data_1EKP
# 
_entry.id   1EKP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EKP         
RCSB  RCSB010681   
WWPDB D_1000010681 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EKF '1EKF CONTAINS THE SAME PROTEIN IN ORTHORHOMBIC FORM COMPLEXED WITH PYRIDOXAL PHOSPHATE' unspecified 
PDB 1EKV 
;1EKV CONTAINS THE SAME PROTEIN INACTIVATED BY TRIS BOUND TO THE PYRIDOXAL PHOSPHATE ON ONE END AND ACTIVE SITE LYS202 NZ ON THE OTHER.
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EKP 
_pdbx_database_status.recvd_initial_deposition_date   2000-03-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yennawar, N.H.' 1 
'Dunbar, J.H.'   2 
'Conway, M.'     3 
'Hutson, S.M.'   4 
'Farber, G.K.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The structure of human mitochondrial branched-chain aminotransferase.'               'Acta Crystallogr.,Sect.D' 57   506 
515 2001 ABCRE6 DK 0907-4449 0766 ? 11264579 10.1107/S0907444901001925       
1       'Cloning of the Rat and Human Mitochondrial Branched Chain Aminotransferases (BCATm)' BIOCHIM.BIOPHYS.ACTA       1339 9   
13  1997 BBACAQ NE 0006-3002 0113 ? ?        '10.1016/S0167-4838(97)00044-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yennawar, N.'  1 
primary 'Dunbar, J.'    2 
primary 'Conway, M.'    3 
primary 'Hutson, S.'    4 
primary 'Farber, G.'    5 
1       'Bledsoe, R.K.' 6 
1       'Dawson, P.A.'  7 
1       'Hutson, S.M.'  8 
# 
_cell.entry_id           1EKP 
_cell.length_a           59.630 
_cell.length_b           111.640 
_cell.length_c           59.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.89 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EKP 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL)' 41368.016 2   2.6.1.42 ? ? ? 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"                                     247.142   2   ?        ? ? ? 
3 water       nat water                                                        18.015    196 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BCAT(M)' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKA
FKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRR
ALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGT
MNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPV
HRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKA
FKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRR
ALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGT
MNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPV
HRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   SER n 
1 4   SER n 
1 5   PHE n 
1 6   LYS n 
1 7   ALA n 
1 8   ALA n 
1 9   ASP n 
1 10  LEU n 
1 11  GLN n 
1 12  LEU n 
1 13  GLU n 
1 14  MET n 
1 15  THR n 
1 16  GLN n 
1 17  LYS n 
1 18  PRO n 
1 19  HIS n 
1 20  LYS n 
1 21  LYS n 
1 22  PRO n 
1 23  GLY n 
1 24  PRO n 
1 25  GLY n 
1 26  GLU n 
1 27  PRO n 
1 28  LEU n 
1 29  VAL n 
1 30  PHE n 
1 31  GLY n 
1 32  LYS n 
1 33  THR n 
1 34  PHE n 
1 35  THR n 
1 36  ASP n 
1 37  HIS n 
1 38  MET n 
1 39  LEU n 
1 40  MET n 
1 41  VAL n 
1 42  GLU n 
1 43  TRP n 
1 44  ASN n 
1 45  ASP n 
1 46  LYS n 
1 47  GLY n 
1 48  TRP n 
1 49  GLY n 
1 50  GLN n 
1 51  PRO n 
1 52  ARG n 
1 53  ILE n 
1 54  GLN n 
1 55  PRO n 
1 56  PHE n 
1 57  GLN n 
1 58  ASN n 
1 59  LEU n 
1 60  THR n 
1 61  LEU n 
1 62  HIS n 
1 63  PRO n 
1 64  ALA n 
1 65  SER n 
1 66  SER n 
1 67  SER n 
1 68  LEU n 
1 69  HIS n 
1 70  TYR n 
1 71  SER n 
1 72  LEU n 
1 73  GLN n 
1 74  LEU n 
1 75  PHE n 
1 76  GLU n 
1 77  GLY n 
1 78  MET n 
1 79  LYS n 
1 80  ALA n 
1 81  PHE n 
1 82  LYS n 
1 83  GLY n 
1 84  LYS n 
1 85  ASP n 
1 86  GLN n 
1 87  GLN n 
1 88  VAL n 
1 89  ARG n 
1 90  LEU n 
1 91  PHE n 
1 92  ARG n 
1 93  PRO n 
1 94  TRP n 
1 95  LEU n 
1 96  ASN n 
1 97  MET n 
1 98  ASP n 
1 99  ARG n 
1 100 MET n 
1 101 LEU n 
1 102 ARG n 
1 103 SER n 
1 104 ALA n 
1 105 MET n 
1 106 ARG n 
1 107 LEU n 
1 108 CYS n 
1 109 LEU n 
1 110 PRO n 
1 111 SER n 
1 112 PHE n 
1 113 ASP n 
1 114 LYS n 
1 115 LEU n 
1 116 GLU n 
1 117 LEU n 
1 118 LEU n 
1 119 GLU n 
1 120 CYS n 
1 121 ILE n 
1 122 ARG n 
1 123 ARG n 
1 124 LEU n 
1 125 ILE n 
1 126 GLU n 
1 127 VAL n 
1 128 ASP n 
1 129 LYS n 
1 130 ASP n 
1 131 TRP n 
1 132 VAL n 
1 133 PRO n 
1 134 ASP n 
1 135 ALA n 
1 136 ALA n 
1 137 GLY n 
1 138 THR n 
1 139 SER n 
1 140 LEU n 
1 141 TYR n 
1 142 VAL n 
1 143 ARG n 
1 144 PRO n 
1 145 VAL n 
1 146 LEU n 
1 147 ILE n 
1 148 GLY n 
1 149 ASN n 
1 150 GLU n 
1 151 PRO n 
1 152 SER n 
1 153 LEU n 
1 154 GLY n 
1 155 VAL n 
1 156 SER n 
1 157 GLN n 
1 158 PRO n 
1 159 ARG n 
1 160 ARG n 
1 161 ALA n 
1 162 LEU n 
1 163 LEU n 
1 164 PHE n 
1 165 VAL n 
1 166 ILE n 
1 167 LEU n 
1 168 CYS n 
1 169 PRO n 
1 170 VAL n 
1 171 GLY n 
1 172 ALA n 
1 173 TYR n 
1 174 PHE n 
1 175 PRO n 
1 176 GLY n 
1 177 GLY n 
1 178 SER n 
1 179 VAL n 
1 180 THR n 
1 181 PRO n 
1 182 VAL n 
1 183 SER n 
1 184 LEU n 
1 185 LEU n 
1 186 ALA n 
1 187 ASP n 
1 188 PRO n 
1 189 ALA n 
1 190 PHE n 
1 191 ILE n 
1 192 ARG n 
1 193 ALA n 
1 194 TRP n 
1 195 VAL n 
1 196 GLY n 
1 197 GLY n 
1 198 VAL n 
1 199 GLY n 
1 200 ASN n 
1 201 TYR n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 GLY n 
1 206 ASN n 
1 207 TYR n 
1 208 GLY n 
1 209 PRO n 
1 210 THR n 
1 211 VAL n 
1 212 LEU n 
1 213 VAL n 
1 214 GLN n 
1 215 GLN n 
1 216 GLU n 
1 217 ALA n 
1 218 LEU n 
1 219 LYS n 
1 220 ARG n 
1 221 GLY n 
1 222 CYS n 
1 223 GLU n 
1 224 GLN n 
1 225 VAL n 
1 226 LEU n 
1 227 TRP n 
1 228 LEU n 
1 229 TYR n 
1 230 GLY n 
1 231 PRO n 
1 232 ASP n 
1 233 HIS n 
1 234 GLN n 
1 235 LEU n 
1 236 THR n 
1 237 GLU n 
1 238 VAL n 
1 239 GLY n 
1 240 THR n 
1 241 MET n 
1 242 ASN n 
1 243 ILE n 
1 244 PHE n 
1 245 VAL n 
1 246 TYR n 
1 247 TRP n 
1 248 THR n 
1 249 HIS n 
1 250 GLU n 
1 251 ASP n 
1 252 GLY n 
1 253 VAL n 
1 254 LEU n 
1 255 GLU n 
1 256 LEU n 
1 257 VAL n 
1 258 THR n 
1 259 PRO n 
1 260 PRO n 
1 261 LEU n 
1 262 ASN n 
1 263 GLY n 
1 264 VAL n 
1 265 ILE n 
1 266 LEU n 
1 267 PRO n 
1 268 GLY n 
1 269 VAL n 
1 270 VAL n 
1 271 ARG n 
1 272 GLN n 
1 273 SER n 
1 274 LEU n 
1 275 LEU n 
1 276 ASP n 
1 277 MET n 
1 278 ALA n 
1 279 GLN n 
1 280 THR n 
1 281 TRP n 
1 282 GLY n 
1 283 GLU n 
1 284 PHE n 
1 285 ARG n 
1 286 VAL n 
1 287 VAL n 
1 288 GLU n 
1 289 ARG n 
1 290 THR n 
1 291 ILE n 
1 292 THR n 
1 293 MET n 
1 294 LYS n 
1 295 GLN n 
1 296 LEU n 
1 297 LEU n 
1 298 ARG n 
1 299 ALA n 
1 300 LEU n 
1 301 GLU n 
1 302 GLU n 
1 303 GLY n 
1 304 ARG n 
1 305 VAL n 
1 306 ARG n 
1 307 GLU n 
1 308 VAL n 
1 309 PHE n 
1 310 GLY n 
1 311 SER n 
1 312 GLY n 
1 313 THR n 
1 314 ALA n 
1 315 CYS n 
1 316 GLN n 
1 317 VAL n 
1 318 CYS n 
1 319 PRO n 
1 320 VAL n 
1 321 HIS n 
1 322 ARG n 
1 323 ILE n 
1 324 LEU n 
1 325 TYR n 
1 326 LYS n 
1 327 ASP n 
1 328 ARG n 
1 329 ASN n 
1 330 LEU n 
1 331 HIS n 
1 332 ILE n 
1 333 PRO n 
1 334 THR n 
1 335 MET n 
1 336 GLU n 
1 337 ASN n 
1 338 GLY n 
1 339 PRO n 
1 340 GLU n 
1 341 LEU n 
1 342 ILE n 
1 343 LEU n 
1 344 ARG n 
1 345 PHE n 
1 346 GLN n 
1 347 LYS n 
1 348 GLU n 
1 349 LEU n 
1 350 LYS n 
1 351 GLU n 
1 352 ILE n 
1 353 GLN n 
1 354 TYR n 
1 355 GLY n 
1 356 ILE n 
1 357 ARG n 
1 358 ALA n 
1 359 HIS n 
1 360 GLU n 
1 361 TRP n 
1 362 MET n 
1 363 PHE n 
1 364 PRO n 
1 365 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    BCAT2_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          O15382 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EKP A 1 ? 365 ? O15382 28 ? 392 ? 1 365 
2 1 1EKP B 1 ? 365 ? O15382 28 ? 392 ? 1 365 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?                      'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                      'C9 H11 N O2'    165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'  247.142 
PRO 'L-peptide linking' y PROLINE                  ?                      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?                      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ?                      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EKP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   48.55 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;PEG1500, DTT, HEPES; 
NA OR K PHOSPHATE, DTT, HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   1997-03-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EKP 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             40.65 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   21222 
_reflns.number_all                   27035 
_reflns.percent_possible_obs         79.9 
_reflns.pdbx_Rmerge_I_obs            0.0630000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.1 
_reflns.B_iso_Wilson_estimate        18.4 
_reflns.pdbx_redundancy              2.632 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.54 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   66.8 
_reflns_shell.Rmerge_I_obs           0.2030000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        1.35 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1EKP 
_refine.ls_number_reflns_obs                     20603 
_refine.ls_number_reflns_all                     27035 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               320233.84 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             40.65 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    76.2 
_refine.ls_R_factor_obs                          0.1660000 
_refine.ls_R_factor_all                          0.1720000 
_refine.ls_R_factor_R_work                       0.1550000 
_refine.ls_R_factor_R_free                       0.2140000 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.8 
_refine.ls_number_reflns_R_free                  1617 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               26.2 
_refine.aniso_B[1][1]                            -0.06 
_refine.aniso_B[2][2]                            0.58 
_refine.aniso_B[3][3]                            -0.52 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.10 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.303 
_refine.solvent_model_param_bsol                 33.37 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'E. COLI BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1EKP 
_refine_analyze.Luzzati_coordinate_error_obs    0.21 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.37 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5820 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             196 
_refine_hist.number_atoms_total               6046 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        40.65 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.1  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.89  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        2.10  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       3.22  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        3.39  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       4.67  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             2589 
_refine_ls_shell.R_factor_R_work                  0.1980000 
_refine_ls_shell.percent_reflns_obs               63.3 
_refine_ls_shell.R_factor_R_free                  0.2940000 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.percent_reflns_R_free            8.3 
_refine_ls_shell.number_reflns_R_free             233 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARA    ?           'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1EKP 
_struct.title                     
;CRYSTAL STRUCTURE OF HUMAN BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL) COMPLEXED WITH PYRIDOXAL-5'-PHOSPHATE AT 2.5 ANGSTROMS (MONOCLINIC FORM).
;
_struct.pdbx_descriptor           'BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL)(E.C. 2.6.1.42)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EKP 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'FOLD TYPE IV, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'THE BIOLOGICAL ASSEMBLY IS A DIMER CONSTRUCTED FROM CHAINS A AND B.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 6   ? LEU A 10  ? LYS A 6   LEU A 10  5 ? 5  
HELX_P HELX_P2  2  SER A 65  ? TYR A 70  ? SER A 65  TYR A 70  1 ? 6  
HELX_P HELX_P3  3  ARG A 92  ? LEU A 107 ? ARG A 92  LEU A 107 1 ? 16 
HELX_P HELX_P4  4  ASP A 113 ? ASP A 128 ? ASP A 113 ASP A 128 1 ? 16 
HELX_P HELX_P5  5  LYS A 129 ? VAL A 132 ? LYS A 129 VAL A 132 5 ? 4  
HELX_P HELX_P6  6  GLY A 204 ? GLY A 208 ? GLY A 204 GLY A 208 5 ? 5  
HELX_P HELX_P7  7  PRO A 209 ? LYS A 219 ? PRO A 209 LYS A 219 1 ? 11 
HELX_P HELX_P8  8  GLY A 268 ? GLY A 282 ? GLY A 268 GLY A 282 1 ? 15 
HELX_P HELX_P9  9  THR A 292 ? GLU A 302 ? THR A 292 GLU A 302 1 ? 11 
HELX_P HELX_P10 10 PRO A 339 ? TYR A 354 ? PRO A 339 TYR A 354 1 ? 16 
HELX_P HELX_P11 11 LYS B 6   ? LEU B 10  ? LYS B 6   LEU B 10  5 ? 5  
HELX_P HELX_P12 12 SER B 65  ? TYR B 70  ? SER B 65  TYR B 70  1 ? 6  
HELX_P HELX_P13 13 ARG B 92  ? LEU B 107 ? ARG B 92  LEU B 107 1 ? 16 
HELX_P HELX_P14 14 ASP B 113 ? ASP B 128 ? ASP B 113 ASP B 128 1 ? 16 
HELX_P HELX_P15 15 LYS B 129 ? VAL B 132 ? LYS B 129 VAL B 132 5 ? 4  
HELX_P HELX_P16 16 GLY B 204 ? GLY B 208 ? GLY B 204 GLY B 208 5 ? 5  
HELX_P HELX_P17 17 PRO B 209 ? ARG B 220 ? PRO B 209 ARG B 220 1 ? 12 
HELX_P HELX_P18 18 GLY B 268 ? GLY B 282 ? GLY B 268 GLY B 282 1 ? 15 
HELX_P HELX_P19 19 THR B 292 ? GLU B 302 ? THR B 292 GLU B 302 1 ? 11 
HELX_P HELX_P20 20 PRO B 339 ? TYR B 354 ? PRO B 339 TYR B 354 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LYS 202 NZ ? ? ? 1_555 C PLP . C4A ? ? A LYS 202 A PLP 370 1_555 ? ? ? ? ? ? ? 1.380 ? 
covale2 covale ? ? B LYS 202 NZ ? ? ? 1_555 D PLP . C4A ? ? B LYS 202 B PLP 370 1_555 ? ? ? ? ? ? ? 1.380 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 338 A . ? GLY 338 A PRO 339 A ? PRO 339 A 1 -0.43 
2 GLY 338 B . ? GLY 338 B PRO 339 B ? PRO 339 B 1 0.10  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 2  ? 
C ? 11 ? 
D ? 12 ? 
E ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
B 1  2  ? anti-parallel 
C 1  2  ? parallel      
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
C 4  5  ? anti-parallel 
C 5  6  ? anti-parallel 
C 6  7  ? anti-parallel 
C 7  8  ? parallel      
C 8  9  ? parallel      
C 9  10 ? anti-parallel 
C 10 11 ? anti-parallel 
D 1  2  ? parallel      
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? anti-parallel 
D 6  7  ? anti-parallel 
D 7  8  ? anti-parallel 
D 8  9  ? anti-parallel 
D 9  10 ? anti-parallel 
D 10 11 ? anti-parallel 
D 11 12 ? anti-parallel 
E 1  2  ? parallel      
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? anti-parallel 
E 5  6  ? anti-parallel 
E 6  7  ? anti-parallel 
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? anti-parallel 
E 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLN A 11  ? LEU A 12  ? GLN A 11  LEU A 12  
A 2  ARG A 52  ? PRO A 55  ? ARG A 52  PRO A 55  
A 3  HIS A 37  ? TRP A 43  ? HIS A 37  TRP A 43  
A 4  ALA A 161 ? VAL A 170 ? ALA A 161 VAL A 170 
A 5  SER A 139 ? GLY A 148 ? SER A 139 GLY A 148 
A 6  GLN A 73  ? PHE A 75  ? GLN A 73  PHE A 75  
A 7  SER A 139 ? GLY A 148 ? SER A 139 GLY A 148 
A 8  MET A 78  ? LYS A 82  ? MET A 78  LYS A 82  
A 9  VAL A 88  ? PHE A 91  ? VAL A 88  PHE A 91  
A 10 MET A 362 ? PRO A 364 ? MET A 362 PRO A 364 
B 1  LEU A 59  ? LEU A 61  ? LEU A 59  LEU A 61  
B 2  LEU B 59  ? LEU B 61  ? LEU B 59  LEU B 61  
C 1  ARG A 285 ? GLU A 288 ? ARG A 285 GLU A 288 
C 2  LEU A 254 ? THR A 258 ? LEU A 254 THR A 258 
C 3  MET A 241 ? THR A 248 ? MET A 241 THR A 248 
C 4  VAL A 305 ? SER A 311 ? VAL A 305 SER A 311 
C 5  VAL A 317 ? TYR A 325 ? VAL A 317 TYR A 325 
C 6  ASN A 329 ? HIS A 331 ? ASN A 329 HIS A 331 
C 7  VAL A 317 ? TYR A 325 ? VAL A 317 TYR A 325 
C 8  VAL A 182 ? ALA A 186 ? VAL A 182 ALA A 186 
C 9  GLN A 224 ? TYR A 229 ? GLN A 224 TYR A 229 
C 10 GLN A 234 ? VAL A 238 ? GLN A 234 VAL A 238 
C 11 MET A 241 ? THR A 248 ? MET A 241 THR A 248 
D 1  GLN B 11  ? LEU B 12  ? GLN B 11  LEU B 12  
D 2  ARG B 52  ? PRO B 55  ? ARG B 52  PRO B 55  
D 3  HIS B 37  ? ASN B 44  ? HIS B 37  ASN B 44  
D 4  GLY B 47  ? TRP B 48  ? GLY B 47  TRP B 48  
D 5  HIS B 37  ? ASN B 44  ? HIS B 37  ASN B 44  
D 6  ALA B 161 ? VAL B 170 ? ALA B 161 VAL B 170 
D 7  SER B 139 ? GLY B 148 ? SER B 139 GLY B 148 
D 8  GLN B 73  ? PHE B 75  ? GLN B 73  PHE B 75  
D 9  SER B 139 ? GLY B 148 ? SER B 139 GLY B 148 
D 10 MET B 78  ? LYS B 82  ? MET B 78  LYS B 82  
D 11 VAL B 88  ? PHE B 91  ? VAL B 88  PHE B 91  
D 12 MET B 362 ? PRO B 364 ? MET B 362 PRO B 364 
E 1  ARG B 285 ? GLU B 288 ? ARG B 285 GLU B 288 
E 2  LEU B 254 ? THR B 258 ? LEU B 254 THR B 258 
E 3  MET B 241 ? THR B 248 ? MET B 241 THR B 248 
E 4  VAL B 305 ? SER B 311 ? VAL B 305 SER B 311 
E 5  VAL B 317 ? TYR B 325 ? VAL B 317 TYR B 325 
E 6  ASN B 329 ? HIS B 331 ? ASN B 329 HIS B 331 
E 7  VAL B 317 ? TYR B 325 ? VAL B 317 TYR B 325 
E 8  VAL B 182 ? ALA B 186 ? VAL B 182 ALA B 186 
E 9  GLN B 224 ? TYR B 229 ? GLN B 224 TYR B 229 
E 10 GLN B 234 ? VAL B 238 ? GLN B 234 VAL B 238 
E 11 MET B 241 ? THR B 248 ? MET B 241 THR B 248 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O GLN A 11  ? O GLN A 11  N ILE A 53  ? N ILE A 53  
A 2  3  O GLN A 54  ? O GLN A 54  N MET A 38  ? N MET A 38  
A 3  4  O TRP A 43  ? O TRP A 43  N ALA A 161 ? N ALA A 161 
A 4  5  N VAL A 170 ? N VAL A 170 O SER A 139 ? O SER A 139 
A 5  6  N LEU A 146 ? N LEU A 146 O LEU A 74  ? O LEU A 74  
A 6  7  O LEU A 74  ? O LEU A 74  N LEU A 146 ? N LEU A 146 
A 7  8  N VAL A 142 ? N VAL A 142 O MET A 78  ? O MET A 78  
A 8  9  N PHE A 81  ? N PHE A 81  O ARG A 89  ? O ARG A 89  
A 9  10 N LEU A 90  ? N LEU A 90  O PHE A 363 ? O PHE A 363 
B 1  2  O LEU A 61  ? O LEU A 61  N LEU B 59  ? N LEU B 59  
C 1  2  N ARG A 285 ? N ARG A 285 O LEU A 254 ? O LEU A 254 
C 2  3  N VAL A 257 ? N VAL A 257 O VAL A 245 ? O VAL A 245 
C 3  4  O TYR A 246 ? O TYR A 246 N ARG A 306 ? N ARG A 306 
C 4  5  O GLY A 310 ? O GLY A 310 N CYS A 318 ? N CYS A 318 
C 5  6  O ILE A 323 ? O ILE A 323 N LEU A 330 ? N LEU A 330 
C 6  7  O LEU A 330 ? O LEU A 330 N ILE A 323 ? N ILE A 323 
C 7  8  N HIS A 321 ? N HIS A 321 O VAL A 182 ? O VAL A 182 
C 8  9  N LEU A 185 ? N LEU A 185 O GLN A 224 ? O GLN A 224 
C 9  10 O TYR A 229 ? O TYR A 229 N GLN A 234 ? N GLN A 234 
C 10 11 O VAL A 238 ? O VAL A 238 N MET A 241 ? N MET A 241 
D 1  2  O GLN B 11  ? O GLN B 11  N ILE B 53  ? N ILE B 53  
D 2  3  O GLN B 54  ? O GLN B 54  N MET B 38  ? N MET B 38  
D 3  4  N ASN B 44  ? N ASN B 44  O GLY B 47  ? O GLY B 47  
D 4  5  O GLY B 47  ? O GLY B 47  N ASN B 44  ? N ASN B 44  
D 5  6  N TRP B 43  ? N TRP B 43  O ALA B 161 ? O ALA B 161 
D 6  7  N VAL B 170 ? N VAL B 170 O SER B 139 ? O SER B 139 
D 7  8  N LEU B 146 ? N LEU B 146 O LEU B 74  ? O LEU B 74  
D 8  9  O LEU B 74  ? O LEU B 74  N LEU B 146 ? N LEU B 146 
D 9  10 N VAL B 142 ? N VAL B 142 O MET B 78  ? O MET B 78  
D 10 11 N PHE B 81  ? N PHE B 81  O ARG B 89  ? O ARG B 89  
D 11 12 N LEU B 90  ? N LEU B 90  O PHE B 363 ? O PHE B 363 
E 1  2  N ARG B 285 ? N ARG B 285 O LEU B 254 ? O LEU B 254 
E 2  3  O VAL B 257 ? O VAL B 257 N VAL B 245 ? N VAL B 245 
E 3  4  O TYR B 246 ? O TYR B 246 N ARG B 306 ? N ARG B 306 
E 4  5  O GLY B 310 ? O GLY B 310 N CYS B 318 ? N CYS B 318 
E 5  6  O ILE B 323 ? O ILE B 323 N LEU B 330 ? N LEU B 330 
E 6  7  N LEU B 330 ? N LEU B 330 O ILE B 323 ? O ILE B 323 
E 7  8  N HIS B 321 ? N HIS B 321 O VAL B 182 ? O VAL B 182 
E 8  9  N LEU B 185 ? N LEU B 185 O GLN B 224 ? O GLN B 224 
E 9  10 O TYR B 229 ? O TYR B 229 N GLN B 234 ? N GLN B 234 
E 10 11 O VAL B 238 ? O VAL B 238 N MET B 241 ? N MET B 241 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PLP A 370' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PLP B 370' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ARG A 99  ? ARG A 99  . ? 1_555 ? 
2  AC1 12 LYS A 202 ? LYS A 202 . ? 1_555 ? 
3  AC1 12 TYR A 207 ? TYR A 207 . ? 1_555 ? 
4  AC1 12 GLU A 237 ? GLU A 237 . ? 1_555 ? 
5  AC1 12 THR A 240 ? THR A 240 . ? 1_555 ? 
6  AC1 12 LEU A 266 ? LEU A 266 . ? 1_555 ? 
7  AC1 12 GLY A 268 ? GLY A 268 . ? 1_555 ? 
8  AC1 12 VAL A 269 ? VAL A 269 . ? 1_555 ? 
9  AC1 12 VAL A 270 ? VAL A 270 . ? 1_555 ? 
10 AC1 12 THR A 313 ? THR A 313 . ? 1_555 ? 
11 AC1 12 HOH E .   ? HOH A 377 . ? 1_555 ? 
12 AC1 12 HOH E .   ? HOH A 402 . ? 1_555 ? 
13 AC2 14 ARG B 99  ? ARG B 99  . ? 1_555 ? 
14 AC2 14 ARG B 192 ? ARG B 192 . ? 1_555 ? 
15 AC2 14 LYS B 202 ? LYS B 202 . ? 1_555 ? 
16 AC2 14 TYR B 207 ? TYR B 207 . ? 1_555 ? 
17 AC2 14 GLU B 237 ? GLU B 237 . ? 1_555 ? 
18 AC2 14 THR B 240 ? THR B 240 . ? 1_555 ? 
19 AC2 14 LEU B 266 ? LEU B 266 . ? 1_555 ? 
20 AC2 14 GLY B 268 ? GLY B 268 . ? 1_555 ? 
21 AC2 14 VAL B 269 ? VAL B 269 . ? 1_555 ? 
22 AC2 14 VAL B 270 ? VAL B 270 . ? 1_555 ? 
23 AC2 14 THR B 313 ? THR B 313 . ? 1_555 ? 
24 AC2 14 HOH F .   ? HOH B 376 . ? 1_555 ? 
25 AC2 14 HOH F .   ? HOH B 399 . ? 1_555 ? 
26 AC2 14 HOH F .   ? HOH B 407 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EKP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EKP 
_atom_sites.fract_transf_matrix[1][1]   0.016770 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001730 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008957 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016783 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? -10.795 17.355  34.833  1.00 71.26 ? 1   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? -12.055 16.565  34.706  1.00 70.71 ? 1   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? -12.128 15.901  33.332  1.00 69.82 ? 1   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? -11.775 16.515  32.317  1.00 68.80 ? 1   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? -13.268 17.471  34.918  1.00 71.97 ? 1   ALA A CB  1 
ATOM   6    N N   . SER A 1 2   ? -12.578 14.644  33.317  1.00 68.23 ? 2   SER A N   1 
ATOM   7    C CA  . SER A 1 2   ? -12.714 13.847  32.092  1.00 64.94 ? 2   SER A CA  1 
ATOM   8    C C   . SER A 1 2   ? -11.489 13.914  31.167  1.00 62.78 ? 2   SER A C   1 
ATOM   9    O O   . SER A 1 2   ? -10.635 13.017  31.184  1.00 60.97 ? 2   SER A O   1 
ATOM   10   C CB  . SER A 1 2   ? -13.976 14.280  31.321  1.00 64.09 ? 2   SER A CB  1 
ATOM   11   O OG  . SER A 1 2   ? -14.142 13.543  30.115  1.00 60.90 ? 2   SER A OG  1 
ATOM   12   N N   . SER A 1 3   ? -11.409 14.985  30.375  1.00 58.38 ? 3   SER A N   1 
ATOM   13   C CA  . SER A 1 3   ? -10.327 15.183  29.415  1.00 53.25 ? 3   SER A CA  1 
ATOM   14   C C   . SER A 1 3   ? -8.873  15.188  29.914  1.00 49.02 ? 3   SER A C   1 
ATOM   15   O O   . SER A 1 3   ? -7.951  15.267  29.093  1.00 48.79 ? 3   SER A O   1 
ATOM   16   C CB  . SER A 1 3   ? -10.599 16.447  28.594  1.00 53.27 ? 3   SER A CB  1 
ATOM   17   O OG  . SER A 1 3   ? -11.713 16.238  27.740  1.00 53.04 ? 3   SER A OG  1 
ATOM   18   N N   . SER A 1 4   ? -8.648  15.102  31.226  1.00 39.56 ? 4   SER A N   1 
ATOM   19   C CA  . SER A 1 4   ? -7.272  15.056  31.715  1.00 31.59 ? 4   SER A CA  1 
ATOM   20   C C   . SER A 1 4   ? -7.098  14.717  33.187  1.00 28.03 ? 4   SER A C   1 
ATOM   21   O O   . SER A 1 4   ? -7.774  15.272  34.055  1.00 30.44 ? 4   SER A O   1 
ATOM   22   C CB  . SER A 1 4   ? -6.548  16.374  31.424  1.00 28.75 ? 4   SER A CB  1 
ATOM   23   O OG  . SER A 1 4   ? -5.145  16.232  31.635  1.00 21.91 ? 4   SER A OG  1 
ATOM   24   N N   . PHE A 1 5   ? -6.170  13.809  33.466  1.00 23.85 ? 5   PHE A N   1 
ATOM   25   C CA  . PHE A 1 5   ? -5.879  13.414  34.840  1.00 21.94 ? 5   PHE A CA  1 
ATOM   26   C C   . PHE A 1 5   ? -4.988  14.492  35.471  1.00 22.92 ? 5   PHE A C   1 
ATOM   27   O O   . PHE A 1 5   ? -4.352  15.270  34.759  1.00 21.35 ? 5   PHE A O   1 
ATOM   28   C CB  . PHE A 1 5   ? -5.184  12.050  34.859  1.00 19.67 ? 5   PHE A CB  1 
ATOM   29   C CG  . PHE A 1 5   ? -3.962  11.979  33.994  1.00 22.13 ? 5   PHE A CG  1 
ATOM   30   C CD1 . PHE A 1 5   ? -2.740  12.474  34.445  1.00 19.97 ? 5   PHE A CD1 1 
ATOM   31   C CD2 . PHE A 1 5   ? -4.040  11.442  32.708  1.00 20.01 ? 5   PHE A CD2 1 
ATOM   32   C CE1 . PHE A 1 5   ? -1.608  12.437  33.625  1.00 21.60 ? 5   PHE A CE1 1 
ATOM   33   C CE2 . PHE A 1 5   ? -2.922  11.399  31.880  1.00 22.28 ? 5   PHE A CE2 1 
ATOM   34   C CZ  . PHE A 1 5   ? -1.698  11.899  32.337  1.00 21.87 ? 5   PHE A CZ  1 
ATOM   35   N N   . LYS A 1 6   ? -4.939  14.543  36.798  1.00 22.50 ? 6   LYS A N   1 
ATOM   36   C CA  . LYS A 1 6   ? -4.139  15.557  37.479  1.00 23.93 ? 6   LYS A CA  1 
ATOM   37   C C   . LYS A 1 6   ? -3.220  14.992  38.553  1.00 24.80 ? 6   LYS A C   1 
ATOM   38   O O   . LYS A 1 6   ? -3.584  14.060  39.274  1.00 27.67 ? 6   LYS A O   1 
ATOM   39   C CB  . LYS A 1 6   ? -5.073  16.595  38.090  1.00 27.25 ? 6   LYS A CB  1 
ATOM   40   C CG  . LYS A 1 6   ? -5.939  17.275  37.045  1.00 36.01 ? 6   LYS A CG  1 
ATOM   41   C CD  . LYS A 1 6   ? -7.131  17.966  37.653  1.00 38.43 ? 6   LYS A CD  1 
ATOM   42   C CE  . LYS A 1 6   ? -8.087  18.440  36.573  1.00 42.81 ? 6   LYS A CE  1 
ATOM   43   N NZ  . LYS A 1 6   ? -9.355  18.960  37.163  1.00 42.44 ? 6   LYS A NZ  1 
ATOM   44   N N   . ALA A 1 7   ? -2.025  15.560  38.661  1.00 24.34 ? 7   ALA A N   1 
ATOM   45   C CA  . ALA A 1 7   ? -1.067  15.101  39.659  1.00 28.09 ? 7   ALA A CA  1 
ATOM   46   C C   . ALA A 1 7   ? -1.665  15.188  41.067  1.00 27.97 ? 7   ALA A C   1 
ATOM   47   O O   . ALA A 1 7   ? -1.305  14.415  41.954  1.00 27.68 ? 7   ALA A O   1 
ATOM   48   C CB  . ALA A 1 7   ? 0.221   15.932  39.574  1.00 24.66 ? 7   ALA A CB  1 
ATOM   49   N N   . ALA A 1 8   ? -2.593  16.125  41.245  1.00 28.80 ? 8   ALA A N   1 
ATOM   50   C CA  . ALA A 1 8   ? -3.254  16.361  42.529  1.00 31.72 ? 8   ALA A CA  1 
ATOM   51   C C   . ALA A 1 8   ? -4.036  15.169  43.069  1.00 33.55 ? 8   ALA A C   1 
ATOM   52   O O   . ALA A 1 8   ? -4.171  15.023  44.284  1.00 34.26 ? 8   ALA A O   1 
ATOM   53   C CB  . ALA A 1 8   ? -4.179  17.577  42.428  1.00 29.79 ? 8   ALA A CB  1 
ATOM   54   N N   . ASP A 1 9   ? -4.581  14.332  42.191  1.00 32.79 ? 9   ASP A N   1 
ATOM   55   C CA  . ASP A 1 9   ? -5.315  13.178  42.686  1.00 32.10 ? 9   ASP A CA  1 
ATOM   56   C C   . ASP A 1 9   ? -4.577  11.893  42.358  1.00 28.50 ? 9   ASP A C   1 
ATOM   57   O O   . ASP A 1 9   ? -5.165  10.871  42.019  1.00 28.39 ? 9   ASP A O   1 
ATOM   58   C CB  . ASP A 1 9   ? -6.766  13.148  42.167  1.00 35.29 ? 9   ASP A CB  1 
ATOM   59   C CG  . ASP A 1 9   ? -6.912  13.686  40.761  1.00 39.68 ? 9   ASP A CG  1 
ATOM   60   O OD1 . ASP A 1 9   ? -6.049  13.382  39.910  1.00 46.02 ? 9   ASP A OD1 1 
ATOM   61   O OD2 . ASP A 1 9   ? -7.909  14.398  40.508  1.00 34.84 ? 9   ASP A OD2 1 
ATOM   62   N N   . LEU A 1 10  ? -3.261  11.968  42.497  1.00 28.78 ? 10  LEU A N   1 
ATOM   63   C CA  . LEU A 1 10  ? -2.369  10.850  42.244  1.00 28.80 ? 10  LEU A CA  1 
ATOM   64   C C   . LEU A 1 10  ? -2.443  9.852   43.398  1.00 31.14 ? 10  LEU A C   1 
ATOM   65   O O   . LEU A 1 10  ? -2.421  10.253  44.557  1.00 36.12 ? 10  LEU A O   1 
ATOM   66   C CB  . LEU A 1 10  ? -0.945  11.377  42.132  1.00 28.03 ? 10  LEU A CB  1 
ATOM   67   C CG  . LEU A 1 10  ? 0.146   10.386  41.746  1.00 28.87 ? 10  LEU A CG  1 
ATOM   68   C CD1 . LEU A 1 10  ? -0.086  9.911   40.318  1.00 23.44 ? 10  LEU A CD1 1 
ATOM   69   C CD2 . LEU A 1 10  ? 1.503   11.068  41.878  1.00 28.98 ? 10  LEU A CD2 1 
ATOM   70   N N   . GLN A 1 11  ? -2.553  8.558   43.112  1.00 27.78 ? 11  GLN A N   1 
ATOM   71   C CA  . GLN A 1 11  ? -2.577  7.620   44.215  1.00 25.15 ? 11  GLN A CA  1 
ATOM   72   C C   . GLN A 1 11  ? -1.243  6.903   44.300  1.00 25.54 ? 11  GLN A C   1 
ATOM   73   O O   . GLN A 1 11  ? -0.656  6.540   43.280  1.00 21.45 ? 11  GLN A O   1 
ATOM   74   C CB  . GLN A 1 11  ? -3.741  6.622   44.110  1.00 24.76 ? 11  GLN A CB  1 
ATOM   75   C CG  . GLN A 1 11  ? -3.728  5.673   42.955  1.00 31.66 ? 11  GLN A CG  1 
ATOM   76   C CD  . GLN A 1 11  ? -4.663  4.487   43.182  1.00 36.14 ? 11  GLN A CD  1 
ATOM   77   O OE1 . GLN A 1 11  ? -4.521  3.762   44.165  1.00 36.79 ? 11  GLN A OE1 1 
ATOM   78   N NE2 . GLN A 1 11  ? -5.621  4.288   42.275  1.00 33.35 ? 11  GLN A NE2 1 
ATOM   79   N N   . LEU A 1 12  ? -0.759  6.736   45.529  1.00 27.00 ? 12  LEU A N   1 
ATOM   80   C CA  . LEU A 1 12  ? 0.516   6.082   45.790  1.00 31.35 ? 12  LEU A CA  1 
ATOM   81   C C   . LEU A 1 12  ? 0.412   4.727   46.456  1.00 32.72 ? 12  LEU A C   1 
ATOM   82   O O   . LEU A 1 12  ? -0.323  4.550   47.429  1.00 37.03 ? 12  LEU A O   1 
ATOM   83   C CB  . LEU A 1 12  ? 1.406   6.948   46.680  1.00 33.33 ? 12  LEU A CB  1 
ATOM   84   C CG  . LEU A 1 12  ? 2.191   8.123   46.112  1.00 37.04 ? 12  LEU A CG  1 
ATOM   85   C CD1 . LEU A 1 12  ? 3.357   8.383   47.053  1.00 37.70 ? 12  LEU A CD1 1 
ATOM   86   C CD2 . LEU A 1 12  ? 2.721   7.810   44.714  1.00 39.46 ? 12  LEU A CD2 1 
ATOM   87   N N   . GLU A 1 13  ? 1.177   3.779   45.930  1.00 34.00 ? 13  GLU A N   1 
ATOM   88   C CA  . GLU A 1 13  ? 1.236   2.435   46.473  1.00 35.78 ? 13  GLU A CA  1 
ATOM   89   C C   . GLU A 1 13  ? 2.702   2.042   46.501  1.00 34.59 ? 13  GLU A C   1 
ATOM   90   O O   . GLU A 1 13  ? 3.194   1.389   45.578  1.00 37.01 ? 13  GLU A O   1 
ATOM   91   C CB  . GLU A 1 13  ? 0.442   1.437   45.609  1.00 37.81 ? 13  GLU A CB  1 
ATOM   92   C CG  . GLU A 1 13  ? -1.074  1.608   45.684  1.00 38.77 ? 13  GLU A CG  1 
ATOM   93   C CD  . GLU A 1 13  ? -1.844  0.362   45.258  1.00 39.42 ? 13  GLU A CD  1 
ATOM   94   O OE1 . GLU A 1 13  ? -1.893  -0.617  46.041  1.00 34.77 ? 13  GLU A OE1 1 
ATOM   95   O OE2 . GLU A 1 13  ? -2.400  0.368   44.135  1.00 39.67 ? 13  GLU A OE2 1 
ATOM   96   N N   . MET A 1 14  ? 3.402   2.453   47.556  1.00 32.11 ? 14  MET A N   1 
ATOM   97   C CA  . MET A 1 14  ? 4.815   2.129   47.683  1.00 30.70 ? 14  MET A CA  1 
ATOM   98   C C   . MET A 1 14  ? 4.970   0.639   47.622  1.00 30.29 ? 14  MET A C   1 
ATOM   99   O O   . MET A 1 14  ? 4.137   -0.099  48.135  1.00 33.28 ? 14  MET A O   1 
ATOM   100  C CB  . MET A 1 14  ? 5.394   2.629   49.004  1.00 28.27 ? 14  MET A CB  1 
ATOM   101  C CG  . MET A 1 14  ? 5.401   4.127   49.123  1.00 30.21 ? 14  MET A CG  1 
ATOM   102  S SD  . MET A 1 14  ? 6.118   4.857   47.644  1.00 37.76 ? 14  MET A SD  1 
ATOM   103  C CE  . MET A 1 14  ? 4.616   5.385   46.750  1.00 31.86 ? 14  MET A CE  1 
ATOM   104  N N   . THR A 1 15  ? 6.039   0.198   46.982  1.00 32.60 ? 15  THR A N   1 
ATOM   105  C CA  . THR A 1 15  ? 6.304   -1.219  46.866  1.00 33.15 ? 15  THR A CA  1 
ATOM   106  C C   . THR A 1 15  ? 6.620   -1.762  48.241  1.00 36.05 ? 15  THR A C   1 
ATOM   107  O O   . THR A 1 15  ? 7.092   -1.043  49.119  1.00 36.36 ? 15  THR A O   1 
ATOM   108  C CB  . THR A 1 15  ? 7.517   -1.499  45.977  1.00 30.44 ? 15  THR A CB  1 
ATOM   109  O OG1 . THR A 1 15  ? 7.679   -2.914  45.829  1.00 25.34 ? 15  THR A OG1 1 
ATOM   110  C CG2 . THR A 1 15  ? 8.775   -0.915  46.609  1.00 26.36 ? 15  THR A CG2 1 
ATOM   111  N N   . GLN A 1 16  ? 6.350   -3.039  48.427  1.00 40.23 ? 16  GLN A N   1 
ATOM   112  C CA  . GLN A 1 16  ? 6.651   -3.671  49.684  1.00 45.99 ? 16  GLN A CA  1 
ATOM   113  C C   . GLN A 1 16  ? 7.420   -4.927  49.325  1.00 46.08 ? 16  GLN A C   1 
ATOM   114  O O   . GLN A 1 16  ? 6.950   -6.045  49.485  1.00 51.00 ? 16  GLN A O   1 
ATOM   115  C CB  . GLN A 1 16  ? 5.359   -3.926  50.476  1.00 49.65 ? 16  GLN A CB  1 
ATOM   116  C CG  . GLN A 1 16  ? 4.905   -2.644  51.218  1.00 57.14 ? 16  GLN A CG  1 
ATOM   117  C CD  . GLN A 1 16  ? 3.571   -2.762  51.961  1.00 61.48 ? 16  GLN A CD  1 
ATOM   118  O OE1 . GLN A 1 16  ? 3.349   -3.699  52.738  1.00 62.23 ? 16  GLN A OE1 1 
ATOM   119  N NE2 . GLN A 1 16  ? 2.684   -1.790  51.737  1.00 60.99 ? 16  GLN A NE2 1 
ATOM   120  N N   . LYS A 1 17  ? 8.611   -4.679  48.785  1.00 46.05 ? 17  LYS A N   1 
ATOM   121  C CA  . LYS A 1 17  ? 9.579   -5.680  48.344  1.00 44.11 ? 17  LYS A CA  1 
ATOM   122  C C   . LYS A 1 17  ? 10.546  -5.010  47.358  1.00 41.58 ? 17  LYS A C   1 
ATOM   123  O O   . LYS A 1 17  ? 10.467  -5.223  46.144  1.00 39.66 ? 17  LYS A O   1 
ATOM   124  C CB  . LYS A 1 17  ? 8.901   -6.867  47.659  1.00 46.49 ? 17  LYS A CB  1 
ATOM   125  C CG  . LYS A 1 17  ? 9.902   -7.917  47.175  1.00 52.55 ? 17  LYS A CG  1 
ATOM   126  C CD  . LYS A 1 17  ? 10.774  -8.421  48.328  1.00 56.16 ? 17  LYS A CD  1 
ATOM   127  C CE  . LYS A 1 17  ? 11.981  -9.204  47.827  1.00 56.75 ? 17  LYS A CE  1 
ATOM   128  N NZ  . LYS A 1 17  ? 12.908  -8.336  47.036  1.00 56.40 ? 17  LYS A NZ  1 
ATOM   129  N N   . PRO A 1 18  ? 11.456  -4.169  47.877  1.00 37.68 ? 18  PRO A N   1 
ATOM   130  C CA  . PRO A 1 18  ? 12.458  -3.441  47.092  1.00 36.74 ? 18  PRO A CA  1 
ATOM   131  C C   . PRO A 1 18  ? 13.338  -4.367  46.271  1.00 37.28 ? 18  PRO A C   1 
ATOM   132  O O   . PRO A 1 18  ? 13.518  -5.530  46.621  1.00 37.97 ? 18  PRO A O   1 
ATOM   133  C CB  . PRO A 1 18  ? 13.265  -2.712  48.161  1.00 35.91 ? 18  PRO A CB  1 
ATOM   134  C CG  . PRO A 1 18  ? 12.253  -2.454  49.218  1.00 35.16 ? 18  PRO A CG  1 
ATOM   135  C CD  . PRO A 1 18  ? 11.519  -3.768  49.293  1.00 34.76 ? 18  PRO A CD  1 
ATOM   136  N N   . HIS A 1 19  ? 13.885  -3.841  45.180  1.00 39.86 ? 19  HIS A N   1 
ATOM   137  C CA  . HIS A 1 19  ? 14.774  -4.606  44.313  1.00 41.89 ? 19  HIS A CA  1 
ATOM   138  C C   . HIS A 1 19  ? 16.215  -4.206  44.594  1.00 40.77 ? 19  HIS A C   1 
ATOM   139  O O   . HIS A 1 19  ? 16.480  -3.115  45.096  1.00 40.34 ? 19  HIS A O   1 
ATOM   140  C CB  . HIS A 1 19  ? 14.449  -4.350  42.839  1.00 46.23 ? 19  HIS A CB  1 
ATOM   141  C CG  . HIS A 1 19  ? 13.150  -4.944  42.397  1.00 53.14 ? 19  HIS A CG  1 
ATOM   142  N ND1 . HIS A 1 19  ? 12.685  -4.840  41.104  1.00 57.05 ? 19  HIS A ND1 1 
ATOM   143  C CD2 . HIS A 1 19  ? 12.220  -5.662  43.075  1.00 55.81 ? 19  HIS A CD2 1 
ATOM   144  C CE1 . HIS A 1 19  ? 11.526  -5.469  41.002  1.00 57.81 ? 19  HIS A CE1 1 
ATOM   145  N NE2 . HIS A 1 19  ? 11.223  -5.976  42.184  1.00 58.06 ? 19  HIS A NE2 1 
ATOM   146  N N   . LYS A 1 20  ? 17.146  -5.095  44.272  1.00 41.16 ? 20  LYS A N   1 
ATOM   147  C CA  . LYS A 1 20  ? 18.560  -4.829  44.505  1.00 40.32 ? 20  LYS A CA  1 
ATOM   148  C C   . LYS A 1 20  ? 19.064  -3.876  43.429  1.00 38.50 ? 20  LYS A C   1 
ATOM   149  O O   . LYS A 1 20  ? 19.063  -4.204  42.242  1.00 37.70 ? 20  LYS A O   1 
ATOM   150  C CB  . LYS A 1 20  ? 19.345  -6.150  44.469  1.00 43.92 ? 20  LYS A CB  1 
ATOM   151  C CG  . LYS A 1 20  ? 20.732  -6.126  45.120  1.00 46.52 ? 20  LYS A CG  1 
ATOM   152  C CD  . LYS A 1 20  ? 21.308  -7.545  45.189  1.00 50.11 ? 20  LYS A CD  1 
ATOM   153  C CE  . LYS A 1 20  ? 22.726  -7.586  45.759  1.00 54.87 ? 20  LYS A CE  1 
ATOM   154  N NZ  . LYS A 1 20  ? 22.792  -7.172  47.194  1.00 58.38 ? 20  LYS A NZ  1 
ATOM   155  N N   . LYS A 1 21  ? 19.477  -2.686  43.849  1.00 37.44 ? 21  LYS A N   1 
ATOM   156  C CA  . LYS A 1 21  ? 19.993  -1.691  42.918  1.00 37.63 ? 21  LYS A CA  1 
ATOM   157  C C   . LYS A 1 21  ? 21.374  -2.116  42.438  1.00 37.72 ? 21  LYS A C   1 
ATOM   158  O O   . LYS A 1 21  ? 22.157  -2.685  43.195  1.00 37.93 ? 21  LYS A O   1 
ATOM   159  C CB  . LYS A 1 21  ? 20.073  -0.324  43.600  1.00 34.87 ? 21  LYS A CB  1 
ATOM   160  C CG  . LYS A 1 21  ? 18.793  0.034   44.329  1.00 35.98 ? 21  LYS A CG  1 
ATOM   161  C CD  . LYS A 1 21  ? 18.754  1.474   44.801  1.00 32.21 ? 21  LYS A CD  1 
ATOM   162  C CE  . LYS A 1 21  ? 17.431  1.747   45.485  1.00 32.28 ? 21  LYS A CE  1 
ATOM   163  N NZ  . LYS A 1 21  ? 17.259  3.185   45.816  1.00 40.40 ? 21  LYS A NZ  1 
ATOM   164  N N   . PRO A 1 22  ? 21.691  -1.853  41.163  1.00 39.94 ? 22  PRO A N   1 
ATOM   165  C CA  . PRO A 1 22  ? 23.010  -2.242  40.653  1.00 40.32 ? 22  PRO A CA  1 
ATOM   166  C C   . PRO A 1 22  ? 24.102  -1.535  41.453  1.00 40.59 ? 22  PRO A C   1 
ATOM   167  O O   . PRO A 1 22  ? 23.817  -0.629  42.233  1.00 40.28 ? 22  PRO A O   1 
ATOM   168  C CB  . PRO A 1 22  ? 22.980  -1.759  39.202  1.00 39.18 ? 22  PRO A CB  1 
ATOM   169  C CG  . PRO A 1 22  ? 21.516  -1.691  38.877  1.00 40.80 ? 22  PRO A CG  1 
ATOM   170  C CD  . PRO A 1 22  ? 20.913  -1.148  40.132  1.00 38.56 ? 22  PRO A CD  1 
ATOM   171  N N   . GLY A 1 23  ? 25.347  -1.956  41.256  1.00 42.83 ? 23  GLY A N   1 
ATOM   172  C CA  . GLY A 1 23  ? 26.462  -1.329  41.939  1.00 41.78 ? 23  GLY A CA  1 
ATOM   173  C C   . GLY A 1 23  ? 27.306  -0.573  40.924  1.00 42.06 ? 23  GLY A C   1 
ATOM   174  O O   . GLY A 1 23  ? 27.388  -0.991  39.769  1.00 41.76 ? 23  GLY A O   1 
ATOM   175  N N   . PRO A 1 24  ? 27.944  0.542   41.314  1.00 40.92 ? 24  PRO A N   1 
ATOM   176  C CA  . PRO A 1 24  ? 28.780  1.333   40.402  1.00 40.29 ? 24  PRO A CA  1 
ATOM   177  C C   . PRO A 1 24  ? 29.778  0.486   39.590  1.00 41.21 ? 24  PRO A C   1 
ATOM   178  O O   . PRO A 1 24  ? 30.015  0.747   38.407  1.00 39.44 ? 24  PRO A O   1 
ATOM   179  C CB  . PRO A 1 24  ? 29.486  2.301   41.346  1.00 40.42 ? 24  PRO A CB  1 
ATOM   180  C CG  . PRO A 1 24  ? 28.485  2.492   42.438  1.00 37.54 ? 24  PRO A CG  1 
ATOM   181  C CD  . PRO A 1 24  ? 27.989  1.097   42.678  1.00 39.45 ? 24  PRO A CD  1 
ATOM   182  N N   . GLY A 1 25  ? 30.355  -0.526  40.236  1.00 41.21 ? 25  GLY A N   1 
ATOM   183  C CA  . GLY A 1 25  ? 31.322  -1.377  39.568  1.00 42.93 ? 25  GLY A CA  1 
ATOM   184  C C   . GLY A 1 25  ? 30.709  -2.364  38.594  1.00 47.09 ? 25  GLY A C   1 
ATOM   185  O O   . GLY A 1 25  ? 31.388  -3.275  38.113  1.00 48.29 ? 25  GLY A O   1 
ATOM   186  N N   . GLU A 1 26  ? 29.428  -2.190  38.287  1.00 48.75 ? 26  GLU A N   1 
ATOM   187  C CA  . GLU A 1 26  ? 28.752  -3.096  37.365  1.00 49.45 ? 26  GLU A CA  1 
ATOM   188  C C   . GLU A 1 26  ? 28.419  -2.498  36.002  1.00 49.50 ? 26  GLU A C   1 
ATOM   189  O O   . GLU A 1 26  ? 28.410  -1.279  35.821  1.00 49.58 ? 26  GLU A O   1 
ATOM   190  C CB  . GLU A 1 26  ? 27.478  -3.636  38.012  1.00 50.88 ? 26  GLU A CB  1 
ATOM   191  C CG  . GLU A 1 26  ? 27.751  -4.507  39.216  1.00 53.90 ? 26  GLU A CG  1 
ATOM   192  C CD  . GLU A 1 26  ? 26.520  -5.241  39.667  1.00 54.58 ? 26  GLU A CD  1 
ATOM   193  O OE1 . GLU A 1 26  ? 25.898  -5.895  38.803  1.00 56.34 ? 26  GLU A OE1 1 
ATOM   194  O OE2 . GLU A 1 26  ? 26.178  -5.162  40.869  1.00 52.87 ? 26  GLU A OE2 1 
ATOM   195  N N   . PRO A 1 27  ? 28.127  -3.366  35.023  1.00 50.51 ? 27  PRO A N   1 
ATOM   196  C CA  . PRO A 1 27  ? 27.782  -3.015  33.642  1.00 51.13 ? 27  PRO A CA  1 
ATOM   197  C C   . PRO A 1 27  ? 26.811  -1.850  33.458  1.00 50.31 ? 27  PRO A C   1 
ATOM   198  O O   . PRO A 1 27  ? 27.217  -0.686  33.423  1.00 50.93 ? 27  PRO A O   1 
ATOM   199  C CB  . PRO A 1 27  ? 27.207  -4.318  33.095  1.00 52.79 ? 27  PRO A CB  1 
ATOM   200  C CG  . PRO A 1 27  ? 28.032  -5.350  33.799  1.00 54.74 ? 27  PRO A CG  1 
ATOM   201  C CD  . PRO A 1 27  ? 28.070  -4.828  35.218  1.00 51.77 ? 27  PRO A CD  1 
ATOM   202  N N   . LEU A 1 28  ? 25.530  -2.192  33.341  1.00 47.33 ? 28  LEU A N   1 
ATOM   203  C CA  . LEU A 1 28  ? 24.433  -1.249  33.115  1.00 43.05 ? 28  LEU A CA  1 
ATOM   204  C C   . LEU A 1 28  ? 24.111  -1.218  31.622  1.00 43.11 ? 28  LEU A C   1 
ATOM   205  O O   . LEU A 1 28  ? 24.386  -0.227  30.932  1.00 42.34 ? 28  LEU A O   1 
ATOM   206  C CB  . LEU A 1 28  ? 24.763  0.176   33.584  1.00 37.96 ? 28  LEU A CB  1 
ATOM   207  C CG  . LEU A 1 28  ? 24.232  0.674   34.933  1.00 35.38 ? 28  LEU A CG  1 
ATOM   208  C CD1 . LEU A 1 28  ? 24.397  2.188   34.997  1.00 31.57 ? 28  LEU A CD1 1 
ATOM   209  C CD2 . LEU A 1 28  ? 22.760  0.309   35.101  1.00 37.00 ? 28  LEU A CD2 1 
ATOM   210  N N   . VAL A 1 29  ? 23.548  -2.321  31.132  1.00 40.36 ? 29  VAL A N   1 
ATOM   211  C CA  . VAL A 1 29  ? 23.146  -2.441  29.737  1.00 37.24 ? 29  VAL A CA  1 
ATOM   212  C C   . VAL A 1 29  ? 21.894  -1.575  29.549  1.00 38.37 ? 29  VAL A C   1 
ATOM   213  O O   . VAL A 1 29  ? 20.895  -1.751  30.254  1.00 36.27 ? 29  VAL A O   1 
ATOM   214  C CB  . VAL A 1 29  ? 22.835  -3.912  29.383  1.00 34.47 ? 29  VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 29  ? 22.229  -4.005  27.993  1.00 31.56 ? 29  VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 29  ? 24.111  -4.733  29.462  1.00 33.83 ? 29  VAL A CG2 1 
ATOM   217  N N   . PHE A 1 30  ? 21.963  -0.655  28.588  1.00 37.31 ? 30  PHE A N   1 
ATOM   218  C CA  . PHE A 1 30  ? 20.889  0.289   28.312  1.00 41.01 ? 30  PHE A CA  1 
ATOM   219  C C   . PHE A 1 30  ? 19.506  0.029   28.926  1.00 43.61 ? 30  PHE A C   1 
ATOM   220  O O   . PHE A 1 30  ? 19.258  0.424   30.071  1.00 49.31 ? 30  PHE A O   1 
ATOM   221  C CB  . PHE A 1 30  ? 20.744  0.533   26.806  1.00 40.88 ? 30  PHE A CB  1 
ATOM   222  C CG  . PHE A 1 30  ? 19.807  1.667   26.477  1.00 42.06 ? 30  PHE A CG  1 
ATOM   223  C CD1 . PHE A 1 30  ? 20.008  2.934   27.030  1.00 41.78 ? 30  PHE A CD1 1 
ATOM   224  C CD2 . PHE A 1 30  ? 18.693  1.460   25.667  1.00 42.38 ? 30  PHE A CD2 1 
ATOM   225  C CE1 . PHE A 1 30  ? 19.107  3.980   26.787  1.00 40.99 ? 30  PHE A CE1 1 
ATOM   226  C CE2 . PHE A 1 30  ? 17.786  2.499   25.418  1.00 41.17 ? 30  PHE A CE2 1 
ATOM   227  C CZ  . PHE A 1 30  ? 17.995  3.760   25.981  1.00 39.36 ? 30  PHE A CZ  1 
ATOM   228  N N   . GLY A 1 31  ? 18.598  -0.614  28.197  1.00 41.53 ? 31  GLY A N   1 
ATOM   229  C CA  . GLY A 1 31  ? 17.272  -0.827  28.764  1.00 37.24 ? 31  GLY A CA  1 
ATOM   230  C C   . GLY A 1 31  ? 17.002  -2.199  29.346  1.00 35.84 ? 31  GLY A C   1 
ATOM   231  O O   . GLY A 1 31  ? 16.023  -2.830  28.962  1.00 33.10 ? 31  GLY A O   1 
ATOM   232  N N   . LYS A 1 32  ? 17.843  -2.650  30.280  1.00 36.61 ? 32  LYS A N   1 
ATOM   233  C CA  . LYS A 1 32  ? 17.695  -3.974  30.898  1.00 34.77 ? 32  LYS A CA  1 
ATOM   234  C C   . LYS A 1 32  ? 17.349  -3.994  32.389  1.00 33.89 ? 32  LYS A C   1 
ATOM   235  O O   . LYS A 1 32  ? 16.735  -4.954  32.858  1.00 34.34 ? 32  LYS A O   1 
ATOM   236  C CB  . LYS A 1 32  ? 18.974  -4.794  30.713  1.00 37.95 ? 32  LYS A CB  1 
ATOM   237  C CG  . LYS A 1 32  ? 19.222  -5.343  29.322  1.00 43.06 ? 32  LYS A CG  1 
ATOM   238  C CD  . LYS A 1 32  ? 18.354  -6.559  29.043  1.00 46.32 ? 32  LYS A CD  1 
ATOM   239  C CE  . LYS A 1 32  ? 18.994  -7.482  27.997  1.00 46.80 ? 32  LYS A CE  1 
ATOM   240  N NZ  . LYS A 1 32  ? 19.184  -6.854  26.656  1.00 46.40 ? 32  LYS A NZ  1 
ATOM   241  N N   . THR A 1 33  ? 17.760  -2.971  33.139  1.00 31.28 ? 33  THR A N   1 
ATOM   242  C CA  . THR A 1 33  ? 17.477  -2.931  34.576  1.00 30.17 ? 33  THR A CA  1 
ATOM   243  C C   . THR A 1 33  ? 16.460  -1.851  34.925  1.00 27.80 ? 33  THR A C   1 
ATOM   244  O O   . THR A 1 33  ? 16.680  -0.681  34.639  1.00 26.36 ? 33  THR A O   1 
ATOM   245  C CB  . THR A 1 33  ? 18.759  -2.676  35.391  1.00 33.61 ? 33  THR A CB  1 
ATOM   246  O OG1 . THR A 1 33  ? 19.664  -3.773  35.211  1.00 35.78 ? 33  THR A OG1 1 
ATOM   247  C CG2 . THR A 1 33  ? 18.436  -2.543  36.873  1.00 31.58 ? 33  THR A CG2 1 
ATOM   248  N N   . PHE A 1 34  ? 15.362  -2.242  35.565  1.00 24.05 ? 34  PHE A N   1 
ATOM   249  C CA  . PHE A 1 34  ? 14.319  -1.288  35.918  1.00 25.11 ? 34  PHE A CA  1 
ATOM   250  C C   . PHE A 1 34  ? 14.157  -1.027  37.420  1.00 24.35 ? 34  PHE A C   1 
ATOM   251  O O   . PHE A 1 34  ? 14.463  -1.878  38.249  1.00 26.22 ? 34  PHE A O   1 
ATOM   252  C CB  . PHE A 1 34  ? 12.993  -1.741  35.306  1.00 22.58 ? 34  PHE A CB  1 
ATOM   253  C CG  . PHE A 1 34  ? 13.074  -1.969  33.826  1.00 24.95 ? 34  PHE A CG  1 
ATOM   254  C CD1 . PHE A 1 34  ? 13.548  -3.183  33.322  1.00 22.32 ? 34  PHE A CD1 1 
ATOM   255  C CD2 . PHE A 1 34  ? 12.741  -0.954  32.930  1.00 22.05 ? 34  PHE A CD2 1 
ATOM   256  C CE1 . PHE A 1 34  ? 13.691  -3.383  31.947  1.00 23.12 ? 34  PHE A CE1 1 
ATOM   257  C CE2 . PHE A 1 34  ? 12.883  -1.146  31.548  1.00 22.17 ? 34  PHE A CE2 1 
ATOM   258  C CZ  . PHE A 1 34  ? 13.359  -2.360  31.058  1.00 20.15 ? 34  PHE A CZ  1 
ATOM   259  N N   . THR A 1 35  ? 13.658  0.162   37.751  1.00 22.26 ? 35  THR A N   1 
ATOM   260  C CA  . THR A 1 35  ? 13.471  0.573   39.137  1.00 22.33 ? 35  THR A CA  1 
ATOM   261  C C   . THR A 1 35  ? 12.311  -0.126  39.856  1.00 23.51 ? 35  THR A C   1 
ATOM   262  O O   . THR A 1 35  ? 11.723  -1.077  39.331  1.00 26.49 ? 35  THR A O   1 
ATOM   263  C CB  . THR A 1 35  ? 13.294  2.097   39.221  1.00 17.87 ? 35  THR A CB  1 
ATOM   264  O OG1 . THR A 1 35  ? 12.111  2.488   38.518  1.00 21.52 ? 35  THR A OG1 1 
ATOM   265  C CG2 . THR A 1 35  ? 14.482  2.792   38.576  1.00 15.08 ? 35  THR A CG2 1 
ATOM   266  N N   . ASP A 1 36  ? 11.981  0.345   41.057  1.00 20.90 ? 36  ASP A N   1 
ATOM   267  C CA  . ASP A 1 36  ? 10.922  -0.278  41.847  1.00 22.23 ? 36  ASP A CA  1 
ATOM   268  C C   . ASP A 1 36  ? 9.486   0.077   41.525  1.00 22.05 ? 36  ASP A C   1 
ATOM   269  O O   . ASP A 1 36  ? 8.597   -0.750  41.729  1.00 22.86 ? 36  ASP A O   1 
ATOM   270  C CB  . ASP A 1 36  ? 11.150  -0.017  43.337  1.00 25.19 ? 36  ASP A CB  1 
ATOM   271  C CG  . ASP A 1 36  ? 12.415  -0.672  43.858  1.00 27.94 ? 36  ASP A CG  1 
ATOM   272  O OD1 . ASP A 1 36  ? 12.635  -1.874  43.566  1.00 26.62 ? 36  ASP A OD1 1 
ATOM   273  O OD2 . ASP A 1 36  ? 13.182  0.015   44.566  1.00 25.52 ? 36  ASP A OD2 1 
ATOM   274  N N   . HIS A 1 37  ? 9.244   1.294   41.040  1.00 20.77 ? 37  HIS A N   1 
ATOM   275  C CA  . HIS A 1 37  ? 7.877   1.718   40.742  1.00 21.53 ? 37  HIS A CA  1 
ATOM   276  C C   . HIS A 1 37  ? 7.631   2.169   39.304  1.00 22.82 ? 37  HIS A C   1 
ATOM   277  O O   . HIS A 1 37  ? 8.565   2.409   38.535  1.00 23.39 ? 37  HIS A O   1 
ATOM   278  C CB  . HIS A 1 37  ? 7.457   2.844   41.696  1.00 21.51 ? 37  HIS A CB  1 
ATOM   279  C CG  . HIS A 1 37  ? 7.658   2.516   43.142  1.00 23.37 ? 37  HIS A CG  1 
ATOM   280  N ND1 . HIS A 1 37  ? 8.908   2.445   43.722  1.00 24.86 ? 37  HIS A ND1 1 
ATOM   281  C CD2 . HIS A 1 37  ? 6.770   2.215   44.120  1.00 22.27 ? 37  HIS A CD2 1 
ATOM   282  C CE1 . HIS A 1 37  ? 8.780   2.114   44.994  1.00 24.52 ? 37  HIS A CE1 1 
ATOM   283  N NE2 . HIS A 1 37  ? 7.494   1.969   45.262  1.00 21.89 ? 37  HIS A NE2 1 
ATOM   284  N N   . MET A 1 38  ? 6.355   2.284   38.954  1.00 21.78 ? 38  MET A N   1 
ATOM   285  C CA  . MET A 1 38  ? 5.963   2.711   37.621  1.00 21.50 ? 38  MET A CA  1 
ATOM   286  C C   . MET A 1 38  ? 4.705   3.559   37.719  1.00 23.54 ? 38  MET A C   1 
ATOM   287  O O   . MET A 1 38  ? 3.966   3.465   38.699  1.00 24.97 ? 38  MET A O   1 
ATOM   288  C CB  . MET A 1 38  ? 5.697   1.494   36.740  1.00 19.87 ? 38  MET A CB  1 
ATOM   289  C CG  . MET A 1 38  ? 4.451   0.719   37.111  1.00 20.54 ? 38  MET A CG  1 
ATOM   290  S SD  . MET A 1 38  ? 4.386   -0.858  36.257  1.00 19.43 ? 38  MET A SD  1 
ATOM   291  C CE  . MET A 1 38  ? 3.941   -0.360  34.602  1.00 22.32 ? 38  MET A CE  1 
ATOM   292  N N   . LEU A 1 39  ? 4.473   4.399   36.714  1.00 24.23 ? 39  LEU A N   1 
ATOM   293  C CA  . LEU A 1 39  ? 3.287   5.247   36.688  1.00 22.44 ? 39  LEU A CA  1 
ATOM   294  C C   . LEU A 1 39  ? 2.255   4.576   35.791  1.00 24.07 ? 39  LEU A C   1 
ATOM   295  O O   . LEU A 1 39  ? 2.601   3.950   34.796  1.00 22.95 ? 39  LEU A O   1 
ATOM   296  C CB  . LEU A 1 39  ? 3.622   6.631   36.135  1.00 20.29 ? 39  LEU A CB  1 
ATOM   297  C CG  . LEU A 1 39  ? 2.442   7.598   36.001  1.00 14.97 ? 39  LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 39  ? 1.935   8.009   37.369  1.00 15.90 ? 39  LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 39  ? 2.886   8.821   35.220  1.00 21.02 ? 39  LEU A CD2 1 
ATOM   300  N N   . MET A 1 40  ? 0.983   4.708   36.139  1.00 25.69 ? 40  MET A N   1 
ATOM   301  C CA  . MET A 1 40  ? -0.056  4.084   35.341  1.00 26.48 ? 40  MET A CA  1 
ATOM   302  C C   . MET A 1 40  ? -1.336  4.899   35.376  1.00 24.59 ? 40  MET A C   1 
ATOM   303  O O   . MET A 1 40  ? -1.800  5.279   36.444  1.00 25.16 ? 40  MET A O   1 
ATOM   304  C CB  . MET A 1 40  ? -0.333  2.674   35.868  1.00 29.67 ? 40  MET A CB  1 
ATOM   305  C CG  . MET A 1 40  ? -1.275  1.870   35.007  1.00 35.72 ? 40  MET A CG  1 
ATOM   306  S SD  . MET A 1 40  ? -0.422  0.562   34.110  1.00 43.59 ? 40  MET A SD  1 
ATOM   307  C CE  . MET A 1 40  ? -1.205  -0.887  34.826  1.00 43.72 ? 40  MET A CE  1 
ATOM   308  N N   . VAL A 1 41  ? -1.889  5.173   34.198  1.00 24.80 ? 41  VAL A N   1 
ATOM   309  C CA  . VAL A 1 41  ? -3.138  5.921   34.067  1.00 22.80 ? 41  VAL A CA  1 
ATOM   310  C C   . VAL A 1 41  ? -3.927  5.279   32.914  1.00 23.77 ? 41  VAL A C   1 
ATOM   311  O O   . VAL A 1 41  ? -3.398  5.078   31.814  1.00 21.62 ? 41  VAL A O   1 
ATOM   312  C CB  . VAL A 1 41  ? -2.892  7.413   33.729  1.00 23.06 ? 41  VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 41  ? -4.067  8.249   34.211  1.00 23.91 ? 41  VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 41  ? -1.600  7.894   34.346  1.00 19.43 ? 41  VAL A CG2 1 
ATOM   315  N N   . GLU A 1 42  ? -5.187  4.952   33.171  1.00 22.91 ? 42  GLU A N   1 
ATOM   316  C CA  . GLU A 1 42  ? -6.023  4.330   32.161  1.00 24.11 ? 42  GLU A CA  1 
ATOM   317  C C   . GLU A 1 42  ? -7.081  5.288   31.648  1.00 22.17 ? 42  GLU A C   1 
ATOM   318  O O   . GLU A 1 42  ? -7.414  6.271   32.304  1.00 23.04 ? 42  GLU A O   1 
ATOM   319  C CB  . GLU A 1 42  ? -6.668  3.087   32.740  1.00 29.17 ? 42  GLU A CB  1 
ATOM   320  C CG  . GLU A 1 42  ? -5.675  2.237   33.484  1.00 36.51 ? 42  GLU A CG  1 
ATOM   321  C CD  . GLU A 1 42  ? -6.300  1.007   34.080  1.00 41.74 ? 42  GLU A CD  1 
ATOM   322  O OE1 . GLU A 1 42  ? -6.857  0.194   33.305  1.00 46.98 ? 42  GLU A OE1 1 
ATOM   323  O OE2 . GLU A 1 42  ? -6.233  0.859   35.320  1.00 42.31 ? 42  GLU A OE2 1 
ATOM   324  N N   . TRP A 1 43  ? -7.617  4.988   30.474  1.00 22.83 ? 43  TRP A N   1 
ATOM   325  C CA  . TRP A 1 43  ? -8.607  5.846   29.856  1.00 25.94 ? 43  TRP A CA  1 
ATOM   326  C C   . TRP A 1 43  ? -9.655  4.998   29.181  1.00 30.14 ? 43  TRP A C   1 
ATOM   327  O O   . TRP A 1 43  ? -9.388  3.857   28.811  1.00 31.10 ? 43  TRP A O   1 
ATOM   328  C CB  . TRP A 1 43  ? -7.926  6.717   28.791  1.00 24.49 ? 43  TRP A CB  1 
ATOM   329  C CG  . TRP A 1 43  ? -8.836  7.683   28.064  1.00 22.96 ? 43  TRP A CG  1 
ATOM   330  C CD1 . TRP A 1 43  ? -9.155  8.964   28.444  1.00 21.13 ? 43  TRP A CD1 1 
ATOM   331  C CD2 . TRP A 1 43  ? -9.513  7.454   26.828  1.00 20.96 ? 43  TRP A CD2 1 
ATOM   332  N NE1 . TRP A 1 43  ? -9.979  9.541   27.516  1.00 23.16 ? 43  TRP A NE1 1 
ATOM   333  C CE2 . TRP A 1 43  ? -10.216 8.639   26.511  1.00 22.59 ? 43  TRP A CE2 1 
ATOM   334  C CE3 . TRP A 1 43  ? -9.589  6.363   25.951  1.00 24.38 ? 43  TRP A CE3 1 
ATOM   335  C CZ2 . TRP A 1 43  ? -10.991 8.765   25.351  1.00 22.51 ? 43  TRP A CZ2 1 
ATOM   336  C CZ3 . TRP A 1 43  ? -10.359 6.487   24.793  1.00 26.85 ? 43  TRP A CZ3 1 
ATOM   337  C CH2 . TRP A 1 43  ? -11.047 7.682   24.503  1.00 25.79 ? 43  TRP A CH2 1 
ATOM   338  N N   . ASN A 1 44  ? -10.848 5.556   29.017  1.00 36.25 ? 44  ASN A N   1 
ATOM   339  C CA  . ASN A 1 44  ? -11.917 4.866   28.305  1.00 43.11 ? 44  ASN A CA  1 
ATOM   340  C C   . ASN A 1 44  ? -12.851 5.899   27.682  1.00 45.33 ? 44  ASN A C   1 
ATOM   341  O O   . ASN A 1 44  ? -12.560 7.098   27.711  1.00 45.03 ? 44  ASN A O   1 
ATOM   342  C CB  . ASN A 1 44  ? -12.688 3.925   29.221  1.00 43.80 ? 44  ASN A CB  1 
ATOM   343  C CG  . ASN A 1 44  ? -13.289 4.631   30.387  1.00 46.00 ? 44  ASN A CG  1 
ATOM   344  O OD1 . ASN A 1 44  ? -13.926 5.670   30.226  1.00 48.39 ? 44  ASN A OD1 1 
ATOM   345  N ND2 . ASN A 1 44  ? -13.104 4.073   31.581  1.00 47.62 ? 44  ASN A ND2 1 
ATOM   346  N N   . ASP A 1 45  ? -13.959 5.436   27.109  1.00 48.52 ? 45  ASP A N   1 
ATOM   347  C CA  . ASP A 1 45  ? -14.921 6.327   26.458  1.00 50.45 ? 45  ASP A CA  1 
ATOM   348  C C   . ASP A 1 45  ? -15.303 7.501   27.363  1.00 48.87 ? 45  ASP A C   1 
ATOM   349  O O   . ASP A 1 45  ? -15.555 8.610   26.886  1.00 48.30 ? 45  ASP A O   1 
ATOM   350  C CB  . ASP A 1 45  ? -16.171 5.536   26.050  1.00 54.92 ? 45  ASP A CB  1 
ATOM   351  C CG  . ASP A 1 45  ? -16.978 5.057   27.246  1.00 59.67 ? 45  ASP A CG  1 
ATOM   352  O OD1 . ASP A 1 45  ? -16.375 4.531   28.208  1.00 60.41 ? 45  ASP A OD1 1 
ATOM   353  O OD2 . ASP A 1 45  ? -18.221 5.203   27.217  1.00 63.69 ? 45  ASP A OD2 1 
ATOM   354  N N   . LYS A 1 46  ? -15.343 7.253   28.669  1.00 45.59 ? 46  LYS A N   1 
ATOM   355  C CA  . LYS A 1 46  ? -15.664 8.300   29.627  1.00 42.98 ? 46  LYS A CA  1 
ATOM   356  C C   . LYS A 1 46  ? -14.494 9.292   29.600  1.00 41.92 ? 46  LYS A C   1 
ATOM   357  O O   . LYS A 1 46  ? -14.521 10.285  28.863  1.00 45.21 ? 46  LYS A O   1 
ATOM   358  C CB  . LYS A 1 46  ? -15.812 7.701   31.024  1.00 43.10 ? 46  LYS A CB  1 
ATOM   359  C CG  . LYS A 1 46  ? -16.820 8.411   31.891  1.00 46.61 ? 46  LYS A CG  1 
ATOM   360  C CD  . LYS A 1 46  ? -18.222 8.300   31.306  1.00 48.20 ? 46  LYS A CD  1 
ATOM   361  C CE  . LYS A 1 46  ? -18.715 6.856   31.290  1.00 47.75 ? 46  LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 46  ? -17.941 5.973   30.369  1.00 48.30 ? 46  LYS A NZ  1 
ATOM   363  N N   . GLY A 1 47  ? -13.468 9.014   30.400  1.00 35.93 ? 47  GLY A N   1 
ATOM   364  C CA  . GLY A 1 47  ? -12.291 9.859   30.440  1.00 27.59 ? 47  GLY A CA  1 
ATOM   365  C C   . GLY A 1 47  ? -11.175 9.164   31.189  1.00 22.21 ? 47  GLY A C   1 
ATOM   366  O O   . GLY A 1 47  ? -11.164 7.944   31.300  1.00 19.24 ? 47  GLY A O   1 
ATOM   367  N N   . TRP A 1 48  ? -10.240 9.944   31.717  1.00 21.45 ? 48  TRP A N   1 
ATOM   368  C CA  . TRP A 1 48  ? -9.115  9.393   32.465  1.00 20.92 ? 48  TRP A CA  1 
ATOM   369  C C   . TRP A 1 48  ? -9.457  8.972   33.895  1.00 22.86 ? 48  TRP A C   1 
ATOM   370  O O   . TRP A 1 48  ? -10.339 9.540   34.541  1.00 23.71 ? 48  TRP A O   1 
ATOM   371  C CB  . TRP A 1 48  ? -7.961  10.408  32.528  1.00 17.01 ? 48  TRP A CB  1 
ATOM   372  C CG  . TRP A 1 48  ? -7.270  10.650  31.221  1.00 18.45 ? 48  TRP A CG  1 
ATOM   373  C CD1 . TRP A 1 48  ? -7.467  11.697  30.360  1.00 15.28 ? 48  TRP A CD1 1 
ATOM   374  C CD2 . TRP A 1 48  ? -6.254  9.834   30.635  1.00 17.56 ? 48  TRP A CD2 1 
ATOM   375  N NE1 . TRP A 1 48  ? -6.626  11.582  29.277  1.00 18.58 ? 48  TRP A NE1 1 
ATOM   376  C CE2 . TRP A 1 48  ? -5.870  10.449  29.420  1.00 19.23 ? 48  TRP A CE2 1 
ATOM   377  C CE3 . TRP A 1 48  ? -5.627  8.642   31.020  1.00 14.55 ? 48  TRP A CE3 1 
ATOM   378  C CZ2 . TRP A 1 48  ? -4.886  9.910   28.587  1.00 17.70 ? 48  TRP A CZ2 1 
ATOM   379  C CZ3 . TRP A 1 48  ? -4.652  8.104   30.195  1.00 15.66 ? 48  TRP A CZ3 1 
ATOM   380  C CH2 . TRP A 1 48  ? -4.288  8.742   28.989  1.00 17.11 ? 48  TRP A CH2 1 
ATOM   381  N N   . GLY A 1 49  ? -8.747  7.957   34.377  1.00 22.76 ? 49  GLY A N   1 
ATOM   382  C CA  . GLY A 1 49  ? -8.931  7.509   35.742  1.00 21.55 ? 49  GLY A CA  1 
ATOM   383  C C   . GLY A 1 49  ? -7.916  8.295   36.552  1.00 23.70 ? 49  GLY A C   1 
ATOM   384  O O   . GLY A 1 49  ? -7.300  9.232   36.032  1.00 21.56 ? 49  GLY A O   1 
ATOM   385  N N   . GLN A 1 50  ? -7.724  7.954   37.820  1.00 24.51 ? 50  GLN A N   1 
ATOM   386  C CA  . GLN A 1 50  ? -6.745  8.699   38.595  1.00 25.61 ? 50  GLN A CA  1 
ATOM   387  C C   . GLN A 1 50  ? -5.397  8.064   38.352  1.00 24.56 ? 50  GLN A C   1 
ATOM   388  O O   . GLN A 1 50  ? -5.288  6.846   38.241  1.00 22.64 ? 50  GLN A O   1 
ATOM   389  C CB  . GLN A 1 50  ? -7.069  8.686   40.093  1.00 26.62 ? 50  GLN A CB  1 
ATOM   390  C CG  . GLN A 1 50  ? -7.839  7.467   40.565  1.00 34.54 ? 50  GLN A CG  1 
ATOM   391  C CD  . GLN A 1 50  ? -7.760  7.259   42.073  1.00 31.61 ? 50  GLN A CD  1 
ATOM   392  O OE1 . GLN A 1 50  ? -7.838  8.208   42.850  1.00 23.08 ? 50  GLN A OE1 1 
ATOM   393  N NE2 . GLN A 1 50  ? -7.609  6.002   42.487  1.00 38.52 ? 50  GLN A NE2 1 
ATOM   394  N N   . PRO A 1 51  ? -4.350  8.889   38.252  1.00 23.35 ? 51  PRO A N   1 
ATOM   395  C CA  . PRO A 1 51  ? -3.000  8.380   38.020  1.00 24.46 ? 51  PRO A CA  1 
ATOM   396  C C   . PRO A 1 51  ? -2.525  7.672   39.281  1.00 24.32 ? 51  PRO A C   1 
ATOM   397  O O   . PRO A 1 51  ? -2.875  8.057   40.398  1.00 23.05 ? 51  PRO A O   1 
ATOM   398  C CB  . PRO A 1 51  ? -2.175  9.651   37.764  1.00 24.97 ? 51  PRO A CB  1 
ATOM   399  C CG  . PRO A 1 51  ? -3.193  10.729  37.530  1.00 27.18 ? 51  PRO A CG  1 
ATOM   400  C CD  . PRO A 1 51  ? -4.335  10.347  38.421  1.00 24.18 ? 51  PRO A CD  1 
ATOM   401  N N   . ARG A 1 52  ? -1.717  6.645   39.109  1.00 25.11 ? 52  ARG A N   1 
ATOM   402  C CA  . ARG A 1 52  ? -1.203  5.950   40.263  1.00 26.26 ? 52  ARG A CA  1 
ATOM   403  C C   . ARG A 1 52  ? 0.231   5.504   40.068  1.00 23.73 ? 52  ARG A C   1 
ATOM   404  O O   . ARG A 1 52  ? 0.633   5.097   38.979  1.00 27.07 ? 52  ARG A O   1 
ATOM   405  C CB  . ARG A 1 52  ? -2.092  4.743   40.611  1.00 29.23 ? 52  ARG A CB  1 
ATOM   406  C CG  . ARG A 1 52  ? -2.154  3.630   39.575  1.00 31.22 ? 52  ARG A CG  1 
ATOM   407  C CD  . ARG A 1 52  ? -3.029  2.470   40.077  1.00 30.04 ? 52  ARG A CD  1 
ATOM   408  N NE  . ARG A 1 52  ? -3.077  1.361   39.124  1.00 32.04 ? 52  ARG A NE  1 
ATOM   409  C CZ  . ARG A 1 52  ? -3.806  1.352   38.011  1.00 27.75 ? 52  ARG A CZ  1 
ATOM   410  N NH1 . ARG A 1 52  ? -4.561  2.395   37.704  1.00 31.31 ? 52  ARG A NH1 1 
ATOM   411  N NH2 . ARG A 1 52  ? -3.768  0.303   37.197  1.00 31.43 ? 52  ARG A NH2 1 
ATOM   412  N N   . ILE A 1 53  ? 1.010   5.636   41.131  1.00 20.56 ? 53  ILE A N   1 
ATOM   413  C CA  . ILE A 1 53  ? 2.385   5.182   41.141  1.00 17.90 ? 53  ILE A CA  1 
ATOM   414  C C   . ILE A 1 53  ? 2.239   3.846   41.864  1.00 17.92 ? 53  ILE A C   1 
ATOM   415  O O   . ILE A 1 53  ? 1.560   3.764   42.885  1.00 19.40 ? 53  ILE A O   1 
ATOM   416  C CB  . ILE A 1 53  ? 3.288   6.154   41.930  1.00 14.47 ? 53  ILE A CB  1 
ATOM   417  C CG1 . ILE A 1 53  ? 3.408   7.466   41.150  1.00 18.28 ? 53  ILE A CG1 1 
ATOM   418  C CG2 . ILE A 1 53  ? 4.651   5.546   42.152  1.00 18.70 ? 53  ILE A CG2 1 
ATOM   419  C CD1 . ILE A 1 53  ? 4.336   8.482   41.759  1.00 17.03 ? 53  ILE A CD1 1 
ATOM   420  N N   . GLN A 1 54  ? 2.848   2.795   41.335  1.00 18.02 ? 54  GLN A N   1 
ATOM   421  C CA  . GLN A 1 54  ? 2.710   1.482   41.946  1.00 18.94 ? 54  GLN A CA  1 
ATOM   422  C C   . GLN A 1 54  ? 3.966   0.646   41.726  1.00 21.39 ? 54  GLN A C   1 
ATOM   423  O O   . GLN A 1 54  ? 4.846   1.023   40.958  1.00 27.60 ? 54  GLN A O   1 
ATOM   424  C CB  . GLN A 1 54  ? 1.500   0.777   41.323  1.00 22.18 ? 54  GLN A CB  1 
ATOM   425  C CG  . GLN A 1 54  ? 1.685   0.520   39.825  1.00 27.47 ? 54  GLN A CG  1 
ATOM   426  C CD  . GLN A 1 54  ? 0.488   -0.118  39.155  1.00 28.83 ? 54  GLN A CD  1 
ATOM   427  O OE1 . GLN A 1 54  ? 0.622   -0.757  38.102  1.00 29.57 ? 54  GLN A OE1 1 
ATOM   428  N NE2 . GLN A 1 54  ? -0.691  0.061   39.743  1.00 26.78 ? 54  GLN A NE2 1 
ATOM   429  N N   . PRO A 1 55  ? 4.067   -0.509  42.400  1.00 22.76 ? 55  PRO A N   1 
ATOM   430  C CA  . PRO A 1 55  ? 5.250   -1.358  42.227  1.00 22.34 ? 55  PRO A CA  1 
ATOM   431  C C   . PRO A 1 55  ? 5.394   -1.774  40.781  1.00 21.68 ? 55  PRO A C   1 
ATOM   432  O O   . PRO A 1 55  ? 4.394   -1.951  40.089  1.00 23.63 ? 55  PRO A O   1 
ATOM   433  C CB  . PRO A 1 55  ? 4.948   -2.561  43.117  1.00 20.45 ? 55  PRO A CB  1 
ATOM   434  C CG  . PRO A 1 55  ? 4.063   -1.971  44.194  1.00 20.71 ? 55  PRO A CG  1 
ATOM   435  C CD  . PRO A 1 55  ? 3.148   -1.083  43.401  1.00 20.88 ? 55  PRO A CD  1 
ATOM   436  N N   . PHE A 1 56  ? 6.635   -1.925  40.330  1.00 21.11 ? 56  PHE A N   1 
ATOM   437  C CA  . PHE A 1 56  ? 6.908   -2.357  38.967  1.00 20.93 ? 56  PHE A CA  1 
ATOM   438  C C   . PHE A 1 56  ? 6.255   -3.731  38.824  1.00 22.89 ? 56  PHE A C   1 
ATOM   439  O O   . PHE A 1 56  ? 6.458   -4.594  39.674  1.00 28.06 ? 56  PHE A O   1 
ATOM   440  C CB  . PHE A 1 56  ? 8.421   -2.481  38.758  1.00 19.35 ? 56  PHE A CB  1 
ATOM   441  C CG  . PHE A 1 56  ? 8.827   -2.678  37.320  1.00 17.17 ? 56  PHE A CG  1 
ATOM   442  C CD1 . PHE A 1 56  ? 8.926   -1.584  36.451  1.00 14.75 ? 56  PHE A CD1 1 
ATOM   443  C CD2 . PHE A 1 56  ? 9.103   -3.954  36.829  1.00 14.18 ? 56  PHE A CD2 1 
ATOM   444  C CE1 . PHE A 1 56  ? 9.295   -1.757  35.119  1.00 10.34 ? 56  PHE A CE1 1 
ATOM   445  C CE2 . PHE A 1 56  ? 9.477   -4.142  35.496  1.00 15.13 ? 56  PHE A CE2 1 
ATOM   446  C CZ  . PHE A 1 56  ? 9.574   -3.039  34.636  1.00 15.43 ? 56  PHE A CZ  1 
ATOM   447  N N   . GLN A 1 57  ? 5.475   -3.941  37.767  1.00 23.37 ? 57  GLN A N   1 
ATOM   448  C CA  . GLN A 1 57  ? 4.811   -5.236  37.561  1.00 23.94 ? 57  GLN A CA  1 
ATOM   449  C C   . GLN A 1 57  ? 4.416   -5.466  36.102  1.00 21.15 ? 57  GLN A C   1 
ATOM   450  O O   . GLN A 1 57  ? 4.540   -4.563  35.286  1.00 26.13 ? 57  GLN A O   1 
ATOM   451  C CB  . GLN A 1 57  ? 3.569   -5.318  38.443  1.00 21.41 ? 57  GLN A CB  1 
ATOM   452  C CG  . GLN A 1 57  ? 2.643   -4.160  38.241  1.00 29.22 ? 57  GLN A CG  1 
ATOM   453  C CD  . GLN A 1 57  ? 1.506   -4.142  39.232  1.00 32.33 ? 57  GLN A CD  1 
ATOM   454  O OE1 . GLN A 1 57  ? 0.582   -4.953  39.150  1.00 35.97 ? 57  GLN A OE1 1 
ATOM   455  N NE2 . GLN A 1 57  ? 1.565   -3.210  40.183  1.00 33.95 ? 57  GLN A NE2 1 
ATOM   456  N N   . ASN A 1 58  ? 3.943   -6.667  35.776  1.00 18.89 ? 58  ASN A N   1 
ATOM   457  C CA  . ASN A 1 58  ? 3.537   -6.979  34.408  1.00 20.11 ? 58  ASN A CA  1 
ATOM   458  C C   . ASN A 1 58  ? 2.172   -6.411  34.044  1.00 20.16 ? 58  ASN A C   1 
ATOM   459  O O   . ASN A 1 58  ? 1.337   -6.169  34.908  1.00 20.05 ? 58  ASN A O   1 
ATOM   460  C CB  . ASN A 1 58  ? 3.506   -8.490  34.159  1.00 17.91 ? 58  ASN A CB  1 
ATOM   461  C CG  . ASN A 1 58  ? 4.868   -9.128  34.291  1.00 20.72 ? 58  ASN A CG  1 
ATOM   462  O OD1 . ASN A 1 58  ? 5.867   -8.580  33.839  1.00 21.14 ? 58  ASN A OD1 1 
ATOM   463  N ND2 . ASN A 1 58  ? 4.914   -10.300 34.916  1.00 22.95 ? 58  ASN A ND2 1 
ATOM   464  N N   . LEU A 1 59  ? 1.967   -6.195  32.749  1.00 19.33 ? 59  LEU A N   1 
ATOM   465  C CA  . LEU A 1 59  ? 0.713   -5.678  32.240  1.00 20.40 ? 59  LEU A CA  1 
ATOM   466  C C   . LEU A 1 59  ? -0.191  -6.849  31.874  1.00 21.79 ? 59  LEU A C   1 
ATOM   467  O O   . LEU A 1 59  ? 0.278   -7.892  31.404  1.00 22.07 ? 59  LEU A O   1 
ATOM   468  C CB  . LEU A 1 59  ? 0.965   -4.839  30.992  1.00 20.65 ? 59  LEU A CB  1 
ATOM   469  C CG  . LEU A 1 59  ? 1.935   -3.673  31.131  1.00 20.63 ? 59  LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 59  ? 2.132   -3.059  29.772  1.00 19.01 ? 59  LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 59  ? 1.403   -2.647  32.115  1.00 22.50 ? 59  LEU A CD2 1 
ATOM   472  N N   . THR A 1 60  ? -1.485  -6.664  32.082  1.00 21.82 ? 60  THR A N   1 
ATOM   473  C CA  . THR A 1 60  ? -2.476  -7.681  31.763  1.00 25.65 ? 60  THR A CA  1 
ATOM   474  C C   . THR A 1 60  ? -3.257  -7.167  30.553  1.00 24.17 ? 60  THR A C   1 
ATOM   475  O O   . THR A 1 60  ? -4.104  -6.296  30.685  1.00 28.31 ? 60  THR A O   1 
ATOM   476  C CB  . THR A 1 60  ? -3.445  -7.893  32.947  1.00 25.99 ? 60  THR A CB  1 
ATOM   477  O OG1 . THR A 1 60  ? -2.697  -8.257  34.109  1.00 30.21 ? 60  THR A OG1 1 
ATOM   478  C CG2 . THR A 1 60  ? -4.431  -8.996  32.646  1.00 27.37 ? 60  THR A CG2 1 
ATOM   479  N N   . LEU A 1 61  ? -2.965  -7.699  29.375  1.00 22.47 ? 61  LEU A N   1 
ATOM   480  C CA  . LEU A 1 61  ? -3.637  -7.251  28.162  1.00 21.31 ? 61  LEU A CA  1 
ATOM   481  C C   . LEU A 1 61  ? -4.563  -8.297  27.577  1.00 20.50 ? 61  LEU A C   1 
ATOM   482  O O   . LEU A 1 61  ? -4.253  -9.484  27.567  1.00 22.47 ? 61  LEU A O   1 
ATOM   483  C CB  . LEU A 1 61  ? -2.602  -6.862  27.095  1.00 19.26 ? 61  LEU A CB  1 
ATOM   484  C CG  . LEU A 1 61  ? -1.959  -5.472  27.124  1.00 21.29 ? 61  LEU A CG  1 
ATOM   485  C CD1 . LEU A 1 61  ? -1.644  -5.063  28.535  1.00 23.58 ? 61  LEU A CD1 1 
ATOM   486  C CD2 . LEU A 1 61  ? -0.701  -5.480  26.283  1.00 19.11 ? 61  LEU A CD2 1 
ATOM   487  N N   . HIS A 1 62  ? -5.705  -7.840  27.085  1.00 19.81 ? 62  HIS A N   1 
ATOM   488  C CA  . HIS A 1 62  ? -6.667  -8.719  26.447  1.00 19.76 ? 62  HIS A CA  1 
ATOM   489  C C   . HIS A 1 62  ? -6.004  -9.089  25.114  1.00 18.84 ? 62  HIS A C   1 
ATOM   490  O O   . HIS A 1 62  ? -5.466  -8.227  24.429  1.00 14.75 ? 62  HIS A O   1 
ATOM   491  C CB  . HIS A 1 62  ? -7.967  -7.950  26.227  1.00 19.87 ? 62  HIS A CB  1 
ATOM   492  C CG  . HIS A 1 62  ? -9.071  -8.766  25.637  1.00 19.50 ? 62  HIS A CG  1 
ATOM   493  N ND1 . HIS A 1 62  ? -9.081  -9.162  24.318  1.00 20.70 ? 62  HIS A ND1 1 
ATOM   494  C CD2 . HIS A 1 62  ? -10.239 -9.198  26.168  1.00 15.55 ? 62  HIS A CD2 1 
ATOM   495  C CE1 . HIS A 1 62  ? -10.213 -9.794  24.060  1.00 19.23 ? 62  HIS A CE1 1 
ATOM   496  N NE2 . HIS A 1 62  ? -10.933 -9.827  25.166  1.00 12.79 ? 62  HIS A NE2 1 
ATOM   497  N N   . PRO A 1 63  ? -6.021  -10.378 24.742  1.00 18.88 ? 63  PRO A N   1 
ATOM   498  C CA  . PRO A 1 63  ? -5.415  -10.867 23.496  1.00 16.49 ? 63  PRO A CA  1 
ATOM   499  C C   . PRO A 1 63  ? -5.775  -10.078 22.237  1.00 17.49 ? 63  PRO A C   1 
ATOM   500  O O   . PRO A 1 63  ? -5.030  -10.095 21.256  1.00 15.62 ? 63  PRO A O   1 
ATOM   501  C CB  . PRO A 1 63  ? -5.906  -12.306 23.416  1.00 17.18 ? 63  PRO A CB  1 
ATOM   502  C CG  . PRO A 1 63  ? -6.030  -12.697 24.836  1.00 20.70 ? 63  PRO A CG  1 
ATOM   503  C CD  . PRO A 1 63  ? -6.674  -11.481 25.468  1.00 20.86 ? 63  PRO A CD  1 
ATOM   504  N N   . ALA A 1 64  ? -6.919  -9.402  22.256  1.00 16.91 ? 64  ALA A N   1 
ATOM   505  C CA  . ALA A 1 64  ? -7.345  -8.623  21.098  1.00 18.04 ? 64  ALA A CA  1 
ATOM   506  C C   . ALA A 1 64  ? -6.954  -7.147  21.183  1.00 19.24 ? 64  ALA A C   1 
ATOM   507  O O   . ALA A 1 64  ? -7.378  -6.359  20.344  1.00 22.24 ? 64  ALA A O   1 
ATOM   508  C CB  . ALA A 1 64  ? -8.859  -8.742  20.914  1.00 13.23 ? 64  ALA A CB  1 
ATOM   509  N N   . SER A 1 65  ? -6.154  -6.775  22.181  1.00 17.88 ? 65  SER A N   1 
ATOM   510  C CA  . SER A 1 65  ? -5.728  -5.382  22.355  1.00 16.53 ? 65  SER A CA  1 
ATOM   511  C C   . SER A 1 65  ? -5.152  -4.811  21.059  1.00 18.58 ? 65  SER A C   1 
ATOM   512  O O   . SER A 1 65  ? -4.216  -5.382  20.470  1.00 15.28 ? 65  SER A O   1 
ATOM   513  C CB  . SER A 1 65  ? -4.685  -5.279  23.467  1.00 17.16 ? 65  SER A CB  1 
ATOM   514  O OG  . SER A 1 65  ? -4.293  -3.936  23.673  1.00 21.05 ? 65  SER A OG  1 
ATOM   515  N N   . SER A 1 66  ? -5.715  -3.684  20.623  1.00 16.24 ? 66  SER A N   1 
ATOM   516  C CA  . SER A 1 66  ? -5.278  -3.040  19.385  1.00 16.39 ? 66  SER A CA  1 
ATOM   517  C C   . SER A 1 66  ? -3.802  -2.642  19.404  1.00 17.17 ? 66  SER A C   1 
ATOM   518  O O   . SER A 1 66  ? -3.189  -2.446  18.354  1.00 18.66 ? 66  SER A O   1 
ATOM   519  C CB  . SER A 1 66  ? -6.161  -1.822  19.077  1.00 12.78 ? 66  SER A CB  1 
ATOM   520  O OG  . SER A 1 66  ? -6.286  -0.982  20.204  1.00 11.67 ? 66  SER A OG  1 
ATOM   521  N N   . SER A 1 67  ? -3.223  -2.534  20.595  1.00 19.44 ? 67  SER A N   1 
ATOM   522  C CA  . SER A 1 67  ? -1.807  -2.188  20.697  1.00 20.02 ? 67  SER A CA  1 
ATOM   523  C C   . SER A 1 67  ? -0.936  -3.340  20.155  1.00 19.56 ? 67  SER A C   1 
ATOM   524  O O   . SER A 1 67  ? 0.201   -3.121  19.734  1.00 19.58 ? 67  SER A O   1 
ATOM   525  C CB  . SER A 1 67  ? -1.432  -1.914  22.152  1.00 16.04 ? 67  SER A CB  1 
ATOM   526  O OG  . SER A 1 67  ? -1.508  -3.106  22.907  1.00 20.29 ? 67  SER A OG  1 
ATOM   527  N N   . LEU A 1 68  ? -1.478  -4.559  20.160  1.00 16.89 ? 68  LEU A N   1 
ATOM   528  C CA  . LEU A 1 68  ? -0.743  -5.729  19.694  1.00 15.54 ? 68  LEU A CA  1 
ATOM   529  C C   . LEU A 1 68  ? -1.064  -6.166  18.265  1.00 15.32 ? 68  LEU A C   1 
ATOM   530  O O   . LEU A 1 68  ? -0.330  -6.964  17.679  1.00 12.47 ? 68  LEU A O   1 
ATOM   531  C CB  . LEU A 1 68  ? -0.989  -6.905  20.641  1.00 15.93 ? 68  LEU A CB  1 
ATOM   532  C CG  . LEU A 1 68  ? -0.523  -6.742  22.090  1.00 18.22 ? 68  LEU A CG  1 
ATOM   533  C CD1 . LEU A 1 68  ? -0.973  -7.939  22.907  1.00 15.14 ? 68  LEU A CD1 1 
ATOM   534  C CD2 . LEU A 1 68  ? 0.984   -6.603  22.133  1.00 16.36 ? 68  LEU A CD2 1 
ATOM   535  N N   . HIS A 1 69  ? -2.154  -5.647  17.708  1.00 13.58 ? 69  HIS A N   1 
ATOM   536  C CA  . HIS A 1 69  ? -2.564  -5.998  16.348  1.00 12.22 ? 69  HIS A CA  1 
ATOM   537  C C   . HIS A 1 69  ? -2.329  -4.882  15.322  1.00 14.01 ? 69  HIS A C   1 
ATOM   538  O O   . HIS A 1 69  ? -1.858  -5.124  14.209  1.00 14.22 ? 69  HIS A O   1 
ATOM   539  C CB  . HIS A 1 69  ? -4.043  -6.349  16.327  1.00 9.40  ? 69  HIS A CB  1 
ATOM   540  C CG  . HIS A 1 69  ? -4.384  -7.591  17.082  1.00 16.11 ? 69  HIS A CG  1 
ATOM   541  N ND1 . HIS A 1 69  ? -4.690  -8.781  16.456  1.00 11.72 ? 69  HIS A ND1 1 
ATOM   542  C CD2 . HIS A 1 69  ? -4.480  -7.827  18.413  1.00 17.45 ? 69  HIS A CD2 1 
ATOM   543  C CE1 . HIS A 1 69  ? -4.961  -9.697  17.369  1.00 12.62 ? 69  HIS A CE1 1 
ATOM   544  N NE2 . HIS A 1 69  ? -4.841  -9.144  18.565  1.00 17.03 ? 69  HIS A NE2 1 
ATOM   545  N N   . TYR A 1 70  ? -2.674  -3.657  15.697  1.00 12.75 ? 70  TYR A N   1 
ATOM   546  C CA  . TYR A 1 70  ? -2.529  -2.541  14.785  1.00 11.50 ? 70  TYR A CA  1 
ATOM   547  C C   . TYR A 1 70  ? -1.488  -1.516  15.186  1.00 11.44 ? 70  TYR A C   1 
ATOM   548  O O   . TYR A 1 70  ? -1.454  -0.419  14.651  1.00 5.95  ? 70  TYR A O   1 
ATOM   549  C CB  . TYR A 1 70  ? -3.888  -1.899  14.597  1.00 11.48 ? 70  TYR A CB  1 
ATOM   550  C CG  . TYR A 1 70  ? -4.901  -2.941  14.204  1.00 15.05 ? 70  TYR A CG  1 
ATOM   551  C CD1 . TYR A 1 70  ? -4.626  -3.847  13.166  1.00 14.35 ? 70  TYR A CD1 1 
ATOM   552  C CD2 . TYR A 1 70  ? -6.091  -3.074  14.900  1.00 11.30 ? 70  TYR A CD2 1 
ATOM   553  C CE1 . TYR A 1 70  ? -5.511  -4.859  12.844  1.00 15.33 ? 70  TYR A CE1 1 
ATOM   554  C CE2 . TYR A 1 70  ? -6.990  -4.088  14.584  1.00 16.40 ? 70  TYR A CE2 1 
ATOM   555  C CZ  . TYR A 1 70  ? -6.689  -4.976  13.559  1.00 15.27 ? 70  TYR A CZ  1 
ATOM   556  O OH  . TYR A 1 70  ? -7.549  -5.992  13.264  1.00 14.95 ? 70  TYR A OH  1 
ATOM   557  N N   . SER A 1 71  ? -0.634  -1.886  16.130  1.00 12.42 ? 71  SER A N   1 
ATOM   558  C CA  . SER A 1 71  ? 0.429   -1.000  16.562  1.00 14.55 ? 71  SER A CA  1 
ATOM   559  C C   . SER A 1 71  ? -0.037  0.394   17.013  1.00 14.14 ? 71  SER A C   1 
ATOM   560  O O   . SER A 1 71  ? 0.544   1.403   16.625  1.00 10.68 ? 71  SER A O   1 
ATOM   561  C CB  . SER A 1 71  ? 1.454   -0.878  15.427  1.00 12.66 ? 71  SER A CB  1 
ATOM   562  O OG  . SER A 1 71  ? 2.609   -0.173  15.837  1.00 11.12 ? 71  SER A OG  1 
ATOM   563  N N   . LEU A 1 72  ? -1.099  0.458   17.812  1.00 16.09 ? 72  LEU A N   1 
ATOM   564  C CA  . LEU A 1 72  ? -1.553  1.750   18.315  1.00 15.94 ? 72  LEU A CA  1 
ATOM   565  C C   . LEU A 1 72  ? -0.670  1.947   19.531  1.00 15.75 ? 72  LEU A C   1 
ATOM   566  O O   . LEU A 1 72  ? -1.054  1.672   20.661  1.00 17.30 ? 72  LEU A O   1 
ATOM   567  C CB  . LEU A 1 72  ? -3.039  1.710   18.695  1.00 17.61 ? 72  LEU A CB  1 
ATOM   568  C CG  . LEU A 1 72  ? -3.962  1.712   17.468  1.00 18.32 ? 72  LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 72  ? -5.426  1.699   17.869  1.00 21.06 ? 72  LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 72  ? -3.666  2.956   16.663  1.00 21.17 ? 72  LEU A CD2 1 
ATOM   571  N N   . GLN A 1 73  ? 0.539   2.421   19.279  1.00 15.40 ? 73  GLN A N   1 
ATOM   572  C CA  . GLN A 1 73  ? 1.502   2.598   20.343  1.00 14.66 ? 73  GLN A CA  1 
ATOM   573  C C   . GLN A 1 73  ? 2.506   3.679   19.976  1.00 16.85 ? 73  GLN A C   1 
ATOM   574  O O   . GLN A 1 73  ? 2.856   3.837   18.803  1.00 18.10 ? 73  GLN A O   1 
ATOM   575  C CB  . GLN A 1 73  ? 2.242   1.267   20.569  1.00 9.51  ? 73  GLN A CB  1 
ATOM   576  C CG  . GLN A 1 73  ? 2.969   0.776   19.308  1.00 8.76  ? 73  GLN A CG  1 
ATOM   577  C CD  . GLN A 1 73  ? 3.701   -0.544  19.478  1.00 10.22 ? 73  GLN A CD  1 
ATOM   578  O OE1 . GLN A 1 73  ? 3.104   -1.556  19.834  1.00 16.48 ? 73  GLN A OE1 1 
