 24.63 ? 213 VAL A CA  1 
ATOM   1666 C C   . VAL A 1 213 ? -4.643  51.574 29.207 1.00 25.07 ? 213 VAL A C   1 
ATOM   1667 O O   . VAL A 1 213 ? -5.473  52.483 29.201 1.00 22.87 ? 213 VAL A O   1 
ATOM   1668 C CB  . VAL A 1 213 ? -2.467  51.820 27.899 1.00 23.71 ? 213 VAL A CB  1 
ATOM   1669 C CG1 . VAL A 1 213 ? -3.164  52.808 26.939 1.00 19.18 ? 213 VAL A CG1 1 
ATOM   1670 C CG2 . VAL A 1 213 ? -0.991  52.160 28.033 1.00 21.47 ? 213 VAL A CG2 1 
ATOM   1671 N N   . GLN A 1 214 ? -4.998  50.300 29.140 1.00 23.58 ? 214 GLN A N   1 
ATOM   1672 C CA  . GLN A 1 214 ? -6.391  49.945 29.037 1.00 24.79 ? 214 GLN A CA  1 
ATOM   1673 C C   . GLN A 1 214 ? -7.120  50.408 30.294 1.00 29.74 ? 214 GLN A C   1 
ATOM   1674 O O   . GLN A 1 214 ? -8.239  50.877 30.212 1.00 22.19 ? 214 GLN A O   1 
ATOM   1675 C CB  . GLN A 1 214 ? -6.528  48.432 28.849 1.00 30.18 ? 214 GLN A CB  1 
ATOM   1676 C CG  . GLN A 1 214 ? -7.925  47.872 29.028 1.00 33.12 ? 214 GLN A CG  1 
ATOM   1677 C CD  . GLN A 1 214 ? -8.971  48.534 28.144 1.00 39.86 ? 214 GLN A CD  1 
ATOM   1678 O OE1 . GLN A 1 214 ? -8.720  48.848 26.982 1.00 38.79 ? 214 GLN A OE1 1 
ATOM   1679 N NE2 . GLN A 1 214 ? -10.163 48.731 28.694 1.00 43.13 ? 214 GLN A NE2 1 
ATOM   1680 N N   . GLN A 1 215 ? -6.485  50.290 31.461 1.00 29.65 ? 215 GLN A N   1 
ATOM   1681 C CA  . GLN A 1 215 ? -7.136  50.734 32.693 1.00 25.89 ? 215 GLN A CA  1 
ATOM   1682 C C   . GLN A 1 215 ? -7.414  52.238 32.640 1.00 25.92 ? 215 GLN A C   1 
ATOM   1683 O O   . GLN A 1 215 ? -8.429  52.700 33.140 1.00 26.98 ? 215 GLN A O   1 
ATOM   1684 C CB  . GLN A 1 215 ? -6.267  50.417 33.902 1.00 26.21 ? 215 GLN A CB  1 
ATOM   1685 C CG  . GLN A 1 215 ? -6.238  48.964 34.289 1.00 32.84 ? 215 GLN A CG  1 
ATOM   1686 C CD  . GLN A 1 215 ? -5.405  48.726 35.551 1.00 41.54 ? 215 GLN A CD  1 
ATOM   1687 O OE1 . GLN A 1 215 ? -5.336  47.602 36.065 1.00 44.33 ? 215 GLN A OE1 1 
ATOM   1688 N NE2 . GLN A 1 215 ? -4.762  49.788 36.051 1.00 39.15 ? 215 GLN A NE2 1 
ATOM   1689 N N   . GLU A 1 216 ? -6.508  52.990 32.023 1.00 28.10 ? 216 GLU A N   1 
ATOM   1690 C CA  . GLU A 1 216 ? -6.661  54.434 31.892 1.00 29.93 ? 216 GLU A CA  1 
ATOM   1691 C C   . GLU A 1 216 ? -7.828  54.760 30.962 1.00 32.81 ? 216 GLU A C   1 
ATOM   1692 O O   . GLU A 1 216 ? -8.472  55.795 31.106 1.00 30.21 ? 216 GLU A O   1 
ATOM   1693 C CB  . GLU A 1 216 ? -5.380  55.051 31.339 1.00 30.82 ? 216 GLU A CB  1 
ATOM   1694 C CG  . GLU A 1 216 ? -5.410  56.562 31.173 1.00 42.23 ? 216 GLU A CG  1 
ATOM   1695 C CD  . GLU A 1 216 ? -5.441  57.317 32.501 1.00 50.08 ? 216 GLU A CD  1 
ATOM   1696 O OE1 . GLU A 1 216 ? -4.679  56.931 33.417 1.00 49.77 ? 216 GLU A OE1 1 
ATOM   1697 O OE2 . GLU A 1 216 ? -6.218  58.299 32.617 1.00 52.72 ? 216 GLU A OE2 1 
ATOM   1698 N N   . ALA A 1 217 ? -8.093  53.883 30.000 1.00 32.42 ? 217 ALA A N   1 
ATOM   1699 C CA  . ALA A 1 217 ? -9.203  54.109 29.083 1.00 32.19 ? 217 ALA A CA  1 
ATOM   1700 C C   . ALA A 1 217 ? -10.502 53.941 29.866 1.00 31.23 ? 217 ALA A C   1 
ATOM   1701 O O   . ALA A 1 217 ? -11.432 54.729 29.715 1.00 28.53 ? 217 ALA A O   1 
ATOM   1702 C CB  . ALA A 1 217 ? -9.155  53.123 27.916 1.00 33.07 ? 217 ALA A CB  1 
ATOM   1703 N N   . LEU A 1 218 ? -10.572 52.920 30.708 1.00 30.36 ? 218 LEU A N   1 
ATOM   1704 C CA  . LEU A 1 218 ? -11.778 52.727 31.511 1.00 32.77 ? 218 LEU A CA  1 
ATOM   1705 C C   . LEU A 1 218 ? -11.994 53.909 32.452 1.00 34.56 ? 218 LEU A C   1 
ATOM   1706 O O   . LEU A 1 218 ? -13.038 54.568 32.420 1.00 36.66 ? 218 LEU A O   1 
ATOM   1707 C CB  . LEU A 1 218 ? -11.682 51.452 32.350 1.00 32.28 ? 218 LEU A CB  1 
ATOM   1708 C CG  . LEU A 1 218 ? -11.710 50.137 31.565 1.00 35.18 ? 218 LEU A CG  1 
ATOM   1709 C CD1 . LEU A 1 218 ? -11.540 48.977 32.509 1.00 30.76 ? 218 LEU A CD1 1 
ATOM   1710 C CD2 . LEU A 1 218 ? -13.030 50.011 30.813 1.00 35.89 ? 218 LEU A CD2 1 
ATOM   1711 N N   . LYS A 1 219 ? -11.011 54.173 33.302 1.00 34.15 ? 219 LYS A N   1 
ATOM   1712 C CA  . LYS A 1 219 ? -11.144 55.257 34.256 1.00 36.76 ? 219 LYS A CA  1 
ATOM   1713 C C   . LYS A 1 219 ? -11.468 56.566 33.555 1.00 37.92 ? 219 LYS A C   1 
ATOM   1714 O O   . LYS A 1 219 ? -11.807 57.563 34.204 1.00 38.94 ? 219 LYS A O   1 
ATOM   1715 C CB  . LYS A 1 219 ? -9.877  55.401 35.101 1.00 37.65 ? 219 LYS A CB  1 
ATOM   1716 C CG  . LYS A 1 219 ? -8.645  55.780 34.337 1.00 41.54 ? 219 LYS A CG  1 
ATOM   1717 C CD  . LYS A 1 219 ? -7.647  56.485 35.253 1.00 47.47 ? 219 LYS A CD  1 
ATOM   1718 C CE  . LYS A 1 219 ? -8.181  57.850 35.714 1.00 45.92 ? 219 LYS A CE  1 
ATOM   1719 N NZ  . LYS A 1 219 ? -9.380  57.737 36.608 1.00 45.05 ? 219 LYS A NZ  1 
ATOM   1720 N N   . ARG A 1 220 ? -11.371 56.575 32.231 1.00 34.81 ? 220 ARG A N   1 
ATOM   1721 C CA  . ARG A 1 220 ? -11.686 57.784 31.496 1.00 34.94 ? 220 ARG A CA  1 
ATOM   1722 C C   . ARG A 1 220 ? -12.991 57.671 30.741 1.00 31.83 ? 220 ARG A C   1 
ATOM   1723 O O   . ARG A 1 220 ? -13.328 58.547 29.949 1.00 33.29 ? 220 ARG A O   1 
ATOM   1724 C CB  . ARG A 1 220 ? -10.559 58.154 30.543 1.00 37.37 ? 220 ARG A CB  1 
ATOM   1725 C CG  . ARG A 1 220 ? -9.362  58.739 31.247 1.00 32.35 ? 220 ARG A CG  1 
ATOM   1726 C CD  . ARG A 1 220 ? -8.847  59.917 30.466 1.00 35.11 ? 220 ARG A CD  1 
ATOM   1727 N NE  . ARG A 1 220 ? -7.454  59.738 30.080 1.00 31.47 ? 220 ARG A NE  1 
ATOM   1728 C CZ  . ARG A 1 220 ? -6.892  60.363 29.051 1.00 38.29 ? 220 ARG A CZ  1 
ATOM   1729 N NH1 . ARG A 1 220 ? -7.613  61.210 28.309 1.00 39.37 ? 220 ARG A NH1 1 
ATOM   1730 N NH2 . ARG A 1 220 ? -5.621  60.137 28.751 1.00 32.73 ? 220 ARG A NH2 1 
ATOM   1731 N N   . GLY A 1 221 ? -13.721 56.589 30.992 1.00 30.12 ? 221 GLY A N   1 
ATOM   1732 C CA  . GLY A 1 221 ? -15.008 56.399 30.353 1.00 32.99 ? 221 GLY A CA  1 
ATOM   1733 C C   . GLY A 1 221 ? -15.026 55.705 29.004 1.00 33.42 ? 221 GLY A C   1 
ATOM   1734 O O   . GLY A 1 221 ? -16.093 55.585 28.382 1.00 32.25 ? 221 GLY A O   1 
ATOM   1735 N N   . CYS A 1 222 ? -13.863 55.261 28.534 1.00 31.68 ? 222 CYS A N   1 
ATOM   1736 C CA  . CYS A 1 222 ? -13.805 54.560 27.258 1.00 32.29 ? 222 CYS A CA  1 
ATOM   1737 C C   . CYS A 1 222 ? -13.683 53.069 27.482 1.00 33.34 ? 222 CYS A C   1 
ATOM   1738 O O   . CYS A 1 222 ? -13.289 52.627 28.564 1.00 37.07 ? 222 CYS A O   1 
ATOM   1739 C CB  . CYS A 1 222 ? -12.637 55.051 26.411 1.00 27.90 ? 222 CYS A CB  1 
ATOM   1740 S SG  . CYS A 1 222 ? -12.812 56.775 25.966 1.00 30.58 ? 222 CYS A SG  1 
ATOM   1741 N N   . GLU A 1 223 ? -14.020 52.293 26.457 1.00 28.22 ? 223 GLU A N   1 
ATOM   1742 C CA  . GLU A 1 223 ? -13.970 50.845 26.566 1.00 25.33 ? 223 GLU A CA  1 
ATOM   1743 C C   . GLU A 1 223 ? -12.695 50.239 26.010 1.00 29.95 ? 223 GLU A C   1 
ATOM   1744 O O   . GLU A 1 223 ? -12.277 49.172 26.443 1.00 28.95 ? 223 GLU A O   1 
ATOM   1745 C CB  . GLU A 1 223 ? -15.177 50.256 25.864 1.00 31.71 ? 223 GLU A CB  1 
ATOM   1746 C CG  . GLU A 1 223 ? -16.461 50.901 26.381 1.00 39.94 ? 223 GLU A CG  1 
ATOM   1747 C CD  . GLU A 1 223 ? -17.684 50.534 25.576 1.00 41.74 ? 223 GLU A CD  1 
ATOM   1748 O OE1 . GLU A 1 223 ? -18.211 49.417 25.765 1.00 42.10 ? 223 GLU A OE1 1 
ATOM   1749 O OE2 . GLU A 1 223 ? -18.118 51.366 24.751 1.00 45.16 ? 223 GLU A OE2 1 
ATOM   1750 N N   . GLN A 1 224 ? -12.087 50.904 25.032 1.00 27.65 ? 224 GLN A N   1 
ATOM   1751 C CA  . GLN A 1 224 ? -10.849 50.390 24.453 1.00 31.27 ? 224 GLN A CA  1 
ATOM   1752 C C   . GLN A 1 224 ? -9.909  51.508 24.075 1.00 26.30 ? 224 GLN A C   1 
ATOM   1753 O O   . GLN A 1 224 ? -10.274 52.679 24.099 1.00 31.87 ? 224 GLN A O   1 
ATOM   1754 C CB  . GLN A 1 224 ? -11.134 49.526 23.225 1.00 27.86 ? 224 GLN A CB  1 
ATOM   1755 C CG  . GLN A 1 224 ? -12.124 48.456 23.515 1.00 34.16 ? 224 GLN A CG  1 
ATOM   1756 C CD  . GLN A 1 224 ? -11.956 47.260 22.620 1.00 39.82 ? 224 GLN A CD  1 
ATOM   1757 O OE1 . GLN A 1 224 ? -12.853 46.418 22.517 1.00 37.65 ? 224 GLN A OE1 1 
ATOM   1758 N NE2 . GLN A 1 224 ? -10.803 47.164 21.973 1.00 41.80 ? 224 GLN A NE2 1 
ATOM   1759 N N   . VAL A 1 225 ? -8.696  51.132 23.706 1.00 25.38 ? 225 VAL A N   1 
ATOM   1760 C CA  . VAL A 1 225 ? -7.679  52.106 23.352 1.00 25.57 ? 225 VAL A CA  1 
ATOM   1761 C C   . VAL A 1 225 ? -7.502  52.209 21.837 1.00 24.23 ? 225 VAL A C   1 
ATOM   1762 O O   . VAL A 1 225 ? -7.427  51.191 21.169 1.00 22.73 ? 225 VAL A O   1 
ATOM   1763 C CB  . VAL A 1 225 ? -6.325  51.684 23.985 1.00 23.32 ? 225 VAL A CB  1 
ATOM   1764 C CG1 . VAL A 1 225 ? -5.203  52.594 23.524 1.00 19.09 ? 225 VAL A CG1 1 
ATOM   1765 C CG2 . VAL A 1 225 ? -6.441  51.706 25.517 1.00 21.53 ? 225 VAL A CG2 1 
ATOM   1766 N N   . LEU A 1 226 ? -7.481  53.429 21.303 1.00 25.17 ? 226 LEU A N   1 
ATOM   1767 C CA  . LEU A 1 226 ? -7.209  53.634 19.876 1.00 25.40 ? 226 LEU A CA  1 
ATOM   1768 C C   . LEU A 1 226 ? -5.724  54.006 19.900 1.00 26.09 ? 226 LEU A C   1 
ATOM   1769 O O   . LEU A 1 226 ? -5.361  55.084 20.372 1.00 25.11 ? 226 LEU A O   1 
ATOM   1770 C CB  . LEU A 1 226 ? -8.010  54.804 19.298 1.00 26.24 ? 226 LEU A CB  1 
ATOM   1771 C CG  . LEU A 1 226 ? -7.641  55.252 17.871 1.00 25.96 ? 226 LEU A CG  1 
ATOM   1772 C CD1 . LEU A 1 226 ? -7.664  54.079 16.924 1.00 29.01 ? 226 LEU A CD1 1 
ATOM   1773 C CD2 . LEU A 1 226 ? -8.604  56.321 17.393 1.00 27.26 ? 226 LEU A CD2 1 
ATOM   1774 N N   . TRP A 1 227 ? -4.866  53.118 19.406 1.00 23.84 ? 227 TRP A N   1 
ATOM   1775 C CA  . TRP A 1 227 ? -3.436  53.380 19.416 1.00 20.88 ? 227 TRP A CA  1 
ATOM   1776 C C   . TRP A 1 227 ? -2.991  54.352 18.331 1.00 20.99 ? 227 TRP A C   1 
ATOM   1777 O O   . TRP A 1 227 ? -3.174  54.085 17.152 1.00 24.58 ? 227 TRP A O   1 
ATOM   1778 C CB  . TRP A 1 227 ? -2.679  52.070 19.269 1.00 24.24 ? 227 TRP A CB  1 
ATOM   1779 C CG  . TRP A 1 227 ? -2.995  51.113 20.377 1.00 24.12 ? 227 TRP A CG  1 
ATOM   1780 C CD1 . TRP A 1 227 ? -3.890  50.082 20.354 1.00 21.89 ? 227 TRP A CD1 1 
ATOM   1781 C CD2 . TRP A 1 227 ? -2.423  51.125 21.676 1.00 27.06 ? 227 TRP A CD2 1 
ATOM   1782 N NE1 . TRP A 1 227 ? -3.905  49.446 21.574 1.00 22.73 ? 227 TRP A NE1 1 
ATOM   1783 C CE2 . TRP A 1 227 ? -3.011  50.070 22.404 1.00 23.90 ? 227 TRP A CE2 1 
ATOM   1784 C CE3 . TRP A 1 227 ? -1.464  51.932 22.304 1.00 22.93 ? 227 TRP A CE3 1 
ATOM   1785 C CZ2 . TRP A 1 227 ? -2.668  49.799 23.724 1.00 22.37 ? 227 TRP A CZ2 1 
ATOM   1786 C CZ3 . TRP A 1 227 ? -1.126  51.658 23.621 1.00 29.97 ? 227 TRP A CZ3 1 
ATOM   1787 C CH2 . TRP A 1 227 ? -1.724  50.605 24.313 1.00 20.00 ? 227 TRP A CH2 1 
ATOM   1788 N N   . LEU A 1 228 ? -2.413  55.473 18.746 1.00 21.80 ? 228 LEU A N   1 
ATOM   1789 C CA  . LEU A 1 228 ? -1.925  56.500 17.821 1.00 24.15 ? 228 LEU A CA  1 
ATOM   1790 C C   . LEU A 1 228 ? -0.408  56.402 17.703 1.00 21.89 ? 228 LEU A C   1 
ATOM   1791 O O   . LEU A 1 228 ? 0.273   55.997 18.645 1.00 27.15 ? 228 LEU A O   1 
ATOM   1792 C CB  . LEU A 1 228 ? -2.314  57.901 18.319 1.00 24.56 ? 228 LEU A CB  1 
ATOM   1793 C CG  . LEU A 1 228 ? -3.798  58.224 18.486 1.00 24.86 ? 228 LEU A CG  1 
ATOM   1794 C CD1 . LEU A 1 228 ? -3.934  59.589 19.136 1.00 23.76 ? 228 LEU A CD1 1 
ATOM   1795 C CD2 . LEU A 1 228 ? -4.521  58.207 17.142 1.00 21.28 ? 228 LEU A CD2 1 
ATOM   1796 N N   . TYR A 1 229 ? 0.116   56.781 16.543 1.00 24.14 ? 229 TYR A N   1 
ATOM   1797 C CA  . TYR A 1 229 ? 1.551   56.715 16.298 1.00 26.34 ? 229 TYR A CA  1 
ATOM   1798 C C   . TYR A 1 229 ? 2.015   57.866 15.434 1.00 24.65 ? 229 TYR A C   1 
ATOM   1799 O O   . TYR A 1 229 ? 1.294   58.314 14.537 1.00 24.05 ? 229 TYR A O   1 
ATOM   1800 C CB  . TYR A 1 229 ? 1.899   55.411 15.568 1.00 25.17 ? 229 TYR A CB  1 
ATOM   1801 C CG  . TYR A 1 229 ? 3.367   55.249 15.268 1.00 23.78 ? 229 TYR A CG  1 
ATOM   1802 C CD1 . TYR A 1 229 ? 4.251   54.864 16.265 1.00 21.39 ? 229 TYR A CD1 1 
ATOM   1803 C CD2 . TYR A 1 229 ? 3.877   55.477 13.980 1.00 23.49 ? 229 TYR A CD2 1 
ATOM   1804 C CE1 . TYR A 1 229 ? 5.608   54.699 15.998 1.00 21.48 ? 229 TYR A CE1 1 
ATOM   1805 C CE2 . TYR A 1 229 ? 5.245   55.314 13.704 1.00 25.54 ? 229 TYR A CE2 1 
ATOM   1806 C CZ  . TYR A 1 229 ? 6.096   54.920 14.717 1.00 25.59 ? 229 TYR A CZ  1 
ATOM   1807 O OH  . TYR A 1 229 ? 7.438   54.704 14.456 1.00 27.74 ? 229 TYR A OH  1 
ATOM   1808 N N   . GLY A 1 230 ? 3.229   58.327 15.699 1.00 31.11 ? 230 GLY A N   1 
ATOM   1809 C CA  . GLY A 1 230 ? 3.802   59.392 14.894 1.00 37.62 ? 230 GLY A CA  1 
ATOM   1810 C C   . GLY A 1 230 ? 3.385   60.805 15.238 1.00 41.00 ? 230 GLY A C   1 
ATOM   1811 O O   . GLY A 1 230 ? 2.474   61.023 16.042 1.00 36.52 ? 230 GLY A O   1 
ATOM   1812 N N   . PRO A 1 231 ? 4.047   61.796 14.624 1.00 41.81 ? 231 PRO A N   1 
ATOM   1813 C CA  . PRO A 1 231 ? 3.760   63.215 14.855 1.00 42.55 ? 231 PRO A CA  1 
ATOM   1814 C C   . PRO A 1 231 ? 2.398   63.569 14.290 1.00 37.64 ? 231 PRO A C   1 
ATOM   1815 O O   . PRO A 1 231 ? 1.703   64.444 14.810 1.00 36.64 ? 231 PRO A O   1 
ATOM   1816 C CB  . PRO A 1 231 ? 4.890   63.928 14.104 1.00 42.50 ? 231 PRO A CB  1 
ATOM   1817 C CG  . PRO A 1 231 ? 5.981   62.883 14.034 1.00 44.92 ? 231 PRO A CG  1 
ATOM   1818 C CD  . PRO A 1 231 ? 5.197   61.641 13.719 1.00 39.18 ? 231 PRO A CD  1 
ATOM   1819 N N   . ASP A 1 232 ? 2.028   62.890 13.210 1.00 33.72 ? 232 ASP A N   1 
ATOM   1820 C CA  . ASP A 1 232 ? 0.754   63.130 12.570 1.00 33.75 ? 232 ASP A CA  1 
ATOM   1821 C C   . ASP A 1 232 ? -0.376  62.312 13.213 1.00 33.03 ? 232 ASP A C   1 
ATOM   1822 O O   . ASP A 1 232 ? -1.473  62.245 12.678 1.00 39.44 ? 232 ASP A O   1 
ATOM   1823 C CB  . ASP A 1 232 ? 0.853   62.842 11.059 1.00 37.99 ? 232 ASP A CB  1 
ATOM   1824 C CG  . ASP A 1 232 ? 1.364   61.441 10.751 1.00 43.96 ? 232 ASP A CG  1 
ATOM   1825 O OD1 . ASP A 1 232 ? 2.181   60.897 11.541 1.00 38.56 ? 232 ASP A OD1 1 
ATOM   1826 O OD2 . ASP A 1 232 ? 0.956   60.895 9.700  1.00 40.15 ? 232 ASP A OD2 1 
ATOM   1827 N N   . HIS A 1 233 ? -0.106  61.694 14.358 1.00 30.28 ? 233 HIS A N   1 
ATOM   1828 C CA  . HIS A 1 233 ? -1.130  60.911 15.066 1.00 31.85 ? 233 HIS A CA  1 
ATOM   1829 C C   . HIS A 1 233 ? -1.926  59.966 14.176 1.00 28.32 ? 233 HIS A C   1 
ATOM   1830 O O   . HIS A 1 233 ? -3.152  60.086 14.067 1.00 26.71 ? 233 HIS A O   1 
ATOM   1831 C CB  . HIS A 1 233 ? -2.110  61.859 15.746 1.00 30.05 ? 233 HIS A CB  1 
ATOM   1832 C CG  . HIS A 1 233 ? -1.483  62.691 16.813 1.00 33.24 ? 233 HIS A CG  1 
ATOM   1833 N ND1 . HIS A 1 233 ? -2.161  63.692 17.469 1.00 39.09 ? 233 HIS A ND1 1 
ATOM   1834 C CD2 . HIS A 1 233 ? -0.243  62.659 17.350 1.00 34.46 ? 233 HIS A CD2 1 
ATOM   1835 C CE1 . HIS A 1 233 ? -1.365  64.243 18.370 1.00 36.73 ? 233 HIS A CE1 1 
ATOM   1836 N NE2 . HIS A 1 233 ? -0.196  63.634 18.317 1.00 37.73 ? 233 HIS A NE2 1 
ATOM   1837 N N   . GLN A 1 234 ? -1.260  59.029 13.525 1.00 24.46 ? 234 GLN A N   1 
ATOM   1838 C CA  . GLN A 1 234 ? -2.023  58.138 12.680 1.00 31.10 ? 234 GLN A CA  1 
ATOM   1839 C C   . GLN A 1 234 ? -2.690  57.053 13.528 1.00 26.35 ? 234 GLN A C   1 
ATOM   1840 O O   . GLN A 1 234 ? -2.201  56.696 14.604 1.00 21.63 ? 234 GLN A O   1 
ATOM   1841 C CB  . GLN A 1 234 ? -1.125  57.545 11.585 1.00 37.62 ? 234 GLN A CB  1 
ATOM   1842 C CG  . GLN A 1 234 ? 0.141   56.899 12.054 1.00 40.70 ? 234 GLN A CG  1 
ATOM   1843 C CD  . GLN A 1 234 ? 1.195   56.838 10.951 1.00 40.09 ? 234 GLN A CD  1 
ATOM   1844 O OE1 . GLN A 1 234 ? 1.892   57.819 10.676 1.00 40.57 ? 234 GLN A OE1 1 
ATOM   1845 N NE2 . GLN A 1 234 ? 1.305   55.688 10.314 1.00 37.36 ? 234 GLN A NE2 1 
ATOM   1846 N N   . LEU A 1 235 ? -3.832  56.573 13.054 1.00 25.64 ? 235 LEU A N   1 
ATOM   1847 C CA  . LEU A 1 235 ? -4.580  55.526 13.743 1.00 22.30 ? 235 LEU A CA  1 
ATOM   1848 C C   . LEU A 1 235 ? -3.998  54.198 13.300 1.00 24.15 ? 235 LEU A C   1 
ATOM   1849 O O   . LEU A 1 235 ? -4.054  53.854 12.118 1.00 31.58 ? 235 LEU A O   1 
ATOM   1850 C CB  . LEU A 1 235 ? -6.065  55.584 13.374 1.00 16.92 ? 235 LEU A CB  1 
ATOM   1851 C CG  . LEU A 1 235 ? -6.884  56.786 13.869 1.00 28.70 ? 235 LEU A CG  1 
ATOM   1852 C CD1 . LEU A 1 235 ? -6.359  58.104 13.298 1.00 25.31 ? 235 LEU A CD1 1 
ATOM   1853 C CD2 . LEU A 1 235 ? -8.335  56.574 13.474 1.00 24.30 ? 235 LEU A CD2 1 
ATOM   1854 N N   . THR A 1 236 ? -3.436  53.452 14.245 1.00 20.94 ? 236 THR A N   1 
ATOM   1855 C CA  . THR A 1 236 ? -2.830  52.167 13.912 1.00 22.40 ? 236 THR A CA  1 
ATOM   1856 C C   . THR A 1 236 ? -3.749  50.982 14.182 1.00 22.80 ? 236 THR A C   1 
ATOM   1857 O O   . THR A 1 236 ? -4.078  50.236 13.268 1.00 22.38 ? 236 THR A O   1 
ATOM   1858 C CB  . THR A 1 236 ? -1.488  51.975 14.665 1.00 23.44 ? 236 THR A CB  1 
ATOM   1859 O OG1 . THR A 1 236 ? -1.710  51.949 16.082 1.00 23.11 ? 236 THR A OG1 1 
ATOM   1860 C CG2 . THR A 1 236 ? -0.551  53.114 14.359 1.00 23.99 ? 236 THR A CG2 1 
ATOM   1861 N N   . GLU A 1 237 ? -4.178  50.829 15.429 1.00 23.20 ? 237 GLU A N   1 
ATOM   1862 C CA  . GLU A 1 237 ? -5.045  49.726 15.823 1.00 27.24 ? 237 GLU A CA  1 
ATOM   1863 C C   . GLU A 1 237 ? -5.961  50.093 16.982 1.00 30.66 ? 237 GLU A C   1 
ATOM   1864 O O   . GLU A 1 237 ? -5.771  51.126 17.612 1.00 32.97 ? 237 GLU A O   1 
ATOM   1865 C CB  . GLU A 1 237 ? -4.197  48.540 16.230 1.00 32.61 ? 237 GLU A CB  1 
ATOM   1866 C CG  . GLU A 1 237 ? -3.276  48.039 15.150 1.00 32.91 ? 237 GLU A CG  1 
ATOM   1867 C CD  . GLU A 1 237 ? -2.840  46.641 15.439 1.00 38.19 ? 237 GLU A CD  1 
ATOM   1868 O OE1 . GLU A 1 237 ? -3.609  45.976 16.133 1.00 43.14 ? 237 GLU A OE1 1 
ATOM   1869 O OE2 . GLU A 1 237 ? -1.774  46.190 14.987 1.00 33.21 ? 237 GLU A OE2 1 
ATOM   1870 N N   . VAL A 1 238 ? -6.961  49.249 17.248 1.00 29.67 ? 238 VAL A N   1 
ATOM   1871 C CA  . VAL A 1 238 ? -7.908  49.477 18.343 1.00 31.07 ? 238 VAL A CA  1 
ATOM   1872 C C   . VAL A 1 238 ? -7.835  48.298 19.282 1.00 32.09 ? 238 VAL A C   1 
ATOM   1873 O O   . VAL A 1 238 ? -8.179  47.178 18.910 1.00 31.07 ? 238 VAL A O   1 
ATOM   1874 C CB  . VAL A 1 238 ? -9.374  49.628 17.846 1.00 32.25 ? 238 VAL A CB  1 
ATOM   1875 C CG1 . VAL A 1 238 ? -9.479  50.792 16.898 1.00 41.57 ? 238 VAL A CG1 1 
ATOM   1876 C CG2 . VAL A 1 238 ? -9.832  48.364 17.131 1.00 40.55 ? 238 VAL A CG2 1 
ATOM   1877 N N   . GLY A 1 239 ? -7.375  48.547 20.506 1.00 29.94 ? 239 GLY A N   1 
ATOM   1878 C CA  . GLY A 1 239 ? -7.247  47.471 21.466 1.00 28.31 ? 239 GLY A CA  1 
ATOM   1879 C C   . GLY A 1 239 ? -6.327  46.460 20.821 1.00 30.46 ? 239 GLY A C   1 
ATOM   1880 O O   . GLY A 1 239 ? -5.175  46.776 20.520 1.00 30.18 ? 239 GLY A O   1 
ATOM   1881 N N   . THR A 1 240 ? -6.835  45.249 20.608 1.00 23.93 ? 240 THR A N   1 
ATOM   1882 C CA  . THR A 1 240 ? -6.070  44.214 19.944 1.00 25.73 ? 240 THR A CA  1 
ATOM   1883 C C   . THR A 1 240 ? -6.787  43.843 18.634 1.00 26.88 ? 240 THR A C   1 
ATOM   1884 O O   . THR A 1 240 ? -6.934  42.670 18.302 1.00 25.44 ? 240 THR A O   1 
ATOM   1885 C CB  . THR A 1 240 ? -5.956  42.965 20.819 1.00 34.81 ? 240 THR A CB  1 
ATOM   1886 O OG1 . THR A 1 240 ? -7.275  42.509 21.162 1.00 28.51 ? 240 THR A OG1 1 
ATOM   1887 C CG2 . THR A 1 240 ? -5.143  43.283 22.100 1.00 34.12 ? 240 THR A CG2 1 
ATOM   1888 N N   . MET A 1 241 ? -7.255  44.856 17.910 1.00 25.74 ? 241 MET A N   1 
ATOM   1889 C CA  . MET A 1 241 ? -7.948  44.648 16.636 1.00 24.39 ? 241 MET A CA  1 
ATOM   1890 C C   . MET A 1 241 ? -7.419  45.628 15.611 1.00 24.75 ? 241 MET A C   1 
ATOM   1891 O O   . MET A 1 241 ? -6.969  46.721 15.954 1.00 22.80 ? 241 MET A O   1 
ATOM   1892 C CB  . MET A 1 241 ? -9.448  44.932 16.754 1.00 25.02 ? 241 MET A CB  1 
ATOM   1893 C CG  . MET A 1 241 ? -10.223 44.137 17.785 1.00 27.18 ? 241 MET A CG  1 
ATOM   1894 S SD  . MET A 1 241 ? -11.921 44.788 17.864 1.00 27.61 ? 241 MET A SD  1 
ATOM   1895 C CE  . MET A 1 241 ? -11.717 46.097 19.055 1.00 33.30 ? 241 MET A CE  1 
ATOM   1896 N N   . ASN A 1 242 ? -7.493  45.248 14.344 1.00 20.89 ? 242 ASN A N   1 
ATOM   1897 C CA  . ASN A 1 242 ? -7.083  46.165 13.299 1.00 20.99 ? 242 ASN A CA  1 
ATOM   1898 C C   . ASN A 1 242 ? -8.233  47.164 13.126 1.00 19.48 ? 242 ASN A C   1 
ATOM   1899 O O   . ASN A 1 242 ? -9.369  46.914 13.564 1.00 18.72 ? 242 ASN A O   1 
ATOM   1900 C CB  . ASN A 1 242 ? -6.776  45.373 12.031 1.00 18.12 ? 242 ASN A CB  1 
ATOM   1901 C CG  . ASN A 1 242 ? -5.512  44.531 12.191 1.00 11.70 ? 242 ASN A CG  1 
ATOM   1902 O OD1 . ASN A 1 242 ? -4.420  45.078 12.409 1.00 22.09 ? 242 ASN A OD1 1 
ATOM   1903 N ND2 . ASN A 1 242 ? -5.647  43.222 12.103 1.00 13.26 ? 242 ASN A ND2 1 
ATOM   1904 N N   . ILE A 1 243 ? -7.944  48.323 12.548 1.00 19.67 ? 243 ILE A N   1 
ATOM   1905 C CA  . ILE A 1 243 ? -8.987  49.319 12.377 1.00 19.22 ? 243 ILE A CA  1 
ATOM   1906 C C   . ILE A 1 243 ? -9.299  49.598 10.893 1.00 20.86 ? 243 ILE A C   1 
ATOM   1907 O O   . ILE A 1 243 ? -8.393  49.637 10.055 1.00 22.88 ? 243 ILE A O   1 
ATOM   1908 C CB  . ILE A 1 243 ? -8.589  50.628 13.112 1.00 17.58 ? 243 ILE A CB  1 
ATOM   1909 C CG1 . ILE A 1 243 ? -9.773  51.575 13.147 1.00 20.44 ? 243 ILE A CG1 1 
ATOM   1910 C CG2 . ILE A 1 243 ? -7.356  51.282 12.448 1.00 18.31 ? 243 ILE A CG2 1 
ATOM   1911 C CD1 . ILE A 1 243 ? -9.498  52.827 13.890 1.00 26.90 ? 243 ILE A CD1 1 
ATOM   1912 N N   . PHE A 1 244 ? -10.584 49.775 10.589 1.00 17.12 ? 244 PHE A N   1 
ATOM   1913 C CA  . PHE A 1 244 ? -11.056 50.076 9.247  1.00 21.97 ? 244 PHE A CA  1 
ATOM   1914 C C   . PHE A 1 244 ? -11.920 51.324 9.290  1.00 23.67 ? 244 PHE A C   1 
ATOM   1915 O O   . PHE A 1 244 ? -12.606 51.569 10.281 1.00 25.46 ? 244 PHE A O   1 
ATOM   1916 C CB  . PHE A 1 244 ? -11.908 48.937 8.698  1.00 23.85 ? 244 PHE A CB  1 
ATOM   1917 C CG  . PHE A 1 244 ? -11.119 47.746 8.242  1.00 26.81 ? 244 PHE A CG  1 
ATOM   1918 C CD1 . PHE A 1 244 ? -10.601 46.838 9.166  1.00 23.64 ? 244 PHE A CD1 1 
ATOM   1919 C CD2 . PHE A 1 244 ? -10.907 47.523 6.882  1.00 26.44 ? 244 PHE A CD2 1 
ATOM   1920 C CE1 . PHE A 1 244 ? -9.888  45.724 8.742  1.00 25.75 ? 244 PHE A CE1 1 
ATOM   1921 C CE2 . PHE A 1 244 ? -10.184 46.396 6.438  1.00 26.22 ? 244 PHE A CE2 1 
ATOM   1922 C CZ  . PHE A 1 244 ? -9.676  45.495 7.372  1.00 22.20 ? 244 PHE A CZ  1 
ATOM   1923 N N   . VAL A 1 245 ? -11.879 52.112 8.220  1.00 21.73 ? 245 VAL A N   1 
ATOM   1924 C CA  . VAL A 1 245 ? -12.692 53.323 8.117  1.00 25.58 ? 245 VAL A CA  1 
ATOM   1925 C C   . VAL A 1 245 ? -13.367 53.259 6.748  1.00 24.47 ? 245 VAL A C   1 
ATOM   1926 O O   . VAL A 1 245 ? -12.711 53.020 5.744  1.00 24.07 ? 245 VAL A O   1 
ATOM   1927 C CB  . VAL A 1 245 ? -11.835 54.613 8.196  1.00 22.88 ? 245 VAL A CB  1 
ATOM   1928 C CG1 . VAL A 1 245 ? -12.701 55.824 7.872  1.00 20.78 ? 245 VAL A CG1 1 
ATOM   1929 C CG2 . VAL A 1 245 ? -11.223 54.761 9.594  1.00 20.81 ? 245 VAL A CG2 1 
ATOM   1930 N N   . TYR A 1 246 ? -14.681 53.422 6.723  1.00 26.27 ? 246 TYR A N   1 
ATOM   1931 C CA  . TYR A 1 246 ? -15.452 53.399 5.481  1.00 25.70 ? 246 TYR A CA  1 
ATOM   1932 C C   . TYR A 1 246 ? -15.941 54.836 5.344  1.00 28.22 ? 246 TYR A C   1 
ATOM   1933 O O   . TYR A 1 246 ? -16.702 55.319 6.176  1.00 28.91 ? 246 TYR A O   1 
ATOM   1934 C CB  . TYR A 1 246 ? -16.616 52.419 5.629  1.00 30.28 ? 246 TYR A CB  1 
ATOM   1935 C CG  . TYR A 1 246 ? -17.495 52.186 4.414  1.00 32.63 ? 246 TYR A CG  1 
ATOM   1936 C CD1 . TYR A 1 246 ? -16.948 51.924 3.153  1.00 31.59 ? 246 TYR A CD1 1 
ATOM   1937 C CD2 . TYR A 1 246 ? -18.882 52.131 4.553  1.00 30.75 ? 246 TYR A CD2 1 
ATOM   1938 C CE1 . TYR A 1 246 ? -17.777 51.605 2.068  1.00 31.21 ? 246 TYR A CE1 1 
ATOM   1939 C CE2 . TYR A 1 246 ? -19.699 51.818 3.493  1.00 32.39 ? 246 TYR A CE2 1 
ATOM   1940 C CZ  . TYR A 1 246 ? -19.149 51.553 2.256  1.00 33.30 ? 246 TYR A CZ  1 
ATOM   1941 O OH  . TYR A 1 246 ? -19.981 51.213 1.220  1.00 40.01 ? 246 TYR A OH  1 
ATOM   1942 N N   . TRP A 1 247 ? -15.455 55.528 4.319  1.00 26.46 ? 247 TRP A N   1 
ATOM   1943 C CA  . TRP A 1 247 ? -15.825 56.923 4.097  1.00 28.80 ? 247 TRP A CA  1 
ATOM   1944 C C   . TRP A 1 247 ? -15.649 57.339 2.636  1.00 31.52 ? 247 TRP A C   1 
ATOM   1945 O O   . TRP A 1 247 ? -15.247 56.537 1.793  1.00 28.97 ? 247 TRP A O   1 
ATOM   1946 C CB  . TRP A 1 247 ? -14.943 57.832 4.965  1.00 27.61 ? 247 TRP A CB  1 
ATOM   1947 C CG  . TRP A 1 247 ? -13.448 57.707 4.690  1.00 23.19 ? 247 TRP A CG  1 
ATOM   1948 C CD1 . TRP A 1 247 ? -12.856 57.027 3.665  1.00 27.24 ? 247 TRP A CD1 1 
ATOM   1949 C CD2 . TRP A 1 247 ? -12.384 58.283 5.453  1.00 29.58 ? 247 TRP A CD2 1 
ATOM   1950 N NE1 . TRP A 1 247 ? -11.496 57.140 3.740  1.00 29.95 ? 247 TRP A NE1 1 
ATOM   1951 C CE2 . TRP A 1 247 ? -11.172 57.908 4.828  1.00 31.33 ? 247 TRP A CE2 1 
ATOM   1952 C CE3 . TRP A 1 247 ? -12.332 59.081 6.604  1.00 24.39 ? 247 TRP A CE3 1 
ATOM   1953 C CZ2 . TRP A 1 247 ? -9.911  58.304 5.318  1.00 23.65 ? 247 TRP A CZ2 1 
ATOM   1954 C CZ3 . TRP A 1 247 ? -11.070 59.472 7.098  1.00 28.45 ? 247 TRP A CZ3 1 
ATOM   1955 C CH2 . TRP A 1 247 ? -9.884  59.078 6.448  1.00 26.66 ? 247 TRP A CH2 1 
ATOM   1956 N N   . THR A 1 248 ? -15.972 58.593 2.342  1.00 32.69 ? 248 THR A N   1 
ATOM   1957 C CA  . THR A 1 248 ? -15.735 59.123 1.003  1.00 37.68 ? 248 THR A CA  1 
ATOM   1958 C C   . THR A 1 248 ? -14.539 60.019 1.296  1.00 35.19 ? 248 THR A C   1 
ATOM   1959 O O   . THR A 1 248 ? -14.635 60.989 2.055  1.00 39.21 ? 248 THR A O   1 
ATOM   1960 C CB  . THR A 1 248 ? -16.912 59.942 0.450  1.00 35.11 ? 248 THR A CB  1 
ATOM   1961 O OG1 . THR A 1 248 ? -17.052 61.155 1.191  1.00 42.42 ? 248 THR A OG1 1 
ATOM   1962 C CG2 . THR A 1 248 ? -18.184 59.143 0.547  1.00 27.95 ? 248 THR A CG2 1 
ATOM   1963 N N   . HIS A 1 249 ? -13.395 59.642 0.734  1.00 36.24 ? 249 HIS A N   1 
ATOM   1964 C CA  . HIS A 1 249 ? -12.140 60.343 0.964  1.00 35.14 ? 249 HIS A CA  1 
ATOM   1965 C C   . HIS A 1 249 ? -12.138 61.719 0.306  1.00 40.32 ? 249 HIS A C   1 
ATOM   1966 O O   . HIS A 1 249 ? -13.104 62.084 -0.376 1.00 39.98 ? 249 HIS A O   1 
ATOM   1967 C CB  . HIS A 1 249 ? -10.993 59.480 0.436  1.00 36.51 ? 249 HIS A CB  1 
ATOM   1968 C CG  . HIS A 1 249 ? -9.637  59.908 0.900  1.00 31.38 ? 249 HIS A CG  1 
ATOM   1969 N ND1 . HIS A 1 249 ? -8.486  59.567 0.224  1.00 30.02 ? 249 HIS A ND1 1 
ATOM   1970 C CD2 . HIS A 1 249 ? -9.245  60.635 1.973  1.00 30.02 ? 249 HIS A CD2 1 
ATOM   1971 C CE1 . HIS A 1 249 ? -7.442  60.070 0.860  1.00 37.34 ? 249 HIS A CE1 1 
ATOM   1972 N NE2 . HIS A 1 249 ? -7.875  60.722 1.924  1.00 34.09 ? 249 HIS A NE2 1 
ATOM   1973 N N   . GLU A 1 250 ? -11.063 62.473 0.528  1.00 40.74 ? 250 GLU A N   1 
ATOM   1974 C CA  . GLU A 1 250 ? -10.908 63.821 -0.029 1.00 46.55 ? 250 GLU A CA  1 
ATOM   1975 C C   . GLU A 1 250 ? -11.298 63.874 -1.497 1.00 45.80 ? 250 GLU A C   1 
ATOM   1976 O O   . GLU A 1 250 ? -12.199 64.622 -1.884 1.00 52.81 ? 250 GLU A O   1 
ATOM   1977 C CB  . GLU A 1 250 ? -9.462  64.294 0.099  1.00 47.80 ? 250 GLU A CB  1 
ATOM   1978 C CG  . GLU A 1 250 ? -9.247  65.798 -0.136 1.00 55.70 ? 250 GLU A CG  1 
ATOM   1979 C CD  . GLU A 1 250 ? -10.163 66.412 -1.200 1.00 59.37 ? 250 GLU A CD  1 
ATOM   1980 O OE1 . GLU A 1 250 ? -11.365 66.615 -0.898 1.00 59.03 ? 250 GLU A OE1 1 
ATOM   1981 O OE2 . GLU A 1 250 ? -9.686  66.690 -2.330 1.00 56.54 ? 250 GLU A OE2 1 
ATOM   1982 N N   . ASP A 1 251 ? -10.614 63.086 -2.318 1.00 45.40 ? 251 ASP A N   1 
ATOM   1983 C CA  . ASP A 1 251 ? -10.898 63.060 -3.747 1.00 45.82 ? 251 ASP A CA  1 
ATOM   1984 C C   . ASP A 1 251 ? -12.362 62.732 -4.048 1.00 46.08 ? 251 ASP A C   1 
ATOM   1985 O O   . ASP A 1 251 ? -12.752 62.603 -5.208 1.00 49.54 ? 251 ASP A O   1 
ATOM   1986 C CB  . ASP A 1 251 ? -9.991  62.048 -4.428 1.00 47.19 ? 251 ASP A CB  1 
ATOM   1987 C CG  . ASP A 1 251 ? -10.102 60.676 -3.819 1.00 45.52 ? 251 ASP A CG  1 
ATOM   1988 O OD1 . ASP A 1 251 ? -9.445  59.756 -4.342 1.00 45.24 ? 251 ASP A OD1 1 
ATOM   1989 O OD2 . ASP A 1 251 ? -10.843 60.525 -2.822 1.00 33.59 ? 251 ASP A OD2 1 
ATOM   1990 N N   . GLY A 1 252 ? -13.159 62.579 -2.996 1.00 44.88 ? 252 GLY A N   1 
ATOM   1991 C CA  . GLY A 1 252 ? -14.568 62.294 -3.159 1.00 41.42 ? 252 GLY A CA  1 
ATOM   1992 C C   . GLY A 1 252 ? -14.889 60.883 -3.597 1.00 42.08 ? 252 GLY A C   1 
ATOM   1993 O O   . GLY A 1 252 ? -16.011 60.603 -4.018 1.00 42.80 ? 252 GLY A O   1 
ATOM   1994 N N   . VAL A 1 253 ? -13.912 59.989 -3.524 1.00 37.70 ? 253 VAL A N   1 
ATOM   1995 C CA  . VAL A 1 253 ? -14.168 58.612 -3.912 1.00 33.98 ? 253 VAL A CA  1 
ATOM   1996 C C   . VAL A 1 253 ? -14.490 57.825 -2.645 1.00 35.67 ? 253 VAL A C   1 
ATOM   1997 O O   . VAL A 1 253 ? -13.798 57.959 -1.641 1.00 33.28 ? 253 VAL A O   1 
ATOM   1998 C CB  . VAL A 1 253 ? -12.939 57.978 -4.589 1.00 33.70 ? 253 VAL A CB  1 
ATOM   1999 C CG1 . VAL A 1 253 ? -13.221 56.507 -4.925 1.00 29.57 ? 253 VAL A CG1 1 
ATOM   2000 C CG2 . VAL A 1 253 ? -12.591 58.754 -5.853 1.00 34.16 ? 253 VAL A CG2 1 
ATOM   2001 N N   . LEU A 1 254 ? -15.543 57.018 -2.692 1.00 31.36 ? 254 LEU A N   1 
ATOM   2002 C CA  . LEU A 1 254 ? -15.917 56.203 -1.546 1.00 29.83 ? 254 LEU A CA  1 
ATOM   2003 C C   . LEU A 1 254 ? -14.892 55.074 -1.418 1.00 28.19 ? 254 LEU A C   1 
ATOM   2004 O O   . LEU A 1 254 ? -14.543 54.432 -2.407 1.00 29.92 ? 254 LEU A O   1 
ATOM   2005 C CB  . LEU A 1 254 ? -17.306 55.616 -1.754 1.00 28.64 ? 254 LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 254 ? -17.758 54.693 -0.626 1.00 32.05 ? 254 LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 254 ? -18.165 55.545 0.586  1.00 31.07 ? 254 LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 254 ? -18.902 53.862 -1.088 1.00 29.70 ? 254 LEU A CD2 1 
ATOM   2009 N N   . GLU A 1 255 ? -14.389 54.838 -0.211 1.00 31.29 ? 255 GLU A N   1 
ATOM   2010 C CA  . GLU A 1 255 ? -13.397 53.772 -0.018 1.00 27.66 ? 255 GLU A CA  1 
ATOM   2011 C C   . GLU A 1 255 ? -13.391 53.162 1.366  1.00 31.12 ? 255 GLU A C   1 
ATOM   2012 O O   . GLU A 1 255 ? -13.941 53.724 2.328  1.00 26.22 ? 255 GLU A O   1 
ATOM   2013 C CB  . GLU A 1 255 ? -11.983 54.283 -0.275 1.00 35.18 ? 255 GLU A CB  1 
ATOM   2014 C CG  . GLU A 1 255 ? -11.649 55.557 0.478  1.00 33.09 ? 255 GLU A CG  1 
ATOM   2015 C CD  . GLU A 1 255 ? -10.161 55.773 0.668  1.00 31.51 ? 255 GLU A CD  1 
ATOM   2016 O OE1 . GLU A 1 255 ? -9.383  55.550 -0.288 1.00 35.86 ? 255 GLU A OE1 1 
ATOM   2017 O OE2 . GLU A 1 255 ? -9.764  56.178 1.781  1.00 33.83 ? 255 GLU A OE2 1 
ATOM   2018 N N   . LEU A 1 256 ? -12.736 52.007 1.445  1.00 27.74 ? 256 LEU A N   1 
ATOM   2019 C CA  . LEU A 1 256 ? -12.545 51.292 2.697  1.00 25.07 ? 256 LEU A CA  1 
ATOM   2020 C C   . LEU A 1 256 ? -11.028 51.373 2.879  1.00 26.18 ? 256 LEU A C   1 
ATOM   2021 O O   . LEU A 1 256 ? -10.265 50.930 2.008  1.00 25.76 ? 256 LEU A O   1 
ATOM   2022 C CB  . LEU A 1 256 ? -12.984 49.836 2.563  1.00 26.95 ? 256 LEU A CB  1 
ATOM   2023 C CG  . LEU A 1 256 ? -12.741 48.987 3.815  1.00 26.37 ? 256 LEU A CG  1 
ATOM   2024 C CD1 . LEU A 1 256 ? -13.528 49.567 4.987  1.00 20.53 ? 256 LEU A CD1 1 
ATOM   2025 C CD2 . LEU A 1 256 ? -13.154 47.552 3.524  1.00 27.01 ? 256 LEU A CD2 1 
ATOM   2026 N N   . VAL A 1 257 ? -10.578 51.941 3.990  1.00 20.21 ? 257 VAL A N   1 
ATOM   2027 C CA  . VAL A 1 257 ? -9.153  52.089 4.207  1.00 19.02 ? 257 VAL A CA  1 
ATOM   2028 C C   . VAL A 1 257 ? -8.793  51.519 5.555  1.00 26.63 ? 257 VAL A C   1 
ATOM   2029 O O   . VAL A 1 257 ? -9.597  51.557 6.498  1.00 21.90 ? 257 VAL A O   1 
ATOM   2030 C CB  . VAL A 1 257 ? -8.728  53.582 4.166  1.00 21.12 ? 257 VAL A CB  1 
ATOM   2031 C CG1 . VAL A 1 257 ? -9.529  54.393 5.192  1.00 19.99 ? 257 VAL A CG1 1 
ATOM   2032 C CG2 . VAL A 1 257 ? -7.246  53.707 4.483  1.00 22.65 ? 257 VAL A CG2 1 
ATOM   2033 N N   . THR A 1 258 ? -7.586  50.974 5.623  1.00 20.34 ? 258 THR A N   1 
ATOM   2034 C CA  . THR A 1 258 ? -7.047  50.385 6.831  1.00 21.41 ? 258 THR A CA  1 
ATOM   2035 C C   . THR A 1 258 ? -5.550  50.649 6.746  1.00 20.75 ? 258 THR A C   1 
ATOM   2036 O O   . THR A 1 258 ? -4.986  50.636 5.656  1.00 22.89 ? 258 THR A O   1 
ATOM   2037 C CB  . THR A 1 258 ? -7.324  48.863 6.884  1.00 20.02 ? 258 THR A CB  1 
ATOM   2038 O OG1 . THR A 1 258 ? -6.926  48.358 8.160  1.00 19.91 ? 258 THR A OG1 1 
ATOM   2039 C CG2 . THR A 1 258 ? -6.546  48.146 5.841  1.00 23.83 ? 258 THR A CG2 1 
ATOM   2040 N N   . PRO A 1 259 ? -4.887  50.918 7.890  1.00 24.35 ? 259 PRO A N   1 
ATOM   2041 C CA  . PRO A 1 259 ? -3.436  51.188 7.870  1.00 18.95 ? 259 PRO A CA  1 
ATOM   2042 C C   . PRO A 1 259 ? -2.638  50.098 7.174  1.00 22.23 ? 259 PRO A C   1 
ATOM   2043 O O   . PRO A 1 259 ? -2.978  48.928 7.259  1.00 20.81 ? 259 PRO A O   1 
ATOM   2044 C CB  . PRO A 1 259 ? -3.076  51.302 9.348  1.00 24.27 ? 259 PRO A CB  1 
ATOM   2045 C CG  . PRO A 1 259 ? -4.378  51.873 9.958  1.00 25.65 ? 259 PRO A CG  1 
ATOM   2046 C CD  . PRO A 1 259 ? -5.436  51.038 9.256  1.00 20.13 ? 259 PRO A CD  1 
ATOM   2047 N N   . PRO A 1 260 ? -1.571  50.478 6.448  1.00 23.81 ? 260 PRO A N   1 
ATOM   2048 C CA  . PRO A 1 260 ? -0.733  49.516 5.743  1.00 25.69 ? 260 PRO A CA  1 
ATOM   2049 C C   . PRO A 1 260 ? 0.220   48.743 6.680  1.00 22.99 ? 260 PRO A C   1 
ATOM   2050 O O   . PRO A 1 260 ? 0.528   49.175 7.788  1.00 22.40 ? 260 PRO A O   1 
ATOM   2051 C CB  . PRO A 1 260 ? 0.018   50.402 4.727  1.00 22.34 ? 260 PRO A CB  1 
ATOM   2052 C CG  . PRO A 1 260 ? 0.228   51.655 5.482  1.00 20.53 ? 260 PRO A CG  1 
ATOM   2053 C CD  . PRO A 1 260 ? -1.151  51.859 6.134  1.00 23.54 ? 260 PRO A CD  1 
ATOM   2054 N N   . LEU A 1 261 ? 0.665   47.583 6.230  1.00 19.86 ? 261 LEU A N   1 
ATOM   2055 C CA  . LEU A 1 261 ? 1.587   46.768 7.004  1.00 24.84 ? 261 LEU A CA  1 
ATOM   2056 C C   . LEU A 1 261 ? 3.000   47.333 6.871  1.00 27.54 ? 261 LEU A C   1 
ATOM   2057 O O   . LEU A 1 261 ? 3.790   46.873 6.041  1.00 32.76 ? 261 LEU A O   1 
ATOM   2058 C CB  . LEU A 1 261 ? 1.530   45.337 6.486  1.00 23.56 ? 261 LEU A CB  1 
ATOM   2059 C CG  . LEU A 1 261 ? 0.126   44.729 6.536  1.00 21.32 ? 261 LEU A CG  1 
ATOM   2060 C CD1 . LEU A 1 261 ? 0.175   43.311 5.984  1.00 17.89 ? 261 LEU A CD1 1 
ATOM   2061 C CD2 . LEU A 1 261 ? -0.383  44.705 7.982  1.00 21.30 ? 261 LEU A CD2 1 
ATOM   2062 N N   . ASN A 1 262 ? 3.318   48.332 7.690  1.00 30.52 ? 262 ASN A N   1 
ATOM   2063 C CA  . ASN A 1 262 ? 4.621   48.974 7.643  1.00 29.28 ? 262 ASN A CA  1 
ATOM   2064 C C   . ASN A 1 262 ? 5.471   48.761 8.870  1.00 28.25 ? 262 ASN A C   1 
ATOM   2065 O O   . ASN A 1 262 ? 6.425   49.509 9.085  1.00 29.92 ? 262 ASN A O   1 
ATOM   2066 C CB  . ASN A 1 262 ? 4.489   50.482 7.408  1.00 35.92 ? 262 ASN A CB  1 
ATOM   2067 C CG  . ASN A 1 262 ? 3.652   51.176 8.469  1.00 36.41 ? 262 ASN A CG  1 
ATOM   2068 O OD1 . ASN A 1 262 ? 3.650   50.788 9.643  1.00 36.54 ? 262 ASN A OD1 1 
ATOM   2069 N ND2 . ASN A 1 262 ? 2.940   52.222 8.059  1.00 41.32 ? 262 ASN A ND2 1 
ATOM   2070 N N   . GLY A 1 263 ? 5.134   47.760 9.680  1.00 27.08 ? 263 GLY A N   1 
ATOM   2071 C CA  . GLY A 1 263 ? 5.945   47.484 10.855 1.00 30.22 ? 263 GLY A CA  1 
ATOM   2072 C C   . GLY A 1 263 ? 5.288   47.678 12.209 1.00 28.39 ? 263 GLY A C   1 
ATOM   2073 O O   . GLY A 1 263 ? 5.675   47.036 13.198 1.00 29.39 ? 263 GLY A O   1 
ATOM   2074 N N   . VAL A 1 264 ? 4.310   48.570 12.274 1.00 26.91 ? 264 VAL A N   1 
ATOM   2075 C CA  . VAL A 1 264 ? 3.629   48.832 13.544 1.00 30.12 ? 264 VAL A CA  1 
ATOM   2076 C C   . VAL A 1 264 ? 2.245   48.190 13.618 1.00 30.43 ? 264 VAL A C   1 
ATOM   2077 O O   . VAL A 1 264 ? 1.574   48.281 14.643 1.00 35.72 ? 264 VAL A O   1 
ATOM   2078 C CB  . VAL A 1 264 ? 3.483   50.359 13.802 1.00 27.49 ? 264 VAL A CB  1 
ATOM   2079 C CG1 . VAL A 1 264 ? 4.848   51.016 13.818 1.00 33.43 ? 264 VAL A CG1 1 
ATOM   2080 C CG2 . VAL A 1 264 ? 2.619   50.984 12.737 1.00 26.82 ? 264 VAL A CG2 1 
ATOM   2081 N N   . ILE A 1 265 ? 1.818   47.551 12.532 1.00 28.86 ? 265 ILE A N   1 
ATOM   2082 C CA  . ILE A 1 265 ? 0.509   46.906 12.471 1.00 27.91 ? 265 ILE A CA  1 
ATOM   2083 C C   . ILE A 1 265 ? 0.646   45.385 12.490 1.00 28.05 ? 265 ILE A C   1 
ATOM   2084 O O   . ILE A 1 265 ? 1.523   44.816 11.847 1.00 24.05 ? 265 ILE A O   1 
ATOM   2085 C CB  . ILE A 1 265 ? -0.263  47.296 11.160 1.00 29.09 ? 265 ILE A CB  1 
ATOM   2086 C CG1 . ILE A 1 265 ? -0.427  48.813 11.056 1.00 31.68 ? 265 ILE A CG1 1 
ATOM   2087 C CG2 . ILE A 1 265 ? -1.643  46.660 11.149 1.00 26.45 ? 265 ILE A CG2 1 
ATOM   2088 C CD1 . ILE A 1 265 ? -1.267  49.436 12.193 1.00 33.90 ? 265 ILE A CD1 1 
ATOM   2089 N N   . LEU A 1 266 ? -0.225  44.729 13.242 1.00 24.38 ? 266 LEU A N   1 
ATOM   2090 C CA  . LEU A 1 266 ? -0.230  43.276 13.288 1.00 22.44 ? 266 LEU A CA  1 
ATOM   2091 C C   . LEU A 1 266 ? -1.059  42.835 12.073 1.00 18.35 ? 266 LEU A C   1 
ATOM   2092 O O   . LEU A 1 266 ? -2.182  43.285 11.914 1.00 19.69 ? 266 LEU A O   1 
ATOM   2093 C CB  . LEU A 1 266 ? -0.897  42.811 14.578 1.00 18.85 ? 266 LEU A CB  1 
ATOM   2094 C CG  . LEU A 1 266 ? -0.775  41.356 15.049 1.00 24.24 ? 266 LEU A CG  1 
ATOM   2095 C CD1 . LEU A 1 266 ? -1.587  40.464 14.170 1.00 24.18 ? 266 LEU A CD1 1 
ATOM   2096 C CD2 . LEU A 1 266 ? 0.675   40.928 15.085 1.00 18.95 ? 266 LEU A CD2 1 
ATOM   2097 N N   . PRO A 1 267 ? -0.513  41.962 11.199 1.00 22.29 ? 267 PRO A N   1 
ATOM   2098 C CA  . PRO A 1 267 ? -1.266  41.508 10.009 1.00 21.61 ? 267 PRO A CA  1 
ATOM   2099 C C   . PRO A 1 267 ? -2.419  40.569 10.379 1.00 18.89 ? 267 PRO A C   1 
ATOM   2100 O O   . PRO A 1 267 ? -2.286  39.348 10.324 1.00 15.56 ? 267 PRO A O   1 
ATOM   2101 C CB  . PRO A 1 267 ? -0.212  40.794 9.160  1.00 20.54 ? 267 PRO A CB  1 
ATOM   2102 C CG  . PRO A 1 267 ? 1.097   41.278 9.690  1.00 23.90 ? 267 PRO A CG  1 
ATOM   2103 C CD  . PRO A 1 267 ? 0.858   41.430 11.175 1.00 19.99 ? 267 PRO A CD  1 
ATOM   2104 N N   . GLY A 1 268 ? -3.549  41.158 10.752 1.00 21.14 ? 268 GLY A N   1 
ATOM   2105 C CA  . GLY A 1 268 ? -4.695  40.375 11.159 1.00 19.25 ? 268 GLY A CA  1 
ATOM   2106 C C   . GLY A 1 268 ? -5.258  39.458 10.088 1.00 22.13 ? 268 GLY A C   1 
ATOM   2107 O O   . GLY A 1 268 ? -5.307  39.831 8.913  1.00 22.03 ? 268 GLY A O   1 
ATOM   2108 N N   . VAL A 1 269 ? -5.686  38.267 10.500 1.00 22.45 ? 269 VAL A N   1 
ATOM   2109 C CA  . VAL A 1 269 ? -6.290  37.295 9.582  1.00 25.95 ? 269 VAL A CA  1 
ATOM   2110 C C   . VAL A 1 269 ? -7.672  37.812 9.171  1.00 21.79 ? 269 VAL A C   1 
ATOM   2111 O O   . VAL A 1 269 ? -8.042  37.725 8.001  1.00 24.65 ? 269 VAL A O   1 
ATOM   2112 C CB  . VAL A 1 269 ? -6.445  35.875 10.242 1.00 26.22 ? 269 VAL A CB  1 
ATOM   2113 C CG1 . VAL A 1 269 ? -7.197  34.946 9.304  1.00 26.16 ? 269 VAL A CG1 1 
ATOM   2114 C CG2 . VAL A 1 269 ? -5.091  35.281 10.532 1.00 24.88 ? 269 VAL A CG2 1 
ATOM   2115 N N   . VAL A 1 270 ? -8.423  38.372 10.117 1.00 17.64 ? 270 VAL A N   1 
ATOM   2116 C CA  . VAL A 1 270 ? -9.746  38.912 9.791  1.00 21.08 ? 270 VAL A CA  1 
ATOM   2117 C C   . VAL A 1 270 ? -9.523  40.122 8.874  1.00 25.02 ? 270 VAL A C   1 
ATOM   2118 O O   . VAL A 1 270 ? -10.196 40.270 7.839  1.00 18.47 ? 270 VAL A O   1 
ATOM   2119 C CB  . VAL A 1 270 ? -10.539 39.337 11.055 1.00 21.48 ? 270 VAL A CB  1 
ATOM   2120 C CG1 . VAL A 1 270 ? -11.860 39.969 10.648 1.00 21.18 ? 270 VAL A CG1 1 
ATOM   2121 C CG2 . VAL A 1 270 ? -10.793 38.121 11.946 1.00 18.62 ? 270 VAL A CG2 1 
ATOM   2122 N N   . ARG A 1 271 ? -8.565  40.971 9.255  1.00 22.56 ? 271 ARG A N   1 
ATOM   2123 C CA  . ARG A 1 271 ? -8.197  42.133 8.463  1.00 23.52 ? 271 ARG A CA  1 
ATOM   2124 C C   . ARG A 1 271 ? -7.988  41.735 6.992  1.00 24.14 ? 271 ARG A C   1 
ATOM   2125 O O   . ARG A 1 271 ? -8.631  42.289 6.104  1.00 24.95 ? 271 ARG A O   1 
ATOM   2126 C CB  . ARG A 1 271 ? -6.897  42.765 9.007  1.00 24.77 ? 271 ARG A CB  1 
ATOM   2127 C CG  . ARG A 1 271 ? -6.298  43.869 8.115  1.00 20.32 ? 271 ARG A CG  1 
ATOM   2128 C CD  . ARG A 1 271 ? -4.892  44.259 8.597  1.00 22.63 ? 271 ARG A CD  1 
ATOM   2129 N NE  . ARG A 1 271 ? -4.257  45.295 7.774  1.00 23.34 ? 271 ARG A NE  1 
ATOM   2130 C CZ  . ARG A 1 271 ? -3.659  45.095 6.598  1.00 14.79 ? 271 ARG A CZ  1 
ATOM   2131 N NH1 . ARG A 1 271 ? -3.584  43.885 6.060  1.00 18.49 ? 271 ARG A NH1 1 
ATOM   2132 N NH2 . ARG A 1 271 ? -3.129  46.122 5.964  1.00 21.37 ? 271 ARG A NH2 1 
ATOM   2133 N N   . GLN A 1 272 ? -7.100  40.773 6.736  1.00 24.69 ? 272 GLN A N   1 
ATOM   2134 C CA  . GLN A 1 272 ? -6.840  40.338 5.361  1.00 24.18 ? 272 GLN A CA  1 
ATOM   2135 C C   . GLN A 1 272 ? -8.105  39.792 4.675  1.00 23.62 ? 272 GLN A C   1 
ATOM   2136 O O   . GLN A 1 272 ? -8.314  39.986 3.462  1.00 21.30 ? 272 GLN A O   1 
ATOM   2137 C CB  . GLN A 1 272 ? -5.727  39.283 5.327  1.00 23.24 ? 272 GLN A CB  1 
ATOM   2138 C CG  . GLN A 1 272 ? -5.259  38.912 3.911  1.00 26.24 ? 272 GLN A CG  1 
ATOM   2139 C CD  . GLN A 1 272 ? -4.723  40.115 3.145  1.00 30.62 ? 272 GLN A CD  1 
ATOM   2140 O OE1 . GLN A 1 272 ? -5.297  40.540 2.137  1.00 35.09 ? 272 GLN A OE1 1 
ATOM   2141 N NE2 . GLN A 1 272 ? -3.627  40.677 3.626  1.00 32.12 ? 272 GLN A NE2 1 
ATOM   2142 N N   . SER A 1 273 ? -8.953  39.127 5.445  1.00 20.14 ? 273 SER A N   1 
ATOM   2143 C CA  . SER A 1 273 ? -10.172 38.554 4.895  1.00 22.30 ? 273 SER A CA  1 
ATOM   2144 C C   . SER A 1 273 ? -11.135 39.646 4.476  1.00 26.68 ? 273 SER A C   1 
ATOM   2145 O O   . SER A 1 273 ? -11.786 39.533 3.428  1.00 23.14 ? 273 SER A O   1 
ATOM   2146 C CB  . SER A 1 273 ? -10.840 37.634 5.919  1.00 22.20 ? 273 SER A CB  1 
ATOM   2147 O OG  . SER A 1 273 ? -9.940  36.624 6.320  1.00 22.89 ? 273 SER A OG  1 
ATOM   2148 N N   . LEU A 1 274 ? -11.219 40.704 5.280  1.00 24.36 ? 274 LEU A N   1 
ATOM   2149 C CA  . LEU A 1 274 ? -12.126 41.801 4.959  1.00 25.23 ? 274 LEU A CA  1 
ATOM   2150 C C   . LEU A 1 274 ? -11.672 42.512 3.684  1.00 23.91 ? 274 LEU A C   1 
ATOM   2151 O O   . LEU A 1 274 ? -12.498 42.846 2.825  1.00 21.69 ? 274 LEU A O   1 
ATOM   2152 C CB  . LEU A 1 274 ? -12.234 42.792 6.122  1.00 22.43 ? 274 LEU A CB  1 
ATOM   2153 C CG  . LEU A 1 274 ? -12.887 42.238 7.392  1.00 25.02 ? 274 LEU A CG  1 
ATOM   2154 C CD1 . LEU A 1 274 ? -13.129 43.408 8.378  1.00 25.80 ? 274 LEU A CD1 1 
ATOM   2155 C CD2 . LEU A 1 274 ? -14.191 41.531 7.045  1.00 16.54 ? 274 LEU A CD2 1 
ATOM   2156 N N   . LEU A 1 275 ? -10.368 42.737 3.557  1.00 24.37 ? 275 LEU A N   1 
ATOM   2157 C CA  . LEU A 1 275 ? -9.831  43.374 2.355  1.00 23.82 ? 275 LEU A CA  1 
ATOM   2158 C C   . LEU A 1 275 ? -10.139 42.476 1.142  1.00 27.73 ? 275 LEU A C   1 
ATOM   2159 O O   . LEU A 1 275 ? -10.669 42.960 0.132  1.00 25.58 ? 275 LEU A O   1 
ATOM   2160 C CB  . LEU A 1 275 ? -8.315  43.590 2.483  1.00 18.17 ? 275 LEU A CB  1 
ATOM   2161 C CG  . LEU A 1 275 ? -7.823  44.607 3.513  1.00 18.89 ? 275 LEU A CG  1 
ATOM   2162 C CD1 . LEU A 1 275 ? -6.288  44.549 3.623  1.00 19.10 ? 275 LEU A CD1 1 
ATOM   2163 C CD2 . LEU A 1 275 ? -8.294  46.005 3.114  1.00 22.54 ? 275 LEU A CD2 1 
ATOM   2164 N N   . ASP A 1 276 ? -9.833  41.177 1.261  1.00 24.33 ? 276 ASP A N   1 
ATOM   2165 C CA  . ASP A 1 276 ? -10.084 40.201 0.190  1.00 28.40 ? 276 ASP A CA  1 
ATOM   2166 C C   . ASP A 1 276 ? -11.545 40.230 -0.244 1.00 31.13 ? 276 ASP A C   1 
ATOM   2167 O O   . ASP A 1 276 ? -11.863 40.335 -1.434 1.00 31.38 ? 276 ASP A O   1 
ATOM   2168 C CB  . ASP A 1 276 ? -9.760  38.776 0.666  1.00 26.70 ? 276 ASP A CB  1 
ATOM   2169 C CG  . ASP A 1 276 ? -8.286  38.560 0.931  1.00 28.44 ? 276 ASP A CG  1 
ATOM   2170 O OD1 . ASP A 1 276 ? -7.940  37.503 1.500  1.00 27.85 ? 276 ASP A OD1 1 
ATOM   2171 O OD2 . ASP A 1 276 ? -7.470  39.428 0.565  1.00 27.59 ? 276 ASP A OD2 1 
ATOM   2172 N N   . MET A 1 277 ? -12.431 40.134 0.741  1.00 27.74 ? 277 MET A N   1 
ATOM   2173 C CA  . MET A 1 277 ? -13.868 40.140 0.508  1.00 28.79 ? 277 MET A CA  1 
ATOM   2174 C C   . MET A 1 277 ? -14.322 41.428 -0.196 1.00 30.13 ? 277 MET A C   1 
ATOM   2175 O O   . MET A 1 277 ? -14.966 41.377 -1.249 1.00 26.20 ? 277 MET A O   1 
ATOM   2176 C CB  . MET A 1 277 ? -14.589 39.985 1.853  1.00 31.19 ? 277 MET A CB  1 
ATOM   2177 C CG  . MET A 1 277 ? -15.901 39.272 1.784  1.00 37.02 ? 277 MET A CG  1 
ATOM   2178 S SD  . MET A 1 277 ? -16.520 38.988 3.431  1.00 36.27 ? 277 MET A SD  1 
ATOM   2179 C CE  . MET A 1 277 ? -15.750 37.509 3.823  1.00 40.31 ? 277 MET A CE  1 
ATOM   2180 N N   . ALA A 1 278 ? -13.981 42.582 0.372  1.00 29.11 ? 278 ALA A N   1 
ATOM   2181 C CA  . ALA A 1 278 ? -14.382 43.860 -0.221 1.00 30.57 ? 278 ALA A CA  1 
ATOM   2182 C C   . ALA A 1 278 ? -13.786 44.063 -1.609 1.00 33.87 ? 278 ALA A C   1 
ATOM   2183 O O   . ALA A 1 278 ? -14.412 44.669 -2.471 1.00 32.61 ? 278 ALA A O   1 
ATOM   2184 C CB  . ALA A 1 278 ? -13.986 45.010 0.674  1.00 22.12 ? 278 ALA A CB  1 
ATOM   2185 N N   . GLN A 1 279 ? -12.571 43.567 -1.814 1.00 36.17 ? 279 GLN A N   1 
ATOM   2186 C CA  . GLN A 1 279 ? -11.913 43.672 -3.104 1.00 37.54 ? 279 GLN A CA  1 
ATOM   2187 C C   . GLN A 1 279 ? -12.642 42.788 -4.127 1.00 36.39 ? 279 GLN A C   1 
ATOM   2188 O O   . GLN A 1 279 ? -12.754 43.156 -5.293 1.00 38.72 ? 279 GLN A O   1 
ATOM   2189 C CB  . GLN A 1 279 ? -10.448 43.246 -2.971 1.00 40.89 ? 279 GLN A CB  1 
ATOM   2190 C CG  . GLN A 1 279 ? -9.602  43.400 -4.236 1.00 47.36 ? 279 GLN A CG  1 
ATOM   2191 C CD  . GLN A 1 279 ? -9.525  44.836 -4.734 1.00 52.06 ? 279 GLN A CD  1 
ATOM   2192 O OE1 . GLN A 1 279 ? -9.118  45.745 -4.006 1.00 53.09 ? 279 GLN A OE1 1 
ATOM   2193 N NE2 . GLN A 1 279 ? -9.911  45.045 -5.989 1.00 58.16 ? 279 GLN A NE2 1 
ATOM   2194 N N   . THR A 1 280 ? -13.143 41.633 -3.685 1.00 38.49 ? 280 THR A N   1 
ATOM   2195 C CA  . THR A 1 280 ? -13.877 40.711 -4.553 1.00 38.56 ? 280 THR A CA  1 
ATOM   2196 C C   . THR A 1 280 ? -15.181 41.335 -5.059 1.00 38.97 ? 280 THR A C   1 
ATOM   2197 O O   . THR A 1 280 ? -15.499 41.225 -6.246 1.00 37.62 ? 280 THR A O   1 
ATOM   2198 C CB  . THR A 1 280 ? -14.181 39.373 -3.823 1.00 40.61 ? 280 THR A CB  1 
ATOM   2199 O OG1 . THR A 1 280 ? -12.965 38.631 -3.694 1.00 35.71 ? 280 THR A OG1 1 
ATOM   2200 C CG2 . THR A 1 280 ? -15.203 38.528 -4.600 1.00 39.94 ? 280 THR A CG2 1 
ATOM   2201 N N   . TRP A 1 281 ? -15.925 41.997 -4.178 1.00 34.04 ? 281 TRP A N   1 
ATOM   2202 C CA  . TRP A 1 281 ? -17.180 42.630 -4.577 1.00 33.02 ? 281 TRP A CA  1 
ATOM   2203 C C   . TRP A 1 281 ? -16.978 43.605 -5.732 1.00 35.69 ? 281 TRP A C   1 
ATOM   2204 O O   . TRP A 1 281 ? -17.795 43.667 -6.650 1.00 38.49 ? 281 TRP A O   1 
ATOM   2205 C CB  . TRP A 1 281 ? -17.802 43.398 -3.421 1.00 29.35 ? 281 TRP A CB  1 
ATOM   2206 C CG  . TRP A 1 281 ? -18.105 42.581 -2.224 1.00 31.83 ? 281 TRP A CG  1 
ATOM   2207 C CD1 . TRP A 1 281 ? -18.393 41.246 -2.184 1.00 29.51 ? 281 TRP A CD1 1 
ATOM   2208 C CD2 . TRP A 1 281 ? -18.251 43.067 -0.886 1.00 33.57 ? 281 TRP A CD2 1 
ATOM   2209 N NE1 . TRP A 1 281 ? -18.710 40.871 -0.900 1.00 28.38 ? 281 TRP A NE1 1 
ATOM   2210 C CE2 . TRP A 1 281 ? -18.633 41.968 -0.082 1.00 32.50 ? 281 TRP A CE2 1 
ATOM   2211 C CE3 . TRP A 1 281 ? -18.099 44.330 -0.288 1.00 31.06 ? 281 TRP A CE3 1 
ATOM   2212 C CZ2 . TRP A 1 281 ? -18.867 42.089 1.296  1.00 31.42 ? 281 TRP A CZ2 1 
ATOM   2213 C CZ3 . TRP A 1 281 ? -18.331 44.453 1.087  1.00 29.82 ? 281 TRP A CZ3 1 
ATOM   2214 C CH2 . TRP A 1 281 ? -18.712 43.335 1.861  1.00 33.56 ? 281 TRP A CH2 1 
ATOM   2215 N N   . GLY A 1 282 ? -15.894 44.370 -5.673 1.00 35.54 ? 282 GLY A N   1 
ATOM   2216 C CA  . GLY A 1 282 ? -15.604 45.332 -6.720 1.00 37.05 ? 282 GLY A CA  1 
ATOM   2217 C C   . GLY A 1 282 ? -16.629 46.441 -6.783 1.00 40.09 ? 282 GLY A C   1 
ATOM   2218 O O   . GLY A 1 282 ? -16.939 46.948 -7.864 1.00 44.25 ? 282 GLY A O   1 
ATOM   2219 N N   . GLU A 1 283 ? -17.151 46.836 -5.627 1.00 37.61 ? 283 GLU A N   1 
ATOM   2220 C CA  . GLU A 1 283 ? -18.164 47.874 -5.573 1.00 34.58 ? 283 GLU A CA  1 
ATOM   2221 C C   . GLU A 1 283 ? -17.627 49.238 -5.182 1.00 36.18 ? 283 GLU A C   1 
ATOM   2222 O O   . GLU A 1 283 ? -18.266 50.254 -5.449 1.00 35.00 ? 283 GLU A O   1 
ATOM   2223 C CB  . GLU A 1 283 ? -19.279 47.452 -4.622 1.00 35.64 ? 283 GLU A CB  1 
ATOM   2224 C CG  . GLU A 1 283 ? -20.186 46.388 -5.202 1.00 35.79 ? 283 GLU A CG  1 
ATOM   2225 C CD  . GLU A 1 283 ? -21.102 45.791 -4.163 1.00 34.41 ? 283 GLU A CD  1 
ATOM   2226 O OE1 . GLU A 1 283 ? -21.651 46.559 -3.337 1.00 40.89 ? 283 GLU A OE1 1 
ATOM   2227 O OE2 . GLU A 1 283 ? -21.269 44.553 -4.176 1.00 34.18 ? 283 GLU A OE2 1 
ATOM   2228 N N   . PHE A 1 284 ? -16.456 49.262 -4.552 1.00 33.67 ? 284 PHE A N   1 
ATOM   2229 C CA  . PHE A 1 284 ? -15.832 50.517 -4.149 1.00 31.93 ? 284 PHE A CA  1 
ATOM   2230 C C   . PHE A 1 284 ? -14.328 50.359 -3.971 1.00 33.81 ? 284 PHE A C   1 
ATOM   2231 O O   . PHE A 1 284 ? -13.800 49.244 -3.931 1.00 33.74 ? 284 PHE A O   1 
ATOM   2232 C CB  . PHE A 1 284 ? -16.440 51.035 -2.846 1.00 35.32 ? 284 PHE A CB  1 
ATOM   2233 C CG  . PHE A 1 284 ? -16.518 50.003 -1.761 1.00 34.44 ? 284 PHE A CG  1 
ATOM   2234 C CD1 . PHE A 1 284 ? -17.723 49.359 -1.482 1.00 35.51 ? 284 PHE A CD1 1 
ATOM   2235 C CD2 . PHE A 1 284 ? -15.391 49.663 -1.027 1.00 32.07 ? 284 PHE A CD2 1 
ATOM   2236 C CE1 . PHE A 1 284 ? -17.803 48.401 -0.494 1.00 30.40 ? 284 PHE A CE1 1 
ATOM   2237 C CE2 . PHE A 1 284 ? -15.463 48.705 -0.035 1.00 33.10 ? 284 PHE A CE2 1 
ATOM   2238 C CZ  . PHE A 1 284 ? -16.668 48.069 0.235  1.00 34.71 ? 284 PHE A CZ  1 
ATOM   2239 N N   . ARG A 1 285 ? -13.638 51.484 -3.846 1.00 32.03 ? 285 ARG A N   1 
ATOM   2240 C CA  . ARG A 1 285 ? -12.197 51.462 -3.680 1.00 30.46 ? 285 ARG A CA  1 
ATOM   2241 C C   . ARG A 1 285 ? -11.779 50.859 -2.329 1.00 31.67 ? 285 ARG A C   1 
ATOM   2242 O O   . ARG A 1 285 ? -12.326 51.213 -1.272 1.00 27.14 ? 285 ARG A O   1 
ATOM   2243 C CB  . ARG A 1 285 ? -11.646 52.879 -3.786 1.00 34.29 ? 285 ARG A CB  1 
ATOM   2244 C CG  . ARG A 1 285 ? -10.129 52.947 -3.593 1.00 35.52 ? 285 ARG A CG  1 
ATOM   2245 C CD  . ARG A 1 285 ? -9.705  54.323 -3.057 1.00 37.98 ? 285 ARG A CD  1 
ATOM   2246 N NE  . ARG A 1 285 ? -9.792  55.344 -4.077 1.00 37.07 ? 285 ARG A NE  1 
ATOM   2247 C CZ  . ARG A 1 285 ? -9.815  56.651 -3.854 1.00 34.73 ? 285 ARG A CZ  1 
ATOM   2248 N NH1 . ARG A 1 285 ? -9.764  57.138 -2.624 1.00 26.58 ? 285 ARG A NH1 1 
ATOM   2249 N NH2 . ARG A 1 285 ? -9.889  57.476 -4.885 1.00 37.30 ? 285 ARG A NH2 1 
ATOM   2250 N N   . VAL A 1 286 ? -10.814 49.944 -2.377 1.00 31.48 ? 286 VAL A N   1 
ATOM   2251 C CA  . VAL A 1 286 ? -10.277 49.293 -1.176 1.00 29.03 ? 286 VAL A CA  1 
ATOM   2252 C C   . VAL A 1 286 ? -8.757  49.564 -1.186 1.00 27.68 ? 286 VAL A C   1 
ATOM   2253 O O   . VAL A 1 286 ? -8.066  49.210 -2.147 1.00 28.88 ? 286 VAL A O   1 
ATOM   2254 C CB  . VAL A 1 286 ? -10.565 47.773 -1.200 1.00 25.65 ? 286 VAL A CB  1 
ATOM   2255 C CG1 . VAL A 1 286 ? -9.912  47.071 0.012  1.00 24.53 ? 286 VAL A CG1 1 
ATOM   2256 C CG2 . VAL A 1 286 ? -12.055 47.544 -1.206 1.00 25.98 ? 286 VAL A CG2 1 
ATOM   2257 N N   . VAL A 1 287 ? -8.244  50.209 -0.134 1.00 24.33 ? 287 VAL A N   1 
ATOM   2258 C CA  . VAL A 1 287 ? -6.815  50.547 -0.038 1.00 26.84 ? 287 VAL A CA  1 
ATOM   2259 C C   . VAL A 1 287 ? -6.174  50.429 1.362  1.00 26.24 ? 287 VAL A C   1 
ATOM   2260 O O   . VAL A 1 287 ? -6.842  50.495 2.397  1.00 27.44 ? 287 VAL A O   1 
ATOM   2261 C CB  . VAL A 1 287 ? -6.541  52.012 -0.460 1.00 23.15 ? 287 VAL A CB  1 
ATOM   2262 C CG1 . VAL A 1 287 ? -7.132  52.311 -1.842 1.00 32.49 ? 287 VAL A CG1 1 
ATOM   2263 C CG2 . VAL A 1 287 ? -7.102  52.950 0.584  1.00 25.07 ? 287 VAL A CG2 1 
ATOM   2264 N N   . GLU A 1 288 ? -4.861  50.290 1.378  1.00 27.63 ? 288 GLU A N   1 
