data_1EKV
# 
_entry.id   1EKV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EKV         
RCSB  RCSB010687   
WWPDB D_1000010687 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EKF '1EKF CONTAINS THE SAME PROTEIN IN ORTHORHOMBIC FORM COMPLEXED WITH PYRIDOXAL PHOSPHATE.' unspecified 
PDB 1EKP '1EKP CONTAINS THE SAME PROTEIN IN MONOCLINIC FORM COMPLEXED WITH PYRIDOXAL PHOSPHATE.'   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EKV 
_pdbx_database_status.recvd_initial_deposition_date   2000-03-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yennawar, N.H.' 1 
'Dunbar, J.H.'   2 
'Conway, M.'     3 
'Hutson, S.M.'   4 
'Farber, G.K.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The structure of human mitochondrial branched-chain aminotransferase.'                    'Acta Crystallogr.,Sect.D' 57   
506 515 2001 ABCRE6 DK 0907-4449 0766 ? 11264579 10.1107/S0907444901001925       
1       'Cloning of the Rat and Human Mitochondrial Branched Amino Acid Aminotransferase (BCATm).' BIOCHIM.BIOPHYS.ACTA       1339 
9   13  1997 BBACAQ NE 0006-3002 0113 ? ?        '10.1016/S0167-4838(97)00044-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yennawar, N.'  1 
primary 'Dunbar, J.'    2 
primary 'Conway, M.'    3 
primary 'Hutson, S.'    4 
primary 'Farber, G.'    5 
1       'Bledsoe, R.K.' 6 
1       'Dawson, P.A.'  7 
1       'Hutson, S.M.'  8 
# 
_cell.entry_id           1EKV 
_cell.length_a           83.740 
_cell.length_b           83.740 
_cell.length_c           104.810 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EKV 
_symmetry.space_group_name_H-M             'P 32' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                145 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL)' 41368.016 2   2.6.1.42 ? ? ? 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"                                     247.142   2   ?        ? ? ? 
3 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL                     122.143   2   ?        ? ? ? 
4 water       nat water                                                        18.015    212 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BCAT(M)' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKA
FKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRR
ALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGT
MNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPV
HRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKA
FKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRR
ALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGT
MNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPV
HRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   SER n 
1 4   SER n 
1 5   PHE n 
1 6   LYS n 
1 7   ALA n 
1 8   ALA n 
1 9   ASP n 
1 10  LEU n 
1 11  GLN n 
1 12  LEU n 
1 13  GLU n 
1 14  MET n 
1 15  THR n 
1 16  GLN n 
1 17  LYS n 
1 18  PRO n 
1 19  HIS n 
1 20  LYS n 
1 21  LYS n 
1 22  PRO n 
1 23  GLY n 
1 24  PRO n 
1 25  GLY n 
1 26  GLU n 
1 27  PRO n 
1 28  LEU n 
1 29  VAL n 
1 30  PHE n 
1 31  GLY n 
1 32  LYS n 
1 33  THR n 
1 34  PHE n 
1 35  THR n 
1 36  ASP n 
1 37  HIS n 
1 38  MET n 
1 39  LEU n 
1 40  MET n 
1 41  VAL n 
1 42  GLU n 
1 43  TRP n 
1 44  ASN n 
1 45  ASP n 
1 46  LYS n 
1 47  GLY n 
1 48  TRP n 
1 49  GLY n 
1 50  GLN n 
1 51  PRO n 
1 52  ARG n 
1 53  ILE n 
1 54  GLN n 
1 55  PRO n 
1 56  PHE n 
1 57  GLN n 
1 58  ASN n 
1 59  LEU n 
1 60  THR n 
1 61  LEU n 
1 62  HIS n 
1 63  PRO n 
1 64  ALA n 
1 65  SER n 
1 66  SER n 
1 67  SER n 
1 68  LEU n 
1 69  HIS n 
1 70  TYR n 
1 71  SER n 
1 72  LEU n 
1 73  GLN n 
1 74  LEU n 
1 75  PHE n 
1 76  GLU n 
1 77  GLY n 
1 78  MET n 
1 79  LYS n 
1 80  ALA n 
1 81  PHE n 
1 82  LYS n 
1 83  GLY n 
1 84  LYS n 
1 85  ASP n 
1 86  GLN n 
1 87  GLN n 
1 88  VAL n 
1 89  ARG n 
1 90  LEU n 
1 91  PHE n 
1 92  ARG n 
1 93  PRO n 
1 94  TRP n 
1 95  LEU n 
1 96  ASN n 
1 97  MET n 
1 98  ASP n 
1 99  ARG n 
1 100 MET n 
1 101 LEU n 
1 102 ARG n 
1 103 SER n 
1 104 ALA n 
1 105 MET n 
1 106 ARG n 
1 107 LEU n 
1 108 CYS n 
1 109 LEU n 
1 110 PRO n 
1 111 SER n 
1 112 PHE n 
1 113 ASP n 
1 114 LYS n 
1 115 LEU n 
1 116 GLU n 
1 117 LEU n 
1 118 LEU n 
1 119 GLU n 
1 120 CYS n 
1 121 ILE n 
1 122 ARG n 
1 123 ARG n 
1 124 LEU n 
1 125 ILE n 
1 126 GLU n 
1 127 VAL n 
1 128 ASP n 
1 129 LYS n 
1 130 ASP n 
1 131 TRP n 
1 132 VAL n 
1 133 PRO n 
1 134 ASP n 
1 135 ALA n 
1 136 ALA n 
1 137 GLY n 
1 138 THR n 
1 139 SER n 
1 140 LEU n 
1 141 TYR n 
1 142 VAL n 
1 143 ARG n 
1 144 PRO n 
1 145 VAL n 
1 146 LEU n 
1 147 ILE n 
1 148 GLY n 
1 149 ASN n 
1 150 GLU n 
1 151 PRO n 
1 152 SER n 
1 153 LEU n 
1 154 GLY n 
1 155 VAL n 
1 156 SER n 
1 157 GLN n 
1 158 PRO n 
1 159 ARG n 
1 160 ARG n 
1 161 ALA n 
1 162 LEU n 
1 163 LEU n 
1 164 PHE n 
1 165 VAL n 
1 166 ILE n 
1 167 LEU n 
1 168 CYS n 
1 169 PRO n 
1 170 VAL n 
1 171 GLY n 
1 172 ALA n 
1 173 TYR n 
1 174 PHE n 
1 175 PRO n 
1 176 GLY n 
1 177 GLY n 
1 178 SER n 
1 179 VAL n 
1 180 THR n 
1 181 PRO n 
1 182 VAL n 
1 183 SER n 
1 184 LEU n 
1 185 LEU n 
1 186 ALA n 
1 187 ASP n 
1 188 PRO n 
1 189 ALA n 
1 190 PHE n 
1 191 ILE n 
1 192 ARG n 
1 193 ALA n 
1 194 TRP n 
1 195 VAL n 
1 196 GLY n 
1 197 GLY n 
1 198 VAL n 
1 199 GLY n 
1 200 ASN n 
1 201 TYR n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 GLY n 
1 206 ASN n 
1 207 TYR n 
1 208 GLY n 
1 209 PRO n 
1 210 THR n 
1 211 VAL n 
1 212 LEU n 
1 213 VAL n 
1 214 GLN n 
1 215 GLN n 
1 216 GLU n 
1 217 ALA n 
1 218 LEU n 
1 219 LYS n 
1 220 ARG n 
1 221 GLY n 
1 222 CYS n 
1 223 GLU n 
1 224 GLN n 
1 225 VAL n 
1 226 LEU n 
1 227 TRP n 
1 228 LEU n 
1 229 TYR n 
1 230 GLY n 
1 231 PRO n 
1 232 ASP n 
1 233 HIS n 
1 234 GLN n 
1 235 LEU n 
1 236 THR n 
1 237 GLU n 
1 238 VAL n 
1 239 GLY n 
1 240 THR n 
1 241 MET n 
1 242 ASN n 
1 243 ILE n 
1 244 PHE n 
1 245 VAL n 
1 246 TYR n 
1 247 TRP n 
1 248 THR n 
1 249 HIS n 
1 250 GLU n 
1 251 ASP n 
1 252 GLY n 
1 253 VAL n 
1 254 LEU n 
1 255 GLU n 
1 256 LEU n 
1 257 VAL n 
1 258 THR n 
1 259 PRO n 
1 260 PRO n 
1 261 LEU n 
1 262 ASN n 
1 263 GLY n 
1 264 VAL n 
1 265 ILE n 
1 266 LEU n 
1 267 PRO n 
1 268 GLY n 
1 269 VAL n 
1 270 VAL n 
1 271 ARG n 
1 272 GLN n 
1 273 SER n 
1 274 LEU n 
1 275 LEU n 
1 276 ASP n 
1 277 MET n 
1 278 ALA n 
1 279 GLN n 
1 280 THR n 
1 281 TRP n 
1 282 GLY n 
1 283 GLU n 
1 284 PHE n 
1 285 ARG n 
1 286 VAL n 
1 287 VAL n 
1 288 GLU n 
1 289 ARG n 
1 290 THR n 
1 291 ILE n 
1 292 THR n 
1 293 MET n 
1 294 LYS n 
1 295 GLN n 
1 296 LEU n 
1 297 LEU n 
1 298 ARG n 
1 299 ALA n 
1 300 LEU n 
1 301 GLU n 
1 302 GLU n 
1 303 GLY n 
1 304 ARG n 
1 305 VAL n 
1 306 ARG n 
1 307 GLU n 
1 308 VAL n 
1 309 PHE n 
1 310 GLY n 
1 311 SER n 
1 312 GLY n 
1 313 THR n 
1 314 ALA n 
1 315 CYS n 
1 316 GLN n 
1 317 VAL n 
1 318 CYS n 
1 319 PRO n 
1 320 VAL n 
1 321 HIS n 
1 322 ARG n 
1 323 ILE n 
1 324 LEU n 
1 325 TYR n 
1 326 LYS n 
1 327 ASP n 
1 328 ARG n 
1 329 ASN n 
1 330 LEU n 
1 331 HIS n 
1 332 ILE n 
1 333 PRO n 
1 334 THR n 
1 335 MET n 
1 336 GLU n 
1 337 ASN n 
1 338 GLY n 
1 339 PRO n 
1 340 GLU n 
1 341 LEU n 
1 342 ILE n 
1 343 LEU n 
1 344 ARG n 
1 345 PHE n 
1 346 GLN n 
1 347 LYS n 
1 348 GLU n 
1 349 LEU n 
1 350 LYS n 
1 351 GLU n 
1 352 ILE n 
1 353 GLN n 
1 354 TYR n 
1 355 GLY n 
1 356 ILE n 
1 357 ARG n 
1 358 ALA n 
1 359 HIS n 
1 360 GLU n 
1 361 TRP n 
1 362 MET n 
1 363 PHE n 
1 364 PRO n 
1 365 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    BCAM_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          O15382 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EKV A 1 ? 365 ? O15382 28 ? 392 ? 1 365 
2 1 1EKV B 1 ? 365 ? O15382 28 ? 392 ? 1 365 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?                      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?                      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                ?                      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                    ?                      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                               ?                      'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                      'C9 H11 N O2'    165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE"                 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'  247.142 
PRO 'L-peptide linking' y PROLINE                                  ?                      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                   ?                      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                ?                      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                      'C11 H12 N2 O2'  204.225 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER'          'C4 H12 N O3 1'  122.143 
TYR 'L-peptide linking' y TYROSINE                                 ?                      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                   ?                      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EKV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.8 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.2 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    'AMMONIUM SULPHATE, DTT, TRIS, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           223 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   1998-03-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EKV 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             34.27 
_reflns.d_resolution_high            2.25 
_reflns.number_obs                   32336 
_reflns.number_all                   32336 
_reflns.percent_possible_obs         82.8 
_reflns.pdbx_Rmerge_I_obs            0.1270000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.19 
_reflns.B_iso_Wilson_estimate        10.8 
_reflns.pdbx_redundancy              1.80 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.33 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   69.4 
_reflns_shell.Rmerge_I_obs           0.2630000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        2.29 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1EKV 
_refine.ls_number_reflns_obs                     24049 
_refine.ls_number_reflns_all                     31372 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               366108.39 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             34.27 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    63.3 
_refine.ls_R_factor_obs                          0.1950000 
_refine.ls_R_factor_all                          0.2310000 
_refine.ls_R_factor_R_work                       0.1890000 
_refine.ls_R_factor_R_free                       0.2500000 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  2389 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               20.2 
_refine.aniso_B[1][1]                            -1.43 
_refine.aniso_B[2][2]                            -1.43 
_refine.aniso_B[3][3]                            2.87 
_refine.aniso_B[1][2]                            1.63 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.379 
_refine.solvent_model_param_bsol                 34.85 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'E. COLI BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1EKV 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5820 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             212 
_refine_hist.number_atoms_total               6076 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        34.27 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.7   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.2  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.13  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.27 
_refine_ls_shell.d_res_low                        2.41 
_refine_ls_shell.number_reflns_R_work             2377 
_refine_ls_shell.R_factor_R_work                  0.1990000 
_refine_ls_shell.percent_reflns_obs               42.3 
_refine_ls_shell.R_factor_R_free                  0.2780000 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            10.7 
_refine_ls_shell.number_reflns_R_free             285 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARA    ?           'X-RAY DIFFRACTION' 
3 PMP_XPLOR_PAR.TXT ?           'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1EKV 
_struct.title                     
;HUMAN BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL): THREE DIMENSIONAL STRUCTURE OF ENZYME INACTIVATED BY TRIS BOUND TO THE PYRIDOXAL-5'-PHOSPHATE ON ONE END AND ACTIVE SITE LYS202 NZ ON THE OTHER.
;
_struct.pdbx_descriptor           'BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL)(E.C. 2.6.1.42)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EKV 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'FOLD TYPE IV, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'THE BIOLOGICAL ASSEMBLY IS A DIMER CONSTRUCTED FROM CHAINS A AND B.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 6   ? LEU A 10  ? LYS A 6   LEU A 10  5 ? 5  
HELX_P HELX_P2  2  SER A 65  ? TYR A 70  ? SER A 65  TYR A 70  1 ? 6  
HELX_P HELX_P3  3  ARG A 92  ? LEU A 107 ? ARG A 92  LEU A 107 1 ? 16 
HELX_P HELX_P4  4  ASP A 113 ? ASP A 128 ? ASP A 113 ASP A 128 1 ? 16 
HELX_P HELX_P5  5  LYS A 129 ? VAL A 132 ? LYS A 129 VAL A 132 5 ? 4  
HELX_P HELX_P6  6  LEU A 203 ? GLY A 208 ? LEU A 203 GLY A 208 1 ? 6  
HELX_P HELX_P7  7  PRO A 209 ? ARG A 220 ? PRO A 209 ARG A 220 1 ? 12 
HELX_P HELX_P8  8  GLY A 268 ? GLY A 282 ? GLY A 268 GLY A 282 1 ? 15 
HELX_P HELX_P9  9  THR A 292 ? GLU A 302 ? THR A 292 GLU A 302 1 ? 11 
HELX_P HELX_P10 10 PRO A 333 ? GLY A 338 ? PRO A 333 GLY A 338 5 ? 6  
HELX_P HELX_P11 11 PRO A 339 ? TYR A 354 ? PRO A 339 TYR A 354 1 ? 16 
HELX_P HELX_P12 12 LYS B 6   ? LEU B 10  ? LYS B 6   LEU B 10  5 ? 5  
HELX_P HELX_P13 13 SER B 65  ? TYR B 70  ? SER B 65  TYR B 70  1 ? 6  
HELX_P HELX_P14 14 ARG B 92  ? LEU B 107 ? ARG B 92  LEU B 107 1 ? 16 
HELX_P HELX_P15 15 ASP B 113 ? ASP B 128 ? ASP B 113 ASP B 128 1 ? 16 
HELX_P HELX_P16 16 LYS B 129 ? VAL B 132 ? LYS B 129 VAL B 132 5 ? 4  
HELX_P HELX_P17 17 LEU B 203 ? GLY B 208 ? LEU B 203 GLY B 208 1 ? 6  
HELX_P HELX_P18 18 PRO B 209 ? ARG B 220 ? PRO B 209 ARG B 220 1 ? 12 
HELX_P HELX_P19 19 GLY B 268 ? GLY B 282 ? GLY B 268 GLY B 282 1 ? 15 
HELX_P HELX_P20 20 THR B 292 ? GLY B 303 ? THR B 292 GLY B 303 1 ? 12 
HELX_P HELX_P21 21 PRO B 333 ? GLY B 338 ? PRO B 333 GLY B 338 5 ? 6  
HELX_P HELX_P22 22 PRO B 339 ? TYR B 354 ? PRO B 339 TYR B 354 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C PLP .   C4A ? ? ? 1_555 D TRS . N  ? ? A PLP 370 A TRS 371 1_555 ? ? ? ? ? ? ? 1.363 ? 
covale2 covale ? ? A LYS 202 NZ  ? ? ? 1_555 D TRS . C1 ? ? A LYS 202 A TRS 371 1_555 ? ? ? ? ? ? ? 1.379 ? 
covale3 covale ? ? E PLP .   C4A ? ? ? 1_555 F TRS . N  ? ? B PLP 370 B TRS 371 1_555 ? ? ? ? ? ? ? 1.447 ? 
covale4 covale ? ? B LYS 202 NZ  ? ? ? 1_555 F TRS . C1 ? ? B LYS 202 B TRS 371 1_555 ? ? ? ? ? ? ? 1.396 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 338 A . ? GLY 338 A PRO 339 A ? PRO 339 A 1 -0.15 
2 GLY 338 B . ? GLY 338 B PRO 339 B ? PRO 339 B 1 0.17  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 12 ? 
B ? 2  ? 
C ? 2  ? 
D ? 9  ? 
E ? 12 ? 
F ? 9  ? 
G ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? anti-parallel 
B 1  2  ? anti-parallel 
C 1  2  ? anti-parallel 
D 1  2  ? parallel      
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? anti-parallel 
D 6  7  ? anti-parallel 
D 7  8  ? parallel      
D 8  9  ? parallel      
E 1  2  ? parallel      
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? anti-parallel 
E 5  6  ? anti-parallel 
E 6  7  ? anti-parallel 
E 7  8  ? anti-parallel 
E 8  9  ? anti-parallel 
E 9  10 ? anti-parallel 
E 10 11 ? anti-parallel 
E 11 12 ? anti-parallel 
F 1  2  ? parallel      
F 2  3  ? parallel      
F 3  4  ? anti-parallel 
F 4  5  ? anti-parallel 
F 5  6  ? anti-parallel 
F 6  7  ? anti-parallel 
F 7  8  ? anti-parallel 
F 8  9  ? parallel      
G 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLN A 11  ? LEU A 12  ? GLN A 11  LEU A 12  
A 2  ARG A 52  ? PRO A 55  ? ARG A 52  PRO A 55  
A 3  HIS A 37  ? ASN A 44  ? HIS A 37  ASN A 44  
A 4  GLY A 47  ? TRP A 48  ? GLY A 47  TRP A 48  
A 5  HIS A 37  ? ASN A 44  ? HIS A 37  ASN A 44  
A 6  ALA A 161 ? VAL A 170 ? ALA A 161 VAL A 170 
A 7  SER A 139 ? GLY A 148 ? SER A 139 GLY A 148 
A 8  GLN A 73  ? PHE A 75  ? GLN A 73  PHE A 75  
A 9  SER A 139 ? GLY A 148 ? SER A 139 GLY A 148 
A 10 MET A 78  ? LYS A 82  ? MET A 78  LYS A 82  
A 11 VAL A 88  ? PHE A 91  ? VAL A 88  PHE A 91  
A 12 MET A 362 ? PRO A 364 ? MET A 362 PRO A 364 
B 1  LEU A 59  ? LEU A 61  ? LEU A 59  LEU A 61  
B 2  LEU B 59  ? LEU B 61  ? LEU B 59  LEU B 61  
C 1  LEU A 228 ? TYR A 229 ? LEU A 228 TYR A 229 
C 2  GLN A 234 ? LEU A 235 ? GLN A 234 LEU A 235 
D 1  ARG A 285 ? GLU A 288 ? ARG A 285 GLU A 288 
D 2  LEU A 254 ? THR A 258 ? LEU A 254 THR A 258 
D 3  ASN A 242 ? THR A 248 ? ASN A 242 THR A 248 
D 4  VAL A 305 ? GLY A 312 ? VAL A 305 GLY A 312 
D 5  GLN A 316 ? TYR A 325 ? GLN A 316 TYR A 325 
D 6  ARG A 328 ? HIS A 331 ? ARG A 328 HIS A 331 
D 7  GLN A 316 ? TYR A 325 ? GLN A 316 TYR A 325 
D 8  VAL A 182 ? ALA A 186 ? VAL A 182 ALA A 186 
D 9  GLN A 224 ? VAL A 225 ? GLN A 224 VAL A 225 
E 1  GLN B 11  ? LEU B 12  ? GLN B 11  LEU B 12  
E 2  ARG B 52  ? PRO B 55  ? ARG B 52  PRO B 55  
E 3  HIS B 37  ? ASN B 44  ? HIS B 37  ASN B 44  
E 4  GLY B 47  ? TRP B 48  ? GLY B 47  TRP B 48  
E 5  HIS B 37  ? ASN B 44  ? HIS B 37  ASN B 44  
E 6  ALA B 161 ? VAL B 170 ? ALA B 161 VAL B 170 
E 7  SER B 139 ? GLY B 148 ? SER B 139 GLY B 148 
E 8  GLN B 73  ? PHE B 75  ? GLN B 73  PHE B 75  
E 9  SER B 139 ? GLY B 148 ? SER B 139 GLY B 148 
E 10 MET B 78  ? LYS B 82  ? MET B 78  LYS B 82  
E 11 VAL B 88  ? PHE B 91  ? VAL B 88  PHE B 91  
E 12 MET B 362 ? PRO B 364 ? MET B 362 PRO B 364 
F 1  GLN B 224 ? VAL B 225 ? GLN B 224 VAL B 225 
F 2  VAL B 182 ? ALA B 186 ? VAL B 182 ALA B 186 
F 3  GLN B 316 ? TYR B 325 ? GLN B 316 TYR B 325 
F 4  ARG B 328 ? HIS B 331 ? ARG B 328 HIS B 331 
F 5  GLN B 316 ? TYR B 325 ? GLN B 316 TYR B 325 
F 6  VAL B 305 ? GLY B 312 ? VAL B 305 GLY B 312 
F 7  ASN B 242 ? THR B 248 ? ASN B 242 THR B 248 
F 8  LEU B 254 ? THR B 258 ? LEU B 254 THR B 258 
F 9  ARG B 285 ? GLU B 288 ? ARG B 285 GLU B 288 
G 1  LEU B 228 ? TYR B 229 ? LEU B 228 TYR B 229 
G 2  GLN B 234 ? LEU B 235 ? GLN B 234 LEU B 235 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O GLN A 11  ? O GLN A 11  N ILE A 53  ? N ILE A 53  
A 2  3  O GLN A 54  ? O GLN A 54  N MET A 38  ? N MET A 38  
A 3  4  O ASN A 44  ? O ASN A 44  N GLY A 47  ? N GLY A 47  
A 4  5  N GLY A 47  ? N GLY A 47  O ASN A 44  ? O ASN A 44  
A 5  6  O TRP A 43  ? O TRP A 43  N ALA A 161 ? N ALA A 161 
A 6  7  N VAL A 170 ? N VAL A 170 O SER A 139 ? O SER A 139 
A 7  8  N LEU A 146 ? N LEU A 146 O LEU A 74  ? O LEU A 74  
A 8  9  O LEU A 74  ? O LEU A 74  N LEU A 146 ? N LEU A 146 
A 9  10 N VAL A 142 ? N VAL A 142 O MET A 78  ? O MET A 78  
A 10 11 N PHE A 81  ? N PHE A 81  O ARG A 89  ? O ARG A 89  
A 11 12 N LEU A 90  ? N LEU A 90  O PHE A 363 ? O PHE A 363 
B 1  2  O LEU A 61  ? O LEU A 61  N LEU B 59  ? N LEU B 59  
C 1  2  O TYR A 229 ? O TYR A 229 N GLN A 234 ? N GLN A 234 
D 1  2  N ARG A 285 ? N ARG A 285 O LEU A 254 ? O LEU A 254 
D 2  3  N VAL A 257 ? N VAL A 257 O VAL A 245 ? O VAL A 245 
D 3  4  O TYR A 246 ? O TYR A 246 N ARG A 306 ? N ARG A 306 
D 4  5  O GLY A 312 ? O GLY A 312 N GLN A 316 ? N GLN A 316 
D 5  6  N TYR A 325 ? N TYR A 325 O ARG A 328 ? O ARG A 328 
D 6  7  N LEU A 330 ? N LEU A 330 O ILE A 323 ? O ILE A 323 
D 7  8  O PRO A 319 ? O PRO A 319 N VAL A 182 ? N VAL A 182 
D 8  9  N LEU A 185 ? N LEU A 185 O GLN A 224 ? O GLN A 224 
E 1  2  O GLN B 11  ? O GLN B 11  N ILE B 53  ? N ILE B 53  
E 2  3  O GLN B 54  ? O GLN B 54  N MET B 38  ? N MET B 38  
E 3  4  N ASN B 44  ? N ASN B 44  O GLY B 47  ? O GLY B 47  
E 4  5  O GLY B 47  ? O GLY B 47  N ASN B 44  ? N ASN B 44  
E 5  6  O TRP B 43  ? O TRP B 43  N ALA B 161 ? N ALA B 161 
E 6  7  N VAL B 170 ? N VAL B 170 O SER B 139 ? O SER B 139 
E 7  8  N LEU B 146 ? N LEU B 146 O LEU B 74  ? O LEU B 74  
E 8  9  O LEU B 74  ? O LEU B 74  N LEU B 146 ? N LEU B 146 
E 9  10 N VAL B 142 ? N VAL B 142 O MET B 78  ? O MET B 78  
E 10 11 N PHE B 81  ? N PHE B 81  O ARG B 89  ? O ARG B 89  
E 11 12 N LEU B 90  ? N LEU B 90  O PHE B 363 ? O PHE B 363 
F 1  2  N GLN B 224 ? N GLN B 224 O SER B 183 ? O SER B 183 
F 2  3  N VAL B 182 ? N VAL B 182 O PRO B 319 ? O PRO B 319 
F 3  4  N TYR B 325 ? N TYR B 325 O ARG B 328 ? O ARG B 328 
F 4  5  N LEU B 330 ? N LEU B 330 O ILE B 323 ? O ILE B 323 
F 5  6  N VAL B 320 ? N VAL B 320 O VAL B 308 ? O VAL B 308 
F 6  7  N SER B 311 ? N SER B 311 O ASN B 242 ? O ASN B 242 
F 7  8  O TRP B 247 ? O TRP B 247 N GLU B 255 ? N GLU B 255 
F 8  9  N LEU B 256 ? N LEU B 256 O ARG B 285 ? O ARG B 285 
G 1  2  O TYR B 229 ? O TYR B 229 N GLN B 234 ? N GLN B 234 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE PLP A 370' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE PLP B 370' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE TRS A 371' 
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE TRS B 371' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 ARG A 99  ? ARG A 99  . ? 1_555 ? 
2  AC1 15 ARG A 192 ? ARG A 192 . ? 1_555 ? 
3  AC1 15 TYR A 207 ? TYR A 207 . ? 1_555 ? 
4  AC1 15 GLU A 237 ? GLU A 237 . ? 1_555 ? 
5  AC1 15 GLY A 239 ? GLY A 239 . ? 1_555 ? 
6  AC1 15 THR A 240 ? THR A 240 . ? 1_555 ? 
7  AC1 15 ASN A 242 ? ASN A 242 . ? 1_555 ? 
8  AC1 15 LEU A 266 ? LEU A 266 . ? 1_555 ? 
9  AC1 15 GLY A 268 ? GLY A 268 . ? 1_555 ? 
10 AC1 15 VAL A 269 ? VAL A 269 . ? 1_555 ? 
11 AC1 15 VAL A 270 ? VAL A 270 . ? 1_555 ? 
12 AC1 15 GLY A 312 ? GLY A 312 . ? 1_555 ? 
13 AC1 15 THR A 313 ? THR A 313 . ? 1_555 ? 
14 AC1 15 TRS D .   ? TRS A 371 . ? 1_555 ? 
15 AC1 15 HOH G .   ? HOH A 395 . ? 1_555 ? 
16 AC2 17 ARG B 99  ? ARG B 99  . ? 1_555 ? 
17 AC2 17 ARG B 192 ? ARG B 192 . ? 1_555 ? 
18 AC2 17 TYR B 207 ? TYR B 207 . ? 1_555 ? 
19 AC2 17 GLU B 237 ? GLU B 237 . ? 1_555 ? 
20 AC2 17 GLY B 239 ? GLY B 239 . ? 1_555 ? 
21 AC2 17 THR B 240 ? THR B 240 . ? 1_555 ? 
22 AC2 17 MET B 241 ? MET B 241 . ? 1_555 ? 
23 AC2 17 ASN B 242 ? ASN B 242 . ? 1_555 ? 
24 AC2 17 LEU B 266 ? LEU B 266 . ? 1_555 ? 
25 AC2 17 GLY B 268 ? GLY B 268 . ? 1_555 ? 
26 AC2 17 VAL B 269 ? VAL B 269 . ? 1_555 ? 
27 AC2 17 VAL B 270 ? VAL B 270 . ? 1_555 ? 
28 AC2 17 GLY B 312 ? GLY B 312 . ? 1_555 ? 
29 AC2 17 THR B 313 ? THR B 313 . ? 1_555 ? 
30 AC2 17 TRS F .   ? TRS B 371 . ? 1_555 ? 
31 AC2 17 HOH H .   ? HOH B 376 . ? 1_555 ? 
32 AC2 17 HOH H .   ? HOH B 410 . ? 1_555 ? 
33 AC3 6  PHE A 75  ? PHE A 75  . ? 1_555 ? 
34 AC3 6  TYR A 141 ? TYR A 141 . ? 1_555 ? 
35 AC3 6  LYS A 202 ? LYS A 202 . ? 1_555 ? 
36 AC3 6  TYR A 207 ? TYR A 207 . ? 1_555 ? 
37 AC3 6  PLP C .   ? PLP A 370 . ? 1_555 ? 
38 AC3 6  HOH G .   ? HOH A 395 . ? 1_555 ? 
39 AC4 7  PHE B 75  ? PHE B 75  . ? 1_555 ? 
40 AC4 7  LYS B 202 ? LYS B 202 . ? 1_555 ? 
41 AC4 7  TYR B 207 ? TYR B 207 . ? 1_555 ? 
42 AC4 7  THR B 240 ? THR B 240 . ? 1_555 ? 
43 AC4 7  PLP E .   ? PLP B 370 . ? 1_555 ? 
44 AC4 7  HOH H .   ? HOH B 410 . ? 1_555 ? 
45 AC4 7  HOH H .   ? HOH B 414 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EKV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EKV 
_atom_sites.fract_transf_matrix[1][1]   0.011942 
_atom_sites.fract_transf_matrix[1][2]   0.006895 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013789 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009541 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 19.504  -1.388  -27.298 1.00 42.65 ? 1   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 20.952  -1.737  -27.398 1.00 43.51 ? 1   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 21.838  -0.586  -26.870 1.00 43.96 ? 1   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 22.988  -0.383  -27.321 1.00 41.90 ? 1   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 21.298  -2.078  -28.844 1.00 42.87 ? 1   ALA A CB  1 
ATOM   6    N N   . SER A 1 2   ? 21.261  0.145   -25.904 1.00 44.98 ? 2   SER A N   1 
ATOM   7    C CA  . SER A 1 2   ? 21.860  1.283   -25.177 1.00 44.90 ? 2   SER A CA  1 
ATOM   8    C C   . SER A 1 2   ? 20.717  2.195   -24.648 1.00 46.28 ? 2   SER A C   1 
ATOM   9    O O   . SER A 1 2   ? 20.896  3.410   -24.465 1.00 46.37 ? 2   SER A O   1 
ATOM   10   C CB  . SER A 1 2   ? 22.863  2.087   -26.049 1.00 43.04 ? 2   SER A CB  1 
ATOM   11   O OG  . SER A 1 2   ? 22.295  2.599   -27.256 1.00 36.47 ? 2   SER A OG  1 
ATOM   12   N N   . SER A 1 3   ? 19.550  1.579   -24.392 1.00 45.82 ? 3   SER A N   1 
ATOM   13   C CA  . SER A 1 3   ? 18.379  2.278   -23.881 1.00 43.47 ? 3   SER A CA  1 
ATOM   14   C C   . SER A 1 3   ? 17.918  1.665   -22.546 1.00 41.92 ? 3   SER A C   1 
ATOM   15   O O   . SER A 1 3   ? 18.182  2.251   -21.469 1.00 44.69 ? 3   SER A O   1 
ATOM   16   C CB  . SER A 1 3   ? 17.237  2.230   -24.912 1.00 45.65 ? 3   SER A CB  1 
ATOM   17   O OG  . SER A 1 3   ? 16.148  3.097   -24.556 1.00 46.04 ? 3   SER A OG  1 
ATOM   18   N N   . SER A 1 4   ? 17.250  0.498   -22.598 1.00 34.58 ? 4   SER A N   1 
ATOM   19   C CA  . SER A 1 4   ? 16.741  -0.161  -21.381 1.00 27.28 ? 4   SER A CA  1 
ATOM   20   C C   . SER A 1 4   ? 16.938  -1.663  -21.224 1.00 25.21 ? 4   SER A C   1 
ATOM   21   O O   . SER A 1 4   ? 16.930  -2.439  -22.186 1.00 24.28 ? 4   SER A O   1 
ATOM   22   C CB  . SER A 1 4   ? 15.244  0.127   -21.196 1.00 24.30 ? 4   SER A CB  1 
ATOM   23   O OG  . SER A 1 4   ? 14.677  -0.698  -20.180 1.00 21.34 ? 4   SER A OG  1 
ATOM   24   N N   . PHE A 1 5   ? 17.113  -2.065  -19.973 1.00 22.61 ? 5   PHE A N   1 
ATOM   25   C CA  . PHE A 1 5   ? 17.270  -3.463  -19.657 1.00 19.76 ? 5   PHE A CA  1 
ATOM   26   C C   . PHE A 1 5   ? 15.897  -4.119  -19.898 1.00 18.25 ? 5   PHE A C   1 
ATOM   27   O O   . PHE A 1 5   ? 14.841  -3.472  -19.823 1.00 15.19 ? 5   PHE A O   1 
ATOM   28   C CB  . PHE A 1 5   ? 17.754  -3.632  -18.203 1.00 19.85 ? 5   PHE A CB  1 
ATOM   29   C CG  . PHE A 1 5   ? 16.890  -2.943  -17.165 1.00 18.21 ? 5   PHE A CG  1 
ATOM   30   C CD1 . PHE A 1 5   ? 15.722  -3.550  -16.682 1.00 15.98 ? 5   PHE A CD1 1 
ATOM   31   C CD2 . PHE A 1 5   ? 17.282  -1.720  -16.627 1.00 12.76 ? 5   PHE A CD2 1 
ATOM   32   C CE1 . PHE A 1 5   ? 14.973  -2.943  -15.673 1.00 16.44 ? 5   PHE A CE1 1 
ATOM   33   C CE2 . PHE A 1 5   ? 16.545  -1.106  -15.623 1.00 12.09 ? 5   PHE A CE2 1 
ATOM   34   C CZ  . PHE A 1 5   ? 15.389  -1.710  -15.140 1.00 15.07 ? 5   PHE A CZ  1 
ATOM   35   N N   . LYS A 1 6   ? 15.921  -5.400  -20.217 1.00 15.86 ? 6   LYS A N   1 
ATOM   36   C CA  . LYS A 1 6   ? 14.686  -6.084  -20.513 1.00 13.35 ? 6   LYS A CA  1 
ATOM   37   C C   . LYS A 1 6   ? 14.446  -7.287  -19.625 1.00 13.63 ? 6   LYS A C   1 
ATOM   38   O O   . LYS A 1 6   ? 15.337  -8.097  -19.413 1.00 13.17 ? 6   LYS A O   1 
ATOM   39   C CB  . LYS A 1 6   ? 14.716  -6.527  -21.964 1.00 9.82  ? 6   LYS A CB  1 
ATOM   40   C CG  . LYS A 1 6   ? 15.142  -5.447  -22.930 1.00 12.75 ? 6   LYS A CG  1 
ATOM   41   C CD  . LYS A 1 6   ? 14.006  -4.466  -23.197 1.00 16.74 ? 6   LYS A CD  1 
ATOM   42   C CE  . LYS A 1 6   ? 14.166  -3.862  -24.568 1.00 13.72 ? 6   LYS A CE  1 
ATOM   43   N NZ  . LYS A 1 6   ? 15.552  -3.388  -24.694 1.00 19.40 ? 6   LYS A NZ  1 
ATOM   44   N N   . ALA A 1 7   ? 13.219  -7.391  -19.132 1.00 13.79 ? 7   ALA A N   1 
ATOM   45   C CA  . ALA A 1 7   ? 12.802  -8.499  -18.303 1.00 15.96 ? 7   ALA A CA  1 
ATOM   46   C C   . ALA A 1 7   ? 13.116  -9.816  -19.017 1.00 18.13 ? 7   ALA A C   1 
ATOM   47   O O   . ALA A 1 7   ? 13.515  -10.799 -18.388 1.00 15.73 ? 7   ALA A O   1 
ATOM   48   C CB  . ALA A 1 7   ? 11.303  -8.402  -18.023 1.00 17.30 ? 7   ALA A CB  1 
ATOM   49   N N   . ALA A 1 8   ? 12.948  -9.839  -20.334 1.00 16.71 ? 8   ALA A N   1 
ATOM   50   C CA  . ALA A 1 8   ? 13.238  -11.057 -21.064 1.00 18.03 ? 8   ALA A CA  1 
ATOM   51   C C   . ALA A 1 8   ? 14.648  -11.593 -20.784 1.00 17.66 ? 8   ALA A C   1 
ATOM   52   O O   . ALA A 1 8   ? 14.896  -12.794 -20.890 1.00 14.84 ? 8   ALA A O   1 
ATOM   53   C CB  . ALA A 1 8   ? 13.049  -10.817 -22.546 1.00 22.26 ? 8   ALA A CB  1 
ATOM   54   N N   . ASP A 1 9   ? 15.575  -10.716 -20.404 1.00 21.06 ? 9   ASP A N   1 
ATOM   55   C CA  . ASP A 1 9   ? 16.957  -11.165 -20.132 1.00 21.26 ? 9   ASP A CA  1 
ATOM   56   C C   . ASP A 1 9   ? 17.255  -11.358 -18.672 1.00 22.21 ? 9   ASP A C   1 
ATOM   57   O O   . ASP A 1 9   ? 18.409  -11.590 -18.315 1.00 24.42 ? 9   ASP A O   1 
ATOM   58   C CB  . ASP A 1 9   ? 17.968  -10.147 -20.617 1.00 21.08 ? 9   ASP A CB  1 
ATOM   59   C CG  . ASP A 1 9   ? 17.712  -9.691  -22.010 1.00 20.84 ? 9   ASP A CG  1 
ATOM   60   O OD1 . ASP A 1 9   ? 17.899  -8.475  -22.230 1.00 26.85 ? 9   ASP A OD1 1 
ATOM   61   O OD2 . ASP A 1 9   ? 17.344  -10.518 -22.878 1.00 22.13 ? 9   ASP A OD2 1 
ATOM   62   N N   . LEU A 1 10  ? 16.236  -11.247 -17.827 1.00 21.77 ? 10  LEU A N   1 
ATOM   63   C CA  . LEU A 1 10  ? 16.458  -11.361 -16.399 1.00 19.51 ? 10  LEU A CA  1 
ATOM   64   C C   . LEU A 1 10  ? 17.078  -12.693 -16.003 1.00 18.07 ? 10  LEU A C   1 
ATOM   65   O O   . LEU A 1 10  ? 16.774  -13.725 -16.587 1.00 20.44 ? 10  LEU A O   1 
ATOM   66   C CB  . LEU A 1 10  ? 15.158  -11.107 -15.637 1.00 19.05 ? 10  LEU A CB  1 
ATOM   67   C CG  . LEU A 1 10  ? 15.345  -11.016 -14.114 1.00 20.62 ? 10  LEU A CG  1 
ATOM   68   C CD1 . LEU A 1 10  ? 14.732  -9.781  -13.541 1.00 11.64 ? 10  LEU A CD1 1 
ATOM   69   C CD2 . LEU A 1 10  ? 14.743  -12.260 -13.499 1.00 23.84 ? 10  LEU A CD2 1 
ATOM   70   N N   . GLN A 1 11  ? 17.957  -12.645 -15.012 1.00 15.54 ? 11  GLN A N   1 
ATOM   71   C CA  . GLN A 1 11  ? 18.653  -13.823 -14.527 1.00 19.20 ? 11  GLN A CA  1 
ATOM   72   C C   . GLN A 1 11  ? 18.253  -14.193 -13.096 1.00 20.08 ? 11  GLN A C   1 
ATOM   73   O O   . GLN A 1 11  ? 18.291  -13.355 -12.210 1.00 19.29 ? 11  GLN A O   1 
ATOM   74   C CB  . GLN A 1 11  ? 20.158  -13.577 -14.588 1.00 19.96 ? 11  GLN A CB  1 
ATOM   75   C CG  . GLN A 1 11  ? 20.671  -13.164 -15.974 1.00 22.58 ? 11  GLN A CG  1 
ATOM   76   C CD  . GLN A 1 11  ? 20.657  -14.305 -17.018 1.00 24.62 ? 11  GLN A CD  1 
ATOM   77   O OE1 . GLN A 1 11  ? 21.264  -15.379 -16.822 1.00 20.09 ? 11  GLN A OE1 1 
ATOM   78   N NE2 . GLN A 1 11  ? 19.975  -14.056 -18.141 1.00 21.72 ? 11  GLN A NE2 1 
ATOM   79   N N   . LEU A 1 12  ? 17.867  -15.448 -12.879 1.00 23.30 ? 12  LEU A N   1 
ATOM   80   C CA  . LEU A 1 12  ? 17.468  -15.905 -11.554 1.00 25.68 ? 12  LEU A CA  1 
ATOM   81   C C   . LEU A 1 12  ? 18.543  -16.686 -10.820 1.00 27.53 ? 12  LEU A C   1 
ATOM   82   O O   . LEU A 1 12  ? 19.189  -17.563 -11.399 1.00 25.81 ? 12  LEU A O   1 
ATOM   83   C CB  . LEU A 1 12  ? 16.259  -16.815 -11.625 1.00 29.24 ? 12  LEU A CB  1 
ATOM   84   C CG  . LEU A 1 12  ? 15.001  -16.315 -12.319 1.00 36.73 ? 12  LEU A CG  1 
ATOM   85   C CD1 . LEU A 1 12  ? 13.877  -17.360 -12.098 1.00 36.13 ? 12  LEU A CD1 1 
ATOM   86   C CD2 . LEU A 1 12  ? 14.606  -14.937 -11.765 1.00 36.62 ? 12  LEU A CD2 1 
ATOM   87   N N   . GLU A 1 13  ? 18.687  -16.388 -9.528  1.00 26.78 ? 13  GLU A N   1 
ATOM   88   C CA  . GLU A 1 13  ? 19.640  -17.067 -8.658  1.00 25.60 ? 13  GLU A CA  1 
ATOM   89   C C   . GLU A 1 13  ? 18.957  -17.275 -7.301  1.00 24.80 ? 13  GLU A C   1 
ATOM   90   O O   . GLU A 1 13  ? 18.998  -16.417 -6.413  1.00 21.60 ? 13  GLU A O   1 
ATOM   91   C CB  . GLU A 1 13  ? 20.889  -16.212 -8.518  1.00 27.80 ? 13  GLU A CB  1 
ATOM   92   C CG  . GLU A 1 13  ? 21.274  -15.615 -9.845  1.00 36.49 ? 13  GLU A CG  1 
ATOM   93   C CD  . GLU A 1 13  ? 21.842  -14.207 -9.733  1.00 39.59 ? 13  GLU A CD  1 
ATOM   94   O OE1 . GLU A 1 13  ? 21.812  -13.476 -10.752 1.00 42.89 ? 13  GLU A OE1 1 
ATOM   95   O OE2 . GLU A 1 13  ? 22.324  -13.833 -8.640  1.00 41.77 ? 13  GLU A OE2 1 
ATOM   96   N N   . MET A 1 14  ? 18.293  -18.416 -7.174  1.00 26.30 ? 14  MET A N   1 
ATOM   97   C CA  . MET A 1 14  ? 17.581  -18.780 -5.953  1.00 27.93 ? 14  MET A CA  1 
ATOM   98   C C   . MET A 1 14  ? 18.589  -18.867 -4.832  1.00 28.17 ? 14  MET A C   1 
ATOM   99   O O   . MET A 1 14  ? 19.726  -19.293 -5.059  1.00 29.91 ? 14  MET A O   1 
ATOM   100  C CB  . MET A 1 14  ? 16.910  -20.142 -6.123  1.00 27.52 ? 14  MET A CB  1 
ATOM   101  C CG  . MET A 1 14  ? 15.920  -20.182 -7.246  1.00 26.40 ? 14  MET A CG  1 
ATOM   102  S SD  . MET A 1 14  ? 14.920  -18.669 -7.224  1.00 29.15 ? 14  MET A SD  1 
ATOM   103  C CE  . MET A 1 14  ? 14.778  -18.272 -9.091  1.00 26.45 ? 14  MET A CE  1 
ATOM   104  N N   . THR A 1 15  ? 18.202  -18.477 -3.623  1.00 29.31 ? 15  THR A N   1 
ATOM   105  C CA  . THR A 1 15  ? 19.170  -18.554 -2.537  1.00 31.87 ? 15  THR A CA  1 
ATOM   106  C C   . THR A 1 15  ? 19.450  -19.977 -2.064  1.00 32.44 ? 15  THR A C   1 
ATOM   107  O O   . THR A 1 15  ? 18.657  -20.898 -2.256  1.00 31.00 ? 15  THR A O   1 
ATOM   108  C CB  . THR A 1 15  ? 18.762  -17.745 -1.303  1.00 30.81 ? 15  THR A CB  1 
ATOM   109  O OG1 . THR A 1 15  ? 19.869  -17.724 -0.382  1.00 30.50 ? 15  THR A OG1 1 
ATOM   110  C CG2 . THR A 1 15  ? 17.553  -18.396 -0.611  1.00 29.11 ? 15  THR A CG2 1 
ATOM   111  N N   . GLN A 1 16  ? 20.609  -20.115 -1.435  1.00 35.57 ? 16  GLN A N   1 
ATOM   112  C CA  . GLN A 1 16  ? 21.091  -21.373 -0.873  1.00 38.78 ? 16  GLN A CA  1 
ATOM   113  C C   . GLN A 1 16  ? 21.132  -21.209 0.619   1.00 38.26 ? 16  GLN A C   1 
ATOM   114  O O   . GLN A 1 16  ? 21.790  -21.973 1.332   1.00 40.02 ? 16  GLN A O   1 
ATOM   115  C CB  . GLN A 1 16  ? 22.503  -21.691 -1.389  1.00 40.87 ? 16  GLN A CB  1 
ATOM   116  C CG  . GLN A 1 16  ? 22.490  -22.179 -2.832  1.00 45.10 ? 16  GLN A CG  1 
ATOM   117  C CD  . GLN A 1 16  ? 21.409  -23.240 -3.028  1.00 46.84 ? 16  GLN A CD  1 
ATOM   118  O OE1 . GLN A 1 16  ? 20.210  -22.966 -2.848  1.00 47.93 ? 16  GLN A OE1 1 
ATOM   119  N NE2 . GLN A 1 16  ? 21.826  -24.464 -3.374  1.00 47.67 ? 16  GLN A NE2 1 
ATOM   120  N N   . LYS A 1 17  ? 20.430  -20.192 1.088   1.00 37.78 ? 17  LYS A N   1 
ATOM   121  C CA  . LYS A 1 17  ? 20.384  -19.906 2.505   1.00 36.75 ? 17  LYS A CA  1 
ATOM   122  C C   . LYS A 1 17  ? 19.030  -19.250 2.777   1.00 34.85 ? 17  LYS A C   1 
ATOM   123  O O   . LYS A 1 17  ? 18.947  -18.110 3.243   1.00 35.41 ? 17  LYS A O   1 
ATOM   124  C CB  . LYS A 1 17  ? 21.554  -18.973 2.871   1.00 39.49 ? 17  LYS A CB  1 
ATOM   125  C CG  . LYS A 1 17  ? 21.825  -18.813 4.385   1.00 43.96 ? 17  LYS A CG  1 
ATOM   126  C CD  . LYS A 1 17  ? 22.438  -20.079 5.030   1.00 44.89 ? 17  LYS A CD  1 
ATOM   127  C CE  . LYS A 1 17  ? 22.365  -19.989 6.568   1.00 45.29 ? 17  LYS A CE  1 
ATOM   128  N NZ  . LYS A 1 17  ? 20.925  -19.809 7.017   1.00 44.65 ? 17  LYS A NZ  1 
ATOM   129  N N   . PRO A 1 18  ? 17.942  -19.960 2.453   1.00 32.76 ? 18  PRO A N   1 
ATOM   130  C CA  . PRO A 1 18  ? 16.595  -19.441 2.678   1.00 33.46 ? 18  PRO A CA  1 
ATOM   131  C C   . PRO A 1 18  ? 16.539  -18.880 4.083   1.00 33.25 ? 18  PRO A C   1 
ATOM   132  O O   . PRO A 1 18  ? 17.195  -19.413 4.991   1.00 34.34 ? 18  PRO A O   1 
ATOM   133  C CB  . PRO A 1 18  ? 15.729  -20.683 2.575   1.00 31.25 ? 18  PRO A CB  1 
ATOM   134  C CG  . PRO A 1 18  ? 16.448  -21.497 1.567   1.00 33.52 ? 18  PRO A CG  1 
ATOM   135  C CD  . PRO A 1 18  ? 17.897  -21.322 1.898   1.00 31.77 ? 18  PRO A CD  1 
ATOM   136  N N   . HIS A 1 19  ? 15.776  -17.815 4.287   1.00 32.75 ? 19  HIS A N   1 
ATOM   137  C CA  . HIS A 1 19  ? 15.677  -17.312 5.633   1.00 32.48 ? 19  HIS A CA  1 
ATOM   138  C C   . HIS A 1 19  ? 14.353  -17.703 6.270   1.00 31.95 ? 19  HIS A C   1 
ATOM   139  O O   . HIS A 1 19  ? 13.318  -17.762 5.603   1.00 32.39 ? 19  HIS A O   1 
ATOM   140  C CB  . HIS A 1 19  ? 15.859  -15.792 5.699   1.00 35.23 ? 19  HIS A CB  1 
ATOM   141  C CG  . HIS A 1 19  ? 16.309  -15.320 7.047   1.00 38.25 ? 19  HIS A CG  1 
ATOM   142  N ND1 . HIS A 1 19  ? 17.630  -15.361 7.446   1.00 40.45 ? 19  HIS A ND1 1 
ATOM   143  C CD2 . HIS A 1 19  ? 15.607  -14.878 8.119   1.00 40.51 ? 19  HIS A CD2 1 
ATOM   144  C CE1 . HIS A 1 19  ? 17.725  -14.961 8.703   1.00 40.41 ? 19  HIS A CE1 1 
ATOM   145  N NE2 . HIS A 1 19  ? 16.511  -14.662 9.136   1.00 42.02 ? 19  HIS A NE2 1 
ATOM   146  N N   . LYS A 1 20  ? 14.414  -17.980 7.572   1.00 32.69 ? 20  LYS A N   1 
ATOM   147  C CA  . LYS A 1 20  ? 13.252  -18.342 8.367   1.00 32.32 ? 20  LYS A CA  1 
ATOM   148  C C   . LYS A 1 20  ? 12.250  -17.198 8.291   1.00 31.93 ? 20  LYS A C   1 
ATOM   149  O O   . LYS A 1 20  ? 12.567  -16.062 8.661   1.00 29.61 ? 20  LYS A O   1 
ATOM   150  C CB  . LYS A 1 20  ? 13.656  -18.538 9.828   1.00 34.47 ? 20  LYS A CB  1 
ATOM   151  C CG  . LYS A 1 20  ? 14.958  -19.351 10.024  1.00 39.55 ? 20  LYS A CG  1 
ATOM   152  C CD  . LYS A 1 20  ? 16.211  -18.548 9.650   1.00 37.32 ? 20  LYS A CD  1 
ATOM   153  C CE  . LYS A 1 20  ? 17.238  -19.437 8.962   1.00 39.59 ? 20  LYS A CE  1 
ATOM   154  N NZ  . LYS A 1 20  ? 18.335  -18.662 8.271   1.00 37.51 ? 20  LYS A NZ  1 
ATOM   155  N N   . LYS A 1 21  ? 11.051  -17.493 7.792   1.00 30.84 ? 21  LYS A N   1 
ATOM   156  C CA  . LYS A 1 21  ? 9.994   -16.487 7.701   1.00 31.35 ? 21  LYS A CA  1 
ATOM   157  C C   . LYS A 1 21  ? 9.491   -16.173 9.113   1.00 35.39 ? 21  LYS A C   1 
ATOM   158  O O   . LYS A 1 21  ? 9.573   -17.027 10.004  1.00 37.19 ? 21  LYS A O   1 
ATOM   159  C CB  . LYS A 1 21  ? 8.844   -17.028 6.848   1.00 30.11 ? 21  LYS A CB  1 
ATOM   160  C CG  . LYS A 1 21  ? 9.242   -17.128 5.396   1.00 27.43 ? 21  LYS A CG  1 
ATOM   161  C CD  . LYS A 1 21  ? 8.482   -18.145 4.614   1.00 24.93 ? 21  LYS A CD  1 
ATOM   162  C CE  . LYS A 1 21  ? 9.211   -18.290 3.289   1.00 23.83 ? 21  LYS A CE  1 
ATOM   163  N NZ  . LYS A 1 21  ? 8.502   -19.185 2.338   1.00 27.70 ? 21  LYS A NZ  1 
ATOM   164  N N   . PRO A 1 22  ? 8.964   -14.948 9.339   1.00 37.82 ? 22  PRO A N   1 
ATOM   165  C CA  . PRO A 1 22  ? 8.447   -14.540 10.658  1.00 39.24 ? 22  PRO A CA  1 
ATOM   166  C C   . PRO A 1 22  ? 7.263   -15.401 11.083  1.00 39.84 ? 22  PRO A C   1 
ATOM   167  O O   . PRO A 1 22  ? 6.171   -15.223 10.572  1.00 39.19 ? 22  PRO A O   1 
ATOM   168  C CB  . PRO A 1 22  ? 8.007   -13.087 10.435  1.00 38.09 ? 22  PRO A CB  1 
ATOM   169  C CG  . PRO A 1 22  ? 8.874   -12.629 9.313   1.00 37.23 ? 22  PRO A CG  1 
ATOM   170  C CD  . PRO A 1 22  ? 8.894   -13.822 8.389   1.00 37.48 ? 22  PRO A CD  1 
ATOM   171  N N   . GLY A 1 23  ? 7.467   -16.306 12.033  1.00 41.68 ? 23  GLY A N   1 
ATOM   172  C CA  . GLY A 1 23  ? 6.373   -17.155 12.464  1.00 44.67 ? 23  GLY A CA  1 
ATOM   173  C C   . GLY A 1 23  ? 5.064   -16.398 12.653  1.00 46.89 ? 23  GLY A C   1 
ATOM   174  O O   . GLY A 1 23  ? 5.092   -15.196 12.981  1.00 45.94 ? 23  GLY A O   1 
ATOM   175  N N   . PRO A 1 24  ? 3.896   -17.069 12.455  1.00 48.45 ? 24  PRO A N   1 
ATOM   176  C CA  . PRO A 1 24  ? 2.532   -16.509 12.591  1.00 48.38 ? 24  PRO A CA  1 
ATOM   177  C C   . PRO A 1 24  ? 2.324   -15.723 13.890  1.00 47.57 ? 24  PRO A C   1 
ATOM   178  O O   . PRO A 1 24  ? 1.233   -15.171 14.166  1.00 46.78 ? 24  PRO A O   1 
ATOM   179  C CB  . PRO A 1 24  ? 1.638   -17.753 12.507  1.00 48.80 ? 24  PRO A CB  1 
ATOM   180  C CG  . PRO A 1 24  ? 2.383   -18.614 11.508  1.00 49.28 ? 24  PRO A CG  1 
ATOM   181  C CD  . PRO A 1 24  ? 3.831   -18.479 12.010  1.00 49.40 ? 24  PRO A CD  1 
ATOM   182  N N   . GLY A 1 25  ? 3.364   -15.691 14.707  1.00 47.12 ? 25  GLY A N   1 
ATOM   183  C CA  . GLY A 1 25  ? 3.258   -14.932 15.932  1.00 47.38 ? 25  GLY A CA  1 
ATOM   184  C C   . GLY A 1 25  ? 3.977   -13.639 15.644  1.00 46.96 ? 25  GLY A C   1 
ATOM   185  O O   . GLY A 1 25  ? 3.467   -12.540 15.922  1.00 48.80 ? 25  GLY A O   1 
ATOM   186  N N   . GLU A 1 26  ? 5.151   -13.795 15.026  1.00 46.31 ? 26  GLU A N   1 
ATOM   187  C CA  . GLU A 1 26  ? 6.054   -12.696 14.695  1.00 43.81 ? 26  GLU A CA  1 
ATOM   188  C C   . GLU A 1 26  ? 5.375   -11.404 14.266  1.00 43.45 ? 26  GLU A C   1 
ATOM   189  O O   . GLU A 1 26  ? 4.538   -11.404 13.356  1.00 42.78 ? 26  GLU A O   1 
ATOM   190  C CB  . GLU A 1 26  ? 7.065   -13.180 13.655  1.00 43.83 ? 26  GLU A CB  1 
ATOM   191  C CG  . GLU A 1 26  ? 8.012   -14.248 14.220  1.00 41.58 ? 26  GLU A CG  1 
ATOM   192  C CD  . GLU A 1 26  ? 8.553   -13.853 15.591  1.00 37.50 ? 26  GLU A CD  1 
ATOM   193  O OE1 . GLU A 1 26  ? 8.625   -12.632 15.871  1.00 35.17 ? 26  GLU A OE1 1 
ATOM   194  O OE2 . GLU A 1 26  ? 8.908   -14.756 16.379  1.00 34.23 ? 26  GLU A OE2 1 
ATOM   195  N N   . PRO A 1 27  ? 5.717   -10.285 14.957  1.00 42.77 ? 27  PRO A N   1 
ATOM   196  C CA  . PRO A 1 27  ? 5.231   -8.905  14.788  1.00 41.05 ? 27  PRO A CA  1 
ATOM   197  C C   . PRO A 1 27  ? 5.143   -8.316  13.383  1.00 39.30 ? 27  PRO A C   1 
ATOM   198  O O   . PRO A 1 27  ? 4.040   -8.019  12.917  1.00 40.74 ? 27  PRO A O   1 
ATOM   199  C CB  . PRO A 1 27  ? 6.162   -8.095  15.698  1.00 41.42 ? 27  PRO A CB  1 
ATOM   200  C CG  . PRO A 1 27  ? 6.384   -9.043  16.843  1.00 41.70 ? 27  PRO A CG  1 
ATOM   201  C CD  . PRO A 1 27  ? 6.637   -10.368 16.114  1.00 42.13 ? 27  PRO A CD  1 
ATOM   202  N N   . LEU A 1 28  ? 6.289   -8.124  12.727  1.00 34.97 ? 28  LEU A N   1 
ATOM   203  C CA  . LEU A 1 28  ? 6.333   -7.554  11.383  1.00 31.44 ? 28  LEU A CA  1 
ATOM   204  C C   . LEU A 1 28  ? 6.395   -6.020  11.361  1.00 30.93 ? 28  LEU A C   1 
ATOM   205  O O   . LEU A 1 28  ? 5.641   -5.391  10.617  1.00 32.45 ? 28  LEU A O   1 
ATOM   206  C CB  . LEU A 1 28  ? 5.117   -7.988  10.549  1.00 26.46 ? 28  LEU A CB  1 
ATOM   207  C CG  . LEU A 1 28  ? 5.015   -9.416  10.023  1.00 24.94 ? 28  LEU A CG  1 
ATOM   208  C CD1 . LEU A 1 28  ? 3.852   -9.564  9.044   1.00 19.66 ? 28  LEU A CD1 1 
ATOM   209  C CD2 . LEU A 1 28  ? 6.314   -9.750  9.353   1.00 25.42 ? 28  LEU A CD2 1 
ATOM   210  N N   . VAL A 1 29  ? 7.290   -5.416  12.141  1.00 29.61 ? 29  VAL A N   1 
ATOM   211  C CA  . VAL A 1 29  ? 7.422   -3.946  12.173  1.00 27.90 ? 29  VAL A CA  1 
ATOM   212  C C   . VAL A 1 29  ? 7.925   -3.400  10.832  1.00 26.78 ? 29  VAL A C   1 
ATOM   213  O O   . VAL A 1 29  ? 9.036   -3.726  10.391  1.00 24.78 ? 29  VAL A O   1 
ATOM   214  C CB  . VAL A 1 29  ? 8.389   -3.491  13.291  1.00 29.66 ? 29  VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 29  ? 8.651   -1.980  13.178  1.00 27.30 ? 29  VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 29  ? 7.790   -3.843  14.649  1.00 26.64 ? 29  VAL A CG2 1 
ATOM   217  N N   . PHE A 1 30  ? 7.096   -2.553  10.219  1.00 25.78 ? 30  PHE A N   1 
ATOM   218  C CA  . PHE A 1 30  ? 7.337   -1.964  8.904   1.00 24.50 ? 30  PHE A CA  1 
ATOM   219  C C   . PHE A 1 30  ? 8.551   -2.419  8.098   1.00 24.72 ? 30  PHE A C   1 
ATOM   220  O O   . PHE A 1 30  ? 8.469   -3.428  7.386   1.00 28.08 ? 30  PHE A O   1 
ATOM   221  C CB  . PHE A 1 30  ? 7.333   -0.434  8.942   1.00 25.12 ? 30  PHE A CB  1 
ATOM   222  C CG  . PHE A 1 30  ? 7.501   0.192   7.570   1.00 23.07 ? 30  PHE A CG  1 
ATOM   223  C CD1 . PHE A 1 30  ? 6.526   0.016   6.596   1.00 22.11 ? 30  PHE A CD1 1 
ATOM   224  C CD2 . PHE A 1 30  ? 8.685   0.848   7.224   1.00 22.20 ? 30  PHE A CD2 1 
ATOM   225  C CE1 . PHE A 1 30  ? 6.724   0.464   5.308   1.00 22.76 ? 30  PHE A CE1 1 
ATOM   226  C CE2 . PHE A 1 30  ? 8.906   1.309   5.930   1.00 20.83 ? 30  PHE A CE2 1 
ATOM   227  C CZ  . PHE A 1 30  ? 7.926   1.115   4.964   1.00 26.52 ? 30  PHE A CZ  1 
ATOM   228  N N   . GLY A 1 31  ? 9.663   -1.694  8.185   1.00 18.40 ? 31  GLY A N   1 
ATOM   229  C CA  . GLY A 1 31  ? 10.820  -2.071  7.392   1.00 17.89 ? 31  GLY A CA  1 
ATOM   230  C C   . GLY A 1 31  ? 11.958  -2.752  8.124   1.00 17.95 ? 31  GLY A C   1 
ATOM   231  O O   . GLY A 1 31  ? 13.112  -2.388  7.937   1.00 17.15 ? 31  GLY A O   1 
ATOM   232  N N   . LYS A 1 32  ? 11.650  -3.762  8.925   1.00 16.78 ? 32  LYS A N   1 
ATOM   233  C CA  . LYS A 1 32  ? 12.694  -4.435  9.683   1.00 21.48 ? 32  LYS A CA  1 
ATOM   234  C C   . LYS A 1 32  ? 12.986  -5.856  9.186   1.00 20.86 ? 32  LYS A C   1 
ATOM   235  O O   . LYS A 1 32  ? 14.013  -6.433  9.532   1.00 21.07 ? 32  LYS A O   1 
ATOM   236  C CB  . LYS A 1 32  ? 12.330  -4.479  11.183  1.00 22.36 ? 32  LYS A CB  1 
ATOM   237  C CG  . LYS A 1 32  ? 11.789  -3.169  11.754  1.00 25.68 ? 32  LYS A CG  1 
ATOM   238  C CD  . LYS A 1 32  ? 12.806  -2.027  11.704  1.00 29.26 ? 32  LYS A CD  1 
ATOM   239  C CE  . LYS A 1 32  ? 13.579  -1.841  13.018  1.00 32.48 ? 32  LYS A CE  1 
ATOM   240  N NZ  . LYS A 1 32  ? 12.804  -1.139  14.111  1.00 31.62 ? 32  LYS A NZ  1 
ATOM   241  N N   . THR A 1 33  ? 12.093  -6.416  8.380   1.00 20.38 ? 33  THR A N   1 
ATOM   242  C CA  . THR A 1 33  ? 12.310  -7.775  7.869   1.00 18.54 ? 33  THR A CA  1 
ATOM   243  C C   . THR A 1 33  ? 12.329  -7.816  6.370   1.00 16.08 ? 33  THR A C   1 
ATOM   244  O O   . THR A 1 33  ? 11.467  -7.226  5.743   1.00 13.46 ? 33  THR A O   1 
ATOM   245  C CB  . THR A 1 33  ? 11.207  -8.717  8.273   1.00 19.09 ? 33  THR A CB  1 
ATOM   246  O OG1 . THR A 1 33  ? 10.967  -8.584  9.676   1.00 22.99 ? 33  THR A OG1 1 
ATOM   247  C CG2 . THR A 1 33  ? 11.610  -10.148 7.939   1.00 17.57 ? 33  THR A CG2 1 
ATOM   248  N N   . PHE A 1 34  ? 13.292  -8.529  5.794   1.00 12.87 ? 34  PHE A N   1 
ATOM   249  C CA  . PHE A 1 34  ? 13.345  -8.619  4.349   1.00 14.95 ? 34  PHE A CA  1 
ATOM   250  C C   . PHE A 1 34  ? 13.228  -10.049 3.850   1.00 16.44 ? 34  PHE A C   1 
ATOM   251  O O   . PHE A 1 34  ? 13.490  -11.019 4.580   1.00 17.70 ? 34  PHE A O   1 
ATOM   252  C CB  . PHE A 1 34  ? 14.607  -7.953  3.818   1.00 12.41 ? 34  PHE A CB  1 
ATOM   253  C CG  . PHE A 1 34  ? 14.721  -6.498  4.206   1.00 14.56 ? 34  PHE A CG  1 
ATOM   254  C CD1 . PHE A 1 34  ? 15.142  -6.131  5.484   1.00 12.32 ? 34  PHE A CD1 1 
ATOM   255  C CD2 . PHE A 1 34  ? 14.341  -5.500  3.318   1.00 10.25 ? 34  PHE A CD2 1 
ATOM   256  C CE1 . PHE A 1 34  ? 15.174  -4.796  5.862   1.00 13.64 ? 34  PHE A CE1 1 
ATOM   257  C CE2 . PHE A 1 34  ? 14.372  -4.162  3.692   1.00 10.49 ? 34  PHE A CE2 1 
ATOM   258  C CZ  . PHE A 1 34  ? 14.783  -3.804  4.952   1.00 11.02 ? 34  PHE A CZ  1 
ATOM   259  N N   . THR A 1 35  ? 12.817  -10.178 2.598   1.00 17.65 ? 35  THR A N   1 
ATOM   260  C CA  . THR A 1 35  ? 12.650  -11.484 2.000   1.00 17.02 ? 35  THR A CA  1 
ATOM   261  C C   . THR A 1 35  ? 13.967  -12.071 1.509   1.00 17.21 ? 35  THR A C   1 
ATOM   262  O O   . THR A 1 35  ? 15.035  -11.484 1.680   1.00 15.92 ? 35  THR A O   1 
ATOM   263  C CB  . THR A 1 35  ? 11.629  -11.409 0.880   1.00 16.03 ? 35  THR A CB  1 
ATOM   264  O OG1 . THR A 1 35  ? 12.145  -10.630 -0.204  1.00 22.82 ? 35  THR A OG1 1 
ATOM   265  C CG2 . THR A 1 35  ? 10.366  -10.765 1.398   1.00 8.29  ? 35  THR A CG2 1 
ATOM   266  N N   . ASP A 1 36  ? 13.898  -13.241 0.904   1.00 17.05 ? 36  ASP A N   1 
ATOM   267  C CA  . ASP A 1 36  ? 15.109  -13.909 0.455   1.00 16.51 ? 36  ASP A CA  1 
ATOM   268  C C   . ASP A 1 36  ? 15.806  -13.352 -0.769  1.00 14.78 ? 36  ASP A C   1 
ATOM   269  O O   . ASP A 1 36  ? 17.021  -13.452 -0.873  1.00 15.59 ? 36  ASP A O   1 
ATOM   270  C CB  . ASP A 1 36  ? 14.827  -15.412 0.267   1.00 21.02 ? 36  ASP A CB  1 
ATOM   271  C CG  . ASP A 1 36  ? 14.674  -16.150 1.606   1.00 21.47 ? 36  ASP A CG  1 
ATOM   272  O OD1 . ASP A 1 36  ? 15.559  -15.974 2.479   1.00 17.58 ? 36  ASP A OD1 1 
ATOM   273  O OD2 . ASP A 1 36  ? 13.681  -16.906 1.778   1.00 24.52 ? 36  ASP A OD2 1 
ATOM   274  N N   . HIS A 1 37  ? 15.057  -12.765 -1.691  1.00 13.67 ? 37  HIS A N   1 
ATOM   275  C CA  . HIS A 1 37  ? 15.674  -12.219 -2.890  1.00 14.04 ? 37  HIS A CA  1 
ATOM   276  C C   . HIS A 1 37  ? 15.522  -10.732 -3.088  1.00 15.45 ? 37  HIS A C   1 
ATOM   277  O O   . HIS A 1 37  ? 14.749  -10.064 -2.389  1.00 19.43 ? 37  HIS A O   1 
ATOM   278  C CB  . HIS A 1 37  ? 15.141  -12.934 -4.110  1.00 14.45 ? 37  HIS A CB  1 
ATOM   279  C CG  . HIS A 1 37  ? 15.330  -14.404 -4.031  1.00 15.60 ? 37  HIS A CG  1 
ATOM   280  N ND1 . HIS A 1 37  ? 14.511  -15.210 -3.278  1.00 15.33 ? 37  HIS A ND1 1 
ATOM   281  C CD2 . HIS A 1 37  ? 16.336  -15.193 -4.472  1.00 16.33 ? 37  HIS A CD2 1 
ATOM   282  C CE1 . HIS A 1 37  ? 15.009  -16.431 -3.249  1.00 16.79 ? 37  HIS A CE1 1 
ATOM   283  N NE2 . HIS A 1 37  ? 16.117  -16.448 -3.966  1.00 14.88 ? 37  HIS A NE2 1 
ATOM   284  N N   . MET A 1 38  ? 16.283  -10.223 -4.049  1.00 13.79 ? 38  MET A N   1 
ATOM   285  C CA  . MET A 1 38  ? 16.268  -8.811  -4.399  1.00 11.37 ? 38  MET A CA  1 
ATOM   286  C C   . MET A 1 38  ? 16.504  -8.722  -5.899  1.00 10.77 ? 38  MET A C   1 
ATOM   287  O O   . MET A 1 38  ? 16.982  -9.690  -6.502  1.00 11.95 ? 38  MET A O   1 
ATOM   288  C CB  . MET A 1 38  ? 17.375  -8.063  -3.649  1.00 9.63  ? 38  MET A CB  1 
ATOM   289  C CG  . MET A 1 38  ? 18.784  -8.441  -4.092  1.00 10.37 ? 38  MET A CG  1 
ATOM   290  S SD  . MET A 1 38  ? 20.106  -7.830  -3.027  1.00 15.97 ? 38  MET A SD  1 
ATOM   291  C CE  . MET A 1 38  ? 19.918  -6.030  -3.187  1.00 7.51  ? 38  MET A CE  1 
ATOM   292  N N   . LEU A 1 39  ? 16.124  -7.591  -6.497  1.00 8.16  ? 39  LEU A N   1 
ATOM   293  C CA  . LEU A 1 39  ? 16.344  -7.363  -7.917  1.00 11.07 ? 39  LEU A CA  1 
ATOM   294  C C   . LEU A 1 39  ? 17.577  -6.484  -8.013  1.00 12.00 ? 39  LEU A C   1 
ATOM   295  O O   . LEU A 1 39  ? 17.850  -5.701  -7.105  1.00 13.07 ? 39  LEU A O   1 
ATOM   296  C CB  . LEU A 1 39  ? 15.179  -6.623  -8.570  1.00 9.83  ? 39  LEU A CB  1 
ATOM   297  C CG  . LEU A 1 39  ? 15.464  -6.243  -10.039 1.00 10.31 ? 39  LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 39  ? 15.479  -7.497  -10.930 1.00 6.17  ? 39  LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 39  ? 14.412  -5.282  -10.544 1.00 9.17  ? 39  LEU A CD2 1 
ATOM   300  N N   . MET A 1 40  ? 18.291  -6.575  -9.127  1.00 13.32 ? 40  MET A N   1 
ATOM   301  C CA  . MET A 1 40  ? 19.510  -5.792  -9.291  1.00 14.96 ? 40  MET A CA  1 
ATOM   302  C C   . MET A 1 40  ? 19.858  -5.607  -10.764 1.00 12.90 ? 40  MET A C   1 
ATOM   303  O O   . MET A 1 40  ? 19.899  -6.569  -11.517 1.00 14.19 ? 40  MET A O   1 
ATOM   304  C CB  . MET A 1 40  ? 20.644  -6.512  -8.546  1.00 18.57 ? 40  MET A CB  1 
ATOM   305  C CG  . MET A 1 40  ? 22.038  -5.935  -8.714  1.00 22.46 ? 40  MET A CG  1 
ATOM   306  S SD  . MET A 1 40  ? 22.497  -4.862  -7.336  1.00 33.18 ? 40  MET A SD  1 
ATOM   307  C CE  . MET A 1 40  ? 22.452  -6.000  -5.918  1.00 25.15 ? 40  MET A CE  1 
ATOM   308  N N   . VAL A 1 41  ? 20.082  -4.360  -11.165 1.00 13.89 ? 41  VAL A N   1 
ATOM   309  C CA  . VAL A 1 41  ? 20.448  -4.014  -12.541 1.00 13.60 ? 41  VAL A CA  1 
ATOM   310  C C   . VAL A 1 41  ? 21.525  -2.949  -12.468 1.00 13.96 ? 41  VAL A C   1 
ATOM   311  O O   . VAL A 1 41  ? 21.381  -1.980  -11.743 1.00 15.04 ? 41  VAL A O   1 
ATOM   312  C CB  . VAL A 1 41  ? 19.252  -3.414  -13.346 1.00 14.22 ? 41  VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 41  ? 19.558  -3.448  -14.850 1.00 11.41 ? 41  VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 41  ? 17.971  -4.162  -13.033 1.00 10.16 ? 41  VAL A CG2 1 
ATOM   315  N N   . GLU A 1 42  ? 22.612  -3.119  -13.209 1.00 17.47 ? 42  GLU A N   1 
ATOM   316  C CA  . GLU A 1 42  ? 23.671  -2.123  -13.192 1.00 19.30 ? 42  GLU A CA  1 
ATOM   317  C C   . GLU A 1 42  ? 23.629  -1.277  -14.429 1.00 20.37 ? 42  GLU A C   1 
ATOM   318  O O   . GLU A 1 42  ? 23.105  -1.686  -15.463 1.00 22.54 ? 42  GLU A O   1 
ATOM   319  C CB  . GLU A 1 42  ? 25.043  -2.777  -13.097 1.00 21.80 ? 42  GLU A CB  1 
ATOM   320  C CG  . GLU A 1 42  ? 25.268  -3.575  -11.816 1.00 24.48 ? 42  GLU A CG  1 
ATOM   321  C CD  . GLU A 1 42  ? 26.605  -4.276  -11.824 1.00 26.69 ? 42  GLU A CD  1 
ATOM   322  O OE1 . GLU A 1 42  ? 27.650  -3.586  -11.719 1.00 29.66 ? 42  GLU A OE1 1 
ATOM   323  O OE2 . GLU A 1 42  ? 26.618  -5.523  -11.959 1.00 29.62 ? 42  GLU A OE2 1 
ATOM   324  N N   . TRP A 1 43  ? 24.178  -0.080  -14.336 1.00 21.00 ? 43  TRP A N   1 
ATOM   325  C CA  . TRP A 1 43  ? 24.206  0.790   -15.500 1.00 21.80 ? 43  TRP A CA  1 
ATOM   326  C C   . TRP A 1 43  ? 25.563  1.480   -15.539 1.00 21.15 ? 43  TRP A C   1 
ATOM   327  O O   . TRP A 1 43  ? 26.110  1.857   -14.498 1.00 21.45 ? 43  TRP A O   1 
ATOM   328  C CB  . TRP A 1 43  ? 23.069  1.823   -15.419 1.00 20.15 ? 43  TRP A CB  1 
ATOM   329  C CG  . TRP A 1 43  ? 23.015  2.777   -16.583 1.00 21.31 ? 43  TRP A CG  1 
ATOM   330  C CD1 . TRP A 1 43  ? 22.341  2.604   -17.761 1.00 20.16 ? 43  TRP A CD1 1 
ATOM   331  C CD2 . TRP A 1 43  ? 23.666  4.059   -16.681 1.00 22.17 ? 43  TRP A CD2 1 
ATOM   332  N NE1 . TRP A 1 43  ? 22.526  3.693   -18.579 1.00 21.75 ? 43  TRP A NE1 1 
ATOM   333  C CE2 . TRP A 1 43  ? 23.337  4.598   -17.942 1.00 22.70 ? 43  TRP A CE2 1 
ATOM   334  C CE3 . TRP A 1 43  ? 24.492  4.798   -15.825 1.00 18.01 ? 43  TRP A CE3 1 
ATOM   335  C CZ2 . TRP A 1 43  ? 23.806  5.840   -18.365 1.00 23.51 ? 43  TRP A CZ2 1 
ATOM   336  C CZ3 . TRP A 1 43  ? 24.956  6.035   -16.251 1.00 20.82 ? 43  TRP A CZ3 1 
ATOM   337  C CH2 . TRP A 1 43  ? 24.613  6.542   -17.506 1.00 22.21 ? 43  TRP A CH2 1 
ATOM   338  N N   . ASN A 1 44  ? 26.140  1.578   -16.722 1.00 21.79 ? 44  ASN A N   1 
ATOM   339  C CA  . ASN A 1 44  ? 27.405  2.287   -16.890 1.00 26.09 ? 44  ASN A CA  1 
ATOM   340  C C   . ASN A 1 44  ? 27.442  2.775   -18.323 1.00 26.98 ? 44  ASN A C   1 
ATOM   341  O O   . ASN A 1 44  ? 26.436  2.695   -19.015 1.00 27.00 ? 44  ASN A O   1 
ATOM   342  C CB  . ASN A 1 44  ? 28.622  1.417   -16.594 1.00 28.58 ? 44  ASN A CB  1 
ATOM   343  C CG  . ASN A 1 44  ? 28.765  0.267   -17.556 1.00 32.37 ? 44  ASN A CG  1 
ATOM   344  O OD1 . ASN A 1 44  ? 28.573  0.417   -18.779 1.00 33.05 ? 44  ASN A OD1 1 
ATOM   345  N ND2 . ASN A 1 44  ? 29.116  -0.900  -17.016 1.00 32.22 ? 44  ASN A ND2 1 
ATOM   346  N N   . ASP A 1 45  ? 28.585  3.274   -18.777 1.00 31.32 ? 45  ASP A N   1 
ATOM   347  C CA  . ASP A 1 45  ? 28.671  3.813   -20.138 1.00 35.03 ? 45  ASP A CA  1 
ATOM   348  C C   . ASP A 1 45  ? 28.622  2.703   -21.194 1.00 35.27 ? 45  ASP A C   1 
ATOM   349  O O   . ASP A 1 45  ? 29.314  2.735   -22.223 1.00 38.02 ? 45  ASP A O   1 
ATOM   350  C CB  . ASP A 1 45  ? 29.925  4.711   -20.285 1.00 35.31 ? 45  ASP A CB  1 
ATOM   351  C CG  . ASP A 1 45  ? 31.179  3.931   -20.636 1.00 36.28 ? 45  ASP A CG  1 
ATOM   352  O OD1 . ASP A 1 45  ? 31.219  2.725   -20.277 1.00 37.10 ? 45  ASP A OD1 1 
ATOM   353  O OD2 . ASP A 1 45  ? 32.114  4.522   -21.262 1.00 32.67 ? 45  ASP A OD2 1 
ATOM   354  N N   . LYS A 1 46  ? 27.768  1.726   -20.921 1.00 34.29 ? 46  LYS A N   1 
ATOM   355  C CA  . LYS A 1 46  ? 27.563  0.598   -21.807 1.00 33.82 ? 46  LYS A CA  1 
ATOM   356  C C   . LYS A 1 46  ? 26.053  0.297   -21.806 1.00 31.56 ? 46  LYS A C   1 
ATOM   357  O O   . LYS A 1 46  ? 25.579  -0.684  -22.392 1.00 32.99 ? 46  LYS A O   1 
ATOM   358  C CB  . LYS A 1 46  ? 28.373  -0.612  -21.302 1.00 32.92 ? 46  LYS A CB  1 
ATOM   359  C CG  . LYS A 1 46  ? 29.452  -1.081  -22.279 1.00 32.73 ? 46  LYS A CG  1 
ATOM   360  C CD  . LYS A 1 46  ? 30.222  0.144   -22.815 1.00 35.62 ? 46  LYS A CD  1 
ATOM   361  C CE  . LYS A 1 46  ? 30.473  0.098   -24.332 1.00 34.67 ? 46  LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 46  ? 30.865  1.468   -24.844 1.00 34.87 ? 46  LYS A NZ  1 
ATOM   363  N N   . GLY A 1 47  ? 25.302  1.180   -21.172 1.00 28.29 ? 47  GLY A N   1 
ATOM   364  C CA  . GLY A 1 47  ? 23.870  0.993   -21.063 1.00 25.36 ? 47  GLY A CA  1 
ATOM   365  C C   . GLY A 1 47  ? 23.652  0.091   -19.867 1.00 24.07 ? 47  GLY A C   1 
ATOM   366  O O   . GLY A 1 47  ? 24.591  -0.161  -19.098 1.00 25.50 ? 47  GLY A O   1 
ATOM   367  N N   . TRP A 1 48  ? 22.424  -0.398  -19.709 1.00 22.28 ? 48  TRP A N   1 
ATOM   368  C CA  . TRP A 1 48  ? 22.065  -1.282  -18.600 1.00 17.90 ? 48  TRP A CA  1 
ATOM   369  C C   . TRP A 1 48  ? 22.632  -2.668  -18.813 1.00 15.39 ? 48  TRP A C   1 
ATOM   370  O O   . TRP A 1 48  ? 22.725  -3.124  -19.936 1.00 15.12 ? 48  TRP A O   1 
ATOM   371  C CB  . TRP A 1 48  ? 20.548  -1.422  -18.503 1.00 14.61 ? 48  TRP A CB  1 
ATOM   372  C CG  . TRP A 1 48  ? 19.837  -0.181  -18.129 1.00 14.24 ? 48  TRP A CG  1 
ATOM   373  C CD1 . TRP A 1 48  ? 19.205  0.696   -18.965 1.00 13.27 ? 48  TRP A CD1 1 
ATOM   374  C CD2 . TRP A 1 48  ? 19.643  0.313   -16.803 1.00 15.37 ? 48  TRP A CD2 1 
ATOM   375  N NE1 . TRP A 1 48  ? 18.624  1.709   -18.239 1.00 7.93  ? 48  TRP A NE1 1 
ATOM   376  C CE2 . TRP A 1 48  ? 18.874  1.500   -16.910 1.00 12.39 ? 48  TRP A CE2 1 
ATOM   377  C CE3 . TRP A 1 48  ? 20.043  -0.131  -15.534 1.00 11.67 ? 48  TRP A CE3 1 
ATOM   378  C CZ2 . TRP A 1 48  ? 18.492  2.247   -15.794 1.00 12.75 ? 48  TRP A CZ2 1 
ATOM   379  C CZ3 . TRP A 1 48  ? 19.666  0.604   -14.427 1.00 17.19 ? 48  TRP A CZ3 1 
ATOM   380  C CH2 . TRP A 1 48  ? 18.892  1.789   -14.564 1.00 16.34 ? 48  TRP A CH2 1 
ATOM   381  N N   . GLY A 1 49  ? 23.008  -3.337  -17.732 1.00 13.72 ? 49  GLY A N   1 
ATOM   382  C CA  . GLY A 1 49  ? 23.516  -4.681  -17.860 1.00 12.40 ? 49  GLY A CA  1 
ATOM   383  C C   . GLY A 1 49  ? 22.234  -5.495  -17.850 1.00 17.30 ? 49  GLY A C   1 
ATOM   384  O O   . GLY A 1 49  ? 21.142  -4.949  -18.088 1.00 17.80 ? 49  GLY A O   1 
ATOM   385  N N   . GLN A 1 50  ? 22.341  -6.789  -17.581 1.00 16.06 ? 50  GLN A N   1 
ATOM   386  C CA  . GLN A 1 50  ? 21.154  -7.625  -17.529 1.00 15.49 ? 50  GLN A CA  1 
ATOM   387  C C   . GLN A 1 50  ? 20.557  -7.508  -16.147 1.00 16.88 ? 50  GLN A C   1 
ATOM   388  O O   . GLN A 1 50  ? 21.284  -7.449  -15.151 1.00 18.17 ? 50  GLN A O   1 
ATOM   389  C CB  . GLN A 1 50  ? 21.502  -9.089  -17.813 1.00 12.74 ? 50  GLN A CB  1 
ATOM   390  C CG  . GLN A 1 50  ? 21.467  -9.407  -19.279 1.00 16.30 ? 50  GLN A CG  1 
ATOM   391  C CD  . GLN A 1 50  ? 21.814  -10.843 -19.594 1.00 19.48 ? 50  GLN A CD  1 
ATOM   392  O OE1 . GLN A 1 50  ? 21.441  -11.346 -20.650 1.00 19.47 ? 50  GLN A OE1 1 
ATOM   393  N NE2 . GLN A 1 50  ? 22.543  -11.511 -18.688 1.00 20.77 ? 50  GLN A NE2 1 
ATOM   394  N N   . PRO A 1 51  ? 19.223  -7.452  -16.062 1.00 16.10 ? 51  PRO A N   1 
ATOM   395  C CA  . PRO A 1 51  ? 18.600  -7.354  -14.752 1.00 16.21 ? 51  PRO A CA  1 
ATOM   396  C C   . PRO A 1 51  ? 18.729  -8.738  -14.150 1.00 20.03 ? 51  PRO A C   1 
ATOM   397  O O   . PRO A 1 51  ? 18.741  -9.740  -14.885 1.00 18.93 ? 51  PRO A O   1 
ATOM   398  C CB  . PRO A 1 51  ? 17.165  -7.026  -15.099 1.00 13.28 ? 51  PRO A CB  1 
ATOM   399  C CG  . PRO A 1 51  ? 16.948  -7.851  -16.309 1.00 13.82 ? 51  PRO A CG  1 
ATOM   400  C CD  . PRO A 1 51  ? 18.202  -7.585  -17.114 1.00 17.63 ? 51  PRO A CD  1 
ATOM   401  N N   . ARG A 1 52  ? 18.833  -8.837  -12.832 1.00 21.97 ? 52  ARG A N   1 
ATOM   402  C CA  . ARG A 1 52  ? 18.926  -10.176 -12.280 1.00 22.80 ? 52  ARG A CA  1 
ATOM   403  C C   . ARG A 1 52  ? 18.360  -10.322 -10.889 1.00 22.18 ? 52  ARG A C   1 
ATOM   404  O O   . ARG A 1 52  ? 18.593  -9.475  -10.030 1.00 22.18 ? 52  ARG A O   1 
ATOM   405  C CB  . ARG A 1 52  ? 20.377  -10.650 -12.303 1.00 25.18 ? 52  ARG A CB  1 
ATOM   406  C CG  . ARG A 1 52  ? 21.292  -9.920  -11.362 1.00 31.26 ? 52  ARG A CG  1 
ATOM   407  C CD  . ARG A 1 52  ? 22.727  -10.419 -11.507 1.00 33.82 ? 52  ARG A CD  1 
ATOM   408  N NE  . ARG A 1 52  ? 23.625  -9.756  -10.560 1.00 39.72 ? 52  ARG A NE  1 
ATOM   409  C CZ  . ARG A 1 52  ? 23.943  -8.455  -10.583 1.00 42.49 ? 52  ARG A CZ  1 
ATOM   410  N NH1 . ARG A 1 52  ? 23.439  -7.646  -11.531 1.00 41.67 ? 52  ARG A NH1 1 
ATOM   411  N NH2 . ARG A 1 52  ? 24.753  -7.951  -9.634  1.00 40.77 ? 52  ARG A NH2 1 
ATOM   412  N N   . ILE A 1 53  ? 17.590  -11.383 -10.670 1.00 19.97 ? 53  ILE A N   1 
ATOM   413  C CA  . ILE A 1 53  ? 17.062  -11.611 -9.335  1.00 19.35 ? 53  ILE A CA  1 
ATOM   414  C C   . ILE A 1 53  ? 18.153  -12.410 -8.650  1.00 18.87 ? 53  ILE A C   1 
ATOM   415  O O   . ILE A 1 53  ? 18.618  -13.414 -9.168  1.00 18.63 ? 53  ILE A O   1 
ATOM   416  C CB  . ILE A 1 53  ? 15.753  -12.409 -9.328  1.00 15.09 ? 53  ILE A CB  1 
ATOM   417  C CG1 . ILE A 1 53  ? 14.627  -11.584 -9.961  1.00 14.23 ? 53  ILE A CG1 1 
ATOM   418  C CG2 . ILE A 1 53  ? 15.388  -12.734 -7.914  1.00 9.94  ? 53  ILE A CG2 1 
ATOM   419  C CD1 . ILE A 1 53  ? 13.254  -12.244 -9.884  1.00 17.59 ? 53  ILE A CD1 1 
ATOM   420  N N   . GLN A 1 54  ? 18.573  -11.944 -7.488  1.00 19.90 ? 54  GLN A N   1 
ATOM   421  C CA  . GLN A 1 54  ? 19.641  -12.598 -6.771  1.00 18.11 ? 54  GLN A CA  1 
ATOM   422  C C   . GLN A 1 54  ? 19.286  -12.649 -5.284  1.00 15.07 ? 54  GLN A C   1 
ATOM   423  O O   . GLN A 1 54  ? 18.389  -11.947 -4.841  1.00 17.46 ? 54  GLN A O   1 
ATOM   424  C CB  . GLN A 1 54  ? 20.921  -11.790 -6.993  1.00 19.65 ? 54  GLN A CB  1 
ATOM   425  C CG  . GLN A 1 54  ? 20.818  -10.381 -6.420  1.00 22.43 ? 54  GLN A CG  1 
ATOM   426  C CD  . GLN A 1 54  ? 22.075  -9.561  -6.600  1.00 24.16 ? 54  GLN A CD  1 
ATOM   427  O OE1 . GLN A 1 54  ? 22.456  -8.800  -5.710  1.00 23.21 ? 54  GLN A OE1 1 
ATOM   428  N NE2 . GLN A 1 54  ? 22.723  -9.702  -7.752  1.00 26.15 ? 54  GLN A NE2 1 
ATOM   429  N N   . PRO A 1 55  ? 19.981  -13.488 -4.503  1.00 15.45 ? 55  PRO A N   1 
ATOM   430  C CA  . PRO A 1 55  ? 19.704  -13.590 -3.062  1.00 14.03 ? 55  PRO A CA  1 
ATOM   431  C C   . PRO A 1 55  ? 19.923  -12.245 -2.382  1.00 13.97 ? 55  PRO A C   1 
ATOM   432  O O   . PRO A 1 55  ? 20.763  -11.464 -2.801  1.00 16.57 ? 55  PRO A O   1 
ATOM   433  C CB  . PRO A 1 55  ? 20.713  -14.632 -2.581  1.00 13.46 ? 55  PRO A CB  1 
ATOM   434  C CG  . PRO A 1 55  ? 20.949  -15.491 -3.819  1.00 16.45 ? 55  PRO A CG  1 
ATOM   435  C CD  . PRO A 1 55  ? 21.008  -14.463 -4.921  1.00 15.27 ? 55  PRO A CD  1 
ATOM   436  N N   . PHE A 1 56  ? 19.163  -11.971 -1.337  1.00 14.01 ? 56  PHE A N   1 
ATOM   437  C CA  . PHE A 1 56  ? 19.327  -10.721 -0.623  1.00 16.36 ? 56  PHE A CA  1 
ATOM   438  C C   . PHE A 1 56  ? 20.786  -10.647 -0.146  1.00 17.52 ? 56  PHE A C   1 
ATOM   439  O O   . PHE A 1 56  ? 21.293  -11.582 0.462   1.00 18.65 ? 56  PHE A O   1 
ATOM   440  C CB  . PHE A 1 56  ? 18.375  -10.674 0.572   1.00 14.18 ? 56  PHE A CB  1 
ATOM   441  C CG  . PHE A 1 56  ? 18.224  -9.295  1.170   1.00 13.76 ? 56  PHE A CG  1 
ATOM   442  C CD1 . PHE A 1 56  ? 17.229  -8.432  0.720   1.00 14.28 ? 56  PHE A CD1 1 
ATOM   443  C CD2 . PHE A 1 56  ? 19.069  -8.871  2.184   1.00 13.98 ? 56  PHE A CD2 1 
ATOM   444  C CE1 . PHE A 1 56  ? 17.073  -7.162  1.273   1.00 14.56 ? 56  PHE A CE1 1 
ATOM   445  C CE2 . PHE A 1 56  ? 18.932  -7.605  2.748   1.00 13.57 ? 56  PHE A CE2 1 
ATOM   446  C CZ  . PHE A 1 56  ? 17.931  -6.745  2.294   1.00 16.03 ? 56  PHE A CZ  1 
ATOM   447  N N   . GLN A 1 57  ? 21.459  -9.535  -0.422  1.00 18.40 ? 57  GLN A N   1 
ATOM   448  C CA  . GLN A 1 57  ? 22.861  -9.397  -0.044  1.00 20.97 ? 57  GLN A CA  1 
ATOM   449  C C   . GLN A 1 57  ? 23.294  -7.940  0.070   1.00 21.00 ? 57  GLN A C   1 
ATOM   450  O O   . GLN A 1 57  ? 22.621  -7.053  -0.436  1.00 18.99 ? 57  GLN A O   1 
ATOM   451  C CB  . GLN A 1 57  ? 23.738  -10.087 -1.083  1.00 18.08 ? 57  GLN A CB  1 
ATOM   452  C CG  . GLN A 1 57  ? 23.432  -9.633  -2.481  1.00 23.47 ? 57  GLN A CG  1 
ATOM   453  C CD  . GLN A 1 57  ? 24.141  -10.482 -3.514  1.00 27.29 ? 57  GLN A CD  1 
ATOM   454  O OE1 . GLN A 1 57  ? 25.335  -10.297 -3.775  1.00 29.29 ? 57  GLN A OE1 1 
ATOM   455  N NE2 . GLN A 1 57  ? 23.415  -11.440 -4.095  1.00 28.30 ? 57  GLN A NE2 1 
ATOM   456  N N   . ASN A 1 58  ? 24.422  -7.707  0.730   1.00 19.87 ? 58  ASN A N   1 
ATOM   457  C CA  . ASN A 1 58  ? 24.937  -6.359  0.890   1.00 19.72 ? 58  ASN A CA  1 
ATOM   458  C C   . ASN A 1 58  ? 25.300  -5.761  -0.433  1.00 23.26 ? 58  ASN A C   1 
ATOM   459  O O   . ASN A 1 58  ? 25.441  -6.479  -1.431  1.00 24.82 ? 58  ASN A O   1 
ATOM   460  C CB  . ASN A 1 58  ? 26.199  -6.343  1.723   1.00 18.87 ? 58  ASN A CB  1 
ATOM   461  C CG  . ASN A 1 58  ? 25.943  -6.661  3.160   1.00 24.96 ? 58  ASN A CG  1 
ATOM   462  O OD1 . ASN A 1 58  ? 24.953  -6.209  3.729   1.00 24.35 ? 58  ASN A OD1 1 
ATOM   463  N ND2 . ASN A 1 58  ? 26.841  -7.436  3.774   1.00 24.76 ? 58  ASN A ND2 1 
ATOM   464  N N   . LEU A 1 59  ? 25.472  -4.440  -0.426  1.00 20.36 ? 59  LEU A N   1 
ATOM   465  C CA  . LEU A 1 59  ? 25.869  -3.702  -1.609  1.00 20.31 ? 59  LEU A CA  1 
ATOM   466  C C   . LEU A 1 59  ? 27.354  -3.382  -1.418  1.00 20.86 ? 59  LEU A C   1 
ATOM   467  O O   . LEU A 1 59  ? 27.779  -2.986  -0.339  1.00 19.58 ? 59  LEU A O   1 
ATOM   468  C CB  . LEU A 1 59  ? 25.080  -2.397  -1.714  1.00 20.60 ? 59  LEU A CB  1 
ATOM   469  C CG  . LEU A 1 59  ? 23.561  -2.503  -1.725  1.00 20.58 ? 59  LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 59  ? 22.993  -1.130  -1.490  1.00 21.09 ? 59  LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 59  ? 23.066  -3.071  -3.043  1.00 17.26 ? 59  LEU A CD2 1 
ATOM   472  N N   . THR A 1 60  ? 28.145  -3.564  -2.459  1.00 20.01 ? 60  THR A N   1 
ATOM   473  C CA  . THR A 1 60  ? 29.558  -3.269  -2.362  1.00 19.43 ? 60  THR A CA  1 
ATOM   474  C C   . THR A 1 60  ? 29.738  -1.958  -3.098  1.00 19.36 ? 60  THR A C   1 
ATOM   475  O O   . THR A 1 60  ? 29.607  -1.910  -4.319  1.00 20.60 ? 60  THR A O   1 
ATOM   476  C CB  . THR A 1 60  ? 30.371  -4.371  -3.036  1.00 21.25 ? 60  THR A CB  1 
ATOM   477  O OG1 . THR A 1 60  ? 29.952  -5.634  -2.508  1.00 23.77 ? 60  THR A OG1 1 
ATOM   478  C CG2 . THR A 1 60  ? 31.865  -4.190  -2.777  1.00 20.97 ? 60  THR A CG2 1 
ATOM   479  N N   . LEU A 1 61  ? 30.030  -0.898  -2.355  1.00 18.61 ? 61  LEU A N   1 
ATOM   480  C CA  . LEU A 1 61  ? 30.184  0.436   -2.936  1.00 17.48 ? 61  LEU A CA  1 
ATOM   481  C C   . LEU A 1 61  ? 31.531  1.161   -2.759  1.00 16.24 ? 61  LEU A C   1 
ATOM   482  O O   . LEU A 1 61  ? 32.151  1.146   -1.700  1.00 18.97 ? 61  LEU A O   1 
ATOM   483  C CB  . LEU A 1 61  ? 29.073  1.329   -2.396  1.00 13.82 ? 61  LEU A CB  1 
ATOM   484  C CG  . LEU A 1 61  ? 27.747  1.440   -3.120  1.00 12.46 ? 61  LEU A CG  1 
ATOM   485  C CD1 . LEU A 1 61  ? 27.582  0.357   -4.155  1.00 15.45 ? 61  LEU A CD1 1 
ATOM   486  C CD2 . LEU A 1 61  ? 26.657  1.410   -2.084  1.00 10.52 ? 61  LEU A CD2 1 
ATOM   487  N N   . HIS A 1 62  ? 31.964  1.822   -3.815  1.00 16.56 ? 62  HIS A N   1 
ATOM   488  C CA  . HIS A 1 62  ? 33.207  2.550   -3.777  1.00 17.84 ? 62  HIS A CA  1 
ATOM   489  C C   . HIS A 1 62  ? 33.030  3.770   -2.835  1.00 18.65 ? 62  HIS A C   1 
ATOM   490  O O   . HIS A 1 62  ? 32.052  4.516   -2.935  1.00 22.99 ? 62  HIS A O   1 
ATOM   491  C CB  . HIS A 1 62  ? 33.559  2.956   -5.206  1.00 16.30 ? 62  HIS A CB  1 
ATOM   492  C CG  . HIS A 1 62  ? 34.869  3.655   -5.326  1.00 18.04 ? 62  HIS A CG  1 
ATOM   493  N ND1 . HIS A 1 62  ? 35.100  4.894   -4.773  1.00 18.68 ? 62  HIS A ND1 1 
ATOM   494  C CD2 . HIS A 1 62  ? 36.026  3.283   -5.921  1.00 17.36 ? 62  HIS A CD2 1 
ATOM   495  C CE1 . HIS A 1 62  ? 36.343  5.258   -5.023  1.00 19.65 ? 62  HIS A CE1 1 
ATOM   496  N NE2 . HIS A 1 62  ? 36.927  4.297   -5.718  1.00 21.00 ? 62  HIS A NE2 1 
ATOM   497  N N   . PRO A 1 63  ? 33.979  3.984   -1.906  1.00 18.57 ? 63  PRO A N   1 
ATOM   498  C CA  . PRO A 1 63  ? 33.960  5.087   -0.935  1.00 15.42 ? 63  PRO A CA  1 
ATOM   499  C C   . PRO A 1 63  ? 33.588  6.446   -1.475  1.00 13.03 ? 63  PRO A C   1 
ATOM   500  O O   . PRO A 1 63  ? 33.111  7.282   -0.738  1.00 14.99 ? 63  PRO A O   1 
ATOM   501  C CB  . PRO A 1 63  ? 35.382  5.097   -0.393  1.00 17.63 ? 63  PRO A CB  1 
ATOM   502  C CG  . PRO A 1 63  ? 35.801  3.669   -0.524  1.00 18.76 ? 63  PRO A CG  1 
ATOM   503  C CD  . PRO A 1 63  ? 35.290  3.313   -1.886  1.00 18.25 ? 63  PRO A CD  1 
ATOM   504  N N   . ALA A 1 64  ? 33.832  6.677   -2.757  1.00 14.91 ? 64  ALA A N   1 
ATOM   505  C CA  . ALA A 1 64  ? 33.536  7.960   -3.376  1.00 12.93 ? 64  ALA A CA  1 
ATOM   506  C C   . ALA A 1 64  ? 32.170  7.994   -4.046  1.00 13.50 ? 64  ALA A C   1 
ATOM   507  O O   . ALA A 1 64  ? 31.803  8.985   -4.645  1.00 10.89 ? 64  ALA A O   1 
ATOM   508  C CB  . ALA A 1 64  ? 34.625  8.294   -4.393  1.00 14.04 ? 64  ALA A CB  1 
ATOM   509  N N   . SER A 1 65  ? 31.421  6.902   -3.928  1.00 13.16 ? 65  SER A N   1 
ATOM   510  C CA  . SER A 1 65  ? 30.124  6.799   -4.562  1.00 14.84 ? 65  SER A CA  1 
ATOM   511  C C   . SER A 1 65  ? 29.221  8.018   -4.390  1.00 14.05 ? 65  SER A C   1 
ATOM   512  O O   . SER A 1 65  ? 28.890  8.414   -3.267  1.00 13.65 ? 65  SER A O   1 
ATOM   513  C CB  . SER A 1 65  ? 29.418  5.541   -4.075  1.00 15.34 ? 65  SER A CB  1 
ATOM   514  O OG  . SER A 1 65  ? 28.241  5.333   -4.818  1.00 18.31 ? 65  SER A OG  1 
ATOM   515  N N   . SER A 1 66  ? 28.822  8.602   -5.514  1.00 10.56 ? 66  SER A N   1 
ATOM   516  C CA  . SER A 1 66  ? 27.980  9.786   -5.483  1.00 13.57 ? 66  SER A CA  1 
ATOM   517  C C   . SER A 1 66  ? 26.644  9.576   -4.776  1.00 13.91 ? 66  SER A C   1 
ATOM   518  O O   . SER A 1 66  ? 25.996  10.529  -4.357  1.00 15.50 ? 66  SER A O   1 
ATOM   519  C CB  . SER A 1 66  ? 27.767  10.337  -6.903  1.00 10.37 ? 66  SER A CB  1 
ATOM   520  O OG  . SER A 1 66  ? 27.526  9.317   -7.864  1.00 15.16 ? 66  SER A OG  1 
ATOM   521  N N   . SER A 1 67  ? 26.226  8.328   -4.648  1.00 12.53 ? 67  SER A N   1 
ATOM   522  C CA  . SER A 1 67  ? 24.982  8.049   -3.970  1.00 11.98 ? 67  SER A CA  1 
ATOM   523  C C   . SER A 1 67  ? 25.156  8.421   -2.485  1.00 13.16 ? 67  SER A C   1 
ATOM   524  O O   . SER A 1 67  ? 24.171  8.664   -1.772  1.00 10.20 ? 67  SER A O   1 
ATOM   525  C CB  . SER A 1 67  ? 24.649  6.569   -4.097  1.00 12.50 ? 67  SER A CB  1 
ATOM   526  O OG  . SER A 1 67  ? 25.649  5.795   -3.484  1.00 14.65 ? 67  SER A OG  1 
ATOM   527  N N   . LEU A 1 68  ? 26.413  8.494   -2.049  1.00 8.34  ? 68  LEU A N   1 
ATOM   528  C CA  . LEU A 1 68  ? 26.726  8.788   -0.669  1.00 11.25 ? 68  LEU A CA  1 
ATOM   529  C C   . LEU A 1 68  ? 27.210  10.209  -0.343  1.00 14.54 ? 68  LEU A C   1 
ATOM   530  O O   . LEU A 1 68  ? 27.154  10.642  0.812   1.00 15.83 ? 68  LEU A O   1 
ATOM   531  C CB  . LEU A 1 68  ? 27.752  7.770   -0.170  1.00 11.40 ? 68  LEU A CB  1 
ATOM   532  C CG  . LEU A 1 68  ? 27.328  6.292   -0.146  1.00 13.34 ? 68  LEU A CG  1 
ATOM   533  C CD1 . LEU A 1 68  ? 28.496  5.420   0.250   1.00 9.18  ? 68  LEU A CD1 1 
ATOM   534  C CD2 . LEU A 1 68  ? 26.202  6.084   0.831   1.00 8.98  ? 68  LEU A CD2 1 
ATOM   535  N N   . HIS A 1 69  ? 27.676  10.936  -1.352  1.00 14.89 ? 69  HIS A N   1 
ATOM   536  C CA  . HIS A 1 69  ? 28.193  12.285  -1.167  1.00 13.42 ? 69  HIS A CA  1 
ATOM   537  C C   . HIS A 1 69  ? 27.233  13.388  -1.585  1.00 14.80 ? 69  HIS A C   1 
ATOM   538  O O   . HIS A 1 69  ? 27.109  14.404  -0.902  1.00 8.41  ? 69  HIS A O   1 
ATOM   539  C CB  . HIS A 1 69  ? 29.478  12.460  -1.973  1.00 14.18 ? 69  HIS A CB  1 
ATOM   540  C CG  . HIS A 1 69  ? 30.594  11.571  -1.537  1.00 9.55  ? 69  HIS A CG  1 