ATOM   579  N NE2 . GLN A 1 73  ? 4.996   -0.544  19.202  1.00 6.07  ? 73  GLN A NE2 1 
ATOM   580  N N   . LEU A 1 74  ? 2.943   4.433   20.984  1.00 18.27 ? 74  LEU A N   1 
ATOM   581  C CA  . LEU A 1 74  ? 3.959   5.465   20.810  1.00 16.45 ? 74  LEU A CA  1 
ATOM   582  C C   . LEU A 1 74  ? 4.718   5.563   22.116  1.00 17.23 ? 74  LEU A C   1 
ATOM   583  O O   . LEU A 1 74  ? 4.212   5.152   23.162  1.00 20.13 ? 74  LEU A O   1 
ATOM   584  C CB  . LEU A 1 74  ? 3.357   6.826   20.429  1.00 19.85 ? 74  LEU A CB  1 
ATOM   585  C CG  . LEU A 1 74  ? 2.488   7.744   21.313  1.00 22.71 ? 74  LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 74  ? 1.137   7.141   21.502  1.00 21.63 ? 74  LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 74  ? 3.168   8.026   22.640  1.00 22.25 ? 74  LEU A CD2 1 
ATOM   588  N N   . PHE A 1 75  ? 5.936   6.086   22.061  1.00 16.96 ? 75  PHE A N   1 
ATOM   589  C CA  . PHE A 1 75  ? 6.748   6.215   23.263  1.00 14.49 ? 75  PHE A CA  1 
ATOM   590  C C   . PHE A 1 75  ? 7.582   7.475   23.216  1.00 14.86 ? 75  PHE A C   1 
ATOM   591  O O   . PHE A 1 75  ? 7.634   8.159   22.201  1.00 17.75 ? 75  PHE A O   1 
ATOM   592  C CB  . PHE A 1 75  ? 7.695   5.017   23.402  1.00 12.57 ? 75  PHE A CB  1 
ATOM   593  C CG  . PHE A 1 75  ? 8.737   4.944   22.318  1.00 13.94 ? 75  PHE A CG  1 
ATOM   594  C CD1 . PHE A 1 75  ? 8.402   4.501   21.035  1.00 16.89 ? 75  PHE A CD1 1 
ATOM   595  C CD2 . PHE A 1 75  ? 10.041  5.374   22.557  1.00 15.27 ? 75  PHE A CD2 1 
ATOM   596  C CE1 . PHE A 1 75  ? 9.350   4.494   20.003  1.00 18.02 ? 75  PHE A CE1 1 
ATOM   597  C CE2 . PHE A 1 75  ? 10.999  5.370   21.533  1.00 17.09 ? 75  PHE A CE2 1 
ATOM   598  C CZ  . PHE A 1 75  ? 10.654  4.931   20.255  1.00 14.51 ? 75  PHE A CZ  1 
ATOM   599  N N   . GLU A 1 76  ? 8.237   7.764   24.331  1.00 14.79 ? 76  GLU A N   1 
ATOM   600  C CA  . GLU A 1 76  ? 9.132   8.900   24.439  1.00 16.97 ? 76  GLU A CA  1 
ATOM   601  C C   . GLU A 1 76  ? 10.402  8.423   25.132  1.00 19.61 ? 76  GLU A C   1 
ATOM   602  O O   . GLU A 1 76  ? 10.485  7.275   25.571  1.00 17.03 ? 76  GLU A O   1 
ATOM   603  C CB  . GLU A 1 76  ? 8.487   10.052  25.218  1.00 10.80 ? 76  GLU A CB  1 
ATOM   604  C CG  . GLU A 1 76  ? 7.889   11.102  24.297  1.00 13.86 ? 76  GLU A CG  1 
ATOM   605  C CD  . GLU A 1 76  ? 8.937   11.692  23.356  1.00 17.77 ? 76  GLU A CD  1 
ATOM   606  O OE1 . GLU A 1 76  ? 8.558   12.199  22.278  1.00 13.93 ? 76  GLU A OE1 1 
ATOM   607  O OE2 . GLU A 1 76  ? 10.142  11.652  23.698  1.00 14.03 ? 76  GLU A OE2 1 
ATOM   608  N N   . GLY A 1 77  ? 11.395  9.304   25.209  1.00 21.15 ? 77  GLY A N   1 
ATOM   609  C CA  . GLY A 1 77  ? 12.648  8.958   25.848  1.00 21.54 ? 77  GLY A CA  1 
ATOM   610  C C   . GLY A 1 77  ? 13.405  10.197  26.285  1.00 24.39 ? 77  GLY A C   1 
ATOM   611  O O   . GLY A 1 77  ? 13.681  11.081  25.478  1.00 23.68 ? 77  GLY A O   1 
ATOM   612  N N   . MET A 1 78  ? 13.742  10.265  27.568  1.00 23.65 ? 78  MET A N   1 
ATOM   613  C CA  . MET A 1 78  ? 14.469  11.409  28.099  1.00 24.84 ? 78  MET A CA  1 
ATOM   614  C C   . MET A 1 78  ? 15.309  10.969  29.292  1.00 22.50 ? 78  MET A C   1 
ATOM   615  O O   . MET A 1 78  ? 15.149  9.861   29.801  1.00 24.17 ? 78  MET A O   1 
ATOM   616  C CB  . MET A 1 78  ? 13.489  12.509  28.507  1.00 27.19 ? 78  MET A CB  1 
ATOM   617  C CG  . MET A 1 78  ? 12.414  12.040  29.464  1.00 29.47 ? 78  MET A CG  1 
ATOM   618  S SD  . MET A 1 78  ? 11.007  13.139  29.480  1.00 28.36 ? 78  MET A SD  1 
ATOM   619  C CE  . MET A 1 78  ? 11.403  14.165  30.898  1.00 37.73 ? 78  MET A CE  1 
ATOM   620  N N   . LYS A 1 79  ? 16.209  11.839  29.725  1.00 18.77 ? 79  LYS A N   1 
ATOM   621  C CA  . LYS A 1 79  ? 17.082  11.518  30.837  1.00 20.19 ? 79  LYS A CA  1 
ATOM   622  C C   . LYS A 1 79  ? 17.008  12.481  32.014  1.00 22.08 ? 79  LYS A C   1 
ATOM   623  O O   . LYS A 1 79  ? 16.628  13.650  31.877  1.00 21.22 ? 79  LYS A O   1 
ATOM   624  C CB  . LYS A 1 79  ? 18.530  11.441  30.357  1.00 16.28 ? 79  LYS A CB  1 
ATOM   625  C CG  . LYS A 1 79  ? 18.842  10.230  29.506  1.00 20.97 ? 79  LYS A CG  1 
ATOM   626  C CD  . LYS A 1 79  ? 20.312  10.204  29.111  1.00 18.17 ? 79  LYS A CD  1 
ATOM   627  C CE  . LYS A 1 79  ? 20.660  8.920   28.396  1.00 13.69 ? 79  LYS A CE  1 
ATOM   628  N NZ  . LYS A 1 79  ? 22.103  8.842   28.050  1.00 18.63 ? 79  LYS A NZ  1 
ATOM   629  N N   . ALA A 1 80  ? 17.377  11.953  33.176  1.00 22.44 ? 80  ALA A N   1 
ATOM   630  C CA  . ALA A 1 80  ? 17.434  12.710  34.419  1.00 23.95 ? 80  ALA A CA  1 
ATOM   631  C C   . ALA A 1 80  ? 18.872  12.503  34.903  1.00 22.42 ? 80  ALA A C   1 
ATOM   632  O O   . ALA A 1 80  ? 19.398  11.389  34.823  1.00 21.88 ? 80  ALA A O   1 
ATOM   633  C CB  . ALA A 1 80  ? 16.441  12.152  35.424  1.00 24.35 ? 80  ALA A CB  1 
ATOM   634  N N   . PHE A 1 81  ? 19.509  13.569  35.376  1.00 20.91 ? 81  PHE A N   1 
ATOM   635  C CA  . PHE A 1 81  ? 20.885  13.478  35.843  1.00 21.03 ? 81  PHE A CA  1 
ATOM   636  C C   . PHE A 1 81  ? 21.029  13.878  37.304  1.00 23.77 ? 81  PHE A C   1 
ATOM   637  O O   . PHE A 1 81  ? 20.418  14.845  37.758  1.00 23.18 ? 81  PHE A O   1 
ATOM   638  C CB  . PHE A 1 81  ? 21.798  14.361  34.989  1.00 22.37 ? 81  PHE A CB  1 
ATOM   639  C CG  . PHE A 1 81  ? 21.685  14.114  33.509  1.00 20.17 ? 81  PHE A CG  1 
ATOM   640  C CD1 . PHE A 1 81  ? 20.677  14.724  32.763  1.00 22.33 ? 81  PHE A CD1 1 
ATOM   641  C CD2 . PHE A 1 81  ? 22.610  13.305  32.852  1.00 20.37 ? 81  PHE A CD2 1 
ATOM   642  C CE1 . PHE A 1 81  ? 20.591  14.540  31.376  1.00 23.83 ? 81  PHE A CE1 1 
ATOM   643  C CE2 . PHE A 1 81  ? 22.536  13.110  31.461  1.00 25.60 ? 81  PHE A CE2 1 
ATOM   644  C CZ  . PHE A 1 81  ? 21.521  13.734  30.721  1.00 23.10 ? 81  PHE A CZ  1 
ATOM   645  N N   . LYS A 1 82  ? 21.827  13.108  38.040  1.00 25.79 ? 82  LYS A N   1 
ATOM   646  C CA  . LYS A 1 82  ? 22.071  13.386  39.447  1.00 27.25 ? 82  LYS A CA  1 
ATOM   647  C C   . LYS A 1 82  ? 23.222  14.366  39.473  1.00 29.76 ? 82  LYS A C   1 
ATOM   648  O O   . LYS A 1 82  ? 24.381  13.982  39.323  1.00 27.80 ? 82  LYS A O   1 
ATOM   649  C CB  . LYS A 1 82  ? 22.470  12.115  40.207  1.00 28.41 ? 82  LYS A CB  1 
ATOM   650  C CG  . LYS A 1 82  ? 22.855  12.374  41.675  1.00 28.19 ? 82  LYS A CG  1 
ATOM   651  C CD  . LYS A 1 82  ? 21.879  11.741  42.657  1.00 28.65 ? 82  LYS A CD  1 
ATOM   652  C CE  . LYS A 1 82  ? 21.969  10.218  42.605  1.00 34.67 ? 82  LYS A CE  1 
ATOM   653  N NZ  . LYS A 1 82  ? 20.898  9.517   43.391  1.00 35.28 ? 82  LYS A NZ  1 
ATOM   654  N N   . GLY A 1 83  ? 22.892  15.639  39.640  1.00 33.99 ? 83  GLY A N   1 
ATOM   655  C CA  . GLY A 1 83  ? 23.918  16.659  39.681  1.00 37.37 ? 83  GLY A CA  1 
ATOM   656  C C   . GLY A 1 83  ? 24.948  16.371  40.748  1.00 39.10 ? 83  GLY A C   1 
ATOM   657  O O   . GLY A 1 83  ? 24.725  15.558  41.640  1.00 39.71 ? 83  GLY A O   1 
ATOM   658  N N   . LYS A 1 84  ? 26.090  17.039  40.651  1.00 44.44 ? 84  LYS A N   1 
ATOM   659  C CA  . LYS A 1 84  ? 27.158  16.866  41.626  1.00 47.69 ? 84  LYS A CA  1 
ATOM   660  C C   . LYS A 1 84  ? 26.621  17.206  43.022  1.00 46.16 ? 84  LYS A C   1 
ATOM   661  O O   . LYS A 1 84  ? 26.914  16.512  43.994  1.00 47.08 ? 84  LYS A O   1 
ATOM   662  C CB  . LYS A 1 84  ? 28.332  17.786  41.276  1.00 50.45 ? 84  LYS A CB  1 
ATOM   663  C CG  . LYS A 1 84  ? 28.744  17.761  39.799  1.00 52.89 ? 84  LYS A CG  1 
ATOM   664  C CD  . LYS A 1 84  ? 29.359  16.427  39.372  1.00 55.60 ? 84  LYS A CD  1 
ATOM   665  C CE  . LYS A 1 84  ? 29.958  16.517  37.966  1.00 54.25 ? 84  LYS A CE  1 
ATOM   666  N NZ  . LYS A 1 84  ? 30.644  15.257  37.555  1.00 55.96 ? 84  LYS A NZ  1 
ATOM   667  N N   . ASP A 1 85  ? 25.822  18.269  43.103  1.00 43.33 ? 85  ASP A N   1 
ATOM   668  C CA  . ASP A 1 85  ? 25.232  18.724  44.363  1.00 41.51 ? 85  ASP A CA  1 
ATOM   669  C C   . ASP A 1 85  ? 24.155  17.787  44.914  1.00 42.16 ? 85  ASP A C   1 
ATOM   670  O O   . ASP A 1 85  ? 23.393  18.174  45.803  1.00 39.61 ? 85  ASP A O   1 
ATOM   671  C CB  . ASP A 1 85  ? 24.623  20.113  44.172  1.00 38.51 ? 85  ASP A CB  1 
ATOM   672  C CG  . ASP A 1 85  ? 23.557  20.133  43.091  1.00 41.53 ? 85  ASP A CG  1 
ATOM   673  O OD1 . ASP A 1 85  ? 23.014  21.221  42.797  1.00 37.63 ? 85  ASP A OD1 1 
ATOM   674  O OD2 . ASP A 1 85  ? 23.264  19.054  42.533  1.00 42.18 ? 85  ASP A OD2 1 
ATOM   675  N N   . GLN A 1 86  ? 24.087  16.567  44.380  1.00 43.70 ? 86  GLN A N   1 
ATOM   676  C CA  . GLN A 1 86  ? 23.103  15.579  44.827  1.00 43.27 ? 86  GLN A CA  1 
ATOM   677  C C   . GLN A 1 86  ? 21.685  15.828  44.291  1.00 39.31 ? 86  GLN A C   1 
ATOM   678  O O   . GLN A 1 86  ? 20.770  15.054  44.561  1.00 39.72 ? 86  GLN A O   1 
ATOM   679  C CB  . GLN A 1 86  ? 23.070  15.540  46.359  1.00 47.21 ? 86  GLN A CB  1 
ATOM   680  C CG  . GLN A 1 86  ? 24.305  14.915  46.986  1.00 54.23 ? 86  GLN A CG  1 
ATOM   681  C CD  . GLN A 1 86  ? 24.320  13.404  46.836  1.00 60.65 ? 86  GLN A CD  1 
ATOM   682  O OE1 . GLN A 1 86  ? 23.462  12.710  47.383  1.00 64.11 ? 86  GLN A OE1 1 
ATOM   683  N NE2 . GLN A 1 86  ? 25.292  12.887  46.091  1.00 61.94 ? 86  GLN A NE2 1 
ATOM   684  N N   . GLN A 1 87  ? 21.507  16.902  43.530  1.00 34.69 ? 87  GLN A N   1 
ATOM   685  C CA  . GLN A 1 87  ? 20.198  17.247  42.970  1.00 34.77 ? 87  GLN A CA  1 
ATOM   686  C C   . GLN A 1 87  ? 19.898  16.529  41.641  1.00 32.48 ? 87  GLN A C   1 
ATOM   687  O O   . GLN A 1 87  ? 20.768  16.419  40.771  1.00 28.68 ? 87  GLN A O   1 
ATOM   688  C CB  . GLN A 1 87  ? 20.119  18.769  42.770  1.00 37.63 ? 87  GLN A CB  1 
ATOM   689  C CG  . GLN A 1 87  ? 18.920  19.244  41.966  1.00 46.25 ? 87  GLN A CG  1 
ATOM   690  C CD  . GLN A 1 87  ? 17.631  19.212  42.760  1.00 52.57 ? 87  GLN A CD  1 
ATOM   691  O OE1 . GLN A 1 87  ? 17.401  20.058  43.633  1.00 51.99 ? 87  GLN A OE1 1 
ATOM   692  N NE2 . GLN A 1 87  ? 16.782  18.227  42.469  1.00 55.17 ? 87  GLN A NE2 1 
ATOM   693  N N   . VAL A 1 88  ? 18.669  16.037  41.485  1.00 28.59 ? 88  VAL A N   1 
ATOM   694  C CA  . VAL A 1 88  ? 18.286  15.354  40.248  1.00 24.55 ? 88  VAL A CA  1 
ATOM   695  C C   . VAL A 1 88  ? 17.547  16.322  39.319  1.00 24.47 ? 88  VAL A C   1 
ATOM   696  O O   . VAL A 1 88  ? 16.664  17.073  39.755  1.00 22.90 ? 88  VAL A O   1 
ATOM   697  C CB  . VAL A 1 88  ? 17.402  14.122  40.540  1.00 22.52 ? 88  VAL A CB  1 
ATOM   698  C CG1 . VAL A 1 88  ? 16.866  13.538  39.231  1.00 21.85 ? 88  VAL A CG1 1 
ATOM   699  C CG2 . VAL A 1 88  ? 18.212  13.073  41.308  1.00 20.00 ? 88  VAL A CG2 1 
ATOM   700  N N   . ARG A 1 89  ? 17.919  16.305  38.039  1.00 22.95 ? 89  ARG A N   1 
ATOM   701  C CA  . ARG A 1 89  ? 17.316  17.198  37.052  1.00 22.89 ? 89  ARG A CA  1 
ATOM   702  C C   . ARG A 1 89  ? 17.007  16.559  35.697  1.00 21.13 ? 89  ARG A C   1 
ATOM   703  O O   . ARG A 1 89  ? 17.758  15.725  35.208  1.00 22.10 ? 89  ARG A O   1 
ATOM   704  C CB  . ARG A 1 89  ? 18.229  18.408  36.844  1.00 20.76 ? 89  ARG A CB  1 
ATOM   705  C CG  . ARG A 1 89  ? 18.086  19.474  37.913  1.00 28.15 ? 89  ARG A CG  1 
ATOM   706  C CD  . ARG A 1 89  ? 19.232  20.474  37.889  1.00 27.58 ? 89  ARG A CD  1 
ATOM   707  N NE  . ARG A 1 89  ? 20.412  19.900  38.528  1.00 35.25 ? 89  ARG A NE  1 
ATOM   708  C CZ  . ARG A 1 89  ? 21.013  20.423  39.593  1.00 32.70 ? 89  ARG A CZ  1 
ATOM   709  N NH1 . ARG A 1 89  ? 20.548  21.538  40.137  1.00 27.58 ? 89  ARG A NH1 1 
ATOM   710  N NH2 . ARG A 1 89  ? 22.068  19.817  40.122  1.00 33.11 ? 89  ARG A NH2 1 
ATOM   711  N N   . LEU A 1 90  ? 15.889  16.962  35.100  1.00 21.67 ? 90  LEU A N   1 
ATOM   712  C CA  . LEU A 1 90  ? 15.474  16.467  33.791  1.00 22.19 ? 90  LEU A CA  1 
ATOM   713  C C   . LEU A 1 90  ? 15.863  17.478  32.716  1.00 23.96 ? 90  LEU A C   1 
ATOM   714  O O   . LEU A 1 90  ? 15.737  18.692  32.914  1.00 25.50 ? 90  LEU A O   1 
ATOM   715  C CB  . LEU A 1 90  ? 13.962  16.254  33.749  1.00 24.30 ? 90  LEU A CB  1 
ATOM   716  C CG  . LEU A 1 90  ? 13.357  15.072  34.506  1.00 25.97 ? 90  LEU A CG  1 
ATOM   717  C CD1 . LEU A 1 90  ? 11.845  15.186  34.468  1.00 29.44 ? 90  LEU A CD1 1 
ATOM   718  C CD2 . LEU A 1 90  ? 13.803  13.764  33.873  1.00 29.06 ? 90  LEU A CD2 1 
ATOM   719  N N   . PHE A 1 91  ? 16.311  16.969  31.572  1.00 24.32 ? 91  PHE A N   1 
ATOM   720  C CA  . PHE A 1 91  ? 16.740  17.812  30.460  1.00 23.59 ? 91  PHE A CA  1 
ATOM   721  C C   . PHE A 1 91  ? 15.615  18.207  29.492  1.00 22.19 ? 91  PHE A C   1 
ATOM   722  O O   . PHE A 1 91  ? 15.123  17.383  28.729  1.00 24.41 ? 91  PHE A O   1 
ATOM   723  C CB  . PHE A 1 91  ? 17.851  17.091  29.690  1.00 24.17 ? 91  PHE A CB  1 
ATOM   724  C CG  . PHE A 1 91  ? 18.468  17.913  28.604  1.00 22.17 ? 91  PHE A CG  1 
ATOM   725  C CD1 . PHE A 1 91  ? 19.352  18.942  28.909  1.00 22.42 ? 91  PHE A CD1 1 
ATOM   726  C CD2 . PHE A 1 91  ? 18.162  17.663  27.272  1.00 21.89 ? 91  PHE A CD2 1 
ATOM   727  C CE1 . PHE A 1 91  ? 19.927  19.716  27.897  1.00 21.97 ? 91  PHE A CE1 1 
ATOM   728  C CE2 . PHE A 1 91  ? 18.732  18.432  26.251  1.00 21.58 ? 91  PHE A CE2 1 
ATOM   729  C CZ  . PHE A 1 91  ? 19.617  19.461  26.565  1.00 17.71 ? 91  PHE A CZ  1 
ATOM   730  N N   . ARG A 1 92  ? 15.225  19.477  29.524  1.00 23.19 ? 92  ARG A N   1 
ATOM   731  C CA  . ARG A 1 92  ? 14.175  20.014  28.650  1.00 21.13 ? 92  ARG A CA  1 
ATOM   732  C C   . ARG A 1 92  ? 12.968  19.087  28.468  1.00 21.83 ? 92  ARG A C   1 
ATOM   733  O O   . ARG A 1 92  ? 12.538  18.823  27.344  1.00 18.85 ? 92  ARG A O   1 
ATOM   734  C CB  . ARG A 1 92  ? 14.766  20.362  27.277  1.00 22.08 ? 92  ARG A CB  1 
ATOM   735  C CG  . ARG A 1 92  ? 15.976  21.286  27.336  1.00 18.56 ? 92  ARG A CG  1 
ATOM   736  C CD  . ARG A 1 92  ? 16.382  21.794  25.956  1.00 19.97 ? 92  ARG A CD  1 
ATOM   737  N NE  . ARG A 1 92  ? 15.523  22.869  25.455  1.00 18.34 ? 92  ARG A NE  1 
ATOM   738  C CZ  . ARG A 1 92  ? 15.684  23.463  24.272  1.00 21.15 ? 92  ARG A CZ  1 
ATOM   739  N NH1 . ARG A 1 92  ? 16.672  23.088  23.457  1.00 17.78 ? 92  ARG A NH1 1 
ATOM   740  N NH2 . ARG A 1 92  ? 14.861  24.437  23.905  1.00 12.35 ? 92  ARG A NH2 1 
ATOM   741  N N   . PRO A 1 93  ? 12.380  18.618  29.583  1.00 23.66 ? 93  PRO A N   1 
ATOM   742  C CA  . PRO A 1 93  ? 11.220  17.716  29.570  1.00 20.92 ? 93  PRO A CA  1 
ATOM   743  C C   . PRO A 1 93  ? 10.040  18.215  28.724  1.00 20.23 ? 93  PRO A C   1 
ATOM   744  O O   . PRO A 1 93  ? 9.324   17.424  28.116  1.00 23.27 ? 93  PRO A O   1 
ATOM   745  C CB  . PRO A 1 93  ? 10.837  17.614  31.051  1.00 20.48 ? 93  PRO A CB  1 
ATOM   746  C CG  . PRO A 1 93  ? 12.087  17.979  31.781  1.00 23.16 ? 93  PRO A CG  1 
ATOM   747  C CD  . PRO A 1 93  ? 12.649  19.097  30.950  1.00 21.72 ? 93  PRO A CD  1 
ATOM   748  N N   . TRP A 1 94  ? 9.841   19.526  28.702  1.00 17.49 ? 94  TRP A N   1 
ATOM   749  C CA  . TRP A 1 94  ? 8.741   20.135  27.957  1.00 20.46 ? 94  TRP A CA  1 
ATOM   750  C C   . TRP A 1 94  ? 8.706   19.762  26.475  1.00 19.58 ? 94  TRP A C   1 
ATOM   751  O O   . TRP A 1 94  ? 7.635   19.582  25.890  1.00 17.23 ? 94  TRP A O   1 
ATOM   752  C CB  . TRP A 1 94  ? 8.814   21.658  28.089  1.00 20.75 ? 94  TRP A CB  1 
ATOM   753  C CG  . TRP A 1 94  ? 9.060   22.094  29.484  1.00 21.18 ? 94  TRP A CG  1 
ATOM   754  C CD1 . TRP A 1 94  ? 8.142   22.183  30.491  1.00 22.20 ? 94  TRP A CD1 1 
ATOM   755  C CD2 . TRP A 1 94  ? 10.324  22.450  30.055  1.00 22.03 ? 94  TRP A CD2 1 
ATOM   756  N NE1 . TRP A 1 94  ? 8.759   22.572  31.657  1.00 26.25 ? 94  TRP A NE1 1 
ATOM   757  C CE2 . TRP A 1 94  ? 10.098  22.744  31.416  1.00 23.12 ? 94  TRP A CE2 1 
ATOM   758  C CE3 . TRP A 1 94  ? 11.627  22.550  29.547  1.00 23.92 ? 94  TRP A CE3 1 
ATOM   759  C CZ2 . TRP A 1 94  ? 11.126  23.130  32.277  1.00 22.59 ? 94  TRP A CZ2 1 
ATOM   760  C CZ3 . TRP A 1 94  ? 12.650  22.934  30.404  1.00 22.05 ? 94  TRP A CZ3 1 
ATOM   761  C CH2 . TRP A 1 94  ? 12.393  23.220  31.752  1.00 25.39 ? 94  TRP A CH2 1 
ATOM   762  N N   . LEU A 1 95  ? 9.871   19.661  25.852  1.00 19.28 ? 95  LEU A N   1 
ATOM   763  C CA  . LEU A 1 95  ? 9.893   19.303  24.445  1.00 19.59 ? 95  LEU A CA  1 
ATOM   764  C C   . LEU A 1 95  ? 9.391   17.868  24.242  1.00 18.39 ? 95  LEU A C   1 
ATOM   765  O O   . LEU A 1 95  ? 8.735   17.570  23.249  1.00 16.79 ? 95  LEU A O   1 
ATOM   766  C CB  . LEU A 1 95  ? 11.300  19.474  23.872  1.00 18.12 ? 95  LEU A CB  1 
ATOM   767  C CG  . LEU A 1 95  ? 11.812  20.914  23.859  1.00 21.23 ? 95  LEU A CG  1 
ATOM   768  C CD1 . LEU A 1 95  ? 13.155  20.965  23.149  1.00 20.01 ? 95  LEU A CD1 1 
ATOM   769  C CD2 . LEU A 1 95  ? 10.809  21.815  23.165  1.00 18.85 ? 95  LEU A CD2 1 
ATOM   770  N N   . ASN A 1 96  ? 9.681   16.987  25.194  1.00 15.72 ? 96  ASN A N   1 
ATOM   771  C CA  . ASN A 1 96  ? 9.235   15.604  25.089  1.00 18.70 ? 96  ASN A CA  1 
ATOM   772  C C   . ASN A 1 96  ? 7.730   15.482  25.276  1.00 19.34 ? 96  ASN A C   1 
ATOM   773  O O   . ASN A 1 96  ? 7.079   14.679  24.596  1.00 20.40 ? 96  ASN A O   1 
ATOM   774  C CB  . ASN A 1 96  ? 9.941   14.737  26.124  1.00 16.07 ? 96  ASN A CB  1 
ATOM   775  C CG  . ASN A 1 96  ? 11.441  14.702  25.921  1.00 19.94 ? 96  ASN A CG  1 
ATOM   776  O OD1 . ASN A 1 96  ? 11.982  13.772  25.318  1.00 18.61 ? 96  ASN A OD1 1 
ATOM   777  N ND2 . ASN A 1 96  ? 12.121  15.727  26.416  1.00 18.53 ? 96  ASN A ND2 1 
ATOM   778  N N   . MET A 1 97  ? 7.187   16.271  26.200  1.00 17.92 ? 97  MET A N   1 
ATOM   779  C CA  . MET A 1 97  ? 5.757   16.252  26.480  1.00 19.88 ? 97  MET A CA  1 
ATOM   780  C C   . MET A 1 97  ? 4.985   16.700  25.250  1.00 21.46 ? 97  MET A C   1 
ATOM   781  O O   . MET A 1 97  ? 3.910   16.177  24.944  1.00 23.22 ? 97  MET A O   1 
ATOM   782  C CB  . MET A 1 97  ? 5.433   17.176  27.655  1.00 21.32 ? 97  MET A CB  1 
ATOM   783  C CG  . MET A 1 97  ? 6.031   16.748  28.984  1.00 18.84 ? 97  MET A CG  1 
ATOM   784  S SD  . MET A 1 97  ? 5.464   15.123  29.525  1.00 20.54 ? 97  MET A SD  1 
ATOM   785  C CE  . MET A 1 97  ? 6.862   14.079  29.028  1.00 18.19 ? 97  MET A CE  1 
ATOM   786  N N   . ASP A 1 98  ? 5.541   17.673  24.541  1.00 21.37 ? 98  ASP A N   1 
ATOM   787  C CA  . ASP A 1 98  ? 4.907   18.176  23.341  1.00 22.26 ? 98  ASP A CA  1 
ATOM   788  C C   . ASP A 1 98  ? 4.952   17.147  22.221  1.00 21.61 ? 98  ASP A C   1 
ATOM   789  O O   . ASP A 1 98  ? 3.954   16.898  21.544  1.00 21.93 ? 98  ASP A O   1 
ATOM   790  C CB  . ASP A 1 98  ? 5.600   19.450  22.883  1.00 30.32 ? 98  ASP A CB  1 
ATOM   791  C CG  . ASP A 1 98  ? 4.700   20.650  22.974  1.00 37.76 ? 98  ASP A CG  1 
ATOM   792  O OD1 . ASP A 1 98  ? 4.917   21.494  23.877  1.00 39.28 ? 98  ASP A OD1 1 
ATOM   793  O OD2 . ASP A 1 98  ? 3.764   20.734  22.146  1.00 42.31 ? 98  ASP A OD2 1 
ATOM   794  N N   . ARG A 1 99  ? 6.120   16.550  22.027  1.00 18.67 ? 99  ARG A N   1 
ATOM   795  C CA  . ARG A 1 99  ? 6.290   15.563  20.984  1.00 17.07 ? 99  ARG A CA  1 
ATOM   796  C C   . ARG A 1 99  ? 5.325   14.399  21.227  1.00 15.56 ? 99  ARG A C   1 
ATOM   797  O O   . ARG A 1 99  ? 4.695   13.891  20.292  1.00 13.27 ? 99  ARG A O   1 
ATOM   798  C CB  . ARG A 1 99  ? 7.743   15.086  20.973  1.00 15.70 ? 99  ARG A CB  1 
ATOM   799  C CG  . ARG A 1 99  ? 8.168   14.377  19.707  1.00 15.96 ? 99  ARG A CG  1 
ATOM   800  C CD  . ARG A 1 99  ? 9.686   14.353  19.587  1.00 18.80 ? 99  ARG A CD  1 
ATOM   801  N NE  . ARG A 1 99  ? 10.315  13.541  20.627  1.00 19.68 ? 99  ARG A NE  1 
ATOM   802  C CZ  . ARG A 1 99  ? 11.628  13.446  20.802  1.00 18.91 ? 99  ARG A CZ  1 
ATOM   803  N NH1 . ARG A 1 99  ? 12.448  14.122  20.009  1.00 13.58 ? 99  ARG A NH1 1 
ATOM   804  N NH2 . ARG A 1 99  ? 12.122  12.664  21.753  1.00 17.82 ? 99  ARG A NH2 1 
ATOM   805  N N   . MET A 1 100 ? 5.198   13.999  22.489  1.00 13.68 ? 100 MET A N   1 
ATOM   806  C CA  . MET A 1 100 ? 4.314   12.903  22.854  1.00 12.80 ? 100 MET A CA  1 
ATOM   807  C C   . MET A 1 100 ? 2.853   13.227  22.554  1.00 12.68 ? 100 MET A C   1 
ATOM   808  O O   . MET A 1 100 ? 2.120   12.387  22.034  1.00 11.58 ? 100 MET A O   1 
ATOM   809  C CB  . MET A 1 100 ? 4.475   12.571  24.333  1.00 9.43  ? 100 MET A CB  1 
ATOM   810  C CG  . MET A 1 100 ? 3.806   11.281  24.729  1.00 12.99 ? 100 MET A CG  1 
ATOM   811  S SD  . MET A 1 100 ? 4.122   10.802  26.441  1.00 19.19 ? 100 MET A SD  1 
ATOM   812  C CE  . MET A 1 100 ? 3.231   9.259   26.467  1.00 18.90 ? 100 MET A CE  1 
ATOM   813  N N   . LEU A 1 101 ? 2.429   14.443  22.874  1.00 13.58 ? 101 LEU A N   1 
ATOM   814  C CA  . LEU A 1 101 ? 1.057   14.834  22.600  1.00 17.37 ? 101 LEU A CA  1 
ATOM   815  C C   . LEU A 1 101 ? 0.780   14.767  21.098  1.00 18.36 ? 101 LEU A C   1 
ATOM   816  O O   . LEU A 1 101 ? -0.275  14.286  20.677  1.00 18.86 ? 101 LEU A O   1 
ATOM   817  C CB  . LEU A 1 101 ? 0.779   16.249  23.110  1.00 19.03 ? 101 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 101 ? -0.697  16.663  23.098  1.00 18.21 ? 101 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 101 ? -1.505  15.710  23.974  1.00 17.92 ? 101 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 101 ? -0.841  18.092  23.597  1.00 16.35 ? 101 LEU A CD2 1 
ATOM   821  N N   . ARG A 1 102 ? 1.720   15.245  20.287  1.00 19.78 ? 102 ARG A N   1 
ATOM   822  C CA  . ARG A 1 102 ? 1.536   15.209  18.841  1.00 20.20 ? 102 ARG A CA  1 
ATOM   823  C C   . ARG A 1 102 ? 1.429   13.771  18.328  1.00 16.30 ? 102 ARG A C   1 
ATOM   824  O O   . ARG A 1 102 ? 0.567   13.470  17.500  1.00 16.05 ? 102 ARG A O   1 
ATOM   825  C CB  . ARG A 1 102 ? 2.674   15.952  18.126  1.00 23.36 ? 102 ARG A CB  1 
ATOM   826  C CG  . ARG A 1 102 ? 2.548   17.467  18.195  1.00 29.24 ? 102 ARG A CG  1 
ATOM   827  C CD  . ARG A 1 102 ? 3.580   18.172  17.328  1.00 38.66 ? 102 ARG A CD  1 
ATOM   828  N NE  . ARG A 1 102 ? 4.915   18.174  17.923  1.00 47.23 ? 102 ARG A NE  1 
ATOM   829  C CZ  . ARG A 1 102 ? 5.999   17.658  17.349  1.00 50.52 ? 102 ARG A CZ  1 
ATOM   830  N NH1 . ARG A 1 102 ? 5.916   17.083  16.153  1.00 50.53 ? 102 ARG A NH1 1 
ATOM   831  N NH2 . ARG A 1 102 ? 7.173   17.730  17.968  1.00 49.54 ? 102 ARG A NH2 1 
ATOM   832  N N   . SER A 1 103 ? 2.291   12.888  18.823  1.00 9.51  ? 103 SER A N   1 
ATOM   833  C CA  . SER A 1 103 ? 2.268   11.483  18.405  1.00 14.96 ? 103 SER A CA  1 
ATOM   834  C C   . SER A 1 103 ? 0.932   10.851  18.776  1.00 15.25 ? 103 SER A C   1 
ATOM   835  O O   . SER A 1 103 ? 0.357   10.094  18.003  1.00 15.22 ? 103 SER A O   1 
ATOM   836  C CB  . SER A 1 103 ? 3.395   10.694  19.077  1.00 13.34 ? 103 SER A CB  1 
ATOM   837  O OG  . SER A 1 103 ? 4.662   11.195  18.688  1.00 18.63 ? 103 SER A OG  1 
ATOM   838  N N   . ALA A 1 104 ? 0.441   11.174  19.965  1.00 13.60 ? 104 ALA A N   1 
ATOM   839  C CA  . ALA A 1 104 ? -0.831  10.645  20.429  1.00 16.62 ? 104 ALA A CA  1 
ATOM   840  C C   . ALA A 1 104 ? -1.949  11.017  19.465  1.00 18.95 ? 104 ALA A C   1 
ATOM   841  O O   . ALA A 1 104 ? -2.743  10.167  19.048  1.00 22.31 ? 104 ALA A O   1 
ATOM   842  C CB  . ALA A 1 104 ? -1.139  11.184  21.821  1.00 17.35 ? 104 ALA A CB  1 
ATOM   843  N N   . MET A 1 105 ? -1.997  12.294  19.100  1.00 21.59 ? 105 MET A N   1 
ATOM   844  C CA  . MET A 1 105 ? -3.027  12.791  18.195  1.00 20.49 ? 105 MET A CA  1 
ATOM   845  C C   . MET A 1 105 ? -2.957  12.187  16.800  1.00 18.00 ? 105 MET A C   1 
ATOM   846  O O   . MET A 1 105 ? -3.982  12.052  16.141  1.00 17.41 ? 105 MET A O   1 
ATOM   847  C CB  . MET A 1 105 ? -2.957  14.317  18.108  1.00 23.19 ? 105 MET A CB  1 
ATOM   848  C CG  . MET A 1 105 ? -3.152  15.000  19.452  1.00 34.11 ? 105 MET A CG  1 
ATOM   849  S SD  . MET A 1 105 ? -3.584  16.745  19.282  1.00 46.76 ? 105 MET A SD  1 
ATOM   850  C CE  . MET A 1 105 ? -2.024  17.453  18.624  1.00 39.91 ? 105 MET A CE  1 
ATOM   851  N N   . ARG A 1 106 ? -1.755  11.819  16.354  1.00 14.10 ? 106 ARG A N   1 
ATOM   852  C CA  . ARG A 1 106 ? -1.585  11.235  15.026  1.00 16.27 ? 106 ARG A CA  1 
ATOM   853  C C   . ARG A 1 106 ? -2.185  9.819   14.979  1.00 18.09 ? 106 ARG A C   1 
ATOM   854  O O   . ARG A 1 106 ? -2.626  9.355   13.930  1.00 20.94 ? 106 ARG A O   1 
ATOM   855  C CB  . ARG A 1 106 ? -0.096  11.195  14.660  1.00 12.49 ? 106 ARG A CB  1 
ATOM   856  C CG  . ARG A 1 106 ? 0.214   10.572  13.315  1.00 12.85 ? 106 ARG A CG  1 
ATOM   857  C CD  . ARG A 1 106 ? -0.083  11.521  12.165  1.00 17.40 ? 106 ARG A CD  1 
ATOM   858  N NE  . ARG A 1 106 ? -0.963  10.926  11.165  1.00 21.68 ? 106 ARG A NE  1 
ATOM   859  C CZ  . ARG A 1 106 ? -0.707  9.804   10.499  1.00 23.92 ? 106 ARG A CZ  1 
ATOM   860  N NH1 . ARG A 1 106 ? 0.418   9.135   10.715  1.00 31.63 ? 106 ARG A NH1 1 
ATOM   861  N NH2 . ARG A 1 106 ? -1.578  9.342   9.616   1.00 21.53 ? 106 ARG A NH2 1 
ATOM   862  N N   . LEU A 1 107 ? -2.209  9.150   16.129  1.00 16.01 ? 107 LEU A N   1 
ATOM   863  C CA  . LEU A 1 107 ? -2.738  7.798   16.235  1.00 17.13 ? 107 LEU A CA  1 
ATOM   864  C C   . LEU A 1 107 ? -4.144  7.773   16.814  1.00 19.25 ? 107 LEU A C   1 
ATOM   865  O O   . LEU A 1 107 ? -4.694  6.703   17.083  1.00 18.65 ? 107 LEU A O   1 
ATOM   866  C CB  . LEU A 1 107 ? -1.822  6.941   17.115  1.00 16.82 ? 107 LEU A CB  1 
ATOM   867  C CG  . LEU A 1 107 ? -0.463  6.553   16.525  1.00 19.06 ? 107 LEU A CG  1 
ATOM   868  C CD1 . LEU A 1 107 ? 0.270   5.651   17.495  1.00 17.64 ? 107 LEU A CD1 1 
ATOM   869  C CD2 . LEU A 1 107 ? -0.660  5.837   15.195  1.00 14.23 ? 107 LEU A CD2 1 
ATOM   870  N N   . CYS A 1 108 ? -4.719  8.951   17.018  1.00 16.82 ? 108 CYS A N   1 
ATOM   871  C CA  . CYS A 1 108 ? -6.057  9.044   17.574  1.00 18.01 ? 108 CYS A CA  1 
ATOM   872  C C   . CYS A 1 108 ? -6.133  8.495   18.987  1.00 17.32 ? 108 CYS A C   1 
ATOM   873  O O   . CYS A 1 108 ? -7.104  7.849   19.355  1.00 17.23 ? 108 CYS A O   1 
ATOM   874  C CB  . CYS A 1 108 ? -7.058  8.303   16.691  1.00 19.88 ? 108 CYS A CB  1 
ATOM   875  S SG  . CYS A 1 108 ? -7.330  9.080   15.107  1.00 22.36 ? 108 CYS A SG  1 
ATOM   876  N N   . LEU A 1 109 ? -5.092  8.736   19.773  1.00 16.36 ? 109 LEU A N   1 
ATOM   877  C CA  . LEU A 1 109 ? -5.091  8.306   21.156  1.00 16.10 ? 109 LEU A CA  1 
ATOM   878  C C   . LEU A 1 109 ? -5.503  9.531   21.985  1.00 17.20 ? 109 LEU A C   1 
ATOM   879  O O   . LEU A 1 109 ? -5.436  10.658  21.513  1.00 20.59 ? 109 LEU A O   1 
ATOM   880  C CB  . LEU A 1 109 ? -3.712  7.774   21.555  1.00 18.22 ? 109 LEU A CB  1 
ATOM   881  C CG  . LEU A 1 109 ? -3.407  6.374   21.000  1.00 19.73 ? 109 LEU A CG  1 
ATOM   882  C CD1 . LEU A 1 109 ? -2.046  5.918   21.480  1.00 16.36 ? 109 LEU A CD1 1 
ATOM   883  C CD2 . LEU A 1 109 ? -4.496  5.381   21.458  1.00 17.45 ? 109 LEU A CD2 1 
ATOM   884  N N   . PRO A 1 110 ? -5.949  9.322   23.225  1.00 14.84 ? 110 PRO A N   1 
ATOM   885  C CA  . PRO A 1 110 ? -6.382  10.417  24.098  1.00 15.28 ? 110 PRO A CA  1 
ATOM   886  C C   . PRO A 1 110 ? -5.351  11.510  24.372  1.00 17.35 ? 110 PRO A C   1 
ATOM   887  O O   . PRO A 1 110 ? -4.191  11.225  24.676  1.00 21.36 ? 110 PRO A O   1 
ATOM   888  C CB  . PRO A 1 110 ? -6.772  9.703   25.394  1.00 12.63 ? 110 PRO A CB  1 
ATOM   889  C CG  . PRO A 1 110 ? -6.957  8.269   24.985  1.00 19.12 ? 110 PRO A CG  1 
ATOM   890  C CD  . PRO A 1 110 ? -5.912  8.049   23.956  1.00 13.96 ? 110 PRO A CD  1 
ATOM   891  N N   . SER A 1 111 ? -5.767  12.763  24.276  1.00 14.21 ? 111 SER A N   1 
ATOM   892  C CA  . SER A 1 111 ? -4.840  13.835  24.587  1.00 19.13 ? 111 SER A CA  1 
ATOM   893  C C   . SER A 1 111 ? -4.868  13.974  26.123  1.00 17.99 ? 111 SER A C   1 
ATOM   894  O O   . SER A 1 111 ? -5.742  13.422  26.797  1.00 15.04 ? 111 SER A O   1 
ATOM   895  C CB  . SER A 1 111 ? -5.260  15.144  23.896  1.00 19.74 ? 111 SER A CB  1 
ATOM   896  O OG  . SER A 1 111 ? -6.555  15.549  24.303  1.00 23.42 ? 111 SER A OG  1 
ATOM   897  N N   . PHE A 1 112 ? -3.906  14.699  26.673  1.00 19.95 ? 112 PHE A N   1 
ATOM   898  C CA  . PHE A 1 112 ? -3.818  14.888  28.120  1.00 22.57 ? 112 PHE A CA  1 
ATOM   899  C C   . PHE A 1 112 ? -3.146  16.231  28.372  1.00 23.44 ? 112 PHE A C   1 
ATOM   900  O O   . PHE A 1 112 ? -2.806  16.944  27.424  1.00 24.12 ? 112 PHE A O   1 
ATOM   901  C CB  . PHE A 1 112 ? -2.971  13.763  28.715  1.00 20.64 ? 112 PHE A CB  1 
ATOM   902  C CG  . PHE A 1 112 ? -1.672  13.565  27.993  1.00 21.75 ? 112 PHE A CG  1 
ATOM   903  C CD1 . PHE A 1 112 ? -0.569  14.362  28.282  1.00 21.31 ? 112 PHE A CD1 1 
ATOM   904  C CD2 . PHE A 1 112 ? -1.573  12.631  26.969  1.00 19.85 ? 112 PHE A CD2 1 
ATOM   905  C CE1 . PHE A 1 112 ? 0.618   14.237  27.559  1.00 19.66 ? 112 PHE A CE1 1 
ATOM   906  C CE2 . PHE A 1 112 ? -0.394  12.495  26.239  1.00 21.88 ? 112 PHE A CE2 1 
ATOM   907  C CZ  . PHE A 1 112 ? 0.708   13.305  26.537  1.00 23.58 ? 112 PHE A CZ  1 
ATOM   908  N N   . ASP A 1 113 ? -2.946  16.581  29.637  1.00 24.41 ? 113 ASP A N   1 
ATOM   909  C CA  . ASP A 1 113 ? -2.299  17.851  29.945  1.00 21.65 ? 113 ASP A CA  1 
ATOM   910  C C   . ASP A 1 113 ? -0.808  17.612  30.107  1.00 21.16 ? 113 ASP A C   1 
ATOM   911  O O   . ASP A 1 113 ? -0.379  16.857  30.983  1.00 19.13 ? 113 ASP A O   1 
ATOM   912  C CB  . ASP A 1 113 ? -2.876  18.457  31.220  1.00 24.18 ? 113 ASP A CB  1 
ATOM   913  C CG  . ASP A 1 113 ? -2.546  19.925  31.358  1.00 24.45 ? 113 ASP A CG  1 
ATOM   914  O OD1 . ASP A 1 113 ? -1.347  20.275  31.340  1.00 24.70 ? 113 ASP A OD1 1 
ATOM   915  O OD2 . ASP A 1 113 ? -3.490  20.732  31.481  1.00 32.87 ? 113 ASP A OD2 1 
ATOM   916  N N   . LYS A 1 114 ? -0.024  18.250  29.246  1.00 19.79 ? 114 LYS A N   1 
ATOM   917  C CA  . LYS A 1 114 ? 1.422   18.088  29.268  1.00 23.53 ? 114 LYS A CA  1 
ATOM   918  C C   . LYS A 1 114 ? 2.085   18.336  30.621  1.00 23.54 ? 114 LYS A C   1 
ATOM   919  O O   . LYS A 1 114 ? 2.942   17.554  31.038  1.00 23.61 ? 114 LYS A O   1 
ATOM   920  C CB  . LYS A 1 114 ? 2.060   18.980  28.197  1.00 25.75 ? 114 LYS A CB  1 
ATOM   921  C CG  . LYS A 1 114 ? 1.759   18.496  26.789  1.00 28.90 ? 114 LYS A CG  1 
ATOM   922  C CD  . LYS A 1 114 ? 2.461   19.303  25.715  1.00 26.36 ? 114 LYS A CD  1 
ATOM   923  C CE  . LYS A 1 114 ? 1.947   20.718  25.668  1.00 23.80 ? 114 LYS A CE  1 
ATOM   924  N NZ  . LYS A 1 114 ? 2.399   21.385  24.422  1.00 26.09 ? 114 LYS A NZ  1 
ATOM   925  N N   . LEU A 1 115 ? 1.691   19.412  31.302  1.00 22.10 ? 115 LEU A N   1 
ATOM   926  C CA  . LEU A 1 115 ? 2.267   19.751  32.598  1.00 19.79 ? 115 LEU A CA  1 
ATOM   927  C C   . LEU A 1 115 ? 1.831   18.792  33.705  1.00 21.19 ? 115 LEU A C   1 
ATOM   928  O O   . LEU A 1 115 ? 2.610   18.510  34.617  1.00 21.26 ? 115 LEU A O   1 
ATOM   929  C CB  . LEU A 1 115 ? 1.908   21.192  32.971  1.00 21.26 ? 115 LEU A CB  1 
ATOM   930  C CG  . LEU A 1 115 ? 2.406   22.255  31.979  1.00 21.94 ? 115 LEU A CG  1 
ATOM   931  C CD1 . LEU A 1 115 ? 1.982   23.637  32.460  1.00 24.61 ? 115 LEU A CD1 1 
ATOM   932  C CD2 . LEU A 1 115 ? 3.920   22.175  31.838  1.00 18.16 ? 115 LEU A CD2 1 
ATOM   933  N N   . GLU A 1 116 ? 0.597   18.292  33.639  1.00 20.77 ? 116 GLU A N   1 
ATOM   934  C CA  . GLU A 1 116 ? 0.129   17.352  34.655  1.00 20.35 ? 116 GLU A CA  1 
ATOM   935  C C   . GLU A 1 116 ? 0.969   16.087  34.544  1.00 19.61 ? 116 GLU A C   1 
ATOM   936  O O   . GLU A 1 116 ? 1.423   15.535  35.554  1.00 20.64 ? 116 GLU A O   1 
ATOM   937  C CB  . GLU A 1 116 ? -1.344  16.996  34.447  1.00 19.14 ? 116 GLU A CB  1 
ATOM   938  C CG  . GLU A 1 116 ? -2.314  18.131  34.686  1.00 18.36 ? 116 GLU A CG  1 
ATOM   939  C CD  . GLU A 1 116 ? -2.275  18.650  36.111  1.00 20.64 ? 116 GLU A CD  1 
ATOM   940  O OE1 . GLU A 1 116 ? -2.150  17.835  37.050  1.00 25.84 ? 116 GLU A OE1 1 
ATOM   941  O OE2 . GLU A 1 116 ? -2.386  19.877  36.294  1.00 21.94 ? 116 GLU A OE2 1 
ATOM   942  N N   . LEU A 1 117 ? 1.177   15.637  33.306  1.00 18.42 ? 117 LEU A N   1 
ATOM   943  C CA  . LEU A 1 117 ? 1.963   14.436  33.057  1.00 17.63 ? 117 LEU A CA  1 
ATOM   944  C C   . LEU A 1 117 ? 3.381   14.644  33.561  1.00 15.40 ? 117 LEU A C   1 
ATOM   945  O O   . LEU A 1 117 ? 3.973   13.760  34.187  1.00 15.39 ? 117 LEU A O   1 
ATOM   946  C CB  . LEU A 1 117 ? 1.992   14.106  31.561  1.00 15.11 ? 117 LEU A CB  1 
ATOM   947  C CG  . LEU A 1 117 ? 2.881   12.900  31.235  1.00 17.86 ? 117 LEU A CG  1 
ATOM   948  C CD1 . LEU A 1 117 ? 2.405   11.687  32.024  1.00 17.31 ? 117 LEU A CD1 1 
ATOM   949  C CD2 . LEU A 1 117 ? 2.851   12.619  29.755  1.00 17.94 ? 117 LEU A CD2 1 
ATOM   950  N N   . LEU A 1 118 ? 3.923   15.823  33.291  1.00 15.05 ? 118 LEU A N   1 
ATOM   951  C CA  . LEU A 1 118 ? 5.278   16.138  33.725  1.00 19.58 ? 118 LEU A CA  1 
ATOM   952  C C   . LEU A 1 118 ? 5.393   16.021  35.245  1.00 20.22 ? 118 LEU A C   1 
ATOM   953  O O   . LEU A 1 118 ? 6.333   15.407  35.755  1.00 19.59 ? 118 LEU A O   1 
ATOM   954  C CB  . LEU A 1 118 ? 5.679   17.543  33.243  1.00 17.67 ? 118 LEU A CB  1 
ATOM   955  C CG  . LEU A 1 118 ? 7.093   18.046  33.588  1.00 22.44 ? 118 LEU A CG  1 
ATOM   956  C CD1 . LEU A 1 118 ? 8.144   16.947  33.402  1.00 19.61 ? 118 LEU A CD1 1 
ATOM   957  C CD2 . LEU A 1 118 ? 7.411   19.243  32.711  1.00 18.62 ? 118 LEU A CD2 1 
ATOM   958  N N   . GLU A 1 119 ? 4.419   16.588  35.960  1.00 21.46 ? 119 GLU A N   1 
ATOM   959  C CA  . GLU A 1 119 ? 4.407   16.533  37.421  1.00 19.57 ? 119 GLU A CA  1 
ATOM   960  C C   . GLU A 1 119 ? 4.371   15.093  37.914  1.00 20.70 ? 119 GLU A C   1 
ATOM   961  O O   . GLU A 1 119 ? 5.085   14.738  38.852  1.00 21.50 ? 119 GLU A O   1 
ATOM   962  C CB  . GLU A 1 119 ? 3.203   17.286  37.979  1.00 21.91 ? 119 GLU A CB  1 
ATOM   963  C CG  . GLU A 1 119 ? 3.564   18.399  38.950  1.00 28.63 ? 119 GLU A CG  1 
ATOM   964  C CD  . GLU A 1 119 ? 4.281   17.911  40.192  1.00 28.71 ? 119 GLU A CD  1 
ATOM   965  O OE1 . GLU A 1 119 ? 3.624   17.311  41.066  1.00 34.35 ? 119 GLU A OE1 1 
ATOM   966  O OE2 . GLU A 1 119 ? 5.506   18.127  40.291  1.00 29.33 ? 119 GLU A OE2 1 
ATOM   967  N N   . CYS A 1 120 ? 3.544   14.263  37.278  1.00 20.01 ? 120 CYS A N   1 
ATOM   968  C CA  . CYS A 1 120 ? 3.433   12.854  37.666  1.00 22.18 ? 120 CYS A CA  1 
ATOM   969  C C   . CYS A 1 120 ? 4.764   12.134  37.479  1.00 20.12 ? 120 CYS A C   1 
ATOM   970  O O   . CYS A 1 120 ? 5.145   11.297  38.289  1.00 19.73 ? 120 CYS A O   1 
ATOM   971  C CB  . CYS A 1 120 ? 2.349   12.140  36.838  1.00 21.71 ? 120 CYS A CB  1 
ATOM   972  S SG  . CYS A 1 120 ? 0.648   12.690  37.162  1.00 22.34 ? 120 CYS A SG  1 
ATOM   973  N N   . ILE A 1 121 ? 5.466   12.455  36.400  1.00 20.62 ? 121 ILE A N   1 
ATOM   974  C CA  . ILE A 1 121 ? 6.755   11.829  36.135  1.00 20.30 ? 121 ILE A CA  1 
ATOM   975  C C   . ILE A 1 121 ? 7.765   12.281  37.188  1.00 22.87 ? 121 ILE A C   1 
ATOM   976  O O   . ILE A 1 121 ? 8.611   11.498  37.631  1.00 23.60 ? 121 ILE A O   1 
ATOM   977  C CB  . ILE A 1 121 ? 7.255   12.182  34.712  1.00 16.76 ? 121 ILE A CB  1 
ATOM   978  C CG1 . ILE A 1 121 ? 6.353   11.499  33.681  1.00 15.01 ? 121 ILE A CG1 1 
ATOM   979  C CG2 . ILE A 1 121 ? 8.700   11.752  34.519  1.00 14.82 ? 121 ILE A CG2 1 
ATOM   980  C CD1 . ILE A 1 121 ? 6.650   11.887  32.246  1.00 15.49 ? 121 ILE A CD1 1 
ATOM   981  N N   . ARG A 1 122 ? 7.665   13.539  37.604  1.00 22.82 ? 122 ARG A N   1 
ATOM   982  C CA  . ARG A 1 122 ? 8.578   14.057  38.620  1.00 25.71 ? 122 ARG A CA  1 
ATOM   983  C C   . ARG A 1 122 ? 8.374   13.304  39.944  1.00 25.11 ? 122 ARG A C   1 
ATOM   984  O O   . ARG A 1 122 ? 9.342   12.979  40.635  1.00 23.27 ? 122 ARG A O   1 
ATOM   985  C CB  . ARG A 1 122 ? 8.353   15.560  38.837  1.00 22.17 ? 122 ARG A CB  1 
ATOM   986  C CG  . ARG A 1 122 ? 9.463   16.236  39.634  1.00 26.76 ? 122 ARG A CG  1 
ATOM   987  C CD  . ARG A 1 122 ? 9.109   17.673  40.006  1.00 24.94 ? 122 ARG A CD  1 
ATOM   988  N NE  . ARG A 1 122 ? 7.907   17.701  40.824  1.00 29.04 ? 122 ARG A NE  1 
ATOM   989  C CZ  . ARG A 1 122 ? 7.815   17.196  42.055  1.00 35.08 ? 122 ARG A CZ  1 
ATOM   990  N NH1 . ARG A 1 122 ? 8.872   16.622  42.630  1.00 31.55 ? 122 ARG A NH1 1 
ATOM   991  N NH2 . ARG A 1 122 ? 6.651   17.244  42.704  1.00 32.66 ? 122 ARG A NH2 1 
ATOM   992  N N   . ARG A 1 123 ? 7.114   13.028  40.283  1.00 23.65 ? 123 ARG A N   1 
ATOM   993  C CA  . ARG A 1 123 ? 6.777   12.318  41.517  1.00 22.67 ? 123 ARG A CA  1 
ATOM   994  C C   . ARG A 1 123 ? 7.320   10.915  41.428  1.00 23.35 ? 123 ARG A C   1 
ATOM   995  O O   . ARG A 1 123 ? 7.912   10.392  42.379  1.00 24.22 ? 123 ARG A O   1 
ATOM   996  C CB  . ARG A 1 123 ? 5.260   12.251  41.711  1.00 24.63 ? 123 ARG A CB  1 
ATOM   997  C CG  . ARG A 1 123 ? 4.573   13.613  41.757  1.00 27.93 ? 123 ARG A CG  1 
ATOM   998  C CD  . ARG A 1 123 ? 4.887   14.387  43.039  1.00 32.52 ? 123 ARG A CD  1 
ATOM   999  N NE  . ARG A 1 123 ? 3.988   14.041  44.140  1.00 37.14 ? 123 ARG A NE  1 
ATOM   1000 C CZ  . ARG A 1 123 ? 4.054   12.918  44.852  1.00 40.98 ? 123 ARG A CZ  1 
ATOM   1001 N NH1 . ARG A 1 123 ? 4.992   12.014  44.590  1.00 45.43 ? 123 ARG A NH1 1 
ATOM   1002 N NH2 . ARG A 1 123 ? 3.167   12.688  45.818  1.00 39.35 ? 123 ARG A NH2 1 
ATOM   1003 N N   . LEU A 1 124 ? 7.094   10.301  40.277  1.00 19.80 ? 124 LEU A N   1 
ATOM   1004 C CA  . LEU A 1 124 ? 7.575   8.958   40.064  1.00 22.05 ? 124 LEU A CA  1 
ATOM   1005 C C   . LEU A 1 124 ? 9.064   8.934   40.361  1.00 20.07 ? 124 LEU A C   1 
ATOM   1006 O O   . LEU A 1 124 ? 9.523   8.154   41.186  1.00 25.80 ? 124 LEU A O   1 
ATOM   1007 C CB  . LEU A 1 124 ? 7.327   8.526   38.618  1.00 21.22 ? 124 LEU A CB  1 
ATOM   1008 C CG  . LEU A 1 124 ? 7.903   7.157   38.283  1.00 18.52 ? 124 LEU A CG  1 
ATOM   1009 C CD1 . LEU A 1 124 ? 7.345   6.133   39.264  1.00 22.38 ? 124 LEU A CD1 1 
ATOM   1010 C CD2 . LEU A 1 124 ? 7.556   6.785   36.852  1.00 23.24 ? 124 LEU A CD2 1 
ATOM   1011 N N   . ILE A 1 125 ? 9.807   9.805   39.690  1.00 20.71 ? 125 ILE A N   1 
ATOM   1012 C CA  . ILE A 1 125 ? 11.254  9.886   39.849  1.00 20.58 ? 125 ILE A CA  1 
ATOM   1013 C C   . ILE A 1 125 ? 11.646  10.174  41.287  1.00 21.59 ? 125 ILE A C   1 
ATOM   1014 O O   . ILE A 1 125 ? 12.562  9.550   41.831  1.00 21.09 ? 125 ILE A O   1 
ATOM   1015 C CB  . ILE A 1 125 ? 11.842  10.967  38.907  1.00 21.51 ? 125 ILE A CB  1 
ATOM   1016 C CG1 . ILE A 1 125 ? 11.701  10.499  37.452  1.00 15.93 ? 125 ILE A CG1 1 
ATOM   1017 C CG2 . ILE A 1 125 ? 13.297  11.236  39.248  1.00 20.69 ? 125 ILE A CG2 1 
ATOM   1018 C CD1 . ILE A 1 125 ? 11.993  11.570  36.423  1.00 23.98 ? 125 ILE A CD1 1 
ATOM   1019 N N   . GLU A 1 126 ? 10.949  11.115  41.906  1.00 20.56 ? 126 GLU A N   1 
ATOM   1020 C CA  . GLU A 1 126 ? 11.226  11.455  43.287  1.00 24.01 ? 126 GLU A CA  1 
ATOM   1021 C C   . GLU A 1 126 ? 11.150  10.200  44.137  1.00 24.64 ? 126 GLU A C   1 
ATOM   1022 O O   . GLU A 1 126 ? 12.020  9.942   44.967  1.00 28.13 ? 126 GLU A O   1 
ATOM   1023 C CB  . GLU A 1 126 ? 10.207  12.454  43.799  1.00 25.32 ? 126 GLU A CB  1 
ATOM   1024 C CG  . GLU A 1 126 ? 10.511  12.949  45.188  1.00 28.78 ? 126 GLU A CG  1 
ATOM   1025 C CD  . GLU A 1 126 ? 9.377   13.763  45.733  1.00 33.53 ? 126 GLU A CD  1 
ATOM   1026 O OE1 . GLU A 1 126 ? 8.352   13.155  46.111  1.00 37.60 ? 126 GLU A OE1 1 
ATOM   1027 O OE2 . GLU A 1 126 ? 9.504   15.005  45.766  1.00 35.28 ? 126 GLU A OE2 1 
ATOM   1028 N N   . VAL A 1 127 ? 10.089  9.431   43.933  1.00 25.07 ? 127 VAL A N   1 
ATOM   1029 C CA  . VAL A 1 127 ? 9.894   8.195   44.667  1.00 25.29 ? 127 VAL A CA  1 
ATOM   1030 C C   . VAL A 1 127 ? 11.094  7.259   44.493  1.00 26.16 ? 127 VAL A C   1 
ATOM   1031 O O   . VAL A 1 127 ? 11.569  6.677   45.462  1.00 26.36 ? 127 VAL A O   1 
ATOM   1032 C CB  . VAL A 1 127 ? 8.610   7.495   44.188  1.00 27.09 ? 127 VAL A CB  1 
ATOM   1033 C CG1 . VAL A 1 127 ? 8.562   6.066   44.713  1.00 25.43 ? 127 VAL A CG1 1 
ATOM   1034 C CG2 . VAL A 1 127 ? 7.402   8.291   44.651  1.00 24.38 ? 127 VAL A CG2 1 
ATOM   1035 N N   . ASP A 1 128 ? 11.587  7.127   43.261  1.00 23.70 ? 128 ASP A N   1 
ATOM   1036 C CA  . ASP A 1 128 ? 12.730  6.263   42.992  1.00 21.72 ? 128 ASP A CA  1 
ATOM   1037 C C   . ASP A 1 128 ? 14.057  7.037   42.899  1.00 22.64 ? 128 ASP A C   1 
ATOM   1038 O O   . ASP A 1 128 ? 15.039  6.518   42.370  1.00 22.85 ? 128 ASP A O   1 
ATOM   1039 C CB  . ASP A 1 128 ? 12.505  5.468   41.702  1.00 23.08 ? 128 ASP A CB  1 
ATOM   1040 C CG  . ASP A 1 128 ? 11.462  4.357   41.858  1.00 30.39 ? 128 ASP A CG  1 
ATOM   1041 O OD1 . ASP A 1 128 ? 11.010  4.094   42.998  1.00 34.02 ? 128 ASP A OD1 1 
ATOM   1042 O OD2 . ASP A 1 128 ? 11.101  3.732   40.828  1.00 28.75 ? 128 ASP A OD2 1 
ATOM   1043 N N   . LYS A 1 129 ? 14.093  8.261   43.429  1.00 24.58 ? 129 LYS A N   1 
ATOM   1044 C CA  . LYS A 1 129 ? 15.301  9.099   43.379  1.00 29.80 ? 129 LYS A CA  1 
ATOM   1045 C C   . LYS A 1 129 ? 16.637  8.388   43.629  1.00 29.63 ? 129 LYS A C   1 
ATOM   1046 O O   . LYS A 1 129 ? 17.625  8.666   42.947  1.00 29.34 ? 129 LYS A O   1 
ATOM   1047 C CB  . LYS A 1 129 ? 15.185  10.273  44.356  1.00 33.90 ? 129 LYS A CB  1 
ATOM   1048 C CG  . LYS A 1 129 ? 16.461  11.129  44.370  1.00 45.59 ? 129 LYS A CG  1 
ATOM   1049 C CD  . LYS A 1 129 ? 16.407  12.398  45.232  1.00 47.97 ? 129 LYS A CD  1 
ATOM   1050 C CE  . LYS A 1 129 ? 17.764  13.117  45.124  1.00 51.40 ? 129 LYS A CE  1 
ATOM   1051 N NZ  . LYS A 1 129 ? 17.893  14.373  45.920  1.00 50.73 ? 129 LYS A NZ  1 
ATOM   1052 N N   . ASP A 1 130 ? 16.663  7.493   44.612  1.00 27.72 ? 130 ASP A N   1 
ATOM   1053 C CA  . ASP A 1 130 ? 17.869  6.749   44.958  1.00 27.87 ? 130 ASP A CA  1 
ATOM   1054 C C   . ASP A 1 130 ? 18.330  5.824   43.850  1.00 28.95 ? 130 ASP A C   1 
ATOM   1055 O O   . ASP A 1 130 ? 19.416  5.253   43.937  1.00 30.14 ? 130 ASP A O   1 
ATOM   1056 C CB  . ASP A 1 130 ? 17.651  5.918   46.235  1.00 32.68 ? 130 ASP A CB  1 
ATOM   1057 C CG  . ASP A 1 130 ? 17.599  6.772   47.502  1.00 35.90 ? 130 ASP A CG  1 
ATOM   1058 O OD1 . ASP A 1 130 ? 17.059  6.287   48.521  1.00 39.32 ? 130 ASP A OD1 1 
ATOM   1059 O OD2 . ASP A 1 130 ? 18.102  7.915   47.487  1.00 36.99 ? 130 ASP A OD2 1 
ATOM   1060 N N   . TRP A 1 131 ? 17.511  5.645   42.818  1.00 28.87 ? 131 TRP A N   1 
ATOM   1061 C CA  . TRP A 1 131 ? 17.907  4.773   41.713  1.00 26.81 ? 131 TRP A CA  1 
ATOM   1062 C C   . TRP A 1 131 ? 18.783  5.508   40.699  1.00 26.85 ? 131 TRP A C   1 
ATOM   1063 O O   . TRP A 1 131 ? 19.456  4.867   39.883  1.00 24.96 ? 131 TRP A O   1 
ATOM   1064 C CB  . TRP A 1 131 ? 16.690  4.193   40.984  1.00 25.71 ? 131 TRP A CB  1 
ATOM   1065 C CG  . TRP A 1 131 ? 16.076  2.975   41.619  1.00 25.30 ? 131 TRP A CG  1 
ATOM   1066 C CD1 . TRP A 1 131 ? 15.092  2.955   42.567  1.00 21.91 ? 131 TRP A CD1 1 
ATOM   1067 C CD2 . TRP A 1 131 ? 16.357  1.601   41.304  1.00 22.17 ? 131 TRP A CD2 1 
ATOM   1068 N NE1 . TRP A 1 131 ? 14.738  1.665   42.852  1.00 22.85 ? 131 TRP A NE1 1 
ATOM   1069 C CE2 . TRP A 1 131 ? 15.496  0.810   42.094  1.00 21.37 ? 131 TRP A CE2 1 
ATOM   1070 C CE3 . TRP A 1 131 ? 17.251  0.961   40.430  1.00 29.31 ? 131 TRP A CE3 1 
ATOM   1071 C CZ2 . TRP A 1 131 ? 15.497  -0.600  42.038  1.00 22.69 ? 131 TRP A CZ2 1 
ATOM   1072 C CZ3 . TRP A 1 131 ? 17.253  -0.458  40.372  1.00 25.47 ? 131 TRP A CZ3 1 
ATOM   1073 C CH2 . TRP A 1 131 ? 16.379  -1.212  41.173  1.00 22.27 ? 131 TRP A CH2 1 
ATOM   1074 N N   . VAL A 1 132 ? 18.768  6.841   40.741  1.00 24.14 ? 132 VAL A N   1 
ATOM   1075 C CA  . VAL A 1 132 ? 19.583  7.636   39.815  1.00 24.75 ? 132 VAL A CA  1 
ATOM   1076 C C   . VAL A 1 132 ? 21.067  7.507   40.171  1.00 24.90 ? 132 VAL A C   1 
ATOM   1077 O O   . VAL A 1 132 ? 21.461  7.731   41.312  1.00 25.49 ? 132 VAL A O   1 
ATOM   1078 C CB  . VAL A 1 132 ? 19.192  9.143   39.849  1.00 25.23 ? 132 VAL A CB  1 
ATOM   1079 C CG1 . VAL A 1 132 ? 19.920  9.904   38.724  1.00 19.05 ? 132 VAL A CG1 1 
ATOM   1080 C CG2 . VAL A 1 132 ? 17.673  9.296   39.720  1.00 20.00 ? 132 VAL A CG2 1 
ATOM   1081 N N   . PRO A 1 133 ? 21.906  7.132   39.193  1.00 26.48 ? 133 PRO A N   1 
ATOM   1082 C CA  . PRO A 1 133 ? 23.349  6.972   39.406  1.00 31.03 ? 133 PRO A CA  1 
ATOM   1083 C C   . PRO A 1 133 ? 24.075  8.317   39.510  1.00 32.45 ? 133 PRO A C   1 
ATOM   1084 O O   . PRO A 1 133 ? 23.621  9.323   38.957  1.00 34.14 ? 133 PRO A O   1 
ATOM   1085 C CB  . PRO A 1 133 ? 23.806  6.192   38.165  1.00 29.19 ? 133 PRO A CB  1 
ATOM   1086 C CG  . PRO A 1 133 ? 22.554  5.587   37.625  1.00 28.63 ? 133 PRO A CG  1 
ATOM   1087 C CD  . PRO A 1 133 ? 21.546  6.682   37.842  1.00 29.26 ? 133 PRO A CD  1 
ATOM   1088 N N   . ASP A 1 134 ? 25.204  8.329   40.209  1.00 34.91 ? 134 ASP A N   1 
ATOM   1089 C CA  . ASP A 1 134 ? 25.985  9.554   40.346  1.00 41.53 ? 134 ASP A CA  1 
ATOM   1090 C C   . ASP A 1 134 ? 27.452  9.337   39.969  1.00 41.36 ? 134 ASP A C   1 
ATOM   1091 O O   . ASP A 1 134 ? 28.342  10.013  40.485  1.00 42.62 ? 134 ASP A O   1 
ATOM   1092 C CB  . ASP A 1 134 ? 25.884  10.099  41.771  1.00 41.92 ? 134 ASP A CB  1 
ATOM   1093 C CG  . ASP A 1 134 ? 26.433  9.140   42.799  1.00 46.74 ? 134 ASP A CG  1 
ATOM   1094 O OD1 . ASP A 1 134 ? 26.243  9.408   44.004  1.00 52.21 ? 134 ASP A OD1 1 
ATOM   1095 O OD2 . ASP A 1 134 ? 27.052  8.125   42.405  1.00 45.68 ? 134 ASP A OD2 1 
ATOM   1096 N N   . ALA A 1 135 ? 27.698  8.388   39.070  1.00 40.38 ? 135 ALA A N   1 
ATOM   1097 C CA  . ALA A 1 135 ? 29.057  8.116   38.621  1.00 40.86 ? 135 ALA A CA  1 
ATOM   1098 C C   . ALA A 1 135 ? 29.454  9.235   37.673  1.00 41.46 ? 135 ALA A C   1 
ATOM   1099 O O   . ALA A 1 135 ? 29.338  10.419  38.002  1.00 42.33 ? 135 ALA A O   1 
ATOM   1100 C CB  . ALA A 1 135 ? 29.129  6.767   37.903  1.00 37.05 ? 135 ALA A CB  1 
ATOM   1101 N N   . ALA A 1 136 ? 29.927  8.861   36.495  1.00 39.44 ? 136 ALA A N   1 
ATOM   1102 C CA  . ALA A 1 136 ? 30.330  9.848   35.503  1.00 39.69 ? 136 ALA A CA  1 
ATOM   1103 C C   . ALA A 1 136 ? 29.710  9.435   34.173  1.00 37.94 ? 136 ALA A C   1 
ATOM   1104 O O   . ALA A 1 136 ? 29.990  8.355   33.657  1.00 37.96 ? 136 ALA A O   1 
ATOM   1105 C CB  . ALA A 1 136 ? 31.858  9.898   35.393  1.00 35.90 ? 136 ALA A CB  1 
ATOM   1106 N N   . GLY A 1 137 ? 28.858  10.290  33.627  1.00 36.55 ? 137 GLY A N   1 
ATOM   1107 C CA  . GLY A 1 137 ? 28.217  9.960   32.370  1.00 32.99 ? 137 GLY A CA  1 
ATOM   1108 C C   . GLY A 1 137 ? 26.991  9.081   32.557  1.00 32.39 ? 137 GLY A C   1 
ATOM   1109 O O   . GLY A 1 137 ? 26.343  8.719   31.574  1.00 34.25 ? 137 GLY A O   1 
ATOM   1110 N N   . THR A 1 138 ? 26.666  8.730   33.802  1.00 30.50 ? 138 THR A N   1 
ATOM   1111 C CA  . THR A 1 138 ? 25.495  7.890   34.067  1.00 26.84 ? 138 THR A CA  1 
ATOM   1112 C C   . THR A 1 138 ? 24.260  8.762   34.231  1.00 25.55 ? 138 THR A C   1 
ATOM   1113 O O   . THR A 1 138 ? 24.371  9.973   34.429  1.00 22.00 ? 138 THR A O   1 
ATOM   1114 C CB  . THR A 1 138 ? 25.657  7.045   35.352  1.00 24.70 ? 138 THR A CB  1 
ATOM   1115 O OG1 . THR A 1 138 ? 25.857  7.915   36.473  1.00 23.82 ? 138 THR A OG1 1 
ATOM   1116 C CG2 . THR A 1 138 ? 26.833  6.092   35.222  1.00 19.41 ? 138 THR A CG2 1 
ATOM   1117 N N   . SER A 1 139 ? 23.085  8.140   34.166  1.00 26.19 ? 139 SER A N   1 
ATOM   1118 C CA  . SER A 1 139 ? 21.825  8.870   34.294  1.00 24.91 ? 139 SER A CA  1 
ATOM   1119 C C   . SER A 1 139 ? 20.648  7.913   34.395  1.00 26.10 ? 139 SER A C   1 
ATOM   1120 O O   . SER A 1 139 ? 20.816  6.690   34.382  1.00 27.92 ? 139 SER A O   1 
ATOM   1121 C CB  . SER A 1 139 ? 21.620  9.769   33.075  1.00 27.86 ? 139 SER A CB  1 
ATOM   1122 O OG  . SER A 1 139 ? 21.602  8.999   31.883  1.00 25.43 ? 139 SER A OG  1 
ATOM   1123 N N   . LEU A 1 140 ? 19.452  8.483   34.489  1.00 23.17 ? 140 LEU A N   1 
ATOM   1124 C CA  . LEU A 1 140 ? 18.229  7.694   34.569  1.00 21.24 ? 140 LEU A CA  1 
ATOM   1125 C C   . LEU A 1 140 ? 17.455  7.882   33.266  1.00 20.72 ? 140 LEU A C   1 
ATOM   1126 O O   . LEU A 1 140 ? 17.160  9.010   32.869  1.00 23.00 ? 140 LEU A O   1 
ATOM   1127 C CB  . LEU A 1 140 ? 17.358  8.156   35.744  1.00 18.12 ? 140 LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 140 ? 16.054  7.369   35.953  1.00 17.15 ? 140 LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 140 ? 16.362  5.993   36.545  1.00 17.13 ? 140 LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 140 ? 15.124  8.144   36.863  1.00 11.27 ? 140 LEU A CD2 1 
ATOM   1131 N N   . TYR A 1 141 ? 17.135  6.784   32.593  1.00 18.15 ? 141 TYR A N   1 
ATOM   1132 C CA  . TYR A 1 141 ? 16.388  6.882   31.350  1.00 17.16 ? 141 TYR A CA  1 
ATOM   1133 C C   . TYR A 1 141 ? 14.909  6.774   31.685  1.00 18.82 ? 141 TYR A C   1 
ATOM   1134 O O   . TYR A 1 141 ? 14.487  5.827   32.365  1.00 17.90 ? 141 TYR A O   1 
ATOM   1135 C CB  . TYR A 1 141 ? 16.784  5.752   30.404  1.00 18.70 ? 141 TYR A CB  1 
ATOM   1136 C CG  . TYR A 1 141 ? 16.157  5.863   29.040  1.00 14.55 ? 141 TYR A CG  1 
ATOM   1137 C CD1 . TYR A 1 141 ? 16.591  6.826   28.133  1.00 12.23 ? 141 TYR A CD1 1 
ATOM   1138 C CD2 . TYR A 1 141 ? 15.132  5.000   28.650  1.00 14.74 ? 141 TYR A CD2 1 
ATOM   1139 C CE1 . TYR A 1 141 ? 16.021  6.928   26.871  1.00 13.50 ? 141 TYR A CE1 1 
ATOM   1140 C CE2 . TYR A 1 141 ? 14.557  5.091   27.391  1.00 13.92 ? 141 TYR A CE2 1 
ATOM   1141 C CZ  . TYR A 1 141 ? 15.006  6.056   26.504  1.00 13.68 ? 141 TYR A CZ  1 
ATOM   1142 O OH  . TYR A 1 141 ? 14.434  6.152   25.263  1.00 13.19 ? 141 TYR A OH  1 
ATOM   1143 N N   . VAL A 1 142 ? 14.126  7.745   31.222  1.00 16.94 ? 142 VAL A N   1 
ATOM   1144 C CA  . VAL A 1 142 ? 12.692  7.754   31.488  1.00 18.46 ? 142 VAL A CA  1 
ATOM   1145 C C   . VAL A 1 142 ? 11.942  7.329   30.245  1.00 18.82 ? 142 VAL A C   1 
ATOM   1146 O O   . VAL A 1 142 ? 12.112  7.921   29.180  1.00 19.91 ? 142 VAL A O   1 
ATOM   1147 C CB  . VAL A 1 142 ? 12.213  9.156   31.914  1.00 20.63 ? 142 VAL A CB  1 
ATOM   1148 C CG1 . VAL A 1 142 ? 10.737  9.117   32.302  1.00 20.20 ? 142 VAL A CG1 1 
ATOM   1149 C CG2 . VAL A 1 142 ? 13.049  9.650   33.081  1.00 20.70 ? 142 VAL A CG2 1 
ATOM   1150 N N   . ARG A 1 143 ? 11.102  6.308   30.379  1.00 18.49 ? 143 ARG A N   1 
ATOM   1151 C CA  . ARG A 1 143 ? 10.359  5.804   29.237  1.00 16.49 ? 143 ARG A CA  1 
ATOM   1152 C C   . ARG A 1 143 ? 8.827   5.834   29.324  1.00 15.45 ? 143 ARG A C   1 
ATOM   1153 O O   . ARG A 1 143 ? 8.207   4.898   29.824  1.00 16.33 ? 143 ARG A O   1 
ATOM   1154 C CB  . ARG A 1 143 ? 10.806  4.377   28.946  1.00 18.08 ? 143 ARG A CB  1 
ATOM   1155 C CG  . ARG A 1 143 ? 10.144  3.770   27.739  1.00 17.89 ? 143 ARG A CG  1 
ATOM   1156 C CD  . ARG A 1 143 ? 10.582  4.492   26.478  1.00 16.88 ? 143 ARG A CD  1 
ATOM   1157 N NE  . ARG A 1 143 ? 10.650  3.532   25.397  1.00 20.15 ? 143 ARG A NE  1 
ATOM   1158 C CZ  . ARG A 1 143 ? 11.683  3.388   24.585  1.00 19.47 ? 143 ARG A CZ  1 
ATOM   1159 N NH1 . ARG A 1 143 ? 12.760  4.154   24.712  1.00 17.12 ? 143 ARG A NH1 1 
ATOM   1160 N NH2 . ARG A 1 143 ? 11.638  2.448   23.658  1.00 25.09 ? 143 ARG A NH2 1 
ATOM   1161 N N   . PRO A 1 144 ? 8.197   6.912   28.830  1.00 15.77 ? 144 PRO A N   1 
ATOM   1162 C CA  . PRO A 1 144 ? 6.734   7.009   28.863  1.00 15.52 ? 144 PRO A CA  1 
ATOM   1163 C C   . PRO A 1 144 ? 6.190   6.225   27.664  1.00 17.22 ? 144 PRO A C   1 
ATOM   1164 O O   . PRO A 1 144 ? 6.831   6.178   26.609  1.00 16.15 ? 144 PRO A O   1 
ATOM   1165 C CB  . PRO A 1 144 ? 6.471   8.514   28.703  1.00 15.54 ? 144 PRO A CB  1 
ATOM   1166 C CG  . PRO A 1 144 ? 7.792   9.169   29.033  1.00 13.96 ? 144 PRO A CG  1 
ATOM   1167 C CD  . PRO A 1 144 ? 8.785   8.203   28.444  1.00 15.62 ? 144 PRO A CD  1 
ATOM   1168 N N   . VAL A 1 145 ? 5.025   5.606   27.818  1.00 17.23 ? 145 VAL A N   1 
ATOM   1169 C CA  . VAL A 1 145 ? 4.429   4.860   26.720  1.00 17.34 ? 145 VAL A CA  1 
ATOM   1170 C C   . VAL A 1 145 ? 2.922   5.068   26.724  1.00 18.33 ? 145 VAL A C   1 
ATOM   1171 O O   . VAL A 1 145 ? 2.308   5.174   27.784  1.00 19.85 ? 145 VAL A O   1 
ATOM   1172 C CB  . VAL A 1 145 ? 4.721   3.338   26.837  1.00 18.76 ? 145 VAL A CB  1 
ATOM   1173 C CG1 . VAL A 1 145 ? 4.036   2.572   25.720  1.00 13.02 ? 145 VAL A CG1 1 
ATOM   1174 C CG2 . VAL A 1 145 ? 6.207   3.092   26.773  1.00 20.67 ? 145 VAL A CG2 1 
ATOM   1175 N N   . LEU A 1 146 ? 2.329   5.155   25.540  1.00 18.07 ? 146 LEU A N   1 
ATOM   1176 C CA  . LEU A 1 146 ? 0.883   5.308   25.443  1.00 17.00 ? 146 LEU A CA  1 
ATOM   1177 C C   . LEU A 1 146 ? 0.422   4.327   24.388  1.00 14.40 ? 146 LEU A C   1 
ATOM   1178 O O   . LEU A 1 146 ? 0.908   4.355   23.259  1.00 12.29 ? 146 LEU A O   1 
ATOM   1179 C CB  . LEU A 1 146 ? 0.489   6.740   25.057  1.00 18.42 ? 146 LEU A CB  1 
ATOM   1180 C CG  . LEU A 1 146 ? -1.021  7.025   24.958  1.00 19.74 ? 146 LEU A CG  1 
ATOM   1181 C CD1 . LEU A 1 146 ? -1.721  6.619   26.245  1.00 19.66 ? 146 LEU A CD1 1 
ATOM   1182 C CD2 . LEU A 1 146 ? -1.251  8.501   24.684  1.00 19.41 ? 146 LEU A CD2 1 
ATOM   1183 N N   . ILE A 1 147 ? -0.506  3.450   24.766  1.00 15.38 ? 147 ILE A N   1 
ATOM   1184 C CA  . ILE A 1 147 ? -1.018  2.433   23.848  1.00 15.82 ? 147 ILE A CA  1 
ATOM   1185 C C   . ILE A 1 147 ? -2.531  2.360   23.820  1.00 17.22 ? 147 ILE A C   1 
ATOM   1186 O O   . ILE A 1 147 ? -3.199  2.648   24.818  1.00 13.81 ? 147 ILE A O   1 
ATOM   1187 C CB  . ILE A 1 147 ? -0.533  1.015   24.224  1.00 12.69 ? 147 ILE A CB  1 
ATOM   1188 C CG1 . ILE A 1 147 ? -1.003  0.679   25.641  1.00 16.85 ? 147 ILE A CG1 1 
ATOM   1189 C CG2 . ILE A 1 147 ? 0.968   0.921   24.115  1.00 11.24 ? 147 ILE A CG2 1 
ATOM   1190 C CD1 . ILE A 1 147 ? -0.789  -0.783  26.029  1.00 18.01 ? 147 ILE A CD1 1 
ATOM   1191 N N   . GLY A 1 148 ? -3.055  1.971   22.660  1.00 15.87 ? 148 GLY A N   1 
ATOM   1192 C CA  . GLY A 1 148 ? -4.482  1.804   22.512  1.00 15.62 ? 148 GLY A CA  1 
ATOM   1193 C C   . GLY A 1 148 ? -4.729  0.475   23.188  1.00 16.35 ? 148 GLY A C   1 
ATOM   1194 O O   . GLY A 1 148 ? -3.847  -0.384  23.194  1.00 15.49 ? 148 GLY A O   1 
ATOM   1195 N N   . ASN A 1 149 ? -5.911  0.287   23.757  1.00 16.41 ? 149 ASN A N   1 
ATOM   1196 C CA  . ASN A 1 149 ? -6.184  -0.956  24.450  1.00 19.30 ? 149 ASN A CA  1 
ATOM   1197 C C   . ASN A 1 149 ? -7.625  -1.408  24.317  1.00 21.11 ? 149 ASN A C   1 
ATOM   1198 O O   . ASN A 1 149 ? -8.233  -1.836  25.295  1.00 20.67 ? 149 ASN A O   1 
ATOM   1199 C CB  . ASN A 1 149 ? -5.816  -0.803  25.932  1.00 18.67 ? 149 ASN A CB  1 
ATOM   1200 C CG  . ASN A 1 149 ? -5.778  -2.126  26.660  1.00 21.41 ? 149 ASN A CG  1 
ATOM   1201 O OD1 . ASN A 1 149 ? -5.418  -3.146  26.078  1.00 25.59 ? 149 ASN A OD1 1 
ATOM   1202 N ND2 . ASN A 1 149 ? -6.133  -2.118  27.939  1.00 17.87 ? 149 ASN A ND2 1 
ATOM   1203 N N   . GLU A 1 150 ? -8.192  -1.298  23.121  1.00 21.84 ? 150 GLU A N   1 
ATOM   1204 C CA  . GLU A 1 150 ? -9.554  -1.763  22.964  1.00 22.83 ? 150 GLU A CA  1 
ATOM   1205 C C   . GLU A 1 150 ? -9.510  -3.214  22.519  1.00 21.75 ? 150 GLU A C   1 
ATOM   1206 O O   . GLU A 1 150 ? -8.756  -3.587  21.621  1.00 23.75 ? 150 GLU A O   1 
ATOM   1207 C CB  . GLU A 1 150 ? -10.353 -0.935  21.963  1.00 25.67 ? 150 GLU A CB  1 
ATOM   1208 C CG  . GLU A 1 150 ? -11.824 -1.270  22.095  1.00 30.49 ? 150 GLU A CG  1 
ATOM   1209 C CD  . GLU A 1 150 ? -12.723 -0.456  21.212  1.00 37.23 ? 150 GLU A CD  1 
ATOM   1210 O OE1 . GLU A 1 150 ? -13.937 -0.766  21.189  1.00 40.70 ? 150 GLU A OE1 1 
ATOM   1211 O OE2 . GLU A 1 150 ? -12.233 0.484   20.544  1.00 44.63 ? 150 GLU A OE2 1 
ATOM   1212 N N   . PRO A 1 151 ? -10.306 -4.062  23.171  1.00 23.31 ? 151 PRO A N   1 
ATOM   1213 C CA  . PRO A 1 151 ? -10.378 -5.496  22.870  1.00 22.43 ? 151 PRO A CA  1 
ATOM   1214 C C   . PRO A 1 151 ? -11.284 -5.767  21.683  1.00 20.19 ? 151 PRO A C   1 
ATOM   1215 O O   . PRO A 1 151 ? -12.335 -6.371  21.823  1.00 20.85 ? 151 PRO A O   1 
ATOM   1216 C CB  . PRO A 1 151 ? -10.920 -6.077  24.166  1.00 22.63 ? 151 PRO A CB  1 
ATOM   1217 C CG  . PRO A 1 151 ? -11.886 -5.015  24.606  1.00 20.87 ? 151 PRO A CG  1 
ATOM   1218 C CD  . PRO A 1 151 ? -11.117 -3.728  24.358  1.00 23.79 ? 151 PRO A CD  1 
ATOM   1219 N N   . SER A 1 152 ? -10.856 -5.303  20.516  1.00 20.72 ? 152 SER A N   1 
ATOM   1220 C CA  . SER A 1 152 ? -11.613 -5.443  19.284  1.00 19.12 ? 152 SER A CA  1 
ATOM   1221 C C   . SER A 1 152 ? -10.640 -5.574  18.123  1.00 18.19 ? 152 SER A C   1 
ATOM   1222 O O   . SER A 1 152 ? -9.588  -4.946  18.131  1.00 20.06 ? 152 SER A O   1 
ATOM   1223 C CB  . SER A 1 152 ? -12.485 -4.199  19.085  1.00 20.16 ? 152 SER A CB  1 
ATOM   1224 O OG  . SER A 1 152 ? -12.782 -3.990  17.715  1.00 24.41 ? 152 SER A OG  1 
ATOM   1225 N N   . LEU A 1 153 ? -10.990 -6.388  17.133  1.00 18.40 ? 153 LEU A N   1 
ATOM   1226 C CA  . LEU A 1 153 ? -10.135 -6.583  15.966  1.00 19.26 ? 153 LEU A CA  1 
ATOM   1227 C C   . LEU A 1 153 ? -10.483 -5.604  14.848  1.00 21.79 ? 153 LEU A C   1 
ATOM   1228 O O   . LEU A 1 153 ? -9.922  -5.656  13.752  1.00 20.28 ? 153 LEU A O   1 
ATOM   1229 C CB  . LEU A 1 153 ? -10.261 -8.008  15.450  1.00 15.95 ? 153 LEU A CB  1 
ATOM   1230 C CG  . LEU A 1 153 ? -9.845  -9.087  16.441  1.00 15.81 ? 153 LEU A CG  1 
ATOM   1231 C CD1 . LEU A 1 153 ? -9.936  -10.442 15.768  1.00 18.22 ? 153 LEU A CD1 1 
ATOM   1232 C CD2 . LEU A 1 153 ? -8.435  -8.830  16.915  1.00 16.59 ? 153 LEU A CD2 1 
ATOM   1233 N N   . GLY A 1 154 ? -11.422 -4.711  15.124  1.00 21.59 ? 154 GLY A N   1 
ATOM   1234 C CA  . GLY A 1 154 ? -11.783 -3.732  14.125  1.00 22.76 ? 154 GLY A CA  1 
ATOM   1235 C C   . GLY A 1 154 ? -10.687 -2.686  14.121  1.00 24.11 ? 154 GLY A C   1 
ATOM   1236 O O   . GLY A 1 154 ? -10.162 -2.326  15.177  1.00 21.74 ? 154 GLY A O   1 
ATOM   1237 N N   . VAL A 1 155 ? -10.319 -2.225  12.931  1.00 23.97 ? 155 VAL A N   1 
ATOM   1238 C CA  . VAL A 1 155 ? -9.290  -1.207  12.783  1.00 22.09 ? 155 VAL A CA  1 
ATOM   1239 C C   . VAL A 1 155 ? -9.985  0.122   12.981  1.00 24.12 ? 155 VAL A C   1 
ATOM   1240 O O   . VAL A 1 155 ? -10.539 0.681   12.037  1.00 25.09 ? 155 VAL A O   1 
ATOM   1241 C CB  . VAL A 1 155 ? -8.674  -1.244  11.374  1.00 19.18 ? 155 VAL A CB  1 
ATOM   1242 C CG1 . VAL A 1 155 ? -7.711  -0.103  11.200  1.00 20.93 ? 155 VAL A CG1 1 
ATOM   1243 C CG2 . VAL A 1 155 ? -7.956  -2.567  11.156  1.00 23.51 ? 155 VAL A CG2 1 
ATOM   1244 N N   . SER A 1 156 ? -9.958  0.629   14.208  1.00 25.81 ? 156 SER A N   1 
ATOM   1245 C CA  . SER A 1 156 ? -10.625 1.889   14.506  1.00 27.16 ? 156 SER A CA  1 
ATOM   1246 C C   . SER A 1 156 ? -10.055 2.609   15.726  1.00 26.90 ? 156 SER A C   1 
ATOM   1247 O O   . SER A 1 156 ? -9.162  2.098   16.405  1.00 25.70 ? 156 SER A O   1 
ATOM   1248 C CB  . SER A 1 156 ? -12.114 1.631   14.723  1.00 27.74 ? 156 SER A CB  1 
ATOM   1249 O OG  . SER A 1 156 ? -12.297 0.753   15.821  1.00 27.81 ? 156 SER A OG  1 
ATOM   1250 N N   . GLN A 1 157 ? -10.587 3.800   15.993  1.00 26.93 ? 157 GLN A N   1 
ATOM   1251 C CA  . GLN A 1 157 ? -10.153 4.600   17.126  1.00 27.52 ? 157 GLN A CA  1 
ATOM   1252 C C   . GLN A 1 157 ? -10.427 3.838   18.414  1.00 25.74 ? 157 GLN A C   1 
ATOM   1253 O O   . GLN A 1 157 ? -11.516 3.305   18.619  1.00 28.30 ? 157 GLN A O   1 
ATOM   1254 C CB  . GLN A 1 157 ? -10.884 5.939   17.129  1.00 30.43 ? 157 GLN A CB  1 
ATOM   1255 C CG  . GLN A 1 157 ? -10.510 6.840   18.292  1.00 40.61 ? 157 GLN A CG  1 
ATOM   1256 C CD  . GLN A 1 157 ? -10.910 8.287   18.053  1.00 45.09 ? 157 GLN A CD  1 
ATOM   1257 O OE1 . GLN A 1 157 ? -12.044 8.574   17.669  1.00 49.95 ? 157 GLN A OE1 1 
ATOM   1258 N NE2 . GLN A 1 157 ? -9.979  9.205   18.280  1.00 49.31 ? 157 GLN A NE2 1 
ATOM   1259 N N   . PRO A 1 158 ? -9.430  3.767   19.303  1.00 25.65 ? 158 PRO A N   1 
ATOM   1260 C CA  . PRO A 1 158 ? -9.621  3.041   20.564  1.00 23.98 ? 158 PRO A CA  1 
ATOM   1261 C C   . PRO A 1 158 ? -10.590 3.742   21.496  1.00 23.34 ? 158 PRO A C   1 
ATOM   1262 O O   . PRO A 1 158 ? -10.686 4.967   21.496  1.00 21.25 ? 158 PRO A O   1 
ATOM   1263 C CB  . PRO A 1 158 ? -8.211  2.987   21.169  1.00 25.01 ? 158 PRO A CB  1 
ATOM   1264 C CG  . PRO A 1 158 ? -7.288  3.286   19.999  1.00 30.51 ? 158 PRO A CG  1 
ATOM   1265 C CD  . PRO A 1 158 ? -8.054  4.280   19.181  1.00 22.64 ? 158 PRO A CD  1 
ATOM   1266 N N   . ARG A 1 159 ? -11.306 2.956   22.292  1.00 25.21 ? 159 ARG A N   1 
ATOM   1267 C CA  . ARG A 1 159 ? -12.243 3.501   23.264  1.00 26.53 ? 159 ARG A CA  1 
ATOM   1268 C C   . ARG A 1 159 ? -11.599 3.271   24.625  1.00 24.48 ? 159 ARG A C   1 
ATOM   1269 O O   . ARG A 1 159 ? -12.075 3.761   25.645  1.00 25.39 ? 159 ARG A O   1 
ATOM   1270 C CB  . ARG A 1 159 ? -13.595 2.790   23.180  1.00 28.74 ? 159 ARG A CB  1 
ATOM   1271 C CG  . ARG A 1 159 ? -14.361 3.052   21.882  1.00 36.83 ? 159 ARG A CG  1 
ATOM   1272 C CD  . ARG A 1 159 ? -15.520 2.059   21.720  1.00 46.66 ? 159 ARG A CD  1 
ATOM   1273 N NE  . ARG A 1 159 ? -16.527 2.207   22.768  1.00 55.40 ? 159 ARG A NE  1 
ATOM   1274 C CZ  . ARG A 1 159 ? -17.326 3.266   22.884  1.00 60.25 ? 159 ARG A CZ  1 
ATOM   1275 N NH1 . ARG A 1 159 ? -17.234 4.265   22.010  1.00 58.32 ? 159 ARG A NH1 1 
ATOM   1276 N NH2 . ARG A 1 159 ? -18.206 3.336   23.879  1.00 60.95 ? 159 ARG A NH2 1 
ATOM   1277 N N   . ARG A 1 160 ? -10.505 2.514   24.614  1.00 20.28 ? 160 ARG A N   1 
ATOM   1278 C CA  . ARG A 1 160 ? -9.738  2.204   25.820  1.00 23.10 ? 160 ARG A CA  1 
ATOM   1279 C C   . ARG A 1 160 ? -8.263  2.490   25.531  1.00 21.01 ? 160 ARG A C   1 
ATOM   1280 O O   . ARG A 1 160 ? -7.774  2.180   24.446  1.00 21.54 ? 160 ARG A O   1 
ATOM   1281 C CB  . ARG A 1 160 ? -9.861  0.720   26.195  1.00 24.39 ? 160 ARG A CB  1 
ATOM   1282 C CG  . ARG A 1 160 ? -11.262 0.200   26.456  1.00 34.66 ? 160 ARG A CG  1 
ATOM   1283 C CD  . ARG A 1 160 ? -11.675 0.387   27.903  1.00 43.10 ? 160 ARG A CD  1 
ATOM   1284 N NE  . ARG A 1 160 ? -12.444 -0.758  28.392  1.00 46.82 ? 160 ARG A NE  1 
ATOM   1285 C CZ  . ARG A 1 160 ? -11.990 -2.011  28.422  1.00 47.52 ? 160 ARG A CZ  1 
ATOM   1286 N NH1 . ARG A 1 160 ? -10.766 -2.301  27.993  1.00 49.62 ? 160 ARG A NH1 1 
ATOM   1287 N NH2 . ARG A 1 160 ? -12.761 -2.982  28.884  1.00 49.42 ? 160 ARG A NH2 1 
ATOM   1288 N N   . ALA A 1 161 ? -7.554  3.074   26.491  1.00 18.95 ? 161 ALA A N   1 
ATOM   1289 C CA  . ALA A 1 161 ? -6.132  3.347   26.312  1.00 18.99 ? 161 ALA A CA  1 
ATOM   1290 C C   . ALA A 1 161 ? -5.387  3.143   27.620  1.00 19.18 ? 161 ALA A C   1 
ATOM   1291 O O   . ALA A 1 161 ? -5.992  3.047   28.683  1.00 19.89 ? 161 ALA A O   1 
ATOM   1292 C CB  . ALA A 1 161 ? -5.913  4.770   25.787  1.00 17.08 ? 161 ALA A CB  1 
ATOM   1293 N N   . LEU A 1 162 ? -4.067  3.092   27.542  1.00 18.78 ? 162 LEU A N   1 
ATOM   1294 C CA  . LEU A 1 162 ? -3.264  2.890   28.731  1.00 17.09 ? 162 LEU A CA  1 
ATOM   1295 C C   . LEU A 1 162 ? -1.957  3.686   28.643  1.00 16.81 ? 162 LEU A C   1 
ATOM   1296 O O   . LEU A 1 162 ? -1.227  3.597   27.661  1.00 15.16 ? 162 LEU A O   1 
ATOM   1297 C CB  . LEU A 1 162 ? -2.978  1.402   28.864  1.00 17.36 ? 162 LEU A CB  1 
ATOM   1298 C CG  . LEU A 1 162 ? -2.535  0.830   30.198  1.00 23.60 ? 162 LEU A CG  1 
ATOM   1299 C CD1 . LEU A 1 162 ? -1.143  1.311   30.547  1.00 28.32 ? 162 LEU A CD1 1 
ATOM   1300 C CD2 . LEU A 1 162 ? -3.550  1.240   31.257  1.00 28.65 ? 162 LEU A CD2 1 
ATOM   1301 N N   . LEU A 1 163 ? -1.670  4.469   29.675  1.00 17.36 ? 163 LEU A N   1 
ATOM   1302 C CA  . LEU A 1 163 ? -0.445  5.255   29.701  1.00 16.51 ? 163 LEU A CA  1 
ATOM   1303 C C   . LEU A 1 163 ? 0.405   4.865   30.914  1.00 15.88 ? 163 LEU A C   1 
ATOM   1304 O O   . LEU A 1 163 ? -0.051  4.955   32.046  1.00 14.65 ? 163 LEU A O   1 
ATOM   1305 C CB  . LEU A 1 163 ? -0.777  6.753   29.752  1.00 16.92 ? 163 LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 163 ? 0.361   7.788   29.681  1.00 18.76 ? 163 LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 163 ? -0.216  9.184   29.471  1.00 17.26 ? 163 LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 163 ? 1.180   7.757   30.942  1.00 17.36 ? 163 LEU A CD2 1 
ATOM   1309 N N   . PHE A 1 164 ? 1.630   4.410   30.672  1.00 15.52 ? 164 PHE A N   1 
ATOM   1310 C CA  . PHE A 1 164 ? 2.531   4.060   31.757  1.00 15.96 ? 164 PHE A CA  1 
ATOM   1311 C C   . PHE A 1 164 ? 3.920   4.641   31.537  1.00 18.51 ? 164 PHE A C   1 
ATOM   1312 O O   . PHE A 1 164 ? 4.268   5.067   30.434  1.00 20.40 ? 164 PHE A O   1 
ATOM   1313 C CB  . PHE A 1 164 ? 2.622   2.535   31.957  1.00 15.85 ? 164 PHE A CB  1 
ATOM   1314 C CG  . PHE A 1 164 ? 3.096   1.760   30.750  1.00 14.92 ? 164 PHE A CG  1 
ATOM   1315 C CD1 . PHE A 1 164 ? 2.226   1.451   29.709  1.00 16.49 ? 164 PHE A CD1 1 
ATOM   1316 C CD2 . PHE A 1 164 ? 4.405   1.290   30.684  1.00 12.60 ? 164 PHE A CD2 1 
ATOM   1317 C CE1 . PHE A 1 164 ? 2.653   0.678   28.616  1.00 17.51 ? 164 PHE A CE1 1 
ATOM   1318 C CE2 . PHE A 1 164 ? 4.838   0.518   29.601  1.00 13.47 ? 164 PHE A CE2 1 
ATOM   1319 C CZ  . PHE A 1 164 ? 3.964   0.211   28.566  1.00 14.09 ? 164 PHE A CZ  1 
ATOM   1320 N N   . VAL A 1 165 ? 4.707   4.678   32.604  1.00 19.24 ? 165 VAL A N   1 
ATOM   1321 C CA  . VAL A 1 165 ? 6.066   5.195   32.540  1.00 15.67 ? 165 VAL A CA  1 
ATOM   1322 C C   . VAL A 1 165 ? 6.972   4.311   33.391  1.00 18.26 ? 165 VAL A C   1 
ATOM   1323 O O   . VAL A 1 165 ? 6.658   4.039   34.554  1.00 14.93 ? 165 VAL A O   1 
ATOM   1324 C CB  . VAL A 1 165 ? 6.144   6.633   33.101  1.00 18.63 ? 165 VAL A CB  1 
ATOM   1325 C CG1 . VAL A 1 165 ? 7.563   7.160   32.963  1.00 15.17 ? 165 VAL A CG1 1 
ATOM   1326 C CG2 . VAL A 1 165 ? 5.151   7.540   32.389  1.00 15.38 ? 165 VAL A CG2 1 
ATOM   1327 N N   . ILE A 1 166 ? 8.080   3.854   32.814  1.00 16.72 ? 166 ILE A N   1 
ATOM   1328 C CA  . ILE A 1 166 ? 9.033   3.036   33.554  1.00 17.49 ? 166 ILE A CA  1 
ATOM   1329 C C   . ILE A 1 166 ? 10.406  3.719   33.547  1.00 20.18 ? 166 ILE A C   1 
ATOM   1330 O O   . ILE A 1 166 ? 10.703  4.536   32.670  1.00 19.59 ? 166 ILE A O   1 
ATOM   1331 C CB  . ILE A 1 166 ? 9.155   1.616   32.963  1.00 17.20 ? 166 ILE A CB  1 
ATOM   1332 C CG1 . ILE A 1 166 ? 9.542   1.693   31.484  1.00 16.29 ? 166 ILE A CG1 1 
ATOM   1333 C CG2 . ILE A 1 166 ? 7.854   0.868   33.156  1.00 13.84 ? 166 ILE A CG2 1 
ATOM   1334 C CD1 . ILE A 1 166 ? 9.688   0.340   30.829  1.00 18.39 ? 166 ILE A CD1 1 
ATOM   1335 N N   . LEU A 1 167 ? 11.239  3.378   34.524  1.00 20.71 ? 167 LEU A N   1 
ATOM   1336 C CA  . LEU A 1 167 ? 12.554  3.980   34.654  1.00 17.37 ? 167 LEU A CA  1 
ATOM   1337 C C   . LEU A 1 167 ? 13.656  2.936   34.687  1.00 19.85 ? 167 LEU A C   1 
ATOM   1338 O O   . LEU A 1 167 ? 13.454  1.815   35.154  1.00 21.87 ? 167 LEU A O   1 
ATOM   1339 C CB  . LEU A 1 167 ? 12.615  4.784   35.952  1.00 12.89 ? 167 LEU A CB  1 
ATOM   1340 C CG  . LEU A 1 167 ? 11.438  5.720   36.241  1.00 13.24 ? 167 LEU A CG  1 
ATOM   1341 C CD1 . LEU A 1 167 ? 11.491  6.212   37.686  1.00 7.49  ? 167 LEU A CD1 1 
ATOM   1342 C CD2 . LEU A 1 167 ? 11.468  6.891   35.267  1.00 7.77  ? 167 LEU A CD2 1 
ATOM   1343 N N   . CYS A 1 168 ? 14.826  3.297   34.182  1.00 21.23 ? 168 CYS A N   1 
ATOM   1344 C CA  . CYS A 1 168 ? 15.945  2.384   34.237  1.00 24.07 ? 168 CYS A CA  1 
ATOM   1345 C C   . CYS A 1 168 ? 17.272  3.123   34.177  1.00 26.37 ? 168 CYS A C   1 
ATOM   1346 O O   . CYS A 1 168 ? 17.468  4.029   33.362  1.00 24.86 ? 168 CYS A O   1 
ATOM   1347 C CB  . CYS A 1 168 ? 15.843  1.330   33.140  1.00 28.07 ? 168 CYS A CB  1 
ATOM   1348 S SG  . CYS A 1 168 ? 16.088  1.920   31.503  1.00 37.62 ? 168 CYS A SG  1 
ATOM   1349 N N   . PRO A 1 169 ? 18.196  2.755   35.078  1.00 28.11 ? 169 PRO A N   1 
ATOM   1350 C CA  . PRO A 1 169 ? 19.537  3.327   35.208  1.00 26.61 ? 169 PRO A CA  1 
ATOM   1351 C C   . PRO A 1 169 ? 20.387  2.916   34.026  1.00 25.80 ? 169 PRO A C   1 
ATOM   1352 O O   . PRO A 1 169 ? 20.425  1.742   33.670  1.00 25.47 ? 169 PRO A O   1 
ATOM   1353 C CB  . PRO A 1 169 ? 20.064  2.704   36.501  1.00 27.24 ? 169 PRO A CB  1 
ATOM   1354 C CG  . PRO A 1 169 ? 18.834  2.184   37.194  1.00 29.75 ? 169 PRO A CG  1 
ATOM   1355 C CD  . PRO A 1 169 ? 18.005  1.684   36.068  1.00 27.21 ? 169 PRO A CD  1 
ATOM   1356 N N   . VAL A 1 170 ? 21.083  3.873   33.429  1.00 26.45 ? 170 VAL A N   1 
ATOM   1357 C CA  . VAL A 1 170 ? 21.927  3.569   32.288  1.00 28.49 ? 170 VAL A CA  1 
ATOM   1358 C C   . VAL A 1 170 ? 23.306  4.195   32.443  1.00 32.34 ? 170 VAL A C   1 
ATOM   1359 O O   . VAL A 1 170 ? 23.435  5.316   32.929  1.00 34.63 ? 170 VAL A O   1 
ATOM   1360 C CB  . VAL A 1 170 ? 21.281  4.072   30.976  1.00 27.17 ? 170 VAL A CB  1 
ATOM   1361 C CG1 . VAL A 1 170 ? 19.991  3.315   30.704  1.00 23.94 ? 170 VAL A CG1 1 
ATOM   1362 C CG2 . VAL A 1 170 ? 20.994  5.556   31.077  1.00 26.45 ? 170 VAL A CG2 1 
ATOM   1363 N N   . GLY A 1 171 ? 24.339  3.481   32.012  1.00 37.76 ? 171 GLY A N   1 
ATOM   1364 C CA  . GLY A 1 171 ? 25.683  4.013   32.127  1.00 40.39 ? 171 GLY A CA  1 
ATOM   1365 C C   . GLY A 1 171 ? 26.071  4.832   30.917  1.00 43.12 ? 171 GLY A C   1 
ATOM   1366 O O   . GLY A 1 171 ? 25.361  4.833   29.911  1.00 40.35 ? 171 GLY A O   1 
ATOM   1367 N N   . ALA A 1 172 ? 27.198  5.533   31.017  1.00 49.17 ? 172 ALA A N   1 
ATOM   1368 C CA  . ALA A 1 172 ? 27.694  6.358   29.915  1.00 55.03 ? 172 ALA A CA  1 
ATOM   1369 C C   . ALA A 1 172 ? 27.822  5.506   28.645  1.00 57.38 ? 172 ALA A C   1 
ATOM   1370 O O   . ALA A 1 172 ? 28.182  4.327   28.713  1.00 55.72 ? 172 ALA A O   1 
ATOM   1371 C CB  . ALA A 1 172 ? 29.043  6.971   30.285  1.00 54.96 ? 172 ALA A CB  1 
ATOM   1372 N N   . TYR A 1 173 ? 27.535  6.114   27.495  1.00 61.85 ? 173 TYR A N   1 
ATOM   1373 C CA  . TYR A 1 173 ? 27.572  5.414   26.208  1.00 66.91 ? 173 TYR A CA  1 
ATOM   1374 C C   . TYR A 1 173 ? 28.957  4.886   25.813  1.00 69.53 ? 173 TYR A C   1 
ATOM   1375 O O   . TYR A 1 173 ? 29.873  4.846   26.638  1.00 71.09 ? 173 TYR A O   1 
ATOM   1376 C CB  . TYR A 1 173 ? 27.015  6.325   25.097  1.00 66.75 ? 173 TYR A CB  1 
ATOM   1377 C CG  . TYR A 1 173 ? 26.326  5.571   23.971  1.00 65.60 ? 173 TYR A CG  1 
ATOM   1378 C CD1 . TYR A 1 173 ? 25.178  4.812   24.215  1.00 65.91 ? 173 TYR A CD1 1 
ATOM   1379 C CD2 . TYR A 1 173 ? 26.837  5.594   22.668  1.00 65.49 ? 173 TYR A CD2 1 
ATOM   1380 C CE1 . TYR A 1 173 ? 24.557  4.087   23.191  1.00 68.15 ? 173 TYR A CE1 1 
ATOM   1381 C CE2 . TYR A 1 173 ? 26.225  4.876   21.635  1.00 66.96 ? 173 TYR A CE2 1 
ATOM   1382 C CZ  . TYR A 1 173 ? 25.088  4.123   21.902  1.00 69.17 ? 173 TYR A CZ  1 
ATOM   1383 O OH  . TYR A 1 173 ? 24.493  3.399   20.885  1.00 69.77 ? 173 TYR A OH  1 
ATOM   1384 N N   . PHE A 1 174 ? 29.094  4.499   24.543  1.00 71.71 ? 174 PHE A N   1 
ATOM   1385 C CA  . PHE A 1 174 ? 30.327  3.938   23.972  1.00 72.84 ? 174 PHE A CA  1 
ATOM   1386 C C   . PHE A 1 174 ? 31.411  3.422   24.961  1.00 76.31 ? 174 PHE A C   1 
ATOM   1387 O O   . PHE A 1 174 ? 31.210  2.355   25.556  1.00 78.03 ? 174 PHE A O   1 
ATOM   1388 C CB  . PHE A 1 174 ? 30.892  4.886   22.880  1.00 69.02 ? 174 PHE A CB  1 
ATOM   1389 C CG  . PHE A 1 174 ? 30.795  6.373   23.194  1.00 62.62 ? 174 PHE A CG  1 
ATOM   1390 C CD1 . PHE A 1 174 ? 30.797  7.294   22.153  1.00 59.87 ? 174 PHE A CD1 1 
ATOM   1391 C CD2 . PHE A 1 174 ? 30.751  6.851   24.501  1.00 60.03 ? 174 PHE A CD2 1 
ATOM   1392 C CE1 . PHE A 1 174 ? 30.759  8.656   22.404  1.00 57.80 ? 174 PHE A CE1 1 
ATOM   1393 C CE2 . PHE A 1 174 ? 30.713  8.212   24.759  1.00 58.58 ? 174 PHE A CE2 1 
ATOM   1394 C CZ  . PHE A 1 174 ? 30.718  9.115   23.709  1.00 58.49 ? 174 PHE A CZ  1 
ATOM   1395 N N   . PRO A 1 175 ? 32.563  4.119   25.150  1.00 77.46 ? 175 PRO A N   1 
ATOM   1396 C CA  . PRO A 1 175 ? 33.452  3.465   26.126  1.00 77.37 ? 175 PRO A CA  1 
ATOM   1397 C C   . PRO A 1 175 ? 33.148  3.782   27.597  1.00 77.74 ? 175 PRO A C   1 
ATOM   1398 O O   . PRO A 1 175 ? 33.480  3.000   28.493  1.00 77.42 ? 175 PRO A O   1 
ATOM   1399 C CB  . PRO A 1 175 ? 34.836  3.958   25.710  1.00 76.42 ? 175 PRO A CB  1 