ATOM   2265 C CA  . GLU A 1 288 ? -4.120  50.242 2.623  1.00 26.09 ? 288 GLU A CA  1 
ATOM   2266 C C   . GLU A 1 288 ? -3.359  51.562 2.602  1.00 28.73 ? 288 GLU A C   1 
ATOM   2267 O O   . GLU A 1 288 ? -2.555  51.820 1.701  1.00 26.09 ? 288 GLU A O   1 
ATOM   2268 C CB  . GLU A 1 288 ? -3.195  49.029 2.649  1.00 23.70 ? 288 GLU A CB  1 
ATOM   2269 C CG  . GLU A 1 288 ? -3.966  47.737 2.529  1.00 27.74 ? 288 GLU A CG  1 
ATOM   2270 C CD  . GLU A 1 288 ? -3.100  46.491 2.497  1.00 30.29 ? 288 GLU A CD  1 
ATOM   2271 O OE1 . GLU A 1 288 ? -2.409  46.207 3.491  1.00 33.65 ? 288 GLU A OE1 1 
ATOM   2272 O OE2 . GLU A 1 288 ? -3.126  45.783 1.471  1.00 30.63 ? 288 GLU A OE2 1 
ATOM   2273 N N   . ARG A 1 289 ? -3.673  52.431 3.556  1.00 24.47 ? 289 ARG A N   1 
ATOM   2274 C CA  . ARG A 1 289 ? -3.028  53.725 3.624  1.00 19.90 ? 289 ARG A CA  1 
ATOM   2275 C C   . ARG A 1 289 ? -3.076  54.207 5.041  1.00 20.94 ? 289 ARG A C   1 
ATOM   2276 O O   . ARG A 1 289 ? -3.991  53.869 5.777  1.00 22.04 ? 289 ARG A O   1 
ATOM   2277 C CB  . ARG A 1 289 ? -3.760  54.748 2.747  1.00 25.79 ? 289 ARG A CB  1 
ATOM   2278 C CG  . ARG A 1 289 ? -3.112  56.154 2.775  1.00 22.90 ? 289 ARG A CG  1 
ATOM   2279 C CD  . ARG A 1 289 ? -4.102  57.253 2.481  1.00 25.31 ? 289 ARG A CD  1 
ATOM   2280 N NE  . ARG A 1 289 ? -4.922  56.849 1.363  1.00 36.25 ? 289 ARG A NE  1 
ATOM   2281 C CZ  . ARG A 1 289 ? -6.236  56.992 1.311  1.00 25.78 ? 289 ARG A CZ  1 
ATOM   2282 N NH1 . ARG A 1 289 ? -6.896  57.556 2.313  1.00 30.39 ? 289 ARG A NH1 1 
ATOM   2283 N NH2 . ARG A 1 289 ? -6.889  56.490 0.283  1.00 31.35 ? 289 ARG A NH2 1 
ATOM   2284 N N   . THR A 1 290 ? -2.102  55.021 5.418  1.00 27.51 ? 290 THR A N   1 
ATOM   2285 C CA  . THR A 1 290 ? -2.063  55.587 6.750  1.00 27.64 ? 290 THR A CA  1 
ATOM   2286 C C   . THR A 1 290 ? -3.323  56.447 6.904  1.00 28.58 ? 290 THR A C   1 
ATOM   2287 O O   . THR A 1 290 ? -3.826  57.012 5.926  1.00 28.39 ? 290 THR A O   1 
ATOM   2288 C CB  . THR A 1 290 ? -0.800  56.435 6.916  1.00 28.64 ? 290 THR A CB  1 
ATOM   2289 O OG1 . THR A 1 290 ? 0.249   55.611 7.444  1.00 33.61 ? 290 THR A OG1 1 
ATOM   2290 C CG2 . THR A 1 290 ? -1.046  57.609 7.844  1.00 33.69 ? 290 THR A CG2 1 
ATOM   2291 N N   . ILE A 1 291 ? -3.853  56.511 8.118  1.00 26.12 ? 291 ILE A N   1 
ATOM   2292 C CA  . ILE A 1 291 ? -5.049  57.306 8.413  1.00 26.10 ? 291 ILE A CA  1 
ATOM   2293 C C   . ILE A 1 291 ? -4.699  58.226 9.577  1.00 25.43 ? 291 ILE A C   1 
ATOM   2294 O O   . ILE A 1 291 ? -4.233  57.764 10.622 1.00 27.11 ? 291 ILE A O   1 
ATOM   2295 C CB  . ILE A 1 291 ? -6.240  56.406 8.818  1.00 28.22 ? 291 ILE A CB  1 
ATOM   2296 C CG1 . ILE A 1 291 ? -6.567  55.405 7.710  1.00 26.51 ? 291 ILE A CG1 1 
ATOM   2297 C CG2 . ILE A 1 291 ? -7.477  57.254 9.057  1.00 30.74 ? 291 ILE A CG2 1 
ATOM   2298 C CD1 . ILE A 1 291 ? -7.565  54.345 8.148  1.00 20.85 ? 291 ILE A CD1 1 
ATOM   2299 N N   . THR A 1 292 ? -4.893  59.532 9.404  1.00 28.75 ? 292 THR A N   1 
ATOM   2300 C CA  . THR A 1 292 ? -4.565  60.472 10.467 1.00 26.90 ? 292 THR A CA  1 
ATOM   2301 C C   . THR A 1 292 ? -5.782  61.023 11.187 1.00 25.84 ? 292 THR A C   1 
ATOM   2302 O O   . THR A 1 292 ? -6.883  61.036 10.653 1.00 27.76 ? 292 THR A O   1 
ATOM   2303 C CB  . THR A 1 292 ? -3.750  61.679 9.937  1.00 30.85 ? 292 THR A CB  1 
ATOM   2304 O OG1 . THR A 1 292 ? -4.510  62.365 8.937  1.00 33.04 ? 292 THR A OG1 1 
ATOM   2305 C CG2 . THR A 1 292 ? -2.408  61.207 9.333  1.00 35.10 ? 292 THR A CG2 1 
ATOM   2306 N N   . MET A 1 293 ? -5.586  61.485 12.415 1.00 29.41 ? 293 MET A N   1 
ATOM   2307 C CA  . MET A 1 293 ? -6.705  62.055 13.142 1.00 34.18 ? 293 MET A CA  1 
ATOM   2308 C C   . MET A 1 293 ? -7.159  63.298 12.395 1.00 34.88 ? 293 MET A C   1 
ATOM   2309 O O   . MET A 1 293 ? -8.352  63.591 12.344 1.00 36.73 ? 293 MET A O   1 
ATOM   2310 C CB  . MET A 1 293 ? -6.312  62.408 14.570 1.00 28.65 ? 293 MET A CB  1 
ATOM   2311 C CG  . MET A 1 293 ? -6.290  61.209 15.518 1.00 30.27 ? 293 MET A CG  1 
ATOM   2312 S SD  . MET A 1 293 ? -7.923  60.376 15.705 1.00 35.53 ? 293 MET A SD  1 
ATOM   2313 C CE  . MET A 1 293 ? -8.913  61.751 16.192 1.00 29.42 ? 293 MET A CE  1 
ATOM   2314 N N   . LYS A 1 294 ? -6.203  64.012 11.800 1.00 35.04 ? 294 LYS A N   1 
ATOM   2315 C CA  . LYS A 1 294 ? -6.514  65.216 11.033 1.00 33.53 ? 294 LYS A CA  1 
ATOM   2316 C C   . LYS A 1 294 ? -7.512  64.866 9.949  1.00 30.65 ? 294 LYS A C   1 
ATOM   2317 O O   . LYS A 1 294 ? -8.528  65.528 9.805  1.00 33.48 ? 294 LYS A O   1 
ATOM   2318 C CB  . LYS A 1 294 ? -5.243  65.795 10.393 1.00 38.55 ? 294 LYS A CB  1 
ATOM   2319 C CG  . LYS A 1 294 ? -5.490  67.012 9.508  1.00 42.81 ? 294 LYS A CG  1 
ATOM   2320 C CD  . LYS A 1 294 ? -4.211  67.480 8.826  1.00 45.46 ? 294 LYS A CD  1 
ATOM   2321 C CE  . LYS A 1 294 ? -4.458  68.712 7.965  1.00 51.79 ? 294 LYS A CE  1 
ATOM   2322 N NZ  . LYS A 1 294 ? -3.188  69.232 7.366  1.00 52.46 ? 294 LYS A NZ  1 
ATOM   2323 N N   . GLN A 1 295 ? -7.236  63.812 9.195  1.00 29.42 ? 295 GLN A N   1 
ATOM   2324 C CA  . GLN A 1 295 ? -8.145  63.402 8.133  1.00 30.71 ? 295 GLN A CA  1 
ATOM   2325 C C   . GLN A 1 295 ? -9.488  63.002 8.728  1.00 32.02 ? 295 GLN A C   1 
ATOM   2326 O O   . GLN A 1 295 ? -10.538 63.313 8.165  1.00 27.51 ? 295 GLN A O   1 
ATOM   2327 C CB  . GLN A 1 295 ? -7.581  62.206 7.359  1.00 33.67 ? 295 GLN A CB  1 
ATOM   2328 C CG  . GLN A 1 295 ? -6.370  62.500 6.502  1.00 37.18 ? 295 GLN A CG  1 
ATOM   2329 C CD  . GLN A 1 295 ? -5.665  61.231 6.062  1.00 42.02 ? 295 GLN A CD  1 
ATOM   2330 O OE1 . GLN A 1 295 ? -6.220  60.135 6.142  1.00 42.90 ? 295 GLN A OE1 1 
ATOM   2331 N NE2 . GLN A 1 295 ? -4.436  61.375 5.588  1.00 43.49 ? 295 GLN A NE2 1 
ATOM   2332 N N   . LEU A 1 296 ? -9.448  62.315 9.872  1.00 30.66 ? 296 LEU A N   1 
ATOM   2333 C CA  . LEU A 1 296 ? -10.678 61.847 10.521 1.00 30.24 ? 296 LEU A CA  1 
ATOM   2334 C C   . LEU A 1 296 ? -11.536 63.029 10.955 1.00 28.99 ? 296 LEU A C   1 
ATOM   2335 O O   . LEU A 1 296 ? -12.723 63.062 10.674 1.00 28.26 ? 296 LEU A O   1 
ATOM   2336 C CB  . LEU A 1 296 ? -10.361 60.987 11.749 1.00 24.37 ? 296 LEU A CB  1 
ATOM   2337 C CG  . LEU A 1 296 ? -11.279 59.818 12.146 1.00 35.57 ? 296 LEU A CG  1 
ATOM   2338 C CD1 . LEU A 1 296 ? -11.181 59.600 13.671 1.00 28.46 ? 296 LEU A CD1 1 
ATOM   2339 C CD2 . LEU A 1 296 ? -12.705 60.077 11.756 1.00 30.34 ? 296 LEU A CD2 1 
ATOM   2340 N N   . LEU A 1 297 ? -10.933 63.972 11.675 1.00 30.95 ? 297 LEU A N   1 
ATOM   2341 C CA  . LEU A 1 297 ? -11.656 65.163 12.134 1.00 34.50 ? 297 LEU A CA  1 
ATOM   2342 C C   . LEU A 1 297 ? -12.290 65.879 10.944 1.00 33.70 ? 297 LEU A C   1 
ATOM   2343 O O   . LEU A 1 297 ? -13.488 66.155 10.952 1.00 36.70 ? 297 LEU A O   1 
ATOM   2344 C CB  . LEU A 1 297 ? -10.713 66.121 12.867 1.00 32.96 ? 297 LEU A CB  1 
ATOM   2345 C CG  . LEU A 1 297 ? -10.008 65.601 14.133 1.00 39.72 ? 297 LEU A CG  1 
ATOM   2346 C CD1 . LEU A 1 297 ? -9.085  66.674 14.704 1.00 36.14 ? 297 LEU A CD1 1 
ATOM   2347 C CD2 . LEU A 1 297 ? -11.050 65.213 15.169 1.00 37.98 ? 297 LEU A CD2 1 
ATOM   2348 N N   . ARG A 1 298 ? -11.498 66.160 9.913  1.00 39.55 ? 298 ARG A N   1 
ATOM   2349 C CA  . ARG A 1 298 ? -12.033 66.845 8.736  1.00 39.49 ? 298 ARG A CA  1 
ATOM   2350 C C   . ARG A 1 298 ? -13.168 66.041 8.130  1.00 39.75 ? 298 ARG A C   1 
ATOM   2351 O O   . ARG A 1 298 ? -14.217 66.590 7.784  1.00 43.09 ? 298 ARG A O   1 
ATOM   2352 C CB  . ARG A 1 298 ? -10.962 67.071 7.655  1.00 46.28 ? 298 ARG A CB  1 
ATOM   2353 C CG  . ARG A 1 298 ? -11.486 67.962 6.519  1.00 51.22 ? 298 ARG A CG  1 
ATOM   2354 C CD  . ARG A 1 298 ? -10.917 67.633 5.140  1.00 54.86 ? 298 ARG A CD  1 
ATOM   2355 N NE  . ARG A 1 298 ? -9.516  68.020 4.987  1.00 60.93 ? 298 ARG A NE  1 
ATOM   2356 C CZ  . ARG A 1 298 ? -8.833  67.928 3.846  1.00 61.78 ? 298 ARG A CZ  1 
ATOM   2357 N NH1 . ARG A 1 298 ? -9.419  67.462 2.748  1.00 60.53 ? 298 ARG A NH1 1 
ATOM   2358 N NH2 . ARG A 1 298 ? -7.561  68.301 3.801  1.00 60.82 ? 298 ARG A NH2 1 
ATOM   2359 N N   . ALA A 1 299 ? -12.958 64.736 8.007  1.00 33.35 ? 299 ALA A N   1 
ATOM   2360 C CA  . ALA A 1 299 ? -13.962 63.859 7.434  1.00 33.26 ? 299 ALA A CA  1 
ATOM   2361 C C   . ALA A 1 299 ? -15.231 63.816 8.289  1.00 31.84 ? 299 ALA A C   1 
ATOM   2362 O O   . ALA A 1 299 ? -16.347 63.698 7.763  1.00 31.45 ? 299 ALA A O   1 
ATOM   2363 C CB  . ALA A 1 299 ? -13.392 62.475 7.274  1.00 30.94 ? 299 ALA A CB  1 
ATOM   2364 N N   . LEU A 1 300 ? -15.061 63.911 9.604  1.00 29.81 ? 300 LEU A N   1 
ATOM   2365 C CA  . LEU A 1 300 ? -16.202 63.890 10.508 1.00 34.82 ? 300 LEU A CA  1 
ATOM   2366 C C   . LEU A 1 300 ? -17.082 65.121 10.326 1.00 40.91 ? 300 LEU A C   1 
ATOM   2367 O O   . LEU A 1 300 ? -18.293 64.992 10.079 1.00 42.25 ? 300 LEU A O   1 
ATOM   2368 C CB  . LEU A 1 300 ? -15.748 63.793 11.970 1.00 29.68 ? 300 LEU A CB  1 
ATOM   2369 C CG  . LEU A 1 300 ? -15.388 62.367 12.415 1.00 26.87 ? 300 LEU A CG  1 
ATOM   2370 C CD1 . LEU A 1 300 ? -14.881 62.370 13.838 1.00 24.83 ? 300 LEU A CD1 1 
ATOM   2371 C CD2 . LEU A 1 300 ? -16.626 61.472 12.295 1.00 29.78 ? 300 LEU A CD2 1 
ATOM   2372 N N   . GLU A 1 301 ? -16.518 66.319 10.428 1.00 42.55 ? 301 GLU A N   1 
ATOM   2373 C CA  . GLU A 1 301 ? -17.413 67.444 10.251 1.00 47.07 ? 301 GLU A CA  1 
ATOM   2374 C C   . GLU A 1 301 ? -17.715 67.839 8.826  1.00 46.51 ? 301 GLU A C   1 
ATOM   2375 O O   . GLU A 1 301 ? -18.318 68.877 8.587  1.00 50.25 ? 301 GLU A O   1 
ATOM   2376 C CB  . GLU A 1 301 ? -17.016 68.655 11.088 1.00 51.44 ? 301 GLU A CB  1 
ATOM   2377 C CG  . GLU A 1 301 ? -15.600 69.125 11.069 1.00 56.09 ? 301 GLU A CG  1 
ATOM   2378 C CD  . GLU A 1 301 ? -15.395 70.104 12.217 1.00 59.45 ? 301 GLU A CD  1 
ATOM   2379 O OE1 . GLU A 1 301 ? -16.280 70.975 12.412 1.00 51.99 ? 301 GLU A OE1 1 
ATOM   2380 O OE2 . GLU A 1 301 ? -14.374 69.997 12.929 1.00 61.20 ? 301 GLU A OE2 1 
ATOM   2381 N N   . GLU A 1 302 ? -17.314 67.001 7.877  1.00 43.98 ? 302 GLU A N   1 
ATOM   2382 C CA  . GLU A 1 302 ? -17.657 67.249 6.486  1.00 40.85 ? 302 GLU A CA  1 
ATOM   2383 C C   . GLU A 1 302 ? -18.689 66.179 6.113  1.00 41.05 ? 302 GLU A C   1 
ATOM   2384 O O   . GLU A 1 302 ? -19.088 66.048 4.954  1.00 39.01 ? 302 GLU A O   1 
ATOM   2385 C CB  . GLU A 1 302 ? -16.429 67.168 5.583  1.00 43.10 ? 302 GLU A CB  1 
ATOM   2386 C CG  . GLU A 1 302 ? -15.601 68.452 5.558  1.00 38.46 ? 302 GLU A CG  1 
ATOM   2387 C CD  . GLU A 1 302 ? -14.446 68.366 4.585  1.00 41.00 ? 302 GLU A CD  1 
ATOM   2388 O OE1 . GLU A 1 302 ? -14.412 67.387 3.808  1.00 40.61 ? 302 GLU A OE1 1 
ATOM   2389 O OE2 . GLU A 1 302 ? -13.580 69.268 4.591  1.00 41.23 ? 302 GLU A OE2 1 
ATOM   2390 N N   . GLY A 1 303 ? -19.128 65.431 7.125  1.00 33.21 ? 303 GLY A N   1 
ATOM   2391 C CA  . GLY A 1 303 ? -20.111 64.383 6.925  1.00 31.06 ? 303 GLY A CA  1 
ATOM   2392 C C   . GLY A 1 303 ? -19.706 63.299 5.945  1.00 28.81 ? 303 GLY A C   1 
ATOM   2393 O O   . GLY A 1 303 ? -20.558 62.673 5.320  1.00 32.47 ? 303 GLY A O   1 
ATOM   2394 N N   . ARG A 1 304 ? -18.408 63.061 5.819  1.00 33.23 ? 304 ARG A N   1 
ATOM   2395 C CA  . ARG A 1 304 ? -17.903 62.049 4.896  1.00 33.77 ? 304 ARG A CA  1 
ATOM   2396 C C   . ARG A 1 304 ? -17.700 60.633 5.472  1.00 34.24 ? 304 ARG A C   1 
ATOM   2397 O O   . ARG A 1 304 ? -17.600 59.664 4.710  1.00 32.87 ? 304 ARG A O   1 
ATOM   2398 C CB  . ARG A 1 304 ? -16.597 62.570 4.264  1.00 33.43 ? 304 ARG A CB  1 
ATOM   2399 C CG  . ARG A 1 304 ? -16.821 63.592 3.115  1.00 31.43 ? 304 ARG A CG  1 
ATOM   2400 C CD  . ARG A 1 304 ? -15.578 64.450 2.874  1.00 26.69 ? 304 ARG A CD  1 
ATOM   2401 N NE  . ARG A 1 304 ? -14.396 63.634 3.032  1.00 30.20 ? 304 ARG A NE  1 
ATOM   2402 C CZ  . ARG A 1 304 ? -13.295 64.015 3.658  1.00 24.68 ? 304 ARG A CZ  1 
ATOM   2403 N NH1 . ARG A 1 304 ? -13.190 65.216 4.190  1.00 33.03 ? 304 ARG A NH1 1 
ATOM   2404 N NH2 . ARG A 1 304 ? -12.307 63.156 3.793  1.00 36.43 ? 304 ARG A NH2 1 
ATOM   2405 N N   . VAL A 1 305 ? -17.654 60.512 6.802  1.00 29.42 ? 305 VAL A N   1 
ATOM   2406 C CA  . VAL A 1 305 ? -17.456 59.218 7.472  1.00 27.66 ? 305 VAL A CA  1 
ATOM   2407 C C   . VAL A 1 305 ? -18.742 58.402 7.587  1.00 31.07 ? 305 VAL A C   1 
ATOM   2408 O O   . VAL A 1 305 ? -19.738 58.886 8.112  1.00 34.23 ? 305 VAL A O   1 
ATOM   2409 C CB  . VAL A 1 305 ? -16.909 59.401 8.918  1.00 27.11 ? 305 VAL A CB  1 
ATOM   2410 C CG1 . VAL A 1 305 ? -16.722 58.034 9.590  1.00 23.08 ? 305 VAL A CG1 1 
ATOM   2411 C CG2 . VAL A 1 305 ? -15.605 60.167 8.889  1.00 26.07 ? 305 VAL A CG2 1 
ATOM   2412 N N   . ARG A 1 306 ? -18.720 57.161 7.117  1.00 27.44 ? 306 ARG A N   1 
ATOM   2413 C CA  . ARG A 1 306 ? -19.910 56.321 7.222  1.00 30.01 ? 306 ARG A CA  1 
ATOM   2414 C C   . ARG A 1 306 ? -19.812 55.331 8.396  1.00 29.24 ? 306 ARG A C   1 
ATOM   2415 O O   . ARG A 1 306 ? -20.663 55.306 9.297  1.00 26.49 ? 306 ARG A O   1 
ATOM   2416 C CB  . ARG A 1 306 ? -20.149 55.582 5.894  1.00 28.14 ? 306 ARG A CB  1 
ATOM   2417 C CG  . ARG A 1 306 ? -20.617 56.536 4.786  1.00 33.19 ? 306 ARG A CG  1 
ATOM   2418 C CD  . ARG A 1 306 ? -20.818 55.873 3.435  1.00 34.36 ? 306 ARG A CD  1 
ATOM   2419 N NE  . ARG A 1 306 ? -21.697 54.713 3.523  1.00 41.85 ? 306 ARG A NE  1 
ATOM   2420 C CZ  . ARG A 1 306 ? -22.271 54.138 2.476  1.00 39.91 ? 306 ARG A CZ  1 
ATOM   2421 N NH1 . ARG A 1 306 ? -22.055 54.629 1.262  1.00 32.41 ? 306 ARG A NH1 1 
ATOM   2422 N NH2 . ARG A 1 306 ? -23.047 53.072 2.646  1.00 34.05 ? 306 ARG A NH2 1 
ATOM   2423 N N   . GLU A 1 307 ? -18.752 54.541 8.407  1.00 25.25 ? 307 GLU A N   1 
ATOM   2424 C CA  . GLU A 1 307 ? -18.579 53.551 9.459  1.00 23.00 ? 307 GLU A CA  1 
ATOM   2425 C C   . GLU A 1 307 ? -17.109 53.406 9.841  1.00 23.46 ? 307 GLU A C   1 
ATOM   2426 O O   . GLU A 1 307 ? -16.216 53.550 8.991  1.00 24.28 ? 307 GLU A O   1 
ATOM   2427 C CB  . GLU A 1 307 ? -19.124 52.188 8.973  1.00 22.90 ? 307 GLU A CB  1 
ATOM   2428 C CG  . GLU A 1 307 ? -20.529 52.223 8.364  1.00 26.59 ? 307 GLU A CG  1 
ATOM   2429 C CD  . GLU A 1 307 ? -20.993 50.872 7.826  1.00 27.70 ? 307 GLU A CD  1 
ATOM   2430 O OE1 . GLU A 1 307 ? -21.710 50.858 6.804  1.00 29.24 ? 307 GLU A OE1 1 
ATOM   2431 O OE2 . GLU A 1 307 ? -20.661 49.826 8.422  1.00 31.68 ? 307 GLU A OE2 1 
ATOM   2432 N N   . VAL A 1 308 ? -16.860 53.154 11.129 1.00 26.30 ? 308 VAL A N   1 
ATOM   2433 C CA  . VAL A 1 308 ? -15.515 52.916 11.660 1.00 21.44 ? 308 VAL A CA  1 
ATOM   2434 C C   . VAL A 1 308 ? -15.654 51.652 12.528 1.00 24.96 ? 308 VAL A C   1 
ATOM   2435 O O   . VAL A 1 308 ? -16.620 51.515 13.301 1.00 23.40 ? 308 VAL A O   1 
ATOM   2436 C CB  . VAL A 1 308 ? -15.007 54.070 12.535 1.00 19.40 ? 308 VAL A CB  1 
ATOM   2437 C CG1 . VAL A 1 308 ? -13.624 53.723 13.090 1.00 18.01 ? 308 VAL A CG1 1 
ATOM   2438 C CG2 . VAL A 1 308 ? -14.911 55.357 11.722 1.00 18.18 ? 308 VAL A CG2 1 
ATOM   2439 N N   . PHE A 1 309 ? -14.733 50.708 12.370 1.00 22.94 ? 309 PHE A N   1 
ATOM   2440 C CA  . PHE A 1 309 ? -14.800 49.479 13.145 1.00 23.40 ? 309 PHE A CA  1 
ATOM   2441 C C   . PHE A 1 309 ? -13.459 48.787 13.319 1.00 24.73 ? 309 PHE A C   1 
ATOM   2442 O O   . PHE A 1 309 ? -12.486 49.077 12.609 1.00 20.27 ? 309 PHE A O   1 
ATOM   2443 C CB  . PHE A 1 309 ? -15.795 48.490 12.507 1.00 23.76 ? 309 PHE A CB  1 
ATOM   2444 C CG  . PHE A 1 309 ? -15.550 48.233 11.034 1.00 27.76 ? 309 PHE A CG  1 
ATOM   2445 C CD1 . PHE A 1 309 ? -15.969 49.154 10.071 1.00 23.53 ? 309 PHE A CD1 1 
ATOM   2446 C CD2 . PHE A 1 309 ? -14.868 47.097 10.616 1.00 28.24 ? 309 PHE A CD2 1 
ATOM   2447 C CE1 . PHE A 1 309 ? -15.700 48.939 8.718  1.00 30.62 ? 309 PHE A CE1 1 
ATOM   2448 C CE2 . PHE A 1 309 ? -14.597 46.871 9.264  1.00 27.67 ? 309 PHE A CE2 1 
ATOM   2449 C CZ  . PHE A 1 309 ? -15.011 47.793 8.316  1.00 26.99 ? 309 PHE A CZ  1 
ATOM   2450 N N   . GLY A 1 310 ? -13.412 47.866 14.278 1.00 20.20 ? 310 GLY A N   1 
ATOM   2451 C CA  . GLY A 1 310 ? -12.198 47.104 14.509 1.00 23.91 ? 310 GLY A CA  1 
ATOM   2452 C C   . GLY A 1 310 ? -12.426 45.705 13.966 1.00 15.61 ? 310 GLY A C   1 
ATOM   2453 O O   . GLY A 1 310 ? -13.573 45.309 13.760 1.00 21.98 ? 310 GLY A O   1 
ATOM   2454 N N   . SER A 1 311 ? -11.358 44.955 13.721 1.00 19.08 ? 311 SER A N   1 
ATOM   2455 C CA  . SER A 1 311 ? -11.479 43.582 13.219 1.00 19.89 ? 311 SER A CA  1 
ATOM   2456 C C   . SER A 1 311 ? -10.505 42.695 13.958 1.00 16.09 ? 311 SER A C   1 
ATOM   2457 O O   . SER A 1 311 ? -9.367  43.077 14.182 1.00 22.13 ? 311 SER A O   1 
ATOM   2458 C CB  . SER A 1 311 ? -11.183 43.508 11.709 1.00 23.15 ? 311 SER A CB  1 
ATOM   2459 O OG  . SER A 1 311 ? -9.786  43.531 11.439 1.00 22.70 ? 311 SER A OG  1 
ATOM   2460 N N   . GLY A 1 312 ? -10.942 41.505 14.346 1.00 17.11 ? 312 GLY A N   1 
ATOM   2461 C CA  . GLY A 1 312 ? -10.039 40.612 15.039 1.00 22.07 ? 312 GLY A CA  1 
ATOM   2462 C C   . GLY A 1 312 ? -10.780 39.314 15.274 1.00 24.45 ? 312 GLY A C   1 
ATOM   2463 O O   . GLY A 1 312 ? -12.000 39.299 15.180 1.00 24.61 ? 312 GLY A O   1 
ATOM   2464 N N   . THR A 1 313 ? -10.054 38.247 15.593 1.00 23.14 ? 313 THR A N   1 
ATOM   2465 C CA  . THR A 1 313 ? -10.668 36.946 15.827 1.00 24.88 ? 313 THR A CA  1 
ATOM   2466 C C   . THR A 1 313 ? -11.712 36.952 16.956 1.00 27.25 ? 313 THR A C   1 
ATOM   2467 O O   . THR A 1 313 ? -12.751 36.319 16.832 1.00 24.56 ? 313 THR A O   1 
ATOM   2468 C CB  . THR A 1 313 ? -9.583  35.874 16.134 1.00 22.07 ? 313 THR A CB  1 
ATOM   2469 O OG1 . THR A 1 313 ? -8.751  35.686 14.987 1.00 21.76 ? 313 THR A OG1 1 
ATOM   2470 C CG2 . THR A 1 313 ? -10.212 34.547 16.498 1.00 25.26 ? 313 THR A CG2 1 
ATOM   2471 N N   . ALA A 1 314 ? -11.442 37.681 18.035 1.00 28.56 ? 314 ALA A N   1 
ATOM   2472 C CA  . ALA A 1 314 ? -12.340 37.742 19.190 1.00 30.10 ? 314 ALA A CA  1 
ATOM   2473 C C   . ALA A 1 314 ? -13.623 38.472 18.858 1.00 32.05 ? 314 ALA A C   1 
ATOM   2474 O O   . ALA A 1 314 ? -14.713 38.062 19.267 1.00 33.72 ? 314 ALA A O   1 
ATOM   2475 C CB  . ALA A 1 314 ? -11.639 38.444 20.363 1.00 30.63 ? 314 ALA A CB  1 
ATOM   2476 N N   . CYS A 1 315 ? -13.477 39.569 18.125 1.00 34.21 ? 315 CYS A N   1 
ATOM   2477 C CA  . CYS A 1 315 ? -14.614 40.382 17.719 1.00 35.74 ? 315 CYS A CA  1 
ATOM   2478 C C   . CYS A 1 315 ? -14.429 40.692 16.241 1.00 35.68 ? 315 CYS A C   1 
ATOM   2479 O O   . CYS A 1 315 ? -13.846 41.715 15.872 1.00 38.93 ? 315 CYS A O   1 
ATOM   2480 C CB  . CYS A 1 315 ? -14.646 41.672 18.536 1.00 37.57 ? 315 CYS A CB  1 
ATOM   2481 S SG  . CYS A 1 315 ? -16.075 42.674 18.180 1.00 40.69 ? 315 CYS A SG  1 
ATOM   2482 N N   . GLN A 1 316 ? -14.927 39.789 15.405 1.00 36.56 ? 316 GLN A N   1 
ATOM   2483 C CA  . GLN A 1 316 ? -14.808 39.871 13.955 1.00 31.61 ? 316 GLN A CA  1 
ATOM   2484 C C   . GLN A 1 316 ? -14.954 41.261 13.345 1.00 27.73 ? 316 GLN A C   1 
ATOM   2485 O O   . GLN A 1 316 ? -14.044 41.725 12.666 1.00 29.79 ? 316 GLN A O   1 
ATOM   2486 C CB  . GLN A 1 316 ? -15.796 38.902 13.320 1.00 32.49 ? 316 GLN A CB  1 
ATOM   2487 C CG  . GLN A 1 316 ? -15.656 37.497 13.871 1.00 41.61 ? 316 GLN A CG  1 
ATOM   2488 C CD  . GLN A 1 316 ? -15.312 36.480 12.808 1.00 39.01 ? 316 GLN A CD  1 
ATOM   2489 O OE1 . GLN A 1 316 ? -16.056 36.297 11.851 1.00 48.56 ? 316 GLN A OE1 1 
ATOM   2490 N NE2 . GLN A 1 316 ? -14.185 35.808 12.976 1.00 36.98 ? 316 GLN A NE2 1 
ATOM   2491 N N   . VAL A 1 317 ? -16.103 41.904 13.531 1.00 23.17 ? 317 VAL A N   1 
ATOM   2492 C CA  . VAL A 1 317 ? -16.302 43.262 13.020 1.00 25.80 ? 317 VAL A CA  1 
ATOM   2493 C C   . VAL A 1 317 ? -16.964 44.026 14.165 1.00 26.65 ? 317 VAL A C   1 
ATOM   2494 O O   . VAL A 1 317 ? -18.131 43.793 14.479 1.00 28.94 ? 317 VAL A O   1 
ATOM   2495 C CB  . VAL A 1 317 ? -17.217 43.294 11.781 1.00 27.80 ? 317 VAL A CB  1 
ATOM   2496 C CG1 . VAL A 1 317 ? -17.010 44.595 11.030 1.00 23.40 ? 317 VAL A CG1 1 
ATOM   2497 C CG2 . VAL A 1 317 ? -16.925 42.102 10.890 1.00 25.56 ? 317 VAL A CG2 1 
ATOM   2498 N N   . CYS A 1 318 ? -16.209 44.935 14.771 1.00 25.44 ? 318 CYS A N   1 
ATOM   2499 C CA  . CYS A 1 318 ? -16.659 45.697 15.922 1.00 25.01 ? 318 CYS A CA  1 
ATOM   2500 C C   . CYS A 1 318 ? -16.894 47.181 15.647 1.00 23.38 ? 318 CYS A C   1 
ATOM   2501 O O   . CYS A 1 318 ? -15.954 47.935 15.418 1.00 20.91 ? 318 CYS A O   1 
ATOM   2502 C CB  . CYS A 1 318 ? -15.609 45.530 17.014 1.00 27.63 ? 318 CYS A CB  1 
ATOM   2503 S SG  . CYS A 1 318 ? -16.123 46.035 18.634 1.00 41.35 ? 318 CYS A SG  1 
ATOM   2504 N N   . PRO A 1 319 ? -18.163 47.626 15.695 1.00 24.71 ? 319 PRO A N   1 
ATOM   2505 C CA  . PRO A 1 319 ? -18.521 49.029 15.451 1.00 22.84 ? 319 PRO A CA  1 
ATOM   2506 C C   . PRO A 1 319 ? -17.947 49.983 16.480 1.00 22.80 ? 319 PRO A C   1 
ATOM   2507 O O   . PRO A 1 319 ? -17.876 49.656 17.665 1.00 20.95 ? 319 PRO A O   1 
ATOM   2508 C CB  . PRO A 1 319 ? -20.037 49.033 15.536 1.00 23.11 ? 319 PRO A CB  1 
ATOM   2509 C CG  . PRO A 1 319 ? -20.420 47.615 15.373 1.00 31.15 ? 319 PRO A CG  1 
ATOM   2510 C CD  . PRO A 1 319 ? -19.350 46.852 16.074 1.00 26.15 ? 319 PRO A CD  1 
ATOM   2511 N N   . VAL A 1 320 ? -17.565 51.173 16.019 1.00 20.00 ? 320 VAL A N   1 
ATOM   2512 C CA  . VAL A 1 320 ? -17.047 52.213 16.902 1.00 20.40 ? 320 VAL A CA  1 
ATOM   2513 C C   . VAL A 1 320 ? -18.004 53.392 16.811 1.00 21.39 ? 320 VAL A C   1 
ATOM   2514 O O   . VAL A 1 320 ? -18.354 53.825 15.713 1.00 19.80 ? 320 VAL A O   1 
ATOM   2515 C CB  . VAL A 1 320 ? -15.618 52.676 16.482 1.00 22.85 ? 320 VAL A CB  1 
ATOM   2516 C CG1 . VAL A 1 320 ? -15.167 53.880 17.337 1.00 18.52 ? 320 VAL A CG1 1 
ATOM   2517 C CG2 . VAL A 1 320 ? -14.648 51.523 16.639 1.00 20.75 ? 320 VAL A CG2 1 
ATOM   2518 N N   . HIS A 1 321 ? -18.425 53.918 17.959 1.00 23.17 ? 321 HIS A N   1 
ATOM   2519 C CA  . HIS A 1 321 ? -19.342 55.042 17.956 1.00 27.65 ? 321 HIS A CA  1 
ATOM   2520 C C   . HIS A 1 321 ? -18.789 56.316 18.588 1.00 27.16 ? 321 HIS A C   1 
ATOM   2521 O O   . HIS A 1 321 ? -19.348 57.395 18.379 1.00 27.26 ? 321 HIS A O   1 
ATOM   2522 C CB  . HIS A 1 321 ? -20.660 54.676 18.661 1.00 28.93 ? 321 HIS A CB  1 
ATOM   2523 C CG  . HIS A 1 321 ? -20.575 54.696 20.158 1.00 25.20 ? 321 HIS A CG  1 
ATOM   2524 N ND1 . HIS A 1 321 ? -20.049 53.654 20.891 1.00 28.78 ? 321 HIS A ND1 1 
ATOM   2525 C CD2 . HIS A 1 321 ? -20.930 55.645 21.056 1.00 29.61 ? 321 HIS A CD2 1 
ATOM   2526 C CE1 . HIS A 1 321 ? -20.084 53.959 22.177 1.00 25.52 ? 321 HIS A CE1 1 
ATOM   2527 N NE2 . HIS A 1 321 ? -20.615 55.163 22.304 1.00 29.12 ? 321 HIS A NE2 1 
ATOM   2528 N N   . ARG A 1 322 ? -17.702 56.205 19.344 1.00 26.54 ? 322 ARG A N   1 
ATOM   2529 C CA  . ARG A 1 322 ? -17.146 57.388 19.987 1.00 25.43 ? 322 ARG A CA  1 
ATOM   2530 C C   . ARG A 1 322 ? -15.652 57.278 20.162 1.00 25.88 ? 322 ARG A C   1 
ATOM   2531 O O   . ARG A 1 322 ? -15.129 56.207 20.498 1.00 24.49 ? 322 ARG A O   1 
ATOM   2532 C CB  . ARG A 1 322 ? -17.788 57.607 21.366 1.00 25.20 ? 322 ARG A CB  1 
ATOM   2533 C CG  . ARG A 1 322 ? -17.281 58.859 22.131 1.00 30.79 ? 322 ARG A CG  1 
ATOM   2534 C CD  . ARG A 1 322 ? -18.149 59.208 23.374 1.00 23.55 ? 322 ARG A CD  1 
ATOM   2535 N NE  . ARG A 1 322 ? -18.186 58.150 24.389 1.00 25.73 ? 322 ARG A NE  1 
ATOM   2536 C CZ  . ARG A 1 322 ? -17.355 58.075 25.425 1.00 31.36 ? 322 ARG A CZ  1 
ATOM   2537 N NH1 . ARG A 1 322 ? -16.424 59.005 25.590 1.00 33.59 ? 322 ARG A NH1 1 
ATOM   2538 N NH2 . ARG A 1 322 ? -17.440 57.065 26.285 1.00 31.25 ? 322 ARG A NH2 1 
ATOM   2539 N N   . ILE A 1 323 ? -14.965 58.387 19.931 1.00 24.90 ? 323 ILE A N   1 
ATOM   2540 C CA  . ILE A 1 323 ? -13.526 58.426 20.102 1.00 24.53 ? 323 ILE A CA  1 
ATOM   2541 C C   . ILE A 1 323 ? -13.213 59.667 20.923 1.00 26.66 ? 323 ILE A C   1 
ATOM   2542 O O   . ILE A 1 323 ? -13.528 60.789 20.513 1.00 31.62 ? 323 ILE A O   1 
ATOM   2543 C CB  . ILE A 1 323 ? -12.806 58.485 18.739 1.00 25.84 ? 323 ILE A CB  1 
ATOM   2544 C CG1 . ILE A 1 323 ? -12.951 57.138 18.025 1.00 20.59 ? 323 ILE A CG1 1 
ATOM   2545 C CG2 . ILE A 1 323 ? -11.342 58.830 18.929 1.00 30.07 ? 323 ILE A CG2 1 
ATOM   2546 C CD1 . ILE A 1 323 ? -12.480 57.149 16.608 1.00 23.50 ? 323 ILE A CD1 1 
ATOM   2547 N N   . LEU A 1 324 ? -12.615 59.459 22.092 1.00 28.17 ? 324 LEU A N   1 
ATOM   2548 C CA  . LEU A 1 324 ? -12.235 60.564 22.964 1.00 29.22 ? 324 LEU A CA  1 
ATOM   2549 C C   . LEU A 1 324 ? -10.817 60.976 22.621 1.00 28.82 ? 324 LEU A C   1 
ATOM   2550 O O   . LEU A 1 324 ? -9.862  60.356 23.068 1.00 32.83 ? 324 LEU A O   1 
ATOM   2551 C CB  . LEU A 1 324 ? -12.320 60.126 24.421 1.00 24.99 ? 324 LEU A CB  1 
ATOM   2552 C CG  . LEU A 1 324 ? -11.919 61.136 25.497 1.00 29.88 ? 324 LEU A CG  1 
ATOM   2553 C CD1 . LEU A 1 324 ? -12.509 62.513 25.209 1.00 32.21 ? 324 LEU A CD1 1 
ATOM   2554 C CD2 . LEU A 1 324 ? -12.409 60.604 26.840 1.00 27.16 ? 324 LEU A CD2 1 
ATOM   2555 N N   . TYR A 1 325 ? -10.690 62.031 21.825 1.00 34.73 ? 325 TYR A N   1 
ATOM   2556 C CA  . TYR A 1 325 ? -9.393  62.506 21.393 1.00 37.84 ? 325 TYR A CA  1 
ATOM   2557 C C   . TYR A 1 325 ? -8.817  63.516 22.372 1.00 40.62 ? 325 TYR A C   1 
ATOM   2558 O O   . TYR A 1 325 ? -8.383  63.148 23.461 1.00 45.84 ? 325 TYR A O   1 
ATOM   2559 C CB  . TYR A 1 325 ? -9.519  63.127 20.001 1.00 35.21 ? 325 TYR A CB  1 
ATOM   2560 C CG  . TYR A 1 325 ? -8.212  63.488 19.312 1.00 37.93 ? 325 TYR A CG  1 
ATOM   2561 C CD1 . TYR A 1 325 ? -8.184  64.495 18.344 1.00 40.86 ? 325 TYR A CD1 1 
ATOM   2562 C CD2 . TYR A 1 325 ? -7.019  62.816 19.600 1.00 38.91 ? 325 TYR A CD2 1 
ATOM   2563 C CE1 . TYR A 1 325 ? -7.009  64.832 17.677 1.00 41.96 ? 325 TYR A CE1 1 
ATOM   2564 C CE2 . TYR A 1 325 ? -5.824  63.148 18.931 1.00 41.92 ? 325 TYR A CE2 1 
ATOM   2565 C CZ  . TYR A 1 325 ? -5.837  64.158 17.968 1.00 41.92 ? 325 TYR A CZ  1 
ATOM   2566 O OH  . TYR A 1 325 ? -4.694  64.477 17.267 1.00 48.39 ? 325 TYR A OH  1 
ATOM   2567 N N   . LYS A 1 326 ? -8.837  64.789 21.987 1.00 43.18 ? 326 LYS A N   1 
ATOM   2568 C CA  . LYS A 1 326 ? -8.273  65.862 22.803 1.00 47.41 ? 326 LYS A CA  1 
ATOM   2569 C C   . LYS A 1 326 ? -9.238  66.336 23.870 1.00 49.69 ? 326 LYS A C   1 
ATOM   2570 O O   . LYS A 1 326 ? -9.717  67.476 23.802 1.00 49.88 ? 326 LYS A O   1 
ATOM   2571 C CB  . LYS A 1 326 ? -7.907  67.064 21.923 1.00 51.75 ? 326 LYS A CB  1 
ATOM   2572 C CG  . LYS A 1 326 ? -6.889  66.797 20.823 1.00 55.16 ? 326 LYS A CG  1 
ATOM   2573 C CD  . LYS A 1 326 ? -6.189  68.095 20.412 1.00 54.51 ? 326 LYS A CD  1 
ATOM   2574 C CE  . LYS A 1 326 ? -7.197  69.189 20.048 1.00 59.00 ? 326 LYS A CE  1 
ATOM   2575 N NZ  . LYS A 1 326 ? -6.620  70.574 20.150 1.00 60.55 ? 326 LYS A NZ  1 
ATOM   2576 N N   . ASP A 1 327 ? -9.508  65.492 24.865 1.00 47.24 ? 327 ASP A N   1 
ATOM   2577 C CA  . ASP A 1 327 ? -10.466 65.864 25.894 1.00 47.97 ? 327 ASP A CA  1 
ATOM   2578 C C   . ASP A 1 327 ? -11.828 66.032 25.203 1.00 48.02 ? 327 ASP A C   1 
ATOM   2579 O O   . ASP A 1 327 ? -12.861 66.208 25.855 1.00 45.83 ? 327 ASP A O   1 
ATOM   2580 C CB  . ASP A 1 327 ? -10.058 67.194 26.544 1.00 45.06 ? 327 ASP A CB  1 
ATOM   2581 C CG  . ASP A 1 327 ? -9.240  67.004 27.803 1.00 49.91 ? 327 ASP A CG  1 
ATOM   2582 O OD1 . ASP A 1 327 ? -8.146  66.405 27.730 1.00 53.65 ? 327 ASP A OD1 1 
ATOM   2583 O OD2 . ASP A 1 327 ? -9.695  67.455 28.875 1.00 46.28 ? 327 ASP A OD2 1 
ATOM   2584 N N   . ARG A 1 328 ? -11.806 65.946 23.876 1.00 45.83 ? 328 ARG A N   1 
ATOM   2585 C CA  . ARG A 1 328 ? -12.977 66.134 23.037 1.00 44.18 ? 328 ARG A CA  1 
ATOM   2586 C C   . ARG A 1 328 ? -13.599 64.850 22.486 1.00 45.35 ? 328 ARG A C   1 
ATOM   2587 O O   . ARG A 1 328 ? -12.938 64.080 21.788 1.00 43.40 ? 328 ARG A O   1 
ATOM   2588 C CB  . ARG A 1 328 ? -12.572 67.077 21.903 1.00 45.74 ? 328 ARG A CB  1 
ATOM   2589 C CG  . ARG A 1 328 ? -13.441 67.109 20.660 1.00 47.95 ? 328 ARG A CG  1 
ATOM   2590 C CD  . ARG A 1 328 ? -13.103 68.390 19.902 1.00 50.06 ? 328 ARG A CD  1 
ATOM   2591 N NE  . ARG A 1 328 ? -13.056 68.266 18.447 1.00 43.71 ? 328 ARG A NE  1 
ATOM   2592 C CZ  . ARG A 1 328 ? -14.107 68.014 17.674 1.00 46.76 ? 328 ARG A CZ  1 
ATOM   2593 N NH1 . ARG A 1 328 ? -15.308 67.843 18.212 1.00 50.76 ? 328 ARG A NH1 1 
ATOM   2594 N NH2 . ARG A 1 328 ? -13.965 67.973 16.352 1.00 47.63 ? 328 ARG A NH2 1 
ATOM   2595 N N   . ASN A 1 329 ? -14.874 64.625 22.807 1.00 41.65 ? 329 ASN A N   1 
ATOM   2596 C CA  . ASN A 1 329 ? -15.582 63.447 22.323 1.00 40.17 ? 329 ASN A CA  1 
ATOM   2597 C C   . ASN A 1 329 ? -15.981 63.619 20.875 1.00 38.98 ? 329 ASN A C   1 
ATOM   2598 O O   . ASN A 1 329 ? -16.573 64.629 20.498 1.00 39.35 ? 329 ASN A O   1 
ATOM   2599 C CB  . ASN A 1 329 ? -16.839 63.185 23.133 1.00 41.19 ? 329 ASN A CB  1 
ATOM   2600 C CG  . ASN A 1 329 ? -16.539 62.606 24.477 1.00 47.15 ? 329 ASN A CG  1 
ATOM   2601 O OD1 . ASN A 1 329 ? -15.967 61.516 24.582 1.00 46.32 ? 329 ASN A OD1 1 
ATOM   2602 N ND2 . ASN A 1 329 ? -16.920 63.326 25.531 1.00 50.20 ? 329 ASN A ND2 1 
ATOM   2603 N N   . LEU A 1 330 ? -15.642 62.627 20.066 1.00 32.49 ? 330 LEU A N   1 
ATOM   2604 C CA  . LEU A 1 330 ? -15.983 62.656 18.656 1.00 28.84 ? 330 LEU A CA  1 
ATOM   2605 C C   . LEU A 1 330 ? -17.021 61.575 18.432 1.00 30.22 ? 330 LEU A C   1 
ATOM   2606 O O   . LEU A 1 330 ? -16.779 60.402 18.725 1.00 27.85 ? 330 LEU A O   1 
ATOM   2607 C CB  . LEU A 1 330 ? -14.741 62.361 17.805 1.00 34.28 ? 330 LEU A CB  1 
ATOM   2608 C CG  . LEU A 1 330 ? -13.546 63.292 18.006 1.00 33.14 ? 330 LEU A CG  1 
ATOM   2609 C CD1 . LEU A 1 330 ? -12.318 62.724 17.299 1.00 36.97 ? 330 LEU A CD1 1 
ATOM   2610 C CD2 . LEU A 1 330 ? -13.887 64.673 17.475 1.00 33.69 ? 330 LEU A CD2 1 
ATOM   2611 N N   . HIS A 1 331 ? -18.188 61.963 17.931 1.00 27.85 ? 331 HIS A N   1 
ATOM   2612 C CA  . HIS A 1 331 ? -19.213 60.977 17.671 1.00 26.79 ? 331 HIS A CA  1 
ATOM   2613 C C   . HIS A 1 331 ? -18.902 60.380 16.328 1.00 28.40 ? 331 HIS A C   1 
ATOM   2614 O O   . HIS A 1 331 ? -18.601 61.106 15.386 1.00 29.25 ? 331 HIS A O   1 
ATOM   2615 C CB  . HIS A 1 331 ? -20.617 61.600 17.634 1.00 29.57 ? 331 HIS A CB  1 
ATOM   2616 C CG  . HIS A 1 331 ? -21.681 60.620 17.251 1.00 27.03 ? 331 HIS A CG  1 
ATOM   2617 N ND1 . HIS A 1 331 ? -22.046 59.572 18.068 1.00 28.36 ? 331 HIS A ND1 1 
ATOM   2618 C CD2 . HIS A 1 331 ? -22.377 60.458 16.098 1.00 30.48 ? 331 HIS A CD2 1 
ATOM   2619 C CE1 . HIS A 1 331 ? -22.913 58.802 17.436 1.00 31.73 ? 331 HIS A CE1 1 
ATOM   2620 N NE2 . HIS A 1 331 ? -23.128 59.314 16.237 1.00 28.89 ? 331 HIS A NE2 1 
ATOM   2621 N N   . ILE A 1 332 ? -18.938 59.052 16.251 1.00 30.12 ? 332 ILE A N   1 
ATOM   2622 C CA  . ILE A 1 332 ? -18.687 58.360 14.998 1.00 30.07 ? 332 ILE A CA  1 
ATOM   2623 C C   . ILE A 1 332 ? -20.049 57.824 14.537 1.00 28.53 ? 332 ILE A C   1 
ATOM   2624 O O   . ILE A 1 332 ? -20.617 56.941 15.169 1.00 28.85 ? 332 ILE A O   1 
ATOM   2625 C CB  . ILE A 1 332 ? -17.706 57.203 15.196 1.00 26.69 ? 332 ILE A CB  1 
ATOM   2626 C CG1 . ILE A 1 332 ? -16.499 57.678 16.008 1.00 28.28 ? 332 ILE A CG1 1 
ATOM   2627 C CG2 . ILE A 1 332 ? -17.255 56.675 13.822 1.00 30.30 ? 332 ILE A CG2 1 
ATOM   2628 C CD1 . ILE A 1 332 ? -15.769 58.859 15.415 1.00 20.98 ? 332 ILE A CD1 1 
ATOM   2629 N N   . PRO A 1 333 ? -20.565 58.331 13.407 1.00 32.13 ? 333 PRO A N   1 
ATOM   2630 C CA  . PRO A 1 333 ? -21.871 57.926 12.859 1.00 31.13 ? 333 PRO A CA  1 
ATOM   2631 C C   . PRO A 1 333 ? -22.050 56.477 12.422 1.00 26.86 ? 333 PRO A C   1 
ATOM   2632 O O   . PRO A 1 333 ? -22.989 56.183 11.695 1.00 30.50 ? 333 PRO A O   1 
ATOM   2633 C CB  . PRO A 1 333 ? -22.077 58.881 11.665 1.00 32.91 ? 333 PRO A CB  1 
ATOM   2634 C CG  . PRO A 1 333 ? -20.890 59.834 11.692 1.00 37.28 ? 333 PRO A CG  1 
ATOM   2635 C CD  . PRO A 1 333 ? -19.806 59.098 12.404 1.00 34.42 ? 333 PRO A CD  1 
ATOM   2636 N N   . THR A 1 334 ? -21.182 55.569 12.858 1.00 22.72 ? 334 THR A N   1 
ATOM   2637 C CA  . THR A 1 334 ? -21.305 54.174 12.447 1.00 22.52 ? 334 THR A CA  1 
ATOM   2638 C C   . THR A 1 334 ? -22.713 53.578 12.502 1.00 25.68 ? 334 THR A C   1 
ATOM   2639 O O   . THR A 1 334 ? -23.222 53.104 11.486 1.00 25.61 ? 334 THR A O   1 
ATOM   2640 C CB  . THR A 1 334 ? -20.356 53.267 13.242 1.00 23.44 ? 334 THR A CB  1 
ATOM   2641 O OG1 . THR A 1 334 ? -19.014 53.757 13.096 1.00 24.93 ? 334 THR A OG1 1 
ATOM   2642 C CG2 . THR A 1 334 ? -20.435 51.829 12.721 1.00 18.35 ? 334 THR A CG2 1 
ATOM   2643 N N   . MET A 1 335 ? -23.345 53.591 13.668 1.00 23.99 ? 335 MET A N   1 
ATOM   2644 C CA  . MET A 1 335 ? -24.697 53.044 13.790 1.00 31.76 ? 335 MET A CA  1 
ATOM   2645 C C   . MET A 1 335 ? -25.765 53.862 13.028 1.00 34.07 ? 335 MET A C   1 
ATOM   2646 O O   . MET A 1 335 ? -26.737 53.288 12.529 1.00 39.64 ? 335 MET A O   1 
ATOM   2647 C CB  . MET A 1 335 ? -25.092 52.917 15.270 1.00 31.37 ? 335 MET A CB  1 
ATOM   2648 C CG  . MET A 1 335 ? -24.095 52.130 16.108 1.00 27.59 ? 335 MET A CG  1 
ATOM   2649 S SD  . MET A 1 335 ? -23.663 50.544 15.353 1.00 29.71 ? 335 MET A SD  1 
ATOM   2650 C CE  . MET A 1 335 ? -24.846 49.473 16.108 1.00 34.05 ? 335 MET A CE  1 
ATOM   2651 N N   . GLU A 1 336 ? -25.591 55.183 12.932 1.00 35.47 ? 336 GLU A N   1 
ATOM   2652 C CA  . GLU A 1 336 ? -26.547 56.033 12.210 1.00 38.30 ? 336 GLU A CA  1 
ATOM   2653 C C   . GLU A 1 336 ? -26.611 55.532 10.778 1.00 42.73 ? 336 GLU A C   1 
ATOM   2654 O O   . GLU A 1 336 ? -27.682 55.349 10.204 1.00 41.40 ? 336 GLU A O   1 
ATOM   2655 C CB  . GLU A 1 336 ? -26.106 57.497 12.206 1.00 35.03 ? 336 GLU A CB  1 
ATOM   2656 C CG  . GLU A 1 336 ? -26.118 58.172 13.560 1.00 38.60 ? 336 GLU A CG  1 
ATOM   2657 C CD  . GLU A 1 336 ? -25.354 57.385 14.603 1.00 40.42 ? 336 GLU A CD  1 
ATOM   2658 O OE1 . GLU A 1 336 ? -24.205 57.004 14.332 1.00 46.26 ? 336 GLU A OE1 1 
ATOM   2659 O OE2 . GLU A 1 336 ? -25.901 57.145 15.703 1.00 46.07 ? 336 GLU A OE2 1 
ATOM   2660 N N   . ASN A 1 337 ? -25.445 55.323 10.192 1.00 42.36 ? 337 ASN A N   1 
ATOM   2661 C CA  . ASN A 1 337 ? -25.392 54.791 8.850  1.00 46.31 ? 337 ASN A CA  1 
ATOM   2662 C C   . ASN A 1 337 ? -25.505 53.333 9.201  1.00 47.94 ? 337 ASN A C   1 
ATOM   2663 O O   . ASN A 1 337 ? -24.495 52.739 9.554  1.00 60.85 ? 337 ASN A O   1 
ATOM   2664 C CB  . ASN A 1 337 ? -24.028 55.067 8.227  1.00 45.02 ? 337 ASN A CB  1 
ATOM   2665 C CG  . ASN A 1 337 ? -23.840 56.518 7.880  1.00 46.54 ? 337 ASN A CG  1 
ATOM   2666 O OD1 . ASN A 1 337 ? -24.396 57.002 6.895  1.00 49.18 ? 337 ASN A OD1 1 
ATOM   2667 N ND2 . ASN A 1 337 ? -23.067 57.231 8.692  1.00 39.68 ? 337 ASN A ND2 1 
ATOM   2668 N N   . GLY A 1 338 ? -26.714 52.773 9.168  1.00 44.96 ? 338 GLY A N   1 
ATOM   2669 C CA  . GLY A 1 338 ? -26.893 51.377 9.523  1.00 41.55 ? 338 GLY A CA  1 
ATOM   2670 C C   . GLY A 1 338 ? -25.539 50.781 9.292  1.00 47.39 ? 338 GLY A C   1 
ATOM   2671 O O   . GLY A 1 338 ? -24.954 51.063 8.234  1.00 54.60 ? 338 GLY A O   1 
ATOM   2672 N N   . PRO A 1 339 ? -24.976 50.010 10.238 1.00 38.60 ? 339 PRO A N   1 
ATOM   2673 C CA  . PRO A 1 339 ? -23.653 49.501 9.886  1.00 35.04 ? 339 PRO A CA  1 
ATOM   2674 C C   . PRO A 1 339 ? -23.828 48.608 8.657  1.00 29.15 ? 339 PRO A C   1 
ATOM   2675 O O   . PRO A 1 339 ? -23.681 47.392 8.724  1.00 28.08 ? 339 PRO A O   1 
ATOM   2676 C CB  . PRO A 1 339 ? -23.223 48.720 11.145 1.00 35.21 ? 339 PRO A CB  1 
ATOM   2677 C CG  . PRO A 1 339 ? -24.331 48.991 12.183 1.00 35.34 ? 339 PRO A CG  1 
ATOM   2678 C CD  . PRO A 1 339 ? -25.542 49.266 11.373 1.00 29.95 ? 339 PRO A CD  1 
ATOM   2679 N N   . GLU A 1 340 ? -24.150 49.234 7.532  1.00 28.91 ? 340 GLU A N   1 
ATOM   2680 C CA  . GLU A 1 340 ? -24.387 48.526 6.284  1.00 27.99 ? 340 GLU A CA  1 
ATOM   2681 C C   . GLU A 1 340 ? -23.223 47.622 5.953  1.00 22.99 ? 340 GLU A C   1 
ATOM   2682 O O   . GLU A 1 340 ? -23.378 46.404 5.879  1.00 26.84 ? 340 GLU A O   1 
ATOM   2683 C CB  . GLU A 1 340 ? -24.609 49.529 5.155  1.00 36.41 ? 340 GLU A CB  1 
ATOM   2684 C CG  . GLU A 1 340 ? -25.256 48.952 3.919  1.00 36.40 ? 340 GLU A CG  1 
ATOM   2685 C CD  . GLU A 1 340 ? -25.355 49.971 2.791  1.00 42.71 ? 340 GLU A CD  1 
ATOM   2686 O OE1 . GLU A 1 340 ? -25.831 49.605 1.692  1.00 42.11 ? 340 GLU A OE1 1 
ATOM   2687 O OE2 . GLU A 1 340 ? -24.956 51.133 3.006  1.00 48.29 ? 340 GLU A OE2 1 
ATOM   2688 N N   . LEU A 1 341 ? -22.046 48.212 5.790  1.00 23.73 ? 341 LEU A N   1 
ATOM   2689 C CA  . LEU A 1 341 ? -20.865 47.436 5.441  1.00 25.60 ? 341 LEU A CA  1 
ATOM   2690 C C   . LEU A 1 341 ? -20.531 46.414 6.513  1.00 25.22 ? 341 LEU A C   1 
ATOM   2691 O O   . LEU A 1 341 ? -20.224 45.262 6.218  1.00 25.23 ? 341 LEU A O   1 
ATOM   2692 C CB  . LEU A 1 341 ? -19.677 48.370 5.215  1.00 24.27 ? 341 LEU A CB  1 
ATOM   2693 C CG  . LEU A 1 341 ? -18.371 47.649 4.890  1.00 26.18 ? 341 LEU A CG  1 
ATOM   2694 C CD1 . LEU A 1 341 ? -18.548 46.779 3.639  1.00 22.74 ? 341 LEU A CD1 1 
ATOM   2695 C CD2 . LEU A 1 341 ? -17.296 48.678 4.672  1.00 27.04 ? 341 LEU A CD2 1 
ATOM   2696 N N   . ILE A 1 342 ? -20.584 46.851 7.764  1.00 23.95 ? 342 ILE A N   1 
ATOM   2697 C CA  . ILE A 1 342 ? -20.313 45.966 8.883  1.00 20.96 ? 342 ILE A CA  1 
ATOM   2698 C C   . ILE A 1 342 ? -21.281 44.790 8.833  1.00 25.37 ? 342 ILE A C   1 
ATOM   2699 O O   . ILE A 1 342 ? -20.876 43.619 8.950  1.00 24.26 ? 342 ILE A O   1 
ATOM   2700 C CB  . ILE A 1 342 ? -20.481 46.725 10.235 1.00 21.20 ? 342 ILE A CB  1 
ATOM   2701 C CG1 . ILE A 1 342 ? -19.236 47.575 10.503 1.00 22.36 ? 342 ILE A CG1 1 
ATOM   2702 C CG2 . ILE A 1 342 ? -20.748 45.738 11.367 1.00 17.39 ? 342 ILE A CG2 1 
ATOM   2703 C CD1 . ILE A 1 342 ? -19.374 48.499 11.697 1.00 18.74 ? 342 ILE A CD1 1 
ATOM   2704 N N   . LEU A 1 343 ? -22.566 45.102 8.665  1.00 23.30 ? 343 LEU A N   1 
ATOM   2705 C CA  . LEU A 1 343 ? -23.574 44.055 8.604  1.00 27.76 ? 343 LEU A CA  1 
ATOM   2706 C C   . LEU A 1 343 ? -23.326 43.106 7.428  1.00 25.11 ? 343 LEU A C   1 
ATOM   2707 O O   . LEU A 1 343 ? -23.395 41.885 7.609  1.00 26.00 ? 343 LEU A O   1 
ATOM   2708 C CB  . LEU A 1 343 ? -24.985 44.660 8.559  1.00 28.50 ? 343 LEU A CB  1 
ATOM   2709 C CG  . LEU A 1 343 ? -25.378 45.325 9.888  1.00 25.52 ? 343 LEU A CG  1 
ATOM   2710 C CD1 . LEU A 1 343 ? -26.606 46.159 9.710  1.00 26.68 ? 343 LEU A CD1 1 
ATOM   2711 C CD2 . LEU A 1 343 ? -25.599 44.260 10.951 1.00 30.58 ? 343 LEU A CD2 1 
ATOM   2712 N N   . ARG A 1 344 ? -23.004 43.629 6.244  1.00 25.37 ? 344 ARG A N   1 
ATOM   2713 C CA  . ARG A 1 344 ? -22.738 42.711 5.125  1.00 26.52 ? 344 ARG A CA  1 
ATOM   2714 C C   . ARG A 1 344 ? -21.495 41.867 5.453  1.00 27.31 ? 344 ARG A C   1 
ATOM   2715 O O   . ARG A 1 344 ? -21.470 40.654 5.196  1.00 27.27 ? 344 ARG A O   1 
ATOM   2716 C CB  . ARG A 1 344 ? -22.533 43.440 3.768  1.00 27.30 ? 344 ARG A CB  1 
ATOM   2717 C CG  . ARG A 1 344 ? -21.922 42.497 2.700  1.00 35.71 ? 344 ARG A CG  1 
ATOM   2718 C CD  . ARG A 1 344 ? -22.437 42.612 1.247  1.00 33.58 ? 344 ARG A CD  1 
ATOM   2719 N NE  . ARG A 1 344 ? -22.045 43.835 0.554  1.00 32.80 ? 344 ARG A NE  1 
ATOM   2720 C CZ  . ARG A 1 344 ? -21.706 43.913 -0.734 1.00 34.38 ? 344 ARG A CZ  1 
ATOM   2721 N NH1 . ARG A 1 344 ? -21.678 42.838 -1.512 1.00 32.24 ? 344 ARG A NH1 1 
ATOM   2722 N NH2 . ARG A 1 344 ? -21.440 45.094 -1.264 1.00 38.32 ? 344 ARG A NH2 1 
ATOM   2723 N N   . PHE A 1 345 ? -20.455 42.490 6.009  1.00 25.42 ? 345 PHE A N   1 
ATOM   2724 C CA  . PHE A 1 345 ? -19.271 41.707 6.359  1.00 25.62 ? 345 PHE A CA  1 
ATOM   2725 C C   . PHE A 1 345 ? -19.650 40.579 7.315  1.00 22.66 ? 345 PHE A C   1 
ATOM   2726 O O   . PHE A 1 345 ? -19.301 39.431 7.090  1.00 25.81 ? 345 PHE A O   1 
ATOM   2727 C CB  . PHE A 1 345 ? -18.204 42.578 7.022  1.00 24.69 ? 345 PHE A CB  1 
ATOM   2728 C CG  . PHE A 1 345 ? -17.245 43.199 6.056  1.00 27.79 ? 345 PHE A CG  1 
ATOM   2729 C CD1 . PHE A 1 345 ? -16.756 44.487 6.270  1.00 23.42 ? 345 PHE A CD1 1 
ATOM   2730 C CD2 . PHE A 1 345 ? -16.799 42.486 4.940  1.00 25.76 ? 345 PHE A CD2 1 
ATOM   2731 C CE1 . PHE A 1 345 ? -15.830 45.050 5.375  1.00 20.19 ? 345 PHE A CE1 1 
ATOM   2732 C CE2 . PHE A 1 345 ? -15.879 43.048 4.052  1.00 25.31 ? 345 PHE A CE2 1 
ATOM   2733 C CZ  . PHE A 1 345 ? -15.400 44.328 4.274  1.00 13.54 ? 345 PHE A CZ  1 
ATOM   2734 N N   . GLN A 1 346 ? -20.368 40.916 8.381  1.00 24.10 ? 346 GLN A N   1 
ATOM   2735 C CA  . GLN A 1 346 ? -20.764 39.914 9.370  1.00 28.50 ? 346 GLN A CA  1 
ATOM   2736 C C   . GLN A 1 346 ? -21.604 38.772 8.790  1.00 31.85 ? 346 GLN A C   1 
ATOM   2737 O O   . GLN A 1 346 ? -21.413 37.601 9.147  1.00 27.43 ? 346 GLN A O   1 
ATOM   2738 C CB  . GLN A 1 346 ? -21.513 40.585 10.510 1.00 27.86 ? 346 GLN A CB  1 
ATOM   2739 C CG  . GLN A 1 346 ? -20.606 41.226 11.551 1.00 30.79 ? 346 GLN A CG  1 
ATOM   2740 C CD  . GLN A 1 346 ? -21.385 41.760 12.735 1.00 40.63 ? 346 GLN A CD  1 
ATOM   2741 O OE1 . GLN A 1 346 ? -22.418 41.199 13.122 1.00 45.96 ? 346 GLN A OE1 1 
ATOM   2742 N NE2 . GLN A 1 346 ? -20.889 42.835 13.328 1.00 35.33 ? 346 GLN A NE2 1 
ATOM   2743 N N   . LYS A 1 347 ? -22.535 39.106 7.902  1.00 31.94 ? 347 LYS A N   1 
ATOM   2744 C CA  . LYS A 1 347 ? -23.362 38.078 7.276  1.00 32.66 ? 347 LYS A CA  1 
ATOM   2745 C C   . LYS A 1 347 ? -22.497 37.107 6.488  1.00 29.93 ? 347 LYS A C   1 
ATOM   2746 O O   . LYS A 1 347 ? -22.607 35.878 6.626  1.00 31.74 ? 347 LYS A O   1 
ATOM   2747 C CB  . LYS A 1 347 ? -24.375 38.695 6.314  1.00 32.87 ? 347 LYS A CB  1 
ATOM   2748 C CG  . LYS A 1 347 ? -24.957 37.640 5.386  1.00 38.95 ? 347 LYS A CG  1 
ATOM   2749 C CD  . LYS A 1 347 ? -26.148 38.124 4.588  1.00 47.24 ? 347 LYS A CD  1 
ATOM   2750 C CE  . LYS A 1 347 ? -26.683 36.966 3.736  1.00 50.02 ? 347 LYS A CE  1 
ATOM   2751 N NZ  . LYS A 1 347 ? -28.030 37.260 3.186  1.00 55.93 ? 347 LYS A NZ  1 
ATOM   2752 N N   . GLU A 1 348 ? -21.624 37.664 5.658  1.00 29.30 ? 348 GLU A N   1 
ATOM   2753 C CA  . GLU A 1 348 ? -20.759 36.838 4.834  1.00 30.75 ? 348 GLU A CA  1 
ATOM   2754 C C   . GLU A 1 348 ? -19.850 35.899 5.605  1.00 30.72 ? 348 GLU A C   1 
ATOM   2755 O O   . GLU A 1 348 ? -19.693 34.735 5.219  1.00 31.34 ? 348 GLU A O   1 
ATOM   2756 C CB  . GLU A 1 348 ? -19.903 37.704 3.912  1.00 35.37 ? 348 GLU A CB  1 
ATOM   2757 C CG  . GLU A 1 348 ? -20.516 37.940 2.552  1.00 42.71 ? 348 GLU A CG  1 
ATOM   2758 C CD  . GLU A 1 348 ? -19.463 38.016 1.452  1.00 48.94 ? 348 GLU A CD  1 
ATOM   2759 O OE1 . GLU A 1 348 ? -18.767 36.998 1.217  1.00 50.60 ? 348 GLU A OE1 1 
ATOM   2760 O OE2 . GLU A 1 348 ? -19.323 39.090 0.826  1.00 45.06 ? 348 GLU A OE2 1 
ATOM   2761 N N   . LEU A 1 349 ? -19.244 36.399 6.677  1.00 28.51 ? 349 LEU A N   1 
ATOM   2762 C CA  . LEU A 1 349 ? -18.346 35.577 7.480  1.00 32.50 ? 349 LEU A CA  1 
ATOM   2763 C C   . LEU A 1 349 ? -19.121 34.475 8.184  1.00 33.10 ? 349 LEU A C   1 
ATOM   2764 O O   . LEU A 1 349 ? -18.662 33.332 8.266  1.00 29.68 ? 349 LEU A O   1 
ATOM   2765 C CB  . LEU A 1 349 ? -17.606 36.432 8.523  1.00 33.79 ? 349 LEU A CB  1 
ATOM   2766 C CG  . LEU A 1 349 ? -16.512 37.329 7.950  1.00 28.73 ? 349 LEU A CG  1 
ATOM   2767 C CD1 . LEU A 1 349 ? -15.883 38.207 9.037  1.00 24.64 ? 349 LEU A CD1 1 
ATOM   2768 C CD2 . LEU A 1 349 ? -15.473 36.427 7.300  1.00 27.36 ? 349 LEU A CD2 1 
ATOM   2769 N N   . LYS A 1 350 ? -20.297 34.830 8.694  1.00 35.11 ? 350 LYS A N   1 
ATOM   2770 C CA  . LYS A 1 350 ? -21.141 33.882 9.398  1.00 30.83 ? 350 LYS A CA  1 
ATOM   2771 C C   . LYS A 1 350 ? -21.470 32.730 8.445  1.00 34.74 ? 350 LYS A C   1 
ATOM   2772 O O   . LYS A 1 350 ? -21.361 31.557 8.804  1.00 32.37 ? 350 LYS A O   1 
ATOM   2773 C CB  . LYS A 1 350 ? -22.414 34.581 9.854  1.00 30.69 ? 350 LYS A CB  1 
ATOM   2774 C CG  . LYS A 1 350 ? -23.281 33.781 10.809 1.00 34.65 ? 350 LYS A CG  1 
ATOM   2775 C CD  . LYS A 1 350 ? -24.303 34.681 11.504 1.00 44.74 ? 350 LYS A CD  1 
ATOM   2776 C CE  . LYS A 1 350 ? -25.328 35.246 10.518 1.00 51.40 ? 350 LYS A CE  1 
ATOM   2777 N NZ  . LYS A 1 350 ? -26.207 36.284 11.134 1.00 54.67 ? 350 LYS A NZ  1 
ATOM   2778 N N   . GLU A 1 351 ? -21.843 33.066 7.213  1.00 35.54 ? 351 GLU A N   1 
ATOM   2779 C CA  . GLU A 1 351 ? -22.177 32.035 6.237  1.00 35.20 ? 351 GLU A CA  1 
ATOM   2780 C C   . GLU A 1 351 ? -20.989 31.136 5.941  1.00 33.03 ? 351 GLU A C   1 
ATOM   2781 O O   . GLU A 1 351 ? -21.131 29.917 5.831  1.00 30.61 ? 351 GLU A O   1 
ATOM   2782 C CB  . GLU A 1 351 ? -22.671 32.666 4.941  1.00 34.80 ? 351 GLU A CB  1 
ATOM   2783 C CG  . GLU A 1 351 ? -23.950 33.453 5.115  1.00 41.73 ? 351 GLU A CG  1 
ATOM   2784 C CD  . GLU A 1 351 ? -24.449 34.037 3.804  1.00 45.96 ? 351 GLU A CD  1 
ATOM   2785 O OE1 . GLU A 1 351 ? -23.606 34.472 2.992  1.00 45.71 ? 351 GLU A OE1 1 
ATOM   2786 O OE2 . GLU A 1 351 ? -25.680 34.075 3.593  1.00 47.98 ? 351 GLU A OE2 1 
ATOM   2787 N N   . ILE A 1 352 ? -19.815 31.741 5.823  1.00 29.99 ? 352 ILE A N   1 
ATOM   2788 C CA  . ILE A 1 352 ? -18.596 30.994 5.537  1.00 30.69 ? 352 ILE A CA  1 
ATOM   2789 C C   . ILE A 1 352 ? -18.131 30.148 6.726  1.00 30.46 ? 352 ILE A C   1 
ATOM   2790 O O   . ILE A 1 352 ? -17.894 28.945 6.583  1.00 30.52 ? 352 ILE A O   1 
ATOM   2791 C CB  . ILE A 1 352 ? -17.462 31.955 5.124  1.00 29.37 ? 352 ILE A CB  1 
ATOM   2792 C CG1 . ILE A 1 352 ? -17.833 32.642 3.802  1.00 27.07 ? 352 ILE A CG1 1 
ATOM   2793 C CG2 . ILE A 1 352 ? -16.141 31.199 4.986  1.00 27.54 ? 352 ILE A CG2 1 
ATOM   2794 C CD1 . ILE A 1 352 ? -16.939 33.800 3.442  1.00 29.00 ? 352 ILE A CD1 1 
ATOM   2795 N N   . GLN A 1 353 ? -18.003 30.770 7.898  1.00 29.99 ? 353 GLN A N   1 
ATOM   2796 C CA  . GLN A 1 353 ? -17.542 30.060 9.092  1.00 30.43 ? 353 GLN A CA  1 
ATOM   2797 C C   . GLN A 1 353 ? -18.428 28.917 9.599  1.00 30.59 ? 353 GLN A C   1 
ATOM   2798 O O   . GLN A 1 353 ? -17.917 27.898 10.062 1.00 29.88 ? 353 GLN A O   1 
ATOM   2799 C CB  . GLN A 1 353 ? -17.280 31.068 10.209 1.00 31.26 ? 353 GLN A CB  1 
ATOM   2800 C CG  . GLN A 1 353 ? -16.247 32.096 9.772  1.00 28.86 ? 353 GLN A CG  1 
ATOM   2801 C CD  . GLN A 1 353 ? -16.070 33.228 10.738 1.00 23.49 ? 353 GLN A CD  1 
ATOM   2802 O OE1 . GLN A 1 353 ? -17.019 33.680 11.358 1.00 24.62 ? 353 GLN A OE1 1 
ATOM   2803 N NE2 . GLN A 1 353 ? -14.835 33.711 10.856 1.00 25.71 ? 353 GLN A NE2 1 
ATOM   2804 N N   . TYR A 1 354 ? -19.745 29.057 9.502  1.00 35.78 ? 354 TYR A N   1 
ATOM   2805 C CA  . TYR A 1 354 ? -20.612 27.983 9.977  1.00 39.99 ? 354 TYR A CA  1 
ATOM   2806 C C   . TYR A 1 354 ? -21.030 27.003 8.877  1.00 43.93 ? 354 TYR A C   1 
ATOM   2807 O O   . TYR A 1 354 ? -21.962 26.218 9.047  1.00 48.18 ? 354 TYR A O   1 
ATOM   2808 C CB  . TYR A 1 354 ? -21.826 28.567 10.701 1.00 37.41 ? 354 TYR A CB  1 
ATOM   2809 C CG  . TYR A 1 354 ? -21.442 29.256 12.001 1.00 32.98 ? 354 TYR A CG  1 
ATOM   2810 C CD1 . TYR A 1 354 ? -21.136 30.619 12.031 1.00 33.30 ? 354 TYR A CD1 1 
ATOM   2811 C CD2 . TYR A 1 354 ? -21.336 28.534 13.193 1.00 30.68 ? 354 TYR A CD2 1 
ATOM   2812 C CE1 . TYR A 1 354 ? -20.729 31.248 13.217 1.00 27.28 ? 354 TYR A CE1 1 
ATOM   2813 C CE2 . TYR A 1 354 ? -20.928 29.151 14.384 1.00 28.56 ? 354 TYR A CE2 1 
ATOM   2814 C CZ  . TYR A 1 354 ? -20.627 30.508 14.382 1.00 30.36 ? 354 TYR A CZ  1 
ATOM   2815 O OH  . TYR A 1 354 ? -20.217 31.125 15.535 1.00 32.07 ? 354 TYR A OH  1 
ATOM   2816 N N   . GLY A 1 355 ? -20.333 27.061 7.747  1.00 43.36 ? 355 GLY A N   1 
ATOM   2817 C CA  . GLY A 1 355 ? -20.610 26.144 6.651  1.00 43.51 ? 355 GLY A CA  1 
ATOM   2818 C C   . GLY A 1 355 ? -21.859 26.328 5.802  1.00 44.06 ? 355 GLY A C   1 
ATOM   2819 O O   . GLY A 1 355 ? -22.198 25.438 5.022  1.00 43.46 ? 355 GLY A O   1 
ATOM   2820 N N   . ILE A 1 356 ? -22.544 27.458 5.942  1.00 41.67 ? 356 ILE A N   1 
ATOM   2821 C CA  . ILE A 1 356 ? -23.735 27.728 5.140  1.00 43.93 ? 356 ILE A CA  1 
ATOM   2822 C C   . ILE A 1 356 ? -23.359 27.789 3.665  1.00 42.91 ? 356 ILE A C   1 
ATOM   2823 O O   . ILE A 1 356 ? -24.138 27.393 2.798  1.00 41.30 ? 356 ILE A O   1 
ATOM   2824 C CB  . ILE A 1 356 ? -24.399 29.056 5.563  1.00 45.32 ? 356 ILE A CB  1 
ATOM   2825 C CG1 . ILE A 1 356 ? -24.836 28.952 7.029  1.00 47.19 ? 356 ILE A CG1 1 
ATOM   2826 C CG2 . ILE A 1 356 ? -25.581 29.380 4.654  1.00 43.32 ? 356 ILE A CG2 1 
ATOM   2827 C CD1 . ILE A 1 356 ? -25.601 27.667 7.353  1.00 45.83 ? 356 ILE A CD1 1 
ATOM   2828 N N   . ARG A 1 357 ? -22.155 28.283 3.397  1.00 46.33 ? 357 ARG A N   1 
ATOM   2829 C CA  . ARG A 1 357 ? -21.616 28.377 2.039  1.00 48.26 ? 357 ARG A CA  1 
ATOM   2830 C C   . ARG A 1 357 ? -20.251 27.712 2.057  1.00 48.63 ? 357 ARG A C   1 
ATOM   2831 O O   . ARG A 1 357 ? -19.416 28.034 2.907  1.00 47.38 ? 357 ARG A O   1 
ATOM   2832 C CB  . ARG A 1 357 ? -21.428 29.835 1.613  1.00 49.07 ? 357 ARG A CB  1 
ATOM   2833 C CG  . ARG A 1 357 ? -22.688 30.651 1.627  1.00 54.56 ? 357 ARG A CG  1 
ATOM   2834 C CD  . ARG A 1 357 ? -22.456 31.966 0.919  1.00 57.96 ? 357 ARG A CD  1 
ATOM   2835 N NE  . ARG A 1 357 ? -23.724 32.611 0.595  1.00 61.57 ? 357 ARG A NE  1 
ATOM   2836 C CZ  . ARG A 1 357 ? -23.841 33.647 -0.230 1.00 60.97 ? 357 ARG A CZ  1 
ATOM   2837 N NH1 . ARG A 1 357 ? -22.761 34.152 -0.815 1.00 59.06 ? 357 ARG A NH1 1 
ATOM   2838 N NH2 . ARG A 1 357 ? -25.035 34.178 -0.467 1.00 60.73 ? 357 ARG A NH2 1 
ATOM   2839 N N   . ALA A 1 358 ? -20.022 26.783 1.134  1.00 47.45 ? 358 ALA A N   1 
ATOM   2840 C CA  . ALA A 1 358 ? -18.731 26.105 1.052  1.00 44.98 ? 358 ALA A CA  1 
ATOM   2841 C C   . ALA A 1 358 ? -17.683 27.151 0.687  1.00 43.43 ? 358 ALA A C   1 
ATOM   2842 O O   . ALA A 1 358 ? -17.965 28.058 -0.113 1.00 46.11 ? 358 ALA A O   1 
ATOM   2843 C CB  . ALA A 1 358 ? -18.776 25.019 -0.010 1.00 46.08 ? 358 ALA A CB  1 
ATOM   2844 N N   . HIS A 1 359 ? -16.491 27.031 1.272  1.00 38.33 ? 359 HIS A N   1 
ATOM   2845 C CA  . HIS A 1 359 ? -15.436 27.987 0.998  1.00 34.78 ? 359 HIS A CA  1 
ATOM   2846 C C   . HIS A 1 359 ? -14.047 27.396 1.249  1.00 37.39 ? 359 HIS A C   1 
ATOM   2847 O O   . HIS A 1 359 ? -13.865 26.572 2.159  1.00 35.44 ? 359 HIS A O   1 
ATOM   2848 C CB  . HIS A 1 359 ? -15.643 29.224 1.872  1.00 37.22 ? 359 HIS A CB  1 
ATOM   2849 C CG  . HIS A 1 359 ? -15.056 30.468 1.295  1.00 34.66 ? 359 HIS A CG  1 
ATOM   2850 N ND1 . HIS A 1 359 ? -15.833 31.504 0.819  1.00 34.75 ? 359 HIS A ND1 1 
ATOM   2851 C CD2 . HIS A 1 359 ? -13.774 30.803 1.022  1.00 34.77 ? 359 HIS A CD2 1 
ATOM   2852 C CE1 . HIS A 1 359 ? -15.055 32.416 0.265  1.00 34.13 ? 359 HIS A CE1 1 
ATOM   2853 N NE2 . HIS A 1 359 ? -13.801 32.014 0.375  1.00 30.73 ? 359 HIS A NE2 1 
ATOM   2854 N N   . GLU A 1 360 ? -13.070 27.824 0.446  1.00 35.33 ? 360 GLU A N   1 
ATOM   2855 C CA  . GLU A 1 360 ? -11.700 27.344 0.583  1.00 36.80 ? 360 GLU A CA  1 
ATOM   2856 C C   . GLU A 1 360 ? -11.112 27.873 1.891  1.00 35.45 ? 360 GLU A C   1 
ATOM   2857 O O   . GLU A 1 360 ? -10.114 27.347 2.377  1.00 34.17 ? 360 GLU A O   1 
ATOM   2858 C CB  . GLU A 1 360 ? -10.824 27.829 -0.588 1.00 42.16 ? 360 GLU A CB  1 
ATOM   2859 C CG  . GLU A 1 360 ? -9.698  26.853 -1.039 1.00 54.18 ? 360 GLU A CG  1 
ATOM   2860 C CD  . GLU A 1 360 ? -8.729  26.386 0.083  1.00 60.38 ? 360 GLU A CD  1 
ATOM   2861 O OE1 . GLU A 1 360 ? -9.166  25.662 1.013  1.00 59.91 ? 360 GLU A OE1 1 
ATOM   2862 O OE2 . GLU A 1 360 ? -7.518  26.726 0.020  1.00 57.30 ? 360 GLU A OE2 1 
ATOM   2863 N N   . TRP A 1 361 ? -11.715 28.924 2.447  1.00 30.90 ? 361 TRP A N   1 