ATOM   541  N ND1 . HIS A 1 69  ? 31.587  11.996  -0.686  1.00 8.48  ? 69  HIS A ND1 1 
ATOM   542  C CD2 . HIS A 1 69  ? 30.862  10.277  -1.820  1.00 8.46  ? 69  HIS A CD2 1 
ATOM   543  C CE1 . HIS A 1 69  ? 32.423  10.999  -0.464  1.00 12.54 ? 69  HIS A CE1 1 
ATOM   544  N NE2 . HIS A 1 69  ? 32.005  9.945   -1.141  1.00 11.35 ? 69  HIS A NE2 1 
ATOM   545  N N   . TYR A 1 70  ? 26.583  13.187  -2.727  1.00 14.34 ? 70  TYR A N   1 
ATOM   546  C CA  . TYR A 1 70  ? 25.651  14.179  -3.262  1.00 17.87 ? 70  TYR A CA  1 
ATOM   547  C C   . TYR A 1 70  ? 24.221  13.686  -3.362  1.00 17.28 ? 70  TYR A C   1 
ATOM   548  O O   . TYR A 1 70  ? 23.446  14.145  -4.211  1.00 14.31 ? 70  TYR A O   1 
ATOM   549  C CB  . TYR A 1 70  ? 26.129  14.633  -4.633  1.00 18.52 ? 70  TYR A CB  1 
ATOM   550  C CG  . TYR A 1 70  ? 27.604  14.875  -4.629  1.00 22.08 ? 70  TYR A CG  1 
ATOM   551  C CD1 . TYR A 1 70  ? 28.197  15.663  -3.618  1.00 20.99 ? 70  TYR A CD1 1 
ATOM   552  C CD2 . TYR A 1 70  ? 28.429  14.256  -5.569  1.00 20.65 ? 70  TYR A CD2 1 
ATOM   553  C CE1 . TYR A 1 70  ? 29.583  15.817  -3.533  1.00 17.01 ? 70  TYR A CE1 1 
ATOM   554  C CE2 . TYR A 1 70  ? 29.821  14.401  -5.498  1.00 26.86 ? 70  TYR A CE2 1 
ATOM   555  C CZ  . TYR A 1 70  ? 30.397  15.179  -4.466  1.00 23.78 ? 70  TYR A CZ  1 
ATOM   556  O OH  . TYR A 1 70  ? 31.774  15.243  -4.351  1.00 21.95 ? 70  TYR A OH  1 
ATOM   557  N N   . SER A 1 71  ? 23.882  12.746  -2.490  1.00 15.55 ? 71  SER A N   1 
ATOM   558  C CA  . SER A 1 71  ? 22.545  12.192  -2.442  1.00 15.23 ? 71  SER A CA  1 
ATOM   559  C C   . SER A 1 71  ? 21.972  11.798  -3.816  1.00 14.99 ? 71  SER A C   1 
ATOM   560  O O   . SER A 1 71  ? 20.832  12.121  -4.124  1.00 11.47 ? 71  SER A O   1 
ATOM   561  C CB  . SER A 1 71  ? 21.633  13.208  -1.758  1.00 11.65 ? 71  SER A CB  1 
ATOM   562  O OG  . SER A 1 71  ? 20.386  12.638  -1.429  1.00 19.24 ? 71  SER A OG  1 
ATOM   563  N N   . LEU A 1 72  ? 22.762  11.128  -4.650  1.00 14.54 ? 72  LEU A N   1 
ATOM   564  C CA  . LEU A 1 72  ? 22.234  10.714  -5.943  1.00 14.26 ? 72  LEU A CA  1 
ATOM   565  C C   . LEU A 1 72  ? 21.497  9.424   -5.688  1.00 12.49 ? 72  LEU A C   1 
ATOM   566  O O   . LEU A 1 72  ? 22.005  8.321   -5.894  1.00 14.26 ? 72  LEU A O   1 
ATOM   567  C CB  . LEU A 1 72  ? 23.348  10.531  -6.966  1.00 17.31 ? 72  LEU A CB  1 
ATOM   568  C CG  . LEU A 1 72  ? 23.839  11.868  -7.507  1.00 16.36 ? 72  LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 72  ? 24.941  11.630  -8.506  1.00 20.43 ? 72  LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 72  ? 22.691  12.615  -8.141  1.00 15.79 ? 72  LEU A CD2 1 
ATOM   571  N N   . GLN A 1 73  ? 20.272  9.593   -5.224  1.00 12.17 ? 73  GLN A N   1 
ATOM   572  C CA  . GLN A 1 73  ? 19.446  8.476   -4.849  1.00 9.64  ? 73  GLN A CA  1 
ATOM   573  C C   . GLN A 1 73  ? 17.979  8.853   -4.858  1.00 10.59 ? 73  GLN A C   1 
ATOM   574  O O   . GLN A 1 73  ? 17.611  10.000  -4.582  1.00 9.76  ? 73  GLN A O   1 
ATOM   575  C CB  . GLN A 1 73  ? 19.837  8.057   -3.434  1.00 11.03 ? 73  GLN A CB  1 
ATOM   576  C CG  . GLN A 1 73  ? 19.750  9.212   -2.420  1.00 8.45  ? 73  GLN A CG  1 
ATOM   577  C CD  . GLN A 1 73  ? 20.194  8.816   -1.022  1.00 7.48  ? 73  GLN A CD  1 
ATOM   578  O OE1 . GLN A 1 73  ? 21.360  8.520   -0.795  1.00 10.03 ? 73  GLN A OE1 1 
ATOM   579  N NE2 . GLN A 1 73  ? 19.259  8.802   -0.083  1.00 11.15 ? 73  GLN A NE2 1 
ATOM   580  N N   . LEU A 1 74  ? 17.150  7.871   -5.179  1.00 11.48 ? 74  LEU A N   1 
ATOM   581  C CA  . LEU A 1 74  ? 15.709  8.019   -5.171  1.00 9.89  ? 74  LEU A CA  1 
ATOM   582  C C   . LEU A 1 74  ? 15.163  6.632   -4.915  1.00 8.64  ? 74  LEU A C   1 
ATOM   583  O O   . LEU A 1 74  ? 15.868  5.645   -5.042  1.00 6.55  ? 74  LEU A O   1 
ATOM   584  C CB  . LEU A 1 74  ? 15.157  8.570   -6.496  1.00 14.68 ? 74  LEU A CB  1 
ATOM   585  C CG  . LEU A 1 74  ? 15.336  7.887   -7.855  1.00 15.96 ? 74  LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 74  ? 16.767  8.010   -8.242  1.00 14.99 ? 74  LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 74  ? 14.901  6.426   -7.836  1.00 18.54 ? 74  LEU A CD2 1 
ATOM   588  N N   . PHE A 1 75  ? 13.896  6.557   -4.569  1.00 7.51  ? 75  PHE A N   1 
ATOM   589  C CA  . PHE A 1 75  ? 13.299  5.276   -4.272  1.00 7.98  ? 75  PHE A CA  1 
ATOM   590  C C   . PHE A 1 75  ? 11.802  5.352   -4.473  1.00 11.37 ? 75  PHE A C   1 
ATOM   591  O O   . PHE A 1 75  ? 11.239  6.422   -4.685  1.00 10.44 ? 75  PHE A O   1 
ATOM   592  C CB  . PHE A 1 75  ? 13.586  4.892   -2.818  1.00 8.30  ? 75  PHE A CB  1 
ATOM   593  C CG  . PHE A 1 75  ? 12.981  5.835   -1.805  1.00 9.16  ? 75  PHE A CG  1 
ATOM   594  C CD1 . PHE A 1 75  ? 13.534  7.092   -1.580  1.00 8.56  ? 75  PHE A CD1 1 
ATOM   595  C CD2 . PHE A 1 75  ? 11.846  5.469   -1.088  1.00 8.79  ? 75  PHE A CD2 1 
ATOM   596  C CE1 . PHE A 1 75  ? 12.958  7.973   -0.654  1.00 10.42 ? 75  PHE A CE1 1 
ATOM   597  C CE2 . PHE A 1 75  ? 11.271  6.329   -0.175  1.00 12.70 ? 75  PHE A CE2 1 
ATOM   598  C CZ  . PHE A 1 75  ? 11.824  7.591   0.050   1.00 13.11 ? 75  PHE A CZ  1 
ATOM   599  N N   . GLU A 1 76  ? 11.149  4.201   -4.418  1.00 12.45 ? 76  GLU A N   1 
ATOM   600  C CA  . GLU A 1 76  ? 9.724   4.199   -4.549  1.00 11.53 ? 76  GLU A CA  1 
ATOM   601  C C   . GLU A 1 76  ? 9.161   3.296   -3.488  1.00 15.46 ? 76  GLU A C   1 
ATOM   602  O O   . GLU A 1 76  ? 9.876   2.478   -2.898  1.00 15.96 ? 76  GLU A O   1 
ATOM   603  C CB  . GLU A 1 76  ? 9.300   3.772   -5.951  1.00 11.82 ? 76  GLU A CB  1 
ATOM   604  C CG  . GLU A 1 76  ? 9.046   4.981   -6.848  1.00 10.31 ? 76  GLU A CG  1 
ATOM   605  C CD  . GLU A 1 76  ? 7.883   5.856   -6.369  1.00 7.10  ? 76  GLU A CD  1 
ATOM   606  O OE1 . GLU A 1 76  ? 7.771   7.021   -6.787  1.00 10.47 ? 76  GLU A OE1 1 
ATOM   607  O OE2 . GLU A 1 76  ? 7.065   5.367   -5.581  1.00 14.64 ? 76  GLU A OE2 1 
ATOM   608  N N   . GLY A 1 77  ? 7.882   3.463   -3.215  1.00 11.92 ? 77  GLY A N   1 
ATOM   609  C CA  . GLY A 1 77  ? 7.272   2.643   -2.199  1.00 14.78 ? 77  GLY A CA  1 
ATOM   610  C C   . GLY A 1 77  ? 5.883   2.280   -2.624  1.00 14.45 ? 77  GLY A C   1 
ATOM   611  O O   . GLY A 1 77  ? 5.042   3.144   -2.855  1.00 15.58 ? 77  GLY A O   1 
ATOM   612  N N   . MET A 1 78  ? 5.649   0.983   -2.739  1.00 16.09 ? 78  MET A N   1 
ATOM   613  C CA  . MET A 1 78  ? 4.351   0.486   -3.152  1.00 15.46 ? 78  MET A CA  1 
ATOM   614  C C   . MET A 1 78  ? 4.094   -0.825  -2.453  1.00 14.31 ? 78  MET A C   1 
ATOM   615  O O   . MET A 1 78  ? 5.011   -1.414  -1.882  1.00 12.64 ? 78  MET A O   1 
ATOM   616  C CB  . MET A 1 78  ? 4.328   0.301   -4.659  1.00 20.37 ? 78  MET A CB  1 
ATOM   617  C CG  . MET A 1 78  ? 5.609   -0.282  -5.245  1.00 19.03 ? 78  MET A CG  1 
ATOM   618  S SD  . MET A 1 78  ? 5.406   -0.495  -7.021  1.00 26.11 ? 78  MET A SD  1 
ATOM   619  C CE  . MET A 1 78  ? 7.037   -1.163  -7.469  1.00 25.26 ? 78  MET A CE  1 
ATOM   620  N N   . LYS A 1 79  ? 2.843   -1.262  -2.497  1.00 9.86  ? 79  LYS A N   1 
ATOM   621  C CA  . LYS A 1 79  ? 2.442   -2.489  -1.865  1.00 10.17 ? 79  LYS A CA  1 
ATOM   622  C C   . LYS A 1 79  ? 1.815   -3.540  -2.770  1.00 14.62 ? 79  LYS A C   1 
ATOM   623  O O   . LYS A 1 79  ? 1.136   -3.239  -3.757  1.00 16.36 ? 79  LYS A O   1 
ATOM   624  C CB  . LYS A 1 79  ? 1.473   -2.195  -0.732  1.00 10.55 ? 79  LYS A CB  1 
ATOM   625  C CG  . LYS A 1 79  ? 2.089   -1.480  0.408   1.00 6.90  ? 79  LYS A CG  1 
ATOM   626  C CD  . LYS A 1 79  ? 1.143   -1.523  1.560   1.00 13.38 ? 79  LYS A CD  1 
ATOM   627  C CE  . LYS A 1 79  ? 1.777   -0.998  2.817   1.00 10.26 ? 79  LYS A CE  1 
ATOM   628  N NZ  . LYS A 1 79  ? 0.805   -1.149  3.920   1.00 18.34 ? 79  LYS A NZ  1 
ATOM   629  N N   . ALA A 1 80  ? 2.053   -4.787  -2.393  1.00 15.99 ? 80  ALA A N   1 
ATOM   630  C CA  . ALA A 1 80  ? 1.518   -5.946  -3.074  1.00 15.27 ? 80  ALA A CA  1 
ATOM   631  C C   . ALA A 1 80  ? 0.677   -6.563  -1.974  1.00 11.89 ? 80  ALA A C   1 
ATOM   632  O O   . ALA A 1 80  ? 1.099   -6.574  -0.819  1.00 14.97 ? 80  ALA A O   1 
ATOM   633  C CB  . ALA A 1 80  ? 2.643   -6.886  -3.482  1.00 12.43 ? 80  ALA A CB  1 
ATOM   634  N N   . PHE A 1 81  ? -0.508  -7.048  -2.324  1.00 13.09 ? 81  PHE A N   1 
ATOM   635  C CA  . PHE A 1 81  ? -1.425  -7.657  -1.351  1.00 11.72 ? 81  PHE A CA  1 
ATOM   636  C C   . PHE A 1 81  ? -1.839  -9.062  -1.756  1.00 11.05 ? 81  PHE A C   1 
ATOM   637  O O   . PHE A 1 81  ? -2.074  -9.347  -2.931  1.00 9.73  ? 81  PHE A O   1 
ATOM   638  C CB  . PHE A 1 81  ? -2.705  -6.836  -1.190  1.00 8.95  ? 81  PHE A CB  1 
ATOM   639  C CG  . PHE A 1 81  ? -2.478  -5.368  -0.994  1.00 10.20 ? 81  PHE A CG  1 
ATOM   640  C CD1 . PHE A 1 81  ? -2.281  -4.531  -2.086  1.00 8.96  ? 81  PHE A CD1 1 
ATOM   641  C CD2 . PHE A 1 81  ? -2.508  -4.814  0.284   1.00 13.00 ? 81  PHE A CD2 1 
ATOM   642  C CE1 . PHE A 1 81  ? -2.125  -3.152  -1.914  1.00 11.10 ? 81  PHE A CE1 1 
ATOM   643  C CE2 . PHE A 1 81  ? -2.352  -3.440  0.471   1.00 14.87 ? 81  PHE A CE2 1 
ATOM   644  C CZ  . PHE A 1 81  ? -2.162  -2.607  -0.638  1.00 11.52 ? 81  PHE A CZ  1 
ATOM   645  N N   . LYS A 1 82  ? -1.927  -9.932  -0.763  1.00 10.74 ? 82  LYS A N   1 
ATOM   646  C CA  . LYS A 1 82  ? -2.344  -11.293 -1.007  1.00 13.64 ? 82  LYS A CA  1 
ATOM   647  C C   . LYS A 1 82  ? -3.768  -11.452 -0.521  1.00 14.80 ? 82  LYS A C   1 
ATOM   648  O O   . LYS A 1 82  ? -4.067  -11.179 0.639   1.00 14.50 ? 82  LYS A O   1 
ATOM   649  C CB  . LYS A 1 82  ? -1.441  -12.279 -0.277  1.00 14.44 ? 82  LYS A CB  1 
ATOM   650  C CG  . LYS A 1 82  ? -1.904  -13.714 -0.392  1.00 17.24 ? 82  LYS A CG  1 
ATOM   651  C CD  . LYS A 1 82  ? -0.745  -14.638 -0.744  1.00 21.25 ? 82  LYS A CD  1 
ATOM   652  C CE  . LYS A 1 82  ? 0.308   -14.616 0.333   1.00 20.95 ? 82  LYS A CE  1 
ATOM   653  N NZ  . LYS A 1 82  ? 1.522   -15.386 -0.047  1.00 18.12 ? 82  LYS A NZ  1 
ATOM   654  N N   . GLY A 1 83  ? -4.653  -11.846 -1.430  1.00 19.26 ? 83  GLY A N   1 
ATOM   655  C CA  . GLY A 1 83  ? -6.040  -12.062 -1.068  1.00 20.24 ? 83  GLY A CA  1 
ATOM   656  C C   . GLY A 1 83  ? -6.206  -13.440 -0.434  1.00 22.62 ? 83  GLY A C   1 
ATOM   657  O O   . GLY A 1 83  ? -5.269  -14.229 -0.348  1.00 20.80 ? 83  GLY A O   1 
ATOM   658  N N   . LYS A 1 84  ? -7.421  -13.717 0.016   1.00 23.83 ? 84  LYS A N   1 
ATOM   659  C CA  . LYS A 1 84  ? -7.756  -14.971 0.643   1.00 22.35 ? 84  LYS A CA  1 
ATOM   660  C C   . LYS A 1 84  ? -7.508  -16.159 -0.292  1.00 20.50 ? 84  LYS A C   1 
ATOM   661  O O   . LYS A 1 84  ? -7.260  -17.274 0.168   1.00 21.90 ? 84  LYS A O   1 
ATOM   662  C CB  . LYS A 1 84  ? -9.225  -14.918 1.097   1.00 26.11 ? 84  LYS A CB  1 
ATOM   663  C CG  . LYS A 1 84  ? -10.197 -14.267 0.081   1.00 32.43 ? 84  LYS A CG  1 
ATOM   664  C CD  . LYS A 1 84  ? -10.587 -12.795 0.419   1.00 34.85 ? 84  LYS A CD  1 
ATOM   665  C CE  . LYS A 1 84  ? -9.434  -11.781 0.227   1.00 34.60 ? 84  LYS A CE  1 
ATOM   666  N NZ  . LYS A 1 84  ? -9.600  -10.602 1.164   1.00 32.45 ? 84  LYS A NZ  1 
ATOM   667  N N   . ASP A 1 85  ? -7.585  -15.931 -1.598  1.00 17.69 ? 85  ASP A N   1 
ATOM   668  C CA  . ASP A 1 85  ? -7.340  -17.005 -2.548  1.00 18.24 ? 85  ASP A CA  1 
ATOM   669  C C   . ASP A 1 85  ? -5.859  -16.975 -2.881  1.00 20.19 ? 85  ASP A C   1 
ATOM   670  O O   . ASP A 1 85  ? -5.416  -17.404 -3.942  1.00 19.81 ? 85  ASP A O   1 
ATOM   671  C CB  . ASP A 1 85  ? -8.156  -16.818 -3.804  1.00 20.12 ? 85  ASP A CB  1 
ATOM   672  C CG  . ASP A 1 85  ? -7.702  -15.631 -4.617  1.00 25.01 ? 85  ASP A CG  1 
ATOM   673  O OD1 . ASP A 1 85  ? -8.177  -15.522 -5.774  1.00 31.96 ? 85  ASP A OD1 1 
ATOM   674  O OD2 . ASP A 1 85  ? -6.888  -14.808 -4.119  1.00 25.79 ? 85  ASP A OD2 1 
ATOM   675  N N   . GLN A 1 86  ? -5.100  -16.416 -1.953  1.00 21.10 ? 86  GLN A N   1 
ATOM   676  C CA  . GLN A 1 86  ? -3.662  -16.338 -2.063  1.00 22.70 ? 86  GLN A CA  1 
ATOM   677  C C   . GLN A 1 86  ? -3.046  -15.844 -3.387  1.00 22.43 ? 86  GLN A C   1 
ATOM   678  O O   . GLN A 1 86  ? -1.886  -16.160 -3.675  1.00 20.54 ? 86  GLN A O   1 
ATOM   679  C CB  . GLN A 1 86  ? -3.068  -17.704 -1.667  1.00 24.41 ? 86  GLN A CB  1 
ATOM   680  C CG  . GLN A 1 86  ? -3.545  -18.211 -0.318  1.00 26.10 ? 86  GLN A CG  1 
ATOM   681  C CD  . GLN A 1 86  ? -2.786  -19.461 0.131   1.00 31.05 ? 86  GLN A CD  1 
ATOM   682  O OE1 . GLN A 1 86  ? -1.787  -19.847 -0.491  1.00 31.96 ? 86  GLN A OE1 1 
ATOM   683  N NE2 . GLN A 1 86  ? -3.246  -20.089 1.220   1.00 27.93 ? 86  GLN A NE2 1 
ATOM   684  N N   . GLN A 1 87  ? -3.819  -15.095 -4.185  1.00 22.59 ? 87  GLN A N   1 
ATOM   685  C CA  . GLN A 1 87  ? -3.319  -14.481 -5.415  1.00 21.58 ? 87  GLN A CA  1 
ATOM   686  C C   . GLN A 1 87  ? -2.786  -13.104 -4.949  1.00 21.21 ? 87  GLN A C   1 
ATOM   687  O O   . GLN A 1 87  ? -3.445  -12.392 -4.193  1.00 23.09 ? 87  GLN A O   1 
ATOM   688  C CB  . GLN A 1 87  ? -4.456  -14.329 -6.454  1.00 27.10 ? 87  GLN A CB  1 
ATOM   689  C CG  . GLN A 1 87  ? -4.274  -13.233 -7.575  1.00 33.31 ? 87  GLN A CG  1 
ATOM   690  C CD  . GLN A 1 87  ? -3.274  -13.577 -8.724  1.00 34.45 ? 87  GLN A CD  1 
ATOM   691  O OE1 . GLN A 1 87  ? -3.482  -14.528 -9.497  1.00 35.23 ? 87  GLN A OE1 1 
ATOM   692  N NE2 . GLN A 1 87  ? -2.200  -12.784 -8.838  1.00 33.11 ? 87  GLN A NE2 1 
ATOM   693  N N   . VAL A 1 88  ? -1.575  -12.759 -5.370  1.00 20.97 ? 88  VAL A N   1 
ATOM   694  C CA  . VAL A 1 88  ? -0.918  -11.507 -4.993  1.00 15.83 ? 88  VAL A CA  1 
ATOM   695  C C   . VAL A 1 88  ? -1.136  -10.417 -6.037  1.00 17.45 ? 88  VAL A C   1 
ATOM   696  O O   . VAL A 1 88  ? -1.096  -10.682 -7.240  1.00 16.59 ? 88  VAL A O   1 
ATOM   697  C CB  . VAL A 1 88  ? 0.573   -11.760 -4.793  1.00 14.63 ? 88  VAL A CB  1 
ATOM   698  C CG1 . VAL A 1 88  ? 1.323   -10.464 -4.492  1.00 13.23 ? 88  VAL A CG1 1 
ATOM   699  C CG2 . VAL A 1 88  ? 0.744   -12.748 -3.669  1.00 13.87 ? 88  VAL A CG2 1 
ATOM   700  N N   . ARG A 1 89  ? -1.352  -9.191  -5.562  1.00 17.50 ? 89  ARG A N   1 
ATOM   701  C CA  . ARG A 1 89  ? -1.627  -8.047  -6.430  1.00 19.54 ? 89  ARG A CA  1 
ATOM   702  C C   . ARG A 1 89  ? -0.984  -6.722  -6.021  1.00 19.48 ? 89  ARG A C   1 
ATOM   703  O O   . ARG A 1 89  ? -0.929  -6.395  -4.841  1.00 17.33 ? 89  ARG A O   1 
ATOM   704  C CB  . ARG A 1 89  ? -3.127  -7.810  -6.477  1.00 21.81 ? 89  ARG A CB  1 
ATOM   705  C CG  . ARG A 1 89  ? -3.824  -8.423  -7.627  1.00 26.88 ? 89  ARG A CG  1 
ATOM   706  C CD  . ARG A 1 89  ? -5.277  -8.729  -7.261  1.00 25.46 ? 89  ARG A CD  1 
ATOM   707  N NE  . ARG A 1 89  ? -5.403  -10.052 -6.681  1.00 29.64 ? 89  ARG A NE  1 
ATOM   708  C CZ  . ARG A 1 89  ? -6.561  -10.659 -6.483  1.00 29.76 ? 89  ARG A CZ  1 
ATOM   709  N NH1 . ARG A 1 89  ? -7.686  -10.057 -6.813  1.00 34.36 ? 89  ARG A NH1 1 
ATOM   710  N NH2 . ARG A 1 89  ? -6.592  -11.870 -5.963  1.00 31.28 ? 89  ARG A NH2 1 
ATOM   711  N N   . LEU A 1 90  ? -0.538  -5.948  -7.008  1.00 17.19 ? 90  LEU A N   1 
ATOM   712  C CA  . LEU A 1 90  ? 0.044   -4.642  -6.733  1.00 16.55 ? 90  LEU A CA  1 
ATOM   713  C C   . LEU A 1 90  ? -1.021  -3.536  -6.887  1.00 15.88 ? 90  LEU A C   1 
ATOM   714  O O   . LEU A 1 90  ? -2.000  -3.693  -7.609  1.00 17.28 ? 90  LEU A O   1 
ATOM   715  C CB  . LEU A 1 90  ? 1.181   -4.356  -7.693  1.00 17.01 ? 90  LEU A CB  1 
ATOM   716  C CG  . LEU A 1 90  ? 2.470   -5.132  -7.547  1.00 17.28 ? 90  LEU A CG  1 
ATOM   717  C CD1 . LEU A 1 90  ? 3.506   -4.476  -8.423  1.00 17.26 ? 90  LEU A CD1 1 
ATOM   718  C CD2 . LEU A 1 90  ? 2.932   -5.087  -6.134  1.00 24.02 ? 90  LEU A CD2 1 
ATOM   719  N N   . PHE A 1 91  ? -0.829  -2.411  -6.212  1.00 14.88 ? 91  PHE A N   1 
ATOM   720  C CA  . PHE A 1 91  ? -1.788  -1.321  -6.313  1.00 14.56 ? 91  PHE A CA  1 
ATOM   721  C C   . PHE A 1 91  ? -1.318  -0.222  -7.238  1.00 13.43 ? 91  PHE A C   1 
ATOM   722  O O   . PHE A 1 91  ? -0.432  0.544   -6.891  1.00 14.31 ? 91  PHE A O   1 
ATOM   723  C CB  . PHE A 1 91  ? -2.051  -0.721  -4.948  1.00 11.89 ? 91  PHE A CB  1 
ATOM   724  C CG  . PHE A 1 91  ? -3.007  0.414   -4.977  1.00 13.13 ? 91  PHE A CG  1 
ATOM   725  C CD1 . PHE A 1 91  ? -4.328  0.215   -5.348  1.00 11.66 ? 91  PHE A CD1 1 
ATOM   726  C CD2 . PHE A 1 91  ? -2.594  1.687   -4.633  1.00 14.94 ? 91  PHE A CD2 1 
ATOM   727  C CE1 . PHE A 1 91  ? -5.225  1.268   -5.375  1.00 14.56 ? 91  PHE A CE1 1 
ATOM   728  C CE2 . PHE A 1 91  ? -3.488  2.759   -4.656  1.00 14.30 ? 91  PHE A CE2 1 
ATOM   729  C CZ  . PHE A 1 91  ? -4.805  2.546   -5.030  1.00 16.94 ? 91  PHE A CZ  1 
ATOM   730  N N   . ARG A 1 92  ? -1.926  -0.157  -8.414  1.00 11.98 ? 92  ARG A N   1 
ATOM   731  C CA  . ARG A 1 92  ? -1.591  0.841   -9.411  1.00 12.25 ? 92  ARG A CA  1 
ATOM   732  C C   . ARG A 1 92  ? -0.066  1.034   -9.512  1.00 13.57 ? 92  ARG A C   1 
ATOM   733  O O   . ARG A 1 92  ? 0.442   2.140   -9.426  1.00 13.53 ? 92  ARG A O   1 
ATOM   734  C CB  . ARG A 1 92  ? -2.280  2.156   -9.052  1.00 11.61 ? 92  ARG A CB  1 
ATOM   735  C CG  . ARG A 1 92  ? -3.752  2.009   -8.693  1.00 7.62  ? 92  ARG A CG  1 
ATOM   736  C CD  . ARG A 1 92  ? -4.434  3.360   -8.563  1.00 8.43  ? 92  ARG A CD  1 
ATOM   737  N NE  . ARG A 1 92  ? -4.427  4.092   -9.819  1.00 6.74  ? 92  ARG A NE  1 
ATOM   738  C CZ  . ARG A 1 92  ? -5.045  5.243   -10.027 1.00 8.07  ? 92  ARG A CZ  1 
ATOM   739  N NH1 . ARG A 1 92  ? -5.730  5.824   -9.058  1.00 13.19 ? 92  ARG A NH1 1 
ATOM   740  N NH2 . ARG A 1 92  ? -5.001  5.793   -11.218 1.00 8.87  ? 92  ARG A NH2 1 
ATOM   741  N N   . PRO A 1 93  ? 0.669   -0.060  -9.735  1.00 14.32 ? 93  PRO A N   1 
ATOM   742  C CA  . PRO A 1 93  ? 2.128   -0.068  -9.848  1.00 12.90 ? 93  PRO A CA  1 
ATOM   743  C C   . PRO A 1 93  ? 2.636   0.900   -10.903 1.00 13.95 ? 93  PRO A C   1 
ATOM   744  O O   . PRO A 1 93  ? 3.748   1.401   -10.803 1.00 18.47 ? 93  PRO A O   1 
ATOM   745  C CB  . PRO A 1 93  ? 2.452   -1.513  -10.233 1.00 10.42 ? 93  PRO A CB  1 
ATOM   746  C CG  . PRO A 1 93  ? 1.181   -2.278  -9.939  1.00 13.21 ? 93  PRO A CG  1 
ATOM   747  C CD  . PRO A 1 93  ? 0.096   -1.328  -10.230 1.00 9.57  ? 93  PRO A CD  1 
ATOM   748  N N   . TRP A 1 94  ? 1.825   1.139   -11.921 1.00 14.01 ? 94  TRP A N   1 
ATOM   749  C CA  . TRP A 1 94  ? 2.186   2.040   -13.008 1.00 13.87 ? 94  TRP A CA  1 
ATOM   750  C C   . TRP A 1 94  ? 2.460   3.478   -12.535 1.00 13.85 ? 94  TRP A C   1 
ATOM   751  O O   . TRP A 1 94  ? 3.462   4.095   -12.915 1.00 10.03 ? 94  TRP A O   1 
ATOM   752  C CB  . TRP A 1 94  ? 1.077   2.017   -14.030 1.00 11.88 ? 94  TRP A CB  1 
ATOM   753  C CG  . TRP A 1 94  ? 0.594   0.638   -14.282 1.00 13.84 ? 94  TRP A CG  1 
ATOM   754  C CD1 . TRP A 1 94  ? 1.211   -0.320  -15.026 1.00 15.93 ? 94  TRP A CD1 1 
ATOM   755  C CD2 . TRP A 1 94  ? -0.602  0.042   -13.769 1.00 11.80 ? 94  TRP A CD2 1 
ATOM   756  N NE1 . TRP A 1 94  ? 0.479   -1.482  -15.014 1.00 17.45 ? 94  TRP A NE1 1 
ATOM   757  C CE2 . TRP A 1 94  ? -0.643  -1.288  -14.252 1.00 17.02 ? 94  TRP A CE2 1 
ATOM   758  C CE3 . TRP A 1 94  ? -1.643  0.503   -12.952 1.00 14.15 ? 94  TRP A CE3 1 
ATOM   759  C CZ2 . TRP A 1 94  ? -1.694  -2.171  -13.942 1.00 19.06 ? 94  TRP A CZ2 1 
ATOM   760  C CZ3 . TRP A 1 94  ? -2.688  -0.362  -12.638 1.00 13.62 ? 94  TRP A CZ3 1 
ATOM   761  C CH2 . TRP A 1 94  ? -2.709  -1.691  -13.136 1.00 18.94 ? 94  TRP A CH2 1 
ATOM   762  N N   . LEU A 1 95  ? 1.585   4.014   -11.699 1.00 13.28 ? 95  LEU A N   1 
ATOM   763  C CA  . LEU A 1 95  ? 1.791   5.365   -11.193 1.00 13.76 ? 95  LEU A CA  1 
ATOM   764  C C   . LEU A 1 95  ? 3.151   5.487   -10.476 1.00 14.90 ? 95  LEU A C   1 
ATOM   765  O O   . LEU A 1 95  ? 3.800   6.536   -10.522 1.00 15.21 ? 95  LEU A O   1 
ATOM   766  C CB  . LEU A 1 95  ? 0.633   5.733   -10.262 1.00 14.67 ? 95  LEU A CB  1 
ATOM   767  C CG  . LEU A 1 95  ? -0.723  5.892   -10.986 1.00 13.52 ? 95  LEU A CG  1 
ATOM   768  C CD1 . LEU A 1 95  ? -1.821  6.195   -9.992  1.00 15.53 ? 95  LEU A CD1 1 
ATOM   769  C CD2 . LEU A 1 95  ? -0.651  7.021   -11.999 1.00 12.90 ? 95  LEU A CD2 1 
ATOM   770  N N   . ASN A 1 96  ? 3.585   4.397   -9.840  1.00 14.92 ? 96  ASN A N   1 
ATOM   771  C CA  . ASN A 1 96  ? 4.856   4.372   -9.132  1.00 12.14 ? 96  ASN A CA  1 
ATOM   772  C C   . ASN A 1 96  ? 6.008   4.362   -10.113 1.00 12.34 ? 96  ASN A C   1 
ATOM   773  O O   . ASN A 1 96  ? 7.003   5.047   -9.911  1.00 11.31 ? 96  ASN A O   1 
ATOM   774  C CB  . ASN A 1 96  ? 4.943   3.157   -8.223  1.00 12.02 ? 96  ASN A CB  1 
ATOM   775  C CG  . ASN A 1 96  ? 4.177   3.345   -6.949  1.00 15.16 ? 96  ASN A CG  1 
ATOM   776  O OD1 . ASN A 1 96  ? 4.609   4.070   -6.049  1.00 17.59 ? 96  ASN A OD1 1 
ATOM   777  N ND2 . ASN A 1 96  ? 3.027   2.710   -6.859  1.00 14.93 ? 96  ASN A ND2 1 
ATOM   778  N N   . MET A 1 97  ? 5.868   3.587   -11.179 1.00 9.70  ? 97  MET A N   1 
ATOM   779  C CA  . MET A 1 97  ? 6.904   3.541   -12.194 1.00 12.97 ? 97  MET A CA  1 
ATOM   780  C C   . MET A 1 97  ? 7.101   4.939   -12.781 1.00 12.50 ? 97  MET A C   1 
ATOM   781  O O   . MET A 1 97  ? 8.230   5.396   -12.964 1.00 13.36 ? 97  MET A O   1 
ATOM   782  C CB  . MET A 1 97  ? 6.511   2.550   -13.285 1.00 12.75 ? 97  MET A CB  1 
ATOM   783  C CG  . MET A 1 97  ? 6.487   1.126   -12.806 1.00 13.93 ? 97  MET A CG  1 
ATOM   784  S SD  . MET A 1 97  ? 8.144   0.549   -12.318 1.00 15.64 ? 97  MET A SD  1 
ATOM   785  C CE  . MET A 1 97  ? 8.063   0.779   -10.550 1.00 12.63 ? 97  MET A CE  1 
ATOM   786  N N   . ASP A 1 98  ? 5.982   5.602   -13.072 1.00 16.09 ? 98  ASP A N   1 
ATOM   787  C CA  . ASP A 1 98  ? 5.980   6.947   -13.624 1.00 17.91 ? 98  ASP A CA  1 
ATOM   788  C C   . ASP A 1 98  ? 6.781   7.859   -12.724 1.00 17.79 ? 98  ASP A C   1 
ATOM   789  O O   . ASP A 1 98  ? 7.710   8.532   -13.161 1.00 21.42 ? 98  ASP A O   1 
ATOM   790  C CB  . ASP A 1 98  ? 4.553   7.528   -13.688 1.00 19.01 ? 98  ASP A CB  1 
ATOM   791  C CG  . ASP A 1 98  ? 3.667   6.851   -14.716 1.00 20.04 ? 98  ASP A CG  1 
ATOM   792  O OD1 . ASP A 1 98  ? 4.181   6.175   -15.634 1.00 16.98 ? 98  ASP A OD1 1 
ATOM   793  O OD2 . ASP A 1 98  ? 2.443   7.024   -14.598 1.00 16.60 ? 98  ASP A OD2 1 
ATOM   794  N N   . ARG A 1 99  ? 6.397   7.879   -11.455 1.00 16.60 ? 99  ARG A N   1 
ATOM   795  C CA  . ARG A 1 99  ? 7.033   8.735   -10.472 1.00 13.38 ? 99  ARG A CA  1 
ATOM   796  C C   . ARG A 1 99  ? 8.505   8.445   -10.352 1.00 14.20 ? 99  ARG A C   1 
ATOM   797  O O   . ARG A 1 99  ? 9.318   9.364   -10.276 1.00 14.97 ? 99  ARG A O   1 
ATOM   798  C CB  . ARG A 1 99  ? 6.344   8.553   -9.126  1.00 15.02 ? 99  ARG A CB  1 
ATOM   799  C CG  . ARG A 1 99  ? 6.636   9.659   -8.151  1.00 15.23 ? 99  ARG A CG  1 
ATOM   800  C CD  . ARG A 1 99  ? 5.630   9.656   -7.029  1.00 16.01 ? 99  ARG A CD  1 
ATOM   801  N NE  . ARG A 1 99  ? 5.722   8.455   -6.214  1.00 15.33 ? 99  ARG A NE  1 
ATOM   802  C CZ  . ARG A 1 99  ? 4.903   8.181   -5.215  1.00 13.56 ? 99  ARG A CZ  1 
ATOM   803  N NH1 . ARG A 1 99  ? 3.919   9.024   -4.913  1.00 14.04 ? 99  ARG A NH1 1 
ATOM   804  N NH2 . ARG A 1 99  ? 5.088   7.078   -4.508  1.00 12.50 ? 99  ARG A NH2 1 
ATOM   805  N N   . MET A 1 100 ? 8.850   7.168   -10.335 1.00 11.44 ? 100 MET A N   1 
ATOM   806  C CA  . MET A 1 100 ? 10.242  6.795   -10.211 1.00 13.40 ? 100 MET A CA  1 
ATOM   807  C C   . MET A 1 100 ? 10.996  7.402   -11.389 1.00 14.11 ? 100 MET A C   1 
ATOM   808  O O   . MET A 1 100 ? 12.014  8.067   -11.233 1.00 13.42 ? 100 MET A O   1 
ATOM   809  C CB  . MET A 1 100 ? 10.382  5.271   -10.236 1.00 10.65 ? 100 MET A CB  1 
ATOM   810  C CG  . MET A 1 100 ? 11.779  4.816   -9.941  1.00 12.38 ? 100 MET A CG  1 
ATOM   811  S SD  . MET A 1 100 ? 11.929  3.057   -9.780  1.00 13.66 ? 100 MET A SD  1 
ATOM   812  C CE  . MET A 1 100 ? 13.674  2.860   -9.652  1.00 13.23 ? 100 MET A CE  1 
ATOM   813  N N   . LEU A 1 101 ? 10.452  7.192   -12.577 1.00 15.90 ? 101 LEU A N   1 
ATOM   814  C CA  . LEU A 1 101 ? 11.081  7.702   -13.768 1.00 19.59 ? 101 LEU A CA  1 
ATOM   815  C C   . LEU A 1 101 ? 11.282  9.221   -13.684 1.00 18.82 ? 101 LEU A C   1 
ATOM   816  O O   . LEU A 1 101 ? 12.328  9.745   -14.070 1.00 19.53 ? 101 LEU A O   1 
ATOM   817  C CB  . LEU A 1 101 ? 10.234  7.306   -14.965 1.00 20.12 ? 101 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 101 ? 11.015  7.110   -16.254 1.00 26.27 ? 101 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 101 ? 12.335  6.342   -15.972 1.00 24.44 ? 101 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 101 ? 10.131  6.344   -17.247 1.00 21.63 ? 101 LEU A CD2 1 
ATOM   821  N N   . ARG A 1 102 ? 10.285  9.925   -13.185 1.00 17.56 ? 102 ARG A N   1 
ATOM   822  C CA  . ARG A 1 102 ? 10.386  11.370  -13.111 1.00 18.63 ? 102 ARG A CA  1 
ATOM   823  C C   . ARG A 1 102 ? 11.497  11.791  -12.163 1.00 17.04 ? 102 ARG A C   1 
ATOM   824  O O   . ARG A 1 102 ? 12.232  12.733  -12.461 1.00 19.18 ? 102 ARG A O   1 
ATOM   825  C CB  . ARG A 1 102 ? 9.067   12.002  -12.659 1.00 19.73 ? 102 ARG A CB  1 
ATOM   826  C CG  . ARG A 1 102 ? 7.945   11.975  -13.678 1.00 24.43 ? 102 ARG A CG  1 
ATOM   827  C CD  . ARG A 1 102 ? 6.893   13.031  -13.288 1.00 27.16 ? 102 ARG A CD  1 
ATOM   828  N NE  . ARG A 1 102 ? 6.512   12.918  -11.877 1.00 31.31 ? 102 ARG A NE  1 
ATOM   829  C CZ  . ARG A 1 102 ? 6.602   13.897  -10.976 1.00 32.41 ? 102 ARG A CZ  1 
ATOM   830  N NH1 . ARG A 1 102 ? 7.057   15.104  -11.319 1.00 35.37 ? 102 ARG A NH1 1 
ATOM   831  N NH2 . ARG A 1 102 ? 6.271   13.654  -9.710  1.00 31.87 ? 102 ARG A NH2 1 
ATOM   832  N N   . SER A 1 103 ? 11.613  11.100  -11.026 1.00 16.63 ? 103 SER A N   1 
ATOM   833  C CA  . SER A 1 103 ? 12.659  11.390  -10.042 1.00 13.69 ? 103 SER A CA  1 
ATOM   834  C C   . SER A 1 103 ? 14.004  11.117  -10.701 1.00 15.47 ? 103 SER A C   1 
ATOM   835  O O   . SER A 1 103 ? 14.953  11.902  -10.573 1.00 13.62 ? 103 SER A O   1 
ATOM   836  C CB  . SER A 1 103 ? 12.512  10.485  -8.838  1.00 10.95 ? 103 SER A CB  1 
ATOM   837  O OG  . SER A 1 103 ? 11.187  10.524  -8.381  1.00 15.02 ? 103 SER A OG  1 
ATOM   838  N N   . ALA A 1 104 ? 14.060  10.000  -11.421 1.00 12.63 ? 104 ALA A N   1 
ATOM   839  C CA  . ALA A 1 104 ? 15.260  9.599   -12.104 1.00 13.43 ? 104 ALA A CA  1 
ATOM   840  C C   . ALA A 1 104 ? 15.786  10.711  -13.015 1.00 13.60 ? 104 ALA A C   1 
ATOM   841  O O   . ALA A 1 104 ? 16.992  10.922  -13.122 1.00 15.90 ? 104 ALA A O   1 
ATOM   842  C CB  . ALA A 1 104 ? 14.977  8.359   -12.910 1.00 16.10 ? 104 ALA A CB  1 
ATOM   843  N N   . MET A 1 105 ? 14.873  11.435  -13.652 1.00 15.31 ? 105 MET A N   1 
ATOM   844  C CA  . MET A 1 105 ? 15.245  12.496  -14.575 1.00 14.84 ? 105 MET A CA  1 
ATOM   845  C C   . MET A 1 105 ? 15.700  13.754  -13.866 1.00 16.44 ? 105 MET A C   1 
ATOM   846  O O   . MET A 1 105 ? 16.574  14.480  -14.338 1.00 14.64 ? 105 MET A O   1 
ATOM   847  C CB  . MET A 1 105 ? 14.070  12.830  -15.509 1.00 18.58 ? 105 MET A CB  1 
ATOM   848  C CG  . MET A 1 105 ? 13.531  11.659  -16.328 1.00 20.27 ? 105 MET A CG  1 
ATOM   849  S SD  . MET A 1 105 ? 14.886  10.672  -16.988 1.00 27.24 ? 105 MET A SD  1 
ATOM   850  C CE  . MET A 1 105 ? 15.511  11.827  -18.177 1.00 29.52 ? 105 MET A CE  1 
ATOM   851  N N   . ARG A 1 106 ? 15.118  14.007  -12.712 1.00 15.06 ? 106 ARG A N   1 
ATOM   852  C CA  . ARG A 1 106 ? 15.478  15.197  -11.983 1.00 15.30 ? 106 ARG A CA  1 
ATOM   853  C C   . ARG A 1 106 ? 16.919  15.159  -11.480 1.00 13.55 ? 106 ARG A C   1 
ATOM   854  O O   . ARG A 1 106 ? 17.561  16.200  -11.308 1.00 13.41 ? 106 ARG A O   1 
ATOM   855  C CB  . ARG A 1 106 ? 14.499  15.391  -10.819 1.00 15.82 ? 106 ARG A CB  1 
ATOM   856  C CG  . ARG A 1 106 ? 14.689  16.692  -10.107 1.00 17.69 ? 106 ARG A CG  1 
ATOM   857  C CD  . ARG A 1 106 ? 15.060  17.756  -11.117 1.00 22.58 ? 106 ARG A CD  1 
ATOM   858  N NE  . ARG A 1 106 ? 16.147  18.588  -10.610 1.00 25.94 ? 106 ARG A NE  1 
ATOM   859  C CZ  . ARG A 1 106 ? 15.986  19.409  -9.591  1.00 22.03 ? 106 ARG A CZ  1 
ATOM   860  N NH1 . ARG A 1 106 ? 14.809  19.487  -9.004  1.00 28.46 ? 106 ARG A NH1 1 
ATOM   861  N NH2 . ARG A 1 106 ? 16.974  20.150  -9.174  1.00 28.49 ? 106 ARG A NH2 1 
ATOM   862  N N   . LEU A 1 107 ? 17.425  13.952  -11.273 1.00 10.94 ? 107 LEU A N   1 
ATOM   863  C CA  . LEU A 1 107 ? 18.764  13.768  -10.763 1.00 11.35 ? 107 LEU A CA  1 
ATOM   864  C C   . LEU A 1 107 ? 19.748  13.309  -11.826 1.00 14.54 ? 107 LEU A C   1 
ATOM   865  O O   . LEU A 1 107 ? 20.829  12.838  -11.512 1.00 14.92 ? 107 LEU A O   1 
ATOM   866  C CB  . LEU A 1 107 ? 18.744  12.753  -9.632  1.00 10.53 ? 107 LEU A CB  1 
ATOM   867  C CG  . LEU A 1 107 ? 17.987  13.144  -8.363  1.00 11.86 ? 107 LEU A CG  1 
ATOM   868  C CD1 . LEU A 1 107 ? 18.246  12.110  -7.300  1.00 11.93 ? 107 LEU A CD1 1 
ATOM   869  C CD2 . LEU A 1 107 ? 18.455  14.492  -7.857  1.00 12.60 ? 107 LEU A CD2 1 
ATOM   870  N N   . CYS A 1 108 ? 19.351  13.450  -13.085 1.00 18.00 ? 108 CYS A N   1 
ATOM   871  C CA  . CYS A 1 108 ? 20.160  13.065  -14.238 1.00 16.88 ? 108 CYS A CA  1 
ATOM   872  C C   . CYS A 1 108 ? 20.587  11.612  -14.206 1.00 19.46 ? 108 CYS A C   1 
ATOM   873  O O   . CYS A 1 108 ? 21.661  11.274  -14.701 1.00 17.32 ? 108 CYS A O   1 
ATOM   874  C CB  . CYS A 1 108 ? 21.398  13.961  -14.356 1.00 16.82 ? 108 CYS A CB  1 
ATOM   875  S SG  . CYS A 1 108 ? 20.995  15.714  -14.613 1.00 19.01 ? 108 CYS A SG  1 
ATOM   876  N N   . LEU A 1 109 ? 19.764  10.756  -13.611 1.00 17.33 ? 109 LEU A N   1 
ATOM   877  C CA  . LEU A 1 109 ? 20.080  9.338   -13.574 1.00 20.36 ? 109 LEU A CA  1 
ATOM   878  C C   . LEU A 1 109 ? 19.526  8.709   -14.851 1.00 20.12 ? 109 LEU A C   1 
ATOM   879  O O   . LEU A 1 109 ? 18.641  9.289   -15.488 1.00 23.85 ? 109 LEU A O   1 
ATOM   880  C CB  . LEU A 1 109 ? 19.485  8.710   -12.323 1.00 21.00 ? 109 LEU A CB  1 
ATOM   881  C CG  . LEU A 1 109 ? 20.460  8.851   -11.154 1.00 23.36 ? 109 LEU A CG  1 
ATOM   882  C CD1 . LEU A 1 109 ? 19.731  8.597   -9.838  1.00 24.46 ? 109 LEU A CD1 1 
ATOM   883  C CD2 . LEU A 1 109 ? 21.627  7.871   -11.334 1.00 20.92 ? 109 LEU A CD2 1 
ATOM   884  N N   . PRO A 1 110 ? 20.029  7.528   -15.251 1.00 17.65 ? 110 PRO A N   1 
ATOM   885  C CA  . PRO A 1 110 ? 19.523  6.913   -16.483 1.00 19.01 ? 110 PRO A CA  1 
ATOM   886  C C   . PRO A 1 110 ? 18.054  6.511   -16.466 1.00 19.38 ? 110 PRO A C   1 
ATOM   887  O O   . PRO A 1 110 ? 17.540  6.055   -15.445 1.00 17.82 ? 110 PRO A O   1 
ATOM   888  C CB  . PRO A 1 110 ? 20.436  5.701   -16.657 1.00 19.56 ? 110 PRO A CB  1 
ATOM   889  C CG  . PRO A 1 110 ? 20.603  5.241   -15.242 1.00 19.56 ? 110 PRO A CG  1 
ATOM   890  C CD  . PRO A 1 110 ? 20.858  6.566   -14.499 1.00 18.16 ? 110 PRO A CD  1 
ATOM   891  N N   . SER A 1 111 ? 17.385  6.673   -17.604 1.00 18.23 ? 111 SER A N   1 
ATOM   892  C CA  . SER A 1 111 ? 15.985  6.281   -17.703 1.00 19.91 ? 111 SER A CA  1 
ATOM   893  C C   . SER A 1 111 ? 15.943  4.797   -18.015 1.00 19.24 ? 111 SER A C   1 
ATOM   894  O O   . SER A 1 111 ? 16.974  4.177   -18.251 1.00 20.11 ? 111 SER A O   1 
ATOM   895  C CB  . SER A 1 111 ? 15.242  7.066   -18.795 1.00 18.89 ? 111 SER A CB  1 
ATOM   896  O OG  . SER A 1 111 ? 15.808  6.882   -20.087 1.00 20.64 ? 111 SER A OG  1 
ATOM   897  N N   . PHE A 1 112 ? 14.741  4.234   -18.020 1.00 19.16 ? 112 PHE A N   1 
ATOM   898  C CA  . PHE A 1 112 ? 14.551  2.819   -18.298 1.00 16.00 ? 112 PHE A CA  1 
ATOM   899  C C   . PHE A 1 112 ? 13.065  2.647   -18.672 1.00 18.44 ? 112 PHE A C   1 
ATOM   900  O O   . PHE A 1 112 ? 12.273  3.582   -18.510 1.00 18.84 ? 112 PHE A O   1 
ATOM   901  C CB  . PHE A 1 112 ? 14.904  2.031   -17.035 1.00 13.79 ? 112 PHE A CB  1 
ATOM   902  C CG  . PHE A 1 112 ? 14.134  2.462   -15.839 1.00 9.26  ? 112 PHE A CG  1 
ATOM   903  C CD1 . PHE A 1 112 ? 12.782  2.174   -15.732 1.00 10.46 ? 112 PHE A CD1 1 
ATOM   904  C CD2 . PHE A 1 112 ? 14.728  3.245   -14.866 1.00 12.77 ? 112 PHE A CD2 1 
ATOM   905  C CE1 . PHE A 1 112 ? 12.024  2.664   -14.681 1.00 9.04  ? 112 PHE A CE1 1 
ATOM   906  C CE2 . PHE A 1 112 ? 13.980  3.743   -13.801 1.00 12.71 ? 112 PHE A CE2 1 
ATOM   907  C CZ  . PHE A 1 112 ? 12.619  3.455   -13.713 1.00 12.03 ? 112 PHE A CZ  1 
ATOM   908  N N   . ASP A 1 113 ? 12.679  1.469   -19.157 1.00 19.91 ? 113 ASP A N   1 
ATOM   909  C CA  . ASP A 1 113 ? 11.284  1.248   -19.549 1.00 22.67 ? 113 ASP A CA  1 
ATOM   910  C C   . ASP A 1 113 ? 10.466  0.738   -18.391 1.00 19.20 ? 113 ASP A C   1 
ATOM   911  O O   . ASP A 1 113 ? 10.713  -0.350  -17.891 1.00 17.76 ? 113 ASP A O   1 
ATOM   912  C CB  . ASP A 1 113 ? 11.203  0.268   -20.728 1.00 23.92 ? 113 ASP A CB  1 
ATOM   913  C CG  . ASP A 1 113 ? 11.796  0.843   -21.998 1.00 26.92 ? 113 ASP A CG  1 
ATOM   914  O OD1 . ASP A 1 113 ? 11.928  0.083   -22.985 1.00 29.71 ? 113 ASP A OD1 1 
ATOM   915  O OD2 . ASP A 1 113 ? 12.128  2.060   -22.014 1.00 29.48 ? 113 ASP A OD2 1 
ATOM   916  N N   . LYS A 1 114 ? 9.481   1.529   -17.982 1.00 20.59 ? 114 LYS A N   1 
ATOM   917  C CA  . LYS A 1 114 ? 8.645   1.176   -16.843 1.00 20.64 ? 114 LYS A CA  1 
ATOM   918  C C   . LYS A 1 114 ? 7.981   -0.171  -16.864 1.00 17.79 ? 114 LYS A C   1 
ATOM   919  O O   . LYS A 1 114 ? 7.846   -0.782  -15.812 1.00 20.64 ? 114 LYS A O   1 
ATOM   920  C CB  . LYS A 1 114 ? 7.588   2.257   -16.552 1.00 23.30 ? 114 LYS A CB  1 
ATOM   921  C CG  . LYS A 1 114 ? 7.120   3.108   -17.698 1.00 26.41 ? 114 LYS A CG  1 
ATOM   922  C CD  . LYS A 1 114 ? 6.594   4.443   -17.108 1.00 29.64 ? 114 LYS A CD  1 
ATOM   923  C CE  . LYS A 1 114 ? 6.443   5.529   -18.164 1.00 27.17 ? 114 LYS A CE  1 
ATOM   924  N NZ  . LYS A 1 114 ? 6.456   6.889   -17.560 1.00 26.23 ? 114 LYS A NZ  1 
ATOM   925  N N   . LEU A 1 115 ? 7.556   -0.631  -18.036 1.00 16.13 ? 115 LEU A N   1 
ATOM   926  C CA  . LEU A 1 115 ? 6.926   -1.943  -18.141 1.00 15.05 ? 115 LEU A CA  1 
ATOM   927  C C   . LEU A 1 115 ? 7.926   -3.065  -17.846 1.00 17.56 ? 115 LEU A C   1 
ATOM   928  O O   . LEU A 1 115 ? 7.572   -4.084  -17.254 1.00 15.72 ? 115 LEU A O   1 
ATOM   929  C CB  . LEU A 1 115 ? 6.363   -2.123  -19.538 1.00 17.14 ? 115 LEU A CB  1 
ATOM   930  C CG  . LEU A 1 115 ? 4.936   -1.637  -19.752 1.00 18.29 ? 115 LEU A CG  1 
ATOM   931  C CD1 . LEU A 1 115 ? 4.692   -0.340  -19.026 1.00 20.66 ? 115 LEU A CD1 1 
ATOM   932  C CD2 . LEU A 1 115 ? 4.715   -1.481  -21.246 1.00 20.72 ? 115 LEU A CD2 1 
ATOM   933  N N   . GLU A 1 116 ? 9.171   -2.873  -18.279 1.00 14.54 ? 116 GLU A N   1 
ATOM   934  C CA  . GLU A 1 116 ? 10.198  -3.866  -18.041 1.00 15.61 ? 116 GLU A CA  1 
ATOM   935  C C   . GLU A 1 116 ? 10.530  -3.934  -16.544 1.00 15.48 ? 116 GLU A C   1 
ATOM   936  O O   . GLU A 1 116 ? 10.728  -5.007  -15.975 1.00 14.87 ? 116 GLU A O   1 
ATOM   937  C CB  . GLU A 1 116 ? 11.457  -3.504  -18.828 1.00 20.01 ? 116 GLU A CB  1 
ATOM   938  C CG  . GLU A 1 116 ? 11.247  -3.378  -20.325 1.00 16.42 ? 116 GLU A CG  1 
ATOM   939  C CD  . GLU A 1 116 ? 10.955  -4.711  -20.960 1.00 22.31 ? 116 GLU A CD  1 
ATOM   940  O OE1 . GLU A 1 116 ? 11.375  -5.752  -20.400 1.00 17.01 ? 116 GLU A OE1 1 
ATOM   941  O OE2 . GLU A 1 116 ? 10.319  -4.714  -22.035 1.00 25.54 ? 116 GLU A OE2 1 
ATOM   942  N N   . LEU A 1 117 ? 10.600  -2.776  -15.901 1.00 12.43 ? 117 LEU A N   1 
ATOM   943  C CA  . LEU A 1 117 ? 10.920  -2.778  -14.494 1.00 14.22 ? 117 LEU A CA  1 
ATOM   944  C C   . LEU A 1 117 ? 9.762   -3.428  -13.756 1.00 14.35 ? 117 LEU A C   1 
ATOM   945  O O   . LEU A 1 117 ? 9.977   -4.266  -12.876 1.00 15.26 ? 117 LEU A O   1 
ATOM   946  C CB  . LEU A 1 117 ? 11.160  -1.351  -13.974 1.00 7.76  ? 117 LEU A CB  1 
ATOM   947  C CG  . LEU A 1 117 ? 11.452  -1.256  -12.469 1.00 4.70  ? 117 LEU A CG  1 
ATOM   948  C CD1 . LEU A 1 117 ? 12.612  -2.163  -12.114 1.00 3.83  ? 117 LEU A CD1 1 
ATOM   949  C CD2 . LEU A 1 117 ? 11.761  0.172   -12.078 1.00 6.87  ? 117 LEU A CD2 1 
ATOM   950  N N   . LEU A 1 118 ? 8.541   -3.043  -14.130 1.00 12.48 ? 118 LEU A N   1 
ATOM   951  C CA  . LEU A 1 118 ? 7.357   -3.591  -13.493 1.00 13.47 ? 118 LEU A CA  1 
ATOM   952  C C   . LEU A 1 118 ? 7.337   -5.105  -13.615 1.00 11.22 ? 118 LEU A C   1 
ATOM   953  O O   . LEU A 1 118 ? 7.102   -5.792  -12.637 1.00 10.61 ? 118 LEU A O   1 
ATOM   954  C CB  . LEU A 1 118 ? 6.068   -2.990  -14.088 1.00 11.98 ? 118 LEU A CB  1 
ATOM   955  C CG  . LEU A 1 118 ? 4.768   -3.474  -13.412 1.00 10.29 ? 118 LEU A CG  1 
ATOM   956  C CD1 . LEU A 1 118 ? 4.920   -3.420  -11.894 1.00 6.53  ? 118 LEU A CD1 1 
ATOM   957  C CD2 . LEU A 1 118 ? 3.582   -2.628  -13.863 1.00 8.29  ? 118 LEU A CD2 1 
ATOM   958  N N   . GLU A 1 119 ? 7.594   -5.620  -14.811 1.00 11.03 ? 119 GLU A N   1 
ATOM   959  C CA  . GLU A 1 119 ? 7.607   -7.063  -14.997 1.00 13.55 ? 119 GLU A CA  1 
ATOM   960  C C   . GLU A 1 119 ? 8.693   -7.680  -14.108 1.00 15.03 ? 119 GLU A C   1 
ATOM   961  O O   . GLU A 1 119 ? 8.452   -8.667  -13.411 1.00 16.12 ? 119 GLU A O   1 
ATOM   962  C CB  . GLU A 1 119 ? 7.851   -7.420  -16.471 1.00 13.22 ? 119 GLU A CB  1 
ATOM   963  C CG  . GLU A 1 119 ? 8.087   -8.908  -16.751 1.00 14.68 ? 119 GLU A CG  1 
ATOM   964  C CD  . GLU A 1 119 ? 6.880   -9.798  -16.439 1.00 14.54 ? 119 GLU A CD  1 
ATOM   965  O OE1 . GLU A 1 119 ? 7.024   -11.027 -16.530 1.00 18.26 ? 119 GLU A OE1 1 
ATOM   966  O OE2 . GLU A 1 119 ? 5.796   -9.286  -16.113 1.00 11.54 ? 119 GLU A OE2 1 
ATOM   967  N N   . CYS A 1 120 ? 9.877   -7.080  -14.123 1.00 15.32 ? 120 CYS A N   1 
ATOM   968  C CA  . CYS A 1 120 ? 10.977  -7.582  -13.313 1.00 14.58 ? 120 CYS A CA  1 
ATOM   969  C C   . CYS A 1 120 ? 10.539  -7.639  -11.861 1.00 15.22 ? 120 CYS A C   1 
ATOM   970  O O   . CYS A 1 120 ? 10.821  -8.611  -11.167 1.00 18.15 ? 120 CYS A O   1 
ATOM   971  C CB  . CYS A 1 120 ? 12.220  -6.694  -13.467 1.00 13.00 ? 120 CYS A CB  1 
ATOM   972  S SG  . CYS A 1 120 ? 13.061  -6.877  -15.059 1.00 15.53 ? 120 CYS A SG  1 
ATOM   973  N N   . ILE A 1 121 ? 9.844   -6.602  -11.405 1.00 16.00 ? 121 ILE A N   1 
ATOM   974  C CA  . ILE A 1 121 ? 9.365   -6.571  -10.022 1.00 16.65 ? 121 ILE A CA  1 
ATOM   975  C C   . ILE A 1 121 ? 8.356   -7.707  -9.826  1.00 13.69 ? 121 ILE A C   1 
ATOM   976  O O   . ILE A 1 121 ? 8.391   -8.411  -8.824  1.00 15.30 ? 121 ILE A O   1 
ATOM   977  C CB  . ILE A 1 121 ? 8.739   -5.170  -9.663  1.00 12.03 ? 121 ILE A CB  1 
ATOM   978  C CG1 . ILE A 1 121 ? 9.857   -4.140  -9.531  1.00 10.42 ? 121 ILE A CG1 1 
ATOM   979  C CG2 . ILE A 1 121 ? 7.949   -5.239  -8.344  1.00 11.54 ? 121 ILE A CG2 1 
ATOM   980  C CD1 . ILE A 1 121 ? 9.383   -2.700  -9.434  1.00 13.98 ? 121 ILE A CD1 1 
ATOM   981  N N   . ARG A 1 122 ? 7.498   -7.905  -10.810 1.00 13.39 ? 122 ARG A N   1 
ATOM   982  C CA  . ARG A 1 122 ? 6.505   -8.963  -10.752 1.00 16.61 ? 122 ARG A CA  1 
ATOM   983  C C   . ARG A 1 122 ? 7.160   -10.329 -10.654 1.00 16.30 ? 122 ARG A C   1 
ATOM   984  O O   . ARG A 1 122 ? 6.623   -11.233 -10.007 1.00 16.12 ? 122 ARG A O   1 
ATOM   985  C CB  . ARG A 1 122 ? 5.616   -8.950  -11.989 1.00 17.61 ? 122 ARG A CB  1 
ATOM   986  C CG  . ARG A 1 122 ? 4.396   -9.870  -11.856 1.00 18.69 ? 122 ARG A CG  1 
ATOM   987  C CD  . ARG A 1 122 ? 3.717   -10.065 -13.198 1.00 13.01 ? 122 ARG A CD  1 
ATOM   988  N NE  . ARG A 1 122 ? 4.582   -10.813 -14.098 1.00 14.30 ? 122 ARG A NE  1 
ATOM   989  C CZ  . ARG A 1 122 ? 4.945   -12.077 -13.902 1.00 17.54 ? 122 ARG A CZ  1 
ATOM   990  N NH1 . ARG A 1 122 ? 4.511   -12.736 -12.829 1.00 21.47 ? 122 ARG A NH1 1 
ATOM   991  N NH2 . ARG A 1 122 ? 5.743   -12.689 -14.769 1.00 14.72 ? 122 ARG A NH2 1 
ATOM   992  N N   . ARG A 1 123 ? 8.312   -10.474 -11.296 1.00 16.75 ? 123 ARG A N   1 
ATOM   993  C CA  . ARG A 1 123 ? 9.038   -11.744 -11.273 1.00 17.76 ? 123 ARG A CA  1 
ATOM   994  C C   . ARG A 1 123 ? 9.671   -11.956 -9.907  1.00 18.12 ? 123 ARG A C   1 
ATOM   995  O O   . ARG A 1 123 ? 9.683   -13.076 -9.386  1.00 18.59 ? 123 ARG A O   1 
ATOM   996  C CB  . ARG A 1 123 ? 10.139  -11.778 -12.351 1.00 19.63 ? 123 ARG A CB  1 
ATOM   997  C CG  . ARG A 1 123 ? 9.675   -11.777 -13.804 1.00 20.51 ? 123 ARG A CG  1 
ATOM   998  C CD  . ARG A 1 123 ? 8.782   -12.974 -14.112 1.00 24.46 ? 123 ARG A CD  1 
ATOM   999  N NE  . ARG A 1 123 ? 9.411   -14.260 -14.421 1.00 24.75 ? 123 ARG A NE  1 
ATOM   1000 C CZ  . ARG A 1 123 ? 10.646  -14.641 -14.106 1.00 29.41 ? 123 ARG A CZ  1 
ATOM   1001 N NH1 . ARG A 1 123 ? 11.471  -13.846 -13.450 1.00 38.79 ? 123 ARG A NH1 1 
ATOM   1002 N NH2 . ARG A 1 123 ? 11.092  -15.836 -14.451 1.00 29.34 ? 123 ARG A NH2 1 
ATOM   1003 N N   . LEU A 1 124 ? 10.182  -10.868 -9.330  1.00 17.78 ? 124 LEU A N   1 
ATOM   1004 C CA  . LEU A 1 124 ? 10.840  -10.902 -8.022  1.00 14.77 ? 124 LEU A CA  1 
ATOM   1005 C C   . LEU A 1 124 ? 9.855   -11.223 -6.898  1.00 13.68 ? 124 LEU A C   1 
ATOM   1006 O O   . LEU A 1 124 ? 10.124  -12.041 -6.016  1.00 13.27 ? 124 LEU A O   1 
ATOM   1007 C CB  . LEU A 1 124 ? 11.503  -9.556  -7.723  1.00 13.65 ? 124 LEU A CB  1 
ATOM   1008 C CG  . LEU A 1 124 ? 12.063  -9.449  -6.300  1.00 13.63 ? 124 LEU A CG  1 
ATOM   1009 C CD1 . LEU A 1 124 ? 13.293  -10.355 -6.220  1.00 9.99  ? 124 LEU A CD1 1 
ATOM   1010 C CD2 . LEU A 1 124 ? 12.420  -8.014  -5.938  1.00 9.23  ? 124 LEU A CD2 1 
ATOM   1011 N N   . ILE A 1 125 ? 8.722   -10.542 -6.917  1.00 12.68 ? 125 ILE A N   1 
ATOM   1012 C CA  . ILE A 1 125 ? 7.714   -10.786 -5.909  1.00 13.04 ? 125 ILE A CA  1 
ATOM   1013 C C   . ILE A 1 125 ? 7.247   -12.241 -6.063  1.00 17.33 ? 125 ILE A C   1 
ATOM   1014 O O   . ILE A 1 125 ? 7.051   -12.949 -5.060  1.00 16.08 ? 125 ILE A O   1 
ATOM   1015 C CB  . ILE A 1 125 ? 6.553   -9.806  -6.090  1.00 8.11  ? 125 ILE A CB  1 
ATOM   1016 C CG1 . ILE A 1 125 ? 7.079   -8.387  -5.862  1.00 2.65  ? 125 ILE A CG1 1 
ATOM   1017 C CG2 . ILE A 1 125 ? 5.392   -10.161 -5.159  1.00 5.84  ? 125 ILE A CG2 1 
ATOM   1018 C CD1 . ILE A 1 125 ? 6.103   -7.297  -6.209  1.00 3.72  ? 125 ILE A CD1 1 
ATOM   1019 N N   . GLU A 1 126 ? 7.118   -12.672 -7.323  1.00 16.13 ? 126 GLU A N   1 
ATOM   1020 C CA  . GLU A 1 126 ? 6.684   -14.033 -7.673  1.00 16.67 ? 126 GLU A CA  1 
ATOM   1021 C C   . GLU A 1 126 ? 7.607   -15.018 -6.967  1.00 17.38 ? 126 GLU A C   1 
ATOM   1022 O O   . GLU A 1 126 ? 7.148   -15.939 -6.275  1.00 17.67 ? 126 GLU A O   1 
ATOM   1023 C CB  . GLU A 1 126 ? 6.754   -14.227 -9.213  1.00 17.71 ? 126 GLU A CB  1 
ATOM   1024 C CG  . GLU A 1 126 ? 6.286   -15.589 -9.804  1.00 22.42 ? 126 GLU A CG  1 
ATOM   1025 C CD  . GLU A 1 126 ? 6.301   -15.639 -11.357 1.00 20.73 ? 126 GLU A CD  1 
ATOM   1026 O OE1 . GLU A 1 126 ? 7.377   -15.639 -11.982 1.00 23.52 ? 126 GLU A OE1 1 
ATOM   1027 O OE2 . GLU A 1 126 ? 5.216   -15.676 -11.963 1.00 26.54 ? 126 GLU A OE2 1 
ATOM   1028 N N   . VAL A 1 127 ? 8.909   -14.793 -7.138  1.00 15.58 ? 127 VAL A N   1 
ATOM   1029 C CA  . VAL A 1 127 ? 9.929   -15.640 -6.551  1.00 14.33 ? 127 VAL A CA  1 
ATOM   1030 C C   . VAL A 1 127 ? 9.787   -15.763 -5.043  1.00 17.85 ? 127 VAL A C   1 
ATOM   1031 O O   . VAL A 1 127 ? 10.083  -16.816 -4.475  1.00 14.92 ? 127 VAL A O   1 
ATOM   1032 C CB  . VAL A 1 127 ? 11.344  -15.112 -6.889  1.00 16.27 ? 127 VAL A CB  1 
ATOM   1033 C CG1 . VAL A 1 127 ? 12.383  -15.740 -5.954  1.00 10.75 ? 127 VAL A CG1 1 
ATOM   1034 C CG2 . VAL A 1 127 ? 11.684  -15.445 -8.354  1.00 11.34 ? 127 VAL A CG2 1 
ATOM   1035 N N   . ASP A 1 128 ? 9.357   -14.677 -4.400  1.00 18.59 ? 128 ASP A N   1 
ATOM   1036 C CA  . ASP A 1 128 ? 9.176   -14.664 -2.950  1.00 17.11 ? 128 ASP A CA  1 
ATOM   1037 C C   . ASP A 1 128 ? 7.713   -14.566 -2.571  1.00 17.76 ? 128 ASP A C   1 
ATOM   1038 O O   . ASP A 1 128 ? 7.374   -14.053 -1.508  1.00 20.18 ? 128 ASP A O   1 
ATOM   1039 C CB  . ASP A 1 128 ? 9.924   -13.505 -2.320  1.00 16.55 ? 128 ASP A CB  1 
ATOM   1040 C CG  . ASP A 1 128 ? 11.392  -13.751 -2.234  1.00 13.84 ? 128 ASP A CG  1 
ATOM   1041 O OD1 . ASP A 1 128 ? 11.787  -14.910 -2.069  1.00 19.16 ? 128 ASP A OD1 1 
ATOM   1042 O OD2 . ASP A 1 128 ? 12.153  -12.783 -2.303  1.00 14.29 ? 128 ASP A OD2 1 
ATOM   1043 N N   . LYS A 1 129 ? 6.856   -15.061 -3.453  1.00 18.23 ? 129 LYS A N   1 
ATOM   1044 C CA  . LYS A 1 129 ? 5.414   -15.061 -3.251  1.00 16.52 ? 129 LYS A CA  1 
ATOM   1045 C C   . LYS A 1 129 ? 5.048   -15.490 -1.836  1.00 14.55 ? 129 LYS A C   1 
ATOM   1046 O O   . LYS A 1 129 ? 4.073   -15.018 -1.275  1.00 16.00 ? 129 LYS A O   1 
ATOM   1047 C CB  . LYS A 1 129 ? 4.765   -16.023 -4.248  1.00 17.57 ? 129 LYS A CB  1 
ATOM   1048 C CG  . LYS A 1 129 ? 5.041   -17.500 -3.904  1.00 17.50 ? 129 LYS A CG  1 
ATOM   1049 C CD  . LYS A 1 129 ? 4.936   -18.435 -5.107  1.00 22.38 ? 129 LYS A CD  1 
ATOM   1050 C CE  . LYS A 1 129 ? 3.507   -18.742 -5.469  1.00 21.55 ? 129 LYS A CE  1 
ATOM   1051 N NZ  . LYS A 1 129 ? 3.414   -19.383 -6.798  1.00 27.22 ? 129 LYS A NZ  1 
ATOM   1052 N N   . ASP A 1 130 ? 5.844   -16.377 -1.261  1.00 13.27 ? 130 ASP A N   1 
ATOM   1053 C CA  . ASP A 1 130 ? 5.579   -16.899 0.074   1.00 14.35 ? 130 ASP A CA  1 
ATOM   1054 C C   . ASP A 1 130 ? 5.775   -15.860 1.173   1.00 15.86 ? 130 ASP A C   1 
ATOM   1055 O O   . ASP A 1 130 ? 5.216   -15.977 2.264   1.00 18.41 ? 130 ASP A O   1 
ATOM   1056 C CB  . ASP A 1 130 ? 6.458   -18.130 0.355   1.00 14.96 ? 130 ASP A CB  1 
ATOM   1057 C CG  . ASP A 1 130 ? 6.070   -19.354 -0.494  1.00 16.68 ? 130 ASP A CG  1 
ATOM   1058 O OD1 . ASP A 1 130 ? 6.896   -20.292 -0.579  1.00 15.66 ? 130 ASP A OD1 1 
ATOM   1059 O OD2 . ASP A 1 130 ? 4.963   -19.386 -1.065  1.00 15.51 ? 130 ASP A OD2 1 
ATOM   1060 N N   . TRP A 1 131 ? 6.573   -14.846 0.898   1.00 16.14 ? 131 TRP A N   1 
ATOM   1061 C CA  . TRP A 1 131 ? 6.792   -13.812 1.885   1.00 16.98 ? 131 TRP A CA  1 
ATOM   1062 C C   . TRP A 1 131 ? 5.607   -12.866 2.033   1.00 17.64 ? 131 TRP A C   1 
ATOM   1063 O O   . TRP A 1 131 ? 5.538   -12.112 3.004   1.00 17.98 ? 131 TRP A O   1 
ATOM   1064 C CB  . TRP A 1 131 ? 8.047   -13.025 1.536   1.00 18.70 ? 131 TRP A CB  1 
ATOM   1065 C CG  . TRP A 1 131 ? 9.313   -13.813 1.761   1.00 17.64 ? 131 TRP A CG  1 
ATOM   1066 C CD1 . TRP A 1 131 ? 9.947   -14.621 0.868   1.00 14.12 ? 131 TRP A CD1 1 
ATOM   1067 C CD2 . TRP A 1 131 ? 10.068  -13.881 2.979   1.00 16.45 ? 131 TRP A CD2 1 
ATOM   1068 N NE1 . TRP A 1 131 ? 11.053  -15.190 1.455   1.00 15.93 ? 131 TRP A NE1 1 
ATOM   1069 C CE2 . TRP A 1 131 ? 11.150  -14.755 2.750   1.00 14.22 ? 131 TRP A CE2 1 
ATOM   1070 C CE3 . TRP A 1 131 ? 9.933   -13.282 4.247   1.00 17.23 ? 131 TRP A CE3 1 
ATOM   1071 C CZ2 . TRP A 1 131 ? 12.099  -15.053 3.743   1.00 14.87 ? 131 TRP A CZ2 1 
ATOM   1072 C CZ3 . TRP A 1 131 ? 10.883  -13.578 5.239   1.00 16.26 ? 131 TRP A CZ3 1 
ATOM   1073 C CH2 . TRP A 1 131 ? 11.949  -14.459 4.974   1.00 11.89 ? 131 TRP A CH2 1 
ATOM   1074 N N   . VAL A 1 132 ? 4.675   -12.891 1.083   1.00 18.84 ? 132 VAL A N   1 
ATOM   1075 C CA  . VAL A 1 132 ? 3.522   -11.993 1.171   1.00 20.29 ? 132 VAL A CA  1 
ATOM   1076 C C   . VAL A 1 132 ? 2.590   -12.423 2.281   1.00 20.10 ? 132 VAL A C   1 
ATOM   1077 O O   . VAL A 1 132 ? 2.002   -13.478 2.226   1.00 19.77 ? 132 VAL A O   1 
ATOM   1078 C CB  . VAL A 1 132 ? 2.696   -11.962 -0.131  1.00 20.05 ? 132 VAL A CB  1 
ATOM   1079 C CG1 . VAL A 1 132 ? 1.393   -11.241 0.112   1.00 18.45 ? 132 VAL A CG1 1 
ATOM   1080 C CG2 . VAL A 1 132 ? 3.469   -11.266 -1.222  1.00 19.85 ? 132 VAL A CG2 1 
ATOM   1081 N N   . PRO A 1 133 ? 2.442   -11.602 3.310   1.00 20.31 ? 133 PRO A N   1 
ATOM   1082 C CA  . PRO A 1 133 ? 1.537   -12.037 4.375   1.00 20.88 ? 133 PRO A CA  1 
ATOM   1083 C C   . PRO A 1 133 ? 0.158   -12.128 3.782   1.00 19.84 ? 133 PRO A C   1 
ATOM   1084 O O   . PRO A 1 133 ? -0.043  -11.764 2.640   1.00 21.45 ? 133 PRO A O   1 
ATOM   1085 C CB  . PRO A 1 133 ? 1.590   -10.890 5.392   1.00 19.45 ? 133 PRO A CB  1 
ATOM   1086 C CG  . PRO A 1 133 ? 2.748   -10.026 4.951   1.00 20.78 ? 133 PRO A CG  1 
ATOM   1087 C CD  . PRO A 1 133 ? 2.831   -10.197 3.472   1.00 20.54 ? 133 PRO A CD  1 
ATOM   1088 N N   . ASP A 1 134 ? -0.801  -12.602 4.558   1.00 22.05 ? 134 ASP A N   1 
ATOM   1089 C CA  . ASP A 1 134 ? -2.167  -12.627 4.067   1.00 22.50 ? 134 ASP A CA  1 
ATOM   1090 C C   . ASP A 1 134 ? -3.164  -12.547 5.214   1.00 24.58 ? 134 ASP A C   1 
ATOM   1091 O O   . ASP A 1 134 ? -4.348  -12.850 5.059   1.00 22.29 ? 134 ASP A O   1 
ATOM   1092 C CB  . ASP A 1 134 ? -2.429  -13.827 3.158   1.00 23.86 ? 134 ASP A CB  1 
ATOM   1093 C CG  . ASP A 1 134 ? -2.298  -15.129 3.870   1.00 27.85 ? 134 ASP A CG  1 
ATOM   1094 O OD1 . ASP A 1 134 ? -2.445  -16.187 3.193   1.00 28.47 ? 134 ASP A OD1 1 
ATOM   1095 O OD2 . ASP A 1 134 ? -2.066  -15.089 5.106   1.00 29.39 ? 134 ASP A OD2 1 
ATOM   1096 N N   . ALA A 1 135 ? -2.665  -12.141 6.384   1.00 25.17 ? 135 ALA A N   1 
ATOM   1097 C CA  . ALA A 1 135 ? -3.549  -11.932 7.526   1.00 24.55 ? 135 ALA A CA  1 
ATOM   1098 C C   . ALA A 1 135 ? -4.204  -10.609 7.090   1.00 25.95 ? 135 ALA A C   1 
ATOM   1099 O O   . ALA A 1 135 ? -3.553  -9.768  6.443   1.00 26.04 ? 135 ALA A O   1 
ATOM   1100 C CB  . ALA A 1 135 ? -2.736  -11.753 8.838   1.00 22.85 ? 135 ALA A CB  1 
ATOM   1101 N N   . ALA A 1 136 ? -5.479  -10.411 7.414   1.00 24.63 ? 136 ALA A N   1 
ATOM   1102 C CA  . ALA A 1 136 ? -6.146  -9.198  6.973   1.00 19.64 ? 136 ALA A CA  1 
ATOM   1103 C C   . ALA A 1 136 ? -5.306  -7.981  7.334   1.00 18.88 ? 136 ALA A C   1 
ATOM   1104 O O   . ALA A 1 136 ? -4.613  -7.982  8.362   1.00 19.48 ? 136 ALA A O   1 
ATOM   1105 C CB  . ALA A 1 136 ? -7.516  -9.100  7.610   1.00 22.75 ? 136 ALA A CB  1 
ATOM   1106 N N   . GLY A 1 137 ? -5.351  -6.956  6.486   1.00 13.91 ? 137 GLY A N   1 
ATOM   1107 C CA  . GLY A 1 137 ? -4.606  -5.737  6.745   1.00 11.04 ? 137 GLY A CA  1 
ATOM   1108 C C   . GLY A 1 137 ? -3.101  -5.746  6.484   1.00 11.04 ? 137 GLY A C   1 
ATOM   1109 O O   . GLY A 1 137 ? -2.495  -4.684  6.504   1.00 10.05 ? 137 GLY A O   1 
ATOM   1110 N N   . THR A 1 138 ? -2.500  -6.913  6.259   1.00 6.97  ? 138 THR A N   1 
ATOM   1111 C CA  . THR A 1 138 ? -1.061  -6.990  5.996   1.00 10.20 ? 138 THR A CA  1 
ATOM   1112 C C   . THR A 1 138 ? -0.773  -6.926  4.507   1.00 11.09 ? 138 THR A C   1 
ATOM   1113 O O   . THR A 1 138 ? -1.667  -7.071  3.690   1.00 11.66 ? 138 THR A O   1 
ATOM   1114 C CB  . THR A 1 138 ? -0.435  -8.301  6.509   1.00 11.47 ? 138 THR A CB  1 
ATOM   1115 O OG1 . THR A 1 138 ? -0.998  -9.418  5.797   1.00 13.34 ? 138 THR A OG1 1 
ATOM   1116 C CG2 . THR A 1 138 ? -0.677  -8.459  7.992   1.00 12.11 ? 138 THR A CG2 1 
ATOM   1117 N N   . SER A 1 139 ? 0.500   -6.735  4.170   1.00 17.47 ? 139 SER A N   1 
ATOM   1118 C CA  . SER A 1 139 ? 0.932   -6.642  2.784   1.00 18.40 ? 139 SER A CA  1 
ATOM   1119 C C   . SER A 1 139 ? 2.421   -6.834  2.683   1.00 18.24 ? 139 SER A C   1 
ATOM   1120 O O   . SER A 1 139 ? 3.095   -7.047  3.690   1.00 19.25 ? 139 SER A O   1 
ATOM   1121 C CB  . SER A 1 139 ? 0.592   -5.259  2.211   1.00 21.55 ? 139 SER A CB  1 
ATOM   1122 O OG  . SER A 1 139 ? 1.288   -4.231  2.911   1.00 22.34 ? 139 SER A OG  1 
ATOM   1123 N N   . LEU A 1 140 ? 2.923   -6.755  1.448   1.00 17.92 ? 140 LEU A N   1 
ATOM   1124 C CA  . LEU A 1 140 ? 4.356   -6.846  1.173   1.00 18.51 ? 140 LEU A CA  1 
ATOM   1125 C C   . LEU A 1 140 ? 4.774   -5.465  0.682   1.00 17.71 ? 140 LEU A C   1 
ATOM   1126 O O   . LEU A 1 140 ? 4.159   -4.917  -0.235  1.00 18.57 ? 140 LEU A O   1 
ATOM   1127 C CB  . LEU A 1 140 ? 4.659   -7.850  0.080   1.00 17.73 ? 140 LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 140 ? 6.170   -7.852  -0.108  1.00 19.67 ? 140 LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 140 ? 6.815   -8.536  1.101   1.00 19.50 ? 140 LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 140 ? 6.537   -8.561  -1.409  1.00 14.63 ? 140 LEU A CD2 1 
ATOM   1131 N N   . TYR A 1 141 ? 5.797   -4.882  1.289   1.00 16.87 ? 141 TYR A N   1 
ATOM   1132 C CA  . TYR A 1 141 ? 6.202   -3.554  0.849   1.00 15.42 ? 141 TYR A CA  1 
ATOM   1133 C C   . TYR A 1 141 ? 7.268   -3.693  -0.192  1.00 13.97 ? 141 TYR A C   1 
ATOM   1134 O O   . TYR A 1 141 ? 8.227   -4.449  -0.016  1.00 11.53 ? 141 TYR A O   1 
ATOM   1135 C CB  . TYR A 1 141 ? 6.726   -2.720  1.999   1.00 14.30 ? 141 TYR A CB  1 
ATOM   1136 C CG  . TYR A 1 141 ? 6.972   -1.281  1.625   1.00 12.74 ? 141 TYR A CG  1 
ATOM   1137 C CD1 . TYR A 1 141 ? 5.923   -0.442  1.265   1.00 8.18  ? 141 TYR A CD1 1 
ATOM   1138 C CD2 . TYR A 1 141 ? 8.260   -0.747  1.677   1.00 13.01 ? 141 TYR A CD2 1 
ATOM   1139 C CE1 . TYR A 1 141 ? 6.157   0.920   0.970   1.00 15.84 ? 141 TYR A CE1 1 
ATOM   1140 C CE2 . TYR A 1 141 ? 8.510   0.585   1.390   1.00 12.17 ? 141 TYR A CE2 1 
ATOM   1141 C CZ  . TYR A 1 141 ? 7.464   1.426   1.036   1.00 15.37 ? 141 TYR A CZ  1 
ATOM   1142 O OH  . TYR A 1 141 ? 7.731   2.755   0.765   1.00 12.46 ? 141 TYR A OH  1 
ATOM   1143 N N   . VAL A 1 142 ? 7.077   -2.954  -1.278  1.00 11.25 ? 142 VAL A N   1 
ATOM   1144 C CA  . VAL A 1 142 ? 7.984   -2.966  -2.405  1.00 11.70 ? 142 VAL A CA  1 
ATOM   1145 C C   . VAL A 1 142 ? 8.848   -1.701  -2.457  1.00 13.23 ? 142 VAL A C   1 
ATOM   1146 O O   . VAL A 1 142 ? 8.355   -0.583  -2.665  1.00 13.11 ? 142 VAL A O   1 
ATOM   1147 C CB  . VAL A 1 142 ? 7.203   -3.125  -3.699  1.00 8.32  ? 142 VAL A CB  1 
ATOM   1148 C CG1 . VAL A 1 142 ? 8.154   -3.295  -4.858  1.00 9.29  ? 142 VAL A CG1 1 
ATOM   1149 C CG2 . VAL A 1 142 ? 6.279   -4.318  -3.581  1.00 9.69  ? 142 VAL A CG2 1 
ATOM   1150 N N   . ARG A 1 143 ? 10.149  -1.901  -2.275  1.00 9.98  ? 143 ARG A N   1 
ATOM   1151 C CA  . ARG A 1 143 ? 11.087  -0.810  -2.256  1.00 10.98 ? 143 ARG A CA  1 
ATOM   1152 C C   . ARG A 1 143 ? 12.086  -0.720  -3.393  1.00 11.52 ? 143 ARG A C   1 
ATOM   1153 O O   . ARG A 1 143 ? 13.192  -1.243  -3.296  1.00 10.50 ? 143 ARG A O   1 
ATOM   1154 C CB  . ARG A 1 143 ? 11.863  -0.832  -0.952  1.00 14.18 ? 143 ARG A CB  1 
ATOM   1155 C CG  . ARG A 1 143 ? 12.885  0.267   -0.866  1.00 13.72 ? 143 ARG A CG  1 
ATOM   1156 C CD  . ARG A 1 143 ? 12.187  1.608   -0.899  1.00 16.18 ? 143 ARG A CD  1 
ATOM   1157 N NE  . ARG A 1 143 ? 12.726  2.409   0.184   1.00 23.98 ? 143 ARG A NE  1 
ATOM   1158 C CZ  . ARG A 1 143 ? 12.008  2.998   1.122   1.00 20.67 ? 143 ARG A CZ  1 
ATOM   1159 N NH1 . ARG A 1 143 ? 10.689  2.901   1.136   1.00 19.06 ? 143 ARG A NH1 1 
ATOM   1160 N NH2 . ARG A 1 143 ? 12.633  3.686   2.045   1.00 21.97 ? 143 ARG A NH2 1 
ATOM   1161 N N   . PRO A 1 144 ? 11.705  -0.053  -4.498  1.00 11.81 ? 144 PRO A N   1 
ATOM   1162 C CA  . PRO A 1 144 ? 12.645  0.077   -5.611  1.00 11.04 ? 144 PRO A CA  1 
ATOM   1163 C C   . PRO A 1 144 ? 13.573  1.264   -5.271  1.00 13.89 ? 144 PRO A C   1 
ATOM   1164 O O   . PRO A 1 144 ? 13.155  2.227   -4.627  1.00 11.24 ? 144 PRO A O   1 
ATOM   1165 C CB  . PRO A 1 144 ? 11.739  0.381   -6.806  1.00 12.53 ? 144 PRO A CB  1 
ATOM   1166 C CG  . PRO A 1 144 ? 10.358  -0.052  -6.349  1.00 9.76  ? 144 PRO A CG  1 
ATOM   1167 C CD  . PRO A 1 144 ? 10.353  0.344   -4.915  1.00 8.61  ? 144 PRO A CD  1 
ATOM   1168 N N   . VAL A 1 145 ? 14.829  1.183   -5.695  1.00 15.04 ? 145 VAL A N   1 
ATOM   1169 C CA  . VAL A 1 145 ? 15.802  2.247   -5.437  1.00 12.66 ? 145 VAL A CA  1 
ATOM   1170 C C   . VAL A 1 145 ? 16.748  2.377   -6.636  1.00 12.99 ? 145 VAL A C   1 
ATOM   1171 O O   . VAL A 1 145 ? 17.073  1.375   -7.285  1.00 14.71 ? 145 VAL A O   1 
ATOM   1172 C CB  . VAL A 1 145 ? 16.656  1.929   -4.176  1.00 12.98 ? 145 VAL A CB  1 
ATOM   1173 C CG1 . VAL A 1 145 ? 17.611  3.072   -3.882  1.00 14.19 ? 145 VAL A CG1 1 
ATOM   1174 C CG2 . VAL A 1 145 ? 15.758  1.655   -2.994  1.00 9.71  ? 145 VAL A CG2 1 
ATOM   1175 N N   . LEU A 1 146 ? 17.164  3.605   -6.934  1.00 12.84 ? 146 LEU A N   1 
ATOM   1176 C CA  . LEU A 1 146 ? 18.103  3.883   -8.019  1.00 13.30 ? 146 LEU A CA  1 
ATOM   1177 C C   . LEU A 1 146 ? 19.094  4.906   -7.505  1.00 10.78 ? 146 LEU A C   1 
ATOM   1178 O O   . LEU A 1 146 ? 18.708  5.968   -7.040  1.00 11.01 ? 146 LEU A O   1 
ATOM   1179 C CB  . LEU A 1 146 ? 17.391  4.438   -9.255  1.00 15.18 ? 146 LEU A CB  1 
ATOM   1180 C CG  . LEU A 1 146 ? 18.333  4.803   -10.413 1.00 15.46 ? 146 LEU A CG  1 
ATOM   1181 C CD1 . LEU A 1 146 ? 19.116  3.578   -10.846 1.00 12.74 ? 146 LEU A CD1 1 
ATOM   1182 C CD2 . LEU A 1 146 ? 17.532  5.372   -11.586 1.00 13.26 ? 146 LEU A CD2 1 
ATOM   1183 N N   . ILE A 1 147 ? 20.372  4.590   -7.587  1.00 9.10  ? 147 ILE A N   1 
ATOM   1184 C CA  . ILE A 1 147 ? 21.374  5.508   -7.081  1.00 10.81 ? 147 ILE A CA  1 
ATOM   1185 C C   . ILE A 1 147 ? 22.534  5.692   -8.026  1.00 12.07 ? 147 ILE A C   1 
ATOM   1186 O O   . ILE A 1 147 ? 22.909  4.773   -8.762  1.00 10.60 ? 147 ILE A O   1 
ATOM   1187 C CB  . ILE A 1 147 ? 21.951  5.022   -5.716  1.00 10.42 ? 147 ILE A CB  1 
ATOM   1188 C CG1 . ILE A 1 147 ? 22.869  3.818   -5.937  1.00 11.77 ? 147 ILE A CG1 1 
ATOM   1189 C CG2 . ILE A 1 147 ? 20.832  4.637   -4.779  1.00 5.40  ? 147 ILE A CG2 1 
ATOM   1190 C CD1 . ILE A 1 147 ? 23.424  3.215   -4.676  1.00 6.35  ? 147 ILE A CD1 1 
ATOM   1191 N N   . GLY A 1 148 ? 23.098  6.898   -8.019  1.00 12.68 ? 148 GLY A N   1 
ATOM   1192 C CA  . GLY A 1 148 ? 24.255  7.155   -8.854  1.00 12.14 ? 148 GLY A CA  1 
ATOM   1193 C C   . GLY A 1 148 ? 25.399  6.392   -8.208  1.00 12.61 ? 148 GLY A C   1 
ATOM   1194 O O   . GLY A 1 148 ? 25.493  6.292   -6.989  1.00 14.88 ? 148 GLY A O   1 
ATOM   1195 N N   . ASN A 1 149 ? 26.290  5.848   -9.003  1.00 15.74 ? 149 ASN A N   1 
ATOM   1196 C CA  . ASN A 1 149 ? 27.371  5.085   -8.410  1.00 17.09 ? 149 ASN A CA  1 
ATOM   1197 C C   . ASN A 1 149 ? 28.720  5.338   -9.056  1.00 20.48 ? 149 ASN A C   1 
ATOM   1198 O O   . ASN A 1 149 ? 29.418  4.410   -9.448  1.00 20.53 ? 149 ASN A O   1 
ATOM   1199 C CB  . ASN A 1 149 ? 27.040  3.598   -8.466  1.00 15.39 ? 149 ASN A CB  1 
ATOM   1200 C CG  . ASN A 1 149 ? 27.899  2.788   -7.540  1.00 15.54 ? 149 ASN A CG  1 
ATOM   1201 O OD1 . ASN A 1 149 ? 28.532  3.334   -6.638  1.00 18.25 ? 149 ASN A OD1 1 
ATOM   1202 N ND2 . ASN A 1 149 ? 27.921  1.478   -7.746  1.00 11.56 ? 149 ASN A ND2 1 
ATOM   1203 N N   . GLU A 1 150 ? 29.088  6.602   -9.182  1.00 24.32 ? 150 GLU A N   1 
ATOM   1204 C CA  . GLU A 1 150 ? 30.380  6.884   -9.748  1.00 24.13 ? 150 GLU A CA  1 
ATOM   1205 C C   . GLU A 1 150 ? 31.358  7.062   -8.622  1.00 22.16 ? 150 GLU A C   1 
ATOM   1206 O O   . GLU A 1 150 ? 31.093  7.753   -7.647  1.00 20.91 ? 150 GLU A O   1 
ATOM   1207 C CB  . GLU A 1 150 ? 30.368  8.112   -10.611 1.00 28.32 ? 150 GLU A CB  1 
ATOM   1208 C CG  . GLU A 1 150 ? 31.649  8.161   -11.398 1.00 33.13 ? 150 GLU A CG  1 
ATOM   1209 C CD  . GLU A 1 150 ? 31.525  9.002   -12.618 1.00 35.82 ? 150 GLU A CD  1 
ATOM   1210 O OE1 . GLU A 1 150 ? 32.552  9.165   -13.324 1.00 36.35 ? 150 GLU A OE1 1 
ATOM   1211 O OE2 . GLU A 1 150 ? 30.389  9.492   -12.853 1.00 38.22 ? 150 GLU A OE2 1 
ATOM   1212 N N   . PRO A 1 151 ? 32.499  6.398   -8.735  1.00 19.34 ? 151 PRO A N   1 
ATOM   1213 C CA  . PRO A 1 151 ? 33.565  6.432   -7.754  1.00 17.53 ? 151 PRO A CA  1 
ATOM   1214 C C   . PRO A 1 151 ? 34.316  7.708   -7.963  1.00 17.18 ? 151 PRO A C   1 
ATOM   1215 O O   . PRO A 1 151 ? 35.534  7.705   -8.057  1.00 16.30 ? 151 PRO A O   1 
ATOM   1216 C CB  . PRO A 1 151 ? 34.386  5.215   -8.122  1.00 18.10 ? 151 PRO A CB  1 
ATOM   1217 C CG  . PRO A 1 151 ? 34.335  5.265   -9.599  1.00 20.66 ? 151 PRO A CG  1 
ATOM   1218 C CD  . PRO A 1 151 ? 32.863  5.528   -9.860  1.00 21.65 ? 151 PRO A CD  1 
ATOM   1219 N N   . SER A 1 152 ? 33.573  8.805   -8.032  1.00 18.65 ? 152 SER A N   1 
ATOM   1220 C CA  . SER A 1 152 ? 34.176  10.096  -8.275  1.00 20.17 ? 152 SER A CA  1 
ATOM   1221 C C   . SER A 1 152 ? 33.651  11.210  -7.366  1.00 21.87 ? 152 SER A C   1 
ATOM   1222 O O   . SER A 1 152 ? 32.429  11.391  -7.243  1.00 22.83 ? 152 SER A O   1 
ATOM   1223 C CB  . SER A 1 152 ? 33.930  10.479  -9.737  1.00 17.85 ? 152 SER A CB  1 
ATOM   1224 O OG  . SER A 1 152 ? 34.656  11.636  -10.071 1.00 21.93 ? 152 SER A OG  1 
ATOM   1225 N N   . LEU A 1 153 ? 34.555  11.966  -6.739  1.00 20.40 ? 153 LEU A N   1 
ATOM   1226 C CA  . LEU A 1 153 ? 34.094  13.064  -5.892  1.00 23.68 ? 153 LEU A CA  1 
ATOM   1227 C C   . LEU A 1 153 ? 33.585  14.230  -6.725  1.00 23.69 ? 153 LEU A C   1 
ATOM   1228 O O   . LEU A 1 153 ? 33.328  15.315  -6.202  1.00 27.23 ? 153 LEU A O   1 
ATOM   1229 C CB  . LEU A 1 153 ? 35.193  13.591  -4.985  1.00 21.78 ? 153 LEU A CB  1 
ATOM   1230 C CG  . LEU A 1 153 ? 35.678  12.659  -3.898  1.00 18.92 ? 153 LEU A CG  1 
ATOM   1231 C CD1 . LEU A 1 153 ? 36.432  13.492  -2.860  1.00 17.19 ? 153 LEU A CD1 1 
ATOM   1232 C CD2 . LEU A 1 153 ? 34.473  11.936  -3.267  1.00 18.69 ? 153 LEU A CD2 1 
ATOM   1233 N N   . GLY A 1 154 ? 33.441  14.021  -8.026  1.00 24.15 ? 154 GLY A N   1 
ATOM   1234 C CA  . GLY A 1 154 ? 32.937  15.102  -8.845  1.00 25.82 ? 154 GLY A CA  1 
ATOM   1235 C C   . GLY A 1 154 ? 31.420  15.112  -8.813  1.00 24.52 ? 154 GLY A C   1 
ATOM   1236 O O   . GLY A 1 154 ? 30.803  14.060  -8.942  1.00 28.23 ? 154 GLY A O   1 
ATOM   1237 N N   . VAL A 1 155 ? 30.819  16.283  -8.624  1.00 23.73 ? 155 VAL A N   1 
ATOM   1238 C CA  . VAL A 1 155 ? 29.358  16.423  -8.615  1.00 22.65 ? 155 VAL A CA  1 
ATOM   1239 C C   . VAL A 1 155 ? 28.899  16.596  -10.057 1.00 23.36 ? 155 VAL A C   1 
ATOM   1240 O O   . VAL A 1 155 ? 28.592  17.701  -10.488 1.00 24.32 ? 155 VAL A O   1 
ATOM   1241 C CB  . VAL A 1 155 ? 28.929  17.669  -7.849  1.00 21.41 ? 155 VAL A CB  1 
ATOM   1242 C CG1 . VAL A 1 155 ? 27.442  17.751  -7.772  1.00 17.19 ? 155 VAL A CG1 1 
ATOM   1243 C CG2 . VAL A 1 155 ? 29.541  17.653  -6.472  1.00 24.82 ? 155 VAL A CG2 1 
ATOM   1244 N N   . SER A 1 156 ? 28.849  15.501  -10.800 1.00 25.59 ? 156 SER A N   1 
ATOM   1245 C CA  . SER A 1 156 ? 28.455  15.534  -12.205 1.00 28.65 ? 156 SER A CA  1 
ATOM   1246 C C   . SER A 1 156 ? 27.336  14.532  -12.487 1.00 27.03 ? 156 SER A C   1 
ATOM   1247 O O   . SER A 1 156 ? 26.814  13.925  -11.562 1.00 25.43 ? 156 SER A O   1 
ATOM   1248 C CB  . SER A 1 156 ? 29.682  15.198  -13.064 1.00 29.54 ? 156 SER A CB  1 
ATOM   1249 O OG  . SER A 1 156 ? 30.275  13.977  -12.636 1.00 28.96 ? 156 SER A OG  1 
ATOM   1250 N N   . GLN A 1 157 ? 26.949  14.374  -13.753 1.00 28.63 ? 157 GLN A N   1 
ATOM   1251 C CA  . GLN A 1 157 ? 25.911  13.395  -14.081 1.00 28.86 ? 157 GLN A CA  1 
ATOM   1252 C C   . GLN A 1 157 ? 26.648  12.101  -13.974 1.00 27.40 ? 157 GLN A C   1 
ATOM   1253 O O   . GLN A 1 157 ? 27.709  11.959  -14.557 1.00 24.82 ? 157 GLN A O   1 
ATOM   1254 C CB  . GLN A 1 157 ? 25.407  13.544  -15.504 1.00 30.51 ? 157 GLN A CB  1 
ATOM   1255 C CG  . GLN A 1 157 ? 24.284  12.535  -15.839 1.00 33.52 ? 157 GLN A CG  1 
ATOM   1256 C CD  . GLN A 1 157 ? 23.620  12.796  -17.204 1.00 34.41 ? 157 GLN A CD  1 
ATOM   1257 O OE1 . GLN A 1 157 ? 23.467  13.946  -17.635 1.00 32.87 ? 157 GLN A OE1 1 
ATOM   1258 N NE2 . GLN A 1 157 ? 23.200  11.724  -17.872 1.00 36.72 ? 157 GLN A NE2 1 
ATOM   1259 N N   . PRO A 1 158 ? 26.092  11.121  -13.251 1.00 30.10 ? 158 PRO A N   1 
ATOM   1260 C CA  . PRO A 1 158 ? 26.831  9.860   -13.140 1.00 30.02 ? 158 PRO A CA  1 
ATOM   1261 C C   . PRO A 1 158 ? 26.921  9.095   -14.455 1.00 27.33 ? 158 PRO A C   1 
ATOM   1262 O O   . PRO A 1 158 ? 26.111  9.279   -15.376 1.00 26.45 ? 158 PRO A O   1 
ATOM   1263 C CB  . PRO A 1 158 ? 26.074  9.093   -12.047 1.00 31.15 ? 158 PRO A CB  1 
ATOM   1264 C CG  . PRO A 1 158 ? 25.317  10.151  -11.309 1.00 31.93 ? 158 PRO A CG  1 
ATOM   1265 C CD  . PRO A 1 158 ? 24.882  11.095  -12.417 1.00 31.09 ? 158 PRO A CD  1 
ATOM   1266 N N   . ARG A 1 159 ? 27.931  8.242   -14.526 1.00 26.49 ? 159 ARG A N   1 
ATOM   1267 C CA  . ARG A 1 159 ? 28.174  7.452   -15.714 1.00 28.44 ? 159 ARG A CA  1 
ATOM   1268 C C   . ARG A 1 159 ? 28.041  5.995   -15.317 1.00 27.32 ? 159 ARG A C   1 
ATOM   1269 O O   . ARG A 1 159 ? 28.110  5.093   -16.150 1.00 23.72 ? 159 ARG A O   1 
ATOM   1270 C CB  . ARG A 1 159 ? 29.581  7.761   -16.246 1.00 32.48 ? 159 ARG A CB  1 
ATOM   1271 C CG  . ARG A 1 159 ? 29.737  9.173   -16.828 1.00 36.14 ? 159 ARG A CG  1 
ATOM   1272 C CD  . ARG A 1 159 ? 31.171  9.441   -17.276 1.00 43.44 ? 159 ARG A CD  1 
ATOM   1273 N NE  . ARG A 1 159 ? 31.691  8.402   -18.177 1.00 48.45 ? 159 ARG A NE  1 
ATOM   1274 C CZ  . ARG A 1 159 ? 32.969  8.299   -18.560 1.00 51.00 ? 159 ARG A CZ  1 
ATOM   1275 N NH1 . ARG A 1 159 ? 33.876  9.177   -18.129 1.00 51.82 ? 159 ARG A NH1 1 
ATOM   1276 N NH2 . ARG A 1 159 ? 33.346  7.308   -19.362 1.00 49.84 ? 159 ARG A NH2 1 
ATOM   1277 N N   . ARG A 1 160 ? 27.814  5.805   -14.017 1.00 26.69 ? 160 ARG A N   1 
ATOM   1278 C CA  . ARG A 1 160 ? 27.653  4.503   -13.415 1.00 25.09 ? 160 ARG A CA  1 
ATOM   1279 C C   . ARG A 1 160 ? 26.492  4.641   -12.432 1.00 24.55 ? 160 ARG A C   1 
ATOM   1280 O O   . ARG A 1 160 ? 26.474  5.564   -11.602 1.00 26.19 ? 160 ARG A O   1 
ATOM   1281 C CB  . ARG A 1 160 ? 28.944  4.130   -12.685 1.00 26.93 ? 160 ARG A CB  1 
ATOM   1282 C CG  . ARG A 1 160 ? 29.067  2.648   -12.336 1.00 32.69 ? 160 ARG A CG  1 
ATOM   1283 C CD  . ARG A 1 160 ? 30.442  2.298   -11.772 1.00 35.40 ? 160 ARG A CD  1 
ATOM   1284 N NE  . ARG A 1 160 ? 31.527  2.735   -12.650 1.00 40.28 ? 160 ARG A NE  1 
ATOM   1285 C CZ  . ARG A 1 160 ? 32.819  2.737   -12.307 1.00 43.94 ? 160 ARG A CZ  1 
ATOM   1286 N NH1 . ARG A 1 160 ? 33.179  2.309   -11.097 1.00 45.16 ? 160 ARG A NH1 1 
ATOM   1287 N NH2 . ARG A 1 160 ? 33.756  3.189   -13.156 1.00 45.12 ? 160 ARG A NH2 1 
ATOM   1288 N N   . ALA A 1 161 ? 25.496  3.770   -12.553 1.00 21.11 ? 161 ALA A N   1 
ATOM   1289 C CA  . ALA A 1 161 ? 24.348  3.813   -11.655 1.00 17.92 ? 161 ALA A CA  1 
ATOM   1290 C C   . ALA A 1 161 ? 23.946  2.410   -11.259 1.00 18.16 ? 161 ALA A C   1 
ATOM   1291 O O   . ALA A 1 161 ? 24.563  1.435   -11.667 1.00 15.75 ? 161 ALA A O   1 
ATOM   1292 C CB  . ALA A 1 161 ? 23.175  4.523   -12.323 1.00 17.05 ? 161 ALA A CB  1 
ATOM   1293 N N   . LEU A 1 162 ? 22.895  2.303   -10.467 1.00 18.94 ? 162 LEU A N   1 
ATOM   1294 C CA  . LEU A 1 162 ? 22.469  0.991   -10.013 1.00 18.79 ? 162 LEU A CA  1 
ATOM   1295 C C   . LEU A 1 162 ? 21.039  1.040   -9.519  1.00 17.06 ? 162 LEU A C   1 
ATOM   1296 O O   . LEU A 1 162 ? 20.659  1.924   -8.770  1.00 17.69 ? 162 LEU A O   1 
ATOM   1297 C CB  . LEU A 1 162 ? 23.390  0.521   -8.892  1.00 23.12 ? 162 LEU A CB  1 
ATOM   1298 C CG  . LEU A 1 162 ? 23.120  -0.855  -8.313  1.00 27.40 ? 162 LEU A CG  1 
ATOM   1299 C CD1 . LEU A 1 162 ? 23.743  -1.923  -9.197  1.00 28.50 ? 162 LEU A CD1 1 
ATOM   1300 C CD2 . LEU A 1 162 ? 23.693  -0.900  -6.886  1.00 29.86 ? 162 LEU A CD2 1 
ATOM   1301 N N   . LEU A 1 163 ? 20.245  0.069   -9.939  1.00 16.00 ? 163 LEU A N   1 
ATOM   1302 C CA  . LEU A 1 163 ? 18.858  0.024   -9.545  1.00 17.30 ? 163 LEU A CA  1 
ATOM   1303 C C   . LEU A 1 163 ? 18.677  -1.285  -8.817  1.00 16.34 ? 163 LEU A C   1 
ATOM   1304 O O   . LEU A 1 163 ? 19.216  -2.304  -9.240  1.00 19.69 ? 163 LEU A O   1 
ATOM   1305 C CB  . LEU A 1 163 ? 17.970  0.064   -10.787 1.00 17.07 ? 163 LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 163 ? 16.463  0.263   -10.622 1.00 15.63 ? 163 LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 163 ? 15.885  0.674   -11.954 1.00 15.92 ? 163 LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 163 ? 15.811  -1.009  -10.106 1.00 13.60 ? 163 LEU A CD2 1 
ATOM   1309 N N   . PHE A 1 164 ? 17.946  -1.262  -7.713  1.00 15.30 ? 164 PHE A N   1 
ATOM   1310 C CA  . PHE A 1 164 ? 17.711  -2.479  -6.977  1.00 14.14 ? 164 PHE A CA  1 
ATOM   1311 C C   . PHE A 1 164 ? 16.395  -2.416  -6.251  1.00 11.77 ? 164 PHE A C   1 
ATOM   1312 O O   . PHE A 1 164 ? 15.891  -1.344  -5.965  1.00 17.53 ? 164 PHE A O   1 
ATOM   1313 C CB  . PHE A 1 164 ? 18.856  -2.762  -6.007  1.00 12.99 ? 164 PHE A CB  1 
ATOM   1314 C CG  . PHE A 1 164 ? 18.980  -1.778  -4.855  1.00 14.97 ? 164 PHE A CG  1 
ATOM   1315 C CD1 . PHE A 1 164 ? 19.842  -0.690  -4.936  1.00 11.75 ? 164 PHE A CD1 1 
ATOM   1316 C CD2 . PHE A 1 164 ? 18.302  -1.995  -3.653  1.00 14.61 ? 164 PHE A CD2 1 
ATOM   1317 C CE1 . PHE A 1 164 ? 20.033  0.158   -3.841  1.00 13.35 ? 164 PHE A CE1 1 
ATOM   1318 C CE2 . PHE A 1 164 ? 18.487  -1.148  -2.551  1.00 16.13 ? 164 PHE A CE2 1 
ATOM   1319 C CZ  . PHE A 1 164 ? 19.353  -0.073  -2.647  1.00 14.32 ? 164 PHE A CZ  1 
ATOM   1320 N N   . VAL A 1 165 ? 15.817  -3.571  -5.982  1.00 13.47 ? 165 VAL A N   1 
ATOM   1321 C CA  . VAL A 1 165 ? 14.540  -3.633  -5.278  1.00 12.95 ? 165 VAL A CA  1 
ATOM   1322 C C   . VAL A 1 165 ? 14.635  -4.631  -4.129  1.00 14.40 ? 165 VAL A C   1 
ATOM   1323 O O   . VAL A 1 165 ? 15.247  -5.692  -4.258  1.00 10.93 ? 165 VAL A O   1 
ATOM   1324 C CB  . VAL A 1 165 ? 13.392  -4.078  -6.210  1.00 11.36 ? 165 VAL A CB  1 
ATOM   1325 C CG1 . VAL A 1 165 ? 12.077  -4.058  -5.464  1.00 12.75 ? 165 VAL A CG1 1 
ATOM   1326 C CG2 . VAL A 1 165 ? 13.310  -3.168  -7.411  1.00 15.34 ? 165 VAL A CG2 1 
ATOM   1327 N N   . ILE A 1 166 ? 14.052  -4.265  -2.994  1.00 13.81 ? 166 ILE A N   1 
ATOM   1328 C CA  . ILE A 1 166 ? 14.031  -5.140  -1.825  1.00 13.19 ? 166 ILE A CA  1 
ATOM   1329 C C   . ILE A 1 166 ? 12.591  -5.185  -1.335  1.00 14.16 ? 166 ILE A C   1 
ATOM   1330 O O   . ILE A 1 166 ? 11.818  -4.258  -1.588  1.00 11.89 ? 166 ILE A O   1 
ATOM   1331 C CB  . ILE A 1 166 ? 14.977  -4.640  -0.731  1.00 10.12 ? 166 ILE A CB  1 
ATOM   1332 C CG1 . ILE A 1 166 ? 14.797  -3.137  -0.524  1.00 12.29 ? 166 ILE A CG1 1 
ATOM   1333 C CG2 . ILE A 1 166 ? 16.413  -4.981  -1.131  1.00 11.18 ? 166 ILE A CG2 1 
ATOM   1334 C CD1 . ILE A 1 166 ? 15.575  -2.571  0.639   1.00 9.46  ? 166 ILE A CD1 1 
ATOM   1335 N N   . LEU A 1 167 ? 12.236  -6.263  -0.638  1.00 14.77 ? 167 LEU A N   1 
ATOM   1336 C CA  . LEU A 1 167 ? 10.861  -6.462  -0.197  1.00 14.32 ? 167 LEU A CA  1 
ATOM   1337 C C   . LEU A 1 167 ? 10.742  -6.816  1.269   1.00 15.48 ? 167 LEU A C   1 
ATOM   1338 O O   . LEU A 1 167 ? 11.591  -7.514  1.799   1.00 17.92 ? 167 LEU A O   1 
ATOM   1339 C CB  . LEU A 1 167 ? 10.239  -7.601  -1.017  1.00 12.13 ? 167 LEU A CB  1 
ATOM   1340 C CG  . LEU A 1 167 ? 10.538  -7.702  -2.521  1.00 9.19  ? 167 LEU A CG  1 
ATOM   1341 C CD1 . LEU A 1 167 ? 10.055  -9.042  -3.091  1.00 2.98  ? 167 LEU A CD1 1 
ATOM   1342 C CD2 . LEU A 1 167 ? 9.880   -6.554  -3.230  1.00 5.61  ? 167 LEU A CD2 1 
ATOM   1343 N N   . CYS A 1 168 ? 9.687   -6.335  1.923   1.00 15.94 ? 168 CYS A N   1 
ATOM   1344 C CA  . CYS A 1 168 ? 9.444   -6.674  3.314   1.00 16.28 ? 168 CYS A CA  1 
ATOM   1345 C C   . CYS A 1 168 ? 7.980   -6.775  3.677   1.00 15.43 ? 168 CYS A C   1 
ATOM   1346 O O   . CYS A 1 168 ? 7.183   -5.897  3.376   1.00 17.05 ? 168 CYS A O   1 
ATOM   1347 C CB  . CYS A 1 168 ? 10.126  -5.709  4.288   1.00 20.87 ? 168 CYS A CB  1 
ATOM   1348 S SG  . CYS A 1 168 ? 10.449  -4.049  3.807   1.00 22.43 ? 168 CYS A SG  1 
ATOM   1349 N N   . PRO A 1 169 ? 7.605   -7.869  4.338   1.00 15.70 ? 169 PRO A N   1 
ATOM   1350 C CA  . PRO A 1 169 ? 6.208   -8.034  4.719   1.00 14.09 ? 169 PRO A CA  1 