ATOM   1400 C CG  . PRO A 1 175 ? 34.552  5.334   25.243  1.00 75.91 ? 175 PRO A CG  1 
ATOM   1401 C CD  . PRO A 1 175 ? 33.316  5.147   24.400  1.00 76.78 ? 175 PRO A CD  1 
ATOM   1402 N N   . GLY A 1 176 ? 32.512  4.924   27.835  1.00 77.47 ? 176 GLY A N   1 
ATOM   1403 C CA  . GLY A 1 176 ? 32.194  5.333   29.191  1.00 75.64 ? 176 GLY A CA  1 
ATOM   1404 C C   . GLY A 1 176 ? 33.075  6.514   29.540  1.00 74.94 ? 176 GLY A C   1 
ATOM   1405 O O   . GLY A 1 176 ? 32.601  7.641   29.695  1.00 74.84 ? 176 GLY A O   1 
ATOM   1406 N N   . GLY A 1 177 ? 34.372  6.254   29.645  1.00 74.09 ? 177 GLY A N   1 
ATOM   1407 C CA  . GLY A 1 177 ? 35.307  7.313   29.958  1.00 73.43 ? 177 GLY A CA  1 
ATOM   1408 C C   . GLY A 1 177 ? 36.012  7.833   28.718  1.00 73.86 ? 177 GLY A C   1 
ATOM   1409 O O   . GLY A 1 177 ? 37.187  8.199   28.789  1.00 74.58 ? 177 GLY A O   1 
ATOM   1410 N N   . SER A 1 178 ? 35.308  7.863   27.584  1.00 73.25 ? 178 SER A N   1 
ATOM   1411 C CA  . SER A 1 178 ? 35.891  8.352   26.324  1.00 71.69 ? 178 SER A CA  1 
ATOM   1412 C C   . SER A 1 178 ? 34.857  8.578   25.200  1.00 69.18 ? 178 SER A C   1 
ATOM   1413 O O   . SER A 1 178 ? 33.643  8.538   25.430  1.00 69.79 ? 178 SER A O   1 
ATOM   1414 C CB  . SER A 1 178 ? 36.978  7.382   25.837  1.00 71.50 ? 178 SER A CB  1 
ATOM   1415 O OG  . SER A 1 178 ? 37.663  7.901   24.711  1.00 72.87 ? 178 SER A OG  1 
ATOM   1416 N N   . VAL A 1 179 ? 35.351  8.826   23.988  1.00 63.60 ? 179 VAL A N   1 
ATOM   1417 C CA  . VAL A 1 179 ? 34.491  9.059   22.828  1.00 57.07 ? 179 VAL A CA  1 
ATOM   1418 C C   . VAL A 1 179 ? 35.019  8.224   21.658  1.00 51.92 ? 179 VAL A C   1 
ATOM   1419 O O   . VAL A 1 179 ? 36.175  8.378   21.251  1.00 49.10 ? 179 VAL A O   1 
ATOM   1420 C CB  . VAL A 1 179 ? 34.480  10.562  22.438  1.00 57.58 ? 179 VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 179 ? 33.457  10.811  21.348  1.00 57.37 ? 179 VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 179 ? 34.159  11.417  23.659  1.00 59.50 ? 179 VAL A CG2 1 
ATOM   1423 N N   . THR A 1 180 ? 34.174  7.344   21.120  1.00 44.87 ? 180 THR A N   1 
ATOM   1424 C CA  . THR A 1 180 ? 34.586  6.471   20.019  1.00 39.20 ? 180 THR A CA  1 
ATOM   1425 C C   . THR A 1 180 ? 33.624  6.524   18.834  1.00 35.50 ? 180 THR A C   1 
ATOM   1426 O O   . THR A 1 180 ? 32.403  6.558   19.006  1.00 35.36 ? 180 THR A O   1 
ATOM   1427 C CB  . THR A 1 180 ? 34.717  5.019   20.497  1.00 39.59 ? 180 THR A CB  1 
ATOM   1428 O OG1 . THR A 1 180 ? 33.414  4.478   20.754  1.00 39.32 ? 180 THR A OG1 1 
ATOM   1429 C CG2 . THR A 1 180 ? 35.542  4.965   21.780  1.00 37.01 ? 180 THR A CG2 1 
ATOM   1430 N N   . PRO A 1 181 ? 34.171  6.501   17.611  1.00 31.29 ? 181 PRO A N   1 
ATOM   1431 C CA  . PRO A 1 181 ? 33.407  6.562   16.363  1.00 30.49 ? 181 PRO A CA  1 
ATOM   1432 C C   . PRO A 1 181 ? 32.622  5.308   16.029  1.00 29.80 ? 181 PRO A C   1 
ATOM   1433 O O   . PRO A 1 181 ? 32.795  4.276   16.662  1.00 29.61 ? 181 PRO A O   1 
ATOM   1434 C CB  . PRO A 1 181 ? 34.481  6.832   15.297  1.00 31.99 ? 181 PRO A CB  1 
ATOM   1435 C CG  . PRO A 1 181 ? 35.735  7.154   16.078  1.00 32.74 ? 181 PRO A CG  1 
ATOM   1436 C CD  . PRO A 1 181 ? 35.606  6.358   17.323  1.00 28.91 ? 181 PRO A CD  1 
ATOM   1437 N N   . VAL A 1 182 ? 31.771  5.424   15.011  1.00 26.68 ? 182 VAL A N   1 
ATOM   1438 C CA  . VAL A 1 182 ? 30.957  4.320   14.519  1.00 26.31 ? 182 VAL A CA  1 
ATOM   1439 C C   . VAL A 1 182 ? 30.956  4.375   12.997  1.00 24.94 ? 182 VAL A C   1 
ATOM   1440 O O   . VAL A 1 182 ? 31.045  5.449   12.406  1.00 25.34 ? 182 VAL A O   1 
ATOM   1441 C CB  . VAL A 1 182 ? 29.482  4.397   15.010  1.00 25.64 ? 182 VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 182 ? 29.427  4.344   16.536  1.00 27.93 ? 182 VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 182 ? 28.823  5.663   14.490  1.00 22.74 ? 182 VAL A CG2 1 
ATOM   1444 N N   . SER A 1 183 ? 30.881  3.212   12.366  1.00 24.78 ? 183 SER A N   1 
ATOM   1445 C CA  . SER A 1 183 ? 30.846  3.131   10.916  1.00 24.73 ? 183 SER A CA  1 
ATOM   1446 C C   . SER A 1 183 ? 29.386  3.066   10.521  1.00 23.52 ? 183 SER A C   1 
ATOM   1447 O O   . SER A 1 183 ? 28.557  2.546   11.277  1.00 21.68 ? 183 SER A O   1 
ATOM   1448 C CB  . SER A 1 183 ? 31.562  1.870   10.425  1.00 29.96 ? 183 SER A CB  1 
ATOM   1449 O OG  . SER A 1 183 ? 32.968  2.051   10.412  1.00 38.49 ? 183 SER A OG  1 
ATOM   1450 N N   . LEU A 1 184 ? 29.069  3.584   9.341   1.00 20.73 ? 184 LEU A N   1 
ATOM   1451 C CA  . LEU A 1 184 ? 27.689  3.585   8.890   1.00 20.42 ? 184 LEU A CA  1 
ATOM   1452 C C   . LEU A 1 184 ? 27.525  2.920   7.534   1.00 19.13 ? 184 LEU A C   1 
ATOM   1453 O O   . LEU A 1 184 ? 28.380  3.048   6.648   1.00 15.76 ? 184 LEU A O   1 
ATOM   1454 C CB  . LEU A 1 184 ? 27.158  5.021   8.817   1.00 21.05 ? 184 LEU A CB  1 
ATOM   1455 C CG  . LEU A 1 184 ? 27.391  5.962   10.009  1.00 22.27 ? 184 LEU A CG  1 
ATOM   1456 C CD1 . LEU A 1 184 ? 26.742  7.308   9.719   1.00 19.50 ? 184 LEU A CD1 1 
ATOM   1457 C CD2 . LEU A 1 184 ? 26.817  5.360   11.284  1.00 19.87 ? 184 LEU A CD2 1 
ATOM   1458 N N   . LEU A 1 185 ? 26.424  2.192   7.385   1.00 18.15 ? 185 LEU A N   1 
ATOM   1459 C CA  . LEU A 1 185 ? 26.120  1.539   6.119   1.00 20.72 ? 185 LEU A CA  1 
ATOM   1460 C C   . LEU A 1 185 ? 25.065  2.394   5.430   1.00 21.79 ? 185 LEU A C   1 
ATOM   1461 O O   . LEU A 1 185 ? 23.983  2.622   5.989   1.00 19.96 ? 185 LEU A O   1 
ATOM   1462 C CB  . LEU A 1 185 ? 25.550  0.141   6.339   1.00 19.68 ? 185 LEU A CB  1 
ATOM   1463 C CG  . LEU A 1 185 ? 24.810  -0.415  5.118   1.00 17.74 ? 185 LEU A CG  1 
ATOM   1464 C CD1 . LEU A 1 185 ? 25.801  -0.797  4.024   1.00 14.02 ? 185 LEU A CD1 1 
ATOM   1465 C CD2 . LEU A 1 185 ? 23.985  -1.616  5.545   1.00 18.93 ? 185 LEU A CD2 1 
ATOM   1466 N N   . ALA A 1 186 ? 25.382  2.868   4.228   1.00 19.84 ? 186 ALA A N   1 
ATOM   1467 C CA  . ALA A 1 186 ? 24.450  3.700   3.471   1.00 21.87 ? 186 ALA A CA  1 
ATOM   1468 C C   . ALA A 1 186 ? 23.986  2.967   2.214   1.00 22.73 ? 186 ALA A C   1 
ATOM   1469 O O   . ALA A 1 186 ? 24.705  2.898   1.219   1.00 25.85 ? 186 ALA A O   1 
ATOM   1470 C CB  . ALA A 1 186 ? 25.119  5.021   3.098   1.00 14.08 ? 186 ALA A CB  1 
ATOM   1471 N N   . ASP A 1 187 ? 22.777  2.428   2.261   1.00 25.01 ? 187 ASP A N   1 
ATOM   1472 C CA  . ASP A 1 187 ? 22.236  1.689   1.131   1.00 28.47 ? 187 ASP A CA  1 
ATOM   1473 C C   . ASP A 1 187 ? 20.845  2.206   0.784   1.00 27.45 ? 187 ASP A C   1 
ATOM   1474 O O   . ASP A 1 187 ? 19.902  2.037   1.551   1.00 26.74 ? 187 ASP A O   1 
ATOM   1475 C CB  . ASP A 1 187 ? 22.157  0.200   1.476   1.00 33.68 ? 187 ASP A CB  1 
ATOM   1476 C CG  . ASP A 1 187 ? 21.935  -0.669  0.256   1.00 35.83 ? 187 ASP A CG  1 
ATOM   1477 O OD1 . ASP A 1 187 ? 20.993  -0.379  -0.516  1.00 35.15 ? 187 ASP A OD1 1 
ATOM   1478 O OD2 . ASP A 1 187 ? 22.709  -1.639  0.076   1.00 38.28 ? 187 ASP A OD2 1 
ATOM   1479 N N   . PRO A 1 188 ? 20.700  2.824   -0.396  1.00 28.32 ? 188 PRO A N   1 
ATOM   1480 C CA  . PRO A 1 188 ? 19.429  3.380   -0.871  1.00 25.71 ? 188 PRO A CA  1 
ATOM   1481 C C   . PRO A 1 188 ? 18.250  2.412   -0.844  1.00 22.87 ? 188 PRO A C   1 
ATOM   1482 O O   . PRO A 1 188 ? 17.101  2.839   -0.804  1.00 24.40 ? 188 PRO A O   1 
ATOM   1483 C CB  . PRO A 1 188 ? 19.760  3.823   -2.295  1.00 25.23 ? 188 PRO A CB  1 
ATOM   1484 C CG  . PRO A 1 188 ? 21.226  4.135   -2.223  1.00 27.48 ? 188 PRO A CG  1 
ATOM   1485 C CD  . PRO A 1 188 ? 21.752  2.985   -1.417  1.00 28.79 ? 188 PRO A CD  1 
ATOM   1486 N N   . ALA A 1 189 ? 18.534  1.115   -0.868  1.00 21.90 ? 189 ALA A N   1 
ATOM   1487 C CA  . ALA A 1 189 ? 17.482  0.104   -0.888  1.00 22.17 ? 189 ALA A CA  1 
ATOM   1488 C C   . ALA A 1 189 ? 16.583  0.177   0.334   1.00 25.70 ? 189 ALA A C   1 
ATOM   1489 O O   . ALA A 1 189 ? 15.433  -0.269  0.291   1.00 26.63 ? 189 ALA A O   1 
ATOM   1490 C CB  . ALA A 1 189 ? 18.091  -1.286  -0.992  1.00 10.92 ? 189 ALA A CB  1 
ATOM   1491 N N   . PHE A 1 190 ? 17.097  0.753   1.417   1.00 27.54 ? 190 PHE A N   1 
ATOM   1492 C CA  . PHE A 1 190 ? 16.333  0.836   2.655   1.00 30.06 ? 190 PHE A CA  1 
ATOM   1493 C C   . PHE A 1 190 ? 15.735  2.209   2.939   1.00 28.99 ? 190 PHE A C   1 
ATOM   1494 O O   . PHE A 1 190 ? 16.455  3.199   3.070   1.00 31.47 ? 190 PHE A O   1 
ATOM   1495 C CB  . PHE A 1 190 ? 17.217  0.398   3.820   1.00 32.02 ? 190 PHE A CB  1 
ATOM   1496 C CG  . PHE A 1 190 ? 17.984  -0.861  3.547   1.00 32.61 ? 190 PHE A CG  1 
ATOM   1497 C CD1 . PHE A 1 190 ? 19.353  -0.817  3.292   1.00 35.01 ? 190 PHE A CD1 1 
ATOM   1498 C CD2 . PHE A 1 190 ? 17.331  -2.088  3.503   1.00 32.95 ? 190 PHE A CD2 1 
ATOM   1499 C CE1 . PHE A 1 190 ? 20.064  -1.982  2.994   1.00 34.00 ? 190 PHE A CE1 1 
ATOM   1500 C CE2 . PHE A 1 190 ? 18.030  -3.254  3.205   1.00 32.48 ? 190 PHE A CE2 1 
ATOM   1501 C CZ  . PHE A 1 190 ? 19.400  -3.200  2.950   1.00 33.71 ? 190 PHE A CZ  1 
ATOM   1502 N N   . ILE A 1 191 ? 14.411  2.251   3.052   1.00 26.16 ? 191 ILE A N   1 
ATOM   1503 C CA  . ILE A 1 191 ? 13.702  3.491   3.312   1.00 24.29 ? 191 ILE A CA  1 
ATOM   1504 C C   . ILE A 1 191 ? 13.040  3.457   4.686   1.00 22.66 ? 191 ILE A C   1 
ATOM   1505 O O   . ILE A 1 191 ? 12.147  2.658   4.930   1.00 22.61 ? 191 ILE A O   1 
ATOM   1506 C CB  . ILE A 1 191 ? 12.633  3.733   2.236   1.00 24.52 ? 191 ILE A CB  1 
ATOM   1507 C CG1 . ILE A 1 191 ? 13.272  3.647   0.846   1.00 24.17 ? 191 ILE A CG1 1 
ATOM   1508 C CG2 . ILE A 1 191 ? 11.993  5.098   2.428   1.00 25.08 ? 191 ILE A CG2 1 
ATOM   1509 C CD1 . ILE A 1 191 ? 14.350  4.686   0.584   1.00 27.59 ? 191 ILE A CD1 1 
ATOM   1510 N N   . ARG A 1 192 ? 13.486  4.340   5.573   1.00 20.88 ? 192 ARG A N   1 
ATOM   1511 C CA  . ARG A 1 192 ? 12.956  4.429   6.931   1.00 20.27 ? 192 ARG A CA  1 
ATOM   1512 C C   . ARG A 1 192 ? 11.599  5.125   6.981   1.00 19.72 ? 192 ARG A C   1 
ATOM   1513 O O   . ARG A 1 192 ? 10.698  4.701   7.697   1.00 18.57 ? 192 ARG A O   1 
ATOM   1514 C CB  . ARG A 1 192 ? 13.933  5.203   7.823   1.00 17.60 ? 192 ARG A CB  1 
ATOM   1515 C CG  . ARG A 1 192 ? 13.597  5.188   9.295   1.00 17.88 ? 192 ARG A CG  1 
ATOM   1516 C CD  . ARG A 1 192 ? 14.445  6.197   10.046  1.00 11.14 ? 192 ARG A CD  1 
ATOM   1517 N NE  . ARG A 1 192 ? 13.905  7.551   9.947   1.00 17.24 ? 192 ARG A NE  1 
ATOM   1518 C CZ  . ARG A 1 192 ? 12.913  8.022   10.703  1.00 14.90 ? 192 ARG A CZ  1 
ATOM   1519 N NH1 . ARG A 1 192 ? 12.349  7.245   11.619  1.00 12.26 ? 192 ARG A NH1 1 
ATOM   1520 N NH2 . ARG A 1 192 ? 12.493  9.276   10.554  1.00 8.45  ? 192 ARG A NH2 1 
ATOM   1521 N N   . ALA A 1 193 ? 11.455  6.204   6.228   1.00 20.06 ? 193 ALA A N   1 
ATOM   1522 C CA  . ALA A 1 193 ? 10.202  6.946   6.237   1.00 22.67 ? 193 ALA A CA  1 
ATOM   1523 C C   . ALA A 1 193 ? 10.058  7.720   4.951   1.00 21.28 ? 193 ALA A C   1 
ATOM   1524 O O   . ALA A 1 193 ? 11.043  7.991   4.273   1.00 23.60 ? 193 ALA A O   1 
ATOM   1525 C CB  . ALA A 1 193 ? 10.164  7.898   7.423   1.00 17.52 ? 193 ALA A CB  1 
ATOM   1526 N N   . TRP A 1 194 ? 8.828   8.084   4.625   1.00 22.89 ? 194 TRP A N   1 
ATOM   1527 C CA  . TRP A 1 194 ? 8.552   8.827   3.401   1.00 24.87 ? 194 TRP A CA  1 
ATOM   1528 C C   . TRP A 1 194 ? 7.726   10.067  3.711   1.00 22.94 ? 194 TRP A C   1 
ATOM   1529 O O   . TRP A 1 194 ? 7.071   10.134  4.748   1.00 17.64 ? 194 TRP A O   1 
ATOM   1530 C CB  . TRP A 1 194 ? 7.797   7.923   2.432   1.00 28.89 ? 194 TRP A CB  1 
ATOM   1531 C CG  . TRP A 1 194 ? 6.637   7.227   3.088   1.00 38.35 ? 194 TRP A CG  1 
ATOM   1532 C CD1 . TRP A 1 194 ? 5.360   7.701   3.221   1.00 41.61 ? 194 TRP A CD1 1 
ATOM   1533 C CD2 . TRP A 1 194 ? 6.665   5.962   3.775   1.00 42.97 ? 194 TRP A CD2 1 
ATOM   1534 N NE1 . TRP A 1 194 ? 4.589   6.812   3.950   1.00 43.16 ? 194 TRP A NE1 1 
ATOM   1535 C CE2 . TRP A 1 194 ? 5.367   5.738   4.300   1.00 43.43 ? 194 TRP A CE2 1 
ATOM   1536 C CE3 . TRP A 1 194 ? 7.660   4.998   3.998   1.00 43.74 ? 194 TRP A CE3 1 
ATOM   1537 C CZ2 . TRP A 1 194 ? 5.044   4.595   5.037   1.00 41.08 ? 194 TRP A CZ2 1 
ATOM   1538 C CZ3 . TRP A 1 194 ? 7.335   3.861   4.733   1.00 42.34 ? 194 TRP A CZ3 1 
ATOM   1539 C CH2 . TRP A 1 194 ? 6.037   3.671   5.240   1.00 42.11 ? 194 TRP A CH2 1 
ATOM   1540 N N   . VAL A 1 195 ? 7.769   11.049  2.814   1.00 21.29 ? 195 VAL A N   1 
ATOM   1541 C CA  . VAL A 1 195 ? 6.998   12.277  2.996   1.00 20.73 ? 195 VAL A CA  1 
ATOM   1542 C C   . VAL A 1 195 ? 5.511   11.934  2.969   1.00 22.69 ? 195 VAL A C   1 
ATOM   1543 O O   . VAL A 1 195 ? 5.050   11.162  2.121   1.00 25.20 ? 195 VAL A O   1 
ATOM   1544 C CB  . VAL A 1 195 ? 7.308   13.316  1.897   1.00 22.24 ? 195 VAL A CB  1 
ATOM   1545 C CG1 . VAL A 1 195 ? 6.377   14.498  2.026   1.00 14.25 ? 195 VAL A CG1 1 
ATOM   1546 C CG2 . VAL A 1 195 ? 8.756   13.788  2.021   1.00 20.50 ? 195 VAL A CG2 1 
ATOM   1547 N N   . GLY A 1 196 ? 4.760   12.506  3.901   1.00 23.75 ? 196 GLY A N   1 
ATOM   1548 C CA  . GLY A 1 196 ? 3.347   12.190  3.977   1.00 26.45 ? 196 GLY A CA  1 
ATOM   1549 C C   . GLY A 1 196 ? 3.223   10.919  4.802   1.00 27.33 ? 196 GLY A C   1 
ATOM   1550 O O   . GLY A 1 196 ? 2.133   10.384  5.012   1.00 31.22 ? 196 GLY A O   1 
ATOM   1551 N N   . GLY A 1 197 ? 4.370   10.433  5.262   1.00 26.58 ? 197 GLY A N   1 
ATOM   1552 C CA  . GLY A 1 197 ? 4.412   9.239   6.079   1.00 24.61 ? 197 GLY A CA  1 
ATOM   1553 C C   . GLY A 1 197 ? 4.257   9.629   7.533   1.00 25.65 ? 197 GLY A C   1 
ATOM   1554 O O   . GLY A 1 197 ? 3.598   10.625  7.846   1.00 26.41 ? 197 GLY A O   1 
ATOM   1555 N N   . VAL A 1 198 ? 4.890   8.877   8.426   1.00 21.63 ? 198 VAL A N   1 
ATOM   1556 C CA  . VAL A 1 198 ? 4.760   9.146   9.848   1.00 21.09 ? 198 VAL A CA  1 
ATOM   1557 C C   . VAL A 1 198 ? 6.108   9.029   10.580  1.00 21.03 ? 198 VAL A C   1 
ATOM   1558 O O   . VAL A 1 198 ? 6.158   8.837   11.805  1.00 17.60 ? 198 VAL A O   1 
ATOM   1559 C CB  . VAL A 1 198 ? 3.707   8.167   10.446  1.00 20.40 ? 198 VAL A CB  1 
ATOM   1560 C CG1 . VAL A 1 198 ? 4.316   6.788   10.651  1.00 19.61 ? 198 VAL A CG1 1 
ATOM   1561 C CG2 . VAL A 1 198 ? 3.139   8.716   11.716  1.00 24.00 ? 198 VAL A CG2 1 
ATOM   1562 N N   . GLY A 1 199 ? 7.193   9.175   9.820   1.00 19.60 ? 199 GLY A N   1 
ATOM   1563 C CA  . GLY A 1 199 ? 8.531   9.072   10.379  1.00 19.21 ? 199 GLY A CA  1 
ATOM   1564 C C   . GLY A 1 199 ? 8.976   10.232  11.260  1.00 19.82 ? 199 GLY A C   1 
ATOM   1565 O O   . GLY A 1 199 ? 10.034  10.170  11.896  1.00 18.00 ? 199 GLY A O   1 
ATOM   1566 N N   . ASN A 1 200 ? 8.178   11.293  11.303  1.00 17.50 ? 200 ASN A N   1 
ATOM   1567 C CA  . ASN A 1 200 ? 8.524   12.442  12.116  1.00 20.02 ? 200 ASN A CA  1 
ATOM   1568 C C   . ASN A 1 200 ? 7.861   12.351  13.486  1.00 21.35 ? 200 ASN A C   1 
ATOM   1569 O O   . ASN A 1 200 ? 7.804   13.337  14.227  1.00 19.91 ? 200 ASN A O   1 
ATOM   1570 C CB  . ASN A 1 200 ? 8.140   13.756  11.411  1.00 20.19 ? 200 ASN A CB  1 
ATOM   1571 C CG  . ASN A 1 200 ? 6.687   13.784  10.953  1.00 17.48 ? 200 ASN A CG  1 
ATOM   1572 O OD1 . ASN A 1 200 ? 6.065   14.840  10.912  1.00 21.10 ? 200 ASN A OD1 1 
ATOM   1573 N ND2 . ASN A 1 200 ? 6.152   12.629  10.588  1.00 15.45 ? 200 ASN A ND2 1 
ATOM   1574 N N   . TYR A 1 201 ? 7.368   11.157  13.819  1.00 21.34 ? 201 TYR A N   1 
ATOM   1575 C CA  . TYR A 1 201 ? 6.727   10.909  15.120  1.00 19.15 ? 201 TYR A CA  1 
ATOM   1576 C C   . TYR A 1 201 ? 7.419   9.721   15.785  1.00 19.04 ? 201 TYR A C   1 
ATOM   1577 O O   . TYR A 1 201 ? 7.956   8.844   15.095  1.00 18.53 ? 201 TYR A O   1 
ATOM   1578 C CB  . TYR A 1 201 ? 5.249   10.572  14.945  1.00 19.41 ? 201 TYR A CB  1 
ATOM   1579 C CG  . TYR A 1 201 ? 4.423   11.648  14.299  1.00 18.65 ? 201 TYR A CG  1 
ATOM   1580 C CD1 . TYR A 1 201 ? 3.978   12.749  15.030  1.00 23.69 ? 201 TYR A CD1 1 
ATOM   1581 C CD2 . TYR A 1 201 ? 4.040   11.541  12.968  1.00 17.52 ? 201 TYR A CD2 1 
ATOM   1582 C CE1 . TYR A 1 201 ? 3.154   13.714  14.445  1.00 23.69 ? 201 TYR A CE1 1 
ATOM   1583 C CE2 . TYR A 1 201 ? 3.225   12.494  12.377  1.00 19.28 ? 201 TYR A CE2 1 
ATOM   1584 C CZ  . TYR A 1 201 ? 2.781   13.574  13.119  1.00 20.33 ? 201 TYR A CZ  1 
ATOM   1585 O OH  . TYR A 1 201 ? 1.944   14.495  12.544  1.00 23.52 ? 201 TYR A OH  1 
ATOM   1586 N N   . LYS A 1 202 ? 7.405   9.678   17.114  1.00 17.71 ? 202 LYS A N   1 
ATOM   1587 C CA  . LYS A 1 202 ? 8.054   8.579   17.801  1.00 15.40 ? 202 LYS A CA  1 
ATOM   1588 C C   . LYS A 1 202 ? 7.071   7.434   18.031  1.00 15.76 ? 202 LYS A C   1 
ATOM   1589 O O   . LYS A 1 202 ? 6.649   7.182   19.152  1.00 12.09 ? 202 LYS A O   1 
ATOM   1590 C CB  . LYS A 1 202 ? 8.672   9.064   19.118  1.00 14.59 ? 202 LYS A CB  1 
ATOM   1591 C CG  . LYS A 1 202 ? 10.181  8.810   19.184  1.00 19.08 ? 202 LYS A CG  1 
ATOM   1592 C CD  . LYS A 1 202 ? 10.809  9.177   20.524  1.00 20.71 ? 202 LYS A CD  1 
ATOM   1593 C CE  . LYS A 1 202 ? 12.289  8.760   20.584  1.00 17.92 ? 202 LYS A CE  1 
ATOM   1594 N NZ  . LYS A 1 202 ? 13.129  9.606   19.738  1.00 22.80 ? 202 LYS A NZ  1 
ATOM   1595 N N   . LEU A 1 203 ? 6.725   6.740   16.948  1.00 16.48 ? 203 LEU A N   1 
ATOM   1596 C CA  . LEU A 1 203 ? 5.779   5.619   16.996  1.00 19.56 ? 203 LEU A CA  1 
ATOM   1597 C C   . LEU A 1 203 ? 6.471   4.252   16.844  1.00 17.17 ? 203 LEU A C   1 
ATOM   1598 O O   . LEU A 1 203 ? 7.353   4.085   15.991  1.00 15.57 ? 203 LEU A O   1 
ATOM   1599 C CB  . LEU A 1 203 ? 4.732   5.776   15.880  1.00 18.83 ? 203 LEU A CB  1 
ATOM   1600 C CG  . LEU A 1 203 ? 4.034   7.124   15.689  1.00 20.92 ? 203 LEU A CG  1 
ATOM   1601 C CD1 . LEU A 1 203 ? 3.118   7.036   14.465  1.00 17.86 ? 203 LEU A CD1 1 
ATOM   1602 C CD2 . LEU A 1 203 ? 3.241   7.499   16.928  1.00 19.25 ? 203 LEU A CD2 1 
ATOM   1603 N N   . GLY A 1 204 ? 6.052   3.280   17.654  1.00 14.21 ? 204 GLY A N   1 
ATOM   1604 C CA  . GLY A 1 204 ? 6.642   1.951   17.589  1.00 10.38 ? 204 GLY A CA  1 
ATOM   1605 C C   . GLY A 1 204 ? 6.815   1.452   16.163  1.00 15.11 ? 204 GLY A C   1 
ATOM   1606 O O   . GLY A 1 204 ? 7.883   0.963   15.799  1.00 15.85 ? 204 GLY A O   1 
ATOM   1607 N N   . GLY A 1 205 ? 5.765   1.601   15.352  1.00 14.53 ? 205 GLY A N   1 
ATOM   1608 C CA  . GLY A 1 205 ? 5.789   1.167   13.965  1.00 11.15 ? 205 GLY A CA  1 
ATOM   1609 C C   . GLY A 1 205 ? 6.981   1.597   13.119  1.00 14.29 ? 205 GLY A C   1 
ATOM   1610 O O   . GLY A 1 205 ? 7.293   0.968   12.113  1.00 15.00 ? 205 GLY A O   1 
ATOM   1611 N N   . ASN A 1 206 ? 7.656   2.667   13.507  1.00 15.30 ? 206 ASN A N   1 
ATOM   1612 C CA  . ASN A 1 206 ? 8.818   3.116   12.747  1.00 14.83 ? 206 ASN A CA  1 
ATOM   1613 C C   . ASN A 1 206 ? 10.095  2.327   13.062  1.00 16.16 ? 206 ASN A C   1 
ATOM   1614 O O   . ASN A 1 206 ? 11.061  2.415   12.309  1.00 19.36 ? 206 ASN A O   1 
ATOM   1615 C CB  . ASN A 1 206 ? 9.098   4.595   13.013  1.00 14.36 ? 206 ASN A CB  1 
ATOM   1616 C CG  . ASN A 1 206 ? 8.004   5.504   12.489  1.00 13.73 ? 206 ASN A CG  1 
ATOM   1617 O OD1 . ASN A 1 206 ? 7.803   6.603   13.002  1.00 16.52 ? 206 ASN A OD1 1 
ATOM   1618 N ND2 . ASN A 1 206 ? 7.302   5.057   11.460  1.00 18.94 ? 206 ASN A ND2 1 
ATOM   1619 N N   . TYR A 1 207 ? 10.115  1.544   14.140  1.00 13.01 ? 207 TYR A N   1 
ATOM   1620 C CA  . TYR A 1 207 ? 11.346  0.836   14.482  1.00 14.18 ? 207 TYR A CA  1 
ATOM   1621 C C   . TYR A 1 207 ? 11.424  -0.650  14.192  1.00 17.04 ? 207 TYR A C   1 
ATOM   1622 O O   . TYR A 1 207 ? 12.500  -1.161  13.867  1.00 16.23 ? 207 TYR A O   1 
ATOM   1623 C CB  . TYR A 1 207 ? 11.707  1.115   15.947  1.00 14.45 ? 207 TYR A CB  1 
ATOM   1624 C CG  . TYR A 1 207 ? 11.652  2.594   16.247  1.00 14.92 ? 207 TYR A CG  1 
ATOM   1625 C CD1 . TYR A 1 207 ? 10.425  3.226   16.420  1.00 14.62 ? 207 TYR A CD1 1 
ATOM   1626 C CD2 . TYR A 1 207 ? 12.803  3.380   16.212  1.00 13.15 ? 207 TYR A CD2 1 
ATOM   1627 C CE1 . TYR A 1 207 ? 10.333  4.598   16.532  1.00 18.57 ? 207 TYR A CE1 1 
ATOM   1628 C CE2 . TYR A 1 207 ? 12.726  4.762   16.325  1.00 17.55 ? 207 TYR A CE2 1 
ATOM   1629 C CZ  . TYR A 1 207 ? 11.480  5.364   16.477  1.00 19.53 ? 207 TYR A CZ  1 
ATOM   1630 O OH  . TYR A 1 207 ? 11.351  6.726   16.509  1.00 17.84 ? 207 TYR A OH  1 
ATOM   1631 N N   . GLY A 1 208 ? 10.297  -1.345  14.305  1.00 18.98 ? 208 GLY A N   1 
ATOM   1632 C CA  . GLY A 1 208 ? 10.292  -2.774  14.043  1.00 16.69 ? 208 GLY A CA  1 
ATOM   1633 C C   . GLY A 1 208 ? 10.964  -3.110  12.725  1.00 16.68 ? 208 GLY A C   1 
ATOM   1634 O O   . GLY A 1 208 ? 11.826  -3.980  12.671  1.00 17.04 ? 208 GLY A O   1 
ATOM   1635 N N   . PRO A 1 209 ? 10.592  -2.425  11.638  1.00 17.87 ? 209 PRO A N   1 
ATOM   1636 C CA  . PRO A 1 209 ? 11.192  -2.689  10.327  1.00 18.15 ? 209 PRO A CA  1 
ATOM   1637 C C   . PRO A 1 209 ? 12.701  -2.443  10.259  1.00 16.97 ? 209 PRO A C   1 
ATOM   1638 O O   . PRO A 1 209 ? 13.364  -2.980  9.382   1.00 18.62 ? 209 PRO A O   1 
ATOM   1639 C CB  . PRO A 1 209 ? 10.422  -1.749  9.394   1.00 16.51 ? 209 PRO A CB  1 
ATOM   1640 C CG  . PRO A 1 209 ? 9.092   -1.583  10.080  1.00 18.00 ? 209 PRO A CG  1 
ATOM   1641 C CD  . PRO A 1 209 ? 9.497   -1.444  11.527  1.00 20.12 ? 209 PRO A CD  1 
ATOM   1642 N N   . THR A 1 210 ? 13.241  -1.638  11.173  1.00 14.68 ? 210 THR A N   1 
ATOM   1643 C CA  . THR A 1 210 ? 14.671  -1.343  11.150  1.00 14.61 ? 210 THR A CA  1 
ATOM   1644 C C   . THR A 1 210 ? 15.581  -2.452  11.709  1.00 20.57 ? 210 THR A C   1 
ATOM   1645 O O   . THR A 1 210 ? 16.781  -2.465  11.431  1.00 24.72 ? 210 THR A O   1 
ATOM   1646 C CB  . THR A 1 210 ? 15.001  -0.008  11.892  1.00 14.41 ? 210 THR A CB  1 
ATOM   1647 O OG1 . THR A 1 210 ? 14.759  -0.146  13.297  1.00 13.79 ? 210 THR A OG1 1 
ATOM   1648 C CG2 . THR A 1 210 ? 14.155  1.130   11.354  1.00 11.65 ? 210 THR A CG2 1 
ATOM   1649 N N   . VAL A 1 211 ? 15.034  -3.392  12.477  1.00 17.06 ? 211 VAL A N   1 
ATOM   1650 C CA  . VAL A 1 211 ? 15.873  -4.452  13.022  1.00 17.74 ? 211 VAL A CA  1 
ATOM   1651 C C   . VAL A 1 211 ? 16.653  -5.229  11.957  1.00 18.26 ? 211 VAL A C   1 
ATOM   1652 O O   . VAL A 1 211 ? 17.860  -5.406  12.075  1.00 21.86 ? 211 VAL A O   1 
ATOM   1653 C CB  . VAL A 1 211 ? 15.048  -5.441  13.849  1.00 22.85 ? 211 VAL A CB  1 
ATOM   1654 C CG1 . VAL A 1 211 ? 15.955  -6.554  14.373  1.00 18.99 ? 211 VAL A CG1 1 
ATOM   1655 C CG2 . VAL A 1 211 ? 14.367  -4.702  15.008  1.00 20.33 ? 211 VAL A CG2 1 
ATOM   1656 N N   . LEU A 1 212 ? 15.963  -5.692  10.923  1.00 17.72 ? 212 LEU A N   1 
ATOM   1657 C CA  . LEU A 1 212 ? 16.602  -6.430  9.848   1.00 17.85 ? 212 LEU A CA  1 
ATOM   1658 C C   . LEU A 1 212 ? 17.725  -5.624  9.183   1.00 18.38 ? 212 LEU A C   1 
ATOM   1659 O O   . LEU A 1 212 ? 18.798  -6.156  8.910   1.00 19.32 ? 212 LEU A O   1 
ATOM   1660 C CB  . LEU A 1 212 ? 15.570  -6.819  8.791   1.00 18.43 ? 212 LEU A CB  1 
ATOM   1661 C CG  . LEU A 1 212 ? 16.125  -7.563  7.566   1.00 25.13 ? 212 LEU A CG  1 
ATOM   1662 C CD1 . LEU A 1 212 ? 16.448  -9.013  7.941   1.00 22.93 ? 212 LEU A CD1 1 
ATOM   1663 C CD2 . LEU A 1 212 ? 15.098  -7.529  6.437   1.00 25.67 ? 212 LEU A CD2 1 
ATOM   1664 N N   . VAL A 1 213 ? 17.472  -4.345  8.914   1.00 18.12 ? 213 VAL A N   1 
ATOM   1665 C CA  . VAL A 1 213 ? 18.470  -3.482  8.272   1.00 16.51 ? 213 VAL A CA  1 
ATOM   1666 C C   . VAL A 1 213 ? 19.729  -3.294  9.139   1.00 14.22 ? 213 VAL A C   1 
ATOM   1667 O O   . VAL A 1 213 ? 20.836  -3.186  8.623   1.00 13.54 ? 213 VAL A O   1 
ATOM   1668 C CB  . VAL A 1 213 ? 17.854  -2.080  7.923   1.00 16.00 ? 213 VAL A CB  1 
ATOM   1669 C CG1 . VAL A 1 213 ? 18.887  -1.189  7.256   1.00 14.40 ? 213 VAL A CG1 1 
ATOM   1670 C CG2 . VAL A 1 213 ? 16.657  -2.251  6.999   1.00 14.34 ? 213 VAL A CG2 1 
ATOM   1671 N N   . GLN A 1 214 ? 19.549  -3.255  10.453  1.00 18.54 ? 214 GLN A N   1 
ATOM   1672 C CA  . GLN A 1 214 ? 20.659  -3.095  11.391  1.00 21.96 ? 214 GLN A CA  1 
ATOM   1673 C C   . GLN A 1 214 ? 21.550  -4.344  11.370  1.00 22.48 ? 214 GLN A C   1 
ATOM   1674 O O   . GLN A 1 214 ? 22.770  -4.243  11.472  1.00 21.74 ? 214 GLN A O   1 
ATOM   1675 C CB  . GLN A 1 214 ? 20.099  -2.848  12.799  1.00 26.29 ? 214 GLN A CB  1 
ATOM   1676 C CG  . GLN A 1 214 ? 21.094  -3.000  13.943  1.00 37.32 ? 214 GLN A CG  1 
ATOM   1677 C CD  . GLN A 1 214 ? 22.144  -1.905  13.974  1.00 41.85 ? 214 GLN A CD  1 
ATOM   1678 O OE1 . GLN A 1 214 ? 21.822  -0.726  14.106  1.00 48.25 ? 214 GLN A OE1 1 
ATOM   1679 N NE2 . GLN A 1 214 ? 23.410  -2.292  13.852  1.00 44.54 ? 214 GLN A NE2 1 
ATOM   1680 N N   . GLN A 1 215 ? 20.935  -5.516  11.233  1.00 21.89 ? 215 GLN A N   1 
ATOM   1681 C CA  . GLN A 1 215 ? 21.678  -6.773  11.179  1.00 26.28 ? 215 GLN A CA  1 
ATOM   1682 C C   . GLN A 1 215 ? 22.457  -6.805  9.865   1.00 25.86 ? 215 GLN A C   1 
ATOM   1683 O O   . GLN A 1 215 ? 23.605  -7.249  9.807   1.00 24.44 ? 215 GLN A O   1 
ATOM   1684 C CB  . GLN A 1 215 ? 20.715  -7.966  11.228  1.00 29.67 ? 215 GLN A CB  1 
ATOM   1685 C CG  . GLN A 1 215 ? 19.923  -8.086  12.516  1.00 36.00 ? 215 GLN A CG  1 
ATOM   1686 C CD  . GLN A 1 215 ? 20.730  -8.719  13.642  1.00 42.35 ? 215 GLN A CD  1 
ATOM   1687 O OE1 . GLN A 1 215 ? 20.697  -8.252  14.790  1.00 43.24 ? 215 GLN A OE1 1 
ATOM   1688 N NE2 . GLN A 1 215 ? 21.454  -9.792  13.322  1.00 40.41 ? 215 GLN A NE2 1 
ATOM   1689 N N   . GLU A 1 216 ? 21.815  -6.334  8.804   1.00 24.19 ? 216 GLU A N   1 
ATOM   1690 C CA  . GLU A 1 216 ? 22.447  -6.306  7.506   1.00 23.25 ? 216 GLU A CA  1 
ATOM   1691 C C   . GLU A 1 216 ? 23.670  -5.393  7.560   1.00 24.34 ? 216 GLU A C   1 
ATOM   1692 O O   . GLU A 1 216 ? 24.654  -5.619  6.854   1.00 27.30 ? 216 GLU A O   1 
ATOM   1693 C CB  . GLU A 1 216 ? 21.461  -5.821  6.455   1.00 24.93 ? 216 GLU A CB  1 
ATOM   1694 C CG  . GLU A 1 216 ? 22.036  -5.805  5.049   1.00 38.69 ? 216 GLU A CG  1 
ATOM   1695 C CD  . GLU A 1 216 ? 22.753  -7.104  4.691   1.00 46.51 ? 216 GLU A CD  1 
ATOM   1696 O OE1 . GLU A 1 216 ? 22.198  -8.191  4.984   1.00 48.61 ? 216 GLU A OE1 1 
ATOM   1697 O OE2 . GLU A 1 216 ? 23.866  -7.032  4.112   1.00 48.76 ? 216 GLU A OE2 1 
ATOM   1698 N N   . ALA A 1 217 ? 23.614  -4.368  8.403   1.00 21.40 ? 217 ALA A N   1 
ATOM   1699 C CA  . ALA A 1 217 ? 24.745  -3.466  8.545   1.00 22.17 ? 217 ALA A CA  1 
ATOM   1700 C C   . ALA A 1 217 ? 25.873  -4.197  9.280   1.00 23.20 ? 217 ALA A C   1 
ATOM   1701 O O   . ALA A 1 217 ? 27.032  -4.166  8.853   1.00 20.19 ? 217 ALA A O   1 
ATOM   1702 C CB  . ALA A 1 217 ? 24.332  -2.213  9.327   1.00 20.54 ? 217 ALA A CB  1 
ATOM   1703 N N   . LEU A 1 218 ? 25.534  -4.852  10.386  1.00 20.87 ? 218 LEU A N   1 
ATOM   1704 C CA  . LEU A 1 218 ? 26.541  -5.566  11.156  1.00 25.75 ? 218 LEU A CA  1 
ATOM   1705 C C   . LEU A 1 218 ? 27.302  -6.580  10.298  1.00 27.26 ? 218 LEU A C   1 
ATOM   1706 O O   . LEU A 1 218 ? 28.529  -6.651  10.374  1.00 28.57 ? 218 LEU A O   1 
ATOM   1707 C CB  . LEU A 1 218 ? 25.896  -6.254  12.359  1.00 21.26 ? 218 LEU A CB  1 
ATOM   1708 C CG  . LEU A 1 218 ? 25.353  -5.259  13.390  1.00 25.04 ? 218 LEU A CG  1 
ATOM   1709 C CD1 . LEU A 1 218 ? 24.471  -5.980  14.386  1.00 25.29 ? 218 LEU A CD1 1 
ATOM   1710 C CD2 . LEU A 1 218 ? 26.514  -4.551  14.082  1.00 25.42 ? 218 LEU A CD2 1 
ATOM   1711 N N   . LYS A 1 219 ? 26.588  -7.335  9.461   1.00 28.88 ? 219 LYS A N   1 
ATOM   1712 C CA  . LYS A 1 219 ? 27.219  -8.341  8.606   1.00 32.97 ? 219 LYS A CA  1 
ATOM   1713 C C   . LYS A 1 219 ? 28.069  -7.713  7.506   1.00 33.46 ? 219 LYS A C   1 
ATOM   1714 O O   . LYS A 1 219 ? 28.877  -8.391  6.864   1.00 34.15 ? 219 LYS A O   1 
ATOM   1715 C CB  . LYS A 1 219 ? 26.169  -9.261  7.960   1.00 36.71 ? 219 LYS A CB  1 
ATOM   1716 C CG  . LYS A 1 219 ? 25.603  -8.753  6.634   1.00 42.26 ? 219 LYS A CG  1 
ATOM   1717 C CD  . LYS A 1 219 ? 25.644  -9.838  5.542   1.00 48.65 ? 219 LYS A CD  1 
ATOM   1718 C CE  . LYS A 1 219 ? 24.632  -10.969 5.777   1.00 49.60 ? 219 LYS A CE  1 
ATOM   1719 N NZ  . LYS A 1 219 ? 23.212  -10.525 5.598   1.00 48.11 ? 219 LYS A NZ  1 
ATOM   1720 N N   . ARG A 1 220 ? 27.879  -6.417  7.285   1.00 34.84 ? 220 ARG A N   1 
ATOM   1721 C CA  . ARG A 1 220 ? 28.634  -5.698  6.268   1.00 32.59 ? 220 ARG A CA  1 
ATOM   1722 C C   . ARG A 1 220 ? 29.816  -5.007  6.939   1.00 31.44 ? 220 ARG A C   1 
ATOM   1723 O O   . ARG A 1 220 ? 30.658  -4.409  6.276   1.00 33.20 ? 220 ARG A O   1 
ATOM   1724 C CB  . ARG A 1 220 ? 27.745  -4.662  5.585   1.00 34.65 ? 220 ARG A CB  1 
ATOM   1725 C CG  . ARG A 1 220 ? 28.041  -4.480  4.115   1.00 38.56 ? 220 ARG A CG  1 
ATOM   1726 C CD  . ARG A 1 220 ? 27.494  -5.649  3.313   1.00 41.67 ? 220 ARG A CD  1 
ATOM   1727 N NE  . ARG A 1 220 ? 26.049  -5.550  3.106   1.00 45.89 ? 220 ARG A NE  1 
ATOM   1728 C CZ  . ARG A 1 220 ? 25.462  -4.635  2.336   1.00 47.84 ? 220 ARG A CZ  1 
ATOM   1729 N NH1 . ARG A 1 220 ? 26.194  -3.729  1.693   1.00 47.98 ? 220 ARG A NH1 1 
ATOM   1730 N NH2 . ARG A 1 220 ? 24.141  -4.625  2.202   1.00 48.35 ? 220 ARG A NH2 1 
ATOM   1731 N N   . GLY A 1 221 ? 29.864  -5.086  8.264   1.00 29.78 ? 221 GLY A N   1 
ATOM   1732 C CA  . GLY A 1 221 ? 30.955  -4.480  8.997   1.00 29.73 ? 221 GLY A CA  1 
ATOM   1733 C C   . GLY A 1 221 ? 30.705  -3.050  9.432   1.00 34.63 ? 221 GLY A C   1 
ATOM   1734 O O   . GLY A 1 221 ? 31.640  -2.246  9.492   1.00 34.74 ? 221 GLY A O   1 
ATOM   1735 N N   . CYS A 1 222 ? 29.453  -2.722  9.745   1.00 32.59 ? 222 CYS A N   1 
ATOM   1736 C CA  . CYS A 1 222 ? 29.123  -1.373  10.178  1.00 31.54 ? 222 CYS A CA  1 
ATOM   1737 C C   . CYS A 1 222 ? 28.287  -1.444  11.442  1.00 35.88 ? 222 CYS A C   1 
ATOM   1738 O O   . CYS A 1 222 ? 27.521  -2.392  11.626  1.00 40.06 ? 222 CYS A O   1 
ATOM   1739 C CB  . CYS A 1 222 ? 28.353  -0.638  9.081   1.00 29.08 ? 222 CYS A CB  1 
ATOM   1740 S SG  . CYS A 1 222 ? 29.279  -0.393  7.531   1.00 27.63 ? 222 CYS A SG  1 
ATOM   1741 N N   . GLU A 1 223 ? 28.436  -0.448  12.313  1.00 34.13 ? 223 GLU A N   1 
ATOM   1742 C CA  . GLU A 1 223 ? 27.687  -0.413  13.565  1.00 32.15 ? 223 GLU A CA  1 
ATOM   1743 C C   . GLU A 1 223 ? 26.293  0.197   13.431  1.00 30.29 ? 223 GLU A C   1 
ATOM   1744 O O   . GLU A 1 223 ? 25.395  -0.160  14.187  1.00 31.84 ? 223 GLU A O   1 
ATOM   1745 C CB  . GLU A 1 223 ? 28.445  0.386   14.642  1.00 36.13 ? 223 GLU A CB  1 
ATOM   1746 C CG  . GLU A 1 223 ? 29.681  -0.271  15.252  1.00 35.29 ? 223 GLU A CG  1 
ATOM   1747 C CD  . GLU A 1 223 ? 30.910  -0.130  14.388  1.00 41.46 ? 223 GLU A CD  1 
ATOM   1748 O OE1 . GLU A 1 223 ? 31.230  1.012   13.990  1.00 41.54 ? 223 GLU A OE1 1 
ATOM   1749 O OE2 . GLU A 1 223 ? 31.564  -1.162  14.112  1.00 45.88 ? 223 GLU A OE2 1 
ATOM   1750 N N   . GLN A 1 224 ? 26.114  1.118   12.486  1.00 27.91 ? 224 GLN A N   1 
ATOM   1751 C CA  . GLN A 1 224 ? 24.827  1.796   12.319  1.00 26.32 ? 224 GLN A CA  1 
ATOM   1752 C C   . GLN A 1 224 ? 24.384  1.966   10.881  1.00 23.04 ? 224 GLN A C   1 
ATOM   1753 O O   . GLN A 1 224 ? 25.152  1.772   9.937   1.00 23.33 ? 224 GLN A O   1 
ATOM   1754 C CB  . GLN A 1 224 ? 24.878  3.191   12.949  1.00 30.21 ? 224 GLN A CB  1 
ATOM   1755 C CG  . GLN A 1 224 ? 25.208  3.224   14.427  1.00 37.05 ? 224 GLN A CG  1 
ATOM   1756 C CD  . GLN A 1 224 ? 24.024  2.865   15.293  1.00 41.14 ? 224 GLN A CD  1 
ATOM   1757 O OE1 . GLN A 1 224 ? 24.092  2.949   16.522  1.00 46.27 ? 224 GLN A OE1 1 
ATOM   1758 N NE2 . GLN A 1 224 ? 22.925  2.464   14.659  1.00 42.88 ? 224 GLN A NE2 1 
ATOM   1759 N N   . VAL A 1 225 ? 23.135  2.385   10.730  1.00 19.63 ? 225 VAL A N   1 
ATOM   1760 C CA  . VAL A 1 225 ? 22.559  2.591   9.412   1.00 18.72 ? 225 VAL A CA  1 
ATOM   1761 C C   . VAL A 1 225 ? 22.353  4.079   9.085   1.00 22.84 ? 225 VAL A C   1 
ATOM   1762 O O   . VAL A 1 225 ? 21.801  4.851   9.891   1.00 18.08 ? 225 VAL A O   1 
ATOM   1763 C CB  . VAL A 1 225 ? 21.192  1.873   9.288   1.00 17.16 ? 225 VAL A CB  1 
ATOM   1764 C CG1 . VAL A 1 225 ? 20.602  2.115   7.912   1.00 18.84 ? 225 VAL A CG1 1 
ATOM   1765 C CG2 . VAL A 1 225 ? 21.355  0.379   9.540   1.00 17.56 ? 225 VAL A CG2 1 
ATOM   1766 N N   . LEU A 1 226 ? 22.821  4.484   7.908   1.00 19.24 ? 226 LEU A N   1 
ATOM   1767 C CA  . LEU A 1 226 ? 22.629  5.852   7.467   1.00 18.16 ? 226 LEU A CA  1 
ATOM   1768 C C   . LEU A 1 226 ? 21.444  5.797   6.516   1.00 17.36 ? 226 LEU A C   1 
ATOM   1769 O O   . LEU A 1 226 ? 21.547  5.228   5.430   1.00 15.61 ? 226 LEU A O   1 
ATOM   1770 C CB  . LEU A 1 226 ? 23.869  6.384   6.740   1.00 18.55 ? 226 LEU A CB  1 
ATOM   1771 C CG  . LEU A 1 226 ? 23.747  7.755   6.052   1.00 15.60 ? 226 LEU A CG  1 
ATOM   1772 C CD1 . LEU A 1 226 ? 23.216  8.834   6.986   1.00 15.18 ? 226 LEU A CD1 1 
ATOM   1773 C CD2 . LEU A 1 226 ? 25.110  8.130   5.535   1.00 18.81 ? 226 LEU A CD2 1 
ATOM   1774 N N   . TRP A 1 227 ? 20.320  6.376   6.937   1.00 18.31 ? 227 TRP A N   1 
ATOM   1775 C CA  . TRP A 1 227 ? 19.106  6.383   6.124   1.00 16.87 ? 227 TRP A CA  1 
ATOM   1776 C C   . TRP A 1 227 ? 19.108  7.449   5.040   1.00 17.41 ? 227 TRP A C   1 
ATOM   1777 O O   . TRP A 1 227 ? 19.161  8.639   5.322   1.00 19.47 ? 227 TRP A O   1 
ATOM   1778 C CB  . TRP A 1 227 ? 17.877  6.574   7.006   1.00 16.31 ? 227 TRP A CB  1 
ATOM   1779 C CG  . TRP A 1 227 ? 17.763  5.545   8.070   1.00 17.83 ? 227 TRP A CG  1 
ATOM   1780 C CD1 . TRP A 1 227 ? 18.187  5.652   9.365   1.00 14.13 ? 227 TRP A CD1 1 
ATOM   1781 C CD2 . TRP A 1 227 ? 17.241  4.220   7.922   1.00 17.11 ? 227 TRP A CD2 1 
ATOM   1782 N NE1 . TRP A 1 227 ? 17.962  4.470   10.034  1.00 18.63 ? 227 TRP A NE1 1 
ATOM   1783 C CE2 . TRP A 1 227 ? 17.382  3.574   9.173   1.00 18.56 ? 227 TRP A CE2 1 
ATOM   1784 C CE3 . TRP A 1 227 ? 16.666  3.514   6.854   1.00 21.46 ? 227 TRP A CE3 1 
ATOM   1785 C CZ2 . TRP A 1 227 ? 16.969  2.248   9.387   1.00 16.73 ? 227 TRP A CZ2 1 
ATOM   1786 C CZ3 . TRP A 1 227 ? 16.253  2.192   7.068   1.00 20.38 ? 227 TRP A CZ3 1 
ATOM   1787 C CH2 . TRP A 1 227 ? 16.409  1.578   8.327   1.00 16.15 ? 227 TRP A CH2 1 
ATOM   1788 N N   . LEU A 1 228 ? 19.034  7.005   3.795   1.00 18.41 ? 228 LEU A N   1 
ATOM   1789 C CA  . LEU A 1 228 ? 19.021  7.908   2.659   1.00 18.15 ? 228 LEU A CA  1 
ATOM   1790 C C   . LEU A 1 228 ? 17.609  7.994   2.121   1.00 18.96 ? 228 LEU A C   1 
ATOM   1791 O O   . LEU A 1 228 ? 16.856  7.017   2.173   1.00 20.55 ? 228 LEU A O   1 
ATOM   1792 C CB  . LEU A 1 228 ? 19.941  7.379   1.566   1.00 15.34 ? 228 LEU A CB  1 
ATOM   1793 C CG  . LEU A 1 228 ? 21.374  7.102   1.996   1.00 16.93 ? 228 LEU A CG  1 
ATOM   1794 C CD1 . LEU A 1 228 ? 22.088  6.381   0.863   1.00 18.88 ? 228 LEU A CD1 1 
ATOM   1795 C CD2 . LEU A 1 228 ? 22.076  8.407   2.358   1.00 17.45 ? 228 LEU A CD2 1 
ATOM   1796 N N   . TYR A 1 229 ? 17.253  9.158   1.593   1.00 18.24 ? 229 TYR A N   1 
ATOM   1797 C CA  . TYR A 1 229 ? 15.922  9.353   1.036   1.00 17.69 ? 229 TYR A CA  1 
ATOM   1798 C C   . TYR A 1 229 ? 15.979  10.061  -0.310  1.00 16.72 ? 229 TYR A C   1 
ATOM   1799 O O   . TYR A 1 229 ? 16.817  10.934  -0.518  1.00 11.91 ? 229 TYR A O   1 
ATOM   1800 C CB  . TYR A 1 229 ? 15.064  10.181  1.994   1.00 17.42 ? 229 TYR A CB  1 
ATOM   1801 C CG  . TYR A 1 229 ? 13.640  10.362  1.511   1.00 19.13 ? 229 TYR A CG  1 
ATOM   1802 C CD1 . TYR A 1 229 ? 12.735  9.292   1.511   1.00 15.98 ? 229 TYR A CD1 1 
ATOM   1803 C CD2 . TYR A 1 229 ? 13.197  11.603  1.047   1.00 16.99 ? 229 TYR A CD2 1 
ATOM   1804 C CE1 . TYR A 1 229 ? 11.425  9.460   1.065   1.00 15.63 ? 229 TYR A CE1 1 
ATOM   1805 C CE2 . TYR A 1 229 ? 11.896  11.780  0.599   1.00 15.51 ? 229 TYR A CE2 1 
ATOM   1806 C CZ  . TYR A 1 229 ? 11.014  10.709  0.610   1.00 20.78 ? 229 TYR A CZ  1 
ATOM   1807 O OH  . TYR A 1 229 ? 9.724   10.906  0.165   1.00 26.12 ? 229 TYR A OH  1 
ATOM   1808 N N   . GLY A 1 230 ? 15.084  9.676   -1.217  1.00 17.30 ? 230 GLY A N   1 
ATOM   1809 C CA  . GLY A 1 230 ? 15.014  10.313  -2.522  1.00 18.64 ? 230 GLY A CA  1 
ATOM   1810 C C   . GLY A 1 230 ? 16.032  9.866   -3.552  1.00 22.06 ? 230 GLY A C   1 
ATOM   1811 O O   . GLY A 1 230 ? 17.041  9.239   -3.215  1.00 24.19 ? 230 GLY A O   1 
ATOM   1812 N N   . PRO A 1 231 ? 15.787  10.180  -4.835  1.00 22.91 ? 231 PRO A N   1 
ATOM   1813 C CA  . PRO A 1 231 ? 16.667  9.823   -5.953  1.00 24.26 ? 231 PRO A CA  1 
ATOM   1814 C C   . PRO A 1 231 ? 18.008  10.520  -5.795  1.00 24.04 ? 231 PRO A C   1 
ATOM   1815 O O   . PRO A 1 231 ? 19.025  10.045  -6.285  1.00 24.84 ? 231 PRO A O   1 
ATOM   1816 C CB  . PRO A 1 231 ? 15.907  10.334  -7.179  1.00 24.53 ? 231 PRO A CB  1 
ATOM   1817 C CG  . PRO A 1 231 ? 14.481  10.347  -6.735  1.00 27.78 ? 231 PRO A CG  1 
ATOM   1818 C CD  . PRO A 1 231 ? 14.585  10.874  -5.327  1.00 24.53 ? 231 PRO A CD  1 
ATOM   1819 N N   . ASP A 1 232 ? 17.997  11.663  -5.115  1.00 25.15 ? 232 ASP A N   1 
ATOM   1820 C CA  . ASP A 1 232 ? 19.216  12.430  -4.875  1.00 22.52 ? 232 ASP A CA  1 
ATOM   1821 C C   . ASP A 1 232 ? 19.988  11.941  -3.634  1.00 21.17 ? 232 ASP A C   1 
ATOM   1822 O O   . ASP A 1 232 ? 20.937  12.579  -3.191  1.00 17.24 ? 232 ASP A O   1 
ATOM   1823 C CB  . ASP A 1 232 ? 18.879  13.924  -4.730  1.00 25.40 ? 232 ASP A CB  1 
ATOM   1824 C CG  . ASP A 1 232 ? 17.574  14.167  -3.982  1.00 29.57 ? 232 ASP A CG  1 
ATOM   1825 O OD1 . ASP A 1 232 ? 17.072  13.235  -3.313  1.00 28.51 ? 232 ASP A OD1 1 
ATOM   1826 O OD2 . ASP A 1 232 ? 17.055  15.303  -4.064  1.00 34.37 ? 232 ASP A OD2 1 
ATOM   1827 N N   . HIS A 1 233 ? 19.562  10.810  -3.077  1.00 23.98 ? 233 HIS A N   1 
ATOM   1828 C CA  . HIS A 1 233 ? 20.200  10.210  -1.907  1.00 21.60 ? 233 HIS A CA  1 
ATOM   1829 C C   . HIS A 1 233 ? 20.543  11.212  -0.818  1.00 20.22 ? 233 HIS A C   1 
ATOM   1830 O O   . HIS A 1 233 ? 21.713  11.386  -0.470  1.00 20.04 ? 233 HIS A O   1 
ATOM   1831 C CB  . HIS A 1 233 ? 21.468  9.467   -2.332  1.00 21.69 ? 233 HIS A CB  1 
ATOM   1832 C CG  . HIS A 1 233 ? 21.202  8.263   -3.178  1.00 26.16 ? 233 HIS A CG  1 
ATOM   1833 N ND1 . HIS A 1 233 ? 22.204  7.570   -3.821  1.00 27.37 ? 233 HIS A ND1 1 
ATOM   1834 C CD2 . HIS A 1 233 ? 20.050  7.614   -3.469  1.00 27.89 ? 233 HIS A CD2 1 
ATOM   1835 C CE1 . HIS A 1 233 ? 21.682  6.545   -4.470  1.00 28.51 ? 233 HIS A CE1 1 
ATOM   1836 N NE2 . HIS A 1 233 ? 20.376  6.548   -4.273  1.00 30.31 ? 233 HIS A NE2 1 
ATOM   1837 N N   . GLN A 1 234 ? 19.529  11.869  -0.273  1.00 18.55 ? 234 GLN A N   1 
ATOM   1838 C CA  . GLN A 1 234 ? 19.794  12.837  0.774   1.00 21.17 ? 234 GLN A CA  1 
ATOM   1839 C C   . GLN A 1 234 ? 19.879  12.177  2.135   1.00 20.45 ? 234 GLN A C   1 
ATOM   1840 O O   . GLN A 1 234 ? 19.163  11.223  2.422   1.00 24.61 ? 234 GLN A O   1 
ATOM   1841 C CB  . GLN A 1 234 ? 18.752  13.971  0.759   1.00 18.25 ? 234 GLN A CB  1 
ATOM   1842 C CG  . GLN A 1 234 ? 17.297  13.570  0.659   1.00 23.86 ? 234 GLN A CG  1 
ATOM   1843 C CD  . GLN A 1 234 ? 16.405  14.730  0.199   1.00 24.67 ? 234 GLN A CD  1 
ATOM   1844 O OE1 . GLN A 1 234 ? 16.437  15.128  -0.965  1.00 25.09 ? 234 GLN A OE1 1 
ATOM   1845 N NE2 . GLN A 1 234 ? 15.623  15.277  1.117   1.00 22.85 ? 234 GLN A NE2 1 
ATOM   1846 N N   . LEU A 1 235 ? 20.798  12.669  2.958   1.00 19.86 ? 235 LEU A N   1 
ATOM   1847 C CA  . LEU A 1 235 ? 20.992  12.134  4.298   1.00 18.99 ? 235 LEU A CA  1 
ATOM   1848 C C   . LEU A 1 235 ? 19.875  12.619  5.204   1.00 18.37 ? 235 LEU A C   1 
ATOM   1849 O O   . LEU A 1 235 ? 19.548  13.807  5.209   1.00 20.20 ? 235 LEU A O   1 
ATOM   1850 C CB  . LEU A 1 235 ? 22.339  12.591  4.860   1.00 16.33 ? 235 LEU A CB  1 
ATOM   1851 C CG  . LEU A 1 235 ? 23.596  12.077  4.142   1.00 19.39 ? 235 LEU A CG  1 
ATOM   1852 C CD1 . LEU A 1 235 ? 23.585  12.509  2.675   1.00 14.83 ? 235 LEU A CD1 1 
ATOM   1853 C CD2 . LEU A 1 235 ? 24.832  12.608  4.851   1.00 14.97 ? 235 LEU A CD2 1 
ATOM   1854 N N   . THR A 1 236 ? 19.289  11.706  5.971   1.00 16.98 ? 236 THR A N   1 
ATOM   1855 C CA  . THR A 1 236 ? 18.211  12.078  6.874   1.00 15.66 ? 236 THR A CA  1 
ATOM   1856 C C   . THR A 1 236 ? 18.541  11.772  8.329   1.00 18.46 ? 236 THR A C   1 
ATOM   1857 O O   . THR A 1 236 ? 18.540  12.664  9.164   1.00 20.25 ? 236 THR A O   1 
ATOM   1858 C CB  . THR A 1 236 ? 16.889  11.362  6.498   1.00 15.68 ? 236 THR A CB  1 
ATOM   1859 O OG1 . THR A 1 236 ? 16.976  9.955   6.804   1.00 9.45  ? 236 THR A OG1 1 
ATOM   1860 C CG2 . THR A 1 236 ? 16.606  11.556  5.012   1.00 12.33 ? 236 THR A CG2 1 
ATOM   1861 N N   . GLU A 1 237 ? 18.823  10.508  8.629   1.00 20.04 ? 237 GLU A N   1 
ATOM   1862 C CA  . GLU A 1 237 ? 19.132  10.108  9.998   1.00 21.19 ? 237 GLU A CA  1 
ATOM   1863 C C   . GLU A 1 237 ? 20.166  8.977   10.099  1.00 22.63 ? 237 GLU A C   1 
ATOM   1864 O O   . GLU A 1 237 ? 20.533  8.349   9.100   1.00 24.09 ? 237 GLU A O   1 
ATOM   1865 C CB  . GLU A 1 237 ? 17.846  9.691   10.712  1.00 19.68 ? 237 GLU A CB  1 
ATOM   1866 C CG  . GLU A 1 237 ? 16.773  10.756  10.731  1.00 18.80 ? 237 GLU A CG  1 
ATOM   1867 C CD  . GLU A 1 237 ? 16.023  10.786  12.048  1.00 24.22 ? 237 GLU A CD  1 
ATOM   1868 O OE1 . GLU A 1 237 ? 16.635  10.416  13.065  1.00 23.01 ? 237 GLU A OE1 1 
ATOM   1869 O OE2 . GLU A 1 237 ? 14.840  11.196  12.077  1.00 23.48 ? 237 GLU A OE2 1 
ATOM   1870 N N   . VAL A 1 238 ? 20.643  8.740   11.316  1.00 21.37 ? 238 VAL A N   1 
ATOM   1871 C CA  . VAL A 1 238 ? 21.630  7.696   11.575  1.00 22.71 ? 238 VAL A CA  1 
ATOM   1872 C C   . VAL A 1 238 ? 21.064  6.818   12.669  1.00 20.68 ? 238 VAL A C   1 
ATOM   1873 O O   . VAL A 1 238 ? 20.936  7.269   13.803  1.00 23.00 ? 238 VAL A O   1 
ATOM   1874 C CB  . VAL A 1 238 ? 22.971  8.271   12.076  1.00 23.20 ? 238 VAL A CB  1 
ATOM   1875 C CG1 . VAL A 1 238 ? 23.965  7.146   12.317  1.00 25.10 ? 238 VAL A CG1 1 
ATOM   1876 C CG2 . VAL A 1 238 ? 23.531  9.228   11.063  1.00 28.45 ? 238 VAL A CG2 1 
ATOM   1877 N N   . GLY A 1 239 ? 20.740  5.570   12.333  1.00 16.60 ? 239 GLY A N   1 
ATOM   1878 C CA  . GLY A 1 239 ? 20.160  4.680   13.319  1.00 16.72 ? 239 GLY A CA  1 
ATOM   1879 C C   . GLY A 1 239 ? 18.944  5.379   13.898  1.00 17.79 ? 239 GLY A C   1 
ATOM   1880 O O   . GLY A 1 239 ? 17.974  5.634   13.183  1.00 18.09 ? 239 GLY A O   1 
ATOM   1881 N N   . THR A 1 240 ? 19.004  5.710   15.184  1.00 17.34 ? 240 THR A N   1 
ATOM   1882 C CA  . THR A 1 240 ? 17.914  6.409   15.852  1.00 20.12 ? 240 THR A CA  1 
ATOM   1883 C C   . THR A 1 240 ? 18.384  7.805   16.312  1.00 20.41 ? 240 THR A C   1 
ATOM   1884 O O   . THR A 1 240 ? 17.883  8.348   17.300  1.00 21.65 ? 240 THR A O   1 
ATOM   1885 C CB  . THR A 1 240 ? 17.418  5.618   17.084  1.00 20.90 ? 240 THR A CB  1 
ATOM   1886 O OG1 . THR A 1 240 ? 18.475  5.518   18.057  1.00 19.28 ? 240 THR A OG1 1 
ATOM   1887 C CG2 . THR A 1 240 ? 16.970  4.226   16.671  1.00 17.60 ? 240 THR A CG2 1 
ATOM   1888 N N   . MET A 1 241 ? 19.345  8.376   15.587  1.00 19.36 ? 241 MET A N   1 
ATOM   1889 C CA  . MET A 1 241 ? 19.891  9.699   15.913  1.00 18.72 ? 241 MET A CA  1 
ATOM   1890 C C   . MET A 1 241 ? 19.847  10.679  14.739  1.00 18.49 ? 241 MET A C   1 
ATOM   1891 O O   . MET A 1 241 ? 19.887  10.278  13.572  1.00 17.43 ? 241 MET A O   1 
ATOM   1892 C CB  . MET A 1 241 ? 21.356  9.588   16.341  1.00 19.54 ? 241 MET A CB  1 
ATOM   1893 C CG  . MET A 1 241 ? 21.666  8.625   17.462  1.00 19.55 ? 241 MET A CG  1 
ATOM   1894 S SD  . MET A 1 241 ? 23.452  8.398   17.554  1.00 24.57 ? 241 MET A SD  1 
ATOM   1895 C CE  . MET A 1 241 ? 23.632  6.919   16.537  1.00 22.09 ? 241 MET A CE  1 
ATOM   1896 N N   . ASN A 1 242 ? 19.792  11.969  15.064  1.00 19.70 ? 242 ASN A N   1 
ATOM   1897 C CA  . ASN A 1 242 ? 19.800  13.022  14.054  1.00 18.92 ? 242 ASN A CA  1 
ATOM   1898 C C   . ASN A 1 242 ? 21.245  13.152  13.560  1.00 19.92 ? 242 ASN A C   1 
ATOM   1899 O O   . ASN A 1 242 ? 22.186  12.828  14.290  1.00 18.20 ? 242 ASN A O   1 
ATOM   1900 C CB  . ASN A 1 242 ? 19.293  14.330  14.657  1.00 17.32 ? 242 ASN A CB  1 
ATOM   1901 C CG  . ASN A 1 242 ? 17.802  14.282  14.946  1.00 17.76 ? 242 ASN A CG  1 
ATOM   1902 O OD1 . ASN A 1 242 ? 16.992  14.119  14.033  1.00 18.42 ? 242 ASN A OD1 1 
ATOM   1903 N ND2 . ASN A 1 242 ? 17.434  14.411  16.209  1.00 14.42 ? 242 ASN A ND2 1 
ATOM   1904 N N   . ILE A 1 243 ? 21.420  13.602  12.321  1.00 17.66 ? 243 ILE A N   1 
ATOM   1905 C CA  . ILE A 1 243 ? 22.753  13.729  11.739  1.00 17.79 ? 243 ILE A CA  1 
ATOM   1906 C C   . ILE A 1 243 ? 23.200  15.186  11.552  1.00 18.46 ? 243 ILE A C   1 
ATOM   1907 O O   . ILE A 1 243 ? 22.419  16.039  11.124  1.00 17.70 ? 243 ILE A O   1 
ATOM   1908 C CB  . ILE A 1 243 ? 22.809  12.975  10.365  1.00 20.54 ? 243 ILE A CB  1 
ATOM   1909 C CG1 . ILE A 1 243 ? 24.221  13.000  9.789   1.00 22.48 ? 243 ILE A CG1 1 
ATOM   1910 C CG2 . ILE A 1 243 ? 21.857  13.613  9.368   1.00 20.52 ? 243 ILE A CG2 1 
ATOM   1911 C CD1 . ILE A 1 243 ? 25.174  12.100  10.497  1.00 27.15 ? 243 ILE A CD1 1 
ATOM   1912 N N   . PHE A 1 244 ? 24.455  15.462  11.902  1.00 18.42 ? 244 PHE A N   1 
ATOM   1913 C CA  . PHE A 1 244 ? 25.038  16.796  11.751  1.00 16.60 ? 244 PHE A CA  1 
ATOM   1914 C C   . PHE A 1 244 ? 26.347  16.701  10.975  1.00 16.79 ? 244 PHE A C   1 
ATOM   1915 O O   . PHE A 1 244 ? 27.083  15.729  11.107  1.00 14.01 ? 244 PHE A O   1 
ATOM   1916 C CB  . PHE A 1 244 ? 25.360  17.439  13.104  1.00 14.89 ? 244 PHE A CB  1 
ATOM   1917 C CG  . PHE A 1 244 ? 24.167  17.968  13.839  1.00 17.05 ? 244 PHE A CG  1 
ATOM   1918 C CD1 . PHE A 1 244 ? 23.322  17.111  14.532  1.00 15.74 ? 244 PHE A CD1 1 
ATOM   1919 C CD2 . PHE A 1 244 ? 23.907  19.331  13.867  1.00 13.70 ? 244 PHE A CD2 1 
ATOM   1920 C CE1 . PHE A 1 244 ? 22.233  17.609  15.246  1.00 14.35 ? 244 PHE A CE1 1 
ATOM   1921 C CE2 . PHE A 1 244 ? 22.826  19.835  14.576  1.00 14.36 ? 244 PHE A CE2 1 
ATOM   1922 C CZ  . PHE A 1 244 ? 21.985  18.968  15.270  1.00 13.06 ? 244 PHE A CZ  1 
ATOM   1923 N N   . VAL A 1 245 ? 26.634  17.722  10.176  1.00 18.08 ? 245 VAL A N   1 
ATOM   1924 C CA  . VAL A 1 245 ? 27.875  17.768  9.415   1.00 19.50 ? 245 VAL A CA  1 
ATOM   1925 C C   . VAL A 1 245 ? 28.572  19.116  9.659   1.00 19.63 ? 245 VAL A C   1 
ATOM   1926 O O   . VAL A 1 245 ? 27.966  20.185  9.539   1.00 18.26 ? 245 VAL A O   1 
ATOM   1927 C CB  . VAL A 1 245 ? 27.625  17.579  7.896   1.00 21.14 ? 245 VAL A CB  1 
ATOM   1928 C CG1 . VAL A 1 245 ? 28.938  17.623  7.137   1.00 18.34 ? 245 VAL A CG1 1 
ATOM   1929 C CG2 . VAL A 1 245 ? 26.933  16.243  7.644   1.00 25.21 ? 245 VAL A CG2 1 
ATOM   1930 N N   . TYR A 1 246 ? 29.842  19.046  10.030  1.00 17.67 ? 246 TYR A N   1 
ATOM   1931 C CA  . TYR A 1 246 ? 30.644  20.236  10.290  1.00 21.19 ? 246 TYR A CA  1 
ATOM   1932 C C   . TYR A 1 246 ? 31.685  20.351  9.164   1.00 19.36 ? 246 TYR A C   1 
ATOM   1933 O O   . TYR A 1 246 ? 32.611  19.538  9.071   1.00 16.49 ? 246 TYR A O   1 
ATOM   1934 C CB  . TYR A 1 246 ? 31.316  20.101  11.661  1.00 19.09 ? 246 TYR A CB  1 
ATOM   1935 C CG  . TYR A 1 246 ? 32.084  21.307  12.122  1.00 20.48 ? 246 TYR A CG  1 
ATOM   1936 C CD1 . TYR A 1 246 ? 31.551  22.592  11.997  1.00 21.12 ? 246 TYR A CD1 1 
ATOM   1937 C CD2 . TYR A 1 246 ? 33.328  21.163  12.744  1.00 20.41 ? 246 TYR A CD2 1 
ATOM   1938 C CE1 . TYR A 1 246 ? 32.240  23.703  12.486  1.00 19.73 ? 246 TYR A CE1 1 
ATOM   1939 C CE2 . TYR A 1 246 ? 34.021  22.264  13.235  1.00 17.87 ? 246 TYR A CE2 1 
ATOM   1940 C CZ  . TYR A 1 246 ? 33.474  23.524  13.103  1.00 21.14 ? 246 TYR A CZ  1 
ATOM   1941 O OH  . TYR A 1 246 ? 34.167  24.607  13.583  1.00 25.78 ? 246 TYR A OH  1 
ATOM   1942 N N   . TRP A 1 247 ? 31.529  21.363  8.312   1.00 17.11 ? 247 TRP A N   1 
ATOM   1943 C CA  . TRP A 1 247 ? 32.440  21.537  7.185   1.00 19.69 ? 247 TRP A CA  1 
ATOM   1944 C C   . TRP A 1 247 ? 32.490  22.957  6.662   1.00 21.10 ? 247 TRP A C   1 
ATOM   1945 O O   . TRP A 1 247 ? 31.815  23.860  7.160   1.00 21.07 ? 247 TRP A O   1 
ATOM   1946 C CB  . TRP A 1 247 ? 32.002  20.650  6.012   1.00 14.83 ? 247 TRP A CB  1 
ATOM   1947 C CG  . TRP A 1 247 ? 30.603  20.993  5.505   1.00 16.53 ? 247 TRP A CG  1 
ATOM   1948 C CD1 . TRP A 1 247 ? 29.835  22.075  5.866   1.00 13.07 ? 247 TRP A CD1 1 
ATOM   1949 C CD2 . TRP A 1 247 ? 29.817  20.250  4.562   1.00 17.33 ? 247 TRP A CD2 1 
ATOM   1950 N NE1 . TRP A 1 247 ? 28.630  22.045  5.213   1.00 15.05 ? 247 TRP A NE1 1 
ATOM   1951 C CE2 . TRP A 1 247 ? 28.588  20.939  4.405   1.00 16.56 ? 247 TRP A CE2 1 
ATOM   1952 C CE3 . TRP A 1 247 ? 30.029  19.072  3.833   1.00 15.38 ? 247 TRP A CE3 1 
ATOM   1953 C CZ2 . TRP A 1 247 ? 27.577  20.487  3.542   1.00 15.55 ? 247 TRP A CZ2 1 
ATOM   1954 C CZ3 . TRP A 1 247 ? 29.024  18.624  2.975   1.00 15.53 ? 247 TRP A CZ3 1 
ATOM   1955 C CH2 . TRP A 1 247 ? 27.811  19.334  2.839   1.00 15.66 ? 247 TRP A CH2 1 
ATOM   1956 N N   . THR A 1 248 ? 33.297  23.114  5.621   1.00 23.94 ? 248 THR A N   1 
ATOM   1957 C CA  . THR A 1 248 ? 33.451  24.368  4.907   1.00 24.39 ? 248 THR A CA  1 
ATOM   1958 C C   . THR A 1 248 ? 32.637  24.082  3.654   1.00 26.59 ? 248 THR A C   1 
ATOM   1959 O O   . THR A 1 248 ? 33.008  23.224  2.844   1.00 27.43 ? 248 THR A O   1 
ATOM   1960 C CB  . THR A 1 248 ? 34.924  24.637  4.528   1.00 23.40 ? 248 THR A CB  1 
ATOM   1961 O OG1 . THR A 1 248 ? 35.639  25.085  5.685   1.00 25.15 ? 248 THR A OG1 1 
ATOM   1962 C CG2 . THR A 1 248 ? 35.013  25.685  3.450   1.00 20.17 ? 248 THR A CG2 1 
ATOM   1963 N N   . HIS A 1 249 ? 31.514  24.781  3.520   1.00 26.21 ? 249 HIS A N   1 
ATOM   1964 C CA  . HIS A 1 249 ? 30.617  24.586  2.393   1.00 25.91 ? 249 HIS A CA  1 
ATOM   1965 C C   . HIS A 1 249 ? 31.170  25.106  1.065   1.00 26.13 ? 249 HIS A C   1 
ATOM   1966 O O   . HIS A 1 249 ? 32.190  25.801  1.032   1.00 22.02 ? 249 HIS A O   1 
ATOM   1967 C CB  . HIS A 1 249 ? 29.272  25.257  2.684   1.00 25.57 ? 249 HIS A CB  1 
ATOM   1968 C CG  . HIS A 1 249 ? 28.177  24.827  1.760   1.00 28.04 ? 249 HIS A CG  1 
ATOM   1969 N ND1 . HIS A 1 249 ? 27.138  25.656  1.399   1.00 27.83 ? 249 HIS A ND1 1 
ATOM   1970 C CD2 . HIS A 1 249 ? 27.960  23.652  1.121   1.00 30.23 ? 249 HIS A CD2 1 
ATOM   1971 C CE1 . HIS A 1 249 ? 26.329  25.013  0.576   1.00 26.42 ? 249 HIS A CE1 1 
ATOM   1972 N NE2 . HIS A 1 249 ? 26.806  23.795  0.391   1.00 28.85 ? 249 HIS A NE2 1 
ATOM   1973 N N   . GLU A 1 250 ? 30.475  24.746  -0.018  1.00 28.28 ? 250 GLU A N   1 
ATOM   1974 C CA  . GLU A 1 250 ? 30.804  25.144  -1.390  1.00 28.50 ? 250 GLU A CA  1 
ATOM   1975 C C   . GLU A 1 250 ? 31.195  26.620  -1.486  1.00 28.10 ? 250 GLU A C   1 
ATOM   1976 O O   . GLU A 1 250 ? 32.166  26.974  -2.152  1.00 28.14 ? 250 GLU A O   1 
ATOM   1977 C CB  . GLU A 1 250 ? 29.599  24.895  -2.316  1.00 27.04 ? 250 GLU A CB  1 
ATOM   1978 C CG  . GLU A 1 250 ? 29.749  23.729  -3.286  1.00 30.84 ? 250 GLU A CG  1 
ATOM   1979 C CD  . GLU A 1 250 ? 28.812  22.563  -2.977  1.00 37.21 ? 250 GLU A CD  1 
ATOM   1980 O OE1 . GLU A 1 250 ? 28.927  21.498  -3.626  1.00 37.11 ? 250 GLU A OE1 1 
ATOM   1981 O OE2 . GLU A 1 250 ? 27.955  22.713  -2.084  1.00 40.83 ? 250 GLU A OE2 1 
ATOM   1982 N N   . ASP A 1 251 ? 30.433  27.474  -0.812  1.00 28.53 ? 251 ASP A N   1 
ATOM   1983 C CA  . ASP A 1 251 ? 30.688  28.911  -0.842  1.00 27.82 ? 251 ASP A CA  1 
ATOM   1984 C C   . ASP A 1 251 ? 31.849  29.392  0.033   1.00 27.58 ? 251 ASP A C   1 
ATOM   1985 O O   . ASP A 1 251 ? 31.947  30.576  0.350   1.00 26.84 ? 251 ASP A O   1 
ATOM   1986 C CB  . ASP A 1 251 ? 29.415  29.673  -0.462  1.00 27.21 ? 251 ASP A CB  1 
ATOM   1987 C CG  . ASP A 1 251 ? 28.951  29.374  0.949   1.00 28.37 ? 251 ASP A CG  1 
ATOM   1988 O OD1 . ASP A 1 251 ? 28.074  30.121  1.444   1.00 23.86 ? 251 ASP A OD1 1 
ATOM   1989 O OD2 . ASP A 1 251 ? 29.454  28.395  1.556   1.00 30.11 ? 251 ASP A OD2 1 
ATOM   1990 N N   . GLY A 1 252 ? 32.726  28.476  0.426   1.00 28.28 ? 252 GLY A N   1 
ATOM   1991 C CA  . GLY A 1 252 ? 33.867  28.857  1.240   1.00 25.83 ? 252 GLY A CA  1 
ATOM   1992 C C   . GLY A 1 252 ? 33.581  29.252  2.677   1.00 27.20 ? 252 GLY A C   1 
ATOM   1993 O O   . GLY A 1 252 ? 34.461  29.793  3.341   1.00 29.84 ? 252 GLY A O   1 
ATOM   1994 N N   . VAL A 1 253 ? 32.374  28.988  3.176   1.00 24.74 ? 253 VAL A N   1 
ATOM   1995 C CA  . VAL A 1 253 ? 32.041  29.344  4.556   1.00 18.24 ? 253 VAL A CA  1 
ATOM   1996 C C   . VAL A 1 253 ? 31.996  28.125  5.482   1.00 18.99 ? 253 VAL A C   1 
ATOM   1997 O O   . VAL A 1 253 ? 31.568  27.042  5.088   1.00 20.41 ? 253 VAL A O   1 
ATOM   1998 C CB  . VAL A 1 253 ? 30.694  30.094  4.610   1.00 19.54 ? 253 VAL A CB  1 
ATOM   1999 C CG1 . VAL A 1 253 ? 30.240  30.322  6.067   1.00 14.57 ? 253 VAL A CG1 1 
ATOM   2000 C CG2 . VAL A 1 253 ? 30.845  31.423  3.888   1.00 19.37 ? 253 VAL A CG2 1 
ATOM   2001 N N   . LEU A 1 254 ? 32.465  28.313  6.710   1.00 19.31 ? 254 LEU A N   1 
ATOM   2002 C CA  . LEU A 1 254 ? 32.488  27.257  7.713   1.00 21.35 ? 254 LEU A CA  1 
ATOM   2003 C C   . LEU A 1 254 ? 31.103  27.189  8.345   1.00 21.32 ? 254 LEU A C   1 
ATOM   2004 O O   . LEU A 1 254 ? 30.590  28.195  8.831   1.00 23.32 ? 254 LEU A O   1 
ATOM   2005 C CB  . LEU A 1 254 ? 33.541  27.567  8.793   1.00 18.43 ? 254 LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 254 ? 33.815  26.547  9.911   1.00 20.45 ? 254 LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 254 ? 34.396  25.255  9.332   1.00 19.14 ? 254 LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 254 ? 34.791  27.145  10.910  1.00 21.99 ? 254 LEU A CD2 1 
ATOM   2009 N N   . GLU A 1 255 ? 30.487  26.013  8.323   1.00 19.69 ? 255 GLU A N   1 
ATOM   2010 C CA  . GLU A 1 255 ? 29.163  25.878  8.914   1.00 21.11 ? 255 GLU A CA  1 
ATOM   2011 C C   . GLU A 1 255 ? 28.878  24.518  9.517   1.00 18.80 ? 255 GLU A C   1 
ATOM   2012 O O   . GLU A 1 255 ? 29.643  23.565  9.375   1.00 18.36 ? 255 GLU A O   1 
ATOM   2013 C CB  . GLU A 1 255 ? 28.068  26.175  7.880   1.00 22.29 ? 255 GLU A CB  1 
ATOM   2014 C CG  . GLU A 1 255 ? 28.163  25.344  6.618   1.00 22.47 ? 255 GLU A CG  1 
ATOM   2015 C CD  . GLU A 1 255 ? 26.834  25.183  5.908   1.00 19.14 ? 255 GLU A CD  1 
ATOM   2016 O OE1 . GLU A 1 255 ? 26.099  26.181  5.745   1.00 21.56 ? 255 GLU A OE1 1 
ATOM   2017 O OE2 . GLU A 1 255 ? 26.531  24.047  5.497   1.00 28.22 ? 255 GLU A OE2 1 
ATOM   2018 N N   . LEU A 1 256 ? 27.767  24.459  10.232  1.00 19.31 ? 256 LEU A N   1 
ATOM   2019 C CA  . LEU A 1 256 ? 27.311  23.227  10.823  1.00 16.83 ? 256 LEU A CA  1 
ATOM   2020 C C   . LEU A 1 256 ? 25.921  23.104  10.218  1.00 16.38 ? 256 LEU A C   1 
ATOM   2021 O O   . LEU A 1 256 ? 25.095  24.016  10.350  1.00 12.89 ? 256 LEU A O   1 
ATOM   2022 C CB  . LEU A 1 256 ? 27.231  23.328  12.344  1.00 18.47 ? 256 LEU A CB  1 
ATOM   2023 C CG  . LEU A 1 256 ? 26.592  22.085  12.985  1.00 21.48 ? 256 LEU A CG  1 
ATOM   2024 C CD1 . LEU A 1 256 ? 27.494  20.886  12.761  1.00 21.42 ? 256 LEU A CD1 1 
ATOM   2025 C CD2 . LEU A 1 256 ? 26.358  22.314  14.468  1.00 22.50 ? 256 LEU A CD2 1 
ATOM   2026 N N   . VAL A 1 257 ? 25.682  21.998  9.521   1.00 12.39 ? 257 VAL A N   1 
ATOM   2027 C CA  . VAL A 1 257 ? 24.401  21.779  8.886   1.00 12.37 ? 257 VAL A CA  1 
ATOM   2028 C C   . VAL A 1 257 ? 23.763  20.455  9.281   1.00 14.17 ? 257 VAL A C   1 
ATOM   2029 O O   . VAL A 1 257 ? 24.443  19.444  9.454   1.00 13.50 ? 257 VAL A O   1 
ATOM   2030 C CB  . VAL A 1 257 ? 24.528  21.820  7.343   1.00 11.64 ? 257 VAL A CB  1 
ATOM   2031 C CG1 . VAL A 1 257 ? 25.515  20.743  6.864   1.00 13.20 ? 257 VAL A CG1 1 
ATOM   2032 C CG2 . VAL A 1 257 ? 23.162  21.597  6.703   1.00 8.73  ? 257 VAL A CG2 1 
ATOM   2033 N N   . THR A 1 258 ? 22.445  20.486  9.436   1.00 12.82 ? 258 THR A N   1 
ATOM   2034 C CA  . THR A 1 258 ? 21.669  19.309  9.762   1.00 14.62 ? 258 THR A CA  1 
ATOM   2035 C C   . THR A 1 258 ? 20.457  19.362  8.837   1.00 14.32 ? 258 THR A C   1 
ATOM   2036 O O   . THR A 1 258 ? 20.021  20.440  8.442   1.00 15.28 ? 258 THR A O   1 
ATOM   2037 C CB  . THR A 1 258 ? 21.182  19.310  11.249  1.00 16.07 ? 258 THR A CB  1 
ATOM   2038 O OG1 . THR A 1 258 ? 20.378  18.148  11.492  1.00 14.12 ? 258 THR A OG1 1 
ATOM   2039 C CG2 . THR A 1 258 ? 20.341  20.536  11.546  1.00 17.48 ? 258 THR A CG2 1 
ATOM   2040 N N   . PRO A 1 259 ? 19.926  18.196  8.445   1.00 15.23 ? 259 PRO A N   1 
ATOM   2041 C CA  . PRO A 1 259 ? 18.757  18.141  7.566   1.00 14.65 ? 259 PRO A CA  1 
ATOM   2042 C C   . PRO A 1 259 ? 17.582  18.889  8.187   1.00 16.59 ? 259 PRO A C   1 
ATOM   2043 O O   . PRO A 1 259 ? 17.415  18.888  9.408   1.00 17.31 ? 259 PRO A O   1 
ATOM   2044 C CB  . PRO A 1 259 ? 18.489  16.643  7.451   1.00 14.29 ? 259 PRO A CB  1 
ATOM   2045 C CG  . PRO A 1 259 ? 19.850  16.069  7.488   1.00 15.85 ? 259 PRO A CG  1 
ATOM   2046 C CD  . PRO A 1 259 ? 20.530  16.862  8.595   1.00 16.05 ? 259 PRO A CD  1 
ATOM   2047 N N   . PRO A 1 260 ? 16.745  19.526  7.347   1.00 17.47 ? 260 PRO A N   1 
ATOM   2048 C CA  . PRO A 1 260 ? 15.566  20.295  7.769   1.00 17.97 ? 260 PRO A CA  1 
ATOM   2049 C C   . PRO A 1 260 ? 14.416  19.368  8.162   1.00 20.08 ? 260 PRO A C   1 
ATOM   2050 O O   . PRO A 1 260 ? 14.414  18.180  7.823   1.00 22.70 ? 260 PRO A O   1 
ATOM   2051 C CB  . PRO A 1 260 ? 15.206  21.114  6.528   1.00 20.07 ? 260 PRO A CB  1 
ATOM   2052 C CG  . PRO A 1 260 ? 16.300  20.797  5.499   1.00 21.63 ? 260 PRO A CG  1 
ATOM   2053 C CD  . PRO A 1 260 ? 16.812  19.453  5.881   1.00 17.48 ? 260 PRO A CD  1 
ATOM   2054 N N   . LEU A 1 261 ? 13.433  19.916  8.867   1.00 21.60 ? 261 LEU A N   1 
ATOM   2055 C CA  . LEU A 1 261 ? 12.281  19.136  9.304   1.00 19.34 ? 261 LEU A CA  1 
ATOM   2056 C C   . LEU A 1 261 ? 11.238  19.144  8.202   1.00 19.80 ? 261 LEU A C   1 
ATOM   2057 O O   . LEU A 1 261 ? 10.314  19.952  8.217   1.00 18.89 ? 261 LEU A O   1 
ATOM   2058 C CB  . LEU A 1 261 ? 11.694  19.734  10.583  1.00 17.00 ? 261 LEU A CB  1 
ATOM   2059 C CG  . LEU A 1 261 ? 12.633  19.841  11.793  1.00 17.05 ? 261 LEU A CG  1 
ATOM   2060 C CD1 . LEU A 1 261 ? 11.915  20.572  12.906  1.00 9.90  ? 261 LEU A CD1 1 
ATOM   2061 C CD2 . LEU A 1 261 ? 13.090  18.447  12.255  1.00 13.77 ? 261 LEU A CD2 1 
ATOM   2062 N N   . ASN A 1 262 ? 11.394  18.237  7.247   1.00 20.32 ? 262 ASN A N   1 
ATOM   2063 C CA  . ASN A 1 262 ? 10.478  18.137  6.120   1.00 25.78 ? 262 ASN A CA  1 
ATOM   2064 C C   . ASN A 1 262 ? 9.509   16.945  6.209   1.00 26.14 ? 262 ASN A C   1 
ATOM   2065 O O   . ASN A 1 262 ? 8.796   16.632  5.247   1.00 23.35 ? 262 ASN A O   1 
ATOM   2066 C CB  . ASN A 1 262 ? 11.276  18.047  4.814   1.00 28.73 ? 262 ASN A CB  1 
ATOM   2067 C CG  . ASN A 1 262 ? 12.209  16.856  4.784   1.00 29.21 ? 262 ASN A CG  1 
ATOM   2068 O OD1 . ASN A 1 262 ? 11.866  15.775  5.259   1.00 35.80 ? 262 ASN A OD1 1 
ATOM   2069 N ND2 . ASN A 1 262 ? 13.392  17.044  4.213   1.00 34.05 ? 262 ASN A ND2 1 
ATOM   2070 N N   . GLY A 1 263 ? 9.484   16.274  7.352   1.00 24.44 ? 263 GLY A N   1 
ATOM   2071 C CA  . GLY A 1 263 ? 8.579   15.153  7.486   1.00 21.61 ? 263 GLY A CA  1 
ATOM   2072 C C   . GLY A 1 263 ? 9.260   13.817  7.689   1.00 19.93 ? 263 GLY A C   1 
ATOM   2073 O O   . GLY A 1 263 ? 8.798   13.010  8.481   1.00 23.33 ? 263 GLY A O   1 
ATOM   2074 N N   . VAL A 1 264 ? 10.353  13.563  6.988   1.00 17.55 ? 264 VAL A N   1 
ATOM   2075 C CA  . VAL A 1 264 ? 11.023  12.284  7.171   1.00 21.81 ? 264 VAL A CA  1 
ATOM   2076 C C   . VAL A 1 264 ? 12.085  12.308  8.278   1.00 20.66 ? 264 VAL A C   1 
ATOM   2077 O O   . VAL A 1 264 ? 12.909  11.395  8.375   1.00 18.80 ? 264 VAL A O   1 
ATOM   2078 C CB  . VAL A 1 264 ? 11.655  11.804  5.845   1.00 20.92 ? 264 VAL A CB  1 
ATOM   2079 C CG1 . VAL A 1 264 ? 10.574  11.632  4.813   1.00 25.56 ? 264 VAL A CG1 1 
ATOM   2080 C CG2 . VAL A 1 264 ? 12.682  12.800  5.349   1.00 22.38 ? 264 VAL A CG2 1 
ATOM   2081 N N   . ILE A 1 265 ? 12.062  13.351  9.106   1.00 18.76 ? 265 ILE A N   1 
ATOM   2082 C CA  . ILE A 1 265 ? 13.025  13.491  10.199  1.00 18.70 ? 265 ILE A CA  1 
ATOM   2083 C C   . ILE A 1 265 ? 12.332  13.688  11.559  1.00 16.14 ? 265 ILE A C   1 
ATOM   2084 O O   . ILE A 1 265 ? 11.444  14.522  11.694  1.00 15.13 ? 265 ILE A O   1 
ATOM   2085 C CB  . ILE A 1 265 ? 14.007  14.689  9.946   1.00 18.06 ? 265 ILE A CB  1 
ATOM   2086 C CG1 . ILE A 1 265 ? 15.034  14.315  8.884   1.00 19.80 ? 265 ILE A CG1 1 
ATOM   2087 C CG2 . ILE A 1 265 ? 14.760  15.059  11.231  1.00 15.53 ? 265 ILE A CG2 1 
ATOM   2088 C CD1 . ILE A 1 265 ? 14.471  14.165  7.498   1.00 19.55 ? 265 ILE A CD1 1 
ATOM   2089 N N   . LEU A 1 266 ? 12.741  12.902  12.550  1.00 12.72 ? 266 LEU A N   1 
ATOM   2090 C CA  . LEU A 1 266 ? 12.187  12.996  13.890  1.00 14.54 ? 266 LEU A CA  1 
ATOM   2091 C C   . LEU A 1 266 ? 12.830  14.224  14.543  1.00 14.35 ? 266 LEU A C   1 
ATOM   2092 O O   . LEU A 1 266 ? 14.052  14.326  14.585  1.00 13.27 ? 266 LEU A O   1 
ATOM   2093 C CB  . LEU A 1 266 ? 12.537  11.728  14.696  1.00 15.22 ? 266 LEU A CB  1 
ATOM   2094 C CG  . LEU A 1 266 ? 11.861  11.431  16.051  1.00 17.55 ? 266 LEU A CG  1 
ATOM   2095 C CD1 . LEU A 1 266 ? 12.215  12.501  17.066  1.00 20.23 ? 266 LEU A CD1 1 
ATOM   2096 C CD2 . LEU A 1 266 ? 10.344  11.359  15.880  1.00 10.39 ? 266 LEU A CD2 1 
ATOM   2097 N N   . PRO A 1 267 ? 12.015  15.172  15.052  1.00 13.51 ? 267 PRO A N   1 
ATOM   2098 C CA  . PRO A 1 267 ? 12.498  16.400  15.708  1.00 12.84 ? 267 PRO A CA  1 
ATOM   2099 C C   . PRO A 1 267 ? 13.217  16.075  17.020  1.00 14.20 ? 267 PRO A C   1 
ATOM   2100 O O   . PRO A 1 267 ? 12.600  16.076  18.079  1.00 17.18 ? 267 PRO A O   1 
ATOM   2101 C CB  . PRO A 1 267 ? 11.212  17.197  15.959  1.00 12.96 ? 267 PRO A CB  1 
ATOM   2102 C CG  . PRO A 1 267 ? 10.236  16.637  14.943  1.00 12.82 ? 267 PRO A CG  1 
ATOM   2103 C CD  . PRO A 1 267 ? 10.544  15.172  14.962  1.00 12.49 ? 267 PRO A CD  1 
ATOM   2104 N N   . GLY A 1 268 ? 14.514  15.794  16.946  1.00 16.53 ? 268 GLY A N   1 
ATOM   2105 C CA  . GLY A 1 268 ? 15.268  15.453  18.139  1.00 13.50 ? 268 GLY A CA  1 
ATOM   2106 C C   . GLY A 1 268 ? 15.385  16.588  19.142  1.00 15.78 ? 268 GLY A C   1 
ATOM   2107 O O   . GLY A 1 268 ? 15.478  17.758  18.767  1.00 14.44 ? 268 GLY A O   1 
ATOM   2108 N N   . VAL A 1 269 ? 15.368  16.249  20.426  1.00 15.16 ? 269 VAL A N   1 
ATOM   2109 C CA  . VAL A 1 269 ? 15.494  17.260  21.460  1.00 16.48 ? 269 VAL A CA  1 
ATOM   2110 C C   . VAL A 1 269 ? 16.948  17.702  21.541  1.00 15.66 ? 269 VAL A C   1 
ATOM   2111 O O   . VAL A 1 269 ? 17.237  18.892  21.667  1.00 18.43 ? 269 VAL A O   1 
ATOM   2112 C CB  . VAL A 1 269 ? 15.021  16.735  22.822  1.00 16.22 ? 269 VAL A CB  1 
ATOM   2113 C CG1 . VAL A 1 269 ? 15.319  17.747  23.903  1.00 15.68 ? 269 VAL A CG1 1 
ATOM   2114 C CG2 . VAL A 1 269 ? 13.519  16.465  22.772  1.00 17.95 ? 269 VAL A CG2 1 
ATOM   2115 N N   . VAL A 1 270 ? 17.864  16.747  21.452  1.00 12.61 ? 270 VAL A N   1 
ATOM   2116 C CA  . VAL A 1 270 ? 19.281  17.073  21.495  1.00 13.41 ? 270 VAL A CA  1 
ATOM   2117 C C   . VAL A 1 270 ? 19.628  17.875  20.237  1.00 14.83 ? 270 VAL A C   1 
ATOM   2118 O O   . VAL A 1 270 ? 20.432  18.808  20.277  1.00 16.12 ? 270 VAL A O   1 
ATOM   2119 C CB  . VAL A 1 270 ? 20.150  15.791  21.563  1.00 11.47 ? 270 VAL A CB  1 
ATOM   2120 C CG1 . VAL A 1 270 ? 21.631  16.159  21.630  1.00 13.93 ? 270 VAL A CG1 1 
ATOM   2121 C CG2 . VAL A 1 270 ? 19.765  14.980  22.766  1.00 6.88  ? 270 VAL A CG2 1 
ATOM   2122 N N   . ARG A 1 271 ? 19.001  17.507  19.124  1.00 16.45 ? 271 ARG A N   1 
ATOM   2123 C CA  . ARG A 1 271 ? 19.215  18.179  17.847  1.00 15.99 ? 271 ARG A CA  1 
ATOM   2124 C C   . ARG A 1 271 ? 18.914  19.664  17.985  1.00 17.27 ? 271 ARG A C   1 
ATOM   2125 O O   . ARG A 1 271 ? 19.696  20.509  17.563  1.00 20.72 ? 271 ARG A O   1 
ATOM   2126 C CB  . ARG A 1 271 ? 18.295  17.570  16.783  1.00 16.63 ? 271 ARG A CB  1 
ATOM   2127 C CG  . ARG A 1 271 ? 18.167  18.375  15.502  1.00 15.97 ? 271 ARG A CG  1 
ATOM   2128 C CD  . ARG A 1 271 ? 17.083  17.789  14.618  1.00 17.99 ? 271 ARG A CD  1 
ATOM   2129 N NE  . ARG A 1 271 ? 16.935  18.509  13.354  1.00 20.10 ? 271 ARG A NE  1 
ATOM   2130 C CZ  . ARG A 1 271 ? 16.372  19.706  13.230  1.00 19.11 ? 271 ARG A CZ  1 
ATOM   2131 N NH1 . ARG A 1 271 ? 15.893  20.331  14.297  1.00 18.11 ? 271 ARG A NH1 1 
ATOM   2132 N NH2 . ARG A 1 271 ? 16.292  20.282  12.037  1.00 18.31 ? 271 ARG A NH2 1 
ATOM   2133 N N   . GLN A 1 272 ? 17.764  19.967  18.576  1.00 20.50 ? 272 GLN A N   1 
ATOM   2134 C CA  . GLN A 1 272 ? 17.337  21.342  18.771  1.00 20.46 ? 272 GLN A CA  1 
ATOM   2135 C C   . GLN A 1 272 ? 18.284  22.057  19.738  1.00 19.08 ? 272 GLN A C   1 
ATOM   2136 O O   . GLN A 1 272 ? 18.586  23.236  19.552  1.00 14.25 ? 272 GLN A O   1 
ATOM   2137 C CB  . GLN A 1 272 ? 15.901  21.372  19.314  1.00 20.81 ? 272 GLN A CB  1 
ATOM   2138 C CG  . GLN A 1 272 ? 15.284  22.756  19.382  1.00 20.72 ? 272 GLN A CG  1 
ATOM   2139 C CD  . GLN A 1 272 ? 15.272  23.450  18.029  1.00 27.57 ? 272 GLN A CD  1 
ATOM   2140 O OE1 . GLN A 1 272 ? 15.863  24.524  17.863  1.00 25.67 ? 272 GLN A OE1 1 
ATOM   2141 N NE2 . GLN A 1 272 ? 14.603  22.837  17.049  1.00 26.01 ? 272 GLN A NE2 1 
ATOM   2142 N N   . SER A 1 273 ? 18.763  21.333  20.749  1.00 16.69 ? 273 SER A N   1 
ATOM   2143 C CA  . SER A 1 273 ? 19.668  21.912  21.740  1.00 16.68 ? 273 SER A CA  1 
ATOM   2144 C C   . SER A 1 273 ? 21.030  22.249  21.144  1.00 18.04 ? 273 SER A C   1 
ATOM   2145 O O   . SER A 1 273 ? 21.688  23.182  21.594  1.00 17.44 ? 273 SER A O   1 
ATOM   2146 C CB  . SER A 1 273 ? 19.849  20.964  22.930  1.00 15.93 ? 273 SER A CB  1 
ATOM   2147 O OG  . SER A 1 273 ? 18.602  20.648  23.532  1.00 16.68 ? 273 SER A OG  1 
ATOM   2148 N N   . LEU A 1 274 ? 21.459  21.488  20.137  1.00 17.79 ? 274 LEU A N   1 
ATOM   2149 C CA  . LEU A 1 274 ? 22.738  21.754  19.497  1.00 16.04 ? 274 LEU A CA  1 
ATOM   2150 C C   . LEU A 1 274 ? 22.616  23.006  18.638  1.00 17.65 ? 274 LEU A C   1 
ATOM   2151 O O   . LEU A 1 274 ? 23.480  23.889  18.683  1.00 19.71 ? 274 LEU A O   1 
ATOM   2152 C CB  . LEU A 1 274 ? 23.172  20.555  18.660  1.00 14.74 ? 274 LEU A CB  1 
ATOM   2153 C CG  . LEU A 1 274 ? 23.428  19.279  19.486  1.00 17.91 ? 274 LEU A CG  1 
ATOM   2154 C CD1 . LEU A 1 274 ? 23.892  18.149  18.573  1.00 20.23 ? 274 LEU A CD1 1 
ATOM   2155 C CD2 . LEU A 1 274 ? 24.479  19.537  20.558  1.00 16.63 ? 274 LEU A CD2 1 
ATOM   2156 N N   . LEU A 1 275 ? 21.538  23.093  17.866  1.00 14.83 ? 275 LEU A N   1 
ATOM   2157 C CA  . LEU A 1 275 ? 21.312  24.264  17.035  1.00 15.06 ? 275 LEU A CA  1 
ATOM   2158 C C   . LEU A 1 275 ? 21.271  25.547  17.888  1.00 16.71 ? 275 LEU A C   1 
ATOM   2159 O O   . LEU A 1 275 ? 21.875  26.551  17.539  1.00 16.13 ? 275 LEU A O   1 
ATOM   2160 C CB  . LEU A 1 275 ? 19.991  24.136  16.272  1.00 16.54 ? 275 LEU A CB  1 
ATOM   2161 C CG  . LEU A 1 275 ? 19.848  23.462  14.894  1.00 17.88 ? 275 LEU A CG  1 
ATOM   2162 C CD1 . LEU A 1 275 ? 21.202  23.097  14.307  1.00 16.96 ? 275 LEU A CD1 1 
ATOM   2163 C CD2 . LEU A 1 275 ? 18.961  22.243  15.036  1.00 11.59 ? 275 LEU A CD2 1 
ATOM   2164 N N   . ASP A 1 276 ? 20.548  25.504  19.000  1.00 18.58 ? 276 ASP A N   1 
ATOM   2165 C CA  . ASP A 1 276 ? 20.413  26.659  19.894  1.00 21.48 ? 276 ASP A CA  1 
ATOM   2166 C C   . ASP A 1 276 ? 21.765  27.081  20.459  1.00 22.71 ? 276 ASP A C   1 
ATOM   2167 O O   . ASP A 1 276 ? 22.145  28.251  20.435  1.00 23.54 ? 276 ASP A O   1 
ATOM   2168 C CB  . ASP A 1 276 ? 19.483  26.312  21.064  1.00 20.23 ? 276 ASP A CB  1 
ATOM   2169 C CG  . ASP A 1 276 ? 18.056  26.088  20.631  1.00 18.67 ? 276 ASP A CG  1 
ATOM   2170 O OD1 . ASP A 1 276 ? 17.295  25.475  21.411  1.00 22.18 ? 276 ASP A OD1 1 
ATOM   2171 O OD2 . ASP A 1 276 ? 17.693  26.535  19.518  1.00 20.75 ? 276 ASP A OD2 1 
ATOM   2172 N N   . MET A 1 277 ? 22.474  26.098  20.985  1.00 23.39 ? 277 MET A N   1 
ATOM   2173 C CA  . MET A 1 277 ? 23.774  26.302  21.583  1.00 24.33 ? 277 MET A CA  1 
ATOM   2174 C C   . MET A 1 277 ? 24.768  26.872  20.569  1.00 25.86 ? 277 MET A C   1 
ATOM   2175 O O   . MET A 1 277 ? 25.522  27.797  20.879  1.00 28.47 ? 277 MET A O   1 
ATOM   2176 C CB  . MET A 1 277 ? 24.253  24.957  22.136  1.00 25.65 ? 277 MET A CB  1 
ATOM   2177 C CG  . MET A 1 277 ? 25.416  25.003  23.084  1.00 30.83 ? 277 MET A CG  1 
ATOM   2178 S SD  . MET A 1 277 ? 25.581  23.407  23.898  1.00 36.73 ? 277 MET A SD  1 
ATOM   2179 C CE  . MET A 1 277 ? 24.955  23.804  25.522  1.00 35.71 ? 277 MET A CE  1 
ATOM   2180 N N   . ALA A 1 278 ? 24.760  26.330  19.357  1.00 23.93 ? 278 ALA A N   1 
ATOM   2181 C CA  . ALA A 1 278 ? 25.680  26.789  18.330  1.00 24.39 ? 278 ALA A CA  1 
ATOM   2182 C C   . ALA A 1 278 ? 25.340  28.192  17.847  1.00 24.62 ? 278 ALA A C   1 
ATOM   2183 O O   . ALA A 1 278 ? 26.233  29.006  17.594  1.00 23.49 ? 278 ALA A O   1 
ATOM   2184 C CB  . ALA A 1 278 ? 25.680  25.811  17.159  1.00 23.58 ? 278 ALA A CB  1 
ATOM   2185 N N   . GLN A 1 279 ? 24.053  28.487  17.722  1.00 25.94 ? 279 GLN A N   1 
ATOM   2186 C CA  . GLN A 1 279 ? 23.667  29.806  17.252  1.00 31.00 ? 279 GLN A CA  1 
ATOM   2187 C C   . GLN A 1 279 ? 24.087  30.853  18.269  1.00 30.58 ? 279 GLN A C   1 
ATOM   2188 O O   . GLN A 1 279 ? 24.492  31.955  17.904  1.00 30.25 ? 279 GLN A O   1 
ATOM   2189 C CB  . GLN A 1 279 ? 22.163  29.842  16.961  1.00 32.88 ? 279 GLN A CB  1 
ATOM   2190 C CG  . GLN A 1 279 ? 21.818  28.819  15.866  1.00 47.09 ? 279 GLN A CG  1 
ATOM   2191 C CD  . GLN A 1 279 ? 20.375  28.847  15.387  1.00 50.32 ? 279 GLN A CD  1 
ATOM   2192 O OE1 . GLN A 1 279 ? 19.434  28.737  16.179  1.00 53.34 ? 279 GLN A OE1 1 
ATOM   2193 N NE2 . GLN A 1 279 ? 20.197  28.973  14.071  1.00 52.07 ? 279 GLN A NE2 1 
ATOM   2194 N N   . THR A 1 280 ? 24.035  30.485  19.544  1.00 31.82 ? 280 THR A N   1 
ATOM   2195 C CA  . THR A 1 280 ? 24.418  31.390  20.612  1.00 30.03 ? 280 THR A CA  1 
ATOM   2196 C C   . THR A 1 280 ? 25.901  31.774  20.551  1.00 31.07 ? 280 THR A C   1 
ATOM   2197 O O   . THR A 1 280 ? 26.250  32.925  20.807  1.00 31.66 ? 280 THR A O   1 
ATOM   2198 C CB  . THR A 1 280 ? 24.099  30.773  21.991  1.00 32.21 ? 280 THR A CB  1 
ATOM   2199 O OG1 . THR A 1 280 ? 22.678  30.639  22.134  1.00 30.16 ? 280 THR A OG1 1 
ATOM   2200 C CG2 . THR A 1 280 ? 24.631  31.651  23.110  1.00 32.66 ? 280 THR A CG2 1 
ATOM   2201 N N   . TRP A 1 281 ? 26.775  30.831  20.212  1.00 29.58 ? 281 TRP A N   1 
ATOM   2202 C CA  . TRP A 1 281 ? 28.197  31.146  20.143  1.00 30.54 ? 281 TRP A CA  1 
ATOM   2203 C C   . TRP A 1 281 ? 28.497  32.135  19.031  1.00 32.89 ? 281 TRP A C   1 
ATOM   2204 O O   . TRP A 1 281 ? 29.487  32.869  19.096  1.00 34.67 ? 281 TRP A O   1 
ATOM   2205 C CB  . TRP A 1 281 ? 29.046  29.899  19.890  1.00 30.85 ? 281 TRP A CB  1 
ATOM   2206 C CG  . TRP A 1 281 ? 28.954  28.835  20.928  1.00 30.51 ? 281 TRP A CG  1 
ATOM   2207 C CD1 . TRP A 1 281 ? 28.685  28.992  22.260  1.00 28.93 ? 281 TRP A CD1 1 
ATOM   2208 C CD2 . TRP A 1 281 ? 29.157  27.435  20.720  1.00 30.38 ? 281 TRP A CD2 1 
ATOM   2209 N NE1 . TRP A 1 281 ? 28.706  27.770  22.891  1.00 28.23 ? 281 TRP A NE1 1 
ATOM   2210 C CE2 . TRP A 1 281 ? 28.996  26.799  21.969  1.00 30.87 ? 281 TRP A CE2 1 
ATOM   2211 C CE3 . TRP A 1 281 ? 29.467  26.658  19.598  1.00 27.85 ? 281 TRP A CE3 1 
ATOM   2212 C CZ2 . TRP A 1 281 ? 29.127  25.418  22.125  1.00 32.83 ? 281 TRP A CZ2 1 
ATOM   2213 C CZ3 . TRP A 1 281 ? 29.600  25.288  19.753  1.00 30.62 ? 281 TRP A CZ3 1 
ATOM   2214 C CH2 . TRP A 1 281 ? 29.431  24.681  21.010  1.00 32.81 ? 281 TRP A CH2 1 
ATOM   2215 N N   . GLY A 1 282 ? 27.661  32.137  17.997  1.00 33.32 ? 282 GLY A N   1 
ATOM   2216 C CA  . GLY A 1 282 ? 27.873  33.042  16.879  1.00 31.65 ? 282 GLY A CA  1 
ATOM   2217 C C   . GLY A 1 282 ? 29.288  32.980  16.314  1.00 31.93 ? 282 GLY A C   1 
ATOM   2218 O O   . GLY A 1 282 ? 29.850  33.994  15.903  1.00 32.16 ? 282 GLY A O   1 
ATOM   2219 N N   . GLU A 1 283 ? 29.865  31.784  16.286  1.00 30.45 ? 283 GLU A N   1 
ATOM   2220 C CA  . GLU A 1 283 ? 31.216  31.598  15.778  1.00 30.11 ? 283 GLU A CA  1 
ATOM   2221 C C   . GLU A 1 283 ? 31.254  31.094  14.342  1.00 27.65 ? 283 GLU A C   1 