ATOM   2864 C CA  . TRP A 1 361 ? -11.224 29.499 3.694  1.00 28.60 ? 361 TRP A CA  1 
ATOM   2865 C C   . TRP A 1 361 ? -11.381 28.564 4.892  1.00 30.80 ? 361 TRP A C   1 
ATOM   2866 O O   . TRP A 1 361 ? -10.637 28.676 5.874  1.00 35.05 ? 361 TRP A O   1 
ATOM   2867 C CB  . TRP A 1 361 ? -11.936 30.825 3.995  1.00 20.89 ? 361 TRP A CB  1 
ATOM   2868 C CG  . TRP A 1 361 ? -11.407 31.978 3.211  1.00 25.26 ? 361 TRP A CG  1 
ATOM   2869 C CD1 . TRP A 1 361 ? -10.351 31.960 2.340  1.00 23.82 ? 361 TRP A CD1 1 
ATOM   2870 C CD2 . TRP A 1 361 ? -11.881 33.328 3.232  1.00 22.52 ? 361 TRP A CD2 1 
ATOM   2871 N NE1 . TRP A 1 361 ? -10.145 33.207 1.825  1.00 24.16 ? 361 TRP A NE1 1 
ATOM   2872 C CE2 . TRP A 1 361 ? -11.067 34.068 2.355  1.00 22.01 ? 361 TRP A CE2 1 
ATOM   2873 C CE3 . TRP A 1 361 ? -12.912 33.983 3.905  1.00 22.81 ? 361 TRP A CE3 1 
ATOM   2874 C CZ2 . TRP A 1 361 ? -11.254 35.436 2.129  1.00 24.65 ? 361 TRP A CZ2 1 
ATOM   2875 C CZ3 . TRP A 1 361 ? -13.097 35.342 3.683  1.00 29.85 ? 361 TRP A CZ3 1 
ATOM   2876 C CH2 . TRP A 1 361 ? -12.273 36.050 2.805  1.00 24.68 ? 361 TRP A CH2 1 
ATOM   2877 N N   . MET A 1 362 ? -12.338 27.645 4.827  1.00 29.15 ? 362 MET A N   1 
ATOM   2878 C CA  . MET A 1 362 ? -12.574 26.735 5.938  1.00 27.46 ? 362 MET A CA  1 
ATOM   2879 C C   . MET A 1 362 ? -11.800 25.424 5.850  1.00 31.69 ? 362 MET A C   1 
ATOM   2880 O O   . MET A 1 362 ? -11.700 24.818 4.784  1.00 35.24 ? 362 MET A O   1 
ATOM   2881 C CB  . MET A 1 362 ? -14.078 26.450 6.079  1.00 27.31 ? 362 MET A CB  1 
ATOM   2882 C CG  . MET A 1 362 ? -14.921 27.700 6.235  1.00 24.38 ? 362 MET A CG  1 
ATOM   2883 S SD  . MET A 1 362 ? -14.265 28.836 7.501  1.00 28.32 ? 362 MET A SD  1 
ATOM   2884 C CE  . MET A 1 362 ? -14.613 27.968 9.028  1.00 23.87 ? 362 MET A CE  1 
ATOM   2885 N N   . PHE A 1 363 ? -11.236 25.020 6.989  1.00 30.72 ? 363 PHE A N   1 
ATOM   2886 C CA  . PHE A 1 363 ? -10.449 23.800 7.141  1.00 28.50 ? 363 PHE A CA  1 
ATOM   2887 C C   . PHE A 1 363 ? -11.281 22.838 7.973  1.00 29.28 ? 363 PHE A C   1 
ATOM   2888 O O   . PHE A 1 363 ? -11.560 23.100 9.140  1.00 32.62 ? 363 PHE A O   1 
ATOM   2889 C CB  . PHE A 1 363 ? -9.159  24.120 7.880  1.00 29.72 ? 363 PHE A CB  1 
ATOM   2890 C CG  . PHE A 1 363 ? -8.293  22.936 8.133  1.00 28.49 ? 363 PHE A CG  1 
ATOM   2891 C CD1 . PHE A 1 363 ? -7.542  22.375 7.113  1.00 31.16 ? 363 PHE A CD1 1 
ATOM   2892 C CD2 . PHE A 1 363 ? -8.193  22.402 9.410  1.00 24.87 ? 363 PHE A CD2 1 
ATOM   2893 C CE1 . PHE A 1 363 ? -6.692  21.300 7.360  1.00 31.50 ? 363 PHE A CE1 1 
ATOM   2894 C CE2 . PHE A 1 363 ? -7.347  21.325 9.672  1.00 30.18 ? 363 PHE A CE2 1 
ATOM   2895 C CZ  . PHE A 1 363 ? -6.594  20.773 8.648  1.00 28.02 ? 363 PHE A CZ  1 
ATOM   2896 N N   . PRO A 1 364 ? -11.688 21.704 7.385  1.00 34.37 ? 364 PRO A N   1 
ATOM   2897 C CA  . PRO A 1 364 ? -12.506 20.674 8.036  1.00 32.13 ? 364 PRO A CA  1 
ATOM   2898 C C   . PRO A 1 364 ? -11.932 20.043 9.295  1.00 33.27 ? 364 PRO A C   1 
ATOM   2899 O O   . PRO A 1 364 ? -10.759 19.682 9.349  1.00 35.69 ? 364 PRO A O   1 
ATOM   2900 C CB  . PRO A 1 364 ? -12.713 19.640 6.931  1.00 33.25 ? 364 PRO A CB  1 
ATOM   2901 C CG  . PRO A 1 364 ? -12.552 20.429 5.664  1.00 35.78 ? 364 PRO A CG  1 
ATOM   2902 C CD  . PRO A 1 364 ? -11.390 21.322 5.992  1.00 38.11 ? 364 PRO A CD  1 
ATOM   2903 N N   . VAL A 1 365 ? -12.817 19.888 10.275 1.00 39.08 ? 365 VAL A N   1 
ATOM   2904 C CA  . VAL A 1 365 ? -12.569 19.311 11.589 1.00 43.95 ? 365 VAL A CA  1 
ATOM   2905 C C   . VAL A 1 365 ? -11.329 19.797 12.280 1.00 49.68 ? 365 VAL A C   1 
ATOM   2906 O O   . VAL A 1 365 ? -10.284 19.149 12.094 1.00 52.66 ? 365 VAL A O   1 
ATOM   2907 C CB  . VAL A 1 365 ? -12.592 17.748 11.561 1.00 42.35 ? 365 VAL A CB  1 
ATOM   2908 C CG1 . VAL A 1 365 ? -13.992 17.285 11.240 1.00 41.46 ? 365 VAL A CG1 1 
ATOM   2909 C CG2 . VAL A 1 365 ? -11.621 17.190 10.556 1.00 42.53 ? 365 VAL A CG2 1 
ATOM   2910 O OXT . VAL A 1 365 ? -11.422 20.833 12.982 1.00 51.35 ? 365 VAL A OXT 1 
ATOM   2911 N N   . ALA B 1 1   ? 1.020   52.364 46.193 1.00 61.75 ? 1   ALA B N   1 
ATOM   2912 C CA  . ALA B 1 1   ? 0.937   52.273 47.681 1.00 62.84 ? 1   ALA B CA  1 
ATOM   2913 C C   . ALA B 1 1   ? -0.228  51.379 48.115 1.00 63.12 ? 1   ALA B C   1 
ATOM   2914 O O   . ALA B 1 1   ? -1.394  51.755 47.983 1.00 64.84 ? 1   ALA B O   1 
ATOM   2915 C CB  . ALA B 1 1   ? 0.786   53.674 48.281 1.00 59.38 ? 1   ALA B CB  1 
ATOM   2916 N N   . SER B 1 2   ? 0.105   50.197 48.632 1.00 64.39 ? 2   SER B N   1 
ATOM   2917 C CA  . SER B 1 2   ? -0.884  49.224 49.093 1.00 64.96 ? 2   SER B CA  1 
ATOM   2918 C C   . SER B 1 2   ? -0.216  48.234 50.053 1.00 69.01 ? 2   SER B C   1 
ATOM   2919 O O   . SER B 1 2   ? -0.892  47.497 50.781 1.00 68.04 ? 2   SER B O   1 
ATOM   2920 C CB  . SER B 1 2   ? -1.482  48.484 47.897 1.00 63.56 ? 2   SER B CB  1 
ATOM   2921 O OG  . SER B 1 2   ? -2.067  49.401 46.990 1.00 61.60 ? 2   SER B OG  1 
ATOM   2922 N N   . SER B 1 3   ? 1.120   48.233 50.021 1.00 70.73 ? 3   SER B N   1 
ATOM   2923 C CA  . SER B 1 3   ? 2.004   47.412 50.869 1.00 69.53 ? 3   SER B CA  1 
ATOM   2924 C C   . SER B 1 3   ? 1.585   46.008 51.340 1.00 66.92 ? 3   SER B C   1 
ATOM   2925 O O   . SER B 1 3   ? 0.448   45.564 51.136 1.00 63.42 ? 3   SER B O   1 
ATOM   2926 C CB  . SER B 1 3   ? 2.401   48.225 52.110 1.00 70.65 ? 3   SER B CB  1 
ATOM   2927 O OG  . SER B 1 3   ? 1.270   48.476 52.936 1.00 70.15 ? 3   SER B OG  1 
ATOM   2928 N N   . SER B 1 4   ? 2.549   45.335 51.981 1.00 60.87 ? 4   SER B N   1 
ATOM   2929 C CA  . SER B 1 4   ? 2.395   43.994 52.549 1.00 55.08 ? 4   SER B CA  1 
ATOM   2930 C C   . SER B 1 4   ? 3.663   43.152 52.403 1.00 51.63 ? 4   SER B C   1 
ATOM   2931 O O   . SER B 1 4   ? 4.698   43.630 51.910 1.00 52.48 ? 4   SER B O   1 
ATOM   2932 C CB  . SER B 1 4   ? 1.221   43.253 51.899 1.00 58.51 ? 4   SER B CB  1 
ATOM   2933 O OG  . SER B 1 4   ? 0.774   42.180 52.713 1.00 58.84 ? 4   SER B OG  1 
ATOM   2934 N N   . PHE B 1 5   ? 3.559   41.899 52.851 1.00 47.47 ? 5   PHE B N   1 
ATOM   2935 C CA  . PHE B 1 5   ? 4.631   40.914 52.795 1.00 40.94 ? 5   PHE B CA  1 
ATOM   2936 C C   . PHE B 1 5   ? 5.837   41.392 53.622 1.00 43.98 ? 5   PHE B C   1 
ATOM   2937 O O   . PHE B 1 5   ? 6.556   42.320 53.246 1.00 44.30 ? 5   PHE B O   1 
ATOM   2938 C CB  . PHE B 1 5   ? 4.867   40.591 51.298 1.00 45.58 ? 5   PHE B CB  1 
ATOM   2939 C CG  . PHE B 1 5   ? 6.302   40.562 50.829 1.00 44.37 ? 5   PHE B CG  1 
ATOM   2940 C CD1 . PHE B 1 5   ? 7.272   39.808 51.470 1.00 41.18 ? 5   PHE B CD1 1 
ATOM   2941 C CD2 . PHE B 1 5   ? 6.658   41.258 49.670 1.00 40.60 ? 5   PHE B CD2 1 
ATOM   2942 C CE1 . PHE B 1 5   ? 8.581   39.749 50.963 1.00 38.91 ? 5   PHE B CE1 1 
ATOM   2943 C CE2 . PHE B 1 5   ? 7.962   41.203 49.156 1.00 32.66 ? 5   PHE B CE2 1 
ATOM   2944 C CZ  . PHE B 1 5   ? 8.922   40.447 49.805 1.00 34.17 ? 5   PHE B CZ  1 
ATOM   2945 N N   . LYS B 1 6   ? 5.993   40.760 54.791 1.00 42.71 ? 6   LYS B N   1 
ATOM   2946 C CA  . LYS B 1 6   ? 7.043   41.068 55.780 1.00 43.42 ? 6   LYS B CA  1 
ATOM   2947 C C   . LYS B 1 6   ? 8.117   39.999 55.955 1.00 43.57 ? 6   LYS B C   1 
ATOM   2948 O O   . LYS B 1 6   ? 7.838   38.806 55.884 1.00 45.92 ? 6   LYS B O   1 
ATOM   2949 C CB  . LYS B 1 6   ? 6.396   41.342 57.140 1.00 42.27 ? 6   LYS B CB  1 
ATOM   2950 C CG  . LYS B 1 6   ? 5.701   42.691 57.227 1.00 42.56 ? 6   LYS B CG  1 
ATOM   2951 C CD  . LYS B 1 6   ? 4.378   42.593 57.967 1.00 48.97 ? 6   LYS B CD  1 
ATOM   2952 C CE  . LYS B 1 6   ? 3.819   43.980 58.274 1.00 49.94 ? 6   LYS B CE  1 
ATOM   2953 N NZ  . LYS B 1 6   ? 3.790   44.856 57.065 1.00 53.50 ? 6   LYS B NZ  1 
ATOM   2954 N N   . ALA B 1 7   ? 9.344   40.431 56.224 1.00 41.54 ? 7   ALA B N   1 
ATOM   2955 C CA  . ALA B 1 7   ? 10.458  39.499 56.380 1.00 41.22 ? 7   ALA B CA  1 
ATOM   2956 C C   . ALA B 1 7   ? 10.455  38.652 57.657 1.00 42.05 ? 7   ALA B C   1 
ATOM   2957 O O   . ALA B 1 7   ? 10.961  37.523 57.663 1.00 40.52 ? 7   ALA B O   1 
ATOM   2958 C CB  . ALA B 1 7   ? 11.773  40.257 56.274 1.00 42.94 ? 7   ALA B CB  1 
ATOM   2959 N N   . ALA B 1 8   ? 9.908   39.181 58.741 1.00 41.25 ? 8   ALA B N   1 
ATOM   2960 C CA  . ALA B 1 8   ? 9.892   38.413 59.989 1.00 44.09 ? 8   ALA B CA  1 
ATOM   2961 C C   . ALA B 1 8   ? 8.944   37.210 59.924 1.00 45.00 ? 8   ALA B C   1 
ATOM   2962 O O   . ALA B 1 8   ? 8.723   36.534 60.932 1.00 40.76 ? 8   ALA B O   1 
ATOM   2963 C CB  . ALA B 1 8   ? 9.506   39.302 61.138 1.00 43.30 ? 8   ALA B CB  1 
ATOM   2964 N N   . ASP B 1 9   ? 8.388   36.954 58.737 1.00 46.44 ? 9   ASP B N   1 
ATOM   2965 C CA  . ASP B 1 9   ? 7.469   35.840 58.522 1.00 41.28 ? 9   ASP B CA  1 
ATOM   2966 C C   . ASP B 1 9   ? 8.067   34.776 57.630 1.00 38.79 ? 9   ASP B C   1 
ATOM   2967 O O   . ASP B 1 9   ? 7.360   33.869 57.175 1.00 37.43 ? 9   ASP B O   1 
ATOM   2968 C CB  . ASP B 1 9   ? 6.177   36.327 57.881 1.00 42.94 ? 9   ASP B CB  1 
ATOM   2969 C CG  . ASP B 1 9   ? 5.378   37.210 58.798 1.00 51.09 ? 9   ASP B CG  1 
ATOM   2970 O OD1 . ASP B 1 9   ? 5.242   36.845 59.989 1.00 51.78 ? 9   ASP B OD1 1 
ATOM   2971 O OD2 . ASP B 1 9   ? 4.881   38.260 58.330 1.00 51.45 ? 9   ASP B OD2 1 
ATOM   2972 N N   . LEU B 1 10  ? 9.363   34.883 57.373 1.00 37.64 ? 10  LEU B N   1 
ATOM   2973 C CA  . LEU B 1 10  ? 10.031  33.926 56.514 1.00 41.59 ? 10  LEU B CA  1 
ATOM   2974 C C   . LEU B 1 10  ? 9.874   32.505 57.014 1.00 47.77 ? 10  LEU B C   1 
ATOM   2975 O O   . LEU B 1 10  ? 10.109  32.208 58.189 1.00 47.53 ? 10  LEU B O   1 
ATOM   2976 C CB  . LEU B 1 10  ? 11.518  34.262 56.388 1.00 40.39 ? 10  LEU B CB  1 
ATOM   2977 C CG  . LEU B 1 10  ? 11.901  35.415 55.449 1.00 44.33 ? 10  LEU B CG  1 
ATOM   2978 C CD1 . LEU B 1 10  ? 13.339  35.865 55.728 1.00 47.63 ? 10  LEU B CD1 1 
ATOM   2979 C CD2 . LEU B 1 10  ? 11.747  34.964 54.001 1.00 39.16 ? 10  LEU B CD2 1 
ATOM   2980 N N   . GLN B 1 11  ? 9.432   31.634 56.118 1.00 46.68 ? 11  GLN B N   1 
ATOM   2981 C CA  . GLN B 1 11  ? 9.290   30.233 56.432 1.00 46.58 ? 11  GLN B CA  1 
ATOM   2982 C C   . GLN B 1 11  ? 10.585  29.767 55.837 1.00 45.79 ? 11  GLN B C   1 
ATOM   2983 O O   . GLN B 1 11  ? 11.037  30.339 54.850 1.00 54.06 ? 11  GLN B O   1 
ATOM   2984 C CB  . GLN B 1 11  ? 8.088   29.632 55.704 1.00 49.14 ? 11  GLN B CB  1 
ATOM   2985 C CG  . GLN B 1 11  ? 6.784   30.334 56.047 1.00 50.77 ? 11  GLN B CG  1 
ATOM   2986 C CD  . GLN B 1 11  ? 6.559   30.425 57.547 1.00 58.22 ? 11  GLN B CD  1 
ATOM   2987 O OE1 . GLN B 1 11  ? 7.371   31.001 58.278 1.00 59.70 ? 11  GLN B OE1 1 
ATOM   2988 N NE2 . GLN B 1 11  ? 5.452   29.859 58.015 1.00 60.02 ? 11  GLN B NE2 1 
ATOM   2989 N N   . LEU B 1 12  ? 11.207  28.753 56.418 1.00 47.85 ? 12  LEU B N   1 
ATOM   2990 C CA  . LEU B 1 12  ? 12.486  28.315 55.901 1.00 45.60 ? 12  LEU B CA  1 
ATOM   2991 C C   . LEU B 1 12  ? 12.579  26.803 55.817 1.00 49.92 ? 12  LEU B C   1 
ATOM   2992 O O   . LEU B 1 12  ? 12.287  26.098 56.784 1.00 52.28 ? 12  LEU B O   1 
ATOM   2993 C CB  . LEU B 1 12  ? 13.591  28.874 56.794 1.00 45.96 ? 12  LEU B CB  1 
ATOM   2994 C CG  . LEU B 1 12  ? 15.021  28.941 56.264 1.00 47.72 ? 12  LEU B CG  1 
ATOM   2995 C CD1 . LEU B 1 12  ? 15.847  29.734 57.261 1.00 52.87 ? 12  LEU B CD1 1 
ATOM   2996 C CD2 . LEU B 1 12  ? 15.609  27.554 56.062 1.00 49.59 ? 12  LEU B CD2 1 
ATOM   2997 N N   . GLU B 1 13  ? 12.982  26.315 54.648 1.00 45.24 ? 13  GLU B N   1 
ATOM   2998 C CA  . GLU B 1 13  ? 13.130  24.890 54.418 1.00 51.00 ? 13  GLU B CA  1 
ATOM   2999 C C   . GLU B 1 13  ? 14.474  24.616 53.767 1.00 50.71 ? 13  GLU B C   1 
ATOM   3000 O O   . GLU B 1 13  ? 14.632  24.767 52.554 1.00 53.49 ? 13  GLU B O   1 
ATOM   3001 C CB  . GLU B 1 13  ? 12.016  24.371 53.513 1.00 51.51 ? 13  GLU B CB  1 
ATOM   3002 C CG  . GLU B 1 13  ? 12.138  22.887 53.245 1.00 55.77 ? 13  GLU B CG  1 
ATOM   3003 C CD  . GLU B 1 13  ? 11.086  22.378 52.292 1.00 56.78 ? 13  GLU B CD  1 
ATOM   3004 O OE1 . GLU B 1 13  ? 9.888   22.636 52.543 1.00 55.09 ? 13  GLU B OE1 1 
ATOM   3005 O OE2 . GLU B 1 13  ? 11.460  21.716 51.299 1.00 57.85 ? 13  GLU B OE2 1 
ATOM   3006 N N   . MET B 1 14  ? 15.440  24.204 54.578 1.00 50.34 ? 14  MET B N   1 
ATOM   3007 C CA  . MET B 1 14  ? 16.786  23.927 54.091 1.00 47.65 ? 14  MET B CA  1 
ATOM   3008 C C   . MET B 1 14  ? 16.879  22.788 53.081 1.00 48.05 ? 14  MET B C   1 
ATOM   3009 O O   . MET B 1 14  ? 16.091  21.845 53.119 1.00 45.32 ? 14  MET B O   1 
ATOM   3010 C CB  . MET B 1 14  ? 17.710  23.647 55.275 1.00 47.64 ? 14  MET B CB  1 
ATOM   3011 C CG  . MET B 1 14  ? 17.875  24.844 56.197 1.00 50.51 ? 14  MET B CG  1 
ATOM   3012 S SD  . MET B 1 14  ? 18.526  26.304 55.333 1.00 52.71 ? 14  MET B SD  1 
ATOM   3013 C CE  . MET B 1 14  ? 20.167  25.734 54.901 1.00 44.03 ? 14  MET B CE  1 
ATOM   3014 N N   . THR B 1 15  ? 17.864  22.885 52.186 1.00 50.11 ? 15  THR B N   1 
ATOM   3015 C CA  . THR B 1 15  ? 18.084  21.888 51.143 1.00 46.41 ? 15  THR B CA  1 
ATOM   3016 C C   . THR B 1 15  ? 18.184  20.521 51.781 1.00 48.49 ? 15  THR B C   1 
ATOM   3017 O O   . THR B 1 15  ? 17.956  20.382 52.983 1.00 47.83 ? 15  THR B O   1 
ATOM   3018 C CB  . THR B 1 15  ? 19.371  22.190 50.337 1.00 46.01 ? 15  THR B CB  1 
ATOM   3019 O OG1 . THR B 1 15  ? 19.480  21.290 49.225 1.00 48.66 ? 15  THR B OG1 1 
ATOM   3020 C CG2 . THR B 1 15  ? 20.591  22.051 51.212 1.00 52.44 ? 15  THR B CG2 1 
ATOM   3021 N N   . GLN B 1 16  ? 18.512  19.512 50.977 1.00 49.38 ? 16  GLN B N   1 
ATOM   3022 C CA  . GLN B 1 16  ? 18.628  18.144 51.475 1.00 51.95 ? 16  GLN B CA  1 
ATOM   3023 C C   . GLN B 1 16  ? 19.794  17.418 50.804 1.00 51.57 ? 16  GLN B C   1 
ATOM   3024 O O   . GLN B 1 16  ? 20.234  16.358 51.257 1.00 55.77 ? 16  GLN B O   1 
ATOM   3025 C CB  . GLN B 1 16  ? 17.309  17.397 51.244 1.00 54.59 ? 16  GLN B CB  1 
ATOM   3026 C CG  . GLN B 1 16  ? 16.907  16.486 52.388 1.00 57.84 ? 16  GLN B CG  1 
ATOM   3027 C CD  . GLN B 1 16  ? 15.447  16.640 52.773 1.00 61.21 ? 16  GLN B CD  1 
ATOM   3028 O OE1 . GLN B 1 16  ? 14.550  16.407 51.961 1.00 63.09 ? 16  GLN B OE1 1 
ATOM   3029 N NE2 . GLN B 1 16  ? 15.199  17.036 54.021 1.00 60.51 ? 16  GLN B NE2 1 
ATOM   3030 N N   . LYS B 1 17  ? 20.295  17.995 49.720 1.00 49.01 ? 17  LYS B N   1 
ATOM   3031 C CA  . LYS B 1 17  ? 21.433  17.429 49.009 1.00 52.28 ? 17  LYS B CA  1 
ATOM   3032 C C   . LYS B 1 17  ? 22.138  18.608 48.345 1.00 52.68 ? 17  LYS B C   1 
ATOM   3033 O O   . LYS B 1 17  ? 22.083  18.796 47.126 1.00 50.81 ? 17  LYS B O   1 
ATOM   3034 C CB  . LYS B 1 17  ? 20.981  16.398 47.967 1.00 54.20 ? 17  LYS B CB  1 
ATOM   3035 C CG  . LYS B 1 17  ? 22.133  15.625 47.305 1.00 54.16 ? 17  LYS B CG  1 
ATOM   3036 C CD  . LYS B 1 17  ? 22.462  16.161 45.914 1.00 56.47 ? 17  LYS B CD  1 
ATOM   3037 C CE  . LYS B 1 17  ? 21.282  15.974 44.955 1.00 58.37 ? 17  LYS B CE  1 
ATOM   3038 N NZ  . LYS B 1 17  ? 21.551  16.491 43.580 1.00 57.21 ? 17  LYS B NZ  1 
ATOM   3039 N N   . PRO B 1 18  ? 22.815  19.426 49.161 1.00 54.36 ? 18  PRO B N   1 
ATOM   3040 C CA  . PRO B 1 18  ? 23.531  20.596 48.661 1.00 54.17 ? 18  PRO B CA  1 
ATOM   3041 C C   . PRO B 1 18  ? 24.354  20.245 47.435 1.00 55.14 ? 18  PRO B C   1 
ATOM   3042 O O   . PRO B 1 18  ? 25.094  19.264 47.436 1.00 55.10 ? 18  PRO B O   1 
ATOM   3043 C CB  . PRO B 1 18  ? 24.405  20.995 49.847 1.00 56.05 ? 18  PRO B CB  1 
ATOM   3044 C CG  . PRO B 1 18  ? 23.585  20.561 51.029 1.00 54.63 ? 18  PRO B CG  1 
ATOM   3045 C CD  . PRO B 1 18  ? 23.109  19.201 50.590 1.00 54.62 ? 18  PRO B CD  1 
ATOM   3046 N N   . HIS B 1 19  ? 24.205  21.030 46.378 1.00 56.76 ? 19  HIS B N   1 
ATOM   3047 C CA  . HIS B 1 19  ? 24.977  20.787 45.177 1.00 54.93 ? 19  HIS B CA  1 
ATOM   3048 C C   . HIS B 1 19  ? 26.370  21.287 45.487 1.00 54.64 ? 19  HIS B C   1 
ATOM   3049 O O   . HIS B 1 19  ? 26.554  22.148 46.350 1.00 52.81 ? 19  HIS B O   1 
ATOM   3050 C CB  . HIS B 1 19  ? 24.371  21.536 43.992 1.00 55.05 ? 19  HIS B CB  1 
ATOM   3051 C CG  . HIS B 1 19  ? 23.058  20.974 43.544 1.00 53.66 ? 19  HIS B CG  1 
ATOM   3052 N ND1 . HIS B 1 19  ? 22.958  19.786 42.851 1.00 53.15 ? 19  HIS B ND1 1 
ATOM   3053 C CD2 . HIS B 1 19  ? 21.789  21.404 43.738 1.00 52.53 ? 19  HIS B CD2 1 
ATOM   3054 C CE1 . HIS B 1 19  ? 21.684  19.508 42.640 1.00 51.35 ? 19  HIS B CE1 1 
ATOM   3055 N NE2 . HIS B 1 19  ? 20.954  20.473 43.168 1.00 51.79 ? 19  HIS B NE2 1 
ATOM   3056 N N   . LYS B 1 20  ? 27.359  20.735 44.806 1.00 55.14 ? 20  LYS B N   1 
ATOM   3057 C CA  . LYS B 1 20  ? 28.718  21.154 45.065 1.00 58.93 ? 20  LYS B CA  1 
ATOM   3058 C C   . LYS B 1 20  ? 29.087  22.423 44.304 1.00 57.30 ? 20  LYS B C   1 
ATOM   3059 O O   . LYS B 1 20  ? 28.873  22.525 43.092 1.00 57.26 ? 20  LYS B O   1 
ATOM   3060 C CB  . LYS B 1 20  ? 29.682  20.013 44.736 1.00 60.34 ? 20  LYS B CB  1 
ATOM   3061 C CG  . LYS B 1 20  ? 29.511  18.814 45.660 1.00 61.40 ? 20  LYS B CG  1 
ATOM   3062 C CD  . LYS B 1 20  ? 30.638  17.801 45.509 1.00 60.93 ? 20  LYS B CD  1 
ATOM   3063 C CE  . LYS B 1 20  ? 31.994  18.399 45.869 1.00 61.79 ? 20  LYS B CE  1 
ATOM   3064 N NZ  . LYS B 1 20  ? 32.458  19.426 44.883 1.00 60.09 ? 20  LYS B NZ  1 
ATOM   3065 N N   . LYS B 1 21  ? 29.623  23.393 45.040 1.00 52.08 ? 21  LYS B N   1 
ATOM   3066 C CA  . LYS B 1 21  ? 30.037  24.662 44.464 1.00 49.18 ? 21  LYS B CA  1 
ATOM   3067 C C   . LYS B 1 21  ? 30.995  24.449 43.279 1.00 49.44 ? 21  LYS B C   1 
ATOM   3068 O O   . LYS B 1 21  ? 31.666  23.419 43.187 1.00 49.00 ? 21  LYS B O   1 
ATOM   3069 C CB  . LYS B 1 21  ? 30.707  25.518 45.542 1.00 45.39 ? 21  LYS B CB  1 
ATOM   3070 C CG  . LYS B 1 21  ? 29.756  26.207 46.522 1.00 38.09 ? 21  LYS B CG  1 
ATOM   3071 C CD  . LYS B 1 21  ? 29.191  25.278 47.577 1.00 34.90 ? 21  LYS B CD  1 
ATOM   3072 C CE  . LYS B 1 21  ? 28.408  26.073 48.604 1.00 37.47 ? 21  LYS B CE  1 
ATOM   3073 N NZ  . LYS B 1 21  ? 27.804  25.214 49.660 1.00 44.06 ? 21  LYS B NZ  1 
ATOM   3074 N N   . PRO B 1 22  ? 31.060  25.420 42.350 1.00 48.48 ? 22  PRO B N   1 
ATOM   3075 C CA  . PRO B 1 22  ? 31.928  25.354 41.164 1.00 50.12 ? 22  PRO B CA  1 
ATOM   3076 C C   . PRO B 1 22  ? 33.400  25.074 41.475 1.00 52.12 ? 22  PRO B C   1 
ATOM   3077 O O   . PRO B 1 22  ? 33.826  25.147 42.629 1.00 52.51 ? 22  PRO B O   1 
ATOM   3078 C CB  . PRO B 1 22  ? 31.727  26.721 40.520 1.00 49.36 ? 22  PRO B CB  1 
ATOM   3079 C CG  . PRO B 1 22  ? 30.305  27.006 40.835 1.00 46.12 ? 22  PRO B CG  1 
ATOM   3080 C CD  . PRO B 1 22  ? 30.224  26.630 42.302 1.00 45.36 ? 22  PRO B CD  1 
ATOM   3081 N N   . GLY B 1 23  ? 34.176  24.791 40.432 1.00 53.09 ? 23  GLY B N   1 
ATOM   3082 C CA  . GLY B 1 23  ? 35.582  24.475 40.620 1.00 57.93 ? 23  GLY B CA  1 
ATOM   3083 C C   . GLY B 1 23  ? 36.643  25.548 40.413 1.00 60.01 ? 23  GLY B C   1 
ATOM   3084 O O   . GLY B 1 23  ? 36.724  26.153 39.337 1.00 59.14 ? 23  GLY B O   1 
ATOM   3085 N N   . PRO B 1 24  ? 37.492  25.792 41.434 1.00 62.48 ? 24  PRO B N   1 
ATOM   3086 C CA  . PRO B 1 24  ? 38.570  26.790 41.387 1.00 61.66 ? 24  PRO B CA  1 
ATOM   3087 C C   . PRO B 1 24  ? 39.471  26.606 40.162 1.00 63.43 ? 24  PRO B C   1 
ATOM   3088 O O   . PRO B 1 24  ? 40.199  25.611 40.050 1.00 64.40 ? 24  PRO B O   1 
ATOM   3089 C CB  . PRO B 1 24  ? 39.311  26.551 42.701 1.00 61.81 ? 24  PRO B CB  1 
ATOM   3090 C CG  . PRO B 1 24  ? 38.191  26.164 43.631 1.00 62.09 ? 24  PRO B CG  1 
ATOM   3091 C CD  . PRO B 1 24  ? 37.415  25.178 42.776 1.00 62.70 ? 24  PRO B CD  1 
ATOM   3092 N N   . GLY B 1 25  ? 39.412  27.571 39.245 1.00 61.94 ? 25  GLY B N   1 
ATOM   3093 C CA  . GLY B 1 25  ? 40.214  27.496 38.040 1.00 61.64 ? 25  GLY B CA  1 
ATOM   3094 C C   . GLY B 1 25  ? 39.377  27.064 36.853 1.00 62.45 ? 25  GLY B C   1 
ATOM   3095 O O   . GLY B 1 25  ? 39.761  27.283 35.699 1.00 63.41 ? 25  GLY B O   1 
ATOM   3096 N N   . GLU B 1 26  ? 38.232  26.446 37.139 1.00 60.64 ? 26  GLU B N   1 
ATOM   3097 C CA  . GLU B 1 26  ? 37.311  25.979 36.105 1.00 60.43 ? 26  GLU B CA  1 
ATOM   3098 C C   . GLU B 1 26  ? 36.210  27.026 35.899 1.00 60.59 ? 26  GLU B C   1 
ATOM   3099 O O   . GLU B 1 26  ? 35.321  27.183 36.742 1.00 59.45 ? 26  GLU B O   1 
ATOM   3100 C CB  . GLU B 1 26  ? 36.682  24.640 36.519 1.00 62.47 ? 26  GLU B CB  1 
ATOM   3101 C CG  . GLU B 1 26  ? 37.678  23.502 36.747 1.00 60.58 ? 26  GLU B CG  1 
ATOM   3102 C CD  . GLU B 1 26  ? 38.039  22.757 35.469 1.00 60.22 ? 26  GLU B CD  1 
ATOM   3103 O OE1 . GLU B 1 26  ? 38.457  23.416 34.488 1.00 54.21 ? 26  GLU B OE1 1 
ATOM   3104 O OE2 . GLU B 1 26  ? 37.907  21.506 35.460 1.00 58.17 ? 26  GLU B OE2 1 
ATOM   3105 N N   . PRO B 1 27  ? 36.259  27.750 34.766 1.00 60.75 ? 27  PRO B N   1 
ATOM   3106 C CA  . PRO B 1 27  ? 35.303  28.797 34.394 1.00 62.01 ? 27  PRO B CA  1 
ATOM   3107 C C   . PRO B 1 27  ? 33.836  28.478 34.665 1.00 62.47 ? 27  PRO B C   1 
ATOM   3108 O O   . PRO B 1 27  ? 33.427  27.314 34.664 1.00 64.89 ? 27  PRO B O   1 
ATOM   3109 C CB  . PRO B 1 27  ? 35.585  28.998 32.905 1.00 62.85 ? 27  PRO B CB  1 
ATOM   3110 C CG  . PRO B 1 27  ? 37.061  28.805 32.835 1.00 62.02 ? 27  PRO B CG  1 
ATOM   3111 C CD  . PRO B 1 27  ? 37.265  27.570 33.700 1.00 63.46 ? 27  PRO B CD  1 
ATOM   3112 N N   . LEU B 1 28  ? 33.058  29.531 34.904 1.00 60.72 ? 28  LEU B N   1 
ATOM   3113 C CA  . LEU B 1 28  ? 31.626  29.413 35.164 1.00 57.38 ? 28  LEU B CA  1 
ATOM   3114 C C   . LEU B 1 28  ? 30.961  30.259 34.096 1.00 55.68 ? 28  LEU B C   1 
ATOM   3115 O O   . LEU B 1 28  ? 31.301  31.438 33.957 1.00 51.54 ? 28  LEU B O   1 
ATOM   3116 C CB  . LEU B 1 28  ? 31.273  30.005 36.528 1.00 56.11 ? 28  LEU B CB  1 
ATOM   3117 C CG  . LEU B 1 28  ? 32.335  29.817 37.606 1.00 58.31 ? 28  LEU B CG  1 
ATOM   3118 C CD1 . LEU B 1 28  ? 31.922  30.561 38.871 1.00 57.80 ? 28  LEU B CD1 1 
ATOM   3119 C CD2 . LEU B 1 28  ? 32.529  28.324 37.858 1.00 58.54 ? 28  LEU B CD2 1 
ATOM   3120 N N   . VAL B 1 29  ? 30.048  29.678 33.320 1.00 53.50 ? 29  VAL B N   1 
ATOM   3121 C CA  . VAL B 1 29  ? 29.366  30.479 32.308 1.00 49.79 ? 29  VAL B CA  1 
ATOM   3122 C C   . VAL B 1 29  ? 28.329  31.277 33.076 1.00 46.20 ? 29  VAL B C   1 
ATOM   3123 O O   . VAL B 1 29  ? 27.442  30.696 33.700 1.00 51.05 ? 29  VAL B O   1 
ATOM   3124 C CB  . VAL B 1 29  ? 28.644  29.620 31.256 1.00 50.30 ? 29  VAL B CB  1 
ATOM   3125 C CG1 . VAL B 1 29  ? 27.867  30.532 30.302 1.00 50.94 ? 29  VAL B CG1 1 
ATOM   3126 C CG2 . VAL B 1 29  ? 29.654  28.776 30.483 1.00 52.22 ? 29  VAL B CG2 1 
ATOM   3127 N N   . PHE B 1 30  ? 28.451  32.599 33.054 1.00 41.57 ? 30  PHE B N   1 
ATOM   3128 C CA  . PHE B 1 30  ? 27.507  33.448 33.769 1.00 40.74 ? 30  PHE B CA  1 
ATOM   3129 C C   . PHE B 1 30  ? 26.063  33.012 33.544 1.00 39.01 ? 30  PHE B C   1 
ATOM   3130 O O   . PHE B 1 30  ? 25.669  32.713 32.420 1.00 39.37 ? 30  PHE B O   1 
ATOM   3131 C CB  . PHE B 1 30  ? 27.631  34.897 33.320 1.00 37.82 ? 30  PHE B CB  1 
ATOM   3132 C CG  . PHE B 1 30  ? 26.394  35.695 33.575 1.00 45.50 ? 30  PHE B CG  1 
ATOM   3133 C CD1 . PHE B 1 30  ? 26.158  36.260 34.826 1.00 43.44 ? 30  PHE B CD1 1 
ATOM   3134 C CD2 . PHE B 1 30  ? 25.417  35.810 32.591 1.00 41.35 ? 30  PHE B CD2 1 
ATOM   3135 C CE1 . PHE B 1 30  ? 24.967  36.923 35.094 1.00 42.99 ? 30  PHE B CE1 1 
ATOM   3136 C CE2 . PHE B 1 30  ? 24.224  36.471 32.851 1.00 40.22 ? 30  PHE B CE2 1 
ATOM   3137 C CZ  . PHE B 1 30  ? 24.002  37.025 34.106 1.00 42.21 ? 30  PHE B CZ  1 
ATOM   3138 N N   . GLY B 1 31  ? 25.288  32.988 34.622 1.00 37.86 ? 31  GLY B N   1 
ATOM   3139 C CA  . GLY B 1 31  ? 23.881  32.626 34.540 1.00 35.61 ? 31  GLY B CA  1 
ATOM   3140 C C   . GLY B 1 31  ? 23.539  31.182 34.236 1.00 39.64 ? 31  GLY B C   1 
ATOM   3141 O O   . GLY B 1 31  ? 22.381  30.861 33.958 1.00 35.88 ? 31  GLY B O   1 
ATOM   3142 N N   . LYS B 1 32  ? 24.527  30.299 34.282 1.00 39.80 ? 32  LYS B N   1 
ATOM   3143 C CA  . LYS B 1 32  ? 24.270  28.891 34.005 1.00 42.80 ? 32  LYS B CA  1 
ATOM   3144 C C   . LYS B 1 32  ? 24.315  28.076 35.290 1.00 39.97 ? 32  LYS B C   1 
ATOM   3145 O O   . LYS B 1 32  ? 23.769  26.980 35.368 1.00 40.54 ? 32  LYS B O   1 
ATOM   3146 C CB  . LYS B 1 32  ? 25.308  28.354 33.028 1.00 45.53 ? 32  LYS B CB  1 
ATOM   3147 C CG  . LYS B 1 32  ? 25.295  29.015 31.667 1.00 50.35 ? 32  LYS B CG  1 
ATOM   3148 C CD  . LYS B 1 32  ? 24.128  28.562 30.816 1.00 47.97 ? 32  LYS B CD  1 
ATOM   3149 C CE  . LYS B 1 32  ? 24.407  28.806 29.335 1.00 46.79 ? 32  LYS B CE  1 
ATOM   3150 N NZ  . LYS B 1 32  ? 24.723  30.228 29.023 1.00 45.62 ? 32  LYS B NZ  1 
ATOM   3151 N N   . THR B 1 33  ? 24.962  28.620 36.307 1.00 38.42 ? 33  THR B N   1 
ATOM   3152 C CA  . THR B 1 33  ? 25.066  27.914 37.574 1.00 34.70 ? 33  THR B CA  1 
ATOM   3153 C C   . THR B 1 33  ? 24.233  28.572 38.651 1.00 33.11 ? 33  THR B C   1 
ATOM   3154 O O   . THR B 1 33  ? 24.320  29.781 38.865 1.00 41.02 ? 33  THR B O   1 
ATOM   3155 C CB  . THR B 1 33  ? 26.518  27.850 38.028 1.00 37.93 ? 33  THR B CB  1 
ATOM   3156 O OG1 . THR B 1 33  ? 27.308  27.293 36.972 1.00 42.51 ? 33  THR B OG1 1 
ATOM   3157 C CG2 . THR B 1 33  ? 26.649  26.973 39.273 1.00 34.34 ? 33  THR B CG2 1 
ATOM   3158 N N   . PHE B 1 34  ? 23.423  27.781 39.337 1.00 25.83 ? 34  PHE B N   1 
ATOM   3159 C CA  . PHE B 1 34  ? 22.565  28.318 40.366 1.00 27.47 ? 34  PHE B CA  1 
ATOM   3160 C C   . PHE B 1 34  ? 22.900  27.733 41.725 1.00 31.17 ? 34  PHE B C   1 
ATOM   3161 O O   . PHE B 1 34  ? 23.465  26.633 41.818 1.00 35.45 ? 34  PHE B O   1 
ATOM   3162 C CB  . PHE B 1 34  ? 21.092  28.052 40.012 1.00 28.11 ? 34  PHE B CB  1 
ATOM   3163 C CG  . PHE B 1 34  ? 20.716  28.542 38.637 1.00 30.66 ? 34  PHE B CG  1 
ATOM   3164 C CD1 . PHE B 1 34  ? 20.803  27.697 37.534 1.00 31.69 ? 34  PHE B CD1 1 
ATOM   3165 C CD2 . PHE B 1 34  ? 20.390  29.877 38.429 1.00 30.03 ? 34  PHE B CD2 1 
ATOM   3166 C CE1 . PHE B 1 34  ? 20.582  28.184 36.251 1.00 27.53 ? 34  PHE B CE1 1 
ATOM   3167 C CE2 . PHE B 1 34  ? 20.171  30.365 37.153 1.00 26.07 ? 34  PHE B CE2 1 
ATOM   3168 C CZ  . PHE B 1 34  ? 20.270  29.516 36.064 1.00 25.53 ? 34  PHE B CZ  1 
ATOM   3169 N N   . THR B 1 35  ? 22.570  28.468 42.785 1.00 32.00 ? 35  THR B N   1 
ATOM   3170 C CA  . THR B 1 35  ? 22.870  27.994 44.126 1.00 33.22 ? 35  THR B CA  1 
ATOM   3171 C C   . THR B 1 35  ? 21.787  27.036 44.607 1.00 36.55 ? 35  THR B C   1 
ATOM   3172 O O   . THR B 1 35  ? 20.854  26.748 43.868 1.00 35.80 ? 35  THR B O   1 
ATOM   3173 C CB  . THR B 1 35  ? 23.016  29.163 45.127 1.00 31.13 ? 35  THR B CB  1 
ATOM   3174 O OG1 . THR B 1 35  ? 21.754  29.801 45.321 1.00 32.16 ? 35  THR B OG1 1 
ATOM   3175 C CG2 . THR B 1 35  ? 24.039  30.177 44.620 1.00 28.91 ? 35  THR B CG2 1 
ATOM   3176 N N   . ASP B 1 36  ? 21.915  26.563 45.850 1.00 37.27 ? 36  ASP B N   1 
ATOM   3177 C CA  . ASP B 1 36  ? 20.979  25.608 46.460 1.00 36.41 ? 36  ASP B CA  1 
ATOM   3178 C C   . ASP B 1 36  ? 19.583  26.080 46.825 1.00 35.46 ? 36  ASP B C   1 
ATOM   3179 O O   . ASP B 1 36  ? 18.638  25.285 46.779 1.00 34.42 ? 36  ASP B O   1 
ATOM   3180 C CB  . ASP B 1 36  ? 21.594  24.988 47.723 1.00 43.42 ? 36  ASP B CB  1 
ATOM   3181 C CG  . ASP B 1 36  ? 22.815  24.145 47.426 1.00 45.04 ? 36  ASP B CG  1 
ATOM   3182 O OD1 . ASP B 1 36  ? 22.763  23.316 46.494 1.00 49.37 ? 36  ASP B OD1 1 
ATOM   3183 O OD2 . ASP B 1 36  ? 23.830  24.305 48.135 1.00 49.50 ? 36  ASP B OD2 1 
ATOM   3184 N N   . HIS B 1 37  ? 19.439  27.339 47.234 1.00 33.37 ? 37  HIS B N   1 
ATOM   3185 C CA  . HIS B 1 37  ? 18.115  27.845 47.604 1.00 30.86 ? 37  HIS B CA  1 
ATOM   3186 C C   . HIS B 1 37  ? 17.614  29.009 46.734 1.00 28.34 ? 37  HIS B C   1 
ATOM   3187 O O   . HIS B 1 37  ? 18.355  29.548 45.911 1.00 32.24 ? 37  HIS B O   1 
ATOM   3188 C CB  . HIS B 1 37  ? 18.110  28.256 49.069 1.00 23.65 ? 37  HIS B CB  1 
ATOM   3189 C CG  . HIS B 1 37  ? 18.628  27.190 49.986 1.00 35.97 ? 37  HIS B CG  1 
ATOM   3190 N ND1 . HIS B 1 37  ? 19.947  26.785 49.983 1.00 29.51 ? 37  HIS B ND1 1 
ATOM   3191 C CD2 . HIS B 1 37  ? 17.988  26.376 50.858 1.00 34.51 ? 37  HIS B CD2 1 
ATOM   3192 C CE1 . HIS B 1 37  ? 20.094  25.763 50.805 1.00 36.66 ? 37  HIS B CE1 1 
ATOM   3193 N NE2 . HIS B 1 37  ? 18.921  25.494 51.349 1.00 33.88 ? 37  HIS B NE2 1 
ATOM   3194 N N   . MET B 1 38  ? 16.361  29.386 46.952 1.00 28.47 ? 38  MET B N   1 
ATOM   3195 C CA  . MET B 1 38  ? 15.711  30.457 46.211 1.00 32.16 ? 38  MET B CA  1 
ATOM   3196 C C   . MET B 1 38  ? 14.631  31.054 47.108 1.00 26.29 ? 38  MET B C   1 
ATOM   3197 O O   . MET B 1 38  ? 14.197  30.419 48.072 1.00 34.31 ? 38  MET B O   1 
ATOM   3198 C CB  . MET B 1 38  ? 15.053  29.887 44.936 1.00 30.16 ? 38  MET B CB  1 
ATOM   3199 C CG  . MET B 1 38  ? 13.734  29.108 45.211 1.00 32.34 ? 38  MET B CG  1 
ATOM   3200 S SD  . MET B 1 38  ? 13.170  28.115 43.798 1.00 36.58 ? 38  MET B SD  1 
ATOM   3201 C CE  . MET B 1 38  ? 12.561  29.495 42.649 1.00 27.27 ? 38  MET B CE  1 
ATOM   3202 N N   . LEU B 1 39  ? 14.199  32.271 46.790 1.00 28.69 ? 39  LEU B N   1 
ATOM   3203 C CA  . LEU B 1 39  ? 13.137  32.948 47.524 1.00 26.80 ? 39  LEU B CA  1 
ATOM   3204 C C   . LEU B 1 39  ? 11.859  32.779 46.707 1.00 33.21 ? 39  LEU B C   1 
ATOM   3205 O O   . LEU B 1 39  ? 11.892  32.762 45.470 1.00 35.55 ? 39  LEU B O   1 
ATOM   3206 C CB  . LEU B 1 39  ? 13.460  34.440 47.670 1.00 27.45 ? 39  LEU B CB  1 
ATOM   3207 C CG  . LEU B 1 39  ? 12.418  35.271 48.413 1.00 28.69 ? 39  LEU B CG  1 
ATOM   3208 C CD1 . LEU B 1 39  ? 12.308  34.781 49.849 1.00 39.14 ? 39  LEU B CD1 1 
ATOM   3209 C CD2 . LEU B 1 39  ? 12.811  36.728 48.393 1.00 31.90 ? 39  LEU B CD2 1 
ATOM   3210 N N   . MET B 1 40  ? 10.730  32.667 47.387 1.00 34.75 ? 40  MET B N   1 
ATOM   3211 C CA  . MET B 1 40  ? 9.450   32.488 46.707 1.00 36.48 ? 40  MET B CA  1 
ATOM   3212 C C   . MET B 1 40  ? 8.340   33.140 47.523 1.00 35.29 ? 40  MET B C   1 
ATOM   3213 O O   . MET B 1 40  ? 8.194   32.860 48.712 1.00 41.63 ? 40  MET B O   1 
ATOM   3214 C CB  . MET B 1 40  ? 9.175   30.982 46.535 1.00 38.41 ? 40  MET B CB  1 
ATOM   3215 C CG  . MET B 1 40  ? 7.814   30.605 45.982 1.00 43.15 ? 40  MET B CG  1 
ATOM   3216 S SD  . MET B 1 40  ? 7.645   31.027 44.264 1.00 58.30 ? 40  MET B SD  1 
ATOM   3217 C CE  . MET B 1 40  ? 8.833   29.936 43.537 1.00 46.18 ? 40  MET B CE  1 
ATOM   3218 N N   . VAL B 1 41  ? 7.586   34.039 46.901 1.00 30.45 ? 41  VAL B N   1 
ATOM   3219 C CA  . VAL B 1 41  ? 6.465   34.691 47.567 1.00 29.52 ? 41  VAL B CA  1 
ATOM   3220 C C   . VAL B 1 41  ? 5.297   34.760 46.582 1.00 33.80 ? 41  VAL B C   1 
ATOM   3221 O O   . VAL B 1 41  ? 5.469   35.204 45.442 1.00 34.30 ? 41  VAL B O   1 
ATOM   3222 C CB  . VAL B 1 41  ? 6.790   36.128 48.017 1.00 29.77 ? 41  VAL B CB  1 
ATOM   3223 C CG1 . VAL B 1 41  ? 5.762   36.596 49.068 1.00 25.28 ? 41  VAL B CG1 1 
ATOM   3224 C CG2 . VAL B 1 41  ? 8.185   36.197 48.565 1.00 34.16 ? 41  VAL B CG2 1 
ATOM   3225 N N   . GLU B 1 42  ? 4.115   34.322 47.018 1.00 31.65 ? 42  GLU B N   1 
ATOM   3226 C CA  . GLU B 1 42  ? 2.924   34.345 46.167 1.00 33.95 ? 42  GLU B CA  1 
ATOM   3227 C C   . GLU B 1 42  ? 1.948   35.472 46.520 1.00 29.75 ? 42  GLU B C   1 
ATOM   3228 O O   . GLU B 1 42  ? 1.849   35.882 47.671 1.00 30.33 ? 42  GLU B O   1 
ATOM   3229 C CB  . GLU B 1 42  ? 2.213   32.991 46.248 1.00 33.83 ? 42  GLU B CB  1 
ATOM   3230 C CG  . GLU B 1 42  ? 3.184   31.828 46.105 1.00 42.64 ? 42  GLU B CG  1 
ATOM   3231 C CD  . GLU B 1 42  ? 2.579   30.624 45.408 1.00 48.32 ? 42  GLU B CD  1 
ATOM   3232 O OE1 . GLU B 1 42  ? 1.976   30.814 44.323 1.00 47.02 ? 42  GLU B OE1 1 
ATOM   3233 O OE2 . GLU B 1 42  ? 2.719   29.495 45.936 1.00 52.06 ? 42  GLU B OE2 1 
ATOM   3234 N N   . TRP B 1 43  ? 1.235   35.986 45.525 1.00 28.49 ? 43  TRP B N   1 
ATOM   3235 C CA  . TRP B 1 43  ? 0.252   37.051 45.758 1.00 30.32 ? 43  TRP B CA  1 
ATOM   3236 C C   . TRP B 1 43  ? -1.095  36.720 45.106 1.00 33.49 ? 43  TRP B C   1 
ATOM   3237 O O   . TRP B 1 43  ? -1.136  36.239 43.976 1.00 36.42 ? 43  TRP B O   1 
ATOM   3238 C CB  . TRP B 1 43  ? 0.746   38.383 45.170 1.00 25.26 ? 43  TRP B CB  1 
ATOM   3239 C CG  . TRP B 1 43  ? -0.220  39.554 45.338 1.00 25.83 ? 43  TRP B CG  1 
ATOM   3240 C CD1 . TRP B 1 43  ? -0.339  40.364 46.437 1.00 29.78 ? 43  TRP B CD1 1 
ATOM   3241 C CD2 . TRP B 1 43  ? -1.166  40.044 44.381 1.00 27.84 ? 43  TRP B CD2 1 
ATOM   3242 N NE1 . TRP B 1 43  ? -1.292  41.323 46.220 1.00 33.44 ? 43  TRP B NE1 1 
ATOM   3243 C CE2 . TRP B 1 43  ? -1.819  41.150 44.966 1.00 28.18 ? 43  TRP B CE2 1 
ATOM   3244 C CE3 . TRP B 1 43  ? -1.528  39.656 43.080 1.00 33.06 ? 43  TRP B CE3 1 
ATOM   3245 C CZ2 . TRP B 1 43  ? -2.815  41.880 44.295 1.00 32.78 ? 43  TRP B CZ2 1 
ATOM   3246 C CZ3 . TRP B 1 43  ? -2.518  40.384 42.412 1.00 30.55 ? 43  TRP B CZ3 1 
ATOM   3247 C CH2 . TRP B 1 43  ? -3.147  41.485 43.023 1.00 34.71 ? 43  TRP B CH2 1 
ATOM   3248 N N   . ASN B 1 44  ? -2.202  36.964 45.803 1.00 35.80 ? 44  ASN B N   1 
ATOM   3249 C CA  . ASN B 1 44  ? -3.507  36.745 45.180 1.00 40.26 ? 44  ASN B CA  1 
ATOM   3250 C C   . ASN B 1 44  ? -4.521  37.706 45.753 1.00 41.49 ? 44  ASN B C   1 
ATOM   3251 O O   . ASN B 1 44  ? -4.154  38.764 46.256 1.00 40.23 ? 44  ASN B O   1 
ATOM   3252 C CB  . ASN B 1 44  ? -3.999  35.288 45.311 1.00 38.66 ? 44  ASN B CB  1 
ATOM   3253 C CG  . ASN B 1 44  ? -4.132  34.828 46.740 1.00 37.85 ? 44  ASN B CG  1 
ATOM   3254 O OD1 . ASN B 1 44  ? -4.520  35.591 47.628 1.00 40.04 ? 44  ASN B OD1 1 
ATOM   3255 N ND2 . ASN B 1 44  ? -3.825  33.554 46.972 1.00 40.26 ? 44  ASN B ND2 1 
ATOM   3256 N N   . ASP B 1 45  ? -5.799  37.359 45.668 1.00 48.10 ? 45  ASP B N   1 
ATOM   3257 C CA  . ASP B 1 45  ? -6.840  38.236 46.192 1.00 51.57 ? 45  ASP B CA  1 
ATOM   3258 C C   . ASP B 1 45  ? -6.672  38.417 47.702 1.00 49.31 ? 45  ASP B C   1 
ATOM   3259 O O   . ASP B 1 45  ? -7.063  39.439 48.262 1.00 49.12 ? 45  ASP B O   1 
ATOM   3260 C CB  . ASP B 1 45  ? -8.231  37.672 45.847 1.00 56.87 ? 45  ASP B CB  1 
ATOM   3261 C CG  . ASP B 1 45  ? -8.424  36.227 46.314 1.00 59.99 ? 45  ASP B CG  1 
ATOM   3262 O OD1 . ASP B 1 45  ? -7.427  35.560 46.676 1.00 58.97 ? 45  ASP B OD1 1 
ATOM   3263 O OD2 . ASP B 1 45  ? -9.583  35.756 46.306 1.00 61.50 ? 45  ASP B OD2 1 
ATOM   3264 N N   . LYS B 1 46  ? -6.072  37.424 48.348 1.00 48.41 ? 46  LYS B N   1 
ATOM   3265 C CA  . LYS B 1 46  ? -5.826  37.465 49.787 1.00 47.44 ? 46  LYS B CA  1 
ATOM   3266 C C   . LYS B 1 46  ? -4.551  38.242 50.101 1.00 44.45 ? 46  LYS B C   1 
ATOM   3267 O O   . LYS B 1 46  ? -4.098  38.267 51.246 1.00 40.68 ? 46  LYS B O   1 
ATOM   3268 C CB  . LYS B 1 46  ? -5.704  36.043 50.335 1.00 48.24 ? 46  LYS B CB  1 
ATOM   3269 C CG  . LYS B 1 46  ? -7.028  35.294 50.341 1.00 52.85 ? 46  LYS B CG  1 
ATOM   3270 C CD  . LYS B 1 46  ? -6.813  33.796 50.454 1.00 53.39 ? 46  LYS B CD  1 
ATOM   3271 C CE  . LYS B 1 46  ? -8.144  33.077 50.632 1.00 54.50 ? 46  LYS B CE  1 
ATOM   3272 N NZ  . LYS B 1 46  ? -9.140  33.491 49.600 1.00 54.22 ? 46  LYS B NZ  1 
ATOM   3273 N N   . GLY B 1 47  ? -3.976  38.863 49.072 1.00 43.89 ? 47  GLY B N   1 
ATOM   3274 C CA  . GLY B 1 47  ? -2.758  39.632 49.246 1.00 37.75 ? 47  GLY B CA  1 
ATOM   3275 C C   . GLY B 1 47  ? -1.521  38.764 49.190 1.00 39.64 ? 47  GLY B C   1 
ATOM   3276 O O   . GLY B 1 47  ? -1.552  37.667 48.623 1.00 38.50 ? 47  GLY B O   1 
ATOM   3277 N N   . TRP B 1 48  ? -0.425  39.249 49.771 1.00 37.98 ? 48  TRP B N   1 
ATOM   3278 C CA  . TRP B 1 48  ? 0.826   38.495 49.774 1.00 35.17 ? 48  TRP B CA  1 
ATOM   3279 C C   . TRP B 1 48  ? 0.840   37.359 50.785 1.00 36.06 ? 48  TRP B C   1 
ATOM   3280 O O   . TRP B 1 48  ? 0.364   37.519 51.905 1.00 38.16 ? 48  TRP B O   1 
ATOM   3281 C CB  . TRP B 1 48  ? 2.012   39.415 50.071 1.00 34.12 ? 48  TRP B CB  1 
ATOM   3282 C CG  . TRP B 1 48  ? 2.389   40.360 48.968 1.00 30.63 ? 48  TRP B CG  1 
ATOM   3283 C CD1 . TRP B 1 48  ? 2.176   41.718 48.934 1.00 29.66 ? 48  TRP B CD1 1 
ATOM   3284 C CD2 . TRP B 1 48  ? 3.120   40.039 47.776 1.00 27.28 ? 48  TRP B CD2 1 
ATOM   3285 N NE1 . TRP B 1 48  ? 2.740   42.258 47.796 1.00 26.04 ? 48  TRP B NE1 1 
ATOM   3286 C CE2 . TRP B 1 48  ? 3.326   41.252 47.070 1.00 29.17 ? 48  TRP B CE2 1 
ATOM   3287 C CE3 . TRP B 1 48  ? 3.625   38.846 47.237 1.00 25.81 ? 48  TRP B CE3 1 
ATOM   3288 C CZ2 . TRP B 1 48  ? 4.022   41.304 45.846 1.00 26.11 ? 48  TRP B CZ2 1 
ATOM   3289 C CZ3 . TRP B 1 48  ? 4.318   38.899 46.015 1.00 27.24 ? 48  TRP B CZ3 1 
ATOM   3290 C CH2 . TRP B 1 48  ? 4.505   40.126 45.340 1.00 28.63 ? 48  TRP B CH2 1 
ATOM   3291 N N   . GLY B 1 49  ? 1.395   36.218 50.381 1.00 35.40 ? 49  GLY B N   1 
ATOM   3292 C CA  . GLY B 1 49  ? 1.498   35.085 51.283 1.00 40.94 ? 49  GLY B CA  1 
ATOM   3293 C C   . GLY B 1 49  ? 2.777   35.237 52.095 1.00 40.60 ? 49  GLY B C   1 
ATOM   3294 O O   . GLY B 1 49  ? 3.403   36.300 52.083 1.00 38.88 ? 49  GLY B O   1 
ATOM   3295 N N   . GLN B 1 50  ? 3.185   34.192 52.803 1.00 42.55 ? 50  GLN B N   1 
ATOM   3296 C CA  . GLN B 1 50  ? 4.407   34.285 53.588 1.00 43.31 ? 50  GLN B CA  1 
ATOM   3297 C C   . GLN B 1 50  ? 5.614   34.062 52.699 1.00 41.95 ? 50  GLN B C   1 
ATOM   3298 O O   . GLN B 1 50  ? 5.578   33.227 51.793 1.00 41.30 ? 50  GLN B O   1 
ATOM   3299 C CB  . GLN B 1 50  ? 4.422   33.250 54.719 1.00 42.73 ? 50  GLN B CB  1 
ATOM   3300 C CG  . GLN B 1 50  ? 3.507   33.585 55.882 1.00 46.85 ? 50  GLN B CG  1 
ATOM   3301 C CD  . GLN B 1 50  ? 3.506   32.507 56.951 1.00 45.03 ? 50  GLN B CD  1 
ATOM   3302 O OE1 . GLN B 1 50  ? 4.540   32.202 57.538 1.00 48.54 ? 50  GLN B OE1 1 
ATOM   3303 N NE2 . GLN B 1 50  ? 2.341   31.925 57.204 1.00 52.74 ? 50  GLN B NE2 1 
ATOM   3304 N N   . PRO B 1 51  ? 6.697   34.821 52.939 1.00 37.87 ? 51  PRO B N   1 
ATOM   3305 C CA  . PRO B 1 51  ? 7.929   34.697 52.158 1.00 38.29 ? 51  PRO B CA  1 
ATOM   3306 C C   . PRO B 1 51  ? 8.531   33.344 52.461 1.00 38.61 ? 51  PRO B C   1 
ATOM   3307 O O   . PRO B 1 51  ? 8.349   32.814 53.558 1.00 42.11 ? 51  PRO B O   1 
ATOM   3308 C CB  . PRO B 1 51  ? 8.809   35.826 52.695 1.00 39.82 ? 51  PRO B CB  1 
ATOM   3309 C CG  . PRO B 1 51  ? 7.835   36.824 53.209 1.00 41.66 ? 51  PRO B CG  1 
ATOM   3310 C CD  . PRO B 1 51  ? 6.779   35.965 53.863 1.00 41.61 ? 51  PRO B CD  1 
ATOM   3311 N N   . ARG B 1 52  ? 9.249   32.777 51.506 1.00 40.59 ? 52  ARG B N   1 
ATOM   3312 C CA  . ARG B 1 52  ? 9.862   31.489 51.744 1.00 38.75 ? 52  ARG B CA  1 
ATOM   3313 C C   . ARG B 1 52  ? 11.188  31.253 51.042 1.00 38.24 ? 52  ARG B C   1 
ATOM   3314 O O   . ARG B 1 52  ? 11.367  31.568 49.858 1.00 35.01 ? 52  ARG B O   1 
ATOM   3315 C CB  . ARG B 1 52  ? 8.875   30.371 51.385 1.00 45.59 ? 52  ARG B CB  1 
ATOM   3316 C CG  . ARG B 1 52  ? 9.507   29.000 51.224 1.00 47.52 ? 52  ARG B CG  1 
ATOM   3317 C CD  . ARG B 1 52  ? 8.458   27.906 51.226 1.00 55.22 ? 52  ARG B CD  1 
ATOM   3318 N NE  . ARG B 1 52  ? 7.202   28.337 50.617 1.00 58.39 ? 52  ARG B NE  1 
ATOM   3319 C CZ  . ARG B 1 52  ? 7.040   28.632 49.329 1.00 60.43 ? 52  ARG B CZ  1 
ATOM   3320 N NH1 . ARG B 1 52  ? 8.063   28.544 48.483 1.00 57.47 ? 52  ARG B NH1 1 
ATOM   3321 N NH2 . ARG B 1 52  ? 5.847   29.023 48.885 1.00 57.71 ? 52  ARG B NH2 1 
ATOM   3322 N N   . ILE B 1 53  ? 12.136  30.722 51.800 1.00 35.37 ? 53  ILE B N   1 
ATOM   3323 C CA  . ILE B 1 53  ? 13.422  30.373 51.243 1.00 34.77 ? 53  ILE B CA  1 
ATOM   3324 C C   . ILE B 1 53  ? 13.256  28.876 51.126 1.00 37.15 ? 53  ILE B C   1 
ATOM   3325 O O   . ILE B 1 53  ? 12.933  28.198 52.111 1.00 40.78 ? 53  ILE B O   1 
ATOM   3326 C CB  . ILE B 1 53  ? 14.578  30.738 52.196 1.00 36.58 ? 53  ILE B CB  1 
ATOM   3327 C CG1 . ILE B 1 53  ? 14.787  32.259 52.186 1.00 35.07 ? 53  ILE B CG1 1 
ATOM   3328 C CG2 . ILE B 1 53  ? 15.836  29.996 51.788 1.00 36.74 ? 53  ILE B CG2 1 
ATOM   3329 C CD1 . ILE B 1 53  ? 15.828  32.754 53.184 1.00 36.59 ? 53  ILE B CD1 1 
ATOM   3330 N N   . GLN B 1 54  ? 13.452  28.358 49.923 1.00 36.43 ? 54  GLN B N   1 
ATOM   3331 C CA  . GLN B 1 54  ? 13.272  26.941 49.690 1.00 35.36 ? 54  GLN B CA  1 
ATOM   3332 C C   . GLN B 1 54  ? 14.314  26.430 48.743 1.00 36.83 ? 54  GLN B C   1 
ATOM   3333 O O   . GLN B 1 54  ? 15.033  27.203 48.120 1.00 40.08 ? 54  GLN B O   1 
ATOM   3334 C CB  . GLN B 1 54  ? 11.882  26.686 49.096 1.00 40.44 ? 54  GLN B CB  1 
ATOM   3335 C CG  . GLN B 1 54  ? 11.663  27.268 47.691 1.00 40.36 ? 54  GLN B CG  1 
ATOM   3336 C CD  . GLN B 1 54  ? 10.229  27.074 47.210 1.00 49.90 ? 54  GLN B CD  1 
ATOM   3337 O OE1 . GLN B 1 54  ? 9.883   27.377 46.057 1.00 46.30 ? 54  GLN B OE1 1 
ATOM   3338 N NE2 . GLN B 1 54  ? 9.384   26.562 48.101 1.00 51.83 ? 54  GLN B NE2 1 
ATOM   3339 N N   . PRO B 1 55  ? 14.422  25.103 48.627 1.00 36.40 ? 55  PRO B N   1 
ATOM   3340 C CA  . PRO B 1 55  ? 15.389  24.474 47.733 1.00 38.81 ? 55  PRO B CA  1 
ATOM   3341 C C   . PRO B 1 55  ? 15.114  24.902 46.286 1.00 41.88 ? 55  PRO B C   1 
ATOM   3342 O O   . PRO B 1 55  ? 13.960  25.040 45.879 1.00 43.37 ? 55  PRO B O   1 
ATOM   3343 C CB  . PRO B 1 55  ? 15.132  22.988 47.945 1.00 41.49 ? 55  PRO B CB  1 
ATOM   3344 C CG  . PRO B 1 55  ? 14.675  22.937 49.381 1.00 39.87 ? 55  PRO B CG  1 
ATOM   3345 C CD  . PRO B 1 55  ? 13.740  24.100 49.464 1.00 37.08 ? 55  PRO B CD  1 
ATOM   3346 N N   . PHE B 1 56  ? 16.176  25.121 45.518 1.00 40.31 ? 56  PHE B N   1 
ATOM   3347 C CA  . PHE B 1 56  ? 16.023  25.528 44.133 1.00 40.09 ? 56  PHE B CA  1 
ATOM   3348 C C   . PHE B 1 56  ? 15.098  24.468 43.546 1.00 39.60 ? 56  PHE B C   1 
ATOM   3349 O O   . PHE B 1 56  ? 15.299  23.284 43.789 1.00 38.13 ? 56  PHE B O   1 
ATOM   3350 C CB  . PHE B 1 56  ? 17.379  25.488 43.430 1.00 35.09 ? 56  PHE B CB  1 
ATOM   3351 C CG  . PHE B 1 56  ? 17.405  26.211 42.111 1.00 39.03 ? 56  PHE B CG  1 
ATOM   3352 C CD1 . PHE B 1 56  ? 17.593  27.599 42.062 1.00 36.40 ? 56  PHE B CD1 1 
ATOM   3353 C CD2 . PHE B 1 56  ? 17.239  25.514 40.917 1.00 38.55 ? 56  PHE B CD2 1 
ATOM   3354 C CE1 . PHE B 1 56  ? 17.616  28.279 40.840 1.00 35.73 ? 56  PHE B CE1 1 
ATOM   3355 C CE2 . PHE B 1 56  ? 17.262  26.190 39.688 1.00 38.70 ? 56  PHE B CE2 1 
ATOM   3356 C CZ  . PHE B 1 56  ? 17.451  27.574 39.655 1.00 33.68 ? 56  PHE B CZ  1 
ATOM   3357 N N   . GLN B 1 57  ? 14.089  24.876 42.789 1.00 38.56 ? 57  GLN B N   1 
ATOM   3358 C CA  . GLN B 1 57  ? 13.165  23.908 42.202 1.00 37.85 ? 57  GLN B CA  1 
ATOM   3359 C C   . GLN B 1 57  ? 12.386  24.555 41.065 1.00 37.74 ? 57  GLN B C   1 
ATOM   3360 O O   . GLN B 1 57  ? 12.289  25.779 41.005 1.00 37.10 ? 57  GLN B O   1 
ATOM   3361 C CB  . GLN B 1 57  ? 12.196  23.422 43.264 1.00 39.78 ? 57  GLN B CB  1 
ATOM   3362 C CG  . GLN B 1 57  ? 11.309  24.525 43.820 1.00 42.35 ? 57  GLN B CG  1 
ATOM   3363 C CD  . GLN B 1 57  ? 10.602  24.101 45.086 1.00 42.88 ? 57  GLN B CD  1 
ATOM   3364 O OE1 . GLN B 1 57  ? 11.247  23.819 46.098 1.00 45.01 ? 57  GLN B OE1 1 
ATOM   3365 N NE2 . GLN B 1 57  ? 9.275   24.042 45.040 1.00 43.00 ? 57  GLN B NE2 1 
ATOM   3366 N N   . ASN B 1 58  ? 11.830  23.732 40.180 1.00 37.15 ? 58  ASN B N   1 
ATOM   3367 C CA  . ASN B 1 58  ? 11.075  24.234 39.038 1.00 34.90 ? 58  ASN B CA  1 
ATOM   3368 C C   . ASN B 1 58  ? 9.801   24.951 39.452 1.00 33.69 ? 58  ASN B C   1 
ATOM   3369 O O   . ASN B 1 58  ? 9.302   24.774 40.566 1.00 33.74 ? 58  ASN B O   1 
ATOM   3370 C CB  . ASN B 1 58  ? 10.735  23.086 38.093 1.00 33.48 ? 58  ASN B CB  1 
ATOM   3371 C CG  . ASN B 1 58  ? 11.964  22.444 37.511 1.00 36.68 ? 58  ASN B CG  1 
ATOM   3372 O OD1 . ASN B 1 58  ? 12.880  23.128 37.060 1.00 36.97 ? 58  ASN B OD1 1 
ATOM   3373 N ND2 . ASN B 1 58  ? 11.994  21.115 37.509 1.00 42.11 ? 58  ASN B ND2 1 
ATOM   3374 N N   . LEU B 1 59  ? 9.288   25.789 38.559 1.00 30.18 ? 59  LEU B N   1 
ATOM   3375 C CA  . LEU B 1 59  ? 8.060   26.511 38.824 1.00 28.08 ? 59  LEU B CA  1 
ATOM   3376 C C   . LEU B 1 59  ? 6.933   25.694 38.205 1.00 28.05 ? 59  LEU B C   1 
ATOM   3377 O O   . LEU B 1 59  ? 7.155   24.980 37.232 1.00 32.31 ? 59  LEU B O   1 
ATOM   3378 C CB  . LEU B 1 59  ? 8.110   27.888 38.164 1.00 31.01 ? 59  LEU B CB  1 
ATOM   3379 C CG  . LEU B 1 59  ? 9.192   28.811 38.710 1.00 27.45 ? 59  LEU B CG  1 
ATOM   3380 C CD1 . LEU B 1 59  ? 9.464   29.933 37.745 1.00 33.51 ? 59  LEU B CD1 1 
ATOM   3381 C CD2 . LEU B 1 59  ? 8.745   29.337 40.053 1.00 33.90 ? 59  LEU B CD2 1 
ATOM   3382 N N   . THR B 1 60  ? 5.746   25.777 38.793 1.00 26.89 ? 60  THR B N   1 
ATOM   3383 C CA  . THR B 1 60  ? 4.574   25.078 38.268 1.00 32.46 ? 60  THR B CA  1 
ATOM   3384 C C   . THR B 1 60  ? 3.615   26.186 37.891 1.00 31.50 ? 60  THR B C   1 
ATOM   3385 O O   . THR B 1 60  ? 3.129   26.904 38.766 1.00 32.72 ? 60  THR B O   1 
ATOM   3386 C CB  . THR B 1 60  ? 3.880   24.193 39.328 1.00 29.55 ? 60  THR B CB  1 
ATOM   3387 O OG1 . THR B 1 60  ? 4.838   23.337 39.941 1.00 35.27 ? 60  THR B OG1 1 
ATOM   3388 C CG2 . THR B 1 60  ? 2.817   23.324 38.670 1.00 33.50 ? 60  THR B CG2 1 
ATOM   3389 N N   . LEU B 1 61  ? 3.345   26.324 36.595 1.00 31.63 ? 61  LEU B N   1 
ATOM   3390 C CA  . LEU B 1 61  ? 2.456   27.369 36.099 1.00 31.42 ? 61  LEU B CA  1 
ATOM   3391 C C   . LEU B 1 61  ? 1.271   26.870 35.274 1.00 29.72 ? 61  LEU B C   1 
ATOM   3392 O O   . LEU B 1 61  ? 1.383   25.923 34.481 1.00 25.86 ? 61  LEU B O   1 
ATOM   3393 C CB  . LEU B 1 61  ? 3.242   28.365 35.231 1.00 31.45 ? 61  LEU B CB  1 
ATOM   3394 C CG  . LEU B 1 61  ? 4.429   29.148 35.794 1.00 31.36 ? 61  LEU B CG  1 
ATOM   3395 C CD1 . LEU B 1 61  ? 4.956   30.060 34.696 1.00 31.71 ? 61  LEU B CD1 1 
ATOM   3396 C CD2 . LEU B 1 61  ? 3.999   29.968 37.006 1.00 31.02 ? 61  LEU B CD2 1 
ATOM   3397 N N   . HIS B 1 62  ? 0.140   27.525 35.461 1.00 26.13 ? 62  HIS B N   1 
ATOM   3398 C CA  . HIS B 1 62  ? -1.051  27.213 34.692 1.00 29.33 ? 62  HIS B CA  1 
ATOM   3399 C C   . HIS B 1 62  ? -0.659  27.562 33.240 1.00 29.30 ? 62  HIS B C   1 
ATOM   3400 O O   . HIS B 1 62  ? 0.087   28.523 33.014 1.00 26.82 ? 62  HIS B O   1 
ATOM   3401 C CB  . HIS B 1 62  ? -2.199  28.091 35.196 1.00 28.21 ? 62  HIS B CB  1 
ATOM   3402 C CG  . HIS B 1 62  ? -3.531  27.765 34.592 1.00 32.10 ? 62  HIS B CG  1 
ATOM   3403 N ND1 . HIS B 1 62  ? -3.837  28.029 33.273 1.00 26.65 ? 62  HIS B ND1 1 
ATOM   3404 C CD2 . HIS B 1 62  ? -4.651  27.234 35.142 1.00 28.20 ? 62  HIS B CD2 1 
ATOM   3405 C CE1 . HIS B 1 62  ? -5.091  27.680 33.040 1.00 29.76 ? 62  HIS B CE1 1 
ATOM   3406 N NE2 . HIS B 1 62  ? -5.607  27.196 34.158 1.00 29.01 ? 62  HIS B NE2 1 
ATOM   3407 N N   . PRO B 1 63  ? -1.138  26.787 32.247 1.00 28.54 ? 63  PRO B N   1 
ATOM   3408 C CA  . PRO B 1 63  ? -0.818  27.024 30.833 1.00 28.21 ? 63  PRO B CA  1 
ATOM   3409 C C   . PRO B 1 63  ? -1.275  28.366 30.283 1.00 25.94 ? 63  PRO B C   1 
ATOM   3410 O O   . PRO B 1 63  ? -0.770  28.816 29.269 1.00 25.03 ? 63  PRO B O   1 
ATOM   3411 C CB  . PRO B 1 63  ? -1.514  25.866 30.114 1.00 28.11 ? 63  PRO B CB  1 
ATOM   3412 C CG  . PRO B 1 63  ? -1.590  24.806 31.159 1.00 32.50 ? 63  PRO B CG  1 
ATOM   3413 C CD  . PRO B 1 63  ? -1.968  25.580 32.387 1.00 30.31 ? 63  PRO B CD  1 
ATOM   3414 N N   . ALA B 1 64  ? -2.240  28.992 30.935 1.00 26.18 ? 64  ALA B N   1 
ATOM   3415 C CA  . ALA B 1 64  ? -2.737  30.283 30.469 1.00 27.33 ? 64  ALA B CA  1 
ATOM   3416 C C   . ALA B 1 64  ? -2.128  31.432 31.258 1.00 22.73 ? 64  ALA B C   1 
ATOM   3417 O O   . ALA B 1 64  ? -2.576  32.566 31.148 1.00 24.64 ? 64  ALA B O   1 
ATOM   3418 C CB  . ALA B 1 64  ? -4.284  30.318 30.590 1.00 22.05 ? 64  ALA B CB  1 
ATOM   3419 N N   . SER B 1 65  ? -1.127  31.131 32.080 1.00 24.95 ? 65  SER B N   1 
ATOM   3420 C CA  . SER B 1 65  ? -0.475  32.139 32.926 1.00 19.15 ? 65  SER B CA  1 
ATOM   3421 C C   . SER B 1 65  ? -0.115  33.408 32.140 1.00 17.36 ? 65  SER B C   1 
ATOM   3422 O O   . SER B 1 65  ? 0.603   33.333 31.157 1.00 20.14 ? 65  SER B O   1 
ATOM   3423 C CB  . SER B 1 65  ? 0.776   31.525 33.557 1.00 23.92 ? 65  SER B CB  1 
ATOM   3424 O OG  . SER B 1 65  ? 1.492   32.466 34.336 1.00 33.32 ? 65  SER B OG  1 
ATOM   3425 N N   . SER B 1 66  ? -0.595  34.574 32.573 1.00 21.10 ? 66  SER B N   1 
ATOM   3426 C CA  . SER B 1 66  ? -0.301  35.792 31.822 1.00 25.26 ? 66  SER B CA  1 
ATOM   3427 C C   . SER B 1 66  ? 1.189   36.110 31.682 1.00 26.83 ? 66  SER B C   1 
ATOM   3428 O O   . SER B 1 66  ? 1.594   36.885 30.810 1.00 22.89 ? 66  SER B O   1 
ATOM   3429 C CB  . SER B 1 66  ? -1.054  36.991 32.403 1.00 25.07 ? 66  SER B CB  1 
ATOM   3430 O OG  . SER B 1 66  ? -0.943  37.066 33.810 1.00 33.04 ? 66  SER B OG  1 
ATOM   3431 N N   . SER B 1 67  ? 2.011   35.502 32.523 1.00 23.49 ? 67  SER B N   1 
ATOM   3432 C CA  . SER B 1 67  ? 3.445   35.718 32.434 1.00 24.31 ? 67  SER B CA  1 
ATOM   3433 C C   . SER B 1 67  ? 3.989   35.152 31.115 1.00 24.33 ? 67  SER B C   1 
ATOM   3434 O O   . SER B 1 67  ? 5.008   35.613 30.613 1.00 21.76 ? 67  SER B O   1 
ATOM   3435 C CB  . SER B 1 67  ? 4.148   35.009 33.585 1.00 25.98 ? 67  SER B CB  1 
ATOM   3436 O OG  . SER B 1 67  ? 3.931   33.612 33.500 1.00 23.08 ? 67  SER B OG  1 
ATOM   3437 N N   . LEU B 1 68  ? 3.300   34.147 30.570 1.00 21.97 ? 68  LEU B N   1 
ATOM   3438 C CA  . LEU B 1 68  ? 3.730   33.483 29.332 1.00 20.66 ? 68  LEU B CA  1 
ATOM   3439 C C   . LEU B 1 68  ? 3.000   33.920 28.062 1.00 19.34 ? 68  LEU B C   1 
ATOM   3440 O O   . LEU B 1 68  ? 3.503   33.708 26.958 1.00 18.55 ? 68  LEU B O   1 
ATOM   3441 C CB  . LEU B 1 68  ? 3.582   31.969 29.483 1.00 21.53 ? 68  LEU B CB  1 
ATOM   3442 C CG  . LEU B 1 68  ? 4.359   31.283 30.614 1.00 21.84 ? 68  LEU B CG  1 
ATOM   3443 C CD1 . LEU B 1 68  ? 3.937   29.812 30.698 1.00 23.33 ? 68  LEU B CD1 1 
ATOM   3444 C CD2 . LEU B 1 68  ? 5.848   31.388 30.362 1.00 16.76 ? 68  LEU B CD2 1 
ATOM   3445 N N   . HIS B 1 69  ? 1.821   34.515 28.222 1.00 17.50 ? 69  HIS B N   1 
ATOM   3446 C CA  . HIS B 1 69  ? 1.033   34.978 27.078 1.00 22.43 ? 69  HIS B CA  1 
ATOM   3447 C C   . HIS B 1 69  ? 1.171   36.466 26.777 1.00 22.42 ? 69  HIS B C   1 
ATOM   3448 O O   . HIS B 1 69  ? 1.244   36.855 25.604 1.00 17.33 ? 69  HIS B O   1 
ATOM   3449 C CB  . HIS B 1 69  ? -0.437  34.657 27.299 1.00 18.40 ? 69  HIS B CB  1 
ATOM   3450 C CG  . HIS B 1 69  ? -0.733  33.189 27.283 1.00 21.51 ? 69  HIS B CG  1 
ATOM   3451 N ND1 . HIS B 1 69  ? -1.299  32.549 26.200 1.00 22.75 ? 69  HIS B ND1 1 
ATOM   3452 C CD2 . HIS B 1 69  ? -0.524  32.231 28.215 1.00 20.24 ? 69  HIS B CD2 1 
ATOM   3453 C CE1 . HIS B 1 69  ? -1.426  31.261 26.466 1.00 20.39 ? 69  HIS B CE1 1 
ATOM   3454 N NE2 . HIS B 1 69  ? -0.958  31.041 27.683 1.00 20.94 ? 69  HIS B NE2 1 
ATOM   3455 N N   . TYR B 1 70  ? 1.195   37.289 27.828 1.00 23.58 ? 70  TYR B N   1 
ATOM   3456 C CA  . TYR B 1 70  ? 1.285   38.740 27.650 1.00 18.84 ? 70  TYR B CA  1 
ATOM   3457 C C   . TYR B 1 70  ? 2.460   39.416 28.330 1.00 15.70 ? 70  TYR B C   1 
ATOM   3458 O O   . TYR B 1 70  ? 2.420   40.610 28.647 1.00 15.71 ? 70  TYR B O   1 
ATOM   3459 C CB  . TYR B 1 70  ? -0.027  39.376 28.073 1.00 20.06 ? 70  TYR B CB  1 
ATOM   3460 C CG  . TYR B 1 70  ? -1.191  38.642 27.475 1.00 22.46 ? 70  TYR B CG  1 
ATOM   3461 C CD1 . TYR B 1 70  ? -1.281  38.453 26.091 1.00 22.70 ? 70  TYR B CD1 1 
ATOM   3462 C CD2 . TYR B 1 70  ? -2.192  38.093 28.284 1.00 21.53 ? 70  TYR B CD2 1 