ATOM   1351 C C   . PRO A 1 169 ? 5.914   -7.014  5.801   1.00 16.73 ? 169 PRO A C   1 
ATOM   1352 O O   . PRO A 1 169 ? 6.747   -6.753  6.671   1.00 17.58 ? 169 PRO A O   1 
ATOM   1353 C CB  . PRO A 1 169 ? 6.168   -9.461  5.228   1.00 15.26 ? 169 PRO A CB  1 
ATOM   1354 C CG  . PRO A 1 169 ? 7.506   -9.587  5.932   1.00 12.08 ? 169 PRO A CG  1 
ATOM   1355 C CD  . PRO A 1 169 ? 8.452   -8.920  4.944   1.00 16.02 ? 169 PRO A CD  1 
ATOM   1356 N N   . VAL A 1 170 ? 4.742   -6.408  5.728   1.00 18.50 ? 170 VAL A N   1 
ATOM   1357 C CA  . VAL A 1 170 ? 4.374   -5.408  6.707   1.00 18.29 ? 170 VAL A CA  1 
ATOM   1358 C C   . VAL A 1 170 ? 3.085   -5.899  7.316   1.00 17.38 ? 170 VAL A C   1 
ATOM   1359 O O   . VAL A 1 170 ? 2.273   -6.486  6.614   1.00 19.60 ? 170 VAL A O   1 
ATOM   1360 C CB  . VAL A 1 170 ? 4.175   -4.045  6.032   1.00 17.08 ? 170 VAL A CB  1 
ATOM   1361 C CG1 . VAL A 1 170 ? 5.446   -3.633  5.347   1.00 14.00 ? 170 VAL A CG1 1 
ATOM   1362 C CG2 . VAL A 1 170 ? 3.054   -4.131  5.004   1.00 19.52 ? 170 VAL A CG2 1 
ATOM   1363 N N   . GLY A 1 171 ? 2.931   -5.688  8.622   1.00 16.04 ? 171 GLY A N   1 
ATOM   1364 C CA  . GLY A 1 171 ? 1.731   -6.113  9.313   1.00 14.22 ? 171 GLY A CA  1 
ATOM   1365 C C   . GLY A 1 171 ? 0.584   -5.132  9.181   1.00 14.92 ? 171 GLY A C   1 
ATOM   1366 O O   . GLY A 1 171 ? 0.689   -4.141  8.460   1.00 12.25 ? 171 GLY A O   1 
ATOM   1367 N N   . ALA A 1 172 ? -0.520  -5.417  9.875   1.00 17.72 ? 172 ALA A N   1 
ATOM   1368 C CA  . ALA A 1 172 ? -1.709  -4.554  9.850   1.00 16.95 ? 172 ALA A CA  1 
ATOM   1369 C C   . ALA A 1 172 ? -1.471  -3.200  10.540  1.00 19.08 ? 172 ALA A C   1 
ATOM   1370 O O   . ALA A 1 172 ? -0.664  -3.096  11.470  1.00 15.77 ? 172 ALA A O   1 
ATOM   1371 C CB  . ALA A 1 172 ? -2.881  -5.264  10.500  1.00 15.51 ? 172 ALA A CB  1 
ATOM   1372 N N   . TYR A 1 173 ? -2.169  -2.166  10.057  1.00 21.71 ? 173 TYR A N   1 
ATOM   1373 C CA  . TYR A 1 173 ? -2.062  -0.819  10.598  1.00 19.85 ? 173 TYR A CA  1 
ATOM   1374 C C   . TYR A 1 173 ? -3.293  -0.429  11.419  1.00 18.53 ? 173 TYR A C   1 
ATOM   1375 O O   . TYR A 1 173 ? -3.189  0.424   12.297  1.00 17.65 ? 173 TYR A O   1 
ATOM   1376 C CB  . TYR A 1 173 ? -1.826  0.191   9.468   1.00 26.14 ? 173 TYR A CB  1 
ATOM   1377 C CG  . TYR A 1 173 ? -0.424  0.776   9.451   1.00 31.57 ? 173 TYR A CG  1 
ATOM   1378 C CD1 . TYR A 1 173 ? 0.681   0.019   9.023   1.00 32.53 ? 173 TYR A CD1 1 
ATOM   1379 C CD2 . TYR A 1 173 ? -0.192  2.073   9.941   1.00 35.13 ? 173 TYR A CD2 1 
ATOM   1380 C CE1 . TYR A 1 173 ? 1.996   0.551   9.096   1.00 37.38 ? 173 TYR A CE1 1 
ATOM   1381 C CE2 . TYR A 1 173 ? 1.100   2.613   10.016  1.00 37.27 ? 173 TYR A CE2 1 
ATOM   1382 C CZ  . TYR A 1 173 ? 2.197   1.858   9.595   1.00 38.76 ? 173 TYR A CZ  1 
ATOM   1383 O OH  . TYR A 1 173 ? 3.472   2.451   9.652   1.00 39.85 ? 173 TYR A OH  1 
ATOM   1384 N N   . PHE A 1 174 ? -4.446  -1.058  11.141  1.00 17.31 ? 174 PHE A N   1 
ATOM   1385 C CA  . PHE A 1 174 ? -5.703  -0.802  11.882  1.00 16.13 ? 174 PHE A CA  1 
ATOM   1386 C C   . PHE A 1 174 ? -6.533  -2.068  11.974  1.00 16.57 ? 174 PHE A C   1 
ATOM   1387 O O   . PHE A 1 174 ? -6.355  -2.976  11.180  1.00 17.54 ? 174 PHE A O   1 
ATOM   1388 C CB  . PHE A 1 174 ? -6.632  0.190   11.176  1.00 17.13 ? 174 PHE A CB  1 
ATOM   1389 C CG  . PHE A 1 174 ? -6.045  1.522   10.909  1.00 18.47 ? 174 PHE A CG  1 
ATOM   1390 C CD1 . PHE A 1 174 ? -5.906  1.970   9.587   1.00 17.47 ? 174 PHE A CD1 1 
ATOM   1391 C CD2 . PHE A 1 174 ? -5.697  2.371   11.957  1.00 18.17 ? 174 PHE A CD2 1 
ATOM   1392 C CE1 . PHE A 1 174 ? -5.434  3.250   9.310   1.00 15.80 ? 174 PHE A CE1 1 
ATOM   1393 C CE2 . PHE A 1 174 ? -5.223  3.658   11.691  1.00 19.08 ? 174 PHE A CE2 1 
ATOM   1394 C CZ  . PHE A 1 174 ? -5.093  4.099   10.360  1.00 17.07 ? 174 PHE A CZ  1 
ATOM   1395 N N   . PRO A 1 175 ? -7.481  -2.133  12.932  1.00 17.90 ? 175 PRO A N   1 
ATOM   1396 C CA  . PRO A 1 175 ? -8.318  -3.338  13.030  1.00 15.14 ? 175 PRO A CA  1 
ATOM   1397 C C   . PRO A 1 175 ? -9.188  -3.290  11.769  1.00 16.42 ? 175 PRO A C   1 
ATOM   1398 O O   . PRO A 1 175 ? -9.437  -2.200  11.232  1.00 18.53 ? 175 PRO A O   1 
ATOM   1399 C CB  . PRO A 1 175 ? -9.170  -3.091  14.275  1.00 10.98 ? 175 PRO A CB  1 
ATOM   1400 C CG  . PRO A 1 175 ? -8.407  -2.111  15.047  1.00 14.94 ? 175 PRO A CG  1 
ATOM   1401 C CD  . PRO A 1 175 ? -7.822  -1.185  14.002  1.00 15.93 ? 175 PRO A CD  1 
ATOM   1402 N N   . GLY A 1 176 ? -9.672  -4.447  11.334  1.00 17.30 ? 176 GLY A N   1 
ATOM   1403 C CA  . GLY A 1 176 ? -10.493 -4.550  10.141  1.00 20.22 ? 176 GLY A CA  1 
ATOM   1404 C C   . GLY A 1 176 ? -11.445 -3.442  9.709   1.00 25.32 ? 176 GLY A C   1 
ATOM   1405 O O   . GLY A 1 176 ? -11.463 -3.061  8.522   1.00 29.00 ? 176 GLY A O   1 
ATOM   1406 N N   . GLY A 1 177 ? -12.247 -2.908  10.621  1.00 22.04 ? 177 GLY A N   1 
ATOM   1407 C CA  . GLY A 1 177 ? -13.160 -1.881  10.163  1.00 24.15 ? 177 GLY A CA  1 
ATOM   1408 C C   . GLY A 1 177 ? -13.107 -0.544  10.864  1.00 23.49 ? 177 GLY A C   1 
ATOM   1409 O O   . GLY A 1 177 ? -14.101 0.178   10.897  1.00 22.67 ? 177 GLY A O   1 
ATOM   1410 N N   . SER A 1 178 ? -11.958 -0.203  11.423  1.00 22.00 ? 178 SER A N   1 
ATOM   1411 C CA  . SER A 1 178 ? -11.848 1.054   12.125  1.00 18.93 ? 178 SER A CA  1 
ATOM   1412 C C   . SER A 1 178 ? -10.517 1.719   11.846  1.00 17.72 ? 178 SER A C   1 
ATOM   1413 O O   . SER A 1 178 ? -9.689  1.189   11.118  1.00 16.87 ? 178 SER A O   1 
ATOM   1414 C CB  . SER A 1 178 ? -12.000 0.825   13.620  1.00 20.10 ? 178 SER A CB  1 
ATOM   1415 O OG  . SER A 1 178 ? -10.961 -0.007  14.099  1.00 20.17 ? 178 SER A OG  1 
ATOM   1416 N N   . VAL A 1 179 ? -10.330 2.887   12.443  1.00 17.61 ? 179 VAL A N   1 
ATOM   1417 C CA  . VAL A 1 179 ? -9.117  3.667   12.280  1.00 18.96 ? 179 VAL A CA  1 
ATOM   1418 C C   . VAL A 1 179 ? -8.905  4.477   13.553  1.00 20.08 ? 179 VAL A C   1 
ATOM   1419 O O   . VAL A 1 179 ? -9.858  4.785   14.256  1.00 23.11 ? 179 VAL A O   1 
ATOM   1420 C CB  . VAL A 1 179 ? -9.248  4.650   11.103  1.00 18.61 ? 179 VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 179 ? -9.296  3.895   9.812   1.00 14.81 ? 179 VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 179 ? -10.504 5.509   11.278  1.00 13.04 ? 179 VAL A CG2 1 
ATOM   1423 N N   . THR A 1 180 ? -7.660  4.827   13.845  1.00 21.07 ? 180 THR A N   1 
ATOM   1424 C CA  . THR A 1 180 ? -7.340  5.600   15.031  1.00 19.74 ? 180 THR A CA  1 
ATOM   1425 C C   . THR A 1 180 ? -6.561  6.808   14.534  1.00 19.21 ? 180 THR A C   1 
ATOM   1426 O O   . THR A 1 180 ? -5.585  6.674   13.806  1.00 19.50 ? 180 THR A O   1 
ATOM   1427 C CB  . THR A 1 180 ? -6.463  4.767   15.993  1.00 25.87 ? 180 THR A CB  1 
ATOM   1428 O OG1 . THR A 1 180 ? -7.058  3.473   16.168  1.00 24.83 ? 180 THR A OG1 1 
ATOM   1429 C CG2 . THR A 1 180 ? -6.330  5.466   17.386  1.00 27.39 ? 180 THR A CG2 1 
ATOM   1430 N N   . PRO A 1 181 ? -6.988  8.010   14.919  1.00 20.50 ? 181 PRO A N   1 
ATOM   1431 C CA  . PRO A 1 181 ? -6.365  9.285   14.537  1.00 19.32 ? 181 PRO A CA  1 
ATOM   1432 C C   . PRO A 1 181 ? -4.947  9.472   15.067  1.00 18.86 ? 181 PRO A C   1 
ATOM   1433 O O   . PRO A 1 181 ? -4.479  8.706   15.909  1.00 15.24 ? 181 PRO A O   1 
ATOM   1434 C CB  . PRO A 1 181 ? -7.306  10.314  15.147  1.00 19.04 ? 181 PRO A CB  1 
ATOM   1435 C CG  . PRO A 1 181 ? -7.734  9.627   16.444  1.00 21.65 ? 181 PRO A CG  1 
ATOM   1436 C CD  . PRO A 1 181 ? -8.061  8.230   15.911  1.00 22.26 ? 181 PRO A CD  1 
ATOM   1437 N N   . VAL A 1 182 ? -4.275  10.507  14.562  1.00 15.71 ? 182 VAL A N   1 
ATOM   1438 C CA  . VAL A 1 182 ? -2.919  10.845  15.000  1.00 16.50 ? 182 VAL A CA  1 
ATOM   1439 C C   . VAL A 1 182 ? -2.881  12.346  15.276  1.00 16.36 ? 182 VAL A C   1 
ATOM   1440 O O   . VAL A 1 182 ? -3.694  13.109  14.755  1.00 16.31 ? 182 VAL A O   1 
ATOM   1441 C CB  . VAL A 1 182 ? -1.862  10.538  13.916  1.00 17.34 ? 182 VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 182 ? -1.838  9.056   13.619  1.00 20.16 ? 182 VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 182 ? -2.158  11.327  12.657  1.00 13.95 ? 182 VAL A CG2 1 
ATOM   1444 N N   . SER A 1 183 ? -1.950  12.782  16.105  1.00 14.74 ? 183 SER A N   1 
ATOM   1445 C CA  . SER A 1 183 ? -1.854  14.208  16.388  1.00 15.00 ? 183 SER A CA  1 
ATOM   1446 C C   . SER A 1 183 ? -0.727  14.753  15.514  1.00 14.60 ? 183 SER A C   1 
ATOM   1447 O O   . SER A 1 183 ? 0.267   14.073  15.278  1.00 12.78 ? 183 SER A O   1 
ATOM   1448 C CB  . SER A 1 183 ? -1.563  14.434  17.869  1.00 14.62 ? 183 SER A CB  1 
ATOM   1449 O OG  . SER A 1 183 ? -0.522  13.582  18.333  1.00 17.08 ? 183 SER A OG  1 
ATOM   1450 N N   . LEU A 1 184 ? -0.884  15.976  15.030  1.00 17.10 ? 184 LEU A N   1 
ATOM   1451 C CA  . LEU A 1 184 ? 0.141   16.559  14.171  1.00 18.43 ? 184 LEU A CA  1 
ATOM   1452 C C   . LEU A 1 184 ? 0.818   17.809  14.741  1.00 18.66 ? 184 LEU A C   1 
ATOM   1453 O O   . LEU A 1 184 ? 0.184   18.634  15.391  1.00 21.29 ? 184 LEU A O   1 
ATOM   1454 C CB  . LEU A 1 184 ? -0.475  16.906  12.804  1.00 17.81 ? 184 LEU A CB  1 
ATOM   1455 C CG  . LEU A 1 184 ? -1.282  15.822  12.098  1.00 15.75 ? 184 LEU A CG  1 
ATOM   1456 C CD1 . LEU A 1 184 ? -1.900  16.391  10.852  1.00 12.51 ? 184 LEU A CD1 1 
ATOM   1457 C CD2 . LEU A 1 184 ? -0.400  14.634  11.774  1.00 15.15 ? 184 LEU A CD2 1 
ATOM   1458 N N   . LEU A 1 185 ? 2.117   17.933  14.508  1.00 22.12 ? 185 LEU A N   1 
ATOM   1459 C CA  . LEU A 1 185 ? 2.827   19.129  14.927  1.00 21.68 ? 185 LEU A CA  1 
ATOM   1460 C C   . LEU A 1 185 ? 2.854   20.012  13.688  1.00 21.06 ? 185 LEU A C   1 
ATOM   1461 O O   . LEU A 1 185 ? 3.258   19.573  12.610  1.00 17.24 ? 185 LEU A O   1 
ATOM   1462 C CB  . LEU A 1 185 ? 4.268   18.831  15.368  1.00 23.19 ? 185 LEU A CB  1 
ATOM   1463 C CG  . LEU A 1 185 ? 5.046   20.107  15.767  1.00 22.14 ? 185 LEU A CG  1 
ATOM   1464 C CD1 . LEU A 1 185 ? 4.272   20.932  16.762  1.00 23.73 ? 185 LEU A CD1 1 
ATOM   1465 C CD2 . LEU A 1 185 ? 6.374   19.721  16.378  1.00 26.06 ? 185 LEU A CD2 1 
ATOM   1466 N N   . ALA A 1 186 ? 2.385   21.244  13.844  1.00 22.29 ? 186 ALA A N   1 
ATOM   1467 C CA  . ALA A 1 186 ? 2.374   22.195  12.753  1.00 22.95 ? 186 ALA A CA  1 
ATOM   1468 C C   . ALA A 1 186 ? 3.155   23.418  13.220  1.00 23.74 ? 186 ALA A C   1 
ATOM   1469 O O   . ALA A 1 186 ? 2.671   24.209  14.037  1.00 25.68 ? 186 ALA A O   1 
ATOM   1470 C CB  . ALA A 1 186 ? 0.952   22.568  12.399  1.00 20.97 ? 186 ALA A CB  1 
ATOM   1471 N N   . ASP A 1 187 ? 4.379   23.552  12.707  1.00 23.50 ? 187 ASP A N   1 
ATOM   1472 C CA  . ASP A 1 187 ? 5.262   24.659  13.069  1.00 23.35 ? 187 ASP A CA  1 
ATOM   1473 C C   . ASP A 1 187 ? 5.975   25.235  11.845  1.00 21.34 ? 187 ASP A C   1 
ATOM   1474 O O   . ASP A 1 187 ? 6.749   24.541  11.180  1.00 21.78 ? 187 ASP A O   1 
ATOM   1475 C CB  . ASP A 1 187 ? 6.294   24.185  14.109  1.00 24.03 ? 187 ASP A CB  1 
ATOM   1476 C CG  . ASP A 1 187 ? 7.259   25.291  14.523  1.00 26.03 ? 187 ASP A CG  1 
ATOM   1477 O OD1 . ASP A 1 187 ? 7.067   26.435  14.074  1.00 28.69 ? 187 ASP A OD1 1 
ATOM   1478 O OD2 . ASP A 1 187 ? 8.205   25.020  15.290  1.00 25.10 ? 187 ASP A OD2 1 
ATOM   1479 N N   . PRO A 1 188 ? 5.732   26.516  11.537  1.00 21.45 ? 188 PRO A N   1 
ATOM   1480 C CA  . PRO A 1 188 ? 6.347   27.182  10.394  1.00 22.33 ? 188 PRO A CA  1 
ATOM   1481 C C   . PRO A 1 188 ? 7.873   27.136  10.454  1.00 21.86 ? 188 PRO A C   1 
ATOM   1482 O O   . PRO A 1 188 ? 8.553   27.339  9.452   1.00 20.38 ? 188 PRO A O   1 
ATOM   1483 C CB  . PRO A 1 188 ? 5.804   28.612  10.502  1.00 22.22 ? 188 PRO A CB  1 
ATOM   1484 C CG  . PRO A 1 188 ? 4.501   28.435  11.132  1.00 23.72 ? 188 PRO A CG  1 
ATOM   1485 C CD  . PRO A 1 188 ? 4.849   27.455  12.241  1.00 23.40 ? 188 PRO A CD  1 
ATOM   1486 N N   . ALA A 1 189 ? 8.396   26.864  11.648  1.00 23.15 ? 189 ALA A N   1 
ATOM   1487 C CA  . ALA A 1 189 ? 9.835   26.787  11.887  1.00 23.84 ? 189 ALA A CA  1 
ATOM   1488 C C   . ALA A 1 189 ? 10.540  25.955  10.834  1.00 24.96 ? 189 ALA A C   1 
ATOM   1489 O O   . ALA A 1 189 ? 11.685  26.238  10.444  1.00 24.47 ? 189 ALA A O   1 
ATOM   1490 C CB  . ALA A 1 189 ? 10.102  26.194  13.273  1.00 25.27 ? 189 ALA A CB  1 
ATOM   1491 N N   . PHE A 1 190 ? 9.854   24.919  10.361  1.00 27.32 ? 190 PHE A N   1 
ATOM   1492 C CA  . PHE A 1 190 ? 10.465  24.058  9.359   1.00 26.49 ? 190 PHE A CA  1 
ATOM   1493 C C   . PHE A 1 190 ? 9.713   23.956  8.051   1.00 23.93 ? 190 PHE A C   1 
ATOM   1494 O O   . PHE A 1 190 ? 8.480   23.823  8.006   1.00 20.66 ? 190 PHE A O   1 
ATOM   1495 C CB  . PHE A 1 190 ? 10.683  22.647  9.909   1.00 30.25 ? 190 PHE A CB  1 
ATOM   1496 C CG  . PHE A 1 190 ? 11.411  22.607  11.219  1.00 34.56 ? 190 PHE A CG  1 
ATOM   1497 C CD1 . PHE A 1 190 ? 10.706  22.681  12.427  1.00 36.34 ? 190 PHE A CD1 1 
ATOM   1498 C CD2 . PHE A 1 190 ? 12.797  22.489  11.245  1.00 37.56 ? 190 PHE A CD2 1 
ATOM   1499 C CE1 . PHE A 1 190 ? 11.374  22.634  13.662  1.00 38.77 ? 190 PHE A CE1 1 
ATOM   1500 C CE2 . PHE A 1 190 ? 13.483  22.442  12.454  1.00 41.02 ? 190 PHE A CE2 1 
ATOM   1501 C CZ  . PHE A 1 190 ? 12.768  22.514  13.681  1.00 40.94 ? 190 PHE A CZ  1 
ATOM   1502 N N   . ILE A 1 191 ? 10.492  24.029  6.986   1.00 20.73 ? 191 ILE A N   1 
ATOM   1503 C CA  . ILE A 1 191 ? 9.974   23.920  5.646   1.00 23.72 ? 191 ILE A CA  1 
ATOM   1504 C C   . ILE A 1 191 ? 10.456  22.543  5.223   1.00 22.55 ? 191 ILE A C   1 
ATOM   1505 O O   . ILE A 1 191 ? 11.459  22.067  5.754   1.00 24.87 ? 191 ILE A O   1 
ATOM   1506 C CB  . ILE A 1 191 ? 10.588  25.008  4.734   1.00 24.50 ? 191 ILE A CB  1 
ATOM   1507 C CG1 . ILE A 1 191 ? 10.293  26.395  5.325   1.00 25.32 ? 191 ILE A CG1 1 
ATOM   1508 C CG2 . ILE A 1 191 ? 10.062  24.854  3.310   1.00 22.93 ? 191 ILE A CG2 1 
ATOM   1509 C CD1 . ILE A 1 191 ? 8.825   26.610  5.757   1.00 24.21 ? 191 ILE A CD1 1 
ATOM   1510 N N   . ARG A 1 192 ? 9.745   21.899  4.304   1.00 19.95 ? 192 ARG A N   1 
ATOM   1511 C CA  . ARG A 1 192 ? 10.131  20.562  3.845   1.00 19.07 ? 192 ARG A CA  1 
ATOM   1512 C C   . ARG A 1 192 ? 10.655  20.647  2.432   1.00 17.31 ? 192 ARG A C   1 
ATOM   1513 O O   . ARG A 1 192 ? 11.595  19.966  2.055   1.00 15.04 ? 192 ARG A O   1 
ATOM   1514 C CB  . ARG A 1 192 ? 8.941   19.615  3.849   1.00 18.06 ? 192 ARG A CB  1 
ATOM   1515 C CG  . ARG A 1 192 ? 9.332   18.169  3.929   1.00 19.04 ? 192 ARG A CG  1 
ATOM   1516 C CD  . ARG A 1 192 ? 8.166   17.282  3.557   1.00 24.65 ? 192 ARG A CD  1 
ATOM   1517 N NE  . ARG A 1 192 ? 8.110   17.014  2.118   1.00 25.72 ? 192 ARG A NE  1 
ATOM   1518 C CZ  . ARG A 1 192 ? 8.784   16.036  1.516   1.00 23.00 ? 192 ARG A CZ  1 
ATOM   1519 N NH1 . ARG A 1 192 ? 9.578   15.229  2.226   1.00 13.53 ? 192 ARG A NH1 1 
ATOM   1520 N NH2 . ARG A 1 192 ? 8.627   15.844  0.204   1.00 26.05 ? 192 ARG A NH2 1 
ATOM   1521 N N   . ALA A 1 193 ? 9.997   21.486  1.653   1.00 17.01 ? 193 ALA A N   1 
ATOM   1522 C CA  . ALA A 1 193 ? 10.354  21.710  0.270   1.00 18.29 ? 193 ALA A CA  1 
ATOM   1523 C C   . ALA A 1 193 ? 9.839   23.099  -0.032  1.00 20.75 ? 193 ALA A C   1 
ATOM   1524 O O   . ALA A 1 193 ? 9.056   23.678  0.745   1.00 20.05 ? 193 ALA A O   1 
ATOM   1525 C CB  . ALA A 1 193 ? 9.675   20.684  -0.639  1.00 9.26  ? 193 ALA A CB  1 
ATOM   1526 N N   . TRP A 1 194 ? 10.286  23.629  -1.162  1.00 23.16 ? 194 TRP A N   1 
ATOM   1527 C CA  . TRP A 1 194 ? 9.876   24.944  -1.588  1.00 25.50 ? 194 TRP A CA  1 
ATOM   1528 C C   . TRP A 1 194 ? 9.565   24.930  -3.066  1.00 26.04 ? 194 TRP A C   1 
ATOM   1529 O O   . TRP A 1 194 ? 9.793   23.929  -3.760  1.00 25.79 ? 194 TRP A O   1 
ATOM   1530 C CB  . TRP A 1 194 ? 10.990  25.938  -1.284  1.00 28.64 ? 194 TRP A CB  1 
ATOM   1531 C CG  . TRP A 1 194 ? 12.357  25.462  -1.711  1.00 32.89 ? 194 TRP A CG  1 
ATOM   1532 C CD1 . TRP A 1 194 ? 12.997  25.762  -2.879  1.00 32.79 ? 194 TRP A CD1 1 
ATOM   1533 C CD2 . TRP A 1 194 ? 13.255  24.619  -0.961  1.00 34.49 ? 194 TRP A CD2 1 
ATOM   1534 N NE1 . TRP A 1 194 ? 14.241  25.169  -2.903  1.00 33.21 ? 194 TRP A NE1 1 
ATOM   1535 C CE2 . TRP A 1 194 ? 14.426  24.460  -1.741  1.00 35.53 ? 194 TRP A CE2 1 
ATOM   1536 C CE3 . TRP A 1 194 ? 13.182  23.980  0.297   1.00 37.69 ? 194 TRP A CE3 1 
ATOM   1537 C CZ2 . TRP A 1 194 ? 15.537  23.683  -1.304  1.00 34.30 ? 194 TRP A CZ2 1 
ATOM   1538 C CZ3 . TRP A 1 194 ? 14.283  23.202  0.735   1.00 35.44 ? 194 TRP A CZ3 1 
ATOM   1539 C CH2 . TRP A 1 194 ? 15.445  23.066  -0.074  1.00 35.27 ? 194 TRP A CH2 1 
ATOM   1540 N N   . VAL A 1 195 ? 9.030   26.048  -3.538  1.00 25.51 ? 195 VAL A N   1 
ATOM   1541 C CA  . VAL A 1 195 ? 8.660   26.190  -4.940  1.00 22.48 ? 195 VAL A CA  1 
ATOM   1542 C C   . VAL A 1 195 ? 9.925   26.225  -5.771  1.00 24.93 ? 195 VAL A C   1 
ATOM   1543 O O   . VAL A 1 195 ? 10.820  27.038  -5.520  1.00 22.91 ? 195 VAL A O   1 
ATOM   1544 C CB  . VAL A 1 195 ? 7.885   27.488  -5.190  1.00 21.55 ? 195 VAL A CB  1 
ATOM   1545 C CG1 . VAL A 1 195 ? 7.744   27.720  -6.685  1.00 17.33 ? 195 VAL A CG1 1 
ATOM   1546 C CG2 . VAL A 1 195 ? 6.529   27.406  -4.531  1.00 19.65 ? 195 VAL A CG2 1 
ATOM   1547 N N   . GLY A 1 196 ? 9.988   25.355  -6.773  1.00 25.03 ? 196 GLY A N   1 
ATOM   1548 C CA  . GLY A 1 196 ? 11.171  25.297  -7.604  1.00 27.45 ? 196 GLY A CA  1 
ATOM   1549 C C   . GLY A 1 196 ? 12.151  24.330  -6.963  1.00 28.60 ? 196 GLY A C   1 
ATOM   1550 O O   . GLY A 1 196 ? 13.297  24.172  -7.422  1.00 30.07 ? 196 GLY A O   1 
ATOM   1551 N N   . GLY A 1 197 ? 11.688  23.687  -5.888  1.00 27.08 ? 197 GLY A N   1 
ATOM   1552 C CA  . GLY A 1 197 ? 12.504  22.724  -5.180  1.00 22.71 ? 197 GLY A CA  1 
ATOM   1553 C C   . GLY A 1 197 ? 12.357  21.352  -5.787  1.00 23.65 ? 197 GLY A C   1 
ATOM   1554 O O   . GLY A 1 197 ? 12.069  21.193  -6.974  1.00 23.01 ? 197 GLY A O   1 
ATOM   1555 N N   . VAL A 1 198 ? 12.517  20.332  -4.966  1.00 24.96 ? 198 VAL A N   1 
ATOM   1556 C CA  . VAL A 1 198 ? 12.438  18.980  -5.491  1.00 23.96 ? 198 VAL A CA  1 
ATOM   1557 C C   . VAL A 1 198 ? 11.484  18.060  -4.686  1.00 22.48 ? 198 VAL A C   1 
ATOM   1558 O O   . VAL A 1 198 ? 11.475  16.831  -4.839  1.00 22.48 ? 198 VAL A O   1 
ATOM   1559 C CB  . VAL A 1 198 ? 13.898  18.421  -5.597  1.00 22.73 ? 198 VAL A CB  1 
ATOM   1560 C CG1 . VAL A 1 198 ? 14.457  18.119  -4.225  1.00 19.18 ? 198 VAL A CG1 1 
ATOM   1561 C CG2 . VAL A 1 198 ? 13.928  17.232  -6.510  1.00 26.07 ? 198 VAL A CG2 1 
ATOM   1562 N N   . GLY A 1 199 ? 10.641  18.679  -3.866  1.00 21.95 ? 199 GLY A N   1 
ATOM   1563 C CA  . GLY A 1 199 ? 9.689   17.921  -3.072  1.00 21.24 ? 199 GLY A CA  1 
ATOM   1564 C C   . GLY A 1 199 ? 8.640   17.147  -3.848  1.00 18.66 ? 199 GLY A C   1 
ATOM   1565 O O   . GLY A 1 199 ? 7.924   16.314  -3.271  1.00 21.47 ? 199 GLY A O   1 
ATOM   1566 N N   . ASN A 1 200 ? 8.503   17.408  -5.138  1.00 17.27 ? 200 ASN A N   1 
ATOM   1567 C CA  . ASN A 1 200 ? 7.502   16.660  -5.880  1.00 17.14 ? 200 ASN A CA  1 
ATOM   1568 C C   . ASN A 1 200 ? 8.121   15.436  -6.518  1.00 15.38 ? 200 ASN A C   1 
ATOM   1569 O O   . ASN A 1 200 ? 7.575   14.831  -7.433  1.00 16.69 ? 200 ASN A O   1 
ATOM   1570 C CB  . ASN A 1 200 ? 6.784   17.531  -6.913  1.00 20.66 ? 200 ASN A CB  1 
ATOM   1571 C CG  . ASN A 1 200 ? 7.724   18.171  -7.918  1.00 23.92 ? 200 ASN A CG  1 
ATOM   1572 O OD1 . ASN A 1 200 ? 7.325   18.445  -9.061  1.00 23.31 ? 200 ASN A OD1 1 
ATOM   1573 N ND2 . ASN A 1 200 ? 8.967   18.437  -7.502  1.00 26.38 ? 200 ASN A ND2 1 
ATOM   1574 N N   . TYR A 1 201 ? 9.287   15.074  -6.009  1.00 17.05 ? 201 TYR A N   1 
ATOM   1575 C CA  . TYR A 1 201 ? 10.005  13.890  -6.448  1.00 13.39 ? 201 TYR A CA  1 
ATOM   1576 C C   . TYR A 1 201 ? 10.320  13.158  -5.168  1.00 13.22 ? 201 TYR A C   1 
ATOM   1577 O O   . TYR A 1 201 ? 10.544  13.758  -4.125  1.00 10.25 ? 201 TYR A O   1 
ATOM   1578 C CB  . TYR A 1 201 ? 11.303  14.255  -7.147  1.00 14.83 ? 201 TYR A CB  1 
ATOM   1579 C CG  . TYR A 1 201 ? 11.116  15.122  -8.366  1.00 18.67 ? 201 TYR A CG  1 
ATOM   1580 C CD1 . TYR A 1 201 ? 10.775  14.569  -9.604  1.00 14.67 ? 201 TYR A CD1 1 
ATOM   1581 C CD2 . TYR A 1 201 ? 11.301  16.496  -8.287  1.00 15.69 ? 201 TYR A CD2 1 
ATOM   1582 C CE1 . TYR A 1 201 ? 10.634  15.363  -10.724 1.00 13.96 ? 201 TYR A CE1 1 
ATOM   1583 C CE2 . TYR A 1 201 ? 11.162  17.294  -9.402  1.00 18.66 ? 201 TYR A CE2 1 
ATOM   1584 C CZ  . TYR A 1 201 ? 10.834  16.727  -10.615 1.00 17.48 ? 201 TYR A CZ  1 
ATOM   1585 O OH  . TYR A 1 201 ? 10.733  17.551  -11.714 1.00 20.36 ? 201 TYR A OH  1 
ATOM   1586 N N   . LYS A 1 202 ? 10.322  11.843  -5.236  1.00 14.55 ? 202 LYS A N   1 
ATOM   1587 C CA  . LYS A 1 202 ? 10.610  11.068  -4.059  1.00 14.46 ? 202 LYS A CA  1 
ATOM   1588 C C   . LYS A 1 202 ? 12.104  10.768  -4.059  1.00 14.97 ? 202 LYS A C   1 
ATOM   1589 O O   . LYS A 1 202 ? 12.540  9.736   -4.557  1.00 13.55 ? 202 LYS A O   1 
ATOM   1590 C CB  . LYS A 1 202 ? 9.776   9.797   -4.082  1.00 16.67 ? 202 LYS A CB  1 
ATOM   1591 C CG  . LYS A 1 202 ? 10.121  8.804   -3.012  1.00 22.77 ? 202 LYS A CG  1 
ATOM   1592 C CD  . LYS A 1 202 ? 9.254   7.585   -3.164  1.00 22.69 ? 202 LYS A CD  1 
ATOM   1593 C CE  . LYS A 1 202 ? 7.967   7.790   -2.459  1.00 24.80 ? 202 LYS A CE  1 
ATOM   1594 N NZ  . LYS A 1 202 ? 8.205   7.784   -1.025  1.00 26.92 ? 202 LYS A NZ  1 
ATOM   1595 N N   . LEU A 1 203 ? 12.869  11.710  -3.513  1.00 12.83 ? 203 LEU A N   1 
ATOM   1596 C CA  . LEU A 1 203 ? 14.316  11.613  -3.416  1.00 12.70 ? 203 LEU A CA  1 
ATOM   1597 C C   . LEU A 1 203 ? 14.718  11.476  -1.967  1.00 14.23 ? 203 LEU A C   1 
ATOM   1598 O O   . LEU A 1 203 ? 14.104  12.098  -1.101  1.00 16.80 ? 203 LEU A O   1 
ATOM   1599 C CB  . LEU A 1 203 ? 14.961  12.875  -3.954  1.00 13.41 ? 203 LEU A CB  1 
ATOM   1600 C CG  . LEU A 1 203 ? 14.394  13.450  -5.242  1.00 14.55 ? 203 LEU A CG  1 
ATOM   1601 C CD1 . LEU A 1 203 ? 15.177  14.705  -5.557  1.00 15.17 ? 203 LEU A CD1 1 
ATOM   1602 C CD2 . LEU A 1 203 ? 14.478  12.432  -6.378  1.00 9.74  ? 203 LEU A CD2 1 
ATOM   1603 N N   . GLY A 1 204 ? 15.744  10.666  -1.707  1.00 11.62 ? 204 GLY A N   1 
ATOM   1604 C CA  . GLY A 1 204 ? 16.224  10.490  -0.348  1.00 13.03 ? 204 GLY A CA  1 
ATOM   1605 C C   . GLY A 1 204 ? 16.476  11.823  0.350   1.00 11.74 ? 204 GLY A C   1 
ATOM   1606 O O   . GLY A 1 204 ? 16.120  11.997  1.508   1.00 13.63 ? 204 GLY A O   1 
ATOM   1607 N N   . GLY A 1 205 ? 17.067  12.770  -0.368  1.00 10.29 ? 205 GLY A N   1 
ATOM   1608 C CA  . GLY A 1 205 ? 17.342  14.079  0.191   1.00 13.67 ? 205 GLY A CA  1 
ATOM   1609 C C   . GLY A 1 205 ? 16.167  14.814  0.820   1.00 14.50 ? 205 GLY A C   1 
ATOM   1610 O O   . GLY A 1 205 ? 16.356  15.637  1.719   1.00 15.24 ? 205 GLY A O   1 
ATOM   1611 N N   . ASN A 1 206 ? 14.957  14.547  0.346   1.00 14.64 ? 206 ASN A N   1 
ATOM   1612 C CA  . ASN A 1 206 ? 13.778  15.193  0.919   1.00 15.54 ? 206 ASN A CA  1 
ATOM   1613 C C   . ASN A 1 206 ? 13.523  14.761  2.366   1.00 15.91 ? 206 ASN A C   1 
ATOM   1614 O O   . ASN A 1 206 ? 13.009  15.553  3.160   1.00 16.68 ? 206 ASN A O   1 
ATOM   1615 C CB  . ASN A 1 206 ? 12.523  14.857  0.112   1.00 16.12 ? 206 ASN A CB  1 
ATOM   1616 C CG  . ASN A 1 206 ? 12.457  15.578  -1.217  1.00 17.37 ? 206 ASN A CG  1 
ATOM   1617 O OD1 . ASN A 1 206 ? 11.622  15.255  -2.051  1.00 19.94 ? 206 ASN A OD1 1 
ATOM   1618 N ND2 . ASN A 1 206 ? 13.319  16.558  -1.413  1.00 17.26 ? 206 ASN A ND2 1 
ATOM   1619 N N   . TYR A 1 207 ? 13.897  13.524  2.700   1.00 13.40 ? 207 TYR A N   1 
ATOM   1620 C CA  . TYR A 1 207 ? 13.651  12.941  4.030   1.00 16.54 ? 207 TYR A CA  1 
ATOM   1621 C C   . TYR A 1 207 ? 14.681  13.110  5.159   1.00 15.20 ? 207 TYR A C   1 
ATOM   1622 O O   . TYR A 1 207 ? 14.301  13.339  6.319   1.00 14.53 ? 207 TYR A O   1 
ATOM   1623 C CB  . TYR A 1 207 ? 13.327  11.442  3.871   1.00 14.54 ? 207 TYR A CB  1 
ATOM   1624 C CG  . TYR A 1 207 ? 12.209  11.213  2.894   1.00 15.06 ? 207 TYR A CG  1 
ATOM   1625 C CD1 . TYR A 1 207 ? 12.417  11.382  1.517   1.00 16.17 ? 207 TYR A CD1 1 
ATOM   1626 C CD2 . TYR A 1 207 ? 10.908  10.980  3.337   1.00 14.81 ? 207 TYR A CD2 1 
ATOM   1627 C CE1 . TYR A 1 207 ? 11.355  11.346  0.618   1.00 14.34 ? 207 TYR A CE1 1 
ATOM   1628 C CE2 . TYR A 1 207 ? 9.842   10.940  2.442   1.00 13.07 ? 207 TYR A CE2 1 
ATOM   1629 C CZ  . TYR A 1 207 ? 10.071  11.126  1.090   1.00 12.79 ? 207 TYR A CZ  1 
ATOM   1630 O OH  . TYR A 1 207 ? 9.016   11.079  0.208   1.00 14.44 ? 207 TYR A OH  1 
ATOM   1631 N N   . GLY A 1 208 ? 15.961  12.978  4.822   1.00 13.68 ? 208 GLY A N   1 
ATOM   1632 C CA  . GLY A 1 208 ? 17.014  13.098  5.814   1.00 14.22 ? 208 GLY A CA  1 
ATOM   1633 C C   . GLY A 1 208 ? 16.767  14.157  6.865   1.00 15.20 ? 208 GLY A C   1 
ATOM   1634 O O   . GLY A 1 208 ? 16.829  13.884  8.062   1.00 13.02 ? 208 GLY A O   1 
ATOM   1635 N N   . PRO A 1 209 ? 16.453  15.387  6.435   1.00 15.42 ? 209 PRO A N   1 
ATOM   1636 C CA  . PRO A 1 209 ? 16.187  16.536  7.302   1.00 14.50 ? 209 PRO A CA  1 
ATOM   1637 C C   . PRO A 1 209 ? 14.905  16.485  8.128   1.00 13.97 ? 209 PRO A C   1 
ATOM   1638 O O   . PRO A 1 209 ? 14.668  17.369  8.923   1.00 12.76 ? 209 PRO A O   1 
ATOM   1639 C CB  . PRO A 1 209 ? 16.139  17.696  6.318   1.00 15.11 ? 209 PRO A CB  1 
ATOM   1640 C CG  . PRO A 1 209 ? 16.855  17.175  5.090   1.00 13.98 ? 209 PRO A CG  1 
ATOM   1641 C CD  . PRO A 1 209 ? 16.376  15.788  5.023   1.00 12.40 ? 209 PRO A CD  1 
ATOM   1642 N N   . THR A 1 210 ? 14.074  15.470  7.927   1.00 14.09 ? 210 THR A N   1 
ATOM   1643 C CA  . THR A 1 210 ? 12.801  15.384  8.642   1.00 10.04 ? 210 THR A CA  1 
ATOM   1644 C C   . THR A 1 210 ? 12.944  14.640  9.947   1.00 11.05 ? 210 THR A C   1 
ATOM   1645 O O   . THR A 1 210 ? 12.123  14.787  10.839  1.00 11.84 ? 210 THR A O   1 
ATOM   1646 C CB  . THR A 1 210 ? 11.707  14.642  7.818   1.00 11.74 ? 210 THR A CB  1 
ATOM   1647 O OG1 . THR A 1 210 ? 12.080  13.266  7.666   1.00 15.01 ? 210 THR A OG1 1 
ATOM   1648 C CG2 . THR A 1 210 ? 11.518  15.264  6.434   1.00 6.98  ? 210 THR A CG2 1 
ATOM   1649 N N   . VAL A 1 211 ? 13.984  13.834  10.057  1.00 11.16 ? 211 VAL A N   1 
ATOM   1650 C CA  . VAL A 1 211 ? 14.208  13.043  11.263  1.00 12.87 ? 211 VAL A CA  1 
ATOM   1651 C C   . VAL A 1 211 ? 14.281  13.871  12.540  1.00 16.86 ? 211 VAL A C   1 
ATOM   1652 O O   . VAL A 1 211 ? 13.710  13.498  13.551  1.00 20.11 ? 211 VAL A O   1 
ATOM   1653 C CB  . VAL A 1 211 ? 15.491  12.218  11.129  1.00 15.28 ? 211 VAL A CB  1 
ATOM   1654 C CG1 . VAL A 1 211 ? 15.726  11.420  12.401  1.00 14.63 ? 211 VAL A CG1 1 
ATOM   1655 C CG2 . VAL A 1 211 ? 15.386  11.305  9.898   1.00 8.47  ? 211 VAL A CG2 1 
ATOM   1656 N N   . LEU A 1 212 ? 14.981  14.997  12.488  1.00 15.80 ? 212 LEU A N   1 
ATOM   1657 C CA  . LEU A 1 212 ? 15.110  15.874  13.632  1.00 12.53 ? 212 LEU A CA  1 
ATOM   1658 C C   . LEU A 1 212 ? 13.729  16.402  13.964  1.00 15.69 ? 212 LEU A C   1 
ATOM   1659 O O   . LEU A 1 212 ? 13.271  16.271  15.097  1.00 18.23 ? 212 LEU A O   1 
ATOM   1660 C CB  . LEU A 1 212 ? 16.041  17.052  13.300  1.00 15.02 ? 212 LEU A CB  1 
ATOM   1661 C CG  . LEU A 1 212 ? 16.276  18.126  14.369  1.00 14.18 ? 212 LEU A CG  1 
ATOM   1662 C CD1 . LEU A 1 212 ? 17.066  17.482  15.513  1.00 12.01 ? 212 LEU A CD1 1 
ATOM   1663 C CD2 . LEU A 1 212 ? 17.033  19.339  13.792  1.00 9.18  ? 212 LEU A CD2 1 
ATOM   1664 N N   . VAL A 1 213 ? 13.068  16.993  12.970  1.00 12.60 ? 213 VAL A N   1 
ATOM   1665 C CA  . VAL A 1 213 ? 11.734  17.564  13.152  1.00 13.98 ? 213 VAL A CA  1 
ATOM   1666 C C   . VAL A 1 213 ? 10.722  16.551  13.689  1.00 15.92 ? 213 VAL A C   1 
ATOM   1667 O O   . VAL A 1 213 ? 9.859   16.899  14.497  1.00 16.00 ? 213 VAL A O   1 
ATOM   1668 C CB  . VAL A 1 213 ? 11.193  18.168  11.812  1.00 15.40 ? 213 VAL A CB  1 
ATOM   1669 C CG1 . VAL A 1 213 ? 9.754   18.707  11.987  1.00 10.35 ? 213 VAL A CG1 1 
ATOM   1670 C CG2 . VAL A 1 213 ? 12.127  19.269  11.346  1.00 17.92 ? 213 VAL A CG2 1 
ATOM   1671 N N   . GLN A 1 214 ? 10.830  15.309  13.231  1.00 13.23 ? 214 GLN A N   1 
ATOM   1672 C CA  . GLN A 1 214 ? 9.935   14.260  13.665  1.00 13.88 ? 214 GLN A CA  1 
ATOM   1673 C C   . GLN A 1 214 ? 10.132  14.049  15.165  1.00 13.99 ? 214 GLN A C   1 
ATOM   1674 O O   . GLN A 1 214 ? 9.170   13.948  15.907  1.00 15.69 ? 214 GLN A O   1 
ATOM   1675 C CB  . GLN A 1 214 ? 10.205  12.984  12.862  1.00 14.68 ? 214 GLN A CB  1 
ATOM   1676 C CG  . GLN A 1 214 ? 9.253   11.852  13.138  1.00 19.82 ? 214 GLN A CG  1 
ATOM   1677 C CD  . GLN A 1 214 ? 7.812   12.282  13.111  1.00 25.34 ? 214 GLN A CD  1 
ATOM   1678 O OE1 . GLN A 1 214 ? 7.282   12.670  12.056  1.00 28.65 ? 214 GLN A OE1 1 
ATOM   1679 N NE2 . GLN A 1 214 ? 7.155   12.231  14.279  1.00 25.23 ? 214 GLN A NE2 1 
ATOM   1680 N N   . GLN A 1 215 ? 11.378  14.019  15.617  1.00 17.10 ? 215 GLN A N   1 
ATOM   1681 C CA  . GLN A 1 215 ? 11.651  13.858  17.051  1.00 20.67 ? 215 GLN A CA  1 
ATOM   1682 C C   . GLN A 1 215 ? 11.049  15.035  17.843  1.00 18.10 ? 215 GLN A C   1 
ATOM   1683 O O   . GLN A 1 215 ? 10.529  14.847  18.927  1.00 17.08 ? 215 GLN A O   1 
ATOM   1684 C CB  . GLN A 1 215 ? 13.171  13.799  17.342  1.00 20.85 ? 215 GLN A CB  1 
ATOM   1685 C CG  . GLN A 1 215 ? 13.920  12.572  16.808  1.00 26.89 ? 215 GLN A CG  1 
ATOM   1686 C CD  . GLN A 1 215 ? 15.393  12.506  17.280  1.00 27.35 ? 215 GLN A CD  1 
ATOM   1687 O OE1 . GLN A 1 215 ? 16.108  11.548  16.986  1.00 26.13 ? 215 GLN A OE1 1 
ATOM   1688 N NE2 . GLN A 1 215 ? 15.839  13.532  18.011  1.00 29.13 ? 215 GLN A NE2 1 
ATOM   1689 N N   . GLU A 1 216 ? 11.138  16.245  17.287  1.00 19.93 ? 216 GLU A N   1 
ATOM   1690 C CA  . GLU A 1 216 ? 10.622  17.449  17.942  1.00 21.26 ? 216 GLU A CA  1 
ATOM   1691 C C   . GLU A 1 216 ? 9.117   17.404  18.045  1.00 20.12 ? 216 GLU A C   1 
ATOM   1692 O O   . GLU A 1 216 ? 8.528   18.007  18.930  1.00 17.39 ? 216 GLU A O   1 
ATOM   1693 C CB  . GLU A 1 216 ? 11.037  18.695  17.167  1.00 25.08 ? 216 GLU A CB  1 
ATOM   1694 C CG  . GLU A 1 216 ? 10.296  19.973  17.565  1.00 30.98 ? 216 GLU A CG  1 
ATOM   1695 C CD  . GLU A 1 216 ? 10.358  20.249  19.064  1.00 36.67 ? 216 GLU A CD  1 
ATOM   1696 O OE1 . GLU A 1 216 ? 11.488  20.243  19.619  1.00 40.71 ? 216 GLU A OE1 1 
ATOM   1697 O OE2 . GLU A 1 216 ? 9.290   20.468  19.693  1.00 37.28 ? 216 GLU A OE2 1 
ATOM   1698 N N   . ALA A 1 217 ? 8.517   16.676  17.114  1.00 22.03 ? 217 ALA A N   1 
ATOM   1699 C CA  . ALA A 1 217 ? 7.081   16.494  17.045  1.00 24.34 ? 217 ALA A CA  1 
ATOM   1700 C C   . ALA A 1 217 ? 6.666   15.567  18.174  1.00 26.11 ? 217 ALA A C   1 
ATOM   1701 O O   . ALA A 1 217 ? 5.634   15.764  18.795  1.00 29.13 ? 217 ALA A O   1 
ATOM   1702 C CB  . ALA A 1 217 ? 6.707   15.888  15.708  1.00 24.96 ? 217 ALA A CB  1 
ATOM   1703 N N   . LEU A 1 218 ? 7.483   14.553  18.444  1.00 26.32 ? 218 LEU A N   1 
ATOM   1704 C CA  . LEU A 1 218 ? 7.207   13.604  19.513  1.00 25.70 ? 218 LEU A CA  1 
ATOM   1705 C C   . LEU A 1 218 ? 7.493   14.186  20.893  1.00 27.29 ? 218 LEU A C   1 
ATOM   1706 O O   . LEU A 1 218 ? 6.726   13.993  21.835  1.00 28.28 ? 218 LEU A O   1 
ATOM   1707 C CB  . LEU A 1 218 ? 8.058   12.368  19.309  1.00 27.22 ? 218 LEU A CB  1 
ATOM   1708 C CG  . LEU A 1 218 ? 7.644   11.493  18.128  1.00 27.12 ? 218 LEU A CG  1 
ATOM   1709 C CD1 . LEU A 1 218 ? 8.690   10.413  17.918  1.00 29.75 ? 218 LEU A CD1 1 
ATOM   1710 C CD2 . LEU A 1 218 ? 6.276   10.881  18.403  1.00 23.77 ? 218 LEU A CD2 1 
ATOM   1711 N N   . LYS A 1 219 ? 8.625   14.866  21.031  1.00 26.04 ? 219 LYS A N   1 
ATOM   1712 C CA  . LYS A 1 219 ? 8.979   15.471  22.304  1.00 27.64 ? 219 LYS A CA  1 
ATOM   1713 C C   . LYS A 1 219 ? 7.919   16.506  22.640  1.00 27.67 ? 219 LYS A C   1 
ATOM   1714 O O   . LYS A 1 219 ? 7.674   16.810  23.815  1.00 25.95 ? 219 LYS A O   1 
ATOM   1715 C CB  . LYS A 1 219 ? 10.352  16.153  22.212  1.00 29.26 ? 219 LYS A CB  1 
ATOM   1716 C CG  . LYS A 1 219 ? 10.448  17.454  23.011  1.00 33.04 ? 219 LYS A CG  1 
ATOM   1717 C CD  . LYS A 1 219 ? 11.817  17.648  23.631  1.00 35.89 ? 219 LYS A CD  1 
ATOM   1718 C CE  . LYS A 1 219 ? 12.937  17.452  22.608  1.00 37.59 ? 219 LYS A CE  1 
ATOM   1719 N NZ  . LYS A 1 219 ? 12.878  18.439  21.491  1.00 40.82 ? 219 LYS A NZ  1 
ATOM   1720 N N   . ARG A 1 220 ? 7.298   17.042  21.590  1.00 27.99 ? 220 ARG A N   1 
ATOM   1721 C CA  . ARG A 1 220 ? 6.264   18.054  21.756  1.00 28.88 ? 220 ARG A CA  1 
ATOM   1722 C C   . ARG A 1 220 ? 4.897   17.418  21.934  1.00 26.07 ? 220 ARG A C   1 
ATOM   1723 O O   . ARG A 1 220 ? 3.904   18.127  22.059  1.00 25.32 ? 220 ARG A O   1 
ATOM   1724 C CB  . ARG A 1 220 ? 6.201   19.008  20.566  1.00 31.41 ? 220 ARG A CB  1 
ATOM   1725 C CG  . ARG A 1 220 ? 5.451   20.277  20.903  1.00 34.91 ? 220 ARG A CG  1 
ATOM   1726 C CD  . ARG A 1 220 ? 6.394   21.337  21.447  1.00 35.97 ? 220 ARG A CD  1 
ATOM   1727 N NE  . ARG A 1 220 ? 7.178   21.911  20.353  1.00 38.89 ? 220 ARG A NE  1 
ATOM   1728 C CZ  . ARG A 1 220 ? 6.687   22.748  19.432  1.00 40.41 ? 220 ARG A CZ  1 
ATOM   1729 N NH1 . ARG A 1 220 ? 5.402   23.113  19.476  1.00 39.50 ? 220 ARG A NH1 1 
ATOM   1730 N NH2 . ARG A 1 220 ? 7.484   23.228  18.476  1.00 38.97 ? 220 ARG A NH2 1 
ATOM   1731 N N   . GLY A 1 221 ? 4.855   16.090  21.918  1.00 23.48 ? 221 GLY A N   1 
ATOM   1732 C CA  . GLY A 1 221 ? 3.608   15.387  22.151  1.00 25.28 ? 221 GLY A CA  1 
ATOM   1733 C C   . GLY A 1 221 ? 2.762   14.977  20.967  1.00 26.38 ? 221 GLY A C   1 
ATOM   1734 O O   . GLY A 1 221 ? 1.647   14.483  21.161  1.00 29.25 ? 221 GLY A O   1 
ATOM   1735 N N   . CYS A 1 222 ? 3.270   15.153  19.750  1.00 25.48 ? 222 CYS A N   1 
ATOM   1736 C CA  . CYS A 1 222 ? 2.505   14.788  18.561  1.00 25.60 ? 222 CYS A CA  1 
ATOM   1737 C C   . CYS A 1 222 ? 3.070   13.524  17.935  1.00 27.91 ? 222 CYS A C   1 
ATOM   1738 O O   . CYS A 1 222 ? 4.092   13.001  18.393  1.00 30.36 ? 222 CYS A O   1 
ATOM   1739 C CB  . CYS A 1 222 ? 2.507   15.940  17.561  1.00 21.84 ? 222 CYS A CB  1 
ATOM   1740 S SG  . CYS A 1 222 ? 1.860   17.483  18.276  1.00 23.49 ? 222 CYS A SG  1 
ATOM   1741 N N   . GLU A 1 223 ? 2.425   13.022  16.887  1.00 27.54 ? 223 GLU A N   1 
ATOM   1742 C CA  . GLU A 1 223 ? 2.920   11.802  16.276  1.00 28.26 ? 223 GLU A CA  1 
ATOM   1743 C C   . GLU A 1 223 ? 3.433   11.944  14.858  1.00 27.78 ? 223 GLU A C   1 
ATOM   1744 O O   . GLU A 1 223 ? 4.217   11.116  14.403  1.00 27.43 ? 223 GLU A O   1 
ATOM   1745 C CB  . GLU A 1 223 ? 1.829   10.745  16.329  1.00 30.45 ? 223 GLU A CB  1 
ATOM   1746 C CG  . GLU A 1 223 ? 1.312   10.532  17.736  1.00 33.36 ? 223 GLU A CG  1 
ATOM   1747 C CD  . GLU A 1 223 ? 0.003   9.798   17.735  1.00 33.23 ? 223 GLU A CD  1 
ATOM   1748 O OE1 . GLU A 1 223 ? -0.085  8.796   16.988  1.00 35.76 ? 223 GLU A OE1 1 
ATOM   1749 O OE2 . GLU A 1 223 ? -0.932  10.218  18.469  1.00 33.68 ? 223 GLU A OE2 1 
ATOM   1750 N N   . GLN A 1 224 ? 2.979   12.975  14.151  1.00 27.68 ? 224 GLN A N   1 
ATOM   1751 C CA  . GLN A 1 224 ? 3.424   13.209  12.776  1.00 27.05 ? 224 GLN A CA  1 
ATOM   1752 C C   . GLN A 1 224 ? 3.544   14.721  12.606  1.00 26.15 ? 224 GLN A C   1 
ATOM   1753 O O   . GLN A 1 224 ? 3.066   15.495  13.455  1.00 25.69 ? 224 GLN A O   1 
ATOM   1754 C CB  . GLN A 1 224 ? 2.412   12.694  11.746  1.00 29.35 ? 224 GLN A CB  1 
ATOM   1755 C CG  . GLN A 1 224 ? 1.634   11.441  12.129  1.00 34.92 ? 224 GLN A CG  1 
ATOM   1756 C CD  . GLN A 1 224 ? 2.337   10.158  11.744  1.00 38.13 ? 224 GLN A CD  1 
ATOM   1757 O OE1 . GLN A 1 224 ? 1.747   9.056   11.813  1.00 36.81 ? 224 GLN A OE1 1 
ATOM   1758 N NE2 . GLN A 1 224 ? 3.617   10.277  11.345  1.00 39.78 ? 224 GLN A NE2 1 
ATOM   1759 N N   . VAL A 1 225 ? 4.156   15.129  11.494  1.00 22.26 ? 225 VAL A N   1 
ATOM   1760 C CA  . VAL A 1 225 ? 4.376   16.531  11.208  1.00 18.89 ? 225 VAL A CA  1 
ATOM   1761 C C   . VAL A 1 225 ? 3.504   16.993  10.059  1.00 19.15 ? 225 VAL A C   1 
ATOM   1762 O O   . VAL A 1 225 ? 3.466   16.368  9.003   1.00 22.16 ? 225 VAL A O   1 
ATOM   1763 C CB  . VAL A 1 225 ? 5.864   16.810  10.796  1.00 19.24 ? 225 VAL A CB  1 
ATOM   1764 C CG1 . VAL A 1 225 ? 6.048   18.290  10.430  1.00 16.43 ? 225 VAL A CG1 1 
ATOM   1765 C CG2 . VAL A 1 225 ? 6.819   16.411  11.912  1.00 17.18 ? 225 VAL A CG2 1 
ATOM   1766 N N   . LEU A 1 226 ? 2.776   18.075  10.270  1.00 17.14 ? 226 LEU A N   1 
ATOM   1767 C CA  . LEU A 1 226 ? 1.993   18.642  9.190   1.00 16.11 ? 226 LEU A CA  1 
ATOM   1768 C C   . LEU A 1 226 ? 2.937   19.727  8.690   1.00 13.66 ? 226 LEU A C   1 
ATOM   1769 O O   . LEU A 1 226 ? 3.289   20.634  9.435   1.00 14.79 ? 226 LEU A O   1 
ATOM   1770 C CB  . LEU A 1 226 ? 0.694   19.282  9.703   1.00 18.93 ? 226 LEU A CB  1 
ATOM   1771 C CG  . LEU A 1 226 ? 0.025   20.290  8.739   1.00 15.70 ? 226 LEU A CG  1 
ATOM   1772 C CD1 . LEU A 1 226 ? -0.430  19.593  7.460   1.00 13.38 ? 226 LEU A CD1 1 
ATOM   1773 C CD2 . LEU A 1 226 ? -1.126  20.962  9.431   1.00 11.73 ? 226 LEU A CD2 1 
ATOM   1774 N N   . TRP A 1 227 ? 3.366   19.628  7.443   1.00 13.67 ? 227 TRP A N   1 
ATOM   1775 C CA  . TRP A 1 227 ? 4.276   20.620  6.897   1.00 14.32 ? 227 TRP A CA  1 
ATOM   1776 C C   . TRP A 1 227 ? 3.553   21.864  6.409   1.00 14.48 ? 227 TRP A C   1 
ATOM   1777 O O   . TRP A 1 227 ? 2.696   21.794  5.533   1.00 17.16 ? 227 TRP A O   1 
ATOM   1778 C CB  . TRP A 1 227 ? 5.083   20.007  5.757   1.00 14.00 ? 227 TRP A CB  1 
ATOM   1779 C CG  . TRP A 1 227 ? 5.831   18.855  6.214   1.00 14.17 ? 227 TRP A CG  1 
ATOM   1780 C CD1 . TRP A 1 227 ? 5.400   17.563  6.258   1.00 16.03 ? 227 TRP A CD1 1 
ATOM   1781 C CD2 . TRP A 1 227 ? 7.094   18.883  6.873   1.00 16.08 ? 227 TRP A CD2 1 
ATOM   1782 N NE1 . TRP A 1 227 ? 6.317   16.783  6.917   1.00 18.77 ? 227 TRP A NE1 1 
ATOM   1783 C CE2 . TRP A 1 227 ? 7.368   17.570  7.308   1.00 17.12 ? 227 TRP A CE2 1 
ATOM   1784 C CE3 . TRP A 1 227 ? 8.021   19.896  7.150   1.00 15.29 ? 227 TRP A CE3 1 
ATOM   1785 C CZ2 . TRP A 1 227 ? 8.532   17.240  8.011   1.00 14.90 ? 227 TRP A CZ2 1 
ATOM   1786 C CZ3 . TRP A 1 227 ? 9.174   19.566  7.847   1.00 16.37 ? 227 TRP A CZ3 1 
ATOM   1787 C CH2 . TRP A 1 227 ? 9.417   18.246  8.271   1.00 9.43  ? 227 TRP A CH2 1 
ATOM   1788 N N   . LEU A 1 228 ? 3.907   23.004  6.983   1.00 15.93 ? 228 LEU A N   1 
ATOM   1789 C CA  . LEU A 1 228 ? 3.300   24.271  6.591   1.00 17.70 ? 228 LEU A CA  1 
ATOM   1790 C C   . LEU A 1 228 ? 4.258   24.964  5.634   1.00 19.57 ? 228 LEU A C   1 
ATOM   1791 O O   . LEU A 1 228 ? 5.472   24.783  5.732   1.00 22.32 ? 228 LEU A O   1 
ATOM   1792 C CB  . LEU A 1 228 ? 3.057   25.148  7.811   1.00 16.54 ? 228 LEU A CB  1 
ATOM   1793 C CG  . LEU A 1 228 ? 2.011   24.605  8.778   1.00 18.65 ? 228 LEU A CG  1 
ATOM   1794 C CD1 . LEU A 1 228 ? 1.773   25.604  9.897   1.00 19.99 ? 228 LEU A CD1 1 
ATOM   1795 C CD2 . LEU A 1 228 ? 0.731   24.329  8.019   1.00 18.76 ? 228 LEU A CD2 1 
ATOM   1796 N N   . TYR A 1 229 ? 3.721   25.750  4.711   1.00 18.58 ? 229 TYR A N   1 
ATOM   1797 C CA  . TYR A 1 229 ? 4.565   26.427  3.741   1.00 19.56 ? 229 TYR A CA  1 
ATOM   1798 C C   . TYR A 1 229 ? 4.132   27.854  3.528   1.00 20.16 ? 229 TYR A C   1 
ATOM   1799 O O   . TYR A 1 229 ? 2.999   28.210  3.812   1.00 21.63 ? 229 TYR A O   1 
ATOM   1800 C CB  . TYR A 1 229 ? 4.496   25.694  2.406   1.00 17.52 ? 229 TYR A CB  1 
ATOM   1801 C CG  . TYR A 1 229 ? 5.311   26.324  1.315   1.00 15.80 ? 229 TYR A CG  1 
ATOM   1802 C CD1 . TYR A 1 229 ? 6.683   26.102  1.228   1.00 15.25 ? 229 TYR A CD1 1 
ATOM   1803 C CD2 . TYR A 1 229 ? 4.711   27.154  0.364   1.00 19.09 ? 229 TYR A CD2 1 
ATOM   1804 C CE1 . TYR A 1 229 ? 7.437   26.684  0.230   1.00 15.36 ? 229 TYR A CE1 1 
ATOM   1805 C CE2 . TYR A 1 229 ? 5.458   27.746  -0.649  1.00 17.54 ? 229 TYR A CE2 1 
ATOM   1806 C CZ  . TYR A 1 229 ? 6.826   27.504  -0.708  1.00 19.50 ? 229 TYR A CZ  1 
ATOM   1807 O OH  . TYR A 1 229 ? 7.587   28.078  -1.709  1.00 22.52 ? 229 TYR A OH  1 
ATOM   1808 N N   . GLY A 1 230 ? 5.047   28.673  3.021   1.00 22.85 ? 230 GLY A N   1 
ATOM   1809 C CA  . GLY A 1 230 ? 4.718   30.064  2.731   1.00 21.91 ? 230 GLY A CA  1 
ATOM   1810 C C   . GLY A 1 230 ? 4.331   30.951  3.898   1.00 21.53 ? 230 GLY A C   1 
ATOM   1811 O O   . GLY A 1 230 ? 4.229   30.510  5.046   1.00 21.45 ? 230 GLY A O   1 
ATOM   1812 N N   . PRO A 1 231 ? 4.080   32.232  3.615   1.00 24.25 ? 231 PRO A N   1 
ATOM   1813 C CA  . PRO A 1 231 ? 3.701   33.188  4.659   1.00 23.14 ? 231 PRO A CA  1 
ATOM   1814 C C   . PRO A 1 231 ? 2.315   32.923  5.227   1.00 21.14 ? 231 PRO A C   1 
ATOM   1815 O O   . PRO A 1 231 ? 2.032   33.333  6.341   1.00 21.16 ? 231 PRO A O   1 
ATOM   1816 C CB  . PRO A 1 231 ? 3.805   34.532  3.943   1.00 23.63 ? 231 PRO A CB  1 
ATOM   1817 C CG  . PRO A 1 231 ? 3.319   34.176  2.541   1.00 23.49 ? 231 PRO A CG  1 
ATOM   1818 C CD  . PRO A 1 231 ? 4.033   32.856  2.276   1.00 24.48 ? 231 PRO A CD  1 
ATOM   1819 N N   . ASP A 1 232 ? 1.446   32.241  4.483   1.00 20.23 ? 232 ASP A N   1 
ATOM   1820 C CA  . ASP A 1 232 ? 0.119   31.971  5.031   1.00 21.17 ? 232 ASP A CA  1 
ATOM   1821 C C   . ASP A 1 232 ? 0.030   30.597  5.599   1.00 20.29 ? 232 ASP A C   1 
ATOM   1822 O O   . ASP A 1 232 ? -1.067  30.084  5.799   1.00 23.80 ? 232 ASP A O   1 
ATOM   1823 C CB  . ASP A 1 232 ? -0.994  32.084  4.003   1.00 25.51 ? 232 ASP A CB  1 
ATOM   1824 C CG  . ASP A 1 232 ? -0.499  32.481  2.654   1.00 29.99 ? 232 ASP A CG  1 
ATOM   1825 O OD1 . ASP A 1 232 ? 0.347   31.741  2.077   1.00 30.67 ? 232 ASP A OD1 1 
ATOM   1826 O OD2 . ASP A 1 232 ? -0.971  33.542  2.185   1.00 30.59 ? 232 ASP A OD2 1 
ATOM   1827 N N   . HIS A 1 233 ? 1.171   29.982  5.840   1.00 19.98 ? 233 HIS A N   1 
ATOM   1828 C CA  . HIS A 1 233 ? 1.168   28.649  6.413   1.00 22.05 ? 233 HIS A CA  1 
ATOM   1829 C C   . HIS A 1 233 ? 0.148   27.767  5.720   1.00 21.81 ? 233 HIS A C   1 
ATOM   1830 O O   . HIS A 1 233 ? -0.848  27.347  6.327   1.00 20.29 ? 233 HIS A O   1 
ATOM   1831 C CB  . HIS A 1 233 ? 0.839   28.717  7.902   1.00 20.40 ? 233 HIS A CB  1 
ATOM   1832 C CG  . HIS A 1 233 ? 1.706   29.672  8.647   1.00 19.57 ? 233 HIS A CG  1 
ATOM   1833 N ND1 . HIS A 1 233 ? 1.531   29.946  9.983   1.00 18.32 ? 233 HIS A ND1 1 
ATOM   1834 C CD2 . HIS A 1 233 ? 2.720   30.462  8.226   1.00 19.18 ? 233 HIS A CD2 1 
ATOM   1835 C CE1 . HIS A 1 233 ? 2.395   30.873  10.353  1.00 19.98 ? 233 HIS A CE1 1 
ATOM   1836 N NE2 . HIS A 1 233 ? 3.129   31.203  9.306   1.00 22.02 ? 233 HIS A NE2 1 
ATOM   1837 N N   . GLN A 1 234 ? 0.387   27.505  4.446   1.00 19.61 ? 234 GLN A N   1 
ATOM   1838 C CA  . GLN A 1 234 ? -0.512  26.649  3.733   1.00 21.82 ? 234 GLN A CA  1 
ATOM   1839 C C   . GLN A 1 234 ? -0.092  25.222  4.054   1.00 22.98 ? 234 GLN A C   1 
ATOM   1840 O O   . GLN A 1 234 ? 1.097   24.944  4.268   1.00 22.51 ? 234 GLN A O   1 
ATOM   1841 C CB  . GLN A 1 234 ? -0.463  26.949  2.238   1.00 21.82 ? 234 GLN A CB  1 
ATOM   1842 C CG  . GLN A 1 234 ? 0.890   27.088  1.671   1.00 22.86 ? 234 GLN A CG  1 
ATOM   1843 C CD  . GLN A 1 234 ? 0.864   27.857  0.368   1.00 25.13 ? 234 GLN A CD  1 
ATOM   1844 O OE1 . GLN A 1 234 ? 0.431   29.008  0.324   1.00 27.33 ? 234 GLN A OE1 1 
ATOM   1845 N NE2 . GLN A 1 234 ? 1.329   27.230  -0.701  1.00 25.03 ? 234 GLN A NE2 1 
ATOM   1846 N N   . LEU A 1 235 ? -1.080  24.331  4.135   1.00 21.57 ? 235 LEU A N   1 
ATOM   1847 C CA  . LEU A 1 235 ? -0.808  22.942  4.439   1.00 22.94 ? 235 LEU A CA  1 
ATOM   1848 C C   . LEU A 1 235 ? -0.363  22.280  3.189   1.00 22.74 ? 235 LEU A C   1 
ATOM   1849 O O   . LEU A 1 235 ? -0.995  22.433  2.144   1.00 22.75 ? 235 LEU A O   1 
ATOM   1850 C CB  . LEU A 1 235 ? -2.049  22.226  4.974   1.00 23.76 ? 235 LEU A CB  1 
ATOM   1851 C CG  . LEU A 1 235 ? -2.489  22.612  6.392   1.00 26.43 ? 235 LEU A CG  1 
ATOM   1852 C CD1 . LEU A 1 235 ? -2.974  24.077  6.462   1.00 24.12 ? 235 LEU A CD1 1 
ATOM   1853 C CD2 . LEU A 1 235 ? -3.596  21.668  6.795   1.00 24.56 ? 235 LEU A CD2 1 
ATOM   1854 N N   . THR A 1 236 ? 0.741   21.553  3.295   1.00 21.68 ? 236 THR A N   1 
ATOM   1855 C CA  . THR A 1 236 ? 1.292   20.862  2.152   1.00 20.49 ? 236 THR A CA  1 
ATOM   1856 C C   . THR A 1 236 ? 1.080   19.368  2.242   1.00 16.41 ? 236 THR A C   1 
ATOM   1857 O O   . THR A 1 236 ? 0.306   18.823  1.475   1.00 15.28 ? 236 THR A O   1 
ATOM   1858 C CB  . THR A 1 236 ? 2.771   21.160  2.019   1.00 22.34 ? 236 THR A CB  1 
ATOM   1859 O OG1 . THR A 1 236 ? 3.460   20.659  3.163   1.00 25.71 ? 236 THR A OG1 1 
ATOM   1860 C CG2 . THR A 1 236 ? 2.982   22.659  1.946   1.00 23.58 ? 236 THR A CG2 1 
ATOM   1861 N N   . GLU A 1 237 ? 1.758   18.723  3.188   1.00 16.88 ? 237 GLU A N   1 
ATOM   1862 C CA  . GLU A 1 237 ? 1.664   17.281  3.386   1.00 16.50 ? 237 GLU A CA  1 
ATOM   1863 C C   . GLU A 1 237 ? 1.908   16.997  4.831   1.00 17.25 ? 237 GLU A C   1 
ATOM   1864 O O   . GLU A 1 237 ? 2.496   17.814  5.529   1.00 20.49 ? 237 GLU A O   1 
ATOM   1865 C CB  . GLU A 1 237 ? 2.736   16.545  2.600   1.00 18.08 ? 237 GLU A CB  1 
ATOM   1866 C CG  . GLU A 1 237 ? 2.927   17.021  1.194   1.00 19.10 ? 237 GLU A CG  1 
ATOM   1867 C CD  . GLU A 1 237 ? 4.008   16.243  0.462   1.00 20.24 ? 237 GLU A CD  1 
ATOM   1868 O OE1 . GLU A 1 237 ? 3.712   15.152  -0.068  1.00 19.23 ? 237 GLU A OE1 1 
ATOM   1869 O OE2 . GLU A 1 237 ? 5.158   16.725  0.417   1.00 24.68 ? 237 GLU A OE2 1 
ATOM   1870 N N   . VAL A 1 238 ? 1.483   15.814  5.265   1.00 18.97 ? 238 VAL A N   1 
ATOM   1871 C CA  . VAL A 1 238 ? 1.629   15.378  6.660   1.00 23.00 ? 238 VAL A CA  1 
ATOM   1872 C C   . VAL A 1 238 ? 2.703   14.327  6.805   1.00 22.28 ? 238 VAL A C   1 
ATOM   1873 O O   . VAL A 1 238 ? 2.385   13.157  6.970   1.00 22.13 ? 238 VAL A O   1 
ATOM   1874 C CB  . VAL A 1 238 ? 0.354   14.715  7.205   1.00 21.49 ? 238 VAL A CB  1 
ATOM   1875 C CG1 . VAL A 1 238 ? 0.492   14.538  8.687   1.00 24.66 ? 238 VAL A CG1 1 
ATOM   1876 C CG2 . VAL A 1 238 ? -0.866  15.535  6.885   1.00 24.19 ? 238 VAL A CG2 1 
ATOM   1877 N N   . GLY A 1 239 ? 3.964   14.741  6.784   1.00 26.62 ? 239 GLY A N   1 
ATOM   1878 C CA  . GLY A 1 239 ? 5.048   13.779  6.868   1.00 22.18 ? 239 GLY A CA  1 
ATOM   1879 C C   . GLY A 1 239 ? 4.942   13.054  5.552   1.00 22.64 ? 239 GLY A C   1 
ATOM   1880 O O   . GLY A 1 239 ? 4.547   13.660  4.549   1.00 25.34 ? 239 GLY A O   1 
ATOM   1881 N N   . THR A 1 240 ? 5.249   11.764  5.554   1.00 21.78 ? 240 THR A N   1 
ATOM   1882 C CA  . THR A 1 240 ? 5.168   10.949  4.355   1.00 20.69 ? 240 THR A CA  1 
ATOM   1883 C C   . THR A 1 240 ? 3.725   10.655  3.944   1.00 20.65 ? 240 THR A C   1 
ATOM   1884 O O   . THR A 1 240 ? 3.368   9.499   3.677   1.00 21.39 ? 240 THR A O   1 
ATOM   1885 C CB  . THR A 1 240 ? 5.910   9.603   4.550   1.00 23.69 ? 240 THR A CB  1 
ATOM   1886 O OG1 . THR A 1 240 ? 5.299   8.869   5.613   1.00 23.57 ? 240 THR A OG1 1 
ATOM   1887 C CG2 . THR A 1 240 ? 7.381   9.842   4.891   1.00 23.20 ? 240 THR A CG2 1 
ATOM   1888 N N   . MET A 1 241 ? 2.894   11.696  3.886   1.00 19.85 ? 241 MET A N   1 
ATOM   1889 C CA  . MET A 1 241 ? 1.482   11.548  3.498   1.00 15.39 ? 241 MET A CA  1 
ATOM   1890 C C   . MET A 1 241 ? 0.871   12.819  2.938   1.00 14.64 ? 241 MET A C   1 
ATOM   1891 O O   . MET A 1 241 ? 1.211   13.925  3.360   1.00 14.60 ? 241 MET A O   1 
ATOM   1892 C CB  . MET A 1 241 ? 0.627   11.140  4.687   1.00 16.48 ? 241 MET A CB  1 
ATOM   1893 C CG  . MET A 1 241 ? 0.738   9.716   5.111   1.00 14.15 ? 241 MET A CG  1 
ATOM   1894 S SD  . MET A 1 241 ? -0.619  9.371   6.242   1.00 18.13 ? 241 MET A SD  1 
ATOM   1895 C CE  . MET A 1 241 ? 0.031   10.132  7.776   1.00 13.56 ? 241 MET A CE  1 
ATOM   1896 N N   . ASN A 1 242 ? -0.050  12.667  1.992   1.00 15.59 ? 242 ASN A N   1 
ATOM   1897 C CA  . ASN A 1 242 ? -0.724  13.831  1.427   1.00 14.54 ? 242 ASN A CA  1 
ATOM   1898 C C   . ASN A 1 242 ? -1.884  14.170  2.340   1.00 12.92 ? 242 ASN A C   1 
ATOM   1899 O O   . ASN A 1 242 ? -2.513  13.290  2.894   1.00 17.38 ? 242 ASN A O   1 
ATOM   1900 C CB  . ASN A 1 242 ? -1.198  13.536  0.018   1.00 10.57 ? 242 ASN A CB  1 
ATOM   1901 C CG  . ASN A 1 242 ? -0.044  13.402  -0.942  1.00 11.38 ? 242 ASN A CG  1 
ATOM   1902 O OD1 . ASN A 1 242 ? 0.694   14.364  -1.181  1.00 9.26  ? 242 ASN A OD1 1 
ATOM   1903 N ND2 . ASN A 1 242 ? 0.139   12.211  -1.477  1.00 6.68  ? 242 ASN A ND2 1 
ATOM   1904 N N   . ILE A 1 243 ? -2.159  15.446  2.515   1.00 14.15 ? 243 ILE A N   1 
ATOM   1905 C CA  . ILE A 1 243 ? -3.219  15.841  3.409   1.00 13.33 ? 243 ILE A CA  1 
ATOM   1906 C C   . ILE A 1 243 ? -4.517  16.081  2.677   1.00 13.22 ? 243 ILE A C   1 
ATOM   1907 O O   . ILE A 1 243 ? -4.526  16.590  1.565   1.00 11.82 ? 243 ILE A O   1 
ATOM   1908 C CB  . ILE A 1 243 ? -2.788  17.103  4.245   1.00 15.55 ? 243 ILE A CB  1 
ATOM   1909 C CG1 . ILE A 1 243 ? -3.890  17.488  5.230   1.00 16.86 ? 243 ILE A CG1 1 
ATOM   1910 C CG2 . ILE A 1 243 ? -2.447  18.276  3.326   1.00 12.40 ? 243 ILE A CG2 1 
ATOM   1911 C CD1 . ILE A 1 243 ? -4.282  16.373  6.151   1.00 18.75 ? 243 ILE A CD1 1 
ATOM   1912 N N   . PHE A 1 244 ? -5.611  15.659  3.305   1.00 14.65 ? 244 PHE A N   1 
ATOM   1913 C CA  . PHE A 1 244 ? -6.961  15.822  2.772   1.00 12.99 ? 244 PHE A CA  1 
ATOM   1914 C C   . PHE A 1 244 ? -7.896  16.407  3.820   1.00 12.63 ? 244 PHE A C   1 
ATOM   1915 O O   . PHE A 1 244 ? -7.782  16.090  5.011   1.00 10.87 ? 244 PHE A O   1 
ATOM   1916 C CB  . PHE A 1 244 ? -7.569  14.488  2.351   1.00 11.65 ? 244 PHE A CB  1 
ATOM   1917 C CG  . PHE A 1 244 ? -7.097  13.991  1.026   1.00 14.00 ? 244 PHE A CG  1 
ATOM   1918 C CD1 . PHE A 1 244 ? -5.815  13.484  0.874   1.00 15.28 ? 244 PHE A CD1 1 
ATOM   1919 C CD2 . PHE A 1 244 ? -7.945  14.010  -0.077  1.00 13.74 ? 244 PHE A CD2 1 
ATOM   1920 C CE1 . PHE A 1 244 ? -5.379  13.007  -0.351  1.00 15.51 ? 244 PHE A CE1 1 
ATOM   1921 C CE2 . PHE A 1 244 ? -7.518  13.536  -1.306  1.00 16.43 ? 244 PHE A CE2 1 
ATOM   1922 C CZ  . PHE A 1 244 ? -6.227  13.029  -1.446  1.00 17.71 ? 244 PHE A CZ  1 
ATOM   1923 N N   . VAL A 1 245 ? -8.827  17.241  3.357   1.00 10.78 ? 245 VAL A N   1 
ATOM   1924 C CA  . VAL A 1 245 ? -9.832  17.848  4.222   1.00 11.90 ? 245 VAL A CA  1 
ATOM   1925 C C   . VAL A 1 245 ? -11.253 17.738  3.621   1.00 14.59 ? 245 VAL A C   1 
ATOM   1926 O O   . VAL A 1 245 ? -11.494 18.044  2.445   1.00 13.52 ? 245 VAL A O   1 
ATOM   1927 C CB  . VAL A 1 245 ? -9.525  19.328  4.522   1.00 9.60  ? 245 VAL A CB  1 
ATOM   1928 C CG1 . VAL A 1 245 ? -10.601 19.906  5.395   1.00 8.45  ? 245 VAL A CG1 1 
ATOM   1929 C CG2 . VAL A 1 245 ? -8.180  19.460  5.213   1.00 12.15 ? 245 VAL A CG2 1 
ATOM   1930 N N   . TYR A 1 246 ? -12.180 17.285  4.455   1.00 14.94 ? 246 TYR A N   1 
ATOM   1931 C CA  . TYR A 1 246 ? -13.576 17.119  4.082   1.00 15.80 ? 246 TYR A CA  1 
ATOM   1932 C C   . TYR A 1 246 ? -14.291 18.125  4.961   1.00 15.61 ? 246 TYR A C   1 
ATOM   1933 O O   . TYR A 1 246 ? -14.387 17.961  6.186   1.00 14.11 ? 246 TYR A O   1 
ATOM   1934 C CB  . TYR A 1 246 ? -14.010 15.687  4.404   1.00 19.32 ? 246 TYR A CB  1 
ATOM   1935 C CG  . TYR A 1 246 ? -15.391 15.302  3.956   1.00 18.29 ? 246 TYR A CG  1 
ATOM   1936 C CD1 . TYR A 1 246 ? -15.862 15.629  2.680   1.00 17.23 ? 246 TYR A CD1 1 
ATOM   1937 C CD2 . TYR A 1 246 ? -16.201 14.530  4.784   1.00 19.67 ? 246 TYR A CD2 1 
ATOM   1938 C CE1 . TYR A 1 246 ? -17.106 15.187  2.246   1.00 19.27 ? 246 TYR A CE1 1 
ATOM   1939 C CE2 . TYR A 1 246 ? -17.449 14.077  4.360   1.00 20.73 ? 246 TYR A CE2 1 
ATOM   1940 C CZ  . TYR A 1 246 ? -17.899 14.404  3.096   1.00 20.74 ? 246 TYR A CZ  1 
ATOM   1941 O OH  . TYR A 1 246 ? -19.139 13.941  2.705   1.00 21.09 ? 246 TYR A OH  1 
ATOM   1942 N N   . TRP A 1 247 ? -14.792 19.168  4.318   1.00 15.10 ? 247 TRP A N   1 
ATOM   1943 C CA  . TRP A 1 247 ? -15.412 20.266  5.033   1.00 17.80 ? 247 TRP A CA  1 
ATOM   1944 C C   . TRP A 1 247 ? -16.420 21.064  4.194   1.00 17.48 ? 247 TRP A C   1 
ATOM   1945 O O   . TRP A 1 247 ? -16.600 20.829  3.003   1.00 18.98 ? 247 TRP A O   1 
ATOM   1946 C CB  . TRP A 1 247 ? -14.275 21.199  5.497   1.00 14.05 ? 247 TRP A CB  1 
ATOM   1947 C CG  . TRP A 1 247 ? -13.513 21.892  4.348   1.00 13.37 ? 247 TRP A CG  1 
ATOM   1948 C CD1 . TRP A 1 247 ? -13.618 21.625  3.008   1.00 11.12 ? 247 TRP A CD1 1 
ATOM   1949 C CD2 . TRP A 1 247 ? -12.589 22.991  4.461   1.00 10.56 ? 247 TRP A CD2 1 
ATOM   1950 N NE1 . TRP A 1 247 ? -12.828 22.491  2.285   1.00 10.53 ? 247 TRP A NE1 1 
ATOM   1951 C CE2 . TRP A 1 247 ? -12.186 23.336  3.150   1.00 11.08 ? 247 TRP A CE2 1 
ATOM   1952 C CE3 . TRP A 1 247 ? -12.063 23.712  5.539   1.00 11.50 ? 247 TRP A CE3 1 
ATOM   1953 C CZ2 . TRP A 1 247 ? -11.281 24.378  2.892   1.00 12.94 ? 247 TRP A CZ2 1 
ATOM   1954 C CZ3 . TRP A 1 247 ? -11.161 24.742  5.285   1.00 10.63 ? 247 TRP A CZ3 1 
ATOM   1955 C CH2 . TRP A 1 247 ? -10.783 25.064  3.969   1.00 13.27 ? 247 TRP A CH2 1 
ATOM   1956 N N   . THR A 1 248 ? -17.088 22.005  4.833   1.00 17.32 ? 248 THR A N   1 
ATOM   1957 C CA  . THR A 1 248 ? -17.992 22.861  4.105   1.00 15.69 ? 248 THR A CA  1 
ATOM   1958 C C   . THR A 1 248 ? -17.040 24.037  3.952   1.00 18.34 ? 248 THR A C   1 
ATOM   1959 O O   . THR A 1 248 ? -16.476 24.503  4.945   1.00 16.70 ? 248 THR A O   1 
ATOM   1960 C CB  . THR A 1 248 ? -19.192 23.287  4.937   1.00 13.92 ? 248 THR A CB  1 
ATOM   1961 O OG1 . THR A 1 248 ? -19.936 22.135  5.335   1.00 16.03 ? 248 THR A OG1 1 
ATOM   1962 C CG2 . THR A 1 248 ? -20.092 24.183  4.124   1.00 14.93 ? 248 THR A CG2 1 
ATOM   1963 N N   . HIS A 1 249 ? -16.837 24.469  2.713   1.00 18.00 ? 249 HIS A N   1 
ATOM   1964 C CA  . HIS A 1 249 ? -15.948 25.560  2.388   1.00 20.34 ? 249 HIS A CA  1 
ATOM   1965 C C   . HIS A 1 249 ? -16.583 26.888  2.708   1.00 20.47 ? 249 HIS A C   1 
ATOM   1966 O O   . HIS A 1 249 ? -17.759 26.942  3.043   1.00 20.43 ? 249 HIS A O   1 
ATOM   1967 C CB  . HIS A 1 249 ? -15.613 25.526  0.900   1.00 25.62 ? 249 HIS A CB  1 
ATOM   1968 C CG  . HIS A 1 249 ? -14.526 26.476  0.511   1.00 26.17 ? 249 HIS A CG  1 
ATOM   1969 N ND1 . HIS A 1 249 ? -14.696 27.444  -0.454  1.00 29.23 ? 249 HIS A ND1 1 
ATOM   1970 C CD2 . HIS A 1 249 ? -13.246 26.586  0.940   1.00 28.71 ? 249 HIS A CD2 1 
ATOM   1971 C CE1 . HIS A 1 249 ? -13.561 28.108  -0.612  1.00 30.57 ? 249 HIS A CE1 1 
ATOM   1972 N NE2 . HIS A 1 249 ? -12.664 27.606  0.222   1.00 30.12 ? 249 HIS A NE2 1 
ATOM   1973 N N   . GLU A 1 250 ? -15.807 27.961  2.585   1.00 20.18 ? 250 GLU A N   1 
ATOM   1974 C CA  . GLU A 1 250 ? -16.293 29.315  2.868   1.00 19.85 ? 250 GLU A CA  1 
ATOM   1975 C C   . GLU A 1 250 ? -17.504 29.664  2.025   1.00 19.56 ? 250 GLU A C   1 
ATOM   1976 O O   . GLU A 1 250 ? -18.416 30.330  2.497   1.00 21.13 ? 250 GLU A O   1 
ATOM   1977 C CB  . GLU A 1 250 ? -15.192 30.341  2.617   1.00 20.40 ? 250 GLU A CB  1 
ATOM   1978 C CG  . GLU A 1 250 ? -14.036 30.207  3.589   1.00 26.62 ? 250 GLU A CG  1 
ATOM   1979 C CD  . GLU A 1 250 ? -12.769 30.946  3.159   1.00 27.83 ? 250 GLU A CD  1 
ATOM   1980 O OE1 . GLU A 1 250 ? -11.913 31.185  4.033   1.00 32.91 ? 250 GLU A OE1 1 
ATOM   1981 O OE2 . GLU A 1 250 ? -12.613 31.279  1.962   1.00 31.21 ? 250 GLU A OE2 1 
ATOM   1982 N N   . ASP A 1 251 ? -17.520 29.215  0.775   1.00 19.98 ? 251 ASP A N   1 
ATOM   1983 C CA  . ASP A 1 251 ? -18.647 29.496  -0.100  1.00 20.46 ? 251 ASP A CA  1 
ATOM   1984 C C   . ASP A 1 251 ? -19.860 28.614  0.239   1.00 21.33 ? 251 ASP A C   1 
ATOM   1985 O O   . ASP A 1 251 ? -20.832 28.577  -0.521  1.00 24.58 ? 251 ASP A O   1 
ATOM   1986 C CB  . ASP A 1 251 ? -18.267 29.271  -1.559  1.00 20.41 ? 251 ASP A CB  1 
ATOM   1987 C CG  . ASP A 1 251 ? -18.017 27.791  -1.879  1.00 25.82 ? 251 ASP A CG  1 
ATOM   1988 O OD1 . ASP A 1 251 ? -17.937 27.461  -3.086  1.00 25.08 ? 251 ASP A OD1 1 
ATOM   1989 O OD2 . ASP A 1 251 ? -17.892 26.966  -0.935  1.00 25.94 ? 251 ASP A OD2 1 
ATOM   1990 N N   . GLY A 1 252 ? -19.792 27.883  1.347   1.00 19.50 ? 252 GLY A N   1 
ATOM   1991 C CA  . GLY A 1 252 ? -20.912 27.042  1.756   1.00 17.74 ? 252 GLY A CA  1 
ATOM   1992 C C   . GLY A 1 252 ? -21.117 25.721  1.029   1.00 18.09 ? 252 GLY A C   1 
ATOM   1993 O O   . GLY A 1 252 ? -22.140 25.060  1.218   1.00 16.13 ? 252 GLY A O   1 
ATOM   1994 N N   . VAL A 1 253 ? -20.146 25.328  0.208   1.00 19.47 ? 253 VAL A N   1 
ATOM   1995 C CA  . VAL A 1 253 ? -20.245 24.079  -0.544  1.00 20.67 ? 253 VAL A CA  1 
ATOM   1996 C C   . VAL A 1 253 ? -19.479 22.932  0.098   1.00 18.84 ? 253 VAL A C   1 
ATOM   1997 O O   . VAL A 1 253 ? -18.294 23.058  0.414   1.00 19.92 ? 253 VAL A O   1 
ATOM   1998 C CB  . VAL A 1 253 ? -19.717 24.242  -1.995  1.00 21.59 ? 253 VAL A CB  1 
ATOM   1999 C CG1 . VAL A 1 253 ? -19.926 22.924  -2.776  1.00 17.31 ? 253 VAL A CG1 1 
ATOM   2000 C CG2 . VAL A 1 253 ? -20.433 25.411  -2.685  1.00 21.07 ? 253 VAL A CG2 1 
ATOM   2001 N N   . LEU A 1 254 ? -20.153 21.802  0.274   1.00 20.14 ? 254 LEU A N   1 
ATOM   2002 C CA  . LEU A 1 254 ? -19.495 20.648  0.866   1.00 21.02 ? 254 LEU A CA  1 
ATOM   2003 C C   . LEU A 1 254 ? -18.457 20.126  -0.121  1.00 21.35 ? 254 LEU A C   1 
ATOM   2004 O O   . LEU A 1 254 ? -18.761 19.895  -1.288  1.00 25.72 ? 254 LEU A O   1 
ATOM   2005 C CB  . LEU A 1 254 ? -20.491 19.544  1.197   1.00 16.04 ? 254 LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 254 ? -19.737 18.377  1.846   1.00 20.82 ? 254 LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 254 ? -18.857 18.947  2.939   1.00 21.40 ? 254 LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 254 ? -20.678 17.311  2.415   1.00 18.06 ? 254 LEU A CD2 1 
ATOM   2009 N N   . GLU A 1 255 ? -17.232 19.928  0.339   1.00 20.27 ? 255 GLU A N   1 
ATOM   2010 C CA  . GLU A 1 255 ? -16.202 19.449  -0.567  1.00 19.50 ? 255 GLU A CA  1 
ATOM   2011 C C   . GLU A 1 255 ? -15.049 18.727  0.087   1.00 18.48 ? 255 GLU A C   1 
ATOM   2012 O O   . GLU A 1 255 ? -14.805 18.846  1.280   1.00 14.85 ? 255 GLU A O   1 
ATOM   2013 C CB  . GLU A 1 255 ? -15.629 20.613  -1.349  1.00 19.98 ? 255 GLU A CB  1 
ATOM   2014 C CG  . GLU A 1 255 ? -15.056 21.681  -0.450  1.00 20.06 ? 255 GLU A CG  1 
ATOM   2015 C CD  . GLU A 1 255 ? -14.039 22.520  -1.169  1.00 20.19 ? 255 GLU A CD  1 
ATOM   2016 O OE1 . GLU A 1 255 ? -14.378 23.106  -2.217  1.00 20.10 ? 255 GLU A OE1 1 
ATOM   2017 O OE2 . GLU A 1 255 ? -12.893 22.579  -0.691  1.00 21.57 ? 255 GLU A OE2 1 
ATOM   2018 N N   . LEU A 1 256 ? -14.345 17.959  -0.731  1.00 19.01 ? 256 LEU A N   1 
ATOM   2019 C CA  . LEU A 1 256 ? -13.158 17.248  -0.301  1.00 17.55 ? 256 LEU A CA  1 
ATOM   2020 C C   . LEU A 1 256 ? -12.023 18.043  -0.960  1.00 18.55 ? 256 LEU A C   1 
ATOM   2021 O O   . LEU A 1 256 ? -12.009 18.198  -2.184  1.00 17.70 ? 256 LEU A O   1 
ATOM   2022 C CB  . LEU A 1 256 ? -13.179 15.840  -0.849  1.00 15.46 ? 256 LEU A CB  1 
ATOM   2023 C CG  . LEU A 1 256 ? -11.955 14.989  -0.530  1.00 15.53 ? 256 LEU A CG  1 
ATOM   2024 C CD1 . LEU A 1 256 ? -11.740 14.935  0.975   1.00 13.48 ? 256 LEU A CD1 1 
ATOM   2025 C CD2 . LEU A 1 256 ? -12.167 13.583  -1.112  1.00 14.21 ? 256 LEU A CD2 1 
ATOM   2026 N N   . VAL A 1 257 ? -11.086 18.546  -0.166  1.00 17.04 ? 257 VAL A N   1 
ATOM   2027 C CA  . VAL A 1 257 ? -9.981  19.341  -0.702  1.00 15.94 ? 257 VAL A CA  1 
ATOM   2028 C C   . VAL A 1 257 ? -8.584  18.772  -0.354  1.00 14.82 ? 257 VAL A C   1 
ATOM   2029 O O   . VAL A 1 257 ? -8.396  18.150  0.693   1.00 12.86 ? 257 VAL A O   1 
ATOM   2030 C CB  . VAL A 1 257 ? -10.094 20.823  -0.185  1.00 17.56 ? 257 VAL A CB  1 
ATOM   2031 C CG1 . VAL A 1 257 ? -9.845  20.868  1.330   1.00 13.81 ? 257 VAL A CG1 1 
ATOM   2032 C CG2 . VAL A 1 257 ? -9.113  21.745  -0.917  1.00 16.12 ? 257 VAL A CG2 1 
ATOM   2033 N N   . THR A 1 258 ? -7.614  18.995  -1.240  1.00 13.80 ? 258 THR A N   1 
ATOM   2034 C CA  . THR A 1 258 ? -6.234  18.541  -1.040  1.00 13.55 ? 258 THR A CA  1 
ATOM   2035 C C   . THR A 1 258 ? -5.315  19.471  -1.832  1.00 13.17 ? 258 THR A C   1 
ATOM   2036 O O   . THR A 1 258 ? -5.553  19.741  -3.012  1.00 15.68 ? 258 THR A O   1 
ATOM   2037 C CB  . THR A 1 258 ? -6.026  17.030  -1.495  1.00 12.94 ? 258 THR A CB  1 
ATOM   2038 O OG1 . THR A 1 258 ? -4.783  16.537  -0.981  1.00 7.77  ? 258 THR A OG1 1 
ATOM   2039 C CG2 . THR A 1 258 ? -6.011  16.892  -3.023  1.00 8.16  ? 258 THR A CG2 1 
ATOM   2040 N N   . PRO A 1 259 ? -4.248  19.968  -1.194  1.00 15.00 ? 259 PRO A N   1 
ATOM   2041 C CA  . PRO A 1 259 ? -3.301  20.880  -1.852  1.00 18.32 ? 259 PRO A CA  1 
ATOM   2042 C C   . PRO A 1 259 ? -2.941  20.423  -3.260  1.00 20.26 ? 259 PRO A C   1 
ATOM   2043 O O   . PRO A 1 259 ? -2.748  19.228  -3.483  1.00 21.59 ? 259 PRO A O   1 
ATOM   2044 C CB  . PRO A 1 259 ? -2.107  20.861  -0.914  1.00 16.33 ? 259 PRO A CB  1 
ATOM   2045 C CG  . PRO A 1 259 ? -2.752  20.616  0.433   1.00 14.54 ? 259 PRO A CG  1 
ATOM   2046 C CD  . PRO A 1 259 ? -3.703  19.509  0.094   1.00 13.55 ? 259 PRO A CD  1 
ATOM   2047 N N   . PRO A 1 260 ? -2.852  21.368  -4.228  1.00 21.01 ? 260 PRO A N   1 
ATOM   2048 C CA  . PRO A 1 260 ? -2.517  21.048  -5.631  1.00 19.39 ? 260 PRO A CA  1 
ATOM   2049 C C   . PRO A 1 260 ? -1.064  20.662  -5.827  1.00 18.18 ? 260 PRO A C   1 
ATOM   2050 O O   . PRO A 1 260 ? -0.211  20.982  -5.000  1.00 14.82 ? 260 PRO A O   1 
ATOM   2051 C CB  . PRO A 1 260 ? -2.852  22.343  -6.404  1.00 16.24 ? 260 PRO A CB  1 
ATOM   2052 C CG  . PRO A 1 260 ? -3.682  23.145  -5.467  1.00 20.72 ? 260 PRO A CG  1 
ATOM   2053 C CD  . PRO A 1 260 ? -3.114  22.809  -4.087  1.00 20.41 ? 260 PRO A CD  1 
ATOM   2054 N N   . LEU A 1 261 ? -0.797  19.993  -6.950  1.00 19.64 ? 261 LEU A N   1 
ATOM   2055 C CA  . LEU A 1 261 ? 0.550   19.555  -7.295  1.00 19.90 ? 261 LEU A CA  1 
ATOM   2056 C C   . LEU A 1 261 ? 1.382   20.705  -7.864  1.00 18.62 ? 261 LEU A C   1 
ATOM   2057 O O   . LEU A 1 261 ? 1.881   20.652  -8.979  1.00 19.65 ? 261 LEU A O   1 
ATOM   2058 C CB  . LEU A 1 261 ? 0.505   18.382  -8.290  1.00 14.93 ? 261 LEU A CB  1 
ATOM   2059 C CG  . LEU A 1 261 ? -0.186  17.100  -7.796  1.00 19.99 ? 261 LEU A CG  1 
ATOM   2060 C CD1 . LEU A 1 261 ? -0.097  16.033  -8.884  1.00 15.91 ? 261 LEU A CD1 1 
ATOM   2061 C CD2 . LEU A 1 261 ? 0.456   16.603  -6.491  1.00 14.94 ? 261 LEU A CD2 1 
ATOM   2062 N N   . ASN A 1 262 ? 1.515   21.747  -7.058  1.00 20.53 ? 262 ASN A N   1 
ATOM   2063 C CA  . ASN A 1 262 ? 2.283   22.931  -7.407  1.00 22.14 ? 262 ASN A CA  1 
ATOM   2064 C C   . ASN A 1 262 ? 3.707   22.517  -7.734  1.00 24.75 ? 262 ASN A C   1 
ATOM   2065 O O   . ASN A 1 262 ? 4.224   22.831  -8.803  1.00 31.00 ? 262 ASN A O   1 
ATOM   2066 C CB  . ASN A 1 262 ? 2.292   23.893  -6.223  1.00 22.74 ? 262 ASN A CB  1 
ATOM   2067 C CG  . ASN A 1 262 ? 2.450   23.163  -4.878  1.00 25.43 ? 262 ASN A CG  1 
ATOM   2068 O OD1 . ASN A 1 262 ? 2.945   22.018  -4.817  1.00 20.75 ? 262 ASN A OD1 1 
ATOM   2069 N ND2 . ASN A 1 262 ? 2.037   23.828  -3.794  1.00 24.89 ? 262 ASN A ND2 1 
ATOM   2070 N N   . GLY A 1 263 ? 4.340   21.797  -6.819  1.00 24.05 ? 263 GLY A N   1 
ATOM   2071 C CA  . GLY A 1 263 ? 5.704   21.373  -7.034  1.00 22.94 ? 263 GLY A CA  1 
ATOM   2072 C C   . GLY A 1 263 ? 6.405   21.253  -5.699  1.00 24.55 ? 263 GLY A C   1 
ATOM   2073 O O   . GLY A 1 263 ? 7.587   20.920  -5.633  1.00 26.10 ? 263 GLY A O   1 
ATOM   2074 N N   . VAL A 1 264 ? 5.681   21.526  -4.619  1.00 24.35 ? 264 VAL A N   1 
ATOM   2075 C CA  . VAL A 1 264 ? 6.281   21.416  -3.295  1.00 25.10 ? 264 VAL A CA  1 
ATOM   2076 C C   . VAL A 1 264 ? 5.755   20.198  -2.569  1.00 22.89 ? 264 VAL A C   1 
ATOM   2077 O O   . VAL A 1 264 ? 6.173   19.932  -1.432  1.00 25.16 ? 264 VAL A O   1 
ATOM   2078 C CB  . VAL A 1 264 ? 5.965   22.619  -2.397  1.00 24.56 ? 264 VAL A CB  1 
ATOM   2079 C CG1 . VAL A 1 264 ? 6.069   23.903  -3.185  1.00 26.00 ? 264 VAL A CG1 1 
ATOM   2080 C CG2 . VAL A 1 264 ? 4.582   22.438  -1.781  1.00 27.56 ? 264 VAL A CG2 1 
ATOM   2081 N N   . ILE A 1 265 ? 4.799   19.505  -3.188  1.00 21.97 ? 265 ILE A N   1 
ATOM   2082 C CA  . ILE A 1 265 ? 4.236   18.298  -2.593  1.00 20.16 ? 265 ILE A CA  1 
ATOM   2083 C C   . ILE A 1 265 ? 4.395   17.091  -3.510  1.00 16.03 ? 265 ILE A C   1 
ATOM   2084 O O   . ILE A 1 265 ? 4.444   17.206  -4.720  1.00 15.98 ? 265 ILE A O   1 
ATOM   2085 C CB  . ILE A 1 265 ? 2.731   18.440  -2.207  1.00 18.73 ? 265 ILE A CB  1 
ATOM   2086 C CG1 . ILE A 1 265 ? 1.858   18.502  -3.446  1.00 17.56 ? 265 ILE A CG1 1 
ATOM   2087 C CG2 . ILE A 1 265 ? 2.519   19.650  -1.349  1.00 19.83 ? 265 ILE A CG2 1 
ATOM   2088 C CD1 . ILE A 1 265 ? 0.508   17.915  -3.184  1.00 22.20 ? 265 ILE A CD1 1 
ATOM   2089 N N   . LEU A 1 266 ? 4.450   15.926  -2.897  1.00 16.67 ? 266 LEU A N   1 
ATOM   2090 C CA  . LEU A 1 266 ? 4.653   14.687  -3.609  1.00 17.01 ? 266 LEU A CA  1 
ATOM   2091 C C   . LEU A 1 266 ? 3.336   14.099  -4.136  1.00 17.20 ? 266 LEU A C   1 
ATOM   2092 O O   . LEU A 1 266 ? 2.375   13.977  -3.388  1.00 16.90 ? 266 LEU A O   1 
ATOM   2093 C CB  . LEU A 1 266 ? 5.356   13.708  -2.653  1.00 15.89 ? 266 LEU A CB  1 
ATOM   2094 C CG  . LEU A 1 266 ? 6.216   12.540  -3.159  1.00 17.69 ? 266 LEU A CG  1 
ATOM   2095 C CD1 . LEU A 1 266 ? 5.421   11.803  -4.189  1.00 17.11 ? 266 LEU A CD1 1 
ATOM   2096 C CD2 . LEU A 1 266 ? 7.538   13.009  -3.762  1.00 16.36 ? 266 LEU A CD2 1 
ATOM   2097 N N   . PRO A 1 267 ? 3.279   13.752  -5.442  1.00 18.02 ? 267 PRO A N   1 
ATOM   2098 C CA  . PRO A 1 267 ? 2.124   13.166  -6.150  1.00 19.05 ? 267 PRO A CA  1 
ATOM   2099 C C   . PRO A 1 267 ? 1.752   11.763  -5.639  1.00 20.39 ? 267 PRO A C   1 
ATOM   2100 O O   . PRO A 1 267 ? 1.886   10.781  -6.377  1.00 18.65 ? 267 PRO A O   1 
ATOM   2101 C CB  . PRO A 1 267 ? 2.601   13.087  -7.604  1.00 18.75 ? 267 PRO A CB  1 
ATOM   2102 C CG  . PRO A 1 267 ? 3.580   14.192  -7.707  1.00 21.51 ? 267 PRO A CG  1 
ATOM   2103 C CD  . PRO A 1 267 ? 4.331   14.126  -6.403  1.00 20.39 ? 267 PRO A CD  1 
ATOM   2104 N N   . GLY A 1 268 ? 1.283   11.671  -4.397  1.00 18.63 ? 268 GLY A N   1 
ATOM   2105 C CA  . GLY A 1 268 ? 0.929   10.379  -3.849  1.00 17.29 ? 268 GLY A CA  1 
ATOM   2106 C C   . GLY A 1 268 ? 0.014   9.528   -4.717  1.00 16.83 ? 268 GLY A C   1 
ATOM   2107 O O   . GLY A 1 268 ? -0.919  10.030  -5.351  1.00 15.97 ? 268 GLY A O   1 
ATOM   2108 N N   . VAL A 1 269 ? 0.285   8.227   -4.749  1.00 12.99 ? 269 VAL A N   1 
ATOM   2109 C CA  . VAL A 1 269 ? -0.546  7.313   -5.512  1.00 11.72 ? 269 VAL A CA  1 
ATOM   2110 C C   . VAL A 1 269 ? -1.912  7.178   -4.844  1.00 13.82 ? 269 VAL A C   1 
ATOM   2111 O O   . VAL A 1 269 ? -2.949  7.172   -5.523  1.00 15.28 ? 269 VAL A O   1 
ATOM   2112 C CB  . VAL A 1 269 ? 0.079   5.920   -5.617  1.00 8.93  ? 269 VAL A CB  1 
ATOM   2113 C CG1 . VAL A 1 269 ? -0.862  4.997   -6.353  1.00 7.33  ? 269 VAL A CG1 1 
ATOM   2114 C CG2 . VAL A 1 269 ? 1.386   5.997   -6.339  1.00 5.90  ? 269 VAL A CG2 1 
ATOM   2115 N N   . VAL A 1 270 ? -1.916  7.088   -3.513  1.00 13.02 ? 270 VAL A N   1 
ATOM   2116 C CA  . VAL A 1 270 ? -3.176  6.951   -2.783  1.00 13.72 ? 270 VAL A CA  1 
ATOM   2117 C C   . VAL A 1 270 ? -3.990  8.221   -3.002  1.00 16.29 ? 270 VAL A C   1 
ATOM   2118 O O   . VAL A 1 270 ? -5.215  8.162   -3.236  1.00 13.30 ? 270 VAL A O   1 
ATOM   2119 C CB  . VAL A 1 270 ? -2.939  6.725   -1.261  1.00 11.29 ? 270 VAL A CB  1 
ATOM   2120 C CG1 . VAL A 1 270 ? -4.252  6.643   -0.535  1.00 8.60  ? 270 VAL A CG1 1 
ATOM   2121 C CG2 . VAL A 1 270 ? -2.136  5.439   -1.051  1.00 11.76 ? 270 VAL A CG2 1 
ATOM   2122 N N   . ARG A 1 271 ? -3.276  9.350   -2.923  1.00 13.18 ? 271 ARG A N   1 
ATOM   2123 C CA  . ARG A 1 271 ? -3.817  10.678  -3.116  1.00 12.36 ? 271 ARG A CA  1 
ATOM   2124 C C   . ARG A 1 271 ? -4.600  10.702  -4.408  1.00 15.13 ? 271 ARG A C   1 
ATOM   2125 O O   . ARG A 1 271 ? -5.768  11.046  -4.417  1.00 18.69 ? 271 ARG A O   1 
ATOM   2126 C CB  . ARG A 1 271 ? -2.669  11.682  -3.193  1.00 12.37 ? 271 ARG A CB  1 
ATOM   2127 C CG  . ARG A 1 271 ? -3.064  13.076  -3.590  1.00 9.51  ? 271 ARG A CG  1 
ATOM   2128 C CD  . ARG A 1 271 ? -1.844  13.923  -3.850  1.00 11.29 ? 271 ARG A CD  1 
ATOM   2129 N NE  . ARG A 1 271 ? -2.226  15.266  -4.250  1.00 9.02  ? 271 ARG A NE  1 
ATOM   2130 C CZ  . ARG A 1 271 ? -2.833  15.554  -5.394  1.00 12.87 ? 271 ARG A CZ  1 
ATOM   2131 N NH1 . ARG A 1 271 ? -3.118  14.594  -6.268  1.00 11.41 ? 271 ARG A NH1 1 
ATOM   2132 N NH2 . ARG A 1 271 ? -3.195  16.796  -5.650  1.00 12.61 ? 271 ARG A NH2 1 
ATOM   2133 N N   . GLN A 1 272 ? -3.941  10.345  -5.501  1.00 16.18 ? 272 GLN A N   1 
ATOM   2134 C CA  . GLN A 1 272 ? -4.564  10.301  -6.825  1.00 15.88 ? 272 GLN A CA  1 
ATOM   2135 C C   . GLN A 1 272 ? -5.845  9.484   -6.797  1.00 16.09 ? 272 GLN A C   1 
ATOM   2136 O O   . GLN A 1 272 ? -6.899  9.926   -7.251  1.00 14.47 ? 272 GLN A O   1 
ATOM   2137 C CB  . GLN A 1 272 ? -3.624  9.628   -7.816  1.00 20.78 ? 272 GLN A CB  1 
ATOM   2138 C CG  . GLN A 1 272 ? -4.100  9.668   -9.240  1.00 22.11 ? 272 GLN A CG  1 
ATOM   2139 C CD  . GLN A 1 272 ? -4.258  11.086  -9.707  1.00 19.98 ? 272 GLN A CD  1 
ATOM   2140 O OE1 . GLN A 1 272 ? -5.339  11.651  -9.627  1.00 20.65 ? 272 GLN A OE1 1 
ATOM   2141 N NE2 . GLN A 1 272 ? -3.162  11.688  -10.173 1.00 21.76 ? 272 GLN A NE2 1 
ATOM   2142 N N   . SER A 1 273 ? -5.710  8.270   -6.274  1.00 14.20 ? 273 SER A N   1 
ATOM   2143 C CA  . SER A 1 273 ? -6.809  7.338   -6.160  1.00 17.35 ? 273 SER A CA  1 
ATOM   2144 C C   . SER A 1 273 ? -8.003  7.877   -5.368  1.00 16.74 ? 273 SER A C   1 
ATOM   2145 O O   . SER A 1 273 ? -9.131  7.730   -5.785  1.00 17.20 ? 273 SER A O   1 
ATOM   2146 C CB  . SER A 1 273 ? -6.305  6.037   -5.532  1.00 17.30 ? 273 SER A CB  1 
ATOM   2147 O OG  . SER A 1 273 ? -5.279  5.469   -6.329  1.00 18.25 ? 273 SER A OG  1 
ATOM   2148 N N   . LEU A 1 274 ? -7.762  8.506   -4.232  1.00 19.96 ? 274 LEU A N   1 
ATOM   2149 C CA  . LEU A 1 274 ? -8.866  9.031   -3.447  1.00 15.52 ? 274 LEU A CA  1 
ATOM   2150 C C   . LEU A 1 274 ? -9.647  10.066  -4.265  1.00 17.48 ? 274 LEU A C   1 
ATOM   2151 O O   . LEU A 1 274 ? -10.868 10.153  -4.172  1.00 14.87 ? 274 LEU A O   1 
ATOM   2152 C CB  . LEU A 1 274 ? -8.334  9.629   -2.142  1.00 17.29 ? 274 LEU A CB  1 
ATOM   2153 C CG  . LEU A 1 274 ? -7.517  8.703   -1.217  1.00 14.15 ? 274 LEU A CG  1 
ATOM   2154 C CD1 . LEU A 1 274 ? -7.297  9.406   0.111   1.00 17.85 ? 274 LEU A CD1 1 
ATOM   2155 C CD2 . LEU A 1 274 ? -8.230  7.380   -0.974  1.00 13.33 ? 274 LEU A CD2 1 
ATOM   2156 N N   . LEU A 1 275 ? -8.947  10.844  -5.082  1.00 19.57 ? 275 LEU A N   1 
ATOM   2157 C CA  . LEU A 1 275 ? -9.625  11.831  -5.920  1.00 20.12 ? 275 LEU A CA  1 
ATOM   2158 C C   . LEU A 1 275 ? -10.425 11.090  -6.980  1.00 21.54 ? 275 LEU A C   1 
ATOM   2159 O O   . LEU A 1 275 ? -11.599 11.384  -7.227  1.00 23.49 ? 275 LEU A O   1 
ATOM   2160 C CB  . LEU A 1 275 ? -8.628  12.752  -6.621  1.00 19.22 ? 275 LEU A CB  1 
ATOM   2161 C CG  . LEU A 1 275 ? -7.944  13.832  -5.778  1.00 22.67 ? 275 LEU A CG  1 