ATOM   2222 O O   . GLU A 1 283 ? 32.281  31.180  13.675  1.00 25.19 ? 283 GLU A O   1 
ATOM   2223 C CB  . GLU A 1 283 ? 31.996  30.641  16.684  1.00 32.00 ? 283 GLU A CB  1 
ATOM   2224 C CG  . GLU A 1 283 ? 32.439  31.282  17.985  1.00 33.62 ? 283 GLU A CG  1 
ATOM   2225 C CD  . GLU A 1 283 ? 33.160  30.316  18.902  1.00 36.65 ? 283 GLU A CD  1 
ATOM   2226 O OE1 . GLU A 1 283 ? 34.005  29.533  18.410  1.00 33.79 ? 283 GLU A OE1 1 
ATOM   2227 O OE2 . GLU A 1 283 ? 32.883  30.351  20.121  1.00 39.31 ? 283 GLU A OE2 1 
ATOM   2228 N N   . PHE A 1 284 ? 30.139  30.559  13.869  1.00 26.68 ? 284 PHE A N   1 
ATOM   2229 C CA  . PHE A 1 284 ? 30.057  30.073  12.494  1.00 25.16 ? 284 PHE A CA  1 
ATOM   2230 C C   . PHE A 1 284 ? 28.604  29.917  12.088  1.00 24.23 ? 284 PHE A C   1 
ATOM   2231 O O   . PHE A 1 284 ? 27.698  29.970  12.930  1.00 25.42 ? 284 PHE A O   1 
ATOM   2232 C CB  . PHE A 1 284 ? 30.796  28.743  12.326  1.00 24.58 ? 284 PHE A CB  1 
ATOM   2233 C CG  . PHE A 1 284 ? 30.493  27.740  13.395  1.00 29.04 ? 284 PHE A CG  1 
ATOM   2234 C CD1 . PHE A 1 284 ? 31.393  27.523  14.436  1.00 28.56 ? 284 PHE A CD1 1 
ATOM   2235 C CD2 . PHE A 1 284 ? 29.298  27.023  13.379  1.00 28.32 ? 284 PHE A CD2 1 
ATOM   2236 C CE1 . PHE A 1 284 ? 31.109  26.611  15.445  1.00 25.16 ? 284 PHE A CE1 1 
ATOM   2237 C CE2 . PHE A 1 284 ? 29.005  26.110  14.385  1.00 27.96 ? 284 PHE A CE2 1 
ATOM   2238 C CZ  . PHE A 1 284 ? 29.914  25.902  15.423  1.00 25.75 ? 284 PHE A CZ  1 
ATOM   2239 N N   . ARG A 1 285 ? 28.380  29.734  10.793  1.00 21.26 ? 285 ARG A N   1 
ATOM   2240 C CA  . ARG A 1 285 ? 27.024  29.598  10.284  1.00 19.03 ? 285 ARG A CA  1 
ATOM   2241 C C   . ARG A 1 285 ? 26.388  28.278  10.732  1.00 20.37 ? 285 ARG A C   1 
ATOM   2242 O O   . ARG A 1 285 ? 26.980  27.198  10.605  1.00 21.00 ? 285 ARG A O   1 
ATOM   2243 C CB  . ARG A 1 285 ? 27.050  29.702  8.759   1.00 18.11 ? 285 ARG A CB  1 
ATOM   2244 C CG  . ARG A 1 285 ? 25.692  29.684  8.095   1.00 21.82 ? 285 ARG A CG  1 
ATOM   2245 C CD  . ARG A 1 285 ? 25.821  29.115  6.691   1.00 25.92 ? 285 ARG A CD  1 
ATOM   2246 N NE  . ARG A 1 285 ? 26.269  30.095  5.717   1.00 23.63 ? 285 ARG A NE  1 
ATOM   2247 C CZ  . ARG A 1 285 ? 26.912  29.791  4.595   1.00 27.62 ? 285 ARG A CZ  1 
ATOM   2248 N NH1 . ARG A 1 285 ? 27.197  28.526  4.306   1.00 24.89 ? 285 ARG A NH1 1 
ATOM   2249 N NH2 . ARG A 1 285 ? 27.250  30.755  3.746   1.00 27.14 ? 285 ARG A NH2 1 
ATOM   2250 N N   . VAL A 1 286 ? 25.183  28.381  11.278  1.00 18.76 ? 286 VAL A N   1 
ATOM   2251 C CA  . VAL A 1 286 ? 24.439  27.225  11.749  1.00 16.79 ? 286 VAL A CA  1 
ATOM   2252 C C   . VAL A 1 286 ? 23.164  27.155  10.930  1.00 19.33 ? 286 VAL A C   1 
ATOM   2253 O O   . VAL A 1 286 ? 22.297  28.016  11.050  1.00 23.64 ? 286 VAL A O   1 
ATOM   2254 C CB  . VAL A 1 286 ? 24.088  27.381  13.234  1.00 15.10 ? 286 VAL A CB  1 
ATOM   2255 C CG1 . VAL A 1 286 ? 23.284  26.175  13.726  1.00 12.34 ? 286 VAL A CG1 1 
ATOM   2256 C CG2 . VAL A 1 286 ? 25.375  27.551  14.042  1.00 14.00 ? 286 VAL A CG2 1 
ATOM   2257 N N   . VAL A 1 287 ? 23.040  26.130  10.096  1.00 20.35 ? 287 VAL A N   1 
ATOM   2258 C CA  . VAL A 1 287 ? 21.849  26.026  9.269   1.00 22.22 ? 287 VAL A CA  1 
ATOM   2259 C C   . VAL A 1 287 ? 21.207  24.652  9.161   1.00 20.64 ? 287 VAL A C   1 
ATOM   2260 O O   . VAL A 1 287 ? 21.822  23.619  9.441   1.00 19.39 ? 287 VAL A O   1 
ATOM   2261 C CB  . VAL A 1 287 ? 22.133  26.524  7.826   1.00 23.47 ? 287 VAL A CB  1 
ATOM   2262 C CG1 . VAL A 1 287 ? 22.584  27.979  7.862   1.00 27.51 ? 287 VAL A CG1 1 
ATOM   2263 C CG2 . VAL A 1 287 ? 23.198  25.652  7.165   1.00 21.55 ? 287 VAL A CG2 1 
ATOM   2264 N N   . GLU A 1 288 ? 19.940  24.673  8.769   1.00 21.47 ? 288 GLU A N   1 
ATOM   2265 C CA  . GLU A 1 288 ? 19.169  23.466  8.530   1.00 20.29 ? 288 GLU A CA  1 
ATOM   2266 C C   . GLU A 1 288 ? 19.001  23.488  7.026   1.00 20.28 ? 288 GLU A C   1 
ATOM   2267 O O   . GLU A 1 288 ? 18.454  24.454  6.464   1.00 18.64 ? 288 GLU A O   1 
ATOM   2268 C CB  . GLU A 1 288 ? 17.796  23.544  9.166   1.00 16.94 ? 288 GLU A CB  1 
ATOM   2269 C CG  . GLU A 1 288 ? 17.801  23.652  10.653  1.00 18.23 ? 288 GLU A CG  1 
ATOM   2270 C CD  . GLU A 1 288 ? 16.412  23.891  11.183  1.00 19.51 ? 288 GLU A CD  1 
ATOM   2271 O OE1 . GLU A 1 288 ? 15.594  22.944  11.190  1.00 20.49 ? 288 GLU A OE1 1 
ATOM   2272 O OE2 . GLU A 1 288 ? 16.132  25.042  11.575  1.00 24.97 ? 288 GLU A OE2 1 
ATOM   2273 N N   . ARG A 1 289 ? 19.485  22.440  6.375   1.00 17.49 ? 289 ARG A N   1 
ATOM   2274 C CA  . ARG A 1 289 ? 19.390  22.347  4.932   1.00 17.30 ? 289 ARG A CA  1 
ATOM   2275 C C   . ARG A 1 289 ? 19.695  20.939  4.452   1.00 17.26 ? 289 ARG A C   1 
ATOM   2276 O O   . ARG A 1 289 ? 20.487  20.205  5.053   1.00 15.85 ? 289 ARG A O   1 
ATOM   2277 C CB  . ARG A 1 289 ? 20.342  23.362  4.255   1.00 17.13 ? 289 ARG A CB  1 
ATOM   2278 C CG  . ARG A 1 289 ? 20.734  23.004  2.803   1.00 19.47 ? 289 ARG A CG  1 
ATOM   2279 C CD  . ARG A 1 289 ? 21.515  24.092  2.068   1.00 10.29 ? 289 ARG A CD  1 
ATOM   2280 N NE  . ARG A 1 289 ? 22.478  24.795  2.916   1.00 20.43 ? 289 ARG A NE  1 
ATOM   2281 C CZ  . ARG A 1 289 ? 23.750  24.451  3.116   1.00 14.72 ? 289 ARG A CZ  1 
ATOM   2282 N NH1 . ARG A 1 289 ? 24.279  23.389  2.533   1.00 10.86 ? 289 ARG A NH1 1 
ATOM   2283 N NH2 . ARG A 1 289 ? 24.497  25.196  3.913   1.00 19.40 ? 289 ARG A NH2 1 
ATOM   2284 N N   . THR A 1 290 ? 19.039  20.579  3.358   1.00 18.61 ? 290 THR A N   1 
ATOM   2285 C CA  . THR A 1 290 ? 19.203  19.287  2.723   1.00 20.21 ? 290 THR A CA  1 
ATOM   2286 C C   . THR A 1 290 ? 20.673  19.011  2.457   1.00 19.53 ? 290 THR A C   1 
ATOM   2287 O O   . THR A 1 290 ? 21.416  19.927  2.115   1.00 22.36 ? 290 THR A O   1 
ATOM   2288 C CB  . THR A 1 290 ? 18.459  19.254  1.370   1.00 15.92 ? 290 THR A CB  1 
ATOM   2289 O OG1 . THR A 1 290 ? 17.049  19.255  1.603   1.00 20.46 ? 290 THR A OG1 1 
ATOM   2290 C CG2 . THR A 1 290 ? 18.833  18.017  0.581   1.00 22.84 ? 290 THR A CG2 1 
ATOM   2291 N N   . ILE A 1 291 ? 21.075  17.750  2.612   1.00 20.39 ? 291 ILE A N   1 
ATOM   2292 C CA  . ILE A 1 291 ? 22.445  17.308  2.342   1.00 20.31 ? 291 ILE A CA  1 
ATOM   2293 C C   . ILE A 1 291 ? 22.354  16.039  1.495   1.00 21.31 ? 291 ILE A C   1 
ATOM   2294 O O   . ILE A 1 291 ? 21.618  15.112  1.845   1.00 22.06 ? 291 ILE A O   1 
ATOM   2295 C CB  . ILE A 1 291 ? 23.208  16.956  3.628   1.00 18.78 ? 291 ILE A CB  1 
ATOM   2296 C CG1 . ILE A 1 291 ? 23.097  18.094  4.635   1.00 16.74 ? 291 ILE A CG1 1 
ATOM   2297 C CG2 . ILE A 1 291 ? 24.677  16.728  3.308   1.00 19.98 ? 291 ILE A CG2 1 
ATOM   2298 C CD1 . ILE A 1 291 ? 23.821  17.822  5.924   1.00 14.11 ? 291 ILE A CD1 1 
ATOM   2299 N N   . THR A 1 292 ? 23.088  15.987  0.388   1.00 19.69 ? 292 THR A N   1 
ATOM   2300 C CA  . THR A 1 292 ? 23.041  14.802  -0.467  1.00 21.06 ? 292 THR A CA  1 
ATOM   2301 C C   . THR A 1 292 ? 24.391  14.105  -0.466  1.00 21.31 ? 292 THR A C   1 
ATOM   2302 O O   . THR A 1 292 ? 25.418  14.735  -0.198  1.00 18.98 ? 292 THR A O   1 
ATOM   2303 C CB  . THR A 1 292 ? 22.690  15.162  -1.912  1.00 17.35 ? 292 THR A CB  1 
ATOM   2304 O OG1 . THR A 1 292 ? 23.697  16.030  -2.438  1.00 21.18 ? 292 THR A OG1 1 
ATOM   2305 C CG2 . THR A 1 292 ? 21.349  15.862  -1.979  1.00 14.64 ? 292 THR A CG2 1 
ATOM   2306 N N   . MET A 1 293 ? 24.385  12.805  -0.756  1.00 23.10 ? 293 MET A N   1 
ATOM   2307 C CA  . MET A 1 293 ? 25.623  12.027  -0.799  1.00 24.53 ? 293 MET A CA  1 
ATOM   2308 C C   . MET A 1 293 ? 26.663  12.669  -1.714  1.00 24.92 ? 293 MET A C   1 
ATOM   2309 O O   . MET A 1 293 ? 27.842  12.742  -1.364  1.00 26.48 ? 293 MET A O   1 
ATOM   2310 C CB  . MET A 1 293 ? 25.355  10.601  -1.274  1.00 21.90 ? 293 MET A CB  1 
ATOM   2311 C CG  . MET A 1 293 ? 24.894  9.668   -0.188  1.00 29.19 ? 293 MET A CG  1 
ATOM   2312 S SD  . MET A 1 293 ? 25.970  9.711   1.259   1.00 33.02 ? 293 MET A SD  1 
ATOM   2313 C CE  . MET A 1 293 ? 27.482  8.974   0.623   1.00 32.61 ? 293 MET A CE  1 
ATOM   2314 N N   . LYS A 1 294 ? 26.229  13.127  -2.884  1.00 21.91 ? 294 LYS A N   1 
ATOM   2315 C CA  . LYS A 1 294 ? 27.139  13.756  -3.828  1.00 23.91 ? 294 LYS A CA  1 
ATOM   2316 C C   . LYS A 1 294 ? 27.837  14.952  -3.200  1.00 22.12 ? 294 LYS A C   1 
ATOM   2317 O O   . LYS A 1 294 ? 29.044  15.114  -3.358  1.00 21.44 ? 294 LYS A O   1 
ATOM   2318 C CB  . LYS A 1 294 ? 26.383  14.167  -5.092  1.00 30.06 ? 294 LYS A CB  1 
ATOM   2319 C CG  . LYS A 1 294 ? 24.873  14.260  -4.896  1.00 40.39 ? 294 LYS A CG  1 
ATOM   2320 C CD  . LYS A 1 294 ? 24.120  14.090  -6.222  1.00 47.24 ? 294 LYS A CD  1 
ATOM   2321 C CE  . LYS A 1 294 ? 22.602  14.039  -6.023  1.00 46.56 ? 294 LYS A CE  1 
ATOM   2322 N NZ  . LYS A 1 294 ? 21.897  13.635  -7.275  1.00 46.57 ? 294 LYS A NZ  1 
ATOM   2323 N N   . GLN A 1 295 ? 27.083  15.785  -2.485  1.00 22.71 ? 295 GLN A N   1 
ATOM   2324 C CA  . GLN A 1 295 ? 27.661  16.950  -1.815  1.00 22.47 ? 295 GLN A CA  1 
ATOM   2325 C C   . GLN A 1 295 ? 28.681  16.475  -0.793  1.00 22.56 ? 295 GLN A C   1 
ATOM   2326 O O   . GLN A 1 295 ? 29.747  17.064  -0.644  1.00 20.58 ? 295 GLN A O   1 
ATOM   2327 C CB  . GLN A 1 295 ? 26.586  17.750  -1.087  1.00 21.53 ? 295 GLN A CB  1 
ATOM   2328 C CG  . GLN A 1 295 ? 25.840  18.738  -1.937  1.00 21.36 ? 295 GLN A CG  1 
ATOM   2329 C CD  . GLN A 1 295 ? 24.702  19.377  -1.177  1.00 20.76 ? 295 GLN A CD  1 
ATOM   2330 O OE1 . GLN A 1 295 ? 24.352  20.518  -1.425  1.00 25.38 ? 295 GLN A OE1 1 
ATOM   2331 N NE2 . GLN A 1 295 ? 24.110  18.633  -0.252  1.00 23.78 ? 295 GLN A NE2 1 
ATOM   2332 N N   . LEU A 1 296 ? 28.340  15.401  -0.090  1.00 21.05 ? 296 LEU A N   1 
ATOM   2333 C CA  . LEU A 1 296 ? 29.222  14.849  0.920   1.00 20.49 ? 296 LEU A CA  1 
ATOM   2334 C C   . LEU A 1 296 ? 30.519  14.329  0.289   1.00 21.64 ? 296 LEU A C   1 
ATOM   2335 O O   . LEU A 1 296 ? 31.602  14.539  0.824   1.00 20.95 ? 296 LEU A O   1 
ATOM   2336 C CB  . LEU A 1 296 ? 28.519  13.712  1.653   1.00 22.37 ? 296 LEU A CB  1 
ATOM   2337 C CG  . LEU A 1 296 ? 28.830  13.470  3.130   1.00 25.68 ? 296 LEU A CG  1 
ATOM   2338 C CD1 . LEU A 1 296 ? 28.792  11.971  3.377   1.00 25.18 ? 296 LEU A CD1 1 
ATOM   2339 C CD2 . LEU A 1 296 ? 30.183  14.044  3.514   1.00 26.45 ? 296 LEU A CD2 1 
ATOM   2340 N N   . LEU A 1 297 ? 30.414  13.650  -0.848  1.00 22.16 ? 297 LEU A N   1 
ATOM   2341 C CA  . LEU A 1 297 ? 31.595  13.109  -1.521  1.00 26.08 ? 297 LEU A CA  1 
ATOM   2342 C C   . LEU A 1 297 ? 32.557  14.174  -2.028  1.00 26.49 ? 297 LEU A C   1 
ATOM   2343 O O   . LEU A 1 297 ? 33.772  14.061  -1.850  1.00 25.75 ? 297 LEU A O   1 
ATOM   2344 C CB  . LEU A 1 297 ? 31.177  12.234  -2.699  1.00 29.81 ? 297 LEU A CB  1 
ATOM   2345 C CG  . LEU A 1 297 ? 30.697  10.838  -2.342  1.00 30.61 ? 297 LEU A CG  1 
ATOM   2346 C CD1 . LEU A 1 297 ? 29.985  10.220  -3.536  1.00 33.71 ? 297 LEU A CD1 1 
ATOM   2347 C CD2 . LEU A 1 297 ? 31.899  10.005  -1.916  1.00 32.26 ? 297 LEU A CD2 1 
ATOM   2348 N N   . ARG A 1 298 ? 32.017  15.198  -2.678  1.00 25.33 ? 298 ARG A N   1 
ATOM   2349 C CA  . ARG A 1 298 ? 32.854  16.261  -3.205  1.00 24.58 ? 298 ARG A CA  1 
ATOM   2350 C C   . ARG A 1 298 ? 33.617  16.913  -2.059  1.00 22.85 ? 298 ARG A C   1 
ATOM   2351 O O   . ARG A 1 298 ? 34.819  17.163  -2.151  1.00 23.28 ? 298 ARG A O   1 
ATOM   2352 C CB  . ARG A 1 298 ? 32.008  17.314  -3.921  1.00 26.47 ? 298 ARG A CB  1 
ATOM   2353 C CG  . ARG A 1 298 ? 32.830  18.218  -4.810  1.00 33.24 ? 298 ARG A CG  1 
ATOM   2354 C CD  . ARG A 1 298 ? 32.328  19.651  -4.797  1.00 42.45 ? 298 ARG A CD  1 
ATOM   2355 N NE  . ARG A 1 298 ? 33.328  20.562  -5.363  1.00 52.64 ? 298 ARG A NE  1 
ATOM   2356 C CZ  . ARG A 1 298 ? 33.287  21.891  -5.269  1.00 52.49 ? 298 ARG A CZ  1 
ATOM   2357 N NH1 . ARG A 1 298 ? 32.290  22.494  -4.630  1.00 50.25 ? 298 ARG A NH1 1 
ATOM   2358 N NH2 . ARG A 1 298 ? 34.261  22.620  -5.802  1.00 54.52 ? 298 ARG A NH2 1 
ATOM   2359 N N   . ALA A 1 299 ? 32.912  17.170  -0.966  1.00 20.08 ? 299 ALA A N   1 
ATOM   2360 C CA  . ALA A 1 299 ? 33.522  17.813  0.183   1.00 19.09 ? 299 ALA A CA  1 
ATOM   2361 C C   . ALA A 1 299 ? 34.564  16.914  0.839   1.00 19.20 ? 299 ALA A C   1 
ATOM   2362 O O   . ALA A 1 299 ? 35.527  17.398  1.447   1.00 18.37 ? 299 ALA A O   1 
ATOM   2363 C CB  . ALA A 1 299 ? 32.450  18.204  1.171   1.00 17.74 ? 299 ALA A CB  1 
ATOM   2364 N N   . LEU A 1 300 ? 34.375  15.604  0.718   1.00 17.74 ? 300 LEU A N   1 
ATOM   2365 C CA  . LEU A 1 300 ? 35.331  14.672  1.294   1.00 20.34 ? 300 LEU A CA  1 
ATOM   2366 C C   . LEU A 1 300 ? 36.616  14.669  0.476   1.00 20.41 ? 300 LEU A C   1 
ATOM   2367 O O   . LEU A 1 300 ? 37.704  14.598  1.039   1.00 18.95 ? 300 LEU A O   1 
ATOM   2368 C CB  . LEU A 1 300 ? 34.759  13.251  1.353   1.00 18.06 ? 300 LEU A CB  1 
ATOM   2369 C CG  . LEU A 1 300 ? 33.782  12.941  2.494   1.00 20.72 ? 300 LEU A CG  1 
ATOM   2370 C CD1 . LEU A 1 300 ? 33.394  11.473  2.456   1.00 12.00 ? 300 LEU A CD1 1 
ATOM   2371 C CD2 . LEU A 1 300 ? 34.435  13.270  3.830   1.00 19.06 ? 300 LEU A CD2 1 
ATOM   2372 N N   . GLU A 1 301 ? 36.488  14.766  -0.847  1.00 21.40 ? 301 GLU A N   1 
ATOM   2373 C CA  . GLU A 1 301 ? 37.658  14.753  -1.726  1.00 24.56 ? 301 GLU A CA  1 
ATOM   2374 C C   . GLU A 1 301 ? 38.475  16.041  -1.678  1.00 22.99 ? 301 GLU A C   1 
ATOM   2375 O O   . GLU A 1 301 ? 39.706  16.016  -1.803  1.00 21.25 ? 301 GLU A O   1 
ATOM   2376 C CB  . GLU A 1 301 ? 37.249  14.477  -3.177  1.00 26.59 ? 301 GLU A CB  1 
ATOM   2377 C CG  . GLU A 1 301 ? 36.571  13.127  -3.404  1.00 30.80 ? 301 GLU A CG  1 
ATOM   2378 C CD  . GLU A 1 301 ? 36.446  12.780  -4.879  1.00 31.23 ? 301 GLU A CD  1 
ATOM   2379 O OE1 . GLU A 1 301 ? 36.368  13.717  -5.708  1.00 32.78 ? 301 GLU A OE1 1 
ATOM   2380 O OE2 . GLU A 1 301 ? 36.414  11.573  -5.206  1.00 29.87 ? 301 GLU A OE2 1 
ATOM   2381 N N   . GLU A 1 302 ? 37.790  17.161  -1.495  1.00 20.84 ? 302 GLU A N   1 
ATOM   2382 C CA  . GLU A 1 302 ? 38.462  18.443  -1.445  1.00 20.80 ? 302 GLU A CA  1 
ATOM   2383 C C   . GLU A 1 302 ? 38.907  18.710  -0.019  1.00 21.14 ? 302 GLU A C   1 
ATOM   2384 O O   . GLU A 1 302 ? 39.460  19.770  0.290   1.00 23.02 ? 302 GLU A O   1 
ATOM   2385 C CB  . GLU A 1 302 ? 37.507  19.539  -1.917  1.00 22.66 ? 302 GLU A CB  1 
ATOM   2386 C CG  . GLU A 1 302 ? 36.778  19.185  -3.200  1.00 25.10 ? 302 GLU A CG  1 
ATOM   2387 C CD  . GLU A 1 302 ? 35.907  20.314  -3.721  1.00 25.33 ? 302 GLU A CD  1 
ATOM   2388 O OE1 . GLU A 1 302 ? 35.283  21.021  -2.900  1.00 31.32 ? 302 GLU A OE1 1 
ATOM   2389 O OE2 . GLU A 1 302 ? 35.830  20.480  -4.953  1.00 24.09 ? 302 GLU A OE2 1 
ATOM   2390 N N   . GLY A 1 303 ? 38.651  17.741  0.851   1.00 20.90 ? 303 GLY A N   1 
ATOM   2391 C CA  . GLY A 1 303 ? 39.023  17.874  2.247   1.00 20.77 ? 303 GLY A CA  1 
ATOM   2392 C C   . GLY A 1 303 ? 38.368  19.060  2.926   1.00 24.79 ? 303 GLY A C   1 
ATOM   2393 O O   . GLY A 1 303 ? 39.026  19.783  3.667   1.00 27.80 ? 303 GLY A O   1 
ATOM   2394 N N   . ARG A 1 304 ? 37.078  19.274  2.680   1.00 25.38 ? 304 ARG A N   1 
ATOM   2395 C CA  . ARG A 1 304 ? 36.373  20.403  3.297   1.00 25.69 ? 304 ARG A CA  1 
ATOM   2396 C C   . ARG A 1 304 ? 35.570  19.964  4.519   1.00 24.58 ? 304 ARG A C   1 
ATOM   2397 O O   . ARG A 1 304 ? 35.074  20.794  5.278   1.00 27.34 ? 304 ARG A O   1 
ATOM   2398 C CB  . ARG A 1 304 ? 35.432  21.067  2.285   1.00 28.04 ? 304 ARG A CB  1 
ATOM   2399 C CG  . ARG A 1 304 ? 36.095  21.964  1.226   1.00 24.09 ? 304 ARG A CG  1 
ATOM   2400 C CD  . ARG A 1 304 ? 35.180  22.086  0.007   1.00 20.44 ? 304 ARG A CD  1 
ATOM   2401 N NE  . ARG A 1 304 ? 33.780  22.019  0.424   1.00 26.42 ? 304 ARG A NE  1 
ATOM   2402 C CZ  . ARG A 1 304 ? 32.795  21.470  -0.281  1.00 25.43 ? 304 ARG A CZ  1 
ATOM   2403 N NH1 . ARG A 1 304 ? 33.028  20.921  -1.473  1.00 19.66 ? 304 ARG A NH1 1 
ATOM   2404 N NH2 . ARG A 1 304 ? 31.569  21.456  0.226   1.00 28.65 ? 304 ARG A NH2 1 
ATOM   2405 N N   . VAL A 1 305 ? 35.448  18.656  4.700   1.00 21.63 ? 305 VAL A N   1 
ATOM   2406 C CA  . VAL A 1 305 ? 34.712  18.078  5.818   1.00 18.81 ? 305 VAL A CA  1 
ATOM   2407 C C   . VAL A 1 305 ? 35.594  17.985  7.059   1.00 19.53 ? 305 VAL A C   1 
ATOM   2408 O O   . VAL A 1 305 ? 36.744  17.573  6.975   1.00 19.85 ? 305 VAL A O   1 
ATOM   2409 C CB  . VAL A 1 305 ? 34.209  16.654  5.464   1.00 17.04 ? 305 VAL A CB  1 
ATOM   2410 C CG1 . VAL A 1 305 ? 33.563  15.997  6.682   1.00 12.78 ? 305 VAL A CG1 1 
ATOM   2411 C CG2 . VAL A 1 305 ? 33.229  16.732  4.302   1.00 16.94 ? 305 VAL A CG2 1 
ATOM   2412 N N   . ARG A 1 306 ? 35.049  18.351  8.212   1.00 19.23 ? 306 ARG A N   1 
ATOM   2413 C CA  . ARG A 1 306 ? 35.807  18.299  9.454   1.00 22.01 ? 306 ARG A CA  1 
ATOM   2414 C C   . ARG A 1 306 ? 35.285  17.250  10.429  1.00 21.61 ? 306 ARG A C   1 
ATOM   2415 O O   . ARG A 1 306 ? 36.044  16.406  10.905  1.00 21.52 ? 306 ARG A O   1 
ATOM   2416 C CB  . ARG A 1 306 ? 35.799  19.667  10.119  1.00 27.29 ? 306 ARG A CB  1 
ATOM   2417 C CG  . ARG A 1 306 ? 36.302  20.739  9.194   1.00 36.06 ? 306 ARG A CG  1 
ATOM   2418 C CD  . ARG A 1 306 ? 36.397  22.070  9.887   1.00 42.35 ? 306 ARG A CD  1 
ATOM   2419 N NE  . ARG A 1 306 ? 37.248  21.998  11.066  1.00 45.65 ? 306 ARG A NE  1 
ATOM   2420 C CZ  . ARG A 1 306 ? 37.854  23.054  11.596  1.00 52.75 ? 306 ARG A CZ  1 
ATOM   2421 N NH1 . ARG A 1 306 ? 37.702  24.256  11.042  1.00 50.74 ? 306 ARG A NH1 1 
ATOM   2422 N NH2 . ARG A 1 306 ? 38.601  22.912  12.686  1.00 54.95 ? 306 ARG A NH2 1 
ATOM   2423 N N   . GLU A 1 307 ? 33.994  17.303  10.734  1.00 20.97 ? 307 GLU A N   1 
ATOM   2424 C CA  . GLU A 1 307 ? 33.408  16.334  11.651  1.00 20.62 ? 307 GLU A CA  1 
ATOM   2425 C C   . GLU A 1 307 ? 31.986  15.980  11.243  1.00 21.35 ? 307 GLU A C   1 
ATOM   2426 O O   . GLU A 1 307 ? 31.232  16.836  10.786  1.00 23.74 ? 307 GLU A O   1 
ATOM   2427 C CB  . GLU A 1 307 ? 33.370  16.890  13.081  1.00 20.33 ? 307 GLU A CB  1 
ATOM   2428 C CG  . GLU A 1 307 ? 34.668  17.501  13.587  1.00 21.73 ? 307 GLU A CG  1 
ATOM   2429 C CD  . GLU A 1 307 ? 34.566  18.014  15.022  1.00 21.97 ? 307 GLU A CD  1 
ATOM   2430 O OE1 . GLU A 1 307 ? 35.356  18.912  15.396  1.00 22.09 ? 307 GLU A OE1 1 
ATOM   2431 O OE2 . GLU A 1 307 ? 33.706  17.516  15.778  1.00 18.86 ? 307 GLU A OE2 1 
ATOM   2432 N N   . VAL A 1 308 ? 31.630  14.713  11.400  1.00 20.18 ? 308 VAL A N   1 
ATOM   2433 C CA  . VAL A 1 308 ? 30.276  14.263  11.115  1.00 19.94 ? 308 VAL A CA  1 
ATOM   2434 C C   . VAL A 1 308 ? 29.838  13.491  12.346  1.00 19.94 ? 308 VAL A C   1 
ATOM   2435 O O   . VAL A 1 308 ? 30.588  12.659  12.836  1.00 20.76 ? 308 VAL A O   1 
ATOM   2436 C CB  . VAL A 1 308 ? 30.213  13.332  9.899   1.00 22.92 ? 308 VAL A CB  1 
ATOM   2437 C CG1 . VAL A 1 308 ? 28.789  12.762  9.775   1.00 19.75 ? 308 VAL A CG1 1 
ATOM   2438 C CG2 . VAL A 1 308 ? 30.590  14.103  8.633   1.00 15.85 ? 308 VAL A CG2 1 
ATOM   2439 N N   . PHE A 1 309 ? 28.644  13.775  12.862  1.00 19.42 ? 309 PHE A N   1 
ATOM   2440 C CA  . PHE A 1 309 ? 28.167  13.078  14.055  1.00 14.52 ? 309 PHE A CA  1 
ATOM   2441 C C   . PHE A 1 309 ? 26.662  12.903  14.173  1.00 15.95 ? 309 PHE A C   1 
ATOM   2442 O O   . PHE A 1 309 ? 25.884  13.555  13.481  1.00 15.30 ? 309 PHE A O   1 
ATOM   2443 C CB  . PHE A 1 309 ? 28.676  13.772  15.326  1.00 14.55 ? 309 PHE A CB  1 
ATOM   2444 C CG  . PHE A 1 309 ? 28.292  15.232  15.434  1.00 18.75 ? 309 PHE A CG  1 
ATOM   2445 C CD1 . PHE A 1 309 ? 29.101  16.222  14.878  1.00 14.94 ? 309 PHE A CD1 1 
ATOM   2446 C CD2 . PHE A 1 309 ? 27.137  15.615  16.117  1.00 16.01 ? 309 PHE A CD2 1 
ATOM   2447 C CE1 . PHE A 1 309 ? 28.769  17.561  15.007  1.00 17.51 ? 309 PHE A CE1 1 
ATOM   2448 C CE2 . PHE A 1 309 ? 26.796  16.959  16.246  1.00 15.63 ? 309 PHE A CE2 1 
ATOM   2449 C CZ  . PHE A 1 309 ? 27.611  17.930  15.694  1.00 14.75 ? 309 PHE A CZ  1 
ATOM   2450 N N   . GLY A 1 310 ? 26.262  11.998  15.059  1.00 15.15 ? 310 GLY A N   1 
ATOM   2451 C CA  . GLY A 1 310 ? 24.852  11.760  15.288  1.00 16.78 ? 310 GLY A CA  1 
ATOM   2452 C C   . GLY A 1 310 ? 24.475  12.279  16.664  1.00 19.33 ? 310 GLY A C   1 
ATOM   2453 O O   . GLY A 1 310 ? 25.329  12.377  17.550  1.00 23.62 ? 310 GLY A O   1 
ATOM   2454 N N   . SER A 1 311 ? 23.207  12.628  16.858  1.00 19.39 ? 311 SER A N   1 
ATOM   2455 C CA  . SER A 1 311 ? 22.775  13.122  18.159  1.00 16.54 ? 311 SER A CA  1 
ATOM   2456 C C   . SER A 1 311 ? 21.482  12.459  18.605  1.00 17.65 ? 311 SER A C   1 
ATOM   2457 O O   . SER A 1 311 ? 20.608  12.142  17.791  1.00 16.38 ? 311 SER A O   1 
ATOM   2458 C CB  . SER A 1 311 ? 22.583  14.642  18.126  1.00 14.06 ? 311 SER A CB  1 
ATOM   2459 O OG  . SER A 1 311 ? 21.374  14.993  17.482  1.00 16.59 ? 311 SER A OG  1 
ATOM   2460 N N   . GLY A 1 312 ? 21.366  12.262  19.913  1.00 19.23 ? 312 GLY A N   1 
ATOM   2461 C CA  . GLY A 1 312 ? 20.177  11.649  20.475  1.00 18.06 ? 312 GLY A CA  1 
ATOM   2462 C C   . GLY A 1 312 ? 20.367  11.499  21.965  1.00 21.15 ? 312 GLY A C   1 
ATOM   2463 O O   . GLY A 1 312 ? 21.494  11.606  22.461  1.00 22.73 ? 312 GLY A O   1 
ATOM   2464 N N   . THR A 1 313 ? 19.279  11.239  22.682  1.00 20.94 ? 313 THR A N   1 
ATOM   2465 C CA  . THR A 1 313 ? 19.342  11.093  24.128  1.00 20.95 ? 313 THR A CA  1 
ATOM   2466 C C   . THR A 1 313 ? 20.290  9.983   24.570  1.00 23.25 ? 313 THR A C   1 
ATOM   2467 O O   . THR A 1 313 ? 21.048  10.151  25.525  1.00 22.76 ? 313 THR A O   1 
ATOM   2468 C CB  . THR A 1 313 ? 17.945  10.831  24.710  1.00 21.20 ? 313 THR A CB  1 
ATOM   2469 O OG1 . THR A 1 313 ? 17.113  11.972  24.467  1.00 24.69 ? 313 THR A OG1 1 
ATOM   2470 C CG2 . THR A 1 313 ? 18.024  10.591  26.210  1.00 20.22 ? 313 THR A CG2 1 
ATOM   2471 N N   . ALA A 1 314 ? 20.252  8.854   23.870  1.00 24.90 ? 314 ALA A N   1 
ATOM   2472 C CA  . ALA A 1 314 ? 21.104  7.716   24.203  1.00 26.45 ? 314 ALA A CA  1 
ATOM   2473 C C   . ALA A 1 314 ? 22.571  8.088   24.138  1.00 28.79 ? 314 ALA A C   1 
ATOM   2474 O O   . ALA A 1 314 ? 23.334  7.838   25.068  1.00 32.12 ? 314 ALA A O   1 
ATOM   2475 C CB  . ALA A 1 314 ? 20.833  6.573   23.255  1.00 24.72 ? 314 ALA A CB  1 
ATOM   2476 N N   . CYS A 1 315 ? 22.956  8.685   23.021  1.00 31.22 ? 315 CYS A N   1 
ATOM   2477 C CA  . CYS A 1 315 ? 24.327  9.104   22.798  1.00 34.46 ? 315 CYS A CA  1 
ATOM   2478 C C   . CYS A 1 315 ? 24.331  10.588  22.442  1.00 35.85 ? 315 CYS A C   1 
ATOM   2479 O O   . CYS A 1 315 ? 24.285  10.943  21.261  1.00 38.43 ? 315 CYS A O   1 
ATOM   2480 C CB  . CYS A 1 315 ? 24.922  8.289   21.651  1.00 34.37 ? 315 CYS A CB  1 
ATOM   2481 S SG  . CYS A 1 315 ? 26.598  8.751   21.183  1.00 43.39 ? 315 CYS A SG  1 
ATOM   2482 N N   . GLN A 1 316 ? 24.378  11.446  23.461  1.00 33.91 ? 316 GLN A N   1 
ATOM   2483 C CA  . GLN A 1 316 ? 24.377  12.894  23.263  1.00 31.37 ? 316 GLN A CA  1 
ATOM   2484 C C   . GLN A 1 316 ? 24.972  13.294  21.913  1.00 30.27 ? 316 GLN A C   1 
ATOM   2485 O O   . GLN A 1 316 ? 24.268  13.799  21.037  1.00 30.12 ? 316 GLN A O   1 
ATOM   2486 C CB  . GLN A 1 316 ? 25.163  13.586  24.386  1.00 35.00 ? 316 GLN A CB  1 
ATOM   2487 C CG  . GLN A 1 316 ? 24.685  13.267  25.810  1.00 38.22 ? 316 GLN A CG  1 
ATOM   2488 C CD  . GLN A 1 316 ? 23.323  13.863  26.139  1.00 39.03 ? 316 GLN A CD  1 
ATOM   2489 O OE1 . GLN A 1 316 ? 23.159  15.079  26.169  1.00 38.52 ? 316 GLN A OE1 1 
ATOM   2490 N NE2 . GLN A 1 316 ? 22.341  13.003  26.388  1.00 39.39 ? 316 GLN A NE2 1 
ATOM   2491 N N   . VAL A 1 317 ? 26.272  13.067  21.754  1.00 29.51 ? 317 VAL A N   1 
ATOM   2492 C CA  . VAL A 1 317 ? 26.989  13.395  20.517  1.00 26.92 ? 317 VAL A CA  1 
ATOM   2493 C C   . VAL A 1 317 ? 27.825  12.181  20.116  1.00 26.37 ? 317 VAL A C   1 
ATOM   2494 O O   . VAL A 1 317 ? 28.732  11.782  20.846  1.00 27.86 ? 317 VAL A O   1 
ATOM   2495 C CB  . VAL A 1 317 ? 27.922  14.597  20.735  1.00 26.88 ? 317 VAL A CB  1 
ATOM   2496 C CG1 . VAL A 1 317 ? 28.607  14.970  19.428  1.00 30.09 ? 317 VAL A CG1 1 
ATOM   2497 C CG2 . VAL A 1 317 ? 27.130  15.769  21.281  1.00 22.21 ? 317 VAL A CG2 1 
ATOM   2498 N N   . CYS A 1 318 ? 27.525  11.602  18.958  1.00 22.47 ? 318 CYS A N   1 
ATOM   2499 C CA  . CYS A 1 318 ? 28.218  10.404  18.497  1.00 20.73 ? 318 CYS A CA  1 
ATOM   2500 C C   . CYS A 1 318 ? 29.044  10.567  17.211  1.00 19.54 ? 318 CYS A C   1 
ATOM   2501 O O   . CYS A 1 318 ? 28.484  10.729  16.124  1.00 20.76 ? 318 CYS A O   1 
ATOM   2502 C CB  . CYS A 1 318 ? 27.191  9.299   18.294  1.00 23.70 ? 318 CYS A CB  1 
ATOM   2503 S SG  . CYS A 1 318 ? 27.897  7.656   18.292  1.00 38.47 ? 318 CYS A SG  1 
ATOM   2504 N N   . PRO A 1 319 ? 30.385  10.475  17.316  1.00 17.70 ? 319 PRO A N   1 
ATOM   2505 C CA  . PRO A 1 319 ? 31.316  10.613  16.189  1.00 18.65 ? 319 PRO A CA  1 
ATOM   2506 C C   . PRO A 1 319 ? 31.168  9.539   15.128  1.00 19.24 ? 319 PRO A C   1 
ATOM   2507 O O   . PRO A 1 319 ? 30.967  8.365   15.439  1.00 20.94 ? 319 PRO A O   1 
ATOM   2508 C CB  . PRO A 1 319 ? 32.695  10.530  16.849  1.00 18.39 ? 319 PRO A CB  1 
ATOM   2509 C CG  . PRO A 1 319 ? 32.442  10.872  18.282  1.00 23.20 ? 319 PRO A CG  1 
ATOM   2510 C CD  . PRO A 1 319 ? 31.128  10.203  18.555  1.00 22.27 ? 319 PRO A CD  1 
ATOM   2511 N N   . VAL A 1 320 ? 31.296  9.947   13.872  1.00 16.04 ? 320 VAL A N   1 
ATOM   2512 C CA  . VAL A 1 320 ? 31.218  9.024   12.758  1.00 16.42 ? 320 VAL A CA  1 
ATOM   2513 C C   . VAL A 1 320 ? 32.558  9.121   12.053  1.00 18.10 ? 320 VAL A C   1 
ATOM   2514 O O   . VAL A 1 320 ? 33.022  10.223  11.775  1.00 17.64 ? 320 VAL A O   1 
ATOM   2515 C CB  . VAL A 1 320 ? 30.098  9.420   11.774  1.00 16.58 ? 320 VAL A CB  1 
ATOM   2516 C CG1 . VAL A 1 320 ? 30.204  8.583   10.510  1.00 14.90 ? 320 VAL A CG1 1 
ATOM   2517 C CG2 . VAL A 1 320 ? 28.732  9.231   12.433  1.00 12.43 ? 320 VAL A CG2 1 
ATOM   2518 N N   . HIS A 1 321 ? 33.188  7.981   11.773  1.00 20.01 ? 321 HIS A N   1 
ATOM   2519 C CA  . HIS A 1 321 ? 34.486  7.997   11.095  1.00 21.28 ? 321 HIS A CA  1 
ATOM   2520 C C   . HIS A 1 321 ? 34.507  7.233   9.773   1.00 18.79 ? 321 HIS A C   1 
ATOM   2521 O O   . HIS A 1 321 ? 35.485  7.286   9.035   1.00 17.60 ? 321 HIS A O   1 
ATOM   2522 C CB  . HIS A 1 321 ? 35.577  7.433   12.007  1.00 21.56 ? 321 HIS A CB  1 
ATOM   2523 C CG  . HIS A 1 321 ? 35.499  5.953   12.191  1.00 24.41 ? 321 HIS A CG  1 
ATOM   2524 N ND1 . HIS A 1 321 ? 34.367  5.323   12.662  1.00 26.66 ? 321 HIS A ND1 1 
ATOM   2525 C CD2 . HIS A 1 321 ? 36.408  4.977   11.962  1.00 23.11 ? 321 HIS A CD2 1 
ATOM   2526 C CE1 . HIS A 1 321 ? 34.582  4.020   12.714  1.00 21.87 ? 321 HIS A CE1 1 
ATOM   2527 N NE2 . HIS A 1 321 ? 35.812  3.784   12.295  1.00 24.39 ? 321 HIS A NE2 1 
ATOM   2528 N N   . ARG A 1 322 ? 33.437  6.519   9.463   1.00 18.32 ? 322 ARG A N   1 
ATOM   2529 C CA  . ARG A 1 322 ? 33.424  5.778   8.211   1.00 18.05 ? 322 ARG A CA  1 
ATOM   2530 C C   . ARG A 1 322 ? 32.024  5.542   7.674   1.00 16.69 ? 322 ARG A C   1 
ATOM   2531 O O   . ARG A 1 322 ? 31.080  5.321   8.429   1.00 20.97 ? 322 ARG A O   1 
ATOM   2532 C CB  . ARG A 1 322 ? 34.143  4.432   8.391   1.00 15.33 ? 322 ARG A CB  1 
ATOM   2533 C CG  . ARG A 1 322 ? 34.314  3.643   7.104   1.00 22.58 ? 322 ARG A CG  1 
ATOM   2534 C CD  . ARG A 1 322 ? 35.134  2.383   7.331   1.00 24.79 ? 322 ARG A CD  1 
ATOM   2535 N NE  . ARG A 1 322 ? 34.420  1.417   8.157   1.00 28.13 ? 322 ARG A NE  1 
ATOM   2536 C CZ  . ARG A 1 322 ? 33.908  0.278   7.697   1.00 26.52 ? 322 ARG A CZ  1 
ATOM   2537 N NH1 . ARG A 1 322 ? 34.044  -0.037  6.416   1.00 23.90 ? 322 ARG A NH1 1 
ATOM   2538 N NH2 . ARG A 1 322 ? 33.241  -0.533  8.510   1.00 22.34 ? 322 ARG A NH2 1 
ATOM   2539 N N   . ILE A 1 323 ? 31.895  5.603   6.360   1.00 16.05 ? 323 ILE A N   1 
ATOM   2540 C CA  . ILE A 1 323 ? 30.620  5.355   5.710   1.00 17.06 ? 323 ILE A CA  1 
ATOM   2541 C C   . ILE A 1 323 ? 30.828  4.426   4.535   1.00 15.48 ? 323 ILE A C   1 
ATOM   2542 O O   . ILE A 1 323 ? 31.696  4.664   3.695   1.00 12.80 ? 323 ILE A O   1 
ATOM   2543 C CB  . ILE A 1 323 ? 29.976  6.643   5.177   1.00 16.77 ? 323 ILE A CB  1 
ATOM   2544 C CG1 . ILE A 1 323 ? 29.582  7.549   6.346   1.00 16.76 ? 323 ILE A CG1 1 
ATOM   2545 C CG2 . ILE A 1 323 ? 28.754  6.291   4.332   1.00 15.75 ? 323 ILE A CG2 1 
ATOM   2546 C CD1 . ILE A 1 323 ? 29.086  8.908   5.913   1.00 16.52 ? 323 ILE A CD1 1 
ATOM   2547 N N   . LEU A 1 324 ? 30.035  3.364   4.480   1.00 16.88 ? 324 LEU A N   1 
ATOM   2548 C CA  . LEU A 1 324 ? 30.128  2.422   3.372   1.00 22.16 ? 324 LEU A CA  1 
ATOM   2549 C C   . LEU A 1 324 ? 28.980  2.773   2.437   1.00 23.67 ? 324 LEU A C   1 
ATOM   2550 O O   . LEU A 1 324 ? 27.813  2.556   2.757   1.00 27.41 ? 324 LEU A O   1 
ATOM   2551 C CB  . LEU A 1 324 ? 30.006  0.973   3.871   1.00 21.08 ? 324 LEU A CB  1 
ATOM   2552 C CG  . LEU A 1 324 ? 30.112  -0.133  2.817   1.00 20.23 ? 324 LEU A CG  1 
ATOM   2553 C CD1 . LEU A 1 324 ? 31.447  -0.062  2.076   1.00 16.13 ? 324 LEU A CD1 1 
ATOM   2554 C CD2 . LEU A 1 324 ? 29.948  -1.467  3.499   1.00 18.78 ? 324 LEU A CD2 1 
ATOM   2555 N N   . TYR A 1 325 ? 29.331  3.339   1.290   1.00 25.34 ? 325 TYR A N   1 
ATOM   2556 C CA  . TYR A 1 325 ? 28.367  3.767   0.283   1.00 26.30 ? 325 TYR A CA  1 
ATOM   2557 C C   . TYR A 1 325 ? 28.640  3.085   -1.055  1.00 29.41 ? 325 TYR A C   1 
ATOM   2558 O O   . TYR A 1 325 ? 29.729  3.232   -1.611  1.00 29.57 ? 325 TYR A O   1 
ATOM   2559 C CB  . TYR A 1 325 ? 28.479  5.279   0.099   1.00 25.27 ? 325 TYR A CB  1 
ATOM   2560 C CG  . TYR A 1 325 ? 27.489  5.865   -0.874  1.00 21.54 ? 325 TYR A CG  1 
ATOM   2561 C CD1 . TYR A 1 325 ? 27.912  6.706   -1.897  1.00 22.51 ? 325 TYR A CD1 1 
ATOM   2562 C CD2 . TYR A 1 325 ? 26.125  5.589   -0.762  1.00 20.88 ? 325 TYR A CD2 1 
ATOM   2563 C CE1 . TYR A 1 325 ? 27.006  7.263   -2.788  1.00 23.01 ? 325 TYR A CE1 1 
ATOM   2564 C CE2 . TYR A 1 325 ? 25.208  6.137   -1.643  1.00 19.67 ? 325 TYR A CE2 1 
ATOM   2565 C CZ  . TYR A 1 325 ? 25.656  6.976   -2.655  1.00 24.81 ? 325 TYR A CZ  1 
ATOM   2566 O OH  . TYR A 1 325 ? 24.757  7.541   -3.526  1.00 23.52 ? 325 TYR A OH  1 
ATOM   2567 N N   . LYS A 1 326 ? 27.653  2.361   -1.582  1.00 34.54 ? 326 LYS A N   1 
ATOM   2568 C CA  . LYS A 1 326 ? 27.828  1.656   -2.858  1.00 38.86 ? 326 LYS A CA  1 
ATOM   2569 C C   . LYS A 1 326 ? 29.084  0.769   -2.814  1.00 37.56 ? 326 LYS A C   1 
ATOM   2570 O O   . LYS A 1 326 ? 29.935  0.846   -3.706  1.00 35.38 ? 326 LYS A O   1 
ATOM   2571 C CB  . LYS A 1 326 ? 27.994  2.651   -4.014  1.00 42.91 ? 326 LYS A CB  1 
ATOM   2572 C CG  . LYS A 1 326 ? 26.849  3.617   -4.273  1.00 44.54 ? 326 LYS A CG  1 
ATOM   2573 C CD  . LYS A 1 326 ? 27.227  4.522   -5.459  1.00 49.28 ? 326 LYS A CD  1 
ATOM   2574 C CE  . LYS A 1 326 ? 26.136  5.528   -5.813  1.00 51.88 ? 326 LYS A CE  1 
ATOM   2575 N NZ  . LYS A 1 326 ? 24.847  4.869   -6.171  1.00 54.54 ? 326 LYS A NZ  1 
ATOM   2576 N N   . ASP A 1 327 ? 29.200  -0.063  -1.782  1.00 38.56 ? 327 ASP A N   1 
ATOM   2577 C CA  . ASP A 1 327 ? 30.361  -0.940  -1.632  1.00 43.25 ? 327 ASP A CA  1 
ATOM   2578 C C   . ASP A 1 327 ? 31.674  -0.172  -1.789  1.00 41.81 ? 327 ASP A C   1 
ATOM   2579 O O   . ASP A 1 327 ? 32.628  -0.659  -2.396  1.00 42.40 ? 327 ASP A O   1 
ATOM   2580 C CB  . ASP A 1 327 ? 30.318  -2.085  -2.653  1.00 45.78 ? 327 ASP A CB  1 
ATOM   2581 C CG  . ASP A 1 327 ? 29.133  -3.016  -2.441  1.00 50.11 ? 327 ASP A CG  1 
ATOM   2582 O OD1 . ASP A 1 327 ? 28.060  -2.769  -3.037  1.00 48.54 ? 327 ASP A OD1 1 
ATOM   2583 O OD2 . ASP A 1 327 ? 29.279  -3.990  -1.667  1.00 53.94 ? 327 ASP A OD2 1 
ATOM   2584 N N   . ARG A 1 328 ? 31.709  1.035   -1.241  1.00 40.55 ? 328 ARG A N   1 
ATOM   2585 C CA  . ARG A 1 328 ? 32.899  1.868   -1.307  1.00 39.71 ? 328 ARG A CA  1 
ATOM   2586 C C   . ARG A 1 328 ? 33.133  2.527   0.050   1.00 36.12 ? 328 ARG A C   1 
ATOM   2587 O O   . ARG A 1 328 ? 32.197  3.015   0.679   1.00 32.54 ? 328 ARG A O   1 
ATOM   2588 C CB  . ARG A 1 328 ? 32.727  2.924   -2.394  1.00 46.42 ? 328 ARG A CB  1 
ATOM   2589 C CG  . ARG A 1 328 ? 33.907  3.859   -2.547  1.00 55.78 ? 328 ARG A CG  1 
ATOM   2590 C CD  . ARG A 1 328 ? 33.749  4.703   -3.796  1.00 64.05 ? 328 ARG A CD  1 
ATOM   2591 N NE  . ARG A 1 328 ? 33.795  3.883   -5.006  1.00 69.68 ? 328 ARG A NE  1 
ATOM   2592 C CZ  . ARG A 1 328 ? 33.610  4.356   -6.237  1.00 72.87 ? 328 ARG A CZ  1 
ATOM   2593 N NH1 . ARG A 1 328 ? 33.361  5.649   -6.425  1.00 74.95 ? 328 ARG A NH1 1 
ATOM   2594 N NH2 . ARG A 1 328 ? 33.673  3.539   -7.283  1.00 72.03 ? 328 ARG A NH2 1 
ATOM   2595 N N   . ASN A 1 329 ? 34.382  2.525   0.503   1.00 33.40 ? 329 ASN A N   1 
ATOM   2596 C CA  . ASN A 1 329 ? 34.720  3.116   1.794   1.00 32.71 ? 329 ASN A CA  1 
ATOM   2597 C C   . ASN A 1 329 ? 35.032  4.601   1.736   1.00 29.84 ? 329 ASN A C   1 
ATOM   2598 O O   . ASN A 1 329 ? 35.867  5.053   0.950   1.00 28.88 ? 329 ASN A O   1 
ATOM   2599 C CB  . ASN A 1 329 ? 35.913  2.390   2.421   1.00 35.59 ? 329 ASN A CB  1 
ATOM   2600 C CG  . ASN A 1 329 ? 35.535  1.057   3.010   1.00 39.57 ? 329 ASN A CG  1 
ATOM   2601 O OD1 . ASN A 1 329 ? 34.795  0.993   3.995   1.00 43.99 ? 329 ASN A OD1 1 
ATOM   2602 N ND2 . ASN A 1 329 ? 36.032  -0.023  2.408   1.00 36.58 ? 329 ASN A ND2 1 
ATOM   2603 N N   . LEU A 1 330 ? 34.349  5.355   2.582   1.00 27.40 ? 330 LEU A N   1 
ATOM   2604 C CA  . LEU A 1 330 ? 34.569  6.786   2.675   1.00 27.33 ? 330 LEU A CA  1 
ATOM   2605 C C   . LEU A 1 330 ? 35.054  7.039   4.097   1.00 26.72 ? 330 LEU A C   1 
ATOM   2606 O O   . LEU A 1 330 ? 34.322  6.827   5.062   1.00 27.25 ? 330 LEU A O   1 
ATOM   2607 C CB  . LEU A 1 330 ? 33.270  7.552   2.417   1.00 27.73 ? 330 LEU A CB  1 
ATOM   2608 C CG  . LEU A 1 330 ? 32.533  7.236   1.109   1.00 32.04 ? 330 LEU A CG  1 
ATOM   2609 C CD1 . LEU A 1 330 ? 31.289  8.125   0.978   1.00 25.90 ? 330 LEU A CD1 1 
ATOM   2610 C CD2 . LEU A 1 330 ? 33.468  7.451   -0.064  1.00 28.36 ? 330 LEU A CD2 1 
ATOM   2611 N N   . HIS A 1 331 ? 36.303  7.456   4.236   1.00 26.12 ? 331 HIS A N   1 
ATOM   2612 C CA  . HIS A 1 331 ? 36.838  7.731   5.560   1.00 24.02 ? 331 HIS A CA  1 
ATOM   2613 C C   . HIS A 1 331 ? 36.497  9.164   5.930   1.00 22.82 ? 331 HIS A C   1 
ATOM   2614 O O   . HIS A 1 331 ? 36.732  10.082  5.143   1.00 22.81 ? 331 HIS A O   1 
ATOM   2615 C CB  . HIS A 1 331 ? 38.357  7.549   5.592   1.00 24.34 ? 331 HIS A CB  1 
ATOM   2616 C CG  . HIS A 1 331 ? 38.973  7.924   6.903   1.00 24.88 ? 331 HIS A CG  1 
ATOM   2617 N ND1 . HIS A 1 331 ? 38.826  7.159   8.041   1.00 25.23 ? 331 HIS A ND1 1 
ATOM   2618 C CD2 . HIS A 1 331 ? 39.695  9.008   7.271   1.00 24.00 ? 331 HIS A CD2 1 
ATOM   2619 C CE1 . HIS A 1 331 ? 39.429  7.755   9.052   1.00 21.92 ? 331 HIS A CE1 1 
ATOM   2620 N NE2 . HIS A 1 331 ? 39.964  8.880   8.612   1.00 27.27 ? 331 HIS A NE2 1 
ATOM   2621 N N   . ILE A 1 332 ? 35.932  9.346   7.121   1.00 20.23 ? 332 ILE A N   1 
ATOM   2622 C CA  . ILE A 1 332 ? 35.566  10.668  7.603   1.00 17.55 ? 332 ILE A CA  1 
ATOM   2623 C C   . ILE A 1 332 ? 36.585  11.056  8.682   1.00 19.24 ? 332 ILE A C   1 
ATOM   2624 O O   . ILE A 1 332 ? 36.735  10.359  9.688   1.00 15.53 ? 332 ILE A O   1 
ATOM   2625 C CB  . ILE A 1 332 ? 34.130  10.679  8.195   1.00 20.53 ? 332 ILE A CB  1 
ATOM   2626 C CG1 . ILE A 1 332 ? 33.198  9.782   7.369   1.00 22.65 ? 332 ILE A CG1 1 
ATOM   2627 C CG2 . ILE A 1 332 ? 33.569  12.088  8.164   1.00 20.62 ? 332 ILE A CG2 1 
ATOM   2628 C CD1 . ILE A 1 332 ? 33.045  10.195  5.919   1.00 23.32 ? 332 ILE A CD1 1 
ATOM   2629 N N   . PRO A 1 333 ? 37.296  12.181  8.475   1.00 20.53 ? 333 PRO A N   1 
ATOM   2630 C CA  . PRO A 1 333 ? 38.337  12.784  9.323   1.00 20.51 ? 333 PRO A CA  1 
ATOM   2631 C C   . PRO A 1 333 ? 37.913  13.251  10.708  1.00 21.41 ? 333 PRO A C   1 
ATOM   2632 O O   . PRO A 1 333 ? 38.668  13.945  11.387  1.00 22.13 ? 333 PRO A O   1 
ATOM   2633 C CB  . PRO A 1 333 ? 38.826  13.969  8.488   1.00 23.26 ? 333 PRO A CB  1 
ATOM   2634 C CG  . PRO A 1 333 ? 38.415  13.626  7.085   1.00 28.30 ? 333 PRO A CG  1 
ATOM   2635 C CD  . PRO A 1 333 ? 37.074  12.999  7.270   1.00 21.09 ? 333 PRO A CD  1 
ATOM   2636 N N   . THR A 1 334 ? 36.716  12.878  11.136  1.00 21.02 ? 334 THR A N   1 
ATOM   2637 C CA  . THR A 1 334 ? 36.219  13.312  12.435  1.00 21.59 ? 334 THR A CA  1 
ATOM   2638 C C   . THR A 1 334 ? 37.210  13.211  13.596  1.00 23.98 ? 334 THR A C   1 
ATOM   2639 O O   . THR A 1 334 ? 37.451  14.203  14.288  1.00 26.69 ? 334 THR A O   1 
ATOM   2640 C CB  . THR A 1 334 ? 34.931  12.557  12.807  1.00 19.08 ? 334 THR A CB  1 
ATOM   2641 O OG1 . THR A 1 334 ? 33.964  12.746  11.771  1.00 23.78 ? 334 THR A OG1 1 
ATOM   2642 C CG2 . THR A 1 334 ? 34.354  13.083  14.116  1.00 14.88 ? 334 THR A CG2 1 
ATOM   2643 N N   . MET A 1 335 ? 37.791  12.034  13.814  1.00 22.34 ? 335 MET A N   1 
ATOM   2644 C CA  . MET A 1 335 ? 38.729  11.873  14.923  1.00 25.03 ? 335 MET A CA  1 
ATOM   2645 C C   . MET A 1 335 ? 40.064  12.604  14.759  1.00 28.18 ? 335 MET A C   1 
ATOM   2646 O O   . MET A 1 335 ? 40.589  13.151  15.730  1.00 29.97 ? 335 MET A O   1 
ATOM   2647 C CB  . MET A 1 335 ? 38.988  10.389  15.194  1.00 22.99 ? 335 MET A CB  1 
ATOM   2648 C CG  . MET A 1 335 ? 37.722  9.585   15.500  1.00 23.82 ? 335 MET A CG  1 
ATOM   2649 S SD  . MET A 1 335 ? 36.641  10.321  16.760  1.00 27.22 ? 335 MET A SD  1 
ATOM   2650 C CE  . MET A 1 335 ? 37.526  9.880   18.277  1.00 15.90 ? 335 MET A CE  1 
ATOM   2651 N N   . GLU A 1 336 ? 40.619  12.615  13.549  1.00 26.32 ? 336 GLU A N   1 
ATOM   2652 C CA  . GLU A 1 336 ? 41.887  13.299  13.337  1.00 27.72 ? 336 GLU A CA  1 
ATOM   2653 C C   . GLU A 1 336 ? 41.750  14.812  13.554  1.00 28.48 ? 336 GLU A C   1 
ATOM   2654 O O   . GLU A 1 336 ? 42.746  15.510  13.777  1.00 28.94 ? 336 GLU A O   1 
ATOM   2655 C CB  . GLU A 1 336 ? 42.439  13.021  11.927  1.00 28.18 ? 336 GLU A CB  1 
ATOM   2656 C CG  . GLU A 1 336 ? 41.529  12.206  11.018  1.00 31.30 ? 336 GLU A CG  1 
ATOM   2657 C CD  . GLU A 1 336 ? 41.555  10.716  11.308  1.00 29.63 ? 336 GLU A CD  1 
ATOM   2658 O OE1 . GLU A 1 336 ? 40.643  10.015  10.834  1.00 25.96 ? 336 GLU A OE1 1 
ATOM   2659 O OE2 . GLU A 1 336 ? 42.484  10.241  11.993  1.00 33.33 ? 336 GLU A OE2 1 
ATOM   2660 N N   . ASN A 1 337 ? 40.519  15.312  13.487  1.00 26.07 ? 337 ASN A N   1 
ATOM   2661 C CA  . ASN A 1 337 ? 40.264  16.736  13.679  1.00 25.16 ? 337 ASN A CA  1 
ATOM   2662 C C   . ASN A 1 337 ? 39.864  17.074  15.109  1.00 25.27 ? 337 ASN A C   1 
ATOM   2663 O O   . ASN A 1 337 ? 39.295  18.135  15.366  1.00 25.58 ? 337 ASN A O   1 
ATOM   2664 C CB  . ASN A 1 337 ? 39.179  17.213  12.711  1.00 25.56 ? 337 ASN A CB  1 
ATOM   2665 C CG  . ASN A 1 337 ? 39.640  17.174  11.266  1.00 23.13 ? 337 ASN A CG  1 
ATOM   2666 O OD1 . ASN A 1 337 ? 40.593  17.845  10.895  1.00 28.75 ? 337 ASN A OD1 1 
ATOM   2667 N ND2 . ASN A 1 337 ? 38.970  16.383  10.450  1.00 24.82 ? 337 ASN A ND2 1 
ATOM   2668 N N   . GLY A 1 338 ? 40.169  16.173  16.038  1.00 21.76 ? 338 GLY A N   1 
ATOM   2669 C CA  . GLY A 1 338 ? 39.831  16.412  17.423  1.00 24.53 ? 338 GLY A CA  1 
ATOM   2670 C C   . GLY A 1 338 ? 39.171  15.208  18.061  1.00 27.50 ? 338 GLY A C   1 
ATOM   2671 O O   . GLY A 1 338 ? 39.853  14.405  18.682  1.00 30.31 ? 338 GLY A O   1 
ATOM   2672 N N   . PRO A 1 339 ? 37.843  15.055  17.939  1.00 27.86 ? 339 PRO A N   1 
ATOM   2673 C CA  . PRO A 1 339 ? 36.943  15.970  17.236  1.00 26.84 ? 339 PRO A CA  1 
ATOM   2674 C C   . PRO A 1 339 ? 36.689  17.220  18.074  1.00 26.78 ? 339 PRO A C   1 
ATOM   2675 O O   . PRO A 1 339 ? 35.912  17.215  19.029  1.00 29.51 ? 339 PRO A O   1 
ATOM   2676 C CB  . PRO A 1 339 ? 35.690  15.122  17.040  1.00 28.68 ? 339 PRO A CB  1 
ATOM   2677 C CG  . PRO A 1 339 ? 35.661  14.302  18.277  1.00 27.05 ? 339 PRO A CG  1 
ATOM   2678 C CD  . PRO A 1 339 ? 37.106  13.871  18.419  1.00 25.98 ? 339 PRO A CD  1 
ATOM   2679 N N   . GLU A 1 340 ? 37.360  18.293  17.707  1.00 25.59 ? 340 GLU A N   1 
ATOM   2680 C CA  . GLU A 1 340 ? 37.241  19.551  18.417  1.00 27.24 ? 340 GLU A CA  1 
ATOM   2681 C C   . GLU A 1 340 ? 35.807  19.995  18.756  1.00 23.55 ? 340 GLU A C   1 
ATOM   2682 O O   . GLU A 1 340 ? 35.515  20.310  19.910  1.00 21.54 ? 340 GLU A O   1 
ATOM   2683 C CB  . GLU A 1 340 ? 37.965  20.631  17.607  1.00 29.24 ? 340 GLU A CB  1 
ATOM   2684 C CG  . GLU A 1 340 ? 38.050  22.003  18.246  1.00 34.35 ? 340 GLU A CG  1 
ATOM   2685 C CD  . GLU A 1 340 ? 38.887  22.954  17.403  1.00 39.37 ? 340 GLU A CD  1 
ATOM   2686 O OE1 . GLU A 1 340 ? 38.328  23.921  16.830  1.00 40.80 ? 340 GLU A OE1 1 
ATOM   2687 O OE2 . GLU A 1 340 ? 40.111  22.716  17.300  1.00 41.58 ? 340 GLU A OE2 1 
ATOM   2688 N N   . LEU A 1 341 ? 34.918  20.025  17.765  1.00 24.35 ? 341 LEU A N   1 
ATOM   2689 C CA  . LEU A 1 341 ? 33.537  20.472  17.995  1.00 23.55 ? 341 LEU A CA  1 
ATOM   2690 C C   . LEU A 1 341 ? 32.716  19.498  18.834  1.00 23.25 ? 341 LEU A C   1 
ATOM   2691 O O   . LEU A 1 341 ? 31.967  19.905  19.722  1.00 25.33 ? 341 LEU A O   1 
ATOM   2692 C CB  . LEU A 1 341 ? 32.819  20.718  16.659  1.00 24.47 ? 341 LEU A CB  1 
ATOM   2693 C CG  . LEU A 1 341 ? 31.434  21.388  16.707  1.00 24.36 ? 341 LEU A CG  1 
ATOM   2694 C CD1 . LEU A 1 341 ? 31.539  22.741  17.395  1.00 22.51 ? 341 LEU A CD1 1 
ATOM   2695 C CD2 . LEU A 1 341 ? 30.894  21.574  15.300  1.00 15.42 ? 341 LEU A CD2 1 
ATOM   2696 N N   . ILE A 1 342 ? 32.847  18.214  18.540  1.00 20.13 ? 342 ILE A N   1 
ATOM   2697 C CA  . ILE A 1 342 ? 32.121  17.202  19.275  1.00 22.97 ? 342 ILE A CA  1 
ATOM   2698 C C   . ILE A 1 342 ? 32.425  17.294  20.774  1.00 27.70 ? 342 ILE A C   1 
ATOM   2699 O O   . ILE A 1 342 ? 31.515  17.227  21.611  1.00 28.92 ? 342 ILE A O   1 
ATOM   2700 C CB  . ILE A 1 342 ? 32.489  15.805  18.749  1.00 25.58 ? 342 ILE A CB  1 
ATOM   2701 C CG1 . ILE A 1 342 ? 31.747  15.556  17.429  1.00 17.38 ? 342 ILE A CG1 1 
ATOM   2702 C CG2 . ILE A 1 342 ? 32.226  14.747  19.823  1.00 20.78 ? 342 ILE A CG2 1 
ATOM   2703 C CD1 . ILE A 1 342 ? 32.120  14.260  16.750  1.00 15.69 ? 342 ILE A CD1 1 
ATOM   2704 N N   . LEU A 1 343 ? 33.701  17.463  21.107  1.00 27.73 ? 343 LEU A N   1 
ATOM   2705 C CA  . LEU A 1 343 ? 34.124  17.563  22.500  1.00 28.60 ? 343 LEU A CA  1 
ATOM   2706 C C   . LEU A 1 343 ? 33.623  18.837  23.185  1.00 29.17 ? 343 LEU A C   1 
ATOM   2707 O O   . LEU A 1 343 ? 33.399  18.852  24.399  1.00 31.69 ? 343 LEU A O   1 
ATOM   2708 C CB  . LEU A 1 343 ? 35.652  17.494  22.589  1.00 28.31 ? 343 LEU A CB  1 
ATOM   2709 C CG  . LEU A 1 343 ? 36.314  16.197  22.108  1.00 30.53 ? 343 LEU A CG  1 
ATOM   2710 C CD1 . LEU A 1 343 ? 37.819  16.377  22.089  1.00 31.33 ? 343 LEU A CD1 1 
ATOM   2711 C CD2 . LEU A 1 343 ? 35.926  15.035  23.017  1.00 32.79 ? 343 LEU A CD2 1 
ATOM   2712 N N   . ARG A 1 344 ? 33.442  19.905  22.416  1.00 27.30 ? 344 ARG A N   1 
ATOM   2713 C CA  . ARG A 1 344 ? 32.974  21.164  22.986  1.00 26.44 ? 344 ARG A CA  1 
ATOM   2714 C C   . ARG A 1 344 ? 31.508  21.036  23.351  1.00 24.90 ? 344 ARG A C   1 
ATOM   2715 O O   . ARG A 1 344 ? 31.092  21.454  24.428  1.00 22.11 ? 344 ARG A O   1 
ATOM   2716 C CB  . ARG A 1 344 ? 33.170  22.312  21.994  1.00 26.64 ? 344 ARG A CB  1 
ATOM   2717 C CG  . ARG A 1 344 ? 32.754  23.677  22.526  1.00 27.60 ? 344 ARG A CG  1 
ATOM   2718 C CD  . ARG A 1 344 ? 33.128  24.796  21.557  1.00 26.22 ? 344 ARG A CD  1 
ATOM   2719 N NE  . ARG A 1 344 ? 32.588  26.086  21.980  1.00 31.75 ? 344 ARG A NE  1 
ATOM   2720 C CZ  . ARG A 1 344 ? 32.736  27.223  21.302  1.00 31.17 ? 344 ARG A CZ  1 
ATOM   2721 N NH1 . ARG A 1 344 ? 33.416  27.240  20.160  1.00 29.94 ? 344 ARG A NH1 1 
ATOM   2722 N NH2 . ARG A 1 344 ? 32.184  28.345  21.756  1.00 28.22 ? 344 ARG A NH2 1 
ATOM   2723 N N   . PHE A 1 345 ? 30.730  20.452  22.443  1.00 23.65 ? 345 PHE A N   1 
ATOM   2724 C CA  . PHE A 1 345 ? 29.308  20.249  22.678  1.00 21.35 ? 345 PHE A CA  1 
ATOM   2725 C C   . PHE A 1 345 ? 29.172  19.362  23.891  1.00 23.14 ? 345 PHE A C   1 
ATOM   2726 O O   . PHE A 1 345 ? 28.360  19.628  24.785  1.00 23.79 ? 345 PHE A O   1 
ATOM   2727 C CB  . PHE A 1 345 ? 28.656  19.569  21.476  1.00 20.23 ? 345 PHE A CB  1 
ATOM   2728 C CG  . PHE A 1 345 ? 28.178  20.522  20.422  1.00 17.84 ? 345 PHE A CG  1 
ATOM   2729 C CD1 . PHE A 1 345 ? 28.329  20.221  19.082  1.00 16.00 ? 345 PHE A CD1 1 
ATOM   2730 C CD2 . PHE A 1 345 ? 27.526  21.695  20.771  1.00 20.28 ? 345 PHE A CD2 1 
ATOM   2731 C CE1 . PHE A 1 345 ? 27.836  21.071  18.108  1.00 19.61 ? 345 PHE A CE1 1 
ATOM   2732 C CE2 . PHE A 1 345 ? 27.030  22.549  19.800  1.00 21.62 ? 345 PHE A CE2 1 
ATOM   2733 C CZ  . PHE A 1 345 ? 27.184  22.237  18.465  1.00 18.77 ? 345 PHE A CZ  1 
ATOM   2734 N N   . GLN A 1 346 ? 29.975  18.302  23.921  1.00 24.85 ? 346 GLN A N   1 
ATOM   2735 C CA  . GLN A 1 346 ? 29.943  17.374  25.037  1.00 27.36 ? 346 GLN A CA  1 
ATOM   2736 C C   . GLN A 1 346 ? 30.204  18.086  26.360  1.00 27.12 ? 346 GLN A C   1 
ATOM   2737 O O   . GLN A 1 346 ? 29.374  18.043  27.271  1.00 28.13 ? 346 GLN A O   1 
ATOM   2738 C CB  . GLN A 1 346 ? 30.955  16.252  24.825  1.00 30.33 ? 346 GLN A CB  1 
ATOM   2739 C CG  . GLN A 1 346 ? 30.417  15.103  23.994  1.00 35.71 ? 346 GLN A CG  1 
ATOM   2740 C CD  . GLN A 1 346 ? 31.342  13.897  24.003  1.00 45.84 ? 346 GLN A CD  1 
ATOM   2741 O OE1 . GLN A 1 346 ? 31.035  12.857  23.412  1.00 49.05 ? 346 GLN A OE1 1 
ATOM   2742 N NE2 . GLN A 1 346 ? 32.485  14.029  24.678  1.00 49.12 ? 346 GLN A NE2 1 
ATOM   2743 N N   . LYS A 1 347 ? 31.344  18.758  26.463  1.00 27.65 ? 347 LYS A N   1 
ATOM   2744 C CA  . LYS A 1 347 ? 31.673  19.472  27.688  1.00 29.79 ? 347 LYS A CA  1 
ATOM   2745 C C   . LYS A 1 347 ? 30.522  20.362  28.149  1.00 28.18 ? 347 LYS A C   1 
ATOM   2746 O O   . LYS A 1 347 ? 30.087  20.260  29.291  1.00 30.40 ? 347 LYS A O   1 
ATOM   2747 C CB  . LYS A 1 347 ? 32.929  20.332  27.503  1.00 34.13 ? 347 LYS A CB  1 
ATOM   2748 C CG  . LYS A 1 347 ? 33.378  21.041  28.778  1.00 39.80 ? 347 LYS A CG  1 
ATOM   2749 C CD  . LYS A 1 347 ? 34.623  21.893  28.555  1.00 45.53 ? 347 LYS A CD  1 
ATOM   2750 C CE  . LYS A 1 347 ? 34.347  23.029  27.576  1.00 50.55 ? 347 LYS A CE  1 
ATOM   2751 N NZ  . LYS A 1 347 ? 35.534  23.918  27.357  1.00 52.21 ? 347 LYS A NZ  1 
ATOM   2752 N N   . GLU A 1 348 ? 30.019  21.222  27.267  1.00 23.33 ? 348 GLU A N   1 
ATOM   2753 C CA  . GLU A 1 348 ? 28.938  22.119  27.644  1.00 23.96 ? 348 GLU A CA  1 
ATOM   2754 C C   . GLU A 1 348 ? 27.651  21.440  28.077  1.00 24.65 ? 348 GLU A C   1 
ATOM   2755 O O   . GLU A 1 348 ? 26.995  21.914  28.999  1.00 27.46 ? 348 GLU A O   1 
ATOM   2756 C CB  . GLU A 1 348 ? 28.659  23.129  26.529  1.00 26.29 ? 348 GLU A CB  1 
ATOM   2757 C CG  . GLU A 1 348 ? 29.789  24.143  26.380  1.00 35.08 ? 348 GLU A CG  1 
ATOM   2758 C CD  . GLU A 1 348 ? 29.349  25.442  25.732  1.00 40.15 ? 348 GLU A CD  1 
ATOM   2759 O OE1 . GLU A 1 348 ? 28.342  26.028  26.192  1.00 41.70 ? 348 GLU A OE1 1 
ATOM   2760 O OE2 . GLU A 1 348 ? 30.019  25.885  24.773  1.00 43.12 ? 348 GLU A OE2 1 
ATOM   2761 N N   . LEU A 1 349 ? 27.273  20.344  27.426  1.00 21.99 ? 349 LEU A N   1 
ATOM   2762 C CA  . LEU A 1 349 ? 26.055  19.656  27.830  1.00 23.05 ? 349 LEU A CA  1 
ATOM   2763 C C   . LEU A 1 349 ? 26.249  19.064  29.221  1.00 23.16 ? 349 LEU A C   1 
ATOM   2764 O O   . LEU A 1 349 ? 25.354  19.117  30.057  1.00 22.96 ? 349 LEU A O   1 
ATOM   2765 C CB  . LEU A 1 349 ? 25.692  18.554  26.831  1.00 23.36 ? 349 LEU A CB  1 
ATOM   2766 C CG  . LEU A 1 349 ? 24.966  19.008  25.562  1.00 23.46 ? 349 LEU A CG  1 
ATOM   2767 C CD1 . LEU A 1 349 ? 24.894  17.875  24.566  1.00 24.19 ? 349 LEU A CD1 1 
ATOM   2768 C CD2 . LEU A 1 349 ? 23.569  19.481  25.917  1.00 23.09 ? 349 LEU A CD2 1 
ATOM   2769 N N   . LYS A 1 350 ? 27.433  18.514  29.461  1.00 24.81 ? 350 LYS A N   1 
ATOM   2770 C CA  . LYS A 1 350 ? 27.756  17.914  30.743  1.00 25.17 ? 350 LYS A CA  1 
ATOM   2771 C C   . LYS A 1 350 ? 27.647  18.923  31.889  1.00 25.81 ? 350 LYS A C   1 
ATOM   2772 O O   . LYS A 1 350 ? 27.103  18.604  32.957  1.00 26.29 ? 350 LYS A O   1 
ATOM   2773 C CB  . LYS A 1 350 ? 29.161  17.296  30.678  1.00 27.91 ? 350 LYS A CB  1 
ATOM   2774 C CG  . LYS A 1 350 ? 29.766  16.949  32.024  1.00 33.20 ? 350 LYS A CG  1 
ATOM   2775 C CD  . LYS A 1 350 ? 30.724  15.759  31.962  1.00 36.89 ? 350 LYS A CD  1 
ATOM   2776 C CE  . LYS A 1 350 ? 31.767  15.868  30.851  1.00 43.84 ? 350 LYS A CE  1 
ATOM   2777 N NZ  . LYS A 1 350 ? 31.348  15.190  29.581  1.00 45.63 ? 350 LYS A NZ  1 
ATOM   2778 N N   . GLU A 1 351 ? 28.139  20.141  31.673  1.00 24.41 ? 351 GLU A N   1 
ATOM   2779 C CA  . GLU A 1 351 ? 28.075  21.166  32.719  1.00 26.78 ? 351 GLU A CA  1 
ATOM   2780 C C   . GLU A 1 351 ? 26.636  21.591  32.990  1.00 25.62 ? 351 GLU A C   1 
ATOM   2781 O O   . GLU A 1 351 ? 26.264  21.850  34.133  1.00 29.15 ? 351 GLU A O   1 
ATOM   2782 C CB  . GLU A 1 351 ? 28.914  22.395  32.337  1.00 25.92 ? 351 GLU A CB  1 
ATOM   2783 C CG  . GLU A 1 351 ? 30.303  22.048  31.824  1.00 35.28 ? 351 GLU A CG  1 
ATOM   2784 C CD  . GLU A 1 351 ? 31.293  23.201  31.918  1.00 38.30 ? 351 GLU A CD  1 
ATOM   2785 O OE1 . GLU A 1 351 ? 30.924  24.346  31.568  1.00 35.27 ? 351 GLU A OE1 1 
ATOM   2786 O OE2 . GLU A 1 351 ? 32.449  22.947  32.333  1.00 39.24 ? 351 GLU A OE2 1 
ATOM   2787 N N   . ILE A 1 352 ? 25.832  21.670  31.937  1.00 22.77 ? 352 ILE A N   1 
ATOM   2788 C CA  . ILE A 1 352 ? 24.435  22.049  32.076  1.00 21.69 ? 352 ILE A CA  1 
ATOM   2789 C C   . ILE A 1 352 ? 23.602  20.922  32.698  1.00 24.90 ? 352 ILE A C   1 
ATOM   2790 O O   . ILE A 1 352 ? 22.838  21.142  33.641  1.00 24.62 ? 352 ILE A O   1 
ATOM   2791 C CB  . ILE A 1 352 ? 23.820  22.395  30.711  1.00 20.72 ? 352 ILE A CB  1 
ATOM   2792 C CG1 . ILE A 1 352 ? 24.398  23.712  30.191  1.00 19.46 ? 352 ILE A CG1 1 
ATOM   2793 C CG2 . ILE A 1 352 ? 22.310  22.485  30.829  1.00 20.68 ? 352 ILE A CG2 1 
ATOM   2794 C CD1 . ILE A 1 352 ? 23.898  24.079  28.815  1.00 14.23 ? 352 ILE A CD1 1 
ATOM   2795 N N   . GLN A 1 353 ? 23.752  19.715  32.161  1.00 27.80 ? 353 GLN A N   1 
ATOM   2796 C CA  . GLN A 1 353 ? 22.992  18.570  32.641  1.00 28.64 ? 353 GLN A CA  1 
ATOM   2797 C C   . GLN A 1 353 ? 23.336  18.177  34.078  1.00 29.44 ? 353 GLN A C   1 
ATOM   2798 O O   . GLN A 1 353 ? 22.440  17.869  34.860  1.00 26.31 ? 353 GLN A O   1 
ATOM   2799 C CB  . GLN A 1 353 ? 23.175  17.384  31.677  1.00 24.76 ? 353 GLN A CB  1 
ATOM   2800 C CG  . GLN A 1 353 ? 22.786  17.760  30.239  1.00 26.52 ? 353 GLN A CG  1 
ATOM   2801 C CD  . GLN A 1 353 ? 22.899  16.617  29.238  1.00 23.83 ? 353 GLN A CD  1 
ATOM   2802 O OE1 . GLN A 1 353 ? 23.887  15.877  29.219  1.00 24.15 ? 353 GLN A OE1 1 
ATOM   2803 N NE2 . GLN A 1 353 ? 21.890  16.485  28.385  1.00 26.18 ? 353 GLN A NE2 1 
ATOM   2804 N N   . TYR A 1 354 ? 24.618  18.209  34.438  1.00 30.03 ? 354 TYR A N   1 
ATOM   2805 C CA  . TYR A 1 354 ? 25.001  17.834  35.794  1.00 27.88 ? 354 TYR A CA  1 
ATOM   2806 C C   . TYR A 1 354 ? 24.999  18.976  36.802  1.00 28.25 ? 354 TYR A C   1 
ATOM   2807 O O   . TYR A 1 354 ? 25.604  18.867  37.864  1.00 28.94 ? 354 TYR A O   1 
ATOM   2808 C CB  . TYR A 1 354 ? 26.358  17.130  35.797  1.00 27.96 ? 354 TYR A CB  1 
ATOM   2809 C CG  . TYR A 1 354 ? 26.300  15.756  35.177  1.00 29.53 ? 354 TYR A CG  1 
ATOM   2810 C CD1 . TYR A 1 354 ? 26.521  15.580  33.816  1.00 30.17 ? 354 TYR A CD1 1 
ATOM   2811 C CD2 . TYR A 1 354 ? 25.978  14.634  35.944  1.00 29.24 ? 354 TYR A CD2 1 
ATOM   2812 C CE1 . TYR A 1 354 ? 26.425  14.326  33.228  1.00 30.74 ? 354 TYR A CE1 1 
ATOM   2813 C CE2 . TYR A 1 354 ? 25.875  13.370  35.366  1.00 28.60 ? 354 TYR A CE2 1 
ATOM   2814 C CZ  . TYR A 1 354 ? 26.103  13.225  34.007  1.00 30.23 ? 354 TYR A CZ  1 
ATOM   2815 O OH  . TYR A 1 354 ? 26.028  11.986  33.416  1.00 32.53 ? 354 TYR A OH  1 
ATOM   2816 N N   . GLY A 1 355 ? 24.323  20.070  36.465  1.00 28.13 ? 355 GLY A N   1 
ATOM   2817 C CA  . GLY A 1 355 ? 24.223  21.194  37.381  1.00 30.28 ? 355 GLY A CA  1 
ATOM   2818 C C   . GLY A 1 355 ? 25.451  22.048  37.662  1.00 32.71 ? 355 GLY A C   1 
ATOM   2819 O O   . GLY A 1 355 ? 25.363  22.996  38.444  1.00 33.23 ? 355 GLY A O   1 
ATOM   2820 N N   . ILE A 1 356 ? 26.588  21.726  37.051  1.00 33.36 ? 356 ILE A N   1 
ATOM   2821 C CA  . ILE A 1 356 ? 27.812  22.505  37.252  1.00 32.77 ? 356 ILE A CA  1 
ATOM   2822 C C   . ILE A 1 356 ? 27.513  23.974  36.954  1.00 34.58 ? 356 ILE A C   1 
ATOM   2823 O O   . ILE A 1 356 ? 28.060  24.881  37.580  1.00 37.23 ? 356 ILE A O   1 
ATOM   2824 C CB  . ILE A 1 356 ? 28.937  22.054  36.287  1.00 33.32 ? 356 ILE A CB  1 
ATOM   2825 C CG1 . ILE A 1 356 ? 29.291  20.584  36.519  1.00 33.06 ? 356 ILE A CG1 1 
ATOM   2826 C CG2 . ILE A 1 356 ? 30.154  22.937  36.471  1.00 31.21 ? 356 ILE A CG2 1 
ATOM   2827 C CD1 . ILE A 1 356 ? 29.851  20.298  37.893  1.00 38.29 ? 356 ILE A CD1 1 
ATOM   2828 N N   . ARG A 1 357 ? 26.632  24.193  35.988  1.00 35.95 ? 357 ARG A N   1 
ATOM   2829 C CA  . ARG A 1 357 ? 26.253  25.537  35.567  1.00 38.40 ? 357 ARG A CA  1 
ATOM   2830 C C   . ARG A 1 357 ? 24.733  25.667  35.624  1.00 39.47 ? 357 ARG A C   1 
ATOM   2831 O O   . ARG A 1 357 ? 24.013  24.761  35.196  1.00 44.96 ? 357 ARG A O   1 
ATOM   2832 C CB  . ARG A 1 357 ? 26.725  25.766  34.133  1.00 38.64 ? 357 ARG A CB  1 
ATOM   2833 C CG  . ARG A 1 357 ? 26.483  27.162  33.613  1.00 42.21 ? 357 ARG A CG  1 
ATOM   2834 C CD  . ARG A 1 357 ? 26.538  27.195  32.092  1.00 43.77 ? 357 ARG A CD  1 
ATOM   2835 N NE  . ARG A 1 357 ? 27.670  26.449  31.541  1.00 45.55 ? 357 ARG A NE  1 
ATOM   2836 C CZ  . ARG A 1 357 ? 27.896  26.307  30.236  1.00 48.55 ? 357 ARG A CZ  1 
ATOM   2837 N NH1 . ARG A 1 357 ? 27.066  26.863  29.355  1.00 49.44 ? 357 ARG A NH1 1 
ATOM   2838 N NH2 . ARG A 1 357 ? 28.944  25.610  29.806  1.00 47.59 ? 357 ARG A NH2 1 
ATOM   2839 N N   . ALA A 1 358 ? 24.243  26.785  36.144  1.00 37.72 ? 358 ALA A N   1 
ATOM   2840 C CA  . ALA A 1 358 ? 22.799  26.998  36.243  1.00 36.11 ? 358 ALA A CA  1 
ATOM   2841 C C   . ALA A 1 358 ? 22.231  27.283  34.856  1.00 36.04 ? 358 ALA A C   1 
ATOM   2842 O O   . ALA A 1 358 ? 22.773  28.115  34.114  1.00 37.58 ? 358 ALA A O   1 
ATOM   2843 C CB  . ALA A 1 358 ? 22.504  28.160  37.183  1.00 37.75 ? 358 ALA A CB  1 
ATOM   2844 N N   . HIS A 1 359 ? 21.142  26.600  34.505  1.00 35.81 ? 359 HIS A N   1 
ATOM   2845 C CA  . HIS A 1 359 ? 20.530  26.774  33.186  1.00 32.05 ? 359 HIS A CA  1 
ATOM   2846 C C   . HIS A 1 359 ? 19.019  26.533  33.213  1.00 29.55 ? 359 HIS A C   1 
ATOM   2847 O O   . HIS A 1 359 ? 18.529  25.690  33.973  1.00 30.11 ? 359 HIS A O   1 
ATOM   2848 C CB  . HIS A 1 359 ? 21.201  25.818  32.182  1.00 33.98 ? 359 HIS A CB  1 
ATOM   2849 C CG  . HIS A 1 359 ? 21.172  26.310  30.769  1.00 33.38 ? 359 HIS A CG  1 
ATOM   2850 N ND1 . HIS A 1 359 ? 20.028  26.304  30.000  1.00 33.01 ? 359 HIS A ND1 1 
ATOM   2851 C CD2 . HIS A 1 359 ? 22.128  26.902  30.016  1.00 32.83 ? 359 HIS A CD2 1 
ATOM   2852 C CE1 . HIS A 1 359 ? 20.279  26.876  28.836  1.00 30.79 ? 359 HIS A CE1 1 
ATOM   2853 N NE2 . HIS A 1 359 ? 21.546  27.249  28.820  1.00 31.05 ? 359 HIS A NE2 1 
ATOM   2854 N N   . GLU A 1 360 ? 18.289  27.278  32.383  1.00 27.43 ? 360 GLU A N   1 
ATOM   2855 C CA  . GLU A 1 360 ? 16.835  27.151  32.304  1.00 25.50 ? 360 GLU A CA  1 
ATOM   2856 C C   . GLU A 1 360 ? 16.361  25.859  31.631  1.00 24.79 ? 360 GLU A C   1 
ATOM   2857 O O   . GLU A 1 360 ? 15.191  25.491  31.745  1.00 25.16 ? 360 GLU A O   1 
ATOM   2858 C CB  . GLU A 1 360 ? 16.236  28.355  31.578  1.00 28.95 ? 360 GLU A CB  1 
ATOM   2859 C CG  . GLU A 1 360 ? 16.796  28.600  30.180  1.00 38.56 ? 360 GLU A CG  1 
ATOM   2860 C CD  . GLU A 1 360 ? 16.200  29.836  29.519  1.00 42.83 ? 360 GLU A CD  1 
ATOM   2861 O OE1 . GLU A 1 360 ? 16.556  30.124  28.358  1.00 47.23 ? 360 GLU A OE1 1 
ATOM   2862 O OE2 . GLU A 1 360 ? 15.375  30.525  30.156  1.00 44.76 ? 360 GLU A OE2 1 
ATOM   2863 N N   . TRP A 1 361 ? 17.256  25.172  30.928  1.00 24.38 ? 361 TRP A N   1 
ATOM   2864 C CA  . TRP A 1 361 ? 16.886  23.908  30.277  1.00 25.23 ? 361 TRP A CA  1 
ATOM   2865 C C   . TRP A 1 361 ? 16.660  22.789  31.287  1.00 23.60 ? 361 TRP A C   1 
ATOM   2866 O O   . TRP A 1 361 ? 15.969  21.818  30.985  1.00 21.74 ? 361 TRP A O   1 
ATOM   2867 C CB  . TRP A 1 361 ? 17.971  23.421  29.300  1.00 23.16 ? 361 TRP A CB  1 
ATOM   2868 C CG  . TRP A 1 361 ? 18.052  24.161  27.990  1.00 22.08 ? 361 TRP A CG  1 
ATOM   2869 C CD1 . TRP A 1 361 ? 17.172  25.084  27.508  1.00 18.18 ? 361 TRP A CD1 1 
ATOM   2870 C CD2 . TRP A 1 361 ? 19.077  24.022  26.995  1.00 20.38 ? 361 TRP A CD2 1 
ATOM   2871 N NE1 . TRP A 1 361 ? 17.586  25.533  26.274  1.00 22.09 ? 361 TRP A NE1 1 
ATOM   2872 C CE2 . TRP A 1 361 ? 18.752  24.897  25.936  1.00 21.83 ? 361 TRP A CE2 1 
ATOM   2873 C CE3 . TRP A 1 361 ? 20.236  23.240  26.895  1.00 23.74 ? 361 TRP A CE3 1 
ATOM   2874 C CZ2 . TRP A 1 361 ? 19.548  25.014  24.788  1.00 22.25 ? 361 TRP A CZ2 1 
ATOM   2875 C CZ3 . TRP A 1 361 ? 21.029  23.356  25.746  1.00 21.15 ? 361 TRP A CZ3 1 
ATOM   2876 C CH2 . TRP A 1 361 ? 20.677  24.238  24.713  1.00 21.45 ? 361 TRP A CH2 1 
ATOM   2877 N N   . MET A 1 362 ? 17.251  22.913  32.475  1.00 22.55 ? 362 MET A N   1 
ATOM   2878 C CA  . MET A 1 362 ? 17.120  21.867  33.487  1.00 21.52 ? 362 MET A CA  1 
ATOM   2879 C C   . MET A 1 362 ? 15.883  21.992  34.345  1.00 21.37 ? 362 MET A C   1 
ATOM   2880 O O   . MET A 1 362 ? 15.524  23.076  34.799  1.00 25.17 ? 362 MET A O   1 
ATOM   2881 C CB  . MET A 1 362 ? 18.356  21.820  34.383  1.00 20.59 ? 362 MET A CB  1 
ATOM   2882 C CG  . MET A 1 362 ? 19.657  21.584  33.631  1.00 18.96 ? 362 MET A CG  1 
ATOM   2883 S SD  . MET A 1 362 ? 19.498  20.397  32.276  1.00 22.12 ? 362 MET A SD  1 
ATOM   2884 C CE  . MET A 1 362 ? 19.414  18.847  33.163  1.00 22.02 ? 362 MET A CE  1 
ATOM   2885 N N   . PHE A 1 363 ? 15.229  20.860  34.553  1.00 22.34 ? 363 PHE A N   1 
ATOM   2886 C CA  . PHE A 1 363 ? 14.014  20.804  35.344  1.00 23.89 ? 363 PHE A CA  1 
ATOM   2887 C C   . PHE A 1 363 ? 14.334  20.041  36.621  1.00 24.49 ? 363 PHE A C   1 
ATOM   2888 O O   . PHE A 1 363 ? 14.637  18.847  36.579  1.00 26.54 ? 363 PHE A O   1 
ATOM   2889 C CB  . PHE A 1 363 ? 12.932  20.077  34.551  1.00 25.38 ? 363 PHE A CB  1 
ATOM   2890 C CG  . PHE A 1 363 ? 11.606  19.999  35.252  1.00 28.29 ? 363 PHE A CG  1 
ATOM   2891 C CD1 . PHE A 1 363 ? 10.787  21.113  35.350  1.00 29.85 ? 363 PHE A CD1 1 
ATOM   2892 C CD2 . PHE A 1 363 ? 11.169  18.804  35.805  1.00 29.68 ? 363 PHE A CD2 1 
ATOM   2893 C CE1 . PHE A 1 363 ? 9.548   21.033  35.988  1.00 31.83 ? 363 PHE A CE1 1 
ATOM   2894 C CE2 . PHE A 1 363 ? 9.931   18.721  36.443  1.00 30.54 ? 363 PHE A CE2 1 
ATOM   2895 C CZ  . PHE A 1 363 ? 9.124   19.835  36.532  1.00 26.97 ? 363 PHE A CZ  1 
ATOM   2896 N N   . PRO A 1 364 ? 14.265  20.719  37.776  1.00 23.60 ? 364 PRO A N   1 
ATOM   2897 C CA  . PRO A 1 364 ? 14.551  20.106  39.081  1.00 25.20 ? 364 PRO A CA  1 
ATOM   2898 C C   . PRO A 1 364 ? 13.472  19.104  39.505  1.00 26.29 ? 364 PRO A C   1 
ATOM   2899 O O   . PRO A 1 364 ? 12.280  19.355  39.314  1.00 23.33 ? 364 PRO A O   1 
ATOM   2900 C CB  . PRO A 1 364 ? 14.587  21.301  40.046  1.00 21.95 ? 364 PRO A CB  1 
ATOM   2901 C CG  . PRO A 1 364 ? 14.521  22.534  39.158  1.00 23.81 ? 364 PRO A CG  1 
ATOM   2902 C CD  . PRO A 1 364 ? 13.768  22.092  37.946  1.00 23.04 ? 364 PRO A CD  1 
ATOM   2903 N N   . VAL A 1 365 ? 13.876  17.975  40.076  1.00 27.97 ? 365 VAL A N   1 
ATOM   2904 C CA  . VAL A 1 365 ? 12.882  17.012  40.538  1.00 32.60 ? 365 VAL A CA  1 
ATOM   2905 C C   . VAL A 1 365 ? 12.647  17.278  42.018  1.00 31.61 ? 365 VAL A C   1 
ATOM   2906 O O   . VAL A 1 365 ? 13.648  17.311  42.765  1.00 34.70 ? 365 VAL A O   1 
ATOM   2907 C CB  . VAL A 1 365 ? 13.345  15.540  40.350  1.00 33.17 ? 365 VAL A CB  1 
ATOM   2908 C CG1 . VAL A 1 365 ? 14.662  15.317  41.038  1.00 38.04 ? 365 VAL A CG1 1 
ATOM   2909 C CG2 . VAL A 1 365 ? 12.317  14.591  40.939  1.00 31.74 ? 365 VAL A CG2 1 
ATOM   2910 O OXT . VAL A 1 365 ? 11.474  17.460  42.405  1.00 29.77 ? 365 VAL A OXT 1 
ATOM   2911 N N   . ALA B 1 1   ? 14.996  -17.987 14.403  1.00 67.37 ? 1   ALA B N   1 
ATOM   2912 C CA  . ALA B 1 1   ? 14.905  -18.972 13.290  1.00 69.50 ? 1   ALA B CA  1 
ATOM   2913 C C   . ALA B 1 1   ? 15.470  -20.336 13.717  1.00 72.08 ? 1   ALA B C   1 
ATOM   2914 O O   . ALA B 1 1   ? 16.524  -20.764 13.230  1.00 71.59 ? 1   ALA B O   1 
ATOM   2915 C CB  . ALA B 1 1   ? 15.656  -18.442 12.072  1.00 66.18 ? 1   ALA B CB  1 
ATOM   2916 N N   . SER B 1 2   ? 14.755  -21.016 14.617  1.00 73.73 ? 2   SER B N   1 
ATOM   2917 C CA  . SER B 1 2   ? 15.179  -22.329 15.123  1.00 73.96 ? 2   SER B CA  1 
ATOM   2918 C C   . SER B 1 2   ? 14.162  -23.455 14.838  1.00 70.94 ? 2   SER B C   1 
ATOM   2919 O O   . SER B 1 2   ? 13.007  -23.187 14.481  1.00 70.02 ? 2   SER B O   1 
ATOM   2920 C CB  . SER B 1 2   ? 15.436  -22.237 16.637  1.00 75.33 ? 2   SER B CB  1 
ATOM   2921 O OG  . SER B 1 2   ? 16.348  -21.193 16.940  1.00 76.42 ? 2   SER B OG  1 
ATOM   2922 N N   . SER B 1 3   ? 14.597  -24.708 15.002  1.00 65.38 ? 3   SER B N   1 
ATOM   2923 C CA  . SER B 1 3   ? 13.730  -25.869 14.775  1.00 61.79 ? 3   SER B CA  1 
ATOM   2924 C C   . SER B 1 3   ? 12.313  -25.628 15.306  1.00 57.12 ? 3   SER B C   1 
ATOM   2925 O O   . SER B 1 3   ? 12.121  -25.308 16.478  1.00 58.16 ? 3   SER B O   1 
ATOM   2926 C CB  . SER B 1 3   ? 14.323  -27.117 15.441  1.00 62.34 ? 3   SER B CB  1 
ATOM   2927 O OG  . SER B 1 3   ? 14.467  -26.936 16.840  1.00 66.20 ? 3   SER B OG  1 
ATOM   2928 N N   . SER B 1 4   ? 11.329  -25.796 14.429  1.00 50.74 ? 4   SER B N   1 
ATOM   2929 C CA  . SER B 1 4   ? 9.920   -25.581 14.755  1.00 44.71 ? 4   SER B CA  1 
ATOM   2930 C C   . SER B 1 4   ? 9.383   -26.391 15.937  1.00 40.76 ? 4   SER B C   1 
ATOM   2931 O O   . SER B 1 4   ? 10.082  -27.226 16.509  1.00 40.72 ? 4   SER B O   1 
ATOM   2932 C CB  . SER B 1 4   ? 9.073   -25.885 13.510  1.00 41.63 ? 4   SER B CB  1 
ATOM   2933 O OG  . SER B 1 4   ? 7.718   -25.520 13.696  1.00 39.33 ? 4   SER B OG  1 
ATOM   2934 N N   . PHE B 1 5   ? 8.136   -26.107 16.304  1.00 35.88 ? 5   PHE B N   1 
ATOM   2935 C CA  . PHE B 1 5   ? 7.440   -26.825 17.368  1.00 32.40 ? 5   PHE B CA  1 
ATOM   2936 C C   . PHE B 1 5   ? 6.559   -27.846 16.637  1.00 30.67 ? 5   PHE B C   1 
ATOM   2937 O O   . PHE B 1 5   ? 6.257   -27.668 15.456  1.00 28.49 ? 5   PHE B O   1 
ATOM   2938 C CB  . PHE B 1 5   ? 6.562   -25.872 18.189  1.00 32.09 ? 5   PHE B CB  1 
ATOM   2939 C CG  . PHE B 1 5   ? 5.748   -24.931 17.352  1.00 31.78 ? 5   PHE B CG  1 
ATOM   2940 C CD1 . PHE B 1 5   ? 6.229   -23.667 17.046  1.00 29.56 ? 5   PHE B CD1 1 
ATOM   2941 C CD2 . PHE B 1 5   ? 4.524   -25.330 16.820  1.00 29.67 ? 5   PHE B CD2 1 
ATOM   2942 C CE1 . PHE B 1 5   ? 5.504   -22.811 16.217  1.00 32.87 ? 5   PHE B CE1 1 
ATOM   2943 C CE2 . PHE B 1 5   ? 3.794   -24.483 15.990  1.00 30.36 ? 5   PHE B CE2 1 
ATOM   2944 C CZ  . PHE B 1 5   ? 4.284   -23.222 15.687  1.00 29.38 ? 5   PHE B CZ  1 
ATOM   2945 N N   . LYS B 1 6   ? 6.145   -28.909 17.317  1.00 29.03 ? 6   LYS B N   1 
ATOM   2946 C CA  . LYS B 1 6   ? 5.330   -29.931 16.668  1.00 28.75 ? 6   LYS B CA  1 
ATOM   2947 C C   . LYS B 1 6   ? 3.918   -30.036 17.217  1.00 27.07 ? 6   LYS B C   1 
ATOM   2948 O O   . LYS B 1 6   ? 3.706   -30.019 18.427  1.00 29.35 ? 6   LYS B O   1 
ATOM   2949 C CB  . LYS B 1 6   ? 6.024   -31.292 16.766  1.00 33.46 ? 6   LYS B CB  1 
ATOM   2950 C CG  . LYS B 1 6   ? 7.288   -31.414 15.921  1.00 38.71 ? 6   LYS B CG  1 
ATOM   2951 C CD  . LYS B 1 6   ? 8.370   -30.445 16.376  1.00 44.77 ? 6   LYS B CD  1 
ATOM   2952 C CE  . LYS B 1 6   ? 9.498   -30.348 15.347  1.00 49.37 ? 6   LYS B CE  1 
ATOM   2953 N NZ  . LYS B 1 6   ? 10.184  -31.659 15.115  1.00 49.06 ? 6   LYS B NZ  1 
ATOM   2954 N N   . ALA B 1 7   ? 2.948   -30.148 16.317  1.00 25.65 ? 7   ALA B N   1 
ATOM   2955 C CA  . ALA B 1 7   ? 1.551   -30.262 16.723  1.00 27.20 ? 7   ALA B CA  1 
ATOM   2956 C C   . ALA B 1 7   ? 1.382   -31.551 17.535  1.00 28.16 ? 7   ALA B C   1 
ATOM   2957 O O   . ALA B 1 7   ? 0.444   -31.704 18.313  1.00 28.69 ? 7   ALA B O   1 
ATOM   2958 C CB  . ALA B 1 7   ? 0.649   -30.282 15.488  1.00 24.88 ? 7   ALA B CB  1 
ATOM   2959 N N   . ALA B 1 8   ? 2.314   -32.474 17.344  1.00 27.57 ? 8   ALA B N   1 
ATOM   2960 C CA  . ALA B 1 8   ? 2.296   -33.745 18.041  1.00 27.94 ? 8   ALA B CA  1 
ATOM   2961 C C   . ALA B 1 8   ? 2.581   -33.557 19.526  1.00 29.39 ? 8   ALA B C   1 
ATOM   2962 O O   . ALA B 1 8   ? 2.234   -34.417 20.337  1.00 30.43 ? 8   ALA B O   1 
ATOM   2963 C CB  . ALA B 1 8   ? 3.325   -34.693 17.416  1.00 23.54 ? 8   ALA B CB  1 
ATOM   2964 N N   . ASP B 1 9   ? 3.210   -32.439 19.889  1.00 30.97 ? 9   ASP B N   1 
ATOM   2965 C CA  . ASP B 1 9   ? 3.526   -32.173 21.296  1.00 31.05 ? 9   ASP B CA  1 
ATOM   2966 C C   . ASP B 1 9   ? 2.463   -31.300 21.940  1.00 30.58 ? 9   ASP B C   1 
ATOM   2967 O O   . ASP B 1 9   ? 2.612   -30.822 23.066  1.00 32.82 ? 9   ASP B O   1 
ATOM   2968 C CB  . ASP B 1 9   ? 4.889   -31.493 21.424  1.00 30.91 ? 9   ASP B CB  1 
ATOM   2969 C CG  . ASP B 1 9   ? 6.022   -32.376 20.950  1.00 34.77 ? 9   ASP B CG  1 
ATOM   2970 O OD1 . ASP B 1 9   ? 5.993   -33.585 21.263  1.00 40.01 ? 9   ASP B OD1 1 
ATOM   2971 O OD2 . ASP B 1 9   ? 6.947   -31.870 20.280  1.00 31.25 ? 9   ASP B OD2 1 
ATOM   2972 N N   . LEU B 1 10  ? 1.373   -31.123 21.216  1.00 29.87 ? 10  LEU B N   1 
ATOM   2973 C CA  . LEU B 1 10  ? 0.268   -30.294 21.659  1.00 30.87 ? 10  LEU B CA  1 
ATOM   2974 C C   . LEU B 1 10  ? -0.396  -30.686 22.989  1.00 31.00 ? 10  LEU B C   1 
ATOM   2975 O O   . LEU B 1 10  ? -0.930  -31.783 23.128  1.00 32.67 ? 10  LEU B O   1 
ATOM   2976 C CB  . LEU B 1 10  ? -0.778  -30.269 20.549  1.00 30.57 ? 10  LEU B CB  1 
ATOM   2977 C CG  . LEU B 1 10  ? -1.860  -29.206 20.576  1.00 32.20 ? 10  LEU B CG  1 
ATOM   2978 C CD1 . LEU B 1 10  ? -1.222  -27.829 20.452  1.00 33.81 ? 10  LEU B CD1 1 
ATOM   2979 C CD2 . LEU B 1 10  ? -2.824  -29.470 19.431  1.00 33.82 ? 10  LEU B CD2 1 
ATOM   2980 N N   . GLN B 1 11  ? -0.351  -29.782 23.963  1.00 31.82 ? 11  GLN B N   1 
ATOM   2981 C CA  . GLN B 1 11  ? -0.996  -29.998 25.252  1.00 33.59 ? 11  GLN B CA  1 
ATOM   2982 C C   . GLN B 1 11  ? -2.342  -29.287 25.176  1.00 33.62 ? 11  GLN B C   1 
ATOM   2983 O O   . GLN B 1 11  ? -2.430  -28.154 24.699  1.00 34.20 ? 11  GLN B O   1 
ATOM   2984 C CB  . GLN B 1 11  ? -0.167  -29.409 26.399  1.00 38.87 ? 11  GLN B CB  1 
ATOM   2985 C CG  . GLN B 1 11  ? 1.041   -30.250 26.804  1.00 46.94 ? 11  GLN B CG  1 
ATOM   2986 C CD  . GLN B 1 11  ? 0.661   -31.617 27.385  1.00 50.58 ? 11  GLN B CD  1 
ATOM   2987 O OE1 . GLN B 1 11  ? 1.519   -32.350 27.886  1.00 51.04 ? 11  GLN B OE1 1 
ATOM   2988 N NE2 . GLN B 1 11  ? -0.626  -31.961 27.317  1.00 50.34 ? 11  GLN B NE2 1 
ATOM   2989 N N   . LEU B 1 12  ? -3.386  -29.951 25.653  1.00 35.04 ? 12  LEU B N   1 
ATOM   2990 C CA  . LEU B 1 12  ? -4.730  -29.401 25.604  1.00 36.34 ? 12  LEU B CA  1 
ATOM   2991 C C   . LEU B 1 12  ? -5.381  -29.264 26.982  1.00 36.78 ? 12  LEU B C   1 
ATOM   2992 O O   . LEU B 1 12  ? -5.503  -30.240 27.721  1.00 40.74 ? 12  LEU B O   1 
ATOM   2993 C CB  . LEU B 1 12  ? -5.573  -30.288 24.680  1.00 38.76 ? 12  LEU B CB  1 
ATOM   2994 C CG  . LEU B 1 12  ? -7.094  -30.165 24.560  1.00 43.72 ? 12  LEU B CG  1 
ATOM   2995 C CD1 . LEU B 1 12  ? -7.529  -28.716 24.363  1.00 44.87 ? 12  LEU B CD1 1 
ATOM   2996 C CD2 . LEU B 1 12  ? -7.537  -31.037 23.392  1.00 43.51 ? 12  LEU B CD2 1 
ATOM   2997 N N   . GLU B 1 13  ? -5.786  -28.045 27.329  1.00 34.23 ? 13  GLU B N   1 
ATOM   2998 C CA  . GLU B 1 13  ? -6.433  -27.788 28.609  1.00 32.26 ? 13  GLU B CA  1 
ATOM   2999 C C   . GLU B 1 13  ? -7.822  -27.174 28.394  1.00 31.41 ? 13  GLU B C   1 
ATOM   3000 O O   . GLU B 1 13  ? -7.950  -25.974 28.187  1.00 30.67 ? 13  GLU B O   1 
ATOM   3001 C CB  . GLU B 1 13  ? -5.575  -26.844 29.461  1.00 32.93 ? 13  GLU B CB  1 
ATOM   3002 C CG  . GLU B 1 13  ? -6.122  -26.607 30.869  1.00 35.58 ? 13  GLU B CG  1 
ATOM   3003 C CD  . GLU B 1 13  ? -5.375  -25.510 31.626  1.00 39.69 ? 13  GLU B CD  1 
ATOM   3004 O OE1 . GLU B 1 13  ? -4.130  -25.590 31.731  1.00 39.41 ? 13  GLU B OE1 1 
ATOM   3005 O OE2 . GLU B 1 13  ? -6.037  -24.569 32.121  1.00 35.81 ? 13  GLU B OE2 1 
ATOM   3006 N N   . MET B 1 14  ? -8.853  -28.011 28.442  1.00 32.99 ? 14  MET B N   1 
ATOM   3007 C CA  . MET B 1 14  ? -10.234 -27.570 28.263  1.00 34.42 ? 14  MET B CA  1 
ATOM   3008 C C   . MET B 1 14  ? -10.611 -26.517 29.285  1.00 33.73 ? 14  MET B C   1 
ATOM   3009 O O   . MET B 1 14  ? -10.128 -26.542 30.415  1.00 32.98 ? 14  MET B O   1 
ATOM   3010 C CB  . MET B 1 14  ? -11.190 -28.753 28.415  1.00 39.51 ? 14  MET B CB  1 
ATOM   3011 C CG  . MET B 1 14  ? -11.103 -29.774 27.302  1.00 43.20 ? 14  MET B CG  1 
ATOM   3012 S SD  . MET B 1 14  ? -11.763 -29.102 25.781  1.00 50.14 ? 14  MET B SD  1 
ATOM   3013 C CE  . MET B 1 14  ? -13.531 -29.131 26.182  1.00 45.83 ? 14  MET B CE  1 
ATOM   3014 N N   . THR B 1 15  ? -11.490 -25.603 28.888  1.00 33.32 ? 15  THR B N   1 
ATOM   3015 C CA  . THR B 1 15  ? -11.928 -24.542 29.781  1.00 34.50 ? 15  THR B CA  1 
ATOM   3016 C C   . THR B 1 15  ? -12.855 -25.045 30.881  1.00 36.32 ? 15  THR B C   1 
ATOM   3017 O O   . THR B 1 15  ? -13.572 -26.032 30.718  1.00 34.08 ? 15  THR B O   1 
ATOM   3018 C CB  . THR B 1 15  ? -12.660 -23.412 29.019  1.00 35.07 ? 15  THR B CB  1 
ATOM   3019 O OG1 . THR B 1 15  ? -13.150 -22.443 29.957  1.00 30.03 ? 15  THR B OG1 1 
ATOM   3020 C CG2 . THR B 1 15  ? -13.834 -23.971 28.219  1.00 33.67 ? 15  THR B CG2 1 
ATOM   3021 N N   . GLN B 1 16  ? -12.821 -24.342 32.007  1.00 41.84 ? 16  GLN B N   1 
ATOM   3022 C CA  . GLN B 1 16  ? -13.643 -24.658 33.166  1.00 46.70 ? 16  GLN B CA  1 
ATOM   3023 C C   . GLN B 1 16  ? -14.996 -23.972 32.979  1.00 47.81 ? 16  GLN B C   1 
ATOM   3024 O O   . GLN B 1 16  ? -16.044 -24.607 33.066  1.00 50.12 ? 16  GLN B O   1 
ATOM   3025 C CB  . GLN B 1 16  ? -12.986 -24.114 34.440  1.00 50.49 ? 16  GLN B CB  1 
ATOM   3026 C CG  . GLN B 1 16  ? -11.453 -24.126 34.444  1.00 55.10 ? 16  GLN B CG  1 
ATOM   3027 C CD  . GLN B 1 16  ? -10.862 -25.528 34.414  1.00 57.51 ? 16  GLN B CD  1 
ATOM   3028 O OE1 . GLN B 1 16  ? -11.273 -26.405 35.182  1.00 55.03 ? 16  GLN B OE1 1 
ATOM   3029 N NE2 . GLN B 1 16  ? -9.879  -25.741 33.534  1.00 56.57 ? 16  GLN B NE2 1 
ATOM   3030 N N   . LYS B 1 17  ? -14.952 -22.668 32.713  1.00 48.31 ? 17  LYS B N   1 
ATOM   3031 C CA  . LYS B 1 17  ? -16.149 -21.850 32.529  1.00 46.70 ? 17  LYS B CA  1 
ATOM   3032 C C   . LYS B 1 17  ? -16.378 -21.425 31.079  1.00 44.56 ? 17  LYS B C   1 
ATOM   3033 O O   . LYS B 1 17  ? -15.923 -20.364 30.649  1.00 44.13 ? 17  LYS B O   1 
ATOM   3034 C CB  . LYS B 1 17  ? -16.051 -20.600 33.406  1.00 48.38 ? 17  LYS B CB  1 
ATOM   3035 C CG  . LYS B 1 17  ? -16.884 -20.641 34.675  1.00 51.00 ? 17  LYS B CG  1 
ATOM   3036 C CD  . LYS B 1 17  ? -18.362 -20.436 34.372  1.00 52.87 ? 17  LYS B CD  1 
ATOM   3037 C CE  . LYS B 1 17  ? -19.125 -19.992 35.622  1.00 53.87 ? 17  LYS B CE  1 
ATOM   3038 N NZ  . LYS B 1 17  ? -19.025 -20.985 36.736  1.00 54.49 ? 17  LYS B NZ  1 
ATOM   3039 N N   . PRO B 1 18  ? -17.108 -22.243 30.312  1.00 42.72 ? 18  PRO B N   1 
ATOM   3040 C CA  . PRO B 1 18  ? -17.378 -21.914 28.914  1.00 41.92 ? 18  PRO B CA  1 
ATOM   3041 C C   . PRO B 1 18  ? -18.148 -20.599 28.782  1.00 42.53 ? 18  PRO B C   1 
ATOM   3042 O O   . PRO B 1 18  ? -19.106 -20.362 29.513  1.00 40.10 ? 18  PRO B O   1 
ATOM   3043 C CB  . PRO B 1 18  ? -18.208 -23.104 28.437  1.00 41.50 ? 18  PRO B CB  1 
ATOM   3044 C CG  . PRO B 1 18  ? -17.767 -24.220 29.334  1.00 42.49 ? 18  PRO B CG  1 