ATOM   3463 C CE1 . TYR B 1 70  ? -2.346  37.724 25.523 1.00 19.37 ? 70  TYR B CE1 1 
ATOM   3464 C CE2 . TYR B 1 70  ? -3.267  37.361 27.720 1.00 23.39 ? 70  TYR B CE2 1 
ATOM   3465 C CZ  . TYR B 1 70  ? -3.333  37.185 26.346 1.00 26.84 ? 70  TYR B CZ  1 
ATOM   3466 O OH  . TYR B 1 70  ? -4.390  36.490 25.788 1.00 28.51 ? 70  TYR B OH  1 
ATOM   3467 N N   . SER B 1 71  ? 3.510   38.638 28.534 1.00 17.64 ? 71  SER B N   1 
ATOM   3468 C CA  . SER B 1 71  ? 4.757   39.151 29.076 1.00 22.09 ? 71  SER B CA  1 
ATOM   3469 C C   . SER B 1 71  ? 4.619   39.970 30.366 1.00 19.60 ? 71  SER B C   1 
ATOM   3470 O O   . SER B 1 71  ? 5.241   41.007 30.504 1.00 19.87 ? 71  SER B O   1 
ATOM   3471 C CB  . SER B 1 71  ? 5.464   40.000 28.007 1.00 16.05 ? 71  SER B CB  1 
ATOM   3472 O OG  . SER B 1 71  ? 6.857   40.068 28.249 1.00 20.64 ? 71  SER B OG  1 
ATOM   3473 N N   . LEU B 1 72  ? 3.781   39.519 31.294 1.00 19.96 ? 72  LEU B N   1 
ATOM   3474 C CA  . LEU B 1 72  ? 3.688   40.250 32.556 1.00 23.89 ? 72  LEU B CA  1 
ATOM   3475 C C   . LEU B 1 72  ? 4.844   39.680 33.363 1.00 22.78 ? 72  LEU B C   1 
ATOM   3476 O O   . LEU B 1 72  ? 4.696   38.740 34.140 1.00 23.35 ? 72  LEU B O   1 
ATOM   3477 C CB  . LEU B 1 72  ? 2.334   40.015 33.243 1.00 25.02 ? 72  LEU B CB  1 
ATOM   3478 C CG  . LEU B 1 72  ? 1.196   40.770 32.524 1.00 30.67 ? 72  LEU B CG  1 
ATOM   3479 C CD1 . LEU B 1 72  ? -0.151  40.375 33.074 1.00 35.24 ? 72  LEU B CD1 1 
ATOM   3480 C CD2 . LEU B 1 72  ? 1.405   42.276 32.676 1.00 30.72 ? 72  LEU B CD2 1 
ATOM   3481 N N   . GLN B 1 73  ? 6.018   40.242 33.132 1.00 19.46 ? 73  GLN B N   1 
ATOM   3482 C CA  . GLN B 1 73  ? 7.212   39.781 33.804 1.00 18.34 ? 73  GLN B CA  1 
ATOM   3483 C C   . GLN B 1 73  ? 8.221   40.915 33.857 1.00 17.81 ? 73  GLN B C   1 
ATOM   3484 O O   . GLN B 1 73  ? 8.317   41.727 32.924 1.00 19.50 ? 73  GLN B O   1 
ATOM   3485 C CB  . GLN B 1 73  ? 7.829   38.603 33.030 1.00 19.55 ? 73  GLN B CB  1 
ATOM   3486 C CG  . GLN B 1 73  ? 8.158   38.975 31.581 1.00 23.33 ? 73  GLN B CG  1 
ATOM   3487 C CD  . GLN B 1 73  ? 8.665   37.812 30.771 1.00 22.76 ? 73  GLN B CD  1 
ATOM   3488 O OE1 . GLN B 1 73  ? 7.990   36.799 30.633 1.00 26.95 ? 73  GLN B OE1 1 
ATOM   3489 N NE2 . GLN B 1 73  ? 9.854   37.960 30.212 1.00 18.75 ? 73  GLN B NE2 1 
ATOM   3490 N N   . LEU B 1 74  ? 8.957   40.972 34.955 1.00 19.12 ? 74  LEU B N   1 
ATOM   3491 C CA  . LEU B 1 74  ? 10.006  41.965 35.123 1.00 23.70 ? 74  LEU B CA  1 
ATOM   3492 C C   . LEU B 1 74  ? 11.080  41.343 35.997 1.00 23.35 ? 74  LEU B C   1 
ATOM   3493 O O   . LEU B 1 74  ? 10.826  40.357 36.698 1.00 25.74 ? 74  LEU B O   1 
ATOM   3494 C CB  . LEU B 1 74  ? 9.472   43.273 35.738 1.00 21.00 ? 74  LEU B CB  1 
ATOM   3495 C CG  . LEU B 1 74  ? 9.052   43.636 37.178 1.00 27.43 ? 74  LEU B CG  1 
ATOM   3496 C CD1 . LEU B 1 74  ? 7.587   43.412 37.367 1.00 27.94 ? 74  LEU B CD1 1 
ATOM   3497 C CD2 . LEU B 1 74  ? 9.887   42.914 38.205 1.00 23.97 ? 74  LEU B CD2 1 
ATOM   3498 N N   . PHE B 1 75  ? 12.282  41.890 35.947 1.00 20.98 ? 75  PHE B N   1 
ATOM   3499 C CA  . PHE B 1 75  ? 13.370  41.339 36.733 1.00 21.34 ? 75  PHE B CA  1 
ATOM   3500 C C   . PHE B 1 75  ? 14.348  42.404 37.159 1.00 19.43 ? 75  PHE B C   1 
ATOM   3501 O O   . PHE B 1 75  ? 14.253  43.552 36.758 1.00 19.88 ? 75  PHE B O   1 
ATOM   3502 C CB  . PHE B 1 75  ? 14.145  40.283 35.933 1.00 21.15 ? 75  PHE B CB  1 
ATOM   3503 C CG  . PHE B 1 75  ? 14.860  40.832 34.716 1.00 24.20 ? 75  PHE B CG  1 
ATOM   3504 C CD1 . PHE B 1 75  ? 14.158  41.127 33.546 1.00 23.65 ? 75  PHE B CD1 1 
ATOM   3505 C CD2 . PHE B 1 75  ? 16.240  41.047 34.744 1.00 23.72 ? 75  PHE B CD2 1 
ATOM   3506 C CE1 . PHE B 1 75  ? 14.832  41.627 32.409 1.00 23.75 ? 75  PHE B CE1 1 
ATOM   3507 C CE2 . PHE B 1 75  ? 16.923  41.548 33.621 1.00 25.16 ? 75  PHE B CE2 1 
ATOM   3508 C CZ  . PHE B 1 75  ? 16.223  41.836 32.450 1.00 20.08 ? 75  PHE B CZ  1 
ATOM   3509 N N   . GLU B 1 76  ? 15.296  41.994 37.982 1.00 19.49 ? 76  GLU B N   1 
ATOM   3510 C CA  . GLU B 1 76  ? 16.340  42.878 38.437 1.00 25.62 ? 76  GLU B CA  1 
ATOM   3511 C C   . GLU B 1 76  ? 17.643  42.112 38.373 1.00 25.16 ? 76  GLU B C   1 
ATOM   3512 O O   . GLU B 1 76  ? 17.655  40.903 38.139 1.00 26.70 ? 76  GLU B O   1 
ATOM   3513 C CB  . GLU B 1 76  ? 16.049  43.374 39.853 1.00 26.39 ? 76  GLU B CB  1 
ATOM   3514 C CG  . GLU B 1 76  ? 15.319  44.713 39.829 1.00 24.79 ? 76  GLU B CG  1 
ATOM   3515 C CD  . GLU B 1 76  ? 16.134  45.761 39.077 1.00 26.50 ? 76  GLU B CD  1 
ATOM   3516 O OE1 . GLU B 1 76  ? 15.536  46.692 38.519 1.00 26.54 ? 76  GLU B OE1 1 
ATOM   3517 O OE2 . GLU B 1 76  ? 17.382  45.657 39.055 1.00 27.20 ? 76  GLU B OE2 1 
ATOM   3518 N N   . GLY B 1 77  ? 18.732  42.830 38.562 1.00 23.54 ? 77  GLY B N   1 
ATOM   3519 C CA  . GLY B 1 77  ? 20.042  42.222 38.524 1.00 23.28 ? 77  GLY B CA  1 
ATOM   3520 C C   . GLY B 1 77  ? 20.959  43.067 39.372 1.00 27.66 ? 77  GLY B C   1 
ATOM   3521 O O   . GLY B 1 77  ? 21.097  44.272 39.129 1.00 20.63 ? 77  GLY B O   1 
ATOM   3522 N N   . MET B 1 78  ? 21.545  42.451 40.396 1.00 29.55 ? 78  MET B N   1 
ATOM   3523 C CA  . MET B 1 78  ? 22.485  43.149 41.278 1.00 30.15 ? 78  MET B CA  1 
ATOM   3524 C C   . MET B 1 78  ? 23.489  42.140 41.803 1.00 28.62 ? 78  MET B C   1 
ATOM   3525 O O   . MET B 1 78  ? 23.278  40.926 41.687 1.00 26.98 ? 78  MET B O   1 
ATOM   3526 C CB  . MET B 1 78  ? 21.740  43.837 42.431 1.00 31.63 ? 78  MET B CB  1 
ATOM   3527 C CG  . MET B 1 78  ? 20.929  42.904 43.320 1.00 33.90 ? 78  MET B CG  1 
ATOM   3528 S SD  . MET B 1 78  ? 19.989  43.872 44.537 1.00 38.00 ? 78  MET B SD  1 
ATOM   3529 C CE  . MET B 1 78  ? 19.284  42.575 45.552 1.00 37.98 ? 78  MET B CE  1 
ATOM   3530 N N   . LYS B 1 79  ? 24.580  42.639 42.371 1.00 28.89 ? 79  LYS B N   1 
ATOM   3531 C CA  . LYS B 1 79  ? 25.635  41.781 42.876 1.00 29.00 ? 79  LYS B CA  1 
ATOM   3532 C C   . LYS B 1 79  ? 25.980  41.867 44.377 1.00 33.44 ? 79  LYS B C   1 
ATOM   3533 O O   . LYS B 1 79  ? 25.809  42.914 45.027 1.00 28.96 ? 79  LYS B O   1 
ATOM   3534 C CB  . LYS B 1 79  ? 26.912  42.027 42.069 1.00 23.72 ? 79  LYS B CB  1 
ATOM   3535 C CG  . LYS B 1 79  ? 26.977  41.300 40.736 1.00 25.08 ? 79  LYS B CG  1 
ATOM   3536 C CD  . LYS B 1 79  ? 28.214  41.671 39.967 1.00 24.09 ? 79  LYS B CD  1 
ATOM   3537 C CE  . LYS B 1 79  ? 28.357  40.800 38.762 1.00 25.87 ? 79  LYS B CE  1 
ATOM   3538 N NZ  . LYS B 1 79  ? 29.564  41.140 38.000 1.00 29.58 ? 79  LYS B NZ  1 
ATOM   3539 N N   . ALA B 1 80  ? 26.450  40.732 44.898 1.00 32.09 ? 80  ALA B N   1 
ATOM   3540 C CA  . ALA B 1 80  ? 26.898  40.609 46.280 1.00 31.25 ? 80  ALA B CA  1 
ATOM   3541 C C   . ALA B 1 80  ? 28.373  40.251 46.146 1.00 29.73 ? 80  ALA B C   1 
ATOM   3542 O O   . ALA B 1 80  ? 28.728  39.361 45.372 1.00 33.55 ? 80  ALA B O   1 
ATOM   3543 C CB  . ALA B 1 80  ? 26.147  39.494 46.995 1.00 29.82 ? 80  ALA B CB  1 
ATOM   3544 N N   . PHE B 1 81  ? 29.229  40.966 46.872 1.00 30.18 ? 81  PHE B N   1 
ATOM   3545 C CA  . PHE B 1 81  ? 30.663  40.727 46.810 1.00 26.82 ? 81  PHE B CA  1 
ATOM   3546 C C   . PHE B 1 81  ? 31.154  40.241 48.173 1.00 30.46 ? 81  PHE B C   1 
ATOM   3547 O O   . PHE B 1 81  ? 30.733  40.752 49.209 1.00 35.21 ? 81  PHE B O   1 
ATOM   3548 C CB  . PHE B 1 81  ? 31.411  42.016 46.438 1.00 27.87 ? 81  PHE B CB  1 
ATOM   3549 C CG  . PHE B 1 81  ? 30.905  42.680 45.175 1.00 25.62 ? 81  PHE B CG  1 
ATOM   3550 C CD1 . PHE B 1 81  ? 29.720  43.397 45.182 1.00 22.91 ? 81  PHE B CD1 1 
ATOM   3551 C CD2 . PHE B 1 81  ? 31.633  42.596 43.991 1.00 26.17 ? 81  PHE B CD2 1 
ATOM   3552 C CE1 . PHE B 1 81  ? 29.252  44.036 44.026 1.00 26.62 ? 81  PHE B CE1 1 
ATOM   3553 C CE2 . PHE B 1 81  ? 31.181  43.233 42.808 1.00 29.04 ? 81  PHE B CE2 1 
ATOM   3554 C CZ  . PHE B 1 81  ? 29.982  43.959 42.832 1.00 23.74 ? 81  PHE B CZ  1 
ATOM   3555 N N   . LYS B 1 82  ? 32.005  39.224 48.171 1.00 36.21 ? 82  LYS B N   1 
ATOM   3556 C CA  . LYS B 1 82  ? 32.550  38.722 49.415 1.00 40.85 ? 82  LYS B CA  1 
ATOM   3557 C C   . LYS B 1 82  ? 33.952  39.288 49.530 1.00 43.23 ? 82  LYS B C   1 
ATOM   3558 O O   . LYS B 1 82  ? 34.792  39.074 48.654 1.00 44.51 ? 82  LYS B O   1 
ATOM   3559 C CB  . LYS B 1 82  ? 32.610  37.202 49.421 1.00 40.91 ? 82  LYS B CB  1 
ATOM   3560 C CG  . LYS B 1 82  ? 33.243  36.649 50.689 1.00 38.84 ? 82  LYS B CG  1 
ATOM   3561 C CD  . LYS B 1 82  ? 33.308  35.135 50.679 1.00 40.81 ? 82  LYS B CD  1 
ATOM   3562 C CE  . LYS B 1 82  ? 31.951  34.543 50.923 1.00 39.27 ? 82  LYS B CE  1 
ATOM   3563 N NZ  . LYS B 1 82  ? 31.990  33.055 50.866 1.00 47.77 ? 82  LYS B NZ  1 
ATOM   3564 N N   . GLY B 1 83  ? 34.190  40.026 50.607 1.00 50.80 ? 83  GLY B N   1 
ATOM   3565 C CA  . GLY B 1 83  ? 35.494  40.626 50.822 1.00 51.68 ? 83  GLY B CA  1 
ATOM   3566 C C   . GLY B 1 83  ? 36.531  39.603 51.238 1.00 57.80 ? 83  GLY B C   1 
ATOM   3567 O O   . GLY B 1 83  ? 36.348  38.391 51.045 1.00 59.24 ? 83  GLY B O   1 
ATOM   3568 N N   . LYS B 1 84  ? 37.633  40.097 51.795 1.00 57.19 ? 84  LYS B N   1 
ATOM   3569 C CA  . LYS B 1 84  ? 38.711  39.238 52.260 1.00 55.63 ? 84  LYS B CA  1 
ATOM   3570 C C   . LYS B 1 84  ? 38.255  38.595 53.568 1.00 55.20 ? 84  LYS B C   1 
ATOM   3571 O O   . LYS B 1 84  ? 38.368  37.378 53.765 1.00 52.28 ? 84  LYS B O   1 
ATOM   3572 C CB  . LYS B 1 84  ? 39.999  40.061 52.454 1.00 57.36 ? 84  LYS B CB  1 
ATOM   3573 C CG  . LYS B 1 84  ? 39.825  41.449 53.116 1.00 61.59 ? 84  LYS B CG  1 
ATOM   3574 C CD  . LYS B 1 84  ? 39.289  42.522 52.140 1.00 60.18 ? 84  LYS B CD  1 
ATOM   3575 C CE  . LYS B 1 84  ? 39.210  43.900 52.802 1.00 56.39 ? 84  LYS B CE  1 
ATOM   3576 N NZ  . LYS B 1 84  ? 38.349  43.871 54.012 1.00 50.29 ? 84  LYS B NZ  1 
ATOM   3577 N N   . ASP B 1 85  ? 37.703  39.423 54.447 1.00 54.37 ? 85  ASP B N   1 
ATOM   3578 C CA  . ASP B 1 85  ? 37.203  38.960 55.730 1.00 55.30 ? 85  ASP B CA  1 
ATOM   3579 C C   . ASP B 1 85  ? 36.025  37.987 55.583 1.00 54.19 ? 85  ASP B C   1 
ATOM   3580 O O   . ASP B 1 85  ? 35.340  37.681 56.562 1.00 54.19 ? 85  ASP B O   1 
ATOM   3581 C CB  . ASP B 1 85  ? 36.787  40.167 56.579 1.00 55.66 ? 85  ASP B CB  1 
ATOM   3582 C CG  . ASP B 1 85  ? 35.728  41.023 55.904 1.00 57.01 ? 85  ASP B CG  1 
ATOM   3583 O OD1 . ASP B 1 85  ? 35.570  40.918 54.667 1.00 59.96 ? 85  ASP B OD1 1 
ATOM   3584 O OD2 . ASP B 1 85  ? 35.064  41.811 56.612 1.00 51.76 ? 85  ASP B OD2 1 
ATOM   3585 N N   . GLN B 1 86  ? 35.789  37.504 54.364 1.00 52.44 ? 86  GLN B N   1 
ATOM   3586 C CA  . GLN B 1 86  ? 34.701  36.562 54.112 1.00 46.72 ? 86  GLN B CA  1 
ATOM   3587 C C   . GLN B 1 86  ? 33.349  37.262 54.326 1.00 45.08 ? 86  GLN B C   1 
ATOM   3588 O O   . GLN B 1 86  ? 32.298  36.623 54.406 1.00 41.49 ? 86  GLN B O   1 
ATOM   3589 C CB  . GLN B 1 86  ? 34.845  35.363 55.061 1.00 46.69 ? 86  GLN B CB  1 
ATOM   3590 C CG  . GLN B 1 86  ? 34.396  34.029 54.508 1.00 47.73 ? 86  GLN B CG  1 
ATOM   3591 C CD  . GLN B 1 86  ? 35.104  33.661 53.213 1.00 55.67 ? 86  GLN B CD  1 
ATOM   3592 O OE1 . GLN B 1 86  ? 36.268  34.020 52.995 1.00 52.45 ? 86  GLN B OE1 1 
ATOM   3593 N NE2 . GLN B 1 86  ? 34.405  32.928 52.346 1.00 57.15 ? 86  GLN B NE2 1 
ATOM   3594 N N   . GLN B 1 87  ? 33.384  38.585 54.422 1.00 45.33 ? 87  GLN B N   1 
ATOM   3595 C CA  . GLN B 1 87  ? 32.168  39.359 54.614 1.00 43.26 ? 87  GLN B CA  1 
ATOM   3596 C C   . GLN B 1 87  ? 31.523  39.640 53.263 1.00 39.97 ? 87  GLN B C   1 
ATOM   3597 O O   . GLN B 1 87  ? 32.193  40.051 52.315 1.00 38.65 ? 87  GLN B O   1 
ATOM   3598 C CB  . GLN B 1 87  ? 32.472  40.686 55.285 1.00 42.40 ? 87  GLN B CB  1 
ATOM   3599 C CG  . GLN B 1 87  ? 31.688  40.890 56.546 1.00 57.35 ? 87  GLN B CG  1 
ATOM   3600 C CD  . GLN B 1 87  ? 32.448  40.398 57.757 1.00 61.65 ? 87  GLN B CD  1 
ATOM   3601 O OE1 . GLN B 1 87  ? 33.146  39.379 57.696 1.00 65.78 ? 87  GLN B OE1 1 
ATOM   3602 N NE2 . GLN B 1 87  ? 32.313  41.114 58.872 1.00 61.65 ? 87  GLN B NE2 1 
ATOM   3603 N N   . VAL B 1 88  ? 30.214  39.451 53.195 1.00 37.15 ? 88  VAL B N   1 
ATOM   3604 C CA  . VAL B 1 88  ? 29.483  39.659 51.957 1.00 33.51 ? 88  VAL B CA  1 
ATOM   3605 C C   . VAL B 1 88  ? 28.672  40.948 52.016 1.00 32.60 ? 88  VAL B C   1 
ATOM   3606 O O   . VAL B 1 88  ? 28.021  41.242 53.014 1.00 34.76 ? 88  VAL B O   1 
ATOM   3607 C CB  . VAL B 1 88  ? 28.530  38.467 51.684 1.00 36.69 ? 88  VAL B CB  1 
ATOM   3608 C CG1 . VAL B 1 88  ? 27.733  38.708 50.394 1.00 34.84 ? 88  VAL B CG1 1 
ATOM   3609 C CG2 . VAL B 1 88  ? 29.338  37.172 51.582 1.00 37.62 ? 88  VAL B CG2 1 
ATOM   3610 N N   . ARG B 1 89  ? 28.705  41.710 50.931 1.00 30.24 ? 89  ARG B N   1 
ATOM   3611 C CA  . ARG B 1 89  ? 27.980  42.969 50.865 1.00 30.98 ? 89  ARG B CA  1 
ATOM   3612 C C   . ARG B 1 89  ? 27.307  43.150 49.498 1.00 27.70 ? 89  ARG B C   1 
ATOM   3613 O O   . ARG B 1 89  ? 27.846  42.748 48.473 1.00 27.78 ? 89  ARG B O   1 
ATOM   3614 C CB  . ARG B 1 89  ? 28.954  44.122 51.128 1.00 32.47 ? 89  ARG B CB  1 
ATOM   3615 C CG  . ARG B 1 89  ? 29.705  43.996 52.461 1.00 40.64 ? 89  ARG B CG  1 
ATOM   3616 C CD  . ARG B 1 89  ? 30.728  45.118 52.657 1.00 42.53 ? 89  ARG B CD  1 
ATOM   3617 N NE  . ARG B 1 89  ? 32.094  44.608 52.607 1.00 45.07 ? 89  ARG B NE  1 
ATOM   3618 C CZ  . ARG B 1 89  ? 32.755  44.119 53.649 1.00 47.20 ? 89  ARG B CZ  1 
ATOM   3619 N NH1 . ARG B 1 89  ? 32.178  44.085 54.842 1.00 53.99 ? 89  ARG B NH1 1 
ATOM   3620 N NH2 . ARG B 1 89  ? 33.982  43.637 53.496 1.00 45.97 ? 89  ARG B NH2 1 
ATOM   3621 N N   . LEU B 1 90  ? 26.117  43.736 49.500 1.00 29.02 ? 90  LEU B N   1 
ATOM   3622 C CA  . LEU B 1 90  ? 25.392  44.012 48.264 1.00 26.33 ? 90  LEU B CA  1 
ATOM   3623 C C   . LEU B 1 90  ? 25.671  45.471 47.891 1.00 28.65 ? 90  LEU B C   1 
ATOM   3624 O O   . LEU B 1 90  ? 25.694  46.333 48.764 1.00 25.99 ? 90  LEU B O   1 
ATOM   3625 C CB  . LEU B 1 90  ? 23.888  43.817 48.475 1.00 26.33 ? 90  LEU B CB  1 
ATOM   3626 C CG  . LEU B 1 90  ? 23.330  42.391 48.466 1.00 28.28 ? 90  LEU B CG  1 
ATOM   3627 C CD1 . LEU B 1 90  ? 21.899  42.371 49.018 1.00 27.16 ? 90  LEU B CD1 1 
ATOM   3628 C CD2 . LEU B 1 90  ? 23.350  41.872 47.059 1.00 28.52 ? 90  LEU B CD2 1 
ATOM   3629 N N   . PHE B 1 91  ? 25.889  45.739 46.605 1.00 25.27 ? 91  PHE B N   1 
ATOM   3630 C CA  . PHE B 1 91  ? 26.154  47.089 46.107 1.00 27.34 ? 91  PHE B CA  1 
ATOM   3631 C C   . PHE B 1 91  ? 24.856  47.832 45.758 1.00 29.88 ? 91  PHE B C   1 
ATOM   3632 O O   . PHE B 1 91  ? 24.100  47.395 44.874 1.00 27.99 ? 91  PHE B O   1 
ATOM   3633 C CB  . PHE B 1 91  ? 27.039  46.993 44.854 1.00 28.29 ? 91  PHE B CB  1 
ATOM   3634 C CG  . PHE B 1 91  ? 27.358  48.319 44.217 1.00 29.83 ? 91  PHE B CG  1 
ATOM   3635 C CD1 . PHE B 1 91  ? 28.287  49.179 44.797 1.00 27.73 ? 91  PHE B CD1 1 
ATOM   3636 C CD2 . PHE B 1 91  ? 26.777  48.680 43.004 1.00 28.61 ? 91  PHE B CD2 1 
ATOM   3637 C CE1 . PHE B 1 91  ? 28.643  50.376 44.179 1.00 28.98 ? 91  PHE B CE1 1 
ATOM   3638 C CE2 . PHE B 1 91  ? 27.126  49.876 42.376 1.00 27.45 ? 91  PHE B CE2 1 
ATOM   3639 C CZ  . PHE B 1 91  ? 28.063  50.726 42.964 1.00 26.88 ? 91  PHE B CZ  1 
ATOM   3640 N N   . ARG B 1 92  ? 24.619  48.946 46.456 1.00 28.18 ? 92  ARG B N   1 
ATOM   3641 C CA  . ARG B 1 92  ? 23.443  49.817 46.310 1.00 28.05 ? 92  ARG B CA  1 
ATOM   3642 C C   . ARG B 1 92  ? 22.126  49.104 46.006 1.00 27.33 ? 92  ARG B C   1 
ATOM   3643 O O   . ARG B 1 92  ? 21.366  49.532 45.128 1.00 27.01 ? 92  ARG B O   1 
ATOM   3644 C CB  . ARG B 1 92  ? 23.710  50.884 45.228 1.00 29.05 ? 92  ARG B CB  1 
ATOM   3645 C CG  . ARG B 1 92  ? 25.088  51.543 45.340 1.00 30.55 ? 92  ARG B CG  1 
ATOM   3646 C CD  . ARG B 1 92  ? 25.248  52.743 44.410 1.00 23.29 ? 92  ARG B CD  1 
ATOM   3647 N NE  . ARG B 1 92  ? 24.479  53.863 44.895 1.00 21.97 ? 92  ARG B NE  1 
ATOM   3648 C CZ  . ARG B 1 92  ? 24.445  55.067 44.344 1.00 21.83 ? 92  ARG B CZ  1 
ATOM   3649 N NH1 . ARG B 1 92  ? 25.150  55.329 43.245 1.00 28.40 ? 92  ARG B NH1 1 
ATOM   3650 N NH2 . ARG B 1 92  ? 23.704  56.009 44.909 1.00 20.70 ? 92  ARG B NH2 1 
ATOM   3651 N N   . PRO B 1 93  ? 21.812  48.040 46.757 1.00 26.98 ? 93  PRO B N   1 
ATOM   3652 C CA  . PRO B 1 93  ? 20.579  47.259 46.562 1.00 29.43 ? 93  PRO B CA  1 
ATOM   3653 C C   . PRO B 1 93  ? 19.312  48.102 46.514 1.00 27.06 ? 93  PRO B C   1 
ATOM   3654 O O   . PRO B 1 93  ? 18.378  47.804 45.757 1.00 31.21 ? 93  PRO B O   1 
ATOM   3655 C CB  . PRO B 1 93  ? 20.554  46.309 47.766 1.00 30.94 ? 93  PRO B CB  1 
ATOM   3656 C CG  . PRO B 1 93  ? 21.969  46.297 48.260 1.00 35.70 ? 93  PRO B CG  1 
ATOM   3657 C CD  . PRO B 1 93  ? 22.466  47.686 48.025 1.00 27.36 ? 93  PRO B CD  1 
ATOM   3658 N N   . TRP B 1 94  ? 19.277  49.141 47.336 1.00 26.77 ? 94  TRP B N   1 
ATOM   3659 C CA  . TRP B 1 94  ? 18.114  50.015 47.435 1.00 23.79 ? 94  TRP B CA  1 
ATOM   3660 C C   . TRP B 1 94  ? 17.687  50.537 46.068 1.00 24.83 ? 94  TRP B C   1 
ATOM   3661 O O   . TRP B 1 94  ? 16.494  50.617 45.786 1.00 25.18 ? 94  TRP B O   1 
ATOM   3662 C CB  . TRP B 1 94  ? 18.418  51.192 48.358 1.00 26.25 ? 94  TRP B CB  1 
ATOM   3663 C CG  . TRP B 1 94  ? 18.991  50.771 49.675 1.00 33.08 ? 94  TRP B CG  1 
ATOM   3664 C CD1 . TRP B 1 94  ? 18.303  50.337 50.782 1.00 29.42 ? 94  TRP B CD1 1 
ATOM   3665 C CD2 . TRP B 1 94  ? 20.377  50.722 50.017 1.00 27.64 ? 94  TRP B CD2 1 
ATOM   3666 N NE1 . TRP B 1 94  ? 19.186  50.026 51.794 1.00 34.82 ? 94  TRP B NE1 1 
ATOM   3667 C CE2 . TRP B 1 94  ? 20.465  50.255 51.353 1.00 30.85 ? 94  TRP B CE2 1 
ATOM   3668 C CE3 . TRP B 1 94  ? 21.553  51.032 49.329 1.00 29.10 ? 94  TRP B CE3 1 
ATOM   3669 C CZ2 . TRP B 1 94  ? 21.683  50.092 52.010 1.00 31.16 ? 94  TRP B CZ2 1 
ATOM   3670 C CZ3 . TRP B 1 94  ? 22.773  50.872 49.987 1.00 34.00 ? 94  TRP B CZ3 1 
ATOM   3671 C CH2 . TRP B 1 94  ? 22.825  50.404 51.319 1.00 33.43 ? 94  TRP B CH2 1 
ATOM   3672 N N   . LEU B 1 95  ? 18.653  50.905 45.223 1.00 25.17 ? 95  LEU B N   1 
ATOM   3673 C CA  . LEU B 1 95  ? 18.307  51.405 43.901 1.00 22.63 ? 95  LEU B CA  1 
ATOM   3674 C C   . LEU B 1 95  ? 17.599  50.320 43.079 1.00 22.66 ? 95  LEU B C   1 
ATOM   3675 O O   . LEU B 1 95  ? 16.669  50.618 42.346 1.00 23.80 ? 95  LEU B O   1 
ATOM   3676 C CB  . LEU B 1 95  ? 19.550  51.914 43.170 1.00 22.50 ? 95  LEU B CB  1 
ATOM   3677 C CG  . LEU B 1 95  ? 20.290  53.033 43.939 1.00 32.55 ? 95  LEU B CG  1 
ATOM   3678 C CD1 . LEU B 1 95  ? 21.324  53.705 43.062 1.00 22.85 ? 95  LEU B CD1 1 
ATOM   3679 C CD2 . LEU B 1 95  ? 19.300  54.068 44.416 1.00 31.92 ? 95  LEU B CD2 1 
ATOM   3680 N N   . ASN B 1 96  ? 18.035  49.070 43.210 1.00 22.34 ? 96  ASN B N   1 
ATOM   3681 C CA  . ASN B 1 96  ? 17.409  47.972 42.479 1.00 23.49 ? 96  ASN B CA  1 
ATOM   3682 C C   . ASN B 1 96  ? 15.973  47.725 42.976 1.00 29.34 ? 96  ASN B C   1 
ATOM   3683 O O   . ASN B 1 96  ? 15.076  47.429 42.177 1.00 23.33 ? 96  ASN B O   1 
ATOM   3684 C CB  . ASN B 1 96  ? 18.250  46.703 42.593 1.00 23.40 ? 96  ASN B CB  1 
ATOM   3685 C CG  . ASN B 1 96  ? 19.594  46.827 41.874 1.00 32.94 ? 96  ASN B CG  1 
ATOM   3686 O OD1 . ASN B 1 96  ? 19.677  46.661 40.647 1.00 33.86 ? 96  ASN B OD1 1 
ATOM   3687 N ND2 . ASN B 1 96  ? 20.648  47.129 42.624 1.00 23.86 ? 96  ASN B ND2 1 
ATOM   3688 N N   . MET B 1 97  ? 15.744  47.872 44.282 1.00 23.93 ? 97  MET B N   1 
ATOM   3689 C CA  . MET B 1 97  ? 14.407  47.686 44.818 1.00 25.56 ? 97  MET B CA  1 
ATOM   3690 C C   . MET B 1 97  ? 13.514  48.805 44.288 1.00 23.86 ? 97  MET B C   1 
ATOM   3691 O O   . MET B 1 97  ? 12.367  48.555 43.927 1.00 28.65 ? 97  MET B O   1 
ATOM   3692 C CB  . MET B 1 97  ? 14.423  47.711 46.347 1.00 24.27 ? 97  MET B CB  1 
ATOM   3693 C CG  . MET B 1 97  ? 15.278  46.637 46.971 1.00 26.15 ? 97  MET B CG  1 
ATOM   3694 S SD  . MET B 1 97  ? 14.678  45.002 46.596 1.00 30.06 ? 97  MET B SD  1 
ATOM   3695 C CE  . MET B 1 97  ? 15.805  44.512 45.224 1.00 30.52 ? 97  MET B CE  1 
ATOM   3696 N N   . ASP B 1 98  ? 14.034  50.033 44.247 1.00 22.60 ? 98  ASP B N   1 
ATOM   3697 C CA  . ASP B 1 98  ? 13.276  51.174 43.724 1.00 23.32 ? 98  ASP B CA  1 
ATOM   3698 C C   . ASP B 1 98  ? 12.853  50.927 42.258 1.00 25.15 ? 98  ASP B C   1 
ATOM   3699 O O   . ASP B 1 98  ? 11.708  51.160 41.874 1.00 21.10 ? 98  ASP B O   1 
ATOM   3700 C CB  . ASP B 1 98  ? 14.124  52.444 43.713 1.00 24.47 ? 98  ASP B CB  1 
ATOM   3701 C CG  . ASP B 1 98  ? 14.327  53.038 45.075 1.00 31.99 ? 98  ASP B CG  1 
ATOM   3702 O OD1 . ASP B 1 98  ? 15.265  53.851 45.186 1.00 39.64 ? 98  ASP B OD1 1 
ATOM   3703 O OD2 . ASP B 1 98  ? 13.567  52.721 46.020 1.00 36.00 ? 98  ASP B OD2 1 
ATOM   3704 N N   . ARG B 1 99  ? 13.820  50.531 41.442 1.00 23.50 ? 99  ARG B N   1 
ATOM   3705 C CA  . ARG B 1 99  ? 13.579  50.259 40.027 1.00 23.62 ? 99  ARG B CA  1 
ATOM   3706 C C   . ARG B 1 99  ? 12.617  49.082 39.845 1.00 21.69 ? 99  ARG B C   1 
ATOM   3707 O O   . ARG B 1 99  ? 11.730  49.101 38.981 1.00 22.66 ? 99  ARG B O   1 
ATOM   3708 C CB  . ARG B 1 99  ? 14.911  49.963 39.342 1.00 21.82 ? 99  ARG B CB  1 
ATOM   3709 C CG  . ARG B 1 99  ? 14.821  49.887 37.823 1.00 21.33 ? 99  ARG B CG  1 
ATOM   3710 C CD  . ARG B 1 99  ? 16.219  49.912 37.185 1.00 25.12 ? 99  ARG B CD  1 
ATOM   3711 N NE  . ARG B 1 99  ? 16.976  48.671 37.351 1.00 24.11 ? 99  ARG B NE  1 
ATOM   3712 C CZ  . ARG B 1 99  ? 18.283  48.547 37.114 1.00 26.02 ? 99  ARG B CZ  1 
ATOM   3713 N NH1 . ARG B 1 99  ? 18.994  49.599 36.708 1.00 29.65 ? 99  ARG B NH1 1 
ATOM   3714 N NH2 . ARG B 1 99  ? 18.883  47.366 37.263 1.00 19.88 ? 99  ARG B NH2 1 
ATOM   3715 N N   . MET B 1 100 ? 12.771  48.060 40.676 1.00 23.78 ? 100 MET B N   1 
ATOM   3716 C CA  . MET B 1 100 ? 11.900  46.899 40.576 1.00 25.29 ? 100 MET B CA  1 
ATOM   3717 C C   . MET B 1 100 ? 10.461  47.314 40.843 1.00 27.19 ? 100 MET B C   1 
ATOM   3718 O O   . MET B 1 100 ? 9.538   46.896 40.135 1.00 26.20 ? 100 MET B O   1 
ATOM   3719 C CB  . MET B 1 100 ? 12.316  45.813 41.567 1.00 25.69 ? 100 MET B CB  1 
ATOM   3720 C CG  . MET B 1 100 ? 11.514  44.516 41.430 1.00 18.84 ? 100 MET B CG  1 
ATOM   3721 S SD  . MET B 1 100 ? 12.231  43.219 42.413 1.00 27.25 ? 100 MET B SD  1 
ATOM   3722 C CE  . MET B 1 100 ? 11.115  41.796 42.035 1.00 21.17 ? 100 MET B CE  1 
ATOM   3723 N N   . LEU B 1 101 ? 10.259  48.156 41.846 1.00 26.10 ? 101 LEU B N   1 
ATOM   3724 C CA  . LEU B 1 101 ? 8.908   48.595 42.170 1.00 25.15 ? 101 LEU B CA  1 
ATOM   3725 C C   . LEU B 1 101 ? 8.344   49.464 41.032 1.00 22.58 ? 101 LEU B C   1 
ATOM   3726 O O   . LEU B 1 101 ? 7.149   49.414 40.723 1.00 23.84 ? 101 LEU B O   1 
ATOM   3727 C CB  . LEU B 1 101 ? 8.897   49.366 43.496 1.00 28.89 ? 101 LEU B CB  1 
ATOM   3728 C CG  . LEU B 1 101 ? 7.523   49.447 44.177 1.00 35.50 ? 101 LEU B CG  1 
ATOM   3729 C CD1 . LEU B 1 101 ? 7.190   48.086 44.798 1.00 37.59 ? 101 LEU B CD1 1 
ATOM   3730 C CD2 . LEU B 1 101 ? 7.524   50.522 45.257 1.00 36.81 ? 101 LEU B CD2 1 
ATOM   3731 N N   . ARG B 1 102 ? 9.192   50.268 40.400 1.00 23.03 ? 102 ARG B N   1 
ATOM   3732 C CA  . ARG B 1 102 ? 8.718   51.087 39.292 1.00 21.96 ? 102 ARG B CA  1 
ATOM   3733 C C   . ARG B 1 102 ? 8.242   50.158 38.166 1.00 23.08 ? 102 ARG B C   1 
ATOM   3734 O O   . ARG B 1 102 ? 7.202   50.383 37.567 1.00 22.99 ? 102 ARG B O   1 
ATOM   3735 C CB  . ARG B 1 102 ? 9.825   51.995 38.770 1.00 27.11 ? 102 ARG B CB  1 
ATOM   3736 C CG  . ARG B 1 102 ? 10.014  53.282 39.571 1.00 34.01 ? 102 ARG B CG  1 
ATOM   3737 C CD  . ARG B 1 102 ? 10.898  54.255 38.806 1.00 33.71 ? 102 ARG B CD  1 
ATOM   3738 N NE  . ARG B 1 102 ? 12.317  53.927 38.938 1.00 38.68 ? 102 ARG B NE  1 
ATOM   3739 C CZ  . ARG B 1 102 ? 13.133  53.596 37.936 1.00 46.31 ? 102 ARG B CZ  1 
ATOM   3740 N NH1 . ARG B 1 102 ? 12.684  53.528 36.679 1.00 48.11 ? 102 ARG B NH1 1 
ATOM   3741 N NH2 . ARG B 1 102 ? 14.423  53.369 38.190 1.00 32.51 ? 102 ARG B NH2 1 
ATOM   3742 N N   . SER B 1 103 ? 9.006   49.105 37.903 1.00 26.73 ? 103 SER B N   1 
ATOM   3743 C CA  . SER B 1 103 ? 8.650   48.149 36.862 1.00 29.03 ? 103 SER B CA  1 
ATOM   3744 C C   . SER B 1 103 ? 7.325   47.498 37.204 1.00 25.91 ? 103 SER B C   1 
ATOM   3745 O O   . SER B 1 103 ? 6.465   47.364 36.342 1.00 22.64 ? 103 SER B O   1 
ATOM   3746 C CB  . SER B 1 103 ? 9.719   47.061 36.719 1.00 28.15 ? 103 SER B CB  1 
ATOM   3747 O OG  . SER B 1 103 ? 10.929  47.592 36.203 1.00 29.25 ? 103 SER B OG  1 
ATOM   3748 N N   . ALA B 1 104 ? 7.169   47.101 38.467 1.00 28.06 ? 104 ALA B N   1 
ATOM   3749 C CA  . ALA B 1 104 ? 5.945   46.469 38.928 1.00 25.61 ? 104 ALA B CA  1 
ATOM   3750 C C   . ALA B 1 104 ? 4.724   47.331 38.629 1.00 25.33 ? 104 ALA B C   1 
ATOM   3751 O O   . ALA B 1 104 ? 3.725   46.846 38.104 1.00 25.46 ? 104 ALA B O   1 
ATOM   3752 C CB  . ALA B 1 104 ? 6.029   46.170 40.438 1.00 20.90 ? 104 ALA B CB  1 
ATOM   3753 N N   . MET B 1 105 ? 4.792   48.615 38.958 1.00 24.74 ? 105 MET B N   1 
ATOM   3754 C CA  . MET B 1 105 ? 3.655   49.495 38.708 1.00 21.83 ? 105 MET B CA  1 
ATOM   3755 C C   . MET B 1 105 ? 3.340   49.693 37.222 1.00 23.64 ? 105 MET B C   1 
ATOM   3756 O O   . MET B 1 105 ? 2.183   49.827 36.833 1.00 24.64 ? 105 MET B O   1 
ATOM   3757 C CB  . MET B 1 105 ? 3.886   50.860 39.359 1.00 25.99 ? 105 MET B CB  1 
ATOM   3758 C CG  . MET B 1 105 ? 2.830   51.197 40.394 1.00 40.18 ? 105 MET B CG  1 
ATOM   3759 S SD  . MET B 1 105 ? 2.906   50.171 41.878 1.00 50.47 ? 105 MET B SD  1 
ATOM   3760 C CE  . MET B 1 105 ? 2.400   48.526 41.348 1.00 43.91 ? 105 MET B CE  1 
ATOM   3761 N N   . ARG B 1 106 ? 4.374   49.702 36.395 1.00 21.25 ? 106 ARG B N   1 
ATOM   3762 C CA  . ARG B 1 106 ? 4.196   49.912 34.963 1.00 23.74 ? 106 ARG B CA  1 
ATOM   3763 C C   . ARG B 1 106 ? 3.392   48.751 34.367 1.00 23.59 ? 106 ARG B C   1 
ATOM   3764 O O   . ARG B 1 106 ? 2.573   48.946 33.467 1.00 23.04 ? 106 ARG B O   1 
ATOM   3765 C CB  . ARG B 1 106 ? 5.590   50.090 34.313 1.00 25.19 ? 106 ARG B CB  1 
ATOM   3766 C CG  . ARG B 1 106 ? 5.650   50.354 32.802 1.00 20.77 ? 106 ARG B CG  1 
ATOM   3767 C CD  . ARG B 1 106 ? 4.743   51.453 32.312 1.00 17.57 ? 106 ARG B CD  1 
ATOM   3768 N NE  . ARG B 1 106 ? 3.549   50.784 31.877 1.00 36.43 ? 106 ARG B NE  1 
ATOM   3769 C CZ  . ARG B 1 106 ? 3.041   50.828 30.656 1.00 21.89 ? 106 ARG B CZ  1 
ATOM   3770 N NH1 . ARG B 1 106 ? 3.590   51.534 29.688 1.00 25.61 ? 106 ARG B NH1 1 
ATOM   3771 N NH2 . ARG B 1 106 ? 1.989   50.106 30.419 1.00 30.34 ? 106 ARG B NH2 1 
ATOM   3772 N N   . LEU B 1 107 ? 3.593   47.555 34.908 1.00 20.19 ? 107 LEU B N   1 
ATOM   3773 C CA  . LEU B 1 107 ? 2.881   46.355 34.470 1.00 24.14 ? 107 LEU B CA  1 
ATOM   3774 C C   . LEU B 1 107 ? 1.674   45.960 35.350 1.00 20.02 ? 107 LEU B C   1 
ATOM   3775 O O   . LEU B 1 107 ? 1.166   44.833 35.263 1.00 26.16 ? 107 LEU B O   1 
ATOM   3776 C CB  . LEU B 1 107 ? 3.849   45.173 34.406 1.00 19.98 ? 107 LEU B CB  1 
ATOM   3777 C CG  . LEU B 1 107 ? 4.985   45.246 33.395 1.00 21.93 ? 107 LEU B CG  1 
ATOM   3778 C CD1 . LEU B 1 107 ? 5.746   43.923 33.409 1.00 23.88 ? 107 LEU B CD1 1 
ATOM   3779 C CD2 . LEU B 1 107 ? 4.405   45.536 32.001 1.00 21.53 ? 107 LEU B CD2 1 
ATOM   3780 N N   . CYS B 1 108 ? 1.223   46.870 36.199 1.00 22.66 ? 108 CYS B N   1 
ATOM   3781 C CA  . CYS B 1 108 ? 0.083   46.595 37.076 1.00 23.35 ? 108 CYS B CA  1 
ATOM   3782 C C   . CYS B 1 108 ? 0.247   45.345 37.936 1.00 23.88 ? 108 CYS B C   1 
ATOM   3783 O O   . CYS B 1 108 ? -0.724  44.618 38.195 1.00 26.90 ? 108 CYS B O   1 
ATOM   3784 C CB  . CYS B 1 108 ? -1.199  46.471 36.253 1.00 27.57 ? 108 CYS B CB  1 
ATOM   3785 S SG  . CYS B 1 108 ? -1.586  47.984 35.347 1.00 36.91 ? 108 CYS B SG  1 
ATOM   3786 N N   . LEU B 1 109 ? 1.474   45.084 38.362 1.00 26.22 ? 109 LEU B N   1 
ATOM   3787 C CA  . LEU B 1 109 ? 1.755   43.946 39.221 1.00 22.99 ? 109 LEU B CA  1 
ATOM   3788 C C   . LEU B 1 109 ? 1.755   44.477 40.660 1.00 26.67 ? 109 LEU B C   1 
ATOM   3789 O O   . LEU B 1 109 ? 1.902   45.676 40.882 1.00 29.35 ? 109 LEU B O   1 
ATOM   3790 C CB  . LEU B 1 109 ? 3.087   43.320 38.827 1.00 23.90 ? 109 LEU B CB  1 
ATOM   3791 C CG  . LEU B 1 109 ? 2.982   42.416 37.599 1.00 26.07 ? 109 LEU B CG  1 
ATOM   3792 C CD1 . LEU B 1 109 ? 4.343   41.890 37.166 1.00 24.44 ? 109 LEU B CD1 1 
ATOM   3793 C CD2 . LEU B 1 109 ? 2.061   41.271 37.940 1.00 28.91 ? 109 LEU B CD2 1 
ATOM   3794 N N   . PRO B 1 110 ? 1.577   43.596 41.650 1.00 28.68 ? 110 PRO B N   1 
ATOM   3795 C CA  . PRO B 1 110 ? 1.533   43.932 43.073 1.00 33.02 ? 110 PRO B CA  1 
ATOM   3796 C C   . PRO B 1 110 ? 2.713   44.696 43.674 1.00 34.28 ? 110 PRO B C   1 
ATOM   3797 O O   . PRO B 1 110 ? 3.874   44.292 43.555 1.00 31.38 ? 110 PRO B O   1 
ATOM   3798 C CB  . PRO B 1 110 ? 1.369   42.570 43.754 1.00 32.14 ? 110 PRO B CB  1 
ATOM   3799 C CG  . PRO B 1 110 ? 0.942   41.669 42.688 1.00 33.47 ? 110 PRO B CG  1 
ATOM   3800 C CD  . PRO B 1 110 ? 1.668   42.140 41.487 1.00 35.34 ? 110 PRO B CD  1 
ATOM   3801 N N   . SER B 1 111 ? 2.393   45.797 44.342 1.00 36.78 ? 111 SER B N   1 
ATOM   3802 C CA  . SER B 1 111 ? 3.403   46.599 45.013 1.00 36.85 ? 111 SER B CA  1 
ATOM   3803 C C   . SER B 1 111 ? 3.824   45.811 46.244 1.00 33.78 ? 111 SER B C   1 
ATOM   3804 O O   . SER B 1 111 ? 3.082   44.953 46.707 1.00 35.11 ? 111 SER B O   1 
ATOM   3805 C CB  . SER B 1 111 ? 2.817   47.936 45.437 1.00 36.48 ? 111 SER B CB  1 
ATOM   3806 O OG  . SER B 1 111 ? 3.737   48.626 46.256 1.00 42.54 ? 111 SER B OG  1 
ATOM   3807 N N   . PHE B 1 112 ? 5.022   46.082 46.749 1.00 33.90 ? 112 PHE B N   1 
ATOM   3808 C CA  . PHE B 1 112 ? 5.543   45.395 47.929 1.00 35.75 ? 112 PHE B CA  1 
ATOM   3809 C C   . PHE B 1 112 ? 6.465   46.346 48.683 1.00 32.98 ? 112 PHE B C   1 
ATOM   3810 O O   . PHE B 1 112 ? 6.793   47.420 48.180 1.00 30.66 ? 112 PHE B O   1 
ATOM   3811 C CB  . PHE B 1 112 ? 6.305   44.128 47.529 1.00 34.94 ? 112 PHE B CB  1 
ATOM   3812 C CG  . PHE B 1 112 ? 7.425   44.371 46.558 1.00 33.91 ? 112 PHE B CG  1 
ATOM   3813 C CD1 . PHE B 1 112 ? 8.674   44.799 47.002 1.00 34.97 ? 112 PHE B CD1 1 
ATOM   3814 C CD2 . PHE B 1 112 ? 7.219   44.217 45.194 1.00 34.24 ? 112 PHE B CD2 1 
ATOM   3815 C CE1 . PHE B 1 112 ? 9.699   45.076 46.093 1.00 34.56 ? 112 PHE B CE1 1 
ATOM   3816 C CE2 . PHE B 1 112 ? 8.238   44.491 44.270 1.00 31.78 ? 112 PHE B CE2 1 
ATOM   3817 C CZ  . PHE B 1 112 ? 9.479   44.923 44.723 1.00 35.56 ? 112 PHE B CZ  1 
ATOM   3818 N N   . ASP B 1 113 ? 6.875   45.958 49.888 1.00 35.74 ? 113 ASP B N   1 
ATOM   3819 C CA  . ASP B 1 113 ? 7.753   46.809 50.685 1.00 35.93 ? 113 ASP B CA  1 
ATOM   3820 C C   . ASP B 1 113 ? 9.190   46.550 50.273 1.00 31.33 ? 113 ASP B C   1 
ATOM   3821 O O   . ASP B 1 113 ? 9.689   45.430 50.426 1.00 35.74 ? 113 ASP B O   1 
ATOM   3822 C CB  . ASP B 1 113 ? 7.582   46.520 52.174 1.00 38.39 ? 113 ASP B CB  1 
ATOM   3823 C CG  . ASP B 1 113 ? 8.269   47.552 53.040 1.00 44.39 ? 113 ASP B CG  1 
ATOM   3824 O OD1 . ASP B 1 113 ? 9.494   47.759 52.884 1.00 45.32 ? 113 ASP B OD1 1 
ATOM   3825 O OD2 . ASP B 1 113 ? 7.577   48.167 53.876 1.00 54.76 ? 113 ASP B OD2 1 
ATOM   3826 N N   . LYS B 1 114 ? 9.848   47.594 49.758 1.00 32.99 ? 114 LYS B N   1 
ATOM   3827 C CA  . LYS B 1 114 ? 11.226  47.498 49.283 1.00 29.70 ? 114 LYS B CA  1 
ATOM   3828 C C   . LYS B 1 114 ? 12.222  47.014 50.330 1.00 27.16 ? 114 LYS B C   1 
ATOM   3829 O O   . LYS B 1 114 ? 13.125  46.233 50.022 1.00 26.93 ? 114 LYS B O   1 
ATOM   3830 C CB  . LYS B 1 114 ? 11.659  48.845 48.695 1.00 30.93 ? 114 LYS B CB  1 
ATOM   3831 C CG  . LYS B 1 114 ? 10.811  49.211 47.470 1.00 38.30 ? 114 LYS B CG  1 
ATOM   3832 C CD  . LYS B 1 114 ? 11.306  50.422 46.686 1.00 37.59 ? 114 LYS B CD  1 
ATOM   3833 C CE  . LYS B 1 114 ? 11.023  51.739 47.397 1.00 41.19 ? 114 LYS B CE  1 
ATOM   3834 N NZ  . LYS B 1 114 ? 11.064  52.870 46.414 1.00 41.36 ? 114 LYS B NZ  1 
ATOM   3835 N N   . LEU B 1 115 ? 12.051  47.450 51.572 1.00 30.36 ? 115 LEU B N   1 
ATOM   3836 C CA  . LEU B 1 115 ? 12.964  47.036 52.632 1.00 30.53 ? 115 LEU B CA  1 
ATOM   3837 C C   . LEU B 1 115 ? 12.685  45.604 53.065 1.00 33.45 ? 115 LEU B C   1 
ATOM   3838 O O   . LEU B 1 115 ? 13.615  44.864 53.413 1.00 33.32 ? 115 LEU B O   1 
ATOM   3839 C CB  . LEU B 1 115 ? 12.873  48.017 53.803 1.00 34.91 ? 115 LEU B CB  1 
ATOM   3840 C CG  . LEU B 1 115 ? 13.395  49.410 53.412 1.00 33.53 ? 115 LEU B CG  1 
ATOM   3841 C CD1 . LEU B 1 115 ? 13.146  50.405 54.520 1.00 36.12 ? 115 LEU B CD1 1 
ATOM   3842 C CD2 . LEU B 1 115 ? 14.889  49.318 53.083 1.00 32.26 ? 115 LEU B CD2 1 
ATOM   3843 N N   . GLU B 1 116 ? 11.417  45.191 53.006 1.00 31.96 ? 116 GLU B N   1 
ATOM   3844 C CA  . GLU B 1 116 ? 11.068  43.819 53.373 1.00 31.33 ? 116 GLU B CA  1 
ATOM   3845 C C   . GLU B 1 116 ? 11.697  42.876 52.356 1.00 31.30 ? 116 GLU B C   1 
ATOM   3846 O O   . GLU B 1 116 ? 12.270  41.847 52.726 1.00 31.18 ? 116 GLU B O   1 
ATOM   3847 C CB  . GLU B 1 116 ? 9.554   43.621 53.387 1.00 38.56 ? 116 GLU B CB  1 
ATOM   3848 C CG  . GLU B 1 116 ? 8.780   44.438 54.420 1.00 36.38 ? 116 GLU B CG  1 
ATOM   3849 C CD  . GLU B 1 116 ? 9.090   44.054 55.852 1.00 34.47 ? 116 GLU B CD  1 
ATOM   3850 O OE1 . GLU B 1 116 ? 9.524   42.909 56.105 1.00 41.08 ? 116 GLU B OE1 1 
ATOM   3851 O OE2 . GLU B 1 116 ? 8.879   44.911 56.724 1.00 34.01 ? 116 GLU B OE2 1 
ATOM   3852 N N   . LEU B 1 117 ? 11.603  43.214 51.067 1.00 31.20 ? 117 LEU B N   1 
ATOM   3853 C CA  . LEU B 1 117 ? 12.216  42.355 50.059 1.00 28.42 ? 117 LEU B CA  1 
ATOM   3854 C C   . LEU B 1 117 ? 13.737  42.288 50.261 1.00 19.41 ? 117 LEU B C   1 
ATOM   3855 O O   . LEU B 1 117 ? 14.335  41.223 50.197 1.00 25.42 ? 117 LEU B O   1 
ATOM   3856 C CB  . LEU B 1 117 ? 11.891  42.849 48.632 1.00 27.63 ? 117 LEU B CB  1 
ATOM   3857 C CG  . LEU B 1 117 ? 12.603  42.024 47.543 1.00 29.40 ? 117 LEU B CG  1 
ATOM   3858 C CD1 . LEU B 1 117 ? 12.219  40.547 47.680 1.00 28.77 ? 117 LEU B CD1 1 
ATOM   3859 C CD2 . LEU B 1 117 ? 12.232  42.523 46.155 1.00 29.03 ? 117 LEU B CD2 1 
ATOM   3860 N N   . LEU B 1 118 ? 14.372  43.432 50.491 1.00 27.55 ? 118 LEU B N   1 
ATOM   3861 C CA  . LEU B 1 118 ? 15.818  43.437 50.686 1.00 27.70 ? 118 LEU B CA  1 
ATOM   3862 C C   . LEU B 1 118 ? 16.226  42.510 51.842 1.00 29.55 ? 118 LEU B C   1 
ATOM   3863 O O   . LEU B 1 118 ? 17.218  41.794 51.731 1.00 32.77 ? 118 LEU B O   1 
ATOM   3864 C CB  . LEU B 1 118 ? 16.331  44.868 50.915 1.00 28.24 ? 118 LEU B CB  1 
ATOM   3865 C CG  . LEU B 1 118 ? 17.835  45.077 51.160 1.00 28.09 ? 118 LEU B CG  1 
ATOM   3866 C CD1 . LEU B 1 118 ? 18.670  44.437 50.064 1.00 25.99 ? 118 LEU B CD1 1 
ATOM   3867 C CD2 . LEU B 1 118 ? 18.125  46.561 51.228 1.00 29.65 ? 118 LEU B CD2 1 
ATOM   3868 N N   . GLU B 1 119 ? 15.450  42.495 52.928 1.00 31.75 ? 119 GLU B N   1 
ATOM   3869 C CA  . GLU B 1 119 ? 15.752  41.630 54.079 1.00 29.20 ? 119 GLU B CA  1 
ATOM   3870 C C   . GLU B 1 119 ? 15.664  40.170 53.639 1.00 27.82 ? 119 GLU B C   1 
ATOM   3871 O O   . GLU B 1 119 ? 16.564  39.380 53.905 1.00 30.15 ? 119 GLU B O   1 
ATOM   3872 C CB  . GLU B 1 119 ? 14.738  41.834 55.214 1.00 35.31 ? 119 GLU B CB  1 
ATOM   3873 C CG  . GLU B 1 119 ? 15.296  42.093 56.633 1.00 33.16 ? 119 GLU B CG  1 
ATOM   3874 C CD  . GLU B 1 119 ? 16.536  41.306 57.007 1.00 34.47 ? 119 GLU B CD  1 
ATOM   3875 O OE1 . GLU B 1 119 ? 16.411  40.143 57.444 1.00 42.05 ? 119 GLU B OE1 1 
ATOM   3876 O OE2 . GLU B 1 119 ? 17.646  41.861 56.875 1.00 36.39 ? 119 GLU B OE2 1 
ATOM   3877 N N   . CYS B 1 120 ? 14.571  39.807 52.963 1.00 31.81 ? 120 CYS B N   1 
ATOM   3878 C CA  . CYS B 1 120 ? 14.404  38.421 52.503 1.00 32.30 ? 120 CYS B CA  1 
ATOM   3879 C C   . CYS B 1 120 ? 15.560  38.031 51.614 1.00 32.17 ? 120 CYS B C   1 
ATOM   3880 O O   . CYS B 1 120 ? 16.047  36.899 51.672 1.00 34.57 ? 120 CYS B O   1 
ATOM   3881 C CB  . CYS B 1 120 ? 13.104  38.235 51.718 1.00 31.31 ? 120 CYS B CB  1 
ATOM   3882 S SG  . CYS B 1 120 ? 11.598  38.425 52.668 1.00 38.14 ? 120 CYS B SG  1 
ATOM   3883 N N   . ILE B 1 121 ? 16.001  38.970 50.778 1.00 31.56 ? 121 ILE B N   1 
ATOM   3884 C CA  . ILE B 1 121 ? 17.129  38.709 49.894 1.00 29.64 ? 121 ILE B CA  1 
ATOM   3885 C C   . ILE B 1 121 ? 18.405  38.536 50.723 1.00 29.23 ? 121 ILE B C   1 
ATOM   3886 O O   . ILE B 1 121 ? 19.228  37.653 50.457 1.00 28.31 ? 121 ILE B O   1 
ATOM   3887 C CB  . ILE B 1 121 ? 17.297  39.844 48.864 1.00 28.35 ? 121 ILE B CB  1 
ATOM   3888 C CG1 . ILE B 1 121 ? 16.189  39.731 47.799 1.00 30.76 ? 121 ILE B CG1 1 
ATOM   3889 C CG2 . ILE B 1 121 ? 18.670  39.778 48.248 1.00 24.41 ? 121 ILE B CG2 1 
ATOM   3890 C CD1 . ILE B 1 121 ? 16.122  40.921 46.846 1.00 34.83 ? 121 ILE B CD1 1 
ATOM   3891 N N   . ARG B 1 122 ? 18.558  39.375 51.739 1.00 32.76 ? 122 ARG B N   1 
ATOM   3892 C CA  . ARG B 1 122 ? 19.719  39.278 52.616 1.00 31.78 ? 122 ARG B CA  1 
ATOM   3893 C C   . ARG B 1 122 ? 19.723  37.887 53.278 1.00 29.86 ? 122 ARG B C   1 
ATOM   3894 O O   . ARG B 1 122 ? 20.757  37.226 53.350 1.00 29.06 ? 122 ARG B O   1 
ATOM   3895 C CB  . ARG B 1 122 ? 19.658  40.365 53.694 1.00 29.09 ? 122 ARG B CB  1 
ATOM   3896 C CG  . ARG B 1 122 ? 20.915  40.414 54.561 1.00 31.59 ? 122 ARG B CG  1 
ATOM   3897 C CD  . ARG B 1 122 ? 20.738  41.287 55.805 1.00 34.79 ? 122 ARG B CD  1 
ATOM   3898 N NE  . ARG B 1 122 ? 20.716  40.490 57.032 1.00 39.56 ? 122 ARG B NE  1 
ATOM   3899 C CZ  . ARG B 1 122 ? 19.905  39.458 57.241 1.00 48.31 ? 122 ARG B CZ  1 
ATOM   3900 N NH1 . ARG B 1 122 ? 19.047  39.084 56.303 1.00 56.49 ? 122 ARG B NH1 1 
ATOM   3901 N NH2 . ARG B 1 122 ? 19.930  38.805 58.392 1.00 49.40 ? 122 ARG B NH2 1 
ATOM   3902 N N   . ARG B 1 123 ? 18.560  37.449 53.747 1.00 32.19 ? 123 ARG B N   1 
ATOM   3903 C CA  . ARG B 1 123 ? 18.432  36.145 54.397 1.00 32.00 ? 123 ARG B CA  1 
ATOM   3904 C C   . ARG B 1 123 ? 18.744  35.023 53.431 1.00 35.49 ? 123 ARG B C   1 
ATOM   3905 O O   . ARG B 1 123 ? 19.419  34.056 53.796 1.00 39.66 ? 123 ARG B O   1 
ATOM   3906 C CB  . ARG B 1 123 ? 17.020  35.963 54.955 1.00 32.89 ? 123 ARG B CB  1 
ATOM   3907 C CG  . ARG B 1 123 ? 16.615  37.037 55.943 1.00 34.20 ? 123 ARG B CG  1 
ATOM   3908 C CD  . ARG B 1 123 ? 17.147  36.754 57.343 1.00 41.96 ? 123 ARG B CD  1 
ATOM   3909 N NE  . ARG B 1 123 ? 16.409  35.664 57.978 1.00 41.85 ? 123 ARG B NE  1 
ATOM   3910 C CZ  . ARG B 1 123 ? 16.746  34.379 57.904 1.00 47.66 ? 123 ARG B CZ  1 
ATOM   3911 N NH1 . ARG B 1 123 ? 17.832  33.999 57.229 1.00 43.74 ? 123 ARG B NH1 1 
ATOM   3912 N NH2 . ARG B 1 123 ? 15.974  33.463 58.483 1.00 48.32 ? 123 ARG B NH2 1 
ATOM   3913 N N   . LEU B 1 124 ? 18.245  35.141 52.197 1.00 35.06 ? 124 LEU B N   1 
ATOM   3914 C CA  . LEU B 1 124 ? 18.516  34.119 51.200 1.00 33.07 ? 124 LEU B CA  1 
ATOM   3915 C C   . LEU B 1 124 ? 20.011  34.066 50.947 1.00 32.32 ? 124 LEU B C   1 
ATOM   3916 O O   . LEU B 1 124 ? 20.618  32.991 51.018 1.00 38.89 ? 124 LEU B O   1 
ATOM   3917 C CB  . LEU B 1 124 ? 17.784  34.404 49.873 1.00 28.51 ? 124 LEU B CB  1 
ATOM   3918 C CG  . LEU B 1 124 ? 18.159  33.417 48.764 1.00 32.09 ? 124 LEU B CG  1 
ATOM   3919 C CD1 . LEU B 1 124 ? 17.449  32.106 49.052 1.00 31.30 ? 124 LEU B CD1 1 
ATOM   3920 C CD2 . LEU B 1 124 ? 17.744  33.937 47.378 1.00 25.57 ? 124 LEU B CD2 1 
ATOM   3921 N N   . ILE B 1 125 ? 20.625  35.210 50.648 1.00 31.79 ? 125 ILE B N   1 
ATOM   3922 C CA  . ILE B 1 125 ? 22.064  35.192 50.383 1.00 32.63 ? 125 ILE B CA  1 
ATOM   3923 C C   . ILE B 1 125 ? 22.795  34.698 51.642 1.00 32.50 ? 125 ILE B C   1 
ATOM   3924 O O   . ILE B 1 125 ? 23.791  33.987 51.552 1.00 31.59 ? 125 ILE B O   1 
ATOM   3925 C CB  . ILE B 1 125 ? 22.630  36.596 49.979 1.00 32.69 ? 125 ILE B CB  1 
ATOM   3926 C CG1 . ILE B 1 125 ? 21.990  37.079 48.663 1.00 33.14 ? 125 ILE B CG1 1 
ATOM   3927 C CG2 . ILE B 1 125 ? 24.147  36.510 49.802 1.00 31.96 ? 125 ILE B CG2 1 
ATOM   3928 C CD1 . ILE B 1 125 ? 22.510  38.450 48.152 1.00 24.58 ? 125 ILE B CD1 1 
ATOM   3929 N N   . GLU B 1 126 ? 22.296  35.069 52.814 1.00 34.70 ? 126 GLU B N   1 
ATOM   3930 C CA  . GLU B 1 126 ? 22.943  34.616 54.037 1.00 41.78 ? 126 GLU B CA  1 
ATOM   3931 C C   . GLU B 1 126 ? 22.985  33.092 54.062 1.00 43.22 ? 126 GLU B C   1 
ATOM   3932 O O   . GLU B 1 126 ? 24.033  32.490 54.325 1.00 42.41 ? 126 GLU B O   1 
ATOM   3933 C CB  . GLU B 1 126 ? 22.196  35.118 55.253 1.00 42.41 ? 126 GLU B CB  1 
ATOM   3934 C CG  . GLU B 1 126 ? 22.882  34.746 56.537 1.00 50.01 ? 126 GLU B CG  1 
ATOM   3935 C CD  . GLU B 1 126 ? 22.278  35.449 57.713 1.00 47.54 ? 126 GLU B CD  1 
ATOM   3936 O OE1 . GLU B 1 126 ? 21.083  35.223 57.973 1.00 51.04 ? 126 GLU B OE1 1 
ATOM   3937 O OE2 . GLU B 1 126 ? 22.998  36.230 58.366 1.00 53.15 ? 126 GLU B OE2 1 
ATOM   3938 N N   . VAL B 1 127 ? 21.843  32.476 53.763 1.00 44.30 ? 127 VAL B N   1 
ATOM   3939 C CA  . VAL B 1 127 ? 21.749  31.026 53.749 1.00 39.44 ? 127 VAL B CA  1 
ATOM   3940 C C   . VAL B 1 127 ? 22.673  30.420 52.693 1.00 38.19 ? 127 VAL B C   1 
ATOM   3941 O O   . VAL B 1 127 ? 23.286  29.373 52.934 1.00 39.11 ? 127 VAL B O   1 
ATOM   3942 C CB  . VAL B 1 127 ? 20.287  30.583 53.533 1.00 38.99 ? 127 VAL B CB  1 
ATOM   3943 C CG1 . VAL B 1 127 ? 20.199  29.085 53.420 1.00 41.41 ? 127 VAL B CG1 1 
ATOM   3944 C CG2 . VAL B 1 127 ? 19.441  31.059 54.688 1.00 40.85 ? 127 VAL B CG2 1 
ATOM   3945 N N   . ASP B 1 128 ? 22.801  31.067 51.532 1.00 34.70 ? 128 ASP B N   1 
ATOM   3946 C CA  . ASP B 1 128 ? 23.694  30.550 50.493 1.00 35.18 ? 128 ASP B CA  1 
ATOM   3947 C C   . ASP B 1 128 ? 25.079  31.227 50.515 1.00 35.70 ? 128 ASP B C   1 
ATOM   3948 O O   . ASP B 1 128 ? 25.838  31.154 49.536 1.00 38.18 ? 128 ASP B O   1 
ATOM   3949 C CB  . ASP B 1 128 ? 23.068  30.689 49.086 1.00 37.63 ? 128 ASP B CB  1 
ATOM   3950 C CG  . ASP B 1 128 ? 22.268  29.442 48.658 1.00 46.89 ? 128 ASP B CG  1 
ATOM   3951 O OD1 . ASP B 1 128 ? 22.717  28.305 48.945 1.00 46.76 ? 128 ASP B OD1 1 
ATOM   3952 O OD2 . ASP B 1 128 ? 21.199  29.591 48.018 1.00 39.22 ? 128 ASP B OD2 1 
ATOM   3953 N N   . LYS B 1 129 ? 25.413  31.864 51.640 1.00 38.75 ? 129 LYS B N   1 
ATOM   3954 C CA  . LYS B 1 129 ? 26.701  32.558 51.823 1.00 40.58 ? 129 LYS B CA  1 
ATOM   3955 C C   . LYS B 1 129 ? 27.885  31.859 51.169 1.00 40.81 ? 129 LYS B C   1 
ATOM   3956 O O   . LYS B 1 129 ? 28.719  32.466 50.493 1.00 35.96 ? 129 LYS B O   1 
ATOM   3957 C CB  . LYS B 1 129 ? 27.032  32.686 53.310 1.00 46.48 ? 129 LYS B CB  1 
ATOM   3958 C CG  . LYS B 1 129 ? 27.114  34.108 53.824 1.00 54.52 ? 129 LYS B CG  1 
ATOM   3959 C CD  . LYS B 1 129 ? 28.198  34.244 54.891 1.00 56.03 ? 129 LYS B CD  1 
ATOM   3960 C CE  . LYS B 1 129 ? 28.124  35.595 55.591 1.00 58.05 ? 129 LYS B CE  1 
ATOM   3961 N NZ  . LYS B 1 129 ? 26.939  35.674 56.501 1.00 61.78 ? 129 LYS B NZ  1 
ATOM   3962 N N   . ASP B 1 130 ? 27.962  30.563 51.400 1.00 42.27 ? 130 ASP B N   1 
ATOM   3963 C CA  . ASP B 1 130 ? 29.047  29.775 50.883 1.00 43.95 ? 130 ASP B CA  1 
ATOM   3964 C C   . ASP B 1 130 ? 29.197  29.824 49.370 1.00 42.37 ? 130 ASP B C   1 
ATOM   3965 O O   . ASP B 1 130 ? 30.303  29.674 48.851 1.00 41.20 ? 130 ASP B O   1 
ATOM   3966 C CB  . ASP B 1 130 ? 28.866  28.339 51.351 1.00 52.21 ? 130 ASP B CB  1 
ATOM   3967 C CG  . ASP B 1 130 ? 30.172  27.672 51.654 1.00 59.19 ? 130 ASP B CG  1 
ATOM   3968 O OD1 . ASP B 1 130 ? 30.911  27.348 50.699 1.00 65.60 ? 130 ASP B OD1 1 
ATOM   3969 O OD2 . ASP B 1 130 ? 30.463  27.491 52.854 1.00 66.44 ? 130 ASP B OD2 1 
ATOM   3970 N N   . TRP B 1 131 ? 28.097  30.029 48.653 1.00 38.60 ? 131 TRP B N   1 
ATOM   3971 C CA  . TRP B 1 131 ? 28.182  30.071 47.198 1.00 34.65 ? 131 TRP B CA  1 
ATOM   3972 C C   . TRP B 1 131 ? 28.878  31.321 46.670 1.00 33.42 ? 131 TRP B C   1 
ATOM   3973 O O   . TRP B 1 131 ? 29.363  31.330 45.538 1.00 36.05 ? 131 TRP B O   1 
ATOM   3974 C CB  . TRP B 1 131 ? 26.787  29.950 46.580 1.00 35.92 ? 131 TRP B CB  1 
ATOM   3975 C CG  . TRP B 1 131 ? 26.224  28.561 46.629 1.00 37.55 ? 131 TRP B CG  1 
ATOM   3976 C CD1 . TRP B 1 131 ? 25.510  27.988 47.652 1.00 39.50 ? 131 TRP B CD1 1 
ATOM   3977 C CD2 . TRP B 1 131 ? 26.357  27.551 45.619 1.00 36.39 ? 131 TRP B CD2 1 
ATOM   3978 N NE1 . TRP B 1 131 ? 25.194  26.684 47.333 1.00 37.89 ? 131 TRP B NE1 1 
ATOM   3979 C CE2 . TRP B 1 131 ? 25.700  26.394 46.091 1.00 34.65 ? 131 TRP B CE2 1 
ATOM   3980 C CE3 . TRP B 1 131 ? 26.973  27.512 44.356 1.00 40.39 ? 131 TRP B CE3 1 
ATOM   3981 C CZ2 . TRP B 1 131 ? 25.638  25.214 45.346 1.00 34.14 ? 131 TRP B CZ2 1 
ATOM   3982 C CZ3 . TRP B 1 131 ? 26.911  26.326 43.611 1.00 39.46 ? 131 TRP B CZ3 1 
ATOM   3983 C CH2 . TRP B 1 131 ? 26.250  25.200 44.112 1.00 39.08 ? 131 TRP B CH2 1 
ATOM   3984 N N   . VAL B 1 132 ? 28.938  32.374 47.484 1.00 33.78 ? 132 VAL B N   1 
ATOM   3985 C CA  . VAL B 1 132 ? 29.590  33.608 47.052 1.00 34.41 ? 132 VAL B CA  1 
ATOM   3986 C C   . VAL B 1 132 ? 31.101  33.409 46.911 1.00 33.79 ? 132 VAL B C   1 
ATOM   3987 O O   . VAL B 1 132 ? 31.793  33.131 47.886 1.00 36.77 ? 132 VAL B O   1 
ATOM   3988 C CB  . VAL B 1 132 ? 29.325  34.752 48.039 1.00 32.01 ? 132 VAL B CB  1 
ATOM   3989 C CG1 . VAL B 1 132 ? 29.697  36.075 47.408 1.00 32.00 ? 132 VAL B CG1 1 
ATOM   3990 C CG2 . VAL B 1 132 ? 27.874  34.756 48.457 1.00 27.17 ? 132 VAL B CG2 1 
ATOM   3991 N N   . PRO B 1 133 ? 31.629  33.550 45.689 1.00 35.57 ? 133 PRO B N   1 
ATOM   3992 C CA  . PRO B 1 133 ? 33.058  33.389 45.394 1.00 37.28 ? 133 PRO B CA  1 
ATOM   3993 C C   . PRO B 1 133 ? 33.879  34.508 46.037 1.00 40.05 ? 133 PRO B C   1 
ATOM   3994 O O   . PRO B 1 133 ? 33.323  35.521 46.464 1.00 41.04 ? 133 PRO B O   1 
ATOM   3995 C CB  . PRO B 1 133 ? 33.123  33.483 43.866 1.00 38.31 ? 133 PRO B CB  1 
ATOM   3996 C CG  . PRO B 1 133 ? 31.714  33.278 43.411 1.00 36.47 ? 133 PRO B CG  1 
ATOM   3997 C CD  . PRO B 1 133 ? 30.887  33.912 44.473 1.00 35.66 ? 133 PRO B CD  1 
ATOM   3998 N N   . ASP B 1 134 ? 35.197  34.324 46.105 1.00 43.62 ? 134 ASP B N   1 
ATOM   3999 C CA  . ASP B 1 134 ? 36.069  35.352 46.661 1.00 44.77 ? 134 ASP B CA  1 
ATOM   4000 C C   . ASP B 1 134 ? 37.377  35.557 45.891 1.00 45.56 ? 134 ASP B C   1 
ATOM   4001 O O   . ASP B 1 134 ? 38.301  36.203 46.380 1.00 47.98 ? 134 ASP B O   1 
ATOM   4002 C CB  . ASP B 1 134 ? 36.342  35.131 48.173 1.00 44.99 ? 134 ASP B CB  1 
ATOM   4003 C CG  . ASP B 1 134 ? 36.911  33.750 48.507 1.00 47.59 ? 134 ASP B CG  1 
ATOM   4004 O OD1 . ASP B 1 134 ? 37.366  33.014 47.603 1.00 48.43 ? 134 ASP B OD1 1 
ATOM   4005 O OD2 . ASP B 1 134 ? 36.914  33.412 49.713 1.00 50.45 ? 134 ASP B OD2 1 
ATOM   4006 N N   . ALA B 1 135 ? 37.459  35.017 44.679 1.00 43.95 ? 135 ALA B N   1 
ATOM   4007 C CA  . ALA B 1 135 ? 38.653  35.226 43.867 1.00 42.01 ? 135 ALA B CA  1 
ATOM   4008 C C   . ALA B 1 135 ? 38.466  36.620 43.279 1.00 44.87 ? 135 ALA B C   1 
ATOM   4009 O O   . ALA B 1 135 ? 37.339  37.123 43.227 1.00 44.55 ? 135 ALA B O   1 
ATOM   4010 C CB  . ALA B 1 135 ? 38.740  34.187 42.750 1.00 41.41 ? 135 ALA B CB  1 
ATOM   4011 N N   . ALA B 1 136 ? 39.555  37.249 42.847 1.00 43.41 ? 136 ALA B N   1 
ATOM   4012 C CA  . ALA B 1 136 ? 39.468  38.580 42.277 1.00 43.19 ? 136 ALA B CA  1 
ATOM   4013 C C   . ALA B 1 136 ? 38.496  38.608 41.099 1.00 43.70 ? 136 ALA B C   1 
ATOM   4014 O O   . ALA B 1 136 ? 38.508  37.719 40.252 1.00 42.02 ? 136 ALA B O   1 
ATOM   4015 C CB  . ALA B 1 136 ? 40.842  39.034 41.822 1.00 47.21 ? 136 ALA B CB  1 
ATOM   4016 N N   . GLY B 1 137 ? 37.647  39.627 41.062 1.00 42.82 ? 137 GLY B N   1 
ATOM   4017 C CA  . GLY B 1 137 ? 36.699  39.766 39.969 1.00 42.27 ? 137 GLY B CA  1 
ATOM   4018 C C   . GLY B 1 137 ? 35.464  38.897 40.035 1.00 39.36 ? 137 GLY B C   1 
ATOM   4019 O O   . GLY B 1 137 ? 34.611  38.989 39.161 1.00 43.83 ? 137 GLY B O   1 
ATOM   4020 N N   . THR B 1 138 ? 35.350  38.059 41.061 1.00 40.08 ? 138 THR B N   1 
ATOM   4021 C CA  . THR B 1 138 ? 34.189  37.183 41.177 1.00 38.00 ? 138 THR B CA  1 
ATOM   4022 C C   . THR B 1 138 ? 33.153  37.786 42.105 1.00 34.89 ? 138 THR B C   1 
ATOM   4023 O O   . THR B 1 138 ? 33.461  38.679 42.894 1.00 34.94 ? 138 THR B O   1 
ATOM   4024 C CB  . THR B 1 138 ? 34.575  35.794 41.698 1.00 33.75 ? 138 THR B CB  1 
ATOM   4025 O OG1 . THR B 1 138 ? 34.903  35.883 43.087 1.00 41.77 ? 138 THR B OG1 1 
ATOM   4026 C CG2 . THR B 1 138 ? 35.772  35.257 40.935 1.00 36.62 ? 138 THR B CG2 1 
ATOM   4027 N N   . SER B 1 139 ? 31.917  37.298 41.998 1.00 33.48 ? 139 SER B N   1 
ATOM   4028 C CA  . SER B 1 139 ? 30.813  37.799 42.809 1.00 31.16 ? 139 SER B CA  1 
ATOM   4029 C C   . SER B 1 139 ? 29.569  36.920 42.664 1.00 31.04 ? 139 SER B C   1 
ATOM   4030 O O   . SER B 1 139 ? 29.554  35.959 41.900 1.00 32.98 ? 139 SER B O   1 
ATOM   4031 C CB  . SER B 1 139 ? 30.458  39.222 42.377 1.00 36.51 ? 139 SER B CB  1 
ATOM   4032 O OG  . SER B 1 139 ? 29.936  39.231 41.058 1.00 36.71 ? 139 SER B OG  1 
ATOM   4033 N N   . LEU B 1 140 ? 28.524  37.259 43.404 1.00 30.35 ? 140 LEU B N   1 
ATOM   4034 C CA  . LEU B 1 140 ? 27.269  36.529 43.334 1.00 30.63 ? 140 LEU B CA  1 
ATOM   4035 C C   . LEU B 1 140 ? 26.222  37.402 42.632 1.00 29.94 ? 140 LEU B C   1 
ATOM   4036 O O   . LEU B 1 140 ? 25.988  38.549 43.028 1.00 27.17 ? 140 LEU B O   1 
ATOM   4037 C CB  . LEU B 1 140 ? 26.762  36.178 44.730 1.00 30.01 ? 140 LEU B CB  1 
ATOM   4038 C CG  . LEU B 1 140 ? 25.552  35.245 44.688 1.00 31.94 ? 140 LEU B CG  1 
ATOM   4039 C CD1 . LEU B 1 140 ? 26.070  33.828 44.440 1.00 32.64 ? 140 LEU B CD1 1 
ATOM   4040 C CD2 . LEU B 1 140 ? 24.765  35.304 45.982 1.00 29.09 ? 140 LEU B CD2 1 
ATOM   4041 N N   . TYR B 1 141 ? 25.608  36.868 41.578 1.00 28.83 ? 141 TYR B N   1 
ATOM   4042 C CA  . TYR B 1 141 ? 24.581  37.612 40.844 1.00 27.84 ? 141 TYR B CA  1 
ATOM   4043 C C   . TYR B 1 141 ? 23.221  37.248 41.424 1.00 27.08 ? 141 TYR B C   1 
ATOM   4044 O O   . TYR B 1 141 ? 22.875  36.069 41.545 1.00 29.98 ? 141 TYR B O   1 
ATOM   4045 C CB  . TYR B 1 141 ? 24.633  37.265 39.348 1.00 29.18 ? 141 TYR B CB  1 
ATOM   4046 C CG  . TYR B 1 141 ? 23.730  38.115 38.475 1.00 30.75 ? 141 TYR B CG  1 
ATOM   4047 C CD1 . TYR B 1 141 ? 24.049  39.446 38.187 1.00 30.52 ? 141 TYR B CD1 1 
ATOM   4048 C CD2 . TYR B 1 141 ? 22.551  37.593 37.943 1.00 26.96 ? 141 TYR B CD2 1 
ATOM   4049 C CE1 . TYR B 1 141 ? 23.209  40.243 37.377 1.00 26.22 ? 141 TYR B CE1 1 
ATOM   4050 C CE2 . TYR B 1 141 ? 21.715  38.366 37.147 1.00 26.00 ? 141 TYR B CE2 1 
ATOM   4051 C CZ  . TYR B 1 141 ? 22.048  39.693 36.862 1.00 28.27 ? 141 TYR B CZ  1 
ATOM   4052 O OH  . TYR B 1 141 ? 21.228  40.456 36.043 1.00 22.65 ? 141 TYR B OH  1 
ATOM   4053 N N   . VAL B 1 142 ? 22.460  38.267 41.803 1.00 27.38 ? 142 VAL B N   1 
ATOM   4054 C CA  . VAL B 1 142 ? 21.140  38.098 42.386 1.00 25.94 ? 142 VAL B CA  1 
ATOM   4055 C C   . VAL B 1 142 ? 20.092  38.434 41.327 1.00 29.90 ? 142 VAL B C   1 
ATOM   4056 O O   . VAL B 1 142 ? 20.121  39.524 40.746 1.00 25.86 ? 142 VAL B O   1 
ATOM   4057 C CB  . VAL B 1 142 ? 20.963  39.038 43.569 1.00 25.46 ? 142 VAL B CB  1 
ATOM   4058 C CG1 . VAL B 1 142 ? 19.617  38.834 44.211 1.00 28.44 ? 142 VAL B CG1 1 
ATOM   4059 C CG2 . VAL B 1 142 ? 22.083  38.794 44.580 1.00 29.78 ? 142 VAL B CG2 1 
ATOM   4060 N N   . ARG B 1 143 ? 19.160  37.511 41.099 1.00 23.84 ? 143 ARG B N   1 
ATOM   4061 C CA  . ARG B 1 143 ? 18.135  37.712 40.079 1.00 26.60 ? 143 ARG B CA  1 
ATOM   4062 C C   . ARG B 1 143 ? 16.711  37.629 40.593 1.00 25.16 ? 143 ARG B C   1 