ATOM   2162 C CD1 . LEU A 1 275 ? -8.955  14.823  -5.216  1.00 20.38 ? 275 LEU A CD1 1 
ATOM   2163 C CD2 . LEU A 1 275 ? -7.192  13.158  -4.653  1.00 23.95 ? 275 LEU A CD2 1 
ATOM   2164 N N   . ASP A 1 276 ? -9.781  10.126  -7.616  1.00 21.26 ? 276 ASP A N   1 
ATOM   2165 C CA  . ASP A 1 276 ? -10.438 9.355   -8.652  1.00 22.31 ? 276 ASP A CA  1 
ATOM   2166 C C   . ASP A 1 276 ? -11.768 8.834   -8.125  1.00 20.10 ? 276 ASP A C   1 
ATOM   2167 O O   . ASP A 1 276 ? -12.833 9.075   -8.709  1.00 17.56 ? 276 ASP A O   1 
ATOM   2168 C CB  . ASP A 1 276 ? -9.530  8.206   -9.078  1.00 24.62 ? 276 ASP A CB  1 
ATOM   2169 C CG  . ASP A 1 276 ? -8.261  8.701   -9.745  1.00 27.24 ? 276 ASP A CG  1 
ATOM   2170 O OD1 . ASP A 1 276 ? -7.285  7.934   -9.845  1.00 29.74 ? 276 ASP A OD1 1 
ATOM   2171 O OD2 . ASP A 1 276 ? -8.246  9.877   -10.176 1.00 28.32 ? 276 ASP A OD2 1 
ATOM   2172 N N   . MET A 1 277 ? -11.693 8.138   -7.003  1.00 17.74 ? 277 MET A N   1 
ATOM   2173 C CA  . MET A 1 277 ? -12.875 7.574   -6.391  1.00 19.10 ? 277 MET A CA  1 
ATOM   2174 C C   . MET A 1 277 ? -13.935 8.624   -6.124  1.00 17.96 ? 277 MET A C   1 
ATOM   2175 O O   . MET A 1 277 ? -15.063 8.503   -6.603  1.00 15.23 ? 277 MET A O   1 
ATOM   2176 C CB  . MET A 1 277 ? -12.485 6.877   -5.103  1.00 18.99 ? 277 MET A CB  1 
ATOM   2177 C CG  . MET A 1 277 ? -11.440 5.815   -5.336  1.00 19.44 ? 277 MET A CG  1 
ATOM   2178 S SD  . MET A 1 277 ? -10.955 5.037   -3.783  1.00 24.30 ? 277 MET A SD  1 
ATOM   2179 C CE  . MET A 1 277 ? -12.532 4.424   -3.286  1.00 13.39 ? 277 MET A CE  1 
ATOM   2180 N N   . ALA A 1 278 ? -13.557 9.659   -5.377  1.00 17.77 ? 278 ALA A N   1 
ATOM   2181 C CA  . ALA A 1 278 ? -14.483 10.736  -5.033  1.00 19.80 ? 278 ALA A CA  1 
ATOM   2182 C C   . ALA A 1 278 ? -15.084 11.366  -6.285  1.00 19.57 ? 278 ALA A C   1 
ATOM   2183 O O   . ALA A 1 278 ? -16.274 11.623  -6.336  1.00 19.99 ? 278 ALA A O   1 
ATOM   2184 C CB  . ALA A 1 278 ? -13.770 11.814  -4.198  1.00 18.23 ? 278 ALA A CB  1 
ATOM   2185 N N   . GLN A 1 279 ? -14.263 11.620  -7.291  1.00 19.80 ? 279 GLN A N   1 
ATOM   2186 C CA  . GLN A 1 279 ? -14.774 12.217  -8.519  1.00 21.56 ? 279 GLN A CA  1 
ATOM   2187 C C   . GLN A 1 279 ? -15.770 11.270  -9.154  1.00 24.09 ? 279 GLN A C   1 
ATOM   2188 O O   . GLN A 1 279 ? -16.717 11.706  -9.807  1.00 23.84 ? 279 GLN A O   1 
ATOM   2189 C CB  . GLN A 1 279 ? -13.634 12.528  -9.494  1.00 25.18 ? 279 GLN A CB  1 
ATOM   2190 C CG  . GLN A 1 279 ? -12.607 13.513  -8.895  1.00 32.36 ? 279 GLN A CG  1 
ATOM   2191 C CD  . GLN A 1 279 ? -11.638 14.076  -9.919  1.00 36.73 ? 279 GLN A CD  1 
ATOM   2192 O OE1 . GLN A 1 279 ? -11.239 13.377  -10.868 1.00 40.98 ? 279 GLN A OE1 1 
ATOM   2193 N NE2 . GLN A 1 279 ? -11.232 15.336  -9.725  1.00 34.13 ? 279 GLN A NE2 1 
ATOM   2194 N N   . THR A 1 280 ? -15.557 9.973   -8.956  1.00 22.54 ? 280 THR A N   1 
ATOM   2195 C CA  . THR A 1 280 ? -16.466 8.973   -9.502  1.00 21.80 ? 280 THR A CA  1 
ATOM   2196 C C   . THR A 1 280 ? -17.821 9.085   -8.797  1.00 22.87 ? 280 THR A C   1 
ATOM   2197 O O   . THR A 1 280 ? -18.844 9.353   -9.443  1.00 21.72 ? 280 THR A O   1 
ATOM   2198 C CB  . THR A 1 280 ? -15.906 7.531   -9.303  1.00 24.00 ? 280 THR A CB  1 
ATOM   2199 O OG1 . THR A 1 280 ? -14.767 7.327   -10.155 1.00 25.91 ? 280 THR A OG1 1 
ATOM   2200 C CG2 . THR A 1 280 ? -16.966 6.498   -9.625  1.00 21.10 ? 280 THR A CG2 1 
ATOM   2201 N N   . TRP A 1 281 ? -17.819 8.895   -7.474  1.00 19.41 ? 281 TRP A N   1 
ATOM   2202 C CA  . TRP A 1 281 ? -19.040 8.960   -6.687  1.00 17.59 ? 281 TRP A CA  1 
ATOM   2203 C C   . TRP A 1 281 ? -19.935 10.134  -7.065  1.00 19.07 ? 281 TRP A C   1 
ATOM   2204 O O   . TRP A 1 281 ? -21.164 10.011  -7.068  1.00 23.13 ? 281 TRP A O   1 
ATOM   2205 C CB  . TRP A 1 281 ? -18.693 9.037   -5.216  1.00 18.68 ? 281 TRP A CB  1 
ATOM   2206 C CG  . TRP A 1 281 ? -17.930 7.858   -4.742  1.00 19.02 ? 281 TRP A CG  1 
ATOM   2207 C CD1 . TRP A 1 281 ? -17.916 6.596   -5.294  1.00 19.94 ? 281 TRP A CD1 1 
ATOM   2208 C CD2 . TRP A 1 281 ? -17.159 7.774   -3.551  1.00 18.88 ? 281 TRP A CD2 1 
ATOM   2209 N NE1 . TRP A 1 281 ? -17.194 5.740   -4.509  1.00 16.58 ? 281 TRP A NE1 1 
ATOM   2210 C CE2 . TRP A 1 281 ? -16.717 6.434   -3.430  1.00 20.17 ? 281 TRP A CE2 1 
ATOM   2211 C CE3 . TRP A 1 281 ? -16.806 8.697   -2.563  1.00 20.55 ? 281 TRP A CE3 1 
ATOM   2212 C CZ2 . TRP A 1 281 ? -15.936 6.001   -2.363  1.00 22.84 ? 281 TRP A CZ2 1 
ATOM   2213 C CZ3 . TRP A 1 281 ? -16.029 8.268   -1.494  1.00 21.84 ? 281 TRP A CZ3 1 
ATOM   2214 C CH2 . TRP A 1 281 ? -15.603 6.929   -1.402  1.00 22.58 ? 281 TRP A CH2 1 
ATOM   2215 N N   . GLY A 1 282 ? -19.321 11.268  -7.380  1.00 18.54 ? 282 GLY A N   1 
ATOM   2216 C CA  . GLY A 1 282 ? -20.082 12.443  -7.764  1.00 15.75 ? 282 GLY A CA  1 
ATOM   2217 C C   . GLY A 1 282 ? -20.997 12.956  -6.669  1.00 16.34 ? 282 GLY A C   1 
ATOM   2218 O O   . GLY A 1 282 ? -21.924 13.731  -6.913  1.00 18.28 ? 282 GLY A O   1 
ATOM   2219 N N   . GLU A 1 283 ? -20.732 12.551  -5.440  1.00 15.25 ? 283 GLU A N   1 
ATOM   2220 C CA  . GLU A 1 283 ? -21.582 12.989  -4.361  1.00 16.47 ? 283 GLU A CA  1 
ATOM   2221 C C   . GLU A 1 283 ? -21.247 14.359  -3.770  1.00 16.35 ? 283 GLU A C   1 
ATOM   2222 O O   . GLU A 1 283 ? -22.033 14.902  -2.996  1.00 14.27 ? 283 GLU A O   1 
ATOM   2223 C CB  . GLU A 1 283 ? -21.588 11.916  -3.291  1.00 17.95 ? 283 GLU A CB  1 
ATOM   2224 C CG  . GLU A 1 283 ? -22.100 10.595  -3.832  1.00 18.99 ? 283 GLU A CG  1 
ATOM   2225 C CD  . GLU A 1 283 ? -22.020 9.500   -2.811  1.00 23.82 ? 283 GLU A CD  1 
ATOM   2226 O OE1 . GLU A 1 283 ? -21.858 9.829   -1.612  1.00 26.80 ? 283 GLU A OE1 1 
ATOM   2227 O OE2 . GLU A 1 283 ? -22.130 8.312   -3.199  1.00 27.86 ? 283 GLU A OE2 1 
ATOM   2228 N N   . PHE A 1 284 ? -20.100 14.928  -4.133  1.00 15.22 ? 284 PHE A N   1 
ATOM   2229 C CA  . PHE A 1 284 ? -19.728 16.239  -3.606  1.00 16.88 ? 284 PHE A CA  1 
ATOM   2230 C C   . PHE A 1 284 ? -18.553 16.861  -4.350  1.00 18.18 ? 284 PHE A C   1 
ATOM   2231 O O   . PHE A 1 284 ? -17.879 16.189  -5.142  1.00 21.80 ? 284 PHE A O   1 
ATOM   2232 C CB  . PHE A 1 284 ? -19.410 16.152  -2.114  1.00 14.90 ? 284 PHE A CB  1 
ATOM   2233 C CG  . PHE A 1 284 ? -18.448 15.078  -1.775  1.00 14.49 ? 284 PHE A CG  1 
ATOM   2234 C CD1 . PHE A 1 284 ? -18.900 13.850  -1.319  1.00 13.53 ? 284 PHE A CD1 1 
ATOM   2235 C CD2 . PHE A 1 284 ? -17.078 15.277  -1.953  1.00 17.49 ? 284 PHE A CD2 1 
ATOM   2236 C CE1 . PHE A 1 284 ? -18.013 12.831  -1.045  1.00 12.56 ? 284 PHE A CE1 1 
ATOM   2237 C CE2 . PHE A 1 284 ? -16.178 14.262  -1.682  1.00 19.23 ? 284 PHE A CE2 1 
ATOM   2238 C CZ  . PHE A 1 284 ? -16.646 13.030  -1.224  1.00 15.97 ? 284 PHE A CZ  1 
ATOM   2239 N N   . ARG A 1 285 ? -18.307 18.146  -4.111  1.00 15.74 ? 285 ARG A N   1 
ATOM   2240 C CA  . ARG A 1 285 ? -17.221 18.803  -4.808  1.00 16.03 ? 285 ARG A CA  1 
ATOM   2241 C C   . ARG A 1 285 ? -15.860 18.277  -4.349  1.00 15.47 ? 285 ARG A C   1 
ATOM   2242 O O   . ARG A 1 285 ? -15.557 18.192  -3.157  1.00 15.52 ? 285 ARG A O   1 
ATOM   2243 C CB  . ARG A 1 285 ? -17.289 20.310  -4.621  1.00 15.28 ? 285 ARG A CB  1 
ATOM   2244 C CG  . ARG A 1 285 ? -16.203 21.027  -5.382  1.00 19.34 ? 285 ARG A CG  1 
ATOM   2245 C CD  . ARG A 1 285 ? -15.797 22.291  -4.659  1.00 18.46 ? 285 ARG A CD  1 
ATOM   2246 N NE  . ARG A 1 285 ? -16.680 23.378  -5.005  1.00 17.98 ? 285 ARG A NE  1 
ATOM   2247 C CZ  . ARG A 1 285 ? -16.864 24.457  -4.256  1.00 19.13 ? 285 ARG A CZ  1 
ATOM   2248 N NH1 . ARG A 1 285 ? -16.217 24.582  -3.108  1.00 14.90 ? 285 ARG A NH1 1 
ATOM   2249 N NH2 . ARG A 1 285 ? -17.716 25.402  -4.656  1.00 17.25 ? 285 ARG A NH2 1 
ATOM   2250 N N   . VAL A 1 286 ? -15.061 17.891  -5.330  1.00 15.00 ? 286 VAL A N   1 
ATOM   2251 C CA  . VAL A 1 286 ? -13.740 17.353  -5.087  1.00 14.62 ? 286 VAL A CA  1 
ATOM   2252 C C   . VAL A 1 286 ? -12.866 18.382  -5.759  1.00 16.14 ? 286 VAL A C   1 
ATOM   2253 O O   . VAL A 1 286 ? -12.978 18.609  -6.972  1.00 19.00 ? 286 VAL A O   1 
ATOM   2254 C CB  . VAL A 1 286 ? -13.579 15.967  -5.759  1.00 10.29 ? 286 VAL A CB  1 
ATOM   2255 C CG1 . VAL A 1 286 ? -12.175 15.453  -5.534  1.00 9.05  ? 286 VAL A CG1 1 
ATOM   2256 C CG2 . VAL A 1 286 ? -14.620 15.003  -5.222  1.00 2.50  ? 286 VAL A CG2 1 
ATOM   2257 N N   . VAL A 1 287 ? -12.023 19.039  -4.979  1.00 17.34 ? 287 VAL A N   1 
ATOM   2258 C CA  . VAL A 1 287 ? -11.180 20.081  -5.539  1.00 19.80 ? 287 VAL A CA  1 
ATOM   2259 C C   . VAL A 1 287 ? -9.727  20.105  -5.059  1.00 21.37 ? 287 VAL A C   1 
ATOM   2260 O O   . VAL A 1 287 ? -9.430  19.799  -3.891  1.00 18.27 ? 287 VAL A O   1 
ATOM   2261 C CB  . VAL A 1 287 ? -11.779 21.460  -5.220  1.00 18.85 ? 287 VAL A CB  1 
ATOM   2262 C CG1 . VAL A 1 287 ? -11.687 21.731  -3.730  1.00 15.12 ? 287 VAL A CG1 1 
ATOM   2263 C CG2 . VAL A 1 287 ? -11.056 22.514  -6.008  1.00 21.88 ? 287 VAL A CG2 1 
ATOM   2264 N N   . GLU A 1 288 ? -8.825  20.458  -5.971  1.00 19.55 ? 288 GLU A N   1 
ATOM   2265 C CA  . GLU A 1 288 ? -7.422  20.598  -5.593  1.00 21.30 ? 288 GLU A CA  1 
ATOM   2266 C C   . GLU A 1 288 ? -7.232  22.089  -5.448  1.00 17.67 ? 288 GLU A C   1 
ATOM   2267 O O   . GLU A 1 288 ? -7.503  22.847  -6.370  1.00 17.95 ? 288 GLU A O   1 
ATOM   2268 C CB  . GLU A 1 288 ? -6.498  20.047  -6.667  1.00 19.66 ? 288 GLU A CB  1 
ATOM   2269 C CG  . GLU A 1 288 ? -6.666  18.555  -6.847  1.00 21.46 ? 288 GLU A CG  1 
ATOM   2270 C CD  . GLU A 1 288 ? -5.862  18.063  -8.000  1.00 21.05 ? 288 GLU A CD  1 
ATOM   2271 O OE1 . GLU A 1 288 ? -4.653  17.822  -7.816  1.00 21.40 ? 288 GLU A OE1 1 
ATOM   2272 O OE2 . GLU A 1 288 ? -6.444  17.949  -9.094  1.00 21.85 ? 288 GLU A OE2 1 
ATOM   2273 N N   . ARG A 1 289 ? -6.796  22.514  -4.279  1.00 15.67 ? 289 ARG A N   1 
ATOM   2274 C CA  . ARG A 1 289 ? -6.622  23.925  -4.048  1.00 16.20 ? 289 ARG A CA  1 
ATOM   2275 C C   . ARG A 1 289 ? -5.805  24.151  -2.803  1.00 16.72 ? 289 ARG A C   1 
ATOM   2276 O O   . ARG A 1 289 ? -5.658  23.264  -1.962  1.00 17.75 ? 289 ARG A O   1 
ATOM   2277 C CB  . ARG A 1 289 ? -8.003  24.610  -3.919  1.00 18.88 ? 289 ARG A CB  1 
ATOM   2278 C CG  . ARG A 1 289 ? -8.132  25.623  -2.746  1.00 20.97 ? 289 ARG A CG  1 
ATOM   2279 C CD  . ARG A 1 289 ? -9.214  26.685  -2.924  1.00 15.96 ? 289 ARG A CD  1 
ATOM   2280 N NE  . ARG A 1 289 ? -10.481 26.150  -3.416  1.00 18.65 ? 289 ARG A NE  1 
ATOM   2281 C CZ  . ARG A 1 289 ? -11.297 25.337  -2.738  1.00 19.36 ? 289 ARG A CZ  1 
ATOM   2282 N NH1 . ARG A 1 289 ? -10.997 24.941  -1.506  1.00 15.70 ? 289 ARG A NH1 1 
ATOM   2283 N NH2 . ARG A 1 289 ? -12.426 24.921  -3.314  1.00 18.63 ? 289 ARG A NH2 1 
ATOM   2284 N N   . THR A 1 290 ? -5.265  25.353  -2.697  1.00 17.61 ? 290 THR A N   1 
ATOM   2285 C CA  . THR A 1 290 ? -4.477  25.733  -1.538  1.00 18.63 ? 290 THR A CA  1 
ATOM   2286 C C   . THR A 1 290 ? -5.326  25.796  -0.256  1.00 18.46 ? 290 THR A C   1 
ATOM   2287 O O   . THR A 1 290 ? -6.451  26.309  -0.268  1.00 19.76 ? 290 THR A O   1 
ATOM   2288 C CB  . THR A 1 290 ? -3.836  27.099  -1.791  1.00 17.68 ? 290 THR A CB  1 
ATOM   2289 O OG1 . THR A 1 290 ? -2.822  26.946  -2.787  1.00 19.73 ? 290 THR A OG1 1 
ATOM   2290 C CG2 . THR A 1 290 ? -3.253  27.679  -0.511  1.00 18.81 ? 290 THR A CG2 1 
ATOM   2291 N N   . ILE A 1 291 ? -4.793  25.260  0.841   1.00 19.37 ? 291 ILE A N   1 
ATOM   2292 C CA  . ILE A 1 291 ? -5.492  25.299  2.136   1.00 17.69 ? 291 ILE A CA  1 
ATOM   2293 C C   . ILE A 1 291 ? -4.601  26.063  3.113   1.00 16.98 ? 291 ILE A C   1 
ATOM   2294 O O   . ILE A 1 291 ? -3.418  25.763  3.238   1.00 18.68 ? 291 ILE A O   1 
ATOM   2295 C CB  . ILE A 1 291 ? -5.693  23.903  2.716   1.00 18.07 ? 291 ILE A CB  1 
ATOM   2296 C CG1 . ILE A 1 291 ? -6.340  23.000  1.683   1.00 15.66 ? 291 ILE A CG1 1 
ATOM   2297 C CG2 . ILE A 1 291 ? -6.535  23.980  3.964   1.00 17.32 ? 291 ILE A CG2 1 
ATOM   2298 C CD1 . ILE A 1 291 ? -6.500  21.608  2.160   1.00 16.40 ? 291 ILE A CD1 1 
ATOM   2299 N N   . THR A 1 292 ? -5.149  27.040  3.810   1.00 16.41 ? 292 THR A N   1 
ATOM   2300 C CA  . THR A 1 292 ? -4.331  27.790  4.750   1.00 15.54 ? 292 THR A CA  1 
ATOM   2301 C C   . THR A 1 292 ? -4.825  27.577  6.158   1.00 18.68 ? 292 THR A C   1 
ATOM   2302 O O   . THR A 1 292 ? -6.008  27.308  6.376   1.00 19.28 ? 292 THR A O   1 
ATOM   2303 C CB  . THR A 1 292 ? -4.349  29.305  4.438   1.00 15.67 ? 292 THR A CB  1 
ATOM   2304 O OG1 . THR A 1 292 ? -5.581  29.876  4.899   1.00 16.75 ? 292 THR A OG1 1 
ATOM   2305 C CG2 . THR A 1 292 ? -4.175  29.545  2.918   1.00 11.52 ? 292 THR A CG2 1 
ATOM   2306 N N   . MET A 1 293 ? -3.919  27.700  7.122   1.00 18.77 ? 293 MET A N   1 
ATOM   2307 C CA  . MET A 1 293 ? -4.304  27.510  8.504   1.00 20.36 ? 293 MET A CA  1 
ATOM   2308 C C   . MET A 1 293 ? -5.417  28.483  8.841   1.00 20.11 ? 293 MET A C   1 
ATOM   2309 O O   . MET A 1 293 ? -6.332  28.156  9.605   1.00 17.43 ? 293 MET A O   1 
ATOM   2310 C CB  . MET A 1 293 ? -3.105  27.697  9.427   1.00 19.27 ? 293 MET A CB  1 
ATOM   2311 C CG  . MET A 1 293 ? -2.195  26.465  9.454   1.00 22.12 ? 293 MET A CG  1 
ATOM   2312 S SD  . MET A 1 293 ? -3.081  24.981  10.072  1.00 25.84 ? 293 MET A SD  1 
ATOM   2313 C CE  . MET A 1 293 ? -3.310  25.460  11.801  1.00 24.78 ? 293 MET A CE  1 
ATOM   2314 N N   . LYS A 1 294 ? -5.351  29.671  8.247   1.00 21.80 ? 294 LYS A N   1 
ATOM   2315 C CA  . LYS A 1 294 ? -6.389  30.680  8.472   1.00 23.38 ? 294 LYS A CA  1 
ATOM   2316 C C   . LYS A 1 294 ? -7.767  30.068  8.202   1.00 22.47 ? 294 LYS A C   1 
ATOM   2317 O O   . LYS A 1 294 ? -8.651  30.048  9.078   1.00 21.40 ? 294 LYS A O   1 
ATOM   2318 C CB  . LYS A 1 294 ? -6.201  31.876  7.538   1.00 25.15 ? 294 LYS A CB  1 
ATOM   2319 C CG  . LYS A 1 294 ? -7.148  33.026  7.849   1.00 28.76 ? 294 LYS A CG  1 
ATOM   2320 C CD  . LYS A 1 294 ? -7.455  33.852  6.622   1.00 31.22 ? 294 LYS A CD  1 
ATOM   2321 C CE  . LYS A 1 294 ? -7.275  35.332  6.901   1.00 30.81 ? 294 LYS A CE  1 
ATOM   2322 N NZ  . LYS A 1 294 ? -7.768  36.144  5.737   1.00 32.71 ? 294 LYS A NZ  1 
ATOM   2323 N N   . GLN A 1 295 ? -7.935  29.569  6.977   1.00 19.95 ? 295 GLN A N   1 
ATOM   2324 C CA  . GLN A 1 295 ? -9.185  28.947  6.568   1.00 20.36 ? 295 GLN A CA  1 
ATOM   2325 C C   . GLN A 1 295 ? -9.559  27.821  7.506   1.00 18.20 ? 295 GLN A C   1 
ATOM   2326 O O   . GLN A 1 295 ? -10.734 27.656  7.835   1.00 19.35 ? 295 GLN A O   1 
ATOM   2327 C CB  . GLN A 1 295 ? -9.088  28.394  5.140   1.00 19.98 ? 295 GLN A CB  1 
ATOM   2328 C CG  . GLN A 1 295 ? -8.750  29.446  4.109   1.00 20.74 ? 295 GLN A CG  1 
ATOM   2329 C CD  . GLN A 1 295 ? -8.616  28.904  2.690   1.00 22.26 ? 295 GLN A CD  1 
ATOM   2330 O OE1 . GLN A 1 295 ? -8.609  29.676  1.739   1.00 24.37 ? 295 GLN A OE1 1 
ATOM   2331 N NE2 . GLN A 1 295 ? -8.491  27.588  2.542   1.00 23.34 ? 295 GLN A NE2 1 
ATOM   2332 N N   . LEU A 1 296 ? -8.568  27.042  7.932   1.00 16.68 ? 296 LEU A N   1 
ATOM   2333 C CA  . LEU A 1 296 ? -8.823  25.919  8.822   1.00 16.20 ? 296 LEU A CA  1 
ATOM   2334 C C   . LEU A 1 296 ? -9.316  26.313  10.203  1.00 16.42 ? 296 LEU A C   1 
ATOM   2335 O O   . LEU A 1 296 ? -10.227 25.685  10.748  1.00 13.33 ? 296 LEU A O   1 
ATOM   2336 C CB  . LEU A 1 296 ? -7.580  25.058  8.986   1.00 16.38 ? 296 LEU A CB  1 
ATOM   2337 C CG  . LEU A 1 296 ? -7.887  23.799  9.800   1.00 18.87 ? 296 LEU A CG  1 
ATOM   2338 C CD1 . LEU A 1 296 ? -8.752  22.822  8.968   1.00 12.29 ? 296 LEU A CD1 1 
ATOM   2339 C CD2 . LEU A 1 296 ? -6.580  23.169  10.228  1.00 21.11 ? 296 LEU A CD2 1 
ATOM   2340 N N   . LEU A 1 297 ? -8.738  27.377  10.753  1.00 16.72 ? 297 LEU A N   1 
ATOM   2341 C CA  . LEU A 1 297 ? -9.168  27.830  12.073  1.00 17.65 ? 297 LEU A CA  1 
ATOM   2342 C C   . LEU A 1 297 ? -10.620 28.296  12.034  1.00 16.35 ? 297 LEU A C   1 
ATOM   2343 O O   . LEU A 1 297 ? -11.443 27.898  12.867  1.00 15.34 ? 297 LEU A O   1 
ATOM   2344 C CB  . LEU A 1 297 ? -8.224  28.931  12.591  1.00 18.35 ? 297 LEU A CB  1 
ATOM   2345 C CG  . LEU A 1 297 ? -6.762  28.476  12.793  1.00 19.80 ? 297 LEU A CG  1 
ATOM   2346 C CD1 . LEU A 1 297 ? -5.883  29.689  13.116  1.00 21.48 ? 297 LEU A CD1 1 
ATOM   2347 C CD2 . LEU A 1 297 ? -6.660  27.441  13.899  1.00 16.60 ? 297 LEU A CD2 1 
ATOM   2348 N N   . ARG A 1 298 ? -10.930 29.127  11.054  1.00 14.68 ? 298 ARG A N   1 
ATOM   2349 C CA  . ARG A 1 298 ? -12.282 29.612  10.920  1.00 15.99 ? 298 ARG A CA  1 
ATOM   2350 C C   . ARG A 1 298 ? -13.260 28.455  10.653  1.00 15.86 ? 298 ARG A C   1 
ATOM   2351 O O   . ARG A 1 298 ? -14.361 28.439  11.190  1.00 15.68 ? 298 ARG A O   1 
ATOM   2352 C CB  . ARG A 1 298 ? -12.369 30.626  9.783   1.00 18.70 ? 298 ARG A CB  1 
ATOM   2353 C CG  . ARG A 1 298 ? -13.754 31.245  9.614   1.00 25.22 ? 298 ARG A CG  1 
ATOM   2354 C CD  . ARG A 1 298 ? -13.944 31.803  8.204   1.00 27.38 ? 298 ARG A CD  1 
ATOM   2355 N NE  . ARG A 1 298 ? -15.334 32.202  7.996   1.00 31.76 ? 298 ARG A NE  1 
ATOM   2356 C CZ  . ARG A 1 298 ? -15.831 32.699  6.865   1.00 33.62 ? 298 ARG A CZ  1 
ATOM   2357 N NH1 . ARG A 1 298 ? -15.062 32.879  5.784   1.00 31.21 ? 298 ARG A NH1 1 
ATOM   2358 N NH2 . ARG A 1 298 ? -17.115 33.025  6.824   1.00 35.88 ? 298 ARG A NH2 1 
ATOM   2359 N N   . ALA A 1 299 ? -12.864 27.489  9.827   1.00 17.55 ? 299 ALA A N   1 
ATOM   2360 C CA  . ALA A 1 299 ? -13.752 26.375  9.524   1.00 16.55 ? 299 ALA A CA  1 
ATOM   2361 C C   . ALA A 1 299 ? -13.973 25.569  10.797  1.00 18.01 ? 299 ALA A C   1 
ATOM   2362 O O   . ALA A 1 299 ? -15.049 25.025  11.024  1.00 17.88 ? 299 ALA A O   1 
ATOM   2363 C CB  . ALA A 1 299 ? -13.159 25.517  8.455   1.00 16.84 ? 299 ALA A CB  1 
ATOM   2364 N N   . LEU A 1 300 ? -12.947 25.513  11.640  1.00 19.27 ? 300 LEU A N   1 
ATOM   2365 C CA  . LEU A 1 300 ? -13.075 24.797  12.888  1.00 17.55 ? 300 LEU A CA  1 
ATOM   2366 C C   . LEU A 1 300 ? -14.079 25.488  13.795  1.00 18.60 ? 300 LEU A C   1 
ATOM   2367 O O   . LEU A 1 300 ? -14.983 24.846  14.320  1.00 21.04 ? 300 LEU A O   1 
ATOM   2368 C CB  . LEU A 1 300 ? -11.731 24.704  13.589  1.00 15.14 ? 300 LEU A CB  1 
ATOM   2369 C CG  . LEU A 1 300 ? -10.787 23.648  13.002  1.00 18.59 ? 300 LEU A CG  1 
ATOM   2370 C CD1 . LEU A 1 300 ? -9.453  23.740  13.704  1.00 14.81 ? 300 LEU A CD1 1 
ATOM   2371 C CD2 . LEU A 1 300 ? -11.376 22.242  13.147  1.00 10.76 ? 300 LEU A CD2 1 
ATOM   2372 N N   . GLU A 1 301 ? -13.927 26.796  13.974  1.00 18.32 ? 301 GLU A N   1 
ATOM   2373 C CA  . GLU A 1 301 ? -14.830 27.550  14.839  1.00 21.09 ? 301 GLU A CA  1 
ATOM   2374 C C   . GLU A 1 301 ? -16.305 27.461  14.475  1.00 20.97 ? 301 GLU A C   1 
ATOM   2375 O O   . GLU A 1 301 ? -17.163 27.238  15.329  1.00 18.84 ? 301 GLU A O   1 
ATOM   2376 C CB  . GLU A 1 301 ? -14.476 29.024  14.834  1.00 23.30 ? 301 GLU A CB  1 
ATOM   2377 C CG  . GLU A 1 301 ? -13.225 29.366  15.531  1.00 28.72 ? 301 GLU A CG  1 
ATOM   2378 C CD  . GLU A 1 301 ? -13.273 30.790  16.035  1.00 32.38 ? 301 GLU A CD  1 
ATOM   2379 O OE1 . GLU A 1 301 ? -13.830 31.669  15.316  1.00 31.96 ? 301 GLU A OE1 1 
ATOM   2380 O OE2 . GLU A 1 301 ? -12.750 31.013  17.158  1.00 35.94 ? 301 GLU A OE2 1 
ATOM   2381 N N   . GLU A 1 302 ? -16.582 27.713  13.202  1.00 19.34 ? 302 GLU A N   1 
ATOM   2382 C CA  . GLU A 1 302 ? -17.924 27.695  12.676  1.00 19.36 ? 302 GLU A CA  1 
ATOM   2383 C C   . GLU A 1 302 ? -18.344 26.247  12.435  1.00 20.80 ? 302 GLU A C   1 
ATOM   2384 O O   . GLU A 1 302 ? -19.369 25.974  11.798  1.00 20.41 ? 302 GLU A O   1 
ATOM   2385 C CB  . GLU A 1 302 ? -17.967 28.500  11.380  1.00 19.89 ? 302 GLU A CB  1 
ATOM   2386 C CG  . GLU A 1 302 ? -16.925 29.609  11.330  1.00 22.78 ? 302 GLU A CG  1 
ATOM   2387 C CD  . GLU A 1 302 ? -17.330 30.756  10.438  1.00 22.92 ? 302 GLU A CD  1 
ATOM   2388 O OE1 . GLU A 1 302 ? -17.707 30.488  9.280   1.00 20.75 ? 302 GLU A OE1 1 
ATOM   2389 O OE2 . GLU A 1 302 ? -17.268 31.926  10.904  1.00 27.70 ? 302 GLU A OE2 1 
ATOM   2390 N N   . GLY A 1 303 ? -17.542 25.320  12.949  1.00 20.28 ? 303 GLY A N   1 
ATOM   2391 C CA  . GLY A 1 303 ? -17.855 23.911  12.806  1.00 20.51 ? 303 GLY A CA  1 
ATOM   2392 C C   . GLY A 1 303 ? -18.235 23.458  11.408  1.00 17.97 ? 303 GLY A C   1 
ATOM   2393 O O   . GLY A 1 303 ? -19.290 22.866  11.214  1.00 19.42 ? 303 GLY A O   1 
ATOM   2394 N N   . ARG A 1 304 ? -17.377 23.728  10.433  1.00 18.64 ? 304 ARG A N   1 
ATOM   2395 C CA  . ARG A 1 304 ? -17.633 23.322  9.050   1.00 16.10 ? 304 ARG A CA  1 
ATOM   2396 C C   . ARG A 1 304 ? -16.748 22.162  8.667   1.00 14.60 ? 304 ARG A C   1 
ATOM   2397 O O   . ARG A 1 304 ? -16.870 21.627  7.578   1.00 15.02 ? 304 ARG A O   1 
ATOM   2398 C CB  . ARG A 1 304 ? -17.379 24.494  8.103   1.00 17.25 ? 304 ARG A CB  1 
ATOM   2399 C CG  . ARG A 1 304 ? -18.386 25.631  8.291   1.00 18.63 ? 304 ARG A CG  1 
ATOM   2400 C CD  . ARG A 1 304 ? -17.802 26.989  7.884   1.00 18.78 ? 304 ARG A CD  1 
ATOM   2401 N NE  . ARG A 1 304 ? -16.873 26.823  6.771   1.00 18.70 ? 304 ARG A NE  1 
ATOM   2402 C CZ  . ARG A 1 304 ? -15.743 27.493  6.615   1.00 10.51 ? 304 ARG A CZ  1 
ATOM   2403 N NH1 . ARG A 1 304 ? -15.361 28.412  7.489   1.00 10.27 ? 304 ARG A NH1 1 
ATOM   2404 N NH2 . ARG A 1 304 ? -14.972 27.202  5.585   1.00 20.71 ? 304 ARG A NH2 1 
ATOM   2405 N N   . VAL A 1 305 ? -15.860 21.776  9.570   1.00 14.70 ? 305 VAL A N   1 
ATOM   2406 C CA  . VAL A 1 305 ? -14.942 20.680  9.310   1.00 14.51 ? 305 VAL A CA  1 
ATOM   2407 C C   . VAL A 1 305 ? -15.449 19.352  9.810   1.00 15.67 ? 305 VAL A C   1 
ATOM   2408 O O   . VAL A 1 305 ? -15.764 19.206  10.983  1.00 16.81 ? 305 VAL A O   1 
ATOM   2409 C CB  . VAL A 1 305 ? -13.566 20.889  9.972   1.00 14.05 ? 305 VAL A CB  1 
ATOM   2410 C CG1 . VAL A 1 305 ? -12.779 19.611  9.871   1.00 11.69 ? 305 VAL A CG1 1 
ATOM   2411 C CG2 . VAL A 1 305 ? -12.795 21.988  9.280   1.00 14.19 ? 305 VAL A CG2 1 
ATOM   2412 N N   . ARG A 1 306 ? -15.499 18.374  8.920   1.00 15.71 ? 306 ARG A N   1 
ATOM   2413 C CA  . ARG A 1 306 ? -15.955 17.053  9.282   1.00 14.93 ? 306 ARG A CA  1 
ATOM   2414 C C   . ARG A 1 306 ? -14.791 16.077  9.478   1.00 14.42 ? 306 ARG A C   1 
ATOM   2415 O O   . ARG A 1 306 ? -14.649 15.476  10.547  1.00 11.12 ? 306 ARG A O   1 
ATOM   2416 C CB  . ARG A 1 306 ? -16.921 16.528  8.214   1.00 19.53 ? 306 ARG A CB  1 
ATOM   2417 C CG  . ARG A 1 306 ? -18.237 17.326  8.083   1.00 22.75 ? 306 ARG A CG  1 
ATOM   2418 C CD  . ARG A 1 306 ? -19.233 16.616  7.174   1.00 23.09 ? 306 ARG A CD  1 
ATOM   2419 N NE  . ARG A 1 306 ? -19.179 15.174  7.401   1.00 27.60 ? 306 ARG A NE  1 
ATOM   2420 C CZ  . ARG A 1 306 ? -19.928 14.271  6.774   1.00 26.47 ? 306 ARG A CZ  1 
ATOM   2421 N NH1 . ARG A 1 306 ? -20.821 14.665  5.868   1.00 22.90 ? 306 ARG A NH1 1 
ATOM   2422 N NH2 . ARG A 1 306 ? -19.754 12.971  7.035   1.00 22.39 ? 306 ARG A NH2 1 
ATOM   2423 N N   . GLU A 1 307 ? -13.947 15.925  8.462   1.00 13.18 ? 307 GLU A N   1 
ATOM   2424 C CA  . GLU A 1 307 ? -12.832 14.987  8.573   1.00 13.14 ? 307 GLU A CA  1 
ATOM   2425 C C   . GLU A 1 307 ? -11.526 15.524  8.012   1.00 14.74 ? 307 GLU A C   1 
ATOM   2426 O O   . GLU A 1 307 ? -11.518 16.268  7.022   1.00 16.16 ? 307 GLU A O   1 
ATOM   2427 C CB  . GLU A 1 307 ? -13.167 13.660  7.868   1.00 10.25 ? 307 GLU A CB  1 
ATOM   2428 C CG  . GLU A 1 307 ? -14.513 13.051  8.254   1.00 13.24 ? 307 GLU A CG  1 
ATOM   2429 C CD  . GLU A 1 307 ? -14.833 11.783  7.470   1.00 18.09 ? 307 GLU A CD  1 
ATOM   2430 O OE1 . GLU A 1 307 ? -16.023 11.568  7.168   1.00 17.33 ? 307 GLU A OE1 1 
ATOM   2431 O OE2 . GLU A 1 307 ? -13.902 10.999  7.160   1.00 16.63 ? 307 GLU A OE2 1 
ATOM   2432 N N   . VAL A 1 308 ? -10.429 15.146  8.665   1.00 12.10 ? 308 VAL A N   1 
ATOM   2433 C CA  . VAL A 1 308 ? -9.100  15.536  8.243   1.00 12.46 ? 308 VAL A CA  1 
ATOM   2434 C C   . VAL A 1 308 ? -8.236  14.312  8.294   1.00 14.32 ? 308 VAL A C   1 
ATOM   2435 O O   . VAL A 1 308 ? -8.240  13.580  9.279   1.00 16.34 ? 308 VAL A O   1 
ATOM   2436 C CB  . VAL A 1 308 ? -8.471  16.605  9.155   1.00 14.77 ? 308 VAL A CB  1 
ATOM   2437 C CG1 . VAL A 1 308 ? -7.054  16.898  8.699   1.00 8.94  ? 308 VAL A CG1 1 
ATOM   2438 C CG2 . VAL A 1 308 ? -9.299  17.880  9.113   1.00 15.98 ? 308 VAL A CG2 1 
ATOM   2439 N N   . PHE A 1 309 ? -7.474  14.088  7.238   1.00 14.70 ? 309 PHE A N   1 
ATOM   2440 C CA  . PHE A 1 309 ? -6.630  12.902  7.201   1.00 16.27 ? 309 PHE A CA  1 
ATOM   2441 C C   . PHE A 1 309 ? -5.583  12.992  6.110   1.00 14.88 ? 309 PHE A C   1 
ATOM   2442 O O   . PHE A 1 309 ? -5.624  13.873  5.263   1.00 14.80 ? 309 PHE A O   1 
ATOM   2443 C CB  . PHE A 1 309 ? -7.497  11.663  6.959   1.00 14.19 ? 309 PHE A CB  1 
ATOM   2444 C CG  . PHE A 1 309 ? -8.343  11.769  5.737   1.00 10.89 ? 309 PHE A CG  1 
ATOM   2445 C CD1 . PHE A 1 309 ? -9.507  12.529  5.747   1.00 8.63  ? 309 PHE A CD1 1 
ATOM   2446 C CD2 . PHE A 1 309 ? -7.943  11.166  4.547   1.00 11.84 ? 309 PHE A CD2 1 
ATOM   2447 C CE1 . PHE A 1 309 ? -10.262 12.694  4.597   1.00 9.74  ? 309 PHE A CE1 1 
ATOM   2448 C CE2 . PHE A 1 309 ? -8.697  11.325  3.378   1.00 11.82 ? 309 PHE A CE2 1 
ATOM   2449 C CZ  . PHE A 1 309 ? -9.858  12.091  3.405   1.00 10.85 ? 309 PHE A CZ  1 
ATOM   2450 N N   . GLY A 1 310 ? -4.637  12.063  6.147   1.00 15.51 ? 310 GLY A N   1 
ATOM   2451 C CA  . GLY A 1 310 ? -3.595  12.041  5.140   1.00 16.46 ? 310 GLY A CA  1 
ATOM   2452 C C   . GLY A 1 310 ? -3.728  10.760  4.360   1.00 17.14 ? 310 GLY A C   1 
ATOM   2453 O O   . GLY A 1 310 ? -4.399  9.835   4.820   1.00 18.75 ? 310 GLY A O   1 
ATOM   2454 N N   . SER A 1 311 ? -3.120  10.704  3.178   1.00 17.39 ? 311 SER A N   1 
ATOM   2455 C CA  . SER A 1 311 ? -3.143  9.488   2.355   1.00 17.90 ? 311 SER A CA  1 
ATOM   2456 C C   . SER A 1 311 ? -1.694  9.027   2.191   1.00 16.62 ? 311 SER A C   1 
ATOM   2457 O O   . SER A 1 311 ? -0.779  9.828   2.250   1.00 17.20 ? 311 SER A O   1 
ATOM   2458 C CB  . SER A 1 311 ? -3.775  9.760   0.977   1.00 14.94 ? 311 SER A CB  1 
ATOM   2459 O OG  . SER A 1 311 ? -3.133  10.828  0.322   1.00 14.56 ? 311 SER A OG  1 
ATOM   2460 N N   . GLY A 1 312 ? -1.493  7.733   1.992   1.00 14.73 ? 312 GLY A N   1 
ATOM   2461 C CA  . GLY A 1 312 ? -0.148  7.209   1.849   1.00 15.65 ? 312 GLY A CA  1 
ATOM   2462 C C   . GLY A 1 312 ? -0.201  5.693   1.794   1.00 16.01 ? 312 GLY A C   1 
ATOM   2463 O O   . GLY A 1 312 ? -1.150  5.074   2.260   1.00 16.96 ? 312 GLY A O   1 
ATOM   2464 N N   . THR A 1 313 ? 0.828   5.085   1.241   1.00 16.26 ? 313 THR A N   1 
ATOM   2465 C CA  . THR A 1 313 ? 0.839   3.642   1.109   1.00 19.26 ? 313 THR A CA  1 
ATOM   2466 C C   . THR A 1 313 ? 0.969   2.877   2.434   1.00 18.05 ? 313 THR A C   1 
ATOM   2467 O O   . THR A 1 313 ? 0.644   1.690   2.498   1.00 17.69 ? 313 THR A O   1 
ATOM   2468 C CB  . THR A 1 313 ? 1.952   3.198   0.137   1.00 18.58 ? 313 THR A CB  1 
ATOM   2469 O OG1 . THR A 1 313 ? 1.900   4.017   -1.032  1.00 17.53 ? 313 THR A OG1 1 
ATOM   2470 C CG2 . THR A 1 313 ? 1.764   1.747   -0.289  1.00 17.85 ? 313 THR A CG2 1 
ATOM   2471 N N   . ALA A 1 314 ? 1.404   3.550   3.491   1.00 18.98 ? 314 ALA A N   1 
ATOM   2472 C CA  . ALA A 1 314 ? 1.552   2.869   4.782   1.00 21.25 ? 314 ALA A CA  1 
ATOM   2473 C C   . ALA A 1 314 ? 0.210   2.440   5.371   1.00 23.87 ? 314 ALA A C   1 
ATOM   2474 O O   . ALA A 1 314 ? 0.072   1.324   5.873   1.00 25.14 ? 314 ALA A O   1 
ATOM   2475 C CB  . ALA A 1 314 ? 2.274   3.747   5.757   1.00 21.36 ? 314 ALA A CB  1 
ATOM   2476 N N   . CYS A 1 315 ? -0.786  3.322   5.313   1.00 26.24 ? 315 CYS A N   1 
ATOM   2477 C CA  . CYS A 1 315 ? -2.097  2.987   5.850   1.00 27.31 ? 315 CYS A CA  1 
ATOM   2478 C C   . CYS A 1 315 ? -3.244  3.371   4.935   1.00 25.88 ? 315 CYS A C   1 
ATOM   2479 O O   . CYS A 1 315 ? -4.417  3.169   5.279   1.00 25.99 ? 315 CYS A O   1 
ATOM   2480 C CB  . CYS A 1 315 ? -2.290  3.627   7.243   1.00 31.15 ? 315 CYS A CB  1 
ATOM   2481 S SG  . CYS A 1 315 ? -2.297  5.444   7.307   1.00 37.42 ? 315 CYS A SG  1 
ATOM   2482 N N   . GLN A 1 316 ? -2.912  3.882   3.755   1.00 24.65 ? 316 GLN A N   1 
ATOM   2483 C CA  . GLN A 1 316 ? -3.924  4.299   2.787   1.00 23.12 ? 316 GLN A CA  1 
ATOM   2484 C C   . GLN A 1 316 ? -4.588  5.556   3.342   1.00 21.89 ? 316 GLN A C   1 
ATOM   2485 O O   . GLN A 1 316 ? -4.401  6.632   2.812   1.00 24.02 ? 316 GLN A O   1 
ATOM   2486 C CB  . GLN A 1 316 ? -4.967  3.192   2.573   1.00 23.86 ? 316 GLN A CB  1 
ATOM   2487 C CG  . GLN A 1 316 ? -4.397  1.791   2.401   1.00 26.50 ? 316 GLN A CG  1 
ATOM   2488 C CD  . GLN A 1 316 ? -3.588  1.624   1.126   1.00 26.94 ? 316 GLN A CD  1 
ATOM   2489 O OE1 . GLN A 1 316 ? -4.088  1.871   0.030   1.00 25.20 ? 316 GLN A OE1 1 
ATOM   2490 N NE2 . GLN A 1 316 ? -2.332  1.180   1.262   1.00 28.10 ? 316 GLN A NE2 1 
ATOM   2491 N N   . VAL A 1 317 ? -5.361  5.429   4.412   1.00 21.69 ? 317 VAL A N   1 
ATOM   2492 C CA  . VAL A 1 317 ? -6.021  6.601   4.990   1.00 21.47 ? 317 VAL A CA  1 
ATOM   2493 C C   . VAL A 1 317 ? -5.746  6.709   6.497   1.00 20.52 ? 317 VAL A C   1 
ATOM   2494 O O   . VAL A 1 317 ? -5.791  5.715   7.218   1.00 20.25 ? 317 VAL A O   1 
ATOM   2495 C CB  . VAL A 1 317 ? -7.574  6.582   4.731   1.00 21.49 ? 317 VAL A CB  1 
ATOM   2496 C CG1 . VAL A 1 317 ? -7.977  7.736   3.862   1.00 21.83 ? 317 VAL A CG1 1 
ATOM   2497 C CG2 . VAL A 1 317 ? -7.979  5.286   4.052   1.00 25.04 ? 317 VAL A CG2 1 
ATOM   2498 N N   . CYS A 1 318 ? -5.433  7.908   6.975   1.00 18.76 ? 318 CYS A N   1 
ATOM   2499 C CA  . CYS A 1 318 ? -5.137  8.063   8.390   1.00 17.33 ? 318 CYS A CA  1 
ATOM   2500 C C   . CYS A 1 318 ? -5.751  9.325   8.966   1.00 16.27 ? 318 CYS A C   1 
ATOM   2501 O O   . CYS A 1 318 ? -5.395  10.435  8.567   1.00 14.58 ? 318 CYS A O   1 
ATOM   2502 C CB  . CYS A 1 318 ? -3.629  8.096   8.637   1.00 19.24 ? 318 CYS A CB  1 
ATOM   2503 S SG  . CYS A 1 318 ? -3.239  8.125   10.419  1.00 22.39 ? 318 CYS A SG  1 
ATOM   2504 N N   . PRO A 1 319 ? -6.680  9.159   9.929   1.00 15.36 ? 319 PRO A N   1 
ATOM   2505 C CA  . PRO A 1 319 ? -7.431  10.194  10.646  1.00 15.41 ? 319 PRO A CA  1 
ATOM   2506 C C   . PRO A 1 319 ? -6.547  11.143  11.469  1.00 15.83 ? 319 PRO A C   1 
ATOM   2507 O O   . PRO A 1 319 ? -5.510  10.741  12.012  1.00 15.54 ? 319 PRO A O   1 
ATOM   2508 C CB  . PRO A 1 319 ? -8.374  9.391   11.555  1.00 12.10 ? 319 PRO A CB  1 
ATOM   2509 C CG  . PRO A 1 319 ? -8.383  8.034   10.970  1.00 15.66 ? 319 PRO A CG  1 
ATOM   2510 C CD  . PRO A 1 319 ? -6.992  7.829   10.473  1.00 12.20 ? 319 PRO A CD  1 
ATOM   2511 N N   . VAL A 1 320 ? -6.981  12.394  11.566  1.00 15.03 ? 320 VAL A N   1 
ATOM   2512 C CA  . VAL A 1 320 ? -6.268  13.398  12.337  1.00 14.73 ? 320 VAL A CA  1 
ATOM   2513 C C   . VAL A 1 320 ? -7.271  13.967  13.327  1.00 14.81 ? 320 VAL A C   1 
ATOM   2514 O O   . VAL A 1 320 ? -8.354  14.389  12.932  1.00 13.72 ? 320 VAL A O   1 
ATOM   2515 C CB  . VAL A 1 320 ? -5.760  14.531  11.440  1.00 13.91 ? 320 VAL A CB  1 
ATOM   2516 C CG1 . VAL A 1 320 ? -4.968  15.528  12.256  1.00 11.94 ? 320 VAL A CG1 1 
ATOM   2517 C CG2 . VAL A 1 320 ? -4.918  13.955  10.318  1.00 16.21 ? 320 VAL A CG2 1 
ATOM   2518 N N   . HIS A 1 321 ? -6.932  13.962  14.612  1.00 15.26 ? 321 HIS A N   1 
ATOM   2519 C CA  . HIS A 1 321 ? -7.850  14.499  15.611  1.00 15.53 ? 321 HIS A CA  1 
ATOM   2520 C C   . HIS A 1 321 ? -7.234  15.673  16.376  1.00 16.47 ? 321 HIS A C   1 
ATOM   2521 O O   . HIS A 1 321 ? -7.911  16.348  17.164  1.00 17.61 ? 321 HIS A O   1 
ATOM   2522 C CB  . HIS A 1 321 ? -8.301  13.393  16.580  1.00 14.25 ? 321 HIS A CB  1 
ATOM   2523 C CG  . HIS A 1 321 ? -7.239  12.930  17.538  1.00 18.37 ? 321 HIS A CG  1 
ATOM   2524 N ND1 . HIS A 1 321 ? -5.932  12.703  17.158  1.00 19.59 ? 321 HIS A ND1 1 
ATOM   2525 C CD2 . HIS A 1 321 ? -7.315  12.575  18.845  1.00 18.42 ? 321 HIS A CD2 1 
ATOM   2526 C CE1 . HIS A 1 321 ? -5.253  12.222  18.186  1.00 21.19 ? 321 HIS A CE1 1 
ATOM   2527 N NE2 . HIS A 1 321 ? -6.070  12.133  19.222  1.00 21.31 ? 321 HIS A NE2 1 
ATOM   2528 N N   . ARG A 1 322 ? -5.953  15.931  16.126  1.00 15.48 ? 322 ARG A N   1 
ATOM   2529 C CA  . ARG A 1 322 ? -5.280  17.010  16.823  1.00 17.82 ? 322 ARG A CA  1 
ATOM   2530 C C   . ARG A 1 322 ? -4.104  17.601  16.068  1.00 18.39 ? 322 ARG A C   1 
ATOM   2531 O O   . ARG A 1 322 ? -3.263  16.881  15.501  1.00 17.67 ? 322 ARG A O   1 
ATOM   2532 C CB  . ARG A 1 322 ? -4.812  16.527  18.201  1.00 19.09 ? 322 ARG A CB  1 
ATOM   2533 C CG  . ARG A 1 322 ? -4.410  17.641  19.141  1.00 20.68 ? 322 ARG A CG  1 
ATOM   2534 C CD  . ARG A 1 322 ? -4.198  17.110  20.534  1.00 21.38 ? 322 ARG A CD  1 
ATOM   2535 N NE  . ARG A 1 322 ? -3.031  16.233  20.633  1.00 25.16 ? 322 ARG A NE  1 
ATOM   2536 C CZ  . ARG A 1 322 ? -1.766  16.639  20.765  1.00 27.35 ? 322 ARG A CZ  1 
ATOM   2537 N NH1 . ARG A 1 322 ? -1.471  17.933  20.826  1.00 26.42 ? 322 ARG A NH1 1 
ATOM   2538 N NH2 . ARG A 1 322 ? -0.786  15.738  20.825  1.00 29.07 ? 322 ARG A NH2 1 
ATOM   2539 N N   . ILE A 1 323 ? -4.070  18.929  16.057  1.00 17.55 ? 323 ILE A N   1 
ATOM   2540 C CA  . ILE A 1 323 ? -3.003  19.674  15.412  1.00 16.92 ? 323 ILE A CA  1 
ATOM   2541 C C   . ILE A 1 323 ? -2.534  20.759  16.373  1.00 15.18 ? 323 ILE A C   1 
ATOM   2542 O O   . ILE A 1 323 ? -3.287  21.636  16.758  1.00 13.33 ? 323 ILE A O   1 
ATOM   2543 C CB  . ILE A 1 323 ? -3.472  20.357  14.106  1.00 18.39 ? 323 ILE A CB  1 
ATOM   2544 C CG1 . ILE A 1 323 ? -3.940  19.303  13.103  1.00 17.11 ? 323 ILE A CG1 1 
ATOM   2545 C CG2 . ILE A 1 323 ? -2.333  21.219  13.542  1.00 17.50 ? 323 ILE A CG2 1 
ATOM   2546 C CD1 . ILE A 1 323 ? -4.433  19.869  11.817  1.00 12.02 ? 323 ILE A CD1 1 
ATOM   2547 N N   . LEU A 1 324 ? -1.271  20.673  16.763  1.00 19.16 ? 324 LEU A N   1 
ATOM   2548 C CA  . LEU A 1 324 ? -0.678  21.630  17.676  1.00 19.91 ? 324 LEU A CA  1 
ATOM   2549 C C   . LEU A 1 324 ? -0.065  22.741  16.845  1.00 21.20 ? 324 LEU A C   1 
ATOM   2550 O O   . LEU A 1 324 ? 0.892   22.527  16.094  1.00 22.77 ? 324 LEU A O   1 
ATOM   2551 C CB  . LEU A 1 324 ? 0.398   20.947  18.517  1.00 18.88 ? 324 LEU A CB  1 
ATOM   2552 C CG  . LEU A 1 324 ? 1.085   21.881  19.525  1.00 21.69 ? 324 LEU A CG  1 
ATOM   2553 C CD1 . LEU A 1 324 ? 0.051   22.388  20.532  1.00 20.15 ? 324 LEU A CD1 1 
ATOM   2554 C CD2 . LEU A 1 324 ? 2.239   21.147  20.219  1.00 18.52 ? 324 LEU A CD2 1 
ATOM   2555 N N   . TYR A 1 325 ? -0.596  23.941  17.002  1.00 20.90 ? 325 TYR A N   1 
ATOM   2556 C CA  . TYR A 1 325 ? -0.123  25.076  16.216  1.00 23.86 ? 325 TYR A CA  1 
ATOM   2557 C C   . TYR A 1 325 ? 0.004   26.338  17.075  1.00 25.38 ? 325 TYR A C   1 
ATOM   2558 O O   . TYR A 1 325 ? -0.950  26.729  17.758  1.00 25.04 ? 325 TYR A O   1 
ATOM   2559 C CB  . TYR A 1 325 ? -1.112  25.267  15.064  1.00 20.08 ? 325 TYR A CB  1 
ATOM   2560 C CG  . TYR A 1 325 ? -0.942  26.491  14.218  1.00 23.50 ? 325 TYR A CG  1 
ATOM   2561 C CD1 . TYR A 1 325 ? -1.906  27.497  14.228  1.00 24.00 ? 325 TYR A CD1 1 
ATOM   2562 C CD2 . TYR A 1 325 ? 0.140   26.625  13.355  1.00 24.40 ? 325 TYR A CD2 1 
ATOM   2563 C CE1 . TYR A 1 325 ? -1.801  28.597  13.398  1.00 26.03 ? 325 TYR A CE1 1 
ATOM   2564 C CE2 . TYR A 1 325 ? 0.255   27.734  12.520  1.00 24.71 ? 325 TYR A CE2 1 
ATOM   2565 C CZ  . TYR A 1 325 ? -0.712  28.701  12.545  1.00 24.39 ? 325 TYR A CZ  1 
ATOM   2566 O OH  . TYR A 1 325 ? -0.614  29.763  11.689  1.00 27.15 ? 325 TYR A OH  1 
ATOM   2567 N N   . LYS A 1 326 ? 1.185   26.961  17.044  1.00 27.22 ? 326 LYS A N   1 
ATOM   2568 C CA  . LYS A 1 326 ? 1.450   28.179  17.826  1.00 30.05 ? 326 LYS A CA  1 
ATOM   2569 C C   . LYS A 1 326 ? 1.257   27.829  19.288  1.00 32.27 ? 326 LYS A C   1 
ATOM   2570 O O   . LYS A 1 326 ? 0.795   28.654  20.092  1.00 34.28 ? 326 LYS A O   1 
ATOM   2571 C CB  . LYS A 1 326 ? 0.487   29.341  17.446  1.00 30.48 ? 326 LYS A CB  1 
ATOM   2572 C CG  . LYS A 1 326 ? 1.074   30.408  16.496  1.00 29.40 ? 326 LYS A CG  1 
ATOM   2573 C CD  . LYS A 1 326 ? 0.103   31.587  16.252  1.00 32.36 ? 326 LYS A CD  1 
ATOM   2574 C CE  . LYS A 1 326 ? -1.124  31.198  15.396  1.00 31.69 ? 326 LYS A CE  1 
ATOM   2575 N NZ  . LYS A 1 326 ? -1.944  32.368  14.863  1.00 26.84 ? 326 LYS A NZ  1 
ATOM   2576 N N   . ASP A 1 327 ? 1.629   26.599  19.634  1.00 33.75 ? 327 ASP A N   1 
ATOM   2577 C CA  . ASP A 1 327 ? 1.490   26.122  21.000  1.00 35.95 ? 327 ASP A CA  1 
ATOM   2578 C C   . ASP A 1 327 ? 0.013   25.939  21.370  1.00 34.50 ? 327 ASP A C   1 
ATOM   2579 O O   . ASP A 1 327 ? -0.328  25.752  22.537  1.00 35.45 ? 327 ASP A O   1 
ATOM   2580 C CB  . ASP A 1 327 ? 2.186   27.088  21.987  1.00 39.09 ? 327 ASP A CB  1 
ATOM   2581 C CG  . ASP A 1 327 ? 3.698   26.784  22.171  1.00 40.38 ? 327 ASP A CG  1 
ATOM   2582 O OD1 . ASP A 1 327 ? 4.338   27.447  23.027  1.00 41.33 ? 327 ASP A OD1 1 
ATOM   2583 O OD2 . ASP A 1 327 ? 4.244   25.895  21.473  1.00 40.82 ? 327 ASP A OD2 1 
ATOM   2584 N N   . ARG A 1 328 ? -0.859  25.982  20.363  1.00 35.96 ? 328 ARG A N   1 
ATOM   2585 C CA  . ARG A 1 328 ? -2.315  25.823  20.543  1.00 34.23 ? 328 ARG A CA  1 
ATOM   2586 C C   . ARG A 1 328 ? -2.833  24.496  20.016  1.00 31.13 ? 328 ARG A C   1 
ATOM   2587 O O   . ARG A 1 328 ? -2.772  24.225  18.815  1.00 30.66 ? 328 ARG A O   1 
ATOM   2588 C CB  . ARG A 1 328 ? -3.073  26.926  19.834  1.00 36.64 ? 328 ARG A CB  1 
ATOM   2589 C CG  . ARG A 1 328 ? -3.280  28.158  20.652  1.00 40.81 ? 328 ARG A CG  1 
ATOM   2590 C CD  . ARG A 1 328 ? -3.720  29.344  19.772  1.00 44.61 ? 328 ARG A CD  1 
ATOM   2591 N NE  . ARG A 1 328 ? -4.829  29.047  18.854  1.00 44.26 ? 328 ARG A NE  1 
ATOM   2592 C CZ  . ARG A 1 328 ? -5.621  29.992  18.330  1.00 47.47 ? 328 ARG A CZ  1 
ATOM   2593 N NH1 . ARG A 1 328 ? -5.420  31.278  18.648  1.00 48.38 ? 328 ARG A NH1 1 
ATOM   2594 N NH2 . ARG A 1 328 ? -6.602  29.671  17.488  1.00 47.49 ? 328 ARG A NH2 1 
ATOM   2595 N N   . ASN A 1 329 ? -3.364  23.686  20.924  1.00 28.87 ? 329 ASN A N   1 
ATOM   2596 C CA  . ASN A 1 329 ? -3.910  22.385  20.573  1.00 24.13 ? 329 ASN A CA  1 
ATOM   2597 C C   . ASN A 1 329 ? -5.270  22.548  19.923  1.00 22.88 ? 329 ASN A C   1 
ATOM   2598 O O   . ASN A 1 329 ? -6.230  22.971  20.545  1.00 18.70 ? 329 ASN A O   1 
ATOM   2599 C CB  . ASN A 1 329 ? -4.040  21.530  21.808  1.00 23.80 ? 329 ASN A CB  1 
ATOM   2600 C CG  . ASN A 1 329 ? -3.036  20.436  21.844  1.00 25.18 ? 329 ASN A CG  1 
ATOM   2601 O OD1 . ASN A 1 329 ? -1.844  20.654  21.806  1.00 26.37 ? 329 ASN A OD1 1 
ATOM   2602 N ND2 . ASN A 1 329 ? -3.520  19.239  21.909  1.00 31.73 ? 329 ASN A ND2 1 
ATOM   2603 N N   . LEU A 1 330 ? -5.335  22.211  18.648  1.00 23.68 ? 330 LEU A N   1 
ATOM   2604 C CA  . LEU A 1 330 ? -6.580  22.301  17.917  1.00 21.81 ? 330 LEU A CA  1 
ATOM   2605 C C   . LEU A 1 330 ? -7.180  20.916  17.846  1.00 20.37 ? 330 LEU A C   1 
ATOM   2606 O O   . LEU A 1 330 ? -6.555  19.989  17.337  1.00 22.69 ? 330 LEU A O   1 
ATOM   2607 C CB  . LEU A 1 330 ? -6.336  22.792  16.496  1.00 19.47 ? 330 LEU A CB  1 
ATOM   2608 C CG  . LEU A 1 330 ? -5.458  24.027  16.439  1.00 17.15 ? 330 LEU A CG  1 
ATOM   2609 C CD1 . LEU A 1 330 ? -5.208  24.375  14.991  1.00 17.19 ? 330 LEU A CD1 1 
ATOM   2610 C CD2 . LEU A 1 330 ? -6.130  25.161  17.199  1.00 15.16 ? 330 LEU A CD2 1 
ATOM   2611 N N   . HIS A 1 331 ? -8.384  20.777  18.371  1.00 19.23 ? 331 HIS A N   1 
ATOM   2612 C CA  . HIS A 1 331 ? -9.087  19.520  18.326  1.00 14.42 ? 331 HIS A CA  1 
ATOM   2613 C C   . HIS A 1 331 ? -9.693  19.442  16.930  1.00 16.67 ? 331 HIS A C   1 
ATOM   2614 O O   . HIS A 1 331 ? -10.305 20.410  16.469  1.00 19.08 ? 331 HIS A O   1 
ATOM   2615 C CB  . HIS A 1 331 ? -10.200 19.517  19.356  1.00 11.56 ? 331 HIS A CB  1 
ATOM   2616 C CG  . HIS A 1 331 ? -11.222 18.469  19.095  1.00 15.11 ? 331 HIS A CG  1 
ATOM   2617 N ND1 . HIS A 1 331 ? -10.986 17.131  19.328  1.00 13.05 ? 331 HIS A ND1 1 
ATOM   2618 C CD2 . HIS A 1 331 ? -12.444 18.544  18.521  1.00 12.28 ? 331 HIS A CD2 1 
ATOM   2619 C CE1 . HIS A 1 331 ? -12.018 16.428  18.903  1.00 15.81 ? 331 HIS A CE1 1 
ATOM   2620 N NE2 . HIS A 1 331 ? -12.917 17.262  18.409  1.00 14.33 ? 331 HIS A NE2 1 
ATOM   2621 N N   . ILE A 1 332 ? -9.511  18.321  16.245  1.00 12.48 ? 332 ILE A N   1 
ATOM   2622 C CA  . ILE A 1 332 ? -10.083 18.160  14.919  1.00 12.02 ? 332 ILE A CA  1 
ATOM   2623 C C   . ILE A 1 332 ? -11.185 17.115  15.100  1.00 15.20 ? 332 ILE A C   1 
ATOM   2624 O O   . ILE A 1 332 ? -10.926 16.004  15.575  1.00 18.48 ? 332 ILE A O   1 
ATOM   2625 C CB  . ILE A 1 332 ? -9.026  17.677  13.902  1.00 14.03 ? 332 ILE A CB  1 
ATOM   2626 C CG1 . ILE A 1 332 ? -7.783  18.577  13.954  1.00 14.06 ? 332 ILE A CG1 1 
ATOM   2627 C CG2 . ILE A 1 332 ? -9.605  17.695  12.491  1.00 14.54 ? 332 ILE A CG2 1 
ATOM   2628 C CD1 . ILE A 1 332 ? -8.005  20.034  13.549  1.00 12.92 ? 332 ILE A CD1 1 
ATOM   2629 N N   . PRO A 1 333 ? -12.427 17.458  14.723  1.00 16.97 ? 333 PRO A N   1 
ATOM   2630 C CA  . PRO A 1 333 ? -13.631 16.604  14.834  1.00 17.80 ? 333 PRO A CA  1 
ATOM   2631 C C   . PRO A 1 333 ? -13.724 15.323  13.996  1.00 18.76 ? 333 PRO A C   1 
ATOM   2632 O O   . PRO A 1 333 ? -14.780 14.696  13.937  1.00 18.48 ? 333 PRO A O   1 
ATOM   2633 C CB  . PRO A 1 333 ? -14.796 17.556  14.487  1.00 20.85 ? 333 PRO A CB  1 
ATOM   2634 C CG  . PRO A 1 333 ? -14.151 18.893  14.099  1.00 24.37 ? 333 PRO A CG  1 
ATOM   2635 C CD  . PRO A 1 333 ? -12.686 18.631  13.867  1.00 16.67 ? 333 PRO A CD  1 
ATOM   2636 N N   . THR A 1 334 ? -12.633 14.934  13.355  1.00 18.75 ? 334 THR A N   1 
ATOM   2637 C CA  . THR A 1 334 ? -12.660 13.756  12.505  1.00 18.85 ? 334 THR A CA  1 
ATOM   2638 C C   . THR A 1 334 ? -13.398 12.523  13.051  1.00 17.48 ? 334 THR A C   1 
ATOM   2639 O O   . THR A 1 334 ? -14.317 12.026  12.417  1.00 16.69 ? 334 THR A O   1 
ATOM   2640 C CB  . THR A 1 334 ? -11.228 13.373  12.086  1.00 16.46 ? 334 THR A CB  1 
ATOM   2641 O OG1 . THR A 1 334 ? -10.597 14.524  11.514  1.00 16.28 ? 334 THR A OG1 1 
ATOM   2642 C CG2 . THR A 1 334 ? -11.247 12.260  11.065  1.00 8.31  ? 334 THR A CG2 1 
ATOM   2643 N N   . MET A 1 335 ? -13.020 12.042  14.226  1.00 18.55 ? 335 MET A N   1 
ATOM   2644 C CA  . MET A 1 335 ? -13.672 10.861  14.776  1.00 20.63 ? 335 MET A CA  1 
ATOM   2645 C C   . MET A 1 335 ? -15.167 11.053  15.096  1.00 20.61 ? 335 MET A C   1 
ATOM   2646 O O   . MET A 1 335 ? -15.950 10.099  15.048  1.00 20.26 ? 335 MET A O   1 
ATOM   2647 C CB  . MET A 1 335 ? -12.912 10.383  16.012  1.00 18.52 ? 335 MET A CB  1 
ATOM   2648 C CG  . MET A 1 335 ? -11.448 10.030  15.736  1.00 19.58 ? 335 MET A CG  1 
ATOM   2649 S SD  . MET A 1 335 ? -11.250 8.901   14.337  1.00 20.86 ? 335 MET A SD  1 
ATOM   2650 C CE  . MET A 1 335 ? -12.242 7.514   14.857  1.00 18.47 ? 335 MET A CE  1 
ATOM   2651 N N   . GLU A 1 336 ? -15.556 12.288  15.396  1.00 20.62 ? 336 GLU A N   1 
ATOM   2652 C CA  . GLU A 1 336 ? -16.946 12.602  15.717  1.00 21.59 ? 336 GLU A CA  1 
ATOM   2653 C C   . GLU A 1 336 ? -17.839 12.625  14.496  1.00 21.43 ? 336 GLU A C   1 
ATOM   2654 O O   . GLU A 1 336 ? -19.055 12.674  14.606  1.00 24.84 ? 336 GLU A O   1 
ATOM   2655 C CB  . GLU A 1 336 ? -17.050 13.962  16.421  1.00 21.61 ? 336 GLU A CB  1 
ATOM   2656 C CG  . GLU A 1 336 ? -16.672 13.918  17.889  1.00 25.95 ? 336 GLU A CG  1 
ATOM   2657 C CD  . GLU A 1 336 ? -15.220 14.291  18.151  1.00 30.67 ? 336 GLU A CD  1 
ATOM   2658 O OE1 . GLU A 1 336 ? -14.917 15.502  18.077  1.00 30.61 ? 336 GLU A OE1 1 
ATOM   2659 O OE2 . GLU A 1 336 ? -14.379 13.387  18.433  1.00 31.39 ? 336 GLU A OE2 1 
ATOM   2660 N N   . ASN A 1 337 ? -17.241 12.626  13.323  1.00 19.24 ? 337 ASN A N   1 
ATOM   2661 C CA  . ASN A 1 337 ? -18.036 12.642  12.119  1.00 18.53 ? 337 ASN A CA  1 
ATOM   2662 C C   . ASN A 1 337 ? -17.905 11.295  11.407  1.00 15.63 ? 337 ASN A C   1 
ATOM   2663 O O   . ASN A 1 337 ? -17.908 11.217  10.178  1.00 11.64 ? 337 ASN A O   1 
ATOM   2664 C CB  . ASN A 1 337 ? -17.592 13.794  11.229  1.00 16.95 ? 337 ASN A CB  1 
ATOM   2665 C CG  . ASN A 1 337 ? -18.101 15.143  11.717  1.00 20.06 ? 337 ASN A CG  1 
ATOM   2666 O OD1 . ASN A 1 337 ? -19.309 15.403  11.729  1.00 22.16 ? 337 ASN A OD1 1 
ATOM   2667 N ND2 . ASN A 1 337 ? -17.182 16.015  12.106  1.00 20.22 ? 337 ASN A ND2 1 
ATOM   2668 N N   . GLY A 1 338 ? -17.795 10.242  12.212  1.00 12.48 ? 338 GLY A N   1 
ATOM   2669 C CA  . GLY A 1 338 ? -17.674 8.891   11.690  1.00 13.73 ? 338 GLY A CA  1 
ATOM   2670 C C   . GLY A 1 338 ? -16.430 8.183   12.188  1.00 16.58 ? 338 GLY A C   1 
ATOM   2671 O O   . GLY A 1 338 ? -16.488 7.474   13.192  1.00 15.99 ? 338 GLY A O   1 
ATOM   2672 N N   . PRO A 1 339 ? -15.275 8.386   11.527  1.00 17.12 ? 339 PRO A N   1 
ATOM   2673 C CA  . PRO A 1 339 ? -15.160 9.253   10.350  1.00 17.01 ? 339 PRO A CA  1 
ATOM   2674 C C   . PRO A 1 339 ? -15.818 8.585   9.158   1.00 18.40 ? 339 PRO A C   1 
ATOM   2675 O O   . PRO A 1 339 ? -15.298 7.618   8.589   1.00 19.96 ? 339 PRO A O   1 
ATOM   2676 C CB  . PRO A 1 339 ? -13.648 9.415   10.182  1.00 17.39 ? 339 PRO A CB  1 
ATOM   2677 C CG  . PRO A 1 339 ? -13.127 8.057   10.628  1.00 16.29 ? 339 PRO A CG  1 
ATOM   2678 C CD  . PRO A 1 339 ? -13.972 7.786   11.872  1.00 15.78 ? 339 PRO A CD  1 
ATOM   2679 N N   . GLU A 1 340 ? -16.980 9.108   8.798   1.00 17.95 ? 340 GLU A N   1 
ATOM   2680 C CA  . GLU A 1 340 ? -17.751 8.571   7.701   1.00 19.20 ? 340 GLU A CA  1 
ATOM   2681 C C   . GLU A 1 340 ? -17.014 8.389   6.371   1.00 18.14 ? 340 GLU A C   1 
ATOM   2682 O O   . GLU A 1 340 ? -17.056 7.304   5.807   1.00 18.99 ? 340 GLU A O   1 
ATOM   2683 C CB  . GLU A 1 340 ? -19.001 9.428   7.488   1.00 18.67 ? 340 GLU A CB  1 
ATOM   2684 C CG  . GLU A 1 340 ? -19.645 9.244   6.124   1.00 26.76 ? 340 GLU A CG  1 
ATOM   2685 C CD  . GLU A 1 340 ? -21.153 9.382   6.160   1.00 28.46 ? 340 GLU A CD  1 
ATOM   2686 O OE1 . GLU A 1 340 ? -21.639 10.237  6.937   1.00 30.27 ? 340 GLU A OE1 1 
ATOM   2687 O OE2 . GLU A 1 340 ? -21.836 8.639   5.406   1.00 28.44 ? 340 GLU A OE2 1 
ATOM   2688 N N   . LEU A 1 341 ? -16.356 9.440   5.876   1.00 16.47 ? 341 LEU A N   1 
ATOM   2689 C CA  . LEU A 1 341 ? -15.661 9.374   4.585   1.00 17.12 ? 341 LEU A CA  1 
ATOM   2690 C C   . LEU A 1 341 ? -14.436 8.489   4.584   1.00 14.46 ? 341 LEU A C   1 
ATOM   2691 O O   . LEU A 1 341 ? -14.215 7.730   3.642   1.00 15.07 ? 341 LEU A O   1 
ATOM   2692 C CB  . LEU A 1 341 ? -15.254 10.779  4.114   1.00 18.27 ? 341 LEU A CB  1 
ATOM   2693 C CG  . LEU A 1 341 ? -14.501 10.894  2.772   1.00 20.51 ? 341 LEU A CG  1 
ATOM   2694 C CD1 . LEU A 1 341 ? -15.332 10.318  1.640   1.00 16.83 ? 341 LEU A CD1 1 
ATOM   2695 C CD2 . LEU A 1 341 ? -14.157 12.363  2.492   1.00 18.05 ? 341 LEU A CD2 1 
ATOM   2696 N N   . ILE A 1 342 ? -13.641 8.609   5.637   1.00 12.13 ? 342 ILE A N   1 
ATOM   2697 C CA  . ILE A 1 342 ? -12.419 7.830   5.788   1.00 13.12 ? 342 ILE A CA  1 
ATOM   2698 C C   . ILE A 1 342 ? -12.726 6.345   5.717   1.00 14.38 ? 342 ILE A C   1 
ATOM   2699 O O   . ILE A 1 342 ? -12.083 5.602   4.975   1.00 15.46 ? 342 ILE A O   1 
ATOM   2700 C CB  . ILE A 1 342 ? -11.730 8.141   7.136   1.00 10.96 ? 342 ILE A CB  1 
ATOM   2701 C CG1 . ILE A 1 342 ? -11.134 9.546   7.086   1.00 9.47  ? 342 ILE A CG1 1 
ATOM   2702 C CG2 . ILE A 1 342 ? -10.630 7.131   7.425   1.00 10.87 ? 342 ILE A CG2 1 
ATOM   2703 C CD1 . ILE A 1 342 ? -10.572 10.013  8.385   1.00 10.49 ? 342 ILE A CD1 1 
ATOM   2704 N N   . LEU A 1 343 ? -13.710 5.912   6.490   1.00 13.86 ? 343 LEU A N   1 
ATOM   2705 C CA  . LEU A 1 343 ? -14.082 4.507   6.490   1.00 15.94 ? 343 LEU A CA  1 
ATOM   2706 C C   . LEU A 1 343 ? -14.468 4.025   5.072   1.00 16.23 ? 343 LEU A C   1 
ATOM   2707 O O   . LEU A 1 343 ? -14.025 2.969   4.622   1.00 17.31 ? 343 LEU A O   1 
ATOM   2708 C CB  . LEU A 1 343 ? -15.231 4.273   7.494   1.00 15.05 ? 343 LEU A CB  1 
ATOM   2709 C CG  . LEU A 1 343 ? -14.845 4.307   8.976   1.00 13.41 ? 343 LEU A CG  1 
ATOM   2710 C CD1 . LEU A 1 343 ? -16.085 4.212   9.835   1.00 12.56 ? 343 LEU A CD1 1 
ATOM   2711 C CD2 . LEU A 1 343 ? -13.897 3.149   9.312   1.00 10.94 ? 343 LEU A CD2 1 
ATOM   2712 N N   . ARG A 1 344 ? -15.273 4.808   4.361   1.00 16.46 ? 344 ARG A N   1 
ATOM   2713 C CA  . ARG A 1 344 ? -15.677 4.414   3.017   1.00 15.84 ? 344 ARG A CA  1 
ATOM   2714 C C   . ARG A 1 344 ? -14.425 4.239   2.164   1.00 15.74 ? 344 ARG A C   1 
ATOM   2715 O O   . ARG A 1 344 ? -14.236 3.199   1.550   1.00 16.09 ? 344 ARG A O   1 
ATOM   2716 C CB  . ARG A 1 344 ? -16.616 5.459   2.415   1.00 15.10 ? 344 ARG A CB  1 
ATOM   2717 C CG  . ARG A 1 344 ? -17.097 5.135   1.005   1.00 15.93 ? 344 ARG A CG  1 
ATOM   2718 C CD  . ARG A 1 344 ? -18.087 6.176   0.516   1.00 14.20 ? 344 ARG A CD  1 
ATOM   2719 N NE  . ARG A 1 344 ? -18.581 5.866   -0.817  1.00 18.70 ? 344 ARG A NE  1 
ATOM   2720 C CZ  . ARG A 1 344 ? -19.570 6.517   -1.432  1.00 19.06 ? 344 ARG A CZ  1 
ATOM   2721 N NH1 . ARG A 1 344 ? -20.187 7.536   -0.834  1.00 17.05 ? 344 ARG A NH1 1 
ATOM   2722 N NH2 . ARG A 1 344 ? -19.944 6.148   -2.656  1.00 18.23 ? 344 ARG A NH2 1 
ATOM   2723 N N   . PHE A 1 345 ? -13.564 5.259   2.137   1.00 16.36 ? 345 PHE A N   1 
ATOM   2724 C CA  . PHE A 1 345 ? -12.302 5.168   1.393   1.00 14.82 ? 345 PHE A CA  1 
ATOM   2725 C C   . PHE A 1 345 ? -11.588 3.891   1.824   1.00 15.82 ? 345 PHE A C   1 
ATOM   2726 O O   . PHE A 1 345 ? -11.264 3.031   1.011   1.00 18.07 ? 345 PHE A O   1 
ATOM   2727 C CB  . PHE A 1 345 ? -11.397 6.361   1.698   1.00 14.61 ? 345 PHE A CB  1 
ATOM   2728 C CG  . PHE A 1 345 ? -11.707 7.594   0.891   1.00 13.18 ? 345 PHE A CG  1 
ATOM   2729 C CD1 . PHE A 1 345 ? -11.649 8.849   1.475   1.00 10.12 ? 345 PHE A CD1 1 
ATOM   2730 C CD2 . PHE A 1 345 ? -12.027 7.497   -0.459  1.00 10.60 ? 345 PHE A CD2 1 
ATOM   2731 C CE1 . PHE A 1 345 ? -11.901 9.982   0.733   1.00 12.41 ? 345 PHE A CE1 1 
ATOM   2732 C CE2 . PHE A 1 345 ? -12.282 8.624   -1.211  1.00 9.65  ? 345 PHE A CE2 1 
ATOM   2733 C CZ  . PHE A 1 345 ? -12.221 9.867   -0.621  1.00 11.16 ? 345 PHE A CZ  1 
ATOM   2734 N N   . GLN A 1 346 ? -11.363 3.763   3.117   1.00 14.01 ? 346 GLN A N   1 
ATOM   2735 C CA  . GLN A 1 346 ? -10.707 2.589   3.616   1.00 15.84 ? 346 GLN A CA  1 
ATOM   2736 C C   . GLN A 1 346 ? -11.389 1.323   3.080   1.00 16.23 ? 346 GLN A C   1 
ATOM   2737 O O   . GLN A 1 346 ? -10.725 0.456   2.514   1.00 18.86 ? 346 GLN A O   1 
ATOM   2738 C CB  . GLN A 1 346 ? -10.719 2.581   5.140   1.00 16.55 ? 346 GLN A CB  1 
ATOM   2739 C CG  . GLN A 1 346 ? -10.121 1.309   5.711   1.00 27.12 ? 346 GLN A CG  1 
ATOM   2740 C CD  . GLN A 1 346 ? -10.215 1.209   7.229   1.00 30.50 ? 346 GLN A CD  1 
ATOM   2741 O OE1 . GLN A 1 346 ? -9.404  1.794   7.955   1.00 29.63 ? 346 GLN A OE1 1 
ATOM   2742 N NE2 . GLN A 1 346 ? -11.211 0.458   7.715   1.00 32.74 ? 346 GLN A NE2 1 
ATOM   2743 N N   . LYS A 1 347 ? -12.704 1.222   3.235   1.00 13.26 ? 347 LYS A N   1 
ATOM   2744 C CA  . LYS A 1 347 ? -13.408 0.029   2.782   1.00 11.79 ? 347 LYS A CA  1 
ATOM   2745 C C   . LYS A 1 347 ? -13.280 -0.282  1.291   1.00 13.11 ? 347 LYS A C   1 
ATOM   2746 O O   . LYS A 1 347 ? -13.132 -1.443  0.909   1.00 10.37 ? 347 LYS A O   1 
ATOM   2747 C CB  . LYS A 1 347 ? -14.888 0.110   3.153   1.00 8.16  ? 347 LYS A CB  1 
ATOM   2748 C CG  . LYS A 1 347 ? -15.628 -1.148  2.819   1.00 13.11 ? 347 LYS A CG  1 
ATOM   2749 C CD  . LYS A 1 347 ? -17.040 -1.155  3.375   1.00 17.86 ? 347 LYS A CD  1 
ATOM   2750 C CE  . LYS A 1 347 ? -17.586 -2.576  3.396   1.00 20.46 ? 347 LYS A CE  1 
ATOM   2751 N NZ  . LYS A 1 347 ? -18.993 -2.641  3.891   1.00 24.36 ? 347 LYS A NZ  1 
ATOM   2752 N N   . GLU A 1 348 ? -13.355 0.744   0.446   1.00 13.88 ? 348 GLU A N   1 
ATOM   2753 C CA  . GLU A 1 348 ? -13.252 0.525   -0.981  1.00 12.60 ? 348 GLU A CA  1 
ATOM   2754 C C   . GLU A 1 348 ? -11.888 0.048   -1.403  1.00 13.01 ? 348 GLU A C   1 
ATOM   2755 O O   . GLU A 1 348 ? -11.784 -0.825  -2.255  1.00 13.15 ? 348 GLU A O   1 
ATOM   2756 C CB  . GLU A 1 348 ? -13.601 1.790   -1.753  1.00 14.54 ? 348 GLU A CB  1 
ATOM   2757 C CG  . GLU A 1 348 ? -14.986 1.758   -2.338  1.00 23.68 ? 348 GLU A CG  1 
ATOM   2758 C CD  . GLU A 1 348 ? -15.095 2.495   -3.674  1.00 30.72 ? 348 GLU A CD  1 
ATOM   2759 O OE1 . GLU A 1 348 ? -14.363 2.128   -4.651  1.00 30.70 ? 348 GLU A OE1 1 
ATOM   2760 O OE2 . GLU A 1 348 ? -15.925 3.443   -3.745  1.00 31.26 ? 348 GLU A OE2 1 
ATOM   2761 N N   . LEU A 1 349 ? -10.839 0.619   -0.826  1.00 14.11 ? 349 LEU A N   1 
ATOM   2762 C CA  . LEU A 1 349 ? -9.481  0.212   -1.196  1.00 18.52 ? 349 LEU A CA  1 
ATOM   2763 C C   . LEU A 1 349 ? -9.165  -1.243  -0.810  1.00 20.56 ? 349 LEU A C   1 
ATOM   2764 O O   . LEU A 1 349 ? -8.523  -1.987  -1.564  1.00 20.24 ? 349 LEU A O   1 
ATOM   2765 C CB  . LEU A 1 349 ? -8.455  1.167   -0.580  1.00 16.77 ? 349 LEU A CB  1 
ATOM   2766 C CG  . LEU A 1 349 ? -8.441  2.548   -1.248  1.00 18.25 ? 349 LEU A CG  1 
ATOM   2767 C CD1 . LEU A 1 349 ? -7.530  3.489   -0.469  1.00 13.57 ? 349 LEU A CD1 1 
ATOM   2768 C CD2 . LEU A 1 349 ? -7.988  2.418   -2.684  1.00 13.50 ? 349 LEU A CD2 1 
ATOM   2769 N N   . LYS A 1 350 ? -9.635  -1.638  0.364   1.00 19.95 ? 350 LYS A N   1 
ATOM   2770 C CA  . LYS A 1 350 ? -9.442  -2.982  0.875   1.00 21.13 ? 350 LYS A CA  1 
ATOM   2771 C C   . LYS A 1 350 ? -10.040 -4.009  -0.084  1.00 18.05 ? 350 LYS A C   1 
ATOM   2772 O O   . LYS A 1 350 ? -9.393  -4.969  -0.461  1.00 17.02 ? 350 LYS A O   1 
ATOM   2773 C CB  . LYS A 1 350 ? -10.113 -3.069  2.253   1.00 24.01 ? 350 LYS A CB  1 
ATOM   2774 C CG  . LYS A 1 350 ? -10.136 -4.455  2.893   1.00 27.20 ? 350 LYS A CG  1 
ATOM   2775 C CD  . LYS A 1 350 ? -10.143 -4.352  4.404   1.00 30.69 ? 350 LYS A CD  1 
ATOM   2776 C CE  . LYS A 1 350 ? -11.215 -5.219  5.015   1.00 35.62 ? 350 LYS A CE  1 
ATOM   2777 N NZ  . LYS A 1 350 ? -11.502 -4.804  6.446   1.00 36.76 ? 350 LYS A NZ  1 
ATOM   2778 N N   . GLU A 1 351 ? -11.279 -3.790  -0.488  1.00 17.87 ? 351 GLU A N   1 
ATOM   2779 C CA  . GLU A 1 351 ? -11.952 -4.715  -1.401  1.00 20.10 ? 351 GLU A CA  1 
ATOM   2780 C C   . GLU A 1 351 ? -11.284 -4.749  -2.777  1.00 18.04 ? 351 GLU A C   1 
ATOM   2781 O O   . GLU A 1 351 ? -11.359 -5.751  -3.479  1.00 15.43 ? 351 GLU A O   1 
ATOM   2782 C CB  . GLU A 1 351 ? -13.426 -4.328  -1.536  1.00 19.62 ? 351 GLU A CB  1 
ATOM   2783 C CG  . GLU A 1 351 ? -14.144 -4.279  -0.193  1.00 26.11 ? 351 GLU A CG  1 
ATOM   2784 C CD  . GLU A 1 351 ? -15.618 -3.965  -0.325  1.00 27.60 ? 351 GLU A CD  1 
ATOM   2785 O OE1 . GLU A 1 351 ? -15.998 -3.281  -1.306  1.00 30.78 ? 351 GLU A OE1 1 
ATOM   2786 O OE2 . GLU A 1 351 ? -16.389 -4.393  0.563   1.00 30.23 ? 351 GLU A OE2 1 
ATOM   2787 N N   . ILE A 1 352 ? -10.630 -3.660  -3.159  1.00 15.13 ? 352 ILE A N   1 
ATOM   2788 C CA  . ILE A 1 352 ? -9.962  -3.625  -4.444  1.00 16.44 ? 352 ILE A CA  1 
ATOM   2789 C C   . ILE A 1 352 ? -8.595  -4.288  -4.300  1.00 17.11 ? 352 ILE A C   1 
ATOM   2790 O O   . ILE A 1 352 ? -8.208  -5.129  -5.113  1.00 18.87 ? 352 ILE A O   1 
ATOM   2791 C CB  . ILE A 1 352 ? -9.761  -2.167  -4.939  1.00 16.84 ? 352 ILE A CB  1 
ATOM   2792 C CG1 . ILE A 1 352 ? -11.097 -1.580  -5.375  1.00 17.94 ? 352 ILE A CG1 1 
ATOM   2793 C CG2 . ILE A 1 352 ? -8.726  -2.125  -6.083  1.00 17.32 ? 352 ILE A CG2 1 
ATOM   2794 C CD1 . ILE A 1 352 ? -11.096 -0.068  -5.558  1.00 16.09 ? 352 ILE A CD1 1 
ATOM   2795 N N   . GLN A 1 353 ? -7.882  -3.908  -3.245  1.00 16.86 ? 353 GLN A N   1 
ATOM   2796 C CA  . GLN A 1 353 ? -6.540  -4.409  -2.984  1.00 15.62 ? 353 GLN A CA  1 
ATOM   2797 C C   . GLN A 1 353 ? -6.450  -5.899  -2.682  1.00 16.65 ? 353 GLN A C   1 
ATOM   2798 O O   . GLN A 1 353 ? -5.562  -6.579  -3.196  1.00 15.73 ? 353 GLN A O   1 
ATOM   2799 C CB  . GLN A 1 353 ? -5.914  -3.570  -1.870  1.00 11.86 ? 353 GLN A CB  1 
ATOM   2800 C CG  . GLN A 1 353 ? -6.049  -2.089  -2.194  1.00 13.01 ? 353 GLN A CG  1 
ATOM   2801 C CD  . GLN A 1 353 ? -5.357  -1.157  -1.232  1.00 14.47 ? 353 GLN A CD  1 
ATOM   2802 O OE1 . GLN A 1 353 ? -5.531  -1.235  -0.012  1.00 15.77 ? 353 GLN A OE1 1 
ATOM   2803 N NE2 . GLN A 1 353 ? -4.572  -0.245  -1.782  1.00 16.85 ? 353 GLN A NE2 1 
ATOM   2804 N N   . TYR A 1 354 ? -7.385  -6.412  -1.883  1.00 18.15 ? 354 TYR A N   1 
ATOM   2805 C CA  . TYR A 1 354 ? -7.390  -7.826  -1.520  1.00 16.86 ? 354 TYR A CA  1 
ATOM   2806 C C   . TYR A 1 354 ? -8.185  -8.728  -2.459  1.00 16.83 ? 354 TYR A C   1 
ATOM   2807 O O   . TYR A 1 354 ? -8.393  -9.915  -2.187  1.00 15.08 ? 354 TYR A O   1 
ATOM   2808 C CB  . TYR A 1 354 ? -7.868  -7.991  -0.078  1.00 14.37 ? 354 TYR A CB  1 
ATOM   2809 C CG  . TYR A 1 354 ? -6.912  -7.390  0.927   1.00 17.20 ? 354 TYR A CG  1 
ATOM   2810 C CD1 . TYR A 1 354 ? -7.025  -6.058  1.325   1.00 16.04 ? 354 TYR A CD1 1 
ATOM   2811 C CD2 . TYR A 1 354 ? -5.853  -8.132  1.434   1.00 16.27 ? 354 TYR A CD2 1 
ATOM   2812 C CE1 . TYR A 1 354 ? -6.109  -5.479  2.196   1.00 16.83 ? 354 TYR A CE1 1 
ATOM   2813 C CE2 . TYR A 1 354 ? -4.927  -7.562  2.309   1.00 15.72 ? 354 TYR A CE2 1 
ATOM   2814 C CZ  . TYR A 1 354 ? -5.062  -6.243  2.681   1.00 18.80 ? 354 TYR A CZ  1 
ATOM   2815 O OH  . TYR A 1 354 ? -4.137  -5.686  3.528   1.00 20.31 ? 354 TYR A OH  1 
ATOM   2816 N N   . GLY A 1 355 ? -8.613  -8.152  -3.577  1.00 20.21 ? 355 GLY A N   1 
ATOM   2817 C CA  . GLY A 1 355 ? -9.348  -8.901  -4.580  1.00 21.57 ? 355 GLY A CA  1 
ATOM   2818 C C   . GLY A 1 355 ? -10.733 -9.399  -4.214  1.00 25.17 ? 355 GLY A C   1 
ATOM   2819 O O   . GLY A 1 355 ? -11.102 -10.532 -4.550  1.00 26.60 ? 355 GLY A O   1 
ATOM   2820 N N   . ILE A 1 356 ? -11.507 -8.585  -3.507  1.00 25.68 ? 356 ILE A N   1 
ATOM   2821 C CA  . ILE A 1 356 ? -12.865 -8.999  -3.184  1.00 26.56 ? 356 ILE A CA  1 
ATOM   2822 C C   . ILE A 1 356 ? -13.687 -8.689  -4.424  1.00 27.15 ? 356 ILE A C   1 
ATOM   2823 O O   . ILE A 1 356 ? -14.574 -9.450  -4.791  1.00 29.93 ? 356 ILE A O   1 
ATOM   2824 C CB  . ILE A 1 356 ? -13.433 -8.234  -1.984  1.00 27.04 ? 356 ILE A CB  1 
ATOM   2825 C CG1 . ILE A 1 356 ? -12.470 -8.370  -0.816  1.00 25.67 ? 356 ILE A CG1 1 
ATOM   2826 C CG2 . ILE A 1 356 ? -14.804 -8.785  -1.600  1.00 25.59 ? 356 ILE A CG2 1 
ATOM   2827 C CD1 . ILE A 1 356 ? -12.089 -9.772  -0.563  1.00 25.16 ? 356 ILE A CD1 1 
ATOM   2828 N N   . ARG A 1 357 ? -13.378 -7.571  -5.075  1.00 28.56 ? 357 ARG A N   1 
ATOM   2829 C CA  . ARG A 1 357 ? -14.070 -7.175  -6.300  1.00 27.33 ? 357 ARG A CA  1 
ATOM   2830 C C   . ARG A 1 357 ? -12.991 -6.910  -7.321  1.00 26.20 ? 357 ARG A C   1 
ATOM   2831 O O   . ARG A 1 357 ? -11.998 -6.265  -6.997  1.00 23.18 ? 357 ARG A O   1 
ATOM   2832 C CB  . ARG A 1 357 ? -14.894 -5.911  -6.078  1.00 29.47 ? 357 ARG A CB  1 
ATOM   2833 C CG  . ARG A 1 357 ? -14.091 -4.685  -5.722  1.00 33.63 ? 357 ARG A CG  1 
ATOM   2834 C CD  . ARG A 1 357 ? -15.005 -3.590  -5.154  1.00 35.69 ? 357 ARG A CD  1 
ATOM   2835 N NE  . ARG A 1 357 ? -15.875 -3.044  -6.187  1.00 40.28 ? 357 ARG A NE  1 
ATOM   2836 C CZ  . ARG A 1 357 ? -15.681 -1.880  -6.812  1.00 43.13 ? 357 ARG A CZ  1 
ATOM   2837 N NH1 . ARG A 1 357 ? -14.636 -1.113  -6.500  1.00 43.82 ? 357 ARG A NH1 1 
ATOM   2838 N NH2 . ARG A 1 357 ? -16.525 -1.493  -7.773  1.00 43.45 ? 357 ARG A NH2 1 
ATOM   2839 N N   . ALA A 1 358 ? -13.163 -7.419  -8.546  1.00 25.79 ? 358 ALA A N   1 
ATOM   2840 C CA  . ALA A 1 358 ? -12.145 -7.199  -9.573  1.00 24.27 ? 358 ALA A CA  1 
ATOM   2841 C C   . ALA A 1 358 ? -12.052 -5.711  -9.873  1.00 23.53 ? 358 ALA A C   1 
ATOM   2842 O O   . ALA A 1 358 ? -13.013 -4.953  -9.657  1.00 21.83 ? 358 ALA A O   1 
ATOM   2843 C CB  . ALA A 1 358 ? -12.478 -7.983  -10.837 1.00 23.89 ? 358 ALA A CB  1 
ATOM   2844 N N   . HIS A 1 359 ? -10.880 -5.290  -10.348 1.00 24.20 ? 359 HIS A N   1 
ATOM   2845 C CA  . HIS A 1 359 ? -10.685 -3.888  -10.664 1.00 23.25 ? 359 HIS A CA  1 
ATOM   2846 C C   . HIS A 1 359 ? -9.410  -3.544  -11.463 1.00 24.33 ? 359 HIS A C   1 
ATOM   2847 O O   . HIS A 1 359 ? -8.311  -4.074  -11.224 1.00 21.15 ? 359 HIS A O   1 
ATOM   2848 C CB  . HIS A 1 359 ? -10.743 -3.070  -9.366  1.00 21.09 ? 359 HIS A CB  1 
ATOM   2849 C CG  . HIS A 1 359 ? -10.724 -1.595  -9.595  1.00 22.68 ? 359 HIS A CG  1 
ATOM   2850 N ND1 . HIS A 1 359 ? -9.611  -0.933  -10.067 1.00 21.08 ? 359 HIS A ND1 1 
ATOM   2851 C CD2 . HIS A 1 359 ? -11.707 -0.669  -9.505  1.00 20.70 ? 359 HIS A CD2 1 
ATOM   2852 C CE1 . HIS A 1 359 ? -9.912  0.338   -10.264 1.00 19.98 ? 359 HIS A CE1 1 
ATOM   2853 N NE2 . HIS A 1 359 ? -11.176 0.524   -9.929  1.00 22.02 ? 359 HIS A NE2 1 
ATOM   2854 N N   . GLU A 1 360 ? -9.591  -2.640  -12.417 1.00 25.16 ? 360 GLU A N   1 
ATOM   2855 C CA  . GLU A 1 360 ? -8.524  -2.177  -13.291 1.00 26.13 ? 360 GLU A CA  1 
ATOM   2856 C C   . GLU A 1 360 ? -7.285  -1.636  -12.576 1.00 25.46 ? 360 GLU A C   1 
ATOM   2857 O O   . GLU A 1 360 ? -6.209  -1.594  -13.179 1.00 25.59 ? 360 GLU A O   1 
ATOM   2858 C CB  . GLU A 1 360 ? -9.098  -1.098  -14.218 1.00 29.54 ? 360 GLU A CB  1 
ATOM   2859 C CG  . GLU A 1 360 ? -10.342 -0.476  -13.580 1.00 37.39 ? 360 GLU A CG  1 
ATOM   2860 C CD  . GLU A 1 360 ? -10.530 1.005   -13.871 1.00 39.92 ? 360 GLU A CD  1 
ATOM   2861 O OE1 . GLU A 1 360 ? -11.473 1.615   -13.313 1.00 37.22 ? 360 GLU A OE1 1 
ATOM   2862 O OE2 . GLU A 1 360 ? -9.701  1.530   -14.669 1.00 45.12 ? 360 GLU A OE2 1 
ATOM   2863 N N   . TRP A 1 361 ? -7.436  -1.192  -11.325 1.00 21.90 ? 361 TRP A N   1 
ATOM   2864 C CA  . TRP A 1 361 ? -6.307  -0.666  -10.554 1.00 20.44 ? 361 TRP A CA  1 
ATOM   2865 C C   . TRP A 1 361 ? -5.322  -1.740  -10.075 1.00 21.03 ? 361 TRP A C   1 
ATOM   2866 O O   . TRP A 1 361 ? -4.148  -1.443  -9.778  1.00 22.42 ? 361 TRP A O   1 
ATOM   2867 C CB  . TRP A 1 361 ? -6.790  0.129   -9.325  1.00 20.45 ? 361 TRP A CB  1 
ATOM   2868 C CG  . TRP A 1 361 ? -7.239  1.531   -9.616  1.00 17.83 ? 361 TRP A CG  1 
ATOM   2869 C CD1 . TRP A 1 361 ? -7.147  2.179   -10.813 1.00 18.80 ? 361 TRP A CD1 1 
ATOM   2870 C CD2 . TRP A 1 361 ? -7.843  2.465   -8.699  1.00 16.39 ? 361 TRP A CD2 1 
ATOM   2871 N NE1 . TRP A 1 361 ? -7.653  3.449   -10.703 1.00 18.27 ? 361 TRP A NE1 1 
ATOM   2872 C CE2 . TRP A 1 361 ? -8.087  3.653   -9.419  1.00 19.36 ? 361 TRP A CE2 1 
ATOM   2873 C CE3 . TRP A 1 361 ? -8.203  2.411   -7.343  1.00 16.35 ? 361 TRP A CE3 1 
ATOM   2874 C CZ2 . TRP A 1 361 ? -8.675  4.787   -8.830  1.00 18.27 ? 361 TRP A CZ2 1 
ATOM   2875 C CZ3 . TRP A 1 361 ? -8.786  3.527   -6.756  1.00 14.22 ? 361 TRP A CZ3 1 
ATOM   2876 C CH2 . TRP A 1 361 ? -9.017  4.704   -7.501  1.00 17.65 ? 361 TRP A CH2 1 
ATOM   2877 N N   . MET A 1 362 ? -5.781  -2.984  -10.009 1.00 18.61 ? 362 MET A N   1 
ATOM   2878 C CA  . MET A 1 362 ? -4.928  -4.078  -9.533  1.00 19.80 ? 362 MET A CA  1 
ATOM   2879 C C   . MET A 1 362 ? -4.112  -4.842  -10.595 1.00 20.30 ? 362 MET A C   1 
ATOM   2880 O O   . MET A 1 362 ? -4.675  -5.382  -11.566 1.00 21.91 ? 362 MET A O   1 
ATOM   2881 C CB  . MET A 1 362 ? -5.767  -5.084  -8.725  1.00 16.70 ? 362 MET A CB  1 
ATOM   2882 C CG  . MET A 1 362 ? -6.428  -4.504  -7.493  1.00 16.17 ? 362 MET A CG  1 
ATOM   2883 S SD  . MET A 1 362 ? -5.343  -3.400  -6.558  1.00 18.05 ? 362 MET A SD  1 
ATOM   2884 C CE  . MET A 1 362 ? -4.176  -4.583  -5.962  1.00 13.59 ? 362 MET A CE  1 
ATOM   2885 N N   . PHE A 1 363 ? -2.791  -4.893  -10.380 1.00 19.44 ? 363 PHE A N   1 
ATOM   2886 C CA  . PHE A 1 363 ? -1.844  -5.583  -11.263 1.00 17.27 ? 363 PHE A CA  1 
ATOM   2887 C C   . PHE A 1 363 ? -1.436  -6.908  -10.642 1.00 16.92 ? 363 PHE A C   1 
ATOM   2888 O O   . PHE A 1 363 ? -0.563  -6.956  -9.781  1.00 16.37 ? 363 PHE A O   1 
ATOM   2889 C CB  . PHE A 1 363 ? -0.579  -4.738  -11.465 1.00 17.92 ? 363 PHE A CB  1 
ATOM   2890 C CG  . PHE A 1 363 ? 0.457   -5.376  -12.355 1.00 15.90 ? 363 PHE A CG  1 
ATOM   2891 C CD1 . PHE A 1 363 ? 0.328   -5.339  -13.732 1.00 16.61 ? 363 PHE A CD1 1 
ATOM   2892 C CD2 . PHE A 1 363 ? 1.572   -6.002  -11.808 1.00 17.82 ? 363 PHE A CD2 1 
ATOM   2893 C CE1 . PHE A 1 363 ? 1.293   -5.913  -14.571 1.00 17.55 ? 363 PHE A CE1 1 
ATOM   2894 C CE2 . PHE A 1 363 ? 2.542   -6.579  -12.629 1.00 17.62 ? 363 PHE A CE2 1 
ATOM   2895 C CZ  . PHE A 1 363 ? 2.396   -6.531  -14.025 1.00 18.35 ? 363 PHE A CZ  1 
ATOM   2896 N N   . PRO A 1 364 ? -2.039  -8.010  -11.106 1.00 17.79 ? 364 PRO A N   1 
ATOM   2897 C CA  . PRO A 1 364 ? -1.749  -9.355  -10.604 1.00 16.39 ? 364 PRO A CA  1 
ATOM   2898 C C   . PRO A 1 364 ? -0.291  -9.785  -10.746 1.00 15.41 ? 364 PRO A C   1 
ATOM   2899 O O   . PRO A 1 364 ? 0.352   -9.517  -11.753 1.00 18.41 ? 364 PRO A O   1 
ATOM   2900 C CB  . PRO A 1 364 ? -2.682  -10.241 -11.434 1.00 15.54 ? 364 PRO A CB  1 
ATOM   2901 C CG  . PRO A 1 364 ? -3.791  -9.309  -11.855 1.00 16.68 ? 364 PRO A CG  1 
ATOM   2902 C CD  . PRO A 1 364 ? -3.033  -8.062  -12.196 1.00 15.59 ? 364 PRO A CD  1 
ATOM   2903 N N   . VAL A 1 365 ? 0.224   -10.464 -9.729  1.00 17.26 ? 365 VAL A N   1 
ATOM   2904 C CA  . VAL A 1 365 ? 1.593   -10.952 -9.748  1.00 16.58 ? 365 VAL A CA  1 
ATOM   2905 C C   . VAL A 1 365 ? 1.591   -12.385 -10.232 1.00 18.34 ? 365 VAL A C   1 
ATOM   2906 O O   . VAL A 1 365 ? 0.569   -13.046 -10.010 1.00 18.88 ? 365 VAL A O   1 
ATOM   2907 C CB  . VAL A 1 365 ? 2.228   -10.927 -8.335  1.00 19.03 ? 365 VAL A CB  1 
ATOM   2908 C CG1 . VAL A 1 365 ? 3.360   -11.952 -8.248  1.00 15.83 ? 365 VAL A CG1 1 
ATOM   2909 C CG2 . VAL A 1 365 ? 2.773   -9.534  -8.023  1.00 16.29 ? 365 VAL A CG2 1 
ATOM   2910 O OXT . VAL A 1 365 ? 2.613   -12.845 -10.789 1.00 18.87 ? 365 VAL A OXT 1 
ATOM   2911 N N   . ALA B 1 1   ? 25.165  10.969  20.832  1.00 50.48 ? 1   ALA B N   1 
ATOM   2912 C CA  . ALA B 1 1   ? 26.469  11.579  21.226  1.00 51.66 ? 1   ALA B CA  1 
ATOM   2913 C C   . ALA B 1 1   ? 27.525  10.486  21.477  1.00 53.02 ? 1   ALA B C   1 
ATOM   2914 O O   . ALA B 1 1   ? 28.443  10.299  20.648  1.00 52.07 ? 1   ALA B O   1 
ATOM   2915 C CB  . ALA B 1 1   ? 26.292  12.458  22.506  1.00 50.64 ? 1   ALA B CB  1 
ATOM   2916 N N   . SER B 1 2   ? 27.362  9.770   22.606  1.00 53.46 ? 2   SER B N   1 
ATOM   2917 C CA  . SER B 1 2   ? 28.265  8.699   23.059  1.00 51.46 ? 2   SER B CA  1 
ATOM   2918 C C   . SER B 1 2   ? 29.698  9.246   23.256  1.00 49.11 ? 2   SER B C   1 
ATOM   2919 O O   . SER B 1 2   ? 30.020  10.352  22.802  1.00 48.16 ? 2   SER B O   1 
ATOM   2920 C CB  . SER B 1 2   ? 28.240  7.500   22.068  1.00 52.19 ? 2   SER B CB  1 
ATOM   2921 O OG  . SER B 1 2   ? 27.079  6.669   22.265  1.00 49.98 ? 2   SER B OG  1 
ATOM   2922 N N   . SER B 1 3   ? 30.546  8.498   23.963  1.00 46.22 ? 3   SER B N   1 
ATOM   2923 C CA  . SER B 1 3   ? 31.913  8.961   24.184  1.00 42.28 ? 3   SER B CA  1 
ATOM   2924 C C   . SER B 1 3   ? 32.693  8.802   22.878  1.00 38.95 ? 3   SER B C   1 
ATOM   2925 O O   . SER B 1 3   ? 32.904  7.675   22.401  1.00 38.86 ? 3   SER B O   1 
ATOM   2926 C CB  . SER B 1 3   ? 32.614  8.161   25.308  1.00 42.48 ? 3   SER B CB  1 
ATOM   2927 O OG  . SER B 1 3   ? 33.924  8.687   25.601  1.00 40.02 ? 3   SER B OG  1 
ATOM   2928 N N   . SER B 1 4   ? 33.105  9.934   22.309  1.00 33.39 ? 4   SER B N   1 
ATOM   2929 C CA  . SER B 1 4   ? 33.869  9.935   21.078  1.00 29.72 ? 4   SER B CA  1 
ATOM   2930 C C   . SER B 1 4   ? 34.917  8.831   21.070  1.00 29.09 ? 4   SER B C   1 
ATOM   2931 O O   . SER B 1 4   ? 35.383  8.362   22.128  1.00 27.77 ? 4   SER B O   1 
ATOM   2932 C CB  . SER B 1 4   ? 34.582  11.279  20.901  1.00 30.40 ? 4   SER B CB  1 
ATOM   2933 O OG  . SER B 1 4   ? 35.510  11.257  19.822  1.00 25.97 ? 4   SER B OG  1 
ATOM   2934 N N   . PHE B 1 5   ? 35.259  8.408   19.856  1.00 25.35 ? 5   PHE B N   1 
ATOM   2935 C CA  . PHE B 1 5   ? 36.299  7.420   19.635  1.00 19.99 ? 5   PHE B CA  1 
ATOM   2936 C C   . PHE B 1 5   ? 37.586  8.189   19.954  1.00 18.25 ? 5   PHE B C   1 
ATOM   2937 O O   . PHE B 1 5   ? 37.637  9.417   19.824  1.00 14.41 ? 5   PHE B O   1 
ATOM   2938 C CB  . PHE B 1 5   ? 36.312  7.005   18.167  1.00 17.42 ? 5   PHE B CB  1 
ATOM   2939 C CG  . PHE B 1 5   ? 36.105  8.160   17.203  1.00 18.02 ? 5   PHE B CG  1 
ATOM   2940 C CD1 . PHE B 1 5   ? 34.815  8.533   16.814  1.00 12.59 ? 5   PHE B CD1 1 
ATOM   2941 C CD2 . PHE B 1 5   ? 37.200  8.857   16.665  1.00 14.50 ? 5   PHE B CD2 1 
ATOM   2942 C CE1 . PHE B 1 5   ? 34.610  9.580   15.906  1.00 15.79 ? 5   PHE B CE1 1 
ATOM   2943 C CE2 . PHE B 1 5   ? 37.002  9.906   15.762  1.00 15.76 ? 5   PHE B CE2 1 
ATOM   2944 C CZ  . PHE B 1 5   ? 35.701  10.266  15.376  1.00 13.94 ? 5   PHE B CZ  1 
ATOM   2945 N N   . LYS B 1 6   ? 38.628  7.498   20.386  1.00 16.49 ? 6   LYS B N   1 
ATOM   2946 C CA  . LYS B 1 6   ? 39.829  8.240   20.669  1.00 16.10 ? 6   LYS B CA  1 
ATOM   2947 C C   . LYS B 1 6   ? 41.000  7.867   19.773  1.00 17.01 ? 6   LYS B C   1 
ATOM   2948 O O   . LYS B 1 6   ? 41.206  6.708   19.435  1.00 17.31 ? 6   LYS B O   1 
ATOM   2949 C CB  . LYS B 1 6   ? 40.188  8.135   22.145  1.00 13.82 ? 6   LYS B CB  1 
ATOM   2950 C CG  . LYS B 1 6   ? 39.345  9.088   23.024  1.00 18.53 ? 6   LYS B CG  1 
ATOM   2951 C CD  . LYS B 1 6   ? 38.122  8.426   23.643  1.00 22.19 ? 6   LYS B CD  1 
ATOM   2952 C CE  . LYS B 1 6   ? 37.208  9.476   24.305  1.00 24.10 ? 6   LYS B CE  1 
ATOM   2953 N NZ  . LYS B 1 6   ? 37.963  10.331  25.289  1.00 21.96 ? 6   LYS B NZ  1 
ATOM   2954 N N   . ALA B 1 7   ? 41.739  8.894   19.375  1.00 16.80 ? 7   ALA B N   1 
ATOM   2955 C CA  . ALA B 1 7   ? 42.891  8.736   18.538  1.00 20.03 ? 7   ALA B CA  1 
ATOM   2956 C C   . ALA B 1 7   ? 43.854  7.741   19.168  1.00 21.95 ? 7   ALA B C   1 
ATOM   2957 O O   . ALA B 1 7   ? 44.407  6.888   18.489  1.00 21.76 ? 7   ALA B O   1 
ATOM   2958 C CB  . ALA B 1 7   ? 43.549  10.071  18.351  1.00 22.91 ? 7   ALA B CB  1 
ATOM   2959 N N   . ALA B 1 8   ? 44.042  7.838   20.478  1.00 24.17 ? 8   ALA B N   1 
ATOM   2960 C CA  . ALA B 1 8   ? 44.940  6.924   21.171  1.00 23.04 ? 8   ALA B CA  1 
ATOM   2961 C C   . ALA B 1 8   ? 44.686  5.462   20.799  1.00 23.09 ? 8   ALA B C   1 
ATOM   2962 O O   . ALA B 1 8   ? 45.613  4.652   20.781  1.00 23.30 ? 8   ALA B O   1 
ATOM   2963 C CB  . ALA B 1 8   ? 44.806  7.114   22.687  1.00 23.38 ? 8   ALA B CB  1 
ATOM   2964 N N   . ASP B 1 9   ? 43.441  5.115   20.493  1.00 23.84 ? 9   ASP B N   1 
ATOM   2965 C CA  . ASP B 1 9   ? 43.124  3.720   20.143  1.00 23.73 ? 9   ASP B CA  1 
ATOM   2966 C C   . ASP B 1 9   ? 43.108  3.479   18.643  1.00 24.00 ? 9   ASP B C   1 
ATOM   2967 O O   . ASP B 1 9   ? 42.549  2.484   18.167  1.00 23.47 ? 9   ASP B O   1 
ATOM   2968 C CB  . ASP B 1 9   ? 41.757  3.289   20.707  1.00 21.00 ? 9   ASP B CB  1 
ATOM   2969 C CG  . ASP B 1 9   ? 41.401  3.992   21.988  1.00 20.30 ? 9   ASP B CG  1 
ATOM   2970 O OD1 . ASP B 1 9   ? 42.225  4.018   22.917  1.00 26.01 ? 9   ASP B OD1 1 
ATOM   2971 O OD2 . ASP B 1 9   ? 40.283  4.517   22.072  1.00 25.29 ? 9   ASP B OD2 1 
ATOM   2972 N N   . LEU B 1 10  ? 43.721  4.390   17.899  1.00 25.09 ? 10  LEU B N   1 
ATOM   2973 C CA  . LEU B 1 10  ? 43.749  4.262   16.455  1.00 26.06 ? 10  LEU B CA  1 