ATOM   3045 C CD  . PRO B 1 18  ? -17.703 -23.543 30.667  1.00 41.10 ? 18  PRO B CD  1 
ATOM   3046 N N   . HIS B 1 19  ? -17.721 -19.742 27.858  1.00 43.88 ? 19  HIS B N   1 
ATOM   3047 C CA  . HIS B 1 19  ? -18.417 -18.483 27.636  1.00 44.27 ? 19  HIS B CA  1 
ATOM   3048 C C   . HIS B 1 19  ? -19.779 -18.848 27.041  1.00 44.73 ? 19  HIS B C   1 
ATOM   3049 O O   . HIS B 1 19  ? -19.945 -19.898 26.411  1.00 44.12 ? 19  HIS B O   1 
ATOM   3050 C CB  . HIS B 1 19  ? -17.684 -17.592 26.620  1.00 44.88 ? 19  HIS B CB  1 
ATOM   3051 C CG  . HIS B 1 19  ? -16.227 -17.385 26.906  1.00 46.36 ? 19  HIS B CG  1 
ATOM   3052 N ND1 . HIS B 1 19  ? -15.378 -16.771 26.006  1.00 46.17 ? 19  HIS B ND1 1 
ATOM   3053 C CD2 . HIS B 1 19  ? -15.467 -17.711 27.979  1.00 46.35 ? 19  HIS B CD2 1 
ATOM   3054 C CE1 . HIS B 1 19  ? -14.159 -16.731 26.512  1.00 45.44 ? 19  HIS B CE1 1 
ATOM   3055 N NE2 . HIS B 1 19  ? -14.185 -17.295 27.708  1.00 45.74 ? 19  HIS B NE2 1 
ATOM   3056 N N   . LYS B 1 20  ? -20.750 -17.973 27.248  1.00 45.78 ? 20  LYS B N   1 
ATOM   3057 C CA  . LYS B 1 20  ? -22.090 -18.163 26.721  1.00 46.32 ? 20  LYS B CA  1 
ATOM   3058 C C   . LYS B 1 20  ? -22.054 -17.870 25.216  1.00 44.93 ? 20  LYS B C   1 
ATOM   3059 O O   . LYS B 1 20  ? -21.614 -16.798 24.792  1.00 41.97 ? 20  LYS B O   1 
ATOM   3060 C CB  . LYS B 1 20  ? -23.051 -17.211 27.447  1.00 50.53 ? 20  LYS B CB  1 
ATOM   3061 C CG  . LYS B 1 20  ? -22.338 -16.072 28.205  1.00 54.25 ? 20  LYS B CG  1 
ATOM   3062 C CD  . LYS B 1 20  ? -21.545 -15.167 27.248  1.00 58.43 ? 20  LYS B CD  1 
ATOM   3063 C CE  . LYS B 1 20  ? -20.583 -14.226 27.980  1.00 60.12 ? 20  LYS B CE  1 
ATOM   3064 N NZ  . LYS B 1 20  ? -19.460 -14.952 28.647  1.00 56.60 ? 20  LYS B NZ  1 
ATOM   3065 N N   . LYS B 1 21  ? -22.492 -18.833 24.409  1.00 46.52 ? 21  LYS B N   1 
ATOM   3066 C CA  . LYS B 1 21  ? -22.504 -18.663 22.956  1.00 46.27 ? 21  LYS B CA  1 
ATOM   3067 C C   . LYS B 1 21  ? -23.349 -17.454 22.581  1.00 49.13 ? 21  LYS B C   1 
ATOM   3068 O O   . LYS B 1 21  ? -24.167 -16.986 23.375  1.00 49.35 ? 21  LYS B O   1 
ATOM   3069 C CB  . LYS B 1 21  ? -23.095 -19.897 22.273  1.00 44.85 ? 21  LYS B CB  1 
ATOM   3070 C CG  . LYS B 1 21  ? -22.343 -21.194 22.493  1.00 43.00 ? 21  LYS B CG  1 
ATOM   3071 C CD  . LYS B 1 21  ? -20.989 -21.192 21.818  1.00 39.44 ? 21  LYS B CD  1 
ATOM   3072 C CE  . LYS B 1 21  ? -20.518 -22.617 21.543  1.00 37.17 ? 21  LYS B CE  1 
ATOM   3073 N NZ  . LYS B 1 21  ? -20.595 -23.477 22.751  1.00 34.51 ? 21  LYS B NZ  1 
ATOM   3074 N N   . PRO B 1 22  ? -23.158 -16.924 21.365  1.00 51.06 ? 22  PRO B N   1 
ATOM   3075 C CA  . PRO B 1 22  ? -23.950 -15.765 20.950  1.00 53.36 ? 22  PRO B CA  1 
ATOM   3076 C C   . PRO B 1 22  ? -25.430 -16.132 20.970  1.00 55.65 ? 22  PRO B C   1 
ATOM   3077 O O   . PRO B 1 22  ? -26.219 -15.568 21.732  1.00 55.66 ? 22  PRO B O   1 
ATOM   3078 C CB  . PRO B 1 22  ? -23.445 -15.494 19.537  1.00 51.60 ? 22  PRO B CB  1 
ATOM   3079 C CG  . PRO B 1 22  ? -22.018 -15.919 19.614  1.00 50.90 ? 22  PRO B CG  1 
ATOM   3080 C CD  . PRO B 1 22  ? -22.117 -17.226 20.368  1.00 50.84 ? 22  PRO B CD  1 
ATOM   3081 N N   . GLY B 1 23  ? -25.792 -17.097 20.134  1.00 57.93 ? 23  GLY B N   1 
ATOM   3082 C CA  . GLY B 1 23  ? -27.174 -17.531 20.062  1.00 63.62 ? 23  GLY B CA  1 
ATOM   3083 C C   . GLY B 1 23  ? -27.886 -16.997 18.831  1.00 65.77 ? 23  GLY B C   1 
ATOM   3084 O O   . GLY B 1 23  ? -27.842 -15.791 18.564  1.00 66.51 ? 23  GLY B O   1 
ATOM   3085 N N   . PRO B 1 24  ? -28.557 -17.871 18.060  1.00 66.66 ? 24  PRO B N   1 
ATOM   3086 C CA  . PRO B 1 24  ? -29.279 -17.470 16.849  1.00 67.69 ? 24  PRO B CA  1 
ATOM   3087 C C   . PRO B 1 24  ? -30.117 -16.202 17.026  1.00 68.75 ? 24  PRO B C   1 
ATOM   3088 O O   . PRO B 1 24  ? -30.815 -16.032 18.033  1.00 67.59 ? 24  PRO B O   1 
ATOM   3089 C CB  . PRO B 1 24  ? -30.132 -18.698 16.543  1.00 66.62 ? 24  PRO B CB  1 
ATOM   3090 C CG  . PRO B 1 24  ? -29.244 -19.814 16.971  1.00 66.32 ? 24  PRO B CG  1 
ATOM   3091 C CD  . PRO B 1 24  ? -28.710 -19.319 18.301  1.00 66.30 ? 24  PRO B CD  1 
ATOM   3092 N N   . GLY B 1 25  ? -30.031 -15.313 16.041  1.00 69.14 ? 25  GLY B N   1 
ATOM   3093 C CA  . GLY B 1 25  ? -30.791 -14.079 16.098  1.00 69.46 ? 25  GLY B CA  1 
ATOM   3094 C C   . GLY B 1 25  ? -30.080 -12.907 16.752  1.00 68.42 ? 25  GLY B C   1 
ATOM   3095 O O   . GLY B 1 25  ? -30.641 -11.810 16.823  1.00 67.15 ? 25  GLY B O   1 
ATOM   3096 N N   . GLU B 1 26  ? -28.859 -13.122 17.238  1.00 66.89 ? 26  GLU B N   1 
ATOM   3097 C CA  . GLU B 1 26  ? -28.113 -12.040 17.873  1.00 66.23 ? 26  GLU B CA  1 
ATOM   3098 C C   . GLU B 1 26  ? -27.104 -11.385 16.943  1.00 64.34 ? 26  GLU B C   1 
ATOM   3099 O O   . GLU B 1 26  ? -26.540 -12.025 16.054  1.00 63.88 ? 26  GLU B O   1 
ATOM   3100 C CB  . GLU B 1 26  ? -27.409 -12.519 19.147  1.00 68.22 ? 26  GLU B CB  1 
ATOM   3101 C CG  . GLU B 1 26  ? -28.304 -12.482 20.380  1.00 69.89 ? 26  GLU B CG  1 
ATOM   3102 C CD  . GLU B 1 26  ? -27.521 -12.496 21.681  1.00 70.93 ? 26  GLU B CD  1 
ATOM   3103 O OE1 . GLU B 1 26  ? -28.153 -12.406 22.758  1.00 70.16 ? 26  GLU B OE1 1 
ATOM   3104 O OE2 . GLU B 1 26  ? -26.277 -12.592 21.626  1.00 71.67 ? 26  GLU B OE2 1 
ATOM   3105 N N   . PRO B 1 27  ? -26.870 -10.082 17.142  1.00 63.05 ? 27  PRO B N   1 
ATOM   3106 C CA  . PRO B 1 27  ? -25.938 -9.273  16.349  1.00 59.96 ? 27  PRO B CA  1 
ATOM   3107 C C   . PRO B 1 27  ? -24.497 -9.749  16.467  1.00 56.45 ? 27  PRO B C   1 
ATOM   3108 O O   . PRO B 1 27  ? -23.908 -9.703  17.547  1.00 53.93 ? 27  PRO B O   1 
ATOM   3109 C CB  . PRO B 1 27  ? -26.108 -7.868  16.934  1.00 61.71 ? 27  PRO B CB  1 
ATOM   3110 C CG  . PRO B 1 27  ? -27.488 -7.898  17.546  1.00 64.71 ? 27  PRO B CG  1 
ATOM   3111 C CD  . PRO B 1 27  ? -27.532 -9.260  18.170  1.00 62.51 ? 27  PRO B CD  1 
ATOM   3112 N N   . LEU B 1 28  ? -23.931 -10.225 15.367  1.00 53.30 ? 28  LEU B N   1 
ATOM   3113 C CA  . LEU B 1 28  ? -22.542 -10.652 15.398  1.00 51.89 ? 28  LEU B CA  1 
ATOM   3114 C C   . LEU B 1 28  ? -21.699 -9.579  14.706  1.00 50.92 ? 28  LEU B C   1 
ATOM   3115 O O   . LEU B 1 28  ? -21.648 -9.505  13.478  1.00 48.93 ? 28  LEU B O   1 
ATOM   3116 C CB  . LEU B 1 28  ? -22.357 -12.004 14.701  1.00 50.69 ? 28  LEU B CB  1 
ATOM   3117 C CG  . LEU B 1 28  ? -22.815 -13.271 15.435  1.00 49.13 ? 28  LEU B CG  1 
ATOM   3118 C CD1 . LEU B 1 28  ? -22.525 -14.479 14.557  1.00 46.51 ? 28  LEU B CD1 1 
ATOM   3119 C CD2 . LEU B 1 28  ? -22.098 -13.410 16.769  1.00 47.64 ? 28  LEU B CD2 1 
ATOM   3120 N N   . VAL B 1 29  ? -21.063 -8.732  15.510  1.00 49.09 ? 29  VAL B N   1 
ATOM   3121 C CA  . VAL B 1 29  ? -20.214 -7.671  14.984  1.00 47.29 ? 29  VAL B CA  1 
ATOM   3122 C C   . VAL B 1 29  ? -18.817 -8.244  14.775  1.00 43.12 ? 29  VAL B C   1 
ATOM   3123 O O   . VAL B 1 29  ? -18.357 -9.084  15.551  1.00 44.78 ? 29  VAL B O   1 
ATOM   3124 C CB  . VAL B 1 29  ? -20.134 -6.482  15.963  1.00 49.38 ? 29  VAL B CB  1 
ATOM   3125 C CG1 . VAL B 1 29  ? -21.521 -5.916  16.210  1.00 49.65 ? 29  VAL B CG1 1 
ATOM   3126 C CG2 . VAL B 1 29  ? -19.527 -6.934  17.268  1.00 49.49 ? 29  VAL B CG2 1 
ATOM   3127 N N   . PHE B 1 30  ? -18.142 -7.790  13.727  1.00 38.56 ? 30  PHE B N   1 
ATOM   3128 C CA  . PHE B 1 30  ? -16.809 -8.284  13.426  1.00 34.01 ? 30  PHE B CA  1 
ATOM   3129 C C   . PHE B 1 30  ? -15.794 -8.154  14.558  1.00 33.06 ? 30  PHE B C   1 
ATOM   3130 O O   . PHE B 1 30  ? -15.609 -7.082  15.133  1.00 29.64 ? 30  PHE B O   1 
ATOM   3131 C CB  . PHE B 1 30  ? -16.234 -7.583  12.196  1.00 31.57 ? 30  PHE B CB  1 
ATOM   3132 C CG  . PHE B 1 30  ? -14.912 -8.134  11.769  1.00 28.12 ? 30  PHE B CG  1 
ATOM   3133 C CD1 . PHE B 1 30  ? -14.848 -9.238  10.936  1.00 32.01 ? 30  PHE B CD1 1 
ATOM   3134 C CD2 . PHE B 1 30  ? -13.729 -7.604  12.267  1.00 27.52 ? 30  PHE B CD2 1 
ATOM   3135 C CE1 . PHE B 1 30  ? -13.616 -9.813  10.608  1.00 31.18 ? 30  PHE B CE1 1 
ATOM   3136 C CE2 . PHE B 1 30  ? -12.500 -8.169  11.949  1.00 25.14 ? 30  PHE B CE2 1 
ATOM   3137 C CZ  . PHE B 1 30  ? -12.441 -9.271  11.122  1.00 28.42 ? 30  PHE B CZ  1 
ATOM   3138 N N   . GLY B 1 31  ? -15.131 -9.268  14.849  1.00 33.79 ? 31  GLY B N   1 
ATOM   3139 C CA  . GLY B 1 31  ? -14.092 -9.314  15.859  1.00 33.00 ? 31  GLY B CA  1 
ATOM   3140 C C   . GLY B 1 31  ? -14.344 -8.758  17.242  1.00 31.98 ? 31  GLY B C   1 
ATOM   3141 O O   . GLY B 1 31  ? -13.452 -8.116  17.801  1.00 32.99 ? 31  GLY B O   1 
ATOM   3142 N N   . LYS B 1 32  ? -15.528 -8.998  17.800  1.00 31.00 ? 32  LYS B N   1 
ATOM   3143 C CA  . LYS B 1 32  ? -15.844 -8.523  19.150  1.00 33.09 ? 32  LYS B CA  1 
ATOM   3144 C C   . LYS B 1 32  ? -16.188 -9.670  20.110  1.00 33.28 ? 32  LYS B C   1 
ATOM   3145 O O   . LYS B 1 32  ? -16.111 -9.515  21.326  1.00 34.35 ? 32  LYS B O   1 
ATOM   3146 C CB  . LYS B 1 32  ? -16.999 -7.516  19.110  1.00 37.37 ? 32  LYS B CB  1 
ATOM   3147 C CG  . LYS B 1 32  ? -16.666 -6.227  18.367  1.00 40.46 ? 32  LYS B CG  1 
ATOM   3148 C CD  . LYS B 1 32  ? -15.579 -5.440  19.077  1.00 44.52 ? 32  LYS B CD  1 
ATOM   3149 C CE  . LYS B 1 32  ? -16.163 -4.380  20.003  1.00 49.60 ? 32  LYS B CE  1 
ATOM   3150 N NZ  . LYS B 1 32  ? -16.784 -3.256  19.237  1.00 50.95 ? 32  LYS B NZ  1 
ATOM   3151 N N   . THR B 1 33  ? -16.562 -10.821 19.563  1.00 30.37 ? 33  THR B N   1 
ATOM   3152 C CA  . THR B 1 33  ? -16.899 -11.983 20.381  1.00 29.30 ? 33  THR B CA  1 
ATOM   3153 C C   . THR B 1 33  ? -15.894 -13.110 20.145  1.00 27.00 ? 33  THR B C   1 
ATOM   3154 O O   . THR B 1 33  ? -15.703 -13.543 19.017  1.00 27.08 ? 33  THR B O   1 
ATOM   3155 C CB  . THR B 1 33  ? -18.307 -12.499 20.052  1.00 30.42 ? 33  THR B CB  1 
ATOM   3156 O OG1 . THR B 1 33  ? -19.275 -11.506 20.413  1.00 37.05 ? 33  THR B OG1 1 
ATOM   3157 C CG2 . THR B 1 33  ? -18.591 -13.781 20.814  1.00 31.09 ? 33  THR B CG2 1 
ATOM   3158 N N   . PHE B 1 34  ? -15.265 -13.598 21.210  1.00 24.60 ? 34  PHE B N   1 
ATOM   3159 C CA  . PHE B 1 34  ? -14.275 -14.658 21.067  1.00 22.67 ? 34  PHE B CA  1 
ATOM   3160 C C   . PHE B 1 34  ? -14.696 -15.997 21.666  1.00 24.91 ? 34  PHE B C   1 
ATOM   3161 O O   . PHE B 1 34  ? -15.496 -16.046 22.607  1.00 28.12 ? 34  PHE B O   1 
ATOM   3162 C CB  . PHE B 1 34  ? -12.946 -14.194 21.663  1.00 19.29 ? 34  PHE B CB  1 
ATOM   3163 C CG  . PHE B 1 34  ? -12.469 -12.889 21.097  1.00 18.79 ? 34  PHE B CG  1 
ATOM   3164 C CD1 . PHE B 1 34  ? -12.941 -11.674 21.608  1.00 16.76 ? 34  PHE B CD1 1 
ATOM   3165 C CD2 . PHE B 1 34  ? -11.611 -12.868 20.001  1.00 15.88 ? 34  PHE B CD2 1 
ATOM   3166 C CE1 . PHE B 1 34  ? -12.564 -10.459 21.029  1.00 17.15 ? 34  PHE B CE1 1 
ATOM   3167 C CE2 . PHE B 1 34  ? -11.226 -11.663 19.411  1.00 17.11 ? 34  PHE B CE2 1 
ATOM   3168 C CZ  . PHE B 1 34  ? -11.706 -10.453 19.927  1.00 17.98 ? 34  PHE B CZ  1 
ATOM   3169 N N   . THR B 1 35  ? -14.138 -17.075 21.116  1.00 23.20 ? 35  THR B N   1 
ATOM   3170 C CA  . THR B 1 35  ? -14.448 -18.435 21.553  1.00 22.30 ? 35  THR B CA  1 
ATOM   3171 C C   . THR B 1 35  ? -13.863 -18.803 22.916  1.00 22.96 ? 35  THR B C   1 
ATOM   3172 O O   . THR B 1 35  ? -13.336 -17.948 23.615  1.00 24.41 ? 35  THR B O   1 
ATOM   3173 C CB  . THR B 1 35  ? -13.986 -19.447 20.498  1.00 21.58 ? 35  THR B CB  1 
ATOM   3174 O OG1 . THR B 1 35  ? -12.563 -19.384 20.358  1.00 23.18 ? 35  THR B OG1 1 
ATOM   3175 C CG2 . THR B 1 35  ? -14.630 -19.124 19.157  1.00 20.09 ? 35  THR B CG2 1 
ATOM   3176 N N   . ASP B 1 36  ? -13.956 -20.079 23.287  1.00 24.02 ? 36  ASP B N   1 
ATOM   3177 C CA  . ASP B 1 36  ? -13.475 -20.546 24.591  1.00 21.42 ? 36  ASP B CA  1 
ATOM   3178 C C   . ASP B 1 36  ? -11.990 -20.817 24.747  1.00 19.89 ? 36  ASP B C   1 
ATOM   3179 O O   . ASP B 1 36  ? -11.458 -20.679 25.846  1.00 19.35 ? 36  ASP B O   1 
ATOM   3180 C CB  . ASP B 1 36  ? -14.231 -21.813 25.021  1.00 21.43 ? 36  ASP B CB  1 
ATOM   3181 C CG  . ASP B 1 36  ? -15.705 -21.565 25.239  1.00 23.52 ? 36  ASP B CG  1 
ATOM   3182 O OD1 . ASP B 1 36  ? -16.046 -20.576 25.926  1.00 24.19 ? 36  ASP B OD1 1 
ATOM   3183 O OD2 . ASP B 1 36  ? -16.521 -22.362 24.730  1.00 21.49 ? 36  ASP B OD2 1 
ATOM   3184 N N   . HIS B 1 37  ? -11.319 -21.219 23.672  1.00 19.71 ? 37  HIS B N   1 
ATOM   3185 C CA  . HIS B 1 37  ? -9.896  -21.531 23.763  1.00 18.95 ? 37  HIS B CA  1 
ATOM   3186 C C   . HIS B 1 37  ? -8.992  -20.742 22.819  1.00 21.42 ? 37  HIS B C   1 
ATOM   3187 O O   . HIS B 1 37  ? -9.453  -20.106 21.870  1.00 19.17 ? 37  HIS B O   1 
ATOM   3188 C CB  . HIS B 1 37  ? -9.679  -23.026 23.527  1.00 18.28 ? 37  HIS B CB  1 
ATOM   3189 C CG  . HIS B 1 37  ? -10.520 -23.901 24.402  1.00 21.55 ? 37  HIS B CG  1 
ATOM   3190 N ND1 . HIS B 1 37  ? -11.880 -24.040 24.226  1.00 22.00 ? 37  HIS B ND1 1 
ATOM   3191 C CD2 . HIS B 1 37  ? -10.200 -24.655 25.480  1.00 21.69 ? 37  HIS B CD2 1 
ATOM   3192 C CE1 . HIS B 1 37  ? -12.362 -24.841 25.159  1.00 23.22 ? 37  HIS B CE1 1 
ATOM   3193 N NE2 . HIS B 1 37  ? -11.365 -25.228 25.932  1.00 24.62 ? 37  HIS B NE2 1 
ATOM   3194 N N   . MET B 1 38  ? -7.693  -20.802 23.091  1.00 20.77 ? 38  MET B N   1 
ATOM   3195 C CA  . MET B 1 38  ? -6.704  -20.114 22.279  1.00 21.26 ? 38  MET B CA  1 
ATOM   3196 C C   . MET B 1 38  ? -5.440  -20.962 22.178  1.00 22.38 ? 38  MET B C   1 
ATOM   3197 O O   . MET B 1 38  ? -5.203  -21.835 23.012  1.00 23.96 ? 38  MET B O   1 
ATOM   3198 C CB  . MET B 1 38  ? -6.377  -18.762 22.902  1.00 20.13 ? 38  MET B CB  1 
ATOM   3199 C CG  . MET B 1 38  ? -5.596  -18.846 24.195  1.00 22.36 ? 38  MET B CG  1 
ATOM   3200 S SD  . MET B 1 38  ? -5.506  -17.249 25.055  1.00 25.26 ? 38  MET B SD  1 
ATOM   3201 C CE  . MET B 1 38  ? -4.345  -16.375 24.028  1.00 24.12 ? 38  MET B CE  1 
ATOM   3202 N N   . LEU B 1 39  ? -4.642  -20.724 21.143  1.00 21.55 ? 39  LEU B N   1 
ATOM   3203 C CA  . LEU B 1 39  ? -3.402  -21.466 20.962  1.00 20.54 ? 39  LEU B CA  1 
ATOM   3204 C C   . LEU B 1 39  ? -2.267  -20.590 21.472  1.00 22.84 ? 39  LEU B C   1 
ATOM   3205 O O   . LEU B 1 39  ? -2.305  -19.370 21.339  1.00 22.28 ? 39  LEU B O   1 
ATOM   3206 C CB  . LEU B 1 39  ? -3.175  -21.801 19.489  1.00 16.40 ? 39  LEU B CB  1 
ATOM   3207 C CG  . LEU B 1 39  ? -1.866  -22.535 19.167  1.00 18.04 ? 39  LEU B CG  1 
ATOM   3208 C CD1 . LEU B 1 39  ? -1.900  -23.973 19.711  1.00 14.82 ? 39  LEU B CD1 1 
ATOM   3209 C CD2 . LEU B 1 39  ? -1.659  -22.540 17.663  1.00 16.83 ? 39  LEU B CD2 1 
ATOM   3210 N N   . MET B 1 40  ? -1.250  -21.212 22.052  1.00 25.17 ? 40  MET B N   1 
ATOM   3211 C CA  . MET B 1 40  ? -0.135  -20.447 22.580  1.00 28.09 ? 40  MET B CA  1 
ATOM   3212 C C   . MET B 1 40  ? 1.175   -21.226 22.495  1.00 26.89 ? 40  MET B C   1 
ATOM   3213 O O   . MET B 1 40  ? 1.253   -22.381 22.912  1.00 27.75 ? 40  MET B O   1 
ATOM   3214 C CB  . MET B 1 40  ? -0.418  -20.071 24.039  1.00 30.94 ? 40  MET B CB  1 
ATOM   3215 C CG  . MET B 1 40  ? 0.588   -19.113 24.623  1.00 38.13 ? 40  MET B CG  1 
ATOM   3216 S SD  . MET B 1 40  ? -0.083  -17.460 24.810  1.00 45.83 ? 40  MET B SD  1 
ATOM   3217 C CE  . MET B 1 40  ? 0.002   -17.310 26.630  1.00 44.35 ? 40  MET B CE  1 
ATOM   3218 N N   . VAL B 1 41  ? 2.199   -20.587 21.942  1.00 25.77 ? 41  VAL B N   1 
ATOM   3219 C CA  . VAL B 1 41  ? 3.516   -21.198 21.821  1.00 24.85 ? 41  VAL B CA  1 
ATOM   3220 C C   . VAL B 1 41  ? 4.547   -20.098 22.083  1.00 25.73 ? 41  VAL B C   1 
ATOM   3221 O O   . VAL B 1 41  ? 4.489   -19.022 21.485  1.00 25.07 ? 41  VAL B O   1 
ATOM   3222 C CB  . VAL B 1 41  ? 3.760   -21.786 20.407  1.00 27.72 ? 41  VAL B CB  1 
ATOM   3223 C CG1 . VAL B 1 41  ? 4.781   -22.921 20.492  1.00 27.17 ? 41  VAL B CG1 1 
ATOM   3224 C CG2 . VAL B 1 41  ? 2.454   -22.285 19.796  1.00 25.74 ? 41  VAL B CG2 1 
ATOM   3225 N N   . GLU B 1 42  ? 5.491   -20.365 22.976  1.00 24.36 ? 42  GLU B N   1 
ATOM   3226 C CA  . GLU B 1 42  ? 6.504   -19.380 23.304  1.00 24.76 ? 42  GLU B CA  1 
ATOM   3227 C C   . GLU B 1 42  ? 7.847   -19.777 22.731  1.00 26.36 ? 42  GLU B C   1 
ATOM   3228 O O   . GLU B 1 42  ? 8.074   -20.936 22.391  1.00 27.21 ? 42  GLU B O   1 
ATOM   3229 C CB  . GLU B 1 42  ? 6.588   -19.226 24.815  1.00 28.55 ? 42  GLU B CB  1 
ATOM   3230 C CG  . GLU B 1 42  ? 5.210   -19.070 25.430  1.00 40.28 ? 42  GLU B CG  1 
ATOM   3231 C CD  . GLU B 1 42  ? 5.241   -18.918 26.929  1.00 45.58 ? 42  GLU B CD  1 
ATOM   3232 O OE1 . GLU B 1 42  ? 5.867   -17.942 27.406  1.00 47.95 ? 42  GLU B OE1 1 
ATOM   3233 O OE2 . GLU B 1 42  ? 4.633   -19.771 27.622  1.00 47.74 ? 42  GLU B OE2 1 
ATOM   3234 N N   . TRP B 1 43  ? 8.740   -18.807 22.623  1.00 27.23 ? 43  TRP B N   1 
ATOM   3235 C CA  . TRP B 1 43  ? 10.056  -19.061 22.066  1.00 27.90 ? 43  TRP B CA  1 
ATOM   3236 C C   . TRP B 1 43  ? 11.080  -18.281 22.867  1.00 30.43 ? 43  TRP B C   1 
ATOM   3237 O O   . TRP B 1 43  ? 10.770  -17.228 23.429  1.00 32.16 ? 43  TRP B O   1 
ATOM   3238 C CB  . TRP B 1 43  ? 10.082  -18.605 20.603  1.00 27.86 ? 43  TRP B CB  1 
ATOM   3239 C CG  . TRP B 1 43  ? 11.392  -18.809 19.881  1.00 24.61 ? 43  TRP B CG  1 
ATOM   3240 C CD1 . TRP B 1 43  ? 11.798  -19.932 19.211  1.00 25.11 ? 43  TRP B CD1 1 
ATOM   3241 C CD2 . TRP B 1 43  ? 12.447  -17.852 19.734  1.00 22.95 ? 43  TRP B CD2 1 
ATOM   3242 N NE1 . TRP B 1 43  ? 13.039  -19.730 18.652  1.00 23.32 ? 43  TRP B NE1 1 
ATOM   3243 C CE2 . TRP B 1 43  ? 13.462  -18.463 18.961  1.00 22.66 ? 43  TRP B CE2 1 
ATOM   3244 C CE3 . TRP B 1 43  ? 12.639  -16.535 20.185  1.00 22.47 ? 43  TRP B CE3 1 
ATOM   3245 C CZ2 . TRP B 1 43  ? 14.647  -17.800 18.621  1.00 19.72 ? 43  TRP B CZ2 1 
ATOM   3246 C CZ3 . TRP B 1 43  ? 13.823  -15.875 19.845  1.00 21.17 ? 43  TRP B CZ3 1 
ATOM   3247 C CH2 . TRP B 1 43  ? 14.810  -16.513 19.071  1.00 20.22 ? 43  TRP B CH2 1 
ATOM   3248 N N   . ASN B 1 44  ? 12.292  -18.817 22.936  1.00 32.44 ? 44  ASN B N   1 
ATOM   3249 C CA  . ASN B 1 44  ? 13.372  -18.154 23.646  1.00 37.83 ? 44  ASN B CA  1 
ATOM   3250 C C   . ASN B 1 44  ? 14.719  -18.687 23.183  1.00 41.33 ? 44  ASN B C   1 
ATOM   3251 O O   . ASN B 1 44  ? 14.957  -18.828 21.976  1.00 38.27 ? 44  ASN B O   1 
ATOM   3252 C CB  . ASN B 1 44  ? 13.204  -18.316 25.161  1.00 34.88 ? 44  ASN B CB  1 
ATOM   3253 C CG  . ASN B 1 44  ? 13.014  -19.757 25.577  1.00 38.27 ? 44  ASN B CG  1 
ATOM   3254 O OD1 . ASN B 1 44  ? 13.885  -20.597 25.335  1.00 42.49 ? 44  ASN B OD1 1 
ATOM   3255 N ND2 . ASN B 1 44  ? 11.875  -20.057 26.213  1.00 26.65 ? 44  ASN B ND2 1 
ATOM   3256 N N   . ASP B 1 45  ? 15.597  -18.984 24.136  1.00 47.37 ? 45  ASP B N   1 
ATOM   3257 C CA  . ASP B 1 45  ? 16.936  -19.495 23.824  1.00 51.94 ? 45  ASP B CA  1 
ATOM   3258 C C   . ASP B 1 45  ? 16.940  -20.916 23.271  1.00 51.70 ? 45  ASP B C   1 
ATOM   3259 O O   . ASP B 1 45  ? 17.446  -21.152 22.172  1.00 51.32 ? 45  ASP B O   1 
ATOM   3260 C CB  . ASP B 1 45  ? 17.830  -19.445 25.070  1.00 55.55 ? 45  ASP B CB  1 
ATOM   3261 C CG  . ASP B 1 45  ? 18.086  -18.029 25.547  1.00 58.30 ? 45  ASP B CG  1 
ATOM   3262 O OD1 . ASP B 1 45  ? 18.702  -17.252 24.783  1.00 56.99 ? 45  ASP B OD1 1 
ATOM   3263 O OD2 . ASP B 1 45  ? 17.666  -17.702 26.683  1.00 62.06 ? 45  ASP B OD2 1 
ATOM   3264 N N   . LYS B 1 46  ? 16.378  -21.855 24.033  1.00 52.08 ? 46  LYS B N   1 
ATOM   3265 C CA  . LYS B 1 46  ? 16.343  -23.261 23.619  1.00 52.03 ? 46  LYS B CA  1 
ATOM   3266 C C   . LYS B 1 46  ? 15.350  -23.517 22.488  1.00 47.64 ? 46  LYS B C   1 
ATOM   3267 O O   . LYS B 1 46  ? 15.002  -24.666 22.194  1.00 48.61 ? 46  LYS B O   1 
ATOM   3268 C CB  . LYS B 1 46  ? 16.000  -24.168 24.813  1.00 56.88 ? 46  LYS B CB  1 
ATOM   3269 C CG  . LYS B 1 46  ? 16.275  -25.668 24.562  1.00 62.74 ? 46  LYS B CG  1 
ATOM   3270 C CD  . LYS B 1 46  ? 15.890  -26.566 25.752  1.00 63.20 ? 46  LYS B CD  1 
ATOM   3271 C CE  . LYS B 1 46  ? 16.746  -26.299 26.996  1.00 63.98 ? 46  LYS B CE  1 
ATOM   3272 N NZ  . LYS B 1 46  ? 16.511  -24.951 27.599  1.00 63.19 ? 46  LYS B NZ  1 
ATOM   3273 N N   . GLY B 1 47  ? 14.880  -22.448 21.861  1.00 40.84 ? 47  GLY B N   1 
ATOM   3274 C CA  . GLY B 1 47  ? 13.950  -22.630 20.766  1.00 32.38 ? 47  GLY B CA  1 
ATOM   3275 C C   . GLY B 1 47  ? 12.509  -22.594 21.221  1.00 29.35 ? 47  GLY B C   1 
ATOM   3276 O O   . GLY B 1 47  ? 12.187  -21.957 22.223  1.00 28.03 ? 47  GLY B O   1 
ATOM   3277 N N   . TRP B 1 48  ? 11.644  -23.287 20.488  1.00 25.59 ? 48  TRP B N   1 
ATOM   3278 C CA  . TRP B 1 48  ? 10.227  -23.319 20.810  1.00 24.90 ? 48  TRP B CA  1 
ATOM   3279 C C   . TRP B 1 48  ? 9.840   -24.238 21.972  1.00 27.40 ? 48  TRP B C   1 
ATOM   3280 O O   . TRP B 1 48  ? 10.480  -25.271 22.213  1.00 29.23 ? 48  TRP B O   1 
ATOM   3281 C CB  . TRP B 1 48  ? 9.419   -23.732 19.580  1.00 21.79 ? 48  TRP B CB  1 
ATOM   3282 C CG  . TRP B 1 48  ? 9.380   -22.712 18.491  1.00 20.44 ? 48  TRP B CG  1 
ATOM   3283 C CD1 . TRP B 1 48  ? 10.124  -22.706 17.349  1.00 14.30 ? 48  TRP B CD1 1 
ATOM   3284 C CD2 . TRP B 1 48  ? 8.532   -21.560 18.424  1.00 19.70 ? 48  TRP B CD2 1 
ATOM   3285 N NE1 . TRP B 1 48  ? 9.790   -21.632 16.572  1.00 13.41 ? 48  TRP B NE1 1 
ATOM   3286 C CE2 . TRP B 1 48  ? 8.815   -20.909 17.206  1.00 18.63 ? 48  TRP B CE2 1 
ATOM   3287 C CE3 . TRP B 1 48  ? 7.555   -21.018 19.274  1.00 22.15 ? 48  TRP B CE3 1 
ATOM   3288 C CZ2 . TRP B 1 48  ? 8.160   -19.740 16.812  1.00 19.27 ? 48  TRP B CZ2 1 
ATOM   3289 C CZ3 . TRP B 1 48  ? 6.904   -19.859 18.884  1.00 20.62 ? 48  TRP B CZ3 1 
ATOM   3290 C CH2 . TRP B 1 48  ? 7.210   -19.233 17.661  1.00 21.26 ? 48  TRP B CH2 1 
ATOM   3291 N N   . GLY B 1 49  ? 8.786   -23.846 22.687  1.00 23.07 ? 49  GLY B N   1 
ATOM   3292 C CA  . GLY B 1 49  ? 8.291   -24.655 23.782  1.00 22.75 ? 49  GLY B CA  1 
ATOM   3293 C C   . GLY B 1 49  ? 7.234   -25.545 23.153  1.00 24.24 ? 49  GLY B C   1 
ATOM   3294 O O   . GLY B 1 49  ? 7.099   -25.571 21.924  1.00 17.12 ? 49  GLY B O   1 
ATOM   3295 N N   . GLN B 1 50  ? 6.489   -26.290 23.959  1.00 24.78 ? 50  GLN B N   1 
ATOM   3296 C CA  . GLN B 1 50  ? 5.460   -27.131 23.374  1.00 27.43 ? 50  GLN B CA  1 
ATOM   3297 C C   . GLN B 1 50  ? 4.213   -26.285 23.186  1.00 26.20 ? 50  GLN B C   1 
ATOM   3298 O O   . GLN B 1 50  ? 3.884   -25.441 24.020  1.00 26.91 ? 50  GLN B O   1 
ATOM   3299 C CB  . GLN B 1 50  ? 5.158   -28.352 24.255  1.00 29.24 ? 50  GLN B CB  1 
ATOM   3300 C CG  . GLN B 1 50  ? 5.356   -28.126 25.745  1.00 38.30 ? 50  GLN B CG  1 
ATOM   3301 C CD  . GLN B 1 50  ? 4.608   -29.144 26.601  1.00 41.61 ? 50  GLN B CD  1 
ATOM   3302 O OE1 . GLN B 1 50  ? 4.583   -30.344 26.296  1.00 41.86 ? 50  GLN B OE1 1 
ATOM   3303 N NE2 . GLN B 1 50  ? 3.999   -28.666 27.686  1.00 42.65 ? 50  GLN B NE2 1 
ATOM   3304 N N   . PRO B 1 51  ? 3.508   -26.489 22.071  1.00 23.83 ? 51  PRO B N   1 
ATOM   3305 C CA  . PRO B 1 51  ? 2.295   -25.726 21.792  1.00 24.74 ? 51  PRO B CA  1 
ATOM   3306 C C   . PRO B 1 51  ? 1.213   -26.156 22.754  1.00 26.36 ? 51  PRO B C   1 
ATOM   3307 O O   . PRO B 1 51  ? 1.153   -27.322 23.143  1.00 28.95 ? 51  PRO B O   1 
ATOM   3308 C CB  . PRO B 1 51  ? 1.936   -26.135 20.366  1.00 23.86 ? 51  PRO B CB  1 
ATOM   3309 C CG  . PRO B 1 51  ? 3.186   -26.794 19.828  1.00 28.08 ? 51  PRO B CG  1 
ATOM   3310 C CD  . PRO B 1 51  ? 3.751   -27.486 21.020  1.00 24.21 ? 51  PRO B CD  1 
ATOM   3311 N N   . ARG B 1 52  ? 0.353   -25.232 23.142  1.00 23.07 ? 52  ARG B N   1 
ATOM   3312 C CA  . ARG B 1 52  ? -0.721  -25.608 24.022  1.00 25.46 ? 52  ARG B CA  1 
ATOM   3313 C C   . ARG B 1 52  ? -2.016  -24.883 23.681  1.00 25.48 ? 52  ARG B C   1 
ATOM   3314 O O   . ARG B 1 52  ? -2.010  -23.711 23.296  1.00 24.89 ? 52  ARG B O   1 
ATOM   3315 C CB  . ARG B 1 52  ? -0.332  -25.353 25.487  1.00 32.26 ? 52  ARG B CB  1 
ATOM   3316 C CG  . ARG B 1 52  ? -0.100  -23.883 25.864  1.00 37.12 ? 52  ARG B CG  1 
ATOM   3317 C CD  . ARG B 1 52  ? 0.212   -23.745 27.362  1.00 40.33 ? 52  ARG B CD  1 
ATOM   3318 N NE  . ARG B 1 52  ? 0.411   -22.354 27.782  1.00 42.35 ? 52  ARG B NE  1 
ATOM   3319 C CZ  . ARG B 1 52  ? 1.501   -21.630 27.526  1.00 41.52 ? 52  ARG B CZ  1 
ATOM   3320 N NH1 . ARG B 1 52  ? 2.514   -22.156 26.848  1.00 43.64 ? 52  ARG B NH1 1 
ATOM   3321 N NH2 . ARG B 1 52  ? 1.577   -20.371 27.946  1.00 42.49 ? 52  ARG B NH2 1 
ATOM   3322 N N   . ILE B 1 53  ? -3.120  -25.616 23.773  1.00 23.25 ? 53  ILE B N   1 
ATOM   3323 C CA  . ILE B 1 53  ? -4.443  -25.054 23.551  1.00 18.65 ? 53  ILE B CA  1 
ATOM   3324 C C   . ILE B 1 53  ? -4.906  -24.856 24.987  1.00 19.08 ? 53  ILE B C   1 
ATOM   3325 O O   . ILE B 1 53  ? -4.756  -25.751 25.816  1.00 22.23 ? 53  ILE B O   1 
ATOM   3326 C CB  . ILE B 1 53  ? -5.352  -26.040 22.802  1.00 16.20 ? 53  ILE B CB  1 
ATOM   3327 C CG1 . ILE B 1 53  ? -4.870  -26.174 21.359  1.00 12.31 ? 53  ILE B CG1 1 
ATOM   3328 C CG2 . ILE B 1 53  ? -6.784  -25.560 22.825  1.00 18.49 ? 53  ILE B CG2 1 
ATOM   3329 C CD1 . ILE B 1 53  ? -5.691  -27.101 20.496  1.00 14.78 ? 53  ILE B CD1 1 
ATOM   3330 N N   . GLN B 1 54  ? -5.447  -23.688 25.297  1.00 19.70 ? 54  GLN B N   1 
ATOM   3331 C CA  . GLN B 1 54  ? -5.856  -23.411 26.664  1.00 22.40 ? 54  GLN B CA  1 
ATOM   3332 C C   . GLN B 1 54  ? -7.054  -22.472 26.677  1.00 22.67 ? 54  GLN B C   1 
ATOM   3333 O O   . GLN B 1 54  ? -7.420  -21.913 25.643  1.00 25.72 ? 54  GLN B O   1 
ATOM   3334 C CB  . GLN B 1 54  ? -4.685  -22.761 27.408  1.00 25.64 ? 54  GLN B CB  1 
ATOM   3335 C CG  . GLN B 1 54  ? -4.304  -21.409 26.805  1.00 31.67 ? 54  GLN B CG  1 
ATOM   3336 C CD  . GLN B 1 54  ? -3.090  -20.770 27.452  1.00 36.07 ? 54  GLN B CD  1 
ATOM   3337 O OE1 . GLN B 1 54  ? -2.911  -19.547 27.386  1.00 39.05 ? 54  GLN B OE1 1 
ATOM   3338 N NE2 . GLN B 1 54  ? -2.239  -21.589 28.066  1.00 32.82 ? 54  GLN B NE2 1 
ATOM   3339 N N   . PRO B 1 55  ? -7.674  -22.275 27.854  1.00 21.15 ? 55  PRO B N   1 
ATOM   3340 C CA  . PRO B 1 55  ? -8.833  -21.381 27.940  1.00 22.35 ? 55  PRO B CA  1 
ATOM   3341 C C   . PRO B 1 55  ? -8.464  -19.972 27.487  1.00 22.04 ? 55  PRO B C   1 
ATOM   3342 O O   . PRO B 1 55  ? -7.336  -19.525 27.689  1.00 22.10 ? 55  PRO B O   1 
ATOM   3343 C CB  . PRO B 1 55  ? -9.192  -21.413 29.428  1.00 18.90 ? 55  PRO B CB  1 
ATOM   3344 C CG  . PRO B 1 55  ? -8.720  -22.762 29.864  1.00 21.53 ? 55  PRO B CG  1 
ATOM   3345 C CD  . PRO B 1 55  ? -7.386  -22.877 29.167  1.00 20.06 ? 55  PRO B CD  1 
ATOM   3346 N N   . PHE B 1 56  ? -9.416  -19.282 26.871  1.00 21.94 ? 56  PHE B N   1 
ATOM   3347 C CA  . PHE B 1 56  ? -9.204  -17.908 26.428  1.00 19.68 ? 56  PHE B CA  1 
ATOM   3348 C C   . PHE B 1 56  ? -8.877  -17.106 27.690  1.00 22.28 ? 56  PHE B C   1 
ATOM   3349 O O   . PHE B 1 56  ? -9.607  -17.197 28.675  1.00 20.73 ? 56  PHE B O   1 
ATOM   3350 C CB  . PHE B 1 56  ? -10.490 -17.367 25.798  1.00 16.12 ? 56  PHE B CB  1 
ATOM   3351 C CG  . PHE B 1 56  ? -10.316 -16.055 25.087  1.00 16.36 ? 56  PHE B CG  1 
ATOM   3352 C CD1 . PHE B 1 56  ? -9.834  -16.016 23.781  1.00 18.08 ? 56  PHE B CD1 1 
ATOM   3353 C CD2 . PHE B 1 56  ? -10.609 -14.858 25.726  1.00 18.97 ? 56  PHE B CD2 1 
ATOM   3354 C CE1 . PHE B 1 56  ? -9.642  -14.804 23.121  1.00 18.23 ? 56  PHE B CE1 1 
ATOM   3355 C CE2 . PHE B 1 56  ? -10.421 -13.628 25.075  1.00 20.14 ? 56  PHE B CE2 1 
ATOM   3356 C CZ  . PHE B 1 56  ? -9.936  -13.604 23.769  1.00 22.79 ? 56  PHE B CZ  1 
ATOM   3357 N N   . GLN B 1 57  ? -7.793  -16.332 27.669  1.00 23.37 ? 57  GLN B N   1 
ATOM   3358 C CA  . GLN B 1 57  ? -7.396  -15.535 28.840  1.00 23.73 ? 57  GLN B CA  1 
ATOM   3359 C C   . GLN B 1 57  ? -6.491  -14.357 28.474  1.00 22.50 ? 57  GLN B C   1 
ATOM   3360 O O   . GLN B 1 57  ? -6.043  -14.241 27.330  1.00 19.67 ? 57  GLN B O   1 
ATOM   3361 C CB  . GLN B 1 57  ? -6.667  -16.427 29.848  1.00 24.99 ? 57  GLN B CB  1 
ATOM   3362 C CG  . GLN B 1 57  ? -5.495  -17.178 29.241  1.00 30.38 ? 57  GLN B CG  1 
ATOM   3363 C CD  . GLN B 1 57  ? -4.877  -18.193 30.191  1.00 32.08 ? 57  GLN B CD  1 
ATOM   3364 O OE1 . GLN B 1 57  ? -4.201  -17.833 31.149  1.00 36.64 ? 57  GLN B OE1 1 
ATOM   3365 N NE2 . GLN B 1 57  ? -5.115  -19.471 29.927  1.00 33.56 ? 57  GLN B NE2 1 
ATOM   3366 N N   . ASN B 1 58  ? -6.206  -13.490 29.447  1.00 19.96 ? 58  ASN B N   1 
ATOM   3367 C CA  . ASN B 1 58  ? -5.341  -12.336 29.185  1.00 20.29 ? 58  ASN B CA  1 
ATOM   3368 C C   . ASN B 1 58  ? -3.863  -12.684 29.125  1.00 19.23 ? 58  ASN B C   1 
ATOM   3369 O O   . ASN B 1 58  ? -3.417  -13.669 29.698  1.00 20.59 ? 58  ASN B O   1 
ATOM   3370 C CB  . ASN B 1 58  ? -5.531  -11.250 30.237  1.00 18.18 ? 58  ASN B CB  1 
ATOM   3371 C CG  . ASN B 1 58  ? -6.919  -10.669 30.218  1.00 22.52 ? 58  ASN B CG  1 
ATOM   3372 O OD1 . ASN B 1 58  ? -7.485  -10.424 29.150  1.00 25.47 ? 58  ASN B OD1 1 
ATOM   3373 N ND2 . ASN B 1 58  ? -7.481  -10.437 31.402  1.00 18.98 ? 58  ASN B ND2 1 
ATOM   3374 N N   . LEU B 1 59  ? -3.108  -11.864 28.412  1.00 18.37 ? 59  LEU B N   1 
ATOM   3375 C CA  . LEU B 1 59  ? -1.672  -12.062 28.286  1.00 18.57 ? 59  LEU B CA  1 
ATOM   3376 C C   . LEU B 1 59  ? -0.978  -11.253 29.372  1.00 19.91 ? 59  LEU B C   1 
ATOM   3377 O O   . LEU B 1 59  ? -1.425  -10.155 29.731  1.00 17.31 ? 59  LEU B O   1 
ATOM   3378 C CB  . LEU B 1 59  ? -1.182  -11.567 26.930  1.00 19.02 ? 59  LEU B CB  1 
ATOM   3379 C CG  . LEU B 1 59  ? -1.864  -12.138 25.695  1.00 21.03 ? 59  LEU B CG  1 
ATOM   3380 C CD1 . LEU B 1 59  ? -1.352  -11.407 24.479  1.00 19.81 ? 59  LEU B CD1 1 
ATOM   3381 C CD2 . LEU B 1 59  ? -1.577  -13.625 25.581  1.00 17.69 ? 59  LEU B CD2 1 
ATOM   3382 N N   . THR B 1 60  ? 0.125   -11.793 29.872  1.00 21.10 ? 60  THR B N   1 
ATOM   3383 C CA  . THR B 1 60  ? 0.916   -11.137 30.904  1.00 22.91 ? 60  THR B CA  1 
ATOM   3384 C C   . THR B 1 60  ? 2.211   -10.672 30.244  1.00 21.24 ? 60  THR B C   1 
ATOM   3385 O O   . THR B 1 60  ? 3.099   -11.472 29.983  1.00 21.62 ? 60  THR B O   1 
ATOM   3386 C CB  . THR B 1 60  ? 1.238   -12.124 32.050  1.00 25.76 ? 60  THR B CB  1 
ATOM   3387 O OG1 . THR B 1 60  ? 0.013   -12.637 32.584  1.00 27.76 ? 60  THR B OG1 1 
ATOM   3388 C CG2 . THR B 1 60  ? 1.998   -11.435 33.161  1.00 27.49 ? 60  THR B CG2 1 
ATOM   3389 N N   . LEU B 1 61  ? 2.320   -9.380  29.970  1.00 22.85 ? 61  LEU B N   1 
ATOM   3390 C CA  . LEU B 1 61  ? 3.514   -8.864  29.309  1.00 20.03 ? 61  LEU B CA  1 
ATOM   3391 C C   . LEU B 1 61  ? 4.342   -7.989  30.209  1.00 15.79 ? 61  LEU B C   1 
ATOM   3392 O O   . LEU B 1 61  ? 3.809   -7.233  31.004  1.00 18.04 ? 61  LEU B O   1 
ATOM   3393 C CB  . LEU B 1 61  ? 3.120   -8.056  28.069  1.00 22.98 ? 61  LEU B CB  1 
ATOM   3394 C CG  . LEU B 1 61  ? 2.840   -8.771  26.743  1.00 21.97 ? 61  LEU B CG  1 
ATOM   3395 C CD1 . LEU B 1 61  ? 2.102   -10.054 26.970  1.00 17.50 ? 61  LEU B CD1 1 
ATOM   3396 C CD2 . LEU B 1 61  ? 2.029   -7.838  25.848  1.00 20.61 ? 61  LEU B CD2 1 
ATOM   3397 N N   . HIS B 1 62  ? 5.655   -8.108  30.079  1.00 17.83 ? 62  HIS B N   1 
ATOM   3398 C CA  . HIS B 1 62  ? 6.582   -7.285  30.848  1.00 16.00 ? 62  HIS B CA  1 
ATOM   3399 C C   . HIS B 1 62  ? 6.459   -5.883  30.224  1.00 16.29 ? 62  HIS B C   1 
ATOM   3400 O O   . HIS B 1 62  ? 6.440   -5.747  29.008  1.00 18.87 ? 62  HIS B O   1 
ATOM   3401 C CB  . HIS B 1 62  ? 7.987   -7.840  30.679  1.00 15.01 ? 62  HIS B CB  1 
ATOM   3402 C CG  . HIS B 1 62  ? 9.031   -7.123  31.474  1.00 23.91 ? 62  HIS B CG  1 
ATOM   3403 N ND1 . HIS B 1 62  ? 9.508   -5.874  31.131  1.00 22.78 ? 62  HIS B ND1 1 
ATOM   3404 C CD2 . HIS B 1 62  ? 9.728   -7.502  32.574  1.00 24.05 ? 62  HIS B CD2 1 
ATOM   3405 C CE1 . HIS B 1 62  ? 10.455  -5.519  31.980  1.00 24.40 ? 62  HIS B CE1 1 
ATOM   3406 N NE2 . HIS B 1 62  ? 10.609  -6.489  32.865  1.00 26.03 ? 62  HIS B NE2 1 
ATOM   3407 N N   . PRO B 1 63  ? 6.355   -4.833  31.047  1.00 15.99 ? 63  PRO B N   1 
ATOM   3408 C CA  . PRO B 1 63  ? 6.223   -3.456  30.562  1.00 16.18 ? 63  PRO B CA  1 
ATOM   3409 C C   . PRO B 1 63  ? 7.222   -3.042  29.493  1.00 17.29 ? 63  PRO B C   1 
ATOM   3410 O O   . PRO B 1 63  ? 6.962   -2.126  28.723  1.00 17.61 ? 63  PRO B O   1 
ATOM   3411 C CB  . PRO B 1 63  ? 6.375   -2.625  31.831  1.00 14.34 ? 63  PRO B CB  1 
ATOM   3412 C CG  . PRO B 1 63  ? 5.800   -3.517  32.871  1.00 19.11 ? 63  PRO B CG  1 
ATOM   3413 C CD  . PRO B 1 63  ? 6.392   -4.862  32.519  1.00 17.53 ? 63  PRO B CD  1 
ATOM   3414 N N   . ALA B 1 64  ? 8.369   -3.708  29.446  1.00 18.65 ? 64  ALA B N   1 
ATOM   3415 C CA  . ALA B 1 64  ? 9.386   -3.366  28.459  1.00 19.51 ? 64  ALA B CA  1 
ATOM   3416 C C   . ALA B 1 64  ? 9.324   -4.226  27.198  1.00 20.04 ? 64  ALA B C   1 
ATOM   3417 O O   . ALA B 1 64  ? 10.204  -4.124  26.343  1.00 21.13 ? 64  ALA B O   1 
ATOM   3418 C CB  . ALA B 1 64  ? 10.780  -3.453  29.086  1.00 16.27 ? 64  ALA B CB  1 
ATOM   3419 N N   . SER B 1 65  ? 8.287   -5.055  27.074  1.00 18.38 ? 65  SER B N   1 
ATOM   3420 C CA  . SER B 1 65  ? 8.135   -5.924  25.908  1.00 18.42 ? 65  SER B CA  1 
ATOM   3421 C C   . SER B 1 65  ? 8.288   -5.157  24.595  1.00 20.03 ? 65  SER B C   1 
ATOM   3422 O O   . SER B 1 65  ? 7.586   -4.159  24.350  1.00 19.01 ? 65  SER B O   1 
ATOM   3423 C CB  . SER B 1 65  ? 6.778   -6.618  25.932  1.00 19.19 ? 65  SER B CB  1 
ATOM   3424 O OG  . SER B 1 65  ? 6.636   -7.490  24.816  1.00 22.72 ? 65  SER B OG  1 
ATOM   3425 N N   . SER B 1 66  ? 9.200   -5.630  23.748  1.00 16.32 ? 66  SER B N   1 
ATOM   3426 C CA  . SER B 1 66  ? 9.456   -4.957  22.476  1.00 19.71 ? 66  SER B CA  1 
ATOM   3427 C C   . SER B 1 66  ? 8.227   -4.884  21.568  1.00 18.91 ? 66  SER B C   1 
ATOM   3428 O O   . SER B 1 66  ? 8.162   -4.050  20.658  1.00 18.34 ? 66  SER B O   1 
ATOM   3429 C CB  . SER B 1 66  ? 10.628  -5.615  21.738  1.00 13.84 ? 66  SER B CB  1 
ATOM   3430 O OG  . SER B 1 66  ? 10.479  -7.012  21.672  1.00 15.89 ? 66  SER B OG  1 
ATOM   3431 N N   . SER B 1 67  ? 7.246   -5.738  21.829  1.00 16.64 ? 67  SER B N   1 
ATOM   3432 C CA  . SER B 1 67  ? 6.030   -5.732  21.030  1.00 17.49 ? 67  SER B CA  1 
ATOM   3433 C C   . SER B 1 67  ? 5.225   -4.449  21.285  1.00 16.78 ? 67  SER B C   1 
ATOM   3434 O O   . SER B 1 67  ? 4.432   -4.030  20.448  1.00 15.23 ? 67  SER B O   1 
ATOM   3435 C CB  . SER B 1 67  ? 5.165   -6.946  21.379  1.00 17.45 ? 67  SER B CB  1 
ATOM   3436 O OG  . SER B 1 67  ? 4.668   -6.855  22.707  1.00 14.65 ? 67  SER B OG  1 
ATOM   3437 N N   . LEU B 1 68  ? 5.444   -3.833  22.443  1.00 15.32 ? 68  LEU B N   1 
ATOM   3438 C CA  . LEU B 1 68  ? 4.730   -2.622  22.827  1.00 13.46 ? 68  LEU B CA  1 
ATOM   3439 C C   . LEU B 1 68  ? 5.504   -1.312  22.605  1.00 16.23 ? 68  LEU B C   1 
ATOM   3440 O O   . LEU B 1 68  ? 4.928   -0.225  22.661  1.00 11.84 ? 68  LEU B O   1 
ATOM   3441 C CB  . LEU B 1 68  ? 4.326   -2.724  24.297  1.00 13.22 ? 68  LEU B CB  1 
ATOM   3442 C CG  . LEU B 1 68  ? 3.359   -3.846  24.672  1.00 11.43 ? 68  LEU B CG  1 
ATOM   3443 C CD1 . LEU B 1 68  ? 3.161   -3.843  26.183  1.00 12.42 ? 68  LEU B CD1 1 
ATOM   3444 C CD2 . LEU B 1 68  ? 2.022   -3.647  23.956  1.00 12.61 ? 68  LEU B CD2 1 
ATOM   3445 N N   . HIS B 1 69  ? 6.807   -1.424  22.357  1.00 16.41 ? 69  HIS B N   1 
ATOM   3446 C CA  . HIS B 1 69  ? 7.658   -0.256  22.153  1.00 15.31 ? 69  HIS B CA  1 
ATOM   3447 C C   . HIS B 1 69  ? 8.105   -0.080  20.701  1.00 15.16 ? 69  HIS B C   1 
ATOM   3448 O O   . HIS B 1 69  ? 8.079   1.026   20.160  1.00 17.83 ? 69  HIS B O   1 
ATOM   3449 C CB  . HIS B 1 69  ? 8.913   -0.358  23.031  1.00 13.33 ? 69  HIS B CB  1 
ATOM   3450 C CG  . HIS B 1 69  ? 8.639   -0.267  24.496  1.00 12.64 ? 69  HIS B CG  1 
ATOM   3451 N ND1 . HIS B 1 69  ? 8.905   0.867   25.233  1.00 15.95 ? 69  HIS B ND1 1 
ATOM   3452 C CD2 . HIS B 1 69  ? 8.109   -1.165  25.362  1.00 9.50  ? 69  HIS B CD2 1 
ATOM   3453 C CE1 . HIS B 1 69  ? 8.547   0.666   26.489  1.00 14.90 ? 69  HIS B CE1 1 
ATOM   3454 N NE2 . HIS B 1 69  ? 8.059   -0.557  26.593  1.00 12.32 ? 69  HIS B NE2 1 
ATOM   3455 N N   . TYR B 1 70  ? 8.523   -1.173  20.078  1.00 11.79 ? 70  TYR B N   1 
ATOM   3456 C CA  . TYR B 1 70  ? 9.012   -1.103  18.722  1.00 10.68 ? 70  TYR B CA  1 
ATOM   3457 C C   . TYR B 1 70  ? 8.152   -1.818  17.711  1.00 12.89 ? 70  TYR B C   1 
ATOM   3458 O O   . TYR B 1 70  ? 8.587   -2.065  16.587  1.00 13.88 ? 70  TYR B O   1 
ATOM   3459 C CB  . TYR B 1 70  ? 10.435  -1.626  18.693  1.00 10.54 ? 70  TYR B CB  1 
ATOM   3460 C CG  . TYR B 1 70  ? 11.265  -0.917  19.715  1.00 13.76 ? 70  TYR B CG  1 
ATOM   3461 C CD1 . TYR B 1 70  ? 11.252  0.484   19.796  1.00 15.43 ? 70  TYR B CD1 1 
ATOM   3462 C CD2 . TYR B 1 70  ? 12.011  -1.631  20.651  1.00 14.07 ? 70  TYR B CD2 1 
ATOM   3463 C CE1 . TYR B 1 70  ? 11.953  1.154   20.794  1.00 16.81 ? 70  TYR B CE1 1 
ATOM   3464 C CE2 . TYR B 1 70  ? 12.717  -0.976  21.650  1.00 17.42 ? 70  TYR B CE2 1 
ATOM   3465 C CZ  . TYR B 1 70  ? 12.680  0.415   21.721  1.00 18.02 ? 70  TYR B CZ  1 
ATOM   3466 O OH  . TYR B 1 70  ? 13.344  1.044   22.742  1.00 8.42  ? 70  TYR B OH  1 
ATOM   3467 N N   . SER B 1 71  ? 6.931   -2.157  18.110  1.00 11.22 ? 71  SER B N   1 
ATOM   3468 C CA  . SER B 1 71  ? 6.006   -2.797  17.190  1.00 12.59 ? 71  SER B CA  1 
ATOM   3469 C C   . SER B 1 71  ? 6.539   -4.071  16.521  1.00 12.11 ? 71  SER B C   1 
ATOM   3470 O O   . SER B 1 71  ? 6.397   -4.254  15.311  1.00 12.79 ? 71  SER B O   1 
ATOM   3471 C CB  . SER B 1 71  ? 5.590   -1.770  16.118  1.00 10.73 ? 71  SER B CB  1 
ATOM   3472 O OG  . SER B 1 71  ? 4.543   -2.245  15.300  1.00 9.48  ? 71  SER B OG  1 
ATOM   3473 N N   . LEU B 1 72  ? 7.183   -4.939  17.290  1.00 14.97 ? 72  LEU B N   1 
ATOM   3474 C CA  . LEU B 1 72  ? 7.649   -6.209  16.733  1.00 11.94 ? 72  LEU B CA  1 
ATOM   3475 C C   . LEU B 1 72  ? 6.408   -7.090  16.794  1.00 11.78 ? 72  LEU B C   1 
ATOM   3476 O O   . LEU B 1 72  ? 6.217   -7.875  17.708  1.00 12.13 ? 72  LEU B O   1 
ATOM   3477 C CB  . LEU B 1 72  ? 8.787   -6.780  17.578  1.00 13.33 ? 72  LEU B CB  1 
ATOM   3478 C CG  . LEU B 1 72  ? 10.114  -6.042  17.333  1.00 17.14 ? 72  LEU B CG  1 
ATOM   3479 C CD1 . LEU B 1 72  ? 11.239  -6.649  18.151  1.00 18.94 ? 72  LEU B CD1 1 
ATOM   3480 C CD2 . LEU B 1 72  ? 10.455  -6.131  15.854  1.00 14.90 ? 72  LEU B CD2 1 
ATOM   3481 N N   . GLN B 1 73  ? 5.542   -6.924  15.808  1.00 12.12 ? 73  GLN B N   1 
ATOM   3482 C CA  . GLN B 1 73  ? 4.292   -7.647  15.800  1.00 15.14 ? 73  GLN B CA  1 
ATOM   3483 C C   . GLN B 1 73  ? 3.782   -7.801  14.376  1.00 16.45 ? 73  GLN B C   1 
ATOM   3484 O O   . GLN B 1 73  ? 4.000   -6.930  13.535  1.00 18.30 ? 73  GLN B O   1 
ATOM   3485 C CB  . GLN B 1 73  ? 3.261   -6.860  16.632  1.00 14.53 ? 73  GLN B CB  1 
ATOM   3486 C CG  . GLN B 1 73  ? 3.041   -5.425  16.107  1.00 11.01 ? 73  GLN B CG  1 
ATOM   3487 C CD  . GLN B 1 73  ? 2.017   -4.623  16.901  1.00 13.97 ? 73  GLN B CD  1 
ATOM   3488 O OE1 . GLN B 1 73  ? 2.168   -4.416  18.103  1.00 16.22 ? 73  GLN B OE1 1 
ATOM   3489 N NE2 . GLN B 1 73  ? 0.973   -4.159  16.226  1.00 12.16 ? 73  GLN B NE2 1 
ATOM   3490 N N   . LEU B 1 74  ? 3.125   -8.925  14.111  1.00 18.67 ? 74  LEU B N   1 
ATOM   3491 C CA  . LEU B 1 74  ? 2.524   -9.192  12.808  1.00 17.45 ? 74  LEU B CA  1 
ATOM   3492 C C   . LEU B 1 74  ? 1.335   -10.097 13.056  1.00 16.50 ? 74  LEU B C   1 
ATOM   3493 O O   . LEU B 1 74  ? 1.249   -10.749 14.097  1.00 17.90 ? 74  LEU B O   1 
ATOM   3494 C CB  . LEU B 1 74  ? 3.515   -9.844  11.821  1.00 17.89 ? 74  LEU B CB  1 
ATOM   3495 C CG  . LEU B 1 74  ? 4.126   -11.258 11.884  1.00 19.46 ? 74  LEU B CG  1 
ATOM   3496 C CD1 . LEU B 1 74  ? 5.119   -11.335 13.016  1.00 22.50 ? 74  LEU B CD1 1 
ATOM   3497 C CD2 . LEU B 1 74  ? 3.049   -12.308 12.004  1.00 14.51 ? 74  LEU B CD2 1 
ATOM   3498 N N   . PHE B 1 75  ? 0.405   -10.125 12.114  1.00 15.71 ? 75  PHE B N   1 
ATOM   3499 C CA  . PHE B 1 75  ? -0.773  -10.964 12.261  1.00 16.15 ? 75  PHE B CA  1 
ATOM   3500 C C   . PHE B 1 75  ? -1.214  -11.511 10.921  1.00 15.73 ? 75  PHE B C   1 
ATOM   3501 O O   . PHE B 1 75  ? -0.681  -11.135 9.878   1.00 20.84 ? 75  PHE B O   1 
ATOM   3502 C CB  . PHE B 1 75  ? -1.938  -10.162 12.861  1.00 16.24 ? 75  PHE B CB  1 
ATOM   3503 C CG  . PHE B 1 75  ? -2.431  -9.058  11.965  1.00 19.25 ? 75  PHE B CG  1 
ATOM   3504 C CD1 . PHE B 1 75  ? -1.698  -7.870  11.818  1.00 19.64 ? 75  PHE B CD1 1 
ATOM   3505 C CD2 . PHE B 1 75  ? -3.605  -9.217  11.228  1.00 17.76 ? 75  PHE B CD2 1 
ATOM   3506 C CE1 . PHE B 1 75  ? -2.128  -6.861  10.949  1.00 17.30 ? 75  PHE B CE1 1 
ATOM   3507 C CE2 . PHE B 1 75  ? -4.049  -8.213  10.350  1.00 13.77 ? 75  PHE B CE2 1 
ATOM   3508 C CZ  . PHE B 1 75  ? -3.310  -7.033  10.209  1.00 16.29 ? 75  PHE B CZ  1 
ATOM   3509 N N   . GLU B 1 76  ? -2.197  -12.402 10.972  1.00 12.20 ? 76  GLU B N   1 
ATOM   3510 C CA  . GLU B 1 76  ? -2.791  -12.990 9.790   1.00 12.95 ? 76  GLU B CA  1 
ATOM   3511 C C   . GLU B 1 76  ? -4.298  -12.984 9.975   1.00 16.84 ? 76  GLU B C   1 
ATOM   3512 O O   . GLU B 1 76  ? -4.803  -12.596 11.039  1.00 13.68 ? 76  GLU B O   1 
ATOM   3513 C CB  . GLU B 1 76  ? -2.282  -14.413 9.545   1.00 11.28 ? 76  GLU B CB  1 
ATOM   3514 C CG  . GLU B 1 76  ? -1.145  -14.458 8.531   1.00 8.43  ? 76  GLU B CG  1 
ATOM   3515 C CD  . GLU B 1 76  ? -1.562  -13.878 7.185   1.00 13.66 ? 76  GLU B CD  1 
ATOM   3516 O OE1 . GLU B 1 76  ? -0.684  -13.438 6.420   1.00 9.87  ? 76  GLU B OE1 1 
ATOM   3517 O OE2 . GLU B 1 76  ? -2.779  -13.869 6.890   1.00 16.62 ? 76  GLU B OE2 1 
ATOM   3518 N N   . GLY B 1 77  ? -5.013  -13.390 8.931   1.00 17.82 ? 77  GLY B N   1 
ATOM   3519 C CA  . GLY B 1 77  ? -6.464  -13.404 8.995   1.00 18.81 ? 77  GLY B CA  1 
ATOM   3520 C C   . GLY B 1 77  ? -7.046  -14.302 7.924   1.00 20.04 ? 77  GLY B C   1 
ATOM   3521 O O   . GLY B 1 77  ? -6.755  -14.151 6.738   1.00 19.81 ? 77  GLY B O   1 
ATOM   3522 N N   . MET B 1 78  ? -7.867  -15.249 8.348   1.00 20.47 ? 78  MET B N   1 
ATOM   3523 C CA  . MET B 1 78  ? -8.479  -16.186 7.428   1.00 20.97 ? 78  MET B CA  1 
ATOM   3524 C C   . MET B 1 78  ? -9.796  -16.663 8.006   1.00 19.88 ? 78  MET B C   1 
ATOM   3525 O O   . MET B 1 78  ? -10.094 -16.430 9.182   1.00 19.30 ? 78  MET B O   1 
ATOM   3526 C CB  . MET B 1 78  ? -7.536  -17.372 7.184   1.00 24.59 ? 78  MET B CB  1 
ATOM   3527 C CG  . MET B 1 78  ? -7.058  -18.053 8.453   1.00 29.46 ? 78  MET B CG  1 
ATOM   3528 S SD  . MET B 1 78  ? -5.572  -19.039 8.183   1.00 30.66 ? 78  MET B SD  1 
ATOM   3529 C CE  . MET B 1 78  ? -6.286  -20.661 7.944   1.00 31.48 ? 78  MET B CE  1 
ATOM   3530 N N   . LYS B 1 79  ? -10.582 -17.336 7.175   1.00 19.98 ? 79  LYS B N   1 
ATOM   3531 C CA  . LYS B 1 79  ? -11.877 -17.834 7.600   1.00 19.68 ? 79  LYS B CA  1 
ATOM   3532 C C   . LYS B 1 79  ? -12.074 -19.336 7.458   1.00 20.50 ? 79  LYS B C   1 
ATOM   3533 O O   . LYS B 1 79  ? -11.415 -20.008 6.658   1.00 18.75 ? 79  LYS B O   1 
ATOM   3534 C CB  . LYS B 1 79  ? -12.987 -17.115 6.831   1.00 15.59 ? 79  LYS B CB  1 
ATOM   3535 C CG  . LYS B 1 79  ? -13.183 -15.679 7.231   1.00 14.69 ? 79  LYS B CG  1 
ATOM   3536 C CD  . LYS B 1 79  ? -14.323 -15.059 6.440   1.00 16.94 ? 79  LYS B CD  1 
ATOM   3537 C CE  . LYS B 1 79  ? -14.614 -13.645 6.927   1.00 15.73 ? 79  LYS B CE  1 
ATOM   3538 N NZ  . LYS B 1 79  ? -15.766 -13.035 6.215   1.00 19.24 ? 79  LYS B NZ  1 
ATOM   3539 N N   . ALA B 1 80  ? -13.005 -19.839 8.260   1.00 22.63 ? 80  ALA B N   1 
ATOM   3540 C CA  . ALA B 1 80  ? -13.396 -21.240 8.261   1.00 21.18 ? 80  ALA B CA  1 
ATOM   3541 C C   . ALA B 1 80  ? -14.913 -21.190 8.061   1.00 20.12 ? 80  ALA B C   1 
ATOM   3542 O O   . ALA B 1 80  ? -15.595 -20.351 8.657   1.00 21.19 ? 80  ALA B O   1 
ATOM   3543 C CB  . ALA B 1 80  ? -13.044 -21.887 9.597   1.00 19.74 ? 80  ALA B CB  1 
ATOM   3544 N N   . PHE B 1 81  ? -15.440 -22.066 7.213   1.00 21.66 ? 81  PHE B N   1 
ATOM   3545 C CA  . PHE B 1 81  ? -16.874 -22.085 6.940   1.00 20.05 ? 81  PHE B CA  1 
ATOM   3546 C C   . PHE B 1 81  ? -17.513 -23.430 7.250   1.00 22.55 ? 81  PHE B C   1 
ATOM   3547 O O   . PHE B 1 81  ? -16.908 -24.477 7.042   1.00 22.50 ? 81  PHE B O   1 
ATOM   3548 C CB  . PHE B 1 81  ? -17.147 -21.762 5.466   1.00 20.02 ? 81  PHE B CB  1 
ATOM   3549 C CG  . PHE B 1 81  ? -16.491 -20.499 4.978   1.00 17.67 ? 81  PHE B CG  1 
ATOM   3550 C CD1 . PHE B 1 81  ? -15.154 -20.496 4.586   1.00 13.76 ? 81  PHE B CD1 1 
ATOM   3551 C CD2 . PHE B 1 81  ? -17.221 -19.309 4.892   1.00 19.87 ? 81  PHE B CD2 1 
ATOM   3552 C CE1 . PHE B 1 81  ? -14.546 -19.329 4.108   1.00 11.64 ? 81  PHE B CE1 1 
ATOM   3553 C CE2 . PHE B 1 81  ? -16.621 -18.129 4.415   1.00 17.98 ? 81  PHE B CE2 1 
ATOM   3554 C CZ  . PHE B 1 81  ? -15.282 -18.144 4.021   1.00 16.89 ? 81  PHE B CZ  1 
ATOM   3555 N N   . LYS B 1 82  ? -18.752 -23.401 7.727   1.00 23.14 ? 82  LYS B N   1 
ATOM   3556 C CA  . LYS B 1 82  ? -19.459 -24.633 8.026   1.00 25.69 ? 82  LYS B CA  1 
ATOM   3557 C C   . LYS B 1 82  ? -20.520 -24.857 6.958   1.00 26.45 ? 82  LYS B C   1 
ATOM   3558 O O   . LYS B 1 82  ? -21.460 -24.064 6.826   1.00 25.87 ? 82  LYS B O   1 
ATOM   3559 C CB  . LYS B 1 82  ? -20.123 -24.579 9.413   1.00 25.71 ? 82  LYS B CB  1 
ATOM   3560 C CG  . LYS B 1 82  ? -20.866 -25.874 9.766   1.00 29.99 ? 82  LYS B CG  1 
ATOM   3561 C CD  . LYS B 1 82  ? -21.572 -25.818 11.117  1.00 33.87 ? 82  LYS B CD  1 
ATOM   3562 C CE  . LYS B 1 82  ? -20.622 -26.110 12.270  1.00 37.06 ? 82  LYS B CE  1 
ATOM   3563 N NZ  . LYS B 1 82  ? -21.314 -26.055 13.598  1.00 36.24 ? 82  LYS B NZ  1 
ATOM   3564 N N   . GLY B 1 83  ? -20.357 -25.938 6.198   1.00 26.94 ? 83  GLY B N   1 
ATOM   3565 C CA  . GLY B 1 83  ? -21.310 -26.270 5.155   1.00 29.79 ? 83  GLY B CA  1 
ATOM   3566 C C   . GLY B 1 83  ? -22.578 -26.887 5.717   1.00 32.68 ? 83  GLY B C   1 
ATOM   3567 O O   . GLY B 1 83  ? -22.649 -27.209 6.910   1.00 32.21 ? 83  GLY B O   1 
ATOM   3568 N N   . LYS B 1 84  ? -23.588 -27.054 4.865   1.00 34.96 ? 84  LYS B N   1 
ATOM   3569 C CA  . LYS B 1 84  ? -24.851 -27.641 5.309   1.00 36.84 ? 84  LYS B CA  1 
ATOM   3570 C C   . LYS B 1 84  ? -24.618 -29.072 5.768   1.00 34.95 ? 84  LYS B C   1 
ATOM   3571 O O   . LYS B 1 84  ? -25.385 -29.612 6.560   1.00 35.35 ? 84  LYS B O   1 
ATOM   3572 C CB  . LYS B 1 84  ? -25.889 -27.627 4.185   1.00 37.06 ? 84  LYS B CB  1 
ATOM   3573 C CG  . LYS B 1 84  ? -25.504 -28.443 2.953   1.00 39.23 ? 84  LYS B CG  1 
ATOM   3574 C CD  . LYS B 1 84  ? -24.283 -27.863 2.241   1.00 40.48 ? 84  LYS B CD  1 
ATOM   3575 C CE  . LYS B 1 84  ? -24.119 -28.465 0.854   1.00 38.61 ? 84  LYS B CE  1 
ATOM   3576 N NZ  . LYS B 1 84  ? -23.956 -29.933 0.883   1.00 37.54 ? 84  LYS B NZ  1 
ATOM   3577 N N   . ASP B 1 85  ? -23.549 -29.678 5.264   1.00 34.95 ? 85  ASP B N   1 
ATOM   3578 C CA  . ASP B 1 85  ? -23.206 -31.047 5.629   1.00 32.88 ? 85  ASP B CA  1 
ATOM   3579 C C   . ASP B 1 85  ? -22.493 -31.038 6.977   1.00 31.69 ? 85  ASP B C   1 
ATOM   3580 O O   . ASP B 1 85  ? -21.857 -32.019 7.358   1.00 32.27 ? 85  ASP B O   1 
ATOM   3581 C CB  . ASP B 1 85  ? -22.310 -31.676 4.555   1.00 29.42 ? 85  ASP B CB  1 
ATOM   3582 C CG  . ASP B 1 85  ? -20.946 -31.019 4.472   1.00 29.95 ? 85  ASP B CG  1 
ATOM   3583 O OD1 . ASP B 1 85  ? -20.835 -29.830 4.843   1.00 28.72 ? 85  ASP B OD1 1 
ATOM   3584 O OD2 . ASP B 1 85  ? -19.986 -31.685 4.020   1.00 30.71 ? 85  ASP B OD2 1 
ATOM   3585 N N   . GLN B 1 86  ? -22.600 -29.916 7.685   1.00 29.26 ? 86  GLN B N   1 
ATOM   3586 C CA  . GLN B 1 86  ? -21.993 -29.749 9.005   1.00 32.53 ? 86  GLN B CA  1 
ATOM   3587 C C   . GLN B 1 86  ? -20.461 -29.808 9.075   1.00 31.91 ? 86  GLN B C   1 
ATOM   3588 O O   . GLN B 1 86  ? -19.881 -29.715 10.159  1.00 33.80 ? 86  GLN B O   1 
ATOM   3589 C CB  . GLN B 1 86  ? -22.590 -30.761 9.990   1.00 29.72 ? 86  GLN B CB  1 
ATOM   3590 C CG  . GLN B 1 86  ? -24.097 -30.610 10.233  1.00 38.35 ? 86  GLN B CG  1 
ATOM   3591 C CD  . GLN B 1 86  ? -24.502 -29.197 10.644  1.00 44.50 ? 86  GLN B CD  1 
ATOM   3592 O OE1 . GLN B 1 86  ? -24.350 -28.247 9.873   1.00 49.65 ? 86  GLN B OE1 1 
ATOM   3593 N NE2 . GLN B 1 86  ? -25.025 -29.054 11.860  1.00 44.04 ? 86  GLN B NE2 1 
ATOM   3594 N N   . GLN B 1 87  ? -19.804 -29.964 7.930   1.00 31.71 ? 87  GLN B N   1 
ATOM   3595 C CA  . GLN B 1 87  ? -18.344 -30.000 7.890   1.00 32.09 ? 87  GLN B CA  1 
ATOM   3596 C C   . GLN B 1 87  ? -17.720 -28.592 7.881   1.00 30.59 ? 87  GLN B C   1 
ATOM   3597 O O   . GLN B 1 87  ? -18.195 -27.682 7.193   1.00 31.53 ? 87  GLN B O   1 
ATOM   3598 C CB  . GLN B 1 87  ? -17.871 -30.772 6.657   1.00 37.05 ? 87  GLN B CB  1 
ATOM   3599 C CG  . GLN B 1 87  ? -17.702 -32.258 6.891   1.00 46.34 ? 87  GLN B CG  1 
ATOM   3600 C CD  . GLN B 1 87  ? -16.531 -32.570 7.813   1.00 51.27 ? 87  GLN B CD  1 
ATOM   3601 O OE1 . GLN B 1 87  ? -16.503 -33.617 8.466   1.00 51.75 ? 87  GLN B OE1 1 
ATOM   3602 N NE2 . GLN B 1 87  ? -15.553 -31.665 7.862   1.00 54.06 ? 87  GLN B NE2 1 
ATOM   3603 N N   . VAL B 1 88  ? -16.651 -28.419 8.651   1.00 26.98 ? 88  VAL B N   1 
ATOM   3604 C CA  . VAL B 1 88  ? -15.959 -27.139 8.724   1.00 22.01 ? 88  VAL B CA  1 
ATOM   3605 C C   . VAL B 1 88  ? -14.715 -27.176 7.836   1.00 22.47 ? 88  VAL B C   1 
ATOM   3606 O O   . VAL B 1 88  ? -13.964 -28.155 7.846   1.00 26.07 ? 88  VAL B O   1 
ATOM   3607 C CB  . VAL B 1 88  ? -15.564 -26.809 10.179  1.00 20.84 ? 88  VAL B CB  1 
ATOM   3608 C CG1 . VAL B 1 88  ? -14.696 -25.562 10.220  1.00 21.83 ? 88  VAL B CG1 1 
ATOM   3609 C CG2 . VAL B 1 88  ? -16.816 -26.605 11.021  1.00 16.00 ? 88  VAL B CG2 1 
ATOM   3610 N N   . ARG B 1 89  ? -14.504 -26.106 7.073   1.00 22.45 ? 89  ARG B N   1 
ATOM   3611 C CA  . ARG B 1 89  ? -13.376 -26.009 6.152   1.00 20.02 ? 89  ARG B CA  1 
ATOM   3612 C C   . ARG B 1 89  ? -12.699 -24.636 6.108   1.00 20.21 ? 89  ARG B C   1 
ATOM   3613 O O   . ARG B 1 89  ? -13.362 -23.597 6.203   1.00 19.99 ? 89  ARG B O   1 
ATOM   3614 C CB  . ARG B 1 89  ? -13.845 -26.380 4.744   1.00 20.31 ? 89  ARG B CB  1 
ATOM   3615 C CG  . ARG B 1 89  ? -13.966 -27.864 4.513   1.00 25.03 ? 89  ARG B CG  1 
ATOM   3616 C CD  . ARG B 1 89  ? -14.744 -28.178 3.245   1.00 26.01 ? 89  ARG B CD  1 
ATOM   3617 N NE  . ARG B 1 89  ? -16.171 -28.096 3.502   1.00 29.28 ? 89  ARG B NE  1 
ATOM   3618 C CZ  . ARG B 1 89  ? -17.017 -29.115 3.384   1.00 26.82 ? 89  ARG B CZ  1 
ATOM   3619 N NH1 . ARG B 1 89  ? -16.584 -30.308 2.998   1.00 24.75 ? 89  ARG B NH1 1 
ATOM   3620 N NH2 . ARG B 1 89  ? -18.296 -28.941 3.685   1.00 24.88 ? 89  ARG B NH2 1 
ATOM   3621 N N   . LEU B 1 90  ? -11.373 -24.646 5.960   1.00 18.25 ? 90  LEU B N   1 
ATOM   3622 C CA  . LEU B 1 90  ? -10.580 -23.421 5.880   1.00 17.80 ? 90  LEU B CA  1 
ATOM   3623 C C   . LEU B 1 90  ? -10.266 -23.111 4.420   1.00 19.30 ? 90  LEU B C   1 
ATOM   3624 O O   . LEU B 1 90  ? -9.985  -24.006 3.627   1.00 21.32 ? 90  LEU B O   1 
ATOM   3625 C CB  . LEU B 1 90  ? -9.271  -23.571 6.650   1.00 21.86 ? 90  LEU B CB  1 
ATOM   3626 C CG  . LEU B 1 90  ? -9.309  -23.583 8.178   1.00 22.16 ? 90  LEU B CG  1 
ATOM   3627 C CD1 . LEU B 1 90  ? -7.932  -23.941 8.718   1.00 21.13 ? 90  LEU B CD1 1 
ATOM   3628 C CD2 . LEU B 1 90  ? -9.735  -22.222 8.683   1.00 24.93 ? 90  LEU B CD2 1 
ATOM   3629 N N   . PHE B 1 91  ? -10.314 -21.832 4.072   1.00 19.90 ? 91  PHE B N   1 
ATOM   3630 C CA  . PHE B 1 91  ? -10.060 -21.391 2.712   1.00 19.82 ? 91  PHE B CA  1 
ATOM   3631 C C   . PHE B 1 91  ? -8.572  -21.115 2.406   1.00 19.01 ? 91  PHE B C   1 
ATOM   3632 O O   . PHE B 1 91  ? -7.998  -20.141 2.889   1.00 21.82 ? 91  PHE B O   1 
ATOM   3633 C CB  . PHE B 1 91  ? -10.889 -20.134 2.435   1.00 15.62 ? 91  PHE B CB  1 
ATOM   3634 C CG  . PHE B 1 91  ? -10.804 -19.655 1.017   1.00 17.89 ? 91  PHE B CG  1 
ATOM   3635 C CD1 . PHE B 1 91  ? -11.498 -20.311 0.007   1.00 15.86 ? 91  PHE B CD1 1 
ATOM   3636 C CD2 . PHE B 1 91  ? -10.023 -18.555 0.686   1.00 14.18 ? 91  PHE B CD2 1 
ATOM   3637 C CE1 . PHE B 1 91  ? -11.415 -19.874 -1.311  1.00 15.56 ? 91  PHE B CE1 1 
ATOM   3638 C CE2 . PHE B 1 91  ? -9.938  -18.115 -0.632  1.00 15.64 ? 91  PHE B CE2 1 
ATOM   3639 C CZ  . PHE B 1 91  ? -10.636 -18.776 -1.629  1.00 16.50 ? 91  PHE B CZ  1 
ATOM   3640 N N   . ARG B 1 92  ? -7.966  -21.973 1.592   1.00 16.31 ? 92  ARG B N   1 
ATOM   3641 C CA  . ARG B 1 92  ? -6.564  -21.837 1.195   1.00 18.42 ? 92  ARG B CA  1 
ATOM   3642 C C   . ARG B 1 92  ? -5.620  -21.408 2.325   1.00 18.28 ? 92  ARG B C   1 
ATOM   3643 O O   . ARG B 1 92  ? -4.827  -20.481 2.171   1.00 20.45 ? 92  ARG B O   1 
ATOM   3644 C CB  . ARG B 1 92  ? -6.454  -20.847 0.028   1.00 15.35 ? 92  ARG B CB  1 
ATOM   3645 C CG  . ARG B 1 92  ? -7.337  -21.197 -1.160  1.00 17.15 ? 92  ARG B CG  1 
ATOM   3646 C CD  . ARG B 1 92  ? -7.024  -20.354 -2.399  1.00 15.54 ? 92  ARG B CD  1 
ATOM   3647 N NE  . ARG B 1 92  ? -5.829  -20.791 -3.121  1.00 15.69 ? 92  ARG B NE  1 
ATOM   3648 C CZ  . ARG B 1 92  ? -5.368  -20.205 -4.229  1.00 17.26 ? 92  ARG B CZ  1 
ATOM   3649 N NH1 . ARG B 1 92  ? -5.997  -19.156 -4.745  1.00 20.56 ? 92  ARG B NH1 1 
ATOM   3650 N NH2 . ARG B 1 92  ? -4.278  -20.661 -4.831  1.00 12.07 ? 92  ARG B NH2 1 
ATOM   3651 N N   . PRO B 1 93  ? -5.666  -22.111 3.462   1.00 20.15 ? 93  PRO B N   1 
ATOM   3652 C CA  . PRO B 1 93  ? -4.820  -21.800 4.627   1.00 21.25 ? 93  PRO B CA  1 
ATOM   3653 C C   . PRO B 1 93  ? -3.318  -21.688 4.323   1.00 20.25 ? 93  PRO B C   1 
ATOM   3654 O O   . PRO B 1 93  ? -2.605  -20.889 4.941   1.00 16.77 ? 93  PRO B O   1 
ATOM   3655 C CB  . PRO B 1 93  ? -5.104  -22.959 5.589   1.00 23.33 ? 93  PRO B CB  1 
ATOM   3656 C CG  . PRO B 1 93  ? -6.443  -23.496 5.135   1.00 25.28 ? 93  PRO B CG  1 
ATOM   3657 C CD  . PRO B 1 93  ? -6.356  -23.399 3.641   1.00 19.01 ? 93  PRO B CD  1 
ATOM   3658 N N   . TRP B 1 94  ? -2.852  -22.501 3.379   1.00 16.33 ? 94  TRP B N   1 
ATOM   3659 C CA  . TRP B 1 94  ? -1.446  -22.531 3.001   1.00 19.44 ? 94  TRP B CA  1 
ATOM   3660 C C   . TRP B 1 94  ? -0.894  -21.172 2.589   1.00 19.15 ? 94  TRP B C   1 
ATOM   3661 O O   . TRP B 1 94  ? 0.254   -20.841 2.903   1.00 19.46 ? 94  TRP B O   1 
ATOM   3662 C CB  . TRP B 1 94  ? -1.238  -23.522 1.859   1.00 19.19 ? 94  TRP B CB  1 
ATOM   3663 C CG  . TRP B 1 94  ? -1.923  -24.813 2.099   1.00 23.64 ? 94  TRP B CG  1 
ATOM   3664 C CD1 . TRP B 1 94  ? -1.498  -25.841 2.899   1.00 21.56 ? 94  TRP B CD1 1 
ATOM   3665 C CD2 . TRP B 1 94  ? -3.199  -25.206 1.582   1.00 24.28 ? 94  TRP B CD2 1 
ATOM   3666 N NE1 . TRP B 1 94  ? -2.436  -26.845 2.911   1.00 23.45 ? 94  TRP B NE1 1 
ATOM   3667 C CE2 . TRP B 1 94  ? -3.491  -26.480 2.114   1.00 25.32 ? 94  TRP B CE2 1 
ATOM   3668 C CE3 . TRP B 1 94  ? -4.126  -24.599 0.725   1.00 23.16 ? 94  TRP B CE3 1 
ATOM   3669 C CZ2 . TRP B 1 94  ? -4.678  -27.165 1.813   1.00 28.83 ? 94  TRP B CZ2 1 
ATOM   3670 C CZ3 . TRP B 1 94  ? -5.302  -25.276 0.425   1.00 26.63 ? 94  TRP B CZ3 1 
ATOM   3671 C CH2 . TRP B 1 94  ? -5.570  -26.545 0.970   1.00 27.72 ? 94  TRP B CH2 1 
ATOM   3672 N N   . LEU B 1 95  ? -1.692  -20.388 1.874   1.00 19.57 ? 95  LEU B N   1 
ATOM   3673 C CA  . LEU B 1 95  ? -1.216  -19.079 1.455   1.00 19.92 ? 95  LEU B CA  1 
ATOM   3674 C C   . LEU B 1 95  ? -0.984  -18.165 2.656   1.00 18.21 ? 95  LEU B C   1 
ATOM   3675 O O   . LEU B 1 95  ? -0.046  -17.379 2.653   1.00 19.39 ? 95  LEU B O   1 
ATOM   3676 C CB  . LEU B 1 95  ? -2.195  -18.442 0.474   1.00 20.93 ? 95  LEU B CB  1 
ATOM   3677 C CG  . LEU B 1 95  ? -2.324  -19.186 -0.857  1.00 23.94 ? 95  LEU B CG  1 
ATOM   3678 C CD1 . LEU B 1 95  ? -3.220  -18.380 -1.789  1.00 21.21 ? 95  LEU B CD1 1 
ATOM   3679 C CD2 . LEU B 1 95  ? -0.945  -19.387 -1.480  1.00 21.56 ? 95  LEU B CD2 1 
ATOM   3680 N N   . ASN B 1 96  ? -1.823  -18.288 3.684   1.00 15.23 ? 96  ASN B N   1 
ATOM   3681 C CA  . ASN B 1 96  ? -1.682  -17.475 4.891   1.00 16.26 ? 96  ASN B CA  1 
ATOM   3682 C C   . ASN B 1 96  ? -0.449  -17.878 5.699   1.00 19.20 ? 96  ASN B C   1 
ATOM   3683 O O   . ASN B 1 96  ? 0.232   -17.017 6.264   1.00 21.12 ? 96  ASN B O   1 
ATOM   3684 C CB  . ASN B 1 96  ? -2.920  -17.612 5.773   1.00 17.33 ? 96  ASN B CB  1 
ATOM   3685 C CG  . ASN B 1 96  ? -4.181  -17.135 5.087   1.00 15.82 ? 96  ASN B CG  1 
ATOM   3686 O OD1 . ASN B 1 96  ? -4.615  -15.995 5.272   1.00 19.54 ? 96  ASN B OD1 1 
ATOM   3687 N ND2 . ASN B 1 96  ? -4.769  -17.998 4.281   1.00 10.63 ? 96  ASN B ND2 1 
ATOM   3688 N N   . MET B 1 97  ? -0.174  -19.181 5.763   1.00 15.80 ? 97  MET B N   1 
ATOM   3689 C CA  . MET B 1 97  ? 0.975   -19.679 6.510   1.00 18.09 ? 97  MET B CA  1 
ATOM   3690 C C   . MET B 1 97  ? 2.260   -19.164 5.867   1.00 18.04 ? 97  MET B C   1 
ATOM   3691 O O   . MET B 1 97  ? 3.249   -18.863 6.541   1.00 15.87 ? 97  MET B O   1 
ATOM   3692 C CB  . MET B 1 97  ? 0.988   -21.213 6.526   1.00 15.99 ? 97  MET B CB  1 
ATOM   3693 C CG  . MET B 1 97  ? -0.176  -21.855 7.253   1.00 19.49 ? 97  MET B CG  1 
ATOM   3694 S SD  . MET B 1 97  ? -0.281  -21.429 9.012   1.00 22.53 ? 97  MET B SD  1 
ATOM   3695 C CE  . MET B 1 97  ? -1.530  -20.120 8.983   1.00 22.67 ? 97  MET B CE  1 
ATOM   3696 N N   . ASP B 1 98  ? 2.243   -19.067 4.549   1.00 17.76 ? 98  ASP B N   1 
ATOM   3697 C CA  . ASP B 1 98  ? 3.408   -18.577 3.839   1.00 23.35 ? 98  ASP B CA  1 
ATOM   3698 C C   . ASP B 1 98  ? 3.619   -17.084 4.067   1.00 19.26 ? 98  ASP B C   1 
ATOM   3699 O O   . ASP B 1 98  ? 4.730   -16.627 4.319   1.00 22.11 ? 98  ASP B O   1 
ATOM   3700 C CB  . ASP B 1 98  ? 3.263   -18.846 2.346   1.00 27.22 ? 98  ASP B CB  1 
ATOM   3701 C CG  . ASP B 1 98  ? 4.284   -19.827 1.848   1.00 38.06 ? 98  ASP B CG  1 
ATOM   3702 O OD1 . ASP B 1 98  ? 3.911   -20.995 1.584   1.00 39.22 ? 98  ASP B OD1 1 
ATOM   3703 O OD2 . ASP B 1 98  ? 5.468   -19.424 1.743   1.00 43.37 ? 98  ASP B OD2 1 
ATOM   3704 N N   . ARG B 1 99  ? 2.535   -16.332 3.972   1.00 14.01 ? 99  ARG B N   1 
ATOM   3705 C CA  . ARG B 1 99  ? 2.591   -14.905 4.157   1.00 13.84 ? 99  ARG B CA  1 
ATOM   3706 C C   . ARG B 1 99  ? 3.085   -14.597 5.567   1.00 11.74 ? 99  ARG B C   1 
ATOM   3707 O O   . ARG B 1 99  ? 3.902   -13.701 5.771   1.00 12.19 ? 99  ARG B O   1 
ATOM   3708 C CB  . ARG B 1 99  ? 1.202   -14.312 3.921   1.00 16.15 ? 99  ARG B CB  1 
ATOM   3709 C CG  . ARG B 1 99  ? 1.199   -12.818 3.651   1.00 14.55 ? 99  ARG B CG  1 
ATOM   3710 C CD  . ARG B 1 99  ? -0.114  -12.403 3.004   1.00 18.67 ? 99  ARG B CD  1 
ATOM   3711 N NE  . ARG B 1 99  ? -1.270  -12.577 3.887   1.00 18.37 ? 99  ARG B NE  1 
ATOM   3712 C CZ  . ARG B 1 99  ? -2.524  -12.370 3.507   1.00 15.33 ? 99  ARG B CZ  1 
ATOM   3713 N NH1 . ARG B 1 99  ? -2.774  -11.988 2.263   1.00 12.34 ? 99  ARG B NH1 1 
ATOM   3714 N NH2 . ARG B 1 99  ? -3.520  -12.530 4.368   1.00 13.08 ? 99  ARG B NH2 1 
ATOM   3715 N N   . MET B 1 100 ? 2.597   -15.359 6.535   1.00 12.80 ? 100 MET B N   1 
ATOM   3716 C CA  . MET B 1 100 ? 2.997   -15.163 7.916   1.00 13.54 ? 100 MET B CA  1 
ATOM   3717 C C   . MET B 1 100 ? 4.485   -15.441 8.114   1.00 16.97 ? 100 MET B C   1 
ATOM   3718 O O   . MET B 1 100 ? 5.171   -14.711 8.832   1.00 15.73 ? 100 MET B O   1 
ATOM   3719 C CB  . MET B 1 100 ? 2.187   -16.070 8.822   1.00 11.63 ? 100 MET B CB  1 
ATOM   3720 C CG  . MET B 1 100 ? 2.328   -15.728 10.284  1.00 17.21 ? 100 MET B CG  1 
ATOM   3721 S SD  . MET B 1 100 ? 1.260   -16.713 11.330  1.00 16.99 ? 100 MET B SD  1 
ATOM   3722 C CE  . MET B 1 100 ? 1.675   -16.002 12.910  1.00 23.71 ? 100 MET B CE  1 
ATOM   3723 N N   . LEU B 1 101 ? 4.993   -16.492 7.477   1.00 18.00 ? 101 LEU B N   1 
ATOM   3724 C CA  . LEU B 1 101 ? 6.405   -16.806 7.625   1.00 20.74 ? 101 LEU B CA  1 
ATOM   3725 C C   . LEU B 1 101 ? 7.250   -15.659 7.074   1.00 22.30 ? 101 LEU B C   1 
ATOM   3726 O O   . LEU B 1 101 ? 8.237   -15.249 7.688   1.00 24.53 ? 101 LEU B O   1 
ATOM   3727 C CB  . LEU B 1 101 ? 6.757   -18.114 6.912   1.00 20.26 ? 101 LEU B CB  1 
ATOM   3728 C CG  . LEU B 1 101 ? 8.162   -18.669 7.208   1.00 20.95 ? 101 LEU B CG  1 
ATOM   3729 C CD1 . LEU B 1 101 ? 8.314   -18.950 8.712   1.00 18.91 ? 101 LEU B CD1 1 
ATOM   3730 C CD2 . LEU B 1 101 ? 8.396   -19.950 6.402   1.00 19.97 ? 101 LEU B CD2 1 
ATOM   3731 N N   . ARG B 1 102 ? 6.857   -15.127 5.925   1.00 19.29 ? 102 ARG B N   1 
ATOM   3732 C CA  . ARG B 1 102 ? 7.599   -14.030 5.339   1.00 20.71 ? 102 ARG B CA  1 
ATOM   3733 C C   . ARG B 1 102 ? 7.596   -12.794 6.247   1.00 20.96 ? 102 ARG B C   1 
ATOM   3734 O O   . ARG B 1 102 ? 8.633   -12.154 6.434   1.00 21.62 ? 102 ARG B O   1 
ATOM   3735 C CB  . ARG B 1 102 ? 7.035   -13.690 3.955   1.00 24.74 ? 102 ARG B CB  1 
ATOM   3736 C CG  . ARG B 1 102 ? 7.447   -14.688 2.876   1.00 32.40 ? 102 ARG B CG  1 
ATOM   3737 C CD  . ARG B 1 102 ? 7.059   -14.232 1.477   1.00 40.25 ? 102 ARG B CD  1 
ATOM   3738 N NE  . ARG B 1 102 ? 5.634   -14.409 1.211   1.00 49.89 ? 102 ARG B NE  1 
ATOM   3739 C CZ  . ARG B 1 102 ? 4.801   -13.425 0.878   1.00 52.50 ? 102 ARG B CZ  1 
ATOM   3740 N NH1 . ARG B 1 102 ? 5.246   -12.172 0.769   1.00 52.02 ? 102 ARG B NH1 1 
ATOM   3741 N NH2 . ARG B 1 102 ? 3.520   -13.698 0.645   1.00 51.55 ? 102 ARG B NH2 1 
ATOM   3742 N N   . SER B 1 103 ? 6.436   -12.460 6.811   1.00 19.41 ? 103 SER B N   1 
ATOM   3743 C CA  . SER B 1 103 ? 6.324   -11.303 7.698   1.00 20.57 ? 103 SER B CA  1 
ATOM   3744 C C   . SER B 1 103 ? 7.226   -11.497 8.914   1.00 20.15 ? 103 SER B C   1 
ATOM   3745 O O   . SER B 1 103 ? 7.899   -10.571 9.355   1.00 22.70 ? 103 SER B O   1 
ATOM   3746 C CB  . SER B 1 103 ? 4.879   -11.124 8.169   1.00 21.43 ? 103 SER B CB  1 
ATOM   3747 O OG  . SER B 1 103 ? 4.006   -10.929 7.075   1.00 22.21 ? 103 SER B OG  1 
ATOM   3748 N N   . ALA B 1 104 ? 7.243   -12.714 9.448   1.00 20.01 ? 104 ALA B N   1 
ATOM   3749 C CA  . ALA B 1 104 ? 8.072   -13.021 10.610  1.00 19.23 ? 104 ALA B CA  1 
ATOM   3750 C C   . ALA B 1 104 ? 9.538   -12.728 10.302  1.00 20.77 ? 104 ALA B C   1 
ATOM   3751 O O   . ALA B 1 104 ? 10.234  -12.053 11.074  1.00 19.92 ? 104 ALA B O   1 
ATOM   3752 C CB  . ALA B 1 104 ? 7.903   -14.479 11.002  1.00 12.60 ? 104 ALA B CB  1 
ATOM   3753 N N   . MET B 1 105 ? 9.995   -13.221 9.156   1.00 18.73 ? 105 MET B N   1 
ATOM   3754 C CA  . MET B 1 105 ? 11.378  -13.035 8.753   1.00 22.77 ? 105 MET B CA  1 
ATOM   3755 C C   . MET B 1 105 ? 11.773  -11.586 8.503   1.00 20.56 ? 105 MET B C   1 
ATOM   3756 O O   . MET B 1 105 ? 12.929  -11.218 8.701   1.00 18.85 ? 105 MET B O   1 
ATOM   3757 C CB  . MET B 1 105 ? 11.677  -13.873 7.511   1.00 27.62 ? 105 MET B CB  1 
ATOM   3758 C CG  . MET B 1 105 ? 11.447  -15.358 7.731   1.00 33.62 ? 105 MET B CG  1 
ATOM   3759 S SD  . MET B 1 105 ? 12.280  -16.331 6.487   1.00 46.41 ? 105 MET B SD  1 
ATOM   3760 C CE  . MET B 1 105 ? 11.333  -15.945 4.998   1.00 43.51 ? 105 MET B CE  1 
ATOM   3761 N N   . ARG B 1 106 ? 10.816  -10.770 8.069   1.00 20.13 ? 106 ARG B N   1 
ATOM   3762 C CA  . ARG B 1 106 ? 11.078  -9.365  7.807   1.00 18.05 ? 106 ARG B CA  1 
ATOM   3763 C C   . ARG B 1 106 ? 11.323  -8.617  9.132   1.00 15.48 ? 106 ARG B C   1 
ATOM   3764 O O   . ARG B 1 106 ? 12.068  -7.645  9.171   1.00 15.95 ? 106 ARG B O   1 
ATOM   3765 C CB  . ARG B 1 106 ? 9.893   -8.756  7.057   1.00 18.70 ? 106 ARG B CB  1 
ATOM   3766 C CG  . ARG B 1 106 ? 10.028  -7.269  6.775   1.00 22.58 ? 106 ARG B CG  1 
ATOM   3767 C CD  . ARG B 1 106 ? 10.965  -7.004  5.609   1.00 24.52 ? 106 ARG B CD  1 
ATOM   3768 N NE  . ARG B 1 106 ? 12.032  -6.061  5.941   1.00 29.44 ? 106 ARG B NE  1 
ATOM   3769 C CZ  . ARG B 1 106 ? 11.840  -4.822  6.374   1.00 28.88 ? 106 ARG B CZ  1 
ATOM   3770 N NH1 . ARG B 1 106 ? 10.612  -4.350  6.540   1.00 39.93 ? 106 ARG B NH1 1 
ATOM   3771 N NH2 . ARG B 1 106 ? 12.877  -4.048  6.644   1.00 30.23 ? 106 ARG B NH2 1 
ATOM   3772 N N   . LEU B 1 107 ? 10.701  -9.092  10.208  1.00 14.52 ? 107 LEU B N   1 
ATOM   3773 C CA  . LEU B 1 107 ? 10.841  -8.481  11.530  1.00 15.61 ? 107 LEU B CA  1 
ATOM   3774 C C   . LEU B 1 107 ? 11.857  -9.202  12.410  1.00 17.22 ? 107 LEU B C   1 
ATOM   3775 O O   . LEU B 1 107 ? 12.021  -8.865  13.586  1.00 16.13 ? 107 LEU B O   1 
ATOM   3776 C CB  . LEU B 1 107 ? 9.488   -8.458  12.253  1.00 12.35 ? 107 LEU B CB  1 
ATOM   3777 C CG  . LEU B 1 107 ? 8.440   -7.481  11.706  1.00 14.34 ? 107 LEU B CG  1 
ATOM   3778 C CD1 . LEU B 1 107 ? 7.213   -7.508  12.582  1.00 14.64 ? 107 LEU B CD1 1 
ATOM   3779 C CD2 . LEU B 1 107 ? 9.010   -6.071  11.672  1.00 12.96 ? 107 LEU B CD2 1 
ATOM   3780 N N   . CYS B 1 108 ? 12.535  -10.197 11.844  1.00 15.30 ? 108 CYS B N   1 
ATOM   3781 C CA  . CYS B 1 108 ? 13.517  -10.959 12.598  1.00 16.54 ? 108 CYS B CA  1 
ATOM   3782 C C   . CYS B 1 108 ? 12.903  -11.735 13.750  1.00 15.23 ? 108 CYS B C   1 
ATOM   3783 O O   . CYS B 1 108 ? 13.492  -11.843 14.822  1.00 16.95 ? 108 CYS B O   1 
ATOM   3784 C CB  . CYS B 1 108 ? 14.614  -10.045 13.136  1.00 21.69 ? 108 CYS B CB  1 
ATOM   3785 S SG  . CYS B 1 108 ? 15.659  -9.379  11.853  1.00 26.05 ? 108 CYS B SG  1 
ATOM   3786 N N   . LEU B 1 109 ? 11.706  -12.260 13.533  1.00 14.16 ? 109 LEU B N   1 
ATOM   3787 C CA  . LEU B 1 109 ? 11.058  -13.062 14.548  1.00 12.87 ? 109 LEU B CA  1 
ATOM   3788 C C   . LEU B 1 109 ? 11.340  -14.513 14.159  1.00 16.52 ? 109 LEU B C   1 
ATOM   3789 O O   . LEU B 1 109 ? 11.696  -14.799 13.015  1.00 18.07 ? 109 LEU B O   1 
ATOM   3790 C CB  . LEU B 1 109 ? 9.554   -12.762 14.597  1.00 14.47 ? 109 LEU B CB  1 
ATOM   3791 C CG  . LEU B 1 109 ? 9.197   -11.426 15.259  1.00 12.40 ? 109 LEU B CG  1 
ATOM   3792 C CD1 . LEU B 1 109 ? 7.691   -11.238 15.279  1.00 13.02 ? 109 LEU B CD1 1 
ATOM   3793 C CD2 . LEU B 1 109 ? 9.749   -11.403 16.688  1.00 13.66 ? 109 LEU B CD2 1 
ATOM   3794 N N   . PRO B 1 110 ? 11.189  -15.450 15.106  1.00 19.27 ? 110 PRO B N   1 
ATOM   3795 C CA  . PRO B 1 110 ? 11.442  -16.878 14.860  1.00 18.38 ? 110 PRO B CA  1 
ATOM   3796 C C   . PRO B 1 110 ? 10.651  -17.524 13.716  1.00 19.70 ? 110 PRO B C   1 
ATOM   3797 O O   . PRO B 1 110 ? 9.438   -17.343 13.599  1.00 17.55 ? 110 PRO B O   1 
ATOM   3798 C CB  . PRO B 1 110 ? 11.088  -17.532 16.197  1.00 17.67 ? 110 PRO B CB  1 
ATOM   3799 C CG  . PRO B 1 110 ? 11.125  -16.390 17.185  1.00 20.79 ? 110 PRO B CG  1 
ATOM   3800 C CD  . PRO B 1 110 ? 10.579  -15.243 16.429  1.00 17.74 ? 110 PRO B CD  1 
ATOM   3801 N N   . SER B 1 111 ? 11.332  -18.286 12.870  1.00 19.94 ? 111 SER B N   1 
ATOM   3802 C CA  . SER B 1 111 ? 10.617  -18.980 11.814  1.00 21.60 ? 111 SER B CA  1 
ATOM   3803 C C   . SER B 1 111 ? 10.050  -20.253 12.464  1.00 19.37 ? 111 SER B C   1 
ATOM   3804 O O   . SER B 1 111 ? 10.438  -20.623 13.575  1.00 17.12 ? 111 SER B O   1 
ATOM   3805 C CB  . SER B 1 111 ? 11.552  -19.316 10.644  1.00 21.88 ? 111 SER B CB  1 
ATOM   3806 O OG  . SER B 1 111 ? 12.621  -20.144 11.058  1.00 27.37 ? 111 SER B OG  1 
ATOM   3807 N N   . PHE B 1 112 ? 9.126   -20.908 11.780  1.00 21.01 ? 112 PHE B N   1 
ATOM   3808 C CA  . PHE B 1 112 ? 8.494   -22.125 12.297  1.00 21.89 ? 112 PHE B CA  1 
ATOM   3809 C C   . PHE B 1 112 ? 8.084   -22.990 11.107  1.00 22.78 ? 112 PHE B C   1 
ATOM   3810 O O   . PHE B 1 112 ? 8.343   -22.631 9.952   1.00 22.18 ? 112 PHE B O   1 
ATOM   3811 C CB  . PHE B 1 112 ? 7.258   -21.742 13.120  1.00 22.60 ? 112 PHE B CB  1 
ATOM   3812 C CG  . PHE B 1 112 ? 6.343   -20.793 12.401  1.00 21.69 ? 112 PHE B CG  1 
ATOM   3813 C CD1 . PHE B 1 112 ? 5.418   -21.266 11.472  1.00 22.45 ? 112 PHE B CD1 1 
ATOM   3814 C CD2 . PHE B 1 112 ? 6.485   -19.422 12.568  1.00 17.39 ? 112 PHE B CD2 1 
ATOM   3815 C CE1 . PHE B 1 112 ? 4.651   -20.385 10.710  1.00 19.63 ? 112 PHE B CE1 1 
ATOM   3816 C CE2 . PHE B 1 112 ? 5.725   -18.529 11.812  1.00 21.39 ? 112 PHE B CE2 1 
ATOM   3817 C CZ  . PHE B 1 112 ? 4.804   -19.014 10.877  1.00 22.74 ? 112 PHE B CZ  1 
ATOM   3818 N N   . ASP B 1 113 ? 7.449   -24.127 11.377  1.00 24.96 ? 113 ASP B N   1 
ATOM   3819 C CA  . ASP B 1 113 ? 7.030   -24.997 10.286  1.00 23.16 ? 113 ASP B CA  1 
ATOM   3820 C C   . ASP B 1 113 ? 5.583   -24.677 9.918   1.00 23.61 ? 113 ASP B C   1 
ATOM   3821 O O   . ASP B 1 113 ? 4.680   -24.794 10.746  1.00 22.18 ? 113 ASP B O   1 
ATOM   3822 C CB  . ASP B 1 113 ? 7.167   -26.462 10.685  1.00 25.28 ? 113 ASP B CB  1 
ATOM   3823 C CG  . ASP B 1 113 ? 7.150   -27.390 9.488   1.00 26.01 ? 113 ASP B CG  1 
ATOM   3824 O OD1 . ASP B 1 113 ? 6.187   -27.326 8.697   1.00 28.13 ? 113 ASP B OD1 1 
ATOM   3825 O OD2 . ASP B 1 113 ? 8.105   -28.181 9.334   1.00 29.16 ? 113 ASP B OD2 1 
ATOM   3826 N N   . LYS B 1 114 ? 5.382   -24.269 8.668   1.00 21.76 ? 114 LYS B N   1 
ATOM   3827 C CA  . LYS B 1 114 ? 4.069   -23.890 8.156   1.00 22.34 ? 114 LYS B CA  1 
ATOM   3828 C C   . LYS B 1 114 ? 2.969   -24.928 8.339   1.00 22.37 ? 114 LYS B C   1 
ATOM   3829 O O   . LYS B 1 114 ? 1.836   -24.587 8.694   1.00 22.07 ? 114 LYS B O   1 
ATOM   3830 C CB  . LYS B 1 114 ? 4.192   -23.508 6.678   1.00 19.80 ? 114 LYS B CB  1 
ATOM   3831 C CG  . LYS B 1 114 ? 5.080   -22.290 6.484   1.00 27.23 ? 114 LYS B CG  1 
ATOM   3832 C CD  . LYS B 1 114 ? 5.050   -21.755 5.068   1.00 34.52 ? 114 LYS B CD  1 
ATOM   3833 C CE  . LYS B 1 114 ? 5.923   -22.571 4.139   1.00 36.38 ? 114 LYS B CE  1 
ATOM   3834 N NZ  . LYS B 1 114 ? 5.907   -21.996 2.767   1.00 41.83 ? 114 LYS B NZ  1 
ATOM   3835 N N   . LEU B 1 115 ? 3.298   -26.192 8.106   1.00 21.87 ? 115 LEU B N   1 
ATOM   3836 C CA  . LEU B 1 115 ? 2.320   -27.266 8.241   1.00 20.25 ? 115 LEU B CA  1 
ATOM   3837 C C   . LEU B 1 115 ? 2.058   -27.635 9.696   1.00 19.63 ? 115 LEU B C   1 
ATOM   3838 O O   . LEU B 1 115 ? 0.951   -28.015 10.041  1.00 22.20 ? 115 LEU B O   1 
ATOM   3839 C CB  . LEU B 1 115 ? 2.773   -28.499 7.454   1.00 20.13 ? 115 LEU B CB  1 
ATOM   3840 C CG  . LEU B 1 115 ? 2.975   -28.277 5.949   1.00 26.61 ? 115 LEU B CG  1 
ATOM   3841 C CD1 . LEU B 1 115 ? 3.460   -29.566 5.303   1.00 25.43 ? 115 LEU B CD1 1 
ATOM   3842 C CD2 . LEU B 1 115 ? 1.672   -27.817 5.307   1.00 24.43 ? 115 LEU B CD2 1 
ATOM   3843 N N   . GLU B 1 116 ? 3.068   -27.538 10.553  1.00 18.32 ? 116 GLU B N   1 
ATOM   3844 C CA  . GLU B 1 116 ? 2.863   -27.836 11.967  1.00 19.85 ? 116 GLU B CA  1 
ATOM   3845 C C   . GLU B 1 116 ? 1.883   -26.807 12.540  1.00 20.65 ? 116 GLU B C   1 
ATOM   3846 O O   . GLU B 1 116 ? 0.939   -27.152 13.263  1.00 22.92 ? 116 GLU B O   1 
ATOM   3847 C CB  . GLU B 1 116 ? 4.180   -27.755 12.742  1.00 21.05 ? 116 GLU B CB  1 
ATOM   3848 C CG  . GLU B 1 116 ? 5.185   -28.837 12.395  1.00 25.21 ? 116 GLU B CG  1 
ATOM   3849 C CD  . GLU B 1 116 ? 4.659   -30.236 12.661  1.00 26.70 ? 116 GLU B CD  1 
ATOM   3850 O OE1 . GLU B 1 116 ? 3.981   -30.440 13.690  1.00 31.06 ? 116 GLU B OE1 1 
ATOM   3851 O OE2 . GLU B 1 116 ? 4.939   -31.140 11.847  1.00 32.22 ? 116 GLU B OE2 1 
ATOM   3852 N N   . LEU B 1 117 ? 2.119   -25.537 12.218  1.00 18.36 ? 117 LEU B N   1 
ATOM   3853 C CA  . LEU B 1 117 ? 1.254   -24.469 12.682  1.00 19.91 ? 117 LEU B CA  1 
ATOM   3854 C C   . LEU B 1 117 ? -0.169  -24.699 12.179  1.00 19.88 ? 117 LEU B C   1 
ATOM   3855 O O   . LEU B 1 117 ? -1.134  -24.551 12.928  1.00 16.81 ? 117 LEU B O   1 
ATOM   3856 C CB  . LEU B 1 117 ? 1.756   -23.105 12.182  1.00 14.82 ? 117 LEU B CB  1 
ATOM   3857 C CG  . LEU B 1 117 ? 0.848   -21.931 12.589  1.00 18.08 ? 117 LEU B CG  1 
ATOM   3858 C CD1 . LEU B 1 117 ? 0.678   -21.908 14.108  1.00 14.19 ? 117 LEU B CD1 1 
ATOM   3859 C CD2 . LEU B 1 117 ? 1.428   -20.610 12.087  1.00 16.71 ? 117 LEU B CD2 1 
ATOM   3860 N N   . LEU B 1 118 ? -0.291  -25.064 10.907  1.00 20.44 ? 118 LEU B N   1 
ATOM   3861 C CA  . LEU B 1 118 ? -1.599  -25.300 10.316  1.00 23.17 ? 118 LEU B CA  1 
ATOM   3862 C C   . LEU B 1 118 ? -2.349  -26.379 11.095  1.00 25.02 ? 118 LEU B C   1 
ATOM   3863 O O   . LEU B 1 118 ? -3.533  -26.207 11.418  1.00 24.30 ? 118 LEU B O   1 
ATOM   3864 C CB  . LEU B 1 118 ? -1.452  -25.699 8.846   1.00 23.20 ? 118 LEU B CB  1 
ATOM   3865 C CG  . LEU B 1 118 ? -2.739  -25.979 8.055   1.00 26.54 ? 118 LEU B CG  1 
ATOM   3866 C CD1 . LEU B 1 118 ? -3.836  -24.955 8.390   1.00 20.46 ? 118 LEU B CD1 1 
ATOM   3867 C CD2 . LEU B 1 118 ? -2.403  -25.957 6.564   1.00 23.48 ? 118 LEU B CD2 1 