ATOM   4063 O O   . ARG B 1 143 ? 16.118  36.542 40.643 1.00 30.06 ? 143 ARG B O   1 
ATOM   4064 C CB  . ARG B 1 143 ? 18.348  36.714 38.925 1.00 27.18 ? 143 ARG B CB  1 
ATOM   4065 C CG  . ARG B 1 143 ? 17.188  36.607 37.894 1.00 20.70 ? 143 ARG B CG  1 
ATOM   4066 C CD  . ARG B 1 143 ? 16.841  37.947 37.246 1.00 18.37 ? 143 ARG B CD  1 
ATOM   4067 N NE  . ARG B 1 143 ? 17.931  38.549 36.475 1.00 22.99 ? 143 ARG B NE  1 
ATOM   4068 C CZ  . ARG B 1 143 ? 18.183  38.302 35.188 1.00 22.21 ? 143 ARG B CZ  1 
ATOM   4069 N NH1 . ARG B 1 143 ? 17.426  37.446 34.504 1.00 21.61 ? 143 ARG B NH1 1 
ATOM   4070 N NH2 . ARG B 1 143 ? 19.184  38.924 34.573 1.00 26.20 ? 143 ARG B NH2 1 
ATOM   4071 N N   . PRO B 1 144 ? 16.152  38.777 41.032 1.00 23.29 ? 144 PRO B N   1 
ATOM   4072 C CA  . PRO B 1 144 ? 14.779  38.858 41.541 1.00 24.27 ? 144 PRO B CA  1 
ATOM   4073 C C   . PRO B 1 144 ? 13.904  38.850 40.290 1.00 21.86 ? 144 PRO B C   1 
ATOM   4074 O O   . PRO B 1 144 ? 14.354  39.257 39.223 1.00 22.41 ? 144 PRO B O   1 
ATOM   4075 C CB  . PRO B 1 144 ? 14.728  40.228 42.232 1.00 21.77 ? 144 PRO B CB  1 
ATOM   4076 C CG  . PRO B 1 144 ? 16.155  40.551 42.511 1.00 28.33 ? 144 PRO B CG  1 
ATOM   4077 C CD  . PRO B 1 144 ? 16.857  40.044 41.280 1.00 26.92 ? 144 PRO B CD  1 
ATOM   4078 N N   . VAL B 1 145 ? 12.664  38.403 40.423 1.00 21.31 ? 145 VAL B N   1 
ATOM   4079 C CA  . VAL B 1 145 ? 11.737  38.336 39.305 1.00 23.22 ? 145 VAL B CA  1 
ATOM   4080 C C   . VAL B 1 145 ? 10.333  38.426 39.841 1.00 25.36 ? 145 VAL B C   1 
ATOM   4081 O O   . VAL B 1 145 ? 10.029  37.860 40.893 1.00 29.31 ? 145 VAL B O   1 
ATOM   4082 C CB  . VAL B 1 145 ? 11.831  36.982 38.547 1.00 23.04 ? 145 VAL B CB  1 
ATOM   4083 C CG1 . VAL B 1 145 ? 10.842  36.979 37.409 1.00 26.66 ? 145 VAL B CG1 1 
ATOM   4084 C CG2 . VAL B 1 145 ? 13.239  36.729 38.041 1.00 23.56 ? 145 VAL B CG2 1 
ATOM   4085 N N   . LEU B 1 146 ? 9.475   39.153 39.133 1.00 25.02 ? 146 LEU B N   1 
ATOM   4086 C CA  . LEU B 1 146 ? 8.076   39.263 39.521 1.00 19.27 ? 146 LEU B CA  1 
ATOM   4087 C C   . LEU B 1 146 ? 7.292   38.987 38.246 1.00 24.24 ? 146 LEU B C   1 
ATOM   4088 O O   . LEU B 1 146 ? 7.547   39.610 37.206 1.00 22.00 ? 146 LEU B O   1 
ATOM   4089 C CB  . LEU B 1 146 ? 7.758   40.672 40.041 1.00 19.53 ? 146 LEU B CB  1 
ATOM   4090 C CG  . LEU B 1 146 ? 6.331   40.992 40.505 1.00 25.25 ? 146 LEU B CG  1 
ATOM   4091 C CD1 . LEU B 1 146 ? 5.852   39.960 41.507 1.00 23.35 ? 146 LEU B CD1 1 
ATOM   4092 C CD2 . LEU B 1 146 ? 6.294   42.382 41.131 1.00 25.91 ? 146 LEU B CD2 1 
ATOM   4093 N N   . ILE B 1 147 ? 6.356   38.042 38.316 1.00 24.80 ? 147 ILE B N   1 
ATOM   4094 C CA  . ILE B 1 147 ? 5.537   37.716 37.151 1.00 26.20 ? 147 ILE B CA  1 
ATOM   4095 C C   . ILE B 1 147 ? 4.052   37.621 37.470 1.00 25.77 ? 147 ILE B C   1 
ATOM   4096 O O   . ILE B 1 147 ? 3.656   37.200 38.562 1.00 24.29 ? 147 ILE B O   1 
ATOM   4097 C CB  . ILE B 1 147 ? 5.942   36.377 36.507 1.00 19.82 ? 147 ILE B CB  1 
ATOM   4098 C CG1 . ILE B 1 147 ? 5.714   35.245 37.504 1.00 27.36 ? 147 ILE B CG1 1 
ATOM   4099 C CG2 . ILE B 1 147 ? 7.393   36.393 36.085 1.00 18.90 ? 147 ILE B CG2 1 
ATOM   4100 C CD1 . ILE B 1 147 ? 6.013   33.880 36.964 1.00 28.87 ? 147 ILE B CD1 1 
ATOM   4101 N N   . GLY B 1 148 ? 3.235   38.018 36.498 1.00 27.72 ? 148 GLY B N   1 
ATOM   4102 C CA  . GLY B 1 148 ? 1.797   37.927 36.650 1.00 26.49 ? 148 GLY B CA  1 
ATOM   4103 C C   . GLY B 1 148 ? 1.521   36.444 36.532 1.00 29.01 ? 148 GLY B C   1 
ATOM   4104 O O   . GLY B 1 148 ? 2.282   35.709 35.888 1.00 28.98 ? 148 GLY B O   1 
ATOM   4105 N N   . ASN B 1 149 ? 0.444   35.975 37.138 1.00 27.13 ? 149 ASN B N   1 
ATOM   4106 C CA  . ASN B 1 149 ? 0.202   34.545 37.100 1.00 27.79 ? 149 ASN B CA  1 
ATOM   4107 C C   . ASN B 1 149 ? -1.278  34.244 37.096 1.00 28.67 ? 149 ASN B C   1 
ATOM   4108 O O   . ASN B 1 149 ? -1.752  33.377 37.831 1.00 31.84 ? 149 ASN B O   1 
ATOM   4109 C CB  . ASN B 1 149 ? 0.885   33.895 38.304 1.00 30.72 ? 149 ASN B CB  1 
ATOM   4110 C CG  . ASN B 1 149 ? 1.066   32.400 38.138 1.00 31.90 ? 149 ASN B CG  1 
ATOM   4111 O OD1 . ASN B 1 149 ? 1.123   31.882 37.026 1.00 34.95 ? 149 ASN B OD1 1 
ATOM   4112 N ND2 . ASN B 1 149 ? 1.184   31.701 39.255 1.00 39.71 ? 149 ASN B ND2 1 
ATOM   4113 N N   . GLU B 1 150 ? -2.001  34.982 36.261 1.00 29.58 ? 150 GLU B N   1 
ATOM   4114 C CA  . GLU B 1 150 ? -3.447  34.840 36.106 1.00 36.19 ? 150 GLU B CA  1 
ATOM   4115 C C   . GLU B 1 150 ? -3.743  33.709 35.128 1.00 33.33 ? 150 GLU B C   1 
ATOM   4116 O O   . GLU B 1 150 ? -3.181  33.690 34.040 1.00 31.49 ? 150 GLU B O   1 
ATOM   4117 C CB  . GLU B 1 150 ? -4.033  36.136 35.541 1.00 40.23 ? 150 GLU B CB  1 
ATOM   4118 C CG  . GLU B 1 150 ? -5.551  36.138 35.424 1.00 45.93 ? 150 GLU B CG  1 
ATOM   4119 C CD  . GLU B 1 150 ? -6.227  36.251 36.775 1.00 45.37 ? 150 GLU B CD  1 
ATOM   4120 O OE1 . GLU B 1 150 ? -5.664  35.749 37.773 1.00 47.22 ? 150 GLU B OE1 1 
ATOM   4121 O OE2 . GLU B 1 150 ? -7.328  36.829 36.837 1.00 46.58 ? 150 GLU B OE2 1 
ATOM   4122 N N   . PRO B 1 151 ? -4.621  32.755 35.506 1.00 32.47 ? 151 PRO B N   1 
ATOM   4123 C CA  . PRO B 1 151 ? -5.016  31.602 34.673 1.00 32.43 ? 151 PRO B CA  1 
ATOM   4124 C C   . PRO B 1 151 ? -6.117  32.072 33.728 1.00 31.29 ? 151 PRO B C   1 
ATOM   4125 O O   . PRO B 1 151 ? -7.214  31.515 33.719 1.00 31.92 ? 151 PRO B O   1 
ATOM   4126 C CB  . PRO B 1 151 ? -5.577  30.598 35.688 1.00 31.60 ? 151 PRO B CB  1 
ATOM   4127 C CG  . PRO B 1 151 ? -5.072  31.087 37.022 1.00 43.17 ? 151 PRO B CG  1 
ATOM   4128 C CD  . PRO B 1 151 ? -5.125  32.585 36.878 1.00 37.02 ? 151 PRO B CD  1 
ATOM   4129 N N   . SER B 1 152 ? -5.825  33.100 32.945 1.00 31.79 ? 152 SER B N   1 
ATOM   4130 C CA  . SER B 1 152 ? -6.821  33.668 32.048 1.00 31.98 ? 152 SER B CA  1 
ATOM   4131 C C   . SER B 1 152 ? -6.193  34.318 30.818 1.00 29.51 ? 152 SER B C   1 
ATOM   4132 O O   . SER B 1 152 ? -5.180  34.988 30.923 1.00 30.77 ? 152 SER B O   1 
ATOM   4133 C CB  . SER B 1 152 ? -7.648  34.695 32.835 1.00 33.12 ? 152 SER B CB  1 
ATOM   4134 O OG  . SER B 1 152 ? -8.185  35.689 31.988 1.00 38.60 ? 152 SER B OG  1 
ATOM   4135 N N   . LEU B 1 153 ? -6.809  34.118 29.655 1.00 29.72 ? 153 LEU B N   1 
ATOM   4136 C CA  . LEU B 1 153 ? -6.309  34.683 28.411 1.00 28.94 ? 153 LEU B CA  1 
ATOM   4137 C C   . LEU B 1 153 ? -6.712  36.141 28.208 1.00 31.47 ? 153 LEU B C   1 
ATOM   4138 O O   . LEU B 1 153 ? -6.421  36.742 27.169 1.00 30.81 ? 153 LEU B O   1 
ATOM   4139 C CB  . LEU B 1 153 ? -6.802  33.854 27.231 1.00 25.01 ? 153 LEU B CB  1 
ATOM   4140 C CG  . LEU B 1 153 ? -6.377  32.395 27.292 1.00 27.88 ? 153 LEU B CG  1 
ATOM   4141 C CD1 . LEU B 1 153 ? -6.713  31.704 25.963 1.00 26.52 ? 153 LEU B CD1 1 
ATOM   4142 C CD2 . LEU B 1 153 ? -4.869  32.316 27.568 1.00 23.66 ? 153 LEU B CD2 1 
ATOM   4143 N N   . GLY B 1 154 ? -7.408  36.710 29.181 1.00 30.77 ? 154 GLY B N   1 
ATOM   4144 C CA  . GLY B 1 154 ? -7.781  38.107 29.035 1.00 33.23 ? 154 GLY B CA  1 
ATOM   4145 C C   . GLY B 1 154 ? -6.558  38.965 29.292 1.00 27.77 ? 154 GLY B C   1 
ATOM   4146 O O   . GLY B 1 154 ? -5.802  38.688 30.221 1.00 32.20 ? 154 GLY B O   1 
ATOM   4147 N N   . VAL B 1 155 ? -6.327  39.979 28.464 1.00 32.35 ? 155 VAL B N   1 
ATOM   4148 C CA  . VAL B 1 155 ? -5.185  40.872 28.679 1.00 29.83 ? 155 VAL B CA  1 
ATOM   4149 C C   . VAL B 1 155 ? -5.622  41.829 29.775 1.00 32.10 ? 155 VAL B C   1 
ATOM   4150 O O   . VAL B 1 155 ? -6.375  42.759 29.512 1.00 37.53 ? 155 VAL B O   1 
ATOM   4151 C CB  . VAL B 1 155 ? -4.861  41.666 27.405 1.00 31.79 ? 155 VAL B CB  1 
ATOM   4152 C CG1 . VAL B 1 155 ? -3.805  42.740 27.688 1.00 24.31 ? 155 VAL B CG1 1 
ATOM   4153 C CG2 . VAL B 1 155 ? -4.373  40.706 26.339 1.00 32.34 ? 155 VAL B CG2 1 
ATOM   4154 N N   . SER B 1 156 ? -5.167  41.615 31.004 1.00 29.62 ? 156 SER B N   1 
ATOM   4155 C CA  . SER B 1 156 ? -5.610  42.495 32.075 1.00 32.85 ? 156 SER B CA  1 
ATOM   4156 C C   . SER B 1 156 ? -4.767  42.380 33.329 1.00 30.73 ? 156 SER B C   1 
ATOM   4157 O O   . SER B 1 156 ? -3.888  41.537 33.409 1.00 32.39 ? 156 SER B O   1 
ATOM   4158 C CB  . SER B 1 156 ? -7.053  42.163 32.416 1.00 33.34 ? 156 SER B CB  1 
ATOM   4159 O OG  . SER B 1 156 ? -7.137  40.791 32.771 1.00 34.48 ? 156 SER B OG  1 
ATOM   4160 N N   . GLN B 1 157 ? -5.059  43.223 34.312 1.00 29.84 ? 157 GLN B N   1 
ATOM   4161 C CA  . GLN B 1 157 ? -4.321  43.213 35.572 1.00 34.02 ? 157 GLN B CA  1 
ATOM   4162 C C   . GLN B 1 157 ? -4.482  41.872 36.275 1.00 34.19 ? 157 GLN B C   1 
ATOM   4163 O O   . GLN B 1 157 ? -5.596  41.462 36.594 1.00 31.75 ? 157 GLN B O   1 
ATOM   4164 C CB  . GLN B 1 157 ? -4.811  44.329 36.495 1.00 34.20 ? 157 GLN B CB  1 
ATOM   4165 C CG  . GLN B 1 157 ? -4.039  44.384 37.803 1.00 39.37 ? 157 GLN B CG  1 
ATOM   4166 C CD  . GLN B 1 157 ? -4.350  45.619 38.626 1.00 36.21 ? 157 GLN B CD  1 
ATOM   4167 O OE1 . GLN B 1 157 ? -4.194  46.750 38.162 1.00 40.60 ? 157 GLN B OE1 1 
ATOM   4168 N NE2 . GLN B 1 157 ? -4.780  45.406 39.858 1.00 43.08 ? 157 GLN B NE2 1 
ATOM   4169 N N   . PRO B 1 158 ? -3.369  41.176 36.541 1.00 33.07 ? 158 PRO B N   1 
ATOM   4170 C CA  . PRO B 1 158 ? -3.446  39.874 37.206 1.00 34.87 ? 158 PRO B CA  1 
ATOM   4171 C C   . PRO B 1 158 ? -3.970  39.995 38.630 1.00 34.32 ? 158 PRO B C   1 
ATOM   4172 O O   . PRO B 1 158 ? -3.759  41.013 39.292 1.00 34.07 ? 158 PRO B O   1 
ATOM   4173 C CB  . PRO B 1 158 ? -2.001  39.378 37.186 1.00 33.59 ? 158 PRO B CB  1 
ATOM   4174 C CG  . PRO B 1 158 ? -1.327  40.233 36.146 1.00 36.68 ? 158 PRO B CG  1 
ATOM   4175 C CD  . PRO B 1 158 ? -1.970  41.566 36.320 1.00 33.85 ? 158 PRO B CD  1 
ATOM   4176 N N   . ARG B 1 159 ? -4.644  38.950 39.094 1.00 34.42 ? 159 ARG B N   1 
ATOM   4177 C CA  . ARG B 1 159 ? -5.181  38.939 40.442 1.00 36.81 ? 159 ARG B CA  1 
ATOM   4178 C C   . ARG B 1 159 ? -4.376  37.927 41.233 1.00 36.64 ? 159 ARG B C   1 
ATOM   4179 O O   . ARG B 1 159 ? -4.699  37.592 42.374 1.00 36.11 ? 159 ARG B O   1 
ATOM   4180 C CB  . ARG B 1 159 ? -6.671  38.576 40.422 1.00 36.38 ? 159 ARG B CB  1 
ATOM   4181 C CG  . ARG B 1 159 ? -7.500  39.588 39.650 1.00 41.61 ? 159 ARG B CG  1 
ATOM   4182 C CD  . ARG B 1 159 ? -8.993  39.528 39.959 1.00 47.71 ? 159 ARG B CD  1 
ATOM   4183 N NE  . ARG B 1 159 ? -9.558  38.200 39.760 1.00 57.74 ? 159 ARG B NE  1 
ATOM   4184 C CZ  . ARG B 1 159 ? -10.858 37.926 39.827 1.00 59.35 ? 159 ARG B CZ  1 
ATOM   4185 N NH1 . ARG B 1 159 ? -11.731 38.894 40.086 1.00 58.82 ? 159 ARG B NH1 1 
ATOM   4186 N NH2 . ARG B 1 159 ? -11.283 36.684 39.638 1.00 59.40 ? 159 ARG B NH2 1 
ATOM   4187 N N   . ARG B 1 160 ? -3.317  37.452 40.589 1.00 32.61 ? 160 ARG B N   1 
ATOM   4188 C CA  . ARG B 1 160 ? -2.392  36.494 41.164 1.00 35.56 ? 160 ARG B CA  1 
ATOM   4189 C C   . ARG B 1 160 ? -1.029  36.810 40.550 1.00 34.19 ? 160 ARG B C   1 
ATOM   4190 O O   . ARG B 1 160 ? -0.939  37.182 39.373 1.00 31.85 ? 160 ARG B O   1 
ATOM   4191 C CB  . ARG B 1 160 ? -2.826  35.069 40.806 1.00 39.08 ? 160 ARG B CB  1 
ATOM   4192 C CG  . ARG B 1 160 ? -1.949  33.964 41.360 1.00 40.77 ? 160 ARG B CG  1 
ATOM   4193 C CD  . ARG B 1 160 ? -2.444  32.600 40.870 1.00 43.12 ? 160 ARG B CD  1 
ATOM   4194 N NE  . ARG B 1 160 ? -1.673  31.496 41.437 1.00 49.27 ? 160 ARG B NE  1 
ATOM   4195 C CZ  . ARG B 1 160 ? -1.848  30.215 41.122 1.00 53.78 ? 160 ARG B CZ  1 
ATOM   4196 N NH1 . ARG B 1 160 ? -2.779  29.856 40.235 1.00 51.81 ? 160 ARG B NH1 1 
ATOM   4197 N NH2 . ARG B 1 160 ? -1.076  29.292 41.681 1.00 51.47 ? 160 ARG B NH2 1 
ATOM   4198 N N   . ALA B 1 161 ? 0.019   36.695 41.354 1.00 29.88 ? 161 ALA B N   1 
ATOM   4199 C CA  . ALA B 1 161 ? 1.367   36.971 40.892 1.00 29.90 ? 161 ALA B CA  1 
ATOM   4200 C C   . ALA B 1 161 ? 2.351   36.115 41.677 1.00 32.02 ? 161 ALA B C   1 
ATOM   4201 O O   . ALA B 1 161 ? 2.000   35.516 42.699 1.00 33.90 ? 161 ALA B O   1 
ATOM   4202 C CB  . ALA B 1 161 ? 1.697   38.466 41.059 1.00 29.56 ? 161 ALA B CB  1 
ATOM   4203 N N   . LEU B 1 162 ? 3.583   36.058 41.197 1.00 28.83 ? 162 LEU B N   1 
ATOM   4204 C CA  . LEU B 1 162 ? 4.605   35.277 41.852 1.00 30.32 ? 162 LEU B CA  1 
ATOM   4205 C C   . LEU B 1 162 ? 5.917   36.053 41.829 1.00 32.12 ? 162 LEU B C   1 
ATOM   4206 O O   . LEU B 1 162 ? 6.338   36.548 40.779 1.00 31.14 ? 162 LEU B O   1 
ATOM   4207 C CB  . LEU B 1 162 ? 4.737   33.952 41.111 1.00 35.92 ? 162 LEU B CB  1 
ATOM   4208 C CG  . LEU B 1 162 ? 5.221   32.660 41.759 1.00 45.73 ? 162 LEU B CG  1 
ATOM   4209 C CD1 . LEU B 1 162 ? 6.694   32.452 41.495 1.00 40.23 ? 162 LEU B CD1 1 
ATOM   4210 C CD2 . LEU B 1 162 ? 4.883   32.684 43.246 1.00 47.16 ? 162 LEU B CD2 1 
ATOM   4211 N N   . LEU B 1 163 ? 6.546   36.178 42.995 1.00 34.18 ? 163 LEU B N   1 
ATOM   4212 C CA  . LEU B 1 163 ? 7.823   36.876 43.128 1.00 29.27 ? 163 LEU B CA  1 
ATOM   4213 C C   . LEU B 1 163 ? 8.859   35.888 43.642 1.00 29.97 ? 163 LEU B C   1 
ATOM   4214 O O   . LEU B 1 163 ? 8.657   35.277 44.688 1.00 34.42 ? 163 LEU B O   1 
ATOM   4215 C CB  . LEU B 1 163 ? 7.714   38.053 44.119 1.00 27.05 ? 163 LEU B CB  1 
ATOM   4216 C CG  . LEU B 1 163 ? 8.955   38.981 44.200 1.00 25.42 ? 163 LEU B CG  1 
ATOM   4217 C CD1 . LEU B 1 163 ? 8.592   40.250 44.940 1.00 25.52 ? 163 LEU B CD1 1 
ATOM   4218 C CD2 . LEU B 1 163 ? 10.140  38.293 44.871 1.00 22.46 ? 163 LEU B CD2 1 
ATOM   4219 N N   . PHE B 1 164 ? 9.963   35.727 42.916 1.00 27.38 ? 164 PHE B N   1 
ATOM   4220 C CA  . PHE B 1 164 ? 11.017  34.825 43.343 1.00 30.35 ? 164 PHE B CA  1 
ATOM   4221 C C   . PHE B 1 164 ? 12.406  35.391 43.050 1.00 33.82 ? 164 PHE B C   1 
ATOM   4222 O O   . PHE B 1 164 ? 12.567  36.326 42.253 1.00 36.37 ? 164 PHE B O   1 
ATOM   4223 C CB  . PHE B 1 164 ? 10.881  33.436 42.695 1.00 28.54 ? 164 PHE B CB  1 
ATOM   4224 C CG  . PHE B 1 164 ? 10.983  33.426 41.189 1.00 26.91 ? 164 PHE B CG  1 
ATOM   4225 C CD1 . PHE B 1 164 ? 9.869   33.665 40.402 1.00 33.99 ? 164 PHE B CD1 1 
ATOM   4226 C CD2 . PHE B 1 164 ? 12.179  33.136 40.569 1.00 27.90 ? 164 PHE B CD2 1 
ATOM   4227 C CE1 . PHE B 1 164 ? 9.953   33.609 39.014 1.00 28.85 ? 164 PHE B CE1 1 
ATOM   4228 C CE2 . PHE B 1 164 ? 12.269  33.081 39.186 1.00 26.20 ? 164 PHE B CE2 1 
ATOM   4229 C CZ  . PHE B 1 164 ? 11.155  33.319 38.415 1.00 22.36 ? 164 PHE B CZ  1 
ATOM   4230 N N   . VAL B 1 165 ? 13.406  34.827 43.716 1.00 30.24 ? 165 VAL B N   1 
ATOM   4231 C CA  . VAL B 1 165 ? 14.788  35.258 43.542 1.00 23.29 ? 165 VAL B CA  1 
ATOM   4232 C C   . VAL B 1 165 ? 15.698  34.059 43.459 1.00 24.37 ? 165 VAL B C   1 
ATOM   4233 O O   . VAL B 1 165 ? 15.591  33.151 44.286 1.00 29.90 ? 165 VAL B O   1 
ATOM   4234 C CB  . VAL B 1 165 ? 15.262  36.114 44.735 1.00 23.02 ? 165 VAL B CB  1 
ATOM   4235 C CG1 . VAL B 1 165 ? 16.655  36.617 44.468 1.00 25.65 ? 165 VAL B CG1 1 
ATOM   4236 C CG2 . VAL B 1 165 ? 14.285  37.244 45.007 1.00 19.89 ? 165 VAL B CG2 1 
ATOM   4237 N N   . ILE B 1 166 ? 16.577  34.043 42.459 1.00 23.29 ? 166 ILE B N   1 
ATOM   4238 C CA  . ILE B 1 166 ? 17.538  32.964 42.296 1.00 27.73 ? 166 ILE B CA  1 
ATOM   4239 C C   . ILE B 1 166 ? 18.942  33.572 42.250 1.00 28.41 ? 166 ILE B C   1 
ATOM   4240 O O   . ILE B 1 166 ? 19.103  34.742 41.903 1.00 30.10 ? 166 ILE B O   1 
ATOM   4241 C CB  . ILE B 1 166 ? 17.271  32.111 41.018 1.00 28.19 ? 166 ILE B CB  1 
ATOM   4242 C CG1 . ILE B 1 166 ? 17.198  33.006 39.769 1.00 29.60 ? 166 ILE B CG1 1 
ATOM   4243 C CG2 . ILE B 1 166 ? 15.999  31.309 41.193 1.00 28.66 ? 166 ILE B CG2 1 
ATOM   4244 C CD1 . ILE B 1 166 ? 17.071  32.224 38.451 1.00 26.48 ? 166 ILE B CD1 1 
ATOM   4245 N N   . LEU B 1 167 ? 19.956  32.779 42.596 1.00 29.03 ? 167 LEU B N   1 
ATOM   4246 C CA  . LEU B 1 167 ? 21.344  33.254 42.662 1.00 20.54 ? 167 LEU B CA  1 
ATOM   4247 C C   . LEU B 1 167 ? 22.340  32.467 41.826 1.00 24.63 ? 167 LEU B C   1 
ATOM   4248 O O   . LEU B 1 167 ? 22.280  31.237 41.747 1.00 29.57 ? 167 LEU B O   1 
ATOM   4249 C CB  . LEU B 1 167 ? 21.815  33.221 44.120 1.00 26.42 ? 167 LEU B CB  1 
ATOM   4250 C CG  . LEU B 1 167 ? 20.839  33.771 45.163 1.00 26.85 ? 167 LEU B CG  1 
ATOM   4251 C CD1 . LEU B 1 167 ? 21.293  33.383 46.591 1.00 30.28 ? 167 LEU B CD1 1 
ATOM   4252 C CD2 . LEU B 1 167 ? 20.759  35.277 45.030 1.00 27.28 ? 167 LEU B CD2 1 
ATOM   4253 N N   . CYS B 1 168 ? 23.288  33.180 41.233 1.00 23.70 ? 168 CYS B N   1 
ATOM   4254 C CA  . CYS B 1 168 ? 24.319  32.583 40.383 1.00 29.96 ? 168 CYS B CA  1 
ATOM   4255 C C   . CYS B 1 168 ? 25.707  33.072 40.765 1.00 31.87 ? 168 CYS B C   1 
ATOM   4256 O O   . CYS B 1 168 ? 25.928  34.271 40.877 1.00 30.45 ? 168 CYS B O   1 
ATOM   4257 C CB  . CYS B 1 168 ? 24.141  32.986 38.915 1.00 29.22 ? 168 CYS B CB  1 
ATOM   4258 S SG  . CYS B 1 168 ? 22.645  32.486 38.144 1.00 39.65 ? 168 CYS B SG  1 
ATOM   4259 N N   . PRO B 1 169 ? 26.661  32.149 40.959 1.00 32.93 ? 169 PRO B N   1 
ATOM   4260 C CA  . PRO B 1 169 ? 28.004  32.610 41.301 1.00 29.04 ? 169 PRO B CA  1 
ATOM   4261 C C   . PRO B 1 169 ? 28.558  33.022 39.948 1.00 29.89 ? 169 PRO B C   1 
ATOM   4262 O O   . PRO B 1 169 ? 28.370  32.302 38.956 1.00 32.17 ? 169 PRO B O   1 
ATOM   4263 C CB  . PRO B 1 169 ? 28.692  31.343 41.816 1.00 28.31 ? 169 PRO B CB  1 
ATOM   4264 C CG  . PRO B 1 169 ? 27.559  30.496 42.287 1.00 34.62 ? 169 PRO B CG  1 
ATOM   4265 C CD  . PRO B 1 169 ? 26.525  30.705 41.222 1.00 29.69 ? 169 PRO B CD  1 
ATOM   4266 N N   . VAL B 1 170 ? 29.212  34.169 39.869 1.00 31.12 ? 170 VAL B N   1 
ATOM   4267 C CA  . VAL B 1 170 ? 29.753  34.585 38.592 1.00 34.60 ? 170 VAL B CA  1 
ATOM   4268 C C   . VAL B 1 170 ? 31.259  34.722 38.674 1.00 38.88 ? 170 VAL B C   1 
ATOM   4269 O O   . VAL B 1 170 ? 31.822  35.037 39.736 1.00 41.95 ? 170 VAL B O   1 
ATOM   4270 C CB  . VAL B 1 170 ? 29.102  35.891 38.111 1.00 36.95 ? 170 VAL B CB  1 
ATOM   4271 C CG1 . VAL B 1 170 ? 29.418  36.121 36.646 1.00 43.09 ? 170 VAL B CG1 1 
ATOM   4272 C CG2 . VAL B 1 170 ? 27.616  35.800 38.298 1.00 39.12 ? 170 VAL B CG2 1 
ATOM   4273 N N   . GLY B 1 171 ? 31.892  34.436 37.541 1.00 37.86 ? 171 GLY B N   1 
ATOM   4274 C CA  . GLY B 1 171 ? 33.334  34.455 37.434 1.00 44.29 ? 171 GLY B CA  1 
ATOM   4275 C C   . GLY B 1 171 ? 33.993  35.808 37.534 1.00 48.94 ? 171 GLY B C   1 
ATOM   4276 O O   . GLY B 1 171 ? 34.471  36.198 38.596 1.00 55.59 ? 171 GLY B O   1 
ATOM   4277 N N   . ALA B 1 172 ? 34.023  36.522 36.422 1.00 50.05 ? 172 ALA B N   1 
ATOM   4278 C CA  . ALA B 1 172 ? 34.659  37.834 36.348 1.00 49.91 ? 172 ALA B CA  1 
ATOM   4279 C C   . ALA B 1 172 ? 34.772  38.057 34.863 1.00 50.50 ? 172 ALA B C   1 
ATOM   4280 O O   . ALA B 1 172 ? 35.489  37.317 34.195 1.00 52.66 ? 172 ALA B O   1 
ATOM   4281 C CB  . ALA B 1 172 ? 36.050  37.784 36.964 1.00 45.45 ? 172 ALA B CB  1 
ATOM   4282 N N   . TYR B 1 173 ? 34.062  39.055 34.342 1.00 52.54 ? 173 TYR B N   1 
ATOM   4283 C CA  . TYR B 1 173 ? 34.089  39.332 32.909 1.00 52.05 ? 173 TYR B CA  1 
ATOM   4284 C C   . TYR B 1 173 ? 35.483  39.295 32.286 1.00 52.43 ? 173 TYR B C   1 
ATOM   4285 O O   . TYR B 1 173 ? 35.646  38.831 31.155 1.00 55.23 ? 173 TYR B O   1 
ATOM   4286 C CB  . TYR B 1 173 ? 33.415  40.679 32.605 1.00 49.99 ? 173 TYR B CB  1 
ATOM   4287 C CG  . TYR B 1 173 ? 32.073  40.524 31.925 1.00 52.54 ? 173 TYR B CG  1 
ATOM   4288 C CD1 . TYR B 1 173 ? 31.041  39.810 32.537 1.00 51.08 ? 173 TYR B CD1 1 
ATOM   4289 C CD2 . TYR B 1 173 ? 31.842  41.056 30.653 1.00 56.99 ? 173 TYR B CD2 1 
ATOM   4290 C CE1 . TYR B 1 173 ? 29.809  39.621 31.902 1.00 54.68 ? 173 TYR B CE1 1 
ATOM   4291 C CE2 . TYR B 1 173 ? 30.606  40.876 30.004 1.00 57.69 ? 173 TYR B CE2 1 
ATOM   4292 C CZ  . TYR B 1 173 ? 29.596  40.153 30.637 1.00 56.64 ? 173 TYR B CZ  1 
ATOM   4293 O OH  . TYR B 1 173 ? 28.387  39.944 30.011 1.00 57.46 ? 173 TYR B OH  1 
ATOM   4294 N N   . PHE B 1 174 ? 36.492  39.769 33.012 1.00 50.39 ? 174 PHE B N   1 
ATOM   4295 C CA  . PHE B 1 174 ? 37.849  39.769 32.473 1.00 53.84 ? 174 PHE B CA  1 
ATOM   4296 C C   . PHE B 1 174 ? 38.763  38.692 33.077 1.00 53.47 ? 174 PHE B C   1 
ATOM   4297 O O   . PHE B 1 174 ? 39.174  38.793 34.235 1.00 54.34 ? 174 PHE B O   1 
ATOM   4298 C CB  . PHE B 1 174 ? 38.444  41.171 32.626 1.00 52.34 ? 174 PHE B CB  1 
ATOM   4299 C CG  . PHE B 1 174 ? 37.686  42.222 31.852 1.00 54.64 ? 174 PHE B CG  1 
ATOM   4300 C CD1 . PHE B 1 174 ? 37.291  43.418 32.458 1.00 55.41 ? 174 PHE B CD1 1 
ATOM   4301 C CD2 . PHE B 1 174 ? 37.338  42.000 30.519 1.00 52.52 ? 174 PHE B CD2 1 
ATOM   4302 C CE1 . PHE B 1 174 ? 36.554  44.379 31.747 1.00 52.37 ? 174 PHE B CE1 1 
ATOM   4303 C CE2 . PHE B 1 174 ? 36.606  42.949 29.799 1.00 54.47 ? 174 PHE B CE2 1 
ATOM   4304 C CZ  . PHE B 1 174 ? 36.212  44.143 30.415 1.00 53.99 ? 174 PHE B CZ  1 
ATOM   4305 N N   . PRO B 1 175 ? 39.100  37.654 32.274 1.00 54.89 ? 175 PRO B N   1 
ATOM   4306 C CA  . PRO B 1 175 ? 39.944  36.482 32.572 1.00 54.63 ? 175 PRO B CA  1 
ATOM   4307 C C   . PRO B 1 175 ? 40.953  36.646 33.705 1.00 54.65 ? 175 PRO B C   1 
ATOM   4308 O O   . PRO B 1 175 ? 41.167  35.724 34.501 1.00 52.02 ? 175 PRO B O   1 
ATOM   4309 C CB  . PRO B 1 175 ? 40.616  36.203 31.232 1.00 52.30 ? 175 PRO B CB  1 
ATOM   4310 C CG  . PRO B 1 175 ? 39.495  36.468 30.281 1.00 53.34 ? 175 PRO B CG  1 
ATOM   4311 C CD  . PRO B 1 175 ? 38.892  37.764 30.814 1.00 53.31 ? 175 PRO B CD  1 
ATOM   4312 N N   . GLY B 1 176 ? 41.570  37.821 33.765 1.00 54.46 ? 176 GLY B N   1 
ATOM   4313 C CA  . GLY B 1 176 ? 42.539  38.107 34.803 1.00 57.10 ? 176 GLY B CA  1 
ATOM   4314 C C   . GLY B 1 176 ? 42.714  39.606 34.901 1.00 58.22 ? 176 GLY B C   1 
ATOM   4315 O O   . GLY B 1 176 ? 43.802  40.125 34.654 1.00 59.82 ? 176 GLY B O   1 
ATOM   4316 N N   . GLY B 1 177 ? 41.644  40.310 35.265 1.00 60.17 ? 177 GLY B N   1 
ATOM   4317 C CA  . GLY B 1 177 ? 41.723  41.757 35.352 1.00 58.26 ? 177 GLY B CA  1 
ATOM   4318 C C   . GLY B 1 177 ? 42.081  42.242 33.961 1.00 57.65 ? 177 GLY B C   1 
ATOM   4319 O O   . GLY B 1 177 ? 42.581  43.354 33.768 1.00 54.98 ? 177 GLY B O   1 
ATOM   4320 N N   . SER B 1 178 ? 41.814  41.372 32.989 1.00 57.49 ? 178 SER B N   1 
ATOM   4321 C CA  . SER B 1 178 ? 42.096  41.632 31.581 1.00 56.66 ? 178 SER B CA  1 
ATOM   4322 C C   . SER B 1 178 ? 41.732  43.040 31.143 1.00 53.74 ? 178 SER B C   1 
ATOM   4323 O O   . SER B 1 178 ? 42.600  43.847 30.815 1.00 56.22 ? 178 SER B O   1 
ATOM   4324 C CB  . SER B 1 178 ? 41.334  40.634 30.693 1.00 56.73 ? 178 SER B CB  1 
ATOM   4325 O OG  . SER B 1 178 ? 41.641  39.290 31.021 1.00 55.07 ? 178 SER B OG  1 
ATOM   4326 N N   . VAL B 1 179 ? 40.434  43.320 31.162 1.00 52.19 ? 179 VAL B N   1 
ATOM   4327 C CA  . VAL B 1 179 ? 39.871  44.593 30.720 1.00 48.02 ? 179 VAL B CA  1 
ATOM   4328 C C   . VAL B 1 179 ? 40.202  44.767 29.255 1.00 46.57 ? 179 VAL B C   1 
ATOM   4329 O O   . VAL B 1 179 ? 41.033  45.590 28.872 1.00 44.80 ? 179 VAL B O   1 
ATOM   4330 C CB  . VAL B 1 179 ? 40.395  45.803 31.490 1.00 47.56 ? 179 VAL B CB  1 
ATOM   4331 C CG1 . VAL B 1 179 ? 39.581  47.038 31.093 1.00 43.42 ? 179 VAL B CG1 1 
ATOM   4332 C CG2 . VAL B 1 179 ? 40.281  45.559 32.988 1.00 51.97 ? 179 VAL B CG2 1 
ATOM   4333 N N   . THR B 1 180 ? 39.551  43.940 28.450 1.00 43.13 ? 180 THR B N   1 
ATOM   4334 C CA  . THR B 1 180 ? 39.697  43.950 27.007 1.00 40.48 ? 180 THR B CA  1 
ATOM   4335 C C   . THR B 1 180 ? 38.462  44.676 26.436 1.00 40.37 ? 180 THR B C   1 
ATOM   4336 O O   . THR B 1 180 ? 37.354  44.540 26.948 1.00 37.64 ? 180 THR B O   1 
ATOM   4337 C CB  . THR B 1 180 ? 39.761  42.513 26.476 1.00 38.51 ? 180 THR B CB  1 
ATOM   4338 O OG1 . THR B 1 180 ? 38.467  41.918 26.549 1.00 37.83 ? 180 THR B OG1 1 
ATOM   4339 C CG2 . THR B 1 180 ? 40.713  41.682 27.324 1.00 40.20 ? 180 THR B CG2 1 
ATOM   4340 N N   . PRO B 1 181 ? 38.647  45.462 25.370 1.00 38.85 ? 181 PRO B N   1 
ATOM   4341 C CA  . PRO B 1 181 ? 37.564  46.218 24.733 1.00 38.03 ? 181 PRO B CA  1 
ATOM   4342 C C   . PRO B 1 181 ? 36.674  45.393 23.813 1.00 35.79 ? 181 PRO B C   1 
ATOM   4343 O O   . PRO B 1 181 ? 37.048  44.307 23.377 1.00 35.41 ? 181 PRO B O   1 
ATOM   4344 C CB  . PRO B 1 181 ? 38.315  47.289 23.974 1.00 36.07 ? 181 PRO B CB  1 
ATOM   4345 C CG  . PRO B 1 181 ? 39.514  46.509 23.480 1.00 39.17 ? 181 PRO B CG  1 
ATOM   4346 C CD  . PRO B 1 181 ? 39.935  45.739 24.711 1.00 37.84 ? 181 PRO B CD  1 
ATOM   4347 N N   . VAL B 1 182 ? 35.491  45.924 23.521 1.00 31.46 ? 182 VAL B N   1 
ATOM   4348 C CA  . VAL B 1 182 ? 34.543  45.245 22.653 1.00 28.18 ? 182 VAL B CA  1 
ATOM   4349 C C   . VAL B 1 182 ? 34.263  46.089 21.432 1.00 28.23 ? 182 VAL B C   1 
ATOM   4350 O O   . VAL B 1 182 ? 34.426  47.297 21.465 1.00 24.32 ? 182 VAL B O   1 
ATOM   4351 C CB  . VAL B 1 182 ? 33.189  44.991 23.365 1.00 26.61 ? 182 VAL B CB  1 
ATOM   4352 C CG1 . VAL B 1 182 ? 33.391  44.152 24.604 1.00 30.59 ? 182 VAL B CG1 1 
ATOM   4353 C CG2 . VAL B 1 182 ? 32.547  46.305 23.734 1.00 30.43 ? 182 VAL B CG2 1 
ATOM   4354 N N   . SER B 1 183 ? 33.838  45.442 20.347 1.00 26.71 ? 183 SER B N   1 
ATOM   4355 C CA  . SER B 1 183 ? 33.493  46.156 19.108 1.00 28.56 ? 183 SER B CA  1 
ATOM   4356 C C   . SER B 1 183 ? 31.974  46.165 19.040 1.00 27.74 ? 183 SER B C   1 
ATOM   4357 O O   . SER B 1 183 ? 31.333  45.223 19.509 1.00 32.65 ? 183 SER B O   1 
ATOM   4358 C CB  . SER B 1 183 ? 34.063  45.434 17.881 1.00 28.87 ? 183 SER B CB  1 
ATOM   4359 O OG  . SER B 1 183 ? 33.579  44.102 17.795 1.00 27.48 ? 183 SER B OG  1 
ATOM   4360 N N   . LEU B 1 184 ? 31.402  47.205 18.440 1.00 27.12 ? 184 LEU B N   1 
ATOM   4361 C CA  . LEU B 1 184 ? 29.957  47.356 18.369 1.00 26.19 ? 184 LEU B CA  1 
ATOM   4362 C C   . LEU B 1 184 ? 29.395  47.563 16.967 1.00 28.44 ? 184 LEU B C   1 
ATOM   4363 O O   . LEU B 1 184 ? 30.033  48.152 16.100 1.00 30.64 ? 184 LEU B O   1 
ATOM   4364 C CB  . LEU B 1 184 ? 29.541  48.559 19.213 1.00 27.33 ? 184 LEU B CB  1 
ATOM   4365 C CG  . LEU B 1 184 ? 30.072  48.654 20.643 1.00 27.16 ? 184 LEU B CG  1 
ATOM   4366 C CD1 . LEU B 1 184 ? 29.764  50.053 21.229 1.00 30.98 ? 184 LEU B CD1 1 
ATOM   4367 C CD2 . LEU B 1 184 ? 29.435  47.556 21.470 1.00 29.38 ? 184 LEU B CD2 1 
ATOM   4368 N N   . LEU B 1 185 ? 28.186  47.074 16.752 1.00 28.36 ? 185 LEU B N   1 
ATOM   4369 C CA  . LEU B 1 185 ? 27.524  47.272 15.474 1.00 28.28 ? 185 LEU B CA  1 
ATOM   4370 C C   . LEU B 1 185 ? 26.531  48.414 15.684 1.00 28.88 ? 185 LEU B C   1 
ATOM   4371 O O   . LEU B 1 185 ? 25.723  48.387 16.607 1.00 32.86 ? 185 LEU B O   1 
ATOM   4372 C CB  . LEU B 1 185 ? 26.794  46.004 15.047 1.00 27.38 ? 185 LEU B CB  1 
ATOM   4373 C CG  . LEU B 1 185 ? 25.924  46.164 13.798 1.00 29.88 ? 185 LEU B CG  1 
ATOM   4374 C CD1 . LEU B 1 185 ? 26.772  46.649 12.631 1.00 36.19 ? 185 LEU B CD1 1 
ATOM   4375 C CD2 . LEU B 1 185 ? 25.271  44.840 13.464 1.00 34.70 ? 185 LEU B CD2 1 
ATOM   4376 N N   . ALA B 1 186 ? 26.612  49.441 14.848 1.00 31.40 ? 186 ALA B N   1 
ATOM   4377 C CA  . ALA B 1 186 ? 25.707  50.580 14.958 1.00 32.52 ? 186 ALA B CA  1 
ATOM   4378 C C   . ALA B 1 186 ? 24.941  50.707 13.656 1.00 34.69 ? 186 ALA B C   1 
ATOM   4379 O O   . ALA B 1 186 ? 25.416  51.339 12.712 1.00 36.26 ? 186 ALA B O   1 
ATOM   4380 C CB  . ALA B 1 186 ? 26.481  51.852 15.223 1.00 30.78 ? 186 ALA B CB  1 
ATOM   4381 N N   . ASP B 1 187 ? 23.769  50.082 13.610 1.00 32.72 ? 187 ASP B N   1 
ATOM   4382 C CA  . ASP B 1 187 ? 22.913  50.108 12.422 1.00 34.60 ? 187 ASP B CA  1 
ATOM   4383 C C   . ASP B 1 187 ? 21.569  50.677 12.870 1.00 33.19 ? 187 ASP B C   1 
ATOM   4384 O O   . ASP B 1 187 ? 20.862  50.060 13.670 1.00 30.65 ? 187 ASP B O   1 
ATOM   4385 C CB  . ASP B 1 187 ? 22.718  48.689 11.877 1.00 37.57 ? 187 ASP B CB  1 
ATOM   4386 C CG  . ASP B 1 187 ? 21.913  48.662 10.591 1.00 38.45 ? 187 ASP B CG  1 
ATOM   4387 O OD1 . ASP B 1 187 ? 21.048  49.541 10.411 1.00 43.00 ? 187 ASP B OD1 1 
ATOM   4388 O OD2 . ASP B 1 187 ? 22.131  47.752 9.761  1.00 40.67 ? 187 ASP B OD2 1 
ATOM   4389 N N   . PRO B 1 188 ? 21.191  51.843 12.334 1.00 33.38 ? 188 PRO B N   1 
ATOM   4390 C CA  . PRO B 1 188 ? 19.942  52.546 12.648 1.00 36.14 ? 188 PRO B CA  1 
ATOM   4391 C C   . PRO B 1 188 ? 18.652  51.756 12.415 1.00 30.94 ? 188 PRO B C   1 
ATOM   4392 O O   . PRO B 1 188 ? 17.590  52.175 12.843 1.00 32.78 ? 188 PRO B O   1 
ATOM   4393 C CB  . PRO B 1 188 ? 20.001  53.791 11.757 1.00 31.82 ? 188 PRO B CB  1 
ATOM   4394 C CG  . PRO B 1 188 ? 21.430  53.863 11.305 1.00 34.57 ? 188 PRO B CG  1 
ATOM   4395 C CD  . PRO B 1 188 ? 21.833  52.448 11.160 1.00 32.91 ? 188 PRO B CD  1 
ATOM   4396 N N   . ALA B 1 189 ? 18.734  50.618 11.744 1.00 35.35 ? 189 ALA B N   1 
ATOM   4397 C CA  . ALA B 1 189 ? 17.538  49.811 11.479 1.00 32.20 ? 189 ALA B CA  1 
ATOM   4398 C C   . ALA B 1 189 ? 16.985  49.072 12.700 1.00 35.65 ? 189 ALA B C   1 
ATOM   4399 O O   . ALA B 1 189 ? 15.810  48.697 12.729 1.00 33.19 ? 189 ALA B O   1 
ATOM   4400 C CB  . ALA B 1 189 ? 17.844  48.791 10.378 1.00 32.99 ? 189 ALA B CB  1 
ATOM   4401 N N   . PHE B 1 190 ? 17.806  48.878 13.724 1.00 33.59 ? 190 PHE B N   1 
ATOM   4402 C CA  . PHE B 1 190 ? 17.363  48.092 14.867 1.00 35.58 ? 190 PHE B CA  1 
ATOM   4403 C C   . PHE B 1 190 ? 16.392  48.655 15.917 1.00 36.00 ? 190 PHE B C   1 
ATOM   4404 O O   . PHE B 1 190 ? 15.300  48.110 16.080 1.00 41.93 ? 190 PHE B O   1 
ATOM   4405 C CB  . PHE B 1 190 ? 18.613  47.459 15.466 1.00 39.62 ? 190 PHE B CB  1 
ATOM   4406 C CG  . PHE B 1 190 ? 19.384  46.653 14.449 1.00 36.97 ? 190 PHE B CG  1 
ATOM   4407 C CD1 . PHE B 1 190 ? 20.770  46.714 14.379 1.00 37.01 ? 190 PHE B CD1 1 
ATOM   4408 C CD2 . PHE B 1 190 ? 18.697  45.852 13.527 1.00 36.17 ? 190 PHE B CD2 1 
ATOM   4409 C CE1 . PHE B 1 190 ? 21.472  45.986 13.398 1.00 38.35 ? 190 PHE B CE1 1 
ATOM   4410 C CE2 . PHE B 1 190 ? 19.381  45.118 12.542 1.00 36.35 ? 190 PHE B CE2 1 
ATOM   4411 C CZ  . PHE B 1 190 ? 20.771  45.187 12.476 1.00 39.78 ? 190 PHE B CZ  1 
ATOM   4412 N N   . ILE B 1 191 ? 16.737  49.715 16.621 1.00 32.55 ? 191 ILE B N   1 
ATOM   4413 C CA  . ILE B 1 191 ? 15.782  50.286 17.606 1.00 34.26 ? 191 ILE B CA  1 
ATOM   4414 C C   . ILE B 1 191 ? 15.293  49.400 18.770 1.00 34.74 ? 191 ILE B C   1 
ATOM   4415 O O   . ILE B 1 191 ? 14.352  48.612 18.646 1.00 31.65 ? 191 ILE B O   1 
ATOM   4416 C CB  . ILE B 1 191 ? 14.524  50.863 16.908 1.00 32.79 ? 191 ILE B CB  1 
ATOM   4417 C CG1 . ILE B 1 191 ? 14.946  51.870 15.836 1.00 28.82 ? 191 ILE B CG1 1 
ATOM   4418 C CG2 . ILE B 1 191 ? 13.626  51.558 17.938 1.00 30.94 ? 191 ILE B CG2 1 
ATOM   4419 C CD1 . ILE B 1 191 ? 13.796  52.572 15.150 1.00 29.95 ? 191 ILE B CD1 1 
ATOM   4420 N N   . ARG B 1 192 ? 15.917  49.607 19.925 1.00 32.11 ? 192 ARG B N   1 
ATOM   4421 C CA  . ARG B 1 192 ? 15.617  48.869 21.138 1.00 29.59 ? 192 ARG B CA  1 
ATOM   4422 C C   . ARG B 1 192 ? 14.393  49.402 21.883 1.00 27.87 ? 192 ARG B C   1 
ATOM   4423 O O   . ARG B 1 192 ? 13.653  48.634 22.480 1.00 28.00 ? 192 ARG B O   1 
ATOM   4424 C CB  . ARG B 1 192 ? 16.852  48.933 22.050 1.00 27.49 ? 192 ARG B CB  1 
ATOM   4425 C CG  . ARG B 1 192 ? 16.814  48.108 23.328 1.00 27.99 ? 192 ARG B CG  1 
ATOM   4426 C CD  . ARG B 1 192 ? 17.976  48.513 24.232 1.00 33.15 ? 192 ARG B CD  1 
ATOM   4427 N NE  . ARG B 1 192 ? 17.543  49.130 25.489 1.00 38.04 ? 192 ARG B NE  1 
ATOM   4428 C CZ  . ARG B 1 192 ? 16.717  50.167 25.581 1.00 37.49 ? 192 ARG B CZ  1 
ATOM   4429 N NH1 . ARG B 1 192 ? 16.221  50.713 24.478 1.00 45.33 ? 192 ARG B NH1 1 
ATOM   4430 N NH2 . ARG B 1 192 ? 16.381  50.658 26.773 1.00 27.61 ? 192 ARG B NH2 1 
ATOM   4431 N N   . ALA B 1 193 ? 14.174  50.716 21.836 1.00 26.01 ? 193 ALA B N   1 
ATOM   4432 C CA  . ALA B 1 193 ? 13.072  51.330 22.572 1.00 26.38 ? 193 ALA B CA  1 
ATOM   4433 C C   . ALA B 1 193 ? 12.678  52.686 21.996 1.00 25.93 ? 193 ALA B C   1 
ATOM   4434 O O   . ALA B 1 193 ? 13.478  53.342 21.322 1.00 27.84 ? 193 ALA B O   1 
ATOM   4435 C CB  . ALA B 1 193 ? 13.473  51.484 24.054 1.00 22.85 ? 193 ALA B CB  1 
ATOM   4436 N N   . TRP B 1 194 ? 11.466  53.113 22.341 1.00 26.57 ? 194 TRP B N   1 
ATOM   4437 C CA  . TRP B 1 194 ? 10.870  54.335 21.845 1.00 25.93 ? 194 TRP B CA  1 
ATOM   4438 C C   . TRP B 1 194 ? 10.401  55.282 22.950 1.00 25.71 ? 194 TRP B C   1 
ATOM   4439 O O   . TRP B 1 194 ? 10.005  54.842 24.030 1.00 22.06 ? 194 TRP B O   1 
ATOM   4440 C CB  . TRP B 1 194 ? 9.677   53.939 20.951 1.00 28.43 ? 194 TRP B CB  1 
ATOM   4441 C CG  . TRP B 1 194 ? 9.301   54.919 19.868 1.00 36.85 ? 194 TRP B CG  1 
ATOM   4442 C CD1 . TRP B 1 194 ? 8.385   55.930 19.950 1.00 36.91 ? 194 TRP B CD1 1 
ATOM   4443 C CD2 . TRP B 1 194 ? 9.838   54.973 18.541 1.00 36.51 ? 194 TRP B CD2 1 
ATOM   4444 N NE1 . TRP B 1 194 ? 8.319   56.612 18.752 1.00 34.04 ? 194 TRP B NE1 1 
ATOM   4445 C CE2 . TRP B 1 194 ? 9.202   56.047 17.874 1.00 33.07 ? 194 TRP B CE2 1 
ATOM   4446 C CE3 . TRP B 1 194 ? 10.796  54.219 17.849 1.00 34.93 ? 194 TRP B CE3 1 
ATOM   4447 C CZ2 . TRP B 1 194 ? 9.492   56.383 16.562 1.00 30.33 ? 194 TRP B CZ2 1 
ATOM   4448 C CZ3 . TRP B 1 194 ? 11.081  54.552 16.541 1.00 35.27 ? 194 TRP B CZ3 1 
ATOM   4449 C CH2 . TRP B 1 194 ? 10.433  55.625 15.911 1.00 35.27 ? 194 TRP B CH2 1 
ATOM   4450 N N   . VAL B 1 195 ? 10.452  56.586 22.672 1.00 24.58 ? 195 VAL B N   1 
ATOM   4451 C CA  . VAL B 1 195 ? 9.965   57.578 23.632 1.00 27.89 ? 195 VAL B CA  1 
ATOM   4452 C C   . VAL B 1 195 ? 8.469   57.266 23.789 1.00 25.91 ? 195 VAL B C   1 
ATOM   4453 O O   . VAL B 1 195 ? 7.742   57.131 22.816 1.00 25.67 ? 195 VAL B O   1 
ATOM   4454 C CB  . VAL B 1 195 ? 10.178  59.011 23.095 1.00 28.68 ? 195 VAL B CB  1 
ATOM   4455 C CG1 . VAL B 1 195 ? 9.450   60.024 23.976 1.00 35.73 ? 195 VAL B CG1 1 
ATOM   4456 C CG2 . VAL B 1 195 ? 11.654  59.316 23.052 1.00 27.53 ? 195 VAL B CG2 1 
ATOM   4457 N N   . GLY B 1 196 ? 8.025   57.093 25.023 1.00 20.97 ? 196 GLY B N   1 
ATOM   4458 C CA  . GLY B 1 196 ? 6.639   56.772 25.262 1.00 25.02 ? 196 GLY B CA  1 
ATOM   4459 C C   . GLY B 1 196 ? 6.486   55.273 25.452 1.00 32.19 ? 196 GLY B C   1 
ATOM   4460 O O   . GLY B 1 196 ? 5.395   54.796 25.788 1.00 31.63 ? 196 GLY B O   1 
ATOM   4461 N N   . GLY B 1 197 ? 7.576   54.534 25.238 1.00 27.99 ? 197 GLY B N   1 
ATOM   4462 C CA  . GLY B 1 197 ? 7.549   53.082 25.379 1.00 29.58 ? 197 GLY B CA  1 
ATOM   4463 C C   . GLY B 1 197 ? 7.908   52.644 26.784 1.00 23.46 ? 197 GLY B C   1 
ATOM   4464 O O   . GLY B 1 197 ? 7.586   53.349 27.734 1.00 25.75 ? 197 GLY B O   1 
ATOM   4465 N N   . VAL B 1 198 ? 8.578   51.500 26.936 1.00 25.53 ? 198 VAL B N   1 
ATOM   4466 C CA  . VAL B 1 198 ? 8.951   51.024 28.273 1.00 24.10 ? 198 VAL B CA  1 
ATOM   4467 C C   . VAL B 1 198 ? 10.431  50.646 28.390 1.00 27.30 ? 198 VAL B C   1 
ATOM   4468 O O   . VAL B 1 198 ? 10.818  49.834 29.251 1.00 20.30 ? 198 VAL B O   1 
ATOM   4469 C CB  . VAL B 1 198 ? 8.097   49.801 28.705 1.00 23.85 ? 198 VAL B CB  1 
ATOM   4470 C CG1 . VAL B 1 198 ? 6.668   50.236 29.118 1.00 16.89 ? 198 VAL B CG1 1 
ATOM   4471 C CG2 . VAL B 1 198 ? 8.069   48.785 27.562 1.00 25.58 ? 198 VAL B CG2 1 
ATOM   4472 N N   . GLY B 1 199 ? 11.257  51.235 27.524 1.00 25.55 ? 199 GLY B N   1 
ATOM   4473 C CA  . GLY B 1 199 ? 12.679  50.951 27.552 1.00 24.60 ? 199 GLY B CA  1 
ATOM   4474 C C   . GLY B 1 199 ? 13.353  51.320 28.864 1.00 26.19 ? 199 GLY B C   1 
ATOM   4475 O O   . GLY B 1 199 ? 14.425  50.793 29.187 1.00 28.58 ? 199 GLY B O   1 
ATOM   4476 N N   . ASN B 1 200 ? 12.740  52.226 29.623 1.00 25.61 ? 200 ASN B N   1 
ATOM   4477 C CA  . ASN B 1 200 ? 13.307  52.647 30.896 1.00 24.46 ? 200 ASN B CA  1 
ATOM   4478 C C   . ASN B 1 200 ? 12.920  51.770 32.082 1.00 23.69 ? 200 ASN B C   1 
ATOM   4479 O O   . ASN B 1 200 ? 13.171  52.122 33.229 1.00 29.07 ? 200 ASN B O   1 
ATOM   4480 C CB  . ASN B 1 200 ? 12.979  54.124 31.196 1.00 27.62 ? 200 ASN B CB  1 
ATOM   4481 C CG  . ASN B 1 200 ? 11.479  54.437 31.153 1.00 33.86 ? 200 ASN B CG  1 
ATOM   4482 O OD1 . ASN B 1 200 ? 11.004  55.298 31.892 1.00 32.88 ? 200 ASN B OD1 1 
ATOM   4483 N ND2 . ASN B 1 200 ? 10.744  53.766 30.271 1.00 25.07 ? 200 ASN B ND2 1 
ATOM   4484 N N   . TYR B 1 201 ? 12.325  50.618 31.802 1.00 24.95 ? 201 TYR B N   1 
ATOM   4485 C CA  . TYR B 1 201 ? 11.932  49.670 32.840 1.00 22.36 ? 201 TYR B CA  1 
ATOM   4486 C C   . TYR B 1 201 ? 12.623  48.348 32.506 1.00 22.43 ? 201 TYR B C   1 
ATOM   4487 O O   . TYR B 1 201 ? 12.861  48.060 31.333 1.00 19.67 ? 201 TYR B O   1 
ATOM   4488 C CB  . TYR B 1 201 ? 10.404  49.474 32.843 1.00 22.59 ? 201 TYR B CB  1 
ATOM   4489 C CG  . TYR B 1 201 ? 9.609   50.734 33.117 1.00 24.59 ? 201 TYR B CG  1 
ATOM   4490 C CD1 . TYR B 1 201 ? 9.416   51.203 34.419 1.00 25.13 ? 201 TYR B CD1 1 
ATOM   4491 C CD2 . TYR B 1 201 ? 9.066   51.467 32.069 1.00 25.45 ? 201 TYR B CD2 1 
ATOM   4492 C CE1 . TYR B 1 201 ? 8.694   52.370 34.658 1.00 28.90 ? 201 TYR B CE1 1 
ATOM   4493 C CE2 . TYR B 1 201 ? 8.352   52.631 32.297 1.00 28.20 ? 201 TYR B CE2 1 
ATOM   4494 C CZ  . TYR B 1 201 ? 8.161   53.081 33.583 1.00 29.12 ? 201 TYR B CZ  1 
ATOM   4495 O OH  . TYR B 1 201 ? 7.424   54.236 33.779 1.00 25.93 ? 201 TYR B OH  1 
ATOM   4496 N N   . LYS B 1 202 ? 12.961  47.557 33.520 1.00 23.04 ? 202 LYS B N   1 
ATOM   4497 C CA  . LYS B 1 202 ? 13.611  46.272 33.255 1.00 27.36 ? 202 LYS B CA  1 
ATOM   4498 C C   . LYS B 1 202 ? 12.532  45.192 33.123 1.00 23.25 ? 202 LYS B C   1 
ATOM   4499 O O   . LYS B 1 202 ? 12.324  44.370 34.011 1.00 22.76 ? 202 LYS B O   1 
ATOM   4500 C CB  . LYS B 1 202 ? 14.637  45.910 34.358 1.00 28.05 ? 202 LYS B CB  1 
ATOM   4501 C CG  . LYS B 1 202 ? 16.022  45.508 33.788 1.00 33.27 ? 202 LYS B CG  1 
ATOM   4502 C CD  . LYS B 1 202 ? 17.121  45.299 34.853 1.00 32.38 ? 202 LYS B CD  1 
ATOM   4503 C CE  . LYS B 1 202 ? 18.497  44.914 34.217 1.00 35.31 ? 202 LYS B CE  1 
ATOM   4504 N NZ  . LYS B 1 202 ? 19.231  46.075 33.700 1.00 38.32 ? 202 LYS B NZ  1 
ATOM   4505 N N   . LEU B 1 203 ? 11.858  45.216 31.979 1.00 24.15 ? 203 LEU B N   1 
ATOM   4506 C CA  . LEU B 1 203 ? 10.787  44.273 31.667 1.00 23.30 ? 203 LEU B CA  1 
ATOM   4507 C C   . LEU B 1 203 ? 11.290  43.261 30.652 1.00 20.71 ? 203 LEU B C   1 
ATOM   4508 O O   . LEU B 1 203 ? 11.961  43.639 29.685 1.00 22.83 ? 203 LEU B O   1 
ATOM   4509 C CB  . LEU B 1 203 ? 9.595   45.033 31.080 1.00 18.76 ? 203 LEU B CB  1 
ATOM   4510 C CG  . LEU B 1 203 ? 9.160   46.319 31.790 1.00 16.23 ? 203 LEU B CG  1 
ATOM   4511 C CD1 . LEU B 1 203 ? 7.925   46.886 31.109 1.00 24.31 ? 203 LEU B CD1 1 
ATOM   4512 C CD2 . LEU B 1 203 ? 8.859   46.008 33.228 1.00 20.23 ? 203 LEU B CD2 1 
ATOM   4513 N N   . GLY B 1 204 ? 10.961  41.985 30.866 1.00 16.89 ? 204 GLY B N   1 
ATOM   4514 C CA  . GLY B 1 204 ? 11.400  40.936 29.958 1.00 16.37 ? 204 GLY B CA  1 
ATOM   4515 C C   . GLY B 1 204 ? 11.168  41.271 28.490 1.00 19.13 ? 204 GLY B C   1 
ATOM   4516 O O   . GLY B 1 204 ? 12.030  40.994 27.638 1.00 16.03 ? 204 GLY B O   1 
ATOM   4517 N N   . GLY B 1 205 ? 10.018  41.887 28.200 1.00 23.68 ? 205 GLY B N   1 
ATOM   4518 C CA  . GLY B 1 205 ? 9.673   42.254 26.825 1.00 20.91 ? 205 GLY B CA  1 
ATOM   4519 C C   . GLY B 1 205 ? 10.709  43.077 26.066 1.00 24.01 ? 205 GLY B C   1 
ATOM   4520 O O   . GLY B 1 205 ? 10.740  43.061 24.834 1.00 23.81 ? 205 GLY B O   1 
ATOM   4521 N N   . ASN B 1 206 ? 11.562  43.802 26.783 1.00 19.75 ? 206 ASN B N   1 
ATOM   4522 C CA  . ASN B 1 206 ? 12.572  44.622 26.120 1.00 24.41 ? 206 ASN B CA  1 
ATOM   4523 C C   . ASN B 1 206 ? 13.738  43.833 25.571 1.00 18.20 ? 206 ASN B C   1 
ATOM   4524 O O   . ASN B 1 206 ? 14.444  44.315 24.690 1.00 20.50 ? 206 ASN B O   1 
ATOM   4525 C CB  . ASN B 1 206 ? 13.135  45.663 27.083 1.00 23.44 ? 206 ASN B CB  1 
ATOM   4526 C CG  . ASN B 1 206 ? 12.101  46.662 27.527 1.00 21.22 ? 206 ASN B CG  1 
ATOM   4527 O OD1 . ASN B 1 206 ? 12.172  47.191 28.640 1.00 25.04 ? 206 ASN B OD1 1 
ATOM   4528 N ND2 . ASN B 1 206 ? 11.151  46.950 26.659 1.00 15.08 ? 206 ASN B ND2 1 
ATOM   4529 N N   . TYR B 1 207 ? 13.928  42.617 26.081 1.00 21.17 ? 207 TYR B N   1 
ATOM   4530 C CA  . TYR B 1 207 ? 15.062  41.792 25.691 1.00 24.73 ? 207 TYR B CA  1 
ATOM   4531 C C   . TYR B 1 207 ? 14.869  40.741 24.615 1.00 23.58 ? 207 TYR B C   1 
ATOM   4532 O O   . TYR B 1 207 ? 15.762  40.551 23.794 1.00 24.47 ? 207 TYR B O   1 
ATOM   4533 C CB  . TYR B 1 207 ? 15.670  41.144 26.932 1.00 21.71 ? 207 TYR B CB  1 
ATOM   4534 C CG  . TYR B 1 207 ? 16.001  42.190 27.948 1.00 23.42 ? 207 TYR B CG  1 
ATOM   4535 C CD1 . TYR B 1 207 ? 15.010  42.696 28.784 1.00 28.48 ? 207 TYR B CD1 1 
ATOM   4536 C CD2 . TYR B 1 207 ? 17.247  42.817 27.946 1.00 19.22 ? 207 TYR B CD2 1 
ATOM   4537 C CE1 . TYR B 1 207 ? 15.238  43.822 29.582 1.00 20.62 ? 207 TYR B CE1 1 
ATOM   4538 C CE2 . TYR B 1 207 ? 17.477  43.937 28.735 1.00 26.39 ? 207 TYR B CE2 1 
ATOM   4539 C CZ  . TYR B 1 207 ? 16.457  44.430 29.536 1.00 24.73 ? 207 TYR B CZ  1 
ATOM   4540 O OH  . TYR B 1 207 ? 16.610  45.600 30.233 1.00 27.88 ? 207 TYR B OH  1 
ATOM   4541 N N   . GLY B 1 208 ? 13.728  40.059 24.632 1.00 20.52 ? 208 GLY B N   1 
ATOM   4542 C CA  . GLY B 1 208 ? 13.461  39.051 23.620 1.00 19.85 ? 208 GLY B CA  1 
ATOM   4543 C C   . GLY B 1 208 ? 13.789  39.507 22.206 1.00 20.48 ? 208 GLY B C   1 
ATOM   4544 O O   . GLY B 1 208 ? 14.499  38.810 21.500 1.00 22.88 ? 208 GLY B O   1 
ATOM   4545 N N   . PRO B 1 209 ? 13.301  40.675 21.765 1.00 21.47 ? 209 PRO B N   1 
ATOM   4546 C CA  . PRO B 1 209 ? 13.591  41.151 20.406 1.00 25.25 ? 209 PRO B CA  1 
ATOM   4547 C C   . PRO B 1 209 ? 15.068  41.423 20.085 1.00 21.99 ? 209 PRO B C   1 
ATOM   4548 O O   . PRO B 1 209 ? 15.429  41.583 18.929 1.00 16.37 ? 209 PRO B O   1 
ATOM   4549 C CB  . PRO B 1 209 ? 12.744  42.427 20.296 1.00 20.15 ? 209 PRO B CB  1 
ATOM   4550 C CG  . PRO B 1 209 ? 11.563  42.130 21.234 1.00 22.98 ? 209 PRO B CG  1 
ATOM   4551 C CD  . PRO B 1 209 ? 12.304  41.545 22.425 1.00 26.03 ? 209 PRO B CD  1 
ATOM   4552 N N   . THR B 1 210 ? 15.936  41.475 21.095 1.00 23.96 ? 210 THR B N   1 
ATOM   4553 C CA  . THR B 1 210 ? 17.334  41.779 20.819 1.00 22.57 ? 210 THR B CA  1 
ATOM   4554 C C   . THR B 1 210 ? 18.167  40.540 20.475 1.00 21.89 ? 210 THR B C   1 
ATOM   4555 O O   . THR B 1 210 ? 19.291  40.666 19.969 1.00 22.60 ? 210 THR B O   1 
ATOM   4556 C CB  . THR B 1 210 ? 18.037  42.494 22.018 1.00 20.56 ? 210 THR B CB  1 
ATOM   4557 O OG1 . THR B 1 210 ? 18.275  41.536 23.056 1.00 22.57 ? 210 THR B OG1 1 
ATOM   4558 C CG2 . THR B 1 210 ? 17.184  43.648 22.567 1.00 17.18 ? 210 THR B CG2 1 
ATOM   4559 N N   . VAL B 1 211 ? 17.640  39.351 20.733 1.00 19.83 ? 211 VAL B N   1 
ATOM   4560 C CA  . VAL B 1 211 ? 18.411  38.142 20.429 1.00 21.51 ? 211 VAL B CA  1 
ATOM   4561 C C   . VAL B 1 211 ? 18.822  38.109 18.958 1.00 21.09 ? 211 VAL B C   1 
ATOM   4562 O O   . VAL B 1 211 ? 20.001  37.947 18.644 1.00 20.61 ? 211 VAL B O   1 
ATOM   4563 C CB  . VAL B 1 211 ? 17.627  36.853 20.760 1.00 23.05 ? 211 VAL B CB  1 
ATOM   4564 C CG1 . VAL B 1 211 ? 18.501  35.638 20.489 1.00 22.59 ? 211 VAL B CG1 1 
ATOM   4565 C CG2 . VAL B 1 211 ? 17.168  36.874 22.218 1.00 24.13 ? 211 VAL B CG2 1 
ATOM   4566 N N   . LEU B 1 212 ? 17.858  38.273 18.062 1.00 20.31 ? 212 LEU B N   1 
ATOM   4567 C CA  . LEU B 1 212 ? 18.149  38.267 16.621 1.00 24.36 ? 212 LEU B CA  1 
ATOM   4568 C C   . LEU B 1 212 ? 19.130  39.370 16.231 1.00 25.02 ? 212 LEU B C   1 
ATOM   4569 O O   . LEU B 1 212 ? 20.020  39.172 15.389 1.00 26.54 ? 212 LEU B O   1 
ATOM   4570 C CB  . LEU B 1 212 ? 16.858  38.447 15.808 1.00 21.98 ? 212 LEU B CB  1 
ATOM   4571 C CG  . LEU B 1 212 ? 17.040  38.437 14.283 1.00 25.91 ? 212 LEU B CG  1 
ATOM   4572 C CD1 . LEU B 1 212 ? 17.456  37.047 13.848 1.00 26.35 ? 212 LEU B CD1 1 
ATOM   4573 C CD2 . LEU B 1 212 ? 15.751  38.826 13.588 1.00 18.61 ? 212 LEU B CD2 1 
ATOM   4574 N N   . VAL B 1 213 ? 18.978  40.541 16.839 1.00 22.15 ? 213 VAL B N   1 
ATOM   4575 C CA  . VAL B 1 213 ? 19.860  41.645 16.509 1.00 24.13 ? 213 VAL B CA  1 
ATOM   4576 C C   . VAL B 1 213 ? 21.289  41.340 16.949 1.00 22.83 ? 213 VAL B C   1 
ATOM   4577 O O   . VAL B 1 213 ? 22.234  41.599 16.222 1.00 27.19 ? 213 VAL B O   1 
ATOM   4578 C CB  . VAL B 1 213 ? 19.351  42.967 17.149 1.00 21.23 ? 213 VAL B CB  1 
ATOM   4579 C CG1 . VAL B 1 213 ? 20.293  44.136 16.806 1.00 20.58 ? 213 VAL B CG1 1 
ATOM   4580 C CG2 . VAL B 1 213 ? 17.964  43.257 16.642 1.00 19.72 ? 213 VAL B CG2 1 
ATOM   4581 N N   . GLN B 1 214 ? 21.443  40.774 18.132 1.00 26.40 ? 214 GLN B N   1 
ATOM   4582 C CA  . GLN B 1 214 ? 22.767  40.440 18.627 1.00 25.44 ? 214 GLN B CA  1 
ATOM   4583 C C   . GLN B 1 214 ? 23.420  39.443 17.680 1.00 28.35 ? 214 GLN B C   1 
ATOM   4584 O O   . GLN B 1 214 ? 24.602  39.559 17.399 1.00 27.59 ? 214 GLN B O   1 
ATOM   4585 C CB  . GLN B 1 214 ? 22.658  39.867 20.043 1.00 27.31 ? 214 GLN B CB  1 
ATOM   4586 C CG  . GLN B 1 214 ? 23.925  39.217 20.591 1.00 34.51 ? 214 GLN B CG  1 
ATOM   4587 C CD  . GLN B 1 214 ? 25.152  40.105 20.523 1.00 37.84 ? 214 GLN B CD  1 
ATOM   4588 O OE1 . GLN B 1 214 ? 25.078  41.315 20.743 1.00 43.25 ? 214 GLN B OE1 1 
ATOM   4589 N NE2 . GLN B 1 214 ? 26.298  39.501 20.229 1.00 44.54 ? 214 GLN B NE2 1 
ATOM   4590 N N   . GLN B 1 215 ? 22.657  38.473 17.175 1.00 30.34 ? 215 GLN B N   1 
ATOM   4591 C CA  . GLN B 1 215 ? 23.215  37.483 16.250 1.00 31.12 ? 215 GLN B CA  1 
ATOM   4592 C C   . GLN B 1 215 ? 23.744  38.153 14.981 1.00 31.97 ? 215 GLN B C   1 
ATOM   4593 O O   . GLN B 1 215 ? 24.758  37.739 14.411 1.00 31.97 ? 215 GLN B O   1 
ATOM   4594 C CB  . GLN B 1 215 ? 22.162  36.443 15.871 1.00 31.06 ? 215 GLN B CB  1 
ATOM   4595 C CG  . GLN B 1 215 ? 21.837  35.444 16.950 1.00 28.03 ? 215 GLN B CG  1 
ATOM   4596 C CD  . GLN B 1 215 ? 20.847  34.393 16.479 1.00 36.05 ? 215 GLN B CD  1 
ATOM   4597 O OE1 . GLN B 1 215 ? 20.550  33.436 17.202 1.00 35.77 ? 215 GLN B OE1 1 
ATOM   4598 N NE2 . GLN B 1 215 ? 20.327  34.568 15.266 1.00 27.38 ? 215 GLN B NE2 1 
ATOM   4599 N N   . GLU B 1 216 ? 23.053  39.192 14.541 1.00 30.26 ? 216 GLU B N   1 
ATOM   4600 C CA  . GLU B 1 216 ? 23.461  39.929 13.355 1.00 32.52 ? 216 GLU B CA  1 
ATOM   4601 C C   . GLU B 1 216 ? 24.765  40.665 13.636 1.00 32.32 ? 216 GLU B C   1 
ATOM   4602 O O   . GLU B 1 216 ? 25.580  40.864 12.742 1.00 33.13 ? 216 GLU B O   1 
ATOM   4603 C CB  . GLU B 1 216 ? 22.367  40.925 12.963 1.00 34.58 ? 216 GLU B CB  1 
ATOM   4604 C CG  . GLU B 1 216 ? 22.656  41.764 11.728 1.00 42.91 ? 216 GLU B CG  1 
ATOM   4605 C CD  . GLU B 1 216 ? 22.674  40.944 10.441 1.00 51.02 ? 216 GLU B CD  1 
ATOM   4606 O OE1 . GLU B 1 216 ? 21.774  40.086 10.272 1.00 51.16 ? 216 GLU B OE1 1 
ATOM   4607 O OE2 . GLU B 1 216 ? 23.575  41.168 9.594  1.00 49.55 ? 216 GLU B OE2 1 
ATOM   4608 N N   . ALA B 1 217 ? 24.969  41.075 14.880 1.00 31.16 ? 217 ALA B N   1 
ATOM   4609 C CA  . ALA B 1 217 ? 26.199  41.777 15.220 1.00 31.42 ? 217 ALA B CA  1 
ATOM   4610 C C   . ALA B 1 217 ? 27.353  40.784 15.113 1.00 29.20 ? 217 ALA B C   1 
ATOM   4611 O O   . ALA B 1 217 ? 28.416  41.111 14.590 1.00 33.42 ? 217 ALA B O   1 
ATOM   4612 C CB  . ALA B 1 217 ? 26.118  42.360 16.636 1.00 31.12 ? 217 ALA B CB  1 
ATOM   4613 N N   . LEU B 1 218 ? 27.149  39.566 15.593 1.00 31.84 ? 218 LEU B N   1 
ATOM   4614 C CA  . LEU B 1 218 ? 28.220  38.578 15.508 1.00 34.51 ? 218 LEU B CA  1 
ATOM   4615 C C   . LEU B 1 218 ? 28.524  38.310 14.039 1.00 34.98 ? 218 LEU B C   1 
ATOM   4616 O O   . LEU B 1 218 ? 29.672  38.359 13.612 1.00 36.29 ? 218 LEU B O   1 
ATOM   4617 C CB  . LEU B 1 218 ? 27.826  37.279 16.218 1.00 35.00 ? 218 LEU B CB  1 
ATOM   4618 C CG  . LEU B 1 218 ? 27.722  37.374 17.745 1.00 34.26 ? 218 LEU B CG  1 
ATOM   4619 C CD1 . LEU B 1 218 ? 27.256  36.043 18.323 1.00 37.01 ? 218 LEU B CD1 1 
ATOM   4620 C CD2 . LEU B 1 218 ? 29.068  37.744 18.320 1.00 35.19 ? 218 LEU B CD2 1 
ATOM   4621 N N   . LYS B 1 219 ? 27.487  38.070 13.248 1.00 40.63 ? 219 LYS B N   1 
ATOM   4622 C CA  . LYS B 1 219 ? 27.707  37.806 11.833 1.00 40.06 ? 219 LYS B CA  1 
ATOM   4623 C C   . LYS B 1 219 ? 28.397  38.956 11.110 1.00 39.50 ? 219 LYS B C   1 
ATOM   4624 O O   . LYS B 1 219 ? 29.112  38.739 10.128 1.00 34.76 ? 219 LYS B O   1 
ATOM   4625 C CB  . LYS B 1 219 ? 26.387  37.446 11.155 1.00 45.56 ? 219 LYS B CB  1 
ATOM   4626 C CG  . LYS B 1 219 ? 26.111  35.960 11.276 1.00 53.30 ? 219 LYS B CG  1 
ATOM   4627 C CD  . LYS B 1 219 ? 24.675  35.654 11.602 1.00 57.38 ? 219 LYS B CD  1 
ATOM   4628 C CE  . LYS B 1 219 ? 24.614  34.621 12.726 1.00 57.84 ? 219 LYS B CE  1 
ATOM   4629 N NZ  . LYS B 1 219 ? 25.269  35.145 13.962 1.00 49.28 ? 219 LYS B NZ  1 
ATOM   4630 N N   . ARG B 1 220 ? 28.216  40.178 11.599 1.00 34.97 ? 220 ARG B N   1 
ATOM   4631 C CA  . ARG B 1 220 ? 28.869  41.309 10.956 1.00 31.38 ? 220 ARG B CA  1 
ATOM   4632 C C   . ARG B 1 220 ? 30.270  41.536 11.534 1.00 30.67 ? 220 ARG B C   1 
ATOM   4633 O O   . ARG B 1 220 ? 30.976  42.460 11.139 1.00 35.28 ? 220 ARG B O   1 
ATOM   4634 C CB  . ARG B 1 220 ? 28.007  42.564 11.088 1.00 30.83 ? 220 ARG B CB  1 
ATOM   4635 C CG  . ARG B 1 220 ? 26.725  42.511 10.253 1.00 35.50 ? 220 ARG B CG  1 
ATOM   4636 C CD  . ARG B 1 220 ? 26.562  43.814 9.465  1.00 43.75 ? 220 ARG B CD  1 
ATOM   4637 N NE  . ARG B 1 220 ? 27.745  44.077 8.642  1.00 48.06 ? 220 ARG B NE  1 
ATOM   4638 C CZ  . ARG B 1 220 ? 28.036  45.251 8.084  1.00 52.95 ? 220 ARG B CZ  1 
ATOM   4639 N NH1 . ARG B 1 220 ? 27.232  46.296 8.256  1.00 50.78 ? 220 ARG B NH1 1 
ATOM   4640 N NH2 . ARG B 1 220 ? 29.142  45.381 7.356  1.00 52.34 ? 220 ARG B NH2 1 
ATOM   4641 N N   . GLY B 1 221 ? 30.670  40.686 12.470 1.00 33.96 ? 221 GLY B N   1 
ATOM   4642 C CA  . GLY B 1 221 ? 31.999  40.798 13.050 1.00 33.66 ? 221 GLY B CA  1 
ATOM   4643 C C   . GLY B 1 221 ? 32.121  41.609 14.320 1.00 34.73 ? 221 GLY B C   1 
ATOM   4644 O O   . GLY B 1 221 ? 33.228  41.912 14.754 1.00 33.71 ? 221 GLY B O   1 
ATOM   4645 N N   . CYS B 1 222 ? 30.992  41.957 14.924 1.00 33.95 ? 222 CYS B N   1 
ATOM   4646 C CA  . CYS B 1 222 ? 31.002  42.747 16.147 1.00 33.38 ? 222 CYS B CA  1 
ATOM   4647 C C   . CYS B 1 222 ? 30.593  41.898 17.318 1.00 32.30 ? 222 CYS B C   1 
ATOM   4648 O O   . CYS B 1 222 ? 29.967  40.851 17.143 1.00 36.97 ? 222 CYS B O   1 
ATOM   4649 C CB  . CYS B 1 222 ? 30.044  43.926 16.022 1.00 29.57 ? 222 CYS B CB  1 
ATOM   4650 S SG  . CYS B 1 222 ? 30.548  45.072 14.783 1.00 34.18 ? 222 CYS B SG  1 
ATOM   4651 N N   . GLU B 1 223 ? 30.920  42.366 18.517 1.00 29.95 ? 223 GLU B N   1 
ATOM   4652 C CA  . GLU B 1 223 ? 30.610  41.628 19.726 1.00 31.64 ? 223 GLU B CA  1 
ATOM   4653 C C   . GLU B 1 223 ? 29.315  42.055 20.392 1.00 30.79 ? 223 GLU B C   1 
ATOM   4654 O O   . GLU B 1 223 ? 28.660  41.247 21.052 1.00 34.23 ? 223 GLU B O   1 
ATOM   4655 C CB  . GLU B 1 223 ? 31.783  41.762 20.689 1.00 34.89 ? 223 GLU B CB  1 
ATOM   4656 C CG  . GLU B 1 223 ? 33.089  41.364 20.014 1.00 41.00 ? 223 GLU B CG  1 
ATOM   4657 C CD  . GLU B 1 223 ? 34.313  41.670 20.837 1.00 43.82 ? 223 GLU B CD  1 
ATOM   4658 O OE1 . GLU B 1 223 ? 34.623  40.885 21.763 1.00 50.81 ? 223 GLU B OE1 1 
ATOM   4659 O OE2 . GLU B 1 223 ? 34.966  42.697 20.556 1.00 43.73 ? 223 GLU B OE2 1 
ATOM   4660 N N   . GLN B 1 224 ? 28.955  43.327 20.248 1.00 32.51 ? 224 GLN B N   1 
ATOM   4661 C CA  . GLN B 1 224 ? 27.718  43.832 20.844 1.00 30.40 ? 224 GLN B CA  1 