ATOM   2974 C C   . LEU B 1 10  ? 44.462  2.974   16.061  1.00 25.46 ? 10  LEU B C   1 
ATOM   2975 O O   . LEU B 1 10  ? 45.544  2.681   16.572  1.00 26.49 ? 10  LEU B O   1 
ATOM   2976 C CB  . LEU B 1 10  ? 44.448  5.479   15.840  1.00 26.62 ? 10  LEU B CB  1 
ATOM   2977 C CG  . LEU B 1 10  ? 43.983  5.827   14.418  1.00 29.08 ? 10  LEU B CG  1 
ATOM   2978 C CD1 . LEU B 1 10  ? 42.482  6.035   14.348  1.00 31.33 ? 10  LEU B CD1 1 
ATOM   2979 C CD2 . LEU B 1 10  ? 44.669  7.097   13.999  1.00 34.81 ? 10  LEU B CD2 1 
ATOM   2980 N N   . GLN B 1 11  ? 43.831  2.206   15.171  1.00 25.84 ? 11  GLN B N   1 
ATOM   2981 C CA  . GLN B 1 11  ? 44.362  0.934   14.689  1.00 26.58 ? 11  GLN B CA  1 
ATOM   2982 C C   . GLN B 1 11  ? 44.807  1.033   13.240  1.00 25.24 ? 11  GLN B C   1 
ATOM   2983 O O   . GLN B 1 11  ? 44.024  1.406   12.373  1.00 26.09 ? 11  GLN B O   1 
ATOM   2984 C CB  . GLN B 1 11  ? 43.296  -0.153  14.840  1.00 28.85 ? 11  GLN B CB  1 
ATOM   2985 C CG  . GLN B 1 11  ? 42.864  -0.379  16.311  1.00 35.02 ? 11  GLN B CG  1 
ATOM   2986 C CD  . GLN B 1 11  ? 44.012  -0.805  17.232  1.00 35.80 ? 11  GLN B CD  1 
ATOM   2987 O OE1 . GLN B 1 11  ? 44.251  -0.172  18.255  1.00 40.88 ? 11  GLN B OE1 1 
ATOM   2988 N NE2 . GLN B 1 11  ? 44.715  -1.880  16.875  1.00 34.93 ? 11  GLN B NE2 1 
ATOM   2989 N N   . LEU B 1 12  ? 46.056  0.665   12.980  1.00 25.84 ? 12  LEU B N   1 
ATOM   2990 C CA  . LEU B 1 12  ? 46.645  0.785   11.641  1.00 26.15 ? 12  LEU B CA  1 
ATOM   2991 C C   . LEU B 1 12  ? 46.955  -0.463  10.823  1.00 26.22 ? 12  LEU B C   1 
ATOM   2992 O O   . LEU B 1 12  ? 47.760  -1.298  11.239  1.00 25.66 ? 12  LEU B O   1 
ATOM   2993 C CB  . LEU B 1 12  ? 47.966  1.548   11.720  1.00 28.13 ? 12  LEU B CB  1 
ATOM   2994 C CG  . LEU B 1 12  ? 48.044  2.964   12.254  1.00 32.83 ? 12  LEU B CG  1 
ATOM   2995 C CD1 . LEU B 1 12  ? 49.523  3.459   12.192  1.00 35.14 ? 12  LEU B CD1 1 
ATOM   2996 C CD2 . LEU B 1 12  ? 47.134  3.851   11.427  1.00 33.31 ? 12  LEU B CD2 1 
ATOM   2997 N N   . GLU B 1 13  ? 46.344  -0.574  9.646   1.00 24.29 ? 13  GLU B N   1 
ATOM   2998 C CA  . GLU B 1 13  ? 46.632  -1.695  8.771   1.00 22.53 ? 13  GLU B CA  1 
ATOM   2999 C C   . GLU B 1 13  ? 47.229  -1.072  7.520   1.00 22.47 ? 13  GLU B C   1 
ATOM   3000 O O   . GLU B 1 13  ? 46.550  -0.359  6.775   1.00 21.62 ? 13  GLU B O   1 
ATOM   3001 C CB  . GLU B 1 13  ? 45.377  -2.491  8.387   1.00 22.68 ? 13  GLU B CB  1 
ATOM   3002 C CG  . GLU B 1 13  ? 45.734  -3.705  7.494   1.00 24.49 ? 13  GLU B CG  1 
ATOM   3003 C CD  . GLU B 1 13  ? 44.528  -4.463  6.955   1.00 26.55 ? 13  GLU B CD  1 
ATOM   3004 O OE1 . GLU B 1 13  ? 43.449  -4.384  7.581   1.00 30.60 ? 13  GLU B OE1 1 
ATOM   3005 O OE2 . GLU B 1 13  ? 44.660  -5.160  5.917   1.00 26.06 ? 13  GLU B OE2 1 
ATOM   3006 N N   . MET B 1 14  ? 48.513  -1.321  7.304   1.00 22.36 ? 14  MET B N   1 
ATOM   3007 C CA  . MET B 1 14  ? 49.197  -0.773  6.152   1.00 22.35 ? 14  MET B CA  1 
ATOM   3008 C C   . MET B 1 14  ? 48.812  -1.623  4.974   1.00 23.36 ? 14  MET B C   1 
ATOM   3009 O O   . MET B 1 14  ? 48.482  -2.808  5.118   1.00 25.63 ? 14  MET B O   1 
ATOM   3010 C CB  . MET B 1 14  ? 50.704  -0.800  6.356   1.00 23.71 ? 14  MET B CB  1 
ATOM   3011 C CG  . MET B 1 14  ? 51.198  0.177   7.412   1.00 21.77 ? 14  MET B CG  1 
ATOM   3012 S SD  . MET B 1 14  ? 50.560  1.880   7.160   1.00 31.98 ? 14  MET B SD  1 
ATOM   3013 C CE  . MET B 1 14  ? 50.648  2.558   8.965   1.00 32.79 ? 14  MET B CE  1 
ATOM   3014 N N   . THR B 1 15  ? 48.819  -1.008  3.803   1.00 24.91 ? 15  THR B N   1 
ATOM   3015 C CA  . THR B 1 15  ? 48.431  -1.718  2.600   1.00 25.13 ? 15  THR B CA  1 
ATOM   3016 C C   . THR B 1 15  ? 49.528  -2.654  2.119   1.00 25.72 ? 15  THR B C   1 
ATOM   3017 O O   . THR B 1 15  ? 50.684  -2.545  2.522   1.00 24.23 ? 15  THR B O   1 
ATOM   3018 C CB  . THR B 1 15  ? 48.103  -0.757  1.477   1.00 20.59 ? 15  THR B CB  1 
ATOM   3019 O OG1 . THR B 1 15  ? 47.697  -1.485  0.315   1.00 20.86 ? 15  THR B OG1 1 
ATOM   3020 C CG2 . THR B 1 15  ? 49.315  0.045   1.142   1.00 23.51 ? 15  THR B CG2 1 
ATOM   3021 N N   . GLN B 1 16  ? 49.124  -3.550  1.230   1.00 29.67 ? 16  GLN B N   1 
ATOM   3022 C CA  . GLN B 1 16  ? 49.962  -4.559  0.603   1.00 31.20 ? 16  GLN B CA  1 
ATOM   3023 C C   . GLN B 1 16  ? 49.664  -4.461  -0.904  1.00 32.65 ? 16  GLN B C   1 
ATOM   3024 O O   . GLN B 1 16  ? 50.112  -5.296  -1.720  1.00 31.56 ? 16  GLN B O   1 
ATOM   3025 C CB  . GLN B 1 16  ? 49.582  -5.945  1.166   1.00 31.95 ? 16  GLN B CB  1 
ATOM   3026 C CG  . GLN B 1 16  ? 48.077  -6.302  1.076   1.00 39.37 ? 16  GLN B CG  1 
ATOM   3027 C CD  . GLN B 1 16  ? 47.107  -5.236  1.680   1.00 44.71 ? 16  GLN B CD  1 
ATOM   3028 O OE1 . GLN B 1 16  ? 45.951  -5.070  1.212   1.00 43.78 ? 16  GLN B OE1 1 
ATOM   3029 N NE2 . GLN B 1 16  ? 47.567  -4.527  2.725   1.00 45.03 ? 16  GLN B NE2 1 
ATOM   3030 N N   . LYS B 1 17  ? 48.905  -3.422  -1.258  1.00 32.09 ? 17  LYS B N   1 
ATOM   3031 C CA  . LYS B 1 17  ? 48.517  -3.158  -2.642  1.00 31.30 ? 17  LYS B CA  1 
ATOM   3032 C C   . LYS B 1 17  ? 48.668  -1.679  -3.000  1.00 30.11 ? 17  LYS B C   1 
ATOM   3033 O O   . LYS B 1 17  ? 47.807  -1.064  -3.649  1.00 28.19 ? 17  LYS B O   1 
ATOM   3034 C CB  . LYS B 1 17  ? 47.077  -3.622  -2.878  1.00 31.81 ? 17  LYS B CB  1 
ATOM   3035 C CG  . LYS B 1 17  ? 46.966  -5.124  -3.152  1.00 32.97 ? 17  LYS B CG  1 
ATOM   3036 C CD  . LYS B 1 17  ? 46.533  -5.385  -4.598  1.00 34.98 ? 17  LYS B CD  1 
ATOM   3037 C CE  . LYS B 1 17  ? 47.451  -4.674  -5.641  1.00 36.56 ? 17  LYS B CE  1 
ATOM   3038 N NZ  . LYS B 1 17  ? 46.956  -4.827  -7.064  1.00 33.81 ? 17  LYS B NZ  1 
ATOM   3039 N N   . PRO B 1 18  ? 49.802  -1.102  -2.609  1.00 30.43 ? 18  PRO B N   1 
ATOM   3040 C CA  . PRO B 1 18  ? 50.076  0.304   -2.886  1.00 30.51 ? 18  PRO B CA  1 
ATOM   3041 C C   . PRO B 1 18  ? 49.725  0.644   -4.327  1.00 34.39 ? 18  PRO B C   1 
ATOM   3042 O O   . PRO B 1 18  ? 50.210  -0.016  -5.257  1.00 36.26 ? 18  PRO B O   1 
ATOM   3043 C CB  . PRO B 1 18  ? 51.573  0.412   -2.656  1.00 31.47 ? 18  PRO B CB  1 
ATOM   3044 C CG  . PRO B 1 18  ? 51.856  -0.698  -1.627  1.00 32.15 ? 18  PRO B CG  1 
ATOM   3045 C CD  . PRO B 1 18  ? 51.014  -1.810  -2.146  1.00 29.75 ? 18  PRO B CD  1 
ATOM   3046 N N   . HIS B 1 19  ? 48.853  1.628   -4.539  1.00 35.85 ? 19  HIS B N   1 
ATOM   3047 C CA  . HIS B 1 19  ? 48.563  2.030   -5.910  1.00 36.89 ? 19  HIS B CA  1 
ATOM   3048 C C   . HIS B 1 19  ? 49.790  2.878   -6.127  1.00 36.78 ? 19  HIS B C   1 
ATOM   3049 O O   . HIS B 1 19  ? 50.411  3.336   -5.157  1.00 37.42 ? 19  HIS B O   1 
ATOM   3050 C CB  . HIS B 1 19  ? 47.329  2.938   -6.011  1.00 40.23 ? 19  HIS B CB  1 
ATOM   3051 C CG  . HIS B 1 19  ? 46.174  2.511   -5.155  1.00 45.86 ? 19  HIS B CG  1 
ATOM   3052 N ND1 . HIS B 1 19  ? 44.998  3.239   -5.079  1.00 49.60 ? 19  HIS B ND1 1 
ATOM   3053 C CD2 . HIS B 1 19  ? 46.034  1.479   -4.285  1.00 47.28 ? 19  HIS B CD2 1 
ATOM   3054 C CE1 . HIS B 1 19  ? 44.189  2.677   -4.193  1.00 48.43 ? 19  HIS B CE1 1 
ATOM   3055 N NE2 . HIS B 1 19  ? 44.793  1.607   -3.698  1.00 49.29 ? 19  HIS B NE2 1 
ATOM   3056 N N   . LYS B 1 20  ? 50.190  3.110   -7.365  1.00 37.10 ? 20  LYS B N   1 
ATOM   3057 C CA  . LYS B 1 20  ? 51.356  3.968   -7.498  1.00 36.61 ? 20  LYS B CA  1 
ATOM   3058 C C   . LYS B 1 20  ? 50.958  5.377   -7.881  1.00 34.86 ? 20  LYS B C   1 
ATOM   3059 O O   . LYS B 1 20  ? 50.077  5.583   -8.717  1.00 34.33 ? 20  LYS B O   1 
ATOM   3060 C CB  . LYS B 1 20  ? 52.367  3.341   -8.451  1.00 37.10 ? 20  LYS B CB  1 
ATOM   3061 C CG  . LYS B 1 20  ? 52.939  2.087   -7.809  1.00 39.38 ? 20  LYS B CG  1 
ATOM   3062 C CD  . LYS B 1 20  ? 53.405  2.385   -6.355  1.00 38.37 ? 20  LYS B CD  1 
ATOM   3063 C CE  . LYS B 1 20  ? 53.596  1.096   -5.542  1.00 38.79 ? 20  LYS B CE  1 
ATOM   3064 N NZ  . LYS B 1 20  ? 54.351  0.051   -6.305  1.00 38.17 ? 20  LYS B NZ  1 
ATOM   3065 N N   . LYS B 1 21  ? 51.585  6.337   -7.204  1.00 32.60 ? 21  LYS B N   1 
ATOM   3066 C CA  . LYS B 1 21  ? 51.326  7.759   -7.387  1.00 31.87 ? 21  LYS B CA  1 
ATOM   3067 C C   . LYS B 1 21  ? 51.038  8.083   -8.840  1.00 31.87 ? 21  LYS B C   1 
ATOM   3068 O O   . LYS B 1 21  ? 51.400  7.319   -9.727  1.00 30.09 ? 21  LYS B O   1 
ATOM   3069 C CB  . LYS B 1 21  ? 52.544  8.575   -6.907  1.00 32.05 ? 21  LYS B CB  1 
ATOM   3070 C CG  . LYS B 1 21  ? 53.103  8.118   -5.540  1.00 26.48 ? 21  LYS B CG  1 
ATOM   3071 C CD  . LYS B 1 21  ? 52.056  8.270   -4.460  1.00 23.31 ? 21  LYS B CD  1 
ATOM   3072 C CE  . LYS B 1 21  ? 52.515  7.668   -3.164  1.00 21.49 ? 21  LYS B CE  1 
ATOM   3073 N NZ  . LYS B 1 21  ? 52.581  6.196   -3.279  1.00 26.88 ? 21  LYS B NZ  1 
ATOM   3074 N N   . PRO B 1 22  ? 50.340  9.207   -9.098  1.00 34.34 ? 22  PRO B N   1 
ATOM   3075 C CA  . PRO B 1 22  ? 50.020  9.614   -10.478 1.00 36.22 ? 22  PRO B CA  1 
ATOM   3076 C C   . PRO B 1 22  ? 51.330  10.093  -11.105 1.00 36.84 ? 22  PRO B C   1 
ATOM   3077 O O   . PRO B 1 22  ? 51.990  10.975  -10.557 1.00 35.10 ? 22  PRO B O   1 
ATOM   3078 C CB  . PRO B 1 22  ? 49.037  10.783  -10.291 1.00 35.46 ? 22  PRO B CB  1 
ATOM   3079 C CG  . PRO B 1 22  ? 48.431  10.517  -8.942  1.00 35.77 ? 22  PRO B CG  1 
ATOM   3080 C CD  . PRO B 1 22  ? 49.614  10.046  -8.127  1.00 34.03 ? 22  PRO B CD  1 
ATOM   3081 N N   . GLY B 1 23  ? 51.701  9.520   -12.244 1.00 40.13 ? 23  GLY B N   1 
ATOM   3082 C CA  . GLY B 1 23  ? 52.945  9.930   -12.880 1.00 43.65 ? 23  GLY B CA  1 
ATOM   3083 C C   . GLY B 1 23  ? 53.082  11.443  -12.915 1.00 46.23 ? 23  GLY B C   1 
ATOM   3084 O O   . GLY B 1 23  ? 52.069  12.145  -13.104 1.00 44.47 ? 23  GLY B O   1 
ATOM   3085 N N   . PRO B 1 24  ? 54.321  11.976  -12.702 1.00 48.44 ? 24  PRO B N   1 
ATOM   3086 C CA  . PRO B 1 24  ? 54.683  13.407  -12.694 1.00 47.07 ? 24  PRO B CA  1 
ATOM   3087 C C   . PRO B 1 24  ? 54.157  14.204  -13.891 1.00 44.18 ? 24  PRO B C   1 
ATOM   3088 O O   . PRO B 1 24  ? 54.460  15.399  -14.058 1.00 43.58 ? 24  PRO B O   1 
ATOM   3089 C CB  . PRO B 1 24  ? 56.219  13.362  -12.630 1.00 49.29 ? 24  PRO B CB  1 
ATOM   3090 C CG  . PRO B 1 24  ? 56.449  12.217  -11.681 1.00 48.54 ? 24  PRO B CG  1 
ATOM   3091 C CD  . PRO B 1 24  ? 55.473  11.159  -12.237 1.00 48.85 ? 24  PRO B CD  1 
ATOM   3092 N N   . GLY B 1 25  ? 53.372  13.532  -14.722 1.00 42.76 ? 25  GLY B N   1 
ATOM   3093 C CA  . GLY B 1 25  ? 52.790  14.180  -15.877 1.00 41.83 ? 25  GLY B CA  1 
ATOM   3094 C C   . GLY B 1 25  ? 51.381  13.678  -16.049 1.00 41.68 ? 25  GLY B C   1 
ATOM   3095 O O   . GLY B 1 25  ? 50.898  13.605  -17.191 1.00 40.29 ? 25  GLY B O   1 
ATOM   3096 N N   . GLU B 1 26  ? 50.741  13.312  -14.918 1.00 41.79 ? 26  GLU B N   1 
ATOM   3097 C CA  . GLU B 1 26  ? 49.365  12.784  -14.897 1.00 40.78 ? 26  GLU B CA  1 
ATOM   3098 C C   . GLU B 1 26  ? 48.392  13.810  -14.296 1.00 39.10 ? 26  GLU B C   1 
ATOM   3099 O O   . GLU B 1 26  ? 48.582  14.266  -13.160 1.00 38.48 ? 26  GLU B O   1 
ATOM   3100 C CB  . GLU B 1 26  ? 49.294  11.468  -14.093 1.00 41.94 ? 26  GLU B CB  1 
ATOM   3101 C CG  . GLU B 1 26  ? 50.261  10.359  -14.565 1.00 41.49 ? 26  GLU B CG  1 
ATOM   3102 C CD  . GLU B 1 26  ? 49.952  9.866   -15.971 1.00 42.37 ? 26  GLU B CD  1 
ATOM   3103 O OE1 . GLU B 1 26  ? 50.838  9.209   -16.589 1.00 38.33 ? 26  GLU B OE1 1 
ATOM   3104 O OE2 . GLU B 1 26  ? 48.818  10.149  -16.448 1.00 41.85 ? 26  GLU B OE2 1 
ATOM   3105 N N   . PRO B 1 27  ? 47.337  14.171  -15.056 1.00 37.66 ? 27  PRO B N   1 
ATOM   3106 C CA  . PRO B 1 27  ? 46.286  15.129  -14.704 1.00 37.30 ? 27  PRO B CA  1 
ATOM   3107 C C   . PRO B 1 27  ? 45.598  14.842  -13.385 1.00 36.96 ? 27  PRO B C   1 
ATOM   3108 O O   . PRO B 1 27  ? 44.776  13.918  -13.290 1.00 38.96 ? 27  PRO B O   1 
ATOM   3109 C CB  . PRO B 1 27  ? 45.312  15.029  -15.884 1.00 37.02 ? 27  PRO B CB  1 
ATOM   3110 C CG  . PRO B 1 27  ? 46.200  14.684  -17.017 1.00 36.83 ? 27  PRO B CG  1 
ATOM   3111 C CD  . PRO B 1 27  ? 47.106  13.642  -16.414 1.00 38.64 ? 27  PRO B CD  1 
ATOM   3112 N N   . LEU B 1 28  ? 45.923  15.640  -12.370 1.00 34.63 ? 28  LEU B N   1 
ATOM   3113 C CA  . LEU B 1 28  ? 45.326  15.486  -11.049 1.00 32.19 ? 28  LEU B CA  1 
ATOM   3114 C C   . LEU B 1 28  ? 43.870  15.980  -11.031 1.00 31.71 ? 28  LEU B C   1 
ATOM   3115 O O   . LEU B 1 28  ? 43.508  16.928  -10.297 1.00 29.40 ? 28  LEU B O   1 
ATOM   3116 C CB  . LEU B 1 28  ? 46.172  16.252  -10.046 1.00 28.57 ? 28  LEU B CB  1 
ATOM   3117 C CG  . LEU B 1 28  ? 47.555  15.603  -9.995  1.00 27.13 ? 28  LEU B CG  1 
ATOM   3118 C CD1 . LEU B 1 28  ? 48.403  16.227  -8.897  1.00 20.48 ? 28  LEU B CD1 1 
ATOM   3119 C CD2 . LEU B 1 28  ? 47.370  14.087  -9.777  1.00 22.74 ? 28  LEU B CD2 1 
ATOM   3120 N N   . VAL B 1 29  ? 43.040  15.327  -11.838 1.00 29.51 ? 29  VAL B N   1 
ATOM   3121 C CA  . VAL B 1 29  ? 41.643  15.724  -11.955 1.00 29.93 ? 29  VAL B CA  1 
ATOM   3122 C C   . VAL B 1 29  ? 40.957  15.543  -10.623 1.00 28.16 ? 29  VAL B C   1 
ATOM   3123 O O   . VAL B 1 29  ? 40.890  14.432  -10.123 1.00 28.66 ? 29  VAL B O   1 
ATOM   3124 C CB  . VAL B 1 29  ? 40.893  14.890  -13.009 1.00 29.56 ? 29  VAL B CB  1 
ATOM   3125 C CG1 . VAL B 1 29  ? 39.502  15.426  -13.171 1.00 32.40 ? 29  VAL B CG1 1 
ATOM   3126 C CG2 . VAL B 1 29  ? 41.631  14.926  -14.342 1.00 30.80 ? 29  VAL B CG2 1 
ATOM   3127 N N   . PHE B 1 30  ? 40.453  16.637  -10.054 1.00 26.08 ? 30  PHE B N   1 
ATOM   3128 C CA  . PHE B 1 30  ? 39.773  16.583  -8.764  1.00 23.84 ? 30  PHE B CA  1 
ATOM   3129 C C   . PHE B 1 30  ? 38.851  15.363  -8.529  1.00 22.63 ? 30  PHE B C   1 
ATOM   3130 O O   . PHE B 1 30  ? 38.112  14.940  -9.420  1.00 23.39 ? 30  PHE B O   1 
ATOM   3131 C CB  . PHE B 1 30  ? 38.956  17.851  -8.552  1.00 23.50 ? 30  PHE B CB  1 
ATOM   3132 C CG  . PHE B 1 30  ? 38.132  17.811  -7.305  1.00 27.03 ? 30  PHE B CG  1 
ATOM   3133 C CD1 . PHE B 1 30  ? 38.719  18.064  -6.068  1.00 28.59 ? 30  PHE B CD1 1 
ATOM   3134 C CD2 . PHE B 1 30  ? 36.794  17.404  -7.352  1.00 26.53 ? 30  PHE B CD2 1 
ATOM   3135 C CE1 . PHE B 1 30  ? 37.999  17.909  -4.884  1.00 29.05 ? 30  PHE B CE1 1 
ATOM   3136 C CE2 . PHE B 1 30  ? 36.056  17.241  -6.182  1.00 28.12 ? 30  PHE B CE2 1 
ATOM   3137 C CZ  . PHE B 1 30  ? 36.665  17.494  -4.931  1.00 29.62 ? 30  PHE B CZ  1 
ATOM   3138 N N   . GLY B 1 31  ? 38.914  14.808  -7.320  1.00 21.70 ? 31  GLY B N   1 
ATOM   3139 C CA  . GLY B 1 31  ? 38.067  13.688  -6.938  1.00 20.28 ? 31  GLY B CA  1 
ATOM   3140 C C   . GLY B 1 31  ? 38.130  12.414  -7.765  1.00 20.43 ? 31  GLY B C   1 
ATOM   3141 O O   . GLY B 1 31  ? 37.264  11.550  -7.629  1.00 14.24 ? 31  GLY B O   1 
ATOM   3142 N N   . LYS B 1 32  ? 39.166  12.297  -8.590  1.00 20.21 ? 32  LYS B N   1 
ATOM   3143 C CA  . LYS B 1 32  ? 39.366  11.143  -9.466  1.00 23.87 ? 32  LYS B CA  1 
ATOM   3144 C C   . LYS B 1 32  ? 40.344  10.090  -8.948  1.00 22.43 ? 32  LYS B C   1 
ATOM   3145 O O   . LYS B 1 32  ? 40.122  8.886   -9.106  1.00 23.83 ? 32  LYS B O   1 
ATOM   3146 C CB  . LYS B 1 32  ? 39.848  11.612  -10.839 1.00 25.97 ? 32  LYS B CB  1 
ATOM   3147 C CG  . LYS B 1 32  ? 38.742  12.043  -11.775 1.00 31.03 ? 32  LYS B CG  1 
ATOM   3148 C CD  . LYS B 1 32  ? 37.780  10.874  -12.090 1.00 32.61 ? 32  LYS B CD  1 
ATOM   3149 C CE  . LYS B 1 32  ? 36.854  11.221  -13.254 1.00 30.29 ? 32  LYS B CE  1 
ATOM   3150 N NZ  . LYS B 1 32  ? 36.424  12.656  -13.174 1.00 28.80 ? 32  LYS B NZ  1 
ATOM   3151 N N   . THR B 1 33  ? 41.429  10.543  -8.340  1.00 19.69 ? 33  THR B N   1 
ATOM   3152 C CA  . THR B 1 33  ? 42.445  9.632   -7.830  1.00 19.18 ? 33  THR B CA  1 
ATOM   3153 C C   . THR B 1 33  ? 42.457  9.588   -6.320  1.00 17.54 ? 33  THR B C   1 
ATOM   3154 O O   . THR B 1 33  ? 42.352  10.623  -5.683  1.00 17.89 ? 33  THR B O   1 
ATOM   3155 C CB  . THR B 1 33  ? 43.820  10.082  -8.248  1.00 19.92 ? 33  THR B CB  1 
ATOM   3156 O OG1 . THR B 1 33  ? 43.826  10.344  -9.657  1.00 25.91 ? 33  THR B OG1 1 
ATOM   3157 C CG2 . THR B 1 33  ? 44.838  9.008   -7.919  1.00 22.58 ? 33  THR B CG2 1 
ATOM   3158 N N   . PHE B 1 34  ? 42.604  8.397   -5.745  1.00 15.37 ? 34  PHE B N   1 
ATOM   3159 C CA  . PHE B 1 34  ? 42.655  8.294   -4.302  1.00 15.53 ? 34  PHE B CA  1 
ATOM   3160 C C   . PHE B 1 34  ? 43.947  7.674   -3.798  1.00 15.74 ? 34  PHE B C   1 
ATOM   3161 O O   . PHE B 1 34  ? 44.645  6.957   -4.503  1.00 15.49 ? 34  PHE B O   1 
ATOM   3162 C CB  . PHE B 1 34  ? 41.437  7.536   -3.788  1.00 15.73 ? 34  PHE B CB  1 
ATOM   3163 C CG  . PHE B 1 34  ? 40.133  8.182   -4.168  1.00 14.76 ? 34  PHE B CG  1 
ATOM   3164 C CD1 . PHE B 1 34  ? 39.612  8.021   -5.449  1.00 14.55 ? 34  PHE B CD1 1 
ATOM   3165 C CD2 . PHE B 1 34  ? 39.457  8.993   -3.272  1.00 12.22 ? 34  PHE B CD2 1 
ATOM   3166 C CE1 . PHE B 1 34  ? 38.433  8.664   -5.834  1.00 12.87 ? 34  PHE B CE1 1 
ATOM   3167 C CE2 . PHE B 1 34  ? 38.281  9.638   -3.644  1.00 14.28 ? 34  PHE B CE2 1 
ATOM   3168 C CZ  . PHE B 1 34  ? 37.764  9.476   -4.926  1.00 13.51 ? 34  PHE B CZ  1 
ATOM   3169 N N   . THR B 1 35  ? 44.275  7.976   -2.555  1.00 18.23 ? 35  THR B N   1 
ATOM   3170 C CA  . THR B 1 35  ? 45.498  7.472   -1.965  1.00 19.09 ? 35  THR B CA  1 
ATOM   3171 C C   . THR B 1 35  ? 45.358  6.025   -1.495  1.00 17.40 ? 35  THR B C   1 
ATOM   3172 O O   . THR B 1 35  ? 44.328  5.386   -1.700  1.00 18.90 ? 35  THR B O   1 
ATOM   3173 C CB  . THR B 1 35  ? 45.936  8.406   -0.808  1.00 19.57 ? 35  THR B CB  1 
ATOM   3174 O OG1 . THR B 1 35  ? 44.967  8.375   0.260   1.00 19.89 ? 35  THR B OG1 1 
ATOM   3175 C CG2 . THR B 1 35  ? 46.047  9.826   -1.324  1.00 15.99 ? 35  THR B CG2 1 
ATOM   3176 N N   . ASP B 1 36  ? 46.393  5.501   -0.862  1.00 18.60 ? 36  ASP B N   1 
ATOM   3177 C CA  . ASP B 1 36  ? 46.359  4.112   -0.411  1.00 16.44 ? 36  ASP B CA  1 
ATOM   3178 C C   . ASP B 1 36  ? 45.534  3.806   0.827   1.00 14.37 ? 36  ASP B C   1 
ATOM   3179 O O   . ASP B 1 36  ? 45.036  2.705   0.967   1.00 15.63 ? 36  ASP B O   1 
ATOM   3180 C CB  . ASP B 1 36  ? 47.786  3.607   -0.215  1.00 16.71 ? 36  ASP B CB  1 
ATOM   3181 C CG  . ASP B 1 36  ? 48.523  3.426   -1.544  1.00 20.41 ? 36  ASP B CG  1 
ATOM   3182 O OD1 . ASP B 1 36  ? 47.943  2.788   -2.462  1.00 16.79 ? 36  ASP B OD1 1 
ATOM   3183 O OD2 . ASP B 1 36  ? 49.668  3.916   -1.665  1.00 17.42 ? 36  ASP B OD2 1 
ATOM   3184 N N   . HIS B 1 37  ? 45.377  4.768   1.724   1.00 13.29 ? 37  HIS B N   1 
ATOM   3185 C CA  . HIS B 1 37  ? 44.602  4.510   2.932   1.00 14.46 ? 37  HIS B CA  1 
ATOM   3186 C C   . HIS B 1 37  ? 43.388  5.394   3.147   1.00 14.98 ? 37  HIS B C   1 
ATOM   3187 O O   . HIS B 1 37  ? 43.190  6.407   2.475   1.00 14.06 ? 37  HIS B O   1 
ATOM   3188 C CB  . HIS B 1 37  ? 45.502  4.596   4.154   1.00 12.69 ? 37  HIS B CB  1 
ATOM   3189 C CG  . HIS B 1 37  ? 46.680  3.688   4.068   1.00 11.80 ? 37  HIS B CG  1 
ATOM   3190 N ND1 . HIS B 1 37  ? 47.783  3.985   3.308   1.00 12.95 ? 37  HIS B ND1 1 
ATOM   3191 C CD2 . HIS B 1 37  ? 46.867  2.432   4.525   1.00 13.15 ? 37  HIS B CD2 1 
ATOM   3192 C CE1 . HIS B 1 37  ? 48.596  2.950   3.290   1.00 12.54 ? 37  HIS B CE1 1 
ATOM   3193 N NE2 . HIS B 1 37  ? 48.063  1.993   4.020   1.00 14.70 ? 37  HIS B NE2 1 
ATOM   3194 N N   . MET B 1 38  ? 42.574  4.973   4.101   1.00 15.34 ? 38  MET B N   1 
ATOM   3195 C CA  . MET B 1 38  ? 41.362  5.678   4.458   1.00 11.85 ? 38  MET B CA  1 
ATOM   3196 C C   . MET B 1 38  ? 41.171  5.512   5.948   1.00 10.30 ? 38  MET B C   1 
ATOM   3197 O O   . MET B 1 38  ? 41.776  4.616   6.553   1.00 11.74 ? 38  MET B O   1 
ATOM   3198 C CB  . MET B 1 38  ? 40.167  5.083   3.703   1.00 12.16 ? 38  MET B CB  1 
ATOM   3199 C CG  . MET B 1 38  ? 39.793  3.653   4.115   1.00 13.50 ? 38  MET B CG  1 
ATOM   3200 S SD  . MET B 1 38  ? 38.576  2.813   3.027   1.00 12.81 ? 38  MET B SD  1 
ATOM   3201 C CE  . MET B 1 38  ? 37.113  3.892   3.248   1.00 3.86  ? 38  MET B CE  1 
ATOM   3202 N N   . LEU B 1 39  ? 40.372  6.400   6.540   1.00 8.92  ? 39  LEU B N   1 
ATOM   3203 C CA  . LEU B 1 39  ? 40.054  6.327   7.961   1.00 11.33 ? 39  LEU B CA  1 
ATOM   3204 C C   . LEU B 1 39  ? 38.679  5.700   8.059   1.00 12.66 ? 39  LEU B C   1 
ATOM   3205 O O   . LEU B 1 39  ? 37.856  5.832   7.156   1.00 12.86 ? 39  LEU B O   1 
ATOM   3206 C CB  . LEU B 1 39  ? 39.998  7.705   8.623   1.00 10.12 ? 39  LEU B CB  1 
ATOM   3207 C CG  . LEU B 1 39  ? 39.525  7.664   10.091  1.00 11.16 ? 39  LEU B CG  1 
ATOM   3208 C CD1 . LEU B 1 39  ? 40.583  7.049   11.009  1.00 3.57  ? 39  LEU B CD1 1 
ATOM   3209 C CD2 . LEU B 1 39  ? 39.229  9.058   10.556  1.00 11.15 ? 39  LEU B CD2 1 
ATOM   3210 N N   . MET B 1 40  ? 38.413  5.044   9.168   1.00 13.07 ? 40  MET B N   1 
ATOM   3211 C CA  . MET B 1 40  ? 37.124  4.388   9.334   1.00 16.29 ? 40  MET B CA  1 
ATOM   3212 C C   . MET B 1 40  ? 36.785  4.178   10.820  1.00 13.31 ? 40  MET B C   1 
ATOM   3213 O O   . MET B 1 40  ? 37.601  3.656   11.589  1.00 12.80 ? 40  MET B O   1 
ATOM   3214 C CB  . MET B 1 40  ? 37.160  3.051   8.582   1.00 17.51 ? 40  MET B CB  1 
ATOM   3215 C CG  . MET B 1 40  ? 35.972  2.136   8.780   1.00 22.92 ? 40  MET B CG  1 
ATOM   3216 S SD  . MET B 1 40  ? 34.806  2.217   7.420   1.00 34.06 ? 40  MET B SD  1 
ATOM   3217 C CE  . MET B 1 40  ? 35.853  1.766   5.968   1.00 25.48 ? 40  MET B CE  1 
ATOM   3218 N N   . VAL B 1 41  ? 35.593  4.622   11.214  1.00 11.65 ? 41  VAL B N   1 
ATOM   3219 C CA  . VAL B 1 41  ? 35.103  4.473   12.584  1.00 12.94 ? 41  VAL B CA  1 
ATOM   3220 C C   . VAL B 1 41  ? 33.635  4.047   12.512  1.00 13.83 ? 41  VAL B C   1 
ATOM   3221 O O   . VAL B 1 41  ? 32.851  4.626   11.778  1.00 14.40 ? 41  VAL B O   1 
ATOM   3222 C CB  . VAL B 1 41  ? 35.176  5.815   13.391  1.00 10.22 ? 41  VAL B CB  1 
ATOM   3223 C CG1 . VAL B 1 41  ? 35.076  5.529   14.910  1.00 8.26  ? 41  VAL B CG1 1 
ATOM   3224 C CG2 . VAL B 1 41  ? 36.444  6.552   13.064  1.00 8.24  ? 41  VAL B CG2 1 
ATOM   3225 N N   . GLU B 1 42  ? 33.249  3.033   13.263  1.00 17.56 ? 42  GLU B N   1 
ATOM   3226 C CA  . GLU B 1 42  ? 31.855  2.623   13.239  1.00 18.36 ? 42  GLU B CA  1 
ATOM   3227 C C   . GLU B 1 42  ? 31.157  3.079   14.492  1.00 19.03 ? 42  GLU B C   1 
ATOM   3228 O O   . GLU B 1 42  ? 31.782  3.305   15.519  1.00 19.24 ? 42  GLU B O   1 
ATOM   3229 C CB  . GLU B 1 42  ? 31.735  1.118   13.131  1.00 19.85 ? 42  GLU B CB  1 
ATOM   3230 C CG  . GLU B 1 42  ? 32.324  0.532   11.869  1.00 21.82 ? 42  GLU B CG  1 
ATOM   3231 C CD  . GLU B 1 42  ? 32.261  -0.983  11.892  1.00 27.57 ? 42  GLU B CD  1 
ATOM   3232 O OE1 . GLU B 1 42  ? 31.133  -1.540  11.770  1.00 30.30 ? 42  GLU B OE1 1 
ATOM   3233 O OE2 . GLU B 1 42  ? 33.336  -1.612  12.053  1.00 29.65 ? 42  GLU B OE2 1 
ATOM   3234 N N   . TRP B 1 43  ? 29.847  3.223   14.409  1.00 18.56 ? 43  TRP B N   1 
ATOM   3235 C CA  . TRP B 1 43  ? 29.099  3.645   15.565  1.00 19.53 ? 43  TRP B CA  1 
ATOM   3236 C C   . TRP B 1 43  ? 27.838  2.811   15.621  1.00 20.79 ? 43  TRP B C   1 
ATOM   3237 O O   . TRP B 1 43  ? 27.235  2.521   14.594  1.00 21.89 ? 43  TRP B O   1 
ATOM   3238 C CB  . TRP B 1 43  ? 28.748  5.137   15.458  1.00 18.73 ? 43  TRP B CB  1 
ATOM   3239 C CG  . TRP B 1 43  ? 27.952  5.668   16.620  1.00 20.17 ? 43  TRP B CG  1 
ATOM   3240 C CD1 . TRP B 1 43  ? 28.444  6.150   17.799  1.00 21.05 ? 43  TRP B CD1 1 
ATOM   3241 C CD2 . TRP B 1 43  ? 26.517  5.736   16.728  1.00 21.89 ? 43  TRP B CD2 1 
ATOM   3242 N NE1 . TRP B 1 43  ? 27.408  6.512   18.633  1.00 23.10 ? 43  TRP B NE1 1 
ATOM   3243 C CE2 . TRP B 1 43  ? 26.218  6.266   18.002  1.00 22.70 ? 43  TRP B CE2 1 
ATOM   3244 C CE3 . TRP B 1 43  ? 25.460  5.400   15.871  1.00 19.87 ? 43  TRP B CE3 1 
ATOM   3245 C CZ2 . TRP B 1 43  ? 24.903  6.467   18.444  1.00 23.43 ? 43  TRP B CZ2 1 
ATOM   3246 C CZ3 . TRP B 1 43  ? 24.151  5.601   16.307  1.00 21.33 ? 43  TRP B CZ3 1 
ATOM   3247 C CH2 . TRP B 1 43  ? 23.886  6.129   17.584  1.00 22.91 ? 43  TRP B CH2 1 
ATOM   3248 N N   . ASN B 1 44  ? 27.467  2.394   16.820  1.00 21.47 ? 44  ASN B N   1 
ATOM   3249 C CA  . ASN B 1 44  ? 26.251  1.636   16.981  1.00 23.67 ? 44  ASN B CA  1 
ATOM   3250 C C   . ASN B 1 44  ? 25.760  1.692   18.403  1.00 24.53 ? 44  ASN B C   1 
ATOM   3251 O O   . ASN B 1 44  ? 25.964  2.650   19.135  1.00 22.21 ? 44  ASN B O   1 
ATOM   3252 C CB  . ASN B 1 44  ? 26.447  0.173   16.573  1.00 24.28 ? 44  ASN B CB  1 
ATOM   3253 C CG  . ASN B 1 44  ? 27.472  -0.544  17.433  1.00 25.05 ? 44  ASN B CG  1 
ATOM   3254 O OD1 . ASN B 1 44  ? 27.879  -0.045  18.479  1.00 24.07 ? 44  ASN B OD1 1 
ATOM   3255 N ND2 . ASN B 1 44  ? 27.884  -1.727  16.996  1.00 22.06 ? 44  ASN B ND2 1 
ATOM   3256 N N   . ASP B 1 45  ? 25.068  0.624   18.743  1.00 30.67 ? 45  ASP B N   1 
ATOM   3257 C CA  . ASP B 1 45  ? 24.495  0.371   20.057  1.00 35.01 ? 45  ASP B CA  1 
ATOM   3258 C C   . ASP B 1 45  ? 25.523  0.629   21.172  1.00 33.91 ? 45  ASP B C   1 
ATOM   3259 O O   . ASP B 1 45  ? 25.180  1.135   22.252  1.00 34.92 ? 45  ASP B O   1 
ATOM   3260 C CB  . ASP B 1 45  ? 24.044  -1.100  20.070  1.00 38.43 ? 45  ASP B CB  1 
ATOM   3261 C CG  . ASP B 1 45  ? 23.944  -1.697  18.626  1.00 43.88 ? 45  ASP B CG  1 
ATOM   3262 O OD1 . ASP B 1 45  ? 23.130  -1.164  17.803  1.00 44.66 ? 45  ASP B OD1 1 
ATOM   3263 O OD2 . ASP B 1 45  ? 24.690  -2.673  18.301  1.00 44.15 ? 45  ASP B OD2 1 
ATOM   3264 N N   . LYS B 1 46  ? 26.782  0.299   20.890  1.00 33.20 ? 46  LYS B N   1 
ATOM   3265 C CA  . LYS B 1 46  ? 27.877  0.437   21.866  1.00 33.09 ? 46  LYS B CA  1 
ATOM   3266 C C   . LYS B 1 46  ? 28.823  1.656   21.688  1.00 32.71 ? 46  LYS B C   1 
ATOM   3267 O O   . LYS B 1 46  ? 30.049  1.545   21.888  1.00 31.58 ? 46  LYS B O   1 
ATOM   3268 C CB  . LYS B 1 46  ? 28.689  -0.869  21.878  1.00 31.48 ? 46  LYS B CB  1 
ATOM   3269 C CG  . LYS B 1 46  ? 29.006  -1.404  20.480  1.00 32.59 ? 46  LYS B CG  1 
ATOM   3270 C CD  . LYS B 1 46  ? 29.639  -2.811  20.462  1.00 31.79 ? 46  LYS B CD  1 
ATOM   3271 C CE  . LYS B 1 46  ? 29.951  -3.255  19.005  1.00 33.27 ? 46  LYS B CE  1 
ATOM   3272 N NZ  . LYS B 1 46  ? 30.422  -4.669  18.786  1.00 28.72 ? 46  LYS B NZ  1 
ATOM   3273 N N   . GLY B 1 47  ? 28.256  2.815   21.337  1.00 29.27 ? 47  GLY B N   1 
ATOM   3274 C CA  . GLY B 1 47  ? 29.085  3.983   21.128  1.00 23.56 ? 47  GLY B CA  1 
ATOM   3275 C C   . GLY B 1 47  ? 29.975  3.727   19.924  1.00 22.47 ? 47  GLY B C   1 
ATOM   3276 O O   . GLY B 1 47  ? 29.728  2.806   19.134  1.00 19.68 ? 47  GLY B O   1 
ATOM   3277 N N   . TRP B 1 48  ? 31.007  4.551   19.773  1.00 20.65 ? 48  TRP B N   1 
ATOM   3278 C CA  . TRP B 1 48  ? 31.949  4.417   18.667  1.00 17.46 ? 48  TRP B CA  1 
ATOM   3279 C C   . TRP B 1 48  ? 32.859  3.217   18.874  1.00 16.61 ? 48  TRP B C   1 
ATOM   3280 O O   . TRP B 1 48  ? 33.198  2.869   20.005  1.00 17.47 ? 48  TRP B O   1 
ATOM   3281 C CB  . TRP B 1 48  ? 32.837  5.663   18.563  1.00 15.65 ? 48  TRP B CB  1 
ATOM   3282 C CG  . TRP B 1 48  ? 32.117  6.905   18.182  1.00 13.75 ? 48  TRP B CG  1 
ATOM   3283 C CD1 . TRP B 1 48  ? 31.664  7.883   19.020  1.00 15.09 ? 48  TRP B CD1 1 
ATOM   3284 C CD2 . TRP B 1 48  ? 31.783  7.322   16.858  1.00 12.43 ? 48  TRP B CD2 1 
ATOM   3285 N NE1 . TRP B 1 48  ? 31.069  8.894   18.298  1.00 11.25 ? 48  TRP B NE1 1 
ATOM   3286 C CE2 . TRP B 1 48  ? 31.129  8.577   16.967  1.00 13.46 ? 48  TRP B CE2 1 
ATOM   3287 C CE3 . TRP B 1 48  ? 31.977  6.764   15.586  1.00 14.50 ? 48  TRP B CE3 1 
ATOM   3288 C CZ2 . TRP B 1 48  ? 30.662  9.286   15.845  1.00 13.03 ? 48  TRP B CZ2 1 
ATOM   3289 C CZ3 . TRP B 1 48  ? 31.514  7.464   14.470  1.00 15.04 ? 48  TRP B CZ3 1 
ATOM   3290 C CH2 . TRP B 1 48  ? 30.864  8.719   14.611  1.00 13.82 ? 48  TRP B CH2 1 
ATOM   3291 N N   . GLY B 1 49  ? 33.247  2.570   17.789  1.00 14.75 ? 49  GLY B N   1 
ATOM   3292 C CA  . GLY B 1 49  ? 34.162  1.464   17.917  1.00 10.82 ? 49  GLY B CA  1 
ATOM   3293 C C   . GLY B 1 49  ? 35.501  2.172   17.909  1.00 16.08 ? 49  GLY B C   1 
ATOM   3294 O O   . GLY B 1 49  ? 35.567  3.392   18.149  1.00 15.43 ? 49  GLY B O   1 
ATOM   3295 N N   . GLN B 1 50  ? 36.569  1.435   17.633  1.00 15.69 ? 50  GLN B N   1 
ATOM   3296 C CA  . GLN B 1 50  ? 37.887  2.038   17.573  1.00 14.22 ? 50  GLN B CA  1 
ATOM   3297 C C   . GLN B 1 50  ? 38.094  2.613   16.187  1.00 15.44 ? 50  GLN B C   1 
ATOM   3298 O O   . GLN B 1 50  ? 37.704  2.013   15.189  1.00 14.34 ? 50  GLN B O   1 
ATOM   3299 C CB  . GLN B 1 50  ? 38.982  1.007   17.855  1.00 11.73 ? 50  GLN B CB  1 
ATOM   3300 C CG  . GLN B 1 50  ? 39.244  0.844   19.317  1.00 15.69 ? 50  GLN B CG  1 
ATOM   3301 C CD  . GLN B 1 50  ? 40.346  -0.141  19.622  1.00 18.57 ? 50  GLN B CD  1 
ATOM   3302 O OE1 . GLN B 1 50  ? 40.987  -0.046  20.665  1.00 19.15 ? 50  GLN B OE1 1 
ATOM   3303 N NE2 . GLN B 1 50  ? 40.566  -1.103  18.722  1.00 19.34 ? 50  GLN B NE2 1 
ATOM   3304 N N   . PRO B 1 51  ? 38.709  3.794   16.109  1.00 14.64 ? 51  PRO B N   1 
ATOM   3305 C CA  . PRO B 1 51  ? 38.936  4.386   14.799  1.00 15.61 ? 51  PRO B CA  1 
ATOM   3306 C C   . PRO B 1 51  ? 40.067  3.589   14.202  1.00 18.50 ? 51  PRO B C   1 
ATOM   3307 O O   . PRO B 1 51  ? 40.933  3.083   14.940  1.00 17.70 ? 51  PRO B O   1 
ATOM   3308 C CB  . PRO B 1 51  ? 39.352  5.798   15.143  1.00 12.87 ? 51  PRO B CB  1 
ATOM   3309 C CG  . PRO B 1 51  ? 40.144  5.596   16.388  1.00 14.26 ? 51  PRO B CG  1 
ATOM   3310 C CD  . PRO B 1 51  ? 39.313  4.618   17.173  1.00 14.53 ? 51  PRO B CD  1 
ATOM   3311 N N   . ARG B 1 52  ? 40.087  3.437   12.885  1.00 19.36 ? 52  ARG B N   1 
ATOM   3312 C CA  . ARG B 1 52  ? 41.208  2.687   12.332  1.00 23.25 ? 52  ARG B CA  1 
ATOM   3313 C C   . ARG B 1 52  ? 41.623  3.105   10.940  1.00 22.71 ? 52  ARG B C   1 
ATOM   3314 O O   . ARG B 1 52  ? 40.780  3.328   10.069  1.00 26.49 ? 52  ARG B O   1 
ATOM   3315 C CB  . ARG B 1 52  ? 40.896  1.192   12.354  1.00 24.52 ? 52  ARG B CB  1 
ATOM   3316 C CG  . ARG B 1 52  ? 39.794  0.770   11.427  1.00 30.37 ? 52  ARG B CG  1 
ATOM   3317 C CD  . ARG B 1 52  ? 39.532  -0.721  11.561  1.00 33.15 ? 52  ARG B CD  1 
ATOM   3318 N NE  . ARG B 1 52  ? 38.514  -1.147  10.600  1.00 40.21 ? 52  ARG B NE  1 
ATOM   3319 C CZ  . ARG B 1 52  ? 37.231  -0.762  10.616  1.00 41.47 ? 52  ARG B CZ  1 
ATOM   3320 N NH1 . ARG B 1 52  ? 36.789  0.071   11.565  1.00 43.28 ? 52  ARG B NH1 1 
ATOM   3321 N NH2 . ARG B 1 52  ? 36.389  -1.204  9.672   1.00 40.73 ? 52  ARG B NH2 1 
ATOM   3322 N N   . ILE B 1 53  ? 42.924  3.234   10.720  1.00 22.16 ? 53  ILE B N   1 
ATOM   3323 C CA  . ILE B 1 53  ? 43.372  3.591   9.388   1.00 20.65 ? 53  ILE B CA  1 
ATOM   3324 C C   . ILE B 1 53  ? 43.523  2.255   8.706   1.00 20.51 ? 53  ILE B C   1 
ATOM   3325 O O   . ILE B 1 53  ? 44.155  1.348   9.233   1.00 21.82 ? 53  ILE B O   1 
ATOM   3326 C CB  . ILE B 1 53  ? 44.719  4.337   9.376   1.00 17.86 ? 53  ILE B CB  1 
ATOM   3327 C CG1 . ILE B 1 53  ? 44.574  5.715   10.032  1.00 17.69 ? 53  ILE B CG1 1 
ATOM   3328 C CG2 . ILE B 1 53  ? 45.175  4.506   7.946   1.00 11.99 ? 53  ILE B CG2 1 
ATOM   3329 C CD1 . ILE B 1 53  ? 45.838  6.590   9.967   1.00 15.82 ? 53  ILE B CD1 1 
ATOM   3330 N N   . GLN B 1 54  ? 42.932  2.131   7.534   1.00 19.94 ? 54  GLN B N   1 
ATOM   3331 C CA  . GLN B 1 54  ? 42.961  0.874   6.811   1.00 19.18 ? 54  GLN B CA  1 
ATOM   3332 C C   . GLN B 1 54  ? 43.166  1.152   5.315   1.00 18.45 ? 54  GLN B C   1 
ATOM   3333 O O   . GLN B 1 54  ? 42.981  2.278   4.857   1.00 18.46 ? 54  GLN B O   1 
ATOM   3334 C CB  . GLN B 1 54  ? 41.630  0.165   7.037   1.00 19.56 ? 54  GLN B CB  1 
ATOM   3335 C CG  . GLN B 1 54  ? 40.445  0.942   6.452   1.00 22.36 ? 54  GLN B CG  1 
ATOM   3336 C CD  . GLN B 1 54  ? 39.095  0.252   6.652   1.00 23.42 ? 54  GLN B CD  1 
ATOM   3337 O OE1 . GLN B 1 54  ? 38.241  0.295   5.770   1.00 26.24 ? 54  GLN B OE1 1 
ATOM   3338 N NE2 . GLN B 1 54  ? 38.895  -0.367  7.809   1.00 20.85 ? 54  GLN B NE2 1 
ATOM   3339 N N   . PRO B 1 55  ? 43.552  0.122   4.536   1.00 17.70 ? 55  PRO B N   1 
ATOM   3340 C CA  . PRO B 1 55  ? 43.772  0.299   3.092   1.00 15.38 ? 55  PRO B CA  1 
ATOM   3341 C C   . PRO B 1 55  ? 42.491  0.787   2.412   1.00 14.63 ? 55  PRO B C   1 
ATOM   3342 O O   . PRO B 1 55  ? 41.386  0.459   2.843   1.00 18.16 ? 55  PRO B O   1 
ATOM   3343 C CB  . PRO B 1 55  ? 44.174  -1.104  2.627   1.00 15.63 ? 55  PRO B CB  1 
ATOM   3344 C CG  . PRO B 1 55  ? 44.820  -1.706  3.863   1.00 16.61 ? 55  PRO B CG  1 
ATOM   3345 C CD  . PRO B 1 55  ? 43.880  -1.255  4.955   1.00 16.47 ? 55  PRO B CD  1 
ATOM   3346 N N   . PHE B 1 56  ? 42.636  1.588   1.370   1.00 12.10 ? 56  PHE B N   1 
ATOM   3347 C CA  . PHE B 1 56  ? 41.475  2.094   0.662   1.00 13.45 ? 56  PHE B CA  1 
ATOM   3348 C C   . PHE B 1 56  ? 40.693  0.868   0.189   1.00 15.68 ? 56  PHE B C   1 
ATOM   3349 O O   . PHE B 1 56  ? 41.273  -0.028  -0.411  1.00 14.68 ? 56  PHE B O   1 
ATOM   3350 C CB  . PHE B 1 56  ? 41.917  2.927   -0.532  1.00 10.52 ? 56  PHE B CB  1 
ATOM   3351 C CG  . PHE B 1 56  ? 40.814  3.743   -1.132  1.00 15.54 ? 56  PHE B CG  1 
ATOM   3352 C CD1 . PHE B 1 56  ? 40.564  5.046   -0.682  1.00 14.31 ? 56  PHE B CD1 1 
ATOM   3353 C CD2 . PHE B 1 56  ? 40.006  3.213   -2.141  1.00 11.97 ? 56  PHE B CD2 1 
ATOM   3354 C CE1 . PHE B 1 56  ? 39.526  5.812   -1.234  1.00 13.12 ? 56  PHE B CE1 1 
ATOM   3355 C CE2 . PHE B 1 56  ? 38.971  3.964   -2.694  1.00 12.60 ? 56  PHE B CE2 1 
ATOM   3356 C CZ  . PHE B 1 56  ? 38.730  5.272   -2.239  1.00 13.44 ? 56  PHE B CZ  1 
ATOM   3357 N N   . GLN B 1 57  ? 39.389  0.827   0.458   1.00 17.05 ? 57  GLN B N   1 
ATOM   3358 C CA  . GLN B 1 57  ? 38.570  -0.331  0.080   1.00 16.85 ? 57  GLN B CA  1 
ATOM   3359 C C   . GLN B 1 57  ? 37.113  0.031   -0.011  1.00 17.09 ? 57  GLN B C   1 
ATOM   3360 O O   . GLN B 1 57  ? 36.700  1.052   0.514   1.00 15.90 ? 57  GLN B O   1 
ATOM   3361 C CB  . GLN B 1 57  ? 38.713  -1.436  1.116   1.00 17.39 ? 57  GLN B CB  1 
ATOM   3362 C CG  . GLN B 1 57  ? 38.448  -0.944  2.521   1.00 23.08 ? 57  GLN B CG  1 
ATOM   3363 C CD  . GLN B 1 57  ? 38.840  -1.969  3.556   1.00 27.73 ? 57  GLN B CD  1 
ATOM   3364 O OE1 . GLN B 1 57  ? 38.095  -2.916  3.817   1.00 29.49 ? 57  GLN B OE1 1 
ATOM   3365 N NE2 . GLN B 1 57  ? 40.031  -1.804  4.137   1.00 29.36 ? 57  GLN B NE2 1 
ATOM   3366 N N   . ASN B 1 58  ? 36.337  -0.822  -0.670  1.00 17.23 ? 58  ASN B N   1 
ATOM   3367 C CA  . ASN B 1 58  ? 34.914  -0.590  -0.821  1.00 18.89 ? 58  ASN B CA  1 
ATOM   3368 C C   . ASN B 1 58  ? 34.205  -0.589  0.499   1.00 19.76 ? 58  ASN B C   1 
ATOM   3369 O O   . ASN B 1 58  ? 34.735  -1.055  1.500   1.00 20.80 ? 58  ASN B O   1 
ATOM   3370 C CB  . ASN B 1 58  ? 34.266  -1.679  -1.654  1.00 21.42 ? 58  ASN B CB  1 
ATOM   3371 C CG  . ASN B 1 58  ? 34.668  -1.617  -3.083  1.00 25.09 ? 58  ASN B CG  1 
ATOM   3372 O OD1 . ASN B 1 58  ? 34.815  -0.527  -3.636  1.00 25.78 ? 58  ASN B OD1 1 
ATOM   3373 N ND2 . ASN B 1 58  ? 34.834  -2.783  -3.710  1.00 26.87 ? 58  ASN B ND2 1 
ATOM   3374 N N   . LEU B 1 59  ? 32.984  -0.073  0.481   1.00 17.55 ? 59  LEU B N   1 
ATOM   3375 C CA  . LEU B 1 59  ? 32.141  -0.058  1.664   1.00 18.35 ? 59  LEU B CA  1 
ATOM   3376 C C   . LEU B 1 59  ? 31.117  -1.179  1.470   1.00 18.93 ? 59  LEU B C   1 
ATOM   3377 O O   . LEU B 1 59  ? 30.564  -1.342  0.383   1.00 18.45 ? 59  LEU B O   1 
ATOM   3378 C CB  . LEU B 1 59  ? 31.411  1.269   1.777   1.00 16.01 ? 59  LEU B CB  1 
ATOM   3379 C CG  . LEU B 1 59  ? 32.268  2.522   1.775   1.00 15.94 ? 59  LEU B CG  1 
ATOM   3380 C CD1 . LEU B 1 59  ? 31.383  3.723   1.535   1.00 17.94 ? 59  LEU B CD1 1 
ATOM   3381 C CD2 . LEU B 1 59  ? 33.000  2.645   3.077   1.00 15.91 ? 59  LEU B CD2 1 
ATOM   3382 N N   . THR B 1 60  ? 30.885  -1.958  2.517   1.00 17.32 ? 60  THR B N   1 
ATOM   3383 C CA  . THR B 1 60  ? 29.917  -3.028  2.442   1.00 17.44 ? 60  THR B CA  1 
ATOM   3384 C C   . THR B 1 60  ? 28.678  -2.518  3.175   1.00 17.54 ? 60  THR B C   1 
ATOM   3385 O O   . THR B 1 60  ? 28.687  -2.321  4.378   1.00 16.50 ? 60  THR B O   1 
ATOM   3386 C CB  . THR B 1 60  ? 30.468  -4.299  3.097   1.00 15.03 ? 60  THR B CB  1 
ATOM   3387 O OG1 . THR B 1 60  ? 31.759  -4.586  2.551   1.00 18.19 ? 60  THR B OG1 1 
ATOM   3388 C CG2 . THR B 1 60  ? 29.563  -5.478  2.812   1.00 19.33 ? 60  THR B CG2 1 
ATOM   3389 N N   . LEU B 1 61  ? 27.609  -2.282  2.433   1.00 17.80 ? 61  LEU B N   1 
ATOM   3390 C CA  . LEU B 1 61  ? 26.387  -1.747  3.015   1.00 16.50 ? 61  LEU B CA  1 
ATOM   3391 C C   . LEU B 1 61  ? 25.093  -2.542  2.823   1.00 16.40 ? 61  LEU B C   1 
ATOM   3392 O O   . LEU B 1 61  ? 24.788  -3.048  1.742   1.00 16.80 ? 61  LEU B O   1 
ATOM   3393 C CB  . LEU B 1 61  ? 26.159  -0.348  2.474   1.00 15.76 ? 61  LEU B CB  1 
ATOM   3394 C CG  . LEU B 1 61  ? 26.737  0.865   3.192   1.00 15.45 ? 61  LEU B CG  1 
ATOM   3395 C CD1 . LEU B 1 61  ? 27.774  0.484   4.217   1.00 17.50 ? 61  LEU B CD1 1 
ATOM   3396 C CD2 . LEU B 1 61  ? 27.296  1.788   2.126   1.00 15.72 ? 61  LEU B CD2 1 
ATOM   3397 N N   . HIS B 1 62  ? 24.318  -2.620  3.891   1.00 17.10 ? 62  HIS B N   1 
ATOM   3398 C CA  . HIS B 1 62  ? 23.039  -3.305  3.849   1.00 17.22 ? 62  HIS B CA  1 
ATOM   3399 C C   . HIS B 1 62  ? 22.066  -2.547  2.896   1.00 16.83 ? 62  HIS B C   1 
ATOM   3400 O O   . HIS B 1 62  ? 21.915  -1.325  2.980   1.00 20.03 ? 62  HIS B O   1 
ATOM   3401 C CB  . HIS B 1 62  ? 22.500  -3.374  5.268   1.00 13.97 ? 62  HIS B CB  1 
ATOM   3402 C CG  . HIS B 1 62  ? 21.237  -4.156  5.391   1.00 19.04 ? 62  HIS B CG  1 
ATOM   3403 N ND1 . HIS B 1 62  ? 20.048  -3.734  4.835   1.00 18.38 ? 62  HIS B ND1 1 
ATOM   3404 C CD2 . HIS B 1 62  ? 20.981  -5.344  5.982   1.00 14.70 ? 62  HIS B CD2 1 
ATOM   3405 C CE1 . HIS B 1 62  ? 19.115  -4.632  5.081   1.00 18.78 ? 62  HIS B CE1 1 
ATOM   3406 N NE2 . HIS B 1 62  ? 19.655  -5.618  5.774   1.00 15.03 ? 62  HIS B NE2 1 
ATOM   3407 N N   . PRO B 1 63  ? 21.399  -3.268  1.980   1.00 15.43 ? 63  PRO B N   1 
ATOM   3408 C CA  . PRO B 1 63  ? 20.460  -2.702  1.005   1.00 13.78 ? 63  PRO B CA  1 
ATOM   3409 C C   . PRO B 1 63  ? 19.478  -1.694  1.543   1.00 14.47 ? 63  PRO B C   1 
ATOM   3410 O O   . PRO B 1 63  ? 19.006  -0.848  0.793   1.00 14.73 ? 63  PRO B O   1 
ATOM   3411 C CB  . PRO B 1 63  ? 19.730  -3.921  0.467   1.00 14.83 ? 63  PRO B CB  1 
ATOM   3412 C CG  . PRO B 1 63  ? 20.748  -4.997  0.600   1.00 17.55 ? 63  PRO B CG  1 
ATOM   3413 C CD  . PRO B 1 63  ? 21.333  -4.735  1.955   1.00 14.55 ? 63  PRO B CD  1 
ATOM   3414 N N   . ALA B 1 64  ? 19.147  -1.797  2.828   1.00 12.98 ? 64  ALA B N   1 
ATOM   3415 C CA  . ALA B 1 64  ? 18.187  -0.895  3.443   1.00 11.74 ? 64  ALA B CA  1 
ATOM   3416 C C   . ALA B 1 64  ? 18.847  0.298   4.131   1.00 13.31 ? 64  ALA B C   1 
ATOM   3417 O O   . ALA B 1 64  ? 18.173  1.094   4.753   1.00 10.90 ? 64  ALA B O   1 
ATOM   3418 C CB  . ALA B 1 64  ? 17.343  -1.657  4.441   1.00 9.42  ? 64  ALA B CB  1 
ATOM   3419 N N   . SER B 1 65  ? 20.162  0.419   3.993   1.00 12.72 ? 65  SER B N   1 
ATOM   3420 C CA  . SER B 1 65  ? 20.917  1.492   4.625   1.00 13.70 ? 65  SER B CA  1 
ATOM   3421 C C   . SER B 1 65  ? 20.323  2.896   4.449   1.00 16.44 ? 65  SER B C   1 
ATOM   3422 O O   . SER B 1 65  ? 20.158  3.398   3.328   1.00 16.02 ? 65  SER B O   1 
ATOM   3423 C CB  . SER B 1 65  ? 22.362  1.453   4.131   1.00 12.86 ? 65  SER B CB  1 
ATOM   3424 O OG  . SER B 1 65  ? 23.156  2.363   4.857   1.00 17.72 ? 65  SER B OG  1 
ATOM   3425 N N   . SER B 1 66  ? 20.005  3.530   5.573   1.00 15.18 ? 66  SER B N   1 
ATOM   3426 C CA  . SER B 1 66  ? 19.404  4.853   5.537   1.00 16.68 ? 66  SER B CA  1 
ATOM   3427 C C   . SER B 1 66  ? 20.251  5.906   4.828   1.00 12.30 ? 66  SER B C   1 
ATOM   3428 O O   . SER B 1 66  ? 19.750  6.945   4.411   1.00 13.11 ? 66  SER B O   1 
ATOM   3429 C CB  . SER B 1 66  ? 19.035  5.316   6.963   1.00 16.69 ? 66  SER B CB  1 
ATOM   3430 O OG  . SER B 1 66  ? 20.039  5.003   7.920   1.00 17.48 ? 66  SER B OG  1 
ATOM   3431 N N   . SER B 1 67  ? 21.540  5.638   4.698   1.00 11.71 ? 67  SER B N   1 
ATOM   3432 C CA  . SER B 1 67  ? 22.411  6.572   4.012   1.00 10.96 ? 67  SER B CA  1 
ATOM   3433 C C   . SER B 1 67  ? 22.003  6.606   2.524   1.00 10.52 ? 67  SER B C   1 
ATOM   3434 O O   . SER B 1 67  ? 22.290  7.559   1.808   1.00 9.77  ? 67  SER B O   1 
ATOM   3435 C CB  . SER B 1 67  ? 23.851  6.100   4.146   1.00 11.27 ? 67  SER B CB  1 
ATOM   3436 O OG  . SER B 1 67  ? 24.008  4.845   3.528   1.00 13.95 ? 67  SER B OG  1 
ATOM   3437 N N   . LEU B 1 68  ? 21.308  5.562   2.087   1.00 8.14  ? 68  LEU B N   1 
ATOM   3438 C CA  . LEU B 1 68  ? 20.895  5.429   0.705   1.00 9.82  ? 68  LEU B CA  1 
ATOM   3439 C C   . LEU B 1 68  ? 19.427  5.708   0.399   1.00 14.26 ? 68  LEU B C   1 
ATOM   3440 O O   . LEU B 1 68  ? 19.083  5.946   -0.756  1.00 17.45 ? 68  LEU B O   1 
ATOM   3441 C CB  . LEU B 1 68  ? 21.258  4.030   0.217   1.00 7.36  ? 68  LEU B CB  1 
ATOM   3442 C CG  . LEU B 1 68  ? 22.751  3.658   0.206   1.00 8.74  ? 68  LEU B CG  1 
ATOM   3443 C CD1 . LEU B 1 68  ? 22.929  2.214   -0.186  1.00 6.03  ? 68  LEU B CD1 1 
ATOM   3444 C CD2 . LEU B 1 68  ? 23.497  4.530   -0.777  1.00 5.34  ? 68  LEU B CD2 1 
ATOM   3445 N N   . HIS B 1 69  ? 18.566  5.679   1.417   1.00 15.55 ? 69  HIS B N   1 
ATOM   3446 C CA  . HIS B 1 69  ? 17.134  5.913   1.238   1.00 13.50 ? 69  HIS B CA  1 
ATOM   3447 C C   . HIS B 1 69  ? 16.676  7.308   1.647   1.00 13.51 ? 69  HIS B C   1 
ATOM   3448 O O   . HIS B 1 69  ? 15.893  7.954   0.940   1.00 12.68 ? 69  HIS B O   1 
ATOM   3449 C CB  . HIS B 1 69  ? 16.328  4.882   2.038   1.00 13.59 ? 69  HIS B CB  1 
ATOM   3450 C CG  . HIS B 1 69  ? 16.534  3.469   1.595   1.00 11.01 ? 69  HIS B CG  1 
ATOM   3451 N ND1 . HIS B 1 69  ? 15.664  2.819   0.747   1.00 12.72 ? 69  HIS B ND1 1 
ATOM   3452 C CD2 . HIS B 1 69  ? 17.516  2.581   1.878   1.00 9.98  ? 69  HIS B CD2 1 
ATOM   3453 C CE1 . HIS B 1 69  ? 16.099  1.589   0.531   1.00 12.53 ? 69  HIS B CE1 1 
ATOM   3454 N NE2 . HIS B 1 69  ? 17.221  1.420   1.207   1.00 10.08 ? 69  HIS B NE2 1 
ATOM   3455 N N   . TYR B 1 70  ? 17.153  7.763   2.799   1.00 14.21 ? 70  TYR B N   1 
ATOM   3456 C CA  . TYR B 1 70  ? 16.763  9.063   3.324   1.00 14.36 ? 70  TYR B CA  1 
ATOM   3457 C C   . TYR B 1 70  ? 17.903  10.052  3.408   1.00 14.41 ? 70  TYR B C   1 
ATOM   3458 O O   . TYR B 1 70  ? 17.883  10.966  4.228   1.00 11.31 ? 70  TYR B O   1 
ATOM   3459 C CB  . TYR B 1 70  ? 16.123  8.886   4.702   1.00 15.92 ? 70  TYR B CB  1 
ATOM   3460 C CG  . TYR B 1 70  ? 15.167  7.736   4.705   1.00 22.06 ? 70  TYR B CG  1 
ATOM   3461 C CD1 . TYR B 1 70  ? 14.205  7.601   3.673   1.00 20.11 ? 70  TYR B CD1 1 
ATOM   3462 C CD2 . TYR B 1 70  ? 15.282  6.709   5.649   1.00 19.98 ? 70  TYR B CD2 1 
ATOM   3463 C CE1 . TYR B 1 70  ? 13.397  6.465   3.572   1.00 18.29 ? 70  TYR B CE1 1 
ATOM   3464 C CE2 . TYR B 1 70  ? 14.477  5.567   5.562   1.00 24.93 ? 70  TYR B CE2 1 
ATOM   3465 C CZ  . TYR B 1 70  ? 13.538  5.444   4.511   1.00 22.56 ? 70  TYR B CZ  1 
ATOM   3466 O OH  . TYR B 1 70  ? 12.802  4.286   4.381   1.00 21.74 ? 70  TYR B OH  1 
ATOM   3467 N N   . SER B 1 71  ? 18.903  9.853   2.555   1.00 16.97 ? 71  SER B N   1 
ATOM   3468 C CA  . SER B 1 71  ? 20.058  10.738  2.496   1.00 14.59 ? 71  SER B CA  1 
ATOM   3469 C C   . SER B 1 71  ? 20.683  11.027  3.876   1.00 15.40 ? 71  SER B C   1 
ATOM   3470 O O   . SER B 1 71  ? 20.969  12.176  4.202   1.00 18.19 ? 71  SER B O   1 
ATOM   3471 C CB  . SER B 1 71  ? 19.620  12.049  1.822   1.00 14.15 ? 71  SER B CB  1 
ATOM   3472 O OG  . SER B 1 71  ? 20.715  12.880  1.510   1.00 17.37 ? 71  SER B OG  1 
ATOM   3473 N N   . LEU B 1 72  ? 20.873  10.011  4.705   1.00 14.78 ? 72  LEU B N   1 
ATOM   3474 C CA  . LEU B 1 72  ? 21.483  10.276  6.003   1.00 14.42 ? 72  LEU B CA  1 
ATOM   3475 C C   . LEU B 1 72  ? 22.968  10.267  5.745   1.00 12.93 ? 72  LEU B C   1 
ATOM   3476 O O   . LEU B 1 72  ? 23.669  9.276   5.959   1.00 14.66 ? 72  LEU B O   1 
ATOM   3477 C CB  . LEU B 1 72  ? 21.082  9.225   7.035   1.00 16.04 ? 72  LEU B CB  1 
ATOM   3478 C CG  . LEU B 1 72  ? 19.683  9.469   7.582   1.00 17.71 ? 72  LEU B CG  1 
ATOM   3479 C CD1 . LEU B 1 72  ? 19.356  8.418   8.604   1.00 21.72 ? 72  LEU B CD1 1 
ATOM   3480 C CD2 . LEU B 1 72  ? 19.602  10.832  8.214   1.00 18.90 ? 72  LEU B CD2 1 
ATOM   3481 N N   . GLN B 1 73  ? 23.429  11.407  5.268   1.00 11.76 ? 73  GLN B N   1 
ATOM   3482 C CA  . GLN B 1 73  ? 24.803  11.569  4.893   1.00 11.05 ? 73  GLN B CA  1 
ATOM   3483 C C   . GLN B 1 73  ? 25.220  13.025  4.916   1.00 10.44 ? 73  GLN B C   1 
ATOM   3484 O O   . GLN B 1 73  ? 24.419  13.907  4.637   1.00 12.80 ? 73  GLN B O   1 
ATOM   3485 C CB  . GLN B 1 73  ? 24.972  11.037  3.475   1.00 7.73  ? 73  GLN B CB  1 
ATOM   3486 C CG  . GLN B 1 73  ? 24.004  11.677  2.480   1.00 3.46  ? 73  GLN B CG  1 
ATOM   3487 C CD  . GLN B 1 73  ? 24.135  11.104  1.070   1.00 10.35 ? 73  GLN B CD  1 
ATOM   3488 O OE1 . GLN B 1 73  ? 23.826  9.936   0.829   1.00 10.60 ? 73  GLN B OE1 1 
ATOM   3489 N NE2 . GLN B 1 73  ? 24.603  11.926  0.133   1.00 8.82  ? 73  GLN B NE2 1 
ATOM   3490 N N   . LEU B 1 74  ? 26.477  13.259  5.258   1.00 11.64 ? 74  LEU B N   1 
ATOM   3491 C CA  . LEU B 1 74  ? 27.066  14.596  5.240   1.00 12.35 ? 74  LEU B CA  1 
ATOM   3492 C C   . LEU B 1 74  ? 28.538  14.375  4.972   1.00 11.96 ? 74  LEU B C   1 
ATOM   3493 O O   . LEU B 1 74  ? 29.035  13.254  5.074   1.00 11.86 ? 74  LEU B O   1 
ATOM   3494 C CB  . LEU B 1 74  ? 26.875  15.352  6.558   1.00 11.68 ? 74  LEU B CB  1 
ATOM   3495 C CG  . LEU B 1 74  ? 27.381  14.859  7.912   1.00 15.47 ? 74  LEU B CG  1 
ATOM   3496 C CD1 . LEU B 1 74  ? 26.567  13.685  8.328   1.00 15.73 ? 74  LEU B CD1 1 
ATOM   3497 C CD2 . LEU B 1 74  ? 28.859  14.516  7.874   1.00 20.50 ? 74  LEU B CD2 1 
ATOM   3498 N N   . PHE B 1 75  ? 29.246  15.437  4.636   1.00 11.62 ? 75  PHE B N   1 
ATOM   3499 C CA  . PHE B 1 75  ? 30.654  15.299  4.332   1.00 8.56  ? 75  PHE B CA  1 
ATOM   3500 C C   . PHE B 1 75  ? 31.318  16.621  4.540   1.00 10.32 ? 75  PHE B C   1 
ATOM   3501 O O   . PHE B 1 75  ? 30.656  17.627  4.774   1.00 11.94 ? 75  PHE B O   1 
ATOM   3502 C CB  . PHE B 1 75  ? 30.844  14.868  2.866   1.00 9.56  ? 75  PHE B CB  1 
ATOM   3503 C CG  . PHE B 1 75  ? 30.328  15.876  1.857   1.00 10.44 ? 75  PHE B CG  1 
ATOM   3504 C CD1 . PHE B 1 75  ? 28.964  16.044  1.642   1.00 8.42  ? 75  PHE B CD1 1 
ATOM   3505 C CD2 . PHE B 1 75  ? 31.214  16.672  1.132   1.00 11.62 ? 75  PHE B CD2 1 
ATOM   3506 C CE1 . PHE B 1 75  ? 28.489  16.986  0.726   1.00 10.69 ? 75  PHE B CE1 1 
ATOM   3507 C CE2 . PHE B 1 75  ? 30.755  17.609  0.221   1.00 14.45 ? 75  PHE B CE2 1 
ATOM   3508 C CZ  . PHE B 1 75  ? 29.382  17.770  0.014   1.00 12.80 ? 75  PHE B CZ  1 
ATOM   3509 N N   . GLU B 1 76  ? 32.635  16.626  4.470   1.00 11.65 ? 76  GLU B N   1 
ATOM   3510 C CA  . GLU B 1 76  ? 33.343  17.875  4.598   1.00 12.62 ? 76  GLU B CA  1 
ATOM   3511 C C   . GLU B 1 76  ? 34.405  17.890  3.536   1.00 14.76 ? 76  GLU B C   1 
ATOM   3512 O O   . GLU B 1 76  ? 34.727  16.850  2.953   1.00 15.37 ? 76  GLU B O   1 
ATOM   3513 C CB  . GLU B 1 76  ? 33.939  18.036  5.996   1.00 11.09 ? 76  GLU B CB  1 
ATOM   3514 C CG  . GLU B 1 76  ? 33.048  18.848  6.898   1.00 11.93 ? 76  GLU B CG  1 
ATOM   3515 C CD  . GLU B 1 76  ? 32.872  20.286  6.417   1.00 12.44 ? 76  GLU B CD  1 
ATOM   3516 O OE1 . GLU B 1 76  ? 31.899  20.948  6.840   1.00 11.89 ? 76  GLU B OE1 1 
ATOM   3517 O OE2 . GLU B 1 76  ? 33.718  20.753  5.629   1.00 11.67 ? 76  GLU B OE2 1 
ATOM   3518 N N   . GLY B 1 77  ? 34.920  19.073  3.265   1.00 12.55 ? 77  GLY B N   1 
ATOM   3519 C CA  . GLY B 1 77  ? 35.945  19.198  2.259   1.00 15.20 ? 77  GLY B CA  1 
ATOM   3520 C C   . GLY B 1 77  ? 36.950  20.226  2.694   1.00 15.17 ? 77  GLY B C   1 
ATOM   3521 O O   . GLY B 1 77  ? 36.614  21.383  2.953   1.00 14.82 ? 77  GLY B O   1 
ATOM   3522 N N   . MET B 1 78  ? 38.194  19.786  2.792   1.00 14.44 ? 78  MET B N   1 
ATOM   3523 C CA  . MET B 1 78  ? 39.276  20.652  3.205   1.00 13.32 ? 78  MET B CA  1 
ATOM   3524 C C   . MET B 1 78  ? 40.546  20.222  2.511   1.00 12.36 ? 78  MET B C   1 
ATOM   3525 O O   . MET B 1 78  ? 40.615  19.127  1.947   1.00 13.69 ? 78  MET B O   1 
ATOM   3526 C CB  . MET B 1 78  ? 39.442  20.587  4.719   1.00 17.41 ? 78  MET B CB  1 
ATOM   3527 C CG  . MET B 1 78  ? 39.276  19.194  5.321   1.00 18.17 ? 78  MET B CG  1 
ATOM   3528 S SD  . MET B 1 78  ? 39.543  19.255  7.115   1.00 21.96 ? 78  MET B SD  1 
ATOM   3529 C CE  . MET B 1 78  ? 39.363  17.494  7.543   1.00 19.46 ? 78  MET B CE  1 
ATOM   3530 N N   . LYS B 1 79  ? 41.547  21.090  2.547   1.00 9.56  ? 79  LYS B N   1 
ATOM   3531 C CA  . LYS B 1 79  ? 42.807  20.803  1.903   1.00 10.53 ? 79  LYS B CA  1 
ATOM   3532 C C   . LYS B 1 79  ? 44.012  20.808  2.809   1.00 12.73 ? 79  LYS B C   1 
ATOM   3533 O O   . LYS B 1 79  ? 44.054  21.513  3.811   1.00 14.53 ? 79  LYS B O   1 
ATOM   3534 C CB  . LYS B 1 79  ? 43.066  21.795  0.777   1.00 11.93 ? 79  LYS B CB  1 
ATOM   3535 C CG  . LYS B 1 79  ? 42.126  21.652  -0.378  1.00 8.81  ? 79  LYS B CG  1 
ATOM   3536 C CD  . LYS B 1 79  ? 42.617  22.474  -1.513  1.00 8.03  ? 79  LYS B CD  1 
ATOM   3537 C CE  . LYS B 1 79  ? 41.851  22.186  -2.749  1.00 8.39  ? 79  LYS B CE  1 
ATOM   3538 N NZ  . LYS B 1 79  ? 42.465  22.930  -3.862  1.00 16.39 ? 79  LYS B NZ  1 
ATOM   3539 N N   . ALA B 1 80  ? 44.986  19.993  2.429   1.00 13.66 ? 80  ALA B N   1 
ATOM   3540 C CA  . ALA B 1 80  ? 46.268  19.879  3.117   1.00 13.57 ? 80  ALA B CA  1 
ATOM   3541 C C   . ALA B 1 80  ? 47.230  20.299  2.014   1.00 11.96 ? 80  ALA B C   1 
ATOM   3542 O O   . ALA B 1 80  ? 47.039  19.911  0.864   1.00 11.37 ? 80  ALA B O   1 
ATOM   3543 C CB  . ALA B 1 80  ? 46.537  18.432  3.530   1.00 13.26 ? 80  ALA B CB  1 
ATOM   3544 N N   . PHE B 1 81  ? 48.237  21.093  2.363   1.00 10.74 ? 81  PHE B N   1 
ATOM   3545 C CA  . PHE B 1 81  ? 49.221  21.575  1.400   1.00 11.28 ? 81  PHE B CA  1 
ATOM   3546 C C   . PHE B 1 81  ? 50.639  21.239  1.811   1.00 11.29 ? 81  PHE B C   1 
ATOM   3547 O O   . PHE B 1 81  ? 50.982  21.299  2.982   1.00 14.51 ? 81  PHE B O   1 
ATOM   3548 C CB  . PHE B 1 81  ? 49.140  23.091  1.230   1.00 8.37  ? 81  PHE B CB  1 
ATOM   3549 C CG  . PHE B 1 81  ? 47.756  23.612  1.034   1.00 13.65 ? 81  PHE B CG  1 
ATOM   3550 C CD1 . PHE B 1 81  ? 46.919  23.827  2.129   1.00 10.66 ? 81  PHE B CD1 1 
ATOM   3551 C CD2 . PHE B 1 81  ? 47.304  23.953  -0.247  1.00 14.36 ? 81  PHE B CD2 1 
ATOM   3552 C CE1 . PHE B 1 81  ? 45.653  24.383  1.953   1.00 14.58 ? 81  PHE B CE1 1 
ATOM   3553 C CE2 . PHE B 1 81  ? 46.048  24.507  -0.437  1.00 17.72 ? 81  PHE B CE2 1 
ATOM   3554 C CZ  . PHE B 1 81  ? 45.211  24.730  0.666   1.00 13.19 ? 81  PHE B CZ  1 
ATOM   3555 N N   . LYS B 1 82  ? 51.463  20.897  0.837   1.00 11.82 ? 82  LYS B N   1 
ATOM   3556 C CA  . LYS B 1 82  ? 52.861  20.577  1.114   1.00 15.22 ? 82  LYS B CA  1 
ATOM   3557 C C   . LYS B 1 82  ? 53.733  21.739  0.655   1.00 12.73 ? 82  LYS B C   1 
ATOM   3558 O O   . LYS B 1 82  ? 53.561  22.220  -0.453  1.00 16.50 ? 82  LYS B O   1 
ATOM   3559 C CB  . LYS B 1 82  ? 53.292  19.298  0.389   1.00 12.15 ? 82  LYS B CB  1 
ATOM   3560 C CG  . LYS B 1 82  ? 54.691  18.849  0.760   1.00 14.07 ? 82  LYS B CG  1 
ATOM   3561 C CD  . LYS B 1 82  ? 55.038  17.525  0.118   1.00 19.50 ? 82  LYS B CD  1 
ATOM   3562 C CE  . LYS B 1 82  ? 54.134  16.405  0.613   1.00 24.08 ? 82  LYS B CE  1 
ATOM   3563 N NZ  . LYS B 1 82  ? 54.367  15.114  -0.103  1.00 25.29 ? 82  LYS B NZ  1 
ATOM   3564 N N   . GLY B 1 83  ? 54.636  22.198  1.518   1.00 14.34 ? 83  GLY B N   1 
ATOM   3565 C CA  . GLY B 1 83  ? 55.516  23.301  1.167   1.00 14.33 ? 83  GLY B CA  1 
ATOM   3566 C C   . GLY B 1 83  ? 56.725  22.782  0.419   1.00 15.19 ? 83  GLY B C   1 
ATOM   3567 O O   . GLY B 1 83  ? 56.775  21.602  0.097   1.00 14.07 ? 83  GLY B O   1 
ATOM   3568 N N   . LYS B 1 84  ? 57.703  23.636  0.136   1.00 17.74 ? 84  LYS B N   1 
ATOM   3569 C CA  . LYS B 1 84  ? 58.873  23.171  -0.596  1.00 19.04 ? 84  LYS B CA  1 
ATOM   3570 C C   . LYS B 1 84  ? 59.786  22.410  0.332   1.00 20.36 ? 84  LYS B C   1 
ATOM   3571 O O   . LYS B 1 84  ? 60.687  21.711  -0.114  1.00 21.53 ? 84  LYS B O   1 
ATOM   3572 C CB  . LYS B 1 84  ? 59.643  24.331  -1.255  1.00 22.17 ? 84  LYS B CB  1 
ATOM   3573 C CG  . LYS B 1 84  ? 59.104  25.737  -0.993  1.00 30.20 ? 84  LYS B CG  1 
ATOM   3574 C CD  . LYS B 1 84  ? 59.213  26.078  0.510   1.00 35.88 ? 84  LYS B CD  1 
ATOM   3575 C CE  . LYS B 1 84  ? 58.623  27.446  0.879   1.00 36.77 ? 84  LYS B CE  1 
ATOM   3576 N NZ  . LYS B 1 84  ? 58.766  27.724  2.353   1.00 34.83 ? 84  LYS B NZ  1 
ATOM   3577 N N   . ASP B 1 85  ? 59.559  22.561  1.631   1.00 21.90 ? 85  ASP B N   1 
ATOM   3578 C CA  . ASP B 1 85  ? 60.353  21.853  2.628   1.00 21.87 ? 85  ASP B CA  1 
ATOM   3579 C C   . ASP B 1 85  ? 59.662  20.547  2.926   1.00 21.62 ? 85  ASP B C   1 
ATOM   3580 O O   . ASP B 1 85  ? 60.002  19.861  3.887   1.00 22.53 ? 85  ASP B O   1 
ATOM   3581 C CB  . ASP B 1 85  ? 60.455  22.656  3.920   1.00 23.49 ? 85  ASP B CB  1 
ATOM   3582 C CG  . ASP B 1 85  ? 59.122  23.272  4.346   1.00 27.99 ? 85  ASP B CG  1 
ATOM   3583 O OD1 . ASP B 1 85  ? 58.049  22.608  4.253   1.00 23.02 ? 85  ASP B OD1 1 
ATOM   3584 O OD2 . ASP B 1 85  ? 59.166  24.446  4.794   1.00 32.26 ? 85  ASP B OD2 1 
ATOM   3585 N N   . GLN B 1 86  ? 58.694  20.218  2.077   1.00 21.88 ? 86  GLN B N   1 
ATOM   3586 C CA  . GLN B 1 86  ? 57.861  19.015  2.183   1.00 22.82 ? 86  GLN B CA  1 
ATOM   3587 C C   . GLN B 1 86  ? 57.049  18.914  3.484   1.00 20.99 ? 86  GLN B C   1 
ATOM   3588 O O   . GLN B 1 86  ? 56.637  17.834  3.855   1.00 22.15 ? 86  GLN B O   1 
ATOM   3589 C CB  . GLN B 1 86  ? 58.686  17.727  2.008   1.00 21.52 ? 86  GLN B CB  1 
ATOM   3590 C CG  . GLN B 1 86  ? 60.035  17.898  1.311   1.00 27.18 ? 86  GLN B CG  1 
ATOM   3591 C CD  . GLN B 1 86  ? 59.963  17.973  -0.207  1.00 29.41 ? 86  GLN B CD  1 
ATOM   3592 O OE1 . GLN B 1 86  ? 59.425  18.931  -0.779  1.00 30.59 ? 86  GLN B OE1 1 
ATOM   3593 N NE2 . GLN B 1 86  ? 60.519  16.953  -0.875  1.00 32.44 ? 86  GLN B NE2 1 
ATOM   3594 N N   . GLN B 1 87  ? 56.815  20.027  4.172   1.00 21.17 ? 87  GLN B N   1 
ATOM   3595 C CA  . GLN B 1 87  ? 56.017  19.986  5.380   1.00 18.62 ? 87  GLN B CA  1 
ATOM   3596 C C   . GLN B 1 87  ? 54.559  20.140  4.947   1.00 18.40 ? 87  GLN B C   1 
ATOM   3597 O O   . GLN B 1 87  ? 54.216  21.096  4.252   1.00 17.00 ? 87  GLN B O   1 
ATOM   3598 C CB  . GLN B 1 87  ? 56.409  21.128  6.320   1.00 23.83 ? 87  GLN B CB  1 
ATOM   3599 C CG  . GLN B 1 87  ? 56.282  20.797  7.820   1.00 30.40 ? 87  GLN B CG  1 
ATOM   3600 C CD  . GLN B 1 87  ? 54.835  20.565  8.292   1.00 34.29 ? 87  GLN B CD  1 
ATOM   3601 O OE1 . GLN B 1 87  ? 54.595  19.991  9.375   1.00 31.62 ? 87  GLN B OE1 1 
ATOM   3602 N NE2 . GLN B 1 87  ? 53.864  21.022  7.490   1.00 36.82 ? 87  GLN B NE2 1 
ATOM   3603 N N   . VAL B 1 88  ? 53.713  19.196  5.360   1.00 17.40 ? 88  VAL B N   1 
ATOM   3604 C CA  . VAL B 1 88  ? 52.296  19.222  5.029   1.00 11.63 ? 88  VAL B CA  1 
ATOM   3605 C C   . VAL B 1 88  ? 51.478  19.937  6.083   1.00 12.17 ? 88  VAL B C   1 
ATOM   3606 O O   . VAL B 1 88  ? 51.707  19.761  7.281   1.00 7.80  ? 88  VAL B O   1 
ATOM   3607 C CB  . VAL B 1 88  ? 51.767  17.800  4.848   1.00 16.33 ? 88  VAL B CB  1 
ATOM   3608 C CG1 . VAL B 1 88  ? 50.260  17.833  4.540   1.00 13.38 ? 88  VAL B CG1 1 
ATOM   3609 C CG2 . VAL B 1 88  ? 52.546  17.110  3.724   1.00 10.34 ? 88  VAL B CG2 1 
ATOM   3610 N N   . ARG B 1 89  ? 50.512  20.730  5.619   1.00 11.77 ? 89  ARG B N   1 
ATOM   3611 C CA  . ARG B 1 89  ? 49.658  21.541  6.486   1.00 15.66 ? 89  ARG B CA  1 
ATOM   3612 C C   . ARG B 1 89  ? 48.199  21.642  6.079   1.00 15.86 ? 89  ARG B C   1 
ATOM   3613 O O   . ARG B 1 89  ? 47.897  21.757  4.899   1.00 17.03 ? 89  ARG B O   1 
ATOM   3614 C CB  . ARG B 1 89  ? 50.196  22.967  6.523   1.00 18.63 ? 89  ARG B CB  1 
ATOM   3615 C CG  . ARG B 1 89  ? 51.083  23.265  7.657   1.00 24.64 ? 89  ARG B CG  1 
ATOM   3616 C CD  . ARG B 1 89  ? 52.055  24.375  7.323   1.00 25.05 ? 89  ARG B CD  1 
ATOM   3617 N NE  . ARG B 1 89  ? 53.250  23.838  6.705   1.00 32.52 ? 89  ARG B NE  1 
ATOM   3618 C CZ  . ARG B 1 89  ? 54.376  24.521  6.536   1.00 32.07 ? 89  ARG B CZ  1 
ATOM   3619 N NH1 . ARG B 1 89  ? 54.454  25.763  6.948   1.00 32.62 ? 89  ARG B NH1 1 
ATOM   3620 N NH2 . ARG B 1 89  ? 55.416  23.957  5.946   1.00 34.48 ? 89  ARG B NH2 1 
ATOM   3621 N N   . LEU B 1 90  ? 47.301  21.644  7.058   1.00 14.49 ? 90  LEU B N   1 
ATOM   3622 C CA  . LEU B 1 90  ? 45.877  21.800  6.790   1.00 13.34 ? 90  LEU B CA  1 
ATOM   3623 C C   . LEU B 1 90  ? 45.466  23.270  6.949   1.00 13.17 ? 90  LEU B C   1 
ATOM   3624 O O   . LEU B 1 90  ? 46.105  24.020  7.683   1.00 14.38 ? 90  LEU B O   1 
ATOM   3625 C CB  . LEU B 1 90  ? 45.062  20.974  7.762   1.00 16.00 ? 90  LEU B CB  1 
ATOM   3626 C CG  . LEU B 1 90  ? 45.080  19.466  7.612   1.00 16.79 ? 90  LEU B CG  1 
ATOM   3627 C CD1 . LEU B 1 90  ? 43.984  18.891  8.493   1.00 15.04 ? 90  LEU B CD1 1 
ATOM   3628 C CD2 . LEU B 1 90  ? 44.815  19.085  6.180   1.00 21.69 ? 90  LEU B CD2 1 
ATOM   3629 N N   . PHE B 1 91  ? 44.394  23.683  6.275   1.00 15.05 ? 91  PHE B N   1 
ATOM   3630 C CA  . PHE B 1 91  ? 43.931  25.071  6.371   1.00 11.04 ? 91  PHE B CA  1 
ATOM   3631 C C   . PHE B 1 91  ? 42.734  25.219  7.288   1.00 11.71 ? 91  PHE B C   1 
ATOM   3632 O O   . PHE B 1 91  ? 41.620  24.857  6.922   1.00 15.76 ? 91  PHE B O   1 
ATOM   3633 C CB  . PHE B 1 91  ? 43.555  25.599  5.002   1.00 11.80 ? 91  PHE B CB  1 
ATOM   3634 C CG  . PHE B 1 91  ? 43.039  26.993  5.024   1.00 9.16  ? 91  PHE B CG  1 
ATOM   3635 C CD1 . PHE B 1 91  ? 43.871  28.039  5.373   1.00 9.95  ? 91  PHE B CD1 1 
ATOM   3636 C CD2 . PHE B 1 91  ? 41.725  27.263  4.688   1.00 9.90  ? 91  PHE B CD2 1 
ATOM   3637 C CE1 . PHE B 1 91  ? 43.401  29.357  5.385   1.00 12.19 ? 91  PHE B CE1 1 
ATOM   3638 C CE2 . PHE B 1 91  ? 41.232  28.571  4.693   1.00 8.63  ? 91  PHE B CE2 1 
ATOM   3639 C CZ  . PHE B 1 91  ? 42.075  29.626  5.046   1.00 12.26 ? 91  PHE B CZ  1 
ATOM   3640 N N   . ARG B 1 92  ? 42.976  25.753  8.473   1.00 10.71 ? 92  ARG B N   1 
ATOM   3641 C CA  . ARG B 1 92  ? 41.925  25.968  9.462   1.00 11.55 ? 92  ARG B CA  1 
ATOM   3642 C C   . ARG B 1 92  ? 41.004  24.746  9.555   1.00 11.69 ? 92  ARG B C   1 
ATOM   3643 O O   . ARG B 1 92  ? 39.791  24.851  9.426   1.00 10.70 ? 92  ARG B O   1 
ATOM   3644 C CB  . ARG B 1 92  ? 41.121  27.215  9.090   1.00 9.50  ? 92  ARG B CB  1 
ATOM   3645 C CG  . ARG B 1 92  ? 41.994  28.417  8.747   1.00 16.23 ? 92  ARG B CG  1 
ATOM   3646 C CD  . ARG B 1 92  ? 41.151  29.689  8.601   1.00 17.79 ? 92  ARG B CD  1 
ATOM   3647 N NE  . ARG B 1 92  ? 40.513  30.054  9.863   1.00 13.91 ? 92  ARG B NE  1 
ATOM   3648 C CZ  . ARG B 1 92  ? 39.824  31.170  10.064  1.00 14.04 ? 92  ARG B CZ  1 
ATOM   3649 N NH1 . ARG B 1 92  ? 39.649  32.056  9.090   1.00 17.47 ? 92  ARG B NH1 1 
ATOM   3650 N NH2 . ARG B 1 92  ? 39.352  31.429  11.266  1.00 15.63 ? 92  ARG B NH2 1 
ATOM   3651 N N   . PRO B 1 93  ? 41.588  23.569  9.819   1.00 11.05 ? 93  PRO B N   1 
ATOM   3652 C CA  . PRO B 1 93  ? 40.876  22.304  9.930   1.00 9.96  ? 93  PRO B CA  1 
ATOM   3653 C C   . PRO B 1 93  ? 39.766  22.338  10.963  1.00 9.89  ? 93  PRO B C   1 
ATOM   3654 O O   . PRO B 1 93  ? 38.786  21.619  10.857  1.00 10.95 ? 93  PRO B O   1 
ATOM   3655 C CB  . PRO B 1 93  ? 41.975  21.325  10.323  1.00 7.83  ? 93  PRO B CB  1 
ATOM   3656 C CG  . PRO B 1 93  ? 43.223  22.022  9.989   1.00 11.00 ? 93  PRO B CG  1 
ATOM   3657 C CD  . PRO B 1 93  ? 42.975  23.419  10.294  1.00 6.70  ? 93  PRO B CD  1 
ATOM   3658 N N   . TRP B 1 94  ? 39.957  23.165  11.977  1.00 11.66 ? 94  TRP B N   1 
ATOM   3659 C CA  . TRP B 1 94  ? 39.003  23.302  13.060  1.00 13.54 ? 94  TRP B CA  1 
ATOM   3660 C C   . TRP B 1 94  ? 37.636  23.775  12.580  1.00 13.57 ? 94  TRP B C   1 
ATOM   3661 O O   . TRP B 1 94  ? 36.619  23.201  12.937  1.00 13.39 ? 94  TRP B O   1 
ATOM   3662 C CB  . TRP B 1 94  ? 39.579  24.263  14.086  1.00 15.49 ? 94  TRP B CB  1 
ATOM   3663 C CG  . TRP B 1 94  ? 41.026  23.991  14.346  1.00 16.05 ? 94  TRP B CG  1 
ATOM   3664 C CD1 . TRP B 1 94  ? 41.548  22.979  15.098  1.00 19.77 ? 94  TRP B CD1 1 
ATOM   3665 C CD2 . TRP B 1 94  ? 42.145  24.721  13.825  1.00 13.42 ? 94  TRP B CD2 1 
ATOM   3666 N NE1 . TRP B 1 94  ? 42.929  23.034  15.079  1.00 20.20 ? 94  TRP B NE1 1 
ATOM   3667 C CE2 . TRP B 1 94  ? 43.319  24.093  14.306  1.00 14.52 ? 94  TRP B CE2 1 
ATOM   3668 C CE3 . TRP B 1 94  ? 42.269  25.842  13.002  1.00 14.36 ? 94  TRP B CE3 1 
ATOM   3669 C CZ2 . TRP B 1 94  ? 44.601  24.549  13.990  1.00 15.74 ? 94  TRP B CZ2 1 
ATOM   3670 C CZ3 . TRP B 1 94  ? 43.539  26.299  12.686  1.00 13.41 ? 94  TRP B CZ3 1 
ATOM   3671 C CH2 . TRP B 1 94  ? 44.693  25.650  13.182  1.00 16.57 ? 94  TRP B CH2 1 
ATOM   3672 N N   . LEU B 1 95  ? 37.607  24.815  11.759  1.00 12.83 ? 95  LEU B N   1 
ATOM   3673 C CA  . LEU B 1 95  ? 36.335  25.313  11.248  1.00 12.47 ? 95  LEU B CA  1 
ATOM   3674 C C   . LEU B 1 95  ? 35.560  24.194  10.534  1.00 14.69 ? 95  LEU B C   1 
ATOM   3675 O O   . LEU B 1 95  ? 34.332  24.143  10.588  1.00 16.92 ? 95  LEU B O   1 
ATOM   3676 C CB  . LEU B 1 95  ? 36.585  26.503  10.318  1.00 10.70 ? 95  LEU B CB  1 
ATOM   3677 C CG  . LEU B 1 95  ? 37.124  27.762  11.037  1.00 13.99 ? 95  LEU B CG  1 
ATOM   3678 C CD1 . LEU B 1 95  ? 37.419  28.866  10.054  1.00 15.34 ? 95  LEU B CD1 1 
ATOM   3679 C CD2 . LEU B 1 95  ? 36.108  28.268  12.052  1.00 15.97 ? 95  LEU B CD2 1 
ATOM   3680 N N   . ASN B 1 96  ? 36.280  23.279  9.895   1.00 16.49 ? 96  ASN B N   1 
ATOM   3681 C CA  . ASN B 1 96  ? 35.655  22.159  9.196   1.00 14.96 ? 96  ASN B CA  1 
ATOM   3682 C C   . ASN B 1 96  ? 35.071  21.160  10.172  1.00 14.41 ? 96  ASN B C   1 
ATOM   3683 O O   . ASN B 1 96  ? 33.971  20.640  9.960   1.00 12.95 ? 96  ASN B O   1 
ATOM   3684 C CB  . ASN B 1 96  ? 36.664  21.461  8.290   1.00 13.61 ? 96  ASN B CB  1 
ATOM   3685 C CG  . ASN B 1 96  ? 36.906  22.216  7.027   1.00 15.56 ? 96  ASN B CG  1 
ATOM   3686 O OD1 . ASN B 1 96  ? 36.075  22.201  6.120   1.00 18.89 ? 96  ASN B OD1 1 
ATOM   3687 N ND2 . ASN B 1 96  ? 38.036  22.899  6.955   1.00 17.87 ? 96  ASN B ND2 1 
ATOM   3688 N N   . MET B 1 97  ? 35.809  20.896  11.244  1.00 13.76 ? 97  MET B N   1 
ATOM   3689 C CA  . MET B 1 97  ? 35.343  19.960  12.249  1.00 12.26 ? 97  MET B CA  1 
ATOM   3690 C C   . MET B 1 97  ? 34.034  20.494  12.829  1.00 14.30 ? 97  MET B C   1 
ATOM   3691 O O   . MET B 1 97  ? 33.056  19.757  12.978  1.00 11.02 ? 97  MET B O   1 
ATOM   3692 C CB  . MET B 1 97  ? 36.408  19.802  13.333  1.00 12.36 ? 97  MET B CB  1 
ATOM   3693 C CG  . MET B 1 97  ? 37.679  19.144  12.839  1.00 6.13  ? 97  MET B CG  1 
ATOM   3694 S SD  . MET B 1 97  ? 37.417  17.414  12.379  1.00 14.43 ? 97  MET B SD  1 
ATOM   3695 C CE  . MET B 1 97  ? 37.200  17.548  10.601  1.00 6.32  ? 97  MET B CE  1 
ATOM   3696 N N   . ASP B 1 98  ? 34.033  21.791  13.143  1.00 15.93 ? 98  ASP B N   1 
ATOM   3697 C CA  . ASP B 1 98  ? 32.858  22.472  13.687  1.00 18.13 ? 98  ASP B CA  1 
ATOM   3698 C C   . ASP B 1 98  ? 31.662  22.228  12.774  1.00 19.52 ? 98  ASP B C   1 
ATOM   3699 O O   . ASP B 1 98  ? 30.608  21.769  13.196  1.00 22.47 ? 98  ASP B O   1 
ATOM   3700 C CB  . ASP B 1 98  ? 33.065  23.998  13.738  1.00 16.96 ? 98  ASP B CB  1 
ATOM   3701 C CG  . ASP B 1 98  ? 34.093  24.431  14.756  1.00 17.80 ? 98  ASP B CG  1 
ATOM   3702 O OD1 . ASP B 1 98  ? 34.396  23.662  15.684  1.00 15.90 ? 98  ASP B OD1 1 
ATOM   3703 O OD2 . ASP B 1 98  ? 34.584  25.564  14.634  1.00 15.83 ? 98  ASP B OD2 1 
ATOM   3704 N N   . ARG B 1 99  ? 31.840  22.582  11.511  1.00 18.65 ? 99  ARG B N   1 
ATOM   3705 C CA  . ARG B 1 99  ? 30.787  22.454  10.529  1.00 17.24 ? 99  ARG B CA  1 
ATOM   3706 C C   . ARG B 1 99  ? 30.313  21.018  10.416  1.00 16.11 ? 99  ARG B C   1 
ATOM   3707 O O   . ARG B 1 99  ? 29.117  20.754  10.370  1.00 17.58 ? 99  ARG B O   1 
ATOM   3708 C CB  . ARG B 1 99  ? 31.287  22.969  9.176   1.00 15.93 ? 99  ARG B CB  1 
ATOM   3709 C CG  . ARG B 1 99  ? 30.191  23.292  8.215   1.00 13.80 ? 99  ARG B CG  1 
ATOM   3710 C CD  . ARG B 1 99  ? 30.698  24.157  7.085   1.00 16.11 ? 99  ARG B CD  1 
ATOM   3711 N NE  . ARG B 1 99  ? 31.703  23.480  6.279   1.00 16.99 ? 99  ARG B NE  1 
ATOM   3712 C CZ  . ARG B 1 99  ? 32.333  24.044  5.270   1.00 14.93 ? 99  ARG B CZ  1 
ATOM   3713 N NH1 . ARG B 1 99  ? 32.061  25.303  4.946   1.00 17.71 ? 99  ARG B NH1 1 
ATOM   3714 N NH2 . ARG B 1 99  ? 33.219  23.347  4.578   1.00 18.55 ? 99  ARG B NH2 1 
ATOM   3715 N N   . MET B 1 100 ? 31.251  20.093  10.372  1.00 15.18 ? 100 MET B N   1 
ATOM   3716 C CA  . MET B 1 100 ? 30.881  18.700  10.266  1.00 15.06 ? 100 MET B CA  1 
ATOM   3717 C C   . MET B 1 100 ? 29.968  18.352  11.429  1.00 16.73 ? 100 MET B C   1 
ATOM   3718 O O   . MET B 1 100 ? 28.884  17.795  11.264  1.00 16.36 ? 100 MET B O   1 
ATOM   3719 C CB  . MET B 1 100 ? 32.125  17.824  10.299  1.00 14.21 ? 100 MET B CB  1 
ATOM   3720 C CG  . MET B 1 100 ? 31.834  16.378  9.965   1.00 16.62 ? 100 MET B CG  1 
ATOM   3721 S SD  . MET B 1 100 ? 33.306  15.356  9.823   1.00 18.40 ? 100 MET B SD  1 
ATOM   3722 C CE  . MET B 1 100 ? 32.566  13.725  9.734   1.00 14.65 ? 100 MET B CE  1 
ATOM   3723 N N   . LEU B 1 101 ? 30.414  18.717  12.618  1.00 16.15 ? 101 LEU B N   1 
ATOM   3724 C CA  . LEU B 1 101 ? 29.648  18.442  13.819  1.00 17.64 ? 101 LEU B CA  1 
ATOM   3725 C C   . LEU B 1 101 ? 28.240  19.022  13.753  1.00 16.07 ? 101 LEU B C   1 
ATOM   3726 O O   . LEU B 1 101 ? 27.279  18.354  14.125  1.00 18.92 ? 101 LEU B O   1 
ATOM   3727 C CB  . LEU B 1 101 ? 30.393  18.973  15.036  1.00 18.34 ? 101 LEU B CB  1 
ATOM   3728 C CG  . LEU B 1 101 ? 30.181  18.173  16.322  1.00 24.48 ? 101 LEU B CG  1 
ATOM   3729 C CD1 . LEU B 1 101 ? 30.205  16.679  16.017  1.00 18.51 ? 101 LEU B CD1 1 
ATOM   3730 C CD2 . LEU B 1 101 ? 31.264  18.532  17.309  1.00 23.17 ? 101 LEU B CD2 1 
ATOM   3731 N N   . ARG B 1 102 ? 28.113  20.250  13.263  1.00 14.34 ? 102 ARG B N   1 
ATOM   3732 C CA  . ARG B 1 102 ? 26.808  20.880  13.162  1.00 13.10 ? 102 ARG B CA  1 
ATOM   3733 C C   . ARG B 1 102 ? 25.900  20.108  12.199  1.00 13.27 ? 102 ARG B C   1 
ATOM   3734 O O   . ARG B 1 102 ? 24.735  19.873  12.502  1.00 15.01 ? 102 ARG B O   1 
ATOM   3735 C CB  . ARG B 1 102 ? 26.943  22.328  12.698  1.00 18.10 ? 102 ARG B CB  1 
ATOM   3736 C CG  . ARG B 1 102 ? 27.564  23.291  13.717  1.00 21.82 ? 102 ARG B CG  1 
ATOM   3737 C CD  . ARG B 1 102 ? 27.178  24.729  13.336  1.00 28.84 ? 102 ARG B CD  1 
ATOM   3738 N NE  . ARG B 1 102 ? 27.439  25.009  11.918  1.00 31.81 ? 102 ARG B NE  1 
ATOM   3739 C CZ  . ARG B 1 102 ? 26.530  25.418  11.026  1.00 33.30 ? 102 ARG B CZ  1 
ATOM   3740 N NH1 . ARG B 1 102 ? 25.248  25.627  11.371  1.00 33.62 ? 102 ARG B NH1 1 
ATOM   3741 N NH2 . ARG B 1 102 ? 26.906  25.590  9.765   1.00 32.60 ? 102 ARG B NH2 1 
ATOM   3742 N N   . SER B 1 103 ? 26.433  19.713  11.048  1.00 9.99  ? 103 SER B N   1 
ATOM   3743 C CA  . SER B 1 103 ? 25.667  18.932  10.080  1.00 12.73 ? 103 SER B CA  1 
ATOM   3744 C C   . SER B 1 103 ? 25.219  17.618  10.753  1.00 15.23 ? 103 SER B C   1 
ATOM   3745 O O   . SER B 1 103 ? 24.063  17.221  10.659  1.00 14.61 ? 103 SER B O   1 
ATOM   3746 C CB  . SER B 1 103 ? 26.537  18.601  8.876   1.00 13.13 ? 103 SER B CB  1 
ATOM   3747 O OG  . SER B 1 103 ? 27.194  19.762  8.392   1.00 15.17 ? 103 SER B OG  1 
ATOM   3748 N N   . ALA B 1 104 ? 26.162  16.970  11.437  1.00 12.42 ? 104 ALA B N   1 
ATOM   3749 C CA  . ALA B 1 104 ? 25.910  15.739  12.137  1.00 11.33 ? 104 ALA B CA  1 
ATOM   3750 C C   . ALA B 1 104 ? 24.691  15.844  13.066  1.00 12.78 ? 104 ALA B C   1 
ATOM   3751 O O   . ALA B 1 104 ? 23.925  14.893  13.199  1.00 14.08 ? 104 ALA B O   1 
ATOM   3752 C CB  . ALA B 1 104 ? 27.131  15.369  12.938  1.00 14.01 ? 104 ALA B CB  1 
ATOM   3753 N N   . MET B 1 105 ? 24.522  16.997  13.704  1.00 12.67 ? 105 MET B N   1 
ATOM   3754 C CA  . MET B 1 105 ? 23.430  17.207  14.634  1.00 12.94 ? 105 MET B CA  1 
ATOM   3755 C C   . MET B 1 105 ? 22.121  17.448  13.933  1.00 13.24 ? 105 MET B C   1 
ATOM   3756 O O   . MET B 1 105 ? 21.068  17.064  14.424  1.00 14.24 ? 105 MET B O   1 
ATOM   3757 C CB  . MET B 1 105 ? 23.735  18.390  15.566  1.00 18.51 ? 105 MET B CB  1 
ATOM   3758 C CG  . MET B 1 105 ? 25.037  18.255  16.363  1.00 21.35 ? 105 MET B CG  1 
ATOM   3759 S SD  . MET B 1 105 ? 25.222  16.561  17.060  1.00 29.43 ? 105 MET B SD  1 
ATOM   3760 C CE  . MET B 1 105 ? 23.841  16.592  18.249  1.00 31.30 ? 105 MET B CE  1 
ATOM   3761 N N   . ARG B 1 106 ? 22.180  18.080  12.775  1.00 13.67 ? 106 ARG B N   1 
ATOM   3762 C CA  . ARG B 1 106 ? 20.966  18.365  12.044  1.00 14.01 ? 106 ARG B CA  1 
ATOM   3763 C C   . ARG B 1 106 ? 20.267  17.104  11.523  1.00 12.58 ? 106 ARG B C   1 
ATOM   3764 O O   . ARG B 1 106 ? 19.050  17.074  11.326  1.00 14.30 ? 106 ARG B O   1 
ATOM   3765 C CB  . ARG B 1 106 ? 21.285  19.326  10.898  1.00 15.46 ? 106 ARG B CB  1 
ATOM   3766 C CG  . ARG B 1 106 ? 20.061  19.815  10.186  1.00 19.07 ? 106 ARG B CG  1 
ATOM   3767 C CD  . ARG B 1 106 ? 18.954  20.019  11.182  1.00 22.60 ? 106 ARG B CD  1 
ATOM   3768 N NE  . ARG B 1 106 ? 17.688  19.498  10.677  1.00 25.24 ? 106 ARG B NE  1 
ATOM   3769 C CZ  . ARG B 1 106 ? 17.052  20.052  9.665   1.00 23.91 ? 106 ARG B CZ  1 
ATOM   3770 N NH1 . ARG B 1 106 ? 17.568  21.115  9.074   1.00 28.04 ? 106 ARG B NH1 1 
ATOM   3771 N NH2 . ARG B 1 106 ? 15.912  19.563  9.249   1.00 24.97 ? 106 ARG B NH2 1 
ATOM   3772 N N   . LEU B 1 107 ? 21.046  16.053  11.337  1.00 11.02 ? 107 LEU B N   1 
ATOM   3773 C CA  . LEU B 1 107 ? 20.533  14.805  10.814  1.00 10.85 ? 107 LEU B CA  1 
ATOM   3774 C C   . LEU B 1 107 ? 20.435  13.733  11.877  1.00 12.17 ? 107 LEU B C   1 
ATOM   3775 O O   . LEU B 1 107 ? 20.261  12.554  11.572  1.00 10.43 ? 107 LEU B O   1 
ATOM   3776 C CB  . LEU B 1 107 ? 21.438  14.318  9.682   1.00 10.98 ? 107 LEU B CB  1 
ATOM   3777 C CG  . LEU B 1 107 ? 21.496  15.176  8.416   1.00 8.90  ? 107 LEU B CG  1 
ATOM   3778 C CD1 . LEU B 1 107 ? 22.292  14.460  7.352   1.00 5.04  ? 107 LEU B CD1 1 
ATOM   3779 C CD2 . LEU B 1 107 ? 20.105  15.427  7.906   1.00 4.45  ? 107 LEU B CD2 1 
ATOM   3780 N N   . CYS B 1 108 ? 20.548  14.154  13.129  1.00 14.41 ? 108 CYS B N   1 
ATOM   3781 C CA  . CYS B 1 108 ? 20.490  13.256  14.279  1.00 17.08 ? 108 CYS B CA  1 
ATOM   3782 C C   . CYS B 1 108 ? 21.524  12.152  14.241  1.00 17.20 ? 108 CYS B C   1 
ATOM   3783 O O   . CYS B 1 108 ? 21.278  11.059  14.728  1.00 17.33 ? 108 CYS B O   1 
ATOM   3784 C CB  . CYS B 1 108 ? 19.103  12.624  14.423  1.00 18.56 ? 108 CYS B CB  1 
ATOM   3785 S SG  . CYS B 1 108 ? 17.812  13.809  14.618  1.00 22.76 ? 108 CYS B SG  1 