ATOM   3868 N N   . GLU B 1 119 ? -1.654  -27.475 11.407  1.00 22.21 ? 119 GLU B N   1 
ATOM   3869 C CA  . GLU B 1 119 ? -2.249  -28.577 12.168  1.00 22.07 ? 119 GLU B CA  1 
ATOM   3870 C C   . GLU B 1 119 ? -2.731  -28.100 13.538  1.00 20.62 ? 119 GLU B C   1 
ATOM   3871 O O   . GLU B 1 119 ? -3.822  -28.464 13.977  1.00 17.17 ? 119 GLU B O   1 
ATOM   3872 C CB  . GLU B 1 119 ? -1.241  -29.716 12.357  1.00 20.69 ? 119 GLU B CB  1 
ATOM   3873 C CG  . GLU B 1 119 ? -1.722  -31.054 11.822  1.00 29.47 ? 119 GLU B CG  1 
ATOM   3874 C CD  . GLU B 1 119 ? -2.981  -31.566 12.508  1.00 31.71 ? 119 GLU B CD  1 
ATOM   3875 O OE1 . GLU B 1 119 ? -2.899  -32.030 13.665  1.00 34.77 ? 119 GLU B OE1 1 
ATOM   3876 O OE2 . GLU B 1 119 ? -4.060  -31.502 11.884  1.00 33.69 ? 119 GLU B OE2 1 
ATOM   3877 N N   . CYS B 1 120 ? -1.913  -27.290 14.207  1.00 19.00 ? 120 CYS B N   1 
ATOM   3878 C CA  . CYS B 1 120 ? -2.270  -26.767 15.522  1.00 19.21 ? 120 CYS B CA  1 
ATOM   3879 C C   . CYS B 1 120 ? -3.523  -25.924 15.440  1.00 17.54 ? 120 CYS B C   1 
ATOM   3880 O O   . CYS B 1 120 ? -4.368  -25.991 16.326  1.00 17.61 ? 120 CYS B O   1 
ATOM   3881 C CB  . CYS B 1 120 ? -1.132  -25.924 16.101  1.00 22.38 ? 120 CYS B CB  1 
ATOM   3882 S SG  . CYS B 1 120 ? 0.329   -26.856 16.624  1.00 25.18 ? 120 CYS B SG  1 
ATOM   3883 N N   . ILE B 1 121 ? -3.644  -25.129 14.377  1.00 17.72 ? 121 ILE B N   1 
ATOM   3884 C CA  . ILE B 1 121 ? -4.818  -24.277 14.193  1.00 15.03 ? 121 ILE B CA  1 
ATOM   3885 C C   . ILE B 1 121 ? -6.048  -25.147 13.942  1.00 17.00 ? 121 ILE B C   1 
ATOM   3886 O O   . ILE B 1 121 ? -7.139  -24.850 14.426  1.00 17.45 ? 121 ILE B O   1 
ATOM   3887 C CB  . ILE B 1 121 ? -4.599  -23.289 13.026  1.00 15.44 ? 121 ILE B CB  1 
ATOM   3888 C CG1 . ILE B 1 121 ? -3.525  -22.272 13.426  1.00 15.79 ? 121 ILE B CG1 1 
ATOM   3889 C CG2 . ILE B 1 121 ? -5.898  -22.583 12.660  1.00 15.40 ? 121 ILE B CG2 1 
ATOM   3890 C CD1 . ILE B 1 121 ? -3.105  -21.343 12.316  1.00 13.78 ? 121 ILE B CD1 1 
ATOM   3891 N N   . ARG B 1 122 ? -5.867  -26.235 13.204  1.00 15.77 ? 122 ARG B N   1 
ATOM   3892 C CA  . ARG B 1 122 ? -6.971  -27.142 12.927  1.00 18.88 ? 122 ARG B CA  1 
ATOM   3893 C C   . ARG B 1 122 ? -7.484  -27.754 14.243  1.00 21.02 ? 122 ARG B C   1 
ATOM   3894 O O   . ARG B 1 122 ? -8.689  -27.888 14.442  1.00 22.10 ? 122 ARG B O   1 
ATOM   3895 C CB  . ARG B 1 122 ? -6.530  -28.254 11.963  1.00 17.53 ? 122 ARG B CB  1 
ATOM   3896 C CG  . ARG B 1 122 ? -7.695  -29.049 11.394  1.00 19.60 ? 122 ARG B CG  1 
ATOM   3897 C CD  . ARG B 1 122 ? -7.227  -30.273 10.619  1.00 26.56 ? 122 ARG B CD  1 
ATOM   3898 N NE  . ARG B 1 122 ? -6.489  -31.185 11.483  1.00 27.88 ? 122 ARG B NE  1 
ATOM   3899 C CZ  . ARG B 1 122 ? -7.023  -31.847 12.506  1.00 29.47 ? 122 ARG B CZ  1 
ATOM   3900 N NH1 . ARG B 1 122 ? -8.313  -31.714 12.796  1.00 26.05 ? 122 ARG B NH1 1 
ATOM   3901 N NH2 . ARG B 1 122 ? -6.252  -32.615 13.265  1.00 29.78 ? 122 ARG B NH2 1 
ATOM   3902 N N   . ARG B 1 123 ? -6.568  -28.117 15.138  1.00 21.97 ? 123 ARG B N   1 
ATOM   3903 C CA  . ARG B 1 123 ? -6.944  -28.695 16.428  1.00 23.03 ? 123 ARG B CA  1 
ATOM   3904 C C   . ARG B 1 123 ? -7.722  -27.661 17.248  1.00 22.22 ? 123 ARG B C   1 
ATOM   3905 O O   . ARG B 1 123 ? -8.718  -27.995 17.886  1.00 25.37 ? 123 ARG B O   1 
ATOM   3906 C CB  . ARG B 1 123 ? -5.699  -29.137 17.211  1.00 24.38 ? 123 ARG B CB  1 
ATOM   3907 C CG  . ARG B 1 123 ? -4.807  -30.126 16.478  1.00 29.51 ? 123 ARG B CG  1 
ATOM   3908 C CD  . ARG B 1 123 ? -5.424  -31.525 16.368  1.00 34.21 ? 123 ARG B CD  1 
ATOM   3909 N NE  . ARG B 1 123 ? -5.151  -32.355 17.540  1.00 38.28 ? 123 ARG B NE  1 
ATOM   3910 C CZ  . ARG B 1 123 ? -5.743  -32.213 18.723  1.00 39.65 ? 123 ARG B CZ  1 
ATOM   3911 N NH1 . ARG B 1 123 ? -6.660  -31.271 18.905  1.00 43.30 ? 123 ARG B NH1 1 
ATOM   3912 N NH2 . ARG B 1 123 ? -5.406  -33.009 19.728  1.00 36.92 ? 123 ARG B NH2 1 
ATOM   3913 N N   . LEU B 1 124 ? -7.274  -26.405 17.230  1.00 18.07 ? 124 LEU B N   1 
ATOM   3914 C CA  . LEU B 1 124 ? -7.965  -25.349 17.976  1.00 17.66 ? 124 LEU B CA  1 
ATOM   3915 C C   . LEU B 1 124 ? -9.401  -25.210 17.473  1.00 15.81 ? 124 LEU B C   1 
ATOM   3916 O O   . LEU B 1 124 ? -10.353 -25.221 18.263  1.00 13.88 ? 124 LEU B O   1 
ATOM   3917 C CB  . LEU B 1 124 ? -7.240  -23.991 17.834  1.00 17.10 ? 124 LEU B CB  1 
ATOM   3918 C CG  . LEU B 1 124 ? -7.887  -22.750 18.485  1.00 12.52 ? 124 LEU B CG  1 
ATOM   3919 C CD1 . LEU B 1 124 ? -7.857  -22.876 19.995  1.00 17.32 ? 124 LEU B CD1 1 
ATOM   3920 C CD2 . LEU B 1 124 ? -7.151  -21.494 18.102  1.00 8.46  ? 124 LEU B CD2 1 
ATOM   3921 N N   . ILE B 1 125 ? -9.562  -25.080 16.161  1.00 13.14 ? 125 ILE B N   1 
ATOM   3922 C CA  . ILE B 1 125 ? -10.902 -24.944 15.616  1.00 15.86 ? 125 ILE B CA  1 
ATOM   3923 C C   . ILE B 1 125 ? -11.697 -26.207 15.964  1.00 18.19 ? 125 ILE B C   1 
ATOM   3924 O O   . ILE B 1 125 ? -12.903 -26.151 16.231  1.00 16.96 ? 125 ILE B O   1 
ATOM   3925 C CB  . ILE B 1 125 ? -10.876 -24.726 14.082  1.00 12.64 ? 125 ILE B CB  1 
ATOM   3926 C CG1 . ILE B 1 125 ? -10.073 -23.459 13.752  1.00 14.67 ? 125 ILE B CG1 1 
ATOM   3927 C CG2 . ILE B 1 125 ? -12.296 -24.582 13.552  1.00 9.84  ? 125 ILE B CG2 1 
ATOM   3928 C CD1 . ILE B 1 125 ? -9.862  -23.212 12.249  1.00 10.65 ? 125 ILE B CD1 1 
ATOM   3929 N N   . GLU B 1 126 ? -11.013 -27.343 15.994  1.00 20.10 ? 126 GLU B N   1 
ATOM   3930 C CA  . GLU B 1 126 ? -11.692 -28.586 16.315  1.00 24.35 ? 126 GLU B CA  1 
ATOM   3931 C C   . GLU B 1 126 ? -12.293 -28.483 17.710  1.00 25.37 ? 126 GLU B C   1 
ATOM   3932 O O   . GLU B 1 126 ? -13.472 -28.779 17.912  1.00 29.85 ? 126 GLU B O   1 
ATOM   3933 C CB  . GLU B 1 126 ? -10.728 -29.764 16.239  1.00 25.17 ? 126 GLU B CB  1 
ATOM   3934 C CG  . GLU B 1 126 ? -11.427 -31.110 16.275  1.00 30.90 ? 126 GLU B CG  1 
ATOM   3935 C CD  . GLU B 1 126 ? -10.478 -32.259 16.010  1.00 35.72 ? 126 GLU B CD  1 
ATOM   3936 O OE1 . GLU B 1 126 ? -9.532  -32.442 16.811  1.00 37.95 ? 126 GLU B OE1 1 
ATOM   3937 O OE2 . GLU B 1 126 ? -10.676 -32.972 14.998  1.00 39.31 ? 126 GLU B OE2 1 
ATOM   3938 N N   . VAL B 1 127 ? -11.485 -28.046 18.668  1.00 23.59 ? 127 VAL B N   1 
ATOM   3939 C CA  . VAL B 1 127 ? -11.950 -27.886 20.038  1.00 22.50 ? 127 VAL B CA  1 
ATOM   3940 C C   . VAL B 1 127 ? -13.156 -26.949 20.144  1.00 21.96 ? 127 VAL B C   1 
ATOM   3941 O O   . VAL B 1 127 ? -14.118 -27.250 20.845  1.00 20.16 ? 127 VAL B O   1 
ATOM   3942 C CB  . VAL B 1 127 ? -10.823 -27.356 20.935  1.00 22.41 ? 127 VAL B CB  1 
ATOM   3943 C CG1 . VAL B 1 127 ? -11.366 -26.995 22.308  1.00 19.48 ? 127 VAL B CG1 1 
ATOM   3944 C CG2 . VAL B 1 127 ? -9.738  -28.407 21.044  1.00 21.94 ? 127 VAL B CG2 1 
ATOM   3945 N N   . ASP B 1 128 ? -13.111 -25.811 19.462  1.00 23.73 ? 128 ASP B N   1 
ATOM   3946 C CA  . ASP B 1 128 ? -14.242 -24.890 19.516  1.00 23.99 ? 128 ASP B CA  1 
ATOM   3947 C C   . ASP B 1 128 ? -15.146 -25.042 18.294  1.00 21.99 ? 128 ASP B C   1 
ATOM   3948 O O   . ASP B 1 128 ? -15.773 -24.084 17.859  1.00 21.86 ? 128 ASP B O   1 
ATOM   3949 C CB  . ASP B 1 128 ? -13.763 -23.434 19.625  1.00 22.34 ? 128 ASP B CB  1 
ATOM   3950 C CG  . ASP B 1 128 ? -13.206 -23.095 20.999  1.00 23.12 ? 128 ASP B CG  1 
ATOM   3951 O OD1 . ASP B 1 128 ? -13.425 -23.879 21.946  1.00 23.79 ? 128 ASP B OD1 1 
ATOM   3952 O OD2 . ASP B 1 128 ? -12.559 -22.033 21.138  1.00 21.78 ? 128 ASP B OD2 1 
ATOM   3953 N N   . LYS B 1 129 ? -15.223 -26.253 17.755  1.00 23.01 ? 129 LYS B N   1 
ATOM   3954 C CA  . LYS B 1 129 ? -16.041 -26.526 16.575  1.00 25.53 ? 129 LYS B CA  1 
ATOM   3955 C C   . LYS B 1 129 ? -17.483 -25.997 16.671  1.00 24.35 ? 129 LYS B C   1 
ATOM   3956 O O   . LYS B 1 129 ? -18.073 -25.587 15.667  1.00 24.92 ? 129 LYS B O   1 
ATOM   3957 C CB  . LYS B 1 129 ? -16.052 -28.034 16.308  1.00 30.42 ? 129 LYS B CB  1 
ATOM   3958 C CG  . LYS B 1 129 ? -16.671 -28.431 14.977  1.00 40.14 ? 129 LYS B CG  1 
ATOM   3959 C CD  . LYS B 1 129 ? -16.575 -29.938 14.763  1.00 46.88 ? 129 LYS B CD  1 
ATOM   3960 C CE  . LYS B 1 129 ? -17.113 -30.349 13.395  1.00 50.11 ? 129 LYS B CE  1 
ATOM   3961 N NZ  . LYS B 1 129 ? -17.194 -31.835 13.277  1.00 49.21 ? 129 LYS B NZ  1 
ATOM   3962 N N   . ASP B 1 130 ? -18.042 -26.008 17.878  1.00 21.05 ? 130 ASP B N   1 
ATOM   3963 C CA  . ASP B 1 130 ? -19.405 -25.536 18.114  1.00 25.11 ? 130 ASP B CA  1 
ATOM   3964 C C   . ASP B 1 130 ? -19.609 -24.038 17.944  1.00 24.53 ? 130 ASP B C   1 
ATOM   3965 O O   . ASP B 1 130 ? -20.743 -23.585 17.798  1.00 24.03 ? 130 ASP B O   1 
ATOM   3966 C CB  . ASP B 1 130 ? -19.875 -25.896 19.531  1.00 32.12 ? 130 ASP B CB  1 
ATOM   3967 C CG  . ASP B 1 130 ? -20.414 -27.307 19.638  1.00 37.28 ? 130 ASP B CG  1 
ATOM   3968 O OD1 . ASP B 1 130 ? -20.976 -27.622 20.711  1.00 44.88 ? 130 ASP B OD1 1 
ATOM   3969 O OD2 . ASP B 1 130 ? -20.278 -28.099 18.673  1.00 39.45 ? 130 ASP B OD2 1 
ATOM   3970 N N   . TRP B 1 131 ? -18.528 -23.266 17.996  1.00 22.78 ? 131 TRP B N   1 
ATOM   3971 C CA  . TRP B 1 131 ? -18.637 -21.827 17.861  1.00 17.99 ? 131 TRP B CA  1 
ATOM   3972 C C   . TRP B 1 131 ? -18.862 -21.380 16.435  1.00 19.13 ? 131 TRP B C   1 
ATOM   3973 O O   . TRP B 1 131 ? -19.341 -20.267 16.200  1.00 18.25 ? 131 TRP B O   1 
ATOM   3974 C CB  . TRP B 1 131 ? -17.390 -21.143 18.398  1.00 19.82 ? 131 TRP B CB  1 
ATOM   3975 C CG  . TRP B 1 131 ? -17.337 -21.091 19.874  1.00 20.47 ? 131 TRP B CG  1 
ATOM   3976 C CD1 . TRP B 1 131 ? -16.820 -22.038 20.714  1.00 16.51 ? 131 TRP B CD1 1 
ATOM   3977 C CD2 . TRP B 1 131 ? -17.799 -20.019 20.706  1.00 21.29 ? 131 TRP B CD2 1 
ATOM   3978 N NE1 . TRP B 1 131 ? -16.928 -21.618 22.017  1.00 18.52 ? 131 TRP B NE1 1 
ATOM   3979 C CE2 . TRP B 1 131 ? -17.527 -20.383 22.043  1.00 23.18 ? 131 TRP B CE2 1 
ATOM   3980 C CE3 . TRP B 1 131 ? -18.423 -18.788 20.452  1.00 25.25 ? 131 TRP B CE3 1 
ATOM   3981 C CZ2 . TRP B 1 131 ? -17.849 -19.551 23.129  1.00 23.23 ? 131 TRP B CZ2 1 
ATOM   3982 C CZ3 . TRP B 1 131 ? -18.748 -17.957 21.536  1.00 23.87 ? 131 TRP B CZ3 1 
ATOM   3983 C CH2 . TRP B 1 131 ? -18.460 -18.348 22.857  1.00 22.57 ? 131 TRP B CH2 1 
ATOM   3984 N N   . VAL B 1 132 ? -18.518 -22.245 15.488  1.00 17.11 ? 132 VAL B N   1 
ATOM   3985 C CA  . VAL B 1 132 ? -18.659 -21.927 14.079  1.00 15.45 ? 132 VAL B CA  1 
ATOM   3986 C C   . VAL B 1 132 ? -20.115 -21.850 13.651  1.00 19.16 ? 132 VAL B C   1 
ATOM   3987 O O   . VAL B 1 132 ? -20.823 -22.859 13.626  1.00 22.88 ? 132 VAL B O   1 
ATOM   3988 C CB  . VAL B 1 132 ? -17.928 -22.954 13.233  1.00 14.77 ? 132 VAL B CB  1 
ATOM   3989 C CG1 . VAL B 1 132 ? -17.948 -22.538 11.759  1.00 13.17 ? 132 VAL B CG1 1 
ATOM   3990 C CG2 . VAL B 1 132 ? -16.510 -23.093 13.751  1.00 11.15 ? 132 VAL B CG2 1 
ATOM   3991 N N   . PRO B 1 133 ? -20.569 -20.642 13.270  1.00 20.69 ? 133 PRO B N   1 
ATOM   3992 C CA  . PRO B 1 133 ? -21.940 -20.371 12.837  1.00 20.89 ? 133 PRO B CA  1 
ATOM   3993 C C   . PRO B 1 133 ? -22.284 -21.124 11.565  1.00 24.77 ? 133 PRO B C   1 
ATOM   3994 O O   . PRO B 1 133 ? -21.398 -21.513 10.808  1.00 26.53 ? 133 PRO B O   1 
ATOM   3995 C CB  . PRO B 1 133 ? -21.943 -18.853 12.617  1.00 23.69 ? 133 PRO B CB  1 
ATOM   3996 C CG  . PRO B 1 133 ? -20.645 -18.365 13.259  1.00 19.54 ? 133 PRO B CG  1 
ATOM   3997 C CD  . PRO B 1 133 ? -19.714 -19.481 12.985  1.00 19.02 ? 133 PRO B CD  1 
ATOM   3998 N N   . ASP B 1 134 ? -23.572 -21.324 11.320  1.00 29.01 ? 134 ASP B N   1 
ATOM   3999 C CA  . ASP B 1 134 ? -23.977 -22.030 10.114  1.00 35.89 ? 134 ASP B CA  1 
ATOM   4000 C C   . ASP B 1 134 ? -25.128 -21.341 9.380   1.00 37.31 ? 134 ASP B C   1 
ATOM   4001 O O   . ASP B 1 134 ? -25.764 -21.946 8.507   1.00 40.15 ? 134 ASP B O   1 
ATOM   4002 C CB  . ASP B 1 134 ? -24.368 -23.475 10.451  1.00 38.54 ? 134 ASP B CB  1 
ATOM   4003 C CG  . ASP B 1 134 ? -25.581 -23.552 11.346  1.00 43.01 ? 134 ASP B CG  1 
ATOM   4004 O OD1 . ASP B 1 134 ? -25.445 -23.316 12.567  1.00 44.08 ? 134 ASP B OD1 1 
ATOM   4005 O OD2 . ASP B 1 134 ? -26.675 -23.836 10.817  1.00 45.71 ? 134 ASP B OD2 1 
ATOM   4006 N N   . ALA B 1 135 ? -25.395 -20.083 9.727   1.00 35.73 ? 135 ALA B N   1 
ATOM   4007 C CA  . ALA B 1 135 ? -26.470 -19.332 9.084   1.00 36.14 ? 135 ALA B CA  1 
ATOM   4008 C C   . ALA B 1 135 ? -26.179 -19.166 7.588   1.00 35.58 ? 135 ALA B C   1 
ATOM   4009 O O   . ALA B 1 135 ? -25.961 -20.148 6.887   1.00 43.33 ? 135 ALA B O   1 
ATOM   4010 C CB  . ALA B 1 135 ? -26.627 -17.981 9.752   1.00 37.09 ? 135 ALA B CB  1 
ATOM   4011 N N   . ALA B 1 136 ? -26.179 -17.936 7.095   1.00 32.56 ? 136 ALA B N   1 
ATOM   4012 C CA  . ALA B 1 136 ? -25.896 -17.677 5.685   1.00 30.93 ? 136 ALA B CA  1 
ATOM   4013 C C   . ALA B 1 136 ? -24.891 -16.537 5.619   1.00 30.31 ? 136 ALA B C   1 
ATOM   4014 O O   . ALA B 1 136 ? -25.161 -15.437 6.108   1.00 29.99 ? 136 ALA B O   1 
ATOM   4015 C CB  . ALA B 1 136 ? -27.172 -17.296 4.956   1.00 31.14 ? 136 ALA B CB  1 
ATOM   4016 N N   . GLY B 1 137 ? -23.724 -16.794 5.038   1.00 29.21 ? 137 GLY B N   1 
ATOM   4017 C CA  . GLY B 1 137 ? -22.719 -15.746 4.959   1.00 24.02 ? 137 GLY B CA  1 
ATOM   4018 C C   . GLY B 1 137 ? -21.899 -15.627 6.236   1.00 21.58 ? 137 GLY B C   1 
ATOM   4019 O O   . GLY B 1 137 ? -20.994 -14.799 6.317   1.00 23.74 ? 137 GLY B O   1 
ATOM   4020 N N   . THR B 1 138 ? -22.202 -16.446 7.239   1.00 17.34 ? 138 THR B N   1 
ATOM   4021 C CA  . THR B 1 138 ? -21.453 -16.405 8.485   1.00 17.83 ? 138 THR B CA  1 
ATOM   4022 C C   . THR B 1 138 ? -20.220 -17.308 8.400   1.00 18.05 ? 138 THR B C   1 
ATOM   4023 O O   . THR B 1 138 ? -20.115 -18.152 7.511   1.00 16.92 ? 138 THR B O   1 
ATOM   4024 C CB  . THR B 1 138 ? -22.304 -16.857 9.693   1.00 20.28 ? 138 THR B CB  1 
ATOM   4025 O OG1 . THR B 1 138 ? -22.737 -18.204 9.497   1.00 19.01 ? 138 THR B OG1 1 
ATOM   4026 C CG2 . THR B 1 138 ? -23.521 -15.953 9.875   1.00 20.17 ? 138 THR B CG2 1 
ATOM   4027 N N   . SER B 1 139 ? -19.290 -17.130 9.331   1.00 19.35 ? 139 SER B N   1 
ATOM   4028 C CA  . SER B 1 139 ? -18.066 -17.921 9.349   1.00 19.97 ? 139 SER B CA  1 
ATOM   4029 C C   . SER B 1 139 ? -17.281 -17.672 10.625  1.00 17.94 ? 139 SER B C   1 
ATOM   4030 O O   . SER B 1 139 ? -17.707 -16.901 11.484  1.00 14.94 ? 139 SER B O   1 
ATOM   4031 C CB  . SER B 1 139 ? -17.191 -17.550 8.154   1.00 20.97 ? 139 SER B CB  1 
ATOM   4032 O OG  . SER B 1 139 ? -16.844 -16.174 8.207   1.00 18.54 ? 139 SER B OG  1 
ATOM   4033 N N   . LEU B 1 140 ? -16.132 -18.334 10.734  1.00 18.67 ? 140 LEU B N   1 
ATOM   4034 C CA  . LEU B 1 140 ? -15.258 -18.183 11.895  1.00 18.80 ? 140 LEU B CA  1 
ATOM   4035 C C   . LEU B 1 140 ? -13.995 -17.461 11.441  1.00 16.36 ? 140 LEU B C   1 
ATOM   4036 O O   . LEU B 1 140 ? -13.319 -17.904 10.513  1.00 17.60 ? 140 LEU B O   1 
ATOM   4037 C CB  . LEU B 1 140 ? -14.873 -19.549 12.473  1.00 18.10 ? 140 LEU B CB  1 
ATOM   4038 C CG  . LEU B 1 140 ? -13.968 -19.511 13.717  1.00 22.91 ? 140 LEU B CG  1 
ATOM   4039 C CD1 . LEU B 1 140 ? -14.763 -19.083 14.944  1.00 15.92 ? 140 LEU B CD1 1 
ATOM   4040 C CD2 . LEU B 1 140 ? -13.363 -20.882 13.955  1.00 21.57 ? 140 LEU B CD2 1 
ATOM   4041 N N   . TYR B 1 141 ? -13.681 -16.347 12.086  1.00 13.74 ? 141 TYR B N   1 
ATOM   4042 C CA  . TYR B 1 141 ? -12.482 -15.597 11.727  1.00 15.50 ? 141 TYR B CA  1 
ATOM   4043 C C   . TYR B 1 141 ? -11.331 -16.104 12.583  1.00 16.36 ? 141 TYR B C   1 
ATOM   4044 O O   . TYR B 1 141 ? -11.449 -16.160 13.812  1.00 16.78 ? 141 TYR B O   1 
ATOM   4045 C CB  . TYR B 1 141 ? -12.685 -14.104 11.971  1.00 13.71 ? 141 TYR B CB  1 
ATOM   4046 C CG  . TYR B 1 141 ? -11.547 -13.241 11.475  1.00 16.87 ? 141 TYR B CG  1 
ATOM   4047 C CD1 . TYR B 1 141 ? -11.346 -13.034 10.118  1.00 15.42 ? 141 TYR B CD1 1 
ATOM   4048 C CD2 . TYR B 1 141 ? -10.668 -12.635 12.369  1.00 17.77 ? 141 TYR B CD2 1 
ATOM   4049 C CE1 . TYR B 1 141 ? -10.303 -12.249 9.660   1.00 17.37 ? 141 TYR B CE1 1 
ATOM   4050 C CE2 . TYR B 1 141 ? -9.620  -11.845 11.922  1.00 18.20 ? 141 TYR B CE2 1 
ATOM   4051 C CZ  . TYR B 1 141 ? -9.439  -11.656 10.562  1.00 17.70 ? 141 TYR B CZ  1 
ATOM   4052 O OH  . TYR B 1 141 ? -8.382  -10.899 10.105  1.00 10.86 ? 141 TYR B OH  1 
ATOM   4053 N N   . VAL B 1 142 ? -10.233 -16.480 11.937  1.00 14.87 ? 142 VAL B N   1 
ATOM   4054 C CA  . VAL B 1 142 ? -9.071  -16.996 12.647  1.00 16.03 ? 142 VAL B CA  1 
ATOM   4055 C C   . VAL B 1 142 ? -7.992  -15.930 12.661  1.00 17.56 ? 142 VAL B C   1 
ATOM   4056 O O   . VAL B 1 142 ? -7.590  -15.418 11.605  1.00 17.43 ? 142 VAL B O   1 
ATOM   4057 C CB  . VAL B 1 142 ? -8.515  -18.265 11.963  1.00 17.91 ? 142 VAL B CB  1 
ATOM   4058 C CG1 . VAL B 1 142 ? -7.395  -18.848 12.792  1.00 18.91 ? 142 VAL B CG1 1 
ATOM   4059 C CG2 . VAL B 1 142 ? -9.625  -19.286 11.777  1.00 20.84 ? 142 VAL B CG2 1 
ATOM   4060 N N   . ARG B 1 143 ? -7.502  -15.611 13.854  1.00 15.51 ? 143 ARG B N   1 
ATOM   4061 C CA  . ARG B 1 143 ? -6.491  -14.573 13.988  1.00 12.78 ? 143 ARG B CA  1 
ATOM   4062 C C   . ARG B 1 143 ? -5.179  -14.995 14.653  1.00 15.61 ? 143 ARG B C   1 
ATOM   4063 O O   . ARG B 1 143 ? -5.058  -14.975 15.884  1.00 17.44 ? 143 ARG B O   1 
ATOM   4064 C CB  . ARG B 1 143 ? -7.084  -13.394 14.762  1.00 15.22 ? 143 ARG B CB  1 
ATOM   4065 C CG  . ARG B 1 143 ? -6.151  -12.225 14.927  1.00 13.58 ? 143 ARG B CG  1 
ATOM   4066 C CD  . ARG B 1 143 ? -5.846  -11.606 13.584  1.00 15.91 ? 143 ARG B CD  1 
ATOM   4067 N NE  . ARG B 1 143 ? -5.674  -10.184 13.765  1.00 17.90 ? 143 ARG B NE  1 
ATOM   4068 C CZ  . ARG B 1 143 ? -6.311  -9.255  13.067  1.00 21.09 ? 143 ARG B CZ  1 
ATOM   4069 N NH1 . ARG B 1 143 ? -7.171  -9.591  12.113  1.00 16.86 ? 143 ARG B NH1 1 
ATOM   4070 N NH2 . ARG B 1 143 ? -6.107  -7.981  13.360  1.00 26.32 ? 143 ARG B NH2 1 
ATOM   4071 N N   . PRO B 1 144 ? -4.176  -15.380 13.847  1.00 13.19 ? 144 PRO B N   1 
ATOM   4072 C CA  . PRO B 1 144 ? -2.885  -15.787 14.403  1.00 10.75 ? 144 PRO B CA  1 
ATOM   4073 C C   . PRO B 1 144 ? -2.076  -14.507 14.638  1.00 14.24 ? 144 PRO B C   1 
ATOM   4074 O O   . PRO B 1 144 ? -2.208  -13.540 13.884  1.00 12.62 ? 144 PRO B O   1 
ATOM   4075 C CB  . PRO B 1 144 ? -2.271  -16.633 13.286  1.00 11.28 ? 144 PRO B CB  1 
ATOM   4076 C CG  . PRO B 1 144 ? -3.439  -16.963 12.376  1.00 11.84 ? 144 PRO B CG  1 
ATOM   4077 C CD  . PRO B 1 144 ? -4.255  -15.727 12.418  1.00 13.62 ? 144 PRO B CD  1 
ATOM   4078 N N   . VAL B 1 145 ? -1.243  -14.492 15.671  1.00 14.91 ? 145 VAL B N   1 
ATOM   4079 C CA  . VAL B 1 145 ? -0.420  -13.313 15.952  1.00 14.74 ? 145 VAL B CA  1 
ATOM   4080 C C   . VAL B 1 145 ? 0.962   -13.747 16.423  1.00 16.16 ? 145 VAL B C   1 
ATOM   4081 O O   . VAL B 1 145 ? 1.099   -14.742 17.140  1.00 15.46 ? 145 VAL B O   1 
ATOM   4082 C CB  . VAL B 1 145 ? -1.046  -12.420 17.056  1.00 12.39 ? 145 VAL B CB  1 
ATOM   4083 C CG1 . VAL B 1 145 ? -0.133  -11.242 17.357  1.00 9.12  ? 145 VAL B CG1 1 
ATOM   4084 C CG2 . VAL B 1 145 ? -2.397  -11.911 16.614  1.00 15.79 ? 145 VAL B CG2 1 
ATOM   4085 N N   . LEU B 1 146 ? 1.991   -13.017 16.005  1.00 16.14 ? 146 LEU B N   1 
ATOM   4086 C CA  . LEU B 1 146 ? 3.342   -13.333 16.446  1.00 17.15 ? 146 LEU B CA  1 
ATOM   4087 C C   . LEU B 1 146 ? 3.970   -12.025 16.882  1.00 15.97 ? 146 LEU B C   1 
ATOM   4088 O O   . LEU B 1 146 ? 4.005   -11.069 16.120  1.00 13.03 ? 146 LEU B O   1 
ATOM   4089 C CB  . LEU B 1 146 ? 4.158   -13.985 15.321  1.00 18.77 ? 146 LEU B CB  1 
ATOM   4090 C CG  . LEU B 1 146 ? 5.596   -14.405 15.677  1.00 18.94 ? 146 LEU B CG  1 
ATOM   4091 C CD1 . LEU B 1 146 ? 5.601   -15.291 16.887  1.00 18.75 ? 146 LEU B CD1 1 
ATOM   4092 C CD2 . LEU B 1 146 ? 6.229   -15.132 14.511  1.00 17.88 ? 146 LEU B CD2 1 
ATOM   4093 N N   . ILE B 1 147 ? 4.445   -11.982 18.121  1.00 17.57 ? 147 ILE B N   1 
ATOM   4094 C CA  . ILE B 1 147 ? 5.053   -10.774 18.666  1.00 17.35 ? 147 ILE B CA  1 
ATOM   4095 C C   . ILE B 1 147 ? 6.396   -11.022 19.331  1.00 18.64 ? 147 ILE B C   1 
ATOM   4096 O O   . ILE B 1 147 ? 6.643   -12.096 19.881  1.00 18.83 ? 147 ILE B O   1 
ATOM   4097 C CB  . ILE B 1 147 ? 4.157   -10.111 19.744  1.00 13.87 ? 147 ILE B CB  1 
ATOM   4098 C CG1 . ILE B 1 147 ? 3.917   -11.099 20.893  1.00 18.01 ? 147 ILE B CG1 1 
ATOM   4099 C CG2 . ILE B 1 147 ? 2.853   -9.661  19.146  1.00 8.96  ? 147 ILE B CG2 1 
ATOM   4100 C CD1 . ILE B 1 147 ? 3.260   -10.488 22.124  1.00 11.50 ? 147 ILE B CD1 1 
ATOM   4101 N N   . GLY B 1 148 ? 7.254   -10.007 19.275  1.00 17.18 ? 148 GLY B N   1 
ATOM   4102 C CA  . GLY B 1 148 ? 8.542   -10.085 19.931  1.00 20.14 ? 148 GLY B CA  1 
ATOM   4103 C C   . GLY B 1 148 ? 8.207   -9.867  21.392  1.00 21.48 ? 148 GLY B C   1 
ATOM   4104 O O   . GLY B 1 148 ? 7.248   -9.164  21.704  1.00 24.44 ? 148 GLY B O   1 
ATOM   4105 N N   . ASN B 1 149 ? 8.970   -10.461 22.298  1.00 21.93 ? 149 ASN B N   1 
ATOM   4106 C CA  . ASN B 1 149 ? 8.654   -10.314 23.707  1.00 23.79 ? 149 ASN B CA  1 
ATOM   4107 C C   . ASN B 1 149 ? 9.888   -10.235 24.589  1.00 26.08 ? 149 ASN B C   1 
ATOM   4108 O O   . ASN B 1 149 ? 9.956   -10.872 25.643  1.00 25.13 ? 149 ASN B O   1 
ATOM   4109 C CB  . ASN B 1 149 ? 7.757   -11.473 24.152  1.00 20.81 ? 149 ASN B CB  1 
ATOM   4110 C CG  . ASN B 1 149 ? 7.109   -11.225 25.505  1.00 24.40 ? 149 ASN B CG  1 
ATOM   4111 O OD1 . ASN B 1 149 ? 6.791   -10.087 25.855  1.00 23.31 ? 149 ASN B OD1 1 
ATOM   4112 N ND2 . ASN B 1 149 ? 6.893   -12.294 26.264  1.00 24.68 ? 149 ASN B ND2 1 
ATOM   4113 N N   . GLU B 1 150 ? 10.854  -9.440  24.140  1.00 27.53 ? 150 GLU B N   1 
ATOM   4114 C CA  . GLU B 1 150 ? 12.109  -9.222  24.847  1.00 27.39 ? 150 GLU B CA  1 
ATOM   4115 C C   . GLU B 1 150 ? 11.901  -8.082  25.840  1.00 25.79 ? 150 GLU B C   1 
ATOM   4116 O O   . GLU B 1 150 ? 11.449  -7.014  25.442  1.00 26.48 ? 150 GLU B O   1 
ATOM   4117 C CB  . GLU B 1 150 ? 13.173  -8.802  23.838  1.00 30.14 ? 150 GLU B CB  1 
ATOM   4118 C CG  . GLU B 1 150 ? 14.505  -8.405  24.437  1.00 35.72 ? 150 GLU B CG  1 
ATOM   4119 C CD  . GLU B 1 150 ? 15.403  -9.588  24.677  1.00 33.68 ? 150 GLU B CD  1 
ATOM   4120 O OE1 . GLU B 1 150 ? 15.583  -10.376 23.735  1.00 39.54 ? 150 GLU B OE1 1 
ATOM   4121 O OE2 . GLU B 1 150 ? 15.935  -9.729  25.792  1.00 36.85 ? 150 GLU B OE2 1 
ATOM   4122 N N   . PRO B 1 151 ? 12.191  -8.299  27.142  1.00 23.12 ? 151 PRO B N   1 
ATOM   4123 C CA  . PRO B 1 151 ? 12.021  -7.236  28.144  1.00 22.17 ? 151 PRO B CA  1 
ATOM   4124 C C   . PRO B 1 151 ? 13.260  -6.345  28.164  1.00 21.15 ? 151 PRO B C   1 
ATOM   4125 O O   . PRO B 1 151 ? 14.009  -6.310  29.138  1.00 23.68 ? 151 PRO B O   1 
ATOM   4126 C CB  . PRO B 1 151 ? 11.840  -8.013  29.445  1.00 19.97 ? 151 PRO B CB  1 
ATOM   4127 C CG  . PRO B 1 151 ? 12.742  -9.168  29.239  1.00 21.42 ? 151 PRO B CG  1 
ATOM   4128 C CD  . PRO B 1 151 ? 12.457  -9.588  27.803  1.00 22.23 ? 151 PRO B CD  1 
ATOM   4129 N N   . SER B 1 152 ? 13.458  -5.630  27.065  1.00 21.30 ? 152 SER B N   1 
ATOM   4130 C CA  . SER B 1 152 ? 14.594  -4.745  26.887  1.00 19.13 ? 152 SER B CA  1 
ATOM   4131 C C   . SER B 1 152 ? 14.175  -3.568  26.020  1.00 20.58 ? 152 SER B C   1 
ATOM   4132 O O   . SER B 1 152 ? 13.378  -3.727  25.096  1.00 20.19 ? 152 SER B O   1 
ATOM   4133 C CB  . SER B 1 152 ? 15.728  -5.500  26.198  1.00 24.15 ? 152 SER B CB  1 
ATOM   4134 O OG  . SER B 1 152 ? 16.594  -4.596  25.518  1.00 31.18 ? 152 SER B OG  1 
ATOM   4135 N N   . LEU B 1 153 ? 14.715  -2.390  26.313  1.00 22.46 ? 153 LEU B N   1 
ATOM   4136 C CA  . LEU B 1 153 ? 14.391  -1.192  25.546  1.00 23.76 ? 153 LEU B CA  1 
ATOM   4137 C C   . LEU B 1 153 ? 15.373  -0.993  24.391  1.00 26.51 ? 153 LEU B C   1 
ATOM   4138 O O   . LEU B 1 153 ? 15.317  0.002   23.666  1.00 24.56 ? 153 LEU B O   1 
ATOM   4139 C CB  . LEU B 1 153 ? 14.409  0.036   26.450  1.00 22.74 ? 153 LEU B CB  1 
ATOM   4140 C CG  . LEU B 1 153 ? 13.404  -0.010  27.598  1.00 23.00 ? 153 LEU B CG  1 
ATOM   4141 C CD1 . LEU B 1 153 ? 13.450  1.303   28.359  1.00 23.75 ? 153 LEU B CD1 1 
ATOM   4142 C CD2 . LEU B 1 153 ? 12.011  -0.264  27.046  1.00 24.72 ? 153 LEU B CD2 1 
ATOM   4143 N N   . GLY B 1 154 ? 16.286  -1.939  24.229  1.00 25.18 ? 154 GLY B N   1 
ATOM   4144 C CA  . GLY B 1 154 ? 17.227  -1.822  23.139  1.00 24.98 ? 154 GLY B CA  1 
ATOM   4145 C C   . GLY B 1 154 ? 16.497  -2.221  21.877  1.00 23.41 ? 154 GLY B C   1 
ATOM   4146 O O   . GLY B 1 154 ? 15.705  -3.158  21.890  1.00 23.31 ? 154 GLY B O   1 
ATOM   4147 N N   . VAL B 1 155 ? 16.744  -1.494  20.795  1.00 24.39 ? 155 VAL B N   1 
ATOM   4148 C CA  . VAL B 1 155 ? 16.118  -1.781  19.511  1.00 23.97 ? 155 VAL B CA  1 
ATOM   4149 C C   . VAL B 1 155 ? 16.938  -2.879  18.870  1.00 24.35 ? 155 VAL B C   1 
ATOM   4150 O O   . VAL B 1 155 ? 17.940  -2.603  18.217  1.00 26.14 ? 155 VAL B O   1 
ATOM   4151 C CB  . VAL B 1 155 ? 16.136  -0.542  18.604  1.00 20.74 ? 155 VAL B CB  1 
ATOM   4152 C CG1 . VAL B 1 155 ? 15.592  -0.889  17.236  1.00 17.88 ? 155 VAL B CG1 1 
ATOM   4153 C CG2 . VAL B 1 155 ? 15.303  0.562   19.242  1.00 24.02 ? 155 VAL B CG2 1 
ATOM   4154 N N   . SER B 1 156 ? 16.521  -4.123  19.061  1.00 23.36 ? 156 SER B N   1 
ATOM   4155 C CA  . SER B 1 156 ? 17.267  -5.243  18.509  1.00 25.16 ? 156 SER B CA  1 
ATOM   4156 C C   . SER B 1 156 ? 16.422  -6.497  18.308  1.00 25.29 ? 156 SER B C   1 
ATOM   4157 O O   . SER B 1 156 ? 15.243  -6.536  18.662  1.00 24.39 ? 156 SER B O   1 
ATOM   4158 C CB  . SER B 1 156 ? 18.438  -5.574  19.433  1.00 26.93 ? 156 SER B CB  1 
ATOM   4159 O OG  . SER B 1 156 ? 17.949  -5.938  20.709  1.00 29.40 ? 156 SER B OG  1 
ATOM   4160 N N   . GLN B 1 157 ? 17.046  -7.523  17.736  1.00 26.91 ? 157 GLN B N   1 
ATOM   4161 C CA  . GLN B 1 157 ? 16.372  -8.789  17.494  1.00 29.50 ? 157 GLN B CA  1 
ATOM   4162 C C   . GLN B 1 157 ? 15.920  -9.383  18.819  1.00 27.00 ? 157 GLN B C   1 
ATOM   4163 O O   . GLN B 1 157 ? 16.690  -9.451  19.769  1.00 29.56 ? 157 GLN B O   1 
ATOM   4164 C CB  . GLN B 1 157 ? 17.313  -9.752  16.780  1.00 31.89 ? 157 GLN B CB  1 
ATOM   4165 C CG  . GLN B 1 157 ? 16.693  -11.110 16.485  1.00 43.62 ? 157 GLN B CG  1 
ATOM   4166 C CD  . GLN B 1 157 ? 17.460  -11.871 15.419  1.00 46.18 ? 157 GLN B CD  1 
ATOM   4167 O OE1 . GLN B 1 157 ? 18.687  -11.979 15.478  1.00 47.10 ? 157 GLN B OE1 1 
ATOM   4168 N NE2 . GLN B 1 157 ? 16.739  -12.402 14.435  1.00 49.17 ? 157 GLN B NE2 1 
ATOM   4169 N N   . PRO B 1 158 ? 14.656  -9.816  18.902  1.00 26.28 ? 158 PRO B N   1 
ATOM   4170 C CA  . PRO B 1 158 ? 14.154  -10.396 20.151  1.00 28.36 ? 158 PRO B CA  1 
ATOM   4171 C C   . PRO B 1 158 ? 14.795  -11.749 20.456  1.00 29.46 ? 158 PRO B C   1 
ATOM   4172 O O   . PRO B 1 158 ? 15.151  -12.494 19.544  1.00 29.00 ? 158 PRO B O   1 
ATOM   4173 C CB  . PRO B 1 158 ? 12.644  -10.538 19.902  1.00 26.47 ? 158 PRO B CB  1 
ATOM   4174 C CG  . PRO B 1 158 ? 12.365  -9.629  18.740  1.00 28.95 ? 158 PRO B CG  1 
ATOM   4175 C CD  . PRO B 1 158 ? 13.596  -9.764  17.884  1.00 28.35 ? 158 PRO B CD  1 
ATOM   4176 N N   . ARG B 1 159 ? 14.941  -12.050 21.741  1.00 29.26 ? 159 ARG B N   1 
ATOM   4177 C CA  . ARG B 1 159 ? 15.490  -13.322 22.183  1.00 27.49 ? 159 ARG B CA  1 
ATOM   4178 C C   . ARG B 1 159 ? 14.317  -14.114 22.749  1.00 26.66 ? 159 ARG B C   1 
ATOM   4179 O O   . ARG B 1 159 ? 14.445  -15.285 23.094  1.00 26.73 ? 159 ARG B O   1 
ATOM   4180 C CB  . ARG B 1 159 ? 16.558  -13.103 23.261  1.00 28.77 ? 159 ARG B CB  1 
ATOM   4181 C CG  . ARG B 1 159 ? 17.819  -12.416 22.757  1.00 34.86 ? 159 ARG B CG  1 
ATOM   4182 C CD  . ARG B 1 159 ? 18.684  -11.946 23.915  1.00 44.06 ? 159 ARG B CD  1 
ATOM   4183 N NE  . ARG B 1 159 ? 19.176  -13.064 24.714  1.00 53.41 ? 159 ARG B NE  1 
ATOM   4184 C CZ  . ARG B 1 159 ? 20.068  -13.954 24.283  1.00 56.48 ? 159 ARG B CZ  1 
ATOM   4185 N NH1 . ARG B 1 159 ? 20.570  -13.848 23.056  1.00 55.83 ? 159 ARG B NH1 1 
ATOM   4186 N NH2 . ARG B 1 159 ? 20.454  -14.951 25.074  1.00 55.98 ? 159 ARG B NH2 1 
ATOM   4187 N N   . ARG B 1 160 ? 13.167  -13.457 22.840  1.00 27.00 ? 160 ARG B N   1 
ATOM   4188 C CA  . ARG B 1 160 ? 11.955  -14.091 23.344  1.00 28.07 ? 160 ARG B CA  1 
ATOM   4189 C C   . ARG B 1 160 ? 10.802  -13.648 22.447  1.00 27.68 ? 160 ARG B C   1 
ATOM   4190 O O   . ARG B 1 160 ? 10.740  -12.489 22.025  1.00 29.75 ? 160 ARG B O   1 
ATOM   4191 C CB  . ARG B 1 160 ? 11.700  -13.662 24.787  1.00 34.38 ? 160 ARG B CB  1 
ATOM   4192 C CG  . ARG B 1 160 ? 10.772  -14.578 25.536  1.00 43.48 ? 160 ARG B CG  1 
ATOM   4193 C CD  . ARG B 1 160 ? 10.495  -14.048 26.936  1.00 52.36 ? 160 ARG B CD  1 
ATOM   4194 N NE  . ARG B 1 160 ? 9.564   -14.913 27.661  1.00 56.34 ? 160 ARG B NE  1 
ATOM   4195 C CZ  . ARG B 1 160 ? 8.957   -14.578 28.796  1.00 56.41 ? 160 ARG B CZ  1 
ATOM   4196 N NH1 . ARG B 1 160 ? 9.179   -13.388 29.348  1.00 55.21 ? 160 ARG B NH1 1 
ATOM   4197 N NH2 . ARG B 1 160 ? 8.121   -15.434 29.374  1.00 55.58 ? 160 ARG B NH2 1 
ATOM   4198 N N   . ALA B 1 161 ? 9.905   -14.574 22.138  1.00 24.08 ? 161 ALA B N   1 
ATOM   4199 C CA  . ALA B 1 161 ? 8.764   -14.281 21.272  1.00 22.05 ? 161 ALA B CA  1 
ATOM   4200 C C   . ALA B 1 161 ? 7.525   -15.031 21.744  1.00 22.80 ? 161 ALA B C   1 
ATOM   4201 O O   . ALA B 1 161 ? 7.600   -15.931 22.583  1.00 25.24 ? 161 ALA B O   1 
ATOM   4202 C CB  . ALA B 1 161 ? 9.084   -14.670 19.829  1.00 19.89 ? 161 ALA B CB  1 
ATOM   4203 N N   . LEU B 1 162 ? 6.382   -14.682 21.180  1.00 19.19 ? 162 LEU B N   1 
ATOM   4204 C CA  . LEU B 1 162 ? 5.151   -15.312 21.595  1.00 19.17 ? 162 LEU B CA  1 
ATOM   4205 C C   . LEU B 1 162 ? 4.205   -15.438 20.413  1.00 19.08 ? 162 LEU B C   1 
ATOM   4206 O O   . LEU B 1 162 ? 3.952   -14.475 19.704  1.00 19.47 ? 162 LEU B O   1 
ATOM   4207 C CB  . LEU B 1 162 ? 4.520   -14.466 22.704  1.00 24.27 ? 162 LEU B CB  1 
ATOM   4208 C CG  . LEU B 1 162 ? 3.443   -15.053 23.611  1.00 28.03 ? 162 LEU B CG  1 
ATOM   4209 C CD1 . LEU B 1 162 ? 2.166   -15.314 22.845  1.00 30.07 ? 162 LEU B CD1 1 
ATOM   4210 C CD2 . LEU B 1 162 ? 3.984   -16.325 24.224  1.00 31.41 ? 162 LEU B CD2 1 
ATOM   4211 N N   . LEU B 1 163 ? 3.691   -16.640 20.194  1.00 19.81 ? 163 LEU B N   1 
ATOM   4212 C CA  . LEU B 1 163 ? 2.764   -16.872 19.101  1.00 17.28 ? 163 LEU B CA  1 
ATOM   4213 C C   . LEU B 1 163 ? 1.430   -17.389 19.642  1.00 16.25 ? 163 LEU B C   1 
ATOM   4214 O O   . LEU B 1 163 ? 1.385   -18.419 20.319  1.00 19.10 ? 163 LEU B O   1 
ATOM   4215 C CB  . LEU B 1 163 ? 3.366   -17.883 18.115  1.00 15.85 ? 163 LEU B CB  1 
ATOM   4216 C CG  . LEU B 1 163 ? 2.613   -18.190 16.808  1.00 20.12 ? 163 LEU B CG  1 
ATOM   4217 C CD1 . LEU B 1 163 ? 3.506   -18.996 15.862  1.00 16.98 ? 163 LEU B CD1 1 
ATOM   4218 C CD2 . LEU B 1 163 ? 1.338   -18.951 17.105  1.00 21.03 ? 163 LEU B CD2 1 
ATOM   4219 N N   . PHE B 1 164 ? 0.350   -16.664 19.367  1.00 17.07 ? 164 PHE B N   1 
ATOM   4220 C CA  . PHE B 1 164 ? -0.977  -17.103 19.796  1.00 18.02 ? 164 PHE B CA  1 
ATOM   4221 C C   . PHE B 1 164 ? -2.009  -16.993 18.676  1.00 18.29 ? 164 PHE B C   1 
ATOM   4222 O O   . PHE B 1 164 ? -1.791  -16.317 17.669  1.00 17.77 ? 164 PHE B O   1 
ATOM   4223 C CB  . PHE B 1 164 ? -1.464  -16.333 21.030  1.00 14.63 ? 164 PHE B CB  1 
ATOM   4224 C CG  . PHE B 1 164 ? -1.562  -14.841 20.844  1.00 14.02 ? 164 PHE B CG  1 
ATOM   4225 C CD1 . PHE B 1 164 ? -0.421  -14.032 20.912  1.00 19.48 ? 164 PHE B CD1 1 
ATOM   4226 C CD2 . PHE B 1 164 ? -2.797  -14.236 20.658  1.00 9.74  ? 164 PHE B CD2 1 
ATOM   4227 C CE1 . PHE B 1 164 ? -0.512  -12.627 20.802  1.00 13.57 ? 164 PHE B CE1 1 
ATOM   4228 C CE2 . PHE B 1 164 ? -2.904  -12.842 20.547  1.00 17.51 ? 164 PHE B CE2 1 
ATOM   4229 C CZ  . PHE B 1 164 ? -1.758  -12.034 20.620  1.00 12.95 ? 164 PHE B CZ  1 
ATOM   4230 N N   . VAL B 1 165 ? -3.128  -17.684 18.845  1.00 16.93 ? 165 VAL B N   1 
ATOM   4231 C CA  . VAL B 1 165 ? -4.189  -17.660 17.852  1.00 14.22 ? 165 VAL B CA  1 
ATOM   4232 C C   . VAL B 1 165 ? -5.526  -17.597 18.568  1.00 16.54 ? 165 VAL B C   1 
ATOM   4233 O O   . VAL B 1 165 ? -5.783  -18.394 19.472  1.00 14.74 ? 165 VAL B O   1 
ATOM   4234 C CB  . VAL B 1 165 ? -4.175  -18.942 16.983  1.00 17.51 ? 165 VAL B CB  1 
ATOM   4235 C CG1 . VAL B 1 165 ? -5.261  -18.858 15.924  1.00 12.85 ? 165 VAL B CG1 1 
ATOM   4236 C CG2 . VAL B 1 165 ? -2.806  -19.143 16.343  1.00 13.60 ? 165 VAL B CG2 1 
ATOM   4237 N N   . ILE B 1 166 ? -6.371  -16.649 18.179  1.00 15.95 ? 166 ILE B N   1 
ATOM   4238 C CA  . ILE B 1 166 ? -7.700  -16.527 18.780  1.00 15.22 ? 166 ILE B CA  1 
ATOM   4239 C C   . ILE B 1 166 ? -8.771  -16.640 17.689  1.00 15.54 ? 166 ILE B C   1 
ATOM   4240 O O   . ILE B 1 166 ? -8.515  -16.378 16.521  1.00 14.37 ? 166 ILE B O   1 
ATOM   4241 C CB  . ILE B 1 166 ? -7.871  -15.189 19.531  1.00 15.03 ? 166 ILE B CB  1 
ATOM   4242 C CG1 . ILE B 1 166 ? -7.609  -14.014 18.582  1.00 13.03 ? 166 ILE B CG1 1 
ATOM   4243 C CG2 . ILE B 1 166 ? -6.940  -15.150 20.733  1.00 11.30 ? 166 ILE B CG2 1 
ATOM   4244 C CD1 . ILE B 1 166 ? -7.768  -12.661 19.237  1.00 5.09  ? 166 ILE B CD1 1 
ATOM   4245 N N   . LEU B 1 167 ? -9.973  -17.021 18.079  1.00 16.83 ? 167 LEU B N   1 
ATOM   4246 C CA  . LEU B 1 167 ? -11.055 -17.209 17.125  1.00 17.98 ? 167 LEU B CA  1 
ATOM   4247 C C   . LEU B 1 167 ? -12.280 -16.391 17.490  1.00 21.16 ? 167 LEU B C   1 
ATOM   4248 O O   . LEU B 1 167 ? -12.548 -16.154 18.670  1.00 22.87 ? 167 LEU B O   1 
ATOM   4249 C CB  . LEU B 1 167 ? -11.470 -18.684 17.102  1.00 12.89 ? 167 LEU B CB  1 
ATOM   4250 C CG  . LEU B 1 167 ? -10.343 -19.707 17.022  1.00 12.61 ? 167 LEU B CG  1 
ATOM   4251 C CD1 . LEU B 1 167 ? -10.888 -21.101 17.348  1.00 7.93  ? 167 LEU B CD1 1 
ATOM   4252 C CD2 . LEU B 1 167 ? -9.705  -19.644 15.631  1.00 6.16  ? 167 LEU B CD2 1 
ATOM   4253 N N   . CYS B 1 168 ? -13.031 -15.961 16.483  1.00 22.69 ? 168 CYS B N   1 
ATOM   4254 C CA  . CYS B 1 168 ? -14.254 -15.227 16.763  1.00 24.78 ? 168 CYS B CA  1 
ATOM   4255 C C   . CYS B 1 168 ? -15.245 -15.339 15.616  1.00 22.52 ? 168 CYS B C   1 
ATOM   4256 O O   . CYS B 1 168 ? -14.892 -15.190 14.447  1.00 21.34 ? 168 CYS B O   1 
ATOM   4257 C CB  . CYS B 1 168 ? -13.952 -13.762 17.105  1.00 27.79 ? 168 CYS B CB  1 
ATOM   4258 S SG  . CYS B 1 168 ? -13.383 -12.751 15.793  1.00 29.67 ? 168 CYS B SG  1 
ATOM   4259 N N   . PRO B 1 169 ? -16.508 -15.633 15.949  1.00 21.54 ? 169 PRO B N   1 
ATOM   4260 C CA  . PRO B 1 169 ? -17.623 -15.793 15.015  1.00 20.79 ? 169 PRO B CA  1 
ATOM   4261 C C   . PRO B 1 169 ? -17.984 -14.452 14.407  1.00 20.55 ? 169 PRO B C   1 
ATOM   4262 O O   . PRO B 1 169 ? -18.135 -13.463 15.120  1.00 15.15 ? 169 PRO B O   1 
ATOM   4263 C CB  . PRO B 1 169 ? -18.759 -16.304 15.901  1.00 24.33 ? 169 PRO B CB  1 
ATOM   4264 C CG  . PRO B 1 169 ? -18.075 -16.756 17.166  1.00 26.08 ? 169 PRO B CG  1 
ATOM   4265 C CD  . PRO B 1 169 ? -16.981 -15.767 17.332  1.00 20.55 ? 169 PRO B CD  1 
ATOM   4266 N N   . VAL B 1 170 ? -18.134 -14.418 13.094  1.00 19.72 ? 170 VAL B N   1 
ATOM   4267 C CA  . VAL B 1 170 ? -18.487 -13.179 12.436  1.00 23.05 ? 170 VAL B CA  1 
ATOM   4268 C C   . VAL B 1 170 ? -19.684 -13.393 11.517  1.00 27.76 ? 170 VAL B C   1 
ATOM   4269 O O   . VAL B 1 170 ? -19.760 -14.382 10.778  1.00 26.93 ? 170 VAL B O   1 
ATOM   4270 C CB  . VAL B 1 170 ? -17.274 -12.597 11.668  1.00 20.23 ? 170 VAL B CB  1 
ATOM   4271 C CG1 . VAL B 1 170 ? -16.192 -12.202 12.664  1.00 19.68 ? 170 VAL B CG1 1 
ATOM   4272 C CG2 . VAL B 1 170 ? -16.711 -13.620 10.690  1.00 22.93 ? 170 VAL B CG2 1 
ATOM   4273 N N   . GLY B 1 171 ? -20.645 -12.475 11.613  1.00 29.45 ? 171 GLY B N   1 
ATOM   4274 C CA  . GLY B 1 171 ? -21.849 -12.569 10.809  1.00 28.75 ? 171 GLY B CA  1 
ATOM   4275 C C   . GLY B 1 171 ? -21.596 -12.210 9.364   1.00 27.04 ? 171 GLY B C   1 
ATOM   4276 O O   . GLY B 1 171 ? -20.474 -11.865 8.996   1.00 25.77 ? 171 GLY B O   1 
ATOM   4277 N N   . ALA B 1 172 ? -22.644 -12.292 8.548   1.00 27.35 ? 172 ALA B N   1 
ATOM   4278 C CA  . ALA B 1 172 ? -22.545 -11.974 7.133   1.00 25.95 ? 172 ALA B CA  1 
ATOM   4279 C C   . ALA B 1 172 ? -22.181 -10.510 6.966   1.00 29.27 ? 172 ALA B C   1 
ATOM   4280 O O   . ALA B 1 172 ? -22.724 -9.632  7.654   1.00 26.75 ? 172 ALA B O   1 
ATOM   4281 C CB  . ALA B 1 172 ? -23.861 -12.271 6.427   1.00 22.89 ? 172 ALA B CB  1 
ATOM   4282 N N   . TYR B 1 173 ? -21.245 -10.258 6.056   1.00 31.98 ? 173 TYR B N   1 
ATOM   4283 C CA  . TYR B 1 173 ? -20.793 -8.906  5.774   1.00 33.60 ? 173 TYR B CA  1 
ATOM   4284 C C   . TYR B 1 173 ? -21.981 -8.131  5.203   1.00 35.92 ? 173 TYR B C   1 
ATOM   4285 O O   . TYR B 1 173 ? -22.226 -6.980  5.579   1.00 38.92 ? 173 TYR B O   1 
ATOM   4286 C CB  . TYR B 1 173 ? -19.647 -8.938  4.761   1.00 34.06 ? 173 TYR B CB  1 
ATOM   4287 C CG  . TYR B 1 173 ? -18.951 -7.612  4.600   1.00 38.82 ? 173 TYR B CG  1 
ATOM   4288 C CD1 . TYR B 1 173 ? -17.999 -7.181  5.533   1.00 40.11 ? 173 TYR B CD1 1 
ATOM   4289 C CD2 . TYR B 1 173 ? -19.275 -6.761  3.545   1.00 36.15 ? 173 TYR B CD2 1 
ATOM   4290 C CE1 . TYR B 1 173 ? -17.389 -5.928  5.417   1.00 39.35 ? 173 TYR B CE1 1 
ATOM   4291 C CE2 . TYR B 1 173 ? -18.678 -5.509  3.419   1.00 40.98 ? 173 TYR B CE2 1 
ATOM   4292 C CZ  . TYR B 1 173 ? -17.737 -5.094  4.357   1.00 41.76 ? 173 TYR B CZ  1 
ATOM   4293 O OH  . TYR B 1 173 ? -17.173 -3.840  4.235   1.00 38.30 ? 173 TYR B OH  1 
ATOM   4294 N N   . PHE B 1 174 ? -22.719 -8.770  4.296   1.00 36.61 ? 174 PHE B N   1 
ATOM   4295 C CA  . PHE B 1 174 ? -23.899 -8.159  3.685   1.00 36.80 ? 174 PHE B CA  1 
ATOM   4296 C C   . PHE B 1 174 ? -25.165 -8.813  4.238   1.00 37.50 ? 174 PHE B C   1 
ATOM   4297 O O   . PHE B 1 174 ? -25.614 -9.833  3.715   1.00 36.79 ? 174 PHE B O   1 
ATOM   4298 C CB  . PHE B 1 174 ? -23.894 -8.345  2.165   1.00 34.01 ? 174 PHE B CB  1 
ATOM   4299 C CG  . PHE B 1 174 ? -22.775 -7.637  1.464   1.00 33.06 ? 174 PHE B CG  1 
ATOM   4300 C CD1 . PHE B 1 174 ? -21.886 -8.348  0.659   1.00 32.96 ? 174 PHE B CD1 1 
ATOM   4301 C CD2 . PHE B 1 174 ? -22.628 -6.261  1.578   1.00 30.42 ? 174 PHE B CD2 1 
ATOM   4302 C CE1 . PHE B 1 174 ? -20.868 -7.701  -0.028  1.00 33.59 ? 174 PHE B CE1 1 
ATOM   4303 C CE2 . PHE B 1 174 ? -21.615 -5.596  0.897   1.00 33.14 ? 174 PHE B CE2 1 
ATOM   4304 C CZ  . PHE B 1 174 ? -20.730 -6.319  0.089   1.00 35.93 ? 174 PHE B CZ  1 
ATOM   4305 N N   . PRO B 1 175 ? -25.751 -8.238  5.301   1.00 37.74 ? 175 PRO B N   1 
ATOM   4306 C CA  . PRO B 1 175 ? -26.974 -8.775  5.913   1.00 38.18 ? 175 PRO B CA  1 
ATOM   4307 C C   . PRO B 1 175 ? -28.137 -8.812  4.913   1.00 40.32 ? 175 PRO B C   1 
ATOM   4308 O O   . PRO B 1 175 ? -28.582 -7.769  4.430   1.00 41.76 ? 175 PRO B O   1 
ATOM   4309 C CB  . PRO B 1 175 ? -27.245 -7.798  7.054   1.00 36.38 ? 175 PRO B CB  1 
ATOM   4310 C CG  . PRO B 1 175 ? -25.886 -7.299  7.414   1.00 36.44 ? 175 PRO B CG  1 
ATOM   4311 C CD  . PRO B 1 175 ? -25.246 -7.085  6.067   1.00 36.10 ? 175 PRO B CD  1 
ATOM   4312 N N   . GLY B 1 176 ? -28.626 -10.008 4.603   1.00 41.24 ? 176 GLY B N   1 
ATOM   4313 C CA  . GLY B 1 176 ? -29.730 -10.123 3.669   1.00 42.31 ? 176 GLY B CA  1 
ATOM   4314 C C   . GLY B 1 176 ? -29.370 -10.779 2.350   1.00 46.39 ? 176 GLY B C   1 
ATOM   4315 O O   . GLY B 1 176 ? -30.260 -11.142 1.577   1.00 48.64 ? 176 GLY B O   1 
ATOM   4316 N N   . GLY B 1 177 ? -28.072 -10.930 2.084   1.00 47.67 ? 177 GLY B N   1 
ATOM   4317 C CA  . GLY B 1 177 ? -27.629 -11.555 0.846   1.00 44.83 ? 177 GLY B CA  1 
ATOM   4318 C C   . GLY B 1 177 ? -27.363 -10.557 -0.269  1.00 44.63 ? 177 GLY B C   1 
ATOM   4319 O O   . GLY B 1 177 ? -26.755 -10.895 -1.293  1.00 46.70 ? 177 GLY B O   1 
ATOM   4320 N N   . SER B 1 178 ? -27.819 -9.324  -0.069  1.00 40.89 ? 178 SER B N   1 
ATOM   4321 C CA  . SER B 1 178 ? -27.642 -8.263  -1.052  1.00 39.46 ? 178 SER B CA  1 
ATOM   4322 C C   . SER B 1 178 ? -26.407 -7.404  -0.779  1.00 37.41 ? 178 SER B C   1 
ATOM   4323 O O   . SER B 1 178 ? -26.251 -6.822  0.300   1.00 37.28 ? 178 SER B O   1 
ATOM   4324 C CB  . SER B 1 178 ? -28.892 -7.385  -1.084  1.00 43.57 ? 178 SER B CB  1 
ATOM   4325 O OG  . SER B 1 178 ? -29.356 -7.130  0.236   1.00 53.10 ? 178 SER B OG  1 
ATOM   4326 N N   . VAL B 1 179 ? -25.531 -7.336  -1.772  1.00 34.48 ? 179 VAL B N   1 
ATOM   4327 C CA  . VAL B 1 179 ? -24.307 -6.559  -1.676  1.00 33.51 ? 179 VAL B CA  1 
ATOM   4328 C C   . VAL B 1 179 ? -24.595 -5.057  -1.780  1.00 33.03 ? 179 VAL B C   1 
ATOM   4329 O O   . VAL B 1 179 ? -25.446 -4.633  -2.566  1.00 33.25 ? 179 VAL B O   1 
ATOM   4330 C CB  . VAL B 1 179 ? -23.327 -6.971  -2.800  1.00 33.75 ? 179 VAL B CB  1 
ATOM   4331 C CG1 . VAL B 1 179 ? -23.014 -8.447  -2.689  1.00 33.53 ? 179 VAL B CG1 1 
ATOM   4332 C CG2 . VAL B 1 179 ? -23.936 -6.677  -4.169  1.00 30.21 ? 179 VAL B CG2 1 
ATOM   4333 N N   . THR B 1 180 ? -23.901 -4.257  -0.975  1.00 31.28 ? 180 THR B N   1 
ATOM   4334 C CA  . THR B 1 180 ? -24.077 -2.807  -1.009  1.00 30.77 ? 180 THR B CA  1 
ATOM   4335 C C   . THR B 1 180 ? -22.726 -2.128  -1.229  1.00 29.99 ? 180 THR B C   1 
ATOM   4336 O O   . THR B 1 180 ? -21.704 -2.560  -0.688  1.00 30.34 ? 180 THR B O   1 
ATOM   4337 C CB  . THR B 1 180 ? -24.693 -2.286  0.286   1.00 32.12 ? 180 THR B CB  1 
ATOM   4338 O OG1 . THR B 1 180 ? -23.750 -2.442  1.352   1.00 36.48 ? 180 THR B OG1 1 
ATOM   4339 C CG2 . THR B 1 180 ? -25.967 -3.056  0.606   1.00 27.71 ? 180 THR B CG2 1 
ATOM   4340 N N   . PRO B 1 181 ? -22.710 -1.048  -2.026  1.00 26.70 ? 181 PRO B N   1 
ATOM   4341 C CA  . PRO B 1 181 ? -21.513 -0.269  -2.364  1.00 26.92 ? 181 PRO B CA  1 
ATOM   4342 C C   . PRO B 1 181 ? -20.950 0.577   -1.232  1.00 24.35 ? 181 PRO B C   1 
ATOM   4343 O O   . PRO B 1 181 ? -21.573 0.741   -0.191  1.00 25.53 ? 181 PRO B O   1 
ATOM   4344 C CB  . PRO B 1 181 ? -21.981 0.619   -3.524  1.00 30.06 ? 181 PRO B CB  1 
ATOM   4345 C CG  . PRO B 1 181 ? -23.321 0.044   -3.941  1.00 28.23 ? 181 PRO B CG  1 
ATOM   4346 C CD  . PRO B 1 181 ? -23.898 -0.473  -2.674  1.00 25.79 ? 181 PRO B CD  1 
ATOM   4347 N N   . VAL B 1 182 ? -19.758 1.113   -1.462  1.00 24.55 ? 182 VAL B N   1 
ATOM   4348 C CA  . VAL B 1 182 ? -19.081 1.981   -0.504  1.00 23.31 ? 182 VAL B CA  1 
ATOM   4349 C C   . VAL B 1 182 ? -18.450 3.132   -1.281  1.00 20.49 ? 182 VAL B C   1 
ATOM   4350 O O   . VAL B 1 182 ? -18.063 2.970   -2.438  1.00 21.17 ? 182 VAL B O   1 
ATOM   4351 C CB  . VAL B 1 182 ? -17.955 1.232   0.276   1.00 24.99 ? 182 VAL B CB  1 
ATOM   4352 C CG1 . VAL B 1 182 ? -18.539 0.093   1.079   1.00 27.23 ? 182 VAL B CG1 1 
ATOM   4353 C CG2 . VAL B 1 182 ? -16.912 0.702   -0.682  1.00 19.50 ? 182 VAL B CG2 1 
ATOM   4354 N N   . SER B 1 183 ? -18.365 4.292   -0.651  1.00 19.77 ? 183 SER B N   1 
ATOM   4355 C CA  . SER B 1 183 ? -17.759 5.459   -1.282  1.00 20.95 ? 183 SER B CA  1 
ATOM   4356 C C   . SER B 1 183 ? -16.311 5.512   -0.830  1.00 19.84 ? 183 SER B C   1 
ATOM   4357 O O   . SER B 1 183 ? -15.988 5.106   0.289   1.00 21.84 ? 183 SER B O   1 
ATOM   4358 C CB  . SER B 1 183 ? -18.473 6.743   -0.853  1.00 21.04 ? 183 SER B CB  1 
ATOM   4359 O OG  . SER B 1 183 ? -19.673 6.929   -1.576  1.00 25.98 ? 183 SER B OG  1 
ATOM   4360 N N   . LEU B 1 184 ? -15.439 6.019   -1.690  1.00 17.39 ? 184 LEU B N   1 
ATOM   4361 C CA  . LEU B 1 184 ? -14.037 6.090   -1.341  1.00 18.34 ? 184 LEU B CA  1 
ATOM   4362 C C   . LEU B 1 184 ? -13.494 7.508   -1.422  1.00 19.22 ? 184 LEU B C   1 
ATOM   4363 O O   . LEU B 1 184 ? -13.885 8.298   -2.294  1.00 16.21 ? 184 LEU B O   1 
ATOM   4364 C CB  . LEU B 1 184 ? -13.223 5.178   -2.265  1.00 23.05 ? 184 LEU B CB  1 
ATOM   4365 C CG  . LEU B 1 184 ? -13.708 3.743   -2.519  1.00 21.43 ? 184 LEU B CG  1 
ATOM   4366 C CD1 . LEU B 1 184 ? -12.713 3.041   -3.430  1.00 18.76 ? 184 LEU B CD1 1 
ATOM   4367 C CD2 . LEU B 1 184 ? -13.868 2.996   -1.209  1.00 24.86 ? 184 LEU B CD2 1 
ATOM   4368 N N   . LEU B 1 185 ? -12.607 7.830   -0.484  1.00 20.09 ? 185 LEU B N   1 
ATOM   4369 C CA  . LEU B 1 185 ? -11.961 9.136   -0.460  1.00 19.95 ? 185 LEU B CA  1 
ATOM   4370 C C   . LEU B 1 185 ? -10.556 8.921   -1.011  1.00 20.25 ? 185 LEU B C   1 
ATOM   4371 O O   . LEU B 1 185 ? -9.790  8.106   -0.479  1.00 19.69 ? 185 LEU B O   1 
ATOM   4372 C CB  . LEU B 1 185 ? -11.865 9.683   0.962   1.00 15.47 ? 185 LEU B CB  1 
ATOM   4373 C CG  . LEU B 1 185 ? -10.833 10.806  1.103   1.00 21.12 ? 185 LEU B CG  1 
ATOM   4374 C CD1 . LEU B 1 185 ? -11.363 12.081  0.468   1.00 16.01 ? 185 LEU B CD1 1 
ATOM   4375 C CD2 . LEU B 1 185 ? -10.517 11.033  2.563   1.00 21.12 ? 185 LEU B CD2 1 
ATOM   4376 N N   . ALA B 1 186 ? -10.231 9.641   -2.081  1.00 20.43 ? 186 ALA B N   1 
ATOM   4377 C CA  . ALA B 1 186 ? -8.921  9.542   -2.712  1.00 20.57 ? 186 ALA B CA  1 
ATOM   4378 C C   . ALA B 1 186 ? -8.169  10.866  -2.571  1.00 23.72 ? 186 ALA B C   1 
ATOM   4379 O O   . ALA B 1 186 ? -8.433  11.829  -3.293  1.00 26.16 ? 186 ALA B O   1 
ATOM   4380 C CB  . ALA B 1 186 ? -9.078  9.173   -4.177  1.00 14.71 ? 186 ALA B CB  1 
ATOM   4381 N N   . ASP B 1 187 ? -7.225  10.902  -1.640  1.00 24.80 ? 187 ASP B N   1 
ATOM   4382 C CA  . ASP B 1 187 ? -6.443  12.100  -1.391  1.00 25.33 ? 187 ASP B CA  1 
ATOM   4383 C C   . ASP B 1 187 ? -4.951  11.770  -1.384  1.00 24.97 ? 187 ASP B C   1 
ATOM   4384 O O   . ASP B 1 187 ? -4.458  11.102  -0.482  1.00 23.58 ? 187 ASP B O   1 
ATOM   4385 C CB  . ASP B 1 187 ? -6.844  12.703  -0.044  1.00 27.62 ? 187 ASP B CB  1 
ATOM   4386 C CG  . ASP B 1 187 ? -6.336  14.114  0.130   1.00 30.17 ? 187 ASP B CG  1 
ATOM   4387 O OD1 . ASP B 1 187 ? -5.120  14.329  -0.062  1.00 31.83 ? 187 ASP B OD1 1 
ATOM   4388 O OD2 . ASP B 1 187 ? -7.151  15.005  0.453   1.00 29.04 ? 187 ASP B OD2 1 
ATOM   4389 N N   . PRO B 1 188 ? -4.208  12.269  -2.379  1.00 24.63 ? 188 PRO B N   1 
ATOM   4390 C CA  . PRO B 1 188 ? -2.766  12.037  -2.516  1.00 23.71 ? 188 PRO B CA  1 
ATOM   4391 C C   . PRO B 1 188 ? -1.942  12.362  -1.273  1.00 23.38 ? 188 PRO B C   1 
ATOM   4392 O O   . PRO B 1 188 ? -0.838  11.848  -1.108  1.00 23.36 ? 188 PRO B O   1 
ATOM   4393 C CB  . PRO B 1 188 ? -2.383  12.929  -3.691  1.00 24.22 ? 188 PRO B CB  1 
ATOM   4394 C CG  . PRO B 1 188 ? -3.640  12.993  -4.495  1.00 24.88 ? 188 PRO B CG  1 
ATOM   4395 C CD  . PRO B 1 188 ? -4.686  13.179  -3.432  1.00 23.99 ? 188 PRO B CD  1 
ATOM   4396 N N   . ALA B 1 189 ? -2.477  13.211  -0.402  1.00 19.67 ? 189 ALA B N   1 
ATOM   4397 C CA  . ALA B 1 189 ? -1.763  13.603  0.804   1.00 20.83 ? 189 ALA B CA  1 
ATOM   4398 C C   . ALA B 1 189 ? -1.449  12.420  1.719   1.00 25.03 ? 189 ALA B C   1 
ATOM   4399 O O   . ALA B 1 189 ? -0.512  12.475  2.519   1.00 25.72 ? 189 ALA B O   1 
ATOM   4400 C CB  . ALA B 1 189 ? -2.577  14.639  1.569   1.00 13.00 ? 189 ALA B CB  1 
ATOM   4401 N N   . PHE B 1 190 ? -2.236  11.352  1.599   1.00 27.88 ? 190 PHE B N   1 
ATOM   4402 C CA  . PHE B 1 190 ? -2.059  10.173  2.439   1.00 27.24 ? 190 PHE B CA  1 
ATOM   4403 C C   . PHE B 1 190 ? -1.336  9.020   1.756   1.00 26.24 ? 190 PHE B C   1 
ATOM   4404 O O   . PHE B 1 190 ? -1.697  8.599   0.658   1.00 27.57 ? 190 PHE B O   1 
ATOM   4405 C CB  . PHE B 1 190 ? -3.428  9.746   2.959   1.00 33.08 ? 190 PHE B CB  1 
ATOM   4406 C CG  . PHE B 1 190 ? -4.177  10.867  3.619   1.00 34.07 ? 190 PHE B CG  1 
ATOM   4407 C CD1 . PHE B 1 190 ? -5.433  11.255  3.156   1.00 33.97 ? 190 PHE B CD1 1 
ATOM   4408 C CD2 . PHE B 1 190 ? -3.595  11.577  4.668   1.00 34.29 ? 190 PHE B CD2 1 
ATOM   4409 C CE1 . PHE B 1 190 ? -6.097  12.338  3.725   1.00 37.43 ? 190 PHE B CE1 1 
ATOM   4410 C CE2 . PHE B 1 190 ? -4.247  12.661  5.244   1.00 35.48 ? 190 PHE B CE2 1 
ATOM   4411 C CZ  . PHE B 1 190 ? -5.504  13.044  4.771   1.00 36.43 ? 190 PHE B CZ  1 
ATOM   4412 N N   . ILE B 1 191 ? -0.304  8.519   2.424   1.00 23.81 ? 191 ILE B N   1 
ATOM   4413 C CA  . ILE B 1 191 ? 0.509   7.436   1.897   1.00 23.32 ? 191 ILE B CA  1 
ATOM   4414 C C   . ILE B 1 191 ? 0.633   6.304   2.907   1.00 24.86 ? 191 ILE B C   1 
ATOM   4415 O O   . ILE B 1 191 ? 1.282   6.470   3.944   1.00 23.47 ? 191 ILE B O   1 
ATOM   4416 C CB  . ILE B 1 191 ? 1.933   7.933   1.577   1.00 22.84 ? 191 ILE B CB  1 
ATOM   4417 C CG1 . ILE B 1 191 ? 1.888   9.084   0.556   1.00 24.06 ? 191 ILE B CG1 1 
ATOM   4418 C CG2 . ILE B 1 191 ? 2.778   6.770   1.073   1.00 26.88 ? 191 ILE B CG2 1 
ATOM   4419 C CD1 . ILE B 1 191 ? 1.569   8.680   -0.882  1.00 21.16 ? 191 ILE B CD1 1 
ATOM   4420 N N   . ARG B 1 192 ? 0.038   5.150   2.600   1.00 24.61 ? 192 ARG B N   1 
ATOM   4421 C CA  . ARG B 1 192 ? 0.112   4.021   3.512   1.00 24.71 ? 192 ARG B CA  1 
ATOM   4422 C C   . ARG B 1 192 ? 1.402   3.224   3.391   1.00 25.69 ? 192 ARG B C   1 
ATOM   4423 O O   . ARG B 1 192 ? 1.810   2.584   4.348   1.00 28.86 ? 192 ARG B O   1 
ATOM   4424 C CB  . ARG B 1 192 ? -1.096  3.081   3.348   1.00 25.28 ? 192 ARG B CB  1 
ATOM   4425 C CG  . ARG B 1 192 ? -1.194  2.335   2.036   1.00 32.01 ? 192 ARG B CG  1 
ATOM   4426 C CD  . ARG B 1 192 ? -2.210  1.178   2.136   1.00 28.84 ? 192 ARG B CD  1 
ATOM   4427 N NE  . ARG B 1 192 ? -1.754  0.119   3.035   1.00 27.79 ? 192 ARG B NE  1 
ATOM   4428 C CZ  . ARG B 1 192 ? -0.916  -0.865  2.698   1.00 24.94 ? 192 ARG B CZ  1 
ATOM   4429 N NH1 . ARG B 1 192 ? -0.428  -0.956  1.469   1.00 16.39 ? 192 ARG B NH1 1 
ATOM   4430 N NH2 . ARG B 1 192 ? -0.549  -1.759  3.606   1.00 23.89 ? 192 ARG B NH2 1 
ATOM   4431 N N   . ALA B 1 193 ? 2.053   3.262   2.231   1.00 26.38 ? 193 ALA B N   1 
ATOM   4432 C CA  . ALA B 1 193 ? 3.302   2.519   2.043   1.00 25.54 ? 193 ALA B CA  1 
ATOM   4433 C C   . ALA B 1 193 ? 4.143   3.056   0.889   1.00 26.23 ? 193 ALA B C   1 
ATOM   4434 O O   . ALA B 1 193 ? 3.618   3.618   -0.062  1.00 28.04 ? 193 ALA B O   1 
ATOM   4435 C CB  . ALA B 1 193 ? 3.004   1.049   1.833   1.00 24.29 ? 193 ALA B CB  1 
ATOM   4436 N N   . TRP B 1 194 ? 5.452   2.846   0.979   1.00 27.19 ? 194 TRP B N   1 
ATOM   4437 C CA  . TRP B 1 194 ? 6.421   3.323   -0.005  1.00 25.32 ? 194 TRP B CA  1 
ATOM   4438 C C   . TRP B 1 194 ? 7.258   2.134   -0.531  1.00 24.57 ? 194 TRP B C   1 
ATOM   4439 O O   . TRP B 1 194 ? 7.436   1.151   0.178   1.00 22.38 ? 194 TRP B O   1 
ATOM   4440 C CB  . TRP B 1 194 ? 7.309   4.356   0.708   1.00 24.60 ? 194 TRP B CB  1 
ATOM   4441 C CG  . TRP B 1 194 ? 8.113   5.280   -0.165  1.00 32.19 ? 194 TRP B CG  1 
ATOM   4442 C CD1 . TRP B 1 194 ? 9.362   5.055   -0.686  1.00 32.99 ? 194 TRP B CD1 1 
ATOM   4443 C CD2 . TRP B 1 194 ? 7.732   6.593   -0.601  1.00 33.83 ? 194 TRP B CD2 1 
ATOM   4444 N NE1 . TRP B 1 194 ? 9.778   6.148   -1.413  1.00 30.24 ? 194 TRP B NE1 1 
ATOM   4445 C CE2 . TRP B 1 194 ? 8.797   7.102   -1.381  1.00 31.54 ? 194 TRP B CE2 1 
ATOM   4446 C CE3 . TRP B 1 194 ? 6.592   7.389   -0.411  1.00 33.69 ? 194 TRP B CE3 1 
ATOM   4447 C CZ2 . TRP B 1 194 ? 8.753   8.366   -1.970  1.00 31.08 ? 194 TRP B CZ2 1 
ATOM   4448 C CZ3 . TRP B 1 194 ? 6.552   8.647   -0.996  1.00 32.43 ? 194 TRP B CZ3 1 
ATOM   4449 C CH2 . TRP B 1 194 ? 7.628   9.122   -1.768  1.00 29.08 ? 194 TRP B CH2 1 
ATOM   4450 N N   . VAL B 1 195 ? 7.743   2.207   -1.773  1.00 26.20 ? 195 VAL B N   1 
ATOM   4451 C CA  . VAL B 1 195 ? 8.581   1.135   -2.331  1.00 27.73 ? 195 VAL B CA  1 
ATOM   4452 C C   . VAL B 1 195 ? 9.841   1.039   -1.463  1.00 26.94 ? 195 VAL B C   1 
ATOM   4453 O O   . VAL B 1 195 ? 10.422  2.054   -1.079  1.00 27.80 ? 195 VAL B O   1 
ATOM   4454 C CB  . VAL B 1 195 ? 9.002   1.422   -3.811  1.00 26.27 ? 195 VAL B CB  1 
ATOM   4455 C CG1 . VAL B 1 195 ? 10.019  0.387   -4.275  1.00 25.04 ? 195 VAL B CG1 1 
ATOM   4456 C CG2 . VAL B 1 195 ? 7.783   1.376   -4.726  1.00 22.12 ? 195 VAL B CG2 1 
ATOM   4457 N N   . GLY B 1 196 ? 10.267  -0.176  -1.157  1.00 26.03 ? 196 GLY B N   1 
ATOM   4458 C CA  . GLY B 1 196 ? 11.430  -0.325  -0.303  1.00 28.08 ? 196 GLY B CA  1 
ATOM   4459 C C   . GLY B 1 196 ? 10.922  -0.247  1.126   1.00 30.06 ? 196 GLY B C   1 
ATOM   4460 O O   . GLY B 1 196 ? 11.682  -0.326  2.095   1.00 31.27 ? 196 GLY B O   1 
ATOM   4461 N N   . GLY B 1 197 ? 9.609   -0.076  1.246   1.00 29.58 ? 197 GLY B N   1 
ATOM   4462 C CA  . GLY B 1 197 ? 8.979   -0.003  2.548   1.00 27.24 ? 197 GLY B CA  1 
ATOM   4463 C C   . GLY B 1 197 ? 8.603   -1.394  3.025   1.00 26.34 ? 197 GLY B C   1 
ATOM   4464 O O   . GLY B 1 197 ? 9.268   -2.374  2.695   1.00 26.12 ? 197 GLY B O   1 
ATOM   4465 N N   . VAL B 1 198 ? 7.517   -1.496  3.777   1.00 23.71 ? 198 VAL B N   1 
ATOM   4466 C CA  . VAL B 1 198 ? 7.108   -2.785  4.315   1.00 20.00 ? 198 VAL B CA  1 
ATOM   4467 C C   . VAL B 1 198 ? 5.580   -2.988  4.197   1.00 18.76 ? 198 VAL B C   1 
ATOM   4468 O O   . VAL B 1 198 ? 4.980   -3.802  4.914   1.00 16.01 ? 198 VAL B O   1 
ATOM   4469 C CB  . VAL B 1 198 ? 7.595   -2.874  5.799   1.00 20.73 ? 198 VAL B CB  1 
ATOM   4470 C CG1 . VAL B 1 198 ? 6.674   -2.070  6.710   1.00 21.10 ? 198 VAL B CG1 1 
ATOM   4471 C CG2 . VAL B 1 198 ? 7.686   -4.299  6.240   1.00 26.24 ? 198 VAL B CG2 1 
ATOM   4472 N N   . GLY B 1 199 ? 4.965   -2.248  3.271   1.00 16.14 ? 199 GLY B N   1 
ATOM   4473 C CA  . GLY B 1 199 ? 3.530   -2.337  3.057   1.00 15.67 ? 199 GLY B CA  1 
ATOM   4474 C C   . GLY B 1 199 ? 3.031   -3.625  2.412   1.00 18.47 ? 199 GLY B C   1 
ATOM   4475 O O   . GLY B 1 199 ? 1.821   -3.869  2.336   1.00 17.78 ? 199 GLY B O   1 
ATOM   4476 N N   . ASN B 1 200 ? 3.952   -4.453  1.933   1.00 16.47 ? 200 ASN B N   1 
ATOM   4477 C CA  . ASN B 1 200 ? 3.566   -5.706  1.313   1.00 19.23 ? 200 ASN B CA  1 
ATOM   4478 C C   . ASN B 1 200 ? 3.575   -6.858  2.322   1.00 19.29 ? 200 ASN B C   1 
ATOM   4479 O O   . ASN B 1 200 ? 3.546   -8.021  1.944   1.00 14.14 ? 200 ASN B O   1 
ATOM   4480 C CB  . ASN B 1 200 ? 4.471   -6.023  0.114   1.00 19.48 ? 200 ASN B CB  1 
ATOM   4481 C CG  . ASN B 1 200 ? 5.954   -5.997  0.457   1.00 21.52 ? 200 ASN B CG  1 
ATOM   4482 O OD1 . ASN B 1 200 ? 6.749   -6.720  -0.153  1.00 25.10 ? 200 ASN B OD1 1 
ATOM   4483 N ND2 . ASN B 1 200 ? 6.339   -5.154  1.411   1.00 16.58 ? 200 ASN B ND2 1 
ATOM   4484 N N   . TYR B 1 201 ? 3.601   -6.516  3.610   1.00 20.02 ? 201 TYR B N   1 
ATOM   4485 C CA  . TYR B 1 201 ? 3.577   -7.512  4.689   1.00 19.23 ? 201 TYR B CA  1 
ATOM   4486 C C   . TYR B 1 201 ? 2.434   -7.163  5.639   1.00 15.21 ? 201 TYR B C   1 
ATOM   4487 O O   . TYR B 1 201 ? 2.062   -5.996  5.763   1.00 11.58 ? 201 TYR B O   1 
ATOM   4488 C CB  . TYR B 1 201 ? 4.885   -7.488  5.478   1.00 19.59 ? 201 TYR B CB  1 
ATOM   4489 C CG  . TYR B 1 201 ? 6.128   -7.800  4.679   1.00 18.50 ? 201 TYR B CG  1 
ATOM   4490 C CD1 . TYR B 1 201 ? 6.471   -9.116  4.371   1.00 20.13 ? 201 TYR B CD1 1 
ATOM   4491 C CD2 . TYR B 1 201 ? 6.985   -6.784  4.271   1.00 18.90 ? 201 TYR B CD2 1 
ATOM   4492 C CE1 . TYR B 1 201 ? 7.646   -9.413  3.681   1.00 19.23 ? 201 TYR B CE1 1 
ATOM   4493 C CE2 . TYR B 1 201 ? 8.160   -7.064  3.576   1.00 21.41 ? 201 TYR B CE2 1 
ATOM   4494 C CZ  . TYR B 1 201 ? 8.486   -8.377  3.286   1.00 22.27 ? 201 TYR B CZ  1 
ATOM   4495 O OH  . TYR B 1 201 ? 9.651   -8.643  2.611   1.00 23.81 ? 201 TYR B OH  1 
ATOM   4496 N N   . LYS B 1 202 ? 1.880   -8.163  6.319   1.00 12.71 ? 202 LYS B N   1 
ATOM   4497 C CA  . LYS B 1 202 ? 0.799   -7.890  7.250   1.00 13.68 ? 202 LYS B CA  1 
ATOM   4498 C C   . LYS B 1 202 ? 1.341   -7.584  8.656   1.00 15.26 ? 202 LYS B C   1 
ATOM   4499 O O   . LYS B 1 202 ? 1.239   -8.401  9.578   1.00 13.60 ? 202 LYS B O   1 
ATOM   4500 C CB  . LYS B 1 202 ? -0.187  -9.061  7.274   1.00 14.52 ? 202 LYS B CB  1 
ATOM   4501 C CG  . LYS B 1 202 ? -1.598  -8.649  6.869   1.00 17.25 ? 202 LYS B CG  1 
ATOM   4502 C CD  . LYS B 1 202 ? -2.617  -9.778  6.994   1.00 17.83 ? 202 LYS B CD  1 
ATOM   4503 C CE  . LYS B 1 202 ? -4.041  -9.265  6.721   1.00 17.81 ? 202 LYS B CE  1 
ATOM   4504 N NZ  . LYS B 1 202 ? -4.254  -8.944  5.316   1.00 20.37 ? 202 LYS B NZ  1 
ATOM   4505 N N   . LEU B 1 203 ? 1.914   -6.387  8.806   1.00 13.29 ? 203 LEU B N   1 
ATOM   4506 C CA  . LEU B 1 203 ? 2.505   -5.947  10.075  1.00 15.22 ? 203 LEU B CA  1 
ATOM   4507 C C   . LEU B 1 203 ? 1.679   -4.869  10.781  1.00 13.03 ? 203 LEU B C   1 
ATOM   4508 O O   . LEU B 1 203 ? 1.226   -3.903  10.158  1.00 13.58 ? 203 LEU B O   1 
ATOM   4509 C CB  . LEU B 1 203 ? 3.926   -5.412  9.832   1.00 18.74 ? 203 LEU B CB  1 
ATOM   4510 C CG  . LEU B 1 203 ? 4.922   -6.233  8.990   1.00 19.68 ? 203 LEU B CG  1 
ATOM   4511 C CD1 . LEU B 1 203 ? 6.209   -5.435  8.835   1.00 17.97 ? 203 LEU B CD1 1 
ATOM   4512 C CD2 . LEU B 1 203 ? 5.207   -7.575  9.638   1.00 17.38 ? 203 LEU B CD2 1 
ATOM   4513 N N   . GLY B 1 204 ? 1.500   -5.021  12.088  1.00 10.63 ? 204 GLY B N   1 
ATOM   4514 C CA  . GLY B 1 204 ? 0.715   -4.048  12.826  1.00 12.32 ? 204 GLY B CA  1 
ATOM   4515 C C   . GLY B 1 204 ? 1.027   -2.609  12.452  1.00 13.56 ? 204 GLY B C   1 
ATOM   4516 O O   . GLY B 1 204 ? 0.115   -1.811  12.218  1.00 14.02 ? 204 GLY B O   1 
ATOM   4517 N N   . GLY B 1 205 ? 2.321   -2.292  12.389  1.00 13.67 ? 205 GLY B N   1 
ATOM   4518 C CA  . GLY B 1 205 ? 2.775   -0.950  12.049  1.00 14.27 ? 205 GLY B CA  1 
ATOM   4519 C C   . GLY B 1 205 ? 2.162   -0.298  10.817  1.00 14.43 ? 205 GLY B C   1 
ATOM   4520 O O   . GLY B 1 205 ? 2.160   0.918   10.706  1.00 14.12 ? 205 GLY B O   1 
ATOM   4521 N N   . ASN B 1 206 ? 1.648   -1.094  9.889   1.00 15.62 ? 206 ASN B N   1 
ATOM   4522 C CA  . ASN B 1 206 ? 1.022   -0.546  8.694   1.00 13.44 ? 206 ASN B CA  1 
ATOM   4523 C C   . ASN B 1 206 ? -0.404  -0.054  8.932   1.00 12.65 ? 206 ASN B C   1 
ATOM   4524 O O   . ASN B 1 206 ? -0.928  0.692   8.113   1.00 17.24 ? 206 ASN B O   1 
ATOM   4525 C CB  . ASN B 1 206 ? 0.980   -1.598  7.578   1.00 15.02 ? 206 ASN B CB  1 
ATOM   4526 C CG  . ASN B 1 206 ? 2.350   -1.955  7.062   1.00 17.27 ? 206 ASN B CG  1 
ATOM   4527 O OD1 . ASN B 1 206 ? 2.561   -3.049  6.526   1.00 16.13 ? 206 ASN B OD1 1 
ATOM   4528 N ND2 . ASN B 1 206 ? 3.294   -1.030  7.205   1.00 19.04 ? 206 ASN B ND2 1 
ATOM   4529 N N   . TYR B 1 207 ? -1.042  -0.436  10.038  1.00 11.10 ? 207 TYR B N   1 
ATOM   4530 C CA  . TYR B 1 207 ? -2.428  -0.005  10.237  1.00 12.35 ? 207 TYR B CA  1 
ATOM   4531 C C   . TYR B 1 207 ? -2.707  1.133   11.210  1.00 13.50 ? 207 TYR B C   1 
ATOM   4532 O O   . TYR B 1 207 ? -3.639  1.920   10.994  1.00 7.84  ? 207 TYR B O   1 
ATOM   4533 C CB  . TYR B 1 207 ? -3.295  -1.223  10.581  1.00 13.19 ? 207 TYR B CB  1 
ATOM   4534 C CG  . TYR B 1 207 ? -3.039  -2.348  9.611   1.00 17.49 ? 207 TYR B CG  1 
ATOM   4535 C CD1 . TYR B 1 207 ? -1.876  -3.111  9.707   1.00 17.37 ? 207 TYR B CD1 1 
ATOM   4536 C CD2 . TYR B 1 207 ? -3.876  -2.562  8.516   1.00 17.53 ? 207 TYR B CD2 1 
ATOM   4537 C CE1 . TYR B 1 207 ? -1.542  -4.039  8.744   1.00 17.38 ? 207 TYR B CE1 1 
ATOM   4538 C CE2 . TYR B 1 207 ? -3.549  -3.496  7.540   1.00 15.14 ? 207 TYR B CE2 1 
ATOM   4539 C CZ  . TYR B 1 207 ? -2.371  -4.227  7.657   1.00 19.39 ? 207 TYR B CZ  1 
ATOM   4540 O OH  . TYR B 1 207 ? -1.966  -5.100  6.662   1.00 15.70 ? 207 TYR B OH  1 
ATOM   4541 N N   . GLY B 1 208 ? -1.906  1.230   12.268  1.00 15.38 ? 208 GLY B N   1 
ATOM   4542 C CA  . GLY B 1 208 ? -2.105  2.287   13.246  1.00 12.35 ? 208 GLY B CA  1 
ATOM   4543 C C   . GLY B 1 208 ? -2.235  3.648   12.588  1.00 13.74 ? 208 GLY B C   1 
ATOM   4544 O O   . GLY B 1 208 ? -3.176  4.391   12.865  1.00 14.01 ? 208 GLY B O   1 
ATOM   4545 N N   . PRO B 1 209 ? -1.303  3.998   11.689  1.00 14.52 ? 209 PRO B N   1 
ATOM   4546 C CA  . PRO B 1 209 ? -1.361  5.299   11.016  1.00 11.29 ? 209 PRO B CA  1 
ATOM   4547 C C   . PRO B 1 209 ? -2.625  5.516   10.170  1.00 13.33 ? 209 PRO B C   1 
ATOM   4548 O O   . PRO B 1 209 ? -2.990  6.655   9.888   1.00 14.28 ? 209 PRO B O   1 
ATOM   4549 C CB  . PRO B 1 209 ? -0.089  5.305   10.164  1.00 14.34 ? 209 PRO B CB  1 
ATOM   4550 C CG  . PRO B 1 209 ? 0.854   4.370   10.911  1.00 12.73 ? 209 PRO B CG  1 
ATOM   4551 C CD  . PRO B 1 209 ? -0.075  3.256   11.324  1.00 9.89  ? 209 PRO B CD  1 
ATOM   4552 N N   . THR B 1 210 ? -3.300  4.440   9.771   1.00 10.95 ? 210 THR B N   1 
ATOM   4553 C CA  . THR B 1 210 ? -4.487  4.591   8.936   1.00 10.90 ? 210 THR B CA  1 
ATOM   4554 C C   . THR B 1 210 ? -5.762  5.008   9.683   1.00 15.01 ? 210 THR B C   1 
ATOM   4555 O O   . THR B 1 210 ? -6.729  5.445   9.059   1.00 18.52 ? 210 THR B O   1 
ATOM   4556 C CB  . THR B 1 210 ? -4.800  3.293   8.125   1.00 9.19  ? 210 THR B CB  1 
ATOM   4557 O OG1 . THR B 1 210 ? -5.177  2.243   9.020   1.00 11.49 ? 210 THR B OG1 1 
ATOM   4558 C CG2 . THR B 1 210 ? -3.589  2.851   7.309   1.00 12.67 ? 210 THR B CG2 1 
ATOM   4559 N N   . VAL B 1 211 ? -5.779  4.889   11.005  1.00 14.78 ? 211 VAL B N   1 
ATOM   4560 C CA  . VAL B 1 211 ? -6.978  5.257   11.752  1.00 14.40 ? 211 VAL B CA  1 
ATOM   4561 C C   . VAL B 1 211 ? -7.420  6.700   11.525  1.00 15.12 ? 211 VAL B C   1 
ATOM   4562 O O   . VAL B 1 211 ? -8.593  6.959   11.259  1.00 15.49 ? 211 VAL B O   1 
ATOM   4563 C CB  . VAL B 1 211 ? -6.789  5.027   13.248  1.00 18.28 ? 211 VAL B CB  1 
ATOM   4564 C CG1 . VAL B 1 211 ? -8.033  5.481   14.009  1.00 17.34 ? 211 VAL B CG1 1 
ATOM   4565 C CG2 . VAL B 1 211 ? -6.522  3.553   13.498  1.00 20.00 ? 211 VAL B CG2 1 
ATOM   4566 N N   . LEU B 1 212 ? -6.480  7.636   11.627  1.00 13.95 ? 212 LEU B N   1 
ATOM   4567 C CA  . LEU B 1 212 ? -6.775  9.046   11.415  1.00 14.00 ? 212 LEU B CA  1 
ATOM   4568 C C   . LEU B 1 212 ? -7.319  9.312   10.012  1.00 15.03 ? 212 LEU B C   1 
ATOM   4569 O O   . LEU B 1 212 ? -8.266  10.073  9.851   1.00 17.47 ? 212 LEU B O   1 
ATOM   4570 C CB  . LEU B 1 212 ? -5.515  9.887   11.620  1.00 18.27 ? 212 LEU B CB  1 
ATOM   4571 C CG  . LEU B 1 212 ? -5.676  11.395  11.382  1.00 19.83 ? 212 LEU B CG  1 
ATOM   4572 C CD1 . LEU B 1 212 ? -6.419  12.026  12.543  1.00 16.23 ? 212 LEU B CD1 1 
ATOM   4573 C CD2 . LEU B 1 212 ? -4.303  12.039  11.246  1.00 26.64 ? 212 LEU B CD2 1 
ATOM   4574 N N   . VAL B 1 213 ? -6.714  8.694   9.000   1.00 15.89 ? 213 VAL B N   1 
ATOM   4575 C CA  . VAL B 1 213 ? -7.149  8.881   7.617   1.00 18.37 ? 213 VAL B CA  1 
ATOM   4576 C C   . VAL B 1 213 ? -8.574  8.356   7.377   1.00 19.04 ? 213 VAL B C   1 
ATOM   4577 O O   . VAL B 1 213 ? -9.331  8.925   6.590   1.00 20.74 ? 213 VAL B O   1 
ATOM   4578 C CB  . VAL B 1 213 ? -6.154  8.202   6.628   1.00 19.36 ? 213 VAL B CB  1 
ATOM   4579 C CG1 . VAL B 1 213 ? -6.594  8.422   5.178   1.00 14.83 ? 213 VAL B CG1 1 
ATOM   4580 C CG2 . VAL B 1 213 ? -4.764  8.771   6.844   1.00 14.67 ? 213 VAL B CG2 1 
ATOM   4581 N N   . GLN B 1 214 ? -8.936  7.282   8.065   1.00 18.56 ? 214 GLN B N   1 
ATOM   4582 C CA  . GLN B 1 214 ? -10.272 6.696   7.944   1.00 22.24 ? 214 GLN B CA  1 
ATOM   4583 C C   . GLN B 1 214 ? -11.338 7.648   8.515   1.00 21.11 ? 214 GLN B C   1 
ATOM   4584 O O   . GLN B 1 214 ? -12.435 7.773   7.969   1.00 20.00 ? 214 GLN B O   1 
ATOM   4585 C CB  . GLN B 1 214 ? -10.301 5.342   8.667   1.00 24.79 ? 214 GLN B CB  1 
ATOM   4586 C CG  . GLN B 1 214 ? -11.685 4.761   8.919   1.00 36.36 ? 214 GLN B CG  1 
ATOM   4587 C CD  . GLN B 1 214 ? -12.386 4.305   7.652   1.00 40.91 ? 214 GLN B CD  1 
ATOM   4588 O OE1 . GLN B 1 214 ? -11.892 3.437   6.930   1.00 45.10 ? 214 GLN B OE1 1 
ATOM   4589 N NE2 . GLN B 1 214 ? -13.547 4.884   7.379   1.00 43.52 ? 214 GLN B NE2 1 
ATOM   4590 N N   . GLN B 1 215 ? -11.004 8.316   9.613   1.00 21.10 ? 215 GLN B N   1 
ATOM   4591 C CA  . GLN B 1 215 ? -11.910 9.277   10.242  1.00 24.41 ? 215 GLN B CA  1 
ATOM   4592 C C   . GLN B 1 215 ? -12.068 10.470  9.304   1.00 21.80 ? 215 GLN B C   1 
ATOM   4593 O O   . GLN B 1 215 ? -13.157 11.011  9.140   1.00 19.75 ? 215 GLN B O   1 
ATOM   4594 C CB  . GLN B 1 215 ? -11.332 9.764   11.579  1.00 26.02 ? 215 GLN B CB  1 
ATOM   4595 C CG  . GLN B 1 215 ? -11.172 8.673   12.627  1.00 36.97 ? 215 GLN B CG  1 
ATOM   4596 C CD  . GLN B 1 215 ? -12.475 8.344   13.333  1.00 39.59 ? 215 GLN B CD  1 
ATOM   4597 O OE1 . GLN B 1 215 ? -12.803 7.174   13.545  1.00 45.62 ? 215 GLN B OE1 1 
ATOM   4598 N NE2 . GLN B 1 215 ? -13.218 9.378   13.714  1.00 39.94 ? 215 GLN B NE2 1 
ATOM   4599 N N   . GLU B 1 216 ? -10.963 10.877  8.693   1.00 19.44 ? 216 GLU B N   1 
ATOM   4600 C CA  . GLU B 1 216 ? -10.988 11.993  7.779   1.00 20.74 ? 216 GLU B CA  1 
ATOM   4601 C C   . GLU B 1 216 ? -11.900 11.663  6.610   1.00 18.25 ? 216 GLU B C   1 
ATOM   4602 O O   . GLU B 1 216 ? -12.543 12.541  6.052   1.00 21.49 ? 216 GLU B O   1 
ATOM   4603 C CB  . GLU B 1 216 ? -9.571  12.310  7.292   1.00 24.63 ? 216 GLU B CB  1 
ATOM   4604 C CG  . GLU B 1 216 ? -9.498  13.508  6.357   1.00 35.33 ? 216 GLU B CG  1 
ATOM   4605 C CD  . GLU B 1 216 ? -10.272 14.713  6.893   1.00 42.86 ? 216 GLU B CD  1 
ATOM   4606 O OE1 . GLU B 1 216 ? -10.131 15.030  8.103   1.00 43.89 ? 216 GLU B OE1 1 
ATOM   4607 O OE2 . GLU B 1 216 ? -11.015 15.342  6.100   1.00 45.18 ? 216 GLU B OE2 1 
ATOM   4608 N N   . ALA B 1 217 ? -11.960 10.391  6.245   1.00 18.42 ? 217 ALA B N   1 
ATOM   4609 C CA  . ALA B 1 217 ? -12.818 9.970   5.148   1.00 19.83 ? 217 ALA B CA  1 
ATOM   4610 C C   . ALA B 1 217 ? -14.276 10.059  5.587   1.00 19.00 ? 217 ALA B C   1 
ATOM   4611 O O   . ALA B 1 217 ? -15.117 10.611  4.879   1.00 15.94 ? 217 ALA B O   1 
ATOM   4612 C CB  . ALA B 1 217 ? -12.476 8.538   4.729   1.00 21.96 ? 217 ALA B CB  1 
ATOM   4613 N N   . LEU B 1 218 ? -14.577 9.503   6.756   1.00 18.03 ? 218 LEU B N   1 
ATOM   4614 C CA  . LEU B 1 218 ? -15.940 9.546   7.271   1.00 19.41 ? 218 LEU B CA  1 
ATOM   4615 C C   . LEU B 1 218 ? -16.479 10.979  7.347   1.00 20.55 ? 218 LEU B C   1 
ATOM   4616 O O   . LEU B 1 218 ? -17.603 11.252  6.935   1.00 20.81 ? 218 LEU B O   1 
ATOM   4617 C CB  . LEU B 1 218 ? -15.984 8.910   8.650   1.00 16.70 ? 218 LEU B CB  1 
ATOM   4618 C CG  . LEU B 1 218 ? -15.723 7.405   8.621   1.00 23.08 ? 218 LEU B CG  1 
ATOM   4619 C CD1 . LEU B 1 218 ? -15.507 6.889   10.035  1.00 21.95 ? 218 LEU B CD1 1 
ATOM   4620 C CD2 . LEU B 1 218 ? -16.894 6.694   7.944   1.00 21.99 ? 218 LEU B CD2 1 
ATOM   4621 N N   . LYS B 1 219 ? -15.667 11.887  7.875   1.00 20.31 ? 219 LYS B N   1 
ATOM   4622 C CA  . LYS B 1 219 ? -16.087 13.268  7.998   1.00 25.19 ? 219 LYS B CA  1 
ATOM   4623 C C   . LYS B 1 219 ? -16.474 13.815  6.631   1.00 26.70 ? 219 LYS B C   1 
ATOM   4624 O O   . LYS B 1 219 ? -17.406 14.605  6.506   1.00 23.76 ? 219 LYS B O   1 
ATOM   4625 C CB  . LYS B 1 219 ? -14.968 14.115  8.602   1.00 26.11 ? 219 LYS B CB  1 
ATOM   4626 C CG  . LYS B 1 219 ? -15.371 15.552  8.823   1.00 28.91 ? 219 LYS B CG  1 
ATOM   4627 C CD  . LYS B 1 219 ? -14.548 16.196  9.920   1.00 34.29 ? 219 LYS B CD  1 
ATOM   4628 C CE  . LYS B 1 219 ? -15.397 17.188  10.711  1.00 36.03 ? 219 LYS B CE  1 
ATOM   4629 N NZ  . LYS B 1 219 ? -16.067 18.184  9.815   1.00 42.36 ? 219 LYS B NZ  1 
ATOM   4630 N N   . ARG B 1 220 ? -15.752 13.386  5.605   1.00 26.80 ? 220 ARG B N   1 
ATOM   4631 C CA  . ARG B 1 220 ? -16.030 13.844  4.255   1.00 26.37 ? 220 ARG B CA  1 
ATOM   4632 C C   . ARG B 1 220 ? -17.195 13.080  3.618   1.00 25.22 ? 220 ARG B C   1 
ATOM   4633 O O   . ARG B 1 220 ? -17.569 13.346  2.481   1.00 23.21 ? 220 ARG B O   1 
ATOM   4634 C CB  . ARG B 1 220 ? -14.768 13.708  3.409   1.00 30.02 ? 220 ARG B CB  1 
ATOM   4635 C CG  . ARG B 1 220 ? -13.895 14.953  3.417   1.00 41.84 ? 220 ARG B CG  1 
ATOM   4636 C CD  . ARG B 1 220 ? -14.311 15.891  2.278   1.00 53.59 ? 220 ARG B CD  1 
ATOM   4637 N NE  . ARG B 1 220 ? -15.758 15.855  2.042   1.00 61.61 ? 220 ARG B NE  1 
ATOM   4638 C CZ  . ARG B 1 220 ? -16.377 16.485  1.045   1.00 63.64 ? 220 ARG B CZ  1 
ATOM   4639 N NH1 . ARG B 1 220 ? -15.681 17.216  0.175   1.00 65.09 ? 220 ARG B NH1 1 
ATOM   4640 N NH2 . ARG B 1 220 ? -17.692 16.369  0.906   1.00 63.90 ? 220 ARG B NH2 1 
ATOM   4641 N N   . GLY B 1 221 ? -17.764 12.134  4.361   1.00 24.04 ? 221 GLY B N   1 
ATOM   4642 C CA  . GLY B 1 221 ? -18.879 11.354  3.852   1.00 22.44 ? 221 GLY B CA  1 
ATOM   4643 C C   . GLY B 1 221 ? -18.537 10.081  3.083   1.00 25.27 ? 221 GLY B C   1 
ATOM   4644 O O   . GLY B 1 221 ? -19.389 9.549   2.367   1.00 22.88 ? 221 GLY B O   1 
ATOM   4645 N N   . CYS B 1 222 ? -17.308 9.585   3.217   1.00 24.07 ? 222 CYS B N   1 
ATOM   4646 C CA  . CYS B 1 222 ? -16.911 8.362   2.524   1.00 27.02 ? 222 CYS B CA  1 
ATOM   4647 C C   . CYS B 1 222 ? -16.702 7.246   3.529   1.00 29.27 ? 222 CYS B C   1 
ATOM   4648 O O   . CYS B 1 222 ? -16.299 7.500   4.663   1.00 35.85 ? 222 CYS B O   1 
ATOM   4649 C CB  . CYS B 1 222 ? -15.622 8.585   1.724   1.00 24.33 ? 222 CYS B CB  1 
ATOM   4650 S SG  . CYS B 1 222 ? -15.822 9.766   0.372   1.00 19.60 ? 222 CYS B SG  1 
ATOM   4651 N N   . GLU B 1 223 ? -16.969 6.012   3.117   1.00 29.38 ? 223 GLU B N   1 
ATOM   4652 C CA  . GLU B 1 223 ? -16.810 4.870   4.013   1.00 30.23 ? 223 GLU B CA  1 
ATOM   4653 C C   . GLU B 1 223 ? -15.387 4.316   4.054   1.00 29.14 ? 223 GLU B C   1 
ATOM   4654 O O   . GLU B 1 223 ? -14.973 3.755   5.065   1.00 30.36 ? 223 GLU B O   1 
ATOM   4655 C CB  . GLU B 1 223 ? -17.749 3.718   3.614   1.00 30.35 ? 223 GLU B CB  1 
ATOM   4656 C CG  . GLU B 1 223 ? -19.231 3.913   3.895   1.00 33.27 ? 223 GLU B CG  1 
ATOM   4657 C CD  . GLU B 1 223 ? -19.936 4.764   2.849   1.00 37.48 ? 223 GLU B CD  1 
ATOM   4658 O OE1 . GLU B 1 223 ? -19.782 4.482   1.642   1.00 37.45 ? 223 GLU B OE1 1 
ATOM   4659 O OE2 . GLU B 1 223 ? -20.655 5.712   3.233   1.00 43.28 ? 223 GLU B OE2 1 
ATOM   4660 N N   . GLN B 1 224 ? -14.645 4.461   2.960   1.00 27.48 ? 224 GLN B N   1 
ATOM   4661 C CA  . GLN B 1 224 ? -13.292 3.916   2.890   1.00 24.93 ? 224 GLN B CA  1 
ATOM   4662 C C   . GLN B 1 224 ? -12.273 4.839   2.246   1.00 21.97 ? 224 GLN B C   1 
ATOM   4663 O O   . GLN B 1 224 ? -12.613 5.853   1.628   1.00 18.73 ? 224 GLN B O   1 
ATOM   4664 C CB  . GLN B 1 224 ? -13.294 2.606   2.099   1.00 28.12 ? 224 GLN B CB  1 
ATOM   4665 C CG  . GLN B 1 224 ? -14.175 1.505   2.650   1.00 35.13 ? 224 GLN B CG  1 
ATOM   4666 C CD  . GLN B 1 224 ? -13.557 0.791   3.830   1.00 39.64 ? 224 GLN B CD  1 
ATOM   4667 O OE1 . GLN B 1 224 ? -14.106 -0.191  4.336   1.00 41.93 ? 224 GLN B OE1 1 
ATOM   4668 N NE2 . GLN B 1 224 ? -12.409 1.278   4.280   1.00 44.08 ? 224 GLN B NE2 1 
ATOM   4669 N N   . VAL B 1 225 ? -11.010 4.444   2.363   1.00 18.11 ? 225 VAL B N   1 
ATOM   4670 C CA  . VAL B 1 225 ? -9.915  5.215   1.805   1.00 14.26 ? 225 VAL B CA  1 
ATOM   4671 C C   . VAL B 1 225 ? -9.290  4.533   0.587   1.00 18.62 ? 225 VAL B C   1 
ATOM   4672 O O   . VAL B 1 225 ? -8.977  3.337   0.616   1.00 20.02 ? 225 VAL B O   1 
ATOM   4673 C CB  . VAL B 1 225 ? -8.808  5.446   2.867   1.00 11.19 ? 225 VAL B CB  1 
ATOM   4674 C CG1 . VAL B 1 225 ? -7.661  6.255   2.266   1.00 5.85  ? 225 VAL B CG1 1 
ATOM   4675 C CG2 . VAL B 1 225 ? -9.394  6.168   4.081   1.00 8.44  ? 225 VAL B CG2 1 
ATOM   4676 N N   . LEU B 1 226 ? -9.129  5.291   -0.494  1.00 18.59 ? 226 LEU B N   1 
ATOM   4677 C CA  . LEU B 1 226 ? -8.484  4.761   -1.685  1.00 15.60 ? 226 LEU B CA  1 
ATOM   4678 C C   . LEU B 1 226 ? -7.061  5.287   -1.615  1.00 16.47 ? 226 LEU B C   1 
ATOM   4679 O O   . LEU B 1 226 ? -6.842  6.500   -1.752  1.00 17.30 ? 226 LEU B O   1 
ATOM   4680 C CB  . LEU B 1 226 ? -9.170  5.264   -2.960  1.00 15.46 ? 226 LEU B CB  1 
ATOM   4681 C CG  . LEU B 1 226 ? -8.465  4.958   -4.298  1.00 21.49 ? 226 LEU B CG  1 
ATOM   4682 C CD1 . LEU B 1 226 ? -8.140  3.465   -4.450  1.00 17.05 ? 226 LEU B CD1 1 
ATOM   4683 C CD2 . LEU B 1 226 ? -9.367  5.424   -5.430  1.00 22.69 ? 226 LEU B CD2 1 
ATOM   4684 N N   . TRP B 1 227 ? -6.106  4.386   -1.387  1.00 14.13 ? 227 TRP B N   1 
ATOM   4685 C CA  . TRP B 1 227 ? -4.695  4.761   -1.290  1.00 14.94 ? 227 TRP B CA  1 
ATOM   4686 C C   . TRP B 1 227 ? -4.014  4.962   -2.639  1.00 16.76 ? 227 TRP B C   1 
ATOM   4687 O O   . TRP B 1 227 ? -3.911  4.035   -3.446  1.00 19.58 ? 227 TRP B O   1 
ATOM   4688 C CB  . TRP B 1 227 ? -3.912  3.712   -0.495  1.00 15.34 ? 227 TRP B CB  1 
ATOM   4689 C CG  . TRP B 1 227 ? -4.462  3.479   0.858   1.00 15.30 ? 227 TRP B CG  1 
ATOM   4690 C CD1 . TRP B 1 227 ? -5.340  2.497   1.234   1.00 14.01 ? 227 TRP B CD1 1 