ATOM   4662 C C   . GLN B 1 224 ? 27.041  44.842 19.947 1.00 28.25 ? 224 GLN B C   1 
ATOM   4663 O O   . GLN B 1 224 ? 27.606  45.280 18.948 1.00 28.61 ? 224 GLN B O   1 
ATOM   4664 C CB  . GLN B 1 224 ? 27.990  44.456 22.212 1.00 26.93 ? 224 GLN B CB  1 
ATOM   4665 C CG  . GLN B 1 224 ? 28.745  43.532 23.107 1.00 31.62 ? 224 GLN B CG  1 
ATOM   4666 C CD  . GLN B 1 224 ? 28.460  43.779 24.557 1.00 39.12 ? 224 GLN B CD  1 
ATOM   4667 O OE1 . GLN B 1 224 ? 29.200  43.321 25.427 1.00 38.13 ? 224 GLN B OE1 1 
ATOM   4668 N NE2 . GLN B 1 224 ? 27.373  44.496 24.836 1.00 34.25 ? 224 GLN B NE2 1 
ATOM   4669 N N   . VAL B 1 225 ? 25.818  45.204 20.317 1.00 26.68 ? 225 VAL B N   1 
ATOM   4670 C CA  . VAL B 1 225 ? 25.021  46.139 19.560 1.00 23.68 ? 225 VAL B CA  1 
ATOM   4671 C C   . VAL B 1 225 ? 25.030  47.537 20.170 1.00 25.26 ? 225 VAL B C   1 
ATOM   4672 O O   . VAL B 1 225 ? 24.842  47.683 21.380 1.00 34.39 ? 225 VAL B O   1 
ATOM   4673 C CB  . VAL B 1 225 ? 23.558  45.651 19.506 1.00 21.96 ? 225 VAL B CB  1 
ATOM   4674 C CG1 . VAL B 1 225 ? 22.681  46.678 18.846 1.00 18.84 ? 225 VAL B CG1 1 
ATOM   4675 C CG2 . VAL B 1 225 ? 23.485  44.324 18.772 1.00 23.89 ? 225 VAL B CG2 1 
ATOM   4676 N N   . LEU B 1 226 ? 25.267  48.560 19.350 1.00 26.00 ? 226 LEU B N   1 
ATOM   4677 C CA  . LEU B 1 226 ? 25.207  49.951 19.837 1.00 26.24 ? 226 LEU B CA  1 
ATOM   4678 C C   . LEU B 1 226 ? 23.835  50.374 19.379 1.00 26.04 ? 226 LEU B C   1 
ATOM   4679 O O   . LEU B 1 226 ? 23.613  50.519 18.183 1.00 22.08 ? 226 LEU B O   1 
ATOM   4680 C CB  . LEU B 1 226 ? 26.248  50.847 19.172 1.00 26.34 ? 226 LEU B CB  1 
ATOM   4681 C CG  . LEU B 1 226 ? 26.125  52.363 19.435 1.00 26.49 ? 226 LEU B CG  1 
ATOM   4682 C CD1 . LEU B 1 226 ? 26.063  52.659 20.929 1.00 25.55 ? 226 LEU B CD1 1 
ATOM   4683 C CD2 . LEU B 1 226 ? 27.306  53.093 18.811 1.00 25.67 ? 226 LEU B CD2 1 
ATOM   4684 N N   . TRP B 1 227 ? 22.908  50.552 20.320 1.00 24.89 ? 227 TRP B N   1 
ATOM   4685 C CA  . TRP B 1 227 ? 21.547  50.929 19.969 1.00 24.12 ? 227 TRP B CA  1 
ATOM   4686 C C   . TRP B 1 227 ? 21.402  52.399 19.595 1.00 24.58 ? 227 TRP B C   1 
ATOM   4687 O O   . TRP B 1 227 ? 21.689  53.276 20.403 1.00 27.25 ? 227 TRP B O   1 
ATOM   4688 C CB  . TRP B 1 227 ? 20.602  50.588 21.115 1.00 23.16 ? 227 TRP B CB  1 
ATOM   4689 C CG  . TRP B 1 227 ? 20.607  49.130 21.434 1.00 22.39 ? 227 TRP B CG  1 
ATOM   4690 C CD1 . TRP B 1 227 ? 21.300  48.509 22.441 1.00 23.41 ? 227 TRP B CD1 1 
ATOM   4691 C CD2 . TRP B 1 227 ? 19.911  48.106 20.734 1.00 22.33 ? 227 TRP B CD2 1 
ATOM   4692 N NE1 . TRP B 1 227 ? 21.071  47.164 22.411 1.00 21.35 ? 227 TRP B NE1 1 
ATOM   4693 C CE2 . TRP B 1 227 ? 20.216  46.887 21.370 1.00 27.46 ? 227 TRP B CE2 1 
ATOM   4694 C CE3 . TRP B 1 227 ? 19.050  48.098 19.621 1.00 18.40 ? 227 TRP B CE3 1 
ATOM   4695 C CZ2 . TRP B 1 227 ? 19.692  45.668 20.935 1.00 23.34 ? 227 TRP B CZ2 1 
ATOM   4696 C CZ3 . TRP B 1 227 ? 18.531  46.887 19.192 1.00 27.20 ? 227 TRP B CZ3 1 
ATOM   4697 C CH2 . TRP B 1 227 ? 18.852  45.690 19.848 1.00 27.16 ? 227 TRP B CH2 1 
ATOM   4698 N N   . LEU B 1 228 ? 20.984  52.653 18.357 1.00 23.93 ? 228 LEU B N   1 
ATOM   4699 C CA  . LEU B 1 228 ? 20.779  54.010 17.863 1.00 25.10 ? 228 LEU B CA  1 
ATOM   4700 C C   . LEU B 1 228 ? 19.281  54.345 17.856 1.00 26.24 ? 228 LEU B C   1 
ATOM   4701 O O   . LEU B 1 228 ? 18.436  53.475 17.668 1.00 29.27 ? 228 LEU B O   1 
ATOM   4702 C CB  . LEU B 1 228 ? 21.335  54.150 16.438 1.00 25.53 ? 228 LEU B CB  1 
ATOM   4703 C CG  . LEU B 1 228 ? 22.825  53.855 16.212 1.00 25.35 ? 228 LEU B CG  1 
ATOM   4704 C CD1 . LEU B 1 228 ? 23.127  53.865 14.721 1.00 26.29 ? 228 LEU B CD1 1 
ATOM   4705 C CD2 . LEU B 1 228 ? 23.681  54.882 16.934 1.00 27.02 ? 228 LEU B CD2 1 
ATOM   4706 N N   . TYR B 1 229 ? 18.965  55.620 18.044 1.00 27.16 ? 229 TYR B N   1 
ATOM   4707 C CA  . TYR B 1 229 ? 17.586  56.065 18.075 1.00 28.35 ? 229 TYR B CA  1 
ATOM   4708 C C   . TYR B 1 229 ? 17.421  57.435 17.433 1.00 32.09 ? 229 TYR B C   1 
ATOM   4709 O O   . TYR B 1 229 ? 18.300  58.288 17.544 1.00 26.70 ? 229 TYR B O   1 
ATOM   4710 C CB  . TYR B 1 229 ? 17.108  56.180 19.522 1.00 28.85 ? 229 TYR B CB  1 
ATOM   4711 C CG  . TYR B 1 229 ? 15.676  56.626 19.645 1.00 27.70 ? 229 TYR B CG  1 
ATOM   4712 C CD1 . TYR B 1 229 ? 14.633  55.722 19.451 1.00 27.15 ? 229 TYR B CD1 1 
ATOM   4713 C CD2 . TYR B 1 229 ? 15.358  57.941 19.985 1.00 24.54 ? 229 TYR B CD2 1 
ATOM   4714 C CE1 . TYR B 1 229 ? 13.305  56.104 19.598 1.00 27.33 ? 229 TYR B CE1 1 
ATOM   4715 C CE2 . TYR B 1 229 ? 14.019  58.339 20.140 1.00 27.28 ? 229 TYR B CE2 1 
ATOM   4716 C CZ  . TYR B 1 229 ? 13.004  57.406 19.947 1.00 26.80 ? 229 TYR B CZ  1 
ATOM   4717 O OH  . TYR B 1 229 ? 11.684  57.742 20.140 1.00 27.35 ? 229 TYR B OH  1 
ATOM   4718 N N   . GLY B 1 230 ? 16.277  57.648 16.794 1.00 34.09 ? 230 GLY B N   1 
ATOM   4719 C CA  . GLY B 1 230 ? 15.996  58.932 16.193 1.00 35.45 ? 230 GLY B CA  1 
ATOM   4720 C C   . GLY B 1 230 ? 16.600  59.192 14.830 1.00 36.62 ? 230 GLY B C   1 
ATOM   4721 O O   . GLY B 1 230 ? 17.435  58.424 14.339 1.00 35.43 ? 230 GLY B O   1 
ATOM   4722 N N   . PRO B 1 231 ? 16.182  60.296 14.190 1.00 37.43 ? 231 PRO B N   1 
ATOM   4723 C CA  . PRO B 1 231 ? 16.661  60.696 12.864 1.00 38.87 ? 231 PRO B CA  1 
ATOM   4724 C C   . PRO B 1 231 ? 18.113  61.107 12.957 1.00 34.75 ? 231 PRO B C   1 
ATOM   4725 O O   . PRO B 1 231 ? 18.884  60.927 12.023 1.00 34.80 ? 231 PRO B O   1 
ATOM   4726 C CB  . PRO B 1 231 ? 15.763  61.879 12.508 1.00 36.77 ? 231 PRO B CB  1 
ATOM   4727 C CG  . PRO B 1 231 ? 14.541  61.663 13.348 1.00 40.61 ? 231 PRO B CG  1 
ATOM   4728 C CD  . PRO B 1 231 ? 15.125  61.209 14.650 1.00 36.01 ? 231 PRO B CD  1 
ATOM   4729 N N   . ASP B 1 232 ? 18.478  61.670 14.104 1.00 35.95 ? 232 ASP B N   1 
ATOM   4730 C CA  . ASP B 1 232 ? 19.842  62.108 14.324 1.00 35.91 ? 232 ASP B CA  1 
ATOM   4731 C C   . ASP B 1 232 ? 20.755  60.984 14.838 1.00 33.03 ? 232 ASP B C   1 
ATOM   4732 O O   . ASP B 1 232 ? 21.885  61.233 15.239 1.00 32.13 ? 232 ASP B O   1 
ATOM   4733 C CB  . ASP B 1 232 ? 19.846  63.312 15.278 1.00 34.79 ? 232 ASP B CB  1 
ATOM   4734 C CG  . ASP B 1 232 ? 19.145  63.026 16.595 1.00 44.05 ? 232 ASP B CG  1 
ATOM   4735 O OD1 . ASP B 1 232 ? 18.180  62.229 16.612 1.00 43.51 ? 232 ASP B OD1 1 
ATOM   4736 O OD2 . ASP B 1 232 ? 19.557  63.619 17.622 1.00 49.67 ? 232 ASP B OD2 1 
ATOM   4737 N N   . HIS B 1 233 ? 20.263  59.748 14.821 1.00 34.03 ? 233 HIS B N   1 
ATOM   4738 C CA  . HIS B 1 233 ? 21.052  58.599 15.253 1.00 32.03 ? 233 HIS B CA  1 
ATOM   4739 C C   . HIS B 1 233 ? 21.764  58.781 16.573 1.00 29.63 ? 233 HIS B C   1 
ATOM   4740 O O   . HIS B 1 233 ? 22.985  58.677 16.638 1.00 29.77 ? 233 HIS B O   1 
ATOM   4741 C CB  . HIS B 1 233 ? 22.093  58.261 14.183 1.00 34.02 ? 233 HIS B CB  1 
ATOM   4742 C CG  . HIS B 1 233 ? 21.498  57.808 12.885 1.00 38.01 ? 233 HIS B CG  1 
ATOM   4743 N ND1 . HIS B 1 233 ? 22.263  57.540 11.770 1.00 41.00 ? 233 HIS B ND1 1 
ATOM   4744 C CD2 . HIS B 1 233 ? 20.217  57.547 12.534 1.00 39.65 ? 233 HIS B CD2 1 
ATOM   4745 C CE1 . HIS B 1 233 ? 21.477  57.134 10.788 1.00 44.37 ? 233 HIS B CE1 1 
ATOM   4746 N NE2 . HIS B 1 233 ? 20.231  57.129 11.227 1.00 41.57 ? 233 HIS B NE2 1 
ATOM   4747 N N   . GLN B 1 234 ? 21.031  59.064 17.639 1.00 31.52 ? 234 GLN B N   1 
ATOM   4748 C CA  . GLN B 1 234 ? 21.717  59.228 18.907 1.00 29.44 ? 234 GLN B CA  1 
ATOM   4749 C C   . GLN B 1 234 ? 22.087  57.875 19.508 1.00 27.22 ? 234 GLN B C   1 
ATOM   4750 O O   . GLN B 1 234 ? 21.434  56.868 19.245 1.00 28.63 ? 234 GLN B O   1 
ATOM   4751 C CB  . GLN B 1 234 ? 20.870  60.057 19.869 1.00 33.96 ? 234 GLN B CB  1 
ATOM   4752 C CG  . GLN B 1 234 ? 19.480  59.576 20.090 1.00 38.42 ? 234 GLN B CG  1 
ATOM   4753 C CD  . GLN B 1 234 ? 18.568  60.700 20.535 1.00 37.22 ? 234 GLN B CD  1 
ATOM   4754 O OE1 . GLN B 1 234 ? 18.075  61.467 19.716 1.00 35.99 ? 234 GLN B OE1 1 
ATOM   4755 N NE2 . GLN B 1 234 ? 18.355  60.809 21.837 1.00 39.31 ? 234 GLN B NE2 1 
ATOM   4756 N N   . LEU B 1 235 ? 23.174  57.859 20.271 1.00 25.76 ? 235 LEU B N   1 
ATOM   4757 C CA  . LEU B 1 235 ? 23.657  56.654 20.918 1.00 25.76 ? 235 LEU B CA  1 
ATOM   4758 C C   . LEU B 1 235 ? 22.907  56.529 22.234 1.00 28.19 ? 235 LEU B C   1 
ATOM   4759 O O   . LEU B 1 235 ? 23.001  57.404 23.093 1.00 32.19 ? 235 LEU B O   1 
ATOM   4760 C CB  . LEU B 1 235 ? 25.158  56.753 21.179 1.00 28.50 ? 235 LEU B CB  1 
ATOM   4761 C CG  . LEU B 1 235 ? 26.109  56.712 19.976 1.00 23.72 ? 235 LEU B CG  1 
ATOM   4762 C CD1 . LEU B 1 235 ? 25.937  57.931 19.102 1.00 23.93 ? 235 LEU B CD1 1 
ATOM   4763 C CD2 . LEU B 1 235 ? 27.531  56.655 20.489 1.00 26.44 ? 235 LEU B CD2 1 
ATOM   4764 N N   . THR B 1 236 ? 22.154  55.450 22.394 1.00 27.77 ? 236 THR B N   1 
ATOM   4765 C CA  . THR B 1 236 ? 21.379  55.278 23.610 1.00 25.63 ? 236 THR B CA  1 
ATOM   4766 C C   . THR B 1 236 ? 22.040  54.325 24.594 1.00 25.93 ? 236 THR B C   1 
ATOM   4767 O O   . THR B 1 236 ? 22.322  54.708 25.727 1.00 27.65 ? 236 THR B O   1 
ATOM   4768 C CB  . THR B 1 236 ? 19.953  54.789 23.286 1.00 24.75 ? 236 THR B CB  1 
ATOM   4769 O OG1 . THR B 1 236 ? 20.022  53.485 22.701 1.00 23.97 ? 236 THR B OG1 1 
ATOM   4770 C CG2 . THR B 1 236 ? 19.259  55.749 22.305 1.00 23.12 ? 236 THR B CG2 1 
ATOM   4771 N N   . GLU B 1 237 ? 22.299  53.095 24.159 1.00 28.73 ? 237 GLU B N   1 
ATOM   4772 C CA  . GLU B 1 237 ? 22.906  52.081 25.009 1.00 29.06 ? 237 GLU B CA  1 
ATOM   4773 C C   . GLU B 1 237 ? 23.733  51.052 24.228 1.00 26.96 ? 237 GLU B C   1 
ATOM   4774 O O   . GLU B 1 237 ? 23.627  50.964 23.020 1.00 28.76 ? 237 GLU B O   1 
ATOM   4775 C CB  . GLU B 1 237 ? 21.810  51.346 25.771 1.00 34.90 ? 237 GLU B CB  1 
ATOM   4776 C CG  . GLU B 1 237 ? 20.956  52.220 26.633 1.00 36.26 ? 237 GLU B CG  1 
ATOM   4777 C CD  . GLU B 1 237 ? 20.264  51.414 27.668 1.00 33.96 ? 237 GLU B CD  1 
ATOM   4778 O OE1 . GLU B 1 237 ? 20.820  50.359 27.984 1.00 43.69 ? 237 GLU B OE1 1 
ATOM   4779 O OE2 . GLU B 1 237 ? 19.204  51.812 28.165 1.00 35.26 ? 237 GLU B OE2 1 
ATOM   4780 N N   . VAL B 1 238 ? 24.553  50.274 24.930 1.00 26.74 ? 238 VAL B N   1 
ATOM   4781 C CA  . VAL B 1 238 ? 25.387  49.259 24.302 1.00 26.61 ? 238 VAL B CA  1 
ATOM   4782 C C   . VAL B 1 238 ? 25.016  47.908 24.872 1.00 27.18 ? 238 VAL B C   1 
ATOM   4783 O O   . VAL B 1 238 ? 25.247  47.634 26.055 1.00 26.54 ? 238 VAL B O   1 
ATOM   4784 C CB  . VAL B 1 238 ? 26.903  49.497 24.546 1.00 23.20 ? 238 VAL B CB  1 
ATOM   4785 C CG1 . VAL B 1 238 ? 27.311  50.838 24.016 1.00 22.58 ? 238 VAL B CG1 1 
ATOM   4786 C CG2 . VAL B 1 238 ? 27.222  49.430 26.024 1.00 32.74 ? 238 VAL B CG2 1 
ATOM   4787 N N   . GLY B 1 239 ? 24.443  47.059 24.026 1.00 28.96 ? 239 GLY B N   1 
ATOM   4788 C CA  . GLY B 1 239 ? 24.017  45.746 24.477 1.00 25.53 ? 239 GLY B CA  1 
ATOM   4789 C C   . GLY B 1 239 ? 23.024  45.998 25.587 1.00 28.51 ? 239 GLY B C   1 
ATOM   4790 O O   . GLY B 1 239 ? 21.962  46.580 25.352 1.00 30.12 ? 239 GLY B O   1 
ATOM   4791 N N   . THR B 1 240 ? 23.369  45.577 26.800 1.00 27.61 ? 240 THR B N   1 
ATOM   4792 C CA  . THR B 1 240 ? 22.513  45.793 27.953 1.00 26.15 ? 240 THR B CA  1 
ATOM   4793 C C   . THR B 1 240 ? 23.307  46.631 28.971 1.00 29.55 ? 240 THR B C   1 
ATOM   4794 O O   . THR B 1 240 ? 23.300  46.358 30.167 1.00 27.79 ? 240 THR B O   1 
ATOM   4795 C CB  . THR B 1 240 ? 22.068  44.451 28.601 1.00 28.80 ? 240 THR B CB  1 
ATOM   4796 O OG1 . THR B 1 240 ? 23.220  43.684 28.974 1.00 27.52 ? 240 THR B OG1 1 
ATOM   4797 C CG2 . THR B 1 240 ? 21.197  43.655 27.636 1.00 27.34 ? 240 THR B CG2 1 
ATOM   4798 N N   . MET B 1 241 ? 24.008  47.647 28.477 1.00 25.93 ? 241 MET B N   1 
ATOM   4799 C CA  . MET B 1 241 ? 24.791  48.532 29.337 1.00 24.23 ? 241 MET B CA  1 
ATOM   4800 C C   . MET B 1 241 ? 24.549  49.968 28.923 1.00 25.31 ? 241 MET B C   1 
ATOM   4801 O O   . MET B 1 241 ? 24.242  50.258 27.760 1.00 24.67 ? 241 MET B O   1 
ATOM   4802 C CB  . MET B 1 241 ? 26.310  48.288 29.196 1.00 25.55 ? 241 MET B CB  1 
ATOM   4803 C CG  . MET B 1 241 ? 26.788  46.887 29.445 1.00 21.03 ? 241 MET B CG  1 
ATOM   4804 S SD  . MET B 1 241 ? 28.542  46.723 29.041 1.00 29.21 ? 241 MET B SD  1 
ATOM   4805 C CE  . MET B 1 241 ? 28.427  46.381 27.260 1.00 25.76 ? 241 MET B CE  1 
ATOM   4806 N N   . ASN B 1 242 ? 24.683  50.882 29.870 1.00 20.93 ? 242 ASN B N   1 
ATOM   4807 C CA  . ASN B 1 242 ? 24.541  52.281 29.521 1.00 19.20 ? 242 ASN B CA  1 
ATOM   4808 C C   . ASN B 1 242 ? 25.863  52.668 28.857 1.00 21.27 ? 242 ASN B C   1 
ATOM   4809 O O   . ASN B 1 242 ? 26.861  51.963 29.017 1.00 22.21 ? 242 ASN B O   1 
ATOM   4810 C CB  . ASN B 1 242 ? 24.276  53.089 30.780 1.00 20.38 ? 242 ASN B CB  1 
ATOM   4811 C CG  . ASN B 1 242 ? 22.901  52.805 31.343 1.00 19.23 ? 242 ASN B CG  1 
ATOM   4812 O OD1 . ASN B 1 242 ? 21.881  53.087 30.696 1.00 24.17 ? 242 ASN B OD1 1 
ATOM   4813 N ND2 . ASN B 1 242 ? 22.858  52.224 32.522 1.00 14.16 ? 242 ASN B ND2 1 
ATOM   4814 N N   . ILE B 1 243 ? 25.874  53.770 28.112 1.00 23.55 ? 243 ILE B N   1 
ATOM   4815 C CA  . ILE B 1 243 ? 27.077  54.192 27.418 1.00 20.75 ? 243 ILE B CA  1 
ATOM   4816 C C   . ILE B 1 243 ? 27.600  55.555 27.907 1.00 24.01 ? 243 ILE B C   1 
ATOM   4817 O O   . ILE B 1 243 ? 26.834  56.476 28.216 1.00 22.42 ? 243 ILE B O   1 
ATOM   4818 C CB  . ILE B 1 243 ? 26.810  54.228 25.879 1.00 20.08 ? 243 ILE B CB  1 
ATOM   4819 C CG1 . ILE B 1 243 ? 28.122  54.429 25.116 1.00 24.07 ? 243 ILE B CG1 1 
ATOM   4820 C CG2 . ILE B 1 243 ? 25.801  55.321 25.543 1.00 23.12 ? 243 ILE B CG2 1 
ATOM   4821 C CD1 . ILE B 1 243 ? 27.962  54.407 23.627 1.00 25.51 ? 243 ILE B CD1 1 
ATOM   4822 N N   . PHE B 1 244 ? 28.918  55.658 27.997 1.00 21.57 ? 244 PHE B N   1 
ATOM   4823 C CA  . PHE B 1 244 ? 29.576  56.887 28.419 1.00 23.40 ? 244 PHE B CA  1 
ATOM   4824 C C   . PHE B 1 244 ? 30.633  57.269 27.372 1.00 22.83 ? 244 PHE B C   1 
ATOM   4825 O O   . PHE B 1 244 ? 31.228  56.405 26.731 1.00 22.42 ? 244 PHE B O   1 
ATOM   4826 C CB  . PHE B 1 244 ? 30.281  56.692 29.768 1.00 18.84 ? 244 PHE B CB  1 
ATOM   4827 C CG  . PHE B 1 244 ? 29.353  56.676 30.952 1.00 25.19 ? 244 PHE B CG  1 
ATOM   4828 C CD1 . PHE B 1 244 ? 28.611  55.543 31.259 1.00 27.09 ? 244 PHE B CD1 1 
ATOM   4829 C CD2 . PHE B 1 244 ? 29.253  57.793 31.782 1.00 21.11 ? 244 PHE B CD2 1 
ATOM   4830 C CE1 . PHE B 1 244 ? 27.776  55.514 32.390 1.00 29.71 ? 244 PHE B CE1 1 
ATOM   4831 C CE2 . PHE B 1 244 ? 28.430  57.783 32.906 1.00 27.33 ? 244 PHE B CE2 1 
ATOM   4832 C CZ  . PHE B 1 244 ? 27.687  56.642 33.218 1.00 28.92 ? 244 PHE B CZ  1 
ATOM   4833 N N   . VAL B 1 245 ? 30.851  58.569 27.209 1.00 25.70 ? 245 VAL B N   1 
ATOM   4834 C CA  . VAL B 1 245 ? 31.865  59.074 26.290 1.00 26.14 ? 245 VAL B CA  1 
ATOM   4835 C C   . VAL B 1 245 ? 32.682  60.106 27.073 1.00 28.78 ? 245 VAL B C   1 
ATOM   4836 O O   . VAL B 1 245 ? 32.124  61.000 27.707 1.00 29.66 ? 245 VAL B O   1 
ATOM   4837 C CB  . VAL B 1 245 ? 31.239  59.753 25.053 1.00 25.16 ? 245 VAL B CB  1 
ATOM   4838 C CG1 . VAL B 1 245 ? 32.333  60.414 24.220 1.00 28.24 ? 245 VAL B CG1 1 
ATOM   4839 C CG2 . VAL B 1 245 ? 30.492  58.725 24.207 1.00 19.31 ? 245 VAL B CG2 1 
ATOM   4840 N N   . TYR B 1 246 ? 34.002  59.962 27.053 1.00 28.43 ? 246 TYR B N   1 
ATOM   4841 C CA  . TYR B 1 246 ? 34.896  60.882 27.756 1.00 27.31 ? 246 TYR B CA  1 
ATOM   4842 C C   . TYR B 1 246 ? 35.650  61.573 26.641 1.00 30.74 ? 246 TYR B C   1 
ATOM   4843 O O   . TYR B 1 246 ? 36.366  60.928 25.883 1.00 29.37 ? 246 TYR B O   1 
ATOM   4844 C CB  . TYR B 1 246 ? 35.847  60.082 28.647 1.00 29.22 ? 246 TYR B CB  1 
ATOM   4845 C CG  . TYR B 1 246 ? 36.800  60.864 29.530 1.00 32.07 ? 246 TYR B CG  1 
ATOM   4846 C CD1 . TYR B 1 246 ? 36.361  61.929 30.322 1.00 33.37 ? 246 TYR B CD1 1 
ATOM   4847 C CD2 . TYR B 1 246 ? 38.139  60.478 29.632 1.00 33.57 ? 246 TYR B CD2 1 
ATOM   4848 C CE1 . TYR B 1 246 ? 37.244  62.587 31.204 1.00 32.70 ? 246 TYR B CE1 1 
ATOM   4849 C CE2 . TYR B 1 246 ? 39.016  61.121 30.497 1.00 33.06 ? 246 TYR B CE2 1 
ATOM   4850 C CZ  . TYR B 1 246 ? 38.563  62.168 31.277 1.00 31.69 ? 246 TYR B CZ  1 
ATOM   4851 O OH  . TYR B 1 246 ? 39.446  62.778 32.130 1.00 34.73 ? 246 TYR B OH  1 
ATOM   4852 N N   . TRP B 1 247 ? 35.486  62.884 26.537 1.00 29.26 ? 247 TRP B N   1 
ATOM   4853 C CA  . TRP B 1 247 ? 36.116  63.619 25.457 1.00 30.80 ? 247 TRP B CA  1 
ATOM   4854 C C   . TRP B 1 247 ? 36.236  65.101 25.730 1.00 34.88 ? 247 TRP B C   1 
ATOM   4855 O O   . TRP B 1 247 ? 35.841  65.582 26.796 1.00 36.33 ? 247 TRP B O   1 
ATOM   4856 C CB  . TRP B 1 247 ? 35.282  63.441 24.197 1.00 25.82 ? 247 TRP B CB  1 
ATOM   4857 C CG  . TRP B 1 247 ? 33.838  63.902 24.332 1.00 30.16 ? 247 TRP B CG  1 
ATOM   4858 C CD1 . TRP B 1 247 ? 33.257  64.518 25.408 1.00 29.21 ? 247 TRP B CD1 1 
ATOM   4859 C CD2 . TRP B 1 247 ? 32.810  63.786 23.342 1.00 28.80 ? 247 TRP B CD2 1 
ATOM   4860 N NE1 . TRP B 1 247 ? 31.931  64.795 25.145 1.00 24.91 ? 247 TRP B NE1 1 
ATOM   4861 C CE2 . TRP B 1 247 ? 31.632  64.357 23.885 1.00 27.39 ? 247 TRP B CE2 1 
ATOM   4862 C CE3 . TRP B 1 247 ? 32.770  63.257 22.045 1.00 29.77 ? 247 TRP B CE3 1 
ATOM   4863 C CZ2 . TRP B 1 247 ? 30.431  64.414 23.177 1.00 31.36 ? 247 TRP B CZ2 1 
ATOM   4864 C CZ3 . TRP B 1 247 ? 31.574  63.314 21.336 1.00 27.74 ? 247 TRP B CZ3 1 
ATOM   4865 C CH2 . TRP B 1 247 ? 30.421  63.889 21.906 1.00 30.49 ? 247 TRP B CH2 1 
ATOM   4866 N N   . THR B 1 248 ? 36.792  65.809 24.747 1.00 37.04 ? 248 THR B N   1 
ATOM   4867 C CA  . THR B 1 248 ? 36.930  67.259 24.786 1.00 37.54 ? 248 THR B CA  1 
ATOM   4868 C C   . THR B 1 248 ? 35.740  67.684 23.950 1.00 37.42 ? 248 THR B C   1 
ATOM   4869 O O   . THR B 1 248 ? 35.738  67.498 22.734 1.00 39.25 ? 248 THR B O   1 
ATOM   4870 C CB  . THR B 1 248 ? 38.236  67.734 24.104 1.00 38.87 ? 248 THR B CB  1 
ATOM   4871 O OG1 . THR B 1 248 ? 39.314  67.665 25.043 1.00 39.53 ? 248 THR B OG1 1 
ATOM   4872 C CG2 . THR B 1 248 ? 38.100  69.169 23.606 1.00 42.37 ? 248 THR B CG2 1 
ATOM   4873 N N   . HIS B 1 249 ? 34.720  68.227 24.607 1.00 39.80 ? 249 HIS B N   1 
ATOM   4874 C CA  . HIS B 1 249 ? 33.508  68.634 23.925 1.00 37.91 ? 249 HIS B CA  1 
ATOM   4875 C C   . HIS B 1 249 ? 33.797  69.735 22.928 1.00 41.23 ? 249 HIS B C   1 
ATOM   4876 O O   . HIS B 1 249 ? 34.906  70.282 22.901 1.00 39.33 ? 249 HIS B O   1 
ATOM   4877 C CB  . HIS B 1 249 ? 32.449  69.076 24.944 1.00 37.17 ? 249 HIS B CB  1 
ATOM   4878 C CG  . HIS B 1 249 ? 31.069  69.159 24.375 1.00 35.24 ? 249 HIS B CG  1 
ATOM   4879 N ND1 . HIS B 1 249 ? 30.747  68.652 23.135 1.00 40.60 ? 249 HIS B ND1 1 
ATOM   4880 C CD2 . HIS B 1 249 ? 29.931  69.706 24.866 1.00 37.89 ? 249 HIS B CD2 1 
ATOM   4881 C CE1 . HIS B 1 249 ? 29.470  68.887 22.883 1.00 40.76 ? 249 HIS B CE1 1 
ATOM   4882 N NE2 . HIS B 1 249 ? 28.952  69.525 23.917 1.00 36.97 ? 249 HIS B NE2 1 
ATOM   4883 N N   . GLU B 1 250 ? 32.803  70.042 22.098 1.00 40.61 ? 250 GLU B N   1 
ATOM   4884 C CA  . GLU B 1 250 ? 32.926  71.061 21.053 1.00 42.69 ? 250 GLU B CA  1 
ATOM   4885 C C   . GLU B 1 250 ? 33.192  72.467 21.563 1.00 43.58 ? 250 GLU B C   1 
ATOM   4886 O O   . GLU B 1 250 ? 33.655  73.319 20.808 1.00 45.81 ? 250 GLU B O   1 
ATOM   4887 C CB  . GLU B 1 250 ? 31.669  71.072 20.199 1.00 39.03 ? 250 GLU B CB  1 
ATOM   4888 C CG  . GLU B 1 250 ? 31.275  69.700 19.776 1.00 45.22 ? 250 GLU B CG  1 
ATOM   4889 C CD  . GLU B 1 250 ? 30.163  69.708 18.790 1.00 48.03 ? 250 GLU B CD  1 
ATOM   4890 O OE1 . GLU B 1 250 ? 29.229  70.524 18.972 1.00 50.56 ? 250 GLU B OE1 1 
ATOM   4891 O OE2 . GLU B 1 250 ? 30.226  68.892 17.844 1.00 49.49 ? 250 GLU B OE2 1 
ATOM   4892 N N   . ASP B 1 251 ? 32.910  72.706 22.840 1.00 42.71 ? 251 ASP B N   1 
ATOM   4893 C CA  . ASP B 1 251 ? 33.130  74.019 23.424 1.00 43.32 ? 251 ASP B CA  1 
ATOM   4894 C C   . ASP B 1 251 ? 34.534  74.119 24.026 1.00 45.12 ? 251 ASP B C   1 
ATOM   4895 O O   . ASP B 1 251 ? 34.860  75.102 24.689 1.00 47.06 ? 251 ASP B O   1 
ATOM   4896 C CB  . ASP B 1 251 ? 32.071  74.302 24.494 1.00 43.65 ? 251 ASP B CB  1 
ATOM   4897 C CG  . ASP B 1 251 ? 32.330  73.556 25.785 1.00 40.24 ? 251 ASP B CG  1 
ATOM   4898 O OD1 . ASP B 1 251 ? 32.790  72.399 25.729 1.00 40.10 ? 251 ASP B OD1 1 
ATOM   4899 O OD2 . ASP B 1 251 ? 32.058  74.126 26.860 1.00 37.97 ? 251 ASP B OD2 1 
ATOM   4900 N N   . GLY B 1 252 ? 35.357  73.096 23.799 1.00 46.51 ? 252 GLY B N   1 
ATOM   4901 C CA  . GLY B 1 252 ? 36.718  73.097 24.318 1.00 41.87 ? 252 GLY B CA  1 
ATOM   4902 C C   . GLY B 1 252 ? 36.919  72.528 25.716 1.00 40.38 ? 252 GLY B C   1 
ATOM   4903 O O   . GLY B 1 252 ? 38.052  72.332 26.148 1.00 37.96 ? 252 GLY B O   1 
ATOM   4904 N N   . VAL B 1 253 ? 35.837  72.259 26.434 1.00 42.52 ? 253 VAL B N   1 
ATOM   4905 C CA  . VAL B 1 253 ? 35.949  71.715 27.790 1.00 40.16 ? 253 VAL B CA  1 
ATOM   4906 C C   . VAL B 1 253 ? 35.955  70.181 27.826 1.00 38.18 ? 253 VAL B C   1 
ATOM   4907 O O   . VAL B 1 253 ? 35.208  69.533 27.094 1.00 37.71 ? 253 VAL B O   1 
ATOM   4908 C CB  . VAL B 1 253 ? 34.792  72.227 28.670 1.00 41.58 ? 253 VAL B CB  1 
ATOM   4909 C CG1 . VAL B 1 253 ? 34.803  71.518 30.021 1.00 38.77 ? 253 VAL B CG1 1 
ATOM   4910 C CG2 . VAL B 1 253 ? 34.900  73.756 28.840 1.00 41.19 ? 253 VAL B CG2 1 
ATOM   4911 N N   . LEU B 1 254 ? 36.806  69.610 28.678 1.00 36.86 ? 254 LEU B N   1 
ATOM   4912 C CA  . LEU B 1 254 ? 36.903  68.152 28.840 1.00 34.29 ? 254 LEU B CA  1 
ATOM   4913 C C   . LEU B 1 254 ? 35.679  67.661 29.641 1.00 33.63 ? 254 LEU B C   1 
ATOM   4914 O O   . LEU B 1 254 ? 35.355  68.222 30.678 1.00 32.82 ? 254 LEU B O   1 
ATOM   4915 C CB  . LEU B 1 254 ? 38.188  67.788 29.600 1.00 35.22 ? 254 LEU B CB  1 
ATOM   4916 C CG  . LEU B 1 254 ? 38.395  66.313 30.001 1.00 34.37 ? 254 LEU B CG  1 
ATOM   4917 C CD1 . LEU B 1 254 ? 38.764  65.484 28.787 1.00 33.36 ? 254 LEU B CD1 1 
ATOM   4918 C CD2 . LEU B 1 254 ? 39.497  66.205 31.050 1.00 36.75 ? 254 LEU B CD2 1 
ATOM   4919 N N   . GLU B 1 255 ? 34.996  66.620 29.174 1.00 32.07 ? 255 GLU B N   1 
ATOM   4920 C CA  . GLU B 1 255 ? 33.821  66.140 29.911 1.00 30.02 ? 255 GLU B CA  1 
ATOM   4921 C C   . GLU B 1 255 ? 33.532  64.659 29.783 1.00 27.44 ? 255 GLU B C   1 
ATOM   4922 O O   . GLU B 1 255 ? 34.054  63.986 28.895 1.00 28.95 ? 255 GLU B O   1 
ATOM   4923 C CB  . GLU B 1 255 ? 32.561  66.887 29.465 1.00 29.26 ? 255 GLU B CB  1 
ATOM   4924 C CG  . GLU B 1 255 ? 32.219  66.689 27.988 1.00 32.75 ? 255 GLU B CG  1 
ATOM   4925 C CD  . GLU B 1 255 ? 30.843  67.215 27.639 1.00 33.21 ? 255 GLU B CD  1 
ATOM   4926 O OE1 . GLU B 1 255 ? 30.401  68.181 28.288 1.00 36.08 ? 255 GLU B OE1 1 
ATOM   4927 O OE2 . GLU B 1 255 ? 30.207  66.676 26.711 1.00 34.55 ? 255 GLU B OE2 1 
ATOM   4928 N N   . LEU B 1 256 ? 32.685  64.176 30.690 1.00 26.82 ? 256 LEU B N   1 
ATOM   4929 C CA  . LEU B 1 256 ? 32.221  62.798 30.698 1.00 30.87 ? 256 LEU B CA  1 
ATOM   4930 C C   . LEU B 1 256 ? 30.718  62.918 30.499 1.00 29.68 ? 256 LEU B C   1 
ATOM   4931 O O   . LEU B 1 256 ? 30.015  63.386 31.390 1.00 34.30 ? 256 LEU B O   1 
ATOM   4932 C CB  . LEU B 1 256 ? 32.491  62.122 32.041 1.00 32.28 ? 256 LEU B CB  1 
ATOM   4933 C CG  . LEU B 1 256 ? 31.855  60.730 32.186 1.00 33.65 ? 256 LEU B CG  1 
ATOM   4934 C CD1 . LEU B 1 256 ? 32.457  59.760 31.159 1.00 31.26 ? 256 LEU B CD1 1 
ATOM   4935 C CD2 . LEU B 1 256 ? 32.084  60.216 33.582 1.00 29.73 ? 256 LEU B CD2 1 
ATOM   4936 N N   . VAL B 1 257 ? 30.232  62.521 29.327 1.00 28.06 ? 257 VAL B N   1 
ATOM   4937 C CA  . VAL B 1 257 ? 28.811  62.603 29.016 1.00 23.44 ? 257 VAL B CA  1 
ATOM   4938 C C   . VAL B 1 257 ? 28.199  61.221 28.813 1.00 26.05 ? 257 VAL B C   1 
ATOM   4939 O O   . VAL B 1 257 ? 28.886  60.292 28.399 1.00 29.60 ? 257 VAL B O   1 
ATOM   4940 C CB  . VAL B 1 257 ? 28.561  63.463 27.738 1.00 24.60 ? 257 VAL B CB  1 
ATOM   4941 C CG1 . VAL B 1 257 ? 29.282  62.882 26.547 1.00 22.84 ? 257 VAL B CG1 1 
ATOM   4942 C CG2 . VAL B 1 257 ? 27.093  63.550 27.456 1.00 18.23 ? 257 VAL B CG2 1 
ATOM   4943 N N   . THR B 1 258 ? 26.909  61.107 29.127 1.00 25.34 ? 258 THR B N   1 
ATOM   4944 C CA  . THR B 1 258 ? 26.145  59.882 28.965 1.00 23.42 ? 258 THR B CA  1 
ATOM   4945 C C   . THR B 1 258 ? 24.737  60.379 28.610 1.00 25.71 ? 258 THR B C   1 
ATOM   4946 O O   . THR B 1 258 ? 24.327  61.459 29.026 1.00 25.59 ? 258 THR B O   1 
ATOM   4947 C CB  . THR B 1 258 ? 26.130  59.066 30.285 1.00 23.86 ? 258 THR B CB  1 
ATOM   4948 O OG1 . THR B 1 258 ? 25.564  57.767 30.055 1.00 30.84 ? 258 THR B OG1 1 
ATOM   4949 C CG2 . THR B 1 258 ? 25.315  59.795 31.347 1.00 29.42 ? 258 THR B CG2 1 
ATOM   4950 N N   . PRO B 1 259 ? 23.973  59.606 27.829 1.00 26.05 ? 259 PRO B N   1 
ATOM   4951 C CA  . PRO B 1 259 ? 22.634  60.098 27.495 1.00 29.31 ? 259 PRO B CA  1 
ATOM   4952 C C   . PRO B 1 259 ? 21.695  60.337 28.695 1.00 26.20 ? 259 PRO B C   1 
ATOM   4953 O O   . PRO B 1 259 ? 21.757  59.638 29.703 1.00 25.59 ? 259 PRO B O   1 
ATOM   4954 C CB  . PRO B 1 259 ? 22.107  59.032 26.526 1.00 27.69 ? 259 PRO B CB  1 
ATOM   4955 C CG  . PRO B 1 259 ? 23.385  58.492 25.894 1.00 25.84 ? 259 PRO B CG  1 
ATOM   4956 C CD  . PRO B 1 259 ? 24.282  58.366 27.099 1.00 24.45 ? 259 PRO B CD  1 
ATOM   4957 N N   . PRO B 1 260 ? 20.806  61.338 28.577 1.00 30.60 ? 260 PRO B N   1 
ATOM   4958 C CA  . PRO B 1 260 ? 19.815  61.755 29.575 1.00 27.80 ? 260 PRO B CA  1 
ATOM   4959 C C   . PRO B 1 260 ? 18.716  60.715 29.756 1.00 26.75 ? 260 PRO B C   1 
ATOM   4960 O O   . PRO B 1 260 ? 18.345  60.004 28.822 1.00 25.26 ? 260 PRO B O   1 
ATOM   4961 C CB  . PRO B 1 260 ? 19.239  63.039 28.993 1.00 31.12 ? 260 PRO B CB  1 
ATOM   4962 C CG  . PRO B 1 260 ? 20.143  63.379 27.829 1.00 38.18 ? 260 PRO B CG  1 
ATOM   4963 C CD  . PRO B 1 260 ? 20.604  62.077 27.323 1.00 28.20 ? 260 PRO B CD  1 
ATOM   4964 N N   . LEU B 1 261 ? 18.188  60.659 30.966 1.00 23.14 ? 261 LEU B N   1 
ATOM   4965 C CA  . LEU B 1 261 ? 17.130  59.737 31.298 1.00 28.46 ? 261 LEU B CA  1 
ATOM   4966 C C   . LEU B 1 261 ? 15.796  60.168 30.725 1.00 33.26 ? 261 LEU B C   1 
ATOM   4967 O O   . LEU B 1 261 ? 14.907  60.587 31.453 1.00 34.45 ? 261 LEU B O   1 
ATOM   4968 C CB  . LEU B 1 261 ? 16.999  59.611 32.817 1.00 27.65 ? 261 LEU B CB  1 
ATOM   4969 C CG  . LEU B 1 261 ? 17.510  58.359 33.520 1.00 29.97 ? 261 LEU B CG  1 
ATOM   4970 C CD1 . LEU B 1 261 ? 18.501  57.594 32.664 1.00 26.36 ? 261 LEU B CD1 1 
ATOM   4971 C CD2 . LEU B 1 261 ? 18.114  58.779 34.842 1.00 27.82 ? 261 LEU B CD2 1 
ATOM   4972 N N   . ASN B 1 262 ? 15.661  60.121 29.412 1.00 37.47 ? 262 ASN B N   1 
ATOM   4973 C CA  . ASN B 1 262 ? 14.369  60.433 28.846 1.00 39.93 ? 262 ASN B CA  1 
ATOM   4974 C C   . ASN B 1 262 ? 13.787  59.011 28.809 1.00 41.76 ? 262 ASN B C   1 
ATOM   4975 O O   . ASN B 1 262 ? 14.321  58.111 29.468 1.00 45.65 ? 262 ASN B O   1 
ATOM   4976 C CB  . ASN B 1 262 ? 14.522  61.068 27.465 1.00 38.70 ? 262 ASN B CB  1 
ATOM   4977 C CG  . ASN B 1 262 ? 15.127  60.137 26.460 1.00 33.34 ? 262 ASN B CG  1 
ATOM   4978 O OD1 . ASN B 1 262 ? 15.686  59.100 26.812 1.00 40.37 ? 262 ASN B OD1 1 
ATOM   4979 N ND2 . ASN B 1 262 ? 15.029  60.503 25.187 1.00 39.57 ? 262 ASN B ND2 1 
ATOM   4980 N N   . GLY B 1 263 ? 12.733  58.762 28.058 1.00 41.41 ? 263 GLY B N   1 
ATOM   4981 C CA  . GLY B 1 263 ? 12.193  57.412 28.094 1.00 38.59 ? 263 GLY B CA  1 
ATOM   4982 C C   . GLY B 1 263 ? 12.960  56.235 27.505 1.00 35.24 ? 263 GLY B C   1 
ATOM   4983 O O   . GLY B 1 263 ? 12.653  55.109 27.856 1.00 31.82 ? 263 GLY B O   1 
ATOM   4984 N N   . VAL B 1 264 ? 13.957  56.464 26.649 1.00 32.45 ? 264 VAL B N   1 
ATOM   4985 C CA  . VAL B 1 264 ? 14.670  55.362 25.996 1.00 32.35 ? 264 VAL B CA  1 
ATOM   4986 C C   . VAL B 1 264 ? 15.949  54.825 26.652 1.00 30.36 ? 264 VAL B C   1 
ATOM   4987 O O   . VAL B 1 264 ? 16.688  54.028 26.060 1.00 34.32 ? 264 VAL B O   1 
ATOM   4988 C CB  . VAL B 1 264 ? 14.973  55.760 24.520 1.00 34.68 ? 264 VAL B CB  1 
ATOM   4989 C CG1 . VAL B 1 264 ? 15.746  54.679 23.809 1.00 42.99 ? 264 VAL B CG1 1 
ATOM   4990 C CG2 . VAL B 1 264 ? 13.677  56.003 23.784 1.00 34.26 ? 264 VAL B CG2 1 
ATOM   4991 N N   . ILE B 1 265 ? 16.197  55.232 27.886 1.00 30.39 ? 265 ILE B N   1 
ATOM   4992 C CA  . ILE B 1 265 ? 17.399  54.815 28.599 1.00 27.23 ? 265 ILE B CA  1 
ATOM   4993 C C   . ILE B 1 265 ? 17.010  54.073 29.866 1.00 26.07 ? 265 ILE B C   1 
ATOM   4994 O O   . ILE B 1 265 ? 16.104  54.500 30.553 1.00 25.84 ? 265 ILE B O   1 
ATOM   4995 C CB  . ILE B 1 265 ? 18.239  56.076 28.984 1.00 28.13 ? 265 ILE B CB  1 
ATOM   4996 C CG1 . ILE B 1 265 ? 18.507  56.923 27.738 1.00 30.25 ? 265 ILE B CG1 1 
ATOM   4997 C CG2 . ILE B 1 265 ? 19.560  55.682 29.613 1.00 26.10 ? 265 ILE B CG2 1 
ATOM   4998 C CD1 . ILE B 1 265 ? 19.306  56.201 26.658 1.00 33.74 ? 265 ILE B CD1 1 
ATOM   4999 N N   . LEU B 1 266 ? 17.663  52.947 30.164 1.00 28.43 ? 266 LEU B N   1 
ATOM   5000 C CA  . LEU B 1 266 ? 17.394  52.212 31.404 1.00 22.50 ? 266 LEU B CA  1 
ATOM   5001 C C   . LEU B 1 266 ? 18.263  52.916 32.462 1.00 23.50 ? 266 LEU B C   1 
ATOM   5002 O O   . LEU B 1 266 ? 19.471  53.070 32.270 1.00 22.72 ? 266 LEU B O   1 
ATOM   5003 C CB  . LEU B 1 266 ? 17.825  50.753 31.256 1.00 21.09 ? 266 LEU B CB  1 
ATOM   5004 C CG  . LEU B 1 266 ? 17.391  49.702 32.279 1.00 22.86 ? 266 LEU B CG  1 
ATOM   5005 C CD1 . LEU B 1 266 ? 18.127  49.914 33.555 1.00 24.87 ? 266 LEU B CD1 1 
ATOM   5006 C CD2 . LEU B 1 266 ? 15.862  49.744 32.492 1.00 16.51 ? 266 LEU B CD2 1 
ATOM   5007 N N   . PRO B 1 267 ? 17.667  53.366 33.583 1.00 21.10 ? 267 PRO B N   1 
ATOM   5008 C CA  . PRO B 1 267 ? 18.459  54.054 34.622 1.00 22.89 ? 267 PRO B CA  1 
ATOM   5009 C C   . PRO B 1 267 ? 19.381  53.097 35.364 1.00 20.84 ? 267 PRO B C   1 
ATOM   5010 O O   . PRO B 1 267 ? 19.048  52.628 36.447 1.00 22.45 ? 267 PRO B O   1 
ATOM   5011 C CB  . PRO B 1 267 ? 17.403  54.637 35.556 1.00 25.03 ? 267 PRO B CB  1 
ATOM   5012 C CG  . PRO B 1 267 ? 16.148  54.669 34.722 1.00 34.14 ? 267 PRO B CG  1 
ATOM   5013 C CD  . PRO B 1 267 ? 16.236  53.395 33.915 1.00 28.61 ? 267 PRO B CD  1 
ATOM   5014 N N   . GLY B 1 268 ? 20.547  52.836 34.788 1.00 21.44 ? 268 GLY B N   1 
ATOM   5015 C CA  . GLY B 1 268 ? 21.484  51.906 35.391 1.00 23.85 ? 268 GLY B CA  1 
ATOM   5016 C C   . GLY B 1 268 ? 22.018  52.306 36.755 1.00 24.84 ? 268 GLY B C   1 
ATOM   5017 O O   . GLY B 1 268 ? 22.263  53.489 37.011 1.00 22.95 ? 268 GLY B O   1 
ATOM   5018 N N   . VAL B 1 269 ? 22.197  51.318 37.627 1.00 24.49 ? 269 VAL B N   1 
ATOM   5019 C CA  . VAL B 1 269 ? 22.733  51.577 38.964 1.00 27.41 ? 269 VAL B CA  1 
ATOM   5020 C C   . VAL B 1 269 ? 24.216  51.923 38.842 1.00 25.86 ? 269 VAL B C   1 
ATOM   5021 O O   . VAL B 1 269 ? 24.707  52.823 39.522 1.00 32.04 ? 269 VAL B O   1 
ATOM   5022 C CB  . VAL B 1 269 ? 22.569  50.353 39.899 1.00 29.40 ? 269 VAL B CB  1 
ATOM   5023 C CG1 . VAL B 1 269 ? 23.265  50.623 41.225 1.00 26.48 ? 269 VAL B CG1 1 
ATOM   5024 C CG2 . VAL B 1 269 ? 21.096  50.065 40.130 1.00 20.50 ? 269 VAL B CG2 1 
ATOM   5025 N N   . VAL B 1 270 ? 24.936  51.214 37.977 1.00 25.46 ? 270 VAL B N   1 
ATOM   5026 C CA  . VAL B 1 270 ? 26.352  51.517 37.785 1.00 24.24 ? 270 VAL B CA  1 
ATOM   5027 C C   . VAL B 1 270 ? 26.455  52.896 37.153 1.00 23.90 ? 270 VAL B C   1 
ATOM   5028 O O   . VAL B 1 270 ? 27.280  53.712 37.582 1.00 22.84 ? 270 VAL B O   1 
ATOM   5029 C CB  . VAL B 1 270 ? 27.063  50.473 36.887 1.00 26.88 ? 270 VAL B CB  1 
ATOM   5030 C CG1 . VAL B 1 270 ? 28.529  50.866 36.682 1.00 26.98 ? 270 VAL B CG1 1 
ATOM   5031 C CG2 . VAL B 1 270 ? 27.014  49.110 37.551 1.00 26.61 ? 270 VAL B CG2 1 
ATOM   5032 N N   . ARG B 1 271 ? 25.617  53.151 36.145 1.00 19.87 ? 271 ARG B N   1 
ATOM   5033 C CA  . ARG B 1 271 ? 25.563  54.453 35.471 1.00 23.17 ? 271 ARG B CA  1 
ATOM   5034 C C   . ARG B 1 271 ? 25.447  55.596 36.507 1.00 26.44 ? 271 ARG B C   1 
ATOM   5035 O O   . ARG B 1 271 ? 26.248  56.539 36.498 1.00 24.03 ? 271 ARG B O   1 
ATOM   5036 C CB  . ARG B 1 271 ? 24.335  54.509 34.527 1.00 21.47 ? 271 ARG B CB  1 
ATOM   5037 C CG  . ARG B 1 271 ? 24.027  55.888 33.923 1.00 18.95 ? 271 ARG B CG  1 
ATOM   5038 C CD  . ARG B 1 271 ? 22.650  55.905 33.222 1.00 16.36 ? 271 ARG B CD  1 
ATOM   5039 N NE  . ARG B 1 271 ? 22.303  57.209 32.659 1.00 23.30 ? 271 ARG B NE  1 
ATOM   5040 C CZ  . ARG B 1 271 ? 21.832  58.251 33.350 1.00 16.71 ? 271 ARG B CZ  1 
ATOM   5041 N NH1 . ARG B 1 271 ? 21.632  58.169 34.665 1.00 20.65 ? 271 ARG B NH1 1 
ATOM   5042 N NH2 . ARG B 1 271 ? 21.573  59.385 32.728 1.00 20.61 ? 271 ARG B NH2 1 
ATOM   5043 N N   . GLN B 1 272 ? 24.457  55.512 37.404 1.00 20.64 ? 272 GLN B N   1 
ATOM   5044 C CA  . GLN B 1 272 ? 24.278  56.567 38.396 1.00 24.35 ? 272 GLN B CA  1 
ATOM   5045 C C   . GLN B 1 272 ? 25.513  56.677 39.303 1.00 25.17 ? 272 GLN B C   1 
ATOM   5046 O O   . GLN B 1 272 ? 25.934  57.773 39.667 1.00 20.39 ? 272 GLN B O   1 
ATOM   5047 C CB  . GLN B 1 272 ? 23.021  56.309 39.235 1.00 23.66 ? 272 GLN B CB  1 
ATOM   5048 C CG  . GLN B 1 272 ? 22.673  57.448 40.179 1.00 24.24 ? 272 GLN B CG  1 
ATOM   5049 C CD  . GLN B 1 272 ? 22.399  58.743 39.440 1.00 27.93 ? 272 GLN B CD  1 
ATOM   5050 O OE1 . GLN B 1 272 ? 23.117  59.726 39.594 1.00 30.91 ? 272 GLN B OE1 1 
ATOM   5051 N NE2 . GLN B 1 272 ? 21.357  58.746 38.627 1.00 31.68 ? 272 GLN B NE2 1 
ATOM   5052 N N   . SER B 1 273 ? 26.107  55.539 39.644 1.00 23.25 ? 273 SER B N   1 
ATOM   5053 C CA  . SER B 1 273 ? 27.293  55.519 40.501 1.00 24.66 ? 273 SER B CA  1 
ATOM   5054 C C   . SER B 1 273 ? 28.482  56.206 39.835 1.00 27.21 ? 273 SER B C   1 
ATOM   5055 O O   . SER B 1 273 ? 29.239  56.921 40.488 1.00 24.37 ? 273 SER B O   1 
ATOM   5056 C CB  . SER B 1 273 ? 27.664  54.073 40.841 1.00 19.51 ? 273 SER B CB  1 
ATOM   5057 O OG  . SER B 1 273 ? 26.558  53.428 41.441 1.00 28.00 ? 273 SER B OG  1 
ATOM   5058 N N   . LEU B 1 274 ? 28.659  55.969 38.539 1.00 24.66 ? 274 LEU B N   1 
ATOM   5059 C CA  . LEU B 1 274 ? 29.744  56.599 37.815 1.00 26.83 ? 274 LEU B CA  1 
ATOM   5060 C C   . LEU B 1 274 ? 29.556  58.120 37.761 1.00 26.31 ? 274 LEU B C   1 
ATOM   5061 O O   . LEU B 1 274 ? 30.528  58.855 37.968 1.00 26.80 ? 274 LEU B O   1 
ATOM   5062 C CB  . LEU B 1 274 ? 29.857  56.027 36.406 1.00 29.49 ? 274 LEU B CB  1 
ATOM   5063 C CG  . LEU B 1 274 ? 30.277  54.557 36.327 1.00 30.84 ? 274 LEU B CG  1 
ATOM   5064 C CD1 . LEU B 1 274 ? 30.602  54.227 34.866 1.00 27.79 ? 274 LEU B CD1 1 
ATOM   5065 C CD2 . LEU B 1 274 ? 31.516  54.300 37.214 1.00 21.88 ? 274 LEU B CD2 1 
ATOM   5066 N N   . LEU B 1 275 ? 28.331  58.587 37.491 1.00 20.78 ? 275 LEU B N   1 
ATOM   5067 C CA  . LEU B 1 275 ? 28.059  60.021 37.466 1.00 25.89 ? 275 LEU B CA  1 
ATOM   5068 C C   . LEU B 1 275 ? 28.345  60.594 38.868 1.00 27.69 ? 275 LEU B C   1 
ATOM   5069 O O   . LEU B 1 275 ? 29.049  61.589 38.995 1.00 29.57 ? 275 LEU B O   1 
ATOM   5070 C CB  . LEU B 1 275 ? 26.599  60.291 37.070 1.00 23.89 ? 275 LEU B CB  1 
ATOM   5071 C CG  . LEU B 1 275 ? 26.178  59.951 35.635 1.00 20.88 ? 275 LEU B CG  1 
ATOM   5072 C CD1 . LEU B 1 275 ? 24.661  60.054 35.508 1.00 23.77 ? 275 LEU B CD1 1 
ATOM   5073 C CD2 . LEU B 1 275 ? 26.860  60.870 34.657 1.00 22.12 ? 275 LEU B CD2 1 
ATOM   5074 N N   . ASP B 1 276 ? 27.810  59.957 39.913 1.00 27.33 ? 276 ASP B N   1 
ATOM   5075 C CA  . ASP B 1 276 ? 28.011  60.405 41.303 1.00 31.06 ? 276 ASP B CA  1 
ATOM   5076 C C   . ASP B 1 276 ? 29.511  60.531 41.624 1.00 34.64 ? 276 ASP B C   1 
ATOM   5077 O O   . ASP B 1 276 ? 29.999  61.556 42.148 1.00 29.97 ? 276 ASP B O   1 
ATOM   5078 C CB  . ASP B 1 276 ? 27.399  59.394 42.282 1.00 23.12 ? 276 ASP B CB  1 
ATOM   5079 C CG  . ASP B 1 276 ? 25.890  59.327 42.193 1.00 25.86 ? 276 ASP B CG  1 
ATOM   5080 O OD1 . ASP B 1 276 ? 25.294  58.386 42.779 1.00 24.52 ? 276 ASP B OD1 1 
ATOM   5081 O OD2 . ASP B 1 276 ? 25.298  60.217 41.545 1.00 29.30 ? 276 ASP B OD2 1 
ATOM   5082 N N   . MET B 1 277 ? 30.233  59.466 41.304 1.00 28.14 ? 277 MET B N   1 
ATOM   5083 C CA  . MET B 1 277 ? 31.654  59.395 41.546 1.00 29.14 ? 277 MET B CA  1 
ATOM   5084 C C   . MET B 1 277 ? 32.406  60.501 40.815 1.00 30.31 ? 277 MET B C   1 
ATOM   5085 O O   . MET B 1 277 ? 33.151  61.254 41.437 1.00 28.04 ? 277 MET B O   1 
ATOM   5086 C CB  . MET B 1 277 ? 32.170  58.022 41.115 1.00 29.16 ? 277 MET B CB  1 
ATOM   5087 C CG  . MET B 1 277 ? 33.368  57.534 41.876 1.00 30.71 ? 277 MET B CG  1 
ATOM   5088 S SD  . MET B 1 277 ? 33.753  55.830 41.402 1.00 39.53 ? 277 MET B SD  1 
ATOM   5089 C CE  . MET B 1 277 ? 32.698  54.953 42.447 1.00 35.80 ? 277 MET B CE  1 
ATOM   5090 N N   . ALA B 1 278 ? 32.215  60.596 39.501 1.00 26.65 ? 278 ALA B N   1 
ATOM   5091 C CA  . ALA B 1 278 ? 32.890  61.636 38.729 1.00 29.67 ? 278 ALA B CA  1 
ATOM   5092 C C   . ALA B 1 278 ? 32.499  63.050 39.189 1.00 31.38 ? 278 ALA B C   1 
ATOM   5093 O O   . ALA B 1 278 ? 33.310  63.961 39.106 1.00 38.40 ? 278 ALA B O   1 
ATOM   5094 C CB  . ALA B 1 278 ? 32.594  61.465 37.249 1.00 20.95 ? 278 ALA B CB  1 
ATOM   5095 N N   . GLN B 1 279 ? 31.274  63.245 39.676 1.00 32.91 ? 279 GLN B N   1 
ATOM   5096 C CA  . GLN B 1 279 ? 30.876  64.584 40.115 1.00 37.21 ? 279 GLN B CA  1 
ATOM   5097 C C   . GLN B 1 279 ? 31.526  64.906 41.442 1.00 39.05 ? 279 GLN B C   1 
ATOM   5098 O O   . GLN B 1 279 ? 31.804  66.069 41.757 1.00 36.92 ? 279 GLN B O   1 
ATOM   5099 C CB  . GLN B 1 279 ? 29.363  64.709 40.276 1.00 41.46 ? 279 GLN B CB  1 
ATOM   5100 C CG  . GLN B 1 279 ? 28.583  64.457 39.000 1.00 49.36 ? 279 GLN B CG  1 
ATOM   5101 C CD  . GLN B 1 279 ? 27.185  65.005 39.075 1.00 53.48 ? 279 GLN B CD  1 
ATOM   5102 O OE1 . GLN B 1 279 ? 26.993  66.221 39.059 1.00 57.82 ? 279 GLN B OE1 1 
ATOM   5103 N NE2 . GLN B 1 279 ? 26.194  64.116 39.168 1.00 50.88 ? 279 GLN B NE2 1 
ATOM   5104 N N   . THR B 1 280 ? 31.755  63.866 42.229 1.00 38.00 ? 280 THR B N   1 
ATOM   5105 C CA  . THR B 1 280 ? 32.380  64.054 43.518 1.00 38.62 ? 280 THR B CA  1 
ATOM   5106 C C   . THR B 1 280 ? 33.813  64.550 43.332 1.00 37.76 ? 280 THR B C   1 
ATOM   5107 O O   . THR B 1 280 ? 34.243  65.482 44.016 1.00 35.60 ? 280 THR B O   1 
ATOM   5108 C CB  . THR B 1 280 ? 32.351  62.751 44.348 1.00 37.98 ? 280 THR B CB  1 
ATOM   5109 O OG1 . THR B 1 280 ? 31.012  62.516 44.807 1.00 36.48 ? 280 THR B OG1 1 
ATOM   5110 C CG2 . THR B 1 280 ? 33.275  62.855 45.568 1.00 34.86 ? 280 THR B CG2 1 
ATOM   5111 N N   . TRP B 1 281 ? 34.547  63.952 42.396 1.00 33.76 ? 281 TRP B N   1 
ATOM   5112 C CA  . TRP B 1 281 ? 35.924  64.380 42.155 1.00 31.71 ? 281 TRP B CA  1 
ATOM   5113 C C   . TRP B 1 281 ? 36.026  65.870 41.832 1.00 35.04 ? 281 TRP B C   1 
ATOM   5114 O O   . TRP B 1 281 ? 36.959  66.530 42.270 1.00 34.93 ? 281 TRP B O   1 
ATOM   5115 C CB  . TRP B 1 281 ? 36.546  63.613 40.991 1.00 37.05 ? 281 TRP B CB  1 
ATOM   5116 C CG  . TRP B 1 281 ? 36.564  62.146 41.151 1.00 32.81 ? 281 TRP B CG  1 
ATOM   5117 C CD1 . TRP B 1 281 ? 36.607  61.449 42.319 1.00 31.42 ? 281 TRP B CD1 1 
ATOM   5118 C CD2 . TRP B 1 281 ? 36.631  61.177 40.096 1.00 33.93 ? 281 TRP B CD2 1 
ATOM   5119 N NE1 . TRP B 1 281 ? 36.705  60.097 42.059 1.00 27.84 ? 281 TRP B NE1 1 
ATOM   5120 C CE2 . TRP B 1 281 ? 36.721  59.905 40.704 1.00 33.92 ? 281 TRP B CE2 1 
ATOM   5121 C CE3 . TRP B 1 281 ? 36.628  61.264 38.695 1.00 36.74 ? 281 TRP B CE3 1 
ATOM   5122 C CZ2 . TRP B 1 281 ? 36.808  58.719 39.959 1.00 34.08 ? 281 TRP B CZ2 1 
ATOM   5123 C CZ3 . TRP B 1 281 ? 36.715  60.095 37.955 1.00 36.25 ? 281 TRP B CZ3 1 
ATOM   5124 C CH2 . TRP B 1 281 ? 36.804  58.834 38.592 1.00 35.69 ? 281 TRP B CH2 1 
ATOM   5125 N N   . GLY B 1 282 ? 35.078  66.383 41.052 1.00 35.06 ? 282 GLY B N   1 
ATOM   5126 C CA  . GLY B 1 282 ? 35.090  67.791 40.688 1.00 36.99 ? 282 GLY B CA  1 
ATOM   5127 C C   . GLY B 1 282 ? 36.280  68.165 39.826 1.00 40.79 ? 282 GLY B C   1 
ATOM   5128 O O   . GLY B 1 282 ? 36.786  69.289 39.895 1.00 45.49 ? 282 GLY B O   1 
ATOM   5129 N N   . GLU B 1 283 ? 36.729  67.230 39.000 1.00 36.11 ? 283 GLU B N   1 
ATOM   5130 C CA  . GLU B 1 283 ? 37.870  67.480 38.141 1.00 37.30 ? 283 GLU B CA  1 
ATOM   5131 C C   . GLU B 1 283 ? 37.521  67.870 36.710 1.00 38.54 ? 283 GLU B C   1 
ATOM   5132 O O   . GLU B 1 283 ? 38.348  68.444 36.008 1.00 39.85 ? 283 GLU B O   1 
ATOM   5133 C CB  . GLU B 1 283 ? 38.781  66.262 38.140 1.00 33.88 ? 283 GLU B CB  1 
ATOM   5134 C CG  . GLU B 1 283 ? 39.538  66.099 39.436 1.00 37.45 ? 283 GLU B CG  1 
ATOM   5135 C CD  . GLU B 1 283 ? 40.240  64.765 39.549 1.00 40.73 ? 283 GLU B CD  1 
ATOM   5136 O OE1 . GLU B 1 283 ? 40.838  64.299 38.546 1.00 39.47 ? 283 GLU B OE1 1 
ATOM   5137 O OE2 . GLU B 1 283 ? 40.209  64.186 40.656 1.00 37.19 ? 283 GLU B OE2 1 
ATOM   5138 N N   . PHE B 1 284 ? 36.306  67.558 36.278 1.00 39.14 ? 284 PHE B N   1 
ATOM   5139 C CA  . PHE B 1 284 ? 35.868  67.890 34.924 1.00 38.74 ? 284 PHE B CA  1 
ATOM   5140 C C   . PHE B 1 284 ? 34.351  67.911 34.845 1.00 36.40 ? 284 PHE B C   1 
ATOM   5141 O O   . PHE B 1 284 ? 33.667  67.428 35.748 1.00 37.98 ? 284 PHE B O   1 
ATOM   5142 C CB  . PHE B 1 284 ? 36.411  66.882 33.909 1.00 36.94 ? 284 PHE B CB  1 
ATOM   5143 C CG  . PHE B 1 284 ? 36.190  65.448 34.300 1.00 35.49 ? 284 PHE B CG  1 
ATOM   5144 C CD1 . PHE B 1 284 ? 37.229  64.693 34.825 1.00 33.41 ? 284 PHE B CD1 1 
ATOM   5145 C CD2 . PHE B 1 284 ? 34.947  64.852 34.137 1.00 34.32 ? 284 PHE B CD2 1 
ATOM   5146 C CE1 . PHE B 1 284 ? 37.032  63.374 35.181 1.00 35.91 ? 284 PHE B CE1 1 
ATOM   5147 C CE2 . PHE B 1 284 ? 34.743  63.529 34.491 1.00 29.96 ? 284 PHE B CE2 1 
ATOM   5148 C CZ  . PHE B 1 284 ? 35.782  62.787 35.013 1.00 31.56 ? 284 PHE B CZ  1 
ATOM   5149 N N   . ARG B 1 285 ? 33.838  68.461 33.751 1.00 34.31 ? 285 ARG B N   1 
ATOM   5150 C CA  . ARG B 1 285 ? 32.412  68.556 33.547 1.00 35.45 ? 285 ARG B CA  1 
ATOM   5151 C C   . ARG B 1 285 ? 31.795  67.162 33.404 1.00 35.65 ? 285 ARG B C   1 
ATOM   5152 O O   . ARG B 1 285 ? 32.335  66.303 32.703 1.00 30.35 ? 285 ARG B O   1 
ATOM   5153 C CB  . ARG B 1 285 ? 32.120  69.387 32.290 1.00 38.01 ? 285 ARG B CB  1 
ATOM   5154 C CG  . ARG B 1 285 ? 30.637  69.525 31.982 1.00 40.16 ? 285 ARG B CG  1 
ATOM   5155 C CD  . ARG B 1 285 ? 30.397  69.775 30.501 1.00 42.17 ? 285 ARG B CD  1 
ATOM   5156 N NE  . ARG B 1 285 ? 30.779  71.121 30.116 1.00 45.78 ? 285 ARG B NE  1 
ATOM   5157 C CZ  . ARG B 1 285 ? 30.991  71.523 28.868 1.00 45.83 ? 285 ARG B CZ  1 
ATOM   5158 N NH1 . ARG B 1 285 ? 30.866  70.685 27.846 1.00 44.74 ? 285 ARG B NH1 1 
ATOM   5159 N NH2 . ARG B 1 285 ? 31.327  72.781 28.644 1.00 50.65 ? 285 ARG B NH2 1 
ATOM   5160 N N   . VAL B 1 286 ? 30.682  66.954 34.110 1.00 36.20 ? 286 VAL B N   1 
ATOM   5161 C CA  . VAL B 1 286 ? 29.910  65.711 34.077 1.00 35.36 ? 286 VAL B CA  1 
ATOM   5162 C C   . VAL B 1 286 ? 28.510  66.163 33.681 1.00 34.04 ? 286 VAL B C   1 
ATOM   5163 O O   . VAL B 1 286 ? 27.900  67.015 34.323 1.00 36.67 ? 286 VAL B O   1 
ATOM   5164 C CB  . VAL B 1 286 ? 29.888  65.003 35.459 1.00 32.95 ? 286 VAL B CB  1 
ATOM   5165 C CG1 . VAL B 1 286 ? 28.998  63.747 35.419 1.00 25.60 ? 286 VAL B CG1 1 
ATOM   5166 C CG2 . VAL B 1 286 ? 31.294  64.603 35.830 1.00 29.38 ? 286 VAL B CG2 1 
ATOM   5167 N N   . VAL B 1 287 ? 28.011  65.607 32.601 1.00 30.00 ? 287 VAL B N   1 
ATOM   5168 C CA  . VAL B 1 287 ? 26.724  66.018 32.123 1.00 32.09 ? 287 VAL B CA  1 
ATOM   5169 C C   . VAL B 1 287 ? 25.977  64.879 31.452 1.00 28.60 ? 287 VAL B C   1 
ATOM   5170 O O   . VAL B 1 287 ? 26.565  63.923 30.945 1.00 26.73 ? 287 VAL B O   1 
ATOM   5171 C CB  . VAL B 1 287 ? 26.907  67.171 31.113 1.00 34.90 ? 287 VAL B CB  1 
ATOM   5172 C CG1 . VAL B 1 287 ? 27.786  66.708 29.976 1.00 38.80 ? 287 VAL B CG1 1 
ATOM   5173 C CG2 . VAL B 1 287 ? 25.584  67.632 30.584 1.00 37.34 ? 287 VAL B CG2 1 
ATOM   5174 N N   . GLU B 1 288 ? 24.663  64.997 31.475 1.00 31.42 ? 288 GLU B N   1 
ATOM   5175 C CA  . GLU B 1 288 ? 23.803  64.037 30.834 1.00 31.53 ? 288 GLU B CA  1 
ATOM   5176 C C   . GLU B 1 288 ? 23.278  64.835 29.662 1.00 30.18 ? 288 GLU B C   1 
ATOM   5177 O O   . GLU B 1 288 ? 22.568  65.806 29.840 1.00 36.33 ? 288 GLU B O   1 
ATOM   5178 C CB  . GLU B 1 288 ? 22.680  63.624 31.776 1.00 32.72 ? 288 GLU B CB  1 
ATOM   5179 C CG  . GLU B 1 288 ? 23.178  62.782 32.934 1.00 37.55 ? 288 GLU B CG  1 
ATOM   5180 C CD  . GLU B 1 288 ? 22.104  62.500 33.955 1.00 41.73 ? 288 GLU B CD  1 
ATOM   5181 O OE1 . GLU B 1 288 ? 21.098  61.840 33.611 1.00 40.45 ? 288 GLU B OE1 1 
ATOM   5182 O OE2 . GLU B 1 288 ? 22.271  62.949 35.109 1.00 43.07 ? 288 GLU B OE2 1 
ATOM   5183 N N   . ARG B 1 289 ? 23.673  64.451 28.462 1.00 30.16 ? 289 ARG B N   1 
ATOM   5184 C CA  . ARG B 1 289 ? 23.238  65.159 27.262 1.00 30.75 ? 289 ARG B CA  1 
ATOM   5185 C C   . ARG B 1 289 ? 23.119  64.107 26.165 1.00 25.70 ? 289 ARG B C   1 
ATOM   5186 O O   . ARG B 1 289 ? 23.736  63.051 26.252 1.00 28.14 ? 289 ARG B O   1 
ATOM   5187 C CB  . ARG B 1 289 ? 24.288  66.219 26.855 1.00 27.80 ? 289 ARG B CB  1 
ATOM   5188 C CG  . ARG B 1 289 ? 23.878  67.103 25.656 1.00 36.56 ? 289 ARG B CG  1 
ATOM   5189 C CD  . ARG B 1 289 ? 25.065  67.837 24.979 1.00 33.29 ? 289 ARG B CD  1 
ATOM   5190 N NE  . ARG B 1 289 ? 25.924  68.531 25.940 1.00 30.68 ? 289 ARG B NE  1 
ATOM   5191 C CZ  . ARG B 1 289 ? 27.131  68.113 26.315 1.00 33.36 ? 289 ARG B CZ  1 
ATOM   5192 N NH1 . ARG B 1 289 ? 27.643  67.000 25.803 1.00 32.21 ? 289 ARG B NH1 1 
ATOM   5193 N NH2 . ARG B 1 289 ? 27.817  68.788 27.234 1.00 34.29 ? 289 ARG B NH2 1 
ATOM   5194 N N   . THR B 1 290 ? 22.315  64.384 25.150 1.00 27.18 ? 290 THR B N   1 
ATOM   5195 C CA  . THR B 1 290 ? 22.164  63.457 24.051 1.00 31.77 ? 290 THR B CA  1 
ATOM   5196 C C   . THR B 1 290 ? 23.476  63.388 23.258 1.00 31.41 ? 290 THR B C   1 
ATOM   5197 O O   . THR B 1 290 ? 24.186  64.391 23.132 1.00 35.63 ? 290 THR B O   1 
ATOM   5198 C CB  . THR B 1 290 ? 21.032  63.904 23.121 1.00 30.27 ? 290 THR B CB  1 
ATOM   5199 O OG1 . THR B 1 290 ? 21.071  63.121 21.927 1.00 36.92 ? 290 THR B OG1 1 
ATOM   5200 C CG2 . THR B 1 290 ? 21.196  65.365 22.757 1.00 41.34 ? 290 THR B CG2 1 
ATOM   5201 N N   . ILE B 1 291 ? 23.795  62.212 22.723 1.00 29.12 ? 291 ILE B N   1 
ATOM   5202 C CA  . ILE B 1 291 ? 25.023  62.042 21.961 1.00 27.42 ? 291 ILE B CA  1 
ATOM   5203 C C   . ILE B 1 291 ? 24.677  61.505 20.584 1.00 29.77 ? 291 ILE B C   1 
ATOM   5204 O O   . ILE B 1 291 ? 24.021  60.470 20.469 1.00 33.14 ? 291 ILE B O   1 
ATOM   5205 C CB  . ILE B 1 291 ? 25.992  61.043 22.653 1.00 25.05 ? 291 ILE B CB  1 
ATOM   5206 C CG1 . ILE B 1 291 ? 26.246  61.458 24.101 1.00 25.00 ? 291 ILE B CG1 1 
ATOM   5207 C CG2 . ILE B 1 291 ? 27.316  61.008 21.923 1.00 27.43 ? 291 ILE B CG2 1 
ATOM   5208 C CD1 . ILE B 1 291 ? 27.017  60.436 24.889 1.00 23.37 ? 291 ILE B CD1 1 
ATOM   5209 N N   . THR B 1 292 ? 25.117  62.199 19.534 1.00 32.38 ? 292 THR B N   1 
ATOM   5210 C CA  . THR B 1 292 ? 24.836  61.752 18.176 1.00 31.11 ? 292 THR B CA  1 
ATOM   5211 C C   . THR B 1 292 ? 26.063  61.168 17.478 1.00 31.92 ? 292 THR B C   1 
ATOM   5212 O O   . THR B 1 292 ? 27.209  61.444 17.859 1.00 28.19 ? 292 THR B O   1 
ATOM   5213 C CB  . THR B 1 292 ? 24.303  62.911 17.316 1.00 36.20 ? 292 THR B CB  1 
ATOM   5214 O OG1 . THR B 1 292 ? 25.286  63.958 17.254 1.00 34.34 ? 292 THR B OG1 1 
ATOM   5215 C CG2 . THR B 1 292 ? 22.998  63.454 17.912 1.00 36.21 ? 292 THR B CG2 1 
ATOM   5216 N N   . MET B 1 293 ? 25.824  60.335 16.470 1.00 30.67 ? 293 MET B N   1 
ATOM   5217 C CA  . MET B 1 293 ? 26.927  59.767 15.720 1.00 32.54 ? 293 MET B CA  1 
ATOM   5218 C C   . MET B 1 293 ? 27.655  60.924 15.049 1.00 33.70 ? 293 MET B C   1 
ATOM   5219 O O   . MET B 1 293 ? 28.885  60.927 14.959 1.00 28.68 ? 293 MET B O   1 
ATOM   5220 C CB  . MET B 1 293 ? 26.427  58.774 14.673 1.00 32.29 ? 293 MET B CB  1 
ATOM   5221 C CG  . MET B 1 293 ? 26.093  57.395 15.249 1.00 33.38 ? 293 MET B CG  1 
ATOM   5222 S SD  . MET B 1 293 ? 27.498  56.629 16.091 1.00 37.55 ? 293 MET B SD  1 
ATOM   5223 C CE  . MET B 1 293 ? 28.664  56.552 14.712 1.00 33.27 ? 293 MET B CE  1 
ATOM   5224 N N   . LYS B 1 294 ? 26.891  61.926 14.612 1.00 35.84 ? 294 LYS B N   1 
ATOM   5225 C CA  . LYS B 1 294 ? 27.478  63.092 13.954 1.00 37.08 ? 294 LYS B CA  1 
ATOM   5226 C C   . LYS B 1 294 ? 28.536  63.711 14.854 1.00 36.60 ? 294 LYS B C   1 
ATOM   5227 O O   . LYS B 1 294 ? 29.650  63.998 14.409 1.00 38.33 ? 294 LYS B O   1 
ATOM   5228 C CB  . LYS B 1 294 ? 26.401  64.132 13.629 1.00 38.71 ? 294 LYS B CB  1 
ATOM   5229 C CG  . LYS B 1 294 ? 26.957  65.417 13.020 1.00 39.56 ? 294 LYS B CG  1 
ATOM   5230 C CD  . LYS B 1 294 ? 25.865  66.459 12.817 1.00 45.24 ? 294 LYS B CD  1 
ATOM   5231 C CE  . LYS B 1 294 ? 26.418  67.721 12.167 1.00 45.37 ? 294 LYS B CE  1 
ATOM   5232 N NZ  . LYS B 1 294 ? 25.350  68.711 11.878 1.00 48.16 ? 294 LYS B NZ  1 
ATOM   5233 N N   . GLN B 1 295 ? 28.191  63.915 16.122 1.00 34.55 ? 295 GLN B N   1 
ATOM   5234 C CA  . GLN B 1 295 ? 29.132  64.486 17.085 1.00 33.52 ? 295 GLN B CA  1 
ATOM   5235 C C   . GLN B 1 295 ? 30.312  63.543 17.284 1.00 33.53 ? 295 GLN B C   1 
ATOM   5236 O O   . GLN B 1 295 ? 31.461  63.985 17.357 1.00 36.64 ? 295 GLN B O   1 
ATOM   5237 C CB  . GLN B 1 295 ? 28.461  64.708 18.437 1.00 38.04 ? 295 GLN B CB  1 
ATOM   5238 C CG  . GLN B 1 295 ? 27.442  65.825 18.475 1.00 41.07 ? 295 GLN B CG  1 
ATOM   5239 C CD  . GLN B 1 295 ? 26.585  65.759 19.723 1.00 44.33 ? 295 GLN B CD  1 
ATOM   5240 O OE1 . GLN B 1 295 ? 26.953  65.120 20.709 1.00 45.43 ? 295 GLN B OE1 1 
ATOM   5241 N NE2 . GLN B 1 295 ? 25.439  66.423 19.687 1.00 47.22 ? 295 GLN B NE2 1 
ATOM   5242 N N   . LEU B 1 296 ? 30.026  62.247 17.385 1.00 30.09 ? 296 LEU B N   1 
ATOM   5243 C CA  . LEU B 1 296 ? 31.076  61.249 17.576 1.00 29.54 ? 296 LEU B CA  1 
ATOM   5244 C C   . LEU B 1 296 ? 32.071  61.296 16.398 1.00 28.53 ? 296 LEU B C   1 
ATOM   5245 O O   . LEU B 1 296 ? 33.282  61.299 16.595 1.00 29.12 ? 296 LEU B O   1 
ATOM   5246 C CB  . LEU B 1 296 ? 30.471  59.841 17.673 1.00 31.49 ? 296 LEU B CB  1 
ATOM   5247 C CG  . LEU B 1 296 ? 31.127  58.778 18.574 1.00 33.34 ? 296 LEU B CG  1 
ATOM   5248 C CD1 . LEU B 1 296 ? 30.833  57.377 18.019 1.00 28.90 ? 296 LEU B CD1 1 
ATOM   5249 C CD2 . LEU B 1 296 ? 32.612  58.986 18.660 1.00 33.16 ? 296 LEU B CD2 1 
ATOM   5250 N N   . LEU B 1 297 ? 31.555  61.332 15.177 1.00 31.34 ? 297 LEU B N   1 
ATOM   5251 C CA  . LEU B 1 297 ? 32.420  61.386 14.007 1.00 31.26 ? 297 LEU B CA  1 
ATOM   5252 C C   . LEU B 1 297 ? 33.355  62.597 13.993 1.00 33.13 ? 297 LEU B C   1 
ATOM   5253 O O   . LEU B 1 297 ? 34.544  62.462 13.703 1.00 34.63 ? 297 LEU B O   1 
ATOM   5254 C CB  . LEU B 1 297 ? 31.575  61.375 12.747 1.00 33.72 ? 297 LEU B CB  1 
ATOM   5255 C CG  . LEU B 1 297 ? 30.940  60.020 12.459 1.00 36.08 ? 297 LEU B CG  1 
ATOM   5256 C CD1 . LEU B 1 297 ? 30.216  60.110 11.137 1.00 37.17 ? 297 LEU B CD1 1 
ATOM   5257 C CD2 . LEU B 1 297 ? 32.016  58.931 12.423 1.00 34.54 ? 297 LEU B CD2 1 
ATOM   5258 N N   . ARG B 1 298 ? 32.834  63.779 14.310 1.00 35.52 ? 298 ARG B N   1 
ATOM   5259 C CA  . ARG B 1 298 ? 33.687  64.957 14.312 1.00 36.15 ? 298 ARG B CA  1 
ATOM   5260 C C   . ARG B 1 298 ? 34.721  64.879 15.420 1.00 35.16 ? 298 ARG B C   1 