ATOM   3786 N N   . LEU B 1 109 ? 22.677  12.428  13.653  1.00 16.93 ? 109 LEU B N   1 
ATOM   3787 C CA  . LEU B 1 109 ? 23.740  11.443  13.626  1.00 17.78 ? 109 LEU B CA  1 
ATOM   3788 C C   . LEU B 1 109 ? 24.548  11.610  14.919  1.00 18.64 ? 109 LEU B C   1 
ATOM   3789 O O   . LEU B 1 109 ? 24.454  12.645  15.579  1.00 22.88 ? 109 LEU B O   1 
ATOM   3790 C CB  . LEU B 1 109 ? 24.593  11.649  12.383  1.00 17.56 ? 109 LEU B CB  1 
ATOM   3791 C CG  . LEU B 1 109 ? 23.981  10.889  11.214  1.00 17.43 ? 109 LEU B CG  1 
ATOM   3792 C CD1 . LEU B 1 109 ? 24.568  11.397  9.909   1.00 15.87 ? 109 LEU B CD1 1 
ATOM   3793 C CD2 . LEU B 1 109 ? 24.223  9.384   11.403  1.00 14.96 ? 109 LEU B CD2 1 
ATOM   3794 N N   . PRO B 1 110 ? 25.350  10.602  15.305  1.00 17.74 ? 110 PRO B N   1 
ATOM   3795 C CA  . PRO B 1 110 ? 26.123  10.731  16.543  1.00 17.21 ? 110 PRO B CA  1 
ATOM   3796 C C   . PRO B 1 110 ? 27.206  11.798  16.503  1.00 17.60 ? 110 PRO B C   1 
ATOM   3797 O O   . PRO B 1 110 ? 27.847  12.002  15.467  1.00 19.18 ? 110 PRO B O   1 
ATOM   3798 C CB  . PRO B 1 110 ? 26.704  9.336   16.725  1.00 15.01 ? 110 PRO B CB  1 
ATOM   3799 C CG  . PRO B 1 110 ? 27.031  8.968   15.326  1.00 19.42 ? 110 PRO B CG  1 
ATOM   3800 C CD  . PRO B 1 110 ? 25.776  9.409   14.558  1.00 19.07 ? 110 PRO B CD  1 
ATOM   3801 N N   . SER B 1 111 ? 27.396  12.477  17.636  1.00 16.83 ? 111 SER B N   1 
ATOM   3802 C CA  . SER B 1 111 ? 28.429  13.491  17.755  1.00 17.45 ? 111 SER B CA  1 
ATOM   3803 C C   . SER B 1 111 ? 29.731  12.773  18.080  1.00 19.72 ? 111 SER B C   1 
ATOM   3804 O O   . SER B 1 111 ? 29.740  11.568  18.339  1.00 20.11 ? 111 SER B O   1 
ATOM   3805 C CB  . SER B 1 111 ? 28.096  14.510  18.854  1.00 16.91 ? 111 SER B CB  1 
ATOM   3806 O OG  . SER B 1 111 ? 27.972  13.927  20.147  1.00 19.55 ? 111 SER B OG  1 
ATOM   3807 N N   . PHE B 1 112 ? 30.828  13.523  18.059  1.00 20.22 ? 112 PHE B N   1 
ATOM   3808 C CA  . PHE B 1 112 ? 32.159  12.993  18.333  1.00 18.31 ? 112 PHE B CA  1 
ATOM   3809 C C   . PHE B 1 112 ? 33.053  14.197  18.703  1.00 19.19 ? 112 PHE B C   1 
ATOM   3810 O O   . PHE B 1 112 ? 32.642  15.340  18.539  1.00 16.41 ? 112 PHE B O   1 
ATOM   3811 C CB  . PHE B 1 112 ? 32.664  12.294  17.082  1.00 15.92 ? 112 PHE B CB  1 
ATOM   3812 C CG  . PHE B 1 112 ? 32.671  13.174  15.886  1.00 13.53 ? 112 PHE B CG  1 
ATOM   3813 C CD1 . PHE B 1 112 ? 33.607  14.186  15.774  1.00 10.51 ? 112 PHE B CD1 1 
ATOM   3814 C CD2 . PHE B 1 112 ? 31.683  13.057  14.923  1.00 15.70 ? 112 PHE B CD2 1 
ATOM   3815 C CE1 . PHE B 1 112 ? 33.563  15.084  14.737  1.00 11.07 ? 112 PHE B CE1 1 
ATOM   3816 C CE2 . PHE B 1 112 ? 31.626  13.947  13.869  1.00 15.56 ? 112 PHE B CE2 1 
ATOM   3817 C CZ  . PHE B 1 112 ? 32.574  14.975  13.776  1.00 16.50 ? 112 PHE B CZ  1 
ATOM   3818 N N   . ASP B 1 113 ? 34.260  13.942  19.201  1.00 21.63 ? 113 ASP B N   1 
ATOM   3819 C CA  . ASP B 1 113 ? 35.160  15.027  19.597  1.00 23.30 ? 113 ASP B CA  1 
ATOM   3820 C C   . ASP B 1 113 ? 36.024  15.492  18.455  1.00 22.39 ? 113 ASP B C   1 
ATOM   3821 O O   . ASP B 1 113 ? 36.824  14.729  17.920  1.00 20.14 ? 113 ASP B O   1 
ATOM   3822 C CB  . ASP B 1 113 ? 36.047  14.606  20.773  1.00 25.14 ? 113 ASP B CB  1 
ATOM   3823 C CG  . ASP B 1 113 ? 35.247  14.389  22.053  1.00 31.79 ? 113 ASP B CG  1 
ATOM   3824 O OD1 . ASP B 1 113 ? 35.861  13.897  23.039  1.00 31.79 ? 113 ASP B OD1 1 
ATOM   3825 O OD2 . ASP B 1 113 ? 34.015  14.712  22.065  1.00 29.34 ? 113 ASP B OD2 1 
ATOM   3826 N N   . LYS B 1 114 ? 35.846  16.773  18.123  1.00 22.15 ? 114 LYS B N   1 
ATOM   3827 C CA  . LYS B 1 114 ? 36.524  17.459  17.022  1.00 20.03 ? 114 LYS B CA  1 
ATOM   3828 C C   . LYS B 1 114 ? 38.003  17.251  16.943  1.00 17.74 ? 114 LYS B C   1 
ATOM   3829 O O   . LYS B 1 114 ? 38.549  17.046  15.863  1.00 18.87 ? 114 LYS B O   1 
ATOM   3830 C CB  . LYS B 1 114 ? 36.255  18.965  17.094  1.00 17.61 ? 114 LYS B CB  1 
ATOM   3831 C CG  . LYS B 1 114 ? 34.830  19.350  16.824  1.00 21.29 ? 114 LYS B CG  1 
ATOM   3832 C CD  . LYS B 1 114 ? 34.520  20.722  17.392  1.00 22.96 ? 114 LYS B CD  1 
ATOM   3833 C CE  . LYS B 1 114 ? 33.042  21.045  17.282  1.00 26.44 ? 114 LYS B CE  1 
ATOM   3834 N NZ  . LYS B 1 114 ? 32.655  22.222  18.121  1.00 28.19 ? 114 LYS B NZ  1 
ATOM   3835 N N   . LEU B 1 115 ? 38.647  17.341  18.097  1.00 18.19 ? 115 LEU B N   1 
ATOM   3836 C CA  . LEU B 1 115 ? 40.086  17.184  18.207  1.00 16.83 ? 115 LEU B CA  1 
ATOM   3837 C C   . LEU B 1 115 ? 40.554  15.767  17.893  1.00 16.45 ? 115 LEU B C   1 
ATOM   3838 O O   . LEU B 1 115 ? 41.606  15.557  17.294  1.00 13.15 ? 115 LEU B O   1 
ATOM   3839 C CB  . LEU B 1 115 ? 40.515  17.571  19.621  1.00 16.71 ? 115 LEU B CB  1 
ATOM   3840 C CG  . LEU B 1 115 ? 40.809  19.053  19.828  1.00 17.94 ? 115 LEU B CG  1 
ATOM   3841 C CD1 . LEU B 1 115 ? 39.824  19.919  19.084  1.00 20.30 ? 115 LEU B CD1 1 
ATOM   3842 C CD2 . LEU B 1 115 ? 40.784  19.334  21.309  1.00 17.12 ? 115 LEU B CD2 1 
ATOM   3843 N N   . GLU B 1 116 ? 39.762  14.791  18.313  1.00 16.53 ? 116 GLU B N   1 
ATOM   3844 C CA  . GLU B 1 116 ? 40.107  13.395  18.085  1.00 17.44 ? 116 GLU B CA  1 
ATOM   3845 C C   . GLU B 1 116 ? 40.024  13.081  16.595  1.00 17.01 ? 116 GLU B C   1 
ATOM   3846 O O   . GLU B 1 116 ? 40.880  12.396  16.031  1.00 16.95 ? 116 GLU B O   1 
ATOM   3847 C CB  . GLU B 1 116 ? 39.148  12.491  18.866  1.00 18.52 ? 116 GLU B CB  1 
ATOM   3848 C CG  . GLU B 1 116 ? 39.145  12.722  20.369  1.00 15.70 ? 116 GLU B CG  1 
ATOM   3849 C CD  . GLU B 1 116 ? 40.449  12.314  21.009  1.00 17.94 ? 116 GLU B CD  1 
ATOM   3850 O OE1 . GLU B 1 116 ? 41.140  11.437  20.464  1.00 12.34 ? 116 GLU B OE1 1 
ATOM   3851 O OE2 . GLU B 1 116 ? 40.767  12.863  22.078  1.00 22.37 ? 116 GLU B OE2 1 
ATOM   3852 N N   . LEU B 1 117 ? 38.979  13.589  15.954  1.00 16.86 ? 117 LEU B N   1 
ATOM   3853 C CA  . LEU B 1 117 ? 38.821  13.339  14.539  1.00 14.67 ? 117 LEU B CA  1 
ATOM   3854 C C   . LEU B 1 117 ? 39.964  14.017  13.808  1.00 13.35 ? 117 LEU B C   1 
ATOM   3855 O O   . LEU B 1 117 ? 40.583  13.428  12.931  1.00 14.24 ? 117 LEU B O   1 
ATOM   3856 C CB  . LEU B 1 117 ? 37.470  13.866  14.034  1.00 10.90 ? 117 LEU B CB  1 
ATOM   3857 C CG  . LEU B 1 117 ? 37.242  13.641  12.526  1.00 11.42 ? 117 LEU B CG  1 
ATOM   3858 C CD1 . LEU B 1 117 ? 37.466  12.167  12.179  1.00 7.07  ? 117 LEU B CD1 1 
ATOM   3859 C CD2 . LEU B 1 117 ? 35.830  14.098  12.130  1.00 6.62  ? 117 LEU B CD2 1 
ATOM   3860 N N   . LEU B 1 118 ? 40.252  15.253  14.195  1.00 13.05 ? 118 LEU B N   1 
ATOM   3861 C CA  . LEU B 1 118 ? 41.306  16.005  13.545  1.00 12.50 ? 118 LEU B CA  1 
ATOM   3862 C C   . LEU B 1 118 ? 42.637  15.277  13.669  1.00 9.93  ? 118 LEU B C   1 
ATOM   3863 O O   . LEU B 1 118 ? 43.368  15.149  12.697  1.00 8.03  ? 118 LEU B O   1 
ATOM   3864 C CB  . LEU B 1 118 ? 41.402  17.436  14.115  1.00 16.18 ? 118 LEU B CB  1 
ATOM   3865 C CG  . LEU B 1 118 ? 42.487  18.321  13.456  1.00 13.46 ? 118 LEU B CG  1 
ATOM   3866 C CD1 . LEU B 1 118 ? 42.361  18.221  11.948  1.00 13.35 ? 118 LEU B CD1 1 
ATOM   3867 C CD2 . LEU B 1 118 ? 42.387  19.761  13.908  1.00 11.21 ? 118 LEU B CD2 1 
ATOM   3868 N N   . GLU B 1 119 ? 42.936  14.778  14.860  1.00 11.06 ? 119 GLU B N   1 
ATOM   3869 C CA  . GLU B 1 119 ? 44.179  14.052  15.056  1.00 11.39 ? 119 GLU B CA  1 
ATOM   3870 C C   . GLU B 1 119 ? 44.166  12.809  14.170  1.00 13.67 ? 119 GLU B C   1 
ATOM   3871 O O   . GLU B 1 119 ? 45.149  12.512  13.490  1.00 13.18 ? 119 GLU B O   1 
ATOM   3872 C CB  . GLU B 1 119 ? 44.345  13.653  16.519  1.00 8.71  ? 119 GLU B CB  1 
ATOM   3873 C CG  . GLU B 1 119 ? 45.524  12.708  16.812  1.00 11.24 ? 119 GLU B CG  1 
ATOM   3874 C CD  . GLU B 1 119 ? 46.896  13.307  16.509  1.00 13.33 ? 119 GLU B CD  1 
ATOM   3875 O OE1 . GLU B 1 119 ? 47.897  12.569  16.604  1.00 15.80 ? 119 GLU B OE1 1 
ATOM   3876 O OE2 . GLU B 1 119 ? 46.979  14.506  16.178  1.00 15.22 ? 119 GLU B OE2 1 
ATOM   3877 N N   . CYS B 1 120 ? 43.039  12.095  14.170  1.00 15.32 ? 120 CYS B N   1 
ATOM   3878 C CA  . CYS B 1 120 ? 42.928  10.894  13.368  1.00 15.67 ? 120 CYS B CA  1 
ATOM   3879 C C   . CYS B 1 120 ? 43.217  11.237  11.911  1.00 16.23 ? 120 CYS B C   1 
ATOM   3880 O O   . CYS B 1 120 ? 43.958  10.521  11.225  1.00 16.11 ? 120 CYS B O   1 
ATOM   3881 C CB  . CYS B 1 120 ? 41.534  10.267  13.522  1.00 15.86 ? 120 CYS B CB  1 
ATOM   3882 S SG  . CYS B 1 120 ? 41.238  9.435   15.118  1.00 18.30 ? 120 CYS B SG  1 
ATOM   3883 N N   . ILE B 1 121 ? 42.638  12.338  11.444  1.00 16.46 ? 121 ILE B N   1 
ATOM   3884 C CA  . ILE B 1 121 ? 42.863  12.778  10.066  1.00 15.79 ? 121 ILE B CA  1 
ATOM   3885 C C   . ILE B 1 121 ? 44.358  13.072  9.867   1.00 13.69 ? 121 ILE B C   1 
ATOM   3886 O O   . ILE B 1 121 ? 44.942  12.666  8.866   1.00 13.26 ? 121 ILE B O   1 
ATOM   3887 C CB  . ILE B 1 121 ? 41.982  14.028  9.721   1.00 9.42  ? 121 ILE B CB  1 
ATOM   3888 C CG1 . ILE B 1 121 ? 40.525  13.590  9.583   1.00 11.23 ? 121 ILE B CG1 1 
ATOM   3889 C CG2 . ILE B 1 121 ? 42.444  14.681  8.431   1.00 9.72  ? 121 ILE B CG2 1 
ATOM   3890 C CD1 . ILE B 1 121 ? 39.539  14.719  9.496   1.00 7.31  ? 121 ILE B CD1 1 
ATOM   3891 N N   . ARG B 1 122 ? 44.969  13.732  10.846  1.00 14.41 ? 122 ARG B N   1 
ATOM   3892 C CA  . ARG B 1 122 ? 46.392  14.057  10.786  1.00 15.68 ? 122 ARG B CA  1 
ATOM   3893 C C   . ARG B 1 122 ? 47.243  12.802  10.699  1.00 17.33 ? 122 ARG B C   1 
ATOM   3894 O O   . ARG B 1 122 ? 48.294  12.791  10.050  1.00 20.46 ? 122 ARG B O   1 
ATOM   3895 C CB  . ARG B 1 122 ? 46.830  14.851  12.013  1.00 16.57 ? 122 ARG B CB  1 
ATOM   3896 C CG  . ARG B 1 122 ? 48.234  15.439  11.881  1.00 13.91 ? 122 ARG B CG  1 
ATOM   3897 C CD  . ARG B 1 122 ? 48.752  15.928  13.222  1.00 9.19  ? 122 ARG B CD  1 
ATOM   3898 N NE  . ARG B 1 122 ? 48.953  14.815  14.144  1.00 11.59 ? 122 ARG B NE  1 
ATOM   3899 C CZ  . ARG B 1 122 ? 49.859  13.859  13.971  1.00 16.54 ? 122 ARG B CZ  1 
ATOM   3900 N NH1 . ARG B 1 122 ? 50.646  13.899  12.907  1.00 20.80 ? 122 ARG B NH1 1 
ATOM   3901 N NH2 . ARG B 1 122 ? 49.975  12.859  14.846  1.00 14.54 ? 122 ARG B NH2 1 
ATOM   3902 N N   . ARG B 1 123 ? 46.781  11.741  11.347  1.00 16.35 ? 123 ARG B N   1 
ATOM   3903 C CA  . ARG B 1 123 ? 47.507  10.471  11.336  1.00 16.76 ? 123 ARG B CA  1 
ATOM   3904 C C   . ARG B 1 123 ? 47.377  9.800   9.975   1.00 16.19 ? 123 ARG B C   1 
ATOM   3905 O O   . ARG B 1 123 ? 48.339  9.245   9.450   1.00 13.04 ? 123 ARG B O   1 
ATOM   3906 C CB  . ARG B 1 123 ? 46.969  9.532   12.427  1.00 17.37 ? 123 ARG B CB  1 
ATOM   3907 C CG  . ARG B 1 123 ? 47.259  9.942   13.860  1.00 14.63 ? 123 ARG B CG  1 
ATOM   3908 C CD  . ARG B 1 123 ? 48.726  10.075  14.108  1.00 23.29 ? 123 ARG B CD  1 
ATOM   3909 N NE  . ARG B 1 123 ? 49.444  8.891   14.574  1.00 23.18 ? 123 ARG B NE  1 
ATOM   3910 C CZ  . ARG B 1 123 ? 49.249  7.649   14.151  1.00 27.92 ? 123 ARG B CZ  1 
ATOM   3911 N NH1 . ARG B 1 123 ? 48.335  7.378   13.246  1.00 36.08 ? 123 ARG B NH1 1 
ATOM   3912 N NH2 . ARG B 1 123 ? 50.009  6.663   14.586  1.00 29.05 ? 123 ARG B NH2 1 
ATOM   3913 N N   . LEU B 1 124 ? 46.172  9.853   9.416   1.00 16.71 ? 124 LEU B N   1 
ATOM   3914 C CA  . LEU B 1 124 ? 45.907  9.252   8.110   1.00 18.28 ? 124 LEU B CA  1 
ATOM   3915 C C   . LEU B 1 124 ? 46.703  9.957   6.995   1.00 20.38 ? 124 LEU B C   1 
ATOM   3916 O O   . LEU B 1 124 ? 47.260  9.313   6.099   1.00 22.64 ? 124 LEU B O   1 
ATOM   3917 C CB  . LEU B 1 124 ? 44.419  9.338   7.787   1.00 13.10 ? 124 LEU B CB  1 
ATOM   3918 C CG  . LEU B 1 124 ? 44.089  8.991   6.330   1.00 11.55 ? 124 LEU B CG  1 
ATOM   3919 C CD1 . LEU B 1 124 ? 44.225  7.497   6.135   1.00 2.50  ? 124 LEU B CD1 1 
ATOM   3920 C CD2 . LEU B 1 124 ? 42.678  9.447   5.981   1.00 6.09  ? 124 LEU B CD2 1 
ATOM   3921 N N   . ILE B 1 125 ? 46.731  11.282  7.049   1.00 19.61 ? 125 ILE B N   1 
ATOM   3922 C CA  . ILE B 1 125 ? 47.445  12.061  6.064   1.00 17.82 ? 125 ILE B CA  1 
ATOM   3923 C C   . ILE B 1 125 ? 48.927  11.772  6.218   1.00 19.91 ? 125 ILE B C   1 
ATOM   3924 O O   . ILE B 1 125 ? 49.667  11.672  5.235   1.00 20.43 ? 125 ILE B O   1 
ATOM   3925 C CB  . ILE B 1 125 ? 47.155  13.540  6.256   1.00 12.69 ? 125 ILE B CB  1 
ATOM   3926 C CG1 . ILE B 1 125 ? 45.677  13.778  5.972   1.00 11.81 ? 125 ILE B CG1 1 
ATOM   3927 C CG2 . ILE B 1 125 ? 48.052  14.378  5.358   1.00 14.72 ? 125 ILE B CG2 1 
ATOM   3928 C CD1 . ILE B 1 125 ? 45.223  15.226  6.119   1.00 11.78 ? 125 ILE B CD1 1 
ATOM   3929 N N   . GLU B 1 126 ? 49.346  11.605  7.463   1.00 19.84 ? 126 GLU B N   1 
ATOM   3930 C CA  . GLU B 1 126 ? 50.739  11.294  7.752   1.00 18.45 ? 126 GLU B CA  1 
ATOM   3931 C C   . GLU B 1 126 ? 51.089  10.018  7.044   1.00 16.68 ? 126 GLU B C   1 
ATOM   3932 O O   . GLU B 1 126 ? 52.136  9.901   6.401   1.00 18.48 ? 126 GLU B O   1 
ATOM   3933 C CB  . GLU B 1 126 ? 50.943  11.103  9.254   1.00 18.99 ? 126 GLU B CB  1 
ATOM   3934 C CG  . GLU B 1 126 ? 52.368  10.745  9.653   1.00 21.04 ? 126 GLU B CG  1 
ATOM   3935 C CD  . GLU B 1 126 ? 52.711  11.191  11.064  1.00 23.30 ? 126 GLU B CD  1 
ATOM   3936 O OE1 . GLU B 1 126 ? 52.203  10.568  12.032  1.00 20.01 ? 126 GLU B OE1 1 
ATOM   3937 O OE2 . GLU B 1 126 ? 53.497  12.178  11.185  1.00 30.17 ? 126 GLU B OE2 1 
ATOM   3938 N N   . VAL B 1 127 ? 50.206  9.044   7.172   1.00 19.05 ? 127 VAL B N   1 
ATOM   3939 C CA  . VAL B 1 127 ? 50.447  7.752   6.551   1.00 18.27 ? 127 VAL B CA  1 
ATOM   3940 C C   . VAL B 1 127 ? 50.563  7.842   5.038   1.00 19.06 ? 127 VAL B C   1 
ATOM   3941 O O   . VAL B 1 127 ? 51.392  7.165   4.453   1.00 19.40 ? 127 VAL B O   1 
ATOM   3942 C CB  . VAL B 1 127 ? 49.370  6.748   6.968   1.00 19.18 ? 127 VAL B CB  1 
ATOM   3943 C CG1 . VAL B 1 127 ? 49.344  5.553   6.009   1.00 21.68 ? 127 VAL B CG1 1 
ATOM   3944 C CG2 . VAL B 1 127 ? 49.674  6.270   8.387   1.00 20.10 ? 127 VAL B CG2 1 
ATOM   3945 N N   . ASP B 1 128 ? 49.735  8.666   4.403   1.00 20.59 ? 128 ASP B N   1 
ATOM   3946 C CA  . ASP B 1 128 ? 49.810  8.821   2.950   1.00 21.07 ? 128 ASP B CA  1 
ATOM   3947 C C   . ASP B 1 128 ? 50.577  10.080  2.555   1.00 22.92 ? 128 ASP B C   1 
ATOM   3948 O O   . ASP B 1 128 ? 50.374  10.619  1.469   1.00 25.38 ? 128 ASP B O   1 
ATOM   3949 C CB  . ASP B 1 128 ? 48.420  8.893   2.357   1.00 19.86 ? 128 ASP B CB  1 
ATOM   3950 C CG  . ASP B 1 128 ? 47.843  7.528   2.086   1.00 21.40 ? 128 ASP B CG  1 
ATOM   3951 O OD1 . ASP B 1 128 ? 48.639  6.564   2.036   1.00 22.71 ? 128 ASP B OD1 1 
ATOM   3952 O OD2 . ASP B 1 128 ? 46.608  7.429   1.908   1.00 14.53 ? 128 ASP B OD2 1 
ATOM   3953 N N   . LYS B 1 129 ? 51.454  10.532  3.449   1.00 22.98 ? 129 LYS B N   1 
ATOM   3954 C CA  . LYS B 1 129 ? 52.253  11.740  3.273   1.00 21.58 ? 129 LYS B CA  1 
ATOM   3955 C C   . LYS B 1 129 ? 52.775  11.956  1.848   1.00 22.05 ? 129 LYS B C   1 
ATOM   3956 O O   . LYS B 1 129 ? 52.759  13.075  1.327   1.00 21.16 ? 129 LYS B O   1 
ATOM   3957 C CB  . LYS B 1 129 ? 53.431  11.695  4.247   1.00 23.73 ? 129 LYS B CB  1 
ATOM   3958 C CG  . LYS B 1 129 ? 53.741  13.008  4.968   1.00 29.63 ? 129 LYS B CG  1 
ATOM   3959 C CD  . LYS B 1 129 ? 53.064  13.103  6.349   1.00 30.75 ? 129 LYS B CD  1 
ATOM   3960 C CE  . LYS B 1 129 ? 53.791  14.117  7.276   1.00 31.32 ? 129 LYS B CE  1 
ATOM   3961 N NZ  . LYS B 1 129 ? 55.166  13.689  7.714   1.00 30.76 ? 129 LYS B NZ  1 
ATOM   3962 N N   . ASP B 1 130 ? 53.238  10.872  1.232   1.00 20.99 ? 130 ASP B N   1 
ATOM   3963 C CA  . ASP B 1 130 ? 53.801  10.891  -0.116  1.00 20.55 ? 130 ASP B CA  1 
ATOM   3964 C C   . ASP B 1 130 ? 52.790  11.197  -1.209  1.00 20.59 ? 130 ASP B C   1 
ATOM   3965 O O   . ASP B 1 130 ? 53.152  11.466  -2.358  1.00 21.46 ? 130 ASP B O   1 
ATOM   3966 C CB  . ASP B 1 130 ? 54.466  9.537   -0.413  1.00 22.49 ? 130 ASP B CB  1 
ATOM   3967 C CG  . ASP B 1 130 ? 55.688  9.286   0.462   1.00 19.60 ? 130 ASP B CG  1 
ATOM   3968 O OD1 . ASP B 1 130 ? 56.164  8.143   0.551   1.00 16.27 ? 130 ASP B OD1 1 
ATOM   3969 O OD2 . ASP B 1 130 ? 56.172  10.256  1.061   1.00 24.64 ? 130 ASP B OD2 1 
ATOM   3970 N N   . TRP B 1 131 ? 51.520  11.145  -0.861  1.00 17.44 ? 131 TRP B N   1 
ATOM   3971 C CA  . TRP B 1 131 ? 50.505  11.421  -1.841  1.00 17.45 ? 131 TRP B CA  1 
ATOM   3972 C C   . TRP B 1 131 ? 50.206  12.908  -2.010  1.00 17.65 ? 131 TRP B C   1 
ATOM   3973 O O   . TRP B 1 131 ? 49.499  13.299  -2.938  1.00 18.40 ? 131 TRP B O   1 
ATOM   3974 C CB  . TRP B 1 131 ? 49.237  10.670  -1.485  1.00 16.70 ? 131 TRP B CB  1 
ATOM   3975 C CG  . TRP B 1 131 ? 49.328  9.212   -1.764  1.00 14.95 ? 131 TRP B CG  1 
ATOM   3976 C CD1 . TRP B 1 131 ? 49.717  8.220   -0.898  1.00 11.51 ? 131 TRP B CD1 1 
ATOM   3977 C CD2 . TRP B 1 131 ? 48.976  8.564   -2.990  1.00 13.49 ? 131 TRP B CD2 1 
ATOM   3978 N NE1 . TRP B 1 131 ? 49.612  6.995   -1.515  1.00 12.96 ? 131 TRP B NE1 1 
ATOM   3979 C CE2 . TRP B 1 131 ? 49.162  7.176   -2.797  1.00 10.22 ? 131 TRP B CE2 1 
ATOM   3980 C CE3 . TRP B 1 131 ? 48.516  9.021   -4.233  1.00 11.63 ? 131 TRP B CE3 1 
ATOM   3981 C CZ2 . TRP B 1 131 ? 48.903  6.241   -3.800  1.00 6.26  ? 131 TRP B CZ2 1 
ATOM   3982 C CZ3 . TRP B 1 131 ? 48.255  8.084   -5.235  1.00 13.64 ? 131 TRP B CZ3 1 
ATOM   3983 C CH2 . TRP B 1 131 ? 48.452  6.708   -5.007  1.00 8.68  ? 131 TRP B CH2 1 
ATOM   3984 N N   . VAL B 1 132 ? 50.730  13.741  -1.122  1.00 17.17 ? 132 VAL B N   1 
ATOM   3985 C CA  . VAL B 1 132 ? 50.493  15.169  -1.256  1.00 20.29 ? 132 VAL B CA  1 
ATOM   3986 C C   . VAL B 1 132 ? 51.447  15.712  -2.286  1.00 20.98 ? 132 VAL B C   1 
ATOM   3987 O O   . VAL B 1 132 ? 52.661  15.665  -2.095  1.00 24.51 ? 132 VAL B O   1 
ATOM   3988 C CB  . VAL B 1 132 ? 50.759  15.927  0.031   1.00 19.95 ? 132 VAL B CB  1 
ATOM   3989 C CG1 . VAL B 1 132 ? 50.751  17.425  -0.262  1.00 19.28 ? 132 VAL B CG1 1 
ATOM   3990 C CG2 . VAL B 1 132 ? 49.708  15.557  1.075   1.00 18.68 ? 132 VAL B CG2 1 
ATOM   3991 N N   . PRO B 1 133 ? 50.918  16.244  -3.389  1.00 19.03 ? 133 PRO B N   1 
ATOM   3992 C CA  . PRO B 1 133 ? 51.747  16.799  -4.465  1.00 20.44 ? 133 PRO B CA  1 
ATOM   3993 C C   . PRO B 1 133 ? 52.609  17.961  -4.031  1.00 22.01 ? 133 PRO B C   1 
ATOM   3994 O O   . PRO B 1 133 ? 52.295  18.642  -3.038  1.00 20.48 ? 133 PRO B O   1 
ATOM   3995 C CB  . PRO B 1 133 ? 50.718  17.212  -5.506  1.00 20.24 ? 133 PRO B CB  1 
ATOM   3996 C CG  . PRO B 1 133 ? 49.522  17.548  -4.681  1.00 16.43 ? 133 PRO B CG  1 
ATOM   3997 C CD  . PRO B 1 133 ? 49.487  16.422  -3.687  1.00 18.70 ? 133 PRO B CD  1 
ATOM   3998 N N   . ASP B 1 134 ? 53.686  18.192  -4.777  1.00 22.43 ? 134 ASP B N   1 
ATOM   3999 C CA  . ASP B 1 134 ? 54.609  19.281  -4.492  1.00 24.77 ? 134 ASP B CA  1 
ATOM   4000 C C   . ASP B 1 134 ? 54.462  20.451  -5.464  1.00 24.06 ? 134 ASP B C   1 
ATOM   4001 O O   . ASP B 1 134 ? 54.837  21.568  -5.145  1.00 21.16 ? 134 ASP B O   1 
ATOM   4002 C CB  . ASP B 1 134 ? 56.062  18.775  -4.553  1.00 30.82 ? 134 ASP B CB  1 
ATOM   4003 C CG  . ASP B 1 134 ? 56.505  18.110  -3.253  1.00 36.77 ? 134 ASP B CG  1 
ATOM   4004 O OD1 . ASP B 1 134 ? 55.734  18.229  -2.266  1.00 42.59 ? 134 ASP B OD1 1 
ATOM   4005 O OD2 . ASP B 1 134 ? 57.595  17.472  -3.195  1.00 37.94 ? 134 ASP B OD2 1 
ATOM   4006 N N   . ALA B 1 135 ? 53.918  20.201  -6.650  1.00 24.23 ? 135 ALA B N   1 
ATOM   4007 C CA  . ALA B 1 135 ? 53.765  21.270  -7.644  1.00 23.48 ? 135 ALA B CA  1 
ATOM   4008 C C   . ALA B 1 135 ? 53.095  22.501  -7.035  1.00 23.67 ? 135 ALA B C   1 
ATOM   4009 O O   . ALA B 1 135 ? 52.174  22.386  -6.212  1.00 26.40 ? 135 ALA B O   1 
ATOM   4010 C CB  . ALA B 1 135 ? 52.941  20.760  -8.852  1.00 23.89 ? 135 ALA B CB  1 
ATOM   4011 N N   . ALA B 1 136 ? 53.554  23.683  -7.418  1.00 21.89 ? 136 ALA B N   1 
ATOM   4012 C CA  . ALA B 1 136 ? 52.918  24.883  -6.909  1.00 18.12 ? 136 ALA B CA  1 
ATOM   4013 C C   . ALA B 1 136 ? 51.444  24.762  -7.265  1.00 14.69 ? 136 ALA B C   1 
ATOM   4014 O O   . ALA B 1 136 ? 51.100  24.167  -8.296  1.00 16.05 ? 136 ALA B O   1 
ATOM   4015 C CB  . ALA B 1 136 ? 53.506  26.105  -7.564  1.00 17.50 ? 136 ALA B CB  1 
ATOM   4016 N N   . GLY B 1 137 ? 50.582  25.280  -6.397  1.00 10.60 ? 137 GLY B N   1 
ATOM   4017 C CA  . GLY B 1 137 ? 49.153  25.261  -6.657  1.00 10.28 ? 137 GLY B CA  1 
ATOM   4018 C C   . GLY B 1 137 ? 48.397  23.974  -6.412  1.00 8.78  ? 137 GLY B C   1 
ATOM   4019 O O   . GLY B 1 137 ? 47.181  23.980  -6.431  1.00 7.53  ? 137 GLY B O   1 
ATOM   4020 N N   . THR B 1 138 ? 49.103  22.871  -6.199  1.00 9.58  ? 138 THR B N   1 
ATOM   4021 C CA  . THR B 1 138 ? 48.441  21.600  -5.951  1.00 11.62 ? 138 THR B CA  1 
ATOM   4022 C C   . THR B 1 138 ? 48.223  21.395  -4.461  1.00 12.07 ? 138 THR B C   1 
ATOM   4023 O O   . THR B 1 138 ? 48.760  22.131  -3.643  1.00 13.02 ? 138 THR B O   1 
ATOM   4024 C CB  . THR B 1 138 ? 49.264  20.406  -6.462  1.00 12.10 ? 138 THR B CB  1 
ATOM   4025 O OG1 . THR B 1 138 ? 50.501  20.334  -5.740  1.00 17.41 ? 138 THR B OG1 1 
ATOM   4026 C CG2 . THR B 1 138 ? 49.533  20.540  -7.953  1.00 12.83 ? 138 THR B CG2 1 
ATOM   4027 N N   . SER B 1 139 ? 47.442  20.374  -4.122  1.00 16.52 ? 139 SER B N   1 
ATOM   4028 C CA  . SER B 1 139 ? 47.140  20.051  -2.739  1.00 17.53 ? 139 SER B CA  1 
ATOM   4029 C C   . SER B 1 139 ? 46.560  18.663  -2.628  1.00 18.41 ? 139 SER B C   1 
ATOM   4030 O O   . SER B 1 139 ? 46.392  17.959  -3.631  1.00 15.51 ? 139 SER B O   1 
ATOM   4031 C CB  . SER B 1 139 ? 46.118  21.038  -2.179  1.00 22.21 ? 139 SER B CB  1 
ATOM   4032 O OG  . SER B 1 139 ? 44.862  20.931  -2.842  1.00 18.04 ? 139 SER B OG  1 
ATOM   4033 N N   . LEU B 1 140 ? 46.267  18.275  -1.386  1.00 17.56 ? 140 LEU B N   1 
ATOM   4034 C CA  . LEU B 1 140 ? 45.631  16.990  -1.115  1.00 18.75 ? 140 LEU B CA  1 
ATOM   4035 C C   . LEU B 1 140 ? 44.214  17.320  -0.631  1.00 18.75 ? 140 LEU B C   1 
ATOM   4036 O O   . LEU B 1 140 ? 44.044  18.114  0.308   1.00 17.63 ? 140 LEU B O   1 
ATOM   4037 C CB  . LEU B 1 140 ? 46.334  16.223  -0.006  1.00 15.42 ? 140 LEU B CB  1 
ATOM   4038 C CG  . LEU B 1 140 ? 45.595  14.899  0.160   1.00 14.88 ? 140 LEU B CG  1 
ATOM   4039 C CD1 . LEU B 1 140 ? 45.885  14.022  -1.044  1.00 13.95 ? 140 LEU B CD1 1 
ATOM   4040 C CD2 . LEU B 1 140 ? 46.004  14.212  1.429   1.00 13.83 ? 140 LEU B CD2 1 
ATOM   4041 N N   . TYR B 1 141 ? 43.198  16.725  -1.249  1.00 16.14 ? 141 TYR B N   1 
ATOM   4042 C CA  . TYR B 1 141 ? 41.843  17.026  -0.805  1.00 16.70 ? 141 TYR B CA  1 
ATOM   4043 C C   . TYR B 1 141 ? 41.409  16.035  0.237   1.00 14.37 ? 141 TYR B C   1 
ATOM   4044 O O   . TYR B 1 141 ? 41.549  14.828  0.054   1.00 13.75 ? 141 TYR B O   1 
ATOM   4045 C CB  . TYR B 1 141 ? 40.860  17.009  -1.960  1.00 16.83 ? 141 TYR B CB  1 
ATOM   4046 C CG  . TYR B 1 141 ? 39.489  17.507  -1.583  1.00 10.92 ? 141 TYR B CG  1 
ATOM   4047 C CD1 . TYR B 1 141 ? 39.279  18.830  -1.226  1.00 11.77 ? 141 TYR B CD1 1 
ATOM   4048 C CD2 . TYR B 1 141 ? 38.388  16.655  -1.633  1.00 12.92 ? 141 TYR B CD2 1 
ATOM   4049 C CE1 . TYR B 1 141 ? 37.981  19.298  -0.930  1.00 15.13 ? 141 TYR B CE1 1 
ATOM   4050 C CE2 . TYR B 1 141 ? 37.110  17.103  -1.345  1.00 12.10 ? 141 TYR B CE2 1 
ATOM   4051 C CZ  . TYR B 1 141 ? 36.903  18.418  -0.996  1.00 11.76 ? 141 TYR B CZ  1 
ATOM   4052 O OH  . TYR B 1 141 ? 35.618  18.826  -0.734  1.00 12.18 ? 141 TYR B OH  1 
ATOM   4053 N N   . VAL B 1 142 ? 40.872  16.575  1.323   1.00 14.57 ? 142 VAL B N   1 
ATOM   4054 C CA  . VAL B 1 142 ? 40.433  15.781  2.448   1.00 13.59 ? 142 VAL B CA  1 
ATOM   4055 C C   . VAL B 1 142 ? 38.925  15.682  2.506   1.00 14.26 ? 142 VAL B C   1 
ATOM   4056 O O   . VAL B 1 142 ? 38.222  16.674  2.725   1.00 13.63 ? 142 VAL B O   1 
ATOM   4057 C CB  . VAL B 1 142 ? 40.964  16.373  3.740   1.00 14.94 ? 142 VAL B CB  1 
ATOM   4058 C CG1 . VAL B 1 142 ? 40.633  15.449  4.909   1.00 14.04 ? 142 VAL B CG1 1 
ATOM   4059 C CG2 . VAL B 1 142 ? 42.471  16.576  3.613   1.00 14.45 ? 142 VAL B CG2 1 
ATOM   4060 N N   . ARG B 1 143 ? 38.438  14.461  2.305   1.00 15.23 ? 143 ARG B N   1 
ATOM   4061 C CA  . ARG B 1 143 ? 37.016  14.187  2.299   1.00 15.30 ? 143 ARG B CA  1 
ATOM   4062 C C   . ARG B 1 143 ? 36.434  13.348  3.441   1.00 16.99 ? 143 ARG B C   1 
ATOM   4063 O O   . ARG B 1 143 ? 36.337  12.118  3.337   1.00 15.28 ? 143 ARG B O   1 
ATOM   4064 C CB  . ARG B 1 143 ? 36.642  13.525  0.989   1.00 15.80 ? 143 ARG B CB  1 
ATOM   4065 C CG  . ARG B 1 143 ? 35.181  13.197  0.919   1.00 13.23 ? 143 ARG B CG  1 
ATOM   4066 C CD  . ARG B 1 143 ? 34.377  14.459  0.963   1.00 14.69 ? 143 ARG B CD  1 
ATOM   4067 N NE  . ARG B 1 143 ? 33.422  14.390  -0.116  1.00 21.41 ? 143 ARG B NE  1 
ATOM   4068 C CZ  . ARG B 1 143 ? 33.281  15.295  -1.061  1.00 17.65 ? 143 ARG B CZ  1 
ATOM   4069 N NH1 . ARG B 1 143 ? 34.028  16.383  -1.079  1.00 17.66 ? 143 ARG B NH1 1 
ATOM   4070 N NH2 . ARG B 1 143 ? 32.396  15.081  -2.004  1.00 21.25 ? 143 ARG B NH2 1 
ATOM   4071 N N   . PRO B 1 144 ? 36.045  14.004  4.549   1.00 15.47 ? 144 PRO B N   1 
ATOM   4072 C CA  . PRO B 1 144 ? 35.468  13.250  5.663   1.00 12.65 ? 144 PRO B CA  1 
ATOM   4073 C C   . PRO B 1 144 ? 33.978  13.050  5.335   1.00 15.66 ? 144 PRO B C   1 
ATOM   4074 O O   . PRO B 1 144 ? 33.346  13.913  4.713   1.00 13.99 ? 144 PRO B O   1 
ATOM   4075 C CB  . PRO B 1 144 ? 35.670  14.185  6.867   1.00 14.95 ? 144 PRO B CB  1 
ATOM   4076 C CG  . PRO B 1 144 ? 36.745  15.150  6.411   1.00 12.91 ? 144 PRO B CG  1 
ATOM   4077 C CD  . PRO B 1 144 ? 36.400  15.368  4.973   1.00 12.11 ? 144 PRO B CD  1 
ATOM   4078 N N   . VAL B 1 145 ? 33.423  11.920  5.753   1.00 14.11 ? 145 VAL B N   1 
ATOM   4079 C CA  . VAL B 1 145 ? 32.020  11.616  5.490   1.00 11.52 ? 145 VAL B CA  1 
ATOM   4080 C C   . VAL B 1 145 ? 31.420  10.864  6.690   1.00 14.74 ? 145 VAL B C   1 
ATOM   4081 O O   . VAL B 1 145 ? 32.109  10.060  7.345   1.00 13.09 ? 145 VAL B O   1 
ATOM   4082 C CB  . VAL B 1 145 ? 31.864  10.708  4.227   1.00 9.49  ? 145 VAL B CB  1 
ATOM   4083 C CG1 . VAL B 1 145 ? 30.397  10.469  3.928   1.00 11.04 ? 145 VAL B CG1 1 
ATOM   4084 C CG2 . VAL B 1 145 ? 32.551  11.331  3.028   1.00 5.11  ? 145 VAL B CG2 1 
ATOM   4085 N N   . LEU B 1 146 ? 30.153  11.136  6.981   1.00 12.36 ? 146 LEU B N   1 
ATOM   4086 C CA  . LEU B 1 146 ? 29.452  10.450  8.062   1.00 15.73 ? 146 LEU B CA  1 
ATOM   4087 C C   . LEU B 1 146 ? 28.064  10.098  7.553   1.00 11.25 ? 146 LEU B C   1 
ATOM   4088 O O   . LEU B 1 146 ? 27.319  10.965  7.097   1.00 10.58 ? 146 LEU B O   1 
ATOM   4089 C CB  . LEU B 1 146 ? 29.331  11.329  9.314   1.00 17.06 ? 146 LEU B CB  1 
ATOM   4090 C CG  . LEU B 1 146 ? 28.544  10.704  10.478  1.00 17.62 ? 146 LEU B CG  1 
ATOM   4091 C CD1 . LEU B 1 146 ? 29.225  9.407   10.922  1.00 17.25 ? 146 LEU B CD1 1 
ATOM   4092 C CD2 . LEU B 1 146 ? 28.442  11.698  11.635  1.00 16.67 ? 146 LEU B CD2 1 
ATOM   4093 N N   . ILE B 1 147 ? 27.707  8.828   7.636   1.00 10.91 ? 147 ILE B N   1 
ATOM   4094 C CA  . ILE B 1 147 ? 26.402  8.418   7.137   1.00 11.30 ? 147 ILE B CA  1 
ATOM   4095 C C   . ILE B 1 147 ? 25.671  7.514   8.087   1.00 11.70 ? 147 ILE B C   1 
ATOM   4096 O O   . ILE B 1 147 ? 26.294  6.741   8.824   1.00 9.95  ? 147 ILE B O   1 
ATOM   4097 C CB  . ILE B 1 147 ? 26.526  7.679   5.776   1.00 10.25 ? 147 ILE B CB  1 
ATOM   4098 C CG1 . ILE B 1 147 ? 27.100  6.283   5.988   1.00 13.58 ? 147 ILE B CG1 1 
ATOM   4099 C CG2 . ILE B 1 147 ? 27.458  8.454   4.835   1.00 9.37  ? 147 ILE B CG2 1 
ATOM   4100 C CD1 . ILE B 1 147 ? 27.327  5.531   4.708   1.00 15.94 ? 147 ILE B CD1 1 
ATOM   4101 N N   . GLY B 1 148 ? 24.348  7.622   8.069   1.00 12.47 ? 148 GLY B N   1 
ATOM   4102 C CA  . GLY B 1 148 ? 23.536  6.759   8.907   1.00 16.32 ? 148 GLY B CA  1 
ATOM   4103 C C   . GLY B 1 148 ? 23.626  5.383   8.267   1.00 15.18 ? 148 GLY B C   1 
ATOM   4104 O O   . GLY B 1 148 ? 23.658  5.272   7.051   1.00 19.13 ? 148 GLY B O   1 
ATOM   4105 N N   . ASN B 1 149 ? 23.683  4.325   9.061   1.00 18.68 ? 149 ASN B N   1 
ATOM   4106 C CA  . ASN B 1 149 ? 23.790  2.993   8.480   1.00 16.69 ? 149 ASN B CA  1 
ATOM   4107 C C   . ASN B 1 149 ? 22.872  1.958   9.137   1.00 17.43 ? 149 ASN B C   1 
ATOM   4108 O O   . ASN B 1 149 ? 23.287  0.885   9.532   1.00 16.55 ? 149 ASN B O   1 
ATOM   4109 C CB  . ASN B 1 149 ? 25.239  2.538   8.529   1.00 17.18 ? 149 ASN B CB  1 
ATOM   4110 C CG  . ASN B 1 149 ? 25.506  1.386   7.596   1.00 18.94 ? 149 ASN B CG  1 
ATOM   4111 O OD1 . ASN B 1 149 ? 24.732  1.124   6.671   1.00 20.51 ? 149 ASN B OD1 1 
ATOM   4112 N ND2 . ASN B 1 149 ? 26.602  0.691   7.823   1.00 19.48 ? 149 ASN B ND2 1 
ATOM   4113 N N   . GLU B 1 150 ? 21.602  2.322   9.219   1.00 20.16 ? 150 GLU B N   1 
ATOM   4114 C CA  . GLU B 1 150 ? 20.522  1.523   9.787   1.00 23.61 ? 150 GLU B CA  1 
ATOM   4115 C C   . GLU B 1 150 ? 19.979  0.599   8.674   1.00 22.73 ? 150 GLU B C   1 
ATOM   4116 O O   . GLU B 1 150 ? 19.541  1.075   7.639   1.00 23.82 ? 150 GLU B O   1 
ATOM   4117 C CB  . GLU B 1 150 ? 19.422  2.496   10.231  1.00 27.37 ? 150 GLU B CB  1 
ATOM   4118 C CG  . GLU B 1 150 ? 18.366  1.967   11.168  1.00 31.87 ? 150 GLU B CG  1 
ATOM   4119 C CD  . GLU B 1 150 ? 18.853  1.901   12.597  1.00 35.23 ? 150 GLU B CD  1 
ATOM   4120 O OE1 . GLU B 1 150 ? 19.409  2.923   13.073  1.00 35.79 ? 150 GLU B OE1 1 
ATOM   4121 O OE2 . GLU B 1 150 ? 18.670  0.833   13.235  1.00 34.63 ? 150 GLU B OE2 1 
ATOM   4122 N N   . PRO B 1 151 ? 20.043  -0.722  8.858   1.00 22.22 ? 151 PRO B N   1 
ATOM   4123 C CA  . PRO B 1 151 ? 19.526  -1.629  7.827   1.00 20.92 ? 151 PRO B CA  1 
ATOM   4124 C C   . PRO B 1 151 ? 18.034  -1.660  8.025   1.00 19.74 ? 151 PRO B C   1 
ATOM   4125 O O   . PRO B 1 151 ? 17.431  -2.730  8.115   1.00 18.63 ? 151 PRO B O   1 
ATOM   4126 C CB  . PRO B 1 151 ? 20.160  -2.959  8.187   1.00 20.66 ? 151 PRO B CB  1 
ATOM   4127 C CG  . PRO B 1 151 ? 20.117  -2.899  9.692   1.00 22.51 ? 151 PRO B CG  1 
ATOM   4128 C CD  . PRO B 1 151 ? 20.625  -1.482  9.975   1.00 23.30 ? 151 PRO B CD  1 
ATOM   4129 N N   . SER B 1 152 ? 17.444  -0.467  8.095   1.00 20.97 ? 152 SER B N   1 
ATOM   4130 C CA  . SER B 1 152 ? 16.009  -0.348  8.324   1.00 21.49 ? 152 SER B CA  1 
ATOM   4131 C C   . SER B 1 152 ? 15.311  0.667   7.433   1.00 22.02 ? 152 SER B C   1 
ATOM   4132 O O   . SER B 1 152 ? 15.742  1.813   7.333   1.00 23.25 ? 152 SER B O   1 
ATOM   4133 C CB  . SER B 1 152 ? 15.776  0.032   9.781   1.00 20.72 ? 152 SER B CB  1 
ATOM   4134 O OG  . SER B 1 152 ? 14.403  0.008   10.092  1.00 25.56 ? 152 SER B OG  1 
ATOM   4135 N N   . LEU B 1 153 ? 14.220  0.261   6.789   1.00 22.77 ? 153 LEU B N   1 
ATOM   4136 C CA  . LEU B 1 153 ? 13.499  1.209   5.939   1.00 25.60 ? 153 LEU B CA  1 
ATOM   4137 C C   . LEU B 1 153 ? 12.761  2.232   6.783   1.00 24.97 ? 153 LEU B C   1 
ATOM   4138 O O   . LEU B 1 153 ? 11.971  3.019   6.264   1.00 27.22 ? 153 LEU B O   1 
ATOM   4139 C CB  . LEU B 1 153 ? 12.485  0.517   5.025   1.00 19.61 ? 153 LEU B CB  1 
ATOM   4140 C CG  . LEU B 1 153 ? 13.051  -0.394  3.958   1.00 18.52 ? 153 LEU B CG  1 
ATOM   4141 C CD1 . LEU B 1 153 ? 11.948  -0.649  2.943   1.00 17.18 ? 153 LEU B CD1 1 
ATOM   4142 C CD2 . LEU B 1 153 ? 14.286  0.255   3.306   1.00 18.73 ? 153 LEU B CD2 1 
ATOM   4143 N N   . GLY B 1 154 ? 12.981  2.213   8.086   1.00 26.36 ? 154 GLY B N   1 
ATOM   4144 C CA  . GLY B 1 154 ? 12.306  3.203   8.911   1.00 26.70 ? 154 GLY B CA  1 
ATOM   4145 C C   . GLY B 1 154 ? 13.069  4.526   8.871   1.00 24.02 ? 154 GLY B C   1 
ATOM   4146 O O   . GLY B 1 154 ? 14.292  4.531   8.979   1.00 24.64 ? 154 GLY B O   1 
ATOM   4147 N N   . VAL B 1 155 ? 12.357  5.634   8.702   1.00 24.40 ? 155 VAL B N   1 
ATOM   4148 C CA  . VAL B 1 155 ? 12.965  6.973   8.675   1.00 24.37 ? 155 VAL B CA  1 
ATOM   4149 C C   . VAL B 1 155 ? 13.060  7.470   10.114  1.00 24.48 ? 155 VAL B C   1 
ATOM   4150 O O   . VAL B 1 155 ? 12.281  8.325   10.541  1.00 26.60 ? 155 VAL B O   1 
ATOM   4151 C CB  . VAL B 1 155 ? 12.086  7.962   7.896   1.00 23.07 ? 155 VAL B CB  1 
ATOM   4152 C CG1 . VAL B 1 155 ? 12.766  9.307   7.806   1.00 23.44 ? 155 VAL B CG1 1 
ATOM   4153 C CG2 . VAL B 1 155 ? 11.794  7.412   6.528   1.00 26.71 ? 155 VAL B CG2 1 
ATOM   4154 N N   . SER B 1 156 ? 14.011  6.936   10.862  1.00 25.56 ? 156 SER B N   1 
ATOM   4155 C CA  . SER B 1 156 ? 14.176  7.308   12.259  1.00 26.91 ? 156 SER B CA  1 
ATOM   4156 C C   . SER B 1 156 ? 15.611  7.783   12.528  1.00 27.60 ? 156 SER B C   1 
ATOM   4157 O O   . SER B 1 156 ? 16.384  7.940   11.581  1.00 24.00 ? 156 SER B O   1 
ATOM   4158 C CB  . SER B 1 156 ? 13.872  6.087   13.112  1.00 28.69 ? 156 SER B CB  1 
ATOM   4159 O OG  . SER B 1 156 ? 14.612  4.973   12.627  1.00 29.12 ? 156 SER B OG  1 
ATOM   4160 N N   . GLN B 1 157 ? 15.945  8.041   13.801  1.00 27.75 ? 157 GLN B N   1 
ATOM   4161 C CA  . GLN B 1 157 ? 17.302  8.453   14.138  1.00 28.36 ? 157 GLN B CA  1 
ATOM   4162 C C   . GLN B 1 157 ? 18.060  7.159   14.034  1.00 27.81 ? 157 GLN B C   1 
ATOM   4163 O O   . GLN B 1 157 ? 17.637  6.156   14.596  1.00 23.92 ? 157 GLN B O   1 
ATOM   4164 C CB  . GLN B 1 157 ? 17.434  8.971   15.559  1.00 30.50 ? 157 GLN B CB  1 
ATOM   4165 C CG  . GLN B 1 157 ? 18.873  9.429   15.884  1.00 33.99 ? 157 GLN B CG  1 
ATOM   4166 C CD  . GLN B 1 157 ? 18.984  10.112  17.260  1.00 35.08 ? 157 GLN B CD  1 
ATOM   4167 O OE1 . GLN B 1 157 ? 18.054  10.793  17.704  1.00 35.01 ? 157 GLN B OE1 1 
ATOM   4168 N NE2 . GLN B 1 157 ? 20.128  9.947   17.922  1.00 36.69 ? 157 GLN B NE2 1 
ATOM   4169 N N   . PRO B 1 158 ? 19.199  7.162   13.312  1.00 29.73 ? 158 PRO B N   1 
ATOM   4170 C CA  . PRO B 1 158 ? 19.929  5.899   13.200  1.00 29.81 ? 158 PRO B CA  1 
ATOM   4171 C C   . PRO B 1 158 ? 20.530  5.433   14.513  1.00 28.15 ? 158 PRO B C   1 
ATOM   4172 O O   . PRO B 1 158 ? 20.773  6.217   15.436  1.00 26.89 ? 158 PRO B O   1 
ATOM   4173 C CB  . PRO B 1 158 ? 20.971  6.183   12.114  1.00 31.86 ? 158 PRO B CB  1 
ATOM   4174 C CG  . PRO B 1 158 ? 20.394  7.354   11.345  1.00 32.76 ? 158 PRO B CG  1 
ATOM   4175 C CD  . PRO B 1 158 ? 19.792  8.200   12.450  1.00 29.08 ? 158 PRO B CD  1 
ATOM   4176 N N   . ARG B 1 159 ? 20.744  4.129   14.586  1.00 28.41 ? 159 ARG B N   1 
ATOM   4177 C CA  . ARG B 1 159 ? 21.309  3.502   15.764  1.00 29.47 ? 159 ARG B CA  1 
ATOM   4178 C C   . ARG B 1 159 ? 22.650  2.895   15.369  1.00 29.62 ? 159 ARG B C   1 
ATOM   4179 O O   . ARG B 1 159 ? 23.399  2.385   16.203  1.00 28.67 ? 159 ARG B O   1 
ATOM   4180 C CB  . ARG B 1 159 ? 20.345  2.446   16.273  1.00 30.76 ? 159 ARG B CB  1 
ATOM   4181 C CG  . ARG B 1 159 ? 19.056  3.020   16.880  1.00 35.07 ? 159 ARG B CG  1 
ATOM   4182 C CD  . ARG B 1 159 ? 18.116  1.903   17.307  1.00 42.19 ? 159 ARG B CD  1 
ATOM   4183 N NE  . ARG B 1 159 ? 18.766  0.936   18.209  1.00 48.63 ? 159 ARG B NE  1 
ATOM   4184 C CZ  . ARG B 1 159 ? 18.220  -0.226  18.578  1.00 52.01 ? 159 ARG B CZ  1 
ATOM   4185 N NH1 . ARG B 1 159 ? 17.010  -0.572  18.126  1.00 53.73 ? 159 ARG B NH1 1 
ATOM   4186 N NH2 . ARG B 1 159 ? 18.875  -1.041  19.402  1.00 51.25 ? 159 ARG B NH2 1 
ATOM   4187 N N   . ARG B 1 160 ? 22.942  2.994   14.075  1.00 27.29 ? 160 ARG B N   1 
ATOM   4188 C CA  . ARG B 1 160 ? 24.169  2.500   13.516  1.00 25.65 ? 160 ARG B CA  1 
ATOM   4189 C C   . ARG B 1 160 ? 24.595  3.541   12.516  1.00 24.55 ? 160 ARG B C   1 
ATOM   4190 O O   . ARG B 1 160 ? 23.797  3.935   11.660  1.00 24.96 ? 160 ARG B O   1 
ATOM   4191 C CB  . ARG B 1 160 ? 23.927  1.169   12.816  1.00 28.92 ? 160 ARG B CB  1 
ATOM   4192 C CG  . ARG B 1 160 ? 24.366  -0.046  13.633  1.00 34.79 ? 160 ARG B CG  1 
ATOM   4193 C CD  . ARG B 1 160 ? 24.007  -1.363  12.936  1.00 35.99 ? 160 ARG B CD  1 
ATOM   4194 N NE  . ARG B 1 160 ? 24.264  -1.294  11.497  1.00 42.28 ? 160 ARG B NE  1 
ATOM   4195 C CZ  . ARG B 1 160 ? 25.423  -0.912  10.938  1.00 46.94 ? 160 ARG B CZ  1 
ATOM   4196 N NH1 . ARG B 1 160 ? 26.472  -0.547  11.693  1.00 49.02 ? 160 ARG B NH1 1 
ATOM   4197 N NH2 . ARG B 1 160 ? 25.545  -0.904  9.608   1.00 48.47 ? 160 ARG B NH2 1 
ATOM   4198 N N   . ALA B 1 161 ? 25.839  4.002   12.633  1.00 20.14 ? 161 ALA B N   1 
ATOM   4199 C CA  . ALA B 1 161 ? 26.382  5.003   11.720  1.00 19.64 ? 161 ALA B CA  1 
ATOM   4200 C C   . ALA B 1 161 ? 27.800  4.649   11.312  1.00 18.33 ? 161 ALA B C   1 
ATOM   4201 O O   . ALA B 1 161 ? 28.361  3.655   11.758  1.00 19.73 ? 161 ALA B O   1 
ATOM   4202 C CB  . ALA B 1 161 ? 26.368  6.374   12.379  1.00 19.03 ? 161 ALA B CB  1 
ATOM   4203 N N   . LEU B 1 162 ? 28.397  5.484   10.481  1.00 19.57 ? 162 LEU B N   1 
ATOM   4204 C CA  . LEU B 1 162 ? 29.745  5.212   10.025  1.00 17.62 ? 162 LEU B CA  1 
ATOM   4205 C C   . LEU B 1 162 ? 30.424  6.478   9.539   1.00 14.33 ? 162 LEU B C   1 
ATOM   4206 O O   . LEU B 1 162 ? 29.854  7.251   8.786   1.00 11.87 ? 162 LEU B O   1 
ATOM   4207 C CB  . LEU B 1 162 ? 29.687  4.185   8.899   1.00 20.67 ? 162 LEU B CB  1 
ATOM   4208 C CG  . LEU B 1 162 ? 31.034  3.732   8.350   1.00 26.84 ? 162 LEU B CG  1 
ATOM   4209 C CD1 . LEU B 1 162 ? 31.635  2.631   9.253   1.00 26.72 ? 162 LEU B CD1 1 
ATOM   4210 C CD2 . LEU B 1 162 ? 30.818  3.208   6.931   1.00 28.22 ? 162 LEU B CD2 1 
ATOM   4211 N N   . LEU B 1 163 ? 31.659  6.677   9.962   1.00 15.36 ? 163 LEU B N   1 
ATOM   4212 C CA  . LEU B 1 163 ? 32.402  7.860   9.579   1.00 14.18 ? 163 LEU B CA  1 
ATOM   4213 C C   . LEU B 1 163 ? 33.629  7.361   8.863   1.00 14.86 ? 163 LEU B C   1 
ATOM   4214 O O   . LEU B 1 163 ? 34.243  6.383   9.285   1.00 16.01 ? 163 LEU B O   1 
ATOM   4215 C CB  . LEU B 1 163 ? 32.790  8.649   10.840  1.00 15.08 ? 163 LEU B CB  1 
ATOM   4216 C CG  . LEU B 1 163 ? 33.396  10.051  10.684  1.00 16.54 ? 163 LEU B CG  1 
ATOM   4217 C CD1 . LEU B 1 163 ? 33.327  10.764  12.015  1.00 15.50 ? 163 LEU B CD1 1 
ATOM   4218 C CD2 . LEU B 1 163 ? 34.841  9.972   10.177  1.00 11.79 ? 163 LEU B CD2 1 
ATOM   4219 N N   . PHE B 1 164 ? 33.976  8.004   7.762   1.00 11.95 ? 164 PHE B N   1 
ATOM   4220 C CA  . PHE B 1 164 ? 35.156  7.599   7.039   1.00 12.34 ? 164 PHE B CA  1 
ATOM   4221 C C   . PHE B 1 164 ? 35.774  8.773   6.314   1.00 10.36 ? 164 PHE B C   1 
ATOM   4222 O O   . PHE B 1 164 ? 35.102  9.743   6.012   1.00 13.36 ? 164 PHE B O   1 
ATOM   4223 C CB  . PHE B 1 164 ? 34.847  6.452   6.056   1.00 9.97  ? 164 PHE B CB  1 
ATOM   4224 C CG  . PHE B 1 164 ? 33.923  6.822   4.898   1.00 15.12 ? 164 PHE B CG  1 
ATOM   4225 C CD1 . PHE B 1 164 ? 32.538  6.606   4.978   1.00 14.48 ? 164 PHE B CD1 1 
ATOM   4226 C CD2 . PHE B 1 164 ? 34.443  7.318   3.702   1.00 12.49 ? 164 PHE B CD2 1 
ATOM   4227 C CE1 . PHE B 1 164 ? 31.706  6.875   3.880   1.00 13.78 ? 164 PHE B CE1 1 
ATOM   4228 C CE2 . PHE B 1 164 ? 33.620  7.589   2.604   1.00 11.18 ? 164 PHE B CE2 1 
ATOM   4229 C CZ  . PHE B 1 164 ? 32.255  7.370   2.689   1.00 12.72 ? 164 PHE B CZ  1 
ATOM   4230 N N   . VAL B 1 165 ? 37.068  8.693   6.055   1.00 13.75 ? 165 VAL B N   1 
ATOM   4231 C CA  . VAL B 1 165 ? 37.759  9.769   5.355   1.00 12.29 ? 165 VAL B CA  1 
ATOM   4232 C C   . VAL B 1 165 ? 38.583  9.189   4.220   1.00 14.00 ? 165 VAL B C   1 
ATOM   4233 O O   . VAL B 1 165 ? 39.219  8.147   4.386   1.00 10.73 ? 165 VAL B O   1 
ATOM   4234 C CB  . VAL B 1 165 ? 38.705  10.537  6.292   1.00 13.48 ? 165 VAL B CB  1 
ATOM   4235 C CG1 . VAL B 1 165 ? 39.368  11.674  5.549   1.00 13.05 ? 165 VAL B CG1 1 
ATOM   4236 C CG2 . VAL B 1 165 ? 37.946  11.064  7.484   1.00 13.11 ? 165 VAL B CG2 1 
ATOM   4237 N N   . ILE B 1 166 ? 38.538  9.857   3.066   1.00 13.33 ? 166 ILE B N   1 
ATOM   4238 C CA  . ILE B 1 166 ? 39.301  9.459   1.889   1.00 12.57 ? 166 ILE B CA  1 
ATOM   4239 C C   . ILE B 1 166 ? 40.066  10.685  1.390   1.00 14.31 ? 166 ILE B C   1 
ATOM   4240 O O   . ILE B 1 166 ? 39.655  11.831  1.619   1.00 12.06 ? 166 ILE B O   1 
ATOM   4241 C CB  . ILE B 1 166 ? 38.394  8.895   0.796   1.00 12.81 ? 166 ILE B CB  1 
ATOM   4242 C CG1 . ILE B 1 166 ? 37.176  9.805   0.585   1.00 15.72 ? 166 ILE B CG1 1 
ATOM   4243 C CG2 . ILE B 1 166 ? 37.987  7.482   1.160   1.00 13.56 ? 166 ILE B CG2 1 
ATOM   4244 C CD1 . ILE B 1 166 ? 36.299  9.380   -0.592  1.00 16.65 ? 166 ILE B CD1 1 
ATOM   4245 N N   . LEU B 1 167 ? 41.177  10.446  0.702   1.00 14.89 ? 167 LEU B N   1 
ATOM   4246 C CA  . LEU B 1 167 ? 42.029  11.535  0.260   1.00 16.35 ? 167 LEU B CA  1 
ATOM   4247 C C   . LEU B 1 167 ? 42.400  11.469  -1.203  1.00 17.06 ? 167 LEU B C   1 
ATOM   4248 O O   . LEU B 1 167 ? 42.593  10.386  -1.737  1.00 20.11 ? 167 LEU B O   1 
ATOM   4249 C CB  . LEU B 1 167 ? 43.321  11.507  1.082   1.00 13.94 ? 167 LEU B CB  1 
ATOM   4250 C CG  . LEU B 1 167 ? 43.245  11.203  2.589   1.00 9.06  ? 167 LEU B CG  1 
ATOM   4251 C CD1 . LEU B 1 167 ? 44.642  10.914  3.176   1.00 6.67  ? 167 LEU B CD1 1 
ATOM   4252 C CD2 . LEU B 1 167 ? 42.625  12.372  3.276   1.00 6.83  ? 167 LEU B CD2 1 
ATOM   4253 N N   . CYS B 1 168 ? 42.497  12.623  -1.851  1.00 15.15 ? 168 CYS B N   1 
ATOM   4254 C CA  . CYS B 1 168 ? 42.914  12.663  -3.246  1.00 15.28 ? 168 CYS B CA  1 
ATOM   4255 C C   . CYS B 1 168 ? 43.747  13.875  -3.619  1.00 14.45 ? 168 CYS B C   1 
ATOM   4256 O O   . CYS B 1 168 ? 43.395  15.014  -3.317  1.00 15.24 ? 168 CYS B O   1 
ATOM   4257 C CB  . CYS B 1 168 ? 41.734  12.545  -4.223  1.00 17.73 ? 168 CYS B CB  1 
ATOM   4258 S SG  . CYS B 1 168 ? 40.100  13.155  -3.799  1.00 20.04 ? 168 CYS B SG  1 
ATOM   4259 N N   . PRO B 1 169 ? 44.882  13.641  -4.278  1.00 14.35 ? 169 PRO B N   1 
ATOM   4260 C CA  . PRO B 1 169 ? 45.717  14.774  -4.665  1.00 14.32 ? 169 PRO B CA  1 
ATOM   4261 C C   . PRO B 1 169 ? 44.973  15.545  -5.754  1.00 14.99 ? 169 PRO B C   1 
ATOM   4262 O O   . PRO B 1 169 ? 44.336  14.961  -6.626  1.00 15.24 ? 169 PRO B O   1 
ATOM   4263 C CB  . PRO B 1 169 ? 46.980  14.097  -5.168  1.00 12.07 ? 169 PRO B CB  1 
ATOM   4264 C CG  . PRO B 1 169 ? 46.436  12.901  -5.851  1.00 12.30 ? 169 PRO B CG  1 
ATOM   4265 C CD  . PRO B 1 169 ? 45.392  12.393  -4.867  1.00 16.42 ? 169 PRO B CD  1 
ATOM   4266 N N   . VAL B 1 170 ? 45.036  16.860  -5.689  1.00 16.62 ? 170 VAL B N   1 
ATOM   4267 C CA  . VAL B 1 170 ? 44.366  17.687  -6.668  1.00 15.30 ? 170 VAL B CA  1 
ATOM   4268 C C   . VAL B 1 170 ? 45.445  18.585  -7.259  1.00 16.97 ? 170 VAL B C   1 
ATOM   4269 O O   . VAL B 1 170 ? 46.351  19.009  -6.546  1.00 14.45 ? 170 VAL B O   1 
ATOM   4270 C CB  . VAL B 1 170 ? 43.279  18.523  -5.978  1.00 16.08 ? 170 VAL B CB  1 
ATOM   4271 C CG1 . VAL B 1 170 ? 42.299  17.612  -5.280  1.00 12.63 ? 170 VAL B CG1 1 
ATOM   4272 C CG2 . VAL B 1 170 ? 43.915  19.435  -4.933  1.00 17.73 ? 170 VAL B CG2 1 
ATOM   4273 N N   . GLY B 1 171 ? 45.367  18.854  -8.561  1.00 17.56 ? 171 GLY B N   1 
ATOM   4274 C CA  . GLY B 1 171 ? 46.361  19.704  -9.193  1.00 14.76 ? 171 GLY B CA  1 
ATOM   4275 C C   . GLY B 1 171 ? 45.985  21.168  -9.100  1.00 15.35 ? 171 GLY B C   1 
ATOM   4276 O O   . GLY B 1 171 ? 44.936  21.497  -8.560  1.00 16.45 ? 171 GLY B O   1 
ATOM   4277 N N   . ALA B 1 172 ? 46.837  22.049  -9.618  1.00 16.96 ? 172 ALA B N   1 
ATOM   4278 C CA  . ALA B 1 172 ? 46.568  23.504  -9.603  1.00 19.42 ? 172 ALA B CA  1 
ATOM   4279 C C   . ALA B 1 172 ? 45.286  23.919  -10.370 1.00 20.27 ? 172 ALA B C   1 
ATOM   4280 O O   . ALA B 1 172 ? 44.831  23.211  -11.279 1.00 20.25 ? 172 ALA B O   1 
ATOM   4281 C CB  . ALA B 1 172 ? 47.778  24.264  -10.157 1.00 15.85 ? 172 ALA B CB  1 
ATOM   4282 N N   . TYR B 1 173 ? 44.723  25.071  -10.005 1.00 20.97 ? 173 TYR B N   1 
ATOM   4283 C CA  . TYR B 1 173 ? 43.493  25.562  -10.624 1.00 21.33 ? 173 TYR B CA  1 
ATOM   4284 C C   . TYR B 1 173 ? 43.766  26.800  -11.451 1.00 20.11 ? 173 TYR B C   1 
ATOM   4285 O O   . TYR B 1 173 ? 43.002  27.117  -12.356 1.00 19.35 ? 173 TYR B O   1 
ATOM   4286 C CB  . TYR B 1 173 ? 42.461  25.880  -9.543  1.00 27.13 ? 173 TYR B CB  1 
ATOM   4287 C CG  . TYR B 1 173 ? 41.023  25.998  -10.013 1.00 33.81 ? 173 TYR B CG  1 
ATOM   4288 C CD1 . TYR B 1 173 ? 40.145  24.888  -9.967  1.00 37.82 ? 173 TYR B CD1 1 
ATOM   4289 C CD2 . TYR B 1 173 ? 40.504  27.237  -10.423 1.00 38.39 ? 173 TYR B CD2 1 
ATOM   4290 C CE1 . TYR B 1 173 ? 38.757  25.024  -10.308 1.00 41.32 ? 173 TYR B CE1 1 
ATOM   4291 C CE2 . TYR B 1 173 ? 39.125  27.392  -10.777 1.00 42.47 ? 173 TYR B CE2 1 
ATOM   4292 C CZ  . TYR B 1 173 ? 38.259  26.288  -10.710 1.00 42.95 ? 173 TYR B CZ  1 
ATOM   4293 O OH  . TYR B 1 173 ? 36.918  26.471  -10.997 1.00 40.87 ? 173 TYR B OH  1 
ATOM   4294 N N   . PHE B 1 174 ? 44.863  27.493  -11.133 1.00 18.85 ? 174 PHE B N   1 
ATOM   4295 C CA  . PHE B 1 174 ? 45.279  28.693  -11.856 1.00 17.60 ? 174 PHE B CA  1 
ATOM   4296 C C   . PHE B 1 174 ? 46.803  28.669  -11.967 1.00 16.08 ? 174 PHE B C   1 
ATOM   4297 O O   . PHE B 1 174 ? 47.463  27.965  -11.233 1.00 15.49 ? 174 PHE B O   1 
ATOM   4298 C CB  . PHE B 1 174 ? 44.917  29.987  -11.102 1.00 18.16 ? 174 PHE B CB  1 
ATOM   4299 C CG  . PHE B 1 174 ? 43.459  30.156  -10.797 1.00 23.63 ? 174 PHE B CG  1 
ATOM   4300 C CD1 . PHE B 1 174 ? 43.035  30.363  -9.476  1.00 27.12 ? 174 PHE B CD1 1 
ATOM   4301 C CD2 . PHE B 1 174 ? 42.509  30.155  -11.803 1.00 25.47 ? 174 PHE B CD2 1 
ATOM   4302 C CE1 . PHE B 1 174 ? 41.684  30.561  -9.170  1.00 27.20 ? 174 PHE B CE1 1 
ATOM   4303 C CE2 . PHE B 1 174 ? 41.151  30.355  -11.503 1.00 27.17 ? 174 PHE B CE2 1 
ATOM   4304 C CZ  . PHE B 1 174 ? 40.744  30.558  -10.189 1.00 26.75 ? 174 PHE B CZ  1 
ATOM   4305 N N   . PRO B 1 175 ? 47.378  29.429  -12.899 1.00 16.58 ? 175 PRO B N   1 
ATOM   4306 C CA  . PRO B 1 175 ? 48.837  29.358  -12.913 1.00 19.50 ? 175 PRO B CA  1 
ATOM   4307 C C   . PRO B 1 175 ? 49.236  30.315  -11.791 1.00 22.65 ? 175 PRO B C   1 
ATOM   4308 O O   . PRO B 1 175 ? 48.361  30.940  -11.175 1.00 24.18 ? 175 PRO B O   1 
ATOM   4309 C CB  . PRO B 1 175 ? 49.206  29.882  -14.296 1.00 16.65 ? 175 PRO B CB  1 
ATOM   4310 C CG  . PRO B 1 175 ? 48.135  30.901  -14.563 1.00 13.60 ? 175 PRO B CG  1 
ATOM   4311 C CD  . PRO B 1 175 ? 46.866  30.233  -14.023 1.00 15.31 ? 175 PRO B CD  1 
ATOM   4312 N N   . GLY B 1 176 ? 50.530  30.437  -11.528 1.00 23.83 ? 176 GLY B N   1 
ATOM   4313 C CA  . GLY B 1 176 ? 50.986  31.315  -10.463 1.00 26.07 ? 176 GLY B CA  1 
ATOM   4314 C C   . GLY B 1 176 ? 50.801  32.814  -10.672 1.00 27.90 ? 176 GLY B C   1 
ATOM   4315 O O   . GLY B 1 176 ? 51.176  33.369  -11.710 1.00 27.63 ? 176 GLY B O   1 
ATOM   4316 N N   . GLY B 1 177 ? 50.200  33.467  -9.680  1.00 28.30 ? 177 GLY B N   1 
ATOM   4317 C CA  . GLY B 1 177 ? 50.006  34.905  -9.746  1.00 26.68 ? 177 GLY B CA  1 
ATOM   4318 C C   . GLY B 1 177 ? 48.925  35.438  -10.665 1.00 24.27 ? 177 GLY B C   1 
ATOM   4319 O O   . GLY B 1 177 ? 48.972  36.600  -11.049 1.00 23.65 ? 177 GLY B O   1 
ATOM   4320 N N   . SER B 1 178 ? 47.945  34.617  -11.018 1.00 22.82 ? 178 SER B N   1 
ATOM   4321 C CA  . SER B 1 178 ? 46.880  35.100  -11.897 1.00 20.72 ? 178 SER B CA  1 
ATOM   4322 C C   . SER B 1 178 ? 45.601  34.276  -11.734 1.00 20.58 ? 178 SER B C   1 
ATOM   4323 O O   . SER B 1 178 ? 45.571  33.289  -10.992 1.00 19.28 ? 178 SER B O   1 
ATOM   4324 C CB  . SER B 1 178 ? 47.354  35.063  -13.354 1.00 22.25 ? 178 SER B CB  1 
ATOM   4325 O OG  . SER B 1 178 ? 47.606  33.734  -13.780 1.00 20.04 ? 178 SER B OG  1 
ATOM   4326 N N   . VAL B 1 179 ? 44.546  34.682  -12.426 1.00 18.79 ? 179 VAL B N   1 
ATOM   4327 C CA  . VAL B 1 179 ? 43.282  33.973  -12.327 1.00 16.82 ? 179 VAL B CA  1 
ATOM   4328 C C   . VAL B 1 179 ? 42.466  34.164  -13.585 1.00 18.49 ? 179 VAL B C   1 
ATOM   4329 O O   . VAL B 1 179 ? 42.655  35.123  -14.318 1.00 21.19 ? 179 VAL B O   1 
ATOM   4330 C CB  . VAL B 1 179 ? 42.447  34.486  -11.126 1.00 15.12 ? 179 VAL B CB  1 
ATOM   4331 C CG1 . VAL B 1 179 ? 43.103  34.117  -9.827  1.00 9.54  ? 179 VAL B CG1 1 
ATOM   4332 C CG2 . VAL B 1 179 ? 42.281  35.997  -11.225 1.00 12.23 ? 179 VAL B CG2 1 
ATOM   4333 N N   . THR B 1 180 ? 41.551  33.246  -13.827 1.00 20.36 ? 180 THR B N   1 
ATOM   4334 C CA  . THR B 1 180 ? 40.697  33.326  -14.991 1.00 21.47 ? 180 THR B CA  1 
ATOM   4335 C C   . THR B 1 180 ? 39.249  33.271  -14.485 1.00 20.61 ? 180 THR B C   1 
ATOM   4336 O O   . THR B 1 180 ? 38.867  32.371  -13.752 1.00 21.68 ? 180 THR B O   1 
ATOM   4337 C CB  . THR B 1 180 ? 40.967  32.141  -15.962 1.00 26.17 ? 180 THR B CB  1 
ATOM   4338 O OG1 . THR B 1 180 ? 42.383  31.974  -16.158 1.00 27.48 ? 180 THR B OG1 1 
ATOM   4339 C CG2 . THR B 1 180 ? 40.302  32.410  -17.344 1.00 30.35 ? 180 THR B CG2 1 
ATOM   4340 N N   . PRO B 1 181 ? 38.427  34.240  -14.883 1.00 20.11 ? 181 PRO B N   1 
ATOM   4341 C CA  . PRO B 1 181 ? 37.018  34.340  -14.494 1.00 19.92 ? 181 PRO B CA  1 
ATOM   4342 C C   . PRO B 1 181 ? 36.154  33.203  -15.015 1.00 19.77 ? 181 PRO B C   1 
ATOM   4343 O O   . PRO B 1 181 ? 36.601  32.425  -15.847 1.00 20.48 ? 181 PRO B O   1 
ATOM   4344 C CB  . PRO B 1 181 ? 36.596  35.667  -15.110 1.00 20.23 ? 181 PRO B CB  1 
ATOM   4345 C CG  . PRO B 1 181 ? 37.413  35.705  -16.390 1.00 18.52 ? 181 PRO B CG  1 
ATOM   4346 C CD  . PRO B 1 181 ? 38.777  35.281  -15.867 1.00 19.47 ? 181 PRO B CD  1 
ATOM   4347 N N   . VAL B 1 182 ? 34.921  33.124  -14.513 1.00 18.60 ? 182 VAL B N   1 
ATOM   4348 C CA  . VAL B 1 182 ? 33.941  32.126  -14.953 1.00 19.33 ? 182 VAL B CA  1 
ATOM   4349 C C   . VAL B 1 182 ? 32.612  32.849  -15.192 1.00 19.00 ? 182 VAL B C   1 
ATOM   4350 O O   . VAL B 1 182 ? 32.346  33.905  -14.614 1.00 16.64 ? 182 VAL B O   1 
ATOM   4351 C CB  . VAL B 1 182 ? 33.676  31.062  -13.897 1.00 19.20 ? 182 VAL B CB  1 
ATOM   4352 C CG1 . VAL B 1 182 ? 34.952  30.291  -13.618 1.00 23.93 ? 182 VAL B CG1 1 
ATOM   4353 C CG2 . VAL B 1 182 ? 33.123  31.713  -12.633 1.00 21.47 ? 182 VAL B CG2 1 
ATOM   4354 N N   . SER B 1 183 ? 31.782  32.287  -16.053 1.00 16.85 ? 183 SER B N   1 
ATOM   4355 C CA  . SER B 1 183 ? 30.492  32.890  -16.331 1.00 16.87 ? 183 SER B CA  1 
ATOM   4356 C C   . SER B 1 183 ? 29.446  32.172  -15.458 1.00 15.97 ? 183 SER B C   1 
ATOM   4357 O O   . SER B 1 183 ? 29.535  30.969  -15.223 1.00 14.39 ? 183 SER B O   1 
ATOM   4358 C CB  . SER B 1 183 ? 30.167  32.758  -17.828 1.00 16.66 ? 183 SER B CB  1 
ATOM   4359 O OG  . SER B 1 183 ? 30.379  31.430  -18.310 1.00 18.23 ? 183 SER B OG  1 
ATOM   4360 N N   . LEU B 1 184 ? 28.462  32.911  -14.975 1.00 14.28 ? 184 LEU B N   1 
ATOM   4361 C CA  . LEU B 1 184 ? 27.453  32.321  -14.111 1.00 17.62 ? 184 LEU B CA  1 
ATOM   4362 C C   . LEU B 1 184 ? 26.042  32.378  -14.672 1.00 19.12 ? 184 LEU B C   1 
ATOM   4363 O O   . LEU B 1 184 ? 25.647  33.348  -15.317 1.00 22.67 ? 184 LEU B O   1 
ATOM   4364 C CB  . LEU B 1 184 ? 27.454  33.019  -12.739 1.00 17.89 ? 184 LEU B CB  1 
ATOM   4365 C CG  . LEU B 1 184 ? 28.803  33.162  -12.016 1.00 20.18 ? 184 LEU B CG  1 
ATOM   4366 C CD1 . LEU B 1 184 ? 28.627  33.969  -10.739 1.00 15.54 ? 184 LEU B CD1 1 
ATOM   4367 C CD2 . LEU B 1 184 ? 29.386  31.798  -11.719 1.00 15.86 ? 184 LEU B CD2 1 
ATOM   4368 N N   . LEU B 1 185 ? 25.280  31.319  -14.438 1.00 22.13 ? 185 LEU B N   1 
ATOM   4369 C CA  . LEU B 1 185 ? 23.893  31.310  -14.865 1.00 20.79 ? 185 LEU B CA  1 
ATOM   4370 C C   . LEU B 1 185 ? 23.120  31.720  -13.625 1.00 20.51 ? 185 LEU B C   1 
ATOM   4371 O O   . LEU B 1 185 ? 23.313  31.169  -12.544 1.00 15.71 ? 185 LEU B O   1 
ATOM   4372 C CB  . LEU B 1 185 ? 23.427  29.919  -15.331 1.00 22.38 ? 185 LEU B CB  1 
ATOM   4373 C CG  . LEU B 1 185 ? 21.930  29.864  -15.728 1.00 21.86 ? 185 LEU B CG  1 
ATOM   4374 C CD1 . LEU B 1 185 ? 21.592  30.951  -16.717 1.00 18.79 ? 185 LEU B CD1 1 
ATOM   4375 C CD2 . LEU B 1 185 ? 21.588  28.513  -16.345 1.00 24.16 ? 185 LEU B CD2 1 
ATOM   4376 N N   . ALA B 1 186 ? 22.275  32.725  -13.790 1.00 22.05 ? 186 ALA B N   1 
ATOM   4377 C CA  . ALA B 1 186 ? 21.461  33.209  -12.700 1.00 22.60 ? 186 ALA B CA  1 
ATOM   4378 C C   . ALA B 1 186 ? 20.018  33.161  -13.179 1.00 23.42 ? 186 ALA B C   1 
ATOM   4379 O O   . ALA B 1 186 ? 19.586  33.998  -13.972 1.00 23.41 ? 186 ALA B O   1 
ATOM   4380 C CB  . ALA B 1 186 ? 21.862  34.640  -12.324 1.00 24.36 ? 186 ALA B CB  1 
ATOM   4381 N N   . ASP B 1 187 ? 19.289  32.153  -12.698 1.00 24.19 ? 187 ASP B N   1 
ATOM   4382 C CA  . ASP B 1 187 ? 17.887  31.951  -13.049 1.00 24.53 ? 187 ASP B CA  1 
ATOM   4383 C C   . ASP B 1 187 ? 17.028  31.627  -11.806 1.00 23.64 ? 187 ASP B C   1 
ATOM   4384 O O   . ASP B 1 187 ? 17.251  30.621  -11.129 1.00 25.01 ? 187 ASP B O   1 
ATOM   4385 C CB  . ASP B 1 187 ? 17.775  30.825  -14.088 1.00 25.67 ? 187 ASP B CB  1 
ATOM   4386 C CG  . ASP B 1 187 ? 16.337  30.525  -14.467 1.00 28.94 ? 187 ASP B CG  1 
ATOM   4387 O OD1 . ASP B 1 187 ? 15.435  31.292  -14.031 1.00 30.24 ? 187 ASP B OD1 1 
ATOM   4388 O OD2 . ASP B 1 187 ? 16.099  29.532  -15.197 1.00 28.12 ? 187 ASP B OD2 1 
ATOM   4389 N N   . PRO B 1 188 ? 16.036  32.481  -11.498 1.00 23.43 ? 188 PRO B N   1 
ATOM   4390 C CA  . PRO B 1 188 ? 15.161  32.280  -10.342 1.00 23.79 ? 188 PRO B CA  1 
ATOM   4391 C C   . PRO B 1 188 ? 14.422  30.941  -10.405 1.00 24.30 ? 188 PRO B C   1 
ATOM   4392 O O   . PRO B 1 188 ? 13.895  30.472  -9.407  1.00 21.42 ? 188 PRO B O   1 
ATOM   4393 C CB  . PRO B 1 188 ? 14.199  33.466  -10.437 1.00 24.73 ? 188 PRO B CB  1 
ATOM   4394 C CG  . PRO B 1 188 ? 15.010  34.506  -11.107 1.00 24.28 ? 188 PRO B CG  1 
ATOM   4395 C CD  . PRO B 1 188 ? 15.647  33.709  -12.211 1.00 22.98 ? 188 PRO B CD  1 
ATOM   4396 N N   . ALA B 1 189 ? 14.397  30.347  -11.599 1.00 25.45 ? 189 ALA B N   1 
ATOM   4397 C CA  . ALA B 1 189 ? 13.729  29.065  -11.844 1.00 27.36 ? 189 ALA B CA  1 
ATOM   4398 C C   . ALA B 1 189 ? 14.099  28.024  -10.813 1.00 28.41 ? 189 ALA B C   1 
ATOM   4399 O O   . ALA B 1 189 ? 13.249  27.243  -10.364 1.00 27.84 ? 189 ALA B O   1 
ATOM   4400 C CB  . ALA B 1 189 ? 14.088  28.543  -13.231 1.00 26.98 ? 189 ALA B CB  1 
ATOM   4401 N N   . PHE B 1 190 ? 15.379  28.013  -10.456 1.00 30.59 ? 190 PHE B N   1 
ATOM   4402 C CA  . PHE B 1 190 ? 15.883  27.058  -9.490  1.00 32.07 ? 190 PHE B CA  1 
ATOM   4403 C C   . PHE B 1 190 ? 16.341  27.612  -8.156  1.00 31.14 ? 190 PHE B C   1 
ATOM   4404 O O   . PHE B 1 190 ? 17.096  28.588  -8.096  1.00 29.25 ? 190 PHE B O   1 
ATOM   4405 C CB  . PHE B 1 190 ? 17.018  26.276  -10.114 1.00 35.39 ? 190 PHE B CB  1 
ATOM   4406 C CG  . PHE B 1 190 ? 16.555  25.257  -11.093 1.00 40.05 ? 190 PHE B CG  1 
ATOM   4407 C CD1 . PHE B 1 190 ? 16.609  25.510  -12.469 1.00 39.66 ? 190 PHE B CD1 1 
ATOM   4408 C CD2 . PHE B 1 190 ? 16.047  24.037  -10.636 1.00 41.96 ? 190 PHE B CD2 1 
ATOM   4409 C CE1 . PHE B 1 190 ? 16.164  24.560  -13.375 1.00 40.76 ? 190 PHE B CE1 1 
ATOM   4410 C CE2 . PHE B 1 190 ? 15.599  23.077  -11.528 1.00 42.61 ? 190 PHE B CE2 1 
ATOM   4411 C CZ  . PHE B 1 190 ? 15.658  23.338  -12.908 1.00 42.57 ? 190 PHE B CZ  1 
ATOM   4412 N N   . ILE B 1 191 ? 15.870  26.965  -7.090  1.00 30.02 ? 191 ILE B N   1 
ATOM   4413 C CA  . ILE B 1 191 ? 16.226  27.341  -5.726  1.00 28.05 ? 191 ILE B CA  1 
ATOM   4414 C C   . ILE B 1 191 ? 17.053  26.205  -5.089  1.00 26.56 ? 191 ILE B C   1 
ATOM   4415 O O   . ILE B 1 191 ? 16.650  25.038  -5.120  1.00 24.66 ? 191 ILE B O   1 
ATOM   4416 C CB  . ILE B 1 191 ? 14.949  27.600  -4.880  1.00 28.98 ? 191 ILE B CB  1 
ATOM   4417 C CG1 . ILE B 1 191 ? 14.160  28.755  -5.487  1.00 26.25 ? 191 ILE B CG1 1 
ATOM   4418 C CG2 . ILE B 1 191 ? 15.320  27.908  -3.427  1.00 28.92 ? 191 ILE B CG2 1 
ATOM   4419 C CD1 . ILE B 1 191 ? 14.950  30.056  -5.581  1.00 28.73 ? 191 ILE B CD1 1 
ATOM   4420 N N   . ARG B 1 192 ? 18.203  26.555  -4.514  1.00 22.83 ? 192 ARG B N   1 
ATOM   4421 C CA  . ARG B 1 192 ? 19.080  25.574  -3.876  1.00 20.60 ? 192 ARG B CA  1 
ATOM   4422 C C   . ARG B 1 192 ? 18.709  25.227  -2.426  1.00 19.48 ? 192 ARG B C   1 
ATOM   4423 O O   . ARG B 1 192 ? 18.735  24.069  -2.029  1.00 14.58 ? 192 ARG B O   1 
ATOM   4424 C CB  . ARG B 1 192 ? 20.516  26.059  -3.898  1.00 18.92 ? 192 ARG B CB  1 
ATOM   4425 C CG  . ARG B 1 192 ? 21.401  25.162  -3.090  1.00 20.57 ? 192 ARG B CG  1 
ATOM   4426 C CD  . ARG B 1 192 ? 22.845  25.470  -3.317  1.00 22.88 ? 192 ARG B CD  1 
ATOM   4427 N NE  . ARG B 1 192 ? 23.699  24.368  -2.856  1.00 26.14 ? 192 ARG B NE  1 
ATOM   4428 C CZ  . ARG B 1 192 ? 23.920  24.069  -1.580  1.00 23.50 ? 192 ARG B CZ  1 
ATOM   4429 N NH1 . ARG B 1 192 ? 23.346  24.777  -0.620  1.00 19.92 ? 192 ARG B NH1 1 
ATOM   4430 N NH2 . ARG B 1 192 ? 24.748  23.086  -1.274  1.00 26.40 ? 192 ARG B NH2 1 
ATOM   4431 N N   . ALA B 1 193 ? 18.411  26.248  -1.633  1.00 20.36 ? 193 ALA B N   1 
ATOM   4432 C CA  . ALA B 1 193 ? 18.013  26.052  -0.244  1.00 20.74 ? 193 ALA B CA  1 
ATOM   4433 C C   . ALA B 1 193 ? 16.967  27.109  0.080   1.00 20.82 ? 193 ALA B C   1 
ATOM   4434 O O   . ALA B 1 193 ? 16.766  28.039  -0.701  1.00 22.66 ? 193 ALA B O   1 
ATOM   4435 C CB  . ALA B 1 193 ? 19.214  26.167  0.678   1.00 13.20 ? 193 ALA B CB  1 
ATOM   4436 N N   . TRP B 1 194 ? 16.302  26.966  1.227   1.00 23.66 ? 194 TRP B N   1 
ATOM   4437 C CA  . TRP B 1 194 ? 15.241  27.889  1.646   1.00 23.34 ? 194 TRP B CA  1 
ATOM   4438 C C   . TRP B 1 194 ? 15.467  28.280  3.119   1.00 25.91 ? 194 TRP B C   1 
ATOM   4439 O O   . TRP B 1 194 ? 16.302  27.669  3.813   1.00 22.47 ? 194 TRP B O   1 
ATOM   4440 C CB  . TRP B 1 194 ? 13.892  27.171  1.443   1.00 25.60 ? 194 TRP B CB  1 
ATOM   4441 C CG  . TRP B 1 194 ? 12.622  28.011  1.549   1.00 27.32 ? 194 TRP B CG  1 
ATOM   4442 C CD1 . TRP B 1 194 ? 11.908  28.289  2.688   1.00 26.71 ? 194 TRP B CD1 1 
ATOM   4443 C CD2 . TRP B 1 194 ? 11.903  28.652  0.464   1.00 28.19 ? 194 TRP B CD2 1 
ATOM   4444 N NE1 . TRP B 1 194 ? 10.801  29.054  2.381   1.00 25.08 ? 194 TRP B NE1 1 
ATOM   4445 C CE2 . TRP B 1 194 ? 10.774  29.291  1.030   1.00 25.10 ? 194 TRP B CE2 1 
ATOM   4446 C CE3 . TRP B 1 194 ? 12.110  28.749  -0.926  1.00 25.76 ? 194 TRP B CE3 1 
ATOM   4447 C CZ2 . TRP B 1 194 ? 9.856   30.011  0.259   1.00 24.69 ? 194 TRP B CZ2 1 
ATOM   4448 C CZ3 . TRP B 1 194 ? 11.200  29.463  -1.688  1.00 21.00 ? 194 TRP B CZ3 1 
ATOM   4449 C CH2 . TRP B 1 194 ? 10.082  30.085  -1.090  1.00 24.26 ? 194 TRP B CH2 1 
ATOM   4450 N N   . VAL B 1 195 ? 14.769  29.327  3.576   1.00 24.87 ? 195 VAL B N   1 
ATOM   4451 C CA  . VAL B 1 195 ? 14.878  29.777  4.967   1.00 23.41 ? 195 VAL B CA  1 
ATOM   4452 C C   . VAL B 1 195 ? 14.236  28.694  5.800   1.00 23.40 ? 195 VAL B C   1 
ATOM   4453 O O   . VAL B 1 195 ? 13.106  28.301  5.526   1.00 23.61 ? 195 VAL B O   1 
ATOM   4454 C CB  . VAL B 1 195 ? 14.104  31.090  5.220   1.00 20.79 ? 195 VAL B CB  1 
ATOM   4455 C CG1 . VAL B 1 195 ? 13.974  31.331  6.719   1.00 18.14 ? 195 VAL B CG1 1 
ATOM   4456 C CG2 . VAL B 1 195 ? 14.823  32.240  4.568   1.00 22.01 ? 195 VAL B CG2 1 
ATOM   4457 N N   . GLY B 1 196 ? 14.948  28.221  6.816   1.00 24.67 ? 196 GLY B N   1 
ATOM   4458 C CA  . GLY B 1 196 ? 14.411  27.161  7.653   1.00 27.44 ? 196 GLY B CA  1 
ATOM   4459 C C   . GLY B 1 196 ? 14.729  25.821  7.013   1.00 29.00 ? 196 GLY B C   1 
ATOM   4460 O O   . GLY B 1 196 ? 14.259  24.758  7.458   1.00 27.69 ? 196 GLY B O   1 
ATOM   4461 N N   . GLY B 1 197 ? 15.536  25.894  5.952   1.00 28.09 ? 197 GLY B N   1 
ATOM   4462 C CA  . GLY B 1 197 ? 15.949  24.715  5.225   1.00 24.19 ? 197 GLY B CA  1 
ATOM   4463 C C   . GLY B 1 197 ? 17.200  24.138  5.840   1.00 24.91 ? 197 GLY B C   1 
ATOM   4464 O O   . GLY B 1 197 ? 17.447  24.285  7.033   1.00 27.37 ? 197 GLY B O   1 
ATOM   4465 N N   . VAL B 1 198 ? 18.020  23.494  5.028   1.00 22.41 ? 198 VAL B N   1 
ATOM   4466 C CA  . VAL B 1 198 ? 19.217  22.891  5.563   1.00 20.07 ? 198 VAL B CA  1 
ATOM   4467 C C   . VAL B 1 198 ? 20.487  23.255  4.754   1.00 18.89 ? 198 VAL B C   1 
ATOM   4468 O O   . VAL B 1 198 ? 21.538  22.631  4.896   1.00 17.80 ? 198 VAL B O   1 
ATOM   4469 C CB  . VAL B 1 198 ? 18.978  21.359  5.669   1.00 17.51 ? 198 VAL B CB  1 
ATOM   4470 C CG1 . VAL B 1 198 ? 18.970  20.728  4.304   1.00 18.72 ? 198 VAL B CG1 1 
ATOM   4471 C CG2 . VAL B 1 198 ? 19.993  20.732  6.577   1.00 19.93 ? 198 VAL B CG2 1 
ATOM   4472 N N   . GLY B 1 199 ? 20.382  24.305  3.943   1.00 18.37 ? 199 GLY B N   1 
ATOM   4473 C CA  . GLY B 1 199 ? 21.507  24.752  3.141   1.00 19.23 ? 199 GLY B CA  1 
ATOM   4474 C C   . GLY B 1 199 ? 22.706  25.272  3.919   1.00 19.51 ? 199 GLY B C   1 
ATOM   4475 O O   . GLY B 1 199 ? 23.795  25.444  3.369   1.00 19.13 ? 199 GLY B O   1 
ATOM   4476 N N   . ASN B 1 200 ? 22.539  25.543  5.200   1.00 16.83 ? 200 ASN B N   1 
ATOM   4477 C CA  . ASN B 1 200 ? 23.686  26.025  5.930   1.00 18.61 ? 200 ASN B CA  1 
ATOM   4478 C C   . ASN B 1 200 ? 24.437  24.862  6.559   1.00 19.85 ? 200 ASN B C   1 
ATOM   4479 O O   . ASN B 1 200 ? 25.240  25.031  7.477   1.00 20.58 ? 200 ASN B O   1 
ATOM   4480 C CB  . ASN B 1 200 ? 23.294  27.068  6.976   1.00 22.26 ? 200 ASN B CB  1 
ATOM   4481 C CG  . ASN B 1 200 ? 22.253  26.573  7.962   1.00 25.03 ? 200 ASN B CG  1 
ATOM   4482 O OD1 . ASN B 1 200 ? 22.206  27.042  9.111   1.00 25.60 ? 200 ASN B OD1 1 
ATOM   4483 N ND2 . ASN B 1 200 ? 21.399  25.644  7.524   1.00 25.64 ? 200 ASN B ND2 1 
ATOM   4484 N N   . TYR B 1 201 ? 24.167  23.671  6.043   1.00 19.63 ? 201 TYR B N   1 
ATOM   4485 C CA  . TYR B 1 201 ? 24.841  22.463  6.494   1.00 15.45 ? 201 TYR B CA  1 
ATOM   4486 C C   . TYR B 1 201 ? 25.357  21.815  5.231   1.00 15.26 ? 201 TYR B C   1 
ATOM   4487 O O   . TYR B 1 201 ? 24.775  21.967  4.157   1.00 14.27 ? 201 TYR B O   1 
ATOM   4488 C CB  . TYR B 1 201 ? 23.881  21.513  7.200   1.00 13.34 ? 201 TYR B CB  1 
ATOM   4489 C CG  . TYR B 1 201 ? 23.219  22.099  8.423   1.00 16.65 ? 201 TYR B CG  1 
ATOM   4490 C CD1 . TYR B 1 201 ? 23.866  22.110  9.658   1.00 12.72 ? 201 TYR B CD1 1 
ATOM   4491 C CD2 . TYR B 1 201 ? 21.929  22.632  8.346   1.00 15.28 ? 201 TYR B CD2 1 
ATOM   4492 C CE1 . TYR B 1 201 ? 23.248  22.626  10.780  1.00 14.01 ? 201 TYR B CE1 1 
ATOM   4493 C CE2 . TYR B 1 201 ? 21.307  23.147  9.455   1.00 17.77 ? 201 TYR B CE2 1 
ATOM   4494 C CZ  . TYR B 1 201 ? 21.969  23.141  10.674  1.00 17.82 ? 201 TYR B CZ  1 
ATOM   4495 O OH  . TYR B 1 201 ? 21.324  23.631  11.779  1.00 21.58 ? 201 TYR B OH  1 
ATOM   4496 N N   . LYS B 1 202 ? 26.451  21.088  5.368   1.00 15.02 ? 202 LYS B N   1 
ATOM   4497 C CA  . LYS B 1 202 ? 27.059  20.427  4.243   1.00 16.67 ? 202 LYS B CA  1 
ATOM   4498 C C   . LYS B 1 202 ? 26.501  19.006  4.128   1.00 16.38 ? 202 LYS B C   1 
ATOM   4499 O O   . LYS B 1 202 ? 27.151  18.025  4.483   1.00 15.60 ? 202 LYS B O   1 
ATOM   4500 C CB  . LYS B 1 202 ? 28.574  20.425  4.435   1.00 17.47 ? 202 LYS B CB  1 
ATOM   4501 C CG  . LYS B 1 202 ? 29.364  19.936  3.250   1.00 20.94 ? 202 LYS B CG  1 
ATOM   4502 C CD  . LYS B 1 202 ? 30.849  19.939  3.547   1.00 24.09 ? 202 LYS B CD  1 
ATOM   4503 C CE  . LYS B 1 202 ? 31.494  21.183  2.976   1.00 26.47 ? 202 LYS B CE  1 
ATOM   4504 N NZ  . LYS B 1 202 ? 31.341  21.254  1.525   1.00 24.99 ? 202 LYS B NZ  1 
ATOM   4505 N N   . LEU B 1 203 ? 25.287  18.906  3.608   1.00 15.58 ? 203 LEU B N   1 
ATOM   4506 C CA  . LEU B 1 203 ? 24.642  17.614  3.458   1.00 15.62 ? 203 LEU B CA  1 
ATOM   4507 C C   . LEU B 1 203 ? 24.564  17.192  2.006   1.00 15.88 ? 203 LEU B C   1 
ATOM   4508 O O   . LEU B 1 203 ? 24.301  18.020  1.139   1.00 19.09 ? 203 LEU B O   1 
ATOM   4509 C CB  . LEU B 1 203 ? 23.224  17.676  4.006   1.00 14.32 ? 203 LEU B CB  1 
ATOM   4510 C CG  . LEU B 1 203 ? 23.011  18.457  5.301   1.00 17.57 ? 203 LEU B CG  1 
ATOM   4511 C CD1 . LEU B 1 203 ? 21.527  18.397  5.608   1.00 15.79 ? 203 LEU B CD1 1 
ATOM   4512 C CD2 . LEU B 1 203 ? 23.842  17.885  6.462   1.00 12.07 ? 203 LEU B CD2 1 
ATOM   4513 N N   . GLY B 1 204 ? 24.776  15.900  1.749   1.00 15.87 ? 204 GLY B N   1 
ATOM   4514 C CA  . GLY B 1 204 ? 24.682  15.388  0.392   1.00 15.88 ? 204 GLY B CA  1 
ATOM   4515 C C   . GLY B 1 204 ? 23.401  15.841  -0.295  1.00 14.54 ? 204 GLY B C   1 
ATOM   4516 O O   . GLY B 1 204 ? 23.430  16.241  -1.450  1.00 15.02 ? 204 GLY B O   1 
ATOM   4517 N N   . GLY B 1 205 ? 22.281  15.797  0.425   1.00 13.18 ? 205 GLY B N   1 
ATOM   4518 C CA  . GLY B 1 205 ? 21.008  16.209  -0.137  1.00 14.31 ? 205 GLY B CA  1 
ATOM   4519 C C   . GLY B 1 205 ? 20.969  17.588  -0.769  1.00 16.41 ? 205 GLY B C   1 
ATOM   4520 O O   . GLY B 1 205 ? 20.183  17.846  -1.681  1.00 17.01 ? 205 GLY B O   1 
ATOM   4521 N N   . ASN B 1 206 ? 21.796  18.505  -0.281  1.00 17.58 ? 206 ASN B N   1 
ATOM   4522 C CA  . ASN B 1 206 ? 21.818  19.844  -0.860  1.00 17.49 ? 206 ASN B CA  1 
ATOM   4523 C C   . ASN B 1 206 ? 22.299  19.845  -2.318  1.00 15.85 ? 206 ASN B C   1 
ATOM   4524 O O   . ASN B 1 206 ? 21.830  20.660  -3.117  1.00 12.91 ? 206 ASN B O   1 
ATOM   4525 C CB  . ASN B 1 206 ? 22.739  20.773  -0.049  1.00 16.59 ? 206 ASN B CB  1 
ATOM   4526 C CG  . ASN B 1 206 ? 22.147  21.182  1.288   1.00 17.09 ? 206 ASN B CG  1 
ATOM   4527 O OD1 . ASN B 1 206 ? 22.838  21.755  2.125   1.00 18.79 ? 206 ASN B OD1 1 
ATOM   4528 N ND2 . ASN B 1 206 ? 20.867  20.912  1.486   1.00 15.70 ? 206 ASN B ND2 1 
ATOM   4529 N N   . TYR B 1 207 ? 23.206  18.920  -2.651  1.00 14.28 ? 207 TYR B N   1 
ATOM   4530 C CA  . TYR B 1 207 ? 23.828  18.838  -3.987  1.00 17.09 ? 207 TYR B CA  1 
ATOM   4531 C C   . TYR B 1 207 ? 23.170  18.024  -5.113  1.00 17.26 ? 207 TYR B C   1 
ATOM   4532 O O   . TYR B 1 207 ? 23.128  18.472  -6.263  1.00 15.61 ? 207 TYR B O   1 
ATOM   4533 C CB  . TYR B 1 207 ? 25.290  18.377  -3.829  1.00 16.51 ? 207 TYR B CB  1 
ATOM   4534 C CG  . TYR B 1 207 ? 26.044  19.228  -2.845  1.00 16.70 ? 207 TYR B CG  1 
ATOM   4535 C CD1 . TYR B 1 207 ? 25.792  19.132  -1.470  1.00 18.17 ? 207 TYR B CD1 1 
ATOM   4536 C CD2 . TYR B 1 207 ? 26.903  20.228  -3.285  1.00 17.23 ? 207 TYR B CD2 1 
ATOM   4537 C CE1 . TYR B 1 207 ? 26.364  20.019  -0.570  1.00 16.66 ? 207 TYR B CE1 1 
ATOM   4538 C CE2 . TYR B 1 207 ? 27.477  21.118  -2.389  1.00 18.92 ? 207 TYR B CE2 1 
ATOM   4539 C CZ  . TYR B 1 207 ? 27.202  21.008  -1.039  1.00 16.69 ? 207 TYR B CZ  1 
ATOM   4540 O OH  . TYR B 1 207 ? 27.773  21.890  -0.168  1.00 20.55 ? 207 TYR B OH  1 
ATOM   4541 N N   . GLY B 1 208 ? 22.682  16.831  -4.784  1.00 16.53 ? 208 GLY B N   1 
ATOM   4542 C CA  . GLY B 1 208 ? 22.053  15.977  -5.777  1.00 14.76 ? 208 GLY B CA  1 
ATOM   4543 C C   . GLY B 1 208 ? 21.247  16.733  -6.811  1.00 15.04 ? 208 GLY B C   1 
ATOM   4544 O O   . GLY B 1 208 ? 21.467  16.549  -8.004  1.00 16.93 ? 208 GLY B O   1 
ATOM   4545 N N   . PRO B 1 209 ? 20.316  17.609  -6.384  1.00 16.01 ? 209 PRO B N   1 
ATOM   4546 C CA  . PRO B 1 209 ? 19.448  18.418  -7.261  1.00 14.28 ? 209 PRO B CA  1 
ATOM   4547 C C   . PRO B 1 209 ? 20.134  19.517  -8.076  1.00 16.01 ? 209 PRO B C   1 
ATOM   4548 O O   . PRO B 1 209 ? 19.481  20.179  -8.867  1.00 14.46 ? 209 PRO B O   1 
ATOM   4549 C CB  . PRO B 1 209 ? 18.446  19.029  -6.284  1.00 14.77 ? 209 PRO B CB  1 
ATOM   4550 C CG  . PRO B 1 209 ? 18.565  18.184  -5.028  1.00 14.41 ? 209 PRO B CG  1 
ATOM   4551 C CD  . PRO B 1 209 ? 20.021  17.903  -4.970  1.00 12.50 ? 209 PRO B CD  1 
ATOM   4552 N N   . THR B 1 210 ? 21.434  19.737  -7.866  1.00 16.67 ? 210 THR B N   1 
ATOM   4553 C CA  . THR B 1 210 ? 22.149  20.792  -8.592  1.00 16.44 ? 210 THR B CA  1 
ATOM   4554 C C   . THR B 1 210 ? 22.728  20.287  -9.898  1.00 14.64 ? 210 THR B C   1 
ATOM   4555 O O   . THR B 1 210 ? 23.025  21.071  -10.786 1.00 17.34 ? 210 THR B O   1 
ATOM   4556 C CB  . THR B 1 210 ? 23.345  21.384  -7.778  1.00 15.26 ? 210 THR B CB  1 
ATOM   4557 O OG1 . THR B 1 210 ? 24.359  20.377  -7.619  1.00 17.21 ? 210 THR B OG1 1 
ATOM   4558 C CG2 . THR B 1 210 ? 22.897  21.877  -6.401  1.00 15.93 ? 210 THR B CG2 1 
ATOM   4559 N N   . VAL B 1 211 ? 22.901  18.982  -10.010 1.00 14.44 ? 211 VAL B N   1 
ATOM   4560 C CA  . VAL B 1 211 ? 23.468  18.396  -11.212 1.00 14.83 ? 211 VAL B CA  1 
ATOM   4561 C C   . VAL B 1 211 ? 22.705  18.744  -12.483 1.00 17.89 ? 211 VAL B C   1 
ATOM   4562 O O   . VAL B 1 211 ? 23.296  19.028  -13.515 1.00 21.63 ? 211 VAL B O   1 
ATOM   4563 C CB  . VAL B 1 211 ? 23.535  16.884  -11.080 1.00 16.50 ? 211 VAL B CB  1 
ATOM   4564 C CG1 . VAL B 1 211 ? 24.130  16.274  -12.349 1.00 14.04 ? 211 VAL B CG1 1 
ATOM   4565 C CG2 . VAL B 1 211 ? 24.359  16.523  -9.844  1.00 12.54 ? 211 VAL B CG2 1 
ATOM   4566 N N   . LEU B 1 212 ? 21.383  18.703  -12.416 1.00 19.39 ? 212 LEU B N   1 
ATOM   4567 C CA  . LEU B 1 212 ? 20.554  19.040  -13.567 1.00 18.83 ? 212 LEU B CA  1 
ATOM   4568 C C   . LEU B 1 212 ? 20.805  20.510  -13.914 1.00 18.43 ? 212 LEU B C   1 
ATOM   4569 O O   . LEU B 1 212 ? 21.177  20.830  -15.034 1.00 18.58 ? 212 LEU B O   1 
ATOM   4570 C CB  . LEU B 1 212 ? 19.067  18.837  -13.227 1.00 17.88 ? 212 LEU B CB  1 
ATOM   4571 C CG  . LEU B 1 212 ? 18.035  19.183  -14.310 1.00 19.12 ? 212 LEU B CG  1 
ATOM   4572 C CD1 . LEU B 1 212 ? 18.190  18.179  -15.450 1.00 11.51 ? 212 LEU B CD1 1 
ATOM   4573 C CD2 . LEU B 1 212 ? 16.604  19.143  -13.733 1.00 15.11 ? 212 LEU B CD2 1 
ATOM   4574 N N   . VAL B 1 213 ? 20.613  21.390  -12.929 1.00 17.48 ? 213 VAL B N   1 
ATOM   4575 C CA  . VAL B 1 213 ? 20.789  22.836  -13.110 1.00 15.03 ? 213 VAL B CA  1 
ATOM   4576 C C   . VAL B 1 213 ? 22.177  23.196  -13.625 1.00 17.51 ? 213 VAL B C   1 
ATOM   4577 O O   . VAL B 1 213 ? 22.343  24.127  -14.418 1.00 18.78 ? 213 VAL B O   1 
ATOM   4578 C CB  . VAL B 1 213 ? 20.527  23.584  -11.782 1.00 15.14 ? 213 VAL B CB  1 
ATOM   4579 C CG1 . VAL B 1 213 ? 20.763  25.086  -11.955 1.00 12.98 ? 213 VAL B CG1 1 
ATOM   4580 C CG2 . VAL B 1 213 ? 19.112  23.323  -11.328 1.00 11.43 ? 213 VAL B CG2 1 
ATOM   4581 N N   . GLN B 1 214 ? 23.179  22.456  -13.168 1.00 17.24 ? 214 GLN B N   1 
ATOM   4582 C CA  . GLN B 1 214 ? 24.539  22.705  -13.614 1.00 18.61 ? 214 GLN B CA  1 
ATOM   4583 C C   . GLN B 1 214 ? 24.623  22.429  -15.121 1.00 18.34 ? 214 GLN B C   1 
ATOM   4584 O O   . GLN B 1 214 ? 25.189  23.219  -15.863 1.00 21.33 ? 214 GLN B O   1 
ATOM   4585 C CB  . GLN B 1 214 ? 25.511  21.825  -12.820 1.00 19.93 ? 214 GLN B CB  1 
ATOM   4586 C CG  . GLN B 1 214 ? 26.970  22.108  -13.096 1.00 25.96 ? 214 GLN B CG  1 
ATOM   4587 C CD  . GLN B 1 214 ? 27.308  23.587  -13.046 1.00 28.56 ? 214 GLN B CD  1 
ATOM   4588 O OE1 . GLN B 1 214 ? 27.232  24.234  -11.980 1.00 29.48 ? 214 GLN B OE1 1 
ATOM   4589 N NE2 . GLN B 1 214 ? 27.681  24.140  -14.203 1.00 27.88 ? 214 GLN B NE2 1 
ATOM   4590 N N   . GLN B 1 215 ? 24.039  21.325  -15.575 1.00 19.04 ? 215 GLN B N   1 
ATOM   4591 C CA  . GLN B 1 215 ? 24.045  21.006  -16.998 1.00 21.32 ? 215 GLN B CA  1 
ATOM   4592 C C   . GLN B 1 215 ? 23.333  22.127  -17.787 1.00 21.06 ? 215 GLN B C   1 
ATOM   4593 O O   . GLN B 1 215 ? 23.787  22.515  -18.851 1.00 22.52 ? 215 GLN B O   1 
ATOM   4594 C CB  . GLN B 1 215 ? 23.326  19.668  -17.271 1.00 23.06 ? 215 GLN B CB  1 
ATOM   4595 C CG  . GLN B 1 215 ? 24.016  18.420  -16.730 1.00 26.71 ? 215 GLN B CG  1 
ATOM   4596 C CD  . GLN B 1 215 ? 23.346  17.107  -17.192 1.00 29.27 ? 215 GLN B CD  1 
ATOM   4597 O OE1 . GLN B 1 215 ? 23.825  16.007  -16.899 1.00 28.46 ? 215 GLN B OE1 1 