ATOM   4691 C CD2 . TRP B 1 227 ? -4.230  4.282   2.019   1.00 15.37 ? 227 TRP B CD2 1 
ATOM   4692 N NE1 . TRP B 1 227 ? -5.668  2.643   2.559   1.00 14.52 ? 227 TRP B NE1 1 
ATOM   4693 C CE2 . TRP B 1 227 ? -5.003  3.729   3.069   1.00 13.96 ? 227 TRP B CE2 1 
ATOM   4694 C CE3 . TRP B 1 227 ? -3.447  5.420   2.277   1.00 14.71 ? 227 TRP B CE3 1 
ATOM   4695 C CZ2 . TRP B 1 227 ? -5.015  4.273   4.361   1.00 9.61  ? 227 TRP B CZ2 1 
ATOM   4696 C CZ3 . TRP B 1 227 ? -3.459  5.965   3.568   1.00 13.74 ? 227 TRP B CZ3 1 
ATOM   4697 C CH2 . TRP B 1 227 ? -4.242  5.384   4.591   1.00 13.56 ? 227 TRP B CH2 1 
ATOM   4698 N N   . LEU B 1 228 ? -3.535  6.178   -2.866  1.00 16.89 ? 228 LEU B N   1 
ATOM   4699 C CA  . LEU B 1 228 ? -2.857  6.516   -4.102  1.00 19.48 ? 228 LEU B CA  1 
ATOM   4700 C C   . LEU B 1 228 ? -1.362  6.591   -3.845  1.00 20.83 ? 228 LEU B C   1 
ATOM   4701 O O   . LEU B 1 228 ? -0.925  6.975   -2.761  1.00 22.28 ? 228 LEU B O   1 
ATOM   4702 C CB  . LEU B 1 228 ? -3.347  7.862   -4.618  1.00 19.52 ? 228 LEU B CB  1 
ATOM   4703 C CG  . LEU B 1 228 ? -4.853  7.993   -4.795  1.00 20.09 ? 228 LEU B CG  1 
ATOM   4704 C CD1 . LEU B 1 228 ? -5.196  9.441   -5.075  1.00 20.16 ? 228 LEU B CD1 1 
ATOM   4705 C CD2 . LEU B 1 228 ? -5.324  7.090   -5.925  1.00 19.95 ? 228 LEU B CD2 1 
ATOM   4706 N N   . TYR B 1 229 ? -0.579  6.222   -4.849  1.00 21.47 ? 229 TYR B N   1 
ATOM   4707 C CA  . TYR B 1 229 ? 0.865   6.256   -4.725  1.00 17.98 ? 229 TYR B CA  1 
ATOM   4708 C C   . TYR B 1 229 ? 1.518   6.896   -5.943  1.00 18.35 ? 229 TYR B C   1 
ATOM   4709 O O   . TYR B 1 229 ? 1.046   6.734   -7.077  1.00 13.29 ? 229 TYR B O   1 
ATOM   4710 C CB  . TYR B 1 229 ? 1.414   4.839   -4.559  1.00 18.69 ? 229 TYR B CB  1 
ATOM   4711 C CG  . TYR B 1 229 ? 2.909   4.805   -4.349  1.00 17.09 ? 229 TYR B CG  1 
ATOM   4712 C CD1 . TYR B 1 229 ? 3.477   5.245   -3.147  1.00 19.62 ? 229 TYR B CD1 1 
ATOM   4713 C CD2 . TYR B 1 229 ? 3.760   4.334   -5.347  1.00 17.90 ? 229 TYR B CD2 1 
ATOM   4714 C CE1 . TYR B 1 229 ? 4.860   5.210   -2.944  1.00 19.05 ? 229 TYR B CE1 1 
ATOM   4715 C CE2 . TYR B 1 229 ? 5.140   4.297   -5.157  1.00 15.38 ? 229 TYR B CE2 1 
ATOM   4716 C CZ  . TYR B 1 229 ? 5.679   4.731   -3.954  1.00 19.04 ? 229 TYR B CZ  1 
ATOM   4717 O OH  . TYR B 1 229 ? 7.036   4.673   -3.756  1.00 27.59 ? 229 TYR B OH  1 
ATOM   4718 N N   . GLY B 1 230 ? 2.608   7.621   -5.695  1.00 18.37 ? 230 GLY B N   1 
ATOM   4719 C CA  . GLY B 1 230 ? 3.353   8.259   -6.769  1.00 20.18 ? 230 GLY B CA  1 
ATOM   4720 C C   . GLY B 1 230 ? 2.761   9.532   -7.353  1.00 21.46 ? 230 GLY B C   1 
ATOM   4721 O O   . GLY B 1 230 ? 1.592   9.856   -7.114  1.00 19.34 ? 230 GLY B O   1 
ATOM   4722 N N   . PRO B 1 231 ? 3.561   10.277  -8.136  1.00 22.77 ? 231 PRO B N   1 
ATOM   4723 C CA  . PRO B 1 231 ? 3.156   11.530  -8.784  1.00 22.14 ? 231 PRO B CA  1 
ATOM   4724 C C   . PRO B 1 231 ? 2.065   11.256  -9.807  1.00 22.03 ? 231 PRO B C   1 
ATOM   4725 O O   . PRO B 1 231 ? 1.270   12.130  -10.122 1.00 26.14 ? 231 PRO B O   1 
ATOM   4726 C CB  . PRO B 1 231 ? 4.443   12.011  -9.452  1.00 24.97 ? 231 PRO B CB  1 
ATOM   4727 C CG  . PRO B 1 231 ? 5.531   11.340  -8.665  1.00 24.20 ? 231 PRO B CG  1 
ATOM   4728 C CD  . PRO B 1 231 ? 4.977   9.983   -8.406  1.00 22.30 ? 231 PRO B CD  1 
ATOM   4729 N N   . ASP B 1 232 ? 2.047   10.035  -10.334 1.00 21.37 ? 232 ASP B N   1 
ATOM   4730 C CA  . ASP B 1 232 ? 1.043   9.640   -11.319 1.00 22.72 ? 232 ASP B CA  1 
ATOM   4731 C C   . ASP B 1 232 ? -0.248  9.133   -10.672 1.00 18.25 ? 232 ASP B C   1 
ATOM   4732 O O   . ASP B 1 232 ? -1.119  8.587   -11.353 1.00 14.69 ? 232 ASP B O   1 
ATOM   4733 C CB  . ASP B 1 232 ? 1.613   8.564   -12.265 1.00 24.82 ? 232 ASP B CB  1 
ATOM   4734 C CG  . ASP B 1 232 ? 2.524   7.568   -11.549 1.00 25.47 ? 232 ASP B CG  1 
ATOM   4735 O OD1 . ASP B 1 232 ? 2.515   7.514   -10.299 1.00 24.65 ? 232 ASP B OD1 1 
ATOM   4736 O OD2 . ASP B 1 232 ? 3.250   6.828   -12.240 1.00 25.37 ? 232 ASP B OD2 1 
ATOM   4737 N N   . HIS B 1 233 ? -0.355  9.312   -9.358  1.00 19.70 ? 233 HIS B N   1 
ATOM   4738 C CA  . HIS B 1 233 ? -1.535  8.898   -8.595  1.00 21.80 ? 233 HIS B CA  1 
ATOM   4739 C C   . HIS B 1 233 ? -2.075  7.524   -8.982  1.00 19.63 ? 233 HIS B C   1 
ATOM   4740 O O   . HIS B 1 233 ? -3.225  7.397   -9.428  1.00 18.08 ? 233 HIS B O   1 
ATOM   4741 C CB  . HIS B 1 233 ? -2.648  9.938   -8.757  1.00 21.78 ? 233 HIS B CB  1 
ATOM   4742 C CG  . HIS B 1 233 ? -2.336  11.256  -8.128  1.00 26.95 ? 233 HIS B CG  1 
ATOM   4743 N ND1 . HIS B 1 233 ? -3.115  12.377  -8.323  1.00 29.49 ? 233 HIS B ND1 1 
ATOM   4744 C CD2 . HIS B 1 233 ? -1.345  11.629  -7.283  1.00 28.42 ? 233 HIS B CD2 1 
ATOM   4745 C CE1 . HIS B 1 233 ? -2.617  13.384  -7.628  1.00 29.25 ? 233 HIS B CE1 1 
ATOM   4746 N NE2 . HIS B 1 233 ? -1.543  12.956  -6.987  1.00 30.94 ? 233 HIS B NE2 1 
ATOM   4747 N N   . GLN B 1 234 ? -1.257  6.495   -8.813  1.00 18.35 ? 234 GLN B N   1 
ATOM   4748 C CA  . GLN B 1 234 ? -1.706  5.162   -9.161  1.00 19.50 ? 234 GLN B CA  1 
ATOM   4749 C C   . GLN B 1 234 ? -2.470  4.529   -8.012  1.00 20.32 ? 234 GLN B C   1 
ATOM   4750 O O   . GLN B 1 234 ? -2.145  4.739   -6.841  1.00 23.42 ? 234 GLN B O   1 
ATOM   4751 C CB  . GLN B 1 234 ? -0.528  4.280   -9.613  1.00 20.96 ? 234 GLN B CB  1 
ATOM   4752 C CG  . GLN B 1 234 ? 0.723   4.292   -8.755  1.00 23.39 ? 234 GLN B CG  1 
ATOM   4753 C CD  . GLN B 1 234 ? 1.953   3.764   -9.509  1.00 24.08 ? 234 GLN B CD  1 
ATOM   4754 O OE1 . GLN B 1 234 ? 2.476   4.417   -10.414 1.00 28.39 ? 234 GLN B OE1 1 
ATOM   4755 N NE2 . GLN B 1 234 ? 2.402   2.574   -9.144  1.00 23.09 ? 234 GLN B NE2 1 
ATOM   4756 N N   . LEU B 1 235 ? -3.519  3.789   -8.357  1.00 19.64 ? 235 LEU B N   1 
ATOM   4757 C CA  . LEU B 1 235 ? -4.360  3.125   -7.368  1.00 18.14 ? 235 LEU B CA  1 
ATOM   4758 C C   . LEU B 1 235 ? -3.636  1.899   -6.858  1.00 18.31 ? 235 LEU B C   1 
ATOM   4759 O O   . LEU B 1 235 ? -3.089  1.125   -7.644  1.00 20.86 ? 235 LEU B O   1 
ATOM   4760 C CB  . LEU B 1 235 ? -5.695  2.707   -7.994  1.00 20.45 ? 235 LEU B CB  1 
ATOM   4761 C CG  . LEU B 1 235 ? -6.628  3.813   -8.508  1.00 18.66 ? 235 LEU B CG  1 
ATOM   4762 C CD1 . LEU B 1 235 ? -5.934  4.649   -9.562  1.00 14.68 ? 235 LEU B CD1 1 
ATOM   4763 C CD2 . LEU B 1 235 ? -7.887  3.171   -9.079  1.00 16.44 ? 235 LEU B CD2 1 
ATOM   4764 N N   . THR B 1 236 ? -3.627  1.725   -5.542  1.00 17.46 ? 236 THR B N   1 
ATOM   4765 C CA  . THR B 1 236 ? -2.965  0.575   -4.945  1.00 17.69 ? 236 THR B CA  1 
ATOM   4766 C C   . THR B 1 236 ? -3.917  -0.287  -4.136  1.00 15.27 ? 236 THR B C   1 
ATOM   4767 O O   . THR B 1 236 ? -4.072  -1.466  -4.423  1.00 21.51 ? 236 THR B O   1 
ATOM   4768 C CB  . THR B 1 236 ? -1.800  1.002   -4.039  1.00 17.38 ? 236 THR B CB  1 
ATOM   4769 O OG1 . THR B 1 236 ? -2.311  1.623   -2.851  1.00 16.91 ? 236 THR B OG1 1 
ATOM   4770 C CG2 . THR B 1 236 ? -0.894  1.975   -4.789  1.00 17.34 ? 236 THR B CG2 1 
ATOM   4771 N N   . GLU B 1 237 ? -4.555  0.296   -3.125  1.00 18.40 ? 237 GLU B N   1 
ATOM   4772 C CA  . GLU B 1 237 ? -5.479  -0.461  -2.279  1.00 17.91 ? 237 GLU B CA  1 
ATOM   4773 C C   . GLU B 1 237 ? -6.672  0.353   -1.804  1.00 17.61 ? 237 GLU B C   1 
ATOM   4774 O O   . GLU B 1 237 ? -6.707  1.572   -1.963  1.00 19.00 ? 237 GLU B O   1 
ATOM   4775 C CB  . GLU B 1 237 ? -4.735  -1.022  -1.065  1.00 13.59 ? 237 GLU B CB  1 
ATOM   4776 C CG  . GLU B 1 237 ? -3.550  -1.888  -1.425  1.00 15.62 ? 237 GLU B CG  1 
ATOM   4777 C CD  . GLU B 1 237 ? -3.411  -3.083  -0.506  1.00 17.90 ? 237 GLU B CD  1 
ATOM   4778 O OE1 . GLU B 1 237 ? -4.444  -3.512  0.041   1.00 16.63 ? 237 GLU B OE1 1 
ATOM   4779 O OE2 . GLU B 1 237 ? -2.287  -3.611  -0.349  1.00 18.42 ? 237 GLU B OE2 1 
ATOM   4780 N N   . VAL B 1 238 ? -7.656  -0.339  -1.237  1.00 18.89 ? 238 VAL B N   1 
ATOM   4781 C CA  . VAL B 1 238 ? -8.861  0.296   -0.707  1.00 19.50 ? 238 VAL B CA  1 
ATOM   4782 C C   . VAL B 1 238 ? -9.002  -0.157  0.737   1.00 21.20 ? 238 VAL B C   1 
ATOM   4783 O O   . VAL B 1 238 ? -9.255  -1.334  0.999   1.00 21.37 ? 238 VAL B O   1 
ATOM   4784 C CB  . VAL B 1 238 ? -10.129 -0.142  -1.460  1.00 19.69 ? 238 VAL B CB  1 
ATOM   4785 C CG1 . VAL B 1 238 ? -11.347 0.577   -0.888  1.00 21.15 ? 238 VAL B CG1 1 
ATOM   4786 C CG2 . VAL B 1 238 ? -9.996  0.174   -2.918  1.00 24.54 ? 238 VAL B CG2 1 
ATOM   4787 N N   . GLY B 1 239 ? -8.849  0.778   1.670   1.00 17.45 ? 239 GLY B N   1 
ATOM   4788 C CA  . GLY B 1 239 ? -8.941  0.425   3.066   1.00 15.59 ? 239 GLY B CA  1 
ATOM   4789 C C   . GLY B 1 239 ? -7.945  -0.690  3.302   1.00 17.94 ? 239 GLY B C   1 
ATOM   4790 O O   . GLY B 1 239 ? -6.739  -0.492  3.143   1.00 21.09 ? 239 GLY B O   1 
ATOM   4791 N N   . THR B 1 240 ? -8.448  -1.863  3.671   1.00 15.54 ? 240 THR B N   1 
ATOM   4792 C CA  . THR B 1 240 ? -7.601  -3.021  3.905   1.00 18.97 ? 240 THR B CA  1 
ATOM   4793 C C   . THR B 1 240 ? -7.908  -4.107  2.857   1.00 21.39 ? 240 THR B C   1 
ATOM   4794 O O   . THR B 1 240 ? -7.759  -5.302  3.128   1.00 25.12 ? 240 THR B O   1 
ATOM   4795 C CB  . THR B 1 240 ? -7.833  -3.607  5.326   1.00 21.22 ? 240 THR B CB  1 
ATOM   4796 O OG1 . THR B 1 240 ? -9.188  -4.066  5.452   1.00 15.80 ? 240 THR B OG1 1 
ATOM   4797 C CG2 . THR B 1 240 ? -7.559  -2.554  6.385   1.00 18.16 ? 240 THR B CG2 1 
ATOM   4798 N N   . MET B 1 241 ? -8.339  -3.686  1.667   1.00 20.85 ? 241 MET B N   1 
ATOM   4799 C CA  . MET B 1 241 ? -8.674  -4.614  0.578   1.00 21.43 ? 241 MET B CA  1 
ATOM   4800 C C   . MET B 1 241 ? -7.933  -4.315  -0.728  1.00 20.37 ? 241 MET B C   1 
ATOM   4801 O O   . MET B 1 241 ? -7.570  -3.173  -1.003  1.00 19.15 ? 241 MET B O   1 
ATOM   4802 C CB  . MET B 1 241 ? -10.171 -4.561  0.254   1.00 21.16 ? 241 MET B CB  1 
ATOM   4803 C CG  . MET B 1 241 ? -11.127 -4.792  1.397   1.00 20.45 ? 241 MET B CG  1 
ATOM   4804 S SD  . MET B 1 241 ? -12.801 -4.296  0.886   1.00 21.49 ? 241 MET B SD  1 
ATOM   4805 C CE  . MET B 1 241 ? -12.834 -2.643  1.454   1.00 20.92 ? 241 MET B CE  1 
ATOM   4806 N N   . ASN B 1 242 ? -7.736  -5.353  -1.537  1.00 20.84 ? 242 ASN B N   1 
ATOM   4807 C CA  . ASN B 1 242 ? -7.094  -5.197  -2.839  1.00 20.27 ? 242 ASN B CA  1 
ATOM   4808 C C   . ASN B 1 242 ? -8.143  -4.594  -3.781  1.00 17.38 ? 242 ASN B C   1 
ATOM   4809 O O   . ASN B 1 242 ? -9.349  -4.770  -3.575  1.00 18.20 ? 242 ASN B O   1 
ATOM   4810 C CB  . ASN B 1 242 ? -6.598  -6.556  -3.357  1.00 17.18 ? 242 ASN B CB  1 
ATOM   4811 C CG  . ASN B 1 242 ? -5.403  -7.069  -2.573  1.00 20.28 ? 242 ASN B CG  1 
ATOM   4812 O OD1 . ASN B 1 242 ? -4.345  -6.433  -2.557  1.00 14.11 ? 242 ASN B OD1 1 
ATOM   4813 N ND2 . ASN B 1 242 ? -5.563  -8.216  -1.915  1.00 16.30 ? 242 ASN B ND2 1 
ATOM   4814 N N   . ILE B 1 243 ? -7.690  -3.883  -4.806  1.00 13.57 ? 243 ILE B N   1 
ATOM   4815 C CA  . ILE B 1 243 ? -8.611  -3.228  -5.732  1.00 18.04 ? 243 ILE B CA  1 
ATOM   4816 C C   . ILE B 1 243 ? -8.625  -3.858  -7.131  1.00 16.99 ? 243 ILE B C   1 
ATOM   4817 O O   . ILE B 1 243 ? -7.577  -4.195  -7.682  1.00 21.76 ? 243 ILE B O   1 
ATOM   4818 C CB  . ILE B 1 243 ? -8.266  -1.705  -5.839  1.00 18.26 ? 243 ILE B CB  1 
ATOM   4819 C CG1 . ILE B 1 243 ? -9.283  -0.976  -6.718  1.00 23.27 ? 243 ILE B CG1 1 
ATOM   4820 C CG2 . ILE B 1 243 ? -6.879  -1.518  -6.435  1.00 18.57 ? 243 ILE B CG2 1 
ATOM   4821 C CD1 . ILE B 1 243 ? -10.619 -0.782  -6.080  1.00 23.73 ? 243 ILE B CD1 1 
ATOM   4822 N N   . PHE B 1 244 ? -9.822  -4.041  -7.684  1.00 14.55 ? 244 PHE B N   1 
ATOM   4823 C CA  . PHE B 1 244 ? -9.982  -4.597  -9.031  1.00 14.24 ? 244 PHE B CA  1 
ATOM   4824 C C   . PHE B 1 244 ? -10.834 -3.659  -9.875  1.00 15.56 ? 244 PHE B C   1 
ATOM   4825 O O   . PHE B 1 244 ? -11.732 -2.981  -9.356  1.00 12.22 ? 244 PHE B O   1 
ATOM   4826 C CB  . PHE B 1 244 ? -10.680 -5.961  -9.015  1.00 10.24 ? 244 PHE B CB  1 
ATOM   4827 C CG  . PHE B 1 244 ? -9.812  -7.091  -8.567  1.00 8.55  ? 244 PHE B CG  1 
ATOM   4828 C CD1 . PHE B 1 244 ? -9.541  -7.295  -7.216  1.00 11.83 ? 244 PHE B CD1 1 
ATOM   4829 C CD2 . PHE B 1 244 ? -9.291  -7.978  -9.491  1.00 11.15 ? 244 PHE B CD2 1 
ATOM   4830 C CE1 . PHE B 1 244 ? -8.766  -8.373  -6.798  1.00 11.85 ? 244 PHE B CE1 1 
ATOM   4831 C CE2 . PHE B 1 244 ? -8.512  -9.063  -9.081  1.00 12.39 ? 244 PHE B CE2 1 
ATOM   4832 C CZ  . PHE B 1 244 ? -8.253  -9.257  -7.733  1.00 9.19  ? 244 PHE B CZ  1 
ATOM   4833 N N   . VAL B 1 245 ? -10.551 -3.621  -11.173 1.00 16.46 ? 245 VAL B N   1 
ATOM   4834 C CA  . VAL B 1 245 ? -11.326 -2.788  -12.087 1.00 19.90 ? 245 VAL B CA  1 
ATOM   4835 C C   . VAL B 1 245 ? -11.754 -3.632  -13.288 1.00 19.21 ? 245 VAL B C   1 
ATOM   4836 O O   . VAL B 1 245 ? -10.940 -4.300  -13.920 1.00 19.61 ? 245 VAL B O   1 
ATOM   4837 C CB  . VAL B 1 245 ? -10.523 -1.560  -12.584 1.00 21.44 ? 245 VAL B CB  1 
ATOM   4838 C CG1 . VAL B 1 245 ? -11.378 -0.744  -13.525 1.00 24.11 ? 245 VAL B CG1 1 
ATOM   4839 C CG2 . VAL B 1 245 ? -10.083 -0.694  -11.402 1.00 22.32 ? 245 VAL B CG2 1 
ATOM   4840 N N   . TYR B 1 246 ? -13.048 -3.611  -13.581 1.00 19.63 ? 246 TYR B N   1 
ATOM   4841 C CA  . TYR B 1 246 ? -13.599 -4.365  -14.704 1.00 20.11 ? 246 TYR B CA  1 
ATOM   4842 C C   . TYR B 1 246 ? -14.018 -3.329  -15.753 1.00 17.78 ? 246 TYR B C   1 
ATOM   4843 O O   . TYR B 1 246 ? -15.008 -2.612  -15.588 1.00 14.75 ? 246 TYR B O   1 
ATOM   4844 C CB  . TYR B 1 246 ? -14.789 -5.202  -14.211 1.00 20.20 ? 246 TYR B CB  1 
ATOM   4845 C CG  . TYR B 1 246 ? -15.399 -6.125  -15.236 1.00 20.38 ? 246 TYR B CG  1 
ATOM   4846 C CD1 . TYR B 1 246 ? -14.598 -6.906  -16.071 1.00 18.54 ? 246 TYR B CD1 1 
ATOM   4847 C CD2 . TYR B 1 246 ? -16.781 -6.271  -15.323 1.00 20.60 ? 246 TYR B CD2 1 
ATOM   4848 C CE1 . TYR B 1 246 ? -15.157 -7.805  -16.964 1.00 17.49 ? 246 TYR B CE1 1 
ATOM   4849 C CE2 . TYR B 1 246 ? -17.355 -7.172  -16.208 1.00 18.79 ? 246 TYR B CE2 1 
ATOM   4850 C CZ  . TYR B 1 246 ? -16.543 -7.935  -17.028 1.00 22.21 ? 246 TYR B CZ  1 
ATOM   4851 O OH  . TYR B 1 246 ? -17.120 -8.807  -17.930 1.00 20.08 ? 246 TYR B OH  1 
ATOM   4852 N N   . TRP B 1 247 ? -13.229 -3.244  -16.818 1.00 21.04 ? 247 TRP B N   1 
ATOM   4853 C CA  . TRP B 1 247 ? -13.459 -2.261  -17.873 1.00 21.78 ? 247 TRP B CA  1 
ATOM   4854 C C   . TRP B 1 247 ? -12.984 -2.729  -19.249 1.00 23.69 ? 247 TRP B C   1 
ATOM   4855 O O   . TRP B 1 247 ? -12.431 -3.824  -19.415 1.00 20.78 ? 247 TRP B O   1 
ATOM   4856 C CB  . TRP B 1 247 ? -12.713 -0.951  -17.531 1.00 16.52 ? 247 TRP B CB  1 
ATOM   4857 C CG  . TRP B 1 247 ? -11.171 -1.093  -17.505 1.00 14.27 ? 247 TRP B CG  1 
ATOM   4858 C CD1 . TRP B 1 247 ? -10.442 -2.213  -17.808 1.00 11.79 ? 247 TRP B CD1 1 
ATOM   4859 C CD2 . TRP B 1 247 ? -10.205 -0.080  -17.146 1.00 12.04 ? 247 TRP B CD2 1 
ATOM   4860 N NE1 . TRP B 1 247 ? -9.095  -1.964  -17.661 1.00 13.78 ? 247 TRP B NE1 1 
ATOM   4861 C CE2 . TRP B 1 247 ? -8.919  -0.669  -17.254 1.00 12.05 ? 247 TRP B CE2 1 
ATOM   4862 C CE3 . TRP B 1 247 ? -10.303 1.263   -16.741 1.00 13.59 ? 247 TRP B CE3 1 
ATOM   4863 C CZ2 . TRP B 1 247 ? -7.732  0.041   -16.972 1.00 12.34 ? 247 TRP B CZ2 1 
ATOM   4864 C CZ3 . TRP B 1 247 ? -9.121  1.973   -16.460 1.00 10.38 ? 247 TRP B CZ3 1 
ATOM   4865 C CH2 . TRP B 1 247 ? -7.856  1.356   -16.578 1.00 11.23 ? 247 TRP B CH2 1 
ATOM   4866 N N   . THR B 1 248 ? -13.203 -1.861  -20.229 1.00 25.13 ? 248 THR B N   1 
ATOM   4867 C CA  . THR B 1 248 ? -12.763 -2.098  -21.590 1.00 26.86 ? 248 THR B CA  1 
ATOM   4868 C C   . THR B 1 248 ? -11.523 -1.212  -21.678 1.00 26.63 ? 248 THR B C   1 
ATOM   4869 O O   . THR B 1 248 ? -11.624 0.018   -21.614 1.00 25.89 ? 248 THR B O   1 
ATOM   4870 C CB  . THR B 1 248 ? -13.811 -1.617  -22.619 1.00 28.51 ? 248 THR B CB  1 
ATOM   4871 O OG1 . THR B 1 248 ? -15.015 -2.385  -22.477 1.00 29.16 ? 248 THR B OG1 1 
ATOM   4872 C CG2 . THR B 1 248 ? -13.267 -1.767  -24.044 1.00 29.66 ? 248 THR B CG2 1 
ATOM   4873 N N   . HIS B 1 249 ? -10.354 -1.833  -21.798 1.00 26.32 ? 249 HIS B N   1 
ATOM   4874 C CA  . HIS B 1 249 ? -9.101  -1.086  -21.878 1.00 29.12 ? 249 HIS B CA  1 
ATOM   4875 C C   . HIS B 1 249 ? -9.087  -0.106  -23.067 1.00 30.66 ? 249 HIS B C   1 
ATOM   4876 O O   . HIS B 1 249 ? -10.021 -0.081  -23.883 1.00 29.70 ? 249 HIS B O   1 
ATOM   4877 C CB  . HIS B 1 249 ? -7.922  -2.071  -21.957 1.00 30.99 ? 249 HIS B CB  1 
ATOM   4878 C CG  . HIS B 1 249 ? -6.589  -1.447  -21.673 1.00 33.94 ? 249 HIS B CG  1 
ATOM   4879 N ND1 . HIS B 1 249 ? -6.397  -0.531  -20.660 1.00 34.95 ? 249 HIS B ND1 1 
ATOM   4880 C CD2 . HIS B 1 249 ? -5.378  -1.621  -22.256 1.00 34.52 ? 249 HIS B CD2 1 
ATOM   4881 C CE1 . HIS B 1 249 ? -5.126  -0.168  -20.632 1.00 38.00 ? 249 HIS B CE1 1 
ATOM   4882 N NE2 . HIS B 1 249 ? -4.486  -0.816  -21.589 1.00 37.30 ? 249 HIS B NE2 1 
ATOM   4883 N N   . GLU B 1 250 ? -8.040  0.714   -23.149 1.00 31.09 ? 250 GLU B N   1 
ATOM   4884 C CA  . GLU B 1 250 ? -7.908  1.684   -24.232 1.00 29.08 ? 250 GLU B CA  1 
ATOM   4885 C C   . GLU B 1 250 ? -7.809  0.987   -25.583 1.00 29.33 ? 250 GLU B C   1 
ATOM   4886 O O   . GLU B 1 250 ? -8.142  1.574   -26.606 1.00 31.76 ? 250 GLU B O   1 
ATOM   4887 C CB  . GLU B 1 250 ? -6.650  2.534   -24.053 1.00 33.13 ? 250 GLU B CB  1 
ATOM   4888 C CG  . GLU B 1 250 ? -6.511  3.237   -22.721 1.00 38.89 ? 250 GLU B CG  1 
ATOM   4889 C CD  . GLU B 1 250 ? -5.214  4.027   -22.630 1.00 42.03 ? 250 GLU B CD  1 
ATOM   4890 O OE1 . GLU B 1 250 ? -4.133  3.435   -22.870 1.00 36.95 ? 250 GLU B OE1 1 
ATOM   4891 O OE2 . GLU B 1 250 ? -5.277  5.239   -22.318 1.00 43.41 ? 250 GLU B OE2 1 
ATOM   4892 N N   . ASP B 1 251 ? -7.346  -0.258  -25.592 1.00 26.40 ? 251 ASP B N   1 
ATOM   4893 C CA  . ASP B 1 251 ? -7.189  -0.980  -26.847 1.00 29.91 ? 251 ASP B CA  1 
ATOM   4894 C C   . ASP B 1 251 ? -8.436  -1.736  -27.309 1.00 30.56 ? 251 ASP B C   1 
ATOM   4895 O O   . ASP B 1 251 ? -8.372  -2.536  -28.245 1.00 27.77 ? 251 ASP B O   1 
ATOM   4896 C CB  . ASP B 1 251 ? -5.999  -1.940  -26.751 1.00 31.73 ? 251 ASP B CB  1 
ATOM   4897 C CG  . ASP B 1 251 ? -6.275  -3.128  -25.850 1.00 34.01 ? 251 ASP B CG  1 
ATOM   4898 O OD1 . ASP B 1 251 ? -7.129  -3.016  -24.945 1.00 34.65 ? 251 ASP B OD1 1 
ATOM   4899 O OD2 . ASP B 1 251 ? -5.623  -4.174  -26.040 1.00 33.50 ? 251 ASP B OD2 1 
ATOM   4900 N N   . GLY B 1 252 ? -9.563  -1.493  -26.648 1.00 29.74 ? 252 GLY B N   1 
ATOM   4901 C CA  . GLY B 1 252 ? -10.796 -2.146  -27.046 1.00 28.26 ? 252 GLY B CA  1 
ATOM   4902 C C   . GLY B 1 252 ? -11.080 -3.518  -26.471 1.00 28.11 ? 252 GLY B C   1 
ATOM   4903 O O   . GLY B 1 252 ? -12.151 -4.075  -26.711 1.00 31.04 ? 252 GLY B O   1 
ATOM   4904 N N   . VAL B 1 253 ? -10.138 -4.074  -25.719 1.00 25.37 ? 253 VAL B N   1 
ATOM   4905 C CA  . VAL B 1 253 ? -10.341 -5.388  -25.119 1.00 25.34 ? 253 VAL B CA  1 
ATOM   4906 C C   . VAL B 1 253 ? -11.037 -5.294  -23.762 1.00 26.22 ? 253 VAL B C   1 
ATOM   4907 O O   . VAL B 1 253 ? -10.762 -4.397  -22.969 1.00 28.03 ? 253 VAL B O   1 
ATOM   4908 C CB  . VAL B 1 253 ? -9.002  -6.129  -24.906 1.00 22.93 ? 253 VAL B CB  1 
ATOM   4909 C CG1 . VAL B 1 253 ? -9.256  -7.531  -24.390 1.00 21.30 ? 253 VAL B CG1 1 
ATOM   4910 C CG2 . VAL B 1 253 ? -8.232  -6.176  -26.196 1.00 22.86 ? 253 VAL B CG2 1 
ATOM   4911 N N   . LEU B 1 254 ? -11.950 -6.222  -23.504 1.00 29.05 ? 254 LEU B N   1 
ATOM   4912 C CA  . LEU B 1 254 ? -12.656 -6.271  -22.226 1.00 29.41 ? 254 LEU B CA  1 
ATOM   4913 C C   . LEU B 1 254 ? -11.710 -6.983  -21.253 1.00 29.87 ? 254 LEU B C   1 
ATOM   4914 O O   . LEU B 1 254 ? -11.210 -8.068  -21.564 1.00 29.12 ? 254 LEU B O   1 
ATOM   4915 C CB  . LEU B 1 254 ? -13.957 -7.074  -22.367 1.00 24.83 ? 254 LEU B CB  1 
ATOM   4916 C CG  . LEU B 1 254 ? -14.810 -7.240  -21.105 1.00 27.58 ? 254 LEU B CG  1 
ATOM   4917 C CD1 . LEU B 1 254 ? -15.358 -5.883  -20.694 1.00 24.73 ? 254 LEU B CD1 1 
ATOM   4918 C CD2 . LEU B 1 254 ? -15.948 -8.227  -21.352 1.00 22.07 ? 254 LEU B CD2 1 
ATOM   4919 N N   . GLU B 1 255 ? -11.456 -6.379  -20.092 1.00 28.87 ? 255 GLU B N   1 
ATOM   4920 C CA  . GLU B 1 255 ? -10.559 -6.989  -19.106 1.00 27.04 ? 255 GLU B CA  1 
ATOM   4921 C C   . GLU B 1 255 ? -10.844 -6.678  -17.639 1.00 25.57 ? 255 GLU B C   1 
ATOM   4922 O O   . GLU B 1 255 ? -11.645 -5.806  -17.296 1.00 25.84 ? 255 GLU B O   1 
ATOM   4923 C CB  . GLU B 1 255 ? -9.105  -6.592  -19.385 1.00 25.87 ? 255 GLU B CB  1 
ATOM   4924 C CG  . GLU B 1 255 ? -8.858  -5.089  -19.365 1.00 24.22 ? 255 GLU B CG  1 
ATOM   4925 C CD  . GLU B 1 255 ? -7.387  -4.726  -19.194 1.00 24.07 ? 255 GLU B CD  1 
ATOM   4926 O OE1 . GLU B 1 255 ? -6.518  -5.404  -19.785 1.00 21.09 ? 255 GLU B OE1 1 
ATOM   4927 O OE2 . GLU B 1 255 ? -7.098  -3.746  -18.473 1.00 20.89 ? 255 GLU B OE2 1 
ATOM   4928 N N   . LEU B 1 256 ? -10.159 -7.431  -16.785 1.00 24.34 ? 256 LEU B N   1 
ATOM   4929 C CA  . LEU B 1 256 ? -10.219 -7.284  -15.339 1.00 20.85 ? 256 LEU B CA  1 
ATOM   4930 C C   . LEU B 1 256 ? -8.761  -7.005  -14.972 1.00 20.78 ? 256 LEU B C   1 
ATOM   4931 O O   . LEU B 1 256 ? -7.858  -7.736  -15.394 1.00 19.16 ? 256 LEU B O   1 
ATOM   4932 C CB  . LEU B 1 256 ? -10.696 -8.584  -14.683 1.00 18.77 ? 256 LEU B CB  1 
ATOM   4933 C CG  . LEU B 1 256 ? -10.748 -8.667  -13.147 1.00 16.73 ? 256 LEU B CG  1 
ATOM   4934 C CD1 . LEU B 1 256 ? -11.693 -7.648  -12.572 1.00 10.86 ? 256 LEU B CD1 1 
ATOM   4935 C CD2 . LEU B 1 256 ? -11.197 -10.065 -12.752 1.00 20.13 ? 256 LEU B CD2 1 
ATOM   4936 N N   . VAL B 1 257 ? -8.525  -5.941  -14.214 1.00 19.39 ? 257 VAL B N   1 
ATOM   4937 C CA  . VAL B 1 257 ? -7.166  -5.590  -13.836 1.00 18.34 ? 257 VAL B CA  1 
ATOM   4938 C C   . VAL B 1 257 ? -7.038  -5.241  -12.352 1.00 19.88 ? 257 VAL B C   1 
ATOM   4939 O O   . VAL B 1 257 ? -7.985  -4.759  -11.715 1.00 21.36 ? 257 VAL B O   1 
ATOM   4940 C CB  . VAL B 1 257 ? -6.642  -4.393  -14.710 1.00 18.34 ? 257 VAL B CB  1 
ATOM   4941 C CG1 . VAL B 1 257 ? -7.572  -3.196  -14.574 1.00 17.62 ? 257 VAL B CG1 1 
ATOM   4942 C CG2 . VAL B 1 257 ? -5.229  -4.001  -14.306 1.00 14.27 ? 257 VAL B CG2 1 
ATOM   4943 N N   . THR B 1 258 ? -5.856  -5.517  -11.815 1.00 16.91 ? 258 THR B N   1 
ATOM   4944 C CA  . THR B 1 258 ? -5.517  -5.218  -10.438 1.00 16.44 ? 258 THR B CA  1 
ATOM   4945 C C   . THR B 1 258 ? -4.049  -4.809  -10.484 1.00 15.86 ? 258 THR B C   1 
ATOM   4946 O O   . THR B 1 258 ? -3.301  -5.264  -11.344 1.00 16.33 ? 258 THR B O   1 
ATOM   4947 C CB  . THR B 1 258 ? -5.695  -6.462  -9.490  1.00 16.92 ? 258 THR B CB  1 
ATOM   4948 O OG1 . THR B 1 258 ? -5.297  -6.116  -8.149  1.00 16.05 ? 258 THR B OG1 1 
ATOM   4949 C CG2 . THR B 1 258 ? -4.858  -7.635  -9.967  1.00 5.90  ? 258 THR B CG2 1 
ATOM   4950 N N   . PRO B 1 259 ? -3.631  -3.911  -9.586  1.00 15.30 ? 259 PRO B N   1 
ATOM   4951 C CA  . PRO B 1 259 ? -2.232  -3.474  -9.559  1.00 18.03 ? 259 PRO B CA  1 
ATOM   4952 C C   . PRO B 1 259 ? -1.286  -4.642  -9.274  1.00 18.12 ? 259 PRO B C   1 
ATOM   4953 O O   . PRO B 1 259 ? -1.609  -5.551  -8.513  1.00 19.34 ? 259 PRO B O   1 
ATOM   4954 C CB  . PRO B 1 259 ? -2.217  -2.433  -8.441  1.00 16.31 ? 259 PRO B CB  1 
ATOM   4955 C CG  . PRO B 1 259 ? -3.581  -1.816  -8.546  1.00 19.85 ? 259 PRO B CG  1 
ATOM   4956 C CD  . PRO B 1 259 ? -4.481  -3.029  -8.768  1.00 18.69 ? 259 PRO B CD  1 
ATOM   4957 N N   . PRO B 1 260 ? -0.091  -4.619  -9.876  1.00 19.96 ? 260 PRO B N   1 
ATOM   4958 C CA  . PRO B 1 260 ? 0.902   -5.682  -9.686  1.00 17.99 ? 260 PRO B CA  1 
ATOM   4959 C C   . PRO B 1 260 ? 1.547   -5.613  -8.305  1.00 16.85 ? 260 PRO B C   1 
ATOM   4960 O O   . PRO B 1 260 ? 1.469   -4.594  -7.624  1.00 17.54 ? 260 PRO B O   1 
ATOM   4961 C CB  . PRO B 1 260 ? 1.932   -5.411  -10.789 1.00 18.60 ? 260 PRO B CB  1 
ATOM   4962 C CG  . PRO B 1 260 ? 1.330   -4.277  -11.644 1.00 19.19 ? 260 PRO B CG  1 
ATOM   4963 C CD  . PRO B 1 260 ? 0.465   -3.524  -10.690 1.00 18.91 ? 260 PRO B CD  1 
ATOM   4964 N N   . LEU B 1 261 ? 2.188   -6.701  -7.900  1.00 17.83 ? 261 LEU B N   1 
ATOM   4965 C CA  . LEU B 1 261 ? 2.867   -6.748  -6.618  1.00 16.10 ? 261 LEU B CA  1 
ATOM   4966 C C   . LEU B 1 261 ? 4.182   -6.018  -6.803  1.00 19.37 ? 261 LEU B C   1 
ATOM   4967 O O   . LEU B 1 261 ? 5.212   -6.636  -7.055  1.00 19.32 ? 261 LEU B O   1 
ATOM   4968 C CB  . LEU B 1 261 ? 3.108   -8.202  -6.210  1.00 14.59 ? 261 LEU B CB  1 
ATOM   4969 C CG  . LEU B 1 261 ? 1.929   -8.897  -5.514  1.00 20.29 ? 261 LEU B CG  1 
ATOM   4970 C CD1 . LEU B 1 261 ? 0.683   -7.997  -5.557  1.00 17.37 ? 261 LEU B CD1 1 
ATOM   4971 C CD2 . LEU B 1 261 ? 1.657   -10.244 -6.155  1.00 9.32  ? 261 LEU B CD2 1 
ATOM   4972 N N   . ASN B 1 262 ? 4.136   -4.694  -6.686  1.00 20.81 ? 262 ASN B N   1 
ATOM   4973 C CA  . ASN B 1 262 ? 5.315   -3.859  -6.860  1.00 22.36 ? 262 ASN B CA  1 
ATOM   4974 C C   . ASN B 1 262 ? 5.986   -3.472  -5.545  1.00 23.82 ? 262 ASN B C   1 
ATOM   4975 O O   . ASN B 1 262 ? 6.899   -2.647  -5.534  1.00 23.62 ? 262 ASN B O   1 
ATOM   4976 C CB  . ASN B 1 262 ? 4.934   -2.584  -7.615  1.00 25.50 ? 262 ASN B CB  1 
ATOM   4977 C CG  . ASN B 1 262 ? 3.733   -1.881  -6.998  1.00 29.94 ? 262 ASN B CG  1 
ATOM   4978 O OD1 . ASN B 1 262 ? 3.572   -1.855  -5.776  1.00 33.16 ? 262 ASN B OD1 1 
ATOM   4979 N ND2 . ASN B 1 262 ? 2.890   -1.300  -7.841  1.00 32.87 ? 262 ASN B ND2 1 
ATOM   4980 N N   . GLY B 1 263 ? 5.526   -4.047  -4.438  1.00 22.92 ? 263 GLY B N   1 
ATOM   4981 C CA  . GLY B 1 263 ? 6.113   -3.719  -3.151  1.00 22.26 ? 263 GLY B CA  1 
ATOM   4982 C C   . GLY B 1 263 ? 5.255   -2.860  -2.229  1.00 23.80 ? 263 GLY B C   1 
ATOM   4983 O O   . GLY B 1 263 ? 5.456   -2.874  -1.012  1.00 24.81 ? 263 GLY B O   1 
ATOM   4984 N N   . VAL B 1 264 ? 4.304   -2.113  -2.785  1.00 19.15 ? 264 VAL B N   1 
ATOM   4985 C CA  . VAL B 1 264 ? 3.439   -1.260  -1.972  1.00 19.78 ? 264 VAL B CA  1 
ATOM   4986 C C   . VAL B 1 264 ? 2.055   -1.889  -1.847  1.00 22.23 ? 264 VAL B C   1 
ATOM   4987 O O   . VAL B 1 264 ? 1.086   -1.230  -1.458  1.00 20.83 ? 264 VAL B O   1 
ATOM   4988 C CB  . VAL B 1 264 ? 3.289   0.140   -2.609  1.00 20.16 ? 264 VAL B CB  1 
ATOM   4989 C CG1 . VAL B 1 264 ? 2.452   1.030   -1.730  1.00 25.23 ? 264 VAL B CG1 1 
ATOM   4990 C CG2 . VAL B 1 264 ? 4.655   0.772   -2.795  1.00 24.46 ? 264 VAL B CG2 1 
ATOM   4991 N N   . ILE B 1 265 ? 1.967   -3.175  -2.164  1.00 20.36 ? 265 ILE B N   1 
ATOM   4992 C CA  . ILE B 1 265 ? 0.690   -3.864  -2.127  1.00 20.36 ? 265 ILE B CA  1 
ATOM   4993 C C   . ILE B 1 265 ? 0.758   -5.200  -1.394  1.00 20.89 ? 265 ILE B C   1 
ATOM   4994 O O   . ILE B 1 265 ? 1.673   -5.992  -1.609  1.00 23.95 ? 265 ILE B O   1 
ATOM   4995 C CB  . ILE B 1 265 ? 0.180   -4.083  -3.573  1.00 23.23 ? 265 ILE B CB  1 
ATOM   4996 C CG1 . ILE B 1 265 ? 0.041   -2.724  -4.267  1.00 19.85 ? 265 ILE B CG1 1 
ATOM   4997 C CG2 . ILE B 1 265 ? -1.132  -4.857  -3.569  1.00 20.24 ? 265 ILE B CG2 1 
ATOM   4998 C CD1 . ILE B 1 265 ? -0.396  -2.802  -5.697  1.00 25.80 ? 265 ILE B CD1 1 
ATOM   4999 N N   . LEU B 1 266 ? -0.226  -5.437  -0.530  1.00 18.49 ? 266 LEU B N   1 
ATOM   5000 C CA  . LEU B 1 266 ? -0.303  -6.664  0.251   1.00 12.94 ? 266 LEU B CA  1 
ATOM   5001 C C   . LEU B 1 266 ? -0.865  -7.769  -0.640  1.00 10.62 ? 266 LEU B C   1 
ATOM   5002 O O   . LEU B 1 266 ? -1.933  -7.610  -1.218  1.00 6.45  ? 266 LEU B O   1 
ATOM   5003 C CB  . LEU B 1 266 ? -1.220  -6.441  1.460   1.00 14.79 ? 266 LEU B CB  1 
ATOM   5004 C CG  . LEU B 1 266 ? -1.229  -7.433  2.633   1.00 15.48 ? 266 LEU B CG  1 
ATOM   5005 C CD1 . LEU B 1 266 ? -1.705  -8.817  2.174   1.00 15.87 ? 266 LEU B CD1 1 
ATOM   5006 C CD2 . LEU B 1 266 ? 0.174   -7.518  3.232   1.00 16.10 ? 266 LEU B CD2 1 
ATOM   5007 N N   . PRO B 1 267 ? -0.146  -8.900  -0.769  1.00 11.73 ? 267 PRO B N   1 
ATOM   5008 C CA  . PRO B 1 267 ? -0.567  -10.046 -1.593  1.00 12.78 ? 267 PRO B CA  1 
ATOM   5009 C C   . PRO B 1 267 ? -1.810  -10.714 -1.005  1.00 13.14 ? 267 PRO B C   1 
ATOM   5010 O O   . PRO B 1 267 ? -1.702  -11.666 -0.251  1.00 17.31 ? 267 PRO B O   1 
ATOM   5011 C CB  . PRO B 1 267 ? 0.642   -10.983 -1.539  1.00 6.67  ? 267 PRO B CB  1 
ATOM   5012 C CG  . PRO B 1 267 ? 1.789   -10.064 -1.233  1.00 13.09 ? 267 PRO B CG  1 
ATOM   5013 C CD  . PRO B 1 267 ? 1.200   -9.124  -0.222  1.00 11.93 ? 267 PRO B CD  1 
ATOM   5014 N N   . GLY B 1 268 ? -2.987  -10.213 -1.349  1.00 17.05 ? 268 GLY B N   1 
ATOM   5015 C CA  . GLY B 1 268 ? -4.216  -10.772 -0.819  1.00 15.60 ? 268 GLY B CA  1 
ATOM   5016 C C   . GLY B 1 268 ? -4.489  -12.187 -1.286  1.00 16.52 ? 268 GLY B C   1 
ATOM   5017 O O   . GLY B 1 268 ? -4.178  -12.555 -2.423  1.00 14.93 ? 268 GLY B O   1 
ATOM   5018 N N   . VAL B 1 269 ? -5.073  -12.986 -0.398  1.00 17.35 ? 269 VAL B N   1 
ATOM   5019 C CA  . VAL B 1 269 ? -5.393  -14.362 -0.722  1.00 18.71 ? 269 VAL B CA  1 
ATOM   5020 C C   . VAL B 1 269 ? -6.618  -14.387 -1.622  1.00 17.08 ? 269 VAL B C   1 
ATOM   5021 O O   . VAL B 1 269 ? -6.673  -15.144 -2.588  1.00 19.21 ? 269 VAL B O   1 
ATOM   5022 C CB  . VAL B 1 269 ? -5.650  -15.192 0.557   1.00 19.76 ? 269 VAL B CB  1 
ATOM   5023 C CG1 . VAL B 1 269 ? -6.150  -16.573 0.188   1.00 17.19 ? 269 VAL B CG1 1 
ATOM   5024 C CG2 . VAL B 1 269 ? -4.361  -15.320 1.355   1.00 18.38 ? 269 VAL B CG2 1 
ATOM   5025 N N   . VAL B 1 270 ? -7.595  -13.545 -1.311  1.00 13.27 ? 270 VAL B N   1 
ATOM   5026 C CA  . VAL B 1 270 ? -8.793  -13.483 -2.123  1.00 14.79 ? 270 VAL B CA  1 
ATOM   5027 C C   . VAL B 1 270 ? -8.413  -12.926 -3.488  1.00 16.95 ? 270 VAL B C   1 
ATOM   5028 O O   . VAL B 1 270 ? -8.945  -13.358 -4.518  1.00 19.16 ? 270 VAL B O   1 
ATOM   5029 C CB  . VAL B 1 270 ? -9.870  -12.589 -1.457  1.00 13.19 ? 270 VAL B CB  1 
ATOM   5030 C CG1 . VAL B 1 270 ? -11.126 -12.536 -2.315  1.00 10.38 ? 270 VAL B CG1 1 
ATOM   5031 C CG2 . VAL B 1 270 ? -10.207 -13.147 -0.098  1.00 10.59 ? 270 VAL B CG2 1 
ATOM   5032 N N   . ARG B 1 271 ? -7.483  -11.971 -3.488  1.00 16.35 ? 271 ARG B N   1 
ATOM   5033 C CA  . ARG B 1 271 ? -7.009  -11.346 -4.720  1.00 17.69 ? 271 ARG B CA  1 
ATOM   5034 C C   . ARG B 1 271 ? -6.474  -12.411 -5.678  1.00 19.95 ? 271 ARG B C   1 
ATOM   5035 O O   . ARG B 1 271 ? -6.807  -12.432 -6.862  1.00 21.01 ? 271 ARG B O   1 
ATOM   5036 C CB  . ARG B 1 271 ? -5.894  -10.359 -4.395  1.00 17.52 ? 271 ARG B CB  1 
ATOM   5037 C CG  . ARG B 1 271 ? -5.103  -9.854  -5.594  1.00 14.57 ? 271 ARG B CG  1 
ATOM   5038 C CD  . ARG B 1 271 ? -3.893  -9.063  -5.120  1.00 13.24 ? 271 ARG B CD  1 
ATOM   5039 N NE  . ARG B 1 271 ? -3.087  -8.549  -6.220  1.00 15.59 ? 271 ARG B NE  1 
ATOM   5040 C CZ  . ARG B 1 271 ? -2.254  -9.280  -6.952  1.00 16.65 ? 271 ARG B CZ  1 
ATOM   5041 N NH1 . ARG B 1 271 ? -2.102  -10.575 -6.702  1.00 15.30 ? 271 ARG B NH1 1 
ATOM   5042 N NH2 . ARG B 1 271 ? -1.576  -8.712  -7.943  1.00 16.48 ? 271 ARG B NH2 1 
ATOM   5043 N N   . GLN B 1 272 ? -5.636  -13.292 -5.144  1.00 19.58 ? 272 GLN B N   1 
ATOM   5044 C CA  . GLN B 1 272 ? -5.043  -14.359 -5.926  1.00 19.65 ? 272 GLN B CA  1 
ATOM   5045 C C   . GLN B 1 272 ? -6.115  -15.345 -6.394  1.00 21.18 ? 272 GLN B C   1 
ATOM   5046 O O   . GLN B 1 272 ? -6.026  -15.890 -7.499  1.00 18.18 ? 272 GLN B O   1 
ATOM   5047 C CB  . GLN B 1 272 ? -3.985  -15.090 -5.087  1.00 19.37 ? 272 GLN B CB  1 
ATOM   5048 C CG  . GLN B 1 272 ? -3.158  -16.111 -5.863  1.00 24.96 ? 272 GLN B CG  1 
ATOM   5049 C CD  . GLN B 1 272 ? -2.433  -15.487 -7.046  1.00 28.67 ? 272 GLN B CD  1 
ATOM   5050 O OE1 . GLN B 1 272 ? -2.661  -15.870 -8.194  1.00 28.61 ? 272 GLN B OE1 1 
ATOM   5051 N NE2 . GLN B 1 272 ? -1.560  -14.513 -6.770  1.00 27.59 ? 272 GLN B NE2 1 
ATOM   5052 N N   . SER B 1 273 ? -7.131  -15.563 -5.557  1.00 18.58 ? 273 SER B N   1 
ATOM   5053 C CA  . SER B 1 273 ? -8.198  -16.496 -5.894  1.00 18.98 ? 273 SER B CA  1 
ATOM   5054 C C   . SER B 1 273 ? -9.088  -15.959 -7.013  1.00 21.40 ? 273 SER B C   1 
ATOM   5055 O O   . SER B 1 273 ? -9.643  -16.733 -7.795  1.00 23.61 ? 273 SER B O   1 
ATOM   5056 C CB  . SER B 1 273 ? -9.049  -16.805 -4.661  1.00 18.78 ? 273 SER B CB  1 
ATOM   5057 O OG  . SER B 1 273 ? -8.257  -17.343 -3.617  1.00 22.67 ? 273 SER B OG  1 
ATOM   5058 N N   . LEU B 1 274 ? -9.232  -14.641 -7.088  1.00 18.21 ? 274 LEU B N   1 
ATOM   5059 C CA  . LEU B 1 274 ? -10.045 -14.045 -8.132  1.00 18.58 ? 274 LEU B CA  1 
ATOM   5060 C C   . LEU B 1 274 ? -9.304  -14.159 -9.472  1.00 21.61 ? 274 LEU B C   1 
ATOM   5061 O O   . LEU B 1 274 ? -9.894  -14.537 -10.495 1.00 21.64 ? 274 LEU B O   1 
ATOM   5062 C CB  . LEU B 1 274 ? -10.348 -12.582 -7.794  1.00 17.14 ? 274 LEU B CB  1 
ATOM   5063 C CG  . LEU B 1 274 ? -11.167 -12.390 -6.511  1.00 15.53 ? 274 LEU B CG  1 
ATOM   5064 C CD1 . LEU B 1 274 ? -11.435 -10.915 -6.274  1.00 12.76 ? 274 LEU B CD1 1 
ATOM   5065 C CD2 . LEU B 1 274 ? -12.475 -13.152 -6.625  1.00 17.36 ? 274 LEU B CD2 1 
ATOM   5066 N N   . LEU B 1 275 ? -8.011  -13.843 -9.467  1.00 19.70 ? 275 LEU B N   1 
ATOM   5067 C CA  . LEU B 1 275 ? -7.206  -13.942 -10.683 1.00 19.30 ? 275 LEU B CA  1 
ATOM   5068 C C   . LEU B 1 275 ? -7.238  -15.372 -11.231 1.00 21.74 ? 275 LEU B C   1 
ATOM   5069 O O   . LEU B 1 275 ? -7.403  -15.577 -12.432 1.00 25.90 ? 275 LEU B O   1 
ATOM   5070 C CB  . LEU B 1 275 ? -5.748  -13.554 -10.406 1.00 15.78 ? 275 LEU B CB  1 
ATOM   5071 C CG  . LEU B 1 275 ? -5.202  -12.117 -10.495 1.00 18.34 ? 275 LEU B CG  1 
ATOM   5072 C CD1 . LEU B 1 275 ? -6.239  -11.147 -11.051 1.00 18.25 ? 275 LEU B CD1 1 
ATOM   5073 C CD2 . LEU B 1 275 ? -4.733  -11.687 -9.124  1.00 20.03 ? 275 LEU B CD2 1 
ATOM   5074 N N   . ASP B 1 276 ? -7.072  -16.357 -10.352 1.00 20.92 ? 276 ASP B N   1 
ATOM   5075 C CA  . ASP B 1 276 ? -7.069  -17.766 -10.752 1.00 21.66 ? 276 ASP B CA  1 
ATOM   5076 C C   . ASP B 1 276 ? -8.400  -18.177 -11.356 1.00 22.20 ? 276 ASP B C   1 
ATOM   5077 O O   . ASP B 1 276 ? -8.460  -18.797 -12.415 1.00 23.76 ? 276 ASP B O   1 
ATOM   5078 C CB  . ASP B 1 276 ? -6.798  -18.669 -9.541  1.00 23.00 ? 276 ASP B CB  1 
ATOM   5079 C CG  . ASP B 1 276 ? -5.397  -18.516 -8.993  1.00 23.33 ? 276 ASP B CG  1 
ATOM   5080 O OD1 . ASP B 1 276 ? -5.187  -18.892 -7.824  1.00 28.05 ? 276 ASP B OD1 1 
ATOM   5081 O OD2 . ASP B 1 276 ? -4.507  -18.033 -9.721  1.00 24.84 ? 276 ASP B OD2 1 
ATOM   5082 N N   . MET B 1 277 ? -9.463  -17.834 -10.647 1.00 21.40 ? 277 MET B N   1 
ATOM   5083 C CA  . MET B 1 277 ? -10.823 -18.147 -11.053 1.00 23.31 ? 277 MET B CA  1 
ATOM   5084 C C   . MET B 1 277 ? -11.166 -17.495 -12.402 1.00 24.20 ? 277 MET B C   1 
ATOM   5085 O O   . MET B 1 277 ? -11.770 -18.124 -13.276 1.00 22.05 ? 277 MET B O   1 
ATOM   5086 C CB  . MET B 1 277 ? -11.762 -17.662 -9.950  1.00 22.96 ? 277 MET B CB  1 
ATOM   5087 C CG  . MET B 1 277 ? -13.169 -18.174 -9.993  1.00 29.05 ? 277 MET B CG  1 
ATOM   5088 S SD  . MET B 1 277 ? -13.971 -17.817 -8.386  1.00 31.13 ? 277 MET B SD  1 
ATOM   5089 C CE  . MET B 1 277 ? -14.029 -19.441 -7.696  1.00 38.01 ? 277 MET B CE  1 
ATOM   5090 N N   . ALA B 1 278 ? -10.765 -16.238 -12.576 1.00 22.54 ? 278 ALA B N   1 
ATOM   5091 C CA  . ALA B 1 278 ? -11.052 -15.527 -13.810 1.00 23.32 ? 278 ALA B CA  1 
ATOM   5092 C C   . ALA B 1 278 ? -10.216 -16.066 -14.975 1.00 25.19 ? 278 ALA B C   1 
ATOM   5093 O O   . ALA B 1 278 ? -10.690 -16.149 -16.114 1.00 20.98 ? 278 ALA B O   1 
ATOM   5094 C CB  . ALA B 1 278 ? -10.804 -14.048 -13.617 1.00 19.35 ? 278 ALA B CB  1 
ATOM   5095 N N   . GLN B 1 279 ? -8.967  -16.417 -14.684 1.00 29.86 ? 279 GLN B N   1 
ATOM   5096 C CA  . GLN B 1 279 ? -8.053  -16.976 -15.684 1.00 34.29 ? 279 GLN B CA  1 
ATOM   5097 C C   . GLN B 1 279 ? -8.624  -18.295 -16.225 1.00 34.04 ? 279 GLN B C   1 
ATOM   5098 O O   . GLN B 1 279 ? -8.468  -18.624 -17.400 1.00 31.32 ? 279 GLN B O   1 
ATOM   5099 C CB  . GLN B 1 279 ? -6.683  -17.250 -15.054 1.00 34.76 ? 279 GLN B CB  1 
ATOM   5100 C CG  . GLN B 1 279 ? -5.661  -16.131 -15.167 1.00 41.94 ? 279 GLN B CG  1 
ATOM   5101 C CD  . GLN B 1 279 ? -5.020  -16.047 -16.550 1.00 47.40 ? 279 GLN B CD  1 
ATOM   5102 O OE1 . GLN B 1 279 ? -4.813  -17.066 -17.219 1.00 48.18 ? 279 GLN B OE1 1 
ATOM   5103 N NE2 . GLN B 1 279 ? -4.677  -14.831 -16.972 1.00 49.00 ? 279 GLN B NE2 1 
ATOM   5104 N N   . THR B 1 280 ? -9.288  -19.038 -15.349 1.00 33.57 ? 280 THR B N   1 
ATOM   5105 C CA  . THR B 1 280 ? -9.885  -20.315 -15.706 1.00 34.33 ? 280 THR B CA  1 
ATOM   5106 C C   . THR B 1 280 ? -11.094 -20.194 -16.640 1.00 34.18 ? 280 THR B C   1 
ATOM   5107 O O   . THR B 1 280 ? -11.265 -21.022 -17.529 1.00 36.93 ? 280 THR B O   1 
ATOM   5108 C CB  . THR B 1 280 ? -10.306 -21.090 -14.436 1.00 36.99 ? 280 THR B CB  1 
ATOM   5109 O OG1 . THR B 1 280 ? -9.142  -21.419 -13.666 1.00 36.95 ? 280 THR B OG1 1 
ATOM   5110 C CG2 . THR B 1 280 ? -11.029 -22.372 -14.808 1.00 37.78 ? 280 THR B CG2 1 
ATOM   5111 N N   . TRP B 1 281 ? -11.937 -19.183 -16.446 1.00 32.39 ? 281 TRP B N   1 
ATOM   5112 C CA  . TRP B 1 281 ? -13.103 -19.024 -17.308 1.00 31.51 ? 281 TRP B CA  1 
ATOM   5113 C C   . TRP B 1 281 ? -12.690 -18.684 -18.728 1.00 34.97 ? 281 TRP B C   1 
ATOM   5114 O O   . TRP B 1 281 ? -13.435 -18.945 -19.670 1.00 39.35 ? 281 TRP B O   1 
ATOM   5115 C CB  . TRP B 1 281 ? -14.026 -17.909 -16.822 1.00 30.64 ? 281 TRP B CB  1 
ATOM   5116 C CG  . TRP B 1 281 ? -14.582 -18.085 -15.455 1.00 30.61 ? 281 TRP B CG  1 
ATOM   5117 C CD1 . TRP B 1 281 ? -14.858 -19.258 -14.821 1.00 28.62 ? 281 TRP B CD1 1 
ATOM   5118 C CD2 . TRP B 1 281 ? -14.985 -17.039 -14.561 1.00 32.10 ? 281 TRP B CD2 1 
ATOM   5119 N NE1 . TRP B 1 281 ? -15.408 -19.010 -13.586 1.00 31.20 ? 281 TRP B NE1 1 
ATOM   5120 C CE2 . TRP B 1 281 ? -15.494 -17.654 -13.401 1.00 31.63 ? 281 TRP B CE2 1 
ATOM   5121 C CE3 . TRP B 1 281 ? -14.962 -15.637 -14.631 1.00 32.01 ? 281 TRP B CE3 1 
ATOM   5122 C CZ2 . TRP B 1 281 ? -15.980 -16.918 -12.318 1.00 31.87 ? 281 TRP B CZ2 1 
ATOM   5123 C CZ3 . TRP B 1 281 ? -15.447 -14.906 -13.554 1.00 30.63 ? 281 TRP B CZ3 1 
ATOM   5124 C CH2 . TRP B 1 281 ? -15.946 -15.549 -12.413 1.00 31.38 ? 281 TRP B CH2 1 
ATOM   5125 N N   . GLY B 1 282 ? -11.515 -18.082 -18.880 1.00 33.96 ? 282 GLY B N   1 
ATOM   5126 C CA  . GLY B 1 282 ? -11.047 -17.710 -20.204 1.00 33.51 ? 282 GLY B CA  1 
ATOM   5127 C C   . GLY B 1 282 ? -12.078 -16.942 -21.012 1.00 34.34 ? 282 GLY B C   1 
ATOM   5128 O O   . GLY B 1 282 ? -12.172 -17.118 -22.226 1.00 40.30 ? 282 GLY B O   1 
ATOM   5129 N N   . GLU B 1 283 ? -12.850 -16.088 -20.348 1.00 34.29 ? 283 GLU B N   1 
ATOM   5130 C CA  . GLU B 1 283 ? -13.881 -15.300 -21.018 1.00 35.23 ? 283 GLU B CA  1 
ATOM   5131 C C   . GLU B 1 283 ? -13.436 -13.885 -21.353 1.00 33.95 ? 283 GLU B C   1 
ATOM   5132 O O   . GLU B 1 283 ? -14.054 -13.214 -22.180 1.00 34.16 ? 283 GLU B O   1 
ATOM   5133 C CB  . GLU B 1 283 ? -15.149 -15.261 -20.163 1.00 37.71 ? 283 GLU B CB  1 
ATOM   5134 C CG  . GLU B 1 283 ? -15.938 -16.568 -20.208 1.00 40.01 ? 283 GLU B CG  1 
ATOM   5135 C CD  . GLU B 1 283 ? -17.171 -16.551 -19.322 1.00 41.13 ? 283 GLU B CD  1 
ATOM   5136 O OE1 . GLU B 1 283 ? -17.895 -15.528 -19.320 1.00 40.25 ? 283 GLU B OE1 1 
ATOM   5137 O OE2 . GLU B 1 283 ? -17.417 -17.569 -18.638 1.00 42.04 ? 283 GLU B OE2 1 
ATOM   5138 N N   . PHE B 1 284 ? -12.371 -13.427 -20.702 1.00 31.64 ? 284 PHE B N   1 
ATOM   5139 C CA  . PHE B 1 284 ? -11.840 -12.094 -20.960 1.00 28.82 ? 284 PHE B CA  1 
ATOM   5140 C C   . PHE B 1 284 ? -10.419 -11.995 -20.438 1.00 25.78 ? 284 PHE B C   1 
ATOM   5141 O O   . PHE B 1 284 ? -9.954  -12.868 -19.703 1.00 22.94 ? 284 PHE B O   1 
ATOM   5142 C CB  . PHE B 1 284 ? -12.719 -11.017 -20.319 1.00 26.93 ? 284 PHE B CB  1 
ATOM   5143 C CG  . PHE B 1 284 ? -13.100 -11.314 -18.911 1.00 29.49 ? 284 PHE B CG  1 
ATOM   5144 C CD1 . PHE B 1 284 ? -14.361 -11.808 -18.612 1.00 29.63 ? 284 PHE B CD1 1 
ATOM   5145 C CD2 . PHE B 1 284 ? -12.193 -11.116 -17.876 1.00 31.21 ? 284 PHE B CD2 1 
ATOM   5146 C CE1 . PHE B 1 284 ? -14.718 -12.103 -17.298 1.00 29.45 ? 284 PHE B CE1 1 
ATOM   5147 C CE2 . PHE B 1 284 ? -12.545 -11.411 -16.557 1.00 30.83 ? 284 PHE B CE2 1 
ATOM   5148 C CZ  . PHE B 1 284 ? -13.811 -11.906 -16.271 1.00 27.77 ? 284 PHE B CZ  1 
ATOM   5149 N N   . ARG B 1 285 ? -9.727  -10.937 -20.839 1.00 23.35 ? 285 ARG B N   1 
ATOM   5150 C CA  . ARG B 1 285 ? -8.347  -10.731 -20.428 1.00 22.86 ? 285 ARG B CA  1 
ATOM   5151 C C   . ARG B 1 285 ? -8.248  -10.403 -18.930 1.00 23.95 ? 285 ARG B C   1 
ATOM   5152 O O   . ARG B 1 285 ? -8.938  -9.518  -18.417 1.00 22.72 ? 285 ARG B O   1 
ATOM   5153 C CB  . ARG B 1 285 ? -7.737  -9.607  -21.264 1.00 23.86 ? 285 ARG B CB  1 
ATOM   5154 C CG  . ARG B 1 285 ? -6.262  -9.351  -21.005 1.00 27.20 ? 285 ARG B CG  1 
ATOM   5155 C CD  . ARG B 1 285 ? -5.944  -7.904  -21.303 1.00 24.89 ? 285 ARG B CD  1 
ATOM   5156 N NE  . ARG B 1 285 ? -5.740  -7.645  -22.719 1.00 27.76 ? 285 ARG B NE  1 
ATOM   5157 C CZ  . ARG B 1 285 ? -5.900  -6.455  -23.297 1.00 30.68 ? 285 ARG B CZ  1 
ATOM   5158 N NH1 . ARG B 1 285 ? -6.283  -5.399  -22.591 1.00 28.77 ? 285 ARG B NH1 1 
ATOM   5159 N NH2 . ARG B 1 285 ? -5.641  -6.310  -24.588 1.00 32.00 ? 285 ARG B NH2 1 
ATOM   5160 N N   . VAL B 1 286 ? -7.391  -11.137 -18.237 1.00 22.01 ? 286 VAL B N   1 
ATOM   5161 C CA  . VAL B 1 286 ? -7.182  -10.958 -16.806 1.00 21.95 ? 286 VAL B CA  1 
ATOM   5162 C C   . VAL B 1 286 ? -5.721  -10.554 -16.647 1.00 20.95 ? 286 VAL B C   1 
ATOM   5163 O O   . VAL B 1 286 ? -4.834  -11.361 -16.898 1.00 21.56 ? 286 VAL B O   1 
ATOM   5164 C CB  . VAL B 1 286 ? -7.441  -12.285 -16.056 1.00 20.28 ? 286 VAL B CB  1 
ATOM   5165 C CG1 . VAL B 1 286 ? -7.205  -12.111 -14.558 1.00 13.64 ? 286 VAL B CG1 1 
ATOM   5166 C CG2 . VAL B 1 286 ? -8.866  -12.751 -16.324 1.00 21.66 ? 286 VAL B CG2 1 
ATOM   5167 N N   . VAL B 1 287 ? -5.457  -9.325  -16.218 1.00 18.42 ? 287 VAL B N   1 
ATOM   5168 C CA  . VAL B 1 287 ? -4.070  -8.886  -16.115 1.00 21.48 ? 287 VAL B CA  1 
ATOM   5169 C C   . VAL B 1 287 ? -3.707  -8.050  -14.891 1.00 19.78 ? 287 VAL B C   1 
ATOM   5170 O O   . VAL B 1 287 ? -4.565  -7.401  -14.297 1.00 25.17 ? 287 VAL B O   1 
ATOM   5171 C CB  . VAL B 1 287 ? -3.679  -8.090  -17.395 1.00 18.87 ? 287 VAL B CB  1 
ATOM   5172 C CG1 . VAL B 1 287 ? -4.723  -7.017  -17.677 1.00 16.88 ? 287 VAL B CG1 1 
ATOM   5173 C CG2 . VAL B 1 287 ? -2.320  -7.442  -17.219 1.00 24.33 ? 287 VAL B CG2 1 
ATOM   5174 N N   . GLU B 1 288 ? -2.428  -8.090  -14.519 1.00 17.68 ? 288 GLU B N   1 
ATOM   5175 C CA  . GLU B 1 288 ? -1.900  -7.317  -13.393 1.00 20.07 ? 288 GLU B CA  1 
ATOM   5176 C C   . GLU B 1 288 ? -1.151  -6.125  -13.984 1.00 21.05 ? 288 GLU B C   1 
ATOM   5177 O O   . GLU B 1 288 ? -0.033  -6.272  -14.482 1.00 21.62 ? 288 GLU B O   1 
ATOM   5178 C CB  . GLU B 1 288 ? -0.923  -8.156  -12.563 1.00 15.71 ? 288 GLU B CB  1 
ATOM   5179 C CG  . GLU B 1 288 ? -1.534  -9.389  -11.937 1.00 13.54 ? 288 GLU B CG  1 
ATOM   5180 C CD  . GLU B 1 288 ? -0.537  -10.157 -11.093 1.00 17.25 ? 288 GLU B CD  1 
ATOM   5181 O OE1 . GLU B 1 288 ? -0.062  -9.607  -10.075 1.00 18.50 ? 288 GLU B OE1 1 
ATOM   5182 O OE2 . GLU B 1 288 ? -0.222  -11.310 -11.451 1.00 15.61 ? 288 GLU B OE2 1 
ATOM   5183 N N   . ARG B 1 289 ? -1.751  -4.945  -13.933 1.00 19.66 ? 289 ARG B N   1 
ATOM   5184 C CA  . ARG B 1 289 ? -1.098  -3.778  -14.513 1.00 20.49 ? 289 ARG B CA  1 
ATOM   5185 C C   . ARG B 1 289 ? -1.377  -2.503  -13.717 1.00 21.31 ? 289 ARG B C   1 
ATOM   5186 O O   . ARG B 1 289 ? -2.439  -2.365  -13.101 1.00 23.79 ? 289 ARG B O   1 
ATOM   5187 C CB  . ARG B 1 289 ? -1.578  -3.609  -15.957 1.00 19.08 ? 289 ARG B CB  1 
ATOM   5188 C CG  . ARG B 1 289 ? -0.808  -2.589  -16.776 1.00 21.70 ? 289 ARG B CG  1 
ATOM   5189 C CD  . ARG B 1 289 ? -1.646  -2.054  -17.928 1.00 18.56 ? 289 ARG B CD  1 
ATOM   5190 N NE  . ARG B 1 289 ? -2.231  -3.134  -18.720 1.00 22.31 ? 289 ARG B NE  1 
ATOM   5191 C CZ  . ARG B 1 289 ? -3.536  -3.272  -18.947 1.00 19.14 ? 289 ARG B CZ  1 
ATOM   5192 N NH1 . ARG B 1 289 ? -4.398  -2.391  -18.437 1.00 9.23  ? 289 ARG B NH1 1 
ATOM   5193 N NH2 . ARG B 1 289 ? -3.975  -4.283  -19.693 1.00 14.51 ? 289 ARG B NH2 1 
ATOM   5194 N N   . THR B 1 290 ? -0.426  -1.572  -13.727 1.00 19.54 ? 290 THR B N   1 
ATOM   5195 C CA  . THR B 1 290 ? -0.593  -0.309  -13.010 1.00 16.05 ? 290 THR B CA  1 
ATOM   5196 C C   . THR B 1 290 ? -1.830  0.422   -13.506 1.00 16.30 ? 290 THR B C   1 
ATOM   5197 O O   . THR B 1 290 ? -2.149  0.382   -14.691 1.00 22.85 ? 290 THR B O   1 
ATOM   5198 C CB  . THR B 1 290 ? 0.640   0.615   -13.195 1.00 14.82 ? 290 THR B CB  1 
ATOM   5199 O OG1 . THR B 1 290 ? 1.758   0.057   -12.497 1.00 19.21 ? 290 THR B OG1 1 
ATOM   5200 C CG2 . THR B 1 290 ? 0.365   2.019   -12.651 1.00 14.24 ? 290 THR B CG2 1 
ATOM   5201 N N   . ILE B 1 291 ? -2.535  1.072   -12.590 1.00 17.38 ? 291 ILE B N   1 
ATOM   5202 C CA  . ILE B 1 291 ? -3.724  1.837   -12.932 1.00 17.14 ? 291 ILE B CA  1 
ATOM   5203 C C   . ILE B 1 291 ? -3.554  3.230   -12.318 1.00 20.29 ? 291 ILE B C   1 
ATOM   5204 O O   . ILE B 1 291 ? -3.223  3.357   -11.140 1.00 19.29 ? 291 ILE B O   1 
ATOM   5205 C CB  . ILE B 1 291 ? -5.000  1.211   -12.340 1.00 16.21 ? 291 ILE B CB  1 
ATOM   5206 C CG1 . ILE B 1 291 ? -5.078  -0.265  -12.695 1.00 18.89 ? 291 ILE B CG1 1 
ATOM   5207 C CG2 . ILE B 1 291 ? -6.235  1.903   -12.901 1.00 16.79 ? 291 ILE B CG2 1 
ATOM   5208 C CD1 . ILE B 1 291 ? -6.313  -0.944  -12.133 1.00 15.77 ? 291 ILE B CD1 1 
ATOM   5209 N N   . THR B 1 292 ? -3.781  4.272   -13.105 1.00 18.07 ? 292 THR B N   1 
ATOM   5210 C CA  . THR B 1 292 ? -3.646  5.628   -12.590 1.00 18.46 ? 292 THR B CA  1 
ATOM   5211 C C   . THR B 1 292 ? -5.002  6.326   -12.609 1.00 21.37 ? 292 THR B C   1 
ATOM   5212 O O   . THR B 1 292 ? -5.883  5.959   -13.388 1.00 22.76 ? 292 THR B O   1 
ATOM   5213 C CB  . THR B 1 292 ? -2.679  6.457   -13.447 1.00 17.16 ? 292 THR B CB  1 
ATOM   5214 O OG1 . THR B 1 292 ? -3.189  6.546   -14.786 1.00 14.91 ? 292 THR B OG1 1 
ATOM   5215 C CG2 . THR B 1 292 ? -1.303  5.825   -13.464 1.00 14.70 ? 292 THR B CG2 1 
ATOM   5216 N N   . MET B 1 293 ? -5.163  7.336   -11.759 1.00 22.03 ? 293 MET B N   1 
ATOM   5217 C CA  . MET B 1 293 ? -6.415  8.085   -11.694 1.00 23.89 ? 293 MET B CA  1 
ATOM   5218 C C   . MET B 1 293 ? -6.826  8.625   -13.049 1.00 26.23 ? 293 MET B C   1 
ATOM   5219 O O   . MET B 1 293 ? -8.000  8.574   -13.406 1.00 26.73 ? 293 MET B O   1 
ATOM   5220 C CB  . MET B 1 293 ? -6.301  9.253   -10.713 1.00 25.55 ? 293 MET B CB  1 
ATOM   5221 C CG  . MET B 1 293 ? -6.526  8.873   -9.261  1.00 31.17 ? 293 MET B CG  1 
ATOM   5222 S SD  . MET B 1 293 ? -8.064  7.943   -9.017  1.00 33.29 ? 293 MET B SD  1 
ATOM   5223 C CE  . MET B 1 293 ? -9.300  9.201   -9.385  1.00 31.74 ? 293 MET B CE  1 
ATOM   5224 N N   . LYS B 1 294 ? -5.859  9.154   -13.795 1.00 28.85 ? 294 LYS B N   1 
ATOM   5225 C CA  . LYS B 1 294 ? -6.135  9.698   -15.120 1.00 30.54 ? 294 LYS B CA  1 
ATOM   5226 C C   . LYS B 1 294 ? -6.744  8.638   -16.020 1.00 25.65 ? 294 LYS B C   1 
ATOM   5227 O O   . LYS B 1 294 ? -7.721  8.906   -16.711 1.00 28.08 ? 294 LYS B O   1 
ATOM   5228 C CB  . LYS B 1 294 ? -4.855  10.270  -15.744 1.00 36.51 ? 294 LYS B CB  1 
ATOM   5229 C CG  . LYS B 1 294 ? -3.580  9.756   -15.087 1.00 47.54 ? 294 LYS B CG  1 
ATOM   5230 C CD  . LYS B 1 294 ? -2.412  10.727  -15.292 1.00 51.89 ? 294 LYS B CD  1 
ATOM   5231 C CE  . LYS B 1 294 ? -1.174  10.291  -14.503 1.00 50.64 ? 294 LYS B CE  1 
ATOM   5232 N NZ  . LYS B 1 294 ? -0.120  11.350  -14.501 1.00 49.43 ? 294 LYS B NZ  1 
ATOM   5233 N N   . GLN B 1 295 ? -6.182  7.435   -16.007 1.00 23.31 ? 295 GLN B N   1 
ATOM   5234 C CA  . GLN B 1 295 ? -6.721  6.343   -16.823 1.00 23.31 ? 295 GLN B CA  1 
ATOM   5235 C C   . GLN B 1 295 ? -8.145  6.040   -16.377 1.00 21.62 ? 295 GLN B C   1 
ATOM   5236 O O   . GLN B 1 295 ? -9.021  5.758   -17.194 1.00 23.72 ? 295 GLN B O   1 
ATOM   5237 C CB  . GLN B 1 295 ? -5.894  5.076   -16.652 1.00 20.62 ? 295 GLN B CB  1 
ATOM   5238 C CG  . GLN B 1 295 ? -4.666  4.987   -17.508 1.00 24.99 ? 295 GLN B CG  1 
ATOM   5239 C CD  . GLN B 1 295 ? -3.817  3.782   -17.149 1.00 29.63 ? 295 GLN B CD  1 
ATOM   5240 O OE1 . GLN B 1 295 ? -3.151  3.203   -18.004 1.00 32.81 ? 295 GLN B OE1 1 
ATOM   5241 N NE2 . GLN B 1 295 ? -3.829  3.405   -15.872 1.00 31.70 ? 295 GLN B NE2 1 
ATOM   5242 N N   . LEU B 1 296 ? -8.364  6.103   -15.070 1.00 18.00 ? 296 LEU B N   1 
ATOM   5243 C CA  . LEU B 1 296 ? -9.672  5.823   -14.510 1.00 21.48 ? 296 LEU B CA  1 
ATOM   5244 C C   . LEU B 1 296 ? -10.640 6.906   -14.940 1.00 20.84 ? 296 LEU B C   1 
ATOM   5245 O O   . LEU B 1 296 ? -11.764 6.629   -15.354 1.00 22.83 ? 296 LEU B O   1 
ATOM   5246 C CB  . LEU B 1 296 ? -9.596  5.795   -12.984 1.00 19.89 ? 296 LEU B CB  1 
ATOM   5247 C CG  . LEU B 1 296 ? -10.527 4.853   -12.222 1.00 22.12 ? 296 LEU B CG  1 
ATOM   5248 C CD1 . LEU B 1 296 ? -10.942 5.550   -10.945 1.00 25.14 ? 296 LEU B CD1 1 
ATOM   5249 C CD2 . LEU B 1 296 ? -11.753 4.493   -13.033 1.00 23.01 ? 296 LEU B CD2 1 
ATOM   5250 N N   . LEU B 1 297 ? -10.186 8.146   -14.830 1.00 23.99 ? 297 LEU B N   1 
ATOM   5251 C CA  . LEU B 1 297 ? -11.010 9.288   -15.187 1.00 27.41 ? 297 LEU B CA  1 
ATOM   5252 C C   . LEU B 1 297 ? -11.368 9.294   -16.651 1.00 26.47 ? 297 LEU B C   1 
ATOM   5253 O O   . LEU B 1 297 ? -12.489 9.637   -17.011 1.00 25.95 ? 297 LEU B O   1 
ATOM   5254 C CB  . LEU B 1 297 ? -10.306 10.595  -14.830 1.00 27.37 ? 297 LEU B CB  1 
ATOM   5255 C CG  . LEU B 1 297 ? -10.419 11.036  -13.372 1.00 27.79 ? 297 LEU B CG  1 
ATOM   5256 C CD1 . LEU B 1 297 ? -9.713  12.360  -13.187 1.00 26.13 ? 297 LEU B CD1 1 
ATOM   5257 C CD2 . LEU B 1 297 ? -11.883 11.175  -12.999 1.00 28.78 ? 297 LEU B CD2 1 
ATOM   5258 N N   . ARG B 1 298 ? -10.415 8.914   -17.494 1.00 27.40 ? 298 ARG B N   1 
ATOM   5259 C CA  . ARG B 1 298 ? -10.660 8.879   -18.928 1.00 27.83 ? 298 ARG B CA  1 
ATOM   5260 C C   . ARG B 1 298 ? -11.681 7.781   -19.216 1.00 28.83 ? 298 ARG B C   1 
ATOM   5261 O O   . ARG B 1 298 ? -12.659 8.016   -19.928 1.00 28.46 ? 298 ARG B O   1 
ATOM   5262 C CB  . ARG B 1 298 ? -9.360  8.611   -19.695 1.00 29.34 ? 298 ARG B CB  1 
ATOM   5263 C CG  . ARG B 1 298 ? -9.419  8.972   -21.183 1.00 34.60 ? 298 ARG B CG  1 
ATOM   5264 C CD  . ARG B 1 298 ? -8.360  8.206   -21.985 1.00 43.36 ? 298 ARG B CD  1 
ATOM   5265 N NE  . ARG B 1 298 ? -8.418  8.486   -23.421 1.00 53.68 ? 298 ARG B NE  1 
ATOM   5266 C CZ  . ARG B 1 298 ? -7.845  7.734   -24.362 1.00 55.59 ? 298 ARG B CZ  1 
ATOM   5267 N NH1 . ARG B 1 298 ? -7.164  6.642   -24.027 1.00 56.34 ? 298 ARG B NH1 1 
ATOM   5268 N NH2 . ARG B 1 298 ? -7.954  8.069   -25.643 1.00 55.75 ? 298 ARG B NH2 1 
ATOM   5269 N N   . ALA B 1 299 ? -11.467 6.592   -18.645 1.00 25.76 ? 299 ALA B N   1 
ATOM   5270 C CA  . ALA B 1 299 ? -12.383 5.463   -18.851 1.00 22.67 ? 299 ALA B CA  1 
ATOM   5271 C C   . ALA B 1 299 ? -13.788 5.822   -18.392 1.00 21.00 ? 299 ALA B C   1 
ATOM   5272 O O   . ALA B 1 299 ? -14.781 5.443   -19.019 1.00 17.18 ? 299 ALA B O   1 
ATOM   5273 C CB  . ALA B 1 299 ? -11.890 4.226   -18.090 1.00 22.53 ? 299 ALA B CB  1 
ATOM   5274 N N   . LEU B 1 300 ? -13.862 6.560   -17.292 1.00 19.64 ? 300 LEU B N   1 
ATOM   5275 C CA  . LEU B 1 300 ? -15.145 6.961   -16.759 1.00 23.13 ? 300 LEU B CA  1 
ATOM   5276 C C   . LEU B 1 300 ? -15.874 7.910   -17.705 1.00 26.59 ? 300 LEU B C   1 
ATOM   5277 O O   . LEU B 1 300 ? -17.069 7.739   -17.950 1.00 26.55 ? 300 LEU B O   1 
ATOM   5278 C CB  . LEU B 1 300 ? -14.971 7.596   -15.379 1.00 23.66 ? 300 LEU B CB  1 
ATOM   5279 C CG  . LEU B 1 300 ? -14.844 6.611   -14.211 1.00 19.97 ? 300 LEU B CG  1 
ATOM   5280 C CD1 . LEU B 1 300 ? -14.529 7.379   -12.934 1.00 23.61 ? 300 LEU B CD1 1 
ATOM   5281 C CD2 . LEU B 1 300 ? -16.134 5.821   -14.052 1.00 15.99 ? 300 LEU B CD2 1 
ATOM   5282 N N   . GLU B 1 301 ? -15.162 8.896   -18.250 1.00 29.50 ? 301 GLU B N   1 
ATOM   5283 C CA  . GLU B 1 301 ? -15.791 9.835   -19.176 1.00 33.02 ? 301 GLU B CA  1 
ATOM   5284 C C   . GLU B 1 301 ? -16.138 9.188   -20.520 1.00 30.66 ? 301 GLU B C   1 
ATOM   5285 O O   . GLU B 1 301 ? -17.057 9.626   -21.205 1.00 33.62 ? 301 GLU B O   1 
ATOM   5286 C CB  . GLU B 1 301 ? -14.911 11.076  -19.391 1.00 38.75 ? 301 GLU B CB  1 
ATOM   5287 C CG  . GLU B 1 301 ? -13.477 10.819  -19.811 1.00 48.74 ? 301 GLU B CG  1 
ATOM   5288 C CD  . GLU B 1 301 ? -12.761 12.104  -20.249 1.00 54.22 ? 301 GLU B CD  1 
ATOM   5289 O OE1 . GLU B 1 301 ? -13.133 12.667  -21.304 1.00 56.52 ? 301 GLU B OE1 1 
ATOM   5290 O OE2 . GLU B 1 301 ? -11.838 12.557  -19.533 1.00 55.48 ? 301 GLU B OE2 1 
ATOM   5291 N N   . GLU B 1 302 ? -15.414 8.142   -20.889 1.00 28.80 ? 302 GLU B N   1 
ATOM   5292 C CA  . GLU B 1 302 ? -15.680 7.439   -22.139 1.00 27.75 ? 302 GLU B CA  1 
ATOM   5293 C C   . GLU B 1 302 ? -16.664 6.285   -21.912 1.00 28.01 ? 302 GLU B C   1 
ATOM   5294 O O   . GLU B 1 302 ? -17.024 5.565   -22.846 1.00 26.22 ? 302 GLU B O   1 
ATOM   5295 C CB  . GLU B 1 302 ? -14.375 6.901   -22.731 1.00 26.19 ? 302 GLU B CB  1 
ATOM   5296 C CG  . GLU B 1 302 ? -13.495 7.972   -23.357 1.00 27.21 ? 302 GLU B CG  1 
ATOM   5297 C CD  . GLU B 1 302 ? -12.176 7.419   -23.883 1.00 30.04 ? 302 GLU B CD  1 
ATOM   5298 O OE1 . GLU B 1 302 ? -12.185 6.323   -24.489 1.00 32.85 ? 302 GLU B OE1 1 
ATOM   5299 O OE2 . GLU B 1 302 ? -11.132 8.085   -23.703 1.00 30.94 ? 302 GLU B OE2 1 
ATOM   5300 N N   . GLY B 1 303 ? -17.085 6.106   -20.663 1.00 28.62 ? 303 GLY B N   1 
ATOM   5301 C CA  . GLY B 1 303 ? -18.029 5.050   -20.338 1.00 28.75 ? 303 GLY B CA  1 
ATOM   5302 C C   . GLY B 1 303 ? -17.541 3.630   -20.574 1.00 27.79 ? 303 GLY B C   1 
ATOM   5303 O O   . GLY B 1 303 ? -18.325 2.743   -20.907 1.00 26.37 ? 303 GLY B O   1 
ATOM   5304 N N   . ARG B 1 304 ? -16.245 3.397   -20.404 1.00 28.13 ? 304 ARG B N   1 
ATOM   5305 C CA  . ARG B 1 304 ? -15.713 2.060   -20.620 1.00 25.10 ? 304 ARG B CA  1 
ATOM   5306 C C   . ARG B 1 304 ? -15.635 1.249   -19.330 1.00 22.30 ? 304 ARG B C   1 
ATOM   5307 O O   . ARG B 1 304 ? -15.354 0.048   -19.368 1.00 19.66 ? 304 ARG B O   1 
ATOM   5308 C CB  . ARG B 1 304 ? -14.330 2.146   -21.256 1.00 26.31 ? 304 ARG B CB  1 
ATOM   5309 C CG  . ARG B 1 304 ? -14.289 3.001   -22.505 1.00 28.42 ? 304 ARG B CG  1 
ATOM   5310 C CD  . ARG B 1 304 ? -13.057 2.681   -23.329 1.00 27.42 ? 304 ARG B CD  1 
ATOM   5311 N NE  . ARG B 1 304 ? -11.853 2.630   -22.507 1.00 31.22 ? 304 ARG B NE  1 
ATOM   5312 C CZ  . ARG B 1 304 ? -11.190 3.694   -22.070 1.00 27.62 ? 304 ARG B CZ  1 
ATOM   5313 N NH1 . ARG B 1 304 ? -11.595 4.914   -22.370 1.00 30.07 ? 304 ARG B NH1 1 
ATOM   5314 N NH2 . ARG B 1 304 ? -10.112 3.533   -21.327 1.00 33.67 ? 304 ARG B NH2 1 
ATOM   5315 N N   . VAL B 1 305 ? -15.891 1.904   -18.199 1.00 21.77 ? 305 VAL B N   1 
ATOM   5316 C CA  . VAL B 1 305 ? -15.846 1.248   -16.892 1.00 22.00 ? 305 VAL B CA  1 
ATOM   5317 C C   . VAL B 1 305 ? -17.159 0.535   -16.583 1.00 21.38 ? 305 VAL B C   1 
ATOM   5318 O O   . VAL B 1 305 ? -18.235 1.095   -16.786 1.00 22.76 ? 305 VAL B O   1 
ATOM   5319 C CB  . VAL B 1 305 ? -15.572 2.274   -15.759 1.00 22.79 ? 305 VAL B CB  1 
ATOM   5320 C CG1 . VAL B 1 305 ? -15.631 1.581   -14.402 1.00 21.67 ? 305 VAL B CG1 1 
ATOM   5321 C CG2 . VAL B 1 305 ? -14.215 2.942   -15.967 1.00 22.16 ? 305 VAL B CG2 1 
ATOM   5322 N N   . ARG B 1 306 ? -17.067 -0.693  -16.083 1.00 23.22 ? 306 ARG B N   1 
ATOM   5323 C CA  . ARG B 1 306 ? -18.255 -1.468  -15.750 1.00 25.28 ? 306 ARG B CA  1 
ATOM   5324 C C   . ARG B 1 306 ? -18.417 -1.695  -14.256 1.00 23.57 ? 306 ARG B C   1 
ATOM   5325 O O   . ARG B 1 306 ? -19.468 -1.403  -13.688 1.00 22.27 ? 306 ARG B O   1 
ATOM   5326 C CB  . ARG B 1 306 ? -18.215 -2.805  -16.466 1.00 26.50 ? 306 ARG B CB  1 
ATOM   5327 C CG  . ARG B 1 306 ? -18.058 -2.632  -17.950 1.00 35.94 ? 306 ARG B CG  1 
ATOM   5328 C CD  . ARG B 1 306 ? -18.139 -3.943  -18.681 1.00 41.99 ? 306 ARG B CD  1 
ATOM   5329 N NE  . ARG B 1 306 ? -19.394 -4.627  -18.415 1.00 47.64 ? 306 ARG B NE  1 
ATOM   5330 C CZ  . ARG B 1 306 ? -19.921 -5.535  -19.228 1.00 55.16 ? 306 ARG B CZ  1 
ATOM   5331 N NH1 . ARG B 1 306 ? -19.297 -5.855  -20.359 1.00 54.78 ? 306 ARG B NH1 1 
ATOM   5332 N NH2 . ARG B 1 306 ? -21.063 -6.135  -18.903 1.00 57.02 ? 306 ARG B NH2 1 
ATOM   5333 N N   . GLU B 1 307 ? -17.378 -2.216  -13.617 1.00 22.21 ? 307 GLU B N   1 
ATOM   5334 C CA  . GLU B 1 307 ? -17.452 -2.479  -12.184 1.00 22.09 ? 307 GLU B CA  1 
ATOM   5335 C C   . GLU B 1 307 ? -16.112 -2.244  -11.515 1.00 20.35 ? 307 GLU B C   1 
ATOM   5336 O O   . GLU B 1 307 ? -15.062 -2.542  -12.089 1.00 20.11 ? 307 GLU B O   1 
ATOM   5337 C CB  . GLU B 1 307 ? -17.875 -3.935  -11.913 1.00 18.37 ? 307 GLU B CB  1 
ATOM   5338 C CG  . GLU B 1 307 ? -19.106 -4.424  -12.669 1.00 19.56 ? 307 GLU B CG  1 
ATOM   5339 C CD  . GLU B 1 307 ? -19.492 -5.867  -12.313 1.00 22.20 ? 307 GLU B CD  1 
ATOM   5340 O OE1 . GLU B 1 307 ? -20.150 -6.532  -13.143 1.00 21.88 ? 307 GLU B OE1 1 
ATOM   5341 O OE2 . GLU B 1 307 ? -19.150 -6.334  -11.203 1.00 22.28 ? 307 GLU B OE2 1 
ATOM   5342 N N   . VAL B 1 308 ? -16.149 -1.693  -10.307 1.00 16.86 ? 308 VAL B N   1 
ATOM   5343 C CA  . VAL B 1 308 ? -14.927 -1.488  -9.542  1.00 17.95 ? 308 VAL B CA  1 
ATOM   5344 C C   . VAL B 1 308 ? -15.198 -2.072  -8.160  1.00 19.08 ? 308 VAL B C   1 
ATOM   5345 O O   . VAL B 1 308 ? -16.235 -1.799  -7.565  1.00 19.04 ? 308 VAL B O   1 
ATOM   5346 C CB  . VAL B 1 308 ? -14.554 0.000   -9.402  1.00 17.85 ? 308 VAL B CB  1 
ATOM   5347 C CG1 . VAL B 1 308 ? -13.369 0.136   -8.459  1.00 13.86 ? 308 VAL B CG1 1 
ATOM   5348 C CG2 . VAL B 1 308 ? -14.207 0.585   -10.765 1.00 13.02 ? 308 VAL B CG2 1 
ATOM   5349 N N   . PHE B 1 309 ? -14.287 -2.902  -7.656  1.00 18.19 ? 309 PHE B N   1 
ATOM   5350 C CA  . PHE B 1 309 ? -14.496 -3.498  -6.343  1.00 15.40 ? 309 PHE B CA  1 
ATOM   5351 C C   . PHE B 1 309 ? -13.248 -3.784  -5.523  1.00 16.05 ? 309 PHE B C   1 
ATOM   5352 O O   . PHE B 1 309 ? -12.124 -3.771  -6.030  1.00 18.19 ? 309 PHE B O   1 
ATOM   5353 C CB  . PHE B 1 309 ? -15.310 -4.787  -6.468  1.00 13.69 ? 309 PHE B CB  1 
ATOM   5354 C CG  . PHE B 1 309 ? -14.701 -5.819  -7.388  1.00 17.68 ? 309 PHE B CG  1 
ATOM   5355 C CD1 . PHE B 1 309 ? -14.995 -5.823  -8.750  1.00 16.42 ? 309 PHE B CD1 1 
ATOM   5356 C CD2 . PHE B 1 309 ? -13.863 -6.812  -6.884  1.00 16.12 ? 309 PHE B CD2 1 
ATOM   5357 C CE1 . PHE B 1 309 ? -14.467 -6.804  -9.585  1.00 16.33 ? 309 PHE B CE1 1 
ATOM   5358 C CE2 . PHE B 1 309 ? -13.335 -7.791  -7.714  1.00 12.76 ? 309 PHE B CE2 1 
ATOM   5359 C CZ  . PHE B 1 309 ? -13.637 -7.787  -9.062  1.00 13.32 ? 309 PHE B CZ  1 
ATOM   5360 N N   . GLY B 1 310 ? -13.463 -4.030  -4.237  1.00 12.62 ? 310 GLY B N   1 
ATOM   5361 C CA  . GLY B 1 310 ? -12.358 -4.353  -3.361  1.00 16.11 ? 310 GLY B CA  1 
ATOM   5362 C C   . GLY B 1 310 ? -12.474 -5.804  -2.937  1.00 16.34 ? 310 GLY B C   1 
ATOM   5363 O O   . GLY B 1 310 ? -13.574 -6.364  -2.934  1.00 19.07 ? 310 GLY B O   1 
ATOM   5364 N N   . SER B 1 311 ? -11.353 -6.431  -2.597  1.00 15.74 ? 311 SER B N   1 
ATOM   5365 C CA  . SER B 1 311 ? -11.393 -7.826  -2.167  1.00 14.48 ? 311 SER B CA  1 
ATOM   5366 C C   . SER B 1 311 ? -10.571 -8.043  -0.902  1.00 15.78 ? 311 SER B C   1 
ATOM   5367 O O   . SER B 1 311 ? -9.546  -7.384  -0.678  1.00 15.11 ? 311 SER B O   1 
ATOM   5368 C CB  . SER B 1 311 ? -10.879 -8.746  -3.270  1.00 14.22 ? 311 SER B CB  1 
ATOM   5369 O OG  . SER B 1 311 ? -9.470  -8.677  -3.364  1.00 16.45 ? 311 SER B OG  1 
ATOM   5370 N N   . GLY B 1 312 ? -11.036 -8.973  -0.078  1.00 13.36 ? 312 GLY B N   1 
ATOM   5371 C CA  . GLY B 1 312 ? -10.350 -9.281  1.158   1.00 14.42 ? 312 GLY B CA  1 
ATOM   5372 C C   . GLY B 1 312 ? -11.164 -10.291 1.928   1.00 14.97 ? 312 GLY B C   1 
ATOM   5373 O O   . GLY B 1 312 ? -12.338 -10.499 1.621   1.00 15.23 ? 312 GLY B O   1 
ATOM   5374 N N   . THR B 1 313 ? -10.552 -10.908 2.932   1.00 16.58 ? 313 THR B N   1 
ATOM   5375 C CA  . THR B 1 313 ? -11.228 -11.917 3.729   1.00 20.81 ? 313 THR B CA  1 
ATOM   5376 C C   . THR B 1 313 ? -12.492 -11.407 4.398   1.00 21.28 ? 313 THR B C   1 
ATOM   5377 O O   . THR B 1 313 ? -13.509 -12.099 4.408   1.00 21.73 ? 313 THR B O   1 
ATOM   5378 C CB  . THR B 1 313 ? -10.286 -12.492 4.807   1.00 24.03 ? 313 THR B CB  1 
ATOM   5379 O OG1 . THR B 1 313 ? -9.179  -13.153 4.171   1.00 26.86 ? 313 THR B OG1 1 
ATOM   5380 C CG2 . THR B 1 313 ? -11.039 -13.481 5.697   1.00 18.50 ? 313 THR B CG2 1 
ATOM   5381 N N   . ALA B 1 314 ? -12.426 -10.202 4.957   1.00 22.13 ? 314 ALA B N   1 
ATOM   5382 C CA  . ALA B 1 314 ? -13.573 -9.603  5.641   1.00 23.53 ? 314 ALA B CA  1 
ATOM   5383 C C   . ALA B 1 314 ? -14.767 -9.469  4.709   1.00 27.06 ? 314 ALA B C   1 
ATOM   5384 O O   . ALA B 1 314 ? -15.877 -9.883  5.027   1.00 31.18 ? 314 ALA B O   1 
ATOM   5385 C CB  . ALA B 1 314 ? -13.195 -8.237  6.190   1.00 20.93 ? 314 ALA B CB  1 
ATOM   5386 N N   . CYS B 1 315 ? -14.524 -8.884  3.550   1.00 33.17 ? 315 CYS B N   1 
ATOM   5387 C CA  . CYS B 1 315 ? -15.561 -8.675  2.556   1.00 37.01 ? 315 CYS B CA  1 
ATOM   5388 C C   . CYS B 1 315 ? -15.084 -9.276  1.244   1.00 38.25 ? 315 CYS B C   1 
ATOM   5389 O O   . CYS B 1 315 ? -14.472 -8.572  0.428   1.00 40.78 ? 315 CYS B O   1 
ATOM   5390 C CB  . CYS B 1 315 ? -15.789 -7.178  2.369   1.00 41.02 ? 315 CYS B CB  1 
ATOM   5391 S SG  . CYS B 1 315 ? -16.969 -6.756  1.072   1.00 50.96 ? 315 CYS B SG  1 
ATOM   5392 N N   . GLN B 1 316 ? -15.360 -10.565 1.052   1.00 32.65 ? 316 GLN B N   1 
ATOM   5393 C CA  . GLN B 1 316 ? -14.955 -11.285 -0.154  1.00 31.37 ? 316 GLN B CA  1 
ATOM   5394 C C   . GLN B 1 316 ? -14.842 -10.369 -1.370  1.00 28.19 ? 316 GLN B C   1 
ATOM   5395 O O   . GLN B 1 316 ? -13.752 -10.177 -1.905  1.00 25.91 ? 316 GLN B O   1 
ATOM   5396 C CB  . GLN B 1 316 ? -15.960 -12.406 -0.463  1.00 36.18 ? 316 GLN B CB  1 
ATOM   5397 C CG  . GLN B 1 316 ? -16.180 -13.415 0.668   1.00 36.66 ? 316 GLN B CG  1 
ATOM   5398 C CD  . GLN B 1 316 ? -14.967 -14.294 0.926   1.00 35.04 ? 316 GLN B CD  1 
ATOM   5399 O OE1 . GLN B 1 316 ? -14.559 -15.069 0.067   1.00 33.35 ? 316 GLN B OE1 1 
ATOM   5400 N NE2 . GLN B 1 316 ? -14.388 -14.174 2.113   1.00 34.42 ? 316 GLN B NE2 1 
ATOM   5401 N N   . VAL B 1 317 ? -15.978 -9.816  -1.795  1.00 26.00 ? 317 VAL B N   1 
ATOM   5402 C CA  . VAL B 1 317 ? -16.051 -8.917  -2.948  1.00 25.97 ? 317 VAL B CA  1 
ATOM   5403 C C   . VAL B 1 317 ? -16.890 -7.698  -2.562  1.00 25.16 ? 317 VAL B C   1 
ATOM   5404 O O   . VAL B 1 317 ? -18.083 -7.824  -2.305  1.00 26.61 ? 317 VAL B O   1 
ATOM   5405 C CB  . VAL B 1 317 ? -16.705 -9.619  -4.152  1.00 25.85 ? 317 VAL B CB  1 
ATOM   5406 C CG1 . VAL B 1 317 ? -16.685 -8.705  -5.362  1.00 28.18 ? 317 VAL B CG1 1 
ATOM   5407 C CG2 . VAL B 1 317 ? -15.966 -10.908 -4.456  1.00 27.18 ? 317 VAL B CG2 1 
ATOM   5408 N N   . CYS B 1 318 ? -16.268 -6.522  -2.550  1.00 23.14 ? 318 CYS B N   1 
ATOM   5409 C CA  . CYS B 1 318 ? -16.938 -5.296  -2.139  1.00 22.65 ? 318 CYS B CA  1 
ATOM   5410 C C   . CYS B 1 318 ? -17.112 -4.224  -3.224  1.00 22.76 ? 318 CYS B C   1 
ATOM   5411 O O   . CYS B 1 318 ? -16.143 -3.570  -3.625  1.00 20.16 ? 318 CYS B O   1 
ATOM   5412 C CB  . CYS B 1 318 ? -16.168 -4.694  -0.970  1.00 24.69 ? 318 CYS B CB  1 
ATOM   5413 S SG  . CYS B 1 318 ? -17.127 -3.555  0.010   1.00 43.61 ? 318 CYS B SG  1 
ATOM   5414 N N   . PRO B 1 319 ? -18.361 -4.004  -3.682  1.00 19.45 ? 319 PRO B N   1 
ATOM   5415 C CA  . PRO B 1 319 ? -18.695 -3.019  -4.717  1.00 18.93 ? 319 PRO B CA  1 
ATOM   5416 C C   . PRO B 1 319 ? -18.379 -1.574  -4.340  1.00 17.85 ? 319 PRO B C   1 
ATOM   5417 O O   . PRO B 1 319 ? -18.614 -1.143  -3.205  1.00 17.22 ? 319 PRO B O   1 
ATOM   5418 C CB  . PRO B 1 319 ? -20.204 -3.199  -4.913  1.00 18.70 ? 319 PRO B CB  1 
ATOM   5419 C CG  . PRO B 1 319 ? -20.489 -4.552  -4.369  1.00 22.34 ? 319 PRO B CG  1 
ATOM   5420 C CD  . PRO B 1 319 ? -19.582 -4.649  -3.179  1.00 21.28 ? 319 PRO B CD  1 
ATOM   5421 N N   . VAL B 1 320 ? -17.867 -0.829  -5.314  1.00 17.16 ? 320 VAL B N   1 
ATOM   5422 C CA  . VAL B 1 320 ? -17.556 0.580   -5.124  1.00 17.73 ? 320 VAL B CA  1 
ATOM   5423 C C   . VAL B 1 320 ? -18.430 1.357   -6.094  1.00 17.80 ? 320 VAL B C   1 
ATOM   5424 O O   . VAL B 1 320 ? -18.470 1.028   -7.279  1.00 18.79 ? 320 VAL B O   1 
ATOM   5425 C CB  . VAL B 1 320 ? -16.074 0.875   -5.424  1.00 17.53 ? 320 VAL B CB  1 
ATOM   5426 C CG1 . VAL B 1 320 ? -15.829 2.379   -5.429  1.00 15.32 ? 320 VAL B CG1 1 
ATOM   5427 C CG2 . VAL B 1 320 ? -15.198 0.202   -4.381  1.00 15.77 ? 320 VAL B CG2 1 
ATOM   5428 N N   . HIS B 1 321 ? -19.145 2.367   -5.605  1.00 18.50 ? 321 HIS B N   1 
ATOM   5429 C CA  . HIS B 1 321 ? -20.005 3.166   -6.490  1.00 20.12 ? 321 HIS B CA  1 
ATOM   5430 C C   . HIS B 1 321 ? -19.634 4.647   -6.555  1.00 19.74 ? 321 HIS B C   1 
ATOM   5431 O O   . HIS B 1 321 ? -20.168 5.384   -7.377  1.00 24.40 ? 321 HIS B O   1 
ATOM   5432 C CB  . HIS B 1 321 ? -21.472 3.058   -6.070  1.00 18.18 ? 321 HIS B CB  1 
ATOM   5433 C CG  . HIS B 1 321 ? -21.791 3.787   -4.802  1.00 25.00 ? 321 HIS B CG  1 
ATOM   5434 N ND1 . HIS B 1 321 ? -21.115 3.561   -3.620  1.00 28.41 ? 321 HIS B ND1 1 
ATOM   5435 C CD2 . HIS B 1 321 ? -22.722 4.729   -4.527  1.00 22.76 ? 321 HIS B CD2 1 
ATOM   5436 C CE1 . HIS B 1 321 ? -21.620 4.332   -2.672  1.00 26.58 ? 321 HIS B CE1 1 
ATOM   5437 N NE2 . HIS B 1 321 ? -22.596 5.050   -3.197  1.00 24.88 ? 321 HIS B NE2 1 
ATOM   5438 N N   . ARG B 1 322 ? -18.726 5.097   -5.701  1.00 19.25 ? 322 ARG B N   1 
ATOM   5439 C CA  . ARG B 1 322 ? -18.360 6.500   -5.736  1.00 18.19 ? 322 ARG B CA  1 
ATOM   5440 C C   . ARG B 1 322 ? -16.956 6.766   -5.219  1.00 18.13 ? 322 ARG B C   1 
ATOM   5441 O O   . ARG B 1 322 ? -16.491 6.131   -4.271  1.00 19.53 ? 322 ARG B O   1 
ATOM   5442 C CB  . ARG B 1 322 ? -19.375 7.321   -4.928  1.00 16.74 ? 322 ARG B CB  1 
ATOM   5443 C CG  . ARG B 1 322 ? -19.169 8.826   -5.009  1.00 20.11 ? 322 ARG B CG  1 
ATOM   5444 C CD  . ARG B 1 322 ? -20.253 9.581   -4.250  1.00 21.63 ? 322 ARG B CD  1 
ATOM   5445 N NE  . ARG B 1 322 ? -20.152 9.363   -2.810  1.00 24.51 ? 322 ARG B NE  1 
ATOM   5446 C CZ  . ARG B 1 322 ? -19.766 10.286  -1.937  1.00 18.48 ? 322 ARG B CZ  1 
ATOM   5447 N NH1 . ARG B 1 322 ? -19.445 11.505  -2.351  1.00 19.03 ? 322 ARG B NH1 1 
ATOM   5448 N NH2 . ARG B 1 322 ? -19.697 9.983   -0.651  1.00 16.33 ? 322 ARG B NH2 1 
ATOM   5449 N N   . ILE B 1 323 ? -16.282 7.709   -5.860  1.00 17.53 ? 323 ILE B N   1 
ATOM   5450 C CA  . ILE B 1 323 ? -14.946 8.097   -5.451  1.00 17.83 ? 323 ILE B CA  1 
ATOM   5451 C C   . ILE B 1 323 ? -14.865 9.613   -5.396  1.00 19.47 ? 323 ILE B C   1 
ATOM   5452 O O   . ILE B 1 323 ? -15.255 10.296  -6.339  1.00 21.59 ? 323 ILE B O   1 
ATOM   5453 C CB  . ILE B 1 323 ? -13.882 7.605   -6.434  1.00 13.08 ? 323 ILE B CB  1 
ATOM   5454 C CG1 . ILE B 1 323 ? -13.807 6.078   -6.397  1.00 11.96 ? 323 ILE B CG1 1 
ATOM   5455 C CG2 . ILE B 1 323 ? -12.537 8.230   -6.089  1.00 13.29 ? 323 ILE B CG2 1 
ATOM   5456 C CD1 . ILE B 1 323 ? -12.891 5.497   -7.446  1.00 10.06 ? 323 ILE B CD1 1 
ATOM   5457 N N   . LEU B 1 324 ? -14.369 10.135  -4.283  1.00 22.57 ? 324 LEU B N   1 
ATOM   5458 C CA  . LEU B 1 324 ? -14.211 11.576  -4.128  1.00 23.22 ? 324 LEU B CA  1 
ATOM   5459 C C   . LEU B 1 324 ? -12.740 11.860  -4.368  1.00 26.12 ? 324 LEU B C   1 
ATOM   5460 O O   . LEU B 1 324 ? -11.890 11.521  -3.538  1.00 25.49 ? 324 LEU B O   1 
ATOM   5461 C CB  . LEU B 1 324 ? -14.614 12.023  -2.722  1.00 20.62 ? 324 LEU B CB  1 
ATOM   5462 C CG  . LEU B 1 324 ? -14.497 13.522  -2.421  1.00 19.54 ? 324 LEU B CG  1 
ATOM   5463 C CD1 . LEU B 1 324 ? -15.360 14.341  -3.387  1.00 16.23 ? 324 LEU B CD1 1 
ATOM   5464 C CD2 . LEU B 1 324 ? -14.934 13.761  -0.983  1.00 18.03 ? 324 LEU B CD2 1 
ATOM   5465 N N   . TYR B 1 325 ? -12.458 12.472  -5.516  1.00 27.13 ? 325 TYR B N   1 
ATOM   5466 C CA  . TYR B 1 325 ? -11.098 12.795  -5.931  1.00 29.40 ? 325 TYR B CA  1 
ATOM   5467 C C   . TYR B 1 325 ? -10.952 14.294  -6.162  1.00 32.08 ? 325 TYR B C   1 
ATOM   5468 O O   . TYR B 1 325 ? -11.663 14.860  -6.989  1.00 34.70 ? 325 TYR B O   1 
ATOM   5469 C CB  . TYR B 1 325 ? -10.782 12.054  -7.232  1.00 25.52 ? 325 TYR B CB  1 
ATOM   5470 C CG  . TYR B 1 325 ? -9.377  12.264  -7.743  1.00 26.72 ? 325 TYR B CG  1 
ATOM   5471 C CD1 . TYR B 1 325 ? -9.148  12.639  -9.066  1.00 27.59 ? 325 TYR B CD1 1 
ATOM   5472 C CD2 . TYR B 1 325 ? -8.272  12.053  -6.914  1.00 21.50 ? 325 TYR B CD2 1 
ATOM   5473 C CE1 . TYR B 1 325 ? -7.856  12.796  -9.551  1.00 25.09 ? 325 TYR B CE1 1 
ATOM   5474 C CE2 . TYR B 1 325 ? -6.980  12.204  -7.391  1.00 18.85 ? 325 TYR B CE2 1 
ATOM   5475 C CZ  . TYR B 1 325 ? -6.779  12.575  -8.710  1.00 22.68 ? 325 TYR B CZ  1 
ATOM   5476 O OH  . TYR B 1 325 ? -5.503  12.706  -9.197  1.00 25.79 ? 325 TYR B OH  1 
ATOM   5477 N N   . LYS B 1 326 ? -10.029 14.935  -5.449  1.00 36.01 ? 326 LYS B N   1 
ATOM   5478 C CA  . LYS B 1 326 ? -9.811  16.373  -5.605  1.00 37.41 ? 326 LYS B CA  1 
ATOM   5479 C C   . LYS B 1 326 ? -11.136 17.116  -5.457  1.00 38.37 ? 326 LYS B C   1 
ATOM   5480 O O   . LYS B 1 326 ? -11.533 17.895  -6.336  1.00 34.52 ? 326 LYS B O   1 
ATOM   5481 C CB  . LYS B 1 326 ? -9.202  16.693  -6.982  1.00 41.03 ? 326 LYS B CB  1 
ATOM   5482 C CG  . LYS B 1 326 ? -7.696  16.446  -7.129  1.00 45.11 ? 326 LYS B CG  1 
ATOM   5483 C CD  . LYS B 1 326 ? -7.219  16.864  -8.535  1.00 50.92 ? 326 LYS B CD  1 
ATOM   5484 C CE  . LYS B 1 326 ? -5.738  16.537  -8.809  1.00 53.24 ? 326 LYS B CE  1 
ATOM   5485 N NZ  . LYS B 1 326 ? -4.763  17.346  -8.010  1.00 52.07 ? 326 LYS B NZ  1 
ATOM   5486 N N   . ASP B 1 327 ? -11.817 16.864  -4.343  1.00 39.35 ? 327 ASP B N   1 
ATOM   5487 C CA  . ASP B 1 327 ? -13.099 17.505  -4.069  1.00 42.18 ? 327 ASP B CA  1 
ATOM   5488 C C   . ASP B 1 327 ? -14.033 17.435  -5.274  1.00 41.81 ? 327 ASP B C   1 
ATOM   5489 O O   . ASP B 1 327 ? -14.740 18.392  -5.587  1.00 41.49 ? 327 ASP B O   1 
ATOM   5490 C CB  . ASP B 1 327 ? -12.893 18.971  -3.667  1.00 46.16 ? 327 ASP B CB  1 
ATOM   5491 C CG  . ASP B 1 327 ? -12.135 19.122  -2.353  1.00 52.19 ? 327 ASP B CG  1 
ATOM   5492 O OD1 . ASP B 1 327 ? -10.883 19.212  -2.388  1.00 54.75 ? 327 ASP B OD1 1 
ATOM   5493 O OD2 . ASP B 1 327 ? -12.797 19.139  -1.286  1.00 51.78 ? 327 ASP B OD2 1 
ATOM   5494 N N   . ARG B 1 328 ? -14.027 16.293  -5.951  1.00 41.27 ? 328 ARG B N   1 
ATOM   5495 C CA  . ARG B 1 328 ? -14.872 16.089  -7.117  1.00 39.87 ? 328 ARG B CA  1 
ATOM   5496 C C   . ARG B 1 328 ? -15.478 14.693  -7.055  1.00 35.51 ? 328 ARG B C   1 
ATOM   5497 O O   . ARG B 1 328 ? -14.786 13.722  -6.744  1.00 29.22 ? 328 ARG B O   1 
ATOM   5498 C CB  . ARG B 1 328 ? -14.048 16.254  -8.392  1.00 46.19 ? 328 ARG B CB  1 
ATOM   5499 C CG  . ARG B 1 328 ? -14.827 16.052  -9.676  1.00 56.14 ? 328 ARG B CG  1 
ATOM   5500 C CD  . ARG B 1 328 ? -13.991 16.477  -10.877 1.00 66.42 ? 328 ARG B CD  1 
ATOM   5501 N NE  . ARG B 1 328 ? -13.710 17.914  -10.854 1.00 73.37 ? 328 ARG B NE  1 
ATOM   5502 C CZ  . ARG B 1 328 ? -12.927 18.540  -11.731 1.00 77.68 ? 328 ARG B CZ  1 
ATOM   5503 N NH1 . ARG B 1 328 ? -12.338 17.855  -12.708 1.00 78.79 ? 328 ARG B NH1 1 
ATOM   5504 N NH2 . ARG B 1 328 ? -12.731 19.853  -11.635 1.00 78.71 ? 328 ARG B NH2 1 
ATOM   5505 N N   . ASN B 1 329 ? -16.773 14.602  -7.343  1.00 33.11 ? 329 ASN B N   1 
ATOM   5506 C CA  . ASN B 1 329 ? -17.477 13.327  -7.310  1.00 31.39 ? 329 ASN B CA  1 
ATOM   5507 C C   . ASN B 1 329 ? -17.415 12.537  -8.604  1.00 30.09 ? 329 ASN B C   1 
ATOM   5508 O O   . ASN B 1 329 ? -17.767 13.040  -9.675  1.00 31.32 ? 329 ASN B O   1 
ATOM   5509 C CB  . ASN B 1 329 ? -18.941 13.543  -6.948  1.00 34.01 ? 329 ASN B CB  1 
ATOM   5510 C CG  . ASN B 1 329 ? -19.140 13.791  -5.473  1.00 37.49 ? 329 ASN B CG  1 
ATOM   5511 O OD1 . ASN B 1 329 ? -18.884 12.915  -4.645  1.00 36.23 ? 329 ASN B OD1 1 
ATOM   5512 N ND2 . ASN B 1 329 ? -19.593 14.992  -5.131  1.00 39.74 ? 329 ASN B ND2 1 