ATOM   5261 O O   . ARG B 1 298 ? 35.917  65.009 15.171 1.00 37.87 ? 298 ARG B O   1 
ATOM   5262 C CB  . ARG B 1 298 ? 32.888  66.247 14.478 1.00 41.59 ? 298 ARG B CB  1 
ATOM   5263 C CG  . ARG B 1 298 ? 33.730  67.455 14.114 1.00 47.11 ? 298 ARG B CG  1 
ATOM   5264 C CD  . ARG B 1 298 ? 33.619  68.626 15.079 1.00 52.16 ? 298 ARG B CD  1 
ATOM   5265 N NE  . ARG B 1 298 ? 32.450  69.463 14.834 1.00 53.46 ? 298 ARG B NE  1 
ATOM   5266 C CZ  . ARG B 1 298 ? 32.331  70.717 15.260 1.00 56.17 ? 298 ARG B CZ  1 
ATOM   5267 N NH1 . ARG B 1 298 ? 33.314  71.291 15.944 1.00 56.91 ? 298 ARG B NH1 1 
ATOM   5268 N NH2 . ARG B 1 298 ? 31.218  71.392 15.027 1.00 54.51 ? 298 ARG B NH2 1 
ATOM   5269 N N   . ALA B 1 299 ? 34.259  64.674 16.647 1.00 36.29 ? 299 ALA B N   1 
ATOM   5270 C CA  . ALA B 1 299 ? 35.166  64.579 17.781 1.00 35.47 ? 299 ALA B CA  1 
ATOM   5271 C C   . ALA B 1 299 ? 36.271  63.567 17.469 1.00 34.22 ? 299 ALA B C   1 
ATOM   5272 O O   . ALA B 1 299 ? 37.434  63.775 17.808 1.00 37.79 ? 299 ALA B O   1 
ATOM   5273 C CB  . ALA B 1 299 ? 34.394  64.167 19.030 1.00 30.42 ? 299 ALA B CB  1 
ATOM   5274 N N   . LEU B 1 300 ? 35.908  62.484 16.792 1.00 36.30 ? 300 LEU B N   1 
ATOM   5275 C CA  . LEU B 1 300 ? 36.879  61.457 16.444 1.00 36.58 ? 300 LEU B CA  1 
ATOM   5276 C C   . LEU B 1 300 ? 37.933  61.928 15.443 1.00 43.41 ? 300 LEU B C   1 
ATOM   5277 O O   . LEU B 1 300 ? 39.137  61.755 15.656 1.00 42.54 ? 300 LEU B O   1 
ATOM   5278 C CB  . LEU B 1 300 ? 36.168  60.221 15.886 1.00 36.48 ? 300 LEU B CB  1 
ATOM   5279 C CG  . LEU B 1 300 ? 35.595  59.220 16.893 1.00 31.35 ? 300 LEU B CG  1 
ATOM   5280 C CD1 . LEU B 1 300 ? 34.824  58.117 16.179 1.00 30.28 ? 300 LEU B CD1 1 
ATOM   5281 C CD2 . LEU B 1 300 ? 36.739  58.643 17.704 1.00 32.43 ? 300 LEU B CD2 1 
ATOM   5282 N N   . GLU B 1 301 ? 37.510  62.527 14.344 1.00 47.49 ? 301 GLU B N   1 
ATOM   5283 C CA  . GLU B 1 301 ? 38.513  62.938 13.394 1.00 50.35 ? 301 GLU B CA  1 
ATOM   5284 C C   . GLU B 1 301 ? 39.237  64.195 13.847 1.00 50.20 ? 301 GLU B C   1 
ATOM   5285 O O   . GLU B 1 301 ? 40.135  64.678 13.161 1.00 54.81 ? 301 GLU B O   1 
ATOM   5286 C CB  . GLU B 1 301 ? 37.906  63.123 12.012 1.00 53.31 ? 301 GLU B CB  1 
ATOM   5287 C CG  . GLU B 1 301 ? 37.138  64.383 11.824 1.00 60.69 ? 301 GLU B CG  1 
ATOM   5288 C CD  . GLU B 1 301 ? 37.293  64.894 10.412 1.00 65.93 ? 301 GLU B CD  1 
ATOM   5289 O OE1 . GLU B 1 301 ? 38.431  65.287 10.061 1.00 66.41 ? 301 GLU B OE1 1 
ATOM   5290 O OE2 . GLU B 1 301 ? 36.292  64.888 9.656  1.00 67.29 ? 301 GLU B OE2 1 
ATOM   5291 N N   . GLU B 1 302 ? 38.851  64.719 15.006 1.00 47.71 ? 302 GLU B N   1 
ATOM   5292 C CA  . GLU B 1 302 ? 39.494  65.906 15.562 1.00 42.87 ? 302 GLU B CA  1 
ATOM   5293 C C   . GLU B 1 302 ? 40.332  65.489 16.766 1.00 44.30 ? 302 GLU B C   1 
ATOM   5294 O O   . GLU B 1 302 ? 40.852  66.326 17.502 1.00 46.65 ? 302 GLU B O   1 
ATOM   5295 C CB  . GLU B 1 302 ? 38.451  66.953 15.980 1.00 45.38 ? 302 GLU B CB  1 
ATOM   5296 C CG  . GLU B 1 302 ? 38.142  67.973 14.903 1.00 39.83 ? 302 GLU B CG  1 
ATOM   5297 C CD  . GLU B 1 302 ? 37.034  68.941 15.288 1.00 43.74 ? 302 GLU B CD  1 
ATOM   5298 O OE1 . GLU B 1 302 ? 36.925  69.284 16.483 1.00 38.47 ? 302 GLU B OE1 1 
ATOM   5299 O OE2 . GLU B 1 302 ? 36.277  69.370 14.386 1.00 42.79 ? 302 GLU B OE2 1 
ATOM   5300 N N   . GLY B 1 303 ? 40.464  64.182 16.959 1.00 40.93 ? 303 GLY B N   1 
ATOM   5301 C CA  . GLY B 1 303 ? 41.245  63.674 18.073 1.00 41.12 ? 303 GLY B CA  1 
ATOM   5302 C C   . GLY B 1 303 ? 40.781  64.185 19.424 1.00 37.25 ? 303 GLY B C   1 
ATOM   5303 O O   . GLY B 1 303 ? 41.589  64.402 20.328 1.00 39.31 ? 303 GLY B O   1 
ATOM   5304 N N   . ARG B 1 304 ? 39.472  64.364 19.568 1.00 37.27 ? 304 ARG B N   1 
ATOM   5305 C CA  . ARG B 1 304 ? 38.908  64.869 20.809 1.00 36.34 ? 304 ARG B CA  1 
ATOM   5306 C C   . ARG B 1 304 ? 38.340  63.776 21.721 1.00 37.61 ? 304 ARG B C   1 
ATOM   5307 O O   . ARG B 1 304 ? 38.144  64.003 22.919 1.00 33.95 ? 304 ARG B O   1 
ATOM   5308 C CB  . ARG B 1 304 ? 37.856  65.932 20.483 1.00 36.81 ? 304 ARG B CB  1 
ATOM   5309 C CG  . ARG B 1 304 ? 38.490  67.262 20.084 1.00 40.94 ? 304 ARG B CG  1 
ATOM   5310 C CD  . ARG B 1 304 ? 37.529  68.118 19.302 1.00 43.29 ? 304 ARG B CD  1 
ATOM   5311 N NE  . ARG B 1 304 ? 36.265  68.231 20.002 1.00 45.82 ? 304 ARG B NE  1 
ATOM   5312 C CZ  . ARG B 1 304 ? 35.085  67.934 19.476 1.00 37.80 ? 304 ARG B CZ  1 
ATOM   5313 N NH1 . ARG B 1 304 ? 34.992  67.503 18.225 1.00 37.62 ? 304 ARG B NH1 1 
ATOM   5314 N NH2 . ARG B 1 304 ? 33.995  68.063 20.217 1.00 42.57 ? 304 ARG B NH2 1 
ATOM   5315 N N   . VAL B 1 305 ? 38.096  62.594 21.155 1.00 33.04 ? 305 VAL B N   1 
ATOM   5316 C CA  . VAL B 1 305 ? 37.584  61.465 21.922 1.00 29.12 ? 305 VAL B CA  1 
ATOM   5317 C C   . VAL B 1 305 ? 38.700  60.773 22.693 1.00 28.59 ? 305 VAL B C   1 
ATOM   5318 O O   . VAL B 1 305 ? 39.700  60.370 22.120 1.00 32.02 ? 305 VAL B O   1 
ATOM   5319 C CB  . VAL B 1 305 ? 36.939  60.401 21.009 1.00 25.01 ? 305 VAL B CB  1 
ATOM   5320 C CG1 . VAL B 1 305 ? 36.452  59.221 21.847 1.00 27.51 ? 305 VAL B CG1 1 
ATOM   5321 C CG2 . VAL B 1 305 ? 35.811  61.012 20.226 1.00 30.86 ? 305 VAL B CG2 1 
ATOM   5322 N N   . ARG B 1 306 ? 38.534  60.617 23.989 1.00 21.86 ? 306 ARG B N   1 
ATOM   5323 C CA  . ARG B 1 306 ? 39.543  59.925 24.782 1.00 27.74 ? 306 ARG B CA  1 
ATOM   5324 C C   . ARG B 1 306 ? 39.130  58.482 25.091 1.00 27.32 ? 306 ARG B C   1 
ATOM   5325 O O   . ARG B 1 306 ? 39.860  57.545 24.792 1.00 31.06 ? 306 ARG B O   1 
ATOM   5326 C CB  . ARG B 1 306 ? 39.818  60.694 26.084 1.00 29.71 ? 306 ARG B CB  1 
ATOM   5327 C CG  . ARG B 1 306 ? 40.531  62.012 25.839 1.00 32.85 ? 306 ARG B CG  1 
ATOM   5328 C CD  . ARG B 1 306 ? 40.771  62.825 27.098 1.00 37.81 ? 306 ARG B CD  1 
ATOM   5329 N NE  . ARG B 1 306 ? 41.469  62.072 28.136 1.00 42.22 ? 306 ARG B NE  1 
ATOM   5330 C CZ  . ARG B 1 306 ? 42.037  62.624 29.204 1.00 43.00 ? 306 ARG B CZ  1 
ATOM   5331 N NH1 . ARG B 1 306 ? 42.001  63.941 29.370 1.00 40.61 ? 306 ARG B NH1 1 
ATOM   5332 N NH2 . ARG B 1 306 ? 42.613  61.855 30.122 1.00 39.84 ? 306 ARG B NH2 1 
ATOM   5333 N N   . GLU B 1 307 ? 37.948  58.296 25.668 1.00 27.32 ? 307 GLU B N   1 
ATOM   5334 C CA  . GLU B 1 307 ? 37.507  56.947 26.024 1.00 28.13 ? 307 GLU B CA  1 
ATOM   5335 C C   . GLU B 1 307 ? 35.999  56.784 25.846 1.00 22.47 ? 307 GLU B C   1 
ATOM   5336 O O   . GLU B 1 307 ? 35.243  57.712 26.103 1.00 26.13 ? 307 GLU B O   1 
ATOM   5337 C CB  . GLU B 1 307 ? 37.869  56.656 27.496 1.00 28.69 ? 307 GLU B CB  1 
ATOM   5338 C CG  . GLU B 1 307 ? 39.330  56.946 27.888 1.00 28.25 ? 307 GLU B CG  1 
ATOM   5339 C CD  . GLU B 1 307 ? 39.611  56.690 29.371 1.00 33.73 ? 307 GLU B CD  1 
ATOM   5340 O OE1 . GLU B 1 307 ? 40.425  57.429 29.963 1.00 30.84 ? 307 GLU B OE1 1 
ATOM   5341 O OE2 . GLU B 1 307 ? 39.022  55.753 29.951 1.00 34.48 ? 307 GLU B OE2 1 
ATOM   5342 N N   . VAL B 1 308 ? 35.576  55.611 25.387 1.00 28.61 ? 308 VAL B N   1 
ATOM   5343 C CA  . VAL B 1 308 ? 34.144  55.292 25.215 1.00 25.09 ? 308 VAL B CA  1 
ATOM   5344 C C   . VAL B 1 308 ? 33.974  53.942 25.899 1.00 28.97 ? 308 VAL B C   1 
ATOM   5345 O O   . VAL B 1 308 ? 34.790  53.030 25.687 1.00 27.05 ? 308 VAL B O   1 
ATOM   5346 C CB  . VAL B 1 308 ? 33.743  55.132 23.744 1.00 26.60 ? 308 VAL B CB  1 
ATOM   5347 C CG1 . VAL B 1 308 ? 32.281  54.708 23.668 1.00 25.47 ? 308 VAL B CG1 1 
ATOM   5348 C CG2 . VAL B 1 308 ? 33.969  56.443 22.966 1.00 24.08 ? 308 VAL B CG2 1 
ATOM   5349 N N   . PHE B 1 309 ? 32.944  53.807 26.729 1.00 25.74 ? 309 PHE B N   1 
ATOM   5350 C CA  . PHE B 1 309 ? 32.723  52.545 27.447 1.00 24.77 ? 309 PHE B CA  1 
ATOM   5351 C C   . PHE B 1 309 ? 31.278  52.327 27.851 1.00 26.19 ? 309 PHE B C   1 
ATOM   5352 O O   . PHE B 1 309 ? 30.476  53.269 27.857 1.00 24.68 ? 309 PHE B O   1 
ATOM   5353 C CB  . PHE B 1 309 ? 33.603  52.476 28.706 1.00 25.29 ? 309 PHE B CB  1 
ATOM   5354 C CG  . PHE B 1 309 ? 33.478  53.681 29.614 1.00 28.28 ? 309 PHE B CG  1 
ATOM   5355 C CD1 . PHE B 1 309 ? 34.141  54.867 29.316 1.00 27.52 ? 309 PHE B CD1 1 
ATOM   5356 C CD2 . PHE B 1 309 ? 32.690  53.630 30.760 1.00 27.33 ? 309 PHE B CD2 1 
ATOM   5357 C CE1 . PHE B 1 309 ? 34.022  55.981 30.136 1.00 29.57 ? 309 PHE B CE1 1 
ATOM   5358 C CE2 . PHE B 1 309 ? 32.566  54.753 31.596 1.00 28.35 ? 309 PHE B CE2 1 
ATOM   5359 C CZ  . PHE B 1 309 ? 33.230  55.924 31.281 1.00 24.46 ? 309 PHE B CZ  1 
ATOM   5360 N N   . GLY B 1 310 ? 30.954  51.072 28.172 1.00 19.63 ? 310 GLY B N   1 
ATOM   5361 C CA  . GLY B 1 310 ? 29.612  50.736 28.610 1.00 23.55 ? 310 GLY B CA  1 
ATOM   5362 C C   . GLY B 1 310 ? 29.658  50.530 30.115 1.00 23.05 ? 310 GLY B C   1 
ATOM   5363 O O   . GLY B 1 310 ? 30.748  50.328 30.667 1.00 27.56 ? 310 GLY B O   1 
ATOM   5364 N N   . SER B 1 311 ? 28.508  50.596 30.788 1.00 25.47 ? 311 SER B N   1 
ATOM   5365 C CA  . SER B 1 311 ? 28.463  50.383 32.235 1.00 25.61 ? 311 SER B CA  1 
ATOM   5366 C C   . SER B 1 311 ? 27.272  49.495 32.568 1.00 23.23 ? 311 SER B C   1 
ATOM   5367 O O   . SER B 1 311 ? 26.202  49.660 32.006 1.00 25.27 ? 311 SER B O   1 
ATOM   5368 C CB  . SER B 1 311 ? 28.316  51.715 32.998 1.00 25.40 ? 311 SER B CB  1 
ATOM   5369 O OG  . SER B 1 311 ? 26.973  52.189 32.947 1.00 24.09 ? 311 SER B OG  1 
ATOM   5370 N N   . GLY B 1 312 ? 27.449  48.568 33.501 1.00 22.45 ? 312 GLY B N   1 
ATOM   5371 C CA  . GLY B 1 312 ? 26.344  47.704 33.863 1.00 23.84 ? 312 GLY B CA  1 
ATOM   5372 C C   . GLY B 1 312 ? 26.812  46.759 34.933 1.00 23.83 ? 312 GLY B C   1 
ATOM   5373 O O   . GLY B 1 312 ? 28.016  46.603 35.128 1.00 25.60 ? 312 GLY B O   1 
ATOM   5374 N N   . THR B 1 313 ? 25.880  46.105 35.617 1.00 30.86 ? 313 THR B N   1 
ATOM   5375 C CA  . THR B 1 313 ? 26.250  45.180 36.702 1.00 30.26 ? 313 THR B CA  1 
ATOM   5376 C C   . THR B 1 313 ? 27.141  44.009 36.254 1.00 30.73 ? 313 THR B C   1 
ATOM   5377 O O   . THR B 1 313 ? 28.077  43.618 36.960 1.00 28.88 ? 313 THR B O   1 
ATOM   5378 C CB  . THR B 1 313 ? 24.977  44.641 37.393 1.00 30.78 ? 313 THR B CB  1 
ATOM   5379 O OG1 . THR B 1 313 ? 24.294  45.731 38.019 1.00 25.71 ? 313 THR B OG1 1 
ATOM   5380 C CG2 . THR B 1 313 ? 25.311  43.582 38.452 1.00 25.88 ? 313 THR B CG2 1 
ATOM   5381 N N   . ALA B 1 314 ? 26.876  43.476 35.065 1.00 30.68 ? 314 ALA B N   1 
ATOM   5382 C CA  . ALA B 1 314 ? 27.635  42.334 34.554 1.00 34.79 ? 314 ALA B CA  1 
ATOM   5383 C C   . ALA B 1 314 ? 29.055  42.722 34.195 1.00 39.06 ? 314 ALA B C   1 
ATOM   5384 O O   . ALA B 1 314 ? 30.004  41.991 34.473 1.00 41.07 ? 314 ALA B O   1 
ATOM   5385 C CB  . ALA B 1 314 ? 26.934  41.747 33.341 1.00 34.73 ? 314 ALA B CB  1 
ATOM   5386 N N   . CYS B 1 315 ? 29.189  43.886 33.575 1.00 38.77 ? 315 CYS B N   1 
ATOM   5387 C CA  . CYS B 1 315 ? 30.481  44.407 33.179 1.00 38.38 ? 315 CYS B CA  1 
ATOM   5388 C C   . CYS B 1 315 ? 30.503  45.859 33.600 1.00 39.50 ? 315 CYS B C   1 
ATOM   5389 O O   . CYS B 1 315 ? 30.115  46.744 32.825 1.00 44.04 ? 315 CYS B O   1 
ATOM   5390 C CB  . CYS B 1 315 ? 30.649  44.303 31.669 1.00 37.94 ? 315 CYS B CB  1 
ATOM   5391 S SG  . CYS B 1 315 ? 32.256  44.869 31.113 1.00 51.34 ? 315 CYS B SG  1 
ATOM   5392 N N   . GLN B 1 316 ? 30.964  46.090 34.828 1.00 33.97 ? 316 GLN B N   1 
ATOM   5393 C CA  . GLN B 1 316 ? 31.012  47.415 35.435 1.00 30.58 ? 316 GLN B CA  1 
ATOM   5394 C C   . GLN B 1 316 ? 31.431  48.576 34.532 1.00 29.13 ? 316 GLN B C   1 
ATOM   5395 O O   . GLN B 1 316 ? 30.681  49.533 34.393 1.00 26.67 ? 316 GLN B O   1 
ATOM   5396 C CB  . GLN B 1 316 ? 31.893  47.353 36.679 1.00 39.34 ? 316 GLN B CB  1 
ATOM   5397 C CG  . GLN B 1 316 ? 31.455  46.250 37.643 1.00 42.22 ? 316 GLN B CG  1 
ATOM   5398 C CD  . GLN B 1 316 ? 31.066  46.789 39.004 1.00 41.26 ? 316 GLN B CD  1 
ATOM   5399 O OE1 . GLN B 1 316 ? 31.879  47.422 39.672 1.00 46.45 ? 316 GLN B OE1 1 
ATOM   5400 N NE2 . GLN B 1 316 ? 29.824  46.543 39.422 1.00 36.21 ? 316 GLN B NE2 1 
ATOM   5401 N N   . VAL B 1 317 ? 32.625  48.503 33.944 1.00 24.96 ? 317 VAL B N   1 
ATOM   5402 C CA  . VAL B 1 317 ? 33.118  49.541 33.037 1.00 25.70 ? 317 VAL B CA  1 
ATOM   5403 C C   . VAL B 1 317 ? 33.778  48.764 31.895 1.00 27.44 ? 317 VAL B C   1 
ATOM   5404 O O   . VAL B 1 317 ? 34.838  48.171 32.068 1.00 29.50 ? 317 VAL B O   1 
ATOM   5405 C CB  . VAL B 1 317 ? 34.175  50.461 33.707 1.00 28.22 ? 317 VAL B CB  1 
ATOM   5406 C CG1 . VAL B 1 317 ? 34.269  51.760 32.946 1.00 24.98 ? 317 VAL B CG1 1 
ATOM   5407 C CG2 . VAL B 1 317 ? 33.811  50.718 35.169 1.00 30.46 ? 317 VAL B CG2 1 
ATOM   5408 N N   . CYS B 1 318 ? 33.140  48.788 30.732 1.00 26.25 ? 318 CYS B N   1 
ATOM   5409 C CA  . CYS B 1 318 ? 33.575  48.046 29.564 1.00 27.80 ? 318 CYS B CA  1 
ATOM   5410 C C   . CYS B 1 318 ? 34.087  48.907 28.414 1.00 22.56 ? 318 CYS B C   1 
ATOM   5411 O O   . CYS B 1 318 ? 33.318  49.586 27.749 1.00 25.11 ? 318 CYS B O   1 
ATOM   5412 C CB  . CYS B 1 318 ? 32.399  47.202 29.090 1.00 29.02 ? 318 CYS B CB  1 
ATOM   5413 S SG  . CYS B 1 318 ? 32.836  45.966 27.888 1.00 44.47 ? 318 CYS B SG  1 
ATOM   5414 N N   . PRO B 1 319 ? 35.391  48.833 28.120 1.00 23.44 ? 319 PRO B N   1 
ATOM   5415 C CA  . PRO B 1 319 ? 36.002  49.622 27.047 1.00 26.76 ? 319 PRO B CA  1 
ATOM   5416 C C   . PRO B 1 319 ? 35.468  49.292 25.662 1.00 28.00 ? 319 PRO B C   1 
ATOM   5417 O O   . PRO B 1 319 ? 35.144  48.144 25.364 1.00 23.73 ? 319 PRO B O   1 
ATOM   5418 C CB  . PRO B 1 319 ? 37.491  49.285 27.163 1.00 26.09 ? 319 PRO B CB  1 
ATOM   5419 C CG  . PRO B 1 319 ? 37.637  48.752 28.553 1.00 30.09 ? 319 PRO B CG  1 
ATOM   5420 C CD  . PRO B 1 319 ? 36.390  47.971 28.767 1.00 27.00 ? 319 PRO B CD  1 
ATOM   5421 N N   . VAL B 1 320 ? 35.360  50.308 24.818 1.00 24.88 ? 320 VAL B N   1 
ATOM   5422 C CA  . VAL B 1 320 ? 34.913  50.096 23.451 1.00 24.64 ? 320 VAL B CA  1 
ATOM   5423 C C   . VAL B 1 320 ? 36.063  50.550 22.557 1.00 24.97 ? 320 VAL B C   1 
ATOM   5424 O O   . VAL B 1 320 ? 36.593  51.643 22.734 1.00 30.66 ? 320 VAL B O   1 
ATOM   5425 C CB  . VAL B 1 320 ? 33.660  50.937 23.130 1.00 27.32 ? 320 VAL B CB  1 
ATOM   5426 C CG1 . VAL B 1 320 ? 33.339  50.875 21.609 1.00 20.13 ? 320 VAL B CG1 1 
ATOM   5427 C CG2 . VAL B 1 320 ? 32.490  50.438 23.957 1.00 21.93 ? 320 VAL B CG2 1 
ATOM   5428 N N   . HIS B 1 321 ? 36.438  49.729 21.587 1.00 30.19 ? 321 HIS B N   1 
ATOM   5429 C CA  . HIS B 1 321 ? 37.542  50.094 20.698 1.00 31.22 ? 321 HIS B CA  1 
ATOM   5430 C C   . HIS B 1 321 ? 37.151  50.231 19.232 1.00 31.79 ? 321 HIS B C   1 
ATOM   5431 O O   . HIS B 1 321 ? 37.905  50.806 18.431 1.00 35.52 ? 321 HIS B O   1 
ATOM   5432 C CB  . HIS B 1 321 ? 38.692  49.073 20.812 1.00 29.70 ? 321 HIS B CB  1 
ATOM   5433 C CG  . HIS B 1 321 ? 38.441  47.791 20.085 1.00 33.59 ? 321 HIS B CG  1 
ATOM   5434 N ND1 . HIS B 1 321 ? 37.660  46.781 20.598 1.00 39.87 ? 321 HIS B ND1 1 
ATOM   5435 C CD2 . HIS B 1 321 ? 38.859  47.363 18.871 1.00 36.50 ? 321 HIS B CD2 1 
ATOM   5436 C CE1 . HIS B 1 321 ? 37.607  45.784 19.733 1.00 34.79 ? 321 HIS B CE1 1 
ATOM   5437 N NE2 . HIS B 1 321 ? 38.325  46.113 18.675 1.00 38.66 ? 321 HIS B NE2 1 
ATOM   5438 N N   . ARG B 1 322 ? 35.983  49.716 18.865 1.00 28.79 ? 322 ARG B N   1 
ATOM   5439 C CA  . ARG B 1 322 ? 35.567  49.784 17.465 1.00 28.18 ? 322 ARG B CA  1 
ATOM   5440 C C   . ARG B 1 322 ? 34.060  49.856 17.318 1.00 26.57 ? 322 ARG B C   1 
ATOM   5441 O O   . ARG B 1 322 ? 33.322  49.181 18.023 1.00 24.94 ? 322 ARG B O   1 
ATOM   5442 C CB  . ARG B 1 322 ? 36.089  48.555 16.692 1.00 27.11 ? 322 ARG B CB  1 
ATOM   5443 C CG  . ARG B 1 322 ? 35.692  48.536 15.208 1.00 29.17 ? 322 ARG B CG  1 
ATOM   5444 C CD  . ARG B 1 322 ? 36.469  47.485 14.395 1.00 31.30 ? 322 ARG B CD  1 
ATOM   5445 N NE  . ARG B 1 322 ? 36.222  46.103 14.824 1.00 31.14 ? 322 ARG B NE  1 
ATOM   5446 C CZ  . ARG B 1 322 ? 35.278  45.318 14.312 1.00 27.77 ? 322 ARG B CZ  1 
ATOM   5447 N NH1 . ARG B 1 322 ? 34.488  45.773 13.345 1.00 28.67 ? 322 ARG B NH1 1 
ATOM   5448 N NH2 . ARG B 1 322 ? 35.123  44.083 14.770 1.00 28.23 ? 322 ARG B NH2 1 
ATOM   5449 N N   . ILE B 1 323 ? 33.607  50.698 16.401 1.00 26.81 ? 323 ILE B N   1 
ATOM   5450 C CA  . ILE B 1 323 ? 32.183  50.821 16.150 1.00 29.57 ? 323 ILE B CA  1 
ATOM   5451 C C   . ILE B 1 323 ? 31.988  50.730 14.650 1.00 30.51 ? 323 ILE B C   1 
ATOM   5452 O O   . ILE B 1 323 ? 32.529  51.543 13.893 1.00 29.51 ? 323 ILE B O   1 
ATOM   5453 C CB  . ILE B 1 323 ? 31.640  52.164 16.682 1.00 27.78 ? 323 ILE B CB  1 
ATOM   5454 C CG1 . ILE B 1 323 ? 31.656  52.150 18.213 1.00 31.35 ? 323 ILE B CG1 1 
ATOM   5455 C CG2 . ILE B 1 323 ? 30.259  52.422 16.150 1.00 28.96 ? 323 ILE B CG2 1 
ATOM   5456 C CD1 . ILE B 1 323 ? 31.358  53.492 18.830 1.00 30.04 ? 323 ILE B CD1 1 
ATOM   5457 N N   . LEU B 1 324 ? 31.242  49.714 14.218 1.00 31.66 ? 324 LEU B N   1 
ATOM   5458 C CA  . LEU B 1 324 ? 30.952  49.526 12.798 1.00 30.36 ? 324 LEU B CA  1 
ATOM   5459 C C   . LEU B 1 324 ? 29.675  50.285 12.469 1.00 34.95 ? 324 LEU B C   1 
ATOM   5460 O O   . LEU B 1 324 ? 28.576  49.795 12.704 1.00 36.63 ? 324 LEU B O   1 
ATOM   5461 C CB  . LEU B 1 324 ? 30.762  48.048 12.500 1.00 32.89 ? 324 LEU B CB  1 
ATOM   5462 C CG  . LEU B 1 324 ? 30.434  47.649 11.066 1.00 35.09 ? 324 LEU B CG  1 
ATOM   5463 C CD1 . LEU B 1 324 ? 31.281  48.436 10.080 1.00 40.76 ? 324 LEU B CD1 1 
ATOM   5464 C CD2 . LEU B 1 324 ? 30.682  46.156 10.926 1.00 38.07 ? 324 LEU B CD2 1 
ATOM   5465 N N   . TYR B 1 325 ? 29.823  51.488 11.931 1.00 35.88 ? 325 TYR B N   1 
ATOM   5466 C CA  . TYR B 1 325 ? 28.671  52.317 11.609 1.00 40.91 ? 325 TYR B CA  1 
ATOM   5467 C C   . TYR B 1 325 ? 28.153  52.036 10.196 1.00 45.05 ? 325 TYR B C   1 
ATOM   5468 O O   . TYR B 1 325 ? 27.586  50.964 9.955  1.00 53.65 ? 325 TYR B O   1 
ATOM   5469 C CB  . TYR B 1 325 ? 29.050  53.788 11.777 1.00 37.70 ? 325 TYR B CB  1 
ATOM   5470 C CG  . TYR B 1 325 ? 27.923  54.790 11.660 1.00 36.47 ? 325 TYR B CG  1 
ATOM   5471 C CD1 . TYR B 1 325 ? 28.181  56.094 11.232 1.00 42.18 ? 325 TYR B CD1 1 
ATOM   5472 C CD2 . TYR B 1 325 ? 26.616  54.461 12.000 1.00 40.43 ? 325 TYR B CD2 1 
ATOM   5473 C CE1 . TYR B 1 325 ? 27.172  57.043 11.144 1.00 39.71 ? 325 TYR B CE1 1 
ATOM   5474 C CE2 . TYR B 1 325 ? 25.592  55.407 11.918 1.00 39.41 ? 325 TYR B CE2 1 
ATOM   5475 C CZ  . TYR B 1 325 ? 25.878  56.694 11.489 1.00 42.00 ? 325 TYR B CZ  1 
ATOM   5476 O OH  . TYR B 1 325 ? 24.879  57.643 11.396 1.00 37.79 ? 325 TYR B OH  1 
ATOM   5477 N N   . LYS B 1 326 ? 28.324  52.974 9.264  1.00 44.49 ? 326 LYS B N   1 
ATOM   5478 C CA  . LYS B 1 326 ? 27.839  52.749 7.893  1.00 46.95 ? 326 LYS B CA  1 
ATOM   5479 C C   . LYS B 1 326 ? 28.839  51.929 7.087  1.00 47.00 ? 326 LYS B C   1 
ATOM   5480 O O   . LYS B 1 326 ? 29.583  52.476 6.276  1.00 48.42 ? 326 LYS B O   1 
ATOM   5481 C CB  . LYS B 1 326 ? 27.575  54.077 7.184  1.00 43.30 ? 326 LYS B CB  1 
ATOM   5482 C CG  . LYS B 1 326 ? 26.273  54.745 7.607  1.00 47.32 ? 326 LYS B CG  1 
ATOM   5483 C CD  . LYS B 1 326 ? 25.071  53.989 7.056  1.00 49.21 ? 326 LYS B CD  1 
ATOM   5484 C CE  . LYS B 1 326 ? 23.967  53.844 8.091  1.00 52.68 ? 326 LYS B CE  1 
ATOM   5485 N NZ  . LYS B 1 326 ? 24.383  52.971 9.228  1.00 53.73 ? 326 LYS B NZ  1 
ATOM   5486 N N   . ASP B 1 327 ? 28.865  50.617 7.322  1.00 44.93 ? 327 ASP B N   1 
ATOM   5487 C CA  . ASP B 1 327 ? 29.792  49.741 6.617  1.00 47.18 ? 327 ASP B CA  1 
ATOM   5488 C C   . ASP B 1 327 ? 31.226  50.165 6.928  1.00 48.51 ? 327 ASP B C   1 
ATOM   5489 O O   . ASP B 1 327 ? 32.190  49.489 6.549  1.00 47.58 ? 327 ASP B O   1 
ATOM   5490 C CB  . ASP B 1 327 ? 29.557  49.835 5.108  1.00 45.38 ? 327 ASP B CB  1 
ATOM   5491 C CG  . ASP B 1 327 ? 28.560  48.811 4.606  1.00 53.13 ? 327 ASP B CG  1 
ATOM   5492 O OD1 . ASP B 1 327 ? 27.401  48.824 5.069  1.00 54.13 ? 327 ASP B OD1 1 
ATOM   5493 O OD2 . ASP B 1 327 ? 28.943  47.988 3.742  1.00 59.37 ? 327 ASP B OD2 1 
ATOM   5494 N N   . ARG B 1 328 ? 31.341  51.286 7.633  1.00 45.88 ? 328 ARG B N   1 
ATOM   5495 C CA  . ARG B 1 328 ? 32.621  51.879 7.990  1.00 46.55 ? 328 ARG B CA  1 
ATOM   5496 C C   . ARG B 1 328 ? 33.061  51.663 9.441  1.00 46.57 ? 328 ARG B C   1 
ATOM   5497 O O   . ARG B 1 328 ? 32.355  52.018 10.386 1.00 43.80 ? 328 ARG B O   1 
ATOM   5498 C CB  . ARG B 1 328 ? 32.543  53.367 7.652  1.00 46.88 ? 328 ARG B CB  1 
ATOM   5499 C CG  . ARG B 1 328 ? 33.535  54.295 8.312  1.00 49.25 ? 328 ARG B CG  1 
ATOM   5500 C CD  . ARG B 1 328 ? 33.505  55.609 7.524  1.00 55.11 ? 328 ARG B CD  1 
ATOM   5501 N NE  . ARG B 1 328 ? 33.591  56.833 8.328  1.00 48.95 ? 328 ARG B NE  1 
ATOM   5502 C CZ  . ARG B 1 328 ? 34.658  57.207 9.025  1.00 50.30 ? 328 ARG B CZ  1 
ATOM   5503 N NH1 . ARG B 1 328 ? 35.749  56.448 9.038  1.00 49.08 ? 328 ARG B NH1 1 
ATOM   5504 N NH2 . ARG B 1 328 ? 34.643  58.363 9.680  1.00 50.97 ? 328 ARG B NH2 1 
ATOM   5505 N N   . ASN B 1 329 ? 34.240  51.072 9.603  1.00 43.32 ? 329 ASN B N   1 
ATOM   5506 C CA  . ASN B 1 329 ? 34.784  50.820 10.929 1.00 41.63 ? 329 ASN B CA  1 
ATOM   5507 C C   . ASN B 1 329 ? 35.361  52.081 11.511 1.00 39.76 ? 329 ASN B C   1 
ATOM   5508 O O   . ASN B 1 329 ? 36.150  52.770 10.859 1.00 40.91 ? 329 ASN B O   1 
ATOM   5509 C CB  . ASN B 1 329 ? 35.876  49.761 10.874 1.00 41.97 ? 329 ASN B CB  1 
ATOM   5510 C CG  . ASN B 1 329 ? 35.317  48.380 10.717 1.00 45.59 ? 329 ASN B CG  1 
ATOM   5511 O OD1 . ASN B 1 329 ? 34.540  47.917 11.562 1.00 40.42 ? 329 ASN B OD1 1 
ATOM   5512 N ND2 . ASN B 1 329 ? 35.694  47.705 9.629  1.00 47.75 ? 329 ASN B ND2 1 
ATOM   5513 N N   . LEU B 1 330 ? 34.959  52.386 12.737 1.00 35.14 ? 330 LEU B N   1 
ATOM   5514 C CA  . LEU B 1 330 ? 35.455  53.560 13.422 1.00 33.83 ? 330 LEU B CA  1 
ATOM   5515 C C   . LEU B 1 330 ? 36.329  53.090 14.571 1.00 32.85 ? 330 LEU B C   1 
ATOM   5516 O O   . LEU B 1 330 ? 35.868  52.371 15.460 1.00 34.44 ? 330 LEU B O   1 
ATOM   5517 C CB  . LEU B 1 330 ? 34.299  54.393 13.969 1.00 34.67 ? 330 LEU B CB  1 
ATOM   5518 C CG  . LEU B 1 330 ? 33.263  54.852 12.946 1.00 40.13 ? 330 LEU B CG  1 
ATOM   5519 C CD1 . LEU B 1 330 ? 32.046  55.418 13.666 1.00 41.11 ? 330 LEU B CD1 1 
ATOM   5520 C CD2 . LEU B 1 330 ? 33.883  55.892 12.023 1.00 41.35 ? 330 LEU B CD2 1 
ATOM   5521 N N   . HIS B 1 331 ? 37.600  53.473 14.554 1.00 30.72 ? 331 HIS B N   1 
ATOM   5522 C CA  . HIS B 1 331 ? 38.468  53.074 15.643 1.00 32.24 ? 331 HIS B CA  1 
ATOM   5523 C C   . HIS B 1 331 ? 38.198  54.015 16.799 1.00 31.02 ? 331 HIS B C   1 
ATOM   5524 O O   . HIS B 1 331 ? 38.117  55.235 16.603 1.00 37.51 ? 331 HIS B O   1 
ATOM   5525 C CB  . HIS B 1 331 ? 39.951  53.176 15.260 1.00 27.93 ? 331 HIS B CB  1 
ATOM   5526 C CG  . HIS B 1 331 ? 40.869  52.848 16.392 1.00 27.66 ? 331 HIS B CG  1 
ATOM   5527 N ND1 . HIS B 1 331 ? 40.998  51.570 16.897 1.00 32.41 ? 331 HIS B ND1 1 
ATOM   5528 C CD2 . HIS B 1 331 ? 41.618  53.647 17.189 1.00 23.64 ? 331 HIS B CD2 1 
ATOM   5529 C CE1 . HIS B 1 331 ? 41.782  51.598 17.960 1.00 30.22 ? 331 HIS B CE1 1 
ATOM   5530 N NE2 . HIS B 1 331 ? 42.169  52.847 18.158 1.00 27.15 ? 331 HIS B NE2 1 
ATOM   5531 N N   . ILE B 1 332 ? 38.044  53.460 17.995 1.00 31.33 ? 332 ILE B N   1 
ATOM   5532 C CA  . ILE B 1 332 ? 37.806  54.288 19.173 1.00 28.86 ? 332 ILE B CA  1 
ATOM   5533 C C   . ILE B 1 332 ? 39.090  54.197 19.980 1.00 28.63 ? 332 ILE B C   1 
ATOM   5534 O O   . ILE B 1 332 ? 39.421  53.134 20.492 1.00 28.28 ? 332 ILE B O   1 
ATOM   5535 C CB  . ILE B 1 332 ? 36.629  53.760 19.985 1.00 28.46 ? 332 ILE B CB  1 
ATOM   5536 C CG1 . ILE B 1 332 ? 35.445  53.482 19.051 1.00 28.63 ? 332 ILE B CG1 1 
ATOM   5537 C CG2 . ILE B 1 332 ? 36.240  54.790 21.049 1.00 30.67 ? 332 ILE B CG2 1 
ATOM   5538 C CD1 . ILE B 1 332 ? 34.998  54.691 18.235 1.00 25.76 ? 332 ILE B CD1 1 
ATOM   5539 N N   . PRO B 1 333 ? 39.817  55.320 20.124 1.00 26.93 ? 333 PRO B N   1 
ATOM   5540 C CA  . PRO B 1 333 ? 41.088  55.377 20.858 1.00 31.88 ? 333 PRO B CA  1 
ATOM   5541 C C   . PRO B 1 333 ? 41.077  55.075 22.354 1.00 31.51 ? 333 PRO B C   1 
ATOM   5542 O O   . PRO B 1 333 ? 42.040  55.424 23.046 1.00 33.61 ? 333 PRO B O   1 
ATOM   5543 C CB  . PRO B 1 333 ? 41.601  56.803 20.597 1.00 32.58 ? 333 PRO B CB  1 
ATOM   5544 C CG  . PRO B 1 333 ? 40.590  57.441 19.657 1.00 29.61 ? 333 PRO B CG  1 
ATOM   5545 C CD  . PRO B 1 333 ? 39.317  56.675 19.852 1.00 29.34 ? 333 PRO B CD  1 
ATOM   5546 N N   . THR B 1 334 ? 40.033  54.417 22.855 1.00 30.91 ? 334 THR B N   1 
ATOM   5547 C CA  . THR B 1 334 ? 39.946  54.132 24.292 1.00 28.48 ? 334 THR B CA  1 
ATOM   5548 C C   . THR B 1 334 ? 41.209  53.561 24.926 1.00 29.46 ? 334 THR B C   1 
ATOM   5549 O O   . THR B 1 334 ? 41.729  54.135 25.880 1.00 30.95 ? 334 THR B O   1 
ATOM   5550 C CB  . THR B 1 334 ? 38.773  53.199 24.618 1.00 29.63 ? 334 THR B CB  1 
ATOM   5551 O OG1 . THR B 1 334 ? 37.562  53.775 24.126 1.00 33.50 ? 334 THR B OG1 1 
ATOM   5552 C CG2 . THR B 1 334 ? 38.649  53.014 26.119 1.00 22.11 ? 334 THR B CG2 1 
ATOM   5553 N N   . MET B 1 335 ? 41.707  52.440 24.408 1.00 29.39 ? 335 MET B N   1 
ATOM   5554 C CA  . MET B 1 335 ? 42.920  51.839 24.970 1.00 35.33 ? 335 MET B CA  1 
ATOM   5555 C C   . MET B 1 335 ? 44.190  52.693 24.734 1.00 33.76 ? 335 MET B C   1 
ATOM   5556 O O   . MET B 1 335 ? 45.071  52.715 25.580 1.00 37.13 ? 335 MET B O   1 
ATOM   5557 C CB  . MET B 1 335 ? 43.118  50.417 24.420 1.00 35.70 ? 335 MET B CB  1 
ATOM   5558 C CG  . MET B 1 335 ? 41.892  49.499 24.583 1.00 35.62 ? 335 MET B CG  1 
ATOM   5559 S SD  . MET B 1 335 ? 41.169  49.384 26.272 1.00 35.63 ? 335 MET B SD  1 
ATOM   5560 C CE  . MET B 1 335 ? 42.172  48.118 26.984 1.00 36.41 ? 335 MET B CE  1 
ATOM   5561 N N   . GLU B 1 336 ? 44.264  53.400 23.605 1.00 35.92 ? 336 GLU B N   1 
ATOM   5562 C CA  . GLU B 1 336 ? 45.417  54.252 23.293 1.00 40.61 ? 336 GLU B CA  1 
ATOM   5563 C C   . GLU B 1 336 ? 45.543  55.281 24.402 1.00 45.98 ? 336 GLU B C   1 
ATOM   5564 O O   . GLU B 1 336 ? 46.603  55.427 25.021 1.00 45.19 ? 336 GLU B O   1 
ATOM   5565 C CB  . GLU B 1 336 ? 45.240  54.999 21.964 1.00 33.62 ? 336 GLU B CB  1 
ATOM   5566 C CG  . GLU B 1 336 ? 45.204  54.117 20.723 1.00 38.65 ? 336 GLU B CG  1 
ATOM   5567 C CD  . GLU B 1 336 ? 44.198  53.000 20.846 1.00 35.22 ? 336 GLU B CD  1 
ATOM   5568 O OE1 . GLU B 1 336 ? 43.044  53.263 21.223 1.00 45.47 ? 336 GLU B OE1 1 
ATOM   5569 O OE2 . GLU B 1 336 ? 44.558  51.845 20.580 1.00 50.49 ? 336 GLU B OE2 1 
ATOM   5570 N N   . ASN B 1 337 ? 44.476  56.044 24.610 1.00 47.25 ? 337 ASN B N   1 
ATOM   5571 C CA  . ASN B 1 337 ? 44.492  57.011 25.686 1.00 50.94 ? 337 ASN B CA  1 
ATOM   5572 C C   . ASN B 1 337 ? 44.586  56.022 26.791 1.00 52.77 ? 337 ASN B C   1 
ATOM   5573 O O   . ASN B 1 337 ? 43.632  55.287 27.003 1.00 57.94 ? 337 ASN B O   1 
ATOM   5574 C CB  . ASN B 1 337 ? 43.164  57.748 25.789 1.00 47.59 ? 337 ASN B CB  1 
ATOM   5575 C CG  . ASN B 1 337 ? 43.009  58.790 24.718 1.00 51.55 ? 337 ASN B CG  1 
ATOM   5576 O OD1 . ASN B 1 337 ? 43.583  59.877 24.810 1.00 50.16 ? 337 ASN B OD1 1 
ATOM   5577 N ND2 . ASN B 1 337 ? 42.251  58.461 23.674 1.00 46.70 ? 337 ASN B ND2 1 
ATOM   5578 N N   . GLY B 1 338 ? 45.747  55.941 27.439 1.00 58.23 ? 338 GLY B N   1 
ATOM   5579 C CA  . GLY B 1 338 ? 45.898  55.003 28.533 1.00 53.33 ? 338 GLY B CA  1 
ATOM   5580 C C   . GLY B 1 338 ? 44.477  54.950 28.999 1.00 48.90 ? 338 GLY B C   1 
ATOM   5581 O O   . GLY B 1 338 ? 43.872  56.026 29.174 1.00 47.36 ? 338 GLY B O   1 
ATOM   5582 N N   . PRO B 1 339 ? 43.897  53.743 29.165 1.00 46.41 ? 339 PRO B N   1 
ATOM   5583 C CA  . PRO B 1 339 ? 42.498  53.598 29.605 1.00 36.91 ? 339 PRO B CA  1 
ATOM   5584 C C   . PRO B 1 339 ? 42.278  54.249 30.971 1.00 35.08 ? 339 PRO B C   1 
ATOM   5585 O O   . PRO B 1 339 ? 41.700  53.640 31.869 1.00 32.69 ? 339 PRO B O   1 
ATOM   5586 C CB  . PRO B 1 339 ? 42.289  52.082 29.660 1.00 38.27 ? 339 PRO B CB  1 
ATOM   5587 C CG  . PRO B 1 339 ? 43.568  51.473 29.074 1.00 43.71 ? 339 PRO B CG  1 
ATOM   5588 C CD  . PRO B 1 339 ? 44.644  52.480 29.321 1.00 35.88 ? 339 PRO B CD  1 
ATOM   5589 N N   . GLU B 1 340 ? 42.734  55.494 31.092 1.00 33.20 ? 340 GLU B N   1 
ATOM   5590 C CA  . GLU B 1 340 ? 42.681  56.289 32.316 1.00 34.07 ? 340 GLU B CA  1 
ATOM   5591 C C   . GLU B 1 340 ? 41.426  56.305 33.175 1.00 30.19 ? 340 GLU B C   1 
ATOM   5592 O O   . GLU B 1 340 ? 41.441  55.806 34.306 1.00 32.44 ? 340 GLU B O   1 
ATOM   5593 C CB  . GLU B 1 340 ? 43.038  57.742 32.004 1.00 41.79 ? 340 GLU B CB  1 
ATOM   5594 C CG  . GLU B 1 340 ? 44.493  58.087 32.211 1.00 44.56 ? 340 GLU B CG  1 
ATOM   5595 C CD  . GLU B 1 340 ? 44.673  59.535 32.609 1.00 49.29 ? 340 GLU B CD  1 
ATOM   5596 O OE1 . GLU B 1 340 ? 44.442  59.855 33.797 1.00 46.24 ? 340 GLU B OE1 1 
ATOM   5597 O OE2 . GLU B 1 340 ? 45.026  60.354 31.730 1.00 54.75 ? 340 GLU B OE2 1 
ATOM   5598 N N   . LEU B 1 341 ? 40.368  56.934 32.663 1.00 29.13 ? 341 LEU B N   1 
ATOM   5599 C CA  . LEU B 1 341 ? 39.117  57.053 33.403 1.00 26.97 ? 341 LEU B CA  1 
ATOM   5600 C C   . LEU B 1 341 ? 38.541  55.700 33.740 1.00 28.39 ? 341 LEU B C   1 
ATOM   5601 O O   . LEU B 1 341 ? 38.160  55.449 34.888 1.00 28.68 ? 341 LEU B O   1 
ATOM   5602 C CB  . LEU B 1 341 ? 38.112  57.900 32.624 1.00 27.99 ? 341 LEU B CB  1 
ATOM   5603 C CG  . LEU B 1 341 ? 36.810  58.239 33.354 1.00 28.28 ? 341 LEU B CG  1 
ATOM   5604 C CD1 . LEU B 1 341 ? 37.116  58.659 34.778 1.00 27.28 ? 341 LEU B CD1 1 
ATOM   5605 C CD2 . LEU B 1 341 ? 36.069  59.347 32.619 1.00 25.61 ? 341 LEU B CD2 1 
ATOM   5606 N N   . ILE B 1 342 ? 38.503  54.813 32.749 1.00 32.06 ? 342 ILE B N   1 
ATOM   5607 C CA  . ILE B 1 342 ? 37.999  53.468 32.977 1.00 28.04 ? 342 ILE B CA  1 
ATOM   5608 C C   . ILE B 1 342 ? 38.789  52.805 34.088 1.00 26.28 ? 342 ILE B C   1 
ATOM   5609 O O   . ILE B 1 342 ? 38.207  52.268 35.037 1.00 25.69 ? 342 ILE B O   1 
ATOM   5610 C CB  . ILE B 1 342 ? 38.094  52.590 31.719 1.00 28.40 ? 342 ILE B CB  1 
ATOM   5611 C CG1 . ILE B 1 342 ? 37.127  53.125 30.647 1.00 31.21 ? 342 ILE B CG1 1 
ATOM   5612 C CG2 . ILE B 1 342 ? 37.836  51.120 32.100 1.00 18.84 ? 342 ILE B CG2 1 
ATOM   5613 C CD1 . ILE B 1 342 ? 37.053  52.303 29.393 1.00 21.59 ? 342 ILE B CD1 1 
ATOM   5614 N N   . LEU B 1 343 ? 40.116  52.823 33.994 1.00 26.88 ? 343 LEU B N   1 
ATOM   5615 C CA  . LEU B 1 343 ? 40.896  52.182 35.062 1.00 27.38 ? 343 LEU B CA  1 
ATOM   5616 C C   . LEU B 1 343 ? 40.641  52.816 36.430 1.00 24.95 ? 343 LEU B C   1 
ATOM   5617 O O   . LEU B 1 343 ? 40.588  52.106 37.426 1.00 27.12 ? 343 LEU B O   1 
ATOM   5618 C CB  . LEU B 1 343 ? 42.398  52.193 34.741 1.00 29.67 ? 343 LEU B CB  1 
ATOM   5619 C CG  . LEU B 1 343 ? 42.773  51.327 33.525 1.00 34.05 ? 343 LEU B CG  1 
ATOM   5620 C CD1 . LEU B 1 343 ? 44.260  51.427 33.229 1.00 30.98 ? 343 LEU B CD1 1 
ATOM   5621 C CD2 . LEU B 1 343 ? 42.366  49.882 33.783 1.00 34.81 ? 343 LEU B CD2 1 
ATOM   5622 N N   . ARG B 1 344 ? 40.478  54.137 36.492 1.00 26.32 ? 344 ARG B N   1 
ATOM   5623 C CA  . ARG B 1 344 ? 40.229  54.767 37.781 1.00 30.79 ? 344 ARG B CA  1 
ATOM   5624 C C   . ARG B 1 344 ? 38.864  54.358 38.339 1.00 29.61 ? 344 ARG B C   1 
ATOM   5625 O O   . ARG B 1 344 ? 38.733  54.093 39.536 1.00 28.61 ? 344 ARG B O   1 
ATOM   5626 C CB  . ARG B 1 344 ? 40.327  56.295 37.688 1.00 33.27 ? 344 ARG B CB  1 
ATOM   5627 C CG  . ARG B 1 344 ? 39.639  56.968 38.860 1.00 37.38 ? 344 ARG B CG  1 
ATOM   5628 C CD  . ARG B 1 344 ? 40.460  58.003 39.615 1.00 39.75 ? 344 ARG B CD  1 
ATOM   5629 N NE  . ARG B 1 344 ? 40.408  59.347 39.045 1.00 37.69 ? 344 ARG B NE  1 
ATOM   5630 C CZ  . ARG B 1 344 ? 40.299  60.471 39.766 1.00 38.24 ? 344 ARG B CZ  1 
ATOM   5631 N NH1 . ARG B 1 344 ? 40.217  60.415 41.086 1.00 38.98 ? 344 ARG B NH1 1 
ATOM   5632 N NH2 . ARG B 1 344 ? 40.301  61.660 39.167 1.00 35.82 ? 344 ARG B NH2 1 
ATOM   5633 N N   . PHE B 1 345 ? 37.850  54.311 37.475 1.00 30.17 ? 345 PHE B N   1 
ATOM   5634 C CA  . PHE B 1 345 ? 36.507  53.898 37.891 1.00 28.33 ? 345 PHE B CA  1 
ATOM   5635 C C   . PHE B 1 345 ? 36.506  52.440 38.416 1.00 31.37 ? 345 PHE B C   1 
ATOM   5636 O O   . PHE B 1 345 ? 35.896  52.132 39.450 1.00 26.22 ? 345 PHE B O   1 
ATOM   5637 C CB  . PHE B 1 345 ? 35.542  53.996 36.704 1.00 26.54 ? 345 PHE B CB  1 
ATOM   5638 C CG  . PHE B 1 345 ? 34.931  55.360 36.507 1.00 29.75 ? 345 PHE B CG  1 
ATOM   5639 C CD1 . PHE B 1 345 ? 34.556  55.781 35.233 1.00 25.17 ? 345 PHE B CD1 1 
ATOM   5640 C CD2 . PHE B 1 345 ? 34.622  56.177 37.597 1.00 25.29 ? 345 PHE B CD2 1 
ATOM   5641 C CE1 . PHE B 1 345 ? 33.874  56.990 35.048 1.00 29.22 ? 345 PHE B CE1 1 
ATOM   5642 C CE2 . PHE B 1 345 ? 33.940  57.385 37.412 1.00 27.69 ? 345 PHE B CE2 1 
ATOM   5643 C CZ  . PHE B 1 345 ? 33.567  57.786 36.135 1.00 19.63 ? 345 PHE B CZ  1 
ATOM   5644 N N   . GLN B 1 346 ? 37.182  51.538 37.703 1.00 30.80 ? 346 GLN B N   1 
ATOM   5645 C CA  . GLN B 1 346 ? 37.216  50.130 38.122 1.00 27.43 ? 346 GLN B CA  1 
ATOM   5646 C C   . GLN B 1 346 ? 37.863  49.969 39.478 1.00 28.26 ? 346 GLN B C   1 
ATOM   5647 O O   . GLN B 1 346 ? 37.411  49.186 40.310 1.00 30.63 ? 346 GLN B O   1 
ATOM   5648 C CB  . GLN B 1 346 ? 37.972  49.275 37.112 1.00 30.24 ? 346 GLN B CB  1 
ATOM   5649 C CG  . GLN B 1 346 ? 37.430  49.370 35.708 1.00 41.78 ? 346 GLN B CG  1 
ATOM   5650 C CD  . GLN B 1 346 ? 38.003  48.305 34.805 1.00 47.46 ? 346 GLN B CD  1 
ATOM   5651 O OE1 . GLN B 1 346 ? 39.208  48.049 34.817 1.00 50.48 ? 346 GLN B OE1 1 
ATOM   5652 N NE2 . GLN B 1 346 ? 37.144  47.678 34.012 1.00 44.49 ? 346 GLN B NE2 1 
ATOM   5653 N N   . LYS B 1 347 ? 38.923  50.732 39.699 1.00 30.08 ? 347 LYS B N   1 
ATOM   5654 C CA  . LYS B 1 347 ? 39.634  50.658 40.956 1.00 30.30 ? 347 LYS B CA  1 
ATOM   5655 C C   . LYS B 1 347 ? 38.783  51.158 42.100 1.00 29.01 ? 347 LYS B C   1 
ATOM   5656 O O   . LYS B 1 347 ? 38.697  50.491 43.115 1.00 25.62 ? 347 LYS B O   1 
ATOM   5657 C CB  . LYS B 1 347 ? 40.928  51.465 40.896 1.00 32.51 ? 347 LYS B CB  1 
ATOM   5658 C CG  . LYS B 1 347 ? 41.802  51.267 42.126 1.00 31.40 ? 347 LYS B CG  1 
ATOM   5659 C CD  . LYS B 1 347 ? 43.140  51.951 41.945 1.00 36.92 ? 347 LYS B CD  1 
ATOM   5660 C CE  . LYS B 1 347 ? 44.034  51.724 43.158 1.00 35.95 ? 347 LYS B CE  1 
ATOM   5661 N NZ  . LYS B 1 347 ? 45.322  52.468 43.016 1.00 27.50 ? 347 LYS B NZ  1 
ATOM   5662 N N   . GLU B 1 348 ? 38.179  52.339 41.947 1.00 30.70 ? 348 GLU B N   1 
ATOM   5663 C CA  . GLU B 1 348 ? 37.345  52.883 43.019 1.00 33.33 ? 348 GLU B CA  1 
ATOM   5664 C C   . GLU B 1 348 ? 36.210  51.937 43.381 1.00 31.52 ? 348 GLU B C   1 
ATOM   5665 O O   . GLU B 1 348 ? 35.917  51.728 44.563 1.00 26.14 ? 348 GLU B O   1 
ATOM   5666 C CB  . GLU B 1 348 ? 36.751  54.242 42.642 1.00 31.87 ? 348 GLU B CB  1 
ATOM   5667 C CG  . GLU B 1 348 ? 37.556  55.445 43.114 1.00 45.68 ? 348 GLU B CG  1 
ATOM   5668 C CD  . GLU B 1 348 ? 36.668  56.627 43.461 1.00 42.68 ? 348 GLU B CD  1 
ATOM   5669 O OE1 . GLU B 1 348 ? 35.841  56.491 44.388 1.00 50.73 ? 348 GLU B OE1 1 
ATOM   5670 O OE2 . GLU B 1 348 ? 36.790  57.685 42.808 1.00 45.78 ? 348 GLU B OE2 1 
ATOM   5671 N N   . LEU B 1 349 ? 35.568  51.366 42.363 1.00 30.28 ? 349 LEU B N   1 
ATOM   5672 C CA  . LEU B 1 349 ? 34.462  50.440 42.595 1.00 29.69 ? 349 LEU B CA  1 
ATOM   5673 C C   . LEU B 1 349 ? 34.946  49.186 43.288 1.00 24.90 ? 349 LEU B C   1 
ATOM   5674 O O   . LEU B 1 349 ? 34.297  48.675 44.202 1.00 24.48 ? 349 LEU B O   1 
ATOM   5675 C CB  . LEU B 1 349 ? 33.775  50.066 41.271 1.00 28.84 ? 349 LEU B CB  1 
ATOM   5676 C CG  . LEU B 1 349 ? 32.915  51.179 40.678 1.00 27.02 ? 349 LEU B CG  1 
ATOM   5677 C CD1 . LEU B 1 349 ? 32.313  50.762 39.341 1.00 27.13 ? 349 LEU B CD1 1 
ATOM   5678 C CD2 . LEU B 1 349 ? 31.820  51.506 41.677 1.00 30.85 ? 349 LEU B CD2 1 
ATOM   5679 N N   . LYS B 1 350 ? 36.095  48.691 42.845 1.00 28.95 ? 350 LYS B N   1 
ATOM   5680 C CA  . LYS B 1 350 ? 36.680  47.488 43.426 1.00 27.59 ? 350 LYS B CA  1 
ATOM   5681 C C   . LYS B 1 350 ? 36.920  47.726 44.924 1.00 29.61 ? 350 LYS B C   1 
ATOM   5682 O O   . LYS B 1 350 ? 36.560  46.893 45.762 1.00 26.25 ? 350 LYS B O   1 
ATOM   5683 C CB  . LYS B 1 350 ? 37.996  47.178 42.715 1.00 30.52 ? 350 LYS B CB  1 
ATOM   5684 C CG  . LYS B 1 350 ? 38.608  45.846 43.046 1.00 29.82 ? 350 LYS B CG  1 
ATOM   5685 C CD  . LYS B 1 350 ? 39.696  45.499 42.035 1.00 39.88 ? 350 LYS B CD  1 
ATOM   5686 C CE  . LYS B 1 350 ? 40.881  46.453 42.112 1.00 44.79 ? 350 LYS B CE  1 
ATOM   5687 N NZ  . LYS B 1 350 ? 41.863  46.214 41.006 1.00 48.83 ? 350 LYS B NZ  1 
ATOM   5688 N N   . GLU B 1 351 ? 37.501  48.877 45.258 1.00 29.78 ? 351 GLU B N   1 
ATOM   5689 C CA  . GLU B 1 351 ? 37.767  49.206 46.660 1.00 31.15 ? 351 GLU B CA  1 
ATOM   5690 C C   . GLU B 1 351 ? 36.472  49.269 47.462 1.00 27.83 ? 351 GLU B C   1 
ATOM   5691 O O   . GLU B 1 351 ? 36.397  48.776 48.578 1.00 32.75 ? 351 GLU B O   1 
ATOM   5692 C CB  . GLU B 1 351 ? 38.507  50.545 46.760 1.00 22.90 ? 351 GLU B CB  1 
ATOM   5693 C CG  . GLU B 1 351 ? 39.874  50.515 46.118 1.00 31.05 ? 351 GLU B CG  1 
ATOM   5694 C CD  . GLU B 1 351 ? 40.620  51.817 46.285 1.00 28.14 ? 351 GLU B CD  1 
ATOM   5695 O OE1 . GLU B 1 351 ? 39.982  52.876 46.223 1.00 29.30 ? 351 GLU B OE1 1 
ATOM   5696 O OE2 . GLU B 1 351 ? 41.849  51.770 46.470 1.00 32.80 ? 351 GLU B OE2 1 
ATOM   5697 N N   . ILE B 1 352 ? 35.446  49.869 46.881 1.00 24.41 ? 352 ILE B N   1 
ATOM   5698 C CA  . ILE B 1 352 ? 34.161  49.998 47.571 1.00 22.41 ? 352 ILE B CA  1 
ATOM   5699 C C   . ILE B 1 352 ? 33.441  48.655 47.703 1.00 28.36 ? 352 ILE B C   1 
ATOM   5700 O O   . ILE B 1 352 ? 33.041  48.248 48.806 1.00 23.32 ? 352 ILE B O   1 
ATOM   5701 C CB  . ILE B 1 352 ? 33.267  50.998 46.829 1.00 21.84 ? 352 ILE B CB  1 
ATOM   5702 C CG1 . ILE B 1 352 ? 33.900  52.388 46.887 1.00 25.91 ? 352 ILE B CG1 1 
ATOM   5703 C CG2 . ILE B 1 352 ? 31.870  51.006 47.418 1.00 25.94 ? 352 ILE B CG2 1 
ATOM   5704 C CD1 . ILE B 1 352 ? 33.266  53.423 45.964 1.00 28.09 ? 352 ILE B CD1 1 
ATOM   5705 N N   . GLN B 1 353 ? 33.281  47.956 46.582 1.00 26.37 ? 353 GLN B N   1 
ATOM   5706 C CA  . GLN B 1 353 ? 32.578  46.667 46.591 1.00 28.73 ? 353 GLN B CA  1 
ATOM   5707 C C   . GLN B 1 353 ? 33.191  45.541 47.427 1.00 25.18 ? 353 GLN B C   1 
ATOM   5708 O O   . GLN B 1 353 ? 32.460  44.753 48.002 1.00 29.20 ? 353 GLN B O   1 
ATOM   5709 C CB  . GLN B 1 353 ? 32.363  46.190 45.146 1.00 26.94 ? 353 GLN B CB  1 
ATOM   5710 C CG  . GLN B 1 353 ? 31.530  47.192 44.370 1.00 16.85 ? 353 GLN B CG  1 
ATOM   5711 C CD  . GLN B 1 353 ? 31.461  46.914 42.874 1.00 25.80 ? 353 GLN B CD  1 
ATOM   5712 O OE1 . GLN B 1 353 ? 32.402  46.397 42.271 1.00 30.83 ? 353 GLN B OE1 1 
ATOM   5713 N NE2 . GLN B 1 353 ? 30.349  47.295 42.268 1.00 27.30 ? 353 GLN B NE2 1 
ATOM   5714 N N   . TYR B 1 354 ? 34.514  45.455 47.500 1.00 26.53 ? 354 TYR B N   1 
ATOM   5715 C CA  . TYR B 1 354 ? 35.124  44.397 48.286 1.00 33.18 ? 354 TYR B CA  1 
ATOM   5716 C C   . TYR B 1 354 ? 35.511  44.842 49.704 1.00 36.27 ? 354 TYR B C   1 
ATOM   5717 O O   . TYR B 1 354 ? 36.280  44.177 50.400 1.00 37.37 ? 354 TYR B O   1 
ATOM   5718 C CB  . TYR B 1 354 ? 36.321  43.803 47.537 1.00 34.74 ? 354 TYR B CB  1 
ATOM   5719 C CG  . TYR B 1 354 ? 35.905  43.069 46.280 1.00 32.90 ? 354 TYR B CG  1 
ATOM   5720 C CD1 . TYR B 1 354 ? 35.845  43.721 45.048 1.00 32.67 ? 354 TYR B CD1 1 
ATOM   5721 C CD2 . TYR B 1 354 ? 35.525  41.733 46.333 1.00 29.52 ? 354 TYR B CD2 1 
ATOM   5722 C CE1 . TYR B 1 354 ? 35.410  43.049 43.898 1.00 30.17 ? 354 TYR B CE1 1 
ATOM   5723 C CE2 . TYR B 1 354 ? 35.089  41.056 45.194 1.00 30.60 ? 354 TYR B CE2 1 
ATOM   5724 C CZ  . TYR B 1 354 ? 35.032  41.714 43.983 1.00 35.61 ? 354 TYR B CZ  1 
ATOM   5725 O OH  . TYR B 1 354 ? 34.590  41.037 42.864 1.00 34.31 ? 354 TYR B OH  1 
ATOM   5726 N N   . GLY B 1 355 ? 34.962  45.980 50.117 1.00 35.34 ? 355 GLY B N   1 
ATOM   5727 C CA  . GLY B 1 355 ? 35.195  46.491 51.458 1.00 36.33 ? 355 GLY B CA  1 
ATOM   5728 C C   . GLY B 1 355 ? 36.535  47.095 51.829 1.00 35.64 ? 355 GLY B C   1 
ATOM   5729 O O   . GLY B 1 355 ? 36.778  47.326 53.010 1.00 36.28 ? 355 GLY B O   1 
ATOM   5730 N N   . ILE B 1 356 ? 37.396  47.346 50.854 1.00 32.53 ? 356 ILE B N   1 
ATOM   5731 C CA  . ILE B 1 356 ? 38.692  47.954 51.115 1.00 33.91 ? 356 ILE B CA  1 
ATOM   5732 C C   . ILE B 1 356 ? 38.491  49.351 51.719 1.00 36.08 ? 356 ILE B C   1 
ATOM   5733 O O   . ILE B 1 356 ? 39.288  49.822 52.534 1.00 34.21 ? 356 ILE B O   1 
ATOM   5734 C CB  . ILE B 1 356 ? 39.506  48.068 49.821 1.00 36.63 ? 356 ILE B CB  1 
ATOM   5735 C CG1 . ILE B 1 356 ? 39.758  46.664 49.251 1.00 43.58 ? 356 ILE B CG1 1 
ATOM   5736 C CG2 . ILE B 1 356 ? 40.810  48.813 50.074 1.00 34.70 ? 356 ILE B CG2 1 
ATOM   5737 C CD1 . ILE B 1 356 ? 40.263  45.651 50.265 1.00 43.97 ? 356 ILE B CD1 1 
ATOM   5738 N N   . ARG B 1 357 ? 37.416  50.010 51.312 1.00 37.03 ? 357 ARG B N   1 
ATOM   5739 C CA  . ARG B 1 357 ? 37.082  51.336 51.822 1.00 38.70 ? 357 ARG B CA  1 
ATOM   5740 C C   . ARG B 1 357 ? 35.640  51.280 52.244 1.00 36.79 ? 357 ARG B C   1 
ATOM   5741 O O   . ARG B 1 357 ? 34.800  50.838 51.459 1.00 34.08 ? 357 ARG B O   1 
ATOM   5742 C CB  . ARG B 1 357 ? 37.207  52.397 50.736 1.00 41.70 ? 357 ARG B CB  1 
ATOM   5743 C CG  . ARG B 1 357 ? 38.573  52.526 50.147 1.00 44.83 ? 357 ARG B CG  1 
ATOM   5744 C CD  . ARG B 1 357 ? 38.646  53.777 49.317 1.00 47.49 ? 357 ARG B CD  1 
ATOM   5745 N NE  . ARG B 1 357 ? 40.029  54.122 49.037 1.00 53.42 ? 357 ARG B NE  1 
ATOM   5746 C CZ  . ARG B 1 357 ? 40.413  55.283 48.530 1.00 57.67 ? 357 ARG B CZ  1 
ATOM   5747 N NH1 . ARG B 1 357 ? 39.510  56.218 48.249 1.00 62.51 ? 357 ARG B NH1 1 
ATOM   5748 N NH2 . ARG B 1 357 ? 41.699  55.506 48.297 1.00 60.28 ? 357 ARG B NH2 1 
ATOM   5749 N N   . ALA B 1 358 ? 35.347  51.719 53.466 1.00 32.60 ? 358 ALA B N   1 
ATOM   5750 C CA  . ALA B 1 358 ? 33.973  51.720 53.962 1.00 31.86 ? 358 ALA B CA  1 
ATOM   5751 C C   . ALA B 1 358 ? 33.169  52.695 53.100 1.00 31.01 ? 358 ALA B C   1 
ATOM   5752 O O   . ALA B 1 358 ? 33.695  53.714 52.667 1.00 31.97 ? 358 ALA B O   1 
ATOM   5753 C CB  . ALA B 1 358 ? 33.936  52.157 55.429 1.00 33.11 ? 358 ALA B CB  1 
ATOM   5754 N N   . HIS B 1 359 ? 31.898  52.404 52.852 1.00 25.80 ? 359 HIS B N   1 
ATOM   5755 C CA  . HIS B 1 359 ? 31.084  53.289 52.018 1.00 28.48 ? 359 HIS B CA  1 
ATOM   5756 C C   . HIS B 1 359 ? 29.608  52.988 52.228 1.00 28.05 ? 359 HIS B C   1 
ATOM   5757 O O   . HIS B 1 359 ? 29.220  51.826 52.365 1.00 27.05 ? 359 HIS B O   1 
ATOM   5758 C CB  . HIS B 1 359 ? 31.455  53.105 50.539 1.00 27.19 ? 359 HIS B CB  1 
ATOM   5759 C CG  . HIS B 1 359 ? 31.024  54.237 49.659 1.00 28.26 ? 359 HIS B CG  1 
ATOM   5760 N ND1 . HIS B 1 359 ? 29.701  54.570 49.465 1.00 31.62 ? 359 HIS B ND1 1 
ATOM   5761 C CD2 . HIS B 1 359 ? 31.746  55.125 48.936 1.00 27.48 ? 359 HIS B CD2 1 
ATOM   5762 C CE1 . HIS B 1 359 ? 29.626  55.615 48.663 1.00 27.24 ? 359 HIS B CE1 1 
ATOM   5763 N NE2 . HIS B 1 359 ? 30.853  55.973 48.326 1.00 27.83 ? 359 HIS B NE2 1 
ATOM   5764 N N   . GLU B 1 360 ? 28.796  54.037 52.250 1.00 25.03 ? 360 GLU B N   1 
ATOM   5765 C CA  . GLU B 1 360 ? 27.359  53.910 52.460 1.00 34.06 ? 360 GLU B CA  1 
ATOM   5766 C C   . GLU B 1 360 ? 26.719  53.121 51.318 1.00 35.08 ? 360 GLU B C   1 
ATOM   5767 O O   . GLU B 1 360 ? 25.605  52.630 51.451 1.00 33.07 ? 360 GLU B O   1 
ATOM   5768 C CB  . GLU B 1 360 ? 26.702  55.295 52.529 1.00 41.40 ? 360 GLU B CB  1 
ATOM   5769 C CG  . GLU B 1 360 ? 25.504  55.427 53.514 1.00 52.83 ? 360 GLU B CG  1 
ATOM   5770 C CD  . GLU B 1 360 ? 24.358  54.416 53.290 1.00 57.10 ? 360 GLU B CD  1 
ATOM   5771 O OE1 . GLU B 1 360 ? 24.562  53.194 53.510 1.00 52.32 ? 360 GLU B OE1 1 
ATOM   5772 O OE2 . GLU B 1 360 ? 23.240  54.849 52.906 1.00 61.45 ? 360 GLU B OE2 1 
ATOM   5773 N N   . TRP B 1 361 ? 27.418  53.009 50.192 1.00 31.06 ? 361 TRP B N   1 
ATOM   5774 C CA  . TRP B 1 361 ? 26.880  52.265 49.063 1.00 30.65 ? 361 TRP B CA  1 
ATOM   5775 C C   . TRP B 1 361 ? 26.744  50.771 49.347 1.00 27.35 ? 361 TRP B C   1 
ATOM   5776 O O   . TRP B 1 361 ? 25.910  50.101 48.749 1.00 26.13 ? 361 TRP B O   1 
ATOM   5777 C CB  . TRP B 1 361 ? 27.757  52.463 47.823 1.00 25.47 ? 361 TRP B CB  1 
ATOM   5778 C CG  . TRP B 1 361 ? 27.531  53.778 47.148 1.00 24.31 ? 361 TRP B CG  1 
ATOM   5779 C CD1 . TRP B 1 361 ? 26.590  54.719 47.474 1.00 21.37 ? 361 TRP B CD1 1 
ATOM   5780 C CD2 . TRP B 1 361 ? 28.225  54.287 45.999 1.00 21.49 ? 361 TRP B CD2 1 
ATOM   5781 N NE1 . TRP B 1 361 ? 26.654  55.780 46.598 1.00 20.85 ? 361 TRP B NE1 1 
ATOM   5782 C CE2 . TRP B 1 361 ? 27.649  55.540 45.684 1.00 25.55 ? 361 TRP B CE2 1 
ATOM   5783 C CE3 . TRP B 1 361 ? 29.272  53.806 45.205 1.00 20.18 ? 361 TRP B CE3 1 
ATOM   5784 C CZ2 . TRP B 1 361 ? 28.086  56.320 44.603 1.00 23.26 ? 361 TRP B CZ2 1 
ATOM   5785 C CZ3 . TRP B 1 361 ? 29.705  54.582 44.123 1.00 25.18 ? 361 TRP B CZ3 1 
ATOM   5786 C CH2 . TRP B 1 361 ? 29.110  55.826 43.838 1.00 28.15 ? 361 TRP B CH2 1 
ATOM   5787 N N   . MET B 1 362 ? 27.552  50.242 50.258 1.00 27.93 ? 362 MET B N   1 
ATOM   5788 C CA  . MET B 1 362 ? 27.496  48.814 50.529 1.00 27.78 ? 362 MET B CA  1 
ATOM   5789 C C   . MET B 1 362 ? 26.506  48.442 51.624 1.00 31.29 ? 362 MET B C   1 
ATOM   5790 O O   . MET B 1 362 ? 26.365  49.151 52.624 1.00 29.38 ? 362 MET B O   1 
ATOM   5791 C CB  . MET B 1 362 ? 28.900  48.289 50.855 1.00 32.63 ? 362 MET B CB  1 
ATOM   5792 C CG  . MET B 1 362 ? 29.922  48.589 49.761 1.00 28.72 ? 362 MET B CG  1 
ATOM   5793 S SD  . MET B 1 362 ? 29.376  48.113 48.087 1.00 26.90 ? 362 MET B SD  1 
ATOM   5794 C CE  . MET B 1 362 ? 29.329  46.333 48.241 1.00 17.01 ? 362 MET B CE  1 
ATOM   5795 N N   . PHE B 1 363 ? 25.801  47.334 51.390 1.00 31.36 ? 363 PHE B N   1 
ATOM   5796 C CA  . PHE B 1 363 ? 24.797  46.794 52.296 1.00 30.12 ? 363 PHE B CA  1 
ATOM   5797 C C   . PHE B 1 363 ? 25.356  45.477 52.814 1.00 31.58 ? 363 PHE B C   1 
ATOM   5798 O O   . PHE B 1 363 ? 25.530  44.532 52.048 1.00 32.59 ? 363 PHE B O   1 
ATOM   5799 C CB  . PHE B 1 363 ? 23.491  46.550 51.531 1.00 31.74 ? 363 PHE B CB  1 
ATOM   5800 C CG  . PHE B 1 363 ? 22.403  45.939 52.359 1.00 31.25 ? 363 PHE B CG  1 
ATOM   5801 C CD1 . PHE B 1 363 ? 21.700  46.700 53.278 1.00 32.00 ? 363 PHE B CD1 1 
ATOM   5802 C CD2 . PHE B 1 363 ? 22.067  44.594 52.203 1.00 35.25 ? 363 PHE B CD2 1 
ATOM   5803 C CE1 . PHE B 1 363 ? 20.669  46.128 54.032 1.00 38.45 ? 363 PHE B CE1 1 
ATOM   5804 C CE2 . PHE B 1 363 ? 21.036  44.012 52.953 1.00 35.22 ? 363 PHE B CE2 1 
ATOM   5805 C CZ  . PHE B 1 363 ? 20.339  44.778 53.863 1.00 34.77 ? 363 PHE B CZ  1 
ATOM   5806 N N   . PRO B 1 364 ? 25.629  45.394 54.129 1.00 37.34 ? 364 PRO B N   1 
ATOM   5807 C CA  . PRO B 1 364 ? 26.181  44.213 54.798 1.00 39.11 ? 364 PRO B CA  1 
ATOM   5808 C C   . PRO B 1 364 ? 25.387  42.916 54.692 1.00 37.52 ? 364 PRO B C   1 
ATOM   5809 O O   . PRO B 1 364 ? 24.172  42.898 54.872 1.00 37.01 ? 364 PRO B O   1 
ATOM   5810 C CB  . PRO B 1 364 ? 26.323  44.672 56.255 1.00 40.45 ? 364 PRO B CB  1 
ATOM   5811 C CG  . PRO B 1 364 ? 26.466  46.152 56.143 1.00 39.62 ? 364 PRO B CG  1 
ATOM   5812 C CD  . PRO B 1 364 ? 25.431  46.482 55.103 1.00 39.43 ? 364 PRO B CD  1 
ATOM   5813 N N   . VAL B 1 365 ? 26.127  41.838 54.434 1.00 42.40 ? 365 VAL B N   1 
ATOM   5814 C CA  . VAL B 1 365 ? 25.622  40.477 54.300 1.00 43.78 ? 365 VAL B CA  1 
ATOM   5815 C C   . VAL B 1 365 ? 24.394  40.332 53.433 1.00 49.80 ? 365 VAL B C   1 
ATOM   5816 O O   . VAL B 1 365 ? 23.284  40.380 53.989 1.00 52.33 ? 365 VAL B O   1 
ATOM   5817 C CB  . VAL B 1 365 ? 25.380  39.788 55.694 1.00 45.05 ? 365 VAL B CB  1 
ATOM   5818 C CG1 . VAL B 1 365 ? 26.710  39.575 56.372 1.00 37.68 ? 365 VAL B CG1 1 
ATOM   5819 C CG2 . VAL B 1 365 ? 24.458  40.605 56.585 1.00 40.28 ? 365 VAL B CG2 1 
ATOM   5820 O OXT . VAL B 1 365 ? 24.568  40.187 52.198 1.00 49.56 ? 365 VAL B OXT 1 
HETATM 5821 N N1  . PLP C 2 .   ? -4.018  43.536 16.326 1.00 22.80 ? 370 PLP A N1  1 
HETATM 5822 C C2  . PLP C 2 .   ? -3.402  43.045 17.428 1.00 22.72 ? 370 PLP A C2  1 
HETATM 5823 C C2A . PLP C 2 .   ? -2.506  43.976 18.245 1.00 32.16 ? 370 PLP A C2A 1 
HETATM 5824 C C3  . PLP C 2 .   ? -3.603  41.716 17.775 1.00 32.36 ? 370 PLP A C3  1 
HETATM 5825 O O3  . PLP C 2 .   ? -2.993  41.238 18.876 1.00 30.53 ? 370 PLP A O3  1 
HETATM 5826 C C4  . PLP C 2 .   ? -4.433  40.881 16.985 1.00 30.76 ? 370 PLP A C4  1 
HETATM 5827 C C4A . PLP C 2 .   ? -4.600  39.379 17.416 1.00 33.08 ? 370 PLP A C4A 1 
HETATM 5828 C C5  . PLP C 2 .   ? -5.068  41.468 15.834 1.00 26.66 ? 370 PLP A C5  1 
HETATM 5829 C C6  . PLP C 2 .   ? -4.842  42.783 15.538 1.00 20.40 ? 370 PLP A C6  1 
HETATM 5830 C C5A . PLP C 2 .   ? -6.035  40.773 14.929 1.00 24.22 ? 370 PLP A C5A 1 
HETATM 5831 O O4P . PLP C 2 .   ? -5.590  39.603 14.366 1.00 24.57 ? 370 PLP A O4P 1 
HETATM 5832 P P   . PLP C 2 .   ? -6.608  38.487 13.953 1.00 19.77 ? 370 PLP A P   1 
HETATM 5833 O O1P . PLP C 2 .   ? -7.204  37.830 15.096 1.00 24.63 ? 370 PLP A O1P 1 
HETATM 5834 O O2P . PLP C 2 .   ? -5.603  37.502 13.308 1.00 17.81 ? 370 PLP A O2P 1 
HETATM 5835 O O3P . PLP C 2 .   ? -7.489  39.007 12.870 1.00 26.16 ? 370 PLP A O3P 1 
HETATM 5836 N N1  . PLP D 2 .   ? 20.782  49.005 30.094 1.00 26.11 ? 370 PLP B N1  1 
HETATM 5837 C C2  . PLP D 2 .   ? 19.953  47.931 29.934 1.00 26.95 ? 370 PLP B C2  1 
HETATM 5838 C C2A . PLP D 2 .   ? 19.131  47.825 28.654 1.00 29.14 ? 370 PLP B C2A 1 
HETATM 5839 C C3  . PLP D 2 .   ? 19.890  46.977 30.950 1.00 32.09 ? 370 PLP B C3  1 
HETATM 5840 O O3  . PLP D 2 .   ? 19.079  45.918 30.803 1.00 31.36 ? 370 PLP B O3  1 
HETATM 5841 C C4  . PLP D 2 .   ? 20.671  47.114 32.121 1.00 32.26 ? 370 PLP B C4  1 
HETATM 5842 C C4A . PLP D 2 .   ? 20.533  46.022 33.233 1.00 32.99 ? 370 PLP B C4A 1 
HETATM 5843 C C5  . PLP D 2 .   ? 21.535  48.254 32.223 1.00 29.87 ? 370 PLP B C5  1 
HETATM 5844 C C6  . PLP D 2 .   ? 21.569  49.167 31.207 1.00 25.52 ? 370 PLP B C6  1 
HETATM 5845 C C5A . PLP D 2 .   ? 22.481  48.501 33.359 1.00 20.70 ? 370 PLP B C5A 1 
HETATM 5846 O O4P . PLP D 2 .   ? 21.898  48.616 34.601 1.00 24.50 ? 370 PLP B O4P 1 
HETATM 5847 P P   . PLP D 2 .   ? 22.746  48.299 35.884 1.00 17.38 ? 370 PLP B P   1 
HETATM 5848 O O1P . PLP D 2 .   ? 23.067  46.896 35.997 1.00 25.64 ? 370 PLP B O1P 1 
HETATM 5849 O O2P . PLP D 2 .   ? 21.652  48.616 36.932 1.00 22.67 ? 370 PLP B O2P 1 
HETATM 5850 O O3P . PLP D 2 .   ? 23.816  49.302 35.993 1.00 25.78 ? 370 PLP B O3P 1 
HETATM 5851 O O   . HOH E 3 .   ? -7.875  41.664 11.970 1.00 18.51 ? 371 HOH A O   1 
HETATM 5852 O O   . HOH E 3 .   ? -3.393  41.382 7.597  1.00 17.63 ? 372 HOH A O   1 
HETATM 5853 O O   . HOH E 3 .   ? -7.228  23.049 26.437 1.00 24.24 ? 373 HOH A O   1 
HETATM 5854 O O   . HOH E 3 .   ? -0.124  45.384 21.301 1.00 26.63 ? 374 HOH A O   1 
HETATM 5855 O O   . HOH E 3 .   ? 11.274  39.545 33.006 1.00 23.70 ? 375 HOH A O   1 
HETATM 5856 O O   . HOH E 3 .   ? 12.653  37.417 11.864 1.00 26.19 ? 376 HOH A O   1 
HETATM 5857 O O   . HOH E 3 .   ? -6.416  30.764 3.487  1.00 25.48 ? 377 HOH A O   1 
HETATM 5858 O O   . HOH E 3 .   ? -4.789  56.405 22.984 1.00 33.83 ? 378 HOH A O   1 
HETATM 5859 O O   . HOH E 3 .   ? 1.511   42.566 18.674 1.00 23.19 ? 379 HOH A O   1 
HETATM 5860 O O   . HOH E 3 .   ? 2.393   34.433 16.343 1.00 21.47 ? 380 HOH A O   1 