ATOM   4598 N NE2 . GLN B 1 215 ? 22.234  17.228  -17.915 1.00 34.01 ? 215 GLN B NE2 1 
ATOM   4599 N N   . GLU B 1 216 ? 22.218  22.634  -17.256 1.00 21.48 ? 216 GLU B N   1 
ATOM   4600 C CA  . GLU B 1 216 ? 21.441  23.698  -17.899 1.00 22.31 ? 216 GLU B CA  1 
ATOM   4601 C C   . GLU B 1 216 ? 22.240  24.972  -17.988 1.00 23.44 ? 216 GLU B C   1 
ATOM   4602 O O   . GLU B 1 216 ? 22.011  25.795  -18.867 1.00 21.65 ? 216 GLU B O   1 
ATOM   4603 C CB  . GLU B 1 216 ? 20.161  23.973  -17.109 1.00 25.66 ? 216 GLU B CB  1 
ATOM   4604 C CG  . GLU B 1 216 ? 19.431  25.254  -17.501 1.00 30.50 ? 216 GLU B CG  1 
ATOM   4605 C CD  . GLU B 1 216 ? 19.148  25.341  -19.002 1.00 36.41 ? 216 GLU B CD  1 
ATOM   4606 O OE1 . GLU B 1 216 ? 18.569  24.377  -19.562 1.00 39.22 ? 216 GLU B OE1 1 
ATOM   4607 O OE2 . GLU B 1 216 ? 19.497  26.372  -19.625 1.00 36.07 ? 216 GLU B OE2 1 
ATOM   4608 N N   . ALA B 1 217 ? 23.168  25.127  -17.047 1.00 24.08 ? 217 ALA B N   1 
ATOM   4609 C CA  . ALA B 1 217 ? 24.038  26.282  -16.987 1.00 26.46 ? 217 ALA B CA  1 
ATOM   4610 C C   . ALA B 1 217 ? 25.066  26.184  -18.122 1.00 27.90 ? 217 ALA B C   1 
ATOM   4611 O O   . ALA B 1 217 ? 25.427  27.192  -18.736 1.00 31.81 ? 217 ALA B O   1 
ATOM   4612 C CB  . ALA B 1 217 ? 24.744  26.319  -15.634 1.00 25.86 ? 217 ALA B CB  1 
ATOM   4613 N N   . LEU B 1 218 ? 25.533  24.967  -18.399 1.00 27.09 ? 218 LEU B N   1 
ATOM   4614 C CA  . LEU B 1 218 ? 26.507  24.735  -19.458 1.00 26.67 ? 218 LEU B CA  1 
ATOM   4615 C C   . LEU B 1 218 ? 25.840  24.808  -20.819 1.00 26.68 ? 218 LEU B C   1 
ATOM   4616 O O   . LEU B 1 218 ? 26.409  25.309  -21.793 1.00 28.52 ? 218 LEU B O   1 
ATOM   4617 C CB  . LEU B 1 218 ? 27.131  23.370  -19.265 1.00 27.62 ? 218 LEU B CB  1 
ATOM   4618 C CG  . LEU B 1 218 ? 28.086  23.294  -18.078 1.00 29.77 ? 218 LEU B CG  1 
ATOM   4619 C CD1 . LEU B 1 218 ? 28.528  21.849  -17.886 1.00 31.42 ? 218 LEU B CD1 1 
ATOM   4620 C CD2 . LEU B 1 218 ? 29.308  24.194  -18.326 1.00 30.97 ? 218 LEU B CD2 1 
ATOM   4621 N N   . LYS B 1 219 ? 24.619  24.297  -20.853 1.00 27.64 ? 219 LYS B N   1 
ATOM   4622 C CA  . LYS B 1 219 ? 23.773  24.286  -22.026 1.00 28.03 ? 219 LYS B CA  1 
ATOM   4623 C C   . LYS B 1 219 ? 23.484  25.767  -22.360 1.00 28.44 ? 219 LYS B C   1 
ATOM   4624 O O   . LYS B 1 219 ? 23.443  26.148  -23.529 1.00 28.18 ? 219 LYS B O   1 
ATOM   4625 C CB  . LYS B 1 219 ? 22.464  23.551  -21.673 1.00 30.91 ? 219 LYS B CB  1 
ATOM   4626 C CG  . LYS B 1 219 ? 21.597  23.023  -22.836 1.00 32.01 ? 219 LYS B CG  1 
ATOM   4627 C CD  . LYS B 1 219 ? 20.198  22.567  -22.355 1.00 31.65 ? 219 LYS B CD  1 
ATOM   4628 C CE  . LYS B 1 219 ? 19.422  21.819  -23.458 1.00 35.92 ? 219 LYS B CE  1 
ATOM   4629 N NZ  . LYS B 1 219 ? 19.354  22.560  -24.772 1.00 34.24 ? 219 LYS B NZ  1 
ATOM   4630 N N   . ARG B 1 220 ? 23.290  26.594  -21.332 1.00 27.14 ? 220 ARG B N   1 
ATOM   4631 C CA  . ARG B 1 220 ? 22.999  28.019  -21.540 1.00 26.39 ? 220 ARG B CA  1 
ATOM   4632 C C   . ARG B 1 220 ? 24.257  28.761  -21.901 1.00 24.56 ? 220 ARG B C   1 
ATOM   4633 O O   . ARG B 1 220 ? 24.187  29.941  -22.250 1.00 25.19 ? 220 ARG B O   1 
ATOM   4634 C CB  . ARG B 1 220 ? 22.404  28.673  -20.285 1.00 27.01 ? 220 ARG B CB  1 
ATOM   4635 C CG  . ARG B 1 220 ? 20.885  28.579  -20.154 1.00 31.08 ? 220 ARG B CG  1 
ATOM   4636 C CD  . ARG B 1 220 ? 20.196  29.870  -20.589 1.00 33.99 ? 220 ARG B CD  1 
ATOM   4637 N NE  . ARG B 1 220 ? 20.769  30.338  -21.848 1.00 38.15 ? 220 ARG B NE  1 
ATOM   4638 C CZ  . ARG B 1 220 ? 20.468  31.486  -22.444 1.00 39.63 ? 220 ARG B CZ  1 
ATOM   4639 N NH1 . ARG B 1 220 ? 19.572  32.315  -21.899 1.00 37.86 ? 220 ARG B NH1 1 
ATOM   4640 N NH2 . ARG B 1 220 ? 21.094  31.817  -23.582 1.00 39.53 ? 220 ARG B NH2 1 
ATOM   4641 N N   . GLY B 1 221 ? 25.394  28.068  -21.792 1.00 24.21 ? 221 GLY B N   1 
ATOM   4642 C CA  . GLY B 1 221 ? 26.687  28.656  -22.118 1.00 22.01 ? 221 GLY B CA  1 
ATOM   4643 C C   . GLY B 1 221 ? 27.518  29.200  -20.963 1.00 22.98 ? 221 GLY B C   1 
ATOM   4644 O O   . GLY B 1 221 ? 28.545  29.844  -21.210 1.00 21.45 ? 221 GLY B O   1 
ATOM   4645 N N   . CYS B 1 222 ? 27.091  28.935  -19.718 1.00 23.52 ? 222 CYS B N   1 
ATOM   4646 C CA  . CYS B 1 222 ? 27.791  29.398  -18.518 1.00 23.40 ? 222 CYS B CA  1 
ATOM   4647 C C   . CYS B 1 222 ? 28.608  28.279  -17.889 1.00 24.92 ? 222 CYS B C   1 
ATOM   4648 O O   . CYS B 1 222 ? 28.556  27.139  -18.354 1.00 25.26 ? 222 CYS B O   1 
ATOM   4649 C CB  . CYS B 1 222 ? 26.796  29.956  -17.506 1.00 21.61 ? 222 CYS B CB  1 
ATOM   4650 S SG  . CYS B 1 222 ? 25.757  31.262  -18.226 1.00 27.13 ? 222 CYS B SG  1 
ATOM   4651 N N   . GLU B 1 223 ? 29.351  28.584  -16.830 1.00 24.66 ? 223 GLU B N   1 
ATOM   4652 C CA  . GLU B 1 223 ? 30.183  27.555  -16.222 1.00 27.52 ? 223 GLU B CA  1 
ATOM   4653 C C   . GLU B 1 223 ? 29.837  27.173  -14.802 1.00 26.89 ? 223 GLU B C   1 
ATOM   4654 O O   . GLU B 1 223 ? 30.207  26.095  -14.352 1.00 26.96 ? 223 GLU B O   1 
ATOM   4655 C CB  . GLU B 1 223 ? 31.639  27.988  -16.285 1.00 30.04 ? 223 GLU B CB  1 
ATOM   4656 C CG  . GLU B 1 223 ? 32.088  28.319  -17.694 1.00 31.76 ? 223 GLU B CG  1 
ATOM   4657 C CD  . GLU B 1 223 ? 33.393  29.043  -17.704 1.00 31.44 ? 223 GLU B CD  1 
ATOM   4658 O OE1 . GLU B 1 223 ? 34.278  28.611  -16.930 1.00 34.63 ? 223 GLU B OE1 1 
ATOM   4659 O OE2 . GLU B 1 223 ? 33.533  30.027  -18.471 1.00 34.08 ? 223 GLU B OE2 1 
ATOM   4660 N N   . GLN B 1 224 ? 29.149  28.064  -14.097 1.00 27.20 ? 224 GLN B N   1 
ATOM   4661 C CA  . GLN B 1 224 ? 28.732  27.820  -12.723 1.00 24.82 ? 224 GLN B CA  1 
ATOM   4662 C C   . GLN B 1 224 ? 27.361  28.468  -12.548 1.00 23.00 ? 224 GLN B C   1 
ATOM   4663 O O   . GLN B 1 224 ? 26.926  29.287  -13.391 1.00 21.44 ? 224 GLN B O   1 
ATOM   4664 C CB  . GLN B 1 224 ? 29.690  28.461  -11.719 1.00 29.28 ? 224 GLN B CB  1 
ATOM   4665 C CG  . GLN B 1 224 ? 31.156  28.481  -12.117 1.00 33.59 ? 224 GLN B CG  1 
ATOM   4666 C CD  . GLN B 1 224 ? 31.905  27.231  -11.716 1.00 37.67 ? 224 GLN B CD  1 
ATOM   4667 O OE1 . GLN B 1 224 ? 33.150  27.211  -11.741 1.00 37.76 ? 224 GLN B OE1 1 
ATOM   4668 N NE2 . GLN B 1 224 ? 31.165  26.176  -11.344 1.00 36.90 ? 224 GLN B NE2 1 
ATOM   4669 N N   . VAL B 1 225 ? 26.699  28.116  -11.452 1.00 18.73 ? 225 VAL B N   1 
ATOM   4670 C CA  . VAL B 1 225 ? 25.381  28.636  -11.161 1.00 17.86 ? 225 VAL B CA  1 
ATOM   4671 C C   . VAL B 1 225 ? 25.405  29.628  -10.007 1.00 19.15 ? 225 VAL B C   1 
ATOM   4672 O O   . VAL B 1 225 ? 25.942  29.335  -8.934  1.00 22.15 ? 225 VAL B O   1 
ATOM   4673 C CB  . VAL B 1 225 ? 24.382  27.491  -10.756 1.00 18.03 ? 225 VAL B CB  1 
ATOM   4674 C CG1 . VAL B 1 225 ? 23.010  28.089  -10.361 1.00 13.37 ? 225 VAL B CG1 1 
ATOM   4675 C CG2 . VAL B 1 225 ? 24.229  26.482  -11.895 1.00 11.76 ? 225 VAL B CG2 1 
ATOM   4676 N N   . LEU B 1 226 ? 24.832  30.807  -10.228 1.00 17.71 ? 226 LEU B N   1 
ATOM   4677 C CA  . LEU B 1 226 ? 24.728  31.774  -9.153  1.00 16.51 ? 226 LEU B CA  1 
ATOM   4678 C C   . LEU B 1 226 ? 23.309  31.507  -8.645  1.00 15.35 ? 226 LEU B C   1 
ATOM   4679 O O   . LEU B 1 226 ? 22.338  31.688  -9.381  1.00 12.26 ? 226 LEU B O   1 
ATOM   4680 C CB  . LEU B 1 226 ? 24.850  33.218  -9.664  1.00 17.70 ? 226 LEU B CB  1 
ATOM   4681 C CG  . LEU B 1 226 ? 24.307  34.294  -8.701  1.00 17.01 ? 226 LEU B CG  1 
ATOM   4682 C CD1 . LEU B 1 226 ? 25.127  34.338  -7.419  1.00 12.64 ? 226 LEU B CD1 1 
ATOM   4683 C CD2 . LEU B 1 226 ? 24.298  35.637  -9.396  1.00 14.42 ? 226 LEU B CD2 1 
ATOM   4684 N N   . TRP B 1 227 ? 23.189  31.054  -7.404  1.00 12.73 ? 227 TRP B N   1 
ATOM   4685 C CA  . TRP B 1 227 ? 21.877  30.777  -6.852  1.00 13.22 ? 227 TRP B CA  1 
ATOM   4686 C C   . TRP B 1 227 ? 21.168  32.034  -6.368  1.00 14.38 ? 227 TRP B C   1 
ATOM   4687 O O   . TRP B 1 227 ? 21.687  32.764  -5.512  1.00 15.14 ? 227 TRP B O   1 
ATOM   4688 C CB  . TRP B 1 227 ? 22.004  29.781  -5.709  1.00 14.00 ? 227 TRP B CB  1 
ATOM   4689 C CG  . TRP B 1 227 ? 22.624  28.568  -6.171  1.00 15.23 ? 227 TRP B CG  1 
ATOM   4690 C CD1 . TRP B 1 227 ? 23.963  28.295  -6.217  1.00 13.03 ? 227 TRP B CD1 1 
ATOM   4691 C CD2 . TRP B 1 227 ? 21.969  27.490  -6.834  1.00 14.94 ? 227 TRP B CD2 1 
ATOM   4692 N NE1 . TRP B 1 227 ? 24.175  27.115  -6.874  1.00 13.46 ? 227 TRP B NE1 1 
ATOM   4693 C CE2 . TRP B 1 227 ? 22.973  26.596  -7.267  1.00 12.26 ? 227 TRP B CE2 1 
ATOM   4694 C CE3 . TRP B 1 227 ? 20.628  27.195  -7.114  1.00 15.30 ? 227 TRP B CE3 1 
ATOM   4695 C CZ2 . TRP B 1 227 ? 22.683  25.425  -7.964  1.00 13.14 ? 227 TRP B CZ2 1 
ATOM   4696 C CZ3 . TRP B 1 227 ? 20.338  26.031  -7.807  1.00 13.36 ? 227 TRP B CZ3 1 
ATOM   4697 C CH2 . TRP B 1 227 ? 21.364  25.159  -8.227  1.00 11.02 ? 227 TRP B CH2 1 
ATOM   4698 N N   . LEU B 1 228 ? 19.990  32.294  -6.934  1.00 13.98 ? 228 LEU B N   1 
ATOM   4699 C CA  . LEU B 1 228 ? 19.195  33.452  -6.539  1.00 16.52 ? 228 LEU B CA  1 
ATOM   4700 C C   . LEU B 1 228 ? 18.115  32.962  -5.580  1.00 17.92 ? 228 LEU B C   1 
ATOM   4701 O O   . LEU B 1 228 ? 17.657  31.820  -5.684  1.00 17.24 ? 228 LEU B O   1 
ATOM   4702 C CB  . LEU B 1 228 ? 18.549  34.109  -7.753  1.00 12.72 ? 228 LEU B CB  1 
ATOM   4703 C CG  . LEU B 1 228 ? 19.547  34.738  -8.717  1.00 16.61 ? 228 LEU B CG  1 
ATOM   4704 C CD1 . LEU B 1 228 ? 18.820  35.451  -9.847  1.00 16.82 ? 228 LEU B CD1 1 
ATOM   4705 C CD2 . LEU B 1 228 ? 20.416  35.708  -7.939  1.00 18.66 ? 228 LEU B CD2 1 
ATOM   4706 N N   . TYR B 1 229 ? 17.705  33.826  -4.662  1.00 17.95 ? 229 TYR B N   1 
ATOM   4707 C CA  . TYR B 1 229 ? 16.699  33.447  -3.681  1.00 20.50 ? 229 TYR B CA  1 
ATOM   4708 C C   . TYR B 1 229 ? 15.687  34.543  -3.449  1.00 22.55 ? 229 TYR B C   1 
ATOM   4709 O O   . TYR B 1 229 ? 15.964  35.714  -3.692  1.00 22.84 ? 229 TYR B O   1 
ATOM   4710 C CB  . TYR B 1 229 ? 17.375  33.135  -2.354  1.00 19.19 ? 229 TYR B CB  1 
ATOM   4711 C CG  . TYR B 1 229 ? 16.427  32.735  -1.256  1.00 16.91 ? 229 TYR B CG  1 
ATOM   4712 C CD1 . TYR B 1 229 ? 15.916  31.440  -1.190  1.00 16.10 ? 229 TYR B CD1 1 
ATOM   4713 C CD2 . TYR B 1 229 ? 16.018  33.662  -0.294  1.00 16.72 ? 229 TYR B CD2 1 
ATOM   4714 C CE1 . TYR B 1 229 ? 15.021  31.080  -0.195  1.00 16.65 ? 229 TYR B CE1 1 
ATOM   4715 C CE2 . TYR B 1 229 ? 15.134  33.315  0.705   1.00 16.98 ? 229 TYR B CE2 1 
ATOM   4716 C CZ  . TYR B 1 229 ? 14.637  32.024  0.751   1.00 18.20 ? 229 TYR B CZ  1 
ATOM   4717 O OH  . TYR B 1 229 ? 13.775  31.671  1.758   1.00 24.62 ? 229 TYR B OH  1 
ATOM   4718 N N   . GLY B 1 230 ? 14.508  34.153  -2.974  1.00 23.00 ? 230 GLY B N   1 
ATOM   4719 C CA  . GLY B 1 230 ? 13.471  35.122  -2.675  1.00 20.96 ? 230 GLY B CA  1 
ATOM   4720 C C   . GLY B 1 230 ? 12.903  35.900  -3.845  1.00 23.25 ? 230 GLY B C   1 
ATOM   4721 O O   . GLY B 1 230 ? 13.340  35.756  -4.993  1.00 24.29 ? 230 GLY B O   1 
ATOM   4722 N N   . PRO B 1 231 ? 11.916  36.762  -3.574  1.00 25.03 ? 231 PRO B N   1 
ATOM   4723 C CA  . PRO B 1 231 ? 11.283  37.573  -4.619  1.00 24.19 ? 231 PRO B CA  1 
ATOM   4724 C C   . PRO B 1 231 ? 12.212  38.644  -5.193  1.00 24.34 ? 231 PRO B C   1 
ATOM   4725 O O   . PRO B 1 231 ? 11.996  39.112  -6.316  1.00 25.28 ? 231 PRO B O   1 
ATOM   4726 C CB  . PRO B 1 231 ? 10.088  38.174  -3.898  1.00 24.90 ? 231 PRO B CB  1 
ATOM   4727 C CG  . PRO B 1 231 ? 10.660  38.419  -2.498  1.00 21.20 ? 231 PRO B CG  1 
ATOM   4728 C CD  . PRO B 1 231 ? 11.406  37.124  -2.233  1.00 24.03 ? 231 PRO B CD  1 
ATOM   4729 N N   . ASP B 1 232 ? 13.235  39.061  -4.445  1.00 23.48 ? 232 ASP B N   1 
ATOM   4730 C CA  . ASP B 1 232 ? 14.132  40.069  -4.993  1.00 24.42 ? 232 ASP B CA  1 
ATOM   4731 C C   . ASP B 1 232 ? 15.374  39.452  -5.561  1.00 24.18 ? 232 ASP B C   1 
ATOM   4732 O O   . ASP B 1 232 ? 16.364  40.143  -5.770  1.00 25.50 ? 232 ASP B O   1 
ATOM   4733 C CB  . ASP B 1 232 ? 14.579  41.101  -3.967  1.00 28.62 ? 232 ASP B CB  1 
ATOM   4734 C CG  . ASP B 1 232 ? 14.001  40.857  -2.618  1.00 34.28 ? 232 ASP B CG  1 
ATOM   4735 O OD1 . ASP B 1 232 ? 14.237  39.741  -2.069  1.00 33.54 ? 232 ASP B OD1 1 
ATOM   4736 O OD2 . ASP B 1 232 ? 13.315  41.797  -2.125  1.00 35.26 ? 232 ASP B OD2 1 
ATOM   4737 N N   . HIS B 1 233 ? 15.342  38.151  -5.790  1.00 23.44 ? 233 HIS B N   1 
ATOM   4738 C CA  . HIS B 1 233 ? 16.497  37.487  -6.360  1.00 21.96 ? 233 HIS B CA  1 
ATOM   4739 C C   . HIS B 1 233 ? 17.760  37.941  -5.673  1.00 22.25 ? 233 HIS B C   1 
ATOM   4740 O O   . HIS B 1 233 ? 18.617  38.583  -6.277  1.00 20.48 ? 233 HIS B O   1 
ATOM   4741 C CB  . HIS B 1 233 ? 16.599  37.804  -7.849  1.00 20.47 ? 233 HIS B CB  1 
ATOM   4742 C CG  . HIS B 1 233 ? 15.338  37.536  -8.591  1.00 20.16 ? 233 HIS B CG  1 
ATOM   4743 N ND1 . HIS B 1 233 ? 15.196  37.803  -9.935  1.00 19.61 ? 233 HIS B ND1 1 
ATOM   4744 C CD2 . HIS B 1 233 ? 14.139  37.075  -8.161  1.00 16.94 ? 233 HIS B CD2 1 
ATOM   4745 C CE1 . HIS B 1 233 ? 13.956  37.527  -10.299 1.00 22.53 ? 233 HIS B CE1 1 
ATOM   4746 N NE2 . HIS B 1 233 ? 13.295  37.083  -9.240  1.00 22.29 ? 233 HIS B NE2 1 
ATOM   4747 N N   . GLN B 1 234 ? 17.865  37.625  -4.395  1.00 23.87 ? 234 GLN B N   1 
ATOM   4748 C CA  . GLN B 1 234 ? 19.059  37.982  -3.675  1.00 25.40 ? 234 GLN B CA  1 
ATOM   4749 C C   . GLN B 1 234 ? 20.058  36.887  -3.985  1.00 24.25 ? 234 GLN B C   1 
ATOM   4750 O O   . GLN B 1 234 ? 19.680  35.714  -4.164  1.00 22.36 ? 234 GLN B O   1 
ATOM   4751 C CB  . GLN B 1 234 ? 18.770  38.101  -2.176  1.00 24.50 ? 234 GLN B CB  1 
ATOM   4752 C CG  . GLN B 1 234 ? 17.996  36.972  -1.618  1.00 27.36 ? 234 GLN B CG  1 
ATOM   4753 C CD  . GLN B 1 234 ? 17.315  37.351  -0.328  1.00 27.83 ? 234 GLN B CD  1 
ATOM   4754 O OE1 . GLN B 1 234 ? 16.524  38.290  -0.286  1.00 27.40 ? 234 GLN B OE1 1 
ATOM   4755 N NE2 . GLN B 1 234 ? 17.612  36.615  0.734   1.00 30.89 ? 234 GLN B NE2 1 
ATOM   4756 N N   . LEU B 1 235 ? 21.322  37.290  -4.110  1.00 24.38 ? 235 LEU B N   1 
ATOM   4757 C CA  . LEU B 1 235 ? 22.389  36.348  -4.411  1.00 24.04 ? 235 LEU B CA  1 
ATOM   4758 C C   . LEU B 1 235 ? 22.726  35.613  -3.142  1.00 21.93 ? 235 LEU B C   1 
ATOM   4759 O O   . LEU B 1 235 ? 22.863  36.224  -2.078  1.00 25.18 ? 235 LEU B O   1 
ATOM   4760 C CB  . LEU B 1 235 ? 23.633  37.076  -4.929  1.00 24.63 ? 235 LEU B CB  1 
ATOM   4761 C CG  . LEU B 1 235 ? 23.537  37.660  -6.336  1.00 28.88 ? 235 LEU B CG  1 
ATOM   4762 C CD1 . LEU B 1 235 ? 22.518  38.825  -6.408  1.00 23.96 ? 235 LEU B CD1 1 
ATOM   4763 C CD2 . LEU B 1 235 ? 24.928  38.130  -6.729  1.00 26.65 ? 235 LEU B CD2 1 
ATOM   4764 N N   . THR B 1 236 ? 22.846  34.304  -3.252  1.00 19.12 ? 236 THR B N   1 
ATOM   4765 C CA  . THR B 1 236 ? 23.162  33.497  -2.107  1.00 17.12 ? 236 THR B CA  1 
ATOM   4766 C C   . THR B 1 236 ? 24.569  32.941  -2.213  1.00 16.30 ? 236 THR B C   1 
ATOM   4767 O O   . THR B 1 236 ? 25.439  33.343  -1.464  1.00 18.31 ? 236 THR B O   1 
ATOM   4768 C CB  . THR B 1 236 ? 22.149  32.354  -1.963  1.00 19.59 ? 236 THR B CB  1 
ATOM   4769 O OG1 . THR B 1 236 ? 22.203  31.507  -3.114  1.00 21.70 ? 236 THR B OG1 1 
ATOM   4770 C CG2 . THR B 1 236 ? 20.747  32.922  -1.853  1.00 19.38 ? 236 THR B CG2 1 
ATOM   4771 N N   . GLU B 1 237 ? 24.784  32.019  -3.149  1.00 16.58 ? 237 GLU B N   1 
ATOM   4772 C CA  . GLU B 1 237 ? 26.075  31.390  -3.349  1.00 16.94 ? 237 GLU B CA  1 
ATOM   4773 C C   . GLU B 1 237 ? 26.188  31.032  -4.794  1.00 20.34 ? 237 GLU B C   1 
ATOM   4774 O O   . GLU B 1 237 ? 25.178  30.941  -5.490  1.00 22.89 ? 237 GLU B O   1 
ATOM   4775 C CB  . GLU B 1 237 ? 26.198  30.104  -2.560  1.00 20.10 ? 237 GLU B CB  1 
ATOM   4776 C CG  . GLU B 1 237 ? 25.691  30.186  -1.148  1.00 22.49 ? 237 GLU B CG  1 
ATOM   4777 C CD  . GLU B 1 237 ? 25.808  28.868  -0.413  1.00 19.94 ? 237 GLU B CD  1 
ATOM   4778 O OE1 . GLU B 1 237 ? 26.898  28.580  0.114   1.00 19.94 ? 237 GLU B OE1 1 
ATOM   4779 O OE2 . GLU B 1 237 ? 24.805  28.128  -0.371  1.00 23.43 ? 237 GLU B OE2 1 
ATOM   4780 N N   . VAL B 1 238 ? 27.424  30.806  -5.235  1.00 23.70 ? 238 VAL B N   1 
ATOM   4781 C CA  . VAL B 1 238 ? 27.727  30.462  -6.630  1.00 24.88 ? 238 VAL B CA  1 
ATOM   4782 C C   . VAL B 1 238 ? 28.102  29.010  -6.758  1.00 24.95 ? 238 VAL B C   1 
ATOM   4783 O O   . VAL B 1 238 ? 29.275  28.700  -6.937  1.00 27.75 ? 238 VAL B O   1 
ATOM   4784 C CB  . VAL B 1 238 ? 28.939  31.236  -7.184  1.00 24.54 ? 238 VAL B CB  1 
ATOM   4785 C CG1 . VAL B 1 238 ? 29.031  31.008  -8.665  1.00 25.71 ? 238 VAL B CG1 1 
ATOM   4786 C CG2 . VAL B 1 238 ? 28.854  32.712  -6.853  1.00 23.34 ? 238 VAL B CG2 1 
ATOM   4787 N N   . GLY B 1 239 ? 27.112  28.128  -6.719  1.00 26.61 ? 239 GLY B N   1 
ATOM   4788 C CA  . GLY B 1 239 ? 27.408  26.711  -6.800  1.00 24.23 ? 239 GLY B CA  1 
ATOM   4789 C C   . GLY B 1 239 ? 28.112  26.440  -5.490  1.00 24.64 ? 239 GLY B C   1 
ATOM   4790 O O   . GLY B 1 239 ? 27.814  27.104  -4.485  1.00 26.56 ? 239 GLY B O   1 
ATOM   4791 N N   . THR B 1 240 ? 29.062  25.508  -5.501  1.00 20.64 ? 240 THR B N   1 
ATOM   4792 C CA  . THR B 1 240 ? 29.809  25.175  -4.305  1.00 20.56 ? 240 THR B CA  1 
ATOM   4793 C C   . THR B 1 240 ? 30.771  26.288  -3.885  1.00 20.43 ? 240 THR B C   1 
ATOM   4794 O O   . THR B 1 240 ? 31.937  26.032  -3.614  1.00 21.53 ? 240 THR B O   1 
ATOM   4795 C CB  . THR B 1 240 ? 30.615  23.865  -4.504  1.00 22.72 ? 240 THR B CB  1 
ATOM   4796 O OG1 . THR B 1 240 ? 31.547  24.027  -5.575  1.00 20.01 ? 240 THR B OG1 1 
ATOM   4797 C CG2 . THR B 1 240 ? 29.674  22.702  -4.830  1.00 23.43 ? 240 THR B CG2 1 
ATOM   4798 N N   . MET B 1 241 ? 30.282  27.524  -3.826  1.00 19.29 ? 241 MET B N   1 
ATOM   4799 C CA  . MET B 1 241 ? 31.118  28.669  -3.442  1.00 16.73 ? 241 MET B CA  1 
ATOM   4800 C C   . MET B 1 241 ? 30.320  29.823  -2.882  1.00 15.54 ? 241 MET B C   1 
ATOM   4801 O O   . MET B 1 241 ? 29.190  30.052  -3.284  1.00 16.69 ? 241 MET B O   1 
ATOM   4802 C CB  . MET B 1 241 ? 31.896  29.216  -4.639  1.00 17.70 ? 241 MET B CB  1 
ATOM   4803 C CG  . MET B 1 241 ? 33.081  28.422  -5.052  1.00 16.60 ? 241 MET B CG  1 
ATOM   4804 S SD  . MET B 1 241 ? 34.064  29.412  -6.185  1.00 20.07 ? 241 MET B SD  1 
ATOM   4805 C CE  . MET B 1 241 ? 33.080  29.253  -7.706  1.00 14.56 ? 241 MET B CE  1 
ATOM   4806 N N   . ASN B 1 242 ? 30.922  30.567  -1.963  1.00 16.71 ? 242 ASN B N   1 
ATOM   4807 C CA  . ASN B 1 242 ? 30.254  31.726  -1.390  1.00 14.35 ? 242 ASN B CA  1 
ATOM   4808 C C   . ASN B 1 242 ? 30.549  32.894  -2.297  1.00 13.96 ? 242 ASN B C   1 
ATOM   4809 O O   . ASN B 1 242 ? 31.640  33.007  -2.824  1.00 18.29 ? 242 ASN B O   1 
ATOM   4810 C CB  . ASN B 1 242 ? 30.752  31.982  0.014   1.00 9.32  ? 242 ASN B CB  1 
ATOM   4811 C CG  . ASN B 1 242 ? 30.295  30.919  0.965   1.00 11.72 ? 242 ASN B CG  1 
ATOM   4812 O OD1 . ASN B 1 242 ? 29.093  30.764  1.204   1.00 12.25 ? 242 ASN B OD1 1 
ATOM   4813 N ND2 . ASN B 1 242 ? 31.239  30.172  1.512   1.00 7.42  ? 242 ASN B ND2 1 
ATOM   4814 N N   . ILE B 1 243 ? 29.571  33.759  -2.493  1.00 14.56 ? 243 ILE B N   1 
ATOM   4815 C CA  . ILE B 1 243 ? 29.757  34.884  -3.380  1.00 13.50 ? 243 ILE B CA  1 
ATOM   4816 C C   . ILE B 1 243 ? 30.199  36.141  -2.640  1.00 13.01 ? 243 ILE B C   1 
ATOM   4817 O O   . ILE B 1 243 ? 29.766  36.404  -1.530  1.00 11.18 ? 243 ILE B O   1 
ATOM   4818 C CB  . ILE B 1 243 ? 28.451  35.138  -4.204  1.00 15.22 ? 243 ILE B CB  1 
ATOM   4819 C CG1 . ILE B 1 243 ? 28.669  36.266  -5.202  1.00 16.44 ? 243 ILE B CG1 1 
ATOM   4820 C CG2 . ILE B 1 243 ? 27.278  35.456  -3.276  1.00 13.00 ? 243 ILE B CG2 1 
ATOM   4821 C CD1 . ILE B 1 243 ? 29.812  36.019  -6.122  1.00 21.71 ? 243 ILE B CD1 1 
ATOM   4822 N N   . PHE B 1 244 ? 31.107  36.883  -3.266  1.00 13.91 ? 244 PHE B N   1 
ATOM   4823 C CA  . PHE B 1 244 ? 31.646  38.135  -2.722  1.00 11.57 ? 244 PHE B CA  1 
ATOM   4824 C C   . PHE B 1 244 ? 31.604  39.246  -3.767  1.00 10.56 ? 244 PHE B C   1 
ATOM   4825 O O   . PHE B 1 244 ? 31.799  39.005  -4.961  1.00 13.30 ? 244 PHE B O   1 
ATOM   4826 C CB  . PHE B 1 244 ? 33.104  37.973  -2.303  1.00 11.22 ? 244 PHE B CB  1 
ATOM   4827 C CG  . PHE B 1 244 ? 33.294  37.315  -0.978  1.00 10.94 ? 244 PHE B CG  1 
ATOM   4828 C CD1 . PHE B 1 244 ? 33.094  35.953  -0.830  1.00 10.97 ? 244 PHE B CD1 1 
ATOM   4829 C CD2 . PHE B 1 244 ? 33.708  38.059  0.126   1.00 11.70 ? 244 PHE B CD2 1 
ATOM   4830 C CE1 . PHE B 1 244 ? 33.309  35.334  0.390   1.00 13.01 ? 244 PHE B CE1 1 
ATOM   4831 C CE2 . PHE B 1 244 ? 33.927  37.452  1.351   1.00 12.36 ? 244 PHE B CE2 1 
ATOM   4832 C CZ  . PHE B 1 244 ? 33.727  36.082  1.484   1.00 15.43 ? 244 PHE B CZ  1 
ATOM   4833 N N   . VAL B 1 245 ? 31.364  40.461  -3.306  1.00 5.89  ? 245 VAL B N   1 
ATOM   4834 C CA  . VAL B 1 245 ? 31.337  41.620  -4.179  1.00 6.90  ? 245 VAL B CA  1 
ATOM   4835 C C   . VAL B 1 245 ? 32.139  42.788  -3.576  1.00 9.86  ? 245 VAL B C   1 
ATOM   4836 O O   . VAL B 1 245 ? 32.000  43.142  -2.401  1.00 6.98  ? 245 VAL B O   1 
ATOM   4837 C CB  . VAL B 1 245 ? 29.884  42.092  -4.467  1.00 4.21  ? 245 VAL B CB  1 
ATOM   4838 C CG1 . VAL B 1 245 ? 29.893  43.335  -5.315  1.00 2.50  ? 245 VAL B CG1 1 
ATOM   4839 C CG2 . VAL B 1 245 ? 29.118  41.012  -5.149  1.00 4.06  ? 245 VAL B CG2 1 
ATOM   4840 N N   . TYR B 1 246 ? 32.990  43.366  -4.414  1.00 13.16 ? 246 TYR B N   1 
ATOM   4841 C CA  . TYR B 1 246 ? 33.832  44.501  -4.049  1.00 13.00 ? 246 TYR B CA  1 
ATOM   4842 C C   . TYR B 1 246 ? 33.318  45.613  -4.955  1.00 12.89 ? 246 TYR B C   1 
ATOM   4843 O O   . TYR B 1 246 ? 33.521  45.596  -6.173  1.00 8.64  ? 246 TYR B O   1 
ATOM   4844 C CB  . TYR B 1 246 ? 35.284  44.160  -4.354  1.00 14.39 ? 246 TYR B CB  1 
ATOM   4845 C CG  . TYR B 1 246 ? 36.308  45.163  -3.908  1.00 15.87 ? 246 TYR B CG  1 
ATOM   4846 C CD1 . TYR B 1 246 ? 36.267  45.727  -2.628  1.00 13.66 ? 246 TYR B CD1 1 
ATOM   4847 C CD2 . TYR B 1 246 ? 37.386  45.475  -4.741  1.00 18.77 ? 246 TYR B CD2 1 
ATOM   4848 C CE1 . TYR B 1 246 ? 37.274  46.566  -2.188  1.00 16.78 ? 246 TYR B CE1 1 
ATOM   4849 C CE2 . TYR B 1 246 ? 38.412  46.317  -4.312  1.00 19.51 ? 246 TYR B CE2 1 
ATOM   4850 C CZ  . TYR B 1 246 ? 38.358  46.860  -3.036  1.00 19.98 ? 246 TYR B CZ  1 
ATOM   4851 O OH  . TYR B 1 246 ? 39.392  47.680  -2.630  1.00 17.79 ? 246 TYR B OH  1 
ATOM   4852 N N   . TRP B 1 247 ? 32.633  46.568  -4.333  1.00 15.10 ? 247 TRP B N   1 
ATOM   4853 C CA  . TRP B 1 247 ? 31.995  47.660  -5.037  1.00 13.85 ? 247 TRP B CA  1 
ATOM   4854 C C   . TRP B 1 247 ? 31.815  48.879  -4.152  1.00 14.25 ? 247 TRP B C   1 
ATOM   4855 O O   . TRP B 1 247 ? 32.023  48.834  -2.946  1.00 18.17 ? 247 TRP B O   1 
ATOM   4856 C CB  . TRP B 1 247 ? 30.618  47.188  -5.503  1.00 14.30 ? 247 TRP B CB  1 
ATOM   4857 C CG  . TRP B 1 247 ? 29.625  46.909  -4.355  1.00 17.60 ? 247 TRP B CG  1 
ATOM   4858 C CD1 . TRP B 1 247 ? 29.884  46.922  -2.992  1.00 16.26 ? 247 TRP B CD1 1 
ATOM   4859 C CD2 . TRP B 1 247 ? 28.236  46.568  -4.483  1.00 16.39 ? 247 TRP B CD2 1 
ATOM   4860 N NE1 . TRP B 1 247 ? 28.742  46.614  -2.287  1.00 14.91 ? 247 TRP B NE1 1 
ATOM   4861 C CE2 . TRP B 1 247 ? 27.720  46.391  -3.170  1.00 17.13 ? 247 TRP B CE2 1 
ATOM   4862 C CE3 . TRP B 1 247 ? 27.379  46.392  -5.574  1.00 19.65 ? 247 TRP B CE3 1 
ATOM   4863 C CZ2 . TRP B 1 247 ? 26.384  46.048  -2.930  1.00 21.91 ? 247 TRP B CZ2 1 
ATOM   4864 C CZ3 . TRP B 1 247 ? 26.054  46.054  -5.342  1.00 22.06 ? 247 TRP B CZ3 1 
ATOM   4865 C CH2 . TRP B 1 247 ? 25.567  45.885  -4.025  1.00 24.39 ? 247 TRP B CH2 1 
ATOM   4866 N N   . THR B 1 248 ? 31.435  49.987  -4.760  1.00 15.98 ? 248 THR B N   1 
ATOM   4867 C CA  . THR B 1 248 ? 31.164  51.175  -3.976  1.00 17.50 ? 248 THR B CA  1 
ATOM   4868 C C   . THR B 1 248 ? 29.673  50.952  -3.759  1.00 19.48 ? 248 THR B C   1 
ATOM   4869 O O   . THR B 1 248 ? 28.978  50.618  -4.721  1.00 21.58 ? 248 THR B O   1 
ATOM   4870 C CB  . THR B 1 248 ? 31.341  52.472  -4.782  1.00 10.75 ? 248 THR B CB  1 
ATOM   4871 O OG1 . THR B 1 248 ? 32.714  52.658  -5.113  1.00 7.78  ? 248 THR B OG1 1 
ATOM   4872 C CG2 . THR B 1 248 ? 30.864  53.647  -3.973  1.00 13.83 ? 248 THR B CG2 1 
ATOM   4873 N N   . HIS B 1 249 ? 29.203  51.090  -2.518  1.00 19.58 ? 249 HIS B N   1 
ATOM   4874 C CA  . HIS B 1 249 ? 27.789  50.903  -2.188  1.00 22.20 ? 249 HIS B CA  1 
ATOM   4875 C C   . HIS B 1 249 ? 26.927  52.085  -2.654  1.00 20.46 ? 249 HIS B C   1 
ATOM   4876 O O   . HIS B 1 249 ? 27.431  53.038  -3.236  1.00 22.17 ? 249 HIS B O   1 
ATOM   4877 C CB  . HIS B 1 249 ? 27.607  50.716  -0.671  1.00 22.89 ? 249 HIS B CB  1 
ATOM   4878 C CG  . HIS B 1 249 ? 26.265  50.160  -0.300  1.00 23.44 ? 249 HIS B CG  1 
ATOM   4879 N ND1 . HIS B 1 249 ? 25.654  49.158  -1.026  1.00 25.09 ? 249 HIS B ND1 1 
ATOM   4880 C CD2 . HIS B 1 249 ? 25.429  50.440  0.730   1.00 25.31 ? 249 HIS B CD2 1 
ATOM   4881 C CE1 . HIS B 1 249 ? 24.502  48.839  -0.458  1.00 23.50 ? 249 HIS B CE1 1 
ATOM   4882 N NE2 . HIS B 1 249 ? 24.343  49.602  0.611   1.00 24.14 ? 249 HIS B NE2 1 
ATOM   4883 N N   . GLU B 1 250 ? 25.629  52.030  -2.393  1.00 19.29 ? 250 GLU B N   1 
ATOM   4884 C CA  . GLU B 1 250 ? 24.761  53.111  -2.827  1.00 20.79 ? 250 GLU B CA  1 
ATOM   4885 C C   . GLU B 1 250 ? 24.944  54.310  -1.918  1.00 20.60 ? 250 GLU B C   1 
ATOM   4886 O O   . GLU B 1 250 ? 24.528  55.408  -2.251  1.00 20.45 ? 250 GLU B O   1 
ATOM   4887 C CB  . GLU B 1 250 ? 23.298  52.662  -2.857  1.00 19.49 ? 250 GLU B CB  1 
ATOM   4888 C CG  . GLU B 1 250 ? 23.008  51.678  -3.985  1.00 23.48 ? 250 GLU B CG  1 
ATOM   4889 C CD  . GLU B 1 250 ? 21.729  50.848  -3.772  1.00 26.02 ? 250 GLU B CD  1 
ATOM   4890 O OE1 . GLU B 1 250 ? 21.264  50.766  -2.611  1.00 21.21 ? 250 GLU B OE1 1 
ATOM   4891 O OE2 . GLU B 1 250 ? 21.203  50.264  -4.769  1.00 28.92 ? 250 GLU B OE2 1 
ATOM   4892 N N   . ASP B 1 251 ? 25.578  54.102  -0.768  1.00 22.03 ? 251 ASP B N   1 
ATOM   4893 C CA  . ASP B 1 251 ? 25.822  55.213  0.136   1.00 23.07 ? 251 ASP B CA  1 
ATOM   4894 C C   . ASP B 1 251 ? 27.191  55.855  -0.186  1.00 24.10 ? 251 ASP B C   1 
ATOM   4895 O O   . ASP B 1 251 ? 27.661  56.745  0.537   1.00 25.47 ? 251 ASP B O   1 
ATOM   4896 C CB  . ASP B 1 251 ? 25.760  54.744  1.589   1.00 21.40 ? 251 ASP B CB  1 
ATOM   4897 C CG  . ASP B 1 251 ? 26.712  53.592  1.875   1.00 27.46 ? 251 ASP B CG  1 
ATOM   4898 O OD1 . ASP B 1 251 ? 26.667  53.091  3.018   1.00 27.74 ? 251 ASP B OD1 1 
ATOM   4899 O OD2 . ASP B 1 251 ? 27.500  53.190  0.977   1.00 26.87 ? 251 ASP B OD2 1 
ATOM   4900 N N   . GLY B 1 252 ? 27.825  55.388  -1.265  1.00 23.43 ? 252 GLY B N   1 
ATOM   4901 C CA  . GLY B 1 252 ? 29.108  55.940  -1.692  1.00 20.85 ? 252 GLY B CA  1 
ATOM   4902 C C   . GLY B 1 252 ? 30.341  55.378  -1.013  1.00 20.38 ? 252 GLY B C   1 
ATOM   4903 O O   . GLY B 1 252 ? 31.456  55.884  -1.181  1.00 20.42 ? 252 GLY B O   1 
ATOM   4904 N N   . VAL B 1 253 ? 30.154  54.320  -0.241  1.00 19.06 ? 253 VAL B N   1 
ATOM   4905 C CA  . VAL B 1 253 ? 31.279  53.729  0.463   1.00 17.68 ? 253 VAL B CA  1 
ATOM   4906 C C   . VAL B 1 253 ? 31.775  52.469  -0.224  1.00 16.32 ? 253 VAL B C   1 
ATOM   4907 O O   . VAL B 1 253 ? 30.984  51.603  -0.589  1.00 15.00 ? 253 VAL B O   1 
ATOM   4908 C CB  . VAL B 1 253 ? 30.920  53.361  1.939   1.00 16.41 ? 253 VAL B CB  1 
ATOM   4909 C CG1 . VAL B 1 253 ? 32.178  52.956  2.683   1.00 19.02 ? 253 VAL B CG1 1 
ATOM   4910 C CG2 . VAL B 1 253 ? 30.228  54.524  2.647   1.00 15.77 ? 253 VAL B CG2 1 
ATOM   4911 N N   . LEU B 1 254 ? 33.093  52.388  -0.394  1.00 13.27 ? 254 LEU B N   1 
ATOM   4912 C CA  . LEU B 1 254 ? 33.723  51.223  -0.991  1.00 16.05 ? 254 LEU B CA  1 
ATOM   4913 C C   . LEU B 1 254 ? 33.714  50.086  0.030   1.00 16.11 ? 254 LEU B C   1 
ATOM   4914 O O   . LEU B 1 254 ? 34.142  50.223  1.187   1.00 14.23 ? 254 LEU B O   1 
ATOM   4915 C CB  . LEU B 1 254 ? 35.156  51.539  -1.415  1.00 14.66 ? 254 LEU B CB  1 
ATOM   4916 C CG  . LEU B 1 254 ? 36.066  50.349  -1.768  1.00 18.12 ? 254 LEU B CG  1 
ATOM   4917 C CD1 . LEU B 1 254 ? 35.406  49.410  -2.752  1.00 16.02 ? 254 LEU B CD1 1 
ATOM   4918 C CD2 . LEU B 1 254 ? 37.371  50.880  -2.336  1.00 18.27 ? 254 LEU B CD2 1 
ATOM   4919 N N   . GLU B 1 255 ? 33.210  48.947  -0.399  1.00 16.06 ? 255 GLU B N   1 
ATOM   4920 C CA  . GLU B 1 255 ? 33.151  47.831  0.507   1.00 14.32 ? 255 GLU B CA  1 
ATOM   4921 C C   . GLU B 1 255 ? 33.202  46.511  -0.208  1.00 14.96 ? 255 GLU B C   1 
ATOM   4922 O O   . GLU B 1 255 ? 33.061  46.412  -1.433  1.00 13.22 ? 255 GLU B O   1 
ATOM   4923 C CB  . GLU B 1 255 ? 31.858  47.884  1.325   1.00 14.24 ? 255 GLU B CB  1 
ATOM   4924 C CG  . GLU B 1 255 ? 30.597  47.802  0.461   1.00 14.66 ? 255 GLU B CG  1 
ATOM   4925 C CD  . GLU B 1 255 ? 29.328  47.653  1.276   1.00 16.65 ? 255 GLU B CD  1 
ATOM   4926 O OE1 . GLU B 1 255 ? 29.210  48.305  2.324   1.00 17.81 ? 255 GLU B OE1 1 
ATOM   4927 O OE2 . GLU B 1 255 ? 28.439  46.888  0.865   1.00 15.57 ? 255 GLU B OE2 1 
ATOM   4928 N N   . LEU B 1 256 ? 33.427  45.494  0.603   1.00 13.82 ? 256 LEU B N   1 
ATOM   4929 C CA  . LEU B 1 256 ? 33.435  44.134  0.160   1.00 11.79 ? 256 LEU B CA  1 
ATOM   4930 C C   . LEU B 1 256 ? 32.217  43.613  0.907   1.00 12.87 ? 256 LEU B C   1 
ATOM   4931 O O   . LEU B 1 256 ? 32.127  43.772  2.128   1.00 12.97 ? 256 LEU B O   1 
ATOM   4932 C CB  . LEU B 1 256 ? 34.688  43.439  0.645   1.00 7.88  ? 256 LEU B CB  1 
ATOM   4933 C CG  . LEU B 1 256 ? 34.804  41.961  0.289   1.00 6.62  ? 256 LEU B CG  1 
ATOM   4934 C CD1 . LEU B 1 256 ? 34.714  41.765  -1.217  1.00 2.50  ? 256 LEU B CD1 1 
ATOM   4935 C CD2 . LEU B 1 256 ? 36.119  41.439  0.845   1.00 4.82  ? 256 LEU B CD2 1 
ATOM   4936 N N   . VAL B 1 257 ? 31.267  43.034  0.188   1.00 12.40 ? 257 VAL B N   1 
ATOM   4937 C CA  . VAL B 1 257 ? 30.073  42.497  0.829   1.00 13.89 ? 257 VAL B CA  1 
ATOM   4938 C C   . VAL B 1 257 ? 29.852  41.038  0.436   1.00 15.18 ? 257 VAL B C   1 
ATOM   4939 O O   . VAL B 1 257 ? 30.260  40.604  -0.646  1.00 13.27 ? 257 VAL B O   1 
ATOM   4940 C CB  . VAL B 1 257 ? 28.774  43.351  0.487   1.00 16.03 ? 257 VAL B CB  1 
ATOM   4941 C CG1 . VAL B 1 257 ? 28.485  43.362  -1.024  1.00 13.11 ? 257 VAL B CG1 1 
ATOM   4942 C CG2 . VAL B 1 257 ? 27.572  42.815  1.259   1.00 10.30 ? 257 VAL B CG2 1 
ATOM   4943 N N   . THR B 1 258 ? 29.229  40.288  1.341   1.00 14.69 ? 258 THR B N   1 
ATOM   4944 C CA  . THR B 1 258 ? 28.903  38.883  1.105   1.00 14.95 ? 258 THR B CA  1 
ATOM   4945 C C   . THR B 1 258 ? 27.645  38.577  1.889   1.00 15.96 ? 258 THR B C   1 
ATOM   4946 O O   . THR B 1 258 ? 27.468  39.071  3.011   1.00 17.10 ? 258 THR B O   1 
ATOM   4947 C CB  . THR B 1 258 ? 30.040  37.888  1.570   1.00 15.64 ? 258 THR B CB  1 
ATOM   4948 O OG1 . THR B 1 258 ? 29.692  36.559  1.178   1.00 13.18 ? 258 THR B OG1 1 
ATOM   4949 C CG2 . THR B 1 258 ? 30.206  37.888  3.086   1.00 9.08  ? 258 THR B CG2 1 
ATOM   4950 N N   . PRO B 1 259 ? 26.761  37.741  1.323   1.00 18.12 ? 259 PRO B N   1 
ATOM   4951 C CA  . PRO B 1 259 ? 25.516  37.400  2.018   1.00 18.18 ? 259 PRO B CA  1 
ATOM   4952 C C   . PRO B 1 259 ? 25.755  36.925  3.456   1.00 18.28 ? 259 PRO B C   1 
ATOM   4953 O O   . PRO B 1 259 ? 26.750  36.257  3.747   1.00 13.34 ? 259 PRO B O   1 
ATOM   4954 C CB  . PRO B 1 259 ? 24.907  36.324  1.133   1.00 18.39 ? 259 PRO B CB  1 
ATOM   4955 C CG  . PRO B 1 259 ? 25.398  36.732  -0.254  1.00 20.06 ? 259 PRO B CG  1 
ATOM   4956 C CD  . PRO B 1 259 ? 26.845  37.052  0.021   1.00 17.68 ? 259 PRO B CD  1 
ATOM   4957 N N   . PRO B 1 260 ? 24.834  37.297  4.373   1.00 17.56 ? 260 PRO B N   1 
ATOM   4958 C CA  . PRO B 1 260 ? 24.918  36.924  5.786   1.00 17.81 ? 260 PRO B CA  1 
ATOM   4959 C C   . PRO B 1 260 ? 24.652  35.445  5.994   1.00 17.79 ? 260 PRO B C   1 
ATOM   4960 O O   . PRO B 1 260 ? 24.065  34.774  5.129   1.00 12.15 ? 260 PRO B O   1 
ATOM   4961 C CB  . PRO B 1 260 ? 23.839  37.784  6.457   1.00 13.60 ? 260 PRO B CB  1 
ATOM   4962 C CG  . PRO B 1 260 ? 23.684  38.938  5.541   1.00 20.38 ? 260 PRO B CG  1 
ATOM   4963 C CD  . PRO B 1 260 ? 23.766  38.283  4.168   1.00 17.70 ? 260 PRO B CD  1 
ATOM   4964 N N   . LEU B 1 261 ? 25.085  34.950  7.151   1.00 17.62 ? 261 LEU B N   1 
ATOM   4965 C CA  . LEU B 1 261 ? 24.865  33.570  7.514   1.00 18.40 ? 261 LEU B CA  1 
ATOM   4966 C C   . LEU B 1 261 ? 23.437  33.416  8.047   1.00 20.57 ? 261 LEU B C   1 
ATOM   4967 O O   . LEU B 1 261 ? 23.205  33.015  9.187   1.00 20.82 ? 261 LEU B O   1 
ATOM   4968 C CB  . LEU B 1 261 ? 25.918  33.118  8.532   1.00 16.57 ? 261 LEU B CB  1 
ATOM   4969 C CG  . LEU B 1 261 ? 27.351  33.178  7.961   1.00 16.29 ? 261 LEU B CG  1 
ATOM   4970 C CD1 . LEU B 1 261 ? 28.358  32.563  8.942   1.00 13.91 ? 261 LEU B CD1 1 
ATOM   4971 C CD2 . LEU B 1 261 ? 27.382  32.429  6.627   1.00 15.62 ? 261 LEU B CD2 1 
ATOM   4972 N N   . ASN B 1 262 ? 22.485  33.757  7.181   1.00 22.97 ? 262 ASN B N   1 
ATOM   4973 C CA  . ASN B 1 262 ? 21.058  33.673  7.475   1.00 27.21 ? 262 ASN B CA  1 
ATOM   4974 C C   . ASN B 1 262 ? 20.471  32.249  7.517   1.00 27.99 ? 262 ASN B C   1 
ATOM   4975 O O   . ASN B 1 262 ? 19.334  32.075  7.965   1.00 29.60 ? 262 ASN B O   1 
ATOM   4976 C CB  . ASN B 1 262 ? 20.263  34.469  6.437   1.00 27.65 ? 262 ASN B CB  1 
ATOM   4977 C CG  . ASN B 1 262 ? 20.452  33.927  5.016   1.00 31.35 ? 262 ASN B CG  1 
ATOM   4978 O OD1 . ASN B 1 262 ? 20.978  32.809  4.814   1.00 30.53 ? 262 ASN B OD1 1 
ATOM   4979 N ND2 . ASN B 1 262 ? 20.008  34.705  4.024   1.00 30.19 ? 262 ASN B ND2 1 
ATOM   4980 N N   . GLY B 1 263 ? 21.211  31.246  7.036   1.00 28.26 ? 263 GLY B N   1 
ATOM   4981 C CA  . GLY B 1 263 ? 20.696  29.876  7.036   1.00 25.82 ? 263 GLY B CA  1 
ATOM   4982 C C   . GLY B 1 263 ? 20.442  29.261  5.654   1.00 25.77 ? 263 GLY B C   1 
ATOM   4983 O O   . GLY B 1 263 ? 20.267  28.054  5.533   1.00 26.47 ? 263 GLY B O   1 
ATOM   4984 N N   . VAL B 1 264 ? 20.401  30.080  4.609   1.00 23.66 ? 264 VAL B N   1 
ATOM   4985 C CA  . VAL B 1 264 ? 20.199  29.576  3.260   1.00 23.17 ? 264 VAL B CA  1 
ATOM   4986 C C   . VAL B 1 264 ? 21.586  29.498  2.620   1.00 24.36 ? 264 VAL B C   1 
ATOM   4987 O O   . VAL B 1 264 ? 21.727  29.130  1.439   1.00 26.18 ? 264 VAL B O   1 
ATOM   4988 C CB  . VAL B 1 264 ? 19.333  30.546  2.401   1.00 22.27 ? 264 VAL B CB  1 
ATOM   4989 C CG1 . VAL B 1 264 ? 19.243  30.040  0.982   1.00 22.17 ? 264 VAL B CG1 1 
ATOM   4990 C CG2 . VAL B 1 264 ? 17.922  30.686  2.987   1.00 25.45 ? 264 VAL B CG2 1 
ATOM   4991 N N   . ILE B 1 265 ? 22.604  29.856  3.405   1.00 23.15 ? 265 ILE B N   1 
ATOM   4992 C CA  . ILE B 1 265 ? 23.990  29.873  2.936   1.00 22.92 ? 265 ILE B CA  1 
ATOM   4993 C C   . ILE B 1 265 ? 24.929  28.928  3.684   1.00 20.13 ? 265 ILE B C   1 
ATOM   4994 O O   . ILE B 1 265 ? 24.773  28.683  4.867   1.00 22.41 ? 265 ILE B O   1 
ATOM   4995 C CB  . ILE B 1 265 ? 24.528  31.327  3.008   1.00 23.97 ? 265 ILE B CB  1 
ATOM   4996 C CG1 . ILE B 1 265 ? 23.756  32.172  2.011   1.00 26.77 ? 265 ILE B CG1 1 
ATOM   4997 C CG2 . ILE B 1 265 ? 26.025  31.402  2.701   1.00 28.68 ? 265 ILE B CG2 1 
ATOM   4998 C CD1 . ILE B 1 265 ? 23.556  31.478  0.684   1.00 23.40 ? 265 ILE B CD1 1 
ATOM   4999 N N   . LEU B 1 266 ? 25.897  28.370  2.986   1.00 20.02 ? 266 LEU B N   1 
ATOM   5000 C CA  . LEU B 1 266 ? 26.839  27.486  3.663   1.00 21.50 ? 266 LEU B CA  1 
ATOM   5001 C C   . LEU B 1 266 ? 28.004  28.339  4.202   1.00 21.28 ? 266 LEU B C   1 
ATOM   5002 O O   . LEU B 1 266 ? 28.570  29.144  3.471   1.00 21.89 ? 266 LEU B O   1 
ATOM   5003 C CB  . LEU B 1 266 ? 27.353  26.408  2.685   1.00 18.61 ? 266 LEU B CB  1 
ATOM   5004 C CG  . LEU B 1 266 ? 27.919  25.072  3.211   1.00 20.83 ? 266 LEU B CG  1 
ATOM   5005 C CD1 . LEU B 1 266 ? 28.941  25.368  4.259   1.00 21.05 ? 266 LEU B CD1 1 
ATOM   5006 C CD2 . LEU B 1 266 ? 26.825  24.173  3.804   1.00 19.66 ? 266 LEU B CD2 1 
ATOM   5007 N N   . PRO B 1 267 ? 28.342  28.187  5.498   1.00 21.68 ? 267 PRO B N   1 
ATOM   5008 C CA  . PRO B 1 267 ? 29.418  28.900  6.199   1.00 20.79 ? 267 PRO B CA  1 
ATOM   5009 C C   . PRO B 1 267 ? 30.806  28.536  5.697   1.00 19.27 ? 267 PRO B C   1 
ATOM   5010 O O   . PRO B 1 267 ? 31.586  27.921  6.418   1.00 17.66 ? 267 PRO B O   1 
ATOM   5011 C CB  . PRO B 1 267 ? 29.235  28.469  7.651   1.00 22.58 ? 267 PRO B CB  1 
ATOM   5012 C CG  . PRO B 1 267 ? 27.773  28.226  7.746   1.00 23.70 ? 267 PRO B CG  1 
ATOM   5013 C CD  . PRO B 1 267 ? 27.470  27.500  6.467   1.00 23.19 ? 267 PRO B CD  1 
ATOM   5014 N N   . GLY B 1 268 ? 31.116  28.910  4.465   1.00 18.66 ? 268 GLY B N   1 
ATOM   5015 C CA  . GLY B 1 268 ? 32.417  28.577  3.921   1.00 18.38 ? 268 GLY B CA  1 
ATOM   5016 C C   . GLY B 1 268 ? 33.615  28.926  4.795   1.00 18.93 ? 268 GLY B C   1 
ATOM   5017 O O   . GLY B 1 268 ? 33.654  29.964  5.450   1.00 18.68 ? 268 GLY B O   1 
ATOM   5018 N N   . VAL B 1 269 ? 34.608  28.045  4.807   1.00 17.72 ? 269 VAL B N   1 
ATOM   5019 C CA  . VAL B 1 269 ? 35.817  28.294  5.559   1.00 14.24 ? 269 VAL B CA  1 
ATOM   5020 C C   . VAL B 1 269 ? 36.616  29.410  4.889   1.00 12.99 ? 269 VAL B C   1 
ATOM   5021 O O   . VAL B 1 269 ? 37.162  30.292  5.577   1.00 11.41 ? 269 VAL B O   1 
ATOM   5022 C CB  . VAL B 1 269 ? 36.708  27.056  5.639   1.00 14.21 ? 269 VAL B CB  1 
ATOM   5023 C CG1 . VAL B 1 269 ? 38.012  27.407  6.364   1.00 16.90 ? 269 VAL B CG1 1 
ATOM   5024 C CG2 . VAL B 1 269 ? 35.993  25.960  6.374   1.00 13.71 ? 269 VAL B CG2 1 
ATOM   5025 N N   . VAL B 1 270 ? 36.660  29.386  3.556   1.00 10.12 ? 270 VAL B N   1 
ATOM   5026 C CA  . VAL B 1 270 ? 37.415  30.396  2.822   1.00 13.31 ? 270 VAL B CA  1 
ATOM   5027 C C   . VAL B 1 270 ? 36.734  31.740  3.044   1.00 14.07 ? 270 VAL B C   1 
ATOM   5028 O O   . VAL B 1 270 ? 37.397  32.766  3.280   1.00 12.18 ? 270 VAL B O   1 
ATOM   5029 C CB  . VAL B 1 270 ? 37.508  30.063  1.295   1.00 13.33 ? 270 VAL B CB  1 
ATOM   5030 C CG1 . VAL B 1 270 ? 38.255  31.157  0.567   1.00 12.72 ? 270 VAL B CG1 1 
ATOM   5031 C CG2 . VAL B 1 270 ? 38.228  28.736  1.086   1.00 8.49  ? 270 VAL B CG2 1 
ATOM   5032 N N   . ARG B 1 271 ? 35.401  31.697  2.976   1.00 13.67 ? 271 ARG B N   1 
ATOM   5033 C CA  . ARG B 1 271 ? 34.530  32.834  3.179   1.00 10.10 ? 271 ARG B CA  1 
ATOM   5034 C C   . ARG B 1 271 ? 34.900  33.515  4.478   1.00 11.72 ? 271 ARG B C   1 
ATOM   5035 O O   . ARG B 1 271 ? 35.182  34.694  4.501   1.00 12.41 ? 271 ARG B O   1 
ATOM   5036 C CB  . ARG B 1 271 ? 33.093  32.339  3.251   1.00 16.16 ? 271 ARG B CB  1 
ATOM   5037 C CG  . ARG B 1 271 ? 32.079  33.381  3.639   1.00 13.16 ? 271 ARG B CG  1 
ATOM   5038 C CD  . ARG B 1 271 ? 30.731  32.739  3.916   1.00 13.85 ? 271 ARG B CD  1 
ATOM   5039 N NE  . ARG B 1 271 ? 29.754  33.747  4.310   1.00 14.48 ? 271 ARG B NE  1 
ATOM   5040 C CZ  . ARG B 1 271 ? 29.801  34.418  5.454   1.00 14.66 ? 271 ARG B CZ  1 
ATOM   5041 N NH1 . ARG B 1 271 ? 30.766  34.178  6.330   1.00 12.84 ? 271 ARG B NH1 1 
ATOM   5042 N NH2 . ARG B 1 271 ? 28.910  35.367  5.706   1.00 12.61 ? 271 ARG B NH2 1 
ATOM   5043 N N   . GLN B 1 272 ? 34.898  32.756  5.563   1.00 11.75 ? 272 GLN B N   1 
ATOM   5044 C CA  . GLN B 1 272 ? 35.256  33.268  6.883   1.00 13.96 ? 272 GLN B CA  1 
ATOM   5045 C C   . GLN B 1 272 ? 36.586  33.975  6.845   1.00 14.05 ? 272 GLN B C   1 
ATOM   5046 O O   . GLN B 1 272 ? 36.726  35.115  7.288   1.00 14.54 ? 272 GLN B O   1 
ATOM   5047 C CB  . GLN B 1 272 ? 35.391  32.112  7.863   1.00 20.13 ? 272 GLN B CB  1 
ATOM   5048 C CG  . GLN B 1 272 ? 35.559  32.530  9.302   1.00 23.01 ? 272 GLN B CG  1 
ATOM   5049 C CD  . GLN B 1 272 ? 34.414  33.391  9.745   1.00 22.23 ? 272 GLN B CD  1 
ATOM   5050 O OE1 . GLN B 1 272 ? 34.479  34.611  9.628   1.00 24.98 ? 272 GLN B OE1 1 
ATOM   5051 N NE2 . GLN B 1 272 ? 33.340  32.764  10.226  1.00 21.56 ? 272 GLN B NE2 1 
ATOM   5052 N N   . SER B 1 273 ? 37.570  33.250  6.322   1.00 14.51 ? 273 SER B N   1 
ATOM   5053 C CA  . SER B 1 273 ? 38.926  33.741  6.198   1.00 15.46 ? 273 SER B CA  1 
ATOM   5054 C C   . SER B 1 273 ? 39.053  35.038  5.407   1.00 16.16 ? 273 SER B C   1 
ATOM   5055 O O   . SER B 1 273 ? 39.737  35.944  5.825   1.00 20.73 ? 273 SER B O   1 
ATOM   5056 C CB  . SER B 1 273 ? 39.805  32.657  5.575   1.00 16.09 ? 273 SER B CB  1 
ATOM   5057 O OG  . SER B 1 273 ? 39.811  31.478  6.371   1.00 13.10 ? 273 SER B OG  1 
ATOM   5058 N N   . LEU B 1 274 ? 38.394  35.143  4.269   1.00 18.13 ? 274 LEU B N   1 
ATOM   5059 C CA  . LEU B 1 274 ? 38.495  36.367  3.495   1.00 16.65 ? 274 LEU B CA  1 
ATOM   5060 C C   . LEU B 1 274 ? 37.996  37.567  4.307   1.00 18.64 ? 274 LEU B C   1 
ATOM   5061 O O   . LEU B 1 274 ? 38.540  38.666  4.191   1.00 15.28 ? 274 LEU B O   1 
ATOM   5062 C CB  . LEU B 1 274 ? 37.720  36.231  2.180   1.00 16.79 ? 274 LEU B CB  1 
ATOM   5063 C CG  . LEU B 1 274 ? 38.110  35.050  1.266   1.00 15.44 ? 274 LEU B CG  1 
ATOM   5064 C CD1 . LEU B 1 274 ? 37.390  35.178  -0.053  1.00 14.55 ? 274 LEU B CD1 1 
ATOM   5065 C CD2 . LEU B 1 274 ? 39.615  35.013  1.013   1.00 14.80 ? 274 LEU B CD2 1 
ATOM   5066 N N   . LEU B 1 275 ? 36.963  37.358  5.127   1.00 21.09 ? 275 LEU B N   1 
ATOM   5067 C CA  . LEU B 1 275 ? 36.439  38.428  5.972   1.00 18.64 ? 275 LEU B CA  1 
ATOM   5068 C C   . LEU B 1 275 ? 37.473  38.760  7.045   1.00 20.70 ? 275 LEU B C   1 
ATOM   5069 O O   . LEU B 1 275 ? 37.782  39.929  7.307   1.00 20.73 ? 275 LEU B O   1 
ATOM   5070 C CB  . LEU B 1 275 ? 35.135  38.006  6.658   1.00 17.17 ? 275 LEU B CB  1 
ATOM   5071 C CG  . LEU B 1 275 ? 33.858  37.977  5.816   1.00 19.36 ? 275 LEU B CG  1 
ATOM   5072 C CD1 . LEU B 1 275 ? 33.521  39.351  5.240   1.00 17.17 ? 275 LEU B CD1 1 
ATOM   5073 C CD2 . LEU B 1 275 ? 34.060  37.007  4.701   1.00 22.95 ? 275 LEU B CD2 1 
ATOM   5074 N N   . ASP B 1 276 ? 38.000  37.718  7.671   1.00 20.32 ? 276 ASP B N   1 
ATOM   5075 C CA  . ASP B 1 276 ? 38.995  37.899  8.710   1.00 22.52 ? 276 ASP B CA  1 
ATOM   5076 C C   . ASP B 1 276 ? 40.112  38.782  8.177   1.00 20.04 ? 276 ASP B C   1 
ATOM   5077 O O   . ASP B 1 276 ? 40.441  39.817  8.754   1.00 18.42 ? 276 ASP B O   1 
ATOM   5078 C CB  . ASP B 1 276 ? 39.538  36.529  9.144   1.00 23.48 ? 276 ASP B CB  1 
ATOM   5079 C CG  . ASP B 1 276 ? 38.452  35.656  9.770   1.00 28.51 ? 276 ASP B CG  1 
ATOM   5080 O OD1 . ASP B 1 276 ? 38.613  34.413  9.821   1.00 33.24 ? 276 ASP B OD1 1 
ATOM   5081 O OD2 . ASP B 1 276 ? 37.420  36.215  10.218  1.00 29.59 ? 276 ASP B OD2 1 
ATOM   5082 N N   . MET B 1 277 ? 40.671  38.373  7.047   1.00 18.79 ? 277 MET B N   1 
ATOM   5083 C CA  . MET B 1 277 ? 41.753  39.119  6.452   1.00 17.44 ? 277 MET B CA  1 
ATOM   5084 C C   . MET B 1 277 ? 41.367  40.564  6.168   1.00 17.48 ? 277 MET B C   1 
ATOM   5085 O O   . MET B 1 277 ? 42.047  41.494  6.611   1.00 14.55 ? 277 MET B O   1 
ATOM   5086 C CB  . MET B 1 277 ? 42.187  38.426  5.181   1.00 18.67 ? 277 MET B CB  1 
ATOM   5087 C CG  . MET B 1 277 ? 42.578  37.000  5.431   1.00 22.12 ? 277 MET B CG  1 
ATOM   5088 S SD  . MET B 1 277 ? 42.966  36.155  3.905   1.00 29.45 ? 277 MET B SD  1 
ATOM   5089 C CE  . MET B 1 277 ? 44.328  37.204  3.361   1.00 21.31 ? 277 MET B CE  1 
ATOM   5090 N N   . ALA B 1 278 ? 40.274  40.747  5.431   1.00 15.77 ? 278 ALA B N   1 
ATOM   5091 C CA  . ALA B 1 278 ? 39.831  42.090  5.080   1.00 18.88 ? 278 ALA B CA  1 
ATOM   5092 C C   . ALA B 1 278 ? 39.609  42.908  6.345   1.00 19.98 ? 278 ALA B C   1 
ATOM   5093 O O   . ALA B 1 278 ? 40.032  44.055  6.431   1.00 23.55 ? 278 ALA B O   1 
ATOM   5094 C CB  . ALA B 1 278 ? 38.553  42.036  4.250   1.00 14.33 ? 278 ALA B CB  1 
ATOM   5095 N N   . GLN B 1 279 ? 38.939  42.313  7.321   1.00 21.00 ? 279 GLN B N   1 
ATOM   5096 C CA  . GLN B 1 279 ? 38.672  42.974  8.592   1.00 19.41 ? 279 GLN B CA  1 
ATOM   5097 C C   . GLN B 1 279 ? 40.013  43.435  9.169   1.00 20.94 ? 279 GLN B C   1 
ATOM   5098 O O   . GLN B 1 279 ? 40.138  44.522  9.726   1.00 20.07 ? 279 GLN B O   1 
ATOM   5099 C CB  . GLN B 1 279 ? 37.987  41.974  9.535   1.00 21.67 ? 279 GLN B CB  1 
ATOM   5100 C CG  . GLN B 1 279 ? 37.966  42.357  11.021  1.00 25.24 ? 279 GLN B CG  1 
ATOM   5101 C CD  . GLN B 1 279 ? 36.749  43.169  11.398  1.00 27.17 ? 279 GLN B CD  1 
ATOM   5102 O OE1 . GLN B 1 279 ? 36.439  44.192  10.759  1.00 31.89 ? 279 GLN B OE1 1 
ATOM   5103 N NE2 . GLN B 1 279 ? 36.041  42.727  12.439  1.00 28.42 ? 279 GLN B NE2 1 
ATOM   5104 N N   . THR B 1 280 ? 41.029  42.600  9.021   1.00 20.12 ? 280 THR B N   1 
ATOM   5105 C CA  . THR B 1 280 ? 42.353  42.930  9.537   1.00 19.79 ? 280 THR B CA  1 
ATOM   5106 C C   . THR B 1 280 ? 42.926  44.152  8.834   1.00 18.16 ? 280 THR B C   1 
ATOM   5107 O O   . THR B 1 280 ? 43.207  45.167  9.469   1.00 21.11 ? 280 THR B O   1 
ATOM   5108 C CB  . THR B 1 280 ? 43.312  41.735  9.371   1.00 20.19 ? 280 THR B CB  1 
ATOM   5109 O OG1 . THR B 1 280 ? 42.921  40.691  10.269  1.00 23.98 ? 280 THR B OG1 1 
ATOM   5110 C CG2 . THR B 1 280 ? 44.728  42.133  9.661   1.00 18.26 ? 280 THR B CG2 1 
ATOM   5111 N N   . TRP B 1 281 ? 43.092  44.055  7.522   1.00 16.01 ? 281 TRP B N   1 
ATOM   5112 C CA  . TRP B 1 281 ? 43.628  45.147  6.732   1.00 13.86 ? 281 TRP B CA  1 
ATOM   5113 C C   . TRP B 1 281 ? 43.059  46.507  7.111   1.00 14.71 ? 281 TRP B C   1 
ATOM   5114 O O   . TRP B 1 281 ? 43.776  47.501  7.118   1.00 17.88 ? 281 TRP B O   1 
ATOM   5115 C CB  . TRP B 1 281 ? 43.370  44.880  5.268   1.00 14.59 ? 281 TRP B CB  1 
ATOM   5116 C CG  . TRP B 1 281 ? 44.040  43.640  4.786   1.00 17.31 ? 281 TRP B CG  1 
ATOM   5117 C CD1 . TRP B 1 281 ? 45.114  42.996  5.352   1.00 17.16 ? 281 TRP B CD1 1 
ATOM   5118 C CD2 . TRP B 1 281 ? 43.735  42.927  3.591   1.00 18.83 ? 281 TRP B CD2 1 
ATOM   5119 N NE1 . TRP B 1 281 ? 45.491  41.937  4.576   1.00 15.70 ? 281 TRP B NE1 1 
ATOM   5120 C CE2 . TRP B 1 281 ? 44.660  41.865  3.489   1.00 19.11 ? 281 TRP B CE2 1 
ATOM   5121 C CE3 . TRP B 1 281 ? 42.769  43.084  2.592   1.00 17.04 ? 281 TRP B CE3 1 
ATOM   5122 C CZ2 . TRP B 1 281 ? 44.647  40.962  2.419   1.00 20.62 ? 281 TRP B CZ2 1 
ATOM   5123 C CZ3 . TRP B 1 281 ? 42.759  42.196  1.535   1.00 20.86 ? 281 TRP B CZ3 1 
ATOM   5124 C CH2 . TRP B 1 281 ? 43.694  41.143  1.457   1.00 20.16 ? 281 TRP B CH2 1 
ATOM   5125 N N   . GLY B 1 282 ? 41.771  46.542  7.429   1.00 15.70 ? 282 GLY B N   1 
ATOM   5126 C CA  . GLY B 1 282 ? 41.118  47.778  7.817   1.00 12.64 ? 282 GLY B CA  1 
ATOM   5127 C C   . GLY B 1 282 ? 41.136  48.825  6.722   1.00 13.74 ? 282 GLY B C   1 
ATOM   5128 O O   . GLY B 1 282 ? 40.956  50.006  6.982   1.00 17.28 ? 282 GLY B O   1 
ATOM   5129 N N   . GLU B 1 283 ? 41.328  48.400  5.489   1.00 11.61 ? 283 GLU B N   1 
ATOM   5130 C CA  . GLU B 1 283 ? 41.405  49.352  4.411   1.00 14.37 ? 283 GLU B CA  1 
ATOM   5131 C C   . GLU B 1 283 ? 40.072  49.758  3.810   1.00 15.77 ? 283 GLU B C   1 
ATOM   5132 O O   . GLU B 1 283 ? 40.009  50.706  3.037   1.00 15.36 ? 283 GLU B O   1 
ATOM   5133 C CB  . GLU B 1 283 ? 42.349  48.815  3.341   1.00 16.68 ? 283 GLU B CB  1 
ATOM   5134 C CG  . GLU B 1 283 ? 43.756  48.592  3.881   1.00 17.62 ? 283 GLU B CG  1 
ATOM   5135 C CD  . GLU B 1 283 ? 44.690  47.977  2.847   1.00 20.49 ? 283 GLU B CD  1 
ATOM   5136 O OE1 . GLU B 1 283 ? 44.343  48.001  1.657   1.00 24.06 ? 283 GLU B OE1 1 
ATOM   5137 O OE2 . GLU B 1 283 ? 45.773  47.487  3.218   1.00 21.20 ? 283 GLU B OE2 1 
ATOM   5138 N N   . PHE B 1 284 ? 39.001  49.058  4.173   1.00 18.57 ? 284 PHE B N   1 
ATOM   5139 C CA  . PHE B 1 284 ? 37.679  49.393  3.653   1.00 18.19 ? 284 PHE B CA  1 
ATOM   5140 C C   . PHE B 1 284 ? 36.568  48.678  4.407   1.00 19.66 ? 284 PHE B C   1 
ATOM   5141 O O   . PHE B 1 284 ? 36.836  47.768  5.203   1.00 20.89 ? 284 PHE B O   1 
ATOM   5142 C CB  . PHE B 1 284 ? 37.592  49.065  2.166   1.00 16.25 ? 284 PHE B CB  1 
ATOM   5143 C CG  . PHE B 1 284 ? 38.048  47.689  1.834   1.00 16.03 ? 284 PHE B CG  1 
ATOM   5144 C CD1 . PHE B 1 284 ? 39.342  47.468  1.385   1.00 9.15  ? 284 PHE B CD1 1 
ATOM   5145 C CD2 . PHE B 1 284 ? 37.192  46.603  2.016   1.00 15.01 ? 284 PHE B CD2 1 
ATOM   5146 C CE1 . PHE B 1 284 ? 39.780  46.192  1.121   1.00 12.11 ? 284 PHE B CE1 1 
ATOM   5147 C CE2 . PHE B 1 284 ? 37.623  45.304  1.754   1.00 16.61 ? 284 PHE B CE2 1 
ATOM   5148 C CZ  . PHE B 1 284 ? 38.921  45.096  1.305   1.00 13.70 ? 284 PHE B CZ  1 
ATOM   5149 N N   . ARG B 1 285 ? 35.320  49.088  4.168   1.00 17.28 ? 285 ARG B N   1 
ATOM   5150 C CA  . ARG B 1 285 ? 34.204  48.476  4.868   1.00 15.15 ? 285 ARG B CA  1 
ATOM   5151 C C   . ARG B 1 285 ? 33.977  47.043  4.413   1.00 14.98 ? 285 ARG B C   1 
ATOM   5152 O O   . ARG B 1 285 ? 33.881  46.741  3.232   1.00 14.35 ? 285 ARG B O   1 
ATOM   5153 C CB  . ARG B 1 285 ? 32.932  49.281  4.670   1.00 15.47 ? 285 ARG B CB  1 
ATOM   5154 C CG  . ARG B 1 285 ? 31.764  48.697  5.433   1.00 17.79 ? 285 ARG B CG  1 
ATOM   5155 C CD  . ARG B 1 285 ? 30.468  49.000  4.744   1.00 14.00 ? 285 ARG B CD  1 
ATOM   5156 N NE  . ARG B 1 285 ? 29.989  50.318  5.085   1.00 17.68 ? 285 ARG B NE  1 
ATOM   5157 C CZ  . ARG B 1 285 ? 29.175  51.044  4.323   1.00 17.97 ? 285 ARG B CZ  1 
ATOM   5158 N NH1 . ARG B 1 285 ? 28.738  50.581  3.153   1.00 13.75 ? 285 ARG B NH1 1 
ATOM   5159 N NH2 . ARG B 1 285 ? 28.803  52.245  4.742   1.00 16.98 ? 285 ARG B NH2 1 
ATOM   5160 N N   . VAL B 1 286 ? 33.919  46.156  5.386   1.00 15.48 ? 286 VAL B N   1 
ATOM   5161 C CA  . VAL B 1 286 ? 33.725  44.735  5.139   1.00 12.75 ? 286 VAL B CA  1 
ATOM   5162 C C   . VAL B 1 286 ? 32.398  44.458  5.808   1.00 13.75 ? 286 VAL B C   1 
ATOM   5163 O O   . VAL B 1 286 ? 32.232  44.746  6.993   1.00 16.81 ? 286 VAL B O   1 
ATOM   5164 C CB  . VAL B 1 286 ? 34.839  43.927  5.817   1.00 13.00 ? 286 VAL B CB  1 
ATOM   5165 C CG1 . VAL B 1 286 ? 34.592  42.438  5.630   1.00 16.40 ? 286 VAL B CG1 1 
ATOM   5166 C CG2 . VAL B 1 286 ? 36.201  44.355  5.269   1.00 6.42  ? 286 VAL B CG2 1 
ATOM   5167 N N   . VAL B 1 287 ? 31.452  43.901  5.072   1.00 13.57 ? 287 VAL B N   1 
ATOM   5168 C CA  . VAL B 1 287 ? 30.145  43.672  5.656   1.00 14.91 ? 287 VAL B CA  1 
ATOM   5169 C C   . VAL B 1 287 ? 29.359  42.459  5.153   1.00 15.35 ? 287 VAL B C   1 
ATOM   5170 O O   . VAL B 1 287 ? 29.533  41.998  4.023   1.00 17.60 ? 287 VAL B O   1 
ATOM   5171 C CB  . VAL B 1 287 ? 29.265  44.940  5.466   1.00 14.61 ? 287 VAL B CB  1 
ATOM   5172 C CG1 . VAL B 1 287 ? 28.927  45.147  3.984   1.00 10.67 ? 287 VAL B CG1 1 
ATOM   5173 C CG2 . VAL B 1 287 ? 28.003  44.824  6.302   1.00 18.27 ? 287 VAL B CG2 1 
ATOM   5174 N N   . GLU B 1 288 ? 28.484  41.944  6.005   1.00 15.61 ? 288 GLU B N   1 
ATOM   5175 C CA  . GLU B 1 288 ? 27.629  40.834  5.625   1.00 16.23 ? 288 GLU B CA  1 
ATOM   5176 C C   . GLU B 1 288 ? 26.256  41.458  5.481   1.00 16.09 ? 288 GLU B C   1 
ATOM   5177 O O   . GLU B 1 288 ? 25.680  41.932  6.447   1.00 20.05 ? 288 GLU B O   1 
ATOM   5178 C CB  . GLU B 1 288 ? 27.626  39.749  6.705   1.00 15.61 ? 288 GLU B CB  1 
ATOM   5179 C CG  . GLU B 1 288 ? 28.954  39.032  6.831   1.00 16.83 ? 288 GLU B CG  1 
ATOM   5180 C CD  . GLU B 1 288 ? 29.072  38.195  8.090   1.00 17.47 ? 288 GLU B CD  1 
ATOM   5181 O OE1 . GLU B 1 288 ? 28.307  37.224  8.278   1.00 18.36 ? 288 GLU B OE1 1 
ATOM   5182 O OE2 . GLU B 1 288 ? 29.948  38.522  8.900   1.00 19.96 ? 288 GLU B OE2 1 
ATOM   5183 N N   . ARG B 1 289 ? 25.755  41.491  4.258   1.00 17.06 ? 289 ARG B N   1 
ATOM   5184 C CA  . ARG B 1 289 ? 24.461  42.070  3.982   1.00 17.37 ? 289 ARG B CA  1 
ATOM   5185 C C   . ARG B 1 289 ? 23.877  41.334  2.807   1.00 19.64 ? 289 ARG B C   1 
ATOM   5186 O O   . ARG B 1 289 ? 24.594  40.654  2.065   1.00 20.89 ? 289 ARG B O   1 
ATOM   5187 C CB  . ARG B 1 289 ? 24.586  43.553  3.612   1.00 15.14 ? 289 ARG B CB  1 
ATOM   5188 C CG  . ARG B 1 289 ? 23.221  44.225  3.323   1.00 19.05 ? 289 ARG B CG  1 
ATOM   5189 C CD  . ARG B 1 289 ? 23.308  45.574  2.576   1.00 14.23 ? 289 ARG B CD  1 
ATOM   5190 N NE  . ARG B 1 289 ? 24.304  46.454  3.179   1.00 18.40 ? 289 ARG B NE  1 
ATOM   5191 C CZ  . ARG B 1 289 ? 25.477  46.758  2.629   1.00 16.64 ? 289 ARG B CZ  1 
ATOM   5192 N NH1 . ARG B 1 289 ? 25.817  46.263  1.449   1.00 12.14 ? 289 ARG B NH1 1 
ATOM   5193 N NH2 . ARG B 1 289 ? 26.319  47.547  3.279   1.00 18.78 ? 289 ARG B NH2 1 
ATOM   5194 N N   . THR B 1 290 ? 22.571  41.485  2.631   1.00 21.05 ? 290 THR B N   1 
ATOM   5195 C CA  . THR B 1 290 ? 21.868  40.869  1.517   1.00 19.33 ? 290 THR B CA  1 
ATOM   5196 C C   . THR B 1 290 ? 22.232  41.636  0.260   1.00 19.64 ? 290 THR B C   1 
ATOM   5197 O O   . THR B 1 290 ? 22.375  42.856  0.284   1.00 19.57 ? 290 THR B O   1 
ATOM   5198 C CB  . THR B 1 290 ? 20.369  40.999  1.686   1.00 18.12 ? 290 THR B CB  1 
ATOM   5199 O OG1 . THR B 1 290 ? 19.982  40.350  2.893   1.00 19.89 ? 290 THR B OG1 1 
ATOM   5200 C CG2 . THR B 1 290 ? 19.650  40.401  0.498   1.00 17.18 ? 290 THR B CG2 1 
ATOM   5201 N N   . ILE B 1 291 ? 22.376  40.920  -0.843  1.00 19.16 ? 291 ILE B N   1 
ATOM   5202 C CA  . ILE B 1 291 ? 22.702  41.561  -2.108  1.00 16.38 ? 291 ILE B CA  1 
ATOM   5203 C C   . ILE B 1 291 ? 21.602  41.189  -3.070  1.00 16.52 ? 291 ILE B C   1 
ATOM   5204 O O   . ILE B 1 291 ? 21.261  40.014  -3.200  1.00 17.23 ? 291 ILE B O   1 
ATOM   5205 C CB  . ILE B 1 291 ? 24.028  41.045  -2.676  1.00 17.12 ? 291 ILE B CB  1 
ATOM   5206 C CG1 . ILE B 1 291 ? 25.124  41.153  -1.628  1.00 13.35 ? 291 ILE B CG1 1 
ATOM   5207 C CG2 . ILE B 1 291 ? 24.410  41.836  -3.901  1.00 16.24 ? 291 ILE B CG2 1 
ATOM   5208 C CD1 . ILE B 1 291 ? 26.407  40.605  -2.088  1.00 12.80 ? 291 ILE B CD1 1 
ATOM   5209 N N   . THR B 1 292 ? 21.031  42.176  -3.749  1.00 15.04 ? 292 THR B N   1 
ATOM   5210 C CA  . THR B 1 292 ? 19.972  41.859  -4.682  1.00 15.96 ? 292 THR B CA  1 
ATOM   5211 C C   . THR B 1 292 ? 20.408  42.175  -6.097  1.00 18.39 ? 292 THR B C   1 
ATOM   5212 O O   . THR B 1 292 ? 21.233  43.065  -6.306  1.00 20.90 ? 292 THR B O   1 
ATOM   5213 C CB  . THR B 1 292 ? 18.667  42.639  -4.354  1.00 15.91 ? 292 THR B CB  1 
ATOM   5214 O OG1 . THR B 1 292 ? 18.793  44.000  -4.782  1.00 17.52 ? 292 THR B OG1 1 
ATOM   5215 C CG2 . THR B 1 292 ? 18.381  42.591  -2.857  1.00 9.59  ? 292 THR B CG2 1 
ATOM   5216 N N   . MET B 1 293 ? 19.865  41.447  -7.066  1.00 17.88 ? 293 MET B N   1 
ATOM   5217 C CA  . MET B 1 293 ? 20.225  41.673  -8.450  1.00 20.07 ? 293 MET B CA  1 
ATOM   5218 C C   . MET B 1 293 ? 19.921  43.120  -8.779  1.00 20.19 ? 293 MET B C   1 
ATOM   5219 O O   . MET B 1 293 ? 20.663  43.759  -9.521  1.00 21.42 ? 293 MET B O   1 
ATOM   5220 C CB  . MET B 1 293 ? 19.463  40.715  -9.375  1.00 19.95 ? 293 MET B CB  1 
ATOM   5221 C CG  . MET B 1 293 ? 20.033  39.307  -9.388  1.00 21.03 ? 293 MET B CG  1 
ATOM   5222 S SD  . MET B 1 293 ? 21.771  39.261  -10.023 1.00 29.34 ? 293 MET B SD  1 
ATOM   5223 C CE  . MET B 1 293 ? 21.490  39.769  -11.769 1.00 20.11 ? 293 MET B CE  1 
ATOM   5224 N N   . LYS B 1 294 ? 18.849  43.651  -8.205  1.00 21.80 ? 294 LYS B N   1 
ATOM   5225 C CA  . LYS B 1 294 ? 18.495  45.057  -8.448  1.00 24.98 ? 294 LYS B CA  1 
ATOM   5226 C C   . LYS B 1 294 ? 19.724  45.947  -8.153  1.00 24.66 ? 294 LYS B C   1 
ATOM   5227 O O   . LYS B 1 294 ? 20.204  46.714  -9.019  1.00 23.20 ? 294 LYS B O   1 
ATOM   5228 C CB  . LYS B 1 294 ? 17.353  45.493  -7.534  1.00 26.72 ? 294 LYS B CB  1 
ATOM   5229 C CG  . LYS B 1 294 ? 16.865  46.918  -7.837  1.00 30.50 ? 294 LYS B CG  1 
ATOM   5230 C CD  . LYS B 1 294 ? 16.300  47.602  -6.589  1.00 31.00 ? 294 LYS B CD  1 
ATOM   5231 C CE  . LYS B 1 294 ? 14.918  48.158  -6.851  1.00 28.70 ? 294 LYS B CE  1 
ATOM   5232 N NZ  . LYS B 1 294 ? 14.438  48.993  -5.701  1.00 31.31 ? 294 LYS B NZ  1 
ATOM   5233 N N   . GLN B 1 295 ? 20.233  45.829  -6.929  1.00 21.33 ? 295 GLN B N   1 
ATOM   5234 C CA  . GLN B 1 295 ? 21.398  46.603  -6.522  1.00 21.16 ? 295 GLN B CA  1 
ATOM   5235 C C   . GLN B 1 295 ? 22.560  46.358  -7.465  1.00 18.27 ? 295 GLN B C   1 
ATOM   5236 O O   . GLN B 1 295 ? 23.291  47.282  -7.804  1.00 18.69 ? 295 GLN B O   1 
ATOM   5237 C CB  . GLN B 1 295 ? 21.818  46.225  -5.095  1.00 20.61 ? 295 GLN B CB  1 
ATOM   5238 C CG  . GLN B 1 295 ? 20.732  46.475  -4.066  1.00 18.99 ? 295 GLN B CG  1 
ATOM   5239 C CD  . GLN B 1 295 ? 21.147  46.096  -2.652  1.00 21.19 ? 295 GLN B CD  1 
ATOM   5240 O OE1 . GLN B 1 295 ? 20.502  46.490  -1.686  1.00 23.50 ? 295 GLN B OE1 1 
ATOM   5241 N NE2 . GLN B 1 295 ? 22.223  45.321  -2.526  1.00 24.50 ? 295 GLN B NE2 1 
ATOM   5242 N N   . LEU B 1 296 ? 22.720  45.115  -7.901  1.00 17.83 ? 296 LEU B N   1 
ATOM   5243 C CA  . LEU B 1 296 ? 23.843  44.792  -8.768  1.00 18.47 ? 296 LEU B CA  1 
ATOM   5244 C C   . LEU B 1 296 ? 23.726  45.412  -10.151 1.00 18.98 ? 296 LEU B C   1 
ATOM   5245 O O   . LEU B 1 296 ? 24.716  45.893  -10.721 1.00 16.25 ? 296 LEU B O   1 
ATOM   5246 C CB  . LEU B 1 296 ? 23.999  43.284  -8.905  1.00 19.37 ? 296 LEU B CB  1 
ATOM   5247 C CG  . LEU B 1 296 ? 25.222  42.913  -9.741  1.00 19.77 ? 296 LEU B CG  1 
ATOM   5248 C CD1 . LEU B 1 296 ? 26.494  43.175  -8.931  1.00 17.48 ? 296 LEU B CD1 1 
ATOM   5249 C CD2 . LEU B 1 296 ? 25.124  41.465  -10.170 1.00 21.45 ? 296 LEU B CD2 1 
ATOM   5250 N N   . LEU B 1 297 ? 22.517  45.382  -10.698 1.00 19.24 ? 297 LEU B N   1 
ATOM   5251 C CA  . LEU B 1 297 ? 22.323  45.961  -12.013 1.00 19.60 ? 297 LEU B CA  1 
ATOM   5252 C C   . LEU B 1 297 ? 22.693  47.426  -11.921 1.00 19.11 ? 297 LEU B C   1 
ATOM   5253 O O   . LEU B 1 297 ? 23.534  47.921  -12.688 1.00 18.45 ? 297 LEU B O   1 
ATOM   5254 C CB  . LEU B 1 297 ? 20.880  45.788  -12.489 1.00 16.54 ? 297 LEU B CB  1 
ATOM   5255 C CG  . LEU B 1 297 ? 20.532  44.359  -12.931 1.00 18.97 ? 297 LEU B CG  1 
ATOM   5256 C CD1 . LEU B 1 297 ? 19.089  44.278  -13.418 1.00 17.35 ? 297 LEU B CD1 1 
ATOM   5257 C CD2 . LEU B 1 297 ? 21.480  43.941  -14.027 1.00 14.44 ? 297 LEU B CD2 1 
ATOM   5258 N N   . ARG B 1 298 ? 22.092  48.116  -10.957 1.00 18.61 ? 298 ARG B N   1 
ATOM   5259 C CA  . ARG B 1 298 ? 22.383  49.526  -10.810 1.00 20.19 ? 298 ARG B CA  1 
ATOM   5260 C C   . ARG B 1 298 ? 23.879  49.811  -10.592 1.00 19.73 ? 298 ARG B C   1 
ATOM   5261 O O   . ARG B 1 298 ? 24.397  50.794  -11.106 1.00 19.93 ? 298 ARG B O   1 
ATOM   5262 C CB  . ARG B 1 298 ? 21.571  50.139  -9.671  1.00 19.96 ? 298 ARG B CB  1 
ATOM   5263 C CG  . ARG B 1 298 ? 21.769  51.630  -9.620  1.00 24.24 ? 298 ARG B CG  1 
ATOM   5264 C CD  . ARG B 1 298 ? 21.230  52.282  -8.382  1.00 25.42 ? 298 ARG B CD  1 
ATOM   5265 N NE  . ARG B 1 298 ? 21.760  53.647  -8.321  1.00 29.47 ? 298 ARG B NE  1 
ATOM   5266 C CZ  . ARG B 1 298 ? 21.877  54.368  -7.207  1.00 32.55 ? 298 ARG B CZ  1 
ATOM   5267 N NH1 . ARG B 1 298 ? 21.494  53.872  -6.024  1.00 31.44 ? 298 ARG B NH1 1 
ATOM   5268 N NH2 . ARG B 1 298 ? 22.415  55.577  -7.273  1.00 32.53 ? 298 ARG B NH2 1 
ATOM   5269 N N   . ALA B 1 299 ? 24.584  48.967  -9.841  1.00 18.66 ? 299 ALA B N   1 
ATOM   5270 C CA  . ALA B 1 299 ? 26.001  49.236  -9.626  1.00 17.68 ? 299 ALA B CA  1 
ATOM   5271 C C   . ALA B 1 299 ? 26.790  49.111  -10.936 1.00 19.01 ? 299 ALA B C   1 
ATOM   5272 O O   . ALA B 1 299 ? 27.685  49.913  -11.213 1.00 18.74 ? 299 ALA B O   1 
ATOM   5273 C CB  . ALA B 1 299 ? 26.562  48.300  -8.589  1.00 17.47 ? 299 ALA B CB  1 
ATOM   5274 N N   . LEU B 1 300 ? 26.440  48.108  -11.736 1.00 16.95 ? 300 LEU B N   1 
ATOM   5275 C CA  . LEU B 1 300 ? 27.106  47.864  -12.995 1.00 16.74 ? 300 LEU B CA  1 
ATOM   5276 C C   . LEU B 1 300 ? 26.998  49.043  -13.928 1.00 19.28 ? 300 LEU B C   1 
ATOM   5277 O O   . LEU B 1 300 ? 28.000  49.498  -14.489 1.00 22.99 ? 300 LEU B O   1 
ATOM   5278 C CB  . LEU B 1 300 ? 26.520  46.646  -13.698 1.00 15.37 ? 300 LEU B CB  1 
ATOM   5279 C CG  . LEU B 1 300 ? 26.824  45.289  -13.075 1.00 17.23 ? 300 LEU B CG  1 
ATOM   5280 C CD1 . LEU B 1 300 ? 26.064  44.252  -13.846 1.00 17.24 ? 300 LEU B CD1 1 
ATOM   5281 C CD2 . LEU B 1 300 ? 28.323  44.987  -13.092 1.00 15.92 ? 300 LEU B CD2 1 
ATOM   5282 N N   . GLU B 1 301 ? 25.785  49.549  -14.107 1.00 19.66 ? 301 GLU B N   1 
ATOM   5283 C CA  . GLU B 1 301 ? 25.629  50.661  -15.013 1.00 19.59 ? 301 GLU B CA  1 
ATOM   5284 C C   . GLU B 1 301 ? 26.271  51.948  -14.489 1.00 19.14 ? 301 GLU B C   1 
ATOM   5285 O O   . GLU B 1 301 ? 26.812  52.723  -15.277 1.00 19.13 ? 301 GLU B O   1 
ATOM   5286 C CB  . GLU B 1 301 ? 24.152  50.870  -15.374 1.00 17.46 ? 301 GLU B CB  1 
ATOM   5287 C CG  . GLU B 1 301 ? 23.317  51.556  -14.341 1.00 21.68 ? 301 GLU B CG  1 
ATOM   5288 C CD  . GLU B 1 301 ? 22.138  52.269  -14.978 1.00 27.85 ? 301 GLU B CD  1 
ATOM   5289 O OE1 . GLU B 1 301 ? 21.613  53.231  -14.361 1.00 31.96 ? 301 GLU B OE1 1 
ATOM   5290 O OE2 . GLU B 1 301 ? 21.728  51.880  -16.101 1.00 27.36 ? 301 GLU B OE2 1 
ATOM   5291 N N   . GLU B 1 302 ? 26.231  52.168  -13.174 1.00 17.70 ? 302 GLU B N   1 
ATOM   5292 C CA  . GLU B 1 302 ? 26.794  53.381  -12.585 1.00 17.00 ? 302 GLU B CA  1 
ATOM   5293 C C   . GLU B 1 302 ? 28.288  53.198  -12.419 1.00 19.76 ? 302 GLU B C   1 
ATOM   5294 O O   . GLU B 1 302 ? 28.989  54.123  -12.033 1.00 20.25 ? 302 GLU B O   1 
ATOM   5295 C CB  . GLU B 1 302 ? 26.157  53.700  -11.216 1.00 16.43 ? 302 GLU B CB  1 
ATOM   5296 C CG  . GLU B 1 302 ? 24.634  53.585  -11.213 1.00 18.07 ? 302 GLU B CG  1 
ATOM   5297 C CD  . GLU B 1 302 ? 23.911  54.459  -10.189 1.00 21.09 ? 302 GLU B CD  1 
ATOM   5298 O OE1 . GLU B 1 302 ? 24.259  54.408  -8.986  1.00 22.92 ? 302 GLU B OE1 1 
ATOM   5299 O OE2 . GLU B 1 302 ? 22.966  55.193  -10.592 1.00 24.52 ? 302 GLU B OE2 1 
ATOM   5300 N N   . GLY B 1 303 ? 28.775  51.996  -12.717 1.00 21.28 ? 303 GLY B N   1 
ATOM   5301 C CA  . GLY B 1 303 ? 30.200  51.720  -12.618 1.00 16.46 ? 303 GLY B CA  1 
ATOM   5302 C C   . GLY B 1 303 ? 30.764  51.586  -11.211 1.00 17.14 ? 303 GLY B C   1 
ATOM   5303 O O   . GLY B 1 303 ? 31.985  51.756  -11.019 1.00 16.39 ? 303 GLY B O   1 
ATOM   5304 N N   . ARG B 1 304 ? 29.923  51.275  -10.226 1.00 11.02 ? 304 ARG B N   1 
ATOM   5305 C CA  . ARG B 1 304 ? 30.428  51.148  -8.860  1.00 10.90 ? 304 ARG B CA  1 
ATOM   5306 C C   . ARG B 1 304 ? 31.018  49.786  -8.545  1.00 10.87 ? 304 ARG B C   1 
ATOM   5307 O O   . ARG B 1 304 ? 31.566  49.613  -7.470  1.00 9.19  ? 304 ARG B O   1 
ATOM   5308 C CB  . ARG B 1 304 ? 29.334  51.455  -7.825  1.00 11.58 ? 304 ARG B CB  1 
ATOM   5309 C CG  . ARG B 1 304 ? 28.645  52.802  -8.007  1.00 14.98 ? 304 ARG B CG  1 
ATOM   5310 C CD  . ARG B 1 304 ? 27.756  53.174  -6.806  1.00 14.35 ? 304 ARG B CD  1 
ATOM   5311 N NE  . ARG B 1 304 ? 26.935  52.067  -6.302  1.00 17.91 ? 304 ARG B NE  1 
ATOM   5312 C CZ  . ARG B 1 304 ? 25.787  51.669  -6.834  1.00 13.96 ? 304 ARG B CZ  1 
ATOM   5313 N NH1 . ARG B 1 304 ? 25.295  52.269  -7.896  1.00 21.38 ? 304 ARG B NH1 1 
ATOM   5314 N NH2 . ARG B 1 304 ? 25.111  50.697  -6.277  1.00 18.58 ? 304 ARG B NH2 1 
ATOM   5315 N N   . VAL B 1 305 ? 30.913  48.828  -9.470  1.00 11.31 ? 305 VAL B N   1 
ATOM   5316 C CA  . VAL B 1 305 ? 31.429  47.471  -9.246  1.00 13.91 ? 305 VAL B CA  1 
ATOM   5317 C C   . VAL B 1 305 ? 32.849  47.239  -9.739  1.00 13.41 ? 305 VAL B C   1 
ATOM   5318 O O   . VAL B 1 305 ? 33.155  47.442  -10.902 1.00 17.07 ? 305 VAL B O   1 
ATOM   5319 C CB  . VAL B 1 305 ? 30.552  46.390  -9.917  1.00 11.13 ? 305 VAL B CB  1 
ATOM   5320 C CG1 . VAL B 1 305 ? 31.266  45.064  -9.862  1.00 17.52 ? 305 VAL B CG1 1 
ATOM   5321 C CG2 . VAL B 1 305 ? 29.247  46.254  -9.213  1.00 12.34 ? 305 VAL B CG2 1 
ATOM   5322 N N   . ARG B 1 306 ? 33.705  46.775  -8.852  1.00 16.16 ? 306 ARG B N   1 
ATOM   5323 C CA  . ARG B 1 306 ? 35.082  46.510  -9.222  1.00 16.84 ? 306 ARG B CA  1 
ATOM   5324 C C   . ARG B 1 306 ? 35.345  45.018  -9.425  1.00 16.66 ? 306 ARG B C   1 
ATOM   5325 O O   . ARG B 1 306 ? 35.795  44.592  -10.503 1.00 14.34 ? 306 ARG B O   1 
ATOM   5326 C CB  . ARG B 1 306 ? 36.022  47.075  -8.158  1.00 20.26 ? 306 ARG B CB  1 
ATOM   5327 C CG  . ARG B 1 306 ? 36.018  48.631  -8.052  1.00 24.29 ? 306 ARG B CG  1 
ATOM   5328 C CD  . ARG B 1 306 ? 37.108  49.133  -7.106  1.00 22.11 ? 306 ARG B CD  1 
ATOM   5329 N NE  . ARG B 1 306 ? 38.332  48.367  -7.331  1.00 28.05 ? 306 ARG B NE  1 
ATOM   5330 C CZ  . ARG B 1 306 ? 39.491  48.565  -6.706  1.00 28.31 ? 306 ARG B CZ  1 
ATOM   5331 N NH1 . ARG B 1 306 ? 39.589  49.534  -5.799  1.00 26.29 ? 306 ARG B NH1 1 
ATOM   5332 N NH2 . ARG B 1 306 ? 40.539  47.775  -6.976  1.00 21.43 ? 306 ARG B NH2 1 
ATOM   5333 N N   . GLU B 1 307 ? 35.066  44.217  -8.399  1.00 15.81 ? 307 GLU B N   1 
ATOM   5334 C CA  . GLU B 1 307 ? 35.316  42.786  -8.500  1.00 14.39 ? 307 GLU B CA  1 
ATOM   5335 C C   . GLU B 1 307 ? 34.203  41.918  -7.938  1.00 14.05 ? 307 GLU B C   1 
ATOM   5336 O O   . GLU B 1 307 ? 33.562  42.266  -6.940  1.00 16.39 ? 307 GLU B O   1 
ATOM   5337 C CB  . GLU B 1 307 ? 36.633  42.419  -7.803  1.00 13.10 ? 307 GLU B CB  1 
ATOM   5338 C CG  . GLU B 1 307 ? 37.841  43.252  -8.234  1.00 13.66 ? 307 GLU B CG  1 
ATOM   5339 C CD  . GLU B 1 307 ? 39.115  42.910  -7.451  1.00 15.20 ? 307 GLU B CD  1 
ATOM   5340 O OE1 . GLU B 1 307 ? 39.873  43.842  -7.132  1.00 17.99 ? 307 GLU B OE1 1 
ATOM   5341 O OE2 . GLU B 1 307 ? 39.368  41.727  -7.156  1.00 12.99 ? 307 GLU B OE2 1 
ATOM   5342 N N   . VAL B 1 308 ? 33.984  40.786  -8.591  1.00 10.56 ? 308 VAL B N   1 
ATOM   5343 C CA  . VAL B 1 308 ? 32.978  39.829  -8.172  1.00 13.43 ? 308 VAL B CA  1 
ATOM   5344 C C   . VAL B 1 308 ? 33.609  38.464  -8.234  1.00 15.32 ? 308 VAL B C   1 
ATOM   5345 O O   . VAL B 1 308 ? 34.274  38.114  -9.212  1.00 16.94 ? 308 VAL B O   1 
ATOM   5346 C CB  . VAL B 1 308 ? 31.752  39.836  -9.086  1.00 12.89 ? 308 VAL B CB  1 
ATOM   5347 C CG1 . VAL B 1 308 ? 30.764  38.756  -8.647  1.00 13.04 ? 308 VAL B CG1 1 
ATOM   5348 C CG2 . VAL B 1 308 ? 31.103  41.189  -9.050  1.00 12.81 ? 308 VAL B CG2 1 
ATOM   5349 N N   . PHE B 1 309 ? 33.392  37.676  -7.197  1.00 16.27 ? 309 PHE B N   1 
ATOM   5350 C CA  . PHE B 1 309 ? 34.002  36.359  -7.162  1.00 17.28 ? 309 PHE B CA  1 
ATOM   5351 C C   . PHE B 1 309 ? 33.394  35.508  -6.070  1.00 17.81 ? 309 PHE B C   1 
ATOM   5352 O O   . PHE B 1 309 ? 32.640  35.997  -5.231  1.00 19.15 ? 309 PHE B O   1 
ATOM   5353 C CB  . PHE B 1 309 ? 35.506  36.493  -6.914  1.00 13.41 ? 309 PHE B CB  1 
ATOM   5354 C CG  . PHE B 1 309 ? 35.847  37.290  -5.678  1.00 11.23 ? 309 PHE B CG  1 
ATOM   5355 C CD1 . PHE B 1 309 ? 35.793  38.679  -5.693  1.00 5.16  ? 309 PHE B CD1 1 
ATOM   5356 C CD2 . PHE B 1 309 ? 36.163  36.644  -4.481  1.00 10.14 ? 309 PHE B CD2 1 
ATOM   5357 C CE1 . PHE B 1 309 ? 36.040  39.411  -4.542  1.00 6.24  ? 309 PHE B CE1 1 
ATOM   5358 C CE2 . PHE B 1 309 ? 36.411  37.378  -3.310  1.00 11.54 ? 309 PHE B CE2 1 
ATOM   5359 C CZ  . PHE B 1 309 ? 36.349  38.764  -3.346  1.00 5.89  ? 309 PHE B CZ  1 
ATOM   5360 N N   . GLY B 1 310 ? 33.729  34.224  -6.098  1.00 19.09 ? 310 GLY B N   1 
ATOM   5361 C CA  . GLY B 1 310 ? 33.236  33.305  -5.091  1.00 19.24 ? 310 GLY B CA  1 
ATOM   5362 C C   . GLY B 1 310 ? 34.413  32.763  -4.322  1.00 19.95 ? 310 GLY B C   1 
ATOM   5363 O O   . GLY B 1 310 ? 35.553  32.850  -4.789  1.00 20.61 ? 310 GLY B O   1 
ATOM   5364 N N   . SER B 1 311 ? 34.154  32.212  -3.143  1.00 20.74 ? 311 SER B N   1 
ATOM   5365 C CA  . SER B 1 311 ? 35.212  31.624  -2.320  1.00 17.71 ? 311 SER B CA  1 
ATOM   5366 C C   . SER B 1 311 ? 34.877  30.144  -2.157  1.00 15.03 ? 311 SER B C   1 
ATOM   5367 O O   . SER B 1 311 ? 33.726  29.769  -2.224  1.00 16.09 ? 311 SER B O   1 
ATOM   5368 C CB  . SER B 1 311 ? 35.292  32.328  -0.951  1.00 15.65 ? 311 SER B CB  1 
ATOM   5369 O OG  . SER B 1 311 ? 34.031  32.335  -0.309  1.00 16.75 ? 311 SER B OG  1 
ATOM   5370 N N   . GLY B 1 312 ? 35.888  29.312  -1.952  1.00 14.35 ? 312 GLY B N   1 
ATOM   5371 C CA  . GLY B 1 312 ? 35.674  27.886  -1.805  1.00 14.06 ? 312 GLY B CA  1 
ATOM   5372 C C   . GLY B 1 312 ? 37.019  27.195  -1.765  1.00 15.24 ? 312 GLY B C   1 
ATOM   5373 O O   . GLY B 1 312 ? 37.999  27.719  -2.262  1.00 17.41 ? 312 GLY B O   1 
ATOM   5374 N N   . THR B 1 313 ? 37.067  26.008  -1.188  1.00 16.10 ? 313 THR B N   1 
ATOM   5375 C CA  . THR B 1 313 ? 38.312  25.276  -1.059  1.00 17.39 ? 313 THR B CA  1 
ATOM   5376 C C   . THR B 1 313 ? 38.891  24.788  -2.375  1.00 17.98 ? 313 THR B C   1 
ATOM   5377 O O   . THR B 1 313 ? 40.067  24.455  -2.437  1.00 19.02 ? 313 THR B O   1 
ATOM   5378 C CB  . THR B 1 313 ? 38.137  24.076  -0.114  1.00 14.94 ? 313 THR B CB  1 
ATOM   5379 O OG1 . THR B 1 313 ? 37.452  24.514  1.052   1.00 18.86 ? 313 THR B OG1 1 
ATOM   5380 C CG2 . THR B 1 313 ? 39.475  23.506  0.317   1.00 14.36 ? 313 THR B CG2 1 
ATOM   5381 N N   . ALA B 1 314 ? 38.088  24.756  -3.430  1.00 19.90 ? 314 ALA B N   1 
ATOM   5382 C CA  . ALA B 1 314 ? 38.605  24.274  -4.707  1.00 22.98 ? 314 ALA B CA  1 
ATOM   5383 C C   . ALA B 1 314 ? 39.637  25.204  -5.309  1.00 24.91 ? 314 ALA B C   1 
ATOM   5384 O O   . ALA B 1 314 ? 40.645  24.742  -5.868  1.00 27.92 ? 314 ALA B O   1 
ATOM   5385 C CB  . ALA B 1 314 ? 37.479  24.063  -5.702  1.00 24.03 ? 314 ALA B CB  1 
ATOM   5386 N N   . CYS B 1 315 ? 39.388  26.512  -5.232  1.00 26.50 ? 315 CYS B N   1 
ATOM   5387 C CA  . CYS B 1 315 ? 40.345  27.469  -5.783  1.00 25.96 ? 315 CYS B CA  1 
ATOM   5388 C C   . CYS B 1 315 ? 40.616  28.652  -4.855  1.00 24.47 ? 315 CYS B C   1 
ATOM   5389 O O   . CYS B 1 315 ? 41.406  29.540  -5.185  1.00 22.52 ? 315 CYS B O   1 
ATOM   5390 C CB  . CYS B 1 315 ? 39.864  27.961  -7.158  1.00 29.85 ? 315 CYS B CB  1 
ATOM   5391 S SG  . CYS B 1 315 ? 38.283  28.876  -7.206  1.00 39.56 ? 315 CYS B SG  1 
ATOM   5392 N N   . GLN B 1 316 ? 39.990  28.634  -3.683  1.00 21.96 ? 316 GLN B N   1 
ATOM   5393 C CA  . GLN B 1 316 ? 40.140  29.714  -2.724  1.00 20.73 ? 316 GLN B CA  1 
ATOM   5394 C C   . GLN B 1 316 ? 39.381  30.933  -3.285  1.00 19.51 ? 316 GLN B C   1 
ATOM   5395 O O   . GLN B 1 316 ? 38.374  31.327  -2.748  1.00 20.49 ? 316 GLN B O   1 
ATOM   5396 C CB  . GLN B 1 316 ? 41.615  30.067  -2.528  1.00 23.86 ? 316 GLN B CB  1 
ATOM   5397 C CG  . GLN B 1 316 ? 42.533  28.876  -2.356  1.00 27.40 ? 316 GLN B CG  1 
ATOM   5398 C CD  . GLN B 1 316 ? 42.264  28.082  -1.078  1.00 27.16 ? 316 GLN B CD  1 
ATOM   5399 O OE1 . GLN B 1 316 ? 42.318  28.620  0.026   1.00 27.67 ? 316 GLN B OE1 1 
ATOM   5400 N NE2 . GLN B 1 316 ? 41.991  26.782  -1.233  1.00 30.11 ? 316 GLN B NE2 1 
ATOM   5401 N N   . VAL B 1 317 ? 39.854  31.531  -4.366  1.00 19.38 ? 317 VAL B N   1 
ATOM   5402 C CA  . VAL B 1 317 ? 39.157  32.679  -4.920  1.00 20.00 ? 317 VAL B CA  1 
ATOM   5403 C C   . VAL B 1 317 ? 38.922  32.487  -6.418  1.00 19.11 ? 317 VAL B C   1 
ATOM   5404 O O   . VAL B 1 317 ? 39.804  32.011  -7.125  1.00 18.84 ? 317 VAL B O   1 
ATOM   5405 C CB  . VAL B 1 317 ? 39.951  34.014  -4.667  1.00 17.83 ? 317 VAL B CB  1 
ATOM   5406 C CG1 . VAL B 1 317 ? 39.182  34.913  -3.735  1.00 19.10 ? 317 VAL B CG1 1 
ATOM   5407 C CG2 . VAL B 1 317 ? 41.311  33.730  -4.080  1.00 20.43 ? 317 VAL B CG2 1 
ATOM   5408 N N   . CYS B 1 318 ? 37.725  32.811  -6.898  1.00 18.11 ? 318 CYS B N   1 
ATOM   5409 C CA  . CYS B 1 318 ? 37.452  32.656  -8.319  1.00 18.56 ? 318 CYS B CA  1 
ATOM   5410 C C   . CYS B 1 318 ? 36.670  33.820  -8.911  1.00 17.47 ? 318 CYS B C   1 
ATOM   5411 O O   . CYS B 1 318 ? 35.511  34.060  -8.543  1.00 17.75 ? 318 CYS B O   1 
ATOM   5412 C CB  . CYS B 1 318 ? 36.697  31.352  -8.598  1.00 22.79 ? 318 CYS B CB  1 
ATOM   5413 S SG  . CYS B 1 318 ? 36.447  31.061  -10.397 1.00 25.98 ? 318 CYS B SG  1 
ATOM   5414 N N   . PRO B 1 319 ? 37.289  34.541  -9.862  1.00 16.88 ? 319 PRO B N   1 
ATOM   5415 C CA  . PRO B 1 319 ? 36.768  35.711  -10.588 1.00 17.11 ? 319 PRO B CA  1 
ATOM   5416 C C   . PRO B 1 319 ? 35.514  35.425  -11.419 1.00 16.81 ? 319 PRO B C   1 
ATOM   5417 O O   . PRO B 1 319 ? 35.355  34.336  -11.972 1.00 21.51 ? 319 PRO B O   1 
ATOM   5418 C CB  . PRO B 1 319 ? 37.932  36.117  -11.497 1.00 14.84 ? 319 PRO B CB  1 
ATOM   5419 C CG  . PRO B 1 319 ? 39.118  35.448  -10.907 1.00 15.67 ? 319 PRO B CG  1 
ATOM   5420 C CD  . PRO B 1 319 ? 38.599  34.146  -10.398 1.00 12.96 ? 319 PRO B CD  1 
ATOM   5421 N N   . VAL B 1 320 ? 34.641  36.420  -11.514 1.00 14.06 ? 320 VAL B N   1 
ATOM   5422 C CA  . VAL B 1 320 ? 33.415  36.308  -12.290 1.00 14.10 ? 320 VAL B CA  1 
ATOM   5423 C C   . VAL B 1 320 ? 33.419  37.469  -13.265 1.00 12.67 ? 320 VAL B C   1 
ATOM   5424 O O   . VAL B 1 320 ? 33.569  38.610  -12.855 1.00 12.19 ? 320 VAL B O   1 
ATOM   5425 C CB  . VAL B 1 320 ? 32.164  36.438  -11.392 1.00 13.56 ? 320 VAL B CB  1 
ATOM   5426 C CG1 . VAL B 1 320 ? 30.921  36.243  -12.207 1.00 10.15 ? 320 VAL B CG1 1 
ATOM   5427 C CG2 . VAL B 1 320 ? 32.235  35.442  -10.247 1.00 13.52 ? 320 VAL B CG2 1 
ATOM   5428 N N   . HIS B 1 321 ? 33.257  37.181  -14.553 1.00 16.12 ? 321 HIS B N   1 
ATOM   5429 C CA  . HIS B 1 321 ? 33.246  38.236  -15.556 1.00 16.73 ? 321 HIS B CA  1 
ATOM   5430 C C   . HIS B 1 321 ? 31.923  38.281  -16.332 1.00 18.46 ? 321 HIS B C   1 
ATOM   5431 O O   . HIS B 1 321 ? 31.681  39.204  -17.125 1.00 20.48 ? 321 HIS B O   1 
ATOM   5432 C CB  . HIS B 1 321 ? 34.436  38.067  -16.516 1.00 14.96 ? 321 HIS B CB  1 
ATOM   5433 C CG  . HIS B 1 321 ? 34.297  36.922  -17.472 1.00 16.78 ? 321 HIS B CG  1 
ATOM   5434 N ND1 . HIS B 1 321 ? 33.848  35.680  -17.085 1.00 17.68 ? 321 HIS B ND1 1 
ATOM   5435 C CD2 . HIS B 1 321 ? 34.633  36.810  -18.780 1.00 18.53 ? 321 HIS B CD2 1 
ATOM   5436 C CE1 . HIS B 1 321 ? 33.921  34.847  -18.110 1.00 20.91 ? 321 HIS B CE1 1 
ATOM   5437 N NE2 . HIS B 1 321 ? 34.398  35.509  -19.150 1.00 25.56 ? 321 HIS B NE2 1 
ATOM   5438 N N   . ARG B 1 322 ? 31.053  37.305  -16.084 1.00 16.99 ? 322 ARG B N   1 
ATOM   5439 C CA  . ARG B 1 322 ? 29.783  37.274  -16.784 1.00 18.54 ? 322 ARG B CA  1 
ATOM   5440 C C   . ARG B 1 322 ? 28.687  36.546  -16.028 1.00 19.64 ? 322 ARG B C   1 
ATOM   5441 O O   . ARG B 1 322 ? 28.896  35.449  -15.480 1.00 19.39 ? 322 ARG B O   1 
ATOM   5442 C CB  . ARG B 1 322 ? 29.970  36.623  -18.160 1.00 19.51 ? 322 ARG B CB  1 
ATOM   5443 C CG  . ARG B 1 322 ? 28.790  36.780  -19.080 1.00 21.91 ? 322 ARG B CG  1 
ATOM   5444 C CD  . ARG B 1 322 ? 29.162  36.361  -20.479 1.00 18.95 ? 322 ARG B CD  1 
ATOM   5445 N NE  . ARG B 1 322 ? 29.335  34.927  -20.597 1.00 23.42 ? 322 ARG B NE  1 
ATOM   5446 C CZ  . ARG B 1 322 ? 28.345  34.039  -20.703 1.00 27.17 ? 322 ARG B CZ  1 
ATOM   5447 N NH1 . ARG B 1 322 ? 27.085  34.436  -20.708 1.00 25.34 ? 322 ARG B NH1 1 
ATOM   5448 N NH2 . ARG B 1 322 ? 28.622  32.737  -20.808 1.00 29.65 ? 322 ARG B NH2 1 
ATOM   5449 N N   . ILE B 1 323 ? 27.516  37.167  -16.020 1.00 17.17 ? 323 ILE B N   1 
ATOM   5450 C CA  . ILE B 1 323 ? 26.346  36.621  -15.363 1.00 14.88 ? 323 ILE B CA  1 
ATOM   5451 C C   . ILE B 1 323 ? 25.175  36.762  -16.317 1.00 17.18 ? 323 ILE B C   1 
ATOM   5452 O O   . ILE B 1 323 ? 24.792  37.866  -16.681 1.00 16.40 ? 323 ILE B O   1 
ATOM   5453 C CB  . ILE B 1 323 ? 26.000  37.376  -14.065 1.00 17.50 ? 323 ILE B CB  1 
ATOM   5454 C CG1 . ILE B 1 323 ? 27.133  37.220  -13.049 1.00 14.75 ? 323 ILE B CG1 1 
ATOM   5455 C CG2 . ILE B 1 323 ? 24.683  36.852  -13.487 1.00 15.66 ? 323 ILE B CG2 1 
ATOM   5456 C CD1 . ILE B 1 323 ? 26.880  37.953  -11.760 1.00 11.41 ? 323 ILE B CD1 1 
ATOM   5457 N N   . LEU B 1 324 ? 24.632  35.621  -16.725 1.00 18.22 ? 324 LEU B N   1 
ATOM   5458 C CA  . LEU B 1 324 ? 23.504  35.581  -17.624 1.00 21.80 ? 324 LEU B CA  1 
ATOM   5459 C C   . LEU B 1 324 ? 22.220  35.609  -16.776 1.00 22.28 ? 324 LEU B C   1 
ATOM   5460 O O   . LEU B 1 324 ? 21.931  34.686  -16.009 1.00 19.98 ? 324 LEU B O   1 
ATOM   5461 C CB  . LEU B 1 324 ? 23.566  34.307  -18.473 1.00 19.95 ? 324 LEU B CB  1 
ATOM   5462 C CG  . LEU B 1 324 ? 22.415  34.192  -19.475 1.00 22.37 ? 324 LEU B CG  1 
ATOM   5463 C CD1 . LEU B 1 324 ? 22.526  35.335  -20.470 1.00 21.37 ? 324 LEU B CD1 1 
ATOM   5464 C CD2 . LEU B 1 324 ? 22.446  32.832  -20.174 1.00 20.03 ? 324 LEU B CD2 1 
ATOM   5465 N N   . TYR B 1 325 ? 21.440  36.666  -16.938 1.00 22.60 ? 325 TYR B N   1 
ATOM   5466 C CA  . TYR B 1 325 ? 20.221  36.828  -16.149 1.00 26.13 ? 325 TYR B CA  1 
ATOM   5467 C C   . TYR B 1 325 ? 19.081  37.380  -17.006 1.00 27.13 ? 325 TYR B C   1 
ATOM   5468 O O   . TYR B 1 325 ? 19.258  38.387  -17.683 1.00 26.54 ? 325 TYR B O   1 
ATOM   5469 C CB  . TYR B 1 325 ? 20.554  37.766  -14.984 1.00 23.17 ? 325 TYR B CB  1 
ATOM   5470 C CG  . TYR B 1 325 ? 19.396  38.235  -14.152 1.00 23.59 ? 325 TYR B CG  1 
ATOM   5471 C CD1 . TYR B 1 325 ? 19.006  39.578  -14.173 1.00 22.46 ? 325 TYR B CD1 1 
ATOM   5472 C CD2 . TYR B 1 325 ? 18.741  37.369  -13.283 1.00 23.56 ? 325 TYR B CD2 1 
ATOM   5473 C CE1 . TYR B 1 325 ? 18.011  40.042  -13.353 1.00 21.87 ? 325 TYR B CE1 1 
ATOM   5474 C CE2 . TYR B 1 325 ? 17.734  37.826  -12.448 1.00 23.78 ? 325 TYR B CE2 1 
ATOM   5475 C CZ  . TYR B 1 325 ? 17.379  39.159  -12.487 1.00 23.84 ? 325 TYR B CZ  1 
ATOM   5476 O OH  . TYR B 1 325 ? 16.412  39.618  -11.633 1.00 27.17 ? 325 TYR B OH  1 
ATOM   5477 N N   . LYS B 1 326 ? 17.922  36.723  -16.977 1.00 29.42 ? 326 LYS B N   1 
ATOM   5478 C CA  . LYS B 1 326 ? 16.768  37.161  -17.782 1.00 31.83 ? 326 LYS B CA  1 
ATOM   5479 C C   . LYS B 1 326 ? 17.185  37.095  -19.250 1.00 34.50 ? 326 LYS B C   1 
ATOM   5480 O O   . LYS B 1 326 ? 16.771  37.923  -20.077 1.00 36.91 ? 326 LYS B O   1 
ATOM   5481 C CB  . LYS B 1 326 ? 16.338  38.611  -17.416 1.00 30.74 ? 326 LYS B CB  1 
ATOM   5482 C CG  . LYS B 1 326 ? 15.863  38.807  -15.944 1.00 30.06 ? 326 LYS B CG  1 
ATOM   5483 C CD  . LYS B 1 326 ? 14.833  39.958  -15.792 1.00 31.75 ? 326 LYS B CD  1 
ATOM   5484 C CE  . LYS B 1 326 ? 15.315  41.067  -14.812 1.00 32.21 ? 326 LYS B CE  1 
ATOM   5485 N NZ  . LYS B 1 326 ? 14.295  42.100  -14.413 1.00 29.29 ? 326 LYS B NZ  1 
ATOM   5486 N N   . ASP B 1 327 ? 18.000  36.095  -19.580 1.00 35.81 ? 327 ASP B N   1 
ATOM   5487 C CA  . ASP B 1 327 ? 18.496  35.953  -20.948 1.00 38.45 ? 327 ASP B CA  1 
ATOM   5488 C C   . ASP B 1 327 ? 19.403  37.144  -21.323 1.00 37.99 ? 327 ASP B C   1 
ATOM   5489 O O   . ASP B 1 327 ? 19.745  37.336  -22.500 1.00 38.28 ? 327 ASP B O   1 
ATOM   5490 C CB  . ASP B 1 327 ? 17.327  35.840  -21.942 1.00 41.97 ? 327 ASP B CB  1 
ATOM   5491 C CG  . ASP B 1 327 ? 16.848  34.386  -22.137 1.00 44.68 ? 327 ASP B CG  1 
ATOM   5492 O OD1 . ASP B 1 327 ? 15.969  34.158  -23.015 1.00 44.43 ? 327 ASP B OD1 1 
ATOM   5493 O OD2 . ASP B 1 327 ? 17.345  33.474  -21.416 1.00 46.67 ? 327 ASP B OD2 1 
ATOM   5494 N N   . ARG B 1 328 ? 19.796  37.926  -20.310 1.00 37.36 ? 328 ARG B N   1 
ATOM   5495 C CA  . ARG B 1 328 ? 20.676  39.103  -20.486 1.00 34.86 ? 328 ARG B CA  1 
ATOM   5496 C C   . ARG B 1 328 ? 22.083  38.888  -19.957 1.00 31.26 ? 328 ARG B C   1 
ATOM   5497 O O   . ARG B 1 328 ? 22.298  38.712  -18.761 1.00 28.20 ? 328 ARG B O   1 
ATOM   5498 C CB  . ARG B 1 328 ? 20.099  40.327  -19.779 1.00 35.49 ? 328 ARG B CB  1 
ATOM   5499 C CG  . ARG B 1 328 ? 19.154  41.144  -20.624 1.00 39.57 ? 328 ARG B CG  1 
ATOM   5500 C CD  . ARG B 1 328 ? 18.331  42.112  -19.749 1.00 43.26 ? 328 ARG B CD  1 
ATOM   5501 N NE  . ARG B 1 328 ? 19.139  42.902  -18.807 1.00 43.37 ? 328 ARG B NE  1 
ATOM   5502 C CZ  . ARG B 1 328 ? 18.722  44.046  -18.257 1.00 45.32 ? 328 ARG B CZ  1 
ATOM   5503 N NH1 . ARG B 1 328 ? 17.515  44.529  -18.563 1.00 46.91 ? 328 ARG B NH1 1 
ATOM   5504 N NH2 . ARG B 1 328 ? 19.492  44.715  -17.398 1.00 45.61 ? 328 ARG B NH2 1 
ATOM   5505 N N   . ASN B 1 329 ? 23.042  38.919  -20.867 1.00 30.16 ? 329 ASN B N   1 
ATOM   5506 C CA  . ASN B 1 329 ? 24.442  38.754  -20.520 1.00 26.71 ? 329 ASN B CA  1 
ATOM   5507 C C   . ASN B 1 329 ? 24.987  40.008  -19.883 1.00 23.81 ? 329 ASN B C   1 
ATOM   5508 O O   . ASN B 1 329 ? 25.118  41.042  -20.536 1.00 21.60 ? 329 ASN B O   1 
ATOM   5509 C CB  . ASN B 1 329 ? 25.242  38.453  -21.776 1.00 27.67 ? 329 ASN B CB  1 
ATOM   5510 C CG  . ASN B 1 329 ? 25.704  37.031  -21.825 1.00 27.89 ? 329 ASN B CG  1 
ATOM   5511 O OD1 . ASN B 1 329 ? 24.920  36.114  -21.860 1.00 31.30 ? 329 ASN B OD1 1 
ATOM   5512 N ND2 . ASN B 1 329 ? 26.981  36.847  -21.812 1.00 33.81 ? 329 ASN B ND2 1 
ATOM   5513 N N   . LEU B 1 330 ? 25.315  39.900  -18.607 1.00 21.71 ? 330 LEU B N   1 
ATOM   5514 C CA  . LEU B 1 330 ? 25.862  41.027  -17.882 1.00 17.57 ? 330 LEU B CA  1 
ATOM   5515 C C   . LEU B 1 330 ? 27.364  40.866  -17.814 1.00 17.36 ? 330 LEU B C   1 
ATOM   5516 O O   . LEU B 1 330 ? 27.870  39.872  -17.300 1.00 18.04 ? 330 LEU B O   1 
ATOM   5517 C CB  . LEU B 1 330 ? 25.298  41.056  -16.473 1.00 17.49 ? 330 LEU B CB  1 
ATOM   5518 C CG  . LEU B 1 330 ? 23.798  40.901  -16.408 1.00 18.17 ? 330 LEU B CG  1 
ATOM   5519 C CD1 . LEU B 1 330 ? 23.386  40.877  -14.949 1.00 18.09 ? 330 LEU B CD1 1 
ATOM   5520 C CD2 . LEU B 1 330 ? 23.139  42.036  -17.164 1.00 18.34 ? 330 LEU B CD2 1 
ATOM   5521 N N   . HIS B 1 331 ? 28.073  41.844  -18.341 1.00 14.92 ? 331 HIS B N   1 
ATOM   5522 C CA  . HIS B 1 331 ? 29.508  41.817  -18.285 1.00 14.21 ? 331 HIS B CA  1 
ATOM   5523 C C   . HIS B 1 331 ? 29.880  42.316  -16.885 1.00 14.27 ? 331 HIS B C   1 
ATOM   5524 O O   . HIS B 1 331 ? 29.339  43.318  -16.429 1.00 16.04 ? 331 HIS B O   1 
ATOM   5525 C CB  . HIS B 1 331 ? 30.079  42.766  -19.317 1.00 11.01 ? 331 HIS B CB  1 
ATOM   5526 C CG  . HIS B 1 331 ? 31.499  43.120  -19.054 1.00 13.74 ? 331 HIS B CG  1 
ATOM   5527 N ND1 . HIS B 1 331 ? 32.534  42.238  -19.282 1.00 8.03  ? 331 HIS B ND1 1 
ATOM   5528 C CD2 . HIS B 1 331 ? 32.049  44.215  -18.478 1.00 12.27 ? 331 HIS B CD2 1 
ATOM   5529 C CE1 . HIS B 1 331 ? 33.660  42.774  -18.850 1.00 13.87 ? 331 HIS B CE1 1 
ATOM   5530 N NE2 . HIS B 1 331 ? 33.395  43.972  -18.357 1.00 13.99 ? 331 HIS B NE2 1 
ATOM   5531 N N   . ILE B 1 332 ? 30.772  41.612  -16.202 1.00 12.73 ? 332 ILE B N   1 
ATOM   5532 C CA  . ILE B 1 332 ? 31.194  42.020  -14.878 1.00 13.23 ? 332 ILE B CA  1 
ATOM   5533 C C   . ILE B 1 332 ? 32.651  42.441  -15.061 1.00 17.76 ? 332 ILE B C   1 
ATOM   5534 O O   . ILE B 1 332 ? 33.487  41.656  -15.530 1.00 19.10 ? 332 ILE B O   1 
ATOM   5535 C CB  . ILE B 1 332 ? 31.096  40.859  -13.865 1.00 14.16 ? 332 ILE B CB  1 
ATOM   5536 C CG1 . ILE B 1 332 ? 29.694  40.217  -13.909 1.00 13.89 ? 332 ILE B CG1 1 
ATOM   5537 C CG2 . ILE B 1 332 ? 31.396  41.375  -12.448 1.00 16.55 ? 332 ILE B CG2 1 
ATOM   5538 C CD1 . ILE B 1 332 ? 28.544  41.144  -13.516 1.00 12.87 ? 332 ILE B CD1 1 
ATOM   5539 N N   . PRO B 1 333 ? 32.975  43.684  -14.677 1.00 17.11 ? 333 PRO B N   1 
ATOM   5540 C CA  . PRO B 1 333 ? 34.311  44.297  -14.779 1.00 18.27 ? 333 PRO B CA  1 
ATOM   5541 C C   . PRO B 1 333 ? 35.457  43.733  -13.936 1.00 18.43 ? 333 PRO B C   1 
ATOM   5542 O O   . PRO B 1 333 ? 36.527  44.330  -13.877 1.00 16.21 ? 333 PRO B O   1 
ATOM   5543 C CB  . PRO B 1 333 ? 34.063  45.782  -14.440 1.00 17.33 ? 333 PRO B CB  1 
ATOM   5544 C CG  . PRO B 1 333 ? 32.601  45.889  -14.105 1.00 21.25 ? 333 PRO B CG  1 
ATOM   5545 C CD  . PRO B 1 333 ? 32.089  44.504  -13.839 1.00 17.62 ? 333 PRO B CD  1 
ATOM   5546 N N   . THR B 1 334 ? 35.241  42.594  -13.295 1.00 18.65 ? 334 THR B N   1 
ATOM   5547 C CA  . THR B 1 334 ? 36.279  42.015  -12.445 1.00 20.38 ? 334 THR B CA  1 
ATOM   5548 C C   . THR B 1 334 ? 37.717  42.042  -12.988 1.00 18.79 ? 334 THR B C   1 
ATOM   5549 O O   . THR B 1 334 ? 38.607  42.584  -12.350 1.00 19.97 ? 334 THR B O   1 
ATOM   5550 C CB  . THR B 1 334 ? 35.914  40.572  -12.058 1.00 17.26 ? 334 THR B CB  1 
ATOM   5551 O OG1 . THR B 1 334 ? 34.606  40.571  -11.481 1.00 19.29 ? 334 THR B OG1 1 
ATOM   5552 C CG2 . THR B 1 334 ? 36.906  40.021  -11.051 1.00 15.09 ? 334 THR B CG2 1 
ATOM   5553 N N   . MET B 1 335 ? 37.939  41.483  -14.170 1.00 18.79 ? 335 MET B N   1 
ATOM   5554 C CA  . MET B 1 335 ? 39.284  41.454  -14.726 1.00 17.33 ? 335 MET B CA  1 
ATOM   5555 C C   . MET B 1 335 ? 39.871  42.832  -15.030 1.00 17.22 ? 335 MET B C   1 
ATOM   5556 O O   . MET B 1 335 ? 41.087  43.028  -14.964 1.00 17.27 ? 335 MET B O   1 
ATOM   5557 C CB  . MET B 1 335 ? 39.301  40.568  -15.973 1.00 15.20 ? 335 MET B CB  1 
ATOM   5558 C CG  . MET B 1 335 ? 38.916  39.126  -15.673 1.00 17.71 ? 335 MET B CG  1 
ATOM   5559 S SD  . MET B 1 335 ? 39.826  38.468  -14.229 1.00 18.82 ? 335 MET B SD  1 
ATOM   5560 C CE  . MET B 1 335 ? 41.501  38.501  -14.835 1.00 16.98 ? 335 MET B CE  1 
ATOM   5561 N N   . GLU B 1 336 ? 39.002  43.788  -15.334 1.00 17.13 ? 336 GLU B N   1 
ATOM   5562 C CA  . GLU B 1 336 ? 39.438  45.133  -15.659 1.00 21.64 ? 336 GLU B CA  1 
ATOM   5563 C C   . GLU B 1 336 ? 39.898  45.922  -14.455 1.00 19.82 ? 336 GLU B C   1 
ATOM   5564 O O   . GLU B 1 336 ? 40.428  46.997  -14.593 1.00 22.77 ? 336 GLU B O   1 
ATOM   5565 C CB  . GLU B 1 336 ? 38.319  45.910  -16.362 1.00 24.15 ? 336 GLU B CB  1 
ATOM   5566 C CG  . GLU B 1 336 ? 38.175  45.579  -17.834 1.00 29.82 ? 336 GLU B CG  1 
ATOM   5567 C CD  . GLU B 1 336 ? 37.116  44.518  -18.109 1.00 31.75 ? 336 GLU B CD  1 
ATOM   5568 O OE1 . GLU B 1 336 ? 35.911  44.863  -17.985 1.00 32.63 ? 336 GLU B OE1 1 
ATOM   5569 O OE2 . GLU B 1 336 ? 37.479  43.360  -18.448 1.00 29.78 ? 336 GLU B OE2 1 
ATOM   5570 N N   . ASN B 1 337 ? 39.696  45.388  -13.269 1.00 21.03 ? 337 ASN B N   1 
ATOM   5571 C CA  . ASN B 1 337 ? 40.079  46.086  -12.058 1.00 19.74 ? 337 ASN B CA  1 
ATOM   5572 C C   . ASN B 1 337 ? 41.199  45.317  -11.365 1.00 18.50 ? 337 ASN B C   1 
ATOM   5573 O O   . ASN B 1 337 ? 41.325  45.316  -10.136 1.00 17.81 ? 337 ASN B O   1 
ATOM   5574 C CB  . ASN B 1 337 ? 38.838  46.251  -11.162 1.00 16.99 ? 337 ASN B CB  1 
ATOM   5575 C CG  . ASN B 1 337 ? 37.915  47.393  -11.640 1.00 21.61 ? 337 ASN B CG  1 
ATOM   5576 O OD1 . ASN B 1 337 ? 38.057  48.550  -11.211 1.00 20.39 ? 337 ASN B OD1 1 
ATOM   5577 N ND2 . ASN B 1 337 ? 36.983  47.071  -12.537 1.00 14.86 ? 337 ASN B ND2 1 
ATOM   5578 N N   . GLY B 1 338 ? 42.008  44.656  -12.187 1.00 17.31 ? 338 GLY B N   1 
ATOM   5579 C CA  . GLY B 1 338 ? 43.134  43.886  -11.683 1.00 14.88 ? 338 GLY B CA  1 
ATOM   5580 C C   . GLY B 1 338 ? 43.036  42.446  -12.127 1.00 14.81 ? 338 GLY B C   1 
ATOM   5581 O O   . GLY B 1 338 ? 43.659  42.064  -13.095 1.00 15.83 ? 338 GLY B O   1 
ATOM   5582 N N   . PRO B 1 339 ? 42.229  41.628  -11.453 1.00 16.26 ? 339 PRO B N   1 
ATOM   5583 C CA  . PRO B 1 339 ? 41.420  42.030  -10.304 1.00 14.07 ? 339 PRO B CA  1 
ATOM   5584 C C   . PRO B 1 339 ? 42.309  42.174  -9.097  1.00 16.38 ? 339 PRO B C   1 
ATOM   5585 O O   . PRO B 1 339 ? 42.769  41.175  -8.522  1.00 18.88 ? 339 PRO B O   1 
ATOM   5586 C CB  . PRO B 1 339 ? 40.447  40.880  -10.163 1.00 16.60 ? 339 PRO B CB  1 
ATOM   5587 C CG  . PRO B 1 339 ? 41.330  39.696  -10.513 1.00 15.78 ? 339 PRO B CG  1 
ATOM   5588 C CD  . PRO B 1 339 ? 42.066  40.192  -11.736 1.00 15.00 ? 339 PRO B CD  1 
ATOM   5589 N N   . GLU B 1 340 ? 42.548  43.418  -8.712  1.00 14.27 ? 340 GLU B N   1 
ATOM   5590 C CA  . GLU B 1 340 ? 43.407  43.708  -7.584  1.00 15.89 ? 340 GLU B CA  1 
ATOM   5591 C C   . GLU B 1 340 ? 43.091  42.998  -6.269  1.00 15.18 ? 340 GLU B C   1 
ATOM   5592 O O   . GLU B 1 340 ? 43.975  42.385  -5.681  1.00 17.35 ? 340 GLU B O   1 
ATOM   5593 C CB  . GLU B 1 340 ? 43.434  45.222  -7.365  1.00 21.05 ? 340 GLU B CB  1 
ATOM   5594 C CG  . GLU B 1 340 ? 44.405  45.706  -6.290  1.00 24.84 ? 340 GLU B CG  1 
ATOM   5595 C CD  . GLU B 1 340 ? 44.678  47.205  -6.385  1.00 29.17 ? 340 GLU B CD  1 
ATOM   5596 O OE1 . GLU B 1 340 ? 45.403  47.731  -5.509  1.00 30.72 ? 340 GLU B OE1 1 
ATOM   5597 O OE2 . GLU B 1 340 ? 44.175  47.850  -7.346  1.00 30.65 ? 340 GLU B OE2 1 
ATOM   5598 N N   . LEU B 1 341 ? 41.847  43.074  -5.809  1.00 16.58 ? 341 LEU B N   1 
ATOM   5599 C CA  . LEU B 1 341 ? 41.453  42.456  -4.536  1.00 17.09 ? 341 LEU B CA  1 
ATOM   5600 C C   . LEU B 1 341 ? 41.630  40.950  -4.521  1.00 17.92 ? 341 LEU B C   1 
ATOM   5601 O O   . LEU B 1 341 ? 42.161  40.379  -3.560  1.00 19.44 ? 341 LEU B O   1 
ATOM   5602 C CB  . LEU B 1 341 ? 39.984  42.795  -4.190  1.00 17.57 ? 341 LEU B CB  1 
ATOM   5603 C CG  . LEU B 1 341 ? 39.397  42.151  -2.923  1.00 17.25 ? 341 LEU B CG  1 
ATOM   5604 C CD1 . LEU B 1 341 ? 40.323  42.414  -1.778  1.00 16.70 ? 341 LEU B CD1 1 
ATOM   5605 C CD2 . LEU B 1 341 ? 37.998  42.700  -2.607  1.00 17.82 ? 341 LEU B CD2 1 
ATOM   5606 N N   . ILE B 1 342 ? 41.181  40.323  -5.595  1.00 12.22 ? 342 ILE B N   1 
ATOM   5607 C CA  . ILE B 1 342 ? 41.267  38.883  -5.737  1.00 13.61 ? 342 ILE B CA  1 
ATOM   5608 C C   . ILE B 1 342 ? 42.730  38.426  -5.728  1.00 14.79 ? 342 ILE B C   1 
ATOM   5609 O O   . ILE B 1 342 ? 43.079  37.438  -5.083  1.00 12.67 ? 342 ILE B O   1 
ATOM   5610 C CB  . ILE B 1 342 ? 40.525  38.437  -7.043  1.00 15.07 ? 342 ILE B CB  1 
ATOM   5611 C CG1 . ILE B 1 342 ? 39.005  38.579  -6.838  1.00 8.09  ? 342 ILE B CG1 1 
ATOM   5612 C CG2 . ILE B 1 342 ? 40.907  37.011  -7.438  1.00 12.57 ? 342 ILE B CG2 1 
ATOM   5613 C CD1 . ILE B 1 342 ? 38.184  38.432  -8.108  1.00 15.34 ? 342 ILE B CD1 1 
ATOM   5614 N N   . LEU B 1 343 ? 43.589  39.165  -6.405  1.00 13.40 ? 343 LEU B N   1 
ATOM   5615 C CA  . LEU B 1 343 ? 44.996  38.788  -6.456  1.00 14.10 ? 343 LEU B CA  1 
ATOM   5616 C C   . LEU B 1 343 ? 45.660  38.799  -5.075  1.00 16.03 ? 343 LEU B C   1 
ATOM   5617 O O   . LEU B 1 343 ? 46.430  37.900  -4.728  1.00 15.80 ? 343 LEU B O   1 
ATOM   5618 C CB  . LEU B 1 343 ? 45.746  39.713  -7.419  1.00 13.50 ? 343 LEU B CB  1 
ATOM   5619 C CG  . LEU B 1 343 ? 45.386  39.520  -8.892  1.00 16.96 ? 343 LEU B CG  1 
ATOM   5620 C CD1 . LEU B 1 343 ? 46.122  40.517  -9.764  1.00 17.29 ? 343 LEU B CD1 1 
ATOM   5621 C CD2 . LEU B 1 343 ? 45.762  38.111  -9.314  1.00 14.49 ? 343 LEU B CD2 1 
ATOM   5622 N N   . ARG B 1 344 ? 45.342  39.820  -4.291  1.00 17.30 ? 344 ARG B N   1 
ATOM   5623 C CA  . ARG B 1 344 ? 45.913  39.959  -2.960  1.00 18.23 ? 344 ARG B CA  1 
ATOM   5624 C C   . ARG B 1 344 ? 45.462  38.815  -2.075  1.00 18.01 ? 344 ARG B C   1 
ATOM   5625 O O   . ARG B 1 344 ? 46.269  38.203  -1.382  1.00 17.49 ? 344 ARG B O   1 
ATOM   5626 C CB  . ARG B 1 344 ? 45.510  41.310  -2.366  1.00 15.60 ? 344 ARG B CB  1 
ATOM   5627 C CG  . ARG B 1 344 ? 45.963  41.617  -0.949  1.00 13.11 ? 344 ARG B CG  1 
ATOM   5628 C CD  . ARG B 1 344 ? 45.729  43.102  -0.799  1.00 19.92 ? 344 ARG B CD  1 
ATOM   5629 N NE  . ARG B 1 344 ? 45.718  43.684  0.541   1.00 20.94 ? 344 ARG B NE  1 
ATOM   5630 C CZ  . ARG B 1 344 ? 46.517  43.341  1.546   1.00 29.39 ? 344 ARG B CZ  1 
ATOM   5631 N NH1 . ARG B 1 344 ? 47.423  42.351  1.413   1.00 28.31 ? 344 ARG B NH1 1 
ATOM   5632 N NH2 . ARG B 1 344 ? 46.462  44.061  2.673   1.00 28.90 ? 344 ARG B NH2 1 
ATOM   5633 N N   . PHE B 1 345 ? 44.166  38.523  -2.104  1.00 21.13 ? 345 PHE B N   1 
ATOM   5634 C CA  . PHE B 1 345 ? 43.621  37.417  -1.318  1.00 19.76 ? 345 PHE B CA  1 
ATOM   5635 C C   . PHE B 1 345 ? 44.332  36.129  -1.758  1.00 18.05 ? 345 PHE B C   1 
ATOM   5636 O O   . PHE B 1 345 ? 44.738  35.299  -0.933  1.00 18.44 ? 345 PHE B O   1 
ATOM   5637 C CB  . PHE B 1 345 ? 42.103  37.295  -1.552  1.00 17.80 ? 345 PHE B CB  1 
ATOM   5638 C CG  . PHE B 1 345 ? 41.258  38.204  -0.668  1.00 19.29 ? 345 PHE B CG  1 
ATOM   5639 C CD1 . PHE B 1 345 ? 40.121  38.824  -1.172  1.00 16.53 ? 345 PHE B CD1 1 
ATOM   5640 C CD2 . PHE B 1 345 ? 41.577  38.407  0.672   1.00 16.41 ? 345 PHE B CD2 1 
ATOM   5641 C CE1 . PHE B 1 345 ? 39.323  39.623  -0.365  1.00 16.40 ? 345 PHE B CE1 1 
ATOM   5642 C CE2 . PHE B 1 345 ? 40.775  39.213  1.481   1.00 16.46 ? 345 PHE B CE2 1 
ATOM   5643 C CZ  . PHE B 1 345 ? 39.650  39.819  0.961   1.00 13.36 ? 345 PHE B CZ  1 
ATOM   5644 N N   . GLN B 1 346 ? 44.523  35.984  -3.060  1.00 13.95 ? 346 GLN B N   1 
ATOM   5645 C CA  . GLN B 1 346 ? 45.153  34.789  -3.573  1.00 16.37 ? 346 GLN B CA  1 
ATOM   5646 C C   . GLN B 1 346 ? 46.622  34.706  -3.149  1.00 16.80 ? 346 GLN B C   1 
ATOM   5647 O O   . GLN B 1 346 ? 47.164  33.623  -2.888  1.00 12.28 ? 346 GLN B O   1 
ATOM   5648 C CB  . GLN B 1 346 ? 45.018  34.756  -5.095  1.00 17.06 ? 346 GLN B CB  1 
ATOM   5649 C CG  . GLN B 1 346 ? 45.774  33.642  -5.763  1.00 22.80 ? 346 GLN B CG  1 
ATOM   5650 C CD  . GLN B 1 346 ? 45.479  33.536  -7.257  1.00 30.41 ? 346 GLN B CD  1 
ATOM   5651 O OE1 . GLN B 1 346 ? 44.559  32.803  -7.685  1.00 28.01 ? 346 GLN B OE1 1 
ATOM   5652 N NE2 . GLN B 1 346 ? 46.246  34.285  -8.066  1.00 27.22 ? 346 GLN B NE2 1 
ATOM   5653 N N   . LYS B 1 347 ? 47.269  35.856  -3.074  1.00 16.23 ? 347 LYS B N   1 
ATOM   5654 C CA  . LYS B 1 347 ? 48.651  35.843  -2.683  1.00 15.45 ? 347 LYS B CA  1 
ATOM   5655 C C   . LYS B 1 347 ? 48.774  35.496  -1.189  1.00 17.66 ? 347 LYS B C   1 
ATOM   5656 O O   . LYS B 1 347 ? 49.594  34.663  -0.782  1.00 15.28 ? 347 LYS B O   1 
ATOM   5657 C CB  . LYS B 1 347 ? 49.293  37.204  -2.976  1.00 12.17 ? 347 LYS B CB  1 
ATOM   5658 C CG  . LYS B 1 347 ? 50.759  37.261  -2.610  1.00 11.04 ? 347 LYS B CG  1 
ATOM   5659 C CD  . LYS B 1 347 ? 51.488  38.356  -3.362  1.00 16.08 ? 347 LYS B CD  1 
ATOM   5660 C CE  . LYS B 1 347 ? 52.991  38.191  -3.222  1.00 18.90 ? 347 LYS B CE  1 
ATOM   5661 N NZ  . LYS B 1 347 ? 53.734  39.328  -3.840  1.00 24.38 ? 347 LYS B NZ  1 
ATOM   5662 N N   . GLU B 1 348 ? 47.937  36.122  -0.376  1.00 17.83 ? 348 GLU B N   1 
ATOM   5663 C CA  . GLU B 1 348 ? 48.028  35.895  1.046   1.00 19.44 ? 348 GLU B CA  1 
ATOM   5664 C C   . GLU B 1 348 ? 47.773  34.475  1.449   1.00 18.25 ? 348 GLU B C   1 
ATOM   5665 O O   . GLU B 1 348 ? 48.529  33.918  2.244   1.00 20.47 ? 348 GLU B O   1 
ATOM   5666 C CB  . GLU B 1 348 ? 47.105  36.830  1.817   1.00 20.12 ? 348 GLU B CB  1 
ATOM   5667 C CG  . GLU B 1 348 ? 47.852  38.012  2.406   1.00 28.51 ? 348 GLU B CG  1 
ATOM   5668 C CD  . GLU B 1 348 ? 47.261  38.490  3.740   1.00 33.46 ? 348 GLU B CD  1 
ATOM   5669 O OE1 . GLU B 1 348 ? 47.185  37.664  4.704   1.00 33.17 ? 348 GLU B OE1 1 
ATOM   5670 O OE2 . GLU B 1 348 ? 46.876  39.687  3.819   1.00 32.97 ? 348 GLU B OE2 1 
ATOM   5671 N N   . LEU B 1 349 ? 46.728  33.871  0.903   1.00 19.25 ? 349 LEU B N   1 
ATOM   5672 C CA  . LEU B 1 349 ? 46.415  32.488  1.256   1.00 19.87 ? 349 LEU B CA  1 
ATOM   5673 C C   . LEU B 1 349 ? 47.522  31.494  0.867   1.00 20.44 ? 349 LEU B C   1 
ATOM   5674 O O   . LEU B 1 349 ? 47.847  30.566  1.627   1.00 19.07 ? 349 LEU B O   1 
ATOM   5675 C CB  . LEU B 1 349 ? 45.087  32.092  0.628   1.00 19.38 ? 349 LEU B CB  1 
ATOM   5676 C CG  . LEU B 1 349 ? 43.894  32.780  1.309   1.00 19.13 ? 349 LEU B CG  1 
ATOM   5677 C CD1 . LEU B 1 349 ? 42.600  32.458  0.556   1.00 16.75 ? 349 LEU B CD1 1 
ATOM   5678 C CD2 . LEU B 1 349 ? 43.800  32.321  2.754   1.00 17.17 ? 349 LEU B CD2 1 
ATOM   5679 N N   . LYS B 1 350 ? 48.102  31.710  -0.312  1.00 19.44 ? 350 LYS B N   1 
ATOM   5680 C CA  . LYS B 1 350 ? 49.170  30.873  -0.827  1.00 19.92 ? 350 LYS B CA  1 
ATOM   5681 C C   . LYS B 1 350 ? 50.365  30.875  0.127   1.00 20.90 ? 350 LYS B C   1 
ATOM   5682 O O   . LYS B 1 350 ? 50.881  29.816  0.501   1.00 20.66 ? 350 LYS B O   1 
ATOM   5683 C CB  . LYS B 1 350 ? 49.581  31.390  -2.208  1.00 23.58 ? 350 LYS B CB  1 
ATOM   5684 C CG  . LYS B 1 350 ? 50.780  30.694  -2.842  1.00 25.76 ? 350 LYS B CG  1 
ATOM   5685 C CD  . LYS B 1 350 ? 50.707  30.782  -4.353  1.00 29.69 ? 350 LYS B CD  1 
ATOM   5686 C CE  . LYS B 1 350 ? 51.962  31.382  -4.930  1.00 36.73 ? 350 LYS B CE  1 
ATOM   5687 N NZ  . LYS B 1 350 ? 51.827  31.754  -6.388  1.00 41.65 ? 350 LYS B NZ  1 
ATOM   5688 N N   . GLU B 1 351 ? 50.801  32.063  0.523   1.00 17.40 ? 351 GLU B N   1 
ATOM   5689 C CA  . GLU B 1 351 ? 51.920  32.182  1.441   1.00 19.28 ? 351 GLU B CA  1 
ATOM   5690 C C   . GLU B 1 351 ? 51.628  31.582  2.820   1.00 18.35 ? 351 GLU B C   1 
ATOM   5691 O O   . GLU B 1 351 ? 52.541  31.120  3.512   1.00 16.99 ? 351 GLU B O   1 
ATOM   5692 C CB  . GLU B 1 351 ? 52.324  33.646  1.582   1.00 21.52 ? 351 GLU B CB  1 
ATOM   5693 C CG  . GLU B 1 351 ? 52.637  34.292  0.252   1.00 24.98 ? 351 GLU B CG  1 
ATOM   5694 C CD  . GLU B 1 351 ? 53.116  35.720  0.396   1.00 27.35 ? 351 GLU B CD  1 
ATOM   5695 O OE1 . GLU B 1 351 ? 52.717  36.390  1.381   1.00 28.38 ? 351 GLU B OE1 1 
ATOM   5696 O OE2 . GLU B 1 351 ? 53.886  36.172  -0.486  1.00 30.39 ? 351 GLU B OE2 1 
ATOM   5697 N N   . ILE B 1 352 ? 50.366  31.581  3.220   1.00 17.12 ? 352 ILE B N   1 
ATOM   5698 C CA  . ILE B 1 352 ? 50.001  30.999  4.503   1.00 16.85 ? 352 ILE B CA  1 
ATOM   5699 C C   . ILE B 1 352 ? 49.899  29.492  4.343   1.00 18.11 ? 352 ILE B C   1 
ATOM   5700 O O   . ILE B 1 352 ? 50.457  28.735  5.138   1.00 22.61 ? 352 ILE B O   1 
ATOM   5701 C CB  . ILE B 1 352 ? 48.631  31.543  4.995   1.00 18.05 ? 352 ILE B CB  1 
ATOM   5702 C CG1 . ILE B 1 352 ? 48.773  32.993  5.411   1.00 19.85 ? 352 ILE B CG1 1 
ATOM   5703 C CG2 . ILE B 1 352 ? 48.088  30.694  6.134   1.00 20.33 ? 352 ILE B CG2 1 
ATOM   5704 C CD1 . ILE B 1 352 ? 47.441  33.718  5.593   1.00 23.40 ? 352 ILE B CD1 1 
ATOM   5705 N N   . GLN B 1 353 ? 49.193  29.063  3.301   1.00 15.04 ? 353 GLN B N   1 
ATOM   5706 C CA  . GLN B 1 353 ? 48.961  27.646  3.046   1.00 13.95 ? 353 GLN B CA  1 
ATOM   5707 C C   . GLN B 1 353 ? 50.204  26.826  2.741   1.00 14.98 ? 353 GLN B C   1 
ATOM   5708 O O   . GLN B 1 353 ? 50.347  25.717  3.245   1.00 16.33 ? 353 GLN B O   1 
ATOM   5709 C CB  . GLN B 1 353 ? 47.914  27.508  1.929   1.00 10.21 ? 353 GLN B CB  1 
ATOM   5710 C CG  . GLN B 1 353 ? 46.702  28.346  2.246   1.00 9.21  ? 353 GLN B CG  1 
ATOM   5711 C CD  . GLN B 1 353 ? 45.575  28.231  1.273   1.00 12.05 ? 353 GLN B CD  1 
ATOM   5712 O OE1 . GLN B 1 353 ? 45.752  28.379  0.061   1.00 13.01 ? 353 GLN B OE1 1 
ATOM   5713 N NE2 . GLN B 1 353 ? 44.374  27.987  1.798   1.00 15.59 ? 353 GLN B NE2 1 
ATOM   5714 N N   . TYR B 1 354 ? 51.114  27.373  1.937   1.00 17.83 ? 354 TYR B N   1 
ATOM   5715 C CA  . TYR B 1 354 ? 52.342  26.656  1.574   1.00 16.78 ? 354 TYR B CA  1 
ATOM   5716 C C   . TYR B 1 354 ? 53.523  26.902  2.505   1.00 18.24 ? 354 TYR B C   1 
ATOM   5717 O O   . TYR B 1 354 ? 54.656  26.525  2.216   1.00 19.98 ? 354 TYR B O   1 
ATOM   5718 C CB  . TYR B 1 354 ? 52.723  26.984  0.133   1.00 13.34 ? 354 TYR B CB  1 
ATOM   5719 C CG  . TYR B 1 354 ? 51.717  26.460  -0.862  1.00 15.30 ? 354 TYR B CG  1 
ATOM   5720 C CD1 . TYR B 1 354 ? 50.624  27.245  -1.279  1.00 15.84 ? 354 TYR B CD1 1 
ATOM   5721 C CD2 . TYR B 1 354 ? 51.816  25.153  -1.348  1.00 16.61 ? 354 TYR B CD2 1 
ATOM   5722 C CE1 . TYR B 1 354 ? 49.656  26.739  -2.150  1.00 12.18 ? 354 TYR B CE1 1 
ATOM   5723 C CE2 . TYR B 1 354 ? 50.852  24.632  -2.221  1.00 14.93 ? 354 TYR B CE2 1 
ATOM   5724 C CZ  . TYR B 1 354 ? 49.780  25.426  -2.614  1.00 16.17 ? 354 TYR B CZ  1 
ATOM   5725 O OH  . TYR B 1 354 ? 48.845  24.897  -3.461  1.00 13.14 ? 354 TYR B OH  1 
ATOM   5726 N N   . GLY B 1 355 ? 53.248  27.541  3.632   1.00 22.21 ? 355 GLY B N   1 
ATOM   5727 C CA  . GLY B 1 355 ? 54.280  27.801  4.614   1.00 20.61 ? 355 GLY B CA  1 
ATOM   5728 C C   . GLY B 1 355 ? 55.382  28.758  4.255   1.00 20.35 ? 355 GLY B C   1 
ATOM   5729 O O   . GLY B 1 355 ? 56.529  28.523  4.604   1.00 23.23 ? 355 GLY B O   1 
ATOM   5730 N N   . ILE B 1 356 ? 55.070  29.827  3.543   1.00 23.54 ? 356 ILE B N   1 
ATOM   5731 C CA  . ILE B 1 356 ? 56.106  30.812  3.235   1.00 24.21 ? 356 ILE B CA  1 
ATOM   5732 C C   . ILE B 1 356 ? 56.254  31.689  4.482   1.00 23.78 ? 356 ILE B C   1 
ATOM   5733 O O   . ILE B 1 356 ? 57.347  32.080  4.846   1.00 25.17 ? 356 ILE B O   1 
ATOM   5734 C CB  . ILE B 1 356 ? 55.730  31.680  2.028   1.00 26.56 ? 356 ILE B CB  1 
ATOM   5735 C CG1 . ILE B 1 356 ? 55.373  30.777  0.850   1.00 26.27 ? 356 ILE B CG1 1 
ATOM   5736 C CG2 . ILE B 1 356 ? 56.897  32.587  1.637   1.00 25.42 ? 356 ILE B CG2 1 
ATOM   5737 C CD1 . ILE B 1 356 ? 56.418  29.775  0.563   1.00 23.17 ? 356 ILE B CD1 1 
ATOM   5738 N N   . ARG B 1 357 ? 55.139  31.972  5.144   1.00 26.10 ? 357 ARG B N   1 
ATOM   5739 C CA  . ARG B 1 357 ? 55.137  32.770  6.372   1.00 27.93 ? 357 ARG B CA  1 
ATOM   5740 C C   . ARG B 1 357 ? 54.353  31.987  7.403   1.00 26.99 ? 357 ARG B C   1 
ATOM   5741 O O   . ARG B 1 357 ? 53.254  31.512  7.104   1.00 26.53 ? 357 ARG B O   1 
ATOM   5742 C CB  . ARG B 1 357 ? 54.449  34.115  6.142   1.00 30.30 ? 357 ARG B CB  1 
ATOM   5743 C CG  . ARG B 1 357 ? 52.975  34.022  5.754   1.00 33.60 ? 357 ARG B CG  1 
ATOM   5744 C CD  . ARG B 1 357 ? 52.469  35.368  5.202   1.00 35.96 ? 357 ARG B CD  1 
ATOM   5745 N NE  . ARG B 1 357 ? 52.424  36.389  6.241   1.00 39.18 ? 357 ARG B NE  1 
ATOM   5746 C CZ  . ARG B 1 357 ? 51.315  36.788  6.870   1.00 42.45 ? 357 ARG B CZ  1 
ATOM   5747 N NH1 . ARG B 1 357 ? 50.128  36.260  6.561   1.00 43.88 ? 357 ARG B NH1 1 
ATOM   5748 N NH2 . ARG B 1 357 ? 51.396  37.703  7.833   1.00 41.89 ? 357 ARG B NH2 1 
ATOM   5749 N N   . ALA B 1 358 ? 54.894  31.845  8.610   1.00 26.08 ? 358 ALA B N   1 
ATOM   5750 C CA  . ALA B 1 358 ? 54.189  31.080  9.636   1.00 23.93 ? 358 ALA B CA  1 
ATOM   5751 C C   . ALA B 1 358 ? 52.849  31.746  9.920   1.00 23.27 ? 358 ALA B C   1 
ATOM   5752 O O   . ALA B 1 358 ? 52.681  32.956  9.710   1.00 22.76 ? 358 ALA B O   1 
ATOM   5753 C CB  . ALA B 1 358 ? 55.017  30.987  10.884  1.00 23.86 ? 358 ALA B CB  1 
ATOM   5754 N N   . HIS B 1 359 ? 51.884  30.945  10.361  1.00 23.77 ? 359 HIS B N   1 
ATOM   5755 C CA  . HIS B 1 359 ? 50.562  31.475  10.647  1.00 22.64 ? 359 HIS B CA  1 
ATOM   5756 C C   . HIS B 1 359 ? 49.622  30.563  11.458  1.00 22.85 ? 359 HIS B C   1 
ATOM   5757 O O   . HIS B 1 359 ? 49.478  29.370  11.180  1.00 19.98 ? 359 HIS B O   1 
ATOM   5758 C CB  . HIS B 1 359 ? 49.897  31.871  9.331   1.00 23.95 ? 359 HIS B CB  1 
ATOM   5759 C CG  . HIS B 1 359 ? 48.678  32.702  9.527   1.00 27.58 ? 359 HIS B CG  1 
ATOM   5760 N ND1 . HIS B 1 359 ? 47.547  32.212  10.144  1.00 28.26 ? 359 HIS B ND1 1 
ATOM   5761 C CD2 . HIS B 1 359 ? 48.459  34.022  9.325   1.00 26.80 ? 359 HIS B CD2 1 
ATOM   5762 C CE1 . HIS B 1 359 ? 46.687  33.200  10.321  1.00 28.55 ? 359 HIS B CE1 1 
ATOM   5763 N NE2 . HIS B 1 359 ? 47.216  34.308  9.834   1.00 27.48 ? 359 HIS B NE2 1 
ATOM   5764 N N   . GLU B 1 360 ? 48.982  31.151  12.463  1.00 25.92 ? 360 GLU B N   1 
ATOM   5765 C CA  . GLU B 1 360 ? 48.037  30.465  13.363  1.00 24.42 ? 360 GLU B CA  1 
ATOM   5766 C C   . GLU B 1 360 ? 46.939  29.661  12.637  1.00 23.60 ? 360 GLU B C   1 
ATOM   5767 O O   . GLU B 1 360 ? 46.366  28.749  13.225  1.00 22.54 ? 360 GLU B O   1 
ATOM   5768 C CB  . GLU B 1 360 ? 47.378  31.516  14.255  1.00 25.43 ? 360 GLU B CB  1 
ATOM   5769 C CG  . GLU B 1 360 ? 47.391  32.889  13.553  1.00 34.04 ? 360 GLU B CG  1 
ATOM   5770 C CD  . GLU B 1 360 ? 46.240  33.783  13.935  1.00 38.07 ? 360 GLU B CD  1 
ATOM   5771 O OE1 . GLU B 1 360 ? 46.164  34.918  13.401  1.00 36.76 ? 360 GLU B OE1 1 
ATOM   5772 O OE2 . GLU B 1 360 ? 45.397  33.335  14.761  1.00 42.68 ? 360 GLU B OE2 1 
ATOM   5773 N N   . TRP B 1 361 ? 46.638  30.004  11.382  1.00 20.74 ? 361 TRP B N   1 
ATOM   5774 C CA  . TRP B 1 361 ? 45.613  29.301  10.614  1.00 18.33 ? 361 TRP B CA  1 
ATOM   5775 C C   . TRP B 1 361 ? 46.042  27.910  10.150  1.00 19.30 ? 361 TRP B C   1 
ATOM   5776 O O   . TRP B 1 361 ? 45.195  27.048  9.868   1.00 22.30 ? 361 TRP B O   1 
ATOM   5777 C CB  . TRP B 1 361 ? 45.195  30.124  9.386   1.00 17.66 ? 361 TRP B CB  1 
ATOM   5778 C CG  . TRP B 1 361 ? 44.201  31.224  9.673   1.00 15.33 ? 361 TRP B CG  1 
ATOM   5779 C CD1 . TRP B 1 361 ? 43.572  31.456  10.856  1.00 15.68 ? 361 TRP B CD1 1 
ATOM   5780 C CD2 . TRP B 1 361 ? 43.694  32.204  8.749   1.00 14.16 ? 361 TRP B CD2 1 
ATOM   5781 N NE1 . TRP B 1 361 ? 42.705  32.513  10.738  1.00 14.51 ? 361 TRP B NE1 1 
ATOM   5782 C CE2 . TRP B 1 361 ? 42.757  32.994  9.457   1.00 16.65 ? 361 TRP B CE2 1 
ATOM   5783 C CE3 . TRP B 1 361 ? 43.935  32.488  7.396   1.00 15.09 ? 361 TRP B CE3 1 
ATOM   5784 C CZ2 . TRP B 1 361 ? 42.057  34.062  8.860   1.00 18.61 ? 361 TRP B CZ2 1 
ATOM   5785 C CZ3 . TRP B 1 361 ? 43.242  33.550  6.796   1.00 13.74 ? 361 TRP B CZ3 1 
ATOM   5786 C CH2 . TRP B 1 361 ? 42.310  34.325  7.534   1.00 18.43 ? 361 TRP B CH2 1 
ATOM   5787 N N   . MET B 1 362 ? 47.347  27.678  10.081  1.00 18.90 ? 362 MET B N   1 
ATOM   5788 C CA  . MET B 1 362 ? 47.858  26.402  9.599   1.00 19.25 ? 362 MET B CA  1 
ATOM   5789 C C   . MET B 1 362 ? 48.097  25.323  10.652  1.00 19.93 ? 362 MET B C   1 
ATOM   5790 O O   . MET B 1 362 ? 48.828  25.542  11.626  1.00 21.30 ? 362 MET B O   1 
ATOM   5791 C CB  . MET B 1 362 ? 49.158  26.623  8.793   1.00 18.03 ? 362 MET B CB  1 
ATOM   5792 C CG  . MET B 1 362 ? 49.011  27.490  7.545   1.00 14.77 ? 362 MET B CG  1 
ATOM   5793 S SD  . MET B 1 362 ? 47.513  27.122  6.633   1.00 16.27 ? 362 MET B SD  1 
ATOM   5794 C CE  . MET B 1 362 ? 47.923  25.487  6.031   1.00 16.14 ? 362 MET B CE  1 
ATOM   5795 N N   . PHE B 1 363 ? 47.483  24.157  10.430  1.00 18.33 ? 363 PHE B N   1 
ATOM   5796 C CA  . PHE B 1 363 ? 47.610  22.992  11.312  1.00 19.02 ? 363 PHE B CA  1 
ATOM   5797 C C   . PHE B 1 363 ? 48.565  21.977  10.691  1.00 17.35 ? 363 PHE B C   1 
ATOM   5798 O O   . PHE B 1 363 ? 48.185  21.212  9.815   1.00 15.53 ? 363 PHE B O   1 
ATOM   5799 C CB  . PHE B 1 363 ? 46.246  22.314  11.518  1.00 20.22 ? 363 PHE B CB  1 
ATOM   5800 C CG  . PHE B 1 363 ? 46.287  21.092  12.408  1.00 20.34 ? 363 PHE B CG  1 
ATOM   5801 C CD1 . PHE B 1 363 ? 46.310  21.221  13.797  1.00 19.82 ? 363 PHE B CD1 1 
ATOM   5802 C CD2 . PHE B 1 363 ? 46.291  19.811  11.857  1.00 20.97 ? 363 PHE B CD2 1 
ATOM   5803 C CE1 . PHE B 1 363 ? 46.335  20.108  14.628  1.00 17.75 ? 363 PHE B CE1 1 
ATOM   5804 C CE2 . PHE B 1 363 ? 46.315  18.684  12.679  1.00 22.16 ? 363 PHE B CE2 1 
ATOM   5805 C CZ  . PHE B 1 363 ? 46.337  18.838  14.074  1.00 21.99 ? 363 PHE B CZ  1 
ATOM   5806 N N   . PRO B 1 364 ? 49.815  21.938  11.171  1.00 18.66 ? 364 PRO B N   1 
ATOM   5807 C CA  . PRO B 1 364 ? 50.833  21.012  10.657  1.00 19.67 ? 364 PRO B CA  1 
ATOM   5808 C C   . PRO B 1 364 ? 50.477  19.533  10.806  1.00 18.21 ? 364 PRO B C   1 
ATOM   5809 O O   . PRO B 1 364 ? 49.905  19.116  11.815  1.00 19.18 ? 364 PRO B O   1 
ATOM   5810 C CB  . PRO B 1 364 ? 52.077  21.378  11.470  1.00 17.92 ? 364 PRO B CB  1 
ATOM   5811 C CG  . PRO B 1 364 ? 51.826  22.816  11.876  1.00 17.95 ? 364 PRO B CG  1 
ATOM   5812 C CD  . PRO B 1 364 ? 50.373  22.781  12.244  1.00 15.61 ? 364 PRO B CD  1 
ATOM   5813 N N   . VAL B 1 365 ? 50.818  18.750  9.785   1.00 18.81 ? 365 VAL B N   1 
ATOM   5814 C CA  . VAL B 1 365 ? 50.573  17.315  9.793   1.00 18.58 ? 365 VAL B CA  1 
ATOM   5815 C C   . VAL B 1 365 ? 51.834  16.599  10.255  1.00 19.79 ? 365 VAL B C   1 
ATOM   5816 O O   . VAL B 1 365 ? 52.934  17.128  10.031  1.00 22.60 ? 365 VAL B O   1 
ATOM   5817 C CB  . VAL B 1 365 ? 50.228  16.786  8.382   1.00 19.68 ? 365 VAL B CB  1 
ATOM   5818 C CG1 . VAL B 1 365 ? 50.574  15.290  8.285   1.00 14.64 ? 365 VAL B CG1 1 
ATOM   5819 C CG2 . VAL B 1 365 ? 48.734  17.014  8.080   1.00 14.68 ? 365 VAL B CG2 1 
ATOM   5820 O OXT . VAL B 1 365 ? 51.727  15.499  10.814  1.00 23.73 ? 365 VAL B OXT 1 
HETATM 5821 N N1  . PLP C 2 .   ? 4.084   12.865  0.526   1.00 21.23 ? 370 PLP A N1  1 
HETATM 5822 C C2  . PLP C 2 .   ? 5.305   12.429  1.038   1.00 18.58 ? 370 PLP A C2  1 
HETATM 5823 C C2A . PLP C 2 .   ? 6.344   13.476  1.493   1.00 16.60 ? 370 PLP A C2A 1 
HETATM 5824 C C3  . PLP C 2 .   ? 5.575   11.053  1.126   1.00 17.94 ? 370 PLP A C3  1 
HETATM 5825 O O3  . PLP C 2 .   ? 6.766   10.638  1.634   1.00 15.18 ? 370 PLP A O3  1 
HETATM 5826 C C4  . PLP C 2 .   ? 4.600   10.111  0.705   1.00 20.57 ? 370 PLP A C4  1 
HETATM 5827 C C4A . PLP C 2 .   ? 4.838   8.534   0.797   1.00 19.79 ? 370 PLP A C4A 1 
HETATM 5828 C C5  . PLP C 2 .   ? 3.362   10.597  0.179   1.00 19.16 ? 370 PLP A C5  1 
HETATM 5829 C C6  . PLP C 2 .   ? 3.122   11.970  0.103   1.00 18.56 ? 370 PLP A C6  1 
HETATM 5830 C C5A . PLP C 2 .   ? 2.271   9.631   -0.295  1.00 16.57 ? 370 PLP A C5A 1 
HETATM 5831 O O4P . PLP C 2 .   ? 2.600   8.800   -1.386  1.00 11.21 ? 370 PLP A O4P 1 
HETATM 5832 P P   . PLP C 2 .   ? 1.808   7.475   -1.623  1.00 13.60 ? 370 PLP A P   1 
HETATM 5833 O O1P . PLP C 2 .   ? 2.492   6.439   -0.858  1.00 7.57  ? 370 PLP A O1P 1 
HETATM 5834 O O2P . PLP C 2 .   ? 1.979   7.130   -3.111  1.00 11.87 ? 370 PLP A O2P 1 
HETATM 5835 O O3P . PLP C 2 .   ? 0.368   7.715   -1.417  1.00 12.53 ? 370 PLP A O3P 1 
HETATM 5836 C C   . TRS D 3 .   ? 6.927   7.226   0.863   1.00 27.41 ? 371 TRS A C   1 
HETATM 5837 C C1  . TRS D 3 .   ? 7.836   6.709   -0.244  1.00 28.92 ? 371 TRS A C1  1 
HETATM 5838 C C2  . TRS D 3 .   ? 7.757   8.011   1.683   1.00 25.60 ? 371 TRS A C2  1 
HETATM 5839 C C3  . TRS D 3 .   ? 6.278   5.986   1.596   1.00 30.51 ? 371 TRS A C3  1 
HETATM 5840 N N   . TRS D 3 .   ? 5.948   8.007   0.206   1.00 21.71 ? 371 TRS A N   1 
HETATM 5841 O O2  . TRS D 3 .   ? 8.788   7.405   2.377   1.00 27.01 ? 371 TRS A O2  1 
HETATM 5842 O O3  . TRS D 3 .   ? 6.159   4.756   0.887   1.00 28.02 ? 371 TRS A O3  1 
HETATM 5843 N N1  . PLP E 2 .   ? 28.711  27.042  -0.470  1.00 20.54 ? 370 PLP B N1  1 
HETATM 5844 C C2  . PLP E 2 .   ? 28.439  25.768  -0.948  1.00 21.16 ? 370 PLP B C2  1 
HETATM 5845 C C2A . PLP E 2 .   ? 27.007  25.387  -1.345  1.00 17.90 ? 370 PLP B C2A 1 
HETATM 5846 C C3  . PLP E 2 .   ? 29.478  24.830  -1.050  1.00 21.24 ? 370 PLP B C3  1 
HETATM 5847 O O3  . PLP E 2 .   ? 29.214  23.585  -1.528  1.00 21.15 ? 370 PLP B O3  1 
HETATM 5848 C C4  . PLP E 2 .   ? 30.811  25.174  -0.680  1.00 22.83 ? 370 PLP B C4  1 
HETATM 5849 C C4A . PLP E 2 .   ? 31.986  24.094  -0.798  1.00 24.30 ? 370 PLP B C4A 1 
HETATM 5850 C C5  . PLP E 2 .   ? 31.065  26.506  -0.192  1.00 21.33 ? 370 PLP B C5  1 
HETATM 5851 C C6  . PLP E 2 .   ? 30.001  27.414  -0.104  1.00 22.30 ? 370 PLP B C6  1 
HETATM 5852 C C5A . PLP E 2 .   ? 32.492  26.974  0.223   1.00 20.98 ? 370 PLP B C5A 1 
HETATM 5853 O O4P . PLP E 2 .   ? 32.978  26.500  1.463   1.00 15.51 ? 370 PLP B O4P 1 
HETATM 5854 P P   . PLP E 2 .   ? 34.509  26.380  1.753   1.00 17.74 ? 370 PLP B P   1 
HETATM 5855 O O1P . PLP E 2 .   ? 35.000  25.366  0.830   1.00 11.70 ? 370 PLP B O1P 1 
HETATM 5856 O O2P . PLP E 2 .   ? 34.629  25.814  3.195   1.00 12.32 ? 370 PLP B O2P 1 
HETATM 5857 O O3P . PLP E 2 .   ? 35.143  27.727  1.790   1.00 17.05 ? 370 PLP B O3P 1 
HETATM 5858 C C   . TRS F 3 .   ? 32.067  21.406  -0.773  1.00 29.97 ? 371 TRS B C   1 
HETATM 5859 C C1  . TRS F 3 .   ? 32.461  21.444  0.714   1.00 30.23 ? 371 TRS B C1  1 
HETATM 5860 C C2  . TRS F 3 .   ? 32.745  21.978  -1.872  1.00 32.13 ? 371 TRS B C2  1 
HETATM 5861 C C3  . TRS F 3 .   ? 30.615  21.036  -1.006  1.00 32.86 ? 371 TRS B C3  1 
HETATM 5862 N N   . TRS F 3 .   ? 31.658  22.760  -0.342  1.00 27.05 ? 371 TRS B N   1 
HETATM 5863 O O2  . TRS F 3 .   ? 32.552  21.385  -3.143  1.00 31.30 ? 371 TRS B O2  1 
HETATM 5864 O O3  . TRS F 3 .   ? 30.352  20.450  -2.254  1.00 34.54 ? 371 TRS B O3  1 
HETATM 5865 O O   . HOH G 4 .   ? -15.593 21.621  12.418  1.00 12.54 ? 372 HOH A O   1 
HETATM 5866 O O   . HOH G 4 .   ? 27.252  13.154  1.801   1.00 14.78 ? 373 HOH A O   1 
HETATM 5867 O O   . HOH G 4 .   ? -8.804  -7.109  -9.327  1.00 21.73 ? 374 HOH A O   1 
HETATM 5868 O O   . HOH G 4 .   ? 13.717  0.135   -25.486 1.00 26.58 ? 375 HOH A O   1 
HETATM 5869 O O   . HOH G 4 .   ? 2.600   8.967   -10.485 1.00 20.01 ? 376 HOH A O   1 
HETATM 5870 O O   . HOH G 4 .   ? 10.313  7.983   -7.359  1.00 13.41 ? 377 HOH A O   1 
HETATM 5871 O O   . HOH G 4 .   ? -7.910  -0.071  3.325   1.00 27.34 ? 378 HOH A O   1 
HETATM 5872 O O   . HOH G 4 .   ? -14.164 0.881   6.533   1.00 14.58 ? 379 HOH A O   1 
HETATM 5873 O O   . HOH G 4 .   ? 16.850  15.207  10.566  1.00 11.87 ? 380 HOH A O   1 
HETATM 5874 O O   . HOH G 4 .   ? 6.159   20.167  1.673   1.00 17.93 ? 381 HOH A O   1 
HETATM 5875 O O   . HOH G 4 .   ? -11.629 13.577  16.423  1.00 18.22 ? 382 HOH A O   1 
HETATM 5876 O O   . HOH G 4 .   ? 19.851  17.230  -10.686 1.00 17.45 ? 383 HOH A O   1 
HETATM 5877 O O   . HOH G 4 .   ? 1.699   -17.895 -1.706  1.00 20.29 ? 384 HOH A O   1 
HETATM 5878 O O   . HOH G 4 .   ? 3.190   5.324   9.700   1.00 36.49 ? 385 HOH A O   1 
HETATM 5879 O O   . HOH G 4 .   ? 17.712  14.779  -16.873 1.00 24.07 ? 386 HOH A O   1 
HETATM 5880 O O   . HOH G 4 .   ? 13.910  -8.254  -0.508  1.00 7.74  ? 387 HOH A O   1 
HETATM 5881 O O   . HOH G 4 .   ? 3.297   19.014  -6.315  1.00 20.94 ? 388 HOH A O   1 
HETATM 5882 O O   . HOH G 4 .   ? -3.078  10.696  19.781  1.00 20.48 ? 389 HOH A O   1 
HETATM 5883 O O   . HOH G 4 .   ? -8.579  25.260  -7.926  1.00 35.51 ? 390 HOH A O   1 
HETATM 5884 O O   . HOH G 4 .   ? -4.010  -2.786  4.073   1.00 18.40 ? 391 HOH A O   1 
HETATM 5885 O O   . HOH G 4 .   ? -8.969  -1.559  8.281   1.00 13.61 ? 392 HOH A O   1 
HETATM 5886 O O   . HOH G 4 .   ? 11.793  -8.211  -21.817 1.00 19.19 ? 393 HOH A O   1 
HETATM 5887 O O   . HOH G 4 .   ? -5.635  1.109   -13.753 1.00 17.69 ? 394 HOH A O   1 
HETATM 5888 O O   . HOH G 4 .   ? 4.714   5.202   -1.215  1.00 10.92 ? 395 HOH A O   1 
HETATM 5889 O O   . HOH G 4 .   ? 25.210  -8.162  -17.552 1.00 6.43  ? 396 HOH A O   1 
HETATM 5890 O O   . HOH G 4 .   ? -8.475  0.019   17.922  1.00 6.35  ? 397 HOH A O   1 
HETATM 5891 O O   . HOH G 4 .   ? -12.512 -2.003  5.621   1.00 20.41 ? 398 HOH A O   1 
HETATM 5892 O O   . HOH G 4 .   ? -8.417  3.651   -14.765 1.00 31.32 ? 399 HOH A O   1 
HETATM 5893 O O   . HOH G 4 .   ? 8.330   -17.699 -2.063  1.00 11.30 ? 400 HOH A O   1 
HETATM 5894 O O   . HOH G 4 .   ? -1.371  -9.372  1.700   1.00 17.50 ? 401 HOH A O   1 
HETATM 5895 O O   . HOH G 4 .   ? 32.576  17.721  -3.830  1.00 16.62 ? 402 HOH A O   1 
HETATM 5896 O O   . HOH G 4 .   ? -15.725 18.232  19.200  1.00 27.19 ? 403 HOH A O   1 
HETATM 5897 O O   . HOH G 4 .   ? -3.555  3.092   -12.374 1.00 21.95 ? 404 HOH A O   1 
HETATM 5898 O O   . HOH G 4 .   ? -14.752 1.506   13.462  1.00 26.06 ? 405 HOH A O   1 
HETATM 5899 O O   . HOH G 4 .   ? 23.305  -5.489  -14.662 1.00 9.01  ? 406 HOH A O   1 
HETATM 5900 O O   . HOH G 4 .   ? 13.800  1.812   -23.836 1.00 20.80 ? 407 HOH A O   1 
HETATM 5901 O O   . HOH G 4 .   ? 8.687   16.675  -14.075 1.00 20.64 ? 408 HOH A O   1 
HETATM 5902 O O   . HOH G 4 .   ? 18.598  13.601  -3.769  1.00 20.81 ? 409 HOH A O   1 
HETATM 5903 O O   . HOH G 4 .   ? -6.708  1.200   5.515   1.00 24.42 ? 410 HOH A O   1 
HETATM 5904 O O   . HOH G 4 .   ? 15.458  22.251  -6.126  1.00 20.77 ? 411 HOH A O   1 
HETATM 5905 O O   . HOH G 4 .   ? 0.771   5.289   -15.775 1.00 19.00 ? 412 HOH A O   1 
HETATM 5906 O O   . HOH G 4 .   ? -24.398 15.070  -6.737  1.00 25.00 ? 413 HOH A O   1 
HETATM 5907 O O   . HOH G 4 .   ? -1.013  -2.182  14.035  1.00 26.61 ? 414 HOH A O   1 
HETATM 5908 O O   . HOH G 4 .   ? -20.453 18.328  11.531  1.00 17.97 ? 415 HOH A O   1 
HETATM 5909 O O   . HOH G 4 .   ? 7.083   22.216  5.020   1.00 12.72 ? 416 HOH A O   1 
HETATM 5910 O O   . HOH G 4 .   ? -17.907 3.601   -1.795  1.00 24.45 ? 417 HOH A O   1 
HETATM 5911 O O   . HOH G 4 .   ? 5.075   21.317  11.815  1.00 24.00 ? 418 HOH A O   1 
HETATM 5912 O O   . HOH G 4 .   ? -2.880  19.853  -9.578  1.00 18.17 ? 419 HOH A O   1 
HETATM 5913 O O   . HOH G 4 .   ? -4.035  15.580  -9.228  1.00 14.86 ? 420 HOH A O   1 
HETATM 5914 O O   . HOH G 4 .   ? -12.467 29.054  6.633   1.00 18.78 ? 421 HOH A O   1 
HETATM 5915 O O   . HOH G 4 .   ? 0.059   0.607   -2.737  1.00 15.32 ? 422 HOH A O   1 
HETATM 5916 O O   . HOH G 4 .   ? 11.908  13.343  20.771  1.00 14.69 ? 423 HOH A O   1 
HETATM 5917 O O   . HOH G 4 .   ? 21.219  -17.946 -18.076 1.00 30.66 ? 424 HOH A O   1 
HETATM 5918 O O   . HOH G 4 .   ? 2.472   -15.664 -11.379 1.00 21.16 ? 425 HOH A O   1 
HETATM 5919 O O   . HOH G 4 .   ? -0.951  -20.226 -4.254  1.00 31.37 ? 426 HOH A O   1 
HETATM 5920 O O   . HOH G 4 .   ? 12.760  21.414  -2.442  1.00 16.27 ? 427 HOH A O   1 
HETATM 5921 O O   . HOH G 4 .   ? 8.937   7.314   6.054   1.00 26.06 ? 428 HOH A O   1 
HETATM 5922 O O   . HOH G 4 .   ? -12.540 5.479   -9.497  1.00 24.44 ? 429 HOH A O   1 
HETATM 5923 O O   . HOH G 4 .   ? -2.248  16.715  -2.053  1.00 19.88 ? 430 HOH A O   1 
HETATM 5924 O O   . HOH G 4 .   ? -7.970  3.140   18.107  1.00 26.32 ? 431 HOH A O   1 
HETATM 5925 O O   . HOH G 4 .   ? 13.343  18.118  3.493   1.00 11.76 ? 432 HOH A O   1 
HETATM 5926 O O   . HOH G 4 .   ? 6.373   -15.357 -14.661 1.00 25.86 ? 433 HOH A O   1 
HETATM 5927 O O   . HOH G 4 .   ? -18.067 12.727  -4.209  1.00 23.22 ? 434 HOH A O   1 
HETATM 5928 O O   . HOH G 4 .   ? -3.106  31.119  7.351   1.00 21.17 ? 435 HOH A O   1 
HETATM 5929 O O   . HOH G 4 .   ? 0.968   2.211   -5.050  1.00 20.39 ? 436 HOH A O   1 
HETATM 5930 O O   . HOH G 4 .   ? 28.340  -10.018 3.600   1.00 35.91 ? 437 HOH A O   1 
HETATM 5931 O O   . HOH G 4 .   ? -21.480 15.496  13.615  1.00 30.57 ? 438 HOH A O   1 
HETATM 5932 O O   . HOH G 4 .   ? 18.228  -15.242 0.511   1.00 27.71 ? 439 HOH A O   1 
HETATM 5933 O O   . HOH G 4 .   ? -5.292  8.246   18.940  1.00 27.88 ? 440 HOH A O   1 
HETATM 5934 O O   . HOH G 4 .   ? -0.698  16.594  0.581   1.00 19.33 ? 441 HOH A O   1 
HETATM 5935 O O   . HOH G 4 .   ? 5.379   -12.053 -18.479 1.00 33.59 ? 442 HOH A O   1 
HETATM 5936 O O   . HOH G 4 .   ? -20.711 19.080  -3.449  1.00 22.05 ? 443 HOH A O   1 
HETATM 5937 O O   . HOH G 4 .   ? 2.943   3.943   -17.360 1.00 16.57 ? 444 HOH A O   1 
HETATM 5938 O O   . HOH G 4 .   ? 6.150   13.170  9.893   1.00 24.05 ? 445 HOH A O   1 
HETATM 5939 O O   . HOH G 4 .   ? 25.574  -5.834  -15.784 1.00 20.81 ? 446 HOH A O   1 
HETATM 5940 O O   . HOH G 4 .   ? 17.972  0.356   -26.949 1.00 30.90 ? 447 HOH A O   1 
HETATM 5941 O O   . HOH G 4 .   ? 18.253  5.484   -20.820 1.00 21.79 ? 448 HOH A O   1 
HETATM 5942 O O   . HOH G 4 .   ? -23.294 17.256  12.401  1.00 19.46 ? 449 HOH A O   1 
HETATM 5943 O O   . HOH G 4 .   ? -2.987  35.838  2.812   1.00 31.87 ? 450 HOH A O   1 
HETATM 5944 O O   . HOH G 4 .   ? -5.956  -0.315  17.513  1.00 18.25 ? 451 HOH A O   1 
HETATM 5945 O O   . HOH G 4 .   ? -0.994  12.585  -6.535  1.00 5.65  ? 452 HOH A O   1 
HETATM 5946 O O   . HOH G 4 .   ? 13.332  21.362  -9.385  1.00 25.50 ? 453 HOH A O   1 
HETATM 5947 O O   . HOH G 4 .   ? -7.474  -13.764 -7.283  1.00 23.31 ? 454 HOH A O   1 
HETATM 5948 O O   . HOH G 4 .   ? 10.375  18.363  -15.087 1.00 16.11 ? 455 HOH A O   1 
HETATM 5949 O O   . HOH G 4 .   ? 2.507   -10.108 12.332  1.00 23.13 ? 456 HOH A O   1 
HETATM 5950 O O   . HOH G 4 .   ? -4.834  37.451  6.412   1.00 23.31 ? 457 HOH A O   1 
HETATM 5951 O O   . HOH G 4 .   ? 8.365   24.104  -8.790  1.00 22.84 ? 458 HOH A O   1 
HETATM 5952 O O   . HOH G 4 .   ? 8.820   13.721  4.998   1.00 12.06 ? 459 HOH A O   1 
HETATM 5953 O O   . HOH G 4 .   ? 6.899   22.596  2.109   1.00 9.96  ? 460 HOH A O   1 
HETATM 5954 O O   . HOH G 4 .   ? -7.789  -15.385 -9.563  1.00 23.14 ? 461 HOH A O   1 
HETATM 5955 O O   . HOH G 4 .   ? 19.148  16.750  2.120   1.00 25.49 ? 462 HOH A O   1 
HETATM 5956 O O   . HOH G 4 .   ? 10.414  12.768  23.105  1.00 20.82 ? 463 HOH A O   1 
HETATM 5957 O O   . HOH G 4 .   ? 0.450   9.451   -8.564  1.00 13.09 ? 464 HOH A O   1 
HETATM 5958 O O   . HOH G 4 .   ? 7.230   9.144   -16.080 1.00 15.40 ? 465 HOH A O   1 
HETATM 5959 O O   . HOH G 4 .   ? 9.181   -11.959 -16.893 1.00 23.55 ? 466 HOH A O   1 
HETATM 5960 O O   . HOH G 4 .   ? -4.825  18.150  -11.324 1.00 23.54 ? 467 HOH A O   1 
HETATM 5961 O O   . HOH G 4 .   ? -8.000  30.545  15.874  1.00 27.11 ? 468 HOH A O   1 
HETATM 5962 O O   . HOH G 4 .   ? -4.958  -8.888  -3.562  1.00 28.85 ? 469 HOH A O   1 
HETATM 5963 O O   . HOH G 4 .   ? -2.537  5.272   14.378  1.00 21.23 ? 470 HOH A O   1 
HETATM 5964 O O   . HOH G 4 .   ? 0.340   -4.488  13.623  1.00 16.46 ? 471 HOH A O   1 
HETATM 5965 O O   . HOH G 4 .   ? 16.544  -12.193 3.903   1.00 21.08 ? 472 HOH A O   1 
HETATM 5966 O O   . HOH G 4 .   ? 0.078   3.441   -2.606  1.00 15.41 ? 473 HOH A O   1 
HETATM 5967 O O   . HOH G 4 .   ? 18.807  8.236   -20.205 1.00 33.88 ? 474 HOH A O   1 
HETATM 5968 O O   . HOH G 4 .   ? 1.462   7.076   17.491  1.00 29.01 ? 475 HOH A O   1 
HETATM 5969 O O   . HOH G 4 .   ? -2.351  24.105  0.793   1.00 24.04 ? 476 HOH A O   1 
HETATM 5970 O O   . HOH G 4 .   ? -18.519 30.571  7.111   1.00 18.10 ? 477 HOH A O   1 
HETATM 5971 O O   . HOH G 4 .   ? 6.730   4.277   6.202   1.00 37.61 ? 478 HOH A O   1 
HETATM 5972 O O   . HOH H 4 .   ? 32.758  26.326  10.275  1.00 11.89 ? 372 HOH B O   1 
HETATM 5973 O O   . HOH H 4 .   ? 52.286  23.738  3.677   1.00 13.36 ? 373 HOH B O   1 
HETATM 5974 O O   . HOH H 4 .   ? 43.581  29.500  13.615  1.00 16.72 ? 374 HOH B O   1 
HETATM 5975 O O   . HOH H 4 .   ? 31.709  31.228  6.491   1.00 14.38 ? 375 HOH B O   1 
HETATM 5976 O O   . HOH H 4 .   ? 36.518  23.707  3.884   1.00 11.82 ? 376 HOH B O   1 
HETATM 5977 O O   . HOH H 4 .   ? 45.439  5.415   -6.949  1.00 19.37 ? 377 HOH B O   1 
HETATM 5978 O O   . HOH H 4 .   ? 52.536  27.971  9.151   1.00 27.63 ? 378 HOH B O   1 
HETATM 5979 O O   . HOH H 4 .   ? 52.986  8.074   1.692   1.00 15.26 ? 379 HOH B O   1 
HETATM 5980 O O   . HOH H 4 .   ? 53.756  17.425  7.305   1.00 18.19 ? 380 HOH B O   1 
HETATM 5981 O O   . HOH H 4 .   ? 40.903  23.981  2.915   1.00 21.20 ? 381 HOH B O   1 
HETATM 5982 O O   . HOH H 4 .   ? 45.042  37.613  -13.493 1.00 15.49 ? 382 HOH B O   1 
HETATM 5983 O O   . HOH H 4 .   ? 16.721  7.429   -1.510  1.00 16.21 ? 383 HOH B O   1 
HETATM 5984 O O   . HOH H 4 .   ? 58.713  30.309  7.718   1.00 22.33 ? 384 HOH B O   1 
HETATM 5985 O O   . HOH H 4 .   ? 21.151  29.111  -1.941  1.00 18.05 ? 385 HOH B O   1 
HETATM 5986 O O   . HOH H 4 .   ? 50.593  20.863  -1.672  1.00 12.58 ? 386 HOH B O   1 
HETATM 5987 O O   . HOH H 4 .   ? 40.885  48.745  -17.223 1.00 12.20 ? 387 HOH B O   1 
HETATM 5988 O O   . HOH H 4 .   ? 31.517  48.814  -12.755 1.00 13.12 ? 388 HOH B O   1 
HETATM 5989 O O   . HOH H 4 .   ? 34.899  12.042  25.824  1.00 21.45 ? 389 HOH B O   1 
HETATM 5990 O O   . HOH H 4 .   ? 58.541  10.385  0.470   1.00 29.36 ? 390 HOH B O   1 
HETATM 5991 O O   . HOH H 4 .   ? 39.224  50.211  -9.444  1.00 24.94 ? 391 HOH B O   1 
HETATM 5992 O O   . HOH H 4 .   ? 46.700  42.821  -5.845  1.00 15.52 ? 392 HOH B O   1 
HETATM 5993 O O   . HOH H 4 .   ? 47.550  37.041  6.968   1.00 31.24 ? 393 HOH B O   1 
HETATM 5994 O O   . HOH H 4 .   ? 35.825  3.759   20.835  1.00 19.28 ? 394 HOH B O   1 
HETATM 5995 O O   . HOH H 4 .   ? 36.620  -4.085  -1.498  1.00 29.60 ? 395 HOH B O   1 
HETATM 5996 O O   . HOH H 4 .   ? 17.146  24.141  2.316   1.00 20.81 ? 396 HOH B O   1 
HETATM 5997 O O   . HOH H 4 .   ? 42.217  13.502  -7.674  1.00 27.79 ? 397 HOH B O   1 
HETATM 5998 O O   . HOH H 4 .   ? 34.844  1.355   14.639  1.00 12.52 ? 398 HOH B O   1 
HETATM 5999 O O   . HOH H 4 .   ? 45.671  31.342  -3.253  1.00 10.58 ? 399 HOH B O   1 
HETATM 6000 O O   . HOH H 4 .   ? 21.142  14.474  3.271   1.00 18.07 ? 400 HOH B O   1 
HETATM 6001 O O   . HOH H 4 .   ? 43.373  20.350  -12.188 1.00 22.83 ? 401 HOH B O   1 
HETATM 6002 O O   . HOH H 4 .   ? 36.182  40.878  -16.212 1.00 21.04 ? 402 HOH B O   1 
HETATM 6003 O O   . HOH H 4 .   ? 19.307  21.745  -3.864  1.00 10.64 ? 403 HOH B O   1 
HETATM 6004 O O   . HOH H 4 .   ? 30.416  22.318  16.273  1.00 22.19 ? 404 HOH B O   1 
HETATM 6005 O O   . HOH H 4 .   ? 14.095  37.458  1.435   1.00 14.59 ? 405 HOH B O   1 
HETATM 6006 O O   . HOH H 4 .   ? 30.557  14.643  20.938  1.00 11.66 ? 406 HOH B O   1 
HETATM 6007 O O   . HOH H 4 .   ? 53.599  32.252  -12.665 1.00 16.61 ? 407 HOH B O   1 
HETATM 6008 O O   . HOH H 4 .   ? 43.834  45.889  -2.598  1.00 20.75 ? 408 HOH B O   1 
HETATM 6009 O O   . HOH H 4 .   ? 23.465  25.214  13.672  1.00 23.72 ? 409 HOH B O   1 
HETATM 6010 O O   . HOH H 4 .   ? 35.076  22.761  1.197   1.00 8.37  ? 410 HOH B O   1 
HETATM 6011 O O   . HOH H 4 .   ? 46.761  26.196  -3.763  1.00 19.62 ? 411 HOH B O   1 
HETATM 6012 O O   . HOH H 4 .   ? 25.521  22.357  0.907   1.00 14.17 ? 412 HOH B O   1 
HETATM 6013 O O   . HOH H 4 .   ? 23.598  29.243  9.344   1.00 40.38 ? 413 HOH B O   1 
HETATM 6014 O O   . HOH H 4 .   ? 35.287  21.213  -0.884  1.00 17.49 ? 414 HOH B O   1 
HETATM 6015 O O   . HOH H 4 .   ? 18.614  48.548  -10.536 1.00 19.62 ? 415 HOH B O   1 
HETATM 6016 O O   . HOH H 4 .   ? 45.150  12.794  -11.196 1.00 35.25 ? 416 HOH B O   1 
HETATM 6017 O O   . HOH H 4 .   ? 35.732  51.794  2.817   1.00 14.23 ? 417 HOH B O   1 
HETATM 6018 O O   . HOH H 4 .   ? 46.235  43.683  -9.941  1.00 15.60 ? 418 HOH B O   1 
HETATM 6019 O O   . HOH H 4 .   ? 47.968  45.166  -7.860  1.00 29.00 ? 419 HOH B O   1 
HETATM 6020 O O   . HOH H 4 .   ? 51.037  40.924  4.163   1.00 30.54 ? 420 HOH B O   1 
HETATM 6021 O O   . HOH H 4 .   ? 38.856  26.296  3.013   1.00 11.52 ? 421 HOH B O   1 
HETATM 6022 O O   . HOH H 4 .   ? 28.861  56.894  -13.442 1.00 22.66 ? 422 HOH B O   1 
HETATM 6023 O O   . HOH H 4 .   ? 27.917  26.482  -9.593  1.00 28.11 ? 423 HOH B O   1 
HETATM 6024 O O   . HOH H 4 .   ? 17.002  23.612  9.745   1.00 18.74 ? 424 HOH B O   1 
HETATM 6025 O O   . HOH H 4 .   ? 34.177  51.055  -8.713  1.00 19.25 ? 425 HOH B O   1 
HETATM 6026 O O   . HOH H 4 .   ? 25.336  23.312  -4.893  1.00 16.80 ? 426 HOH B O   1 
HETATM 6027 O O   . HOH H 4 .   ? 31.842  30.787  9.102   1.00 26.54 ? 427 HOH B O   1 
HETATM 6028 O O   . HOH H 4 .   ? 18.202  16.309  -2.123  1.00 21.51 ? 428 HOH B O   1 
HETATM 6029 O O   . HOH H 4 .   ? 20.812  30.414  -10.922 1.00 23.69 ? 429 HOH B O   1 
HETATM 6030 O O   . HOH H 4 .   ? 20.323  10.418  20.766  1.00 16.78 ? 430 HOH B O   1 
HETATM 6031 O O   . HOH H 4 .   ? 25.469  -1.832  6.251   1.00 11.49 ? 431 HOH B O   1 
HETATM 6032 O O   . HOH H 4 .   ? 47.962  38.069  -12.774 1.00 22.18 ? 432 HOH B O   1 
HETATM 6033 O O   . HOH H 4 .   ? 41.917  -2.593  9.328   1.00 22.58 ? 433 HOH B O   1 
HETATM 6034 O O   . HOH H 4 .   ? 18.581  29.204  -4.753  1.00 4.66  ? 434 HOH B O   1 
HETATM 6035 O O   . HOH H 4 .   ? 29.638  19.334  7.599   1.00 23.89 ? 435 HOH B O   1 
HETATM 6036 O O   . HOH H 4 .   ? 46.875  28.983  -2.546  1.00 16.94 ? 436 HOH B O   1 
HETATM 6037 O O   . HOH H 4 .   ? 27.739  38.969  -23.955 1.00 37.97 ? 437 HOH B O   1 
HETATM 6038 O O   . HOH H 4 .   ? 32.203  54.433  -7.704  1.00 15.20 ? 438 HOH B O   1 
HETATM 6039 O O   . HOH H 4 .   ? 48.394  41.212  -4.787  1.00 21.84 ? 439 HOH B O   1 
HETATM 6040 O O   . HOH H 4 .   ? 39.804  18.943  -12.485 1.00 9.60  ? 440 HOH B O   1 
HETATM 6041 O O   . HOH H 4 .   ? 52.251  16.507  13.740  1.00 32.94 ? 441 HOH B O   1 
HETATM 6042 O O   . HOH H 4 .   ? 18.961  30.512  -8.774  1.00 13.85 ? 442 HOH B O   1 
HETATM 6043 O O   . HOH H 4 .   ? 38.195  -0.780  14.606  1.00 17.69 ? 443 HOH B O   1 
HETATM 6044 O O   . HOH H 4 .   ? 22.515  29.741  11.991  1.00 21.31 ? 444 HOH B O   1 
HETATM 6045 O O   . HOH H 4 .   ? 38.561  29.394  -13.546 1.00 27.61 ? 445 HOH B O   1 
HETATM 6046 O O   . HOH H 4 .   ? 59.509  8.626   2.577   1.00 25.04 ? 446 HOH B O   1 
HETATM 6047 O O   . HOH H 4 .   ? 13.514  35.828  -19.887 1.00 25.18 ? 447 HOH B O   1 
HETATM 6048 O O   . HOH H 4 .   ? 30.075  47.692  -14.758 1.00 14.52 ? 448 HOH B O   1 
HETATM 6049 O O   . HOH H 4 .   ? 18.832  22.887  0.492   1.00 11.74 ? 449 HOH B O   1 
HETATM 6050 O O   . HOH H 4 .   ? 46.909  -3.299  18.532  1.00 22.69 ? 450 HOH B O   1 
HETATM 6051 O O   . HOH H 4 .   ? 32.447  11.341  26.670  1.00 28.23 ? 451 HOH B O   1 
HETATM 6052 O O   . HOH H 4 .   ? 16.851  28.229  10.465  1.00 19.51 ? 452 HOH B O   1 
HETATM 6053 O O   . HOH H 4 .   ? 15.586  31.817  -22.797 1.00 44.81 ? 453 HOH B O   1 
HETATM 6054 O O   . HOH H 4 .   ? 27.602  35.642  11.302  1.00 28.05 ? 454 HOH B O   1 
HETATM 6055 O O   . HOH H 4 .   ? 55.594  13.754  -2.216  1.00 28.24 ? 455 HOH B O   1 
HETATM 6056 O O   . HOH H 4 .   ? 37.001  40.520  -18.714 1.00 26.53 ? 456 HOH B O   1 
HETATM 6057 O O   . HOH H 4 .   ? 27.015  48.903  6.244   1.00 22.68 ? 457 HOH B O   1 
HETATM 6058 O O   . HOH H 4 .   ? 13.887  2.107   11.204  1.00 27.01 ? 458 HOH B O   1 
HETATM 6059 O O   . HOH H 4 .   ? 49.419  41.733  -2.587  1.00 23.20 ? 459 HOH B O   1 
HETATM 6060 O O   . HOH H 4 .   ? 49.876  34.093  -5.855  1.00 18.21 ? 460 HOH B O   1 
HETATM 6061 O O   . HOH H 4 .   ? 13.979  22.346  7.363   1.00 22.65 ? 461 HOH B O   1 
HETATM 6062 O O   . HOH H 4 .   ? 27.888  33.070  -0.322  1.00 11.19 ? 462 HOH B O   1 
HETATM 6063 O O   . HOH H 4 .   ? 31.220  -2.225  14.851  1.00 20.88 ? 463 HOH B O   1 
HETATM 6064 O O   . HOH H 4 .   ? 26.423  58.391  -1.719  1.00 24.38 ? 464 HOH B O   1 
HETATM 6065 O O   . HOH H 4 .   ? 32.745  37.423  10.274  1.00 30.26 ? 465 HOH B O   1 
HETATM 6066 O O   . HOH H 4 .   ? 49.663  40.906  -7.000  1.00 31.42 ? 466 HOH B O   1 
HETATM 6067 O O   . HOH H 4 .   ? 33.762  45.534  10.125  1.00 25.17 ? 467 HOH B O   1 
HETATM 6068 O O   . HOH H 4 .   ? 36.662  33.530  12.151  1.00 24.24 ? 468 HOH B O   1 
HETATM 6069 O O   . HOH H 4 .   ? 24.304  26.171  1.431   1.00 20.56 ? 469 HOH B O   1 
HETATM 6070 O O   . HOH H 4 .   ? 23.539  49.046  -6.078  1.00 23.60 ? 470 HOH B O   1 
HETATM 6071 O O   . HOH H 4 .   ? 53.263  35.011  -2.766  1.00 29.73 ? 471 HOH B O   1 
HETATM 6072 O O   . HOH H 4 .   ? 29.042  42.802  9.107   1.00 20.76 ? 472 HOH B O   1 
HETATM 6073 O O   . HOH H 4 .   ? 51.383  43.545  2.266   1.00 18.48 ? 473 HOH B O   1 
HETATM 6074 O O   . HOH H 4 .   ? 26.679  18.671  -18.156 1.00 35.03 ? 474 HOH B O   1 
HETATM 6075 O O   . HOH H 4 .   ? 24.036  45.044  -0.415  1.00 23.52 ? 475 HOH B O   1 
HETATM 6076 O O   . HOH H 4 .   ? 32.916  27.560  13.163  1.00 17.87 ? 476 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  PRO 22  22  22  PRO PRO A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  MET 40  40  40  MET MET A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  TRP 43  43  43  TRP TRP A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  PHE 56  56  56  PHE PHE A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  HIS 62  62  62  HIS HIS A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  MET 78  78  78  MET MET A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLN 86  86  86  GLN GLN A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 MET 105 105 105 MET MET A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 CYS 108 108 108 CYS CYS A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 CYS 120 120 120 CYS CYS A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 TRP 131 131 131 TRP TRP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 GLN 157 157 157 GLN GLN A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 PHE 164 164 164 PHE PHE A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 ARG 192 192 192 ARG ARG A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 TYR 201 201 201 TYR TYR A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 GLN 215 215 215 GLN GLN A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 CYS 222 222 222 CYS CYS A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 TRP 227 227 227 TRP TRP A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 PRO 231 231 231 PRO PRO A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 HIS 233 233 233 HIS HIS A . n 
A 1 234 GLN 234 234 234 GLN GLN A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 MET 241 241 241 MET MET A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 PHE 244 244 244 PHE PHE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 TYR 246 246 246 TYR TYR A . n 
A 1 247 TRP 247 247 247 TRP TRP A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 HIS 249 249 249 HIS HIS A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 ASP 251 251 251 ASP ASP A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 GLU 255 255 255 GLU GLU A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 PRO 259 259 259 PRO PRO A . n 
A 1 260 PRO 260 260 260 PRO PRO A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 ASN 262 262 262 ASN ASN A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 PRO 267 267 267 PRO PRO A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 ARG 271 271 271 ARG ARG A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 SER 273 273 273 SER SER A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 MET 277 277 277 MET MET A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 TRP 281 281 281 TRP TRP A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 VAL 286 286 286 VAL VAL A . n 
A 1 287 VAL 287 287 287 VAL VAL A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 MET 293 293 293 MET MET A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 GLY 303 303 303 GLY GLY A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 VAL 305 305 305 VAL VAL A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 GLU 307 307 307 GLU GLU A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 PHE 309 309 309 PHE PHE A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 CYS 315 315 315 CYS CYS A . n 
A 1 316 GLN 316 316 316 GLN GLN A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 CYS 318 318 318 CYS CYS A . n 
A 1 319 PRO 319 319 319 PRO PRO A . n 
A 1 320 VAL 320 320 320 VAL VAL A . n 
A 1 321 HIS 321 321 321 HIS HIS A . n 
A 1 322 ARG 322 322 322 ARG ARG A . n 
A 1 323 ILE 323 323 323 ILE ILE A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 TYR 325 325 325 TYR TYR A . n 
A 1 326 LYS 326 326 326 LYS LYS A . n 
A 1 327 ASP 327 327 327 ASP ASP A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 ASN 329 329 329 ASN ASN A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 HIS 331 331 331 HIS HIS A . n 
A 1 332 ILE 332 332 332 ILE ILE A . n 
A 1 333 PRO 333 333 333 PRO PRO A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 MET 335 335 335 MET MET A . n 
A 1 336 GLU 336 336 336 GLU GLU A . n 
A 1 337 ASN 337 337 337 ASN ASN A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 ILE 342 342 342 ILE ILE A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 ARG 344 344 344 ARG ARG A . n 
A 1 345 PHE 345 345 345 PHE PHE A . n 
A 1 346 GLN 346 346 346 GLN GLN A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 ILE 352 352 352 ILE ILE A . n 
A 1 353 GLN 353 353 353 GLN GLN A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 ALA 358 358 358 ALA ALA A . n 
A 1 359 HIS 359 359 359 HIS HIS A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 TRP 361 361 361 TRP TRP A . n 
A 1 362 MET 362 362 362 MET MET A . n 
A 1 363 PHE 363 363 363 PHE PHE A . n 
A 1 364 PRO 364 364 364 PRO PRO A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
B 1 1   ALA 1   1   1   ALA ALA B . n 
B 1 2   SER 2   2   2   SER SER B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   PHE 5   5   5   PHE PHE B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   ALA 7   7   7   ALA ALA B . n 
B 1 8   ALA 8   8   8   ALA ALA B . n 
B 1 9   ASP 9   9   9   ASP ASP B . n 
B 1 10  LEU 10  10  10  LEU LEU B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  GLU 13  13  13  GLU GLU B . n 
B 1 14  MET 14  14  14  MET MET B . n 
B 1 15  THR 15  15  15  THR THR B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  PRO 18  18  18  PRO PRO B . n 
B 1 19  HIS 19  19  19  HIS HIS B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  LYS 21  21  21  LYS LYS B . n 
B 1 22  PRO 22  22  22  PRO PRO B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  PRO 27  27  27  PRO PRO B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  PHE 30  30  30  PHE PHE B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  PHE 34  34  34  PHE PHE B . n 
B 1 35  THR 35  35  35  THR THR B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  HIS 37  37  37  HIS HIS B . n 
B 1 38  MET 38  38  38  MET MET B . n 
B 1 39  LEU 39  39  39  LEU LEU B . n 
B 1 40  MET 40  40  40  MET MET B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  TRP 43  43  43  TRP TRP B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  ASP 45  45  45  ASP ASP B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  TRP 48  48  48  TRP TRP B . n 
B 1 49  GLY 49  49  49  GLY GLY B . n 
B 1 50  GLN 50  50  50  GLN GLN B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  ARG 52  52  52  ARG ARG B . n 
B 1 53  ILE 53  53  53  ILE ILE B . n 
B 1 54  GLN 54  54  54  GLN GLN B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  PHE 56  56  56  PHE PHE B . n 
B 1 57  GLN 57  57  57  GLN GLN B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  LEU 59  59  59  LEU LEU B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  LEU 61  61  61  LEU LEU B . n 
B 1 62  HIS 62  62  62  HIS HIS B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  SER 65  65  65  SER SER B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  SER 67  67  67  SER SER B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  GLN 73  73  73  GLN GLN B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  GLU 76  76  76  GLU GLU B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  MET 78  78  78  MET MET B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  ALA 80  80  80  ALA ALA B . n 
B 1 81  PHE 81  81  81  PHE PHE B . n 
B 1 82  LYS 82  82  82  LYS LYS B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  GLN 86  86  86  GLN GLN B . n 
B 1 87  GLN 87  87  87  GLN GLN B . n 
B 1 88  VAL 88  88  88  VAL VAL B . n 
B 1 89  ARG 89  89  89  ARG ARG B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  PHE 91  91  91  PHE PHE B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  TRP 94  94  94  TRP TRP B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  ASN 96  96  96  ASN ASN B . n 
B 1 97  MET 97  97  97  MET MET B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 MET 100 100 100 MET MET B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 ARG 102 102 102 ARG ARG B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 MET 105 105 105 MET MET B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 CYS 108 108 108 CYS CYS B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 PRO 110 110 110 PRO PRO B . n 
B 1 111 SER 111 111 111 SER SER B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 LYS 114 114 114 LYS LYS B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 GLU 119 119 119 GLU GLU B . n 
B 1 120 CYS 120 120 120 CYS CYS B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 ARG 122 122 122 ARG ARG B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 ILE 125 125 125 ILE ILE B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 TRP 131 131 131 TRP TRP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 PRO 133 133 133 PRO PRO B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 GLY 137 137 137 GLY GLY B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 SER 139 139 139 SER SER B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 TYR 141 141 141 TYR TYR B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 ARG 143 143 143 ARG ARG B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 GLY 148 148 148 GLY GLY B . n 
B 1 149 ASN 149 149 149 ASN ASN B . n 
B 1 150 GLU 150 150 150 GLU GLU B . n 
B 1 151 PRO 151 151 151 PRO PRO B . n 
B 1 152 SER 152 152 152 SER SER B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 VAL 155 155 155 VAL VAL B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 GLN 157 157 157 GLN GLN B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 ARG 159 159 159 ARG ARG B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 ALA 161 161 161 ALA ALA B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 PHE 164 164 164 PHE PHE B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 LEU 167 167 167 LEU LEU B . n 
B 1 168 CYS 168 168 168 CYS CYS B . n 
B 1 169 PRO 169 169 169 PRO PRO B . n 
B 1 170 VAL 170 170 170 VAL VAL B . n 
B 1 171 GLY 171 171 171 GLY GLY B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 PHE 174 174 174 PHE PHE B . n 
B 1 175 PRO 175 175 175 PRO PRO B . n 
B 1 176 GLY 176 176 176 GLY GLY B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 SER 178 178 178 SER SER B . n 
B 1 179 VAL 179 179 179 VAL VAL B . n 
B 1 180 THR 180 180 180 THR THR B . n 
B 1 181 PRO 181 181 181 PRO PRO B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 SER 183 183 183 SER SER B . n 
B 1 184 LEU 184 184 184 LEU LEU B . n 
B 1 185 LEU 185 185 185 LEU LEU B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 ASP 187 187 187 ASP ASP B . n 
B 1 188 PRO 188 188 188 PRO PRO B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 ILE 191 191 191 ILE ILE B . n 
B 1 192 ARG 192 192 192 ARG ARG B . n 
B 1 193 ALA 193 193 193 ALA ALA B . n 
B 1 194 TRP 194 194 194 TRP TRP B . n 
B 1 195 VAL 195 195 195 VAL VAL B . n 
B 1 196 GLY 196 196 196 GLY GLY B . n 
B 1 197 GLY 197 197 197 GLY GLY B . n 
B 1 198 VAL 198 198 198 VAL VAL B . n 
B 1 199 GLY 199 199 199 GLY GLY B . n 
B 1 200 ASN 200 200 200 ASN ASN B . n 
B 1 201 TYR 201 201 201 TYR TYR B . n 
B 1 202 LYS 202 202 202 LYS LYS B . n 
B 1 203 LEU 203 203 203 LEU LEU B . n 
B 1 204 GLY 204 204 204 GLY GLY B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ASN 206 206 206 ASN ASN B . n 
B 1 207 TYR 207 207 207 TYR TYR B . n 
B 1 208 GLY 208 208 208 GLY GLY B . n 
B 1 209 PRO 209 209 209 PRO PRO B . n 
B 1 210 THR 210 210 210 THR THR B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 GLN 214 214 214 GLN GLN B . n 
B 1 215 GLN 215 215 215 GLN GLN B . n 
B 1 216 GLU 216 216 216 GLU GLU B . n 
B 1 217 ALA 217 217 217 ALA ALA B . n 
B 1 218 LEU 218 218 218 LEU LEU B . n 
B 1 219 LYS 219 219 219 LYS LYS B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 GLY 221 221 221 GLY GLY B . n 
B 1 222 CYS 222 222 222 CYS CYS B . n 
B 1 223 GLU 223 223 223 GLU GLU B . n 
B 1 224 GLN 224 224 224 GLN GLN B . n 
B 1 225 VAL 225 225 225 VAL VAL B . n 
B 1 226 LEU 226 226 226 LEU LEU B . n 
B 1 227 TRP 227 227 227 TRP TRP B . n 
B 1 228 LEU 228 228 228 LEU LEU B . n 
B 1 229 TYR 229 229 229 TYR TYR B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 PRO 231 231 231 PRO PRO B . n 
B 1 232 ASP 232 232 232 ASP ASP B . n 
B 1 233 HIS 233 233 233 HIS HIS B . n 
B 1 234 GLN 234 234 234 GLN GLN B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 THR 236 236 236 THR THR B . n 
B 1 237 GLU 237 237 237 GLU GLU B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 GLY 239 239 239 GLY GLY B . n 
B 1 240 THR 240 240 240 THR THR B . n 
B 1 241 MET 241 241 241 MET MET B . n 
B 1 242 ASN 242 242 242 ASN ASN B . n 
B 1 243 ILE 243 243 243 ILE