ATOM   5513 N N   . LEU B 1 330 ? -16.963 11.294  -8.498  1.00 26.54 ? 330 LEU B N   1 
ATOM   5514 C CA  . LEU B 1 330 ? -16.890 10.417  -9.654  1.00 25.93 ? 330 LEU B CA  1 
ATOM   5515 C C   . LEU B 1 330 ? -17.852 9.275   -9.369  1.00 24.74 ? 330 LEU B C   1 
ATOM   5516 O O   . LEU B 1 330 ? -17.653 8.507   -8.431  1.00 27.23 ? 330 LEU B O   1 
ATOM   5517 C CB  . LEU B 1 330 ? -15.469 9.879   -9.834  1.00 26.61 ? 330 LEU B CB  1 
ATOM   5518 C CG  . LEU B 1 330 ? -14.353 10.930  -9.924  1.00 31.35 ? 330 LEU B CG  1 
ATOM   5519 C CD1 . LEU B 1 330 ? -13.013 10.237  -10.152 1.00 27.96 ? 330 LEU B CD1 1 
ATOM   5520 C CD2 . LEU B 1 330 ? -14.650 11.908  -11.050 1.00 27.63 ? 330 LEU B CD2 1 
ATOM   5521 N N   . HIS B 1 331 ? -18.918 9.180   -10.151 1.00 23.61 ? 331 HIS B N   1 
ATOM   5522 C CA  . HIS B 1 331 ? -19.874 8.107   -9.946  1.00 24.66 ? 331 HIS B CA  1 
ATOM   5523 C C   . HIS B 1 331 ? -19.411 6.880   -10.721 1.00 22.53 ? 331 HIS B C   1 
ATOM   5524 O O   . HIS B 1 331 ? -19.095 6.979   -11.905 1.00 20.63 ? 331 HIS B O   1 
ATOM   5525 C CB  . HIS B 1 331 ? -21.281 8.507   -10.416 1.00 25.28 ? 331 HIS B CB  1 
ATOM   5526 C CG  . HIS B 1 331 ? -22.286 7.393   -10.314 1.00 34.65 ? 331 HIS B CG  1 
ATOM   5527 N ND1 . HIS B 1 331 ? -22.764 6.924   -9.105  1.00 34.55 ? 331 HIS B ND1 1 
ATOM   5528 C CD2 . HIS B 1 331 ? -22.858 6.617   -11.270 1.00 32.07 ? 331 HIS B CD2 1 
ATOM   5529 C CE1 . HIS B 1 331 ? -23.584 5.909   -9.322  1.00 33.52 ? 331 HIS B CE1 1 
ATOM   5530 N NE2 . HIS B 1 331 ? -23.658 5.703   -10.626 1.00 32.85 ? 331 HIS B NE2 1 
ATOM   5531 N N   . ILE B 1 332 ? -19.356 5.734   -10.042 1.00 21.08 ? 332 ILE B N   1 
ATOM   5532 C CA  . ILE B 1 332 ? -18.947 4.486   -10.681 1.00 21.14 ? 332 ILE B CA  1 
ATOM   5533 C C   . ILE B 1 332 ? -20.203 3.619   -10.880 1.00 21.42 ? 332 ILE B C   1 
ATOM   5534 O O   . ILE B 1 332 ? -20.893 3.271   -9.925  1.00 19.76 ? 332 ILE B O   1 
ATOM   5535 C CB  . ILE B 1 332 ? -17.909 3.723   -9.824  1.00 21.50 ? 332 ILE B CB  1 
ATOM   5536 C CG1 . ILE B 1 332 ? -16.944 4.702   -9.149  1.00 18.29 ? 332 ILE B CG1 1 
ATOM   5537 C CG2 . ILE B 1 332 ? -17.113 2.788   -10.708 1.00 21.51 ? 332 ILE B CG2 1 
ATOM   5538 C CD1 . ILE B 1 332 ? -16.152 5.530   -10.104 1.00 21.57 ? 332 ILE B CD1 1 
ATOM   5539 N N   . PRO B 1 333 ? -20.509 3.270   -12.139 1.00 21.72 ? 333 PRO B N   1 
ATOM   5540 C CA  . PRO B 1 333 ? -21.644 2.464   -12.627 1.00 22.23 ? 333 PRO B CA  1 
ATOM   5541 C C   . PRO B 1 333 ? -21.731 1.026   -12.142 1.00 20.65 ? 333 PRO B C   1 
ATOM   5542 O O   . PRO B 1 333 ? -22.505 0.242   -12.683 1.00 18.90 ? 333 PRO B O   1 
ATOM   5543 C CB  . PRO B 1 333 ? -21.472 2.494   -14.146 1.00 20.46 ? 333 PRO B CB  1 
ATOM   5544 C CG  . PRO B 1 333 ? -20.613 3.680   -14.391 1.00 25.90 ? 333 PRO B CG  1 
ATOM   5545 C CD  . PRO B 1 333 ? -19.648 3.674   -13.257 1.00 19.74 ? 333 PRO B CD  1 
ATOM   5546 N N   . THR B 1 334 ? -20.943 0.675   -11.135 1.00 23.25 ? 334 THR B N   1 
ATOM   5547 C CA  . THR B 1 334 ? -20.934 -0.692  -10.628 1.00 22.26 ? 334 THR B CA  1 
ATOM   5548 C C   . THR B 1 334 ? -22.305 -1.323  -10.392 1.00 21.47 ? 334 THR B C   1 
ATOM   5549 O O   . THR B 1 334 ? -22.582 -2.397  -10.916 1.00 20.78 ? 334 THR B O   1 
ATOM   5550 C CB  . THR B 1 334 ? -20.108 -0.788  -9.342  1.00 20.74 ? 334 THR B CB  1 
ATOM   5551 O OG1 . THR B 1 334 ? -18.782 -0.313  -9.597  1.00 25.03 ? 334 THR B OG1 1 
ATOM   5552 C CG2 . THR B 1 334 ? -20.022 -2.232  -8.878  1.00 23.66 ? 334 THR B CG2 1 
ATOM   5553 N N   . MET B 1 335 ? -23.169 -0.666  -9.624  1.00 22.81 ? 335 MET B N   1 
ATOM   5554 C CA  . MET B 1 335 ? -24.490 -1.234  -9.346  1.00 25.43 ? 335 MET B CA  1 
ATOM   5555 C C   . MET B 1 335 ? -25.452 -1.257  -10.534 1.00 26.88 ? 335 MET B C   1 
ATOM   5556 O O   . MET B 1 335 ? -26.213 -2.210  -10.686 1.00 26.39 ? 335 MET B O   1 
ATOM   5557 C CB  . MET B 1 335 ? -25.155 -0.513  -8.170  1.00 21.84 ? 335 MET B CB  1 
ATOM   5558 C CG  . MET B 1 335 ? -24.324 -0.519  -6.901  1.00 23.62 ? 335 MET B CG  1 
ATOM   5559 S SD  . MET B 1 335 ? -23.722 -2.170  -6.405  1.00 25.82 ? 335 MET B SD  1 
ATOM   5560 C CE  . MET B 1 335 ? -25.215 -2.870  -5.681  1.00 21.93 ? 335 MET B CE  1 
ATOM   5561 N N   . GLU B 1 336 ? -25.432 -0.224  -11.373 1.00 26.36 ? 336 GLU B N   1 
ATOM   5562 C CA  . GLU B 1 336 ? -26.324 -0.209  -12.529 1.00 28.40 ? 336 GLU B CA  1 
ATOM   5563 C C   . GLU B 1 336 ? -25.980 -1.334  -13.528 1.00 29.94 ? 336 GLU B C   1 
ATOM   5564 O O   . GLU B 1 336 ? -26.810 -1.705  -14.361 1.00 32.16 ? 336 GLU B O   1 
ATOM   5565 C CB  . GLU B 1 336 ? -26.296 1.159   -13.239 1.00 27.14 ? 336 GLU B CB  1 
ATOM   5566 C CG  . GLU B 1 336 ? -25.304 2.178   -12.671 1.00 33.76 ? 336 GLU B CG  1 
ATOM   5567 C CD  . GLU B 1 336 ? -25.783 2.846   -11.393 1.00 34.72 ? 336 GLU B CD  1 
ATOM   5568 O OE1 . GLU B 1 336 ? -24.949 3.459   -10.693 1.00 39.28 ? 336 GLU B OE1 1 
ATOM   5569 O OE2 . GLU B 1 336 ? -26.993 2.775   -11.089 1.00 37.41 ? 336 GLU B OE2 1 
ATOM   5570 N N   . ASN B 1 337 ? -24.769 -1.884  -13.448 1.00 28.43 ? 337 ASN B N   1 
ATOM   5571 C CA  . ASN B 1 337 ? -24.365 -2.969  -14.347 1.00 27.00 ? 337 ASN B CA  1 
ATOM   5572 C C   . ASN B 1 337 ? -24.463 -4.375  -13.736 1.00 29.14 ? 337 ASN B C   1 
ATOM   5573 O O   . ASN B 1 337 ? -23.814 -5.305  -14.215 1.00 31.10 ? 337 ASN B O   1 
ATOM   5574 C CB  . ASN B 1 337 ? -22.926 -2.771  -14.843 1.00 26.68 ? 337 ASN B CB  1 
ATOM   5575 C CG  . ASN B 1 337 ? -22.829 -1.819  -16.018 1.00 27.13 ? 337 ASN B CG  1 
ATOM   5576 O OD1 . ASN B 1 337 ? -23.580 -1.928  -16.985 1.00 27.86 ? 337 ASN B OD1 1 
ATOM   5577 N ND2 . ASN B 1 337 ? -21.882 -0.890  -15.950 1.00 27.07 ? 337 ASN B ND2 1 
ATOM   5578 N N   . GLY B 1 338 ? -25.255 -4.544  -12.685 1.00 28.31 ? 338 GLY B N   1 
ATOM   5579 C CA  . GLY B 1 338 ? -25.372 -5.865  -12.096 1.00 26.59 ? 338 GLY B CA  1 
ATOM   5580 C C   . GLY B 1 338 ? -25.403 -5.854  -10.583 1.00 25.45 ? 338 GLY B C   1 
ATOM   5581 O O   . GLY B 1 338 ? -26.475 -5.753  -9.996  1.00 25.73 ? 338 GLY B O   1 
ATOM   5582 N N   . PRO B 1 339 ? -24.239 -5.952  -9.916  1.00 24.84 ? 339 PRO B N   1 
ATOM   5583 C CA  . PRO B 1 339 ? -22.915 -6.069  -10.543 1.00 23.56 ? 339 PRO B CA  1 
ATOM   5584 C C   . PRO B 1 339 ? -22.638 -7.506  -10.983 1.00 26.04 ? 339 PRO B C   1 
ATOM   5585 O O   . PRO B 1 339 ? -22.237 -8.358  -10.185 1.00 29.15 ? 339 PRO B O   1 
ATOM   5586 C CB  . PRO B 1 339 ? -21.978 -5.587  -9.442  1.00 20.94 ? 339 PRO B CB  1 
ATOM   5587 C CG  . PRO B 1 339 ? -22.667 -6.074  -8.202  1.00 20.33 ? 339 PRO B CG  1 
ATOM   5588 C CD  . PRO B 1 339 ? -24.117 -5.768  -8.457  1.00 19.48 ? 339 PRO B CD  1 
ATOM   5589 N N   . GLU B 1 340 ? -22.861 -7.753  -12.267 1.00 26.18 ? 340 GLU B N   1 
ATOM   5590 C CA  . GLU B 1 340 ? -22.687 -9.064  -12.879 1.00 23.75 ? 340 GLU B CA  1 
ATOM   5591 C C   . GLU B 1 340 ? -21.439 -9.866  -12.469 1.00 20.95 ? 340 GLU B C   1 
ATOM   5592 O O   . GLU B 1 340 ? -21.559 -10.961 -11.903 1.00 15.80 ? 340 GLU B O   1 
ATOM   5593 C CB  . GLU B 1 340 ? -22.715 -8.897  -14.394 1.00 25.16 ? 340 GLU B CB  1 
ATOM   5594 C CG  . GLU B 1 340 ? -23.117 -10.135 -15.158 1.00 35.44 ? 340 GLU B CG  1 
ATOM   5595 C CD  . GLU B 1 340 ? -23.027 -9.929  -16.665 1.00 41.27 ? 340 GLU B CD  1 
ATOM   5596 O OE1 . GLU B 1 340 ? -23.453 -10.832 -17.424 1.00 44.36 ? 340 GLU B OE1 1 
ATOM   5597 O OE2 . GLU B 1 340 ? -22.521 -8.863  -17.084 1.00 43.89 ? 340 GLU B OE2 1 
ATOM   5598 N N   . LEU B 1 341 ? -20.252 -9.338  -12.770 1.00 19.26 ? 341 LEU B N   1 
ATOM   5599 C CA  . LEU B 1 341 ? -18.998 -10.027 -12.443 1.00 17.77 ? 341 LEU B CA  1 
ATOM   5600 C C   . LEU B 1 341 ? -18.903 -10.292 -10.942 1.00 20.28 ? 341 LEU B C   1 
ATOM   5601 O O   . LEU B 1 341 ? -18.587 -11.407 -10.508 1.00 16.01 ? 341 LEU B O   1 
ATOM   5602 C CB  . LEU B 1 341 ? -17.786 -9.194  -12.897 1.00 17.04 ? 341 LEU B CB  1 
ATOM   5603 C CG  . LEU B 1 341 ? -16.406 -9.842  -12.712 1.00 13.94 ? 341 LEU B CG  1 
ATOM   5604 C CD1 . LEU B 1 341 ? -16.336 -11.143 -13.481 1.00 14.20 ? 341 LEU B CD1 1 
ATOM   5605 C CD2 . LEU B 1 341 ? -15.323 -8.921  -13.190 1.00 12.31 ? 341 LEU B CD2 1 
ATOM   5606 N N   . ILE B 1 342 ? -19.183 -9.255  -10.157 1.00 18.75 ? 342 ILE B N   1 
ATOM   5607 C CA  . ILE B 1 342 ? -19.143 -9.366  -8.706  1.00 19.09 ? 342 ILE B CA  1 
ATOM   5608 C C   . ILE B 1 342 ? -20.077 -10.477 -8.234  1.00 19.27 ? 342 ILE B C   1 
ATOM   5609 O O   . ILE B 1 342 ? -19.684 -11.343 -7.464  1.00 20.13 ? 342 ILE B O   1 
ATOM   5610 C CB  . ILE B 1 342 ? -19.530 -8.010  -8.038  1.00 16.81 ? 342 ILE B CB  1 
ATOM   5611 C CG1 . ILE B 1 342 ? -18.360 -7.026  -8.168  1.00 15.92 ? 342 ILE B CG1 1 
ATOM   5612 C CG2 . ILE B 1 342 ? -19.889 -8.207  -6.573  1.00 7.56  ? 342 ILE B CG2 1 
ATOM   5613 C CD1 . ILE B 1 342 ? -18.694 -5.602  -7.750  1.00 14.01 ? 342 ILE B CD1 1 
ATOM   5614 N N   . LEU B 1 343 ? -21.312 -10.456 -8.710  1.00 19.66 ? 343 LEU B N   1 
ATOM   5615 C CA  . LEU B 1 343 ? -22.270 -11.466 -8.311  1.00 20.94 ? 343 LEU B CA  1 
ATOM   5616 C C   . LEU B 1 343 ? -21.777 -12.860 -8.677  1.00 21.64 ? 343 LEU B C   1 
ATOM   5617 O O   . LEU B 1 343 ? -21.987 -13.815 -7.927  1.00 22.23 ? 343 LEU B O   1 
ATOM   5618 C CB  . LEU B 1 343 ? -23.639 -11.178 -8.942  1.00 20.23 ? 343 LEU B CB  1 
ATOM   5619 C CG  . LEU B 1 343 ? -24.355 -9.958  -8.328  1.00 23.48 ? 343 LEU B CG  1 
ATOM   5620 C CD1 . LEU B 1 343 ? -25.642 -9.653  -9.077  1.00 16.06 ? 343 LEU B CD1 1 
ATOM   5621 C CD2 . LEU B 1 343 ? -24.641 -10.231 -6.847  1.00 17.54 ? 343 LEU B CD2 1 
ATOM   5622 N N   . ARG B 1 344 ? -21.111 -12.984 -9.820  1.00 22.91 ? 344 ARG B N   1 
ATOM   5623 C CA  . ARG B 1 344 ? -20.597 -14.285 -10.229 1.00 21.04 ? 344 ARG B CA  1 
ATOM   5624 C C   . ARG B 1 344 ? -19.483 -14.752 -9.280  1.00 20.52 ? 344 ARG B C   1 
ATOM   5625 O O   . ARG B 1 344 ? -19.495 -15.892 -8.825  1.00 19.72 ? 344 ARG B O   1 
ATOM   5626 C CB  . ARG B 1 344 ? -20.091 -14.238 -11.675 1.00 22.01 ? 344 ARG B CB  1 
ATOM   5627 C CG  . ARG B 1 344 ? -18.997 -15.258 -11.955 1.00 27.64 ? 344 ARG B CG  1 
ATOM   5628 C CD  . ARG B 1 344 ? -19.283 -16.170 -13.135 1.00 31.04 ? 344 ARG B CD  1 
ATOM   5629 N NE  . ARG B 1 344 ? -19.153 -15.487 -14.416 1.00 32.72 ? 344 ARG B NE  1 
ATOM   5630 C CZ  . ARG B 1 344 ? -18.709 -16.078 -15.523 1.00 33.35 ? 344 ARG B CZ  1 
ATOM   5631 N NH1 . ARG B 1 344 ? -18.353 -17.357 -15.493 1.00 24.90 ? 344 ARG B NH1 1 
ATOM   5632 N NH2 . ARG B 1 344 ? -18.618 -15.391 -16.658 1.00 33.43 ? 344 ARG B NH2 1 
ATOM   5633 N N   . PHE B 1 345 ? -18.523 -13.874 -8.985  1.00 21.69 ? 345 PHE B N   1 
ATOM   5634 C CA  . PHE B 1 345 ? -17.428 -14.221 -8.082  1.00 20.80 ? 345 PHE B CA  1 
ATOM   5635 C C   . PHE B 1 345 ? -18.007 -14.671 -6.753  1.00 21.66 ? 345 PHE B C   1 
ATOM   5636 O O   . PHE B 1 345 ? -17.597 -15.692 -6.186  1.00 21.61 ? 345 PHE B O   1 
ATOM   5637 C CB  . PHE B 1 345 ? -16.504 -13.019 -7.865  1.00 21.45 ? 345 PHE B CB  1 
ATOM   5638 C CG  . PHE B 1 345 ? -15.411 -12.894 -8.890  1.00 24.62 ? 345 PHE B CG  1 
ATOM   5639 C CD1 . PHE B 1 345 ? -15.017 -11.641 -9.359  1.00 26.10 ? 345 PHE B CD1 1 
ATOM   5640 C CD2 . PHE B 1 345 ? -14.748 -14.023 -9.364  1.00 25.39 ? 345 PHE B CD2 1 
ATOM   5641 C CE1 . PHE B 1 345 ? -13.972 -11.515 -10.287 1.00 27.26 ? 345 PHE B CE1 1 
ATOM   5642 C CE2 . PHE B 1 345 ? -13.704 -13.909 -10.289 1.00 27.84 ? 345 PHE B CE2 1 
ATOM   5643 C CZ  . PHE B 1 345 ? -13.315 -12.653 -10.750 1.00 27.05 ? 345 PHE B CZ  1 
ATOM   5644 N N   . GLN B 1 346 ? -18.974 -13.901 -6.269  1.00 19.50 ? 346 GLN B N   1 
ATOM   5645 C CA  . GLN B 1 346 ? -19.642 -14.200 -5.013  1.00 22.56 ? 346 GLN B CA  1 
ATOM   5646 C C   . GLN B 1 346 ? -20.295 -15.587 -4.976  1.00 21.53 ? 346 GLN B C   1 
ATOM   5647 O O   . GLN B 1 346 ? -20.066 -16.373 -4.052  1.00 20.29 ? 346 GLN B O   1 
ATOM   5648 C CB  . GLN B 1 346 ? -20.701 -13.136 -4.732  1.00 25.63 ? 346 GLN B CB  1 
ATOM   5649 C CG  . GLN B 1 346 ? -21.724 -13.570 -3.710  1.00 33.42 ? 346 GLN B CG  1 
ATOM   5650 C CD  . GLN B 1 346 ? -22.495 -12.411 -3.138  1.00 37.93 ? 346 GLN B CD  1 
ATOM   5651 O OE1 . GLN B 1 346 ? -23.424 -12.600 -2.345  1.00 39.81 ? 346 GLN B OE1 1 
ATOM   5652 N NE2 . GLN B 1 346 ? -22.110 -11.196 -3.524  1.00 39.06 ? 346 GLN B NE2 1 
ATOM   5653 N N   . LYS B 1 347 ? -21.123 -15.873 -5.974  1.00 20.67 ? 347 LYS B N   1 
ATOM   5654 C CA  . LYS B 1 347 ? -21.809 -17.152 -6.049  1.00 21.88 ? 347 LYS B CA  1 
ATOM   5655 C C   . LYS B 1 347 ? -20.810 -18.309 -6.086  1.00 21.96 ? 347 LYS B C   1 
ATOM   5656 O O   . LYS B 1 347 ? -20.970 -19.289 -5.355  1.00 19.99 ? 347 LYS B O   1 
ATOM   5657 C CB  . LYS B 1 347 ? -22.710 -17.183 -7.284  1.00 27.09 ? 347 LYS B CB  1 
ATOM   5658 C CG  . LYS B 1 347 ? -23.703 -18.332 -7.311  1.00 34.96 ? 347 LYS B CG  1 
ATOM   5659 C CD  . LYS B 1 347 ? -24.748 -18.104 -8.397  1.00 42.83 ? 347 LYS B CD  1 
ATOM   5660 C CE  . LYS B 1 347 ? -25.777 -19.230 -8.454  1.00 47.24 ? 347 LYS B CE  1 
ATOM   5661 N NZ  . LYS B 1 347 ? -26.811 -18.985 -9.515  1.00 47.56 ? 347 LYS B NZ  1 
ATOM   5662 N N   . GLU B 1 348 ? -19.772 -18.193 -6.915  1.00 19.24 ? 348 GLU B N   1 
ATOM   5663 C CA  . GLU B 1 348 ? -18.787 -19.259 -7.004  1.00 22.73 ? 348 GLU B CA  1 
ATOM   5664 C C   . GLU B 1 348 ? -17.967 -19.451 -5.731  1.00 22.46 ? 348 GLU B C   1 
ATOM   5665 O O   . GLU B 1 348 ? -17.666 -20.581 -5.354  1.00 20.40 ? 348 GLU B O   1 
ATOM   5666 C CB  . GLU B 1 348 ? -17.865 -19.060 -8.212  1.00 24.15 ? 348 GLU B CB  1 
ATOM   5667 C CG  . GLU B 1 348 ? -18.580 -19.288 -9.541  1.00 33.65 ? 348 GLU B CG  1 
ATOM   5668 C CD  . GLU B 1 348 ? -17.637 -19.674 -10.675 1.00 38.57 ? 348 GLU B CD  1 
ATOM   5669 O OE1 . GLU B 1 348 ? -16.808 -20.597 -10.486 1.00 36.71 ? 348 GLU B OE1 1 
ATOM   5670 O OE2 . GLU B 1 348 ? -17.738 -19.062 -11.761 1.00 38.39 ? 348 GLU B OE2 1 
ATOM   5671 N N   . LEU B 1 349 ? -17.596 -18.366 -5.061  1.00 21.28 ? 349 LEU B N   1 
ATOM   5672 C CA  . LEU B 1 349 ? -16.832 -18.519 -3.829  1.00 22.07 ? 349 LEU B CA  1 
ATOM   5673 C C   . LEU B 1 349 ? -17.709 -19.191 -2.765  1.00 21.40 ? 349 LEU B C   1 
ATOM   5674 O O   . LEU B 1 349 ? -17.253 -20.041 -2.003  1.00 22.79 ? 349 LEU B O   1 
ATOM   5675 C CB  . LEU B 1 349 ? -16.339 -17.158 -3.324  1.00 22.73 ? 349 LEU B CB  1 
ATOM   5676 C CG  . LEU B 1 349 ? -15.081 -16.610 -3.997  1.00 23.80 ? 349 LEU B CG  1 
ATOM   5677 C CD1 . LEU B 1 349 ? -14.840 -15.172 -3.566  1.00 21.73 ? 349 LEU B CD1 1 
ATOM   5678 C CD2 . LEU B 1 349 ? -13.894 -17.479 -3.622  1.00 24.93 ? 349 LEU B CD2 1 
ATOM   5679 N N   . LYS B 1 350 ? -18.978 -18.809 -2.729  1.00 23.19 ? 350 LYS B N   1 
ATOM   5680 C CA  . LYS B 1 350 ? -19.917 -19.371 -1.771  1.00 24.61 ? 350 LYS B CA  1 
ATOM   5681 C C   . LYS B 1 350 ? -20.072 -20.886 -1.947  1.00 23.29 ? 350 LYS B C   1 
ATOM   5682 O O   . LYS B 1 350 ? -20.091 -21.634 -0.965  1.00 19.43 ? 350 LYS B O   1 
ATOM   5683 C CB  . LYS B 1 350 ? -21.269 -18.655 -1.900  1.00 27.42 ? 350 LYS B CB  1 
ATOM   5684 C CG  . LYS B 1 350 ? -22.435 -19.366 -1.241  1.00 31.42 ? 350 LYS B CG  1 
ATOM   5685 C CD  . LYS B 1 350 ? -23.523 -18.397 -0.753  1.00 39.42 ? 350 LYS B CD  1 
ATOM   5686 C CE  . LYS B 1 350 ? -23.966 -17.381 -1.814  1.00 41.20 ? 350 LYS B CE  1 
ATOM   5687 N NZ  . LYS B 1 350 ? -23.209 -16.093 -1.742  1.00 43.06 ? 350 LYS B NZ  1 
ATOM   5688 N N   . GLU B 1 351 ? -20.157 -21.344 -3.193  1.00 24.78 ? 351 GLU B N   1 
ATOM   5689 C CA  . GLU B 1 351 ? -20.305 -22.779 -3.452  1.00 25.50 ? 351 GLU B CA  1 
ATOM   5690 C C   . GLU B 1 351 ? -19.041 -23.538 -3.053  1.00 23.74 ? 351 GLU B C   1 
ATOM   5691 O O   . GLU B 1 351 ? -19.119 -24.655 -2.549  1.00 25.12 ? 351 GLU B O   1 
ATOM   5692 C CB  . GLU B 1 351 ? -20.625 -23.038 -4.933  1.00 23.98 ? 351 GLU B CB  1 
ATOM   5693 C CG  . GLU B 1 351 ? -21.728 -22.147 -5.479  1.00 27.78 ? 351 GLU B CG  1 
ATOM   5694 C CD  . GLU B 1 351 ? -22.386 -22.694 -6.723  1.00 28.26 ? 351 GLU B CD  1 
ATOM   5695 O OE1 . GLU B 1 351 ? -21.658 -23.176 -7.615  1.00 33.19 ? 351 GLU B OE1 1 
ATOM   5696 O OE2 . GLU B 1 351 ? -23.634 -22.631 -6.809  1.00 27.16 ? 351 GLU B OE2 1 
ATOM   5697 N N   . ILE B 1 352 ? -17.880 -22.926 -3.268  1.00 20.43 ? 352 ILE B N   1 
ATOM   5698 C CA  . ILE B 1 352 ? -16.610 -23.557 -2.922  1.00 21.26 ? 352 ILE B CA  1 
ATOM   5699 C C   . ILE B 1 352 ? -16.363 -23.536 -1.407  1.00 23.71 ? 352 ILE B C   1 
ATOM   5700 O O   . ILE B 1 352 ? -16.010 -24.555 -0.793  1.00 21.91 ? 352 ILE B O   1 
ATOM   5701 C CB  . ILE B 1 352 ? -15.421 -22.841 -3.619  1.00 17.55 ? 352 ILE B CB  1 
ATOM   5702 C CG1 . ILE B 1 352 ? -15.445 -23.123 -5.126  1.00 19.31 ? 352 ILE B CG1 1 
ATOM   5703 C CG2 . ILE B 1 352 ? -14.102 -23.294 -3.001  1.00 14.67 ? 352 ILE B CG2 1 
ATOM   5704 C CD1 . ILE B 1 352 ? -14.359 -22.403 -5.905  1.00 16.82 ? 352 ILE B CD1 1 
ATOM   5705 N N   . GLN B 1 353 ? -16.554 -22.366 -0.808  1.00 22.12 ? 353 GLN B N   1 
ATOM   5706 C CA  . GLN B 1 353 ? -16.329 -22.209 0.618   1.00 24.39 ? 353 GLN B CA  1 
ATOM   5707 C C   . GLN B 1 353 ? -17.312 -23.002 1.474   1.00 24.22 ? 353 GLN B C   1 
ATOM   5708 O O   . GLN B 1 353 ? -16.914 -23.595 2.477   1.00 23.53 ? 353 GLN B O   1 
ATOM   5709 C CB  . GLN B 1 353 ? -16.348 -20.717 0.985   1.00 22.54 ? 353 GLN B CB  1 
ATOM   5710 C CG  . GLN B 1 353 ? -15.324 -19.921 0.171   1.00 26.80 ? 353 GLN B CG  1 
ATOM   5711 C CD  . GLN B 1 353 ? -15.274 -18.437 0.505   1.00 24.29 ? 353 GLN B CD  1 
ATOM   5712 O OE1 . GLN B 1 353 ? -16.306 -17.778 0.634   1.00 20.97 ? 353 GLN B OE1 1 
ATOM   5713 N NE2 . GLN B 1 353 ? -14.064 -17.904 0.625   1.00 24.34 ? 353 GLN B NE2 1 
ATOM   5714 N N   . TYR B 1 354 ? -18.585 -23.032 1.089   1.00 22.78 ? 354 TYR B N   1 
ATOM   5715 C CA  . TYR B 1 354 ? -19.558 -23.789 1.871   1.00 25.26 ? 354 TYR B CA  1 
ATOM   5716 C C   . TYR B 1 354 ? -19.720 -25.258 1.478   1.00 24.47 ? 354 TYR B C   1 
ATOM   5717 O O   . TYR B 1 354 ? -20.712 -25.891 1.831   1.00 26.76 ? 354 TYR B O   1 
ATOM   5718 C CB  . TYR B 1 354 ? -20.925 -23.091 1.865   1.00 25.96 ? 354 TYR B CB  1 
ATOM   5719 C CG  . TYR B 1 354 ? -20.919 -21.802 2.639   1.00 22.97 ? 354 TYR B CG  1 
ATOM   5720 C CD1 . TYR B 1 354 ? -20.603 -20.600 2.017   1.00 22.95 ? 354 TYR B CD1 1 
ATOM   5721 C CD2 . TYR B 1 354 ? -21.173 -21.790 4.012   1.00 24.25 ? 354 TYR B CD2 1 
ATOM   5722 C CE1 . TYR B 1 354 ? -20.539 -19.412 2.737   1.00 27.55 ? 354 TYR B CE1 1 
ATOM   5723 C CE2 . TYR B 1 354 ? -21.112 -20.605 4.749   1.00 24.62 ? 354 TYR B CE2 1 
ATOM   5724 C CZ  . TYR B 1 354 ? -20.795 -19.416 4.101   1.00 28.43 ? 354 TYR B CZ  1 
ATOM   5725 O OH  . TYR B 1 354 ? -20.746 -18.224 4.792   1.00 27.76 ? 354 TYR B OH  1 
ATOM   5726 N N   . GLY B 1 355 ? -18.748 -25.797 0.750   1.00 23.38 ? 355 GLY B N   1 
ATOM   5727 C CA  . GLY B 1 355 ? -18.797 -27.201 0.383   1.00 23.67 ? 355 GLY B CA  1 
ATOM   5728 C C   . GLY B 1 355 ? -19.824 -27.678 -0.633  1.00 25.24 ? 355 GLY B C   1 
ATOM   5729 O O   . GLY B 1 355 ? -19.877 -28.872 -0.922  1.00 26.67 ? 355 GLY B O   1 
ATOM   5730 N N   . ILE B 1 356 ? -20.642 -26.775 -1.168  1.00 25.32 ? 356 ILE B N   1 
ATOM   5731 C CA  . ILE B 1 356 ? -21.642 -27.141 -2.176  1.00 24.26 ? 356 ILE B CA  1 
ATOM   5732 C C   . ILE B 1 356 ? -20.937 -27.846 -3.337  1.00 24.65 ? 356 ILE B C   1 
ATOM   5733 O O   . ILE B 1 356 ? -21.490 -28.741 -3.972  1.00 19.81 ? 356 ILE B O   1 
ATOM   5734 C CB  . ILE B 1 356 ? -22.342 -25.884 -2.753  1.00 24.78 ? 356 ILE B CB  1 
ATOM   5735 C CG1 . ILE B 1 356 ? -23.053 -25.120 -1.638  1.00 27.99 ? 356 ILE B CG1 1 
ATOM   5736 C CG2 . ILE B 1 356 ? -23.306 -26.271 -3.860  1.00 19.57 ? 356 ILE B CG2 1 
ATOM   5737 C CD1 . ILE B 1 356 ? -24.152 -25.887 -0.983  1.00 33.42 ? 356 ILE B CD1 1 
ATOM   5738 N N   . ARG B 1 357 ? -19.709 -27.417 -3.601  1.00 26.11 ? 357 ARG B N   1 
ATOM   5739 C CA  . ARG B 1 357 ? -18.900 -27.965 -4.676  1.00 28.80 ? 357 ARG B CA  1 
ATOM   5740 C C   . ARG B 1 357 ? -17.549 -28.419 -4.113  1.00 26.45 ? 357 ARG B C   1 
ATOM   5741 O O   . ARG B 1 357 ? -16.940 -27.710 -3.313  1.00 30.47 ? 357 ARG B O   1 
ATOM   5742 C CB  . ARG B 1 357 ? -18.679 -26.884 -5.736  1.00 31.11 ? 357 ARG B CB  1 
ATOM   5743 C CG  . ARG B 1 357 ? -17.974 -27.368 -6.979  1.00 40.50 ? 357 ARG B CG  1 
ATOM   5744 C CD  . ARG B 1 357 ? -17.378 -26.210 -7.747  1.00 43.60 ? 357 ARG B CD  1 
ATOM   5745 N NE  . ARG B 1 357 ? -18.317 -25.108 -7.914  1.00 45.25 ? 357 ARG B NE  1 
ATOM   5746 C CZ  . ARG B 1 357 ? -18.011 -23.973 -8.539  1.00 52.03 ? 357 ARG B CZ  1 
ATOM   5747 N NH1 . ARG B 1 357 ? -16.791 -23.805 -9.052  1.00 51.36 ? 357 ARG B NH1 1 
ATOM   5748 N NH2 . ARG B 1 357 ? -18.913 -23.004 -8.651  1.00 52.91 ? 357 ARG B NH2 1 
ATOM   5749 N N   . ALA B 1 358 ? -17.079 -29.590 -4.529  1.00 22.51 ? 358 ALA B N   1 
ATOM   5750 C CA  . ALA B 1 358 ? -15.793 -30.097 -4.061  1.00 21.98 ? 358 ALA B CA  1 
ATOM   5751 C C   . ALA B 1 358 ? -14.670 -29.311 -4.736  1.00 20.41 ? 358 ALA B C   1 
ATOM   5752 O O   . ALA B 1 358 ? -14.699 -29.091 -5.942  1.00 18.90 ? 358 ALA B O   1 
ATOM   5753 C CB  . ALA B 1 358 ? -15.665 -31.580 -4.387  1.00 22.53 ? 358 ALA B CB  1 
ATOM   5754 N N   . HIS B 1 359 ? -13.673 -28.897 -3.964  1.00 18.77 ? 359 HIS B N   1 
ATOM   5755 C CA  . HIS B 1 359 ? -12.574 -28.125 -4.525  1.00 18.83 ? 359 HIS B CA  1 
ATOM   5756 C C   . HIS B 1 359 ? -11.297 -28.243 -3.683  1.00 18.86 ? 359 HIS B C   1 
ATOM   5757 O O   . HIS B 1 359 ? -11.353 -28.305 -2.461  1.00 12.59 ? 359 HIS B O   1 
ATOM   5758 C CB  . HIS B 1 359 ? -13.006 -26.661 -4.638  1.00 20.30 ? 359 HIS B CB  1 
ATOM   5759 C CG  . HIS B 1 359 ? -12.138 -25.850 -5.536  1.00 21.70 ? 359 HIS B CG  1 
ATOM   5760 N ND1 . HIS B 1 359 ? -10.868 -25.453 -5.183  1.00 22.46 ? 359 HIS B ND1 1 
ATOM   5761 C CD2 . HIS B 1 359 ? -12.339 -25.398 -6.797  1.00 24.24 ? 359 HIS B CD2 1 
ATOM   5762 C CE1 . HIS B 1 359 ? -10.323 -24.793 -6.189  1.00 25.28 ? 359 HIS B CE1 1 
ATOM   5763 N NE2 . HIS B 1 359 ? -11.195 -24.745 -7.181  1.00 23.32 ? 359 HIS B NE2 1 
ATOM   5764 N N   . GLU B 1 360 ? -10.144 -28.255 -4.342  1.00 21.58 ? 360 GLU B N   1 
ATOM   5765 C CA  . GLU B 1 360 ? -8.860  -28.388 -3.648  1.00 25.00 ? 360 GLU B CA  1 
ATOM   5766 C C   . GLU B 1 360 ? -8.447  -27.203 -2.770  1.00 24.70 ? 360 GLU B C   1 
ATOM   5767 O O   . GLU B 1 360 ? -7.538  -27.334 -1.949  1.00 24.59 ? 360 GLU B O   1 
ATOM   5768 C CB  . GLU B 1 360 ? -7.754  -28.676 -4.659  1.00 27.18 ? 360 GLU B CB  1 
ATOM   5769 C CG  . GLU B 1 360 ? -7.646  -27.634 -5.755  1.00 37.10 ? 360 GLU B CG  1 
ATOM   5770 C CD  . GLU B 1 360 ? -6.583  -27.982 -6.778  1.00 42.98 ? 360 GLU B CD  1 
ATOM   5771 O OE1 . GLU B 1 360 ? -6.366  -27.174 -7.707  1.00 46.37 ? 360 GLU B OE1 1 
ATOM   5772 O OE2 . GLU B 1 360 ? -5.965  -29.066 -6.657  1.00 48.33 ? 360 GLU B OE2 1 
ATOM   5773 N N   . TRP B 1 361 ? -9.104  -26.056 -2.946  1.00 21.82 ? 361 TRP B N   1 
ATOM   5774 C CA  . TRP B 1 361 ? -8.796  -24.877 -2.143  1.00 20.30 ? 361 TRP B CA  1 
ATOM   5775 C C   . TRP B 1 361 ? -9.238  -25.039 -0.700  1.00 20.66 ? 361 TRP B C   1 
ATOM   5776 O O   . TRP B 1 361 ? -8.691  -24.382 0.188   1.00 21.52 ? 361 TRP B O   1 
ATOM   5777 C CB  . TRP B 1 361 ? -9.478  -23.617 -2.699  1.00 21.09 ? 361 TRP B CB  1 
ATOM   5778 C CG  . TRP B 1 361 ? -8.840  -23.019 -3.927  1.00 20.89 ? 361 TRP B CG  1 
ATOM   5779 C CD1 . TRP B 1 361 ? -7.660  -23.391 -4.515  1.00 20.35 ? 361 TRP B CD1 1 
ATOM   5780 C CD2 . TRP B 1 361 ? -9.362  -21.947 -4.719  1.00 19.19 ? 361 TRP B CD2 1 
ATOM   5781 N NE1 . TRP B 1 361 ? -7.423  -22.617 -5.627  1.00 24.22 ? 361 TRP B NE1 1 
ATOM   5782 C CE2 . TRP B 1 361 ? -8.453  -21.724 -5.774  1.00 22.79 ? 361 TRP B CE2 1 
ATOM   5783 C CE3 . TRP B 1 361 ? -10.515 -21.153 -4.641  1.00 23.60 ? 361 TRP B CE3 1 
ATOM   5784 C CZ2 . TRP B 1 361 ? -8.659  -20.739 -6.744  1.00 22.92 ? 361 TRP B CZ2 1 
ATOM   5785 C CZ3 . TRP B 1 361 ? -10.722 -20.173 -5.606  1.00 21.18 ? 361 TRP B CZ3 1 
ATOM   5786 C CH2 . TRP B 1 361 ? -9.796  -19.976 -6.644  1.00 22.85 ? 361 TRP B CH2 1 
ATOM   5787 N N   . MET B 1 362 ? -10.230 -25.897 -0.463  1.00 20.53 ? 362 MET B N   1 
ATOM   5788 C CA  . MET B 1 362 ? -10.743 -26.091 0.890   1.00 20.06 ? 362 MET B CA  1 
ATOM   5789 C C   . MET B 1 362 ? -9.962  -27.091 1.719   1.00 21.05 ? 362 MET B C   1 
ATOM   5790 O O   . MET B 1 362 ? -9.598  -28.165 1.256   1.00 23.10 ? 362 MET B O   1 
ATOM   5791 C CB  . MET B 1 362 ? -12.223 -26.492 0.868   1.00 19.18 ? 362 MET B CB  1 
ATOM   5792 C CG  . MET B 1 362 ? -13.141 -25.492 0.173   1.00 15.23 ? 362 MET B CG  1 
ATOM   5793 S SD  . MET B 1 362 ? -12.696 -23.756 0.486   1.00 21.23 ? 362 MET B SD  1 
ATOM   5794 C CE  . MET B 1 362 ? -13.309 -23.517 2.141   1.00 9.83  ? 362 MET B CE  1 
ATOM   5795 N N   . PHE B 1 363 ? -9.714  -26.713 2.964   1.00 23.11 ? 363 PHE B N   1 
ATOM   5796 C CA  . PHE B 1 363 ? -8.979  -27.536 3.903   1.00 23.99 ? 363 PHE B CA  1 
ATOM   5797 C C   . PHE B 1 363 ? -9.956  -27.990 4.981   1.00 25.03 ? 363 PHE B C   1 
ATOM   5798 O O   . PHE B 1 363 ? -10.458 -27.177 5.752   1.00 25.41 ? 363 PHE B O   1 
ATOM   5799 C CB  . PHE B 1 363 ? -7.857  -26.705 4.533   1.00 27.56 ? 363 PHE B CB  1 
ATOM   5800 C CG  . PHE B 1 363 ? -6.979  -27.473 5.480   1.00 27.32 ? 363 PHE B CG  1 
ATOM   5801 C CD1 . PHE B 1 363 ? -6.050  -28.390 5.003   1.00 30.14 ? 363 PHE B CD1 1 
ATOM   5802 C CD2 . PHE B 1 363 ? -7.078  -27.274 6.854   1.00 27.68 ? 363 PHE B CD2 1 
ATOM   5803 C CE1 . PHE B 1 363 ? -5.228  -29.101 5.889   1.00 31.06 ? 363 PHE B CE1 1 
ATOM   5804 C CE2 . PHE B 1 363 ? -6.266  -27.976 7.739   1.00 27.65 ? 363 PHE B CE2 1 
ATOM   5805 C CZ  . PHE B 1 363 ? -5.341  -28.888 7.258   1.00 27.12 ? 363 PHE B CZ  1 
ATOM   5806 N N   . PRO B 1 364 ? -10.226 -29.299 5.054   1.00 27.26 ? 364 PRO B N   1 
ATOM   5807 C CA  . PRO B 1 364 ? -11.149 -29.880 6.042   1.00 28.90 ? 364 PRO B CA  1 
ATOM   5808 C C   . PRO B 1 364 ? -10.584 -29.826 7.459   1.00 28.87 ? 364 PRO B C   1 
ATOM   5809 O O   . PRO B 1 364 ? -9.397  -30.072 7.667   1.00 29.52 ? 364 PRO B O   1 
ATOM   5810 C CB  . PRO B 1 364 ? -11.292 -31.343 5.592   1.00 28.71 ? 364 PRO B CB  1 
ATOM   5811 C CG  . PRO B 1 364 ? -10.614 -31.413 4.230   1.00 29.04 ? 364 PRO B CG  1 
ATOM   5812 C CD  . PRO B 1 364 ? -9.553  -30.357 4.287   1.00 27.34 ? 364 PRO B CD  1 
ATOM   5813 N N   . VAL B 1 365 ? -11.421 -29.513 8.437   1.00 29.38 ? 365 VAL B N   1 
ATOM   5814 C CA  . VAL B 1 365 ? -10.937 -29.501 9.814   1.00 33.40 ? 365 VAL B CA  1 
ATOM   5815 C C   . VAL B 1 365 ? -11.288 -30.858 10.431  1.00 32.48 ? 365 VAL B C   1 
ATOM   5816 O O   . VAL B 1 365 ? -12.472 -31.258 10.353  1.00 28.53 ? 365 VAL B O   1 
ATOM   5817 C CB  . VAL B 1 365 ? -11.584 -28.365 10.665  1.00 33.30 ? 365 VAL B CB  1 
ATOM   5818 C CG1 . VAL B 1 365 ? -13.081 -28.496 10.646  1.00 35.41 ? 365 VAL B CG1 1 
ATOM   5819 C CG2 . VAL B 1 365 ? -11.103 -28.447 12.108  1.00 32.08 ? 365 VAL B CG2 1 
ATOM   5820 O OXT . VAL B 1 365 ? -10.367 -31.504 10.976  1.00 36.55 ? 365 VAL B OXT 1 
HETATM 5821 N N1  . PLP C 2 .   ? 15.589  9.949   15.481  1.00 18.96 ? 370 PLP A N1  1 
HETATM 5822 C C2  . PLP C 2 .   ? 14.773  8.924   15.836  1.00 20.52 ? 370 PLP A C2  1 
HETATM 5823 C C2A . PLP C 2 .   ? 14.278  7.997   14.732  1.00 18.66 ? 370 PLP A C2A 1 
HETATM 5824 C C3  . PLP C 2 .   ? 14.423  8.763   17.188  1.00 19.95 ? 370 PLP A C3  1 
HETATM 5825 O O3  . PLP C 2 .   ? 13.612  7.742   17.535  1.00 23.41 ? 370 PLP A O3  1 
HETATM 5826 C C4  . PLP C 2 .   ? 14.916  9.658   18.166  1.00 22.66 ? 370 PLP A C4  1 
HETATM 5827 C C4A . PLP C 2 .   ? 14.497  9.446   19.646  1.00 22.79 ? 370 PLP A C4A 1 
HETATM 5828 C C5  . PLP C 2 .   ? 15.783  10.722  17.733  1.00 20.05 ? 370 PLP A C5  1 
HETATM 5829 C C6  . PLP C 2 .   ? 16.096  10.835  16.402  1.00 18.95 ? 370 PLP A C6  1 
HETATM 5830 C C5A . PLP C 2 .   ? 16.442  11.717  18.629  1.00 17.27 ? 370 PLP A C5A 1 
HETATM 5831 O O4P . PLP C 2 .   ? 15.620  12.374  19.513  1.00 17.64 ? 370 PLP A O4P 1 
HETATM 5832 P P   . PLP C 2 .   ? 16.137  12.832  20.931  1.00 19.21 ? 370 PLP A P   1 
HETATM 5833 O O1P . PLP C 2 .   ? 16.382  11.707  21.824  1.00 20.36 ? 370 PLP A O1P 1 
HETATM 5834 O O2P . PLP C 2 .   ? 14.847  13.539  21.439  1.00 13.19 ? 370 PLP A O2P 1 
HETATM 5835 O O3P . PLP C 2 .   ? 17.145  13.884  20.755  1.00 8.30  ? 370 PLP A O3P 1 
HETATM 5836 N N1  . PLP D 2 .   ? -4.599  -5.359  1.965   1.00 18.90 ? 370 PLP B N1  1 
HETATM 5837 C C2  . PLP D 2 .   ? -4.248  -5.187  3.263   1.00 22.14 ? 370 PLP B C2  1 
HETATM 5838 C C2A . PLP D 2 .   ? -3.555  -3.882  3.658   1.00 19.30 ? 370 PLP B C2A 1 
HETATM 5839 C C3  . PLP D 2 .   ? -4.535  -6.202  4.185   1.00 20.02 ? 370 PLP B C3  1 
HETATM 5840 O O3  . PLP D 2 .   ? -4.182  -6.022  5.474   1.00 20.00 ? 370 PLP B O3  1 
HETATM 5841 C C4  . PLP D 2 .   ? -5.176  -7.389  3.768   1.00 20.04 ? 370 PLP B C4  1 
HETATM 5842 C C4A . PLP D 2 .   ? -5.462  -8.491  4.825   1.00 24.14 ? 370 PLP B C4A 1 
HETATM 5843 C C5  . PLP D 2 .   ? -5.534  -7.511  2.388   1.00 19.44 ? 370 PLP B C5  1 
HETATM 5844 C C6  . PLP D 2 .   ? -5.233  -6.493  1.524   1.00 20.60 ? 370 PLP B C6  1 
HETATM 5845 C C5A . PLP D 2 .   ? -6.280  -8.663  1.786   1.00 21.59 ? 370 PLP B C5A 1 
HETATM 5846 O O4P . PLP D 2 .   ? -5.767  -9.926  2.034   1.00 20.41 ? 370 PLP B O4P 1 
HETATM 5847 P P   . PLP D 2 .   ? -6.724  -11.166 2.173   1.00 15.21 ? 370 PLP B P   1 
HETATM 5848 O O1P . PLP D 2 .   ? -7.546  -11.130 3.365   1.00 18.93 ? 370 PLP B O1P 1 
HETATM 5849 O O2P . PLP D 2 .   ? -5.640  -12.262 2.405   1.00 14.09 ? 370 PLP B O2P 1 
HETATM 5850 O O3P . PLP D 2 .   ? -7.324  -11.446 0.857   1.00 15.28 ? 370 PLP B O3P 1 
HETATM 5851 O O   . HOH E 3 .   ? 14.762  5.923   20.583  1.00 32.16 ? 371 HOH A O   1 
HETATM 5852 O O   . HOH E 3 .   ? 13.005  4.690   12.608  1.00 19.88 ? 372 HOH A O   1 
HETATM 5853 O O   . HOH E 3 .   ? 6.644   6.912   7.140   1.00 19.85 ? 373 HOH A O   1 
HETATM 5854 O O   . HOH E 3 .   ? 13.185  23.955  26.757  1.00 32.90 ? 374 HOH A O   1 
HETATM 5855 O O   . HOH E 3 .   ? 4.944   20.097  19.320  1.00 38.49 ? 375 HOH A O   1 
HETATM 5856 O O   . HOH E 3 .   ? 7.521   10.450  7.237   1.00 14.90 ? 376 HOH A O   1 
HETATM 5857 O O   . HOH E 3 .   ? 18.557  14.615  18.367  1.00 11.36 ? 377 HOH A O   1 
HETATM 5858 O O   . HOH E 3 .   ? 37.518  16.464  4.738   1.00 23.33 ? 378 HOH A O   1 
HETATM 5859 O O   . HOH E 3 .   ? 10.451  1.668   36.478  1.00 17.79 ? 379 HOH A O   1 
HETATM 5860 O O   . HOH E 3 .   ? 15.493  4.067   13.620  1.00 25.57 ? 380 HOH A O   1 
HETATM 5861 O O   . HOH E 3 .   ? -6.108  4.985   35.866  1.00 21.37 ? 381 HOH A O   1 
HETATM 5862 O O   . HOH E 3 .   ? 37.288  3.763   5.490   1.00 25.68 ? 382 HOH A O   1 
HETATM 5863 O O   . HOH E 3 .   ? 14.740  19.233  16.653  1.00 13.84 ? 383 HOH A O   1 
HETATM 5864 O O   . HOH E 3 .   ? -7.168  -5.356  17.517  1.00 19.24 ? 384 HOH A O   1 
HETATM 5865 O O   . HOH E 3 .   ? 10.127  16.250  9.971   1.00 23.02 ? 385 HOH A O   1 
HETATM 5866 O O   . HOH E 3 .   ? 37.094  20.239  14.081  1.00 27.39 ? 386 HOH A O   1 
HETATM 5867 O O   . HOH E 3 .   ? 28.968  29.028  16.286  1.00 27.96 ? 387 HOH A O   1 
HETATM 5868 O O   . HOH E 3 .   ? 14.401  9.042   7.763   1.00 15.40 ? 388 HOH A O   1 
HETATM 5869 O O   . HOH E 3 .   ? 0.149   -7.241  14.722  1.00 14.99 ? 389 HOH A O   1 
HETATM 5870 O O   . HOH E 3 .   ? 2.189   1.637   50.529  1.00 30.15 ? 390 HOH A O   1 
HETATM 5871 O O   . HOH E 3 .   ? 20.694  3.006   23.158  1.00 32.79 ? 391 HOH A O   1 
HETATM 5872 O O   . HOH E 3 .   ? 14.347  23.229  14.001  1.00 22.27 ? 392 HOH A O   1 
HETATM 5873 O O   . HOH E 3 .   ? 36.803  12.448  25.248  1.00 46.97 ? 393 HOH A O   1 
HETATM 5874 O O   . HOH E 3 .   ? 19.920  14.257  26.793  1.00 25.75 ? 394 HOH A O   1 
HETATM 5875 O O   . HOH E 3 .   ? 10.762  7.942   13.833  1.00 24.92 ? 395 HOH A O   1 
HETATM 5876 O O   . HOH E 3 .   ? -11.619 1.874   30.717  1.00 31.71 ? 396 HOH A O   1 
HETATM 5877 O O   . HOH E 3 .   ? 5.549   -0.875  10.213  1.00 19.85 ? 397 HOH A O   1 
HETATM 5878 O O   . HOH E 3 .   ? 8.931   18.932  20.770  1.00 29.63 ? 398 HOH A O   1 
HETATM 5879 O O   . HOH E 3 .   ? -9.176  -2.344  30.340  1.00 30.68 ? 399 HOH A O   1 
HETATM 5880 O O   . HOH E 3 .   ? 25.148  27.227  26.038  1.00 45.44 ? 400 HOH A O   1 
HETATM 5881 O O   . HOH E 3 .   ? 2.993   2.550   15.887  1.00 13.26 ? 401 HOH A O   1 
HETATM 5882 O O   . HOH E 3 .   ? 14.123  10.411  22.771  1.00 7.56  ? 402 HOH A O   1 
HETATM 5883 O O   . HOH E 3 .   ? 13.544  8.310   4.997   1.00 15.56 ? 403 HOH A O   1 
HETATM 5884 O O   . HOH E 3 .   ? 6.489   10.649  21.385  1.00 17.77 ? 404 HOH A O   1 
HETATM 5885 O O   . HOH E 3 .   ? 29.065  -4.437  1.243   1.00 28.13 ? 405 HOH A O   1 
HETATM 5886 O O   . HOH E 3 .   ? 24.481  20.668  1.951   1.00 18.66 ? 406 HOH A O   1 
HETATM 5887 O O   . HOH E 3 .   ? -1.344  22.450  30.021  1.00 32.99 ? 407 HOH A O   1 
HETATM 5888 O O   . HOH E 3 .   ? 38.090  10.163  12.197  1.00 27.17 ? 408 HOH A O   1 
HETATM 5889 O O   . HOH E 3 .   ? 36.893  22.904  6.800   1.00 21.38 ? 409 HOH A O   1 
HETATM 5890 O O   . HOH E 3 .   ? 15.523  6.359   4.830   1.00 16.23 ? 410 HOH A O   1 
HETATM 5891 O O   . HOH E 3 .   ? 18.995  15.923  3.731   1.00 28.01 ? 411 HOH A O   1 
HETATM 5892 O O   . HOH E 3 .   ? 10.515  2.230   9.765   1.00 12.73 ? 412 HOH A O   1 
HETATM 5893 O O   . HOH E 3 .   ? 21.240  2.644   4.681   1.00 10.04 ? 413 HOH A O   1 
HETATM 5894 O O   . HOH E 3 .   ? 19.284  -0.968  32.329  1.00 29.79 ? 414 HOH A O   1 
HETATM 5895 O O   . HOH E 3 .   ? -8.943  7.503   21.419  1.00 28.72 ? 415 HOH A O   1 
HETATM 5896 O O   . HOH E 3 .   ? -2.280  -4.276  33.427  1.00 33.30 ? 416 HOH A O   1 
HETATM 5897 O O   . HOH E 3 .   ? 18.784  4.366   3.275   1.00 32.32 ? 417 HOH A O   1 
HETATM 5898 O O   . HOH E 3 .   ? 1.066   11.355  8.026   1.00 27.65 ? 418 HOH A O   1 
HETATM 5899 O O   . HOH E 3 .   ? -7.582  12.535  37.085  1.00 25.40 ? 419 HOH A O   1 
HETATM 5900 O O   . HOH E 3 .   ? 19.037  14.104  11.430  1.00 12.26 ? 420 HOH A O   1 
HETATM 5901 O O   . HOH E 3 .   ? 8.356   5.724   9.058   1.00 25.85 ? 421 HOH A O   1 
HETATM 5902 O O   . HOH E 3 .   ? 23.921  17.309  -4.983  1.00 28.95 ? 422 HOH A O   1 
HETATM 5903 O O   . HOH E 3 .   ? 23.112  11.011  36.693  1.00 32.70 ? 423 HOH A O   1 
HETATM 5904 O O   . HOH E 3 .   ? -6.509  17.106  27.411  1.00 30.93 ? 424 HOH A O   1 
HETATM 5905 O O   . HOH E 3 .   ? 33.815  1.492   14.035  1.00 44.60 ? 425 HOH A O   1 
HETATM 5906 O O   . HOH E 3 .   ? 13.889  25.458  28.817  1.00 38.68 ? 426 HOH A O   1 
HETATM 5907 O O   . HOH E 3 .   ? 22.806  6.304   27.001  1.00 43.01 ? 427 HOH A O   1 
HETATM 5908 O O   . HOH E 3 .   ? 29.553  19.270  -5.106  1.00 34.44 ? 428 HOH A O   1 
HETATM 5909 O O   . HOH E 3 .   ? 18.625  8.616   20.807  1.00 40.71 ? 429 HOH A O   1 
HETATM 5910 O O   . HOH E 3 .   ? 27.215  10.870  24.128  1.00 38.30 ? 430 HOH A O   1 
HETATM 5911 O O   . HOH E 3 .   ? 8.440   17.861  11.442  1.00 30.04 ? 431 HOH A O   1 
HETATM 5912 O O   . HOH E 3 .   ? 15.689  -0.910  45.715  1.00 24.93 ? 432 HOH A O   1 
HETATM 5913 O O   . HOH E 3 .   ? 17.381  26.967  9.294   1.00 23.20 ? 433 HOH A O   1 
HETATM 5914 O O   . HOH E 3 .   ? 8.945   -3.201  43.314  1.00 27.91 ? 434 HOH A O   1 
HETATM 5915 O O   . HOH E 3 .   ? 23.677  8.086   30.736  1.00 36.26 ? 435 HOH A O   1 
HETATM 5916 O O   . HOH E 3 .   ? 2.083   13.343  9.835   1.00 34.63 ? 436 HOH A O   1 
HETATM 5917 O O   . HOH E 3 .   ? 32.325  7.264   27.045  1.00 49.60 ? 437 HOH A O   1 
HETATM 5918 O O   . HOH E 3 .   ? -3.798  12.902  46.011  1.00 40.27 ? 438 HOH A O   1 
HETATM 5919 O O   . HOH E 3 .   ? 25.305  21.930  -4.090  1.00 17.43 ? 439 HOH A O   1 
HETATM 5920 O O   . HOH E 3 .   ? 14.862  15.544  27.166  1.00 23.60 ? 440 HOH A O   1 
HETATM 5921 O O   . HOH E 3 .   ? 5.063   -4.593  46.859  1.00 36.66 ? 441 HOH A O   1 
HETATM 5922 O O   . HOH E 3 .   ? 8.858   12.505  -1.595  1.00 33.17 ? 442 HOH A O   1 
HETATM 5923 O O   . HOH E 3 .   ? 21.648  21.391  -0.056  1.00 29.82 ? 443 HOH A O   1 
HETATM 5924 O O   . HOH E 3 .   ? 19.749  -8.738  5.466   1.00 36.11 ? 444 HOH A O   1 
HETATM 5925 O O   . HOH E 3 .   ? 23.220  12.129  -4.066  1.00 40.21 ? 445 HOH A O   1 
HETATM 5926 O O   . HOH E 3 .   ? 1.475   17.294  42.561  1.00 34.14 ? 446 HOH A O   1 
HETATM 5927 O O   . HOH E 3 .   ? 17.210  24.581  36.708  1.00 28.56 ? 447 HOH A O   1 
HETATM 5928 O O   . HOH E 3 .   ? -6.295  4.343   39.813  1.00 33.98 ? 448 HOH A O   1 
HETATM 5929 O O   . HOH E 3 .   ? 21.915  2.188   20.890  1.00 46.92 ? 449 HOH A O   1 
HETATM 5930 O O   . HOH E 3 .   ? 24.077  34.695  18.260  1.00 29.29 ? 450 HOH A O   1 
HETATM 5931 O O   . HOH E 3 .   ? -6.338  -5.357  27.649  1.00 22.89 ? 451 HOH A O   1 
HETATM 5932 O O   . HOH E 3 .   ? -9.840  2.001   9.224   1.00 31.84 ? 452 HOH A O   1 
HETATM 5933 O O   . HOH E 3 .   ? 14.316  5.079   45.985  1.00 37.86 ? 453 HOH A O   1 
HETATM 5934 O O   . HOH E 3 .   ? 12.646  21.033  17.681  1.00 27.99 ? 454 HOH A O   1 
HETATM 5935 O O   . HOH E 3 .   ? -8.035  11.468  20.026  1.00 47.40 ? 455 HOH A O   1 
HETATM 5936 O O   . HOH E 3 .   ? 31.880  1.671   -6.701  1.00 20.02 ? 456 HOH A O   1 
HETATM 5937 O O   . HOH E 3 .   ? 5.012   13.027  7.767   1.00 38.34 ? 457 HOH A O   1 
HETATM 5938 O O   . HOH E 3 .   ? 21.315  4.381   16.653  1.00 27.64 ? 458 HOH A O   1 
HETATM 5939 O O   . HOH E 3 .   ? 17.041  13.781  27.732  1.00 39.21 ? 459 HOH A O   1 
HETATM 5940 O O   . HOH E 3 .   ? 16.822  27.228  24.044  1.00 36.01 ? 460 HOH A O   1 
HETATM 5941 O O   . HOH E 3 .   ? 21.462  16.769  -5.658  1.00 31.64 ? 461 HOH A O   1 
HETATM 5942 O O   . HOH E 3 .   ? 7.127   16.115  45.508  1.00 41.99 ? 462 HOH A O   1 
HETATM 5943 O O   . HOH E 3 .   ? 34.467  16.936  30.759  1.00 26.39 ? 463 HOH A O   1 
HETATM 5944 O O   . HOH E 3 .   ? 33.854  30.735  6.739   1.00 47.42 ? 464 HOH A O   1 
HETATM 5945 O O   . HOH E 3 .   ? 30.868  6.440   -4.981  1.00 36.40 ? 465 HOH A O   1 
HETATM 5946 O O   . HOH E 3 .   ? 30.995  14.220  -5.811  1.00 40.08 ? 466 HOH A O   1 
HETATM 5947 O O   . HOH E 3 .   ? 22.144  9.720   -6.136  1.00 50.19 ? 467 HOH A O   1 
HETATM 5948 O O   . HOH F 3 .   ? -0.930  5.426   -0.264  1.00 8.65  ? 371 HOH B O   1 
HETATM 5949 O O   . HOH F 3 .   ? -2.156  -0.423  5.636   1.00 23.45 ? 372 HOH B O   1 
HETATM 5950 O O   . HOH F 3 .   ? -4.047  6.972   12.946  1.00 11.72 ? 373 HOH B O   1 
HETATM 5951 O O   . HOH F 3 .   ? -4.787  -4.128  -4.532  1.00 13.10 ? 374 HOH B O   1 
HETATM 5952 O O   . HOH F 3 .   ? 3.757   -6.129  -3.438  1.00 14.51 ? 375 HOH B O   1 
HETATM 5953 O O   . HOH F 3 .   ? -6.367  -11.538 5.798   1.00 15.02 ? 376 HOH B O   1 
HETATM 5954 O O   . HOH F 3 .   ? 13.067  -5.925  11.116  1.00 14.14 ? 377 HOH B O   1 
HETATM 5955 O O   . HOH F 3 .   ? -1.956  -11.978 -4.518  1.00 25.37 ? 378 HOH B O   1 
HETATM 5956 O O   . HOH F 3 .   ? -3.484  -23.078 -1.963  1.00 23.91 ? 379 HOH B O   1 
HETATM 5957 O O   . HOH F 3 .   ? 1.257   -12.139 7.915   1.00 27.92 ? 380 HOH B O   1 
HETATM 5958 O O   . HOH F 3 .   ? 3.666   0.834   5.237   1.00 11.81 ? 381 HOH B O   1 
HETATM 5959 O O   . HOH F 3 .   ? -3.777  8.294   -1.148  1.00 20.79 ? 382 HOH B O   1 
HETATM 5960 O O   . HOH F 3 .   ? -7.314  -6.160  9.715   1.00 17.34 ? 383 HOH B O   1 
HETATM 5961 O O   . HOH F 3 .   ? -10.085 -17.658 20.773  1.00 16.81 ? 384 HOH B O   1 
HETATM 5962 O O   . HOH F 3 .   ? -0.211  -12.583 -8.266  1.00 29.77 ? 385 HOH B O   1 
HETATM 5963 O O   . HOH F 3 .   ? -19.018 -15.592 -1.069  1.00 35.42 ? 386 HOH B O   1 
HETATM 5964 O O   . HOH F 3 .   ? -7.273  -30.261 1.000   1.00 28.67 ? 387 HOH B O   1 
HETATM 5965 O O   . HOH F 3 .   ? -18.556 -14.183 7.792   1.00 21.29 ? 388 HOH B O   1 
HETATM 5966 O O   . HOH F 3 .   ? -21.733 10.595  -8.406  1.00 27.91 ? 389 HOH B O   1 
HETATM 5967 O O   . HOH F 3 .   ? 4.944   -22.831 24.569  1.00 29.78 ? 390 HOH B O   1 
HETATM 5968 O O   . HOH F 3 .   ? -20.456 -25.365 -9.074  1.00 28.92 ? 391 HOH B O   1 
HETATM 5969 O O   . HOH F 3 .   ? -0.650  1.195   -17.848 1.00 26.21 ? 392 HOH B O   1 
HETATM 5970 O O   . HOH F 3 .   ? -24.715 -14.072 -6.327  1.00 22.42 ? 393 HOH B O   1 
HETATM 5971 O O   . HOH F 3 .   ? 10.379  -6.956  -0.076  1.00 31.85 ? 394 HOH B O   1 
HETATM 5972 O O   . HOH F 3 .   ? 5.617   2.544   21.125  1.00 24.07 ? 395 HOH B O   1 
HETATM 5973 O O   . HOH F 3 .   ? -7.093  12.023  -21.339 1.00 35.28 ? 396 HOH B O   1 
HETATM 5974 O O   . HOH F 3 .   ? -10.496 2.721   4.520   1.00 20.69 ? 397 HOH B O   1 
HETATM 5975 O O   . HOH F 3 .   ? -6.228  -6.984  7.705   1.00 23.65 ? 398 HOH B O   1 
HETATM 5976 O O   . HOH F 3 .   ? -7.785  -9.935  -1.480  1.00 26.25 ? 399 HOH B O   1 
HETATM 5977 O O   . HOH F 3 .   ? -17.783 3.782   -17.384 1.00 18.04 ? 400 HOH B O   1 
HETATM 5978 O O   . HOH F 3 .   ? -20.627 1.281   -18.252 1.00 26.09 ? 401 HOH B O   1 
HETATM 5979 O O   . HOH F 3 .   ? -10.712 -2.249  5.984   1.00 26.98 ? 402 HOH B O   1 
HETATM 5980 O O   . HOH F 3 .   ? 6.013   -1.043  0.891   1.00 18.85 ? 403 HOH B O   1 
HETATM 5981 O O   . HOH F 3 .   ? 1.015   3.466   -0.772  1.00 16.85 ? 404 HOH B O   1 
HETATM 5982 O O   . HOH F 3 .   ? 4.555   -4.108  12.986  1.00 20.36 ? 405 HOH B O   1 
HETATM 5983 O O   . HOH F 3 .   ? 3.346   2.711   12.563  1.00 21.54 ? 406 HOH B O   1 
HETATM 5984 O O   . HOH F 3 .   ? -6.771  -14.454 3.574   1.00 16.67 ? 407 HOH B O   1 
HETATM 5985 O O   . HOH F 3 .   ? -23.678 -18.530 7.316   1.00 26.51 ? 408 HOH B O   1 
HETATM 5986 O O   . HOH F 3 .   ? 15.475  3.728   21.538  1.00 33.18 ? 409 HOH B O   1 
HETATM 5987 O O   . HOH F 3 .   ? -16.730 -10.731 7.649   1.00 19.25 ? 410 HOH B O   1 
HETATM 5988 O O   . HOH F 3 .   ? -9.985  -6.286  9.309   1.00 33.42 ? 411 HOH B O   1 
HETATM 5989 O O   . HOH F 3 .   ? -13.399 -19.953 28.009  1.00 24.11 ? 412 HOH B O   1 
HETATM 5990 O O   . HOH F 3 .   ? 6.268   0.927   4.142   1.00 10.73 ? 413 HOH B O   1 
HETATM 5991 O O   . HOH F 3 .   ? -25.389 -12.751 9.800   1.00 23.24 ? 414 HOH B O   1 
HETATM 5992 O O   . HOH F 3 .   ? -0.297  1.084   -0.558  1.00 13.43 ? 415 HOH B O   1 
HETATM 5993 O O   . HOH F 3 .   ? 0.051   -4.050  4.842   1.00 24.69 ? 416 HOH B O   1 
HETATM 5994 O O   . HOH F 3 .   ? -23.114 2.145   -9.092  1.00 25.32 ? 417 HOH B O   1 
HETATM 5995 O O   . HOH F 3 .   ? -19.315 12.658  0.357   1.00 31.84 ? 418 HOH B O   1 
HETATM 5996 O O   . HOH F 3 .   ? -18.505 16.635  -8.743  1.00 31.64 ? 419 HOH B O   1 
HETATM 5997 O O   . HOH F 3 .   ? -4.396  4.742   -25.659 1.00 23.11 ? 420 HOH B O   1 
HETATM 5998 O O   . HOH F 3 .   ? -17.413 -25.786 4.485   1.00 22.24 ? 421 HOH B O   1 
HETATM 5999 O O   . HOH F 3 .   ? -9.623  -16.712 4.202   1.00 29.99 ? 422 HOH B O   1 
HETATM 6000 O O   . HOH F 3 .   ? -24.185 -12.480 -12.887 1.00 21.66 ? 423 HOH B O   1 
HETATM 6001 O O   . HOH F 3 .   ? 2.590   -9.055  -9.904  1.00 25.69 ? 424 HOH B O   1 
HETATM 6002 O O   . HOH F 3 .   ? -16.899 -27.207 19.923  1.00 33.71 ? 425 HOH B O   1 
HETATM 6003 O O   . HOH F 3 .   ? -7.353  -17.388 -19.121 1.00 32.60 ? 426 HOH B O   1 
HETATM 6004 O O   . HOH F 3 .   ? -7.046  8.713   -0.115  1.00 26.32 ? 427 HOH B O   1 
HETATM 6005 O O   . HOH F 3 .   ? -3.005  -19.718 -7.048  1.00 19.01 ? 428 HOH B O   1 
HETATM 6006 O O   . HOH F 3 .   ? -13.165 -7.686  -25.638 1.00 21.49 ? 429 HOH B O   1 
HETATM 6007 O O   . HOH F 3 .   ? -15.212 -27.512 -1.134  1.00 30.94 ? 430 HOH B O   1 
HETATM 6008 O O   . HOH F 3 .   ? -20.103 -13.112 -16.564 1.00 36.03 ? 431 HOH B O   1 
HETATM 6009 O O   . HOH F 3 .   ? 5.831   5.937   -9.020  1.00 30.54 ? 432 HOH B O   1 
HETATM 6010 O O   . HOH F 3 .   ? -1.398  0.570   -10.061 1.00 28.05 ? 433 HOH B O   1 
HETATM 6011 O O   . HOH F 3 .   ? -11.984 -15.906 2.353   1.00 30.61 ? 434 HOH B O   1 
HETATM 6012 O O   . HOH F 3 .   ? -11.415 11.241  14.385  1.00 28.57 ? 435 HOH B O   1 
HETATM 6013 O O   . HOH F 3 .   ? -8.192  4.757   -19.596 1.00 20.54 ? 436 HOH B O   1 
HETATM 6014 O O   . HOH F 3 .   ? 7.125   -29.356 19.780  1.00 26.28 ? 437 HOH B O   1 
HETATM 6015 O O   . HOH F 3 .   ? -2.943  4.976   -20.987 1.00 36.84 ? 438 HOH B O   1 
HETATM 6016 O O   . HOH F 3 .   ? 11.092  -2.701  24.089  1.00 28.50 ? 439 HOH B O   1 
HETATM 6017 O O   . HOH F 3 .   ? -21.474 -18.762 17.248  1.00 34.28 ? 440 HOH B O   1 
HETATM 6018 O O   . HOH F 3 .   ? -23.401 -28.501 19.441  1.00 28.22 ? 441 HOH B O   1 
HETATM 6019 O O   . HOH F 3 .   ? -3.194  -3.324  -25.071 1.00 27.51 ? 442 HOH B O   1 
HETATM 6020 O O   . HOH F 3 .   ? -5.357  -22.331 -7.813  1.00 35.26 ? 443 HOH B O   1 
HETATM 6021 O O   . HOH F 3 .   ? -8.100  -32.179 8.440   1.00 46.79 ? 444 HOH B O   1 
HETATM 6022 O O   . HOH F 3 .   ? -5.980  -13.709 -19.627 1.00 38.88 ? 445 HOH B O   1 
HETATM 6023 O O   . HOH F 3 .   ? -17.554 -30.714 -0.380  1.00 25.60 ? 446 HOH B O   1 
HETATM 6024 O O   . HOH F 3 .   ? -16.020 -3.559  -25.090 1.00 34.54 ? 447 HOH B O   1 
HETATM 6025 O O   . HOH F 3 .   ? -9.994  -8.355  5.189   1.00 41.98 ? 448 HOH B O   1 
HETATM 6026 O O   . HOH F 3 .   ? -26.285 -22.716 -5.877  1.00 31.17 ? 449 HOH B O   1 
HETATM 6027 O O   . HOH F 3 .   ? -8.611  1.469   -19.956 1.00 22.59 ? 450 HOH B O   1 
HETATM 6028 O O   . HOH F 3 .   ? -20.134 -20.888 8.689   1.00 28.35 ? 451 HOH B O   1 
HETATM 6029 O O   . HOH F 3 .   ? 5.041   2.048   -9.643  1.00 40.07 ? 452 HOH B O   1 
HETATM 6030 O O   . HOH F 3 .   ? -16.127 -12.662 23.530  1.00 27.58 ? 453 HOH B O   1 
HETATM 6031 O O   . HOH F 3 .   ? -12.421 -14.878 -17.575 1.00 26.99 ? 454 HOH B O   1 
HETATM 6032 O O   . HOH F 3 .   ? -7.298  -17.532 3.612   1.00 23.38 ? 455 HOH B O   1 
HETATM 6033 O O   . HOH F 3 .   ? -20.085 -2.841  2.011   1.00 59.86 ? 456 HOH B O   1 
HETATM 6034 O O   . HOH F 3 .   ? -20.607 -5.718  -15.846 1.00 43.33 ? 457 HOH B O   1 
HETATM 6035 O O   . HOH F 3 .   ? 13.756  -13.781 16.577  1.00 30.33 ? 458 HOH B O   1 
HETATM 6036 O O   . HOH F 3 .   ? 1.140   -14.016 28.223  1.00 30.93 ? 459 HOH B O   1 
HETATM 6037 O O   . HOH F 3 .   ? 2.217   -2.333  -14.841 1.00 16.89 ? 460 HOH B O   1 
HETATM 6038 O O   . HOH F 3 .   ? -12.817 -31.413 -6.706  1.00 29.42 ? 461 HOH B O   1 
HETATM 6039 O O   . HOH F 3 .   ? -19.743 -9.608  18.183  1.00 36.54 ? 462 HOH B O   1 
HETATM 6040 O O   . HOH F 3 .   ? -9.741  12.755  11.524  1.00 50.95 ? 463 HOH B O   1 
HETATM 6041 O O   . HOH F 3 .   ? 10.380  -11.693 4.122   1.00 37.02 ? 464 HOH B O   1 
HETATM 6042 O O   . HOH F 3 .   ? -1.469  -0.389  -21.863 1.00 25.15 ? 465 HOH B O   1 
HETATM 6043 O O   . HOH F 3 .   ? -16.143 8.199   14.225  1.00 40.59 ? 466 HOH B O   1 
HETATM 6044 O O   . HOH F 3 .   ? -3.080  16.054  -10.197 1.00 61.16 ? 467 HOH B O   1 
HETATM 6045 O O   . HOH F 3 .   ? -0.601  -9.964  -16.029 1.00 37.87 ? 468 HOH B O   1 
HETATM 6046 O O   . HOH F 3 .   ? -18.327 -14.727 23.690  1.00 32.84 ? 469 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  PRO 22  22  22  PRO PRO A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  MET 40  40  40  MET MET A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  TRP 43  43  43  TRP TRP A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  PHE 56  56  56  PHE PHE A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  HIS 62  62  62  HIS HIS A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  MET 78  78  78  MET MET A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLN 86  86  86  GLN GLN A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 MET 105 105 105 MET MET A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 CYS 108 108 108 CYS CYS A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 CYS 120 120 120 CYS CYS A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 TRP 131 131 131 TRP TRP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 GLN 157 157 157 GLN GLN A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 PHE 164 164 164 PHE PHE A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 ARG 192 192 192 ARG ARG A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 TYR 201 201 201 TYR TYR A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 GLN 215 215 215 GLN GLN A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 CYS 222 222 222 CYS CYS A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 TRP 227 227 227 TRP TRP A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 PRO 231 231 231 PRO PRO A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 HIS 233 233 233 HIS HIS A . n 
A 1 234 GLN 234 234 234 GLN GLN A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 MET 241 241 241 MET MET A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 PHE 244 244 244 PHE PHE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 TYR 246 246 246 TYR TYR A . n 
A 1 247 TRP 247 247 247 TRP TRP A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 HIS 249 249 249 HIS HIS A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 ASP 251 251 251 ASP ASP A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 GLU 255 255 255 GLU GLU A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 PRO 259 259 259 PRO PRO A . n 
A 1 260 PRO 260 260 260 PRO PRO A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 ASN 262 262 262 ASN ASN A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 PRO 267 267 267 PRO PRO A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 ARG 271 271 271 ARG ARG A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 SER 273 273 273 SER SER A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 MET 277 277 277 MET MET A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 TRP 281 281 281 TRP TRP A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 VAL 286 286 286 VAL VAL A . n 
A 1 287 VAL 287 287 287 VAL VAL A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 MET 293 293 293 MET MET A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 GLY 303 303 303 GLY GLY A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 VAL 305 305 305 VAL VAL A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 GLU 307 307 307 GLU GLU A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 PHE 309 309 309 PHE PHE A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 CYS 315 315 315 CYS CYS A . n 
A 1 316 GLN 316 316 316 GLN GLN A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 CYS 318 318 318 CYS CYS A . n 
A 1 319 PRO 319 319 319 PRO PRO A . n 
A 1 320 VAL 320 320 320 VAL VAL A . n 
A 1 321 HIS 321 321 321 HIS HIS A . n 
A 1 322 ARG 322 322 322 ARG ARG A . n 
A 1 323 ILE 323 323 323 ILE ILE A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 TYR 325 325 325 TYR TYR A . n 
A 1 326 LYS 326 326 326 LYS LYS A . n 
A 1 327 ASP 327 327 327 ASP ASP A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 ASN 329 329 329 ASN ASN A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 HIS 331 331 331 HIS HIS A . n 
A 1 332 ILE 332 332 332 ILE ILE A . n 
A 1 333 PRO 333 333 333 PRO PRO A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 MET 335 335 335 MET MET A . n 
A 1 336 GLU 336 336 336 GLU GLU A . n 
A 1 337 ASN 337 337 337 ASN ASN A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 ILE 342 342 342 ILE ILE A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 ARG 344 344 344 ARG ARG A . n 
A 1 345 PHE 345 345 345 PHE PHE A . n 
A 1 346 GLN 346 346 346 GLN GLN A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 ILE 352 352 352 ILE ILE A . n 
A 1 353 GLN 353 353 353 GLN GLN A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 ALA 358 358 358 ALA ALA A . n 
A 1 359 HIS 359 359 359 HIS HIS A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 TRP 361 361 361 TRP TRP A . n 
A 1 362 MET 362 362 362 MET MET A . n 
A 1 363 PHE 363 363 363 PHE PHE A . n 
A 1 364 PRO 364 364 364 PRO PRO A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
B 1 1   ALA 1   1   1   ALA ALA B . n 
B 1 2   SER 2   2   2   SER SER B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   PHE 5   5   5   PHE PHE B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   ALA 7   7   7   ALA ALA B . n 
B 1 8   ALA 8   8   8   ALA ALA B . n 
B 1 9   ASP 9   9   9   ASP ASP B . n 
B 1 10  LEU 10  10  10  LEU LEU B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  GLU 13  13  13  GLU GLU B . n 
B 1 14  MET 14  14  14  MET MET B . n 
B 1 15  THR 15  15  15  THR THR B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  PRO 18  18  18  PRO PRO B . n 
B 1 19  HIS 19  19  19  HIS HIS B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  LYS 21  21  21  LYS LYS B . n 
B 1 22  PRO 22  22  22  PRO PRO B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  PRO 27  27  27  PRO PRO B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  PHE 30  30  30  PHE PHE B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  PHE 34  34  34  PHE PHE B . n 
B 1 35  THR 35  35  35  THR THR B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  HIS 37  37  37  HIS HIS B . n 
B 1 38  MET 38  38  38  MET MET B . n 
B 1 39  LEU 39  39  39  LEU LEU B . n 
B 1 40  MET 40  40  40  MET MET B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  TRP 43  43  43  TRP TRP B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  ASP 45  45  45  ASP ASP B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  TRP 48  48  48  TRP TRP B . n 
B 1 49  GLY 49  49  49  GLY GLY B . n 
B 1 50  GLN 50  50  50  GLN GLN B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  ARG 52  52  52  ARG ARG B . n 
B 1 53  ILE 53  53  53  ILE ILE B . n 
B 1 54  GLN 54  54  54  GLN GLN B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  PHE 56  56  56  PHE PHE B . n 
B 1 57  GLN 57  57  57  GLN GLN B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  LEU 59  59  59  LEU LEU B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  LEU 61  61  61  LEU LEU B . n 
B 1 62  HIS 62  62  62  HIS HIS B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  SER 65  65  65  SER SER B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  SER 67  67  67  SER SER B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  GLN 73  73  73  GLN GLN B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  GLU 76  76  76  GLU GLU B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  MET 78  78  78  MET MET B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  ALA 80  80  80  ALA ALA B . n 
B 1 81  PHE 81  81  81  PHE PHE B . n 
B 1 82  LYS 82  82  82  LYS LYS B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  GLN 86  86  86  GLN GLN B . n 
B 1 87  GLN 87  87  87  GLN GLN B . n 
B 1 88  VAL 88  88  88  VAL VAL B . n 
B 1 89  ARG 89  89  89  ARG ARG B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  PHE 91  91  91  PHE PHE B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  TRP 94  94  94  TRP TRP B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  ASN 96  96  96  ASN ASN B . n 
B 1 97  MET 97  97  97  MET MET B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 MET 100 100 100 MET MET B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 ARG 102 102 102 ARG ARG B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 MET 105 105 105 MET MET B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 CYS 108 108 108 CYS CYS B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 PRO 110 110 110 PRO PRO B . n 
B 1 111 SER 111 111 111 SER SER B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 LYS 114 114 114 LYS LYS B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 GLU 119 119 119 GLU GLU B . n 
B 1 120 CYS 120 120 120 CYS CYS B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 ARG 122 122 122 ARG ARG B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 ILE 125 125 125 ILE ILE B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 TRP 131 131 131 TRP TRP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 PRO 133 133 133 PRO PRO B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 GLY 137 137 137 GLY GLY B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 SER 139 139 139 SER SER B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 TYR 141 141 141 TYR TYR B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 ARG 143 143 143 ARG ARG B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 GLY 148 148 148 GLY GLY B . n 
B 1 149 ASN 149 149 149 ASN ASN B . n 
B 1 150 GLU 150 150 150 GLU GLU B . n 
B 1 151 PRO 151 151 151 PRO PRO B . n 
B 1 152 SER 152 152 152 SER SER B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 VAL 155 155 155 VAL VAL B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 GLN 157 157 157 GLN GLN B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 ARG 159 159 159 ARG ARG B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 ALA 161 161 161 ALA ALA B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 PHE 164 164 164 PHE PHE B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 LEU 167 167 167 LEU LEU B . n 
B 1 168 CYS 168 168 168 CYS CYS B . n 
B 1 169 PRO 169 169 169 PRO PRO B . n 
B 1 170 VAL 170 170 170 VAL VAL B . n 
B 1 171 GLY 171 171 171 GLY GLY B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 PHE 174 174 174 PHE PHE B . n 
B 1 175 PRO 175 175 175 PRO PRO B . n 
B 1 176 GLY 176 176 176 GLY GLY B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 SER 178 178 178 SER SER B . n 
B 1 179 VAL 179 179 179 VAL VAL B . n 
B 1 180 THR 180 180 180 THR THR B . n 
B 1 181 PRO 181 181 181 PRO PRO B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 SER 183 183 183 SER SER B . n 
B 1 184 LEU 184 184 184 LEU LEU B . n 
B 1 185 LEU 185 185 185 LEU LEU B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 ASP 187 187 187 ASP ASP B . n 
B 1 188 PRO 188 188 188 PRO PRO B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 ILE 191 191 191 ILE ILE B . n 
B 1 192 ARG 192 192 192 ARG ARG B . n 
B 1 193 ALA 193 193 193 ALA ALA B . n 
B 1 194 TRP 194 194 194 TRP TRP B . n 
B 1 195 VAL 195 195 195 VAL VAL B . n 
B 1 196 GLY 196 196 196 GLY GLY B . n 
B 1 197 GLY 197 197 197 GLY GLY B . n 
B 1 198 VAL 198 198 198 VAL VAL B . n 
B 1 199 GLY 199 199 199 GLY GLY B . n 
B 1 200 ASN 200 200 200 ASN ASN B . n 
B 1 201 TYR 201 201 201 TYR TYR B . n 
B 1 202 LYS 202 202 202 LYS LYS B . n 
B 1 203 LEU 203 203 203 LEU LEU B . n 
B 1 204 GLY 204 204 204 GLY GLY B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ASN 206 206 206 ASN ASN B . n 
B 1 207 TYR 207 207 207 TYR TYR B . n 
B 1 208 GLY 208 208 208 GLY GLY B . n 
B 1 209 PRO 209 209 209 PRO PRO B . n 
B 1 210 THR 210 210 210 THR THR B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 GLN 214 214 214 GLN GLN B . n 
B 1 215 GLN 215 215 215 GLN GLN B . n 
B 1 216 GLU 216 216 216 GLU GLU B . n 
B 1 217 ALA 217 217 217 ALA ALA B . n 
B 1 218 LEU 218 218 218 LEU LEU B . n 
B 1 219 LYS 219 219 219 LYS LYS B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 GLY 221 221 221 GLY GLY B . n 
B 1 222 CYS 222 222 222 CYS CYS B . n 
B 1 223 GLU 223 223 223 GLU GLU B . n 
B 1 224 GLN 224 224 224 GLN GLN B . n 
B 1 225 VAL 225 225 225 VAL VAL B . n 
B 1 226 LEU 226 226 226 LEU LEU B . n 
B 1 227 TRP 227 227 227 TRP TRP B . n 
B 1 228 LEU 228 228 228 LEU LEU B . n 
B 1 229 TYR 229 229 229 TYR TYR B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 PRO 231 231 231 PRO PRO B . n 
B 1 232 ASP 232 232 232 ASP ASP B . n 
B 1 233 HIS 233 233 233 HIS HIS B . n 
B 1 234 GLN 234 234 234 GLN GLN B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 THR 236 236 236 THR THR B . n 
B 1 237 GLU 237 237 237 GLU GLU B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 GLY 239 239 239 GLY GLY B . n 
B 1 240 THR 240 240 240 THR THR B . n 
B 1 241 MET 241 241 241 MET MET B . n 
B 1 242 ASN 242 242 242 ASN ASN B . n 
B 1 243 ILE 243 243 243 ILE ILE B . n 
B 1 244 PHE 244 244 244 PHE PHE B . n 
B 1 245 VAL 245 245 245 VAL VAL B . n 
B 1 246 TYR 246 246 246 TYR TYR B . n 
B 1 247 TRP 247 247 247 TRP TRP B . n 
B 1 248 THR 248 248 248 THR THR B . n 
B 1 249 HIS 249 249 249 HIS HIS B . n 
B 1 250 GLU 250 250 250 GLU GLU B . n 
B 1 251 ASP 251 251 251 ASP ASP B . n 
B 1 252 GLY 252 252 252 GLY GLY B . n 
B 1 253 VAL 253 253 253 VAL VAL B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 GLU 255 255 255 GLU GLU B . n 
B 1 256 LEU 256 256 256 LEU LEU B . n 
B 1 257 VAL 257 257 257 VAL VAL B . n 
B 1 258 THR 258 258 258 THR THR B . n 
B 1 259 PRO 259 259 259 PRO PRO B . n 
B 1 260 PRO 260 260 260 PRO PRO B . n 
B 1 261 LEU 261 261 261 LEU LEU B . n 
B 1 262 ASN 262 262 262 ASN ASN B . n 
B 1 263 GLY 263 263 263 GLY GLY B . n 
B 1 264 VAL 264 264 264 VAL VAL B . n 
B 1 265 ILE 265 265 265 ILE ILE B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 PRO 267 267 267 PRO PRO B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 VAL 269 269 269 VAL VAL B . n 
B 1 270 VAL 270 270 270 VAL VAL B . n 
B 1 271 ARG 271 271 271 ARG ARG B . n 
B 1 272 GLN 272 272 272 GLN GLN B . n 
B 1 273 SER 273 273 273 SER SER B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 LEU 275 275 275 LEU LEU B . n 
B 1 276 ASP 276 276 276 ASP ASP B . n 
B 1 277 MET 277 277 277 MET MET B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 THR 280 280 280 THR THR B . n 
B 1 281 TRP 281 281 281 TRP TRP B . n 
B 1 282 GLY 282 282 282 GLY GLY B . n 
B 1 283 GLU 283 283 283 GLU GLU B . n 
B 1 284 PHE 284 284 284 PHE PHE B . n 
B 1 285 ARG 285 285 285 ARG ARG B . n 
B 1 286 VAL 286 286 286 VAL VAL B . n 
B 1 287 VAL 287 287 287 VAL VAL B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 ARG 289 289 289 ARG ARG B . n 
B 1 290 THR 290 290 290 THR THR B . n 
B 1 291 ILE 291 291 291 ILE ILE B . n 
B 1 292 THR 292 292 292 THR THR B . n 
B 1 293 MET 293 293 293 MET MET B . n 
B 1 294 LYS 294 294 294 LYS LYS B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 LEU 296 296 296 LEU LEU B . n 
B 1 297 LEU 297 297 297 LEU LEU B . n 
B 1 298 ARG 298 298 298 ARG ARG B . n 
B 1 299 ALA 299 299 299 ALA ALA B . n 
B 1 300 LEU 300 300 300 LEU LEU B . n 
B 1 301 GLU 301 301 301 GLU GLU B . n 
B 1 302 GLU 302 302 302 GLU GLU B . n 
B 1 303 GLY 303 303 303 GLY GLY B . n 
B 1 304 ARG 304 304 304 ARG ARG B . n 
B 1 305 VAL 305 305 305 VAL VAL B . n 
B 1 306 ARG 306 306 306 ARG ARG B . n 
B 1 307 GLU 307 307 307 GLU GLU B . n 
B 1 308 VAL 308 308 308 VAL VAL B . n 
B 1 309 PHE 309 309 309 PHE PHE B . n 
B 1 310 GLY 310 310 310 GLY GLY B . n 
B 1 311 SER 311 311 311 SER SER B . n 
B 1 312 GLY 312 312 312 GLY GLY B . n 
B 1 313 THR 313 313 313 THR THR B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 CYS 315 315 315 CYS CYS B . n 
B 1 316 GLN 316 316 316 GLN GLN B . n 
B 1 317 VAL 317 317 317 VAL VAL B . n 
B 1 318 CYS 318 318 318 CYS CYS B . n 
B 1 319 PRO 319 319 319 PRO PRO B . n 
B 1 320 VAL 320 320 320 VAL VAL B . n 
B 1 321 HIS 321 321 321 HIS HIS B . n 
B 1 322 ARG 322 322 322 ARG ARG B . n 
B 1 323 ILE 323 323 323 ILE ILE B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 TYR 325 325 325 TYR TYR B . n 
B 1 326 LYS 326 326 326 LYS LYS B . n 
B 1 327 ASP 327 327 327 ASP ASP B . n 
B 1 328 ARG 328 328 328 ARG ARG B . n 
B 1 329 ASN 329 329 329 ASN ASN B . n 
B 1 330 LEU 330 330 330 LEU LEU B . n 
B 1 331 HIS 331 331 331 HIS HIS B . n 
B 1 332 ILE 332 332 332 ILE ILE B . n 
B 1 333 PRO 333 333 333 PRO PRO B . n 
B 1 334 THR 334 334 334 THR THR B . n 
B 1 335 MET 335 335 335 MET MET B . n 
B 1 336 GLU 336 336 336 GLU GLU B . n 
B 1 337 ASN 337 337 337 ASN ASN B . n 
B 1 338 GLY 338 338 338 GLY GLY B . n 
B 1 339 PRO 339 339 339 PRO PRO B . n 
B 1 340 GLU 340 340 340 GLU GLU B . n 
B 1 341 LEU 341 341 341 LEU LEU B . n 
B 1 342 ILE 342 342 342 ILE ILE B . n 
B 1 343 LEU 343 343 343 LEU LEU B . n 
B 1 344 ARG 344 344 344 ARG ARG B . n 
B 1 345 PHE 345 345 345 PHE PHE B . n 
B 1 346 GLN 346 346 346 GLN GLN B . n 
B 1 347 LYS 347 347 347 LYS LYS B . n 
B 1 348 GLU 348 348 348 GLU GLU B . n 
B 1 349 LEU 349 349 349 LEU LEU B . n 
B 1 350 LYS 350 350 350 LYS LYS B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 ILE 352 352 352 ILE ILE B . n 
B 1 353 GLN 353 353 353 GLN GLN B . n 
B 1 354 TYR 354 354 354 TYR TYR B . n 
B 1 355 GLY 355 355 355 GLY GLY B . n 
B 1 356 ILE 356 356 356 ILE ILE B . n 
B 1 357 ARG 357 357 357 ARG ARG B . n 
B 1 358 ALA 358 358 358 ALA ALA B . n 
B 1 359 HIS 359 359 359 HIS HIS B . n 
B 1 360 GLU 360 360 360 GLU GLU B . n 
B 1 361 TRP 361 361 361 TRP TRP B . n 
B 1 362 MET 362 362 362 MET MET B . n 
B 1 363 PHE 363 363 363 PHE PHE B . n 
B 1 364 PRO 364 364 364 PRO PRO B . n 
B 1 365 VAL 365 365 365 VAL VAL B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5810  ? 
1 MORE         -31   ? 
1 'SSA (A^2)'  28000 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-03-09 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       0.9 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A ILE 332 ? ? N A PRO 333 ? ? CA A PRO 333 ? ? 128.83 119.30 9.53 1.50 Y 
2 1 C B ILE 332 ? ? N B PRO 333 ? ? CA B PRO 333 ? ? 128.90 119.30 9.60 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 2   ? ? 46.34   -81.30  
2  1 SER A 3   ? ? -57.04  -4.52   
3  1 LYS A 17  ? ? 159.97  73.70   
4  1 PRO A 27  ? ? -43.43  -94.09  
5  1 LEU A 28  ? ? 97.41   69.51   
6  1 PHE A 30  ? ? -14.00  -94.86  
7  1 LYS A 46  ? ? -67.84  -86.61  
8  1 ASP A 85  ? ? -69.98  14.36   
9  1 GLN A 86  ? ? 76.92   -1.63   
10 1 ALA A 135 ? ? -75.22  -128.13 
11 1 SER A 139 ? ? -171.44 -178.76 
12 1 ASN A 149 ? ? -145.43 42.50   
13 1 TYR A 173 ? ? -62.92  -166.40 
14 1 PHE A 174 ? ? 16.45   -107.15 
15 1 THR A 236 ? ? -120.17 -58.34  
16 1 PRO A 267 ? ? -66.58  86.94   
17 1 GLN A 316 ? ? -27.30  -67.27  
18 1 PRO A 333 ? ? -63.06  11.38   
19 1 SER B 4   ? ? -56.16  174.36  
20 1 ASN B 44  ? ? -160.18 -134.10 
21 1 ASP B 128 ? ? -98.83  31.28   
22 1 ALA B 135 ? ? -62.61  -125.34 
23 1 SER B 139 ? ? -171.24 -179.09 
24 1 ASN B 149 ? ? -144.09 44.64   
25 1 THR B 236 ? ? -120.49 -58.66  
26 1 HIS B 249 ? ? -58.40  173.70  
27 1 PRO B 267 ? ? -67.13  85.97   
28 1 GLN B 316 ? ? -28.15  -65.40  
29 1 PRO B 333 ? ? -61.91  12.37   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "PYRIDOXAL-5'-PHOSPHATE" PLP 
3 water                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PLP 1  370 370 PLP PLP A . 
D 2 PLP 1  370 370 PLP PLP B . 
E 3 HOH 1  371 2   HOH HOH A . 
E 3 HOH 2  372 6   HOH HOH A . 
E 3 HOH 3  373 8   HOH HOH A . 
E 3 HOH 4  374 9   HOH HOH A . 
E 3 HOH 5  375 13  HOH HOH A . 
E 3 HOH 6  376 15  HOH HOH A . 
E 3 HOH 7  377 16  HOH HOH A . 
E 3 HOH 8  378 18  HOH HOH A . 
E 3 HOH 9  379 19  HOH HOH A . 
E 3 HOH 10 380 20  HOH HOH A . 
E 3 HOH 11 381 21  HOH HOH A . 
E 3 HOH 12 382 23  HOH HOH A . 
E 3 HOH 13 383 24  HOH HOH A . 
E 3 HOH 14 384 25  HOH HOH A . 
E 3 HOH 15 385 26  HOH HOH A . 
E 3 HOH 16 386 27  HOH HOH A . 
E 3 HOH 17 387 29  HOH HOH A . 
E 3 HOH 18 388 30  HOH HOH A . 
E 3 HOH 19 389 33  HOH HOH A . 
E 3 HOH 20 390 41  HOH HOH A . 
E 3 HOH 21 391 42  HOH HOH A . 
E 3 HOH 22 392 43  HOH HOH A . 
E 3 HOH 23 393 45  HOH HOH A . 
E 3 HOH 24 394 46  HOH HOH A . 
E 3 HOH 25 395 47  HOH HOH A . 
E 3 HOH 26 396 49  HOH HOH A . 
E 3 HOH 27 397 51  HOH HOH A . 
E 3 HOH 28 398 53  HOH HOH A . 
E 3 HOH 29 399 54  HOH HOH A . 
E 3 HOH 30 400 55  HOH HOH A . 
E 3 HOH 31 401 57  HOH HOH A . 
E 3 HOH 32 402 58  HOH HOH A . 
E 3 HOH 33 403 60  HOH HOH A . 
E 3 HOH 34 404 63  HOH HOH A . 
E 3 HOH 35 405 73  HOH HOH A . 
E 3 HOH 36 406 74  HOH HOH A . 
E 3 HOH 37 407 75  HOH HOH A . 
E 3 HOH 38 408 76  HOH HOH A . 
E 3 HOH 39 409 78  HOH HOH A . 
E 3 HOH 40 410 85  HOH HOH A . 
E 3 HOH 41 411 87  HOH HOH A . 
E 3 HOH 42 412 88  HOH HOH A . 
E 3 HOH 43 413 89  HOH HOH A . 
E 3 HOH 44 414 90  HOH HOH A . 
E 3 HOH 45 415 91  HOH HOH A . 
E 3 HOH 46 416 92  HOH HOH A . 
E 3 HOH 47 417 93  HOH HOH A . 
E 3 HOH 48 418 97  HOH HOH A . 
E 3 HOH 49 419 98  HOH HOH A . 
E 3 HOH 50 420 99  HOH HOH A . 
E 3 HOH 51 421 101 HOH HOH A . 
E 3 HOH 52 422 104 HOH HOH A . 
E 3 HOH 53 423 105 HOH HOH A . 
E 3 HOH 54 424 110 HOH HOH A . 
E 3 HOH 55 425 111 HOH HOH A . 
E 3 HOH 56 426 112 HOH HOH A . 
E 3 HOH 57 427 113 HOH HOH A . 
E 3 HOH 58 428 114 HOH HOH A . 
E 3 HOH 59 429 115 HOH HOH A . 
E 3 HOH 60 430 118 HOH HOH A . 
E 3 HOH 61 431 121 HOH HOH A . 
E 3 HOH 62 432 123 HOH HOH A . 
E 3 HOH 63 433 124 HOH HOH A . 
E 3 HOH 64 434 128 HOH HOH A . 
E 3 HOH 65 435 129 HOH HOH A . 
E 3 HOH 66 436 130 HOH HOH A . 
E 3 HOH 67 437 131 HOH HOH A . 
E 3 HOH 68 438 134 HOH HOH A . 
E 3 HOH 69 439 137 HOH HOH A . 
E 3 HOH 70 440 138 HOH HOH A . 
E 3 HOH 71 441 140 HOH HOH A . 
E 3 HOH 72 442 141 HOH HOH A . 
E 3 HOH 73 443 142 HOH HOH A . 
E 3 HOH 74 444 147 HOH HOH A . 
E 3 HOH 75 445 149 HOH HOH A . 
E 3 HOH 76 446 150 HOH HOH A . 
E 3 HOH 77 447 152 HOH HOH A . 
E 3 HOH 78 448 153 HOH HOH A . 
E 3 HOH 79 449 160 HOH HOH A . 
E 3 HOH 80 450 162 HOH HOH A . 
E 3 HOH 81 451 164 HOH HOH A . 
E 3 HOH 82 452 165 HOH HOH A . 
E 3 HOH 83 453 166 HOH HOH A . 
E 3 HOH 84 454 170 HOH HOH A . 
E 3 HOH 85 455 171 HOH HOH A . 
E 3 HOH 86 456 172 HOH HOH A . 
E 3 HOH 87 457 173 HOH HOH A . 
E 3 HOH 88 458 176 HOH HOH A . 
E 3 HOH 89 459 180 HOH HOH A . 
E 3 HOH 90 460 181 HOH HOH A . 
E 3 HOH 91 461 184 HOH HOH A . 
E 3 HOH 92 462 185 HOH HOH A . 
E 3 HOH 93 463 187 HOH HOH A . 
E 3 HOH 94 464 188 HOH HOH A . 
E 3 HOH 95 465 192 HOH HOH A . 
E 3 HOH 96 466 194 HOH HOH A . 
E 3 HOH 97 467 195 HOH HOH A . 
F 3 HOH 1  371 1   HOH HOH B . 
F 3 HOH 2  372 3   HOH HOH B . 
F 3 HOH 3  373 4   HOH HOH B . 
F 3 HOH 4  374 5   HOH HOH B . 
F 3 HOH 5  375 7   HOH HOH B . 
F 3 HOH 6  376 10  HOH HOH B . 
F 3 HOH 7  377 11  HOH HOH B . 
F 3 HOH 8  378 12  HOH HOH B . 
F 3 HOH 9  379 14  HOH HOH B . 
F 3 HOH 10 380 17  HOH HOH B . 
F 3 HOH 11 381 22  HOH HOH B . 
F 3 HOH 12 382 28  HOH HOH B . 
F 3 HOH 13 383 31  HOH HOH B . 
F 3 HOH 14 384 32  HOH HOH B . 
F 3 HOH 15 385 34  HOH HOH B . 
F 3 HOH 16 386 35  HOH HOH B . 
F 3 HOH 17 387 36  HOH HOH B . 
F 3 HOH 18 388 37  HOH HOH B . 
F 3 HOH 19 389 38  HOH HOH B . 
F 3 HOH 20 390 39  HOH HOH B . 
F 3 HOH 21 391 40  HOH HOH B . 
F 3 HOH 22 392 44  HOH HOH B . 
F 3 HOH 23 393 48  HOH HOH B . 
F 3 HOH 24 394 50  HOH HOH B . 
F 3 HOH 25 395 52  HOH HOH B . 
F 3 HOH 26 396 56  HOH HOH B . 
F 3 HOH 27 397 59  HOH HOH B . 
F 3 HOH 28 398 61  HOH HOH B . 
F 3 HOH 29 399 62  HOH HOH B . 
F 3 HOH 30 400 64  HOH HOH B . 
F 3 HOH 31 401 65  HOH HOH B . 
F 3 HOH 32 402 66  HOH HOH B . 
F 3 HOH 33 403 67  HOH HOH B . 
F 3 HOH 34 404 68  HOH HOH B . 
F 3 HOH 35 405 69  HOH HOH B . 
F 3 HOH 36 406 70  HOH HOH B . 
F 3 HOH 37 407 71  HOH HOH B . 
F 3 HOH 38 408 72  HOH HOH B . 
F 3 HOH 39 409 77  HOH HOH B . 
F 3 HOH 40 410 79  HOH HOH B . 
F 3 HOH 41 411 80  HOH HOH B . 
F 3 HOH 42 412 81  HOH HOH B . 
F 3 HOH 43 413 82  HOH HOH B . 
F 3 HOH 44 414 83  HOH HOH B . 
F 3 HOH 45 415 84  HOH HOH B . 
F 3 HOH 46 416 86  HOH HOH B . 
F 3 HOH 47 417 94  HOH HOH B . 
F 3 HOH 48 418 95  HOH HOH B . 
F 3 HOH 49 419 96  HOH HOH B . 
F 3 HOH 50 420 100 HOH HOH B . 
F 3 HOH 51 421 102 HOH HOH B . 
F 3 HOH 52 422 103 HOH HOH B . 
F 3 HOH 53 423 106 HOH HOH B . 
F 3 HOH 54 424 107 HOH HOH B . 
F 3 HOH 55 425 108 HOH HOH B . 
F 3 HOH 56 426 109 HOH HOH B . 
F 3 HOH 57 427 116 HOH HOH B . 
F 3 HOH 58 428 117 HOH HOH B . 
F 3 HOH 59 429 119 HOH HOH B . 
F 3 HOH 60 430 120 HOH HOH B . 
F 3 HOH 61 431 122 HOH HOH B . 
F 3 HOH 62 432 125 HOH HOH B . 
F 3 HOH 63 433 126 HOH HOH B . 
F 3 HOH 64 434 127 HOH HOH B . 
F 3 HOH 65 435 132 HOH HOH B . 
F 3 HOH 66 436 133 HOH HOH B . 
F 3 HOH 67 437 135 HOH HOH B . 
F 3 HOH 68 438 136 HOH HOH B . 
F 3 HOH 69 439 139 HOH HOH B . 
F 3 HOH 70 440 143 HOH HOH B . 
F 3 HOH 71 441 144 HOH HOH B . 
F 3 HOH 72 442 145 HOH HOH B . 
F 3 HOH 73 443 146 HOH HOH B . 
F 3 HOH 74 444 148 HOH HOH B . 
F 3 HOH 75 445 151 HOH HOH B . 
F 3 HOH 76 446 154 HOH HOH B . 
F 3 HOH 77 447 155 HOH HOH B . 
F 3 HOH 78 448 156 HOH HOH B . 
F 3 HOH 79 449 157 HOH HOH B . 
F 3 HOH 80 450 158 HOH HOH B . 
F 3 HOH 81 451 159 HOH HOH B . 
F 3 HOH 82 452 161 HOH HOH B . 
F 3 HOH 83 453 163 HOH HOH B . 
F 3 HOH 84 454 167 HOH HOH B . 
F 3 HOH 85 455 168 HOH HOH B . 
F 3 HOH 86 456 169 HOH HOH B . 
F 3 HOH 87 457 174 HOH HOH B . 
F 3 HOH 88 458 175 HOH HOH B . 
F 3 HOH 89 459 177 HOH HOH B . 
F 3 HOH 90 460 178 HOH HOH B . 
F 3 HOH 91 461 179 HOH HOH B . 
F 3 HOH 92 462 182 HOH HOH B . 
F 3 HOH 93 463 183 HOH HOH B . 
F 3 HOH 94 464 186 HOH HOH B . 
F 3 HOH 95 465 189 HOH HOH B . 
F 3 HOH 96 466 190 HOH HOH B . 
F 3 HOH 97 467 191 HOH HOH B . 
F 3 HOH 98 468 193 HOH HOH B . 
F 3 HOH 99 469 196 HOH HOH B . 
#