HETATM 5861 O O   . HOH E 3 .   ? -5.693  36.116 16.517 1.00 23.92 ? 381 HOH A O   1 
HETATM 5862 O O   . HOH E 3 .   ? 5.819   46.680 20.119 1.00 31.67 ? 382 HOH A O   1 
HETATM 5863 O O   . HOH E 3 .   ? -2.824  64.163 7.563  1.00 32.84 ? 383 HOH A O   1 
HETATM 5864 O O   . HOH E 3 .   ? 16.306  33.583 31.463 1.00 27.58 ? 384 HOH A O   1 
HETATM 5865 O O   . HOH E 3 .   ? -6.405  34.955 13.419 1.00 20.95 ? 385 HOH A O   1 
HETATM 5866 O O   . HOH E 3 .   ? 15.170  38.124 18.850 1.00 20.04 ? 386 HOH A O   1 
HETATM 5867 O O   . HOH E 3 .   ? 15.697  33.094 13.730 1.00 26.68 ? 387 HOH A O   1 
HETATM 5868 O O   . HOH E 3 .   ? 3.109   47.541 23.575 1.00 26.60 ? 388 HOH A O   1 
HETATM 5869 O O   . HOH E 3 .   ? 0.175   50.070 17.028 1.00 32.62 ? 389 HOH A O   1 
HETATM 5870 O O   . HOH E 3 .   ? -4.344  18.244 8.531  1.00 39.10 ? 390 HOH A O   1 
HETATM 5871 O O   . HOH E 3 .   ? -19.096 39.538 14.870 1.00 37.69 ? 391 HOH A O   1 
HETATM 5872 O O   . HOH E 3 .   ? 7.524   38.424 23.614 1.00 24.01 ? 392 HOH A O   1 
HETATM 5873 O O   . HOH E 3 .   ? -4.688  46.581 -0.756 1.00 35.33 ? 393 HOH A O   1 
HETATM 5874 O O   . HOH E 3 .   ? -6.811  36.267 19.131 1.00 32.54 ? 394 HOH A O   1 
HETATM 5875 O O   . HOH E 3 .   ? -4.437  39.102 21.221 1.00 34.04 ? 395 HOH A O   1 
HETATM 5876 O O   . HOH E 3 .   ? -25.670 45.476 4.821  1.00 26.11 ? 396 HOH A O   1 
HETATM 5877 O O   . HOH E 3 .   ? -9.119  35.175 12.245 1.00 30.17 ? 397 HOH A O   1 
HETATM 5878 O O   . HOH E 3 .   ? -10.789 61.350 4.243  1.00 30.37 ? 398 HOH A O   1 
HETATM 5879 O O   . HOH E 3 .   ? 7.600   20.474 30.719 1.00 36.85 ? 399 HOH A O   1 
HETATM 5880 O O   . HOH E 3 .   ? -20.462 36.932 11.272 1.00 32.87 ? 400 HOH A O   1 
HETATM 5881 O O   . HOH E 3 .   ? 1.387   58.149 20.033 1.00 29.14 ? 401 HOH A O   1 
HETATM 5882 O O   . HOH E 3 .   ? -0.003  46.813 3.416  1.00 26.66 ? 402 HOH A O   1 
HETATM 5883 O O   . HOH E 3 .   ? 2.894   45.844 9.737  1.00 26.56 ? 403 HOH A O   1 
HETATM 5884 O O   . HOH E 3 .   ? 4.422   42.697 8.481  1.00 31.19 ? 404 HOH A O   1 
HETATM 5885 O O   . HOH E 3 .   ? -21.796 17.695 29.623 1.00 39.59 ? 405 HOH A O   1 
HETATM 5886 O O   . HOH E 3 .   ? -2.450  43.470 3.540  1.00 36.51 ? 406 HOH A O   1 
HETATM 5887 O O   . HOH E 3 .   ? -19.393 27.037 17.161 1.00 27.30 ? 407 HOH A O   1 
HETATM 5888 O O   . HOH E 3 .   ? -2.086  56.164 21.347 1.00 24.28 ? 408 HOH A O   1 
HETATM 5889 O O   . HOH E 3 .   ? -18.626 25.366 10.749 1.00 31.65 ? 409 HOH A O   1 
HETATM 5890 O O   . HOH E 3 .   ? -5.080  48.276 11.822 1.00 19.14 ? 410 HOH A O   1 
HETATM 5891 O O   . HOH E 3 .   ? -4.549  47.707 9.155  1.00 22.64 ? 411 HOH A O   1 
HETATM 5892 O O   . HOH E 3 .   ? 15.734  28.305 19.326 1.00 28.79 ? 412 HOH A O   1 
HETATM 5893 O O   . HOH E 3 .   ? -22.571 55.370 15.753 1.00 24.39 ? 413 HOH A O   1 
HETATM 5894 O O   . HOH E 3 .   ? 12.701  20.591 29.798 1.00 36.86 ? 414 HOH A O   1 
HETATM 5895 O O   . HOH E 3 .   ? 4.125   53.049 4.972  1.00 40.16 ? 415 HOH A O   1 
HETATM 5896 O O   . HOH E 3 .   ? -4.935  64.036 3.404  1.00 31.99 ? 416 HOH A O   1 
HETATM 5897 O O   . HOH E 3 .   ? -6.465  58.001 4.930  1.00 27.04 ? 417 HOH A O   1 
HETATM 5898 O O   . HOH E 3 .   ? -0.166  53.666 10.328 1.00 30.47 ? 418 HOH A O   1 
HETATM 5899 O O   . HOH E 3 .   ? 7.527   45.197 7.687  1.00 40.77 ? 419 HOH A O   1 
HETATM 5900 O O   . HOH E 3 .   ? -6.947  38.416 23.012 1.00 45.13 ? 420 HOH A O   1 
HETATM 5901 O O   . HOH E 3 .   ? 3.055   13.270 10.347 1.00 35.87 ? 421 HOH A O   1 
HETATM 5902 O O   . HOH E 3 .   ? -17.123 75.337 14.755 1.00 37.82 ? 422 HOH A O   1 
HETATM 5903 O O   . HOH E 3 .   ? 7.715   47.566 18.663 1.00 21.64 ? 423 HOH A O   1 
HETATM 5904 O O   . HOH E 3 .   ? 15.955  42.708 13.078 1.00 36.18 ? 424 HOH A O   1 
HETATM 5905 O O   . HOH E 3 .   ? -3.984  45.219 24.659 1.00 28.69 ? 425 HOH A O   1 
HETATM 5906 O O   . HOH E 3 .   ? 0.674   39.833 4.608  1.00 38.36 ? 426 HOH A O   1 
HETATM 5907 O O   . HOH E 3 .   ? -0.791  13.704 33.640 1.00 46.55 ? 427 HOH A O   1 
HETATM 5908 O O   . HOH E 3 .   ? 17.360  31.671 25.641 1.00 32.33 ? 428 HOH A O   1 
HETATM 5909 O O   . HOH E 3 .   ? -2.974  12.655 12.634 1.00 30.46 ? 429 HOH A O   1 
HETATM 5910 O O   . HOH E 3 .   ? -25.900 45.422 2.446  1.00 32.02 ? 430 HOH A O   1 
HETATM 5911 O O   . HOH E 3 .   ? -0.353  35.269 7.928  1.00 33.76 ? 431 HOH A O   1 
HETATM 5912 O O   . HOH E 3 .   ? -8.395  11.649 12.507 1.00 36.22 ? 432 HOH A O   1 
HETATM 5913 O O   . HOH E 3 .   ? -6.421  12.848 8.743  1.00 44.14 ? 433 HOH A O   1 
HETATM 5914 O O   . HOH E 3 .   ? 10.259  36.744 10.993 1.00 28.04 ? 434 HOH A O   1 
HETATM 5915 O O   . HOH E 3 .   ? 6.562   47.354 15.505 1.00 31.42 ? 435 HOH A O   1 
HETATM 5916 O O   . HOH E 3 .   ? -8.119  32.693 11.549 1.00 26.36 ? 436 HOH A O   1 
HETATM 5917 O O   . HOH E 3 .   ? -11.687 34.155 12.994 1.00 32.44 ? 437 HOH A O   1 
HETATM 5918 O O   . HOH E 3 .   ? 9.989   35.615 8.741  1.00 37.18 ? 438 HOH A O   1 
HETATM 5919 O O   . HOH E 3 .   ? -5.339  48.142 23.997 1.00 35.97 ? 439 HOH A O   1 
HETATM 5920 O O   . HOH E 3 .   ? -17.563 42.175 20.931 1.00 41.39 ? 440 HOH A O   1 
HETATM 5921 O O   . HOH E 3 .   ? -2.782  49.510 38.057 1.00 32.45 ? 441 HOH A O   1 
HETATM 5922 O O   . HOH E 3 .   ? 21.817  25.980 33.354 1.00 44.25 ? 442 HOH A O   1 
HETATM 5923 O O   . HOH E 3 .   ? 9.790   39.787 23.246 1.00 35.36 ? 443 HOH A O   1 
HETATM 5924 O O   . HOH E 3 .   ? 7.544   58.397 13.873 1.00 38.71 ? 444 HOH A O   1 
HETATM 5925 O O   . HOH E 3 .   ? 7.797   16.448 22.918 1.00 24.10 ? 445 HOH A O   1 
HETATM 5926 O O   . HOH E 3 .   ? 5.898   31.802 7.798  1.00 30.46 ? 446 HOH A O   1 
HETATM 5927 O O   . HOH E 3 .   ? -2.279  40.018 5.668  1.00 28.18 ? 447 HOH A O   1 
HETATM 5928 O O   . HOH E 3 .   ? 4.956   13.035 23.817 1.00 39.76 ? 448 HOH A O   1 
HETATM 5929 O O   . HOH E 3 .   ? 4.725   31.517 3.592  1.00 40.54 ? 449 HOH A O   1 
HETATM 5930 O O   . HOH E 3 .   ? 19.954  24.227 37.050 1.00 37.13 ? 450 HOH A O   1 
HETATM 5931 O O   . HOH E 3 .   ? 16.527  27.194 16.764 1.00 34.29 ? 451 HOH A O   1 
HETATM 5932 O O   . HOH E 3 .   ? 6.238   24.541 7.469  1.00 34.55 ? 452 HOH A O   1 
HETATM 5933 O O   . HOH E 3 .   ? -20.655 23.704 3.079  1.00 40.88 ? 453 HOH A O   1 
HETATM 5934 O O   . HOH E 3 .   ? -11.196 42.159 20.278 1.00 43.19 ? 454 HOH A O   1 
HETATM 5935 O O   . HOH E 3 .   ? 4.981   59.995 25.816 1.00 37.68 ? 455 HOH A O   1 
HETATM 5936 O O   . HOH E 3 .   ? 11.864  43.574 13.820 1.00 37.56 ? 456 HOH A O   1 
HETATM 5937 O O   . HOH E 3 .   ? -26.024 45.845 24.344 1.00 36.97 ? 457 HOH A O   1 
HETATM 5938 O O   . HOH E 3 .   ? 0.005   12.777 9.921  1.00 32.91 ? 458 HOH A O   1 
HETATM 5939 O O   . HOH E 3 .   ? -19.366 61.823 8.850  1.00 30.75 ? 459 HOH A O   1 
HETATM 5940 O O   . HOH E 3 .   ? -2.620  55.043 10.070 1.00 29.96 ? 460 HOH A O   1 
HETATM 5941 O O   . HOH E 3 .   ? -5.300  25.720 1.490  1.00 47.70 ? 461 HOH A O   1 
HETATM 5942 O O   . HOH E 3 .   ? -1.132  49.859 -0.544 1.00 32.31 ? 462 HOH A O   1 
HETATM 5943 O O   . HOH E 3 .   ? 3.446   50.101 3.153  1.00 54.99 ? 463 HOH A O   1 
HETATM 5944 O O   . HOH E 3 .   ? -9.464  19.037 6.918  1.00 48.32 ? 464 HOH A O   1 
HETATM 5945 O O   . HOH E 3 .   ? -10.316 69.996 17.209 1.00 42.96 ? 465 HOH A O   1 
HETATM 5946 O O   . HOH E 3 .   ? 16.047  39.703 10.259 1.00 34.98 ? 466 HOH A O   1 
HETATM 5947 O O   . HOH E 3 .   ? 0.561   33.769 4.825  1.00 43.89 ? 467 HOH A O   1 
HETATM 5948 O O   . HOH E 3 .   ? 0.653   13.722 31.648 1.00 34.75 ? 468 HOH A O   1 
HETATM 5949 O O   . HOH E 3 .   ? -4.796  66.382 15.203 1.00 45.05 ? 469 HOH A O   1 
HETATM 5950 O O   . HOH E 3 .   ? -9.137  68.207 10.350 1.00 41.17 ? 470 HOH A O   1 
HETATM 5951 O O   . HOH E 3 .   ? -22.183 49.532 2.074  1.00 38.62 ? 471 HOH A O   1 
HETATM 5952 O O   . HOH E 3 .   ? -3.364  64.205 12.783 1.00 33.15 ? 472 HOH A O   1 
HETATM 5953 O O   . HOH E 3 .   ? -14.201 22.431 35.617 1.00 50.50 ? 473 HOH A O   1 
HETATM 5954 O O   . HOH E 3 .   ? -16.325 18.357 12.224 1.00 36.26 ? 474 HOH A O   1 
HETATM 5955 O O   . HOH E 3 .   ? -27.732 47.065 13.289 1.00 36.06 ? 475 HOH A O   1 
HETATM 5956 O O   . HOH E 3 .   ? -0.027  55.567 3.712  1.00 33.11 ? 476 HOH A O   1 
HETATM 5957 O O   . HOH E 3 .   ? 14.504  36.188 10.563 1.00 35.48 ? 477 HOH A O   1 
HETATM 5958 O O   . HOH E 3 .   ? -0.020  19.971 0.946  1.00 47.92 ? 478 HOH A O   1 
HETATM 5959 O O   . HOH E 3 .   ? -21.664 39.898 0.820  1.00 28.85 ? 479 HOH A O   1 
HETATM 5960 O O   . HOH E 3 .   ? -1.110  65.443 10.521 1.00 51.27 ? 480 HOH A O   1 
HETATM 5961 O O   . HOH E 3 .   ? 1.627   16.001 7.077  1.00 45.48 ? 481 HOH A O   1 
HETATM 5962 O O   . HOH E 3 .   ? -25.547 40.814 2.640  1.00 38.30 ? 482 HOH A O   1 
HETATM 5963 O O   . HOH E 3 .   ? -18.550 12.946 21.199 1.00 37.49 ? 483 HOH A O   1 
HETATM 5964 O O   . HOH E 3 .   ? 4.740   34.537 6.462  1.00 38.15 ? 484 HOH A O   1 
HETATM 5965 O O   . HOH E 3 .   ? -13.822 23.764 3.198  1.00 39.33 ? 485 HOH A O   1 
HETATM 5966 O O   . HOH E 3 .   ? -4.081  28.568 1.509  1.00 47.71 ? 486 HOH A O   1 
HETATM 5967 O O   . HOH E 3 .   ? -16.967 10.038 18.093 1.00 32.87 ? 487 HOH A O   1 
HETATM 5968 O O   . HOH E 3 .   ? -3.715  49.056 -0.962 1.00 35.79 ? 488 HOH A O   1 
HETATM 5969 O O   . HOH E 3 .   ? -21.411 58.541 20.675 1.00 30.95 ? 489 HOH A O   1 
HETATM 5970 O O   . HOH E 3 .   ? -2.340  22.985 2.164  1.00 40.38 ? 490 HOH A O   1 
HETATM 5971 O O   . HOH E 3 .   ? 11.007  22.661 26.641 1.00 28.62 ? 491 HOH A O   1 
HETATM 5972 O O   . HOH E 3 .   ? -9.612  48.198 34.667 1.00 46.32 ? 492 HOH A O   1 
HETATM 5973 O O   . HOH E 3 .   ? -22.761 52.619 5.564  1.00 26.80 ? 493 HOH A O   1 
HETATM 5974 O O   . HOH E 3 .   ? -3.991  22.091 4.668  1.00 39.22 ? 494 HOH A O   1 
HETATM 5975 O O   . HOH E 3 .   ? 11.868  53.085 8.276  1.00 33.24 ? 495 HOH A O   1 
HETATM 5976 O O   . HOH E 3 .   ? 7.080   47.219 6.014  1.00 44.37 ? 496 HOH A O   1 
HETATM 5977 O O   . HOH E 3 .   ? 0.811   53.200 19.627 1.00 30.27 ? 497 HOH A O   1 
HETATM 5978 O O   . HOH E 3 .   ? 1.827   52.213 17.110 1.00 25.39 ? 498 HOH A O   1 
HETATM 5979 O O   . HOH E 3 .   ? -15.946 17.023 29.930 1.00 34.32 ? 499 HOH A O   1 
HETATM 5980 O O   . HOH E 3 .   ? -15.843 52.399 30.679 1.00 49.72 ? 500 HOH A O   1 
HETATM 5981 O O   . HOH E 3 .   ? -9.352  44.984 21.742 1.00 41.80 ? 501 HOH A O   1 
HETATM 5982 O O   . HOH E 3 .   ? 1.821   50.555 26.149 1.00 35.17 ? 502 HOH A O   1 
HETATM 5983 O O   . HOH E 3 .   ? -14.797 35.787 20.709 1.00 38.20 ? 503 HOH A O   1 
HETATM 5984 O O   . HOH E 3 .   ? 10.728  42.690 11.521 1.00 41.60 ? 504 HOH A O   1 
HETATM 5985 O O   . HOH E 3 .   ? -25.218 27.670 11.481 1.00 45.24 ? 505 HOH A O   1 
HETATM 5986 O O   . HOH E 3 .   ? -18.546 24.124 25.434 1.00 36.38 ? 506 HOH A O   1 
HETATM 5987 O O   . HOH E 3 .   ? 18.870  22.872 20.873 1.00 37.05 ? 507 HOH A O   1 
HETATM 5988 O O   . HOH E 3 .   ? 7.696   13.744 15.343 1.00 31.12 ? 508 HOH A O   1 
HETATM 5989 O O   . HOH E 3 .   ? 7.673   44.296 22.464 1.00 34.19 ? 509 HOH A O   1 
HETATM 5990 O O   . HOH E 3 .   ? 3.057   28.769 2.676  1.00 60.49 ? 510 HOH A O   1 
HETATM 5991 O O   . HOH E 3 .   ? -14.507 10.458 14.193 1.00 51.12 ? 511 HOH A O   1 
HETATM 5992 O O   . HOH E 3 .   ? -14.056 38.745 23.176 1.00 36.12 ? 512 HOH A O   1 
HETATM 5993 O O   . HOH E 3 .   ? -20.221 42.880 -5.876 1.00 37.19 ? 513 HOH A O   1 
HETATM 5994 O O   . HOH F 3 .   ? 17.729  51.787 19.660 1.00 27.97 ? 371 HOH B O   1 
HETATM 5995 O O   . HOH F 3 .   ? 23.079  54.887 28.358 1.00 20.77 ? 372 HOH B O   1 
HETATM 5996 O O   . HOH F 3 .   ? 7.788   42.029 29.967 1.00 22.08 ? 373 HOH B O   1 
HETATM 5997 O O   . HOH F 3 .   ? 22.028  54.112 47.571 1.00 26.40 ? 374 HOH B O   1 
HETATM 5998 O O   . HOH F 3 .   ? 21.125  45.133 36.475 1.00 25.14 ? 375 HOH B O   1 
HETATM 5999 O O   . HOH F 3 .   ? 19.485  45.156 25.147 1.00 29.18 ? 376 HOH B O   1 
HETATM 6000 O O   . HOH F 3 .   ? -2.496  34.883 29.785 1.00 24.43 ? 377 HOH B O   1 
HETATM 6001 O O   . HOH F 3 .   ? 13.681  45.700 22.600 1.00 25.18 ? 378 HOH B O   1 
HETATM 6002 O O   . HOH F 3 .   ? 27.119  69.358 18.397 1.00 35.14 ? 379 HOH B O   1 
HETATM 6003 O O   . HOH F 3 .   ? 22.931  57.253 29.915 1.00 19.23 ? 380 HOH B O   1 
HETATM 6004 O O   . HOH F 3 .   ? 31.480  58.507 46.181 1.00 37.71 ? 381 HOH B O   1 
HETATM 6005 O O   . HOH F 3 .   ? 20.875  55.926 36.112 1.00 18.85 ? 382 HOH B O   1 
HETATM 6006 O O   . HOH F 3 .   ? 22.173  59.977 23.251 1.00 19.44 ? 383 HOH B O   1 
HETATM 6007 O O   . HOH F 3 .   ? 8.728   42.046 23.212 1.00 29.14 ? 384 HOH B O   1 
HETATM 6008 O O   . HOH F 3 .   ? 5.614   53.862 29.396 1.00 28.32 ? 385 HOH B O   1 
HETATM 6009 O O   . HOH F 3 .   ? 43.694  55.524 36.387 1.00 29.28 ? 386 HOH B O   1 
HETATM 6010 O O   . HOH F 3 .   ? 15.892  64.553 17.306 1.00 40.91 ? 387 HOH B O   1 
HETATM 6011 O O   . HOH F 3 .   ? 3.959   27.789 42.734 1.00 40.51 ? 388 HOH B O   1 
HETATM 6012 O O   . HOH F 3 .   ? 17.589  52.646 23.697 1.00 24.91 ? 389 HOH B O   1 
HETATM 6013 O O   . HOH F 3 .   ? 22.719  48.969 15.803 1.00 26.56 ? 390 HOH B O   1 
HETATM 6014 O O   . HOH F 3 .   ? 38.654  55.817 12.797 1.00 32.75 ? 391 HOH B O   1 
HETATM 6015 O O   . HOH F 3 .   ? 24.511  43.383 22.159 1.00 29.81 ? 392 HOH B O   1 
HETATM 6016 O O   . HOH F 3 .   ? 23.210  47.197 42.242 1.00 27.88 ? 393 HOH B O   1 
HETATM 6017 O O   . HOH F 3 .   ? 40.994  51.418 21.754 1.00 30.84 ? 394 HOH B O   1 
HETATM 6018 O O   . HOH F 3 .   ? 10.642  50.218 52.654 1.00 46.53 ? 395 HOH B O   1 
HETATM 6019 O O   . HOH F 3 .   ? 29.747  39.612 35.605 1.00 29.94 ? 396 HOH B O   1 
HETATM 6020 O O   . HOH F 3 .   ? 9.950   51.156 24.263 1.00 24.60 ? 397 HOH B O   1 
HETATM 6021 O O   . HOH F 3 .   ? 20.278  42.312 31.826 1.00 30.10 ? 398 HOH B O   1 
HETATM 6022 O O   . HOH F 3 .   ? 29.337  37.933 57.427 1.00 43.44 ? 399 HOH B O   1 
HETATM 6023 O O   . HOH F 3 .   ? 24.774  51.091 34.156 1.00 20.22 ? 400 HOH B O   1 
HETATM 6024 O O   . HOH F 3 .   ? -5.083  37.300 32.172 1.00 32.46 ? 401 HOH B O   1 
HETATM 6025 O O   . HOH F 3 .   ? 13.566  57.335 32.931 1.00 33.21 ? 402 HOH B O   1 
HETATM 6026 O O   . HOH F 3 .   ? 0.819   47.639 31.682 1.00 19.76 ? 403 HOH B O   1 
HETATM 6027 O O   . HOH F 3 .   ? 19.134  53.467 39.295 1.00 34.62 ? 404 HOH B O   1 
HETATM 6028 O O   . HOH F 3 .   ? 12.975  46.002 37.391 1.00 25.95 ? 405 HOH B O   1 
HETATM 6029 O O   . HOH F 3 .   ? 36.890  69.548 32.777 1.00 36.84 ? 406 HOH B O   1 
HETATM 6030 O O   . HOH F 3 .   ? 20.743  23.834 39.784 1.00 53.62 ? 407 HOH B O   1 
HETATM 6031 O O   . HOH F 3 .   ? 3.919   33.003 49.753 1.00 31.45 ? 408 HOH B O   1 
HETATM 6032 O O   . HOH F 3 .   ? 17.743  53.766 14.982 1.00 27.33 ? 409 HOH B O   1 
HETATM 6033 O O   . HOH F 3 .   ? 10.247  52.761 43.400 1.00 28.31 ? 410 HOH B O   1 
HETATM 6034 O O   . HOH F 3 .   ? 19.556  56.820 38.444 1.00 37.88 ? 411 HOH B O   1 
HETATM 6035 O O   . HOH F 3 .   ? 42.362  48.189 18.529 1.00 43.79 ? 412 HOH B O   1 
HETATM 6036 O O   . HOH F 3 .   ? 16.713  46.052 25.456 1.00 30.33 ? 413 HOH B O   1 
HETATM 6037 O O   . HOH F 3 .   ? 3.362   35.060 24.296 1.00 18.71 ? 414 HOH B O   1 
HETATM 6038 O O   . HOH F 3 .   ? 18.271  33.060 14.325 1.00 36.37 ? 415 HOH B O   1 
HETATM 6039 O O   . HOH F 3 .   ? 35.604  64.675 37.652 1.00 26.53 ? 416 HOH B O   1 
HETATM 6040 O O   . HOH F 3 .   ? 32.662  49.487 51.171 1.00 30.27 ? 417 HOH B O   1 
HETATM 6041 O O   . HOH F 3 .   ? 20.416  42.778 24.294 1.00 30.29 ? 418 HOH B O   1 
HETATM 6042 O O   . HOH F 3 .   ? -7.956  25.891 34.789 1.00 33.69 ? 419 HOH B O   1 
HETATM 6043 O O   . HOH F 3 .   ? 19.900  22.446 46.260 1.00 38.12 ? 420 HOH B O   1 
HETATM 6044 O O   . HOH F 3 .   ? 13.452  54.189 40.769 1.00 30.03 ? 421 HOH B O   1 
HETATM 6045 O O   . HOH F 3 .   ? 21.973  36.260 20.054 1.00 27.93 ? 422 HOH B O   1 
HETATM 6046 O O   . HOH F 3 .   ? 36.660  46.985 5.913  1.00 50.77 ? 423 HOH B O   1 
HETATM 6047 O O   . HOH F 3 .   ? 24.895  23.681 40.646 1.00 38.00 ? 424 HOH B O   1 
HETATM 6048 O O   . HOH F 3 .   ? 16.363  53.133 21.242 1.00 35.74 ? 425 HOH B O   1 
HETATM 6049 O O   . HOH F 3 .   ? 23.160  59.989 8.704  1.00 47.69 ? 426 HOH B O   1 
HETATM 6050 O O   . HOH F 3 .   ? 17.569  52.129 54.155 1.00 33.70 ? 427 HOH B O   1 
HETATM 6051 O O   . HOH F 3 .   ? 26.219  37.135 21.916 1.00 30.80 ? 428 HOH B O   1 
HETATM 6052 O O   . HOH F 3 .   ? 35.821  46.720 39.794 1.00 36.01 ? 429 HOH B O   1 
HETATM 6053 O O   . HOH F 3 .   ? 3.186   51.439 45.089 1.00 43.73 ? 430 HOH B O   1 
HETATM 6054 O O   . HOH F 3 .   ? 19.884  36.638 59.548 1.00 45.20 ? 431 HOH B O   1 
HETATM 6055 O O   . HOH F 3 .   ? 39.859  69.154 41.567 1.00 43.18 ? 432 HOH B O   1 
HETATM 6056 O O   . HOH F 3 .   ? 39.513  60.256 44.196 1.00 41.54 ? 433 HOH B O   1 
HETATM 6057 O O   . HOH F 3 .   ? 36.729  32.211 43.893 1.00 46.64 ? 434 HOH B O   1 
HETATM 6058 O O   . HOH F 3 .   ? 13.641  39.865 59.433 1.00 45.59 ? 435 HOH B O   1 
HETATM 6059 O O   . HOH F 3 .   ? 32.595  42.774 49.925 1.00 32.93 ? 436 HOH B O   1 
HETATM 6060 O O   . HOH F 3 .   ? 42.618  49.033 20.811 1.00 36.81 ? 437 HOH B O   1 
HETATM 6061 O O   . HOH F 3 .   ? 6.005   54.954 32.041 1.00 32.62 ? 438 HOH B O   1 
HETATM 6062 O O   . HOH F 3 .   ? 1.606   31.941 50.151 1.00 40.29 ? 439 HOH B O   1 
HETATM 6063 O O   . HOH F 3 .   ? 41.633  49.879 37.718 1.00 34.43 ? 440 HOH B O   1 
HETATM 6064 O O   . HOH F 3 .   ? 15.226  47.779 28.994 1.00 27.84 ? 441 HOH B O   1 
HETATM 6065 O O   . HOH F 3 .   ? 6.077   53.021 36.933 1.00 35.01 ? 442 HOH B O   1 
HETATM 6066 O O   . HOH F 3 .   ? 20.804  23.824 42.396 1.00 45.44 ? 443 HOH B O   1 
HETATM 6067 O O   . HOH F 3 .   ? 22.815  68.590 9.545  1.00 46.14 ? 444 HOH B O   1 
HETATM 6068 O O   . HOH F 3 .   ? 13.706  61.883 33.913 1.00 39.54 ? 445 HOH B O   1 
HETATM 6069 O O   . HOH F 3 .   ? 23.622  67.298 22.142 1.00 43.03 ? 446 HOH B O   1 
HETATM 6070 O O   . HOH F 3 .   ? 26.049  23.677 48.315 1.00 36.16 ? 447 HOH B O   1 
HETATM 6071 O O   . HOH F 3 .   ? 22.289  46.949 39.135 1.00 20.69 ? 448 HOH B O   1 
HETATM 6072 O O   . HOH F 3 .   ? 8.568   45.439 25.987 1.00 37.04 ? 449 HOH B O   1 
HETATM 6073 O O   . HOH F 3 .   ? 17.320  54.827 46.637 1.00 42.36 ? 450 HOH B O   1 
HETATM 6074 O O   . HOH F 3 .   ? -7.862  41.012 35.998 1.00 43.02 ? 451 HOH B O   1 
HETATM 6075 O O   . HOH F 3 .   ? 11.597  48.897 24.514 1.00 31.98 ? 452 HOH B O   1 
HETATM 6076 O O   . HOH F 3 .   ? 34.783  40.406 16.912 1.00 46.19 ? 453 HOH B O   1 
HETATM 6077 O O   . HOH F 3 .   ? 2.153   31.801 52.834 1.00 40.27 ? 454 HOH B O   1 
HETATM 6078 O O   . HOH F 3 .   ? 43.545  53.770 38.211 1.00 36.69 ? 455 HOH B O   1 
HETATM 6079 O O   . HOH F 3 .   ? 26.755  65.511 23.508 1.00 29.52 ? 456 HOH B O   1 
HETATM 6080 O O   . HOH F 3 .   ? 34.870  45.737 35.979 1.00 42.62 ? 457 HOH B O   1 
HETATM 6081 O O   . HOH F 3 .   ? 19.220  30.282 43.690 1.00 27.06 ? 458 HOH B O   1 
HETATM 6082 O O   . HOH F 3 .   ? 39.925  61.273 19.617 1.00 25.17 ? 459 HOH B O   1 
HETATM 6083 O O   . HOH F 3 .   ? -1.801  43.171 40.000 1.00 32.05 ? 460 HOH B O   1 
HETATM 6084 O O   . HOH F 3 .   ? 14.048  13.809 53.563 1.00 34.45 ? 461 HOH B O   1 
HETATM 6085 O O   . HOH F 3 .   ? 19.167  66.872 8.598  1.00 41.08 ? 462 HOH B O   1 
HETATM 6086 O O   . HOH F 3 .   ? 9.184   19.892 39.391 1.00 32.33 ? 463 HOH B O   1 
HETATM 6087 O O   . HOH F 3 .   ? 11.462  60.367 19.752 1.00 38.35 ? 464 HOH B O   1 
HETATM 6088 O O   . HOH F 3 .   ? 24.368  66.349 16.633 1.00 49.61 ? 465 HOH B O   1 
HETATM 6089 O O   . HOH F 3 .   ? 19.415  42.316 9.615  1.00 45.69 ? 466 HOH B O   1 
HETATM 6090 O O   . HOH F 3 .   ? 22.661  64.679 12.977 1.00 43.92 ? 467 HOH B O   1 
HETATM 6091 O O   . HOH F 3 .   ? 32.583  38.116 45.491 1.00 31.65 ? 468 HOH B O   1 
HETATM 6092 O O   . HOH F 3 .   ? 19.144  20.803 40.222 1.00 58.17 ? 469 HOH B O   1 
HETATM 6093 O O   . HOH F 3 .   ? 33.612  42.594 40.723 1.00 38.16 ? 470 HOH B O   1 
HETATM 6094 O O   . HOH F 3 .   ? 44.378  51.340 37.979 1.00 47.53 ? 471 HOH B O   1 
HETATM 6095 O O   . HOH F 3 .   ? 5.158   52.334 51.688 1.00 53.00 ? 472 HOH B O   1 
HETATM 6096 O O   . HOH F 3 .   ? 31.535  66.771 18.332 1.00 34.72 ? 473 HOH B O   1 
HETATM 6097 O O   . HOH F 3 .   ? 22.119  30.974 14.145 1.00 35.08 ? 474 HOH B O   1 
HETATM 6098 O O   . HOH F 3 .   ? 30.889  50.410 54.666 1.00 37.57 ? 475 HOH B O   1 
HETATM 6099 O O   . HOH F 3 .   ? 43.258  64.065 32.516 1.00 30.26 ? 476 HOH B O   1 
HETATM 6100 O O   . HOH F 3 .   ? -0.377  29.218 37.958 1.00 39.16 ? 477 HOH B O   1 
HETATM 6101 O O   . HOH F 3 .   ? 34.629  70.807 37.249 1.00 44.54 ? 478 HOH B O   1 
HETATM 6102 O O   . HOH F 3 .   ? 21.941  42.712 35.096 1.00 33.66 ? 479 HOH B O   1 
HETATM 6103 O O   . HOH F 3 .   ? 17.013  58.163 38.556 1.00 41.62 ? 480 HOH B O   1 
HETATM 6104 O O   . HOH F 3 .   ? 19.924  58.358 42.455 1.00 44.72 ? 481 HOH B O   1 
HETATM 6105 O O   . HOH F 3 .   ? 37.015  42.966 17.292 1.00 45.33 ? 482 HOH B O   1 
HETATM 6106 O O   . HOH F 3 .   ? 31.240  43.112 38.921 1.00 34.24 ? 483 HOH B O   1 
HETATM 6107 O O   . HOH F 3 .   ? 10.992  53.707 26.104 1.00 28.68 ? 484 HOH B O   1 
HETATM 6108 O O   . HOH F 3 .   ? -3.313  39.343 31.363 1.00 41.03 ? 485 HOH B O   1 
HETATM 6109 O O   . HOH F 3 .   ? 10.469  59.268 31.094 1.00 40.51 ? 486 HOH B O   1 
HETATM 6110 O O   . HOH F 3 .   ? 5.766   58.341 31.519 1.00 40.75 ? 487 HOH B O   1 
HETATM 6111 O O   . HOH F 3 .   ? 34.369  37.597 61.152 1.00 42.24 ? 488 HOH B O   1 
HETATM 6112 O O   . HOH F 3 .   ? 32.193  66.536 21.096 1.00 32.46 ? 489 HOH B O   1 
HETATM 6113 O O   . HOH F 3 .   ? 25.782  43.951 26.726 1.00 29.38 ? 490 HOH B O   1 
HETATM 6114 O O   . HOH F 3 .   ? 28.473  49.605 54.529 1.00 34.48 ? 491 HOH B O   1 
HETATM 6115 O O   . HOH F 3 .   ? 38.322  58.494 13.241 1.00 37.08 ? 492 HOH B O   1 
HETATM 6116 O O   . HOH F 3 .   ? -3.671  47.467 49.428 1.00 47.27 ? 493 HOH B O   1 
HETATM 6117 O O   . HOH F 3 .   ? 40.390  54.950 41.502 1.00 31.36 ? 494 HOH B O   1 
HETATM 6118 O O   . HOH F 3 .   ? -9.460  43.948 33.236 1.00 42.57 ? 495 HOH B O   1 
HETATM 6119 O O   . HOH F 3 .   ? 36.334  57.732 49.623 1.00 48.68 ? 496 HOH B O   1 
HETATM 6120 O O   . HOH F 3 .   ? 45.872  50.007 45.825 1.00 43.22 ? 497 HOH B O   1 
HETATM 6121 O O   . HOH F 3 .   ? 37.821  31.117 41.139 1.00 46.84 ? 498 HOH B O   1 
HETATM 6122 O O   . HOH F 3 .   ? 47.722  52.231 31.786 1.00 42.53 ? 499 HOH B O   1 
HETATM 6123 O O   . HOH F 3 .   ? 28.504  54.677 3.309  1.00 41.33 ? 500 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  PRO 22  22  22  PRO PRO A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  MET 40  40  40  MET MET A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  TRP 43  43  43  TRP TRP A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  PHE 56  56  56  PHE PHE A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  HIS 62  62  62  HIS HIS A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  MET 78  78  78  MET MET A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLN 86  86  86  GLN GLN A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 MET 105 105 105 MET MET A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 CYS 108 108 108 CYS CYS A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 CYS 120 120 120 CYS CYS A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 TRP 131 131 131 TRP TRP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 GLN 157 157 157 GLN GLN A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 PHE 164 164 164 PHE PHE A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 ARG 192 192 192 ARG ARG A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 TYR 201 201 201 TYR TYR A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 GLN 215 215 215 GLN GLN A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 CYS 222 222 222 CYS CYS A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 TRP 227 227 227 TRP TRP A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 PRO 231 231 231 PRO PRO A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 HIS 233 233 233 HIS HIS A . n 
A 1 234 GLN 234 234 234 GLN GLN A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 MET 241 241 241 MET MET A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 PHE 244 244 244 PHE PHE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 TYR 246 246 246 TYR TYR A . n 
A 1 247 TRP 247 247 247 TRP TRP A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 HIS 249 249 249 HIS HIS A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 ASP 251 251 251 ASP ASP A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 GLU 255 255 255 GLU GLU A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 PRO 259 259 259 PRO PRO A . n 
A 1 260 PRO 260 260 260 PRO PRO A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 ASN 262 262 262 ASN ASN A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 PRO 267 267 267 PRO PRO A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 ARG 271 271 271 ARG ARG A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 SER 273 273 273 SER SER A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 MET 277 277 277 MET MET A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 TRP 281 281 281 TRP TRP A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 VAL 286 286 286 VAL VAL A . n 
A 1 287 VAL 287 287 287 VAL VAL A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 MET 293 293 293 MET MET A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 GLY 303 303 303 GLY GLY A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 VAL 305 305 305 VAL VAL A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 GLU 307 307 307 GLU GLU A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 PHE 309 309 309 PHE PHE A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 CYS 315 315 315 CYS CYS A . n 
A 1 316 GLN 316 316 316 GLN GLN A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 CYS 318 318 318 CYS CYS A . n 
A 1 319 PRO 319 319 319 PRO PRO A . n 
A 1 320 VAL 320 320 320 VAL VAL A . n 
A 1 321 HIS 321 321 321 HIS HIS A . n 
A 1 322 ARG 322 322 322 ARG ARG A . n 
A 1 323 ILE 323 323 323 ILE ILE A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 TYR 325 325 325 TYR TYR A . n 
A 1 326 LYS 326 326 326 LYS LYS A . n 
A 1 327 ASP 327 327 327 ASP ASP A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 ASN 329 329 329 ASN ASN A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 HIS 331 331 331 HIS HIS A . n 
A 1 332 ILE 332 332 332 ILE ILE A . n 
A 1 333 PRO 333 333 333 PRO PRO A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 MET 335 335 335 MET MET A . n 
A 1 336 GLU 336 336 336 GLU GLU A . n 
A 1 337 ASN 337 337 337 ASN ASN A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 ILE 342 342 342 ILE ILE A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 ARG 344 344 344 ARG ARG A . n 
A 1 345 PHE 345 345 345 PHE PHE A . n 
A 1 346 GLN 346 346 346 GLN GLN A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 ILE 352 352 352 ILE ILE A . n 
A 1 353 GLN 353 353 353 GLN GLN A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 ALA 358 358 358 ALA ALA A . n 
A 1 359 HIS 359 359 359 HIS HIS A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 TRP 361 361 361 TRP TRP A . n 
A 1 362 MET 362 362 362 MET MET A . n 
A 1 363 PHE 363 363 363 PHE PHE A . n 
A 1 364 PRO 364 364 364 PRO PRO A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
B 1 1   ALA 1   1   1   ALA ALA B . n 
B 1 2   SER 2   2   2   SER SER B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   PHE 5   5   5   PHE PHE B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   ALA 7   7   7   ALA ALA B . n 
B 1 8   ALA 8   8   8   ALA ALA B . n 
B 1 9   ASP 9   9   9   ASP ASP B . n 
B 1 10  LEU 10  10  10  LEU LEU B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  GLU 13  13  13  GLU GLU B . n 
B 1 14  MET 14  14  14  MET MET B . n 
B 1 15  THR 15  15  15  THR THR B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  PRO 18  18  18  PRO PRO B . n 
B 1 19  HIS 19  19  19  HIS HIS B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  LYS 21  21  21  LYS LYS B . n 
B 1 22  PRO 22  22  22  PRO PRO B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  PRO 27  27  27  PRO PRO B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  PHE 30  30  30  PHE PHE B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  PHE 34  34  34  PHE PHE B . n 
B 1 35  THR 35  35  35  THR THR B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  HIS 37  37  37  HIS HIS B . n 
B 1 38  MET 38  38  38  MET MET B . n 
B 1 39  LEU 39  39  39  LEU LEU B . n 
B 1 40  MET 40  40  40  MET MET B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  TRP 43  43  43  TRP TRP B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  ASP 45  45  45  ASP ASP B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  TRP 48  48  48  TRP TRP B . n 
B 1 49  GLY 49  49  49  GLY GLY B . n 
B 1 50  GLN 50  50  50  GLN GLN B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  ARG 52  52  52  ARG ARG B . n 
B 1 53  ILE 53  53  53  ILE ILE B . n 
B 1 54  GLN 54  54  54  GLN GLN B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  PHE 56  56  56  PHE PHE B . n 
B 1 57  GLN 57  57  57  GLN GLN B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  LEU 59  59  59  LEU LEU B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  LEU 61  61  61  LEU LEU B . n 
B 1 62  HIS 62  62  62  HIS HIS B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  SER 65  65  65  SER SER B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  SER 67  67  67  SER SER B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  GLN 73  73  73  GLN GLN B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  GLU 76  76  76  GLU GLU B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  MET 78  78  78  MET MET B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  ALA 80  80  80  ALA ALA B . n 
B 1 81  PHE 81  81  81  PHE PHE B . n 
B 1 82  LYS 82  82  82  LYS LYS B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  GLN 86  86  86  GLN GLN B . n 
B 1 87  GLN 87  87  87  GLN GLN B . n 
B 1 88  VAL 88  88  88  VAL VAL B . n 
B 1 89  ARG 89  89  89  ARG ARG B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  PHE 91  91  91  PHE PHE B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  TRP 94  94  94  TRP TRP B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  ASN 96  96  96  ASN ASN B . n 
B 1 97  MET 97  97  97  MET MET B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 MET 100 100 100 MET MET B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 ARG 102 102 102 ARG ARG B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 MET 105 105 105 MET MET B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 CYS 108 108 108 CYS CYS B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 PRO 110 110 110 PRO PRO B . n 
B 1 111 SER 111 111 111 SER SER B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 LYS 114 114 114 LYS LYS B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 GLU 119 119 119 GLU GLU B . n 
B 1 120 CYS 120 120 120 CYS CYS B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 ARG 122 122 122 ARG ARG B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 ILE 125 125 125 ILE ILE B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 TRP 131 131 131 TRP TRP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 PRO 133 133 133 PRO PRO B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 GLY 137 137 137 GLY GLY B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 SER 139 139 139 SER SER B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 TYR 141 141 141 TYR TYR B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 ARG 143 143 143 ARG ARG B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 GLY 148 148 148 GLY GLY B . n 
B 1 149 ASN 149 149 149 ASN ASN B . n 
B 1 150 GLU 150 150 150 GLU GLU B . n 
B 1 151 PRO 151 151 151 PRO PRO B . n 
B 1 152 SER 152 152 152 SER SER B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 VAL 155 155 155 VAL VAL B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 GLN 157 157 157 GLN GLN B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 ARG 159 159 159 ARG ARG B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 ALA 161 161 161 ALA ALA B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 PHE 164 164 164 PHE PHE B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 LEU 167 167 167 LEU LEU B . n 
B 1 168 CYS 168 168 168 CYS CYS B . n 
B 1 169 PRO 169 169 169 PRO PRO B . n 
B 1 170 VAL 170 170 170 VAL VAL B . n 
B 1 171 GLY 171 171 171 GLY GLY B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 PHE 174 174 174 PHE PHE B . n 
B 1 175 PRO 175 175 175 PRO PRO B . n 
B 1 176 GLY 176 176 176 GLY GLY B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 SER 178 178 178 SER SER B . n 
B 1 179 VAL 179 179 179 VAL VAL B . n 
B 1 180 THR 180 180 180 THR THR B . n 
B 1 181 PRO 181 181 181 PRO PRO B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 SER 183 183 183 SER SER B . n 
B 1 184 LEU 184 184 184 LEU LEU B . n 
B 1 185 LEU 185 185 185 LEU LEU B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 ASP 187 187 187 ASP ASP B . n 
B 1 188 PRO 188 188 188 PRO PRO B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 ILE 191 191 191 ILE ILE B . n 
B 1 192 ARG 192 192 192 ARG ARG B . n 
B 1 193 ALA 193 193 193 ALA ALA B . n 
B 1 194 TRP 194 194 194 TRP TRP B . n 
B 1 195 VAL 195 195 195 VAL VAL B . n 
B 1 196 GLY 196 196 196 GLY GLY B . n 
B 1 197 GLY 197 197 197 GLY GLY B . n 
B 1 198 VAL 198 198 198 VAL VAL B . n 
B 1 199 GLY 199 199 199 GLY GLY B . n 
B 1 200 ASN 200 200 200 ASN ASN B . n 
B 1 201 TYR 201 201 201 TYR TYR B . n 
B 1 202 LYS 202 202 202 LYS LYS B . n 
B 1 203 LEU 203 203 203 LEU LEU B . n 
B 1 204 GLY 204 204 204 GLY GLY B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ASN 206 206 206 ASN ASN B . n 
B 1 207 TYR 207 207 207 TYR TYR B . n 
B 1 208 GLY 208 208 208 GLY GLY B . n 
B 1 209 PRO 209 209 209 PRO PRO B . n 
B 1 210 THR 210 210 210 THR THR B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 GLN 214 214 214 GLN GLN B . n 
B 1 215 GLN 215 215 215 GLN GLN B . n 
B 1 216 GLU 216 216 216 GLU GLU B . n 
B 1 217 ALA 217 217 217 ALA ALA B . n 
B 1 218 LEU 218 218 218 LEU LEU B . n 
B 1 219 LYS 219 219 219 LYS LYS B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 GLY 221 221 221 GLY GLY B . n 
B 1 222 CYS 222 222 222 CYS CYS B . n 
B 1 223 GLU 223 223 223 GLU GLU B . n 
B 1 224 GLN 224 224 224 GLN GLN B . n 
B 1 225 VAL 225 225 225 VAL VAL B . n 
B 1 226 LEU 226 226 226 LEU LEU B . n 
B 1 227 TRP 227 227 227 TRP TRP B . n 
B 1 228 LEU 228 228 228 LEU LEU B . n 
B 1 229 TYR 229 229 229 TYR TYR B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 PRO 231 231 231 PRO PRO B . n 
B 1 232 ASP 232 232 232 ASP ASP B . n 
B 1 233 HIS 233 233 233 HIS HIS B . n 
B 1 234 GLN 234 234 234 GLN GLN B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 THR 236 236 236 THR THR B . n 
B 1 237 GLU 237 237 237 GLU GLU B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 GLY 239 239 239 GLY GLY B . n 
B 1 240 THR 240 240 240 THR THR B . n 
B 1 241 MET 241 241 241 MET MET B . n 
B 1 242 ASN 242 242 242 ASN ASN B . n 
B 1 243 ILE 243 243 243 ILE ILE B . n 
B 1 244 PHE 244 244 244 PHE PHE B . n 
B 1 245 VAL 245 245 245 VAL VAL B . n 
B 1 246 TYR 246 246 246 TYR TYR B . n 
B 1 247 TRP 247 247 247 TRP TRP B . n 
B 1 248 THR 248 248 248 THR THR B . n 
B 1 249 HIS 249 249 249 HIS HIS B . n 
B 1 250 GLU 250 250 250 GLU GLU B . n 
B 1 251 ASP 251 251 251 ASP ASP B . n 
B 1 252 GLY 252 252 252 GLY GLY B . n 
B 1 253 VAL 253 253 253 VAL VAL B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 GLU 255 255 255 GLU GLU B . n 
B 1 256 LEU 256 256 256 LEU LEU B . n 
B 1 257 VAL 257 257 257 VAL VAL B . n 
B 1 258 THR 258 258 258 THR THR B . n 
B 1 259 PRO 259 259 259 PRO PRO B . n 
B 1 260 PRO 260 260 260 PRO PRO B . n 
B 1 261 LEU 261 261 261 LEU LEU B . n 
B 1 262 ASN 262 262 262 ASN ASN B . n 
B 1 263 GLY 263 263 263 GLY GLY B . n 
B 1 264 VAL 264 264 264 VAL VAL B . n 
B 1 265 ILE 265 265 265 ILE ILE B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 PRO 267 267 267 PRO PRO B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 VAL 269 269 269 VAL VAL B . n 
B 1 270 VAL 270 270 270 VAL VAL B . n 
B 1 271 ARG 271 271 271 ARG ARG B . n 
B 1 272 GLN 272 272 272 GLN GLN B . n 
B 1 273 SER 273 273 273 SER SER B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 LEU 275 275 275 LEU LEU B . n 
B 1 276 ASP 276 276 276 ASP ASP B . n 
B 1 277 MET 277 277 277 MET MET B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 THR 280 280 280 THR THR B . n 
B 1 281 TRP 281 281 281 TRP TRP B . n 
B 1 282 GLY 282 282 282 GLY GLY B . n 
B 1 283 GLU 283 283 283 GLU GLU B . n 
B 1 284 PHE 284 284 284 PHE PHE B . n 
B 1 285 ARG 285 285 285 ARG ARG B . n 
B 1 286 VAL 286 286 286 VAL VAL B . n 
B 1 287 VAL 287 287 287 VAL VAL B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 ARG 289 289 289 ARG ARG B . n 
B 1 290 THR 290 290 290 THR THR B . n 
B 1 291 ILE 291 291 291 ILE ILE B . n 
B 1 292 THR 292 292 292 THR THR B . n 
B 1 293 MET 293 293 293 MET MET B . n 
B 1 294 LYS 294 294 294 LYS LYS B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 LEU 296 296 296 LEU LEU B . n 
B 1 297 LEU 297 297 297 LEU LEU B . n 
B 1 298 ARG 298 298 298 ARG ARG B . n 
B 1 299 ALA 299 299 299 ALA ALA B . n 
B 1 300 LEU 300 300 300 LEU LEU B . n 
B 1 301 GLU 301 301 301 GLU GLU B . n 
B 1 302 GLU 302 302 302 GLU GLU B . n 
B 1 303 GLY 303 303 303 GLY GLY B . n 
B 1 304 ARG 304 304 304 ARG ARG B . n 
B 1 305 VAL 305 305 305 VAL VAL B . n 
B 1 306 ARG 306 306 306 ARG ARG B . n 
B 1 307 GLU 307 307 307 GLU GLU B . n 
B 1 308 VAL 308 308 308 VAL VAL B . n 
B 1 309 PHE 309 309 309 PHE PHE B . n 
B 1 310 GLY 310 310 310 GLY GLY B . n 
B 1 311 SER 311 311 311 SER SER B . n 
B 1 312 GLY 312 312 312 GLY GLY B . n 
B 1 313 THR 313 313 313 THR THR B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 CYS 315 315 315 CYS CYS B . n 
B 1 316 GLN 316 316 316 GLN GLN B . n 
B 1 317 VAL 317 317 317 VAL VAL B . n 
B 1 318 CYS 318 318 318 CYS CYS B . n 
B 1 319 PRO 319 319 319 PRO PRO B . n 
B 1 320 VAL 320 320 320 VAL VAL B . n 
B 1 321 HIS 321 321 321 HIS HIS B . n 
B 1 322 ARG 322 322 322 ARG ARG B . n 
B 1 323 ILE 323 323 323 ILE ILE B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 TYR 325 325 325 TYR TYR B . n 
B 1 326 LYS 326 326 326 LYS LYS B . n 
B 1 327 ASP 327 327 327 ASP ASP B . n 
B 1 328 ARG 328 328 328 ARG ARG B . n 
B 1 329 ASN 329 329 329 ASN ASN B . n 
B 1 330 LEU 330 330 330 LEU LEU B . n 
B 1 331 HIS 331 331 331 HIS HIS B . n 
B 1 332 ILE 332 332 332 ILE ILE B . n 
B 1 333 PRO 333 333 333 PRO PRO B . n 
B 1 334 THR 334 334 334 THR THR B . n 
B 1 335 MET 335 335 335 MET MET B . n 
B 1 336 GLU 336 336 336 GLU GLU B . n 
B 1 337 ASN 337 337 337 ASN ASN B . n 
B 1 338 GLY 338 338 338 GLY GLY B . n 
B 1 339 PRO 339 339 339 PRO PRO B . n 
B 1 340 GLU 340 340 340 GLU GLU B . n 
B 1 341 LEU 341 341 341 LEU LEU B . n 
B 1 342 ILE 342 342 342 ILE ILE B . n 
B 1 343 LEU 343 343 343 LEU LEU B . n 
B 1 344 ARG 344 344 344 ARG ARG B . n 
B 1 345 PHE 345 345 345 PHE PHE B . n 
B 1 346 GLN 346 346 346 GLN GLN B . n 
B 1 347 LYS 347 347 347 LYS LYS B . n 
B 1 348 GLU 348 348 348 GLU GLU B . n 
B 1 349 LEU 349 349 349 LEU LEU B . n 
B 1 350 LYS 350 350 350 LYS LYS B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 ILE 352 352 352 ILE ILE B . n 
B 1 353 GLN 353 353 353 GLN GLN B . n 
B 1 354 TYR 354 354 354 TYR TYR B . n 
B 1 355 GLY 355 355 355 GLY GLY B . n 
B 1 356 ILE 356 356 356 ILE ILE B . n 
B 1 357 ARG 357 357 357 ARG ARG B . n 
B 1 358 ALA 358 358 358 ALA ALA B . n 
B 1 359 HIS 359 359 359 HIS HIS B . n 
B 1 360 GLU 360 360 360 GLU GLU B . n 
B 1 361 TRP 361 361 361 TRP TRP B . n 
B 1 362 MET 362 362 362 MET MET B . n 
B 1 363 PHE 363 363 363 PHE PHE B . n 
B 1 364 PRO 364 364 364 PRO PRO B . n 
B 1 365 VAL 365 365 365 VAL VAL B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5690  ? 
1 MORE         -31   ? 
1 'SSA (A^2)'  28410 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-03-08 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       0.9 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A GLY 338 ? ? N A GLU 340 ? ? 2.12 
2 1 NH2 A ARG 106 ? ? O B PRO 209 ? ? 2.15 
3 1 NE  B ARG 102 ? ? O B HOH 421 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 74  ? ? CB A LEU 74  ? ? CG A LEU 74  ? ? 131.47 115.30 16.17 2.30 N 
2 1 CA B LEU 74  ? ? CB B LEU 74  ? ? CG B LEU 74  ? ? 131.79 115.30 16.49 2.30 N 
3 1 C  B PHE 174 ? ? N  B PRO 175 ? ? CA B PRO 175 ? ? 129.16 119.30 9.86  1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 3   ? ? 5.21    -101.53 
2  1 PRO A 18  ? ? -36.92  150.55  
3  1 PRO A 24  ? ? -63.42  -138.72 
4  1 ASN A 44  ? ? -124.19 -161.75 
5  1 GLN A 86  ? ? 93.70   -8.08   
6  1 ARG A 92  ? ? 39.68   48.40   
7  1 ASN A 149 ? ? -146.63 46.95   
8  1 ALA A 172 ? ? 64.12   99.10   
9  1 TYR A 173 ? ? 15.64   -90.10  
10 1 PHE A 174 ? ? -136.28 -64.40  
11 1 SER A 178 ? ? -76.78  -162.32 
12 1 ASP A 251 ? ? -56.02  2.76    
13 1 TYR A 325 ? ? -88.99  -105.64 
14 1 ASP A 327 ? ? 63.28   -6.50   
15 1 PRO A 333 ? ? -63.14  17.30   
16 1 PRO A 339 ? ? -62.78  69.11   
17 1 SER B 2   ? ? -160.13 -15.67  
18 1 SER B 3   ? ? 32.44   173.25  
19 1 SER B 4   ? ? 143.57  -177.16 
20 1 PHE B 5   ? ? 61.66   105.50  
21 1 ALA B 8   ? ? -69.58  6.52    
22 1 THR B 15  ? ? -53.20  -173.81 
23 1 GLN B 16  ? ? -141.92 -14.37  
24 1 LYS B 17  ? ? -152.02 72.47   
25 1 PRO B 27  ? ? -42.32  151.44  
26 1 ASN B 44  ? ? -149.62 -156.99 
27 1 ASP B 85  ? ? -64.19  12.43   
28 1 ARG B 92  ? ? 35.93   47.74   
29 1 ASN B 149 ? ? -148.08 45.41   
30 1 ALA B 172 ? ? 165.04  114.68  
31 1 PRO B 175 ? ? -23.47  -39.68  
32 1 VAL B 179 ? ? 61.63   69.96   
33 1 ILE B 191 ? ? 59.96   99.58   
34 1 TYR B 325 ? ? -88.54  -109.99 
35 1 ASP B 327 ? ? 60.99   -6.60   
36 1 PRO B 333 ? ? -63.44  18.75   
37 1 PRO B 339 ? ? -59.40  49.61   
38 1 GLU B 340 ? ? -43.36  -70.18  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 207 ? ? 0.072 'SIDE CHAIN' 
2 1 TYR B 207 ? ? 0.085 'SIDE CHAIN' 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "PYRIDOXAL-5'-PHOSPHATE" PLP 
3 water                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PLP 1   370 370 PLP PLP A . 
D 2 PLP 1   370 370 PLP PLP B . 
E 3 HOH 1   371 1   HOH HOH A . 
E 3 HOH 2   372 2   HOH HOH A . 
E 3 HOH 3   373 4   HOH HOH A . 
E 3 HOH 4   374 5   HOH HOH A . 
E 3 HOH 5   375 7   HOH HOH A . 
E 3 HOH 6   376 10  HOH HOH A . 
E 3 HOH 7   377 12  HOH HOH A . 
E 3 HOH 8   378 15  HOH HOH A . 
E 3 HOH 9   379 16  HOH HOH A . 
E 3 HOH 10  380 19  HOH HOH A . 
E 3 HOH 11  381 21  HOH HOH A . 
E 3 HOH 12  382 22  HOH HOH A . 
E 3 HOH 13  383 23  HOH HOH A . 
E 3 HOH 14  384 26  HOH HOH A . 
E 3 HOH 15  385 28  HOH HOH A . 
E 3 HOH 16  386 30  HOH HOH A . 
E 3 HOH 17  387 34  HOH HOH A . 
E 3 HOH 18  388 35  HOH HOH A . 
E 3 HOH 19  389 36  HOH HOH A . 
E 3 HOH 20  390 38  HOH HOH A . 
E 3 HOH 21  391 42  HOH HOH A . 
E 3 HOH 22  392 43  HOH HOH A . 
E 3 HOH 23  393 44  HOH HOH A . 
E 3 HOH 24  394 45  HOH HOH A . 
E 3 HOH 25  395 46  HOH HOH A . 
E 3 HOH 26  396 47  HOH HOH A . 
E 3 HOH 27  397 48  HOH HOH A . 
E 3 HOH 28  398 52  HOH HOH A . 
E 3 HOH 29  399 54  HOH HOH A . 
E 3 HOH 30  400 58  HOH HOH A . 
E 3 HOH 31  401 59  HOH HOH A . 
E 3 HOH 32  402 61  HOH HOH A . 
E 3 HOH 33  403 62  HOH HOH A . 
E 3 HOH 34  404 63  HOH HOH A . 
E 3 HOH 35  405 66  HOH HOH A . 
E 3 HOH 36  406 67  HOH HOH A . 
E 3 HOH 37  407 71  HOH HOH A . 
E 3 HOH 38  408 73  HOH HOH A . 
E 3 HOH 39  409 74  HOH HOH A . 
E 3 HOH 40  410 78  HOH HOH A . 
E 3 HOH 41  411 79  HOH HOH A . 
E 3 HOH 42  412 82  HOH HOH A . 
E 3 HOH 43  413 85  HOH HOH A . 
E 3 HOH 44  414 87  HOH HOH A . 
E 3 HOH 45  415 88  HOH HOH A . 
E 3 HOH 46  416 90  HOH HOH A . 
E 3 HOH 47  417 91  HOH HOH A . 
E 3 HOH 48  418 95  HOH HOH A . 
E 3 HOH 49  419 99  HOH HOH A . 
E 3 HOH 50  420 100 HOH HOH A . 
E 3 HOH 51  421 102 HOH HOH A . 
E 3 HOH 52  422 106 HOH HOH A . 
E 3 HOH 53  423 107 HOH HOH A . 
E 3 HOH 54  424 111 HOH HOH A . 
E 3 HOH 55  425 112 HOH HOH A . 
E 3 HOH 56  426 113 HOH HOH A . 
E 3 HOH 57  427 114 HOH HOH A . 
E 3 HOH 58  428 115 HOH HOH A . 
E 3 HOH 59  429 116 HOH HOH A . 
E 3 HOH 60  430 117 HOH HOH A . 
E 3 HOH 61  431 118 HOH HOH A . 
E 3 HOH 62  432 124 HOH HOH A . 
E 3 HOH 63  433 125 HOH HOH A . 
E 3 HOH 64  434 126 HOH HOH A . 
E 3 HOH 65  435 128 HOH HOH A . 
E 3 HOH 66  436 129 HOH HOH A . 
E 3 HOH 67  437 130 HOH HOH A . 
E 3 HOH 68  438 131 HOH HOH A . 
E 3 HOH 69  439 133 HOH HOH A . 
E 3 HOH 70  440 134 HOH HOH A . 
E 3 HOH 71  441 135 HOH HOH A . 
E 3 HOH 72  442 136 HOH HOH A . 
E 3 HOH 73  443 137 HOH HOH A . 
E 3 HOH 74  444 138 HOH HOH A . 
E 3 HOH 75  445 140 HOH HOH A . 
E 3 HOH 76  446 145 HOH HOH A . 
E 3 HOH 77  447 146 HOH HOH A . 
E 3 HOH 78  448 148 HOH HOH A . 
E 3 HOH 79  449 149 HOH HOH A . 
E 3 HOH 80  450 151 HOH HOH A . 
E 3 HOH 81  451 153 HOH HOH A . 
E 3 HOH 82  452 154 HOH HOH A . 
E 3 HOH 83  453 156 HOH HOH A . 
E 3 HOH 84  454 157 HOH HOH A . 
E 3 HOH 85  455 159 HOH HOH A . 
E 3 HOH 86  456 160 HOH HOH A . 
E 3 HOH 87  457 161 HOH HOH A . 
E 3 HOH 88  458 162 HOH HOH A . 
E 3 HOH 89  459 163 HOH HOH A . 
E 3 HOH 90  460 165 HOH HOH A . 
E 3 HOH 91  461 166 HOH HOH A . 
E 3 HOH 92  462 167 HOH HOH A . 
E 3 HOH 93  463 168 HOH HOH A . 
E 3 HOH 94  464 171 HOH HOH A . 
E 3 HOH 95  465 172 HOH HOH A . 
E 3 HOH 96  466 175 HOH HOH A . 
E 3 HOH 97  467 176 HOH HOH A . 
E 3 HOH 98  468 177 HOH HOH A . 
E 3 HOH 99  469 178 HOH HOH A . 
E 3 HOH 100 470 181 HOH HOH A . 
E 3 HOH 101 471 182 HOH HOH A . 
E 3 HOH 102 472 183 HOH HOH A . 
E 3 HOH 103 473 186 HOH HOH A . 
E 3 HOH 104 474 189 HOH HOH A . 
E 3 HOH 105 475 193 HOH HOH A . 
E 3 HOH 106 476 195 HOH HOH A . 
E 3 HOH 107 477 196 HOH HOH A . 
E 3 HOH 108 478 205 HOH HOH A . 
E 3 HOH 109 479 207 HOH HOH A . 
E 3 HOH 110 480 208 HOH HOH A . 
E 3 HOH 111 481 209 HOH HOH A . 
E 3 HOH 112 482 212 HOH HOH A . 
E 3 HOH 113 483 214 HOH HOH A . 
E 3 HOH 114 484 216 HOH HOH A . 
E 3 HOH 115 485 220 HOH HOH A . 
E 3 HOH 116 486 221 HOH HOH A . 
E 3 HOH 117 487 222 HOH HOH A . 
E 3 HOH 118 488 224 HOH HOH A . 
E 3 HOH 119 489 226 HOH HOH A . 
E 3 HOH 120 490 227 HOH HOH A . 
E 3 HOH 121 491 230 HOH HOH A . 
E 3 HOH 122 492 233 HOH HOH A . 
E 3 HOH 123 493 235 HOH HOH A . 
E 3 HOH 124 494 236 HOH HOH A . 
E 3 HOH 125 495 242 HOH HOH A . 
E 3 HOH 126 496 243 HOH HOH A . 
E 3 HOH 127 497 245 HOH HOH A . 
E 3 HOH 128 498 246 HOH HOH A . 
E 3 HOH 129 499 248 HOH HOH A . 
E 3 HOH 130 500 249 HOH HOH A . 
E 3 HOH 131 501 252 HOH HOH A . 
E 3 HOH 132 502 253 HOH HOH A . 
E 3 HOH 133 503 254 HOH HOH A . 
E 3 HOH 134 504 255 HOH HOH A . 
E 3 HOH 135 505 258 HOH HOH A . 
E 3 HOH 136 506 259 HOH HOH A . 
E 3 HOH 137 507 263 HOH HOH A . 
E 3 HOH 138 508 264 HOH HOH A . 
E 3 HOH 139 509 267 HOH HOH A . 
E 3 HOH 140 510 269 HOH HOH A . 
E 3 HOH 141 511 271 HOH HOH A . 
E 3 HOH 142 512 272 HOH HOH A . 
E 3 HOH 143 513 273 HOH HOH A . 
F 3 HOH 1   371 3   HOH HOH B . 
F 3 HOH 2   372 6   HOH HOH B . 
F 3 HOH 3   373 8   HOH HOH B . 
F 3 HOH 4   374 9   HOH HOH B . 
F 3 HOH 5   375 11  HOH HOH B . 
F 3 HOH 6   376 13  HOH HOH B . 
F 3 HOH 7   377 14  HOH HOH B . 
F 3 HOH 8   378 17  HOH HOH B . 
F 3 HOH 9   379 18  HOH HOH B . 
F 3 HOH 10  380 20  HOH HOH B . 
F 3 HOH 11  381 24  HOH HOH B . 
F 3 HOH 12  382 25  HOH HOH B . 
F 3 HOH 13  383 27  HOH HOH B . 
F 3 HOH 14  384 29  HOH HOH B . 
F 3 HOH 15  385 31  HOH HOH B . 
F 3 HOH 16  386 32  HOH HOH B . 
F 3 HOH 17  387 33  HOH HOH B . 
F 3 HOH 18  388 37  HOH HOH B . 
F 3 HOH 19  389 39  HOH HOH B . 
F 3 HOH 20  390 40  HOH HOH B . 
F 3 HOH 21  391 41  HOH HOH B . 
F 3 HOH 22  392 49  HOH HOH B . 
F 3 HOH 23  393 50  HOH HOH B . 
F 3 HOH 24  394 51  HOH HOH B . 
F 3 HOH 25  395 53  HOH HOH B . 
F 3 HOH 26  396 55  HOH HOH B . 
F 3 HOH 27  397 56  HOH HOH B . 
F 3 HOH 28  398 57  HOH HOH B . 
F 3 HOH 29  399 60  HOH HOH B . 
F 3 HOH 30  400 64  HOH HOH B . 
F 3 HOH 31  401 65  HOH HOH B . 
F 3 HOH 32  402 68  HOH HOH B . 
F 3 HOH 33  403 69  HOH HOH B . 
F 3 HOH 34  404 70  HOH HOH B . 
F 3 HOH 35  405 72  HOH HOH B . 
F 3 HOH 36  406 75  HOH HOH B . 
F 3 HOH 37  407 76  HOH HOH B . 
F 3 HOH 38  408 77  HOH HOH B . 
F 3 HOH 39  409 80  HOH HOH B . 
F 3 HOH 40  410 81  HOH HOH B . 
F 3 HOH 41  411 83  HOH HOH B . 
F 3 HOH 42  412 84  HOH HOH B . 
F 3 HOH 43  413 86  HOH HOH B . 
F 3 HOH 44  414 89  HOH HOH B . 
F 3 HOH 45  415 92  HOH HOH B . 
F 3 HOH 46  416 93  HOH HOH B . 
F 3 HOH 47  417 94  HOH HOH B . 
F 3 HOH 48  418 96  HOH HOH B . 
F 3 HOH 49  419 97  HOH HOH B . 
F 3 HOH 50  420 98  HOH HOH B . 
F 3 HOH 51  421 101 HOH HOH B . 
F 3 HOH 52  422 103 HOH HOH B . 
F 3 HOH 53  423 104 HOH HOH B . 
F 3 HOH 54  424 105 HOH HOH B . 
F 3 HOH 55  425 108 HOH HOH B . 
F 3 HOH 56  426 109 HOH HOH B . 
F 3 HOH 57  427 110 HOH HOH B . 
F 3 HOH 58  428 119 HOH HOH B . 
F 3 HOH 59  429 120 HOH HOH B . 
F 3 HOH 60  430 121 HOH HOH B . 
F 3 HOH 61  431 122 HOH HOH B . 
F 3 HOH 62  432 123 HOH HOH B . 
F 3 HOH 63  433 127 HOH HOH B . 
F 3 HOH 64  434 132 HOH HOH B . 
F 3 HOH 65  435 139 HOH HOH B . 
F 3 HOH 66  436 141 HOH HOH B . 
F 3 HOH 67  437 142 HOH HOH B . 
F 3 HOH 68  438 143 HOH HOH B . 
F 3 HOH 69  439 144 HOH HOH B . 
F 3 HOH 70  440 147 HOH HOH B . 
F 3 HOH 71  441 150 HOH HOH B . 
F 3 HOH 72  442 152 HOH HOH B . 
F 3 HOH 73  443 155 HOH HOH B . 
F 3 HOH 74  444 158 HOH HOH B . 
F 3 HOH 75  445 164 HOH HOH B . 
F 3 HOH 76  446 169 HOH HOH B . 
F 3 HOH 77  447 170 HOH HOH B . 
F 3 HOH 78  448 173 HOH HOH B . 
F 3 HOH 79  449 174 HOH HOH B . 
F 3 HOH 80  450 179 HOH HOH B . 
F 3 HOH 81  451 180 HOH HOH B . 
F 3 HOH 82  452 184 HOH HOH B . 
F 3 HOH 83  453 185 HOH HOH B . 
F 3 HOH 84  454 187 HOH HOH B . 
F 3 HOH 85  455 188 HOH HOH B . 
F 3 HOH 86  456 190 HOH HOH B . 
F 3 HOH 87  457 191 HOH HOH B . 
F 3 HOH 88  458 192 HOH HOH B . 
F 3 HOH 89  459 194 HOH HOH B . 
F 3 HOH 90  460 197 HOH HOH B . 
F 3 HOH 91  461 198 HOH HOH B . 
F 3 HOH 92  462 199 HOH HOH B . 
F 3 HOH 93  463 200 HOH HOH B . 
F 3 HOH 94  464 201 HOH HOH B . 
F 3 HOH 95  465 202 HOH HOH B . 
F 3 HOH 96  466 203 HOH HOH B . 
F 3 HOH 97  467 204 HOH HOH B . 
F 3 HOH 98  468 206 HOH HOH B . 
F 3 HOH 99  469 210 HOH HOH B . 
F 3 HOH 100 470 211 HOH HOH B . 
F 3 HOH 101 471 213 HOH HOH B . 
F 3 HOH 102 472 215 HOH HOH B . 
F 3 HOH 103 473 217 HOH HOH B . 
F 3 HOH 104 474 218 HOH HOH B . 
F 3 HOH 105 475 219 HOH HOH B . 
F 3 HOH 106 476 223 HOH HOH B . 
F 3 HOH 107 477 225 HOH HOH B . 
F 3 HOH 108 478 228 HOH HOH B . 
F 3 HOH 109 479 229 HOH HOH B . 
F 3 HOH 110 480 231 HOH HOH B . 
F 3 HOH 111 481 232 HOH HOH B . 
F 3 HOH 112 482 234 HOH HOH B . 
F 3 HOH 113 483 237 HOH HOH B . 
F 3 HOH 114 484 238 HOH HOH B . 
F 3 HOH 115 485 239 HOH HOH B . 
F 3 HOH 116 486 240 HOH HOH B . 
F 3 HOH 117 487 241 HOH HOH B . 
F 3 HOH 118 488 244 HOH HOH B . 
F 3 HOH 119 489 247 HOH HOH B . 
F 3 HOH 120 490 250 HOH HOH B . 
F 3 HOH 121 491 251 HOH HOH B . 
F 3 HOH 122 492 256 HOH HOH B . 
F 3 HOH 123 493 257 HOH HOH B . 
F 3 HOH 124 494 260 HOH HOH B . 
F 3 HOH 125 495 261 HOH HOH B . 
F 3 HOH 126 496 262 HOH HOH B . 
F 3 HOH 127 497 265 HOH HOH B . 
F 3 HOH 128 498 266 HOH HOH B . 
F 3 HOH 129 499 268 HOH HOH B . 
F 3 HOH 130 500 270 HOH HOH B . 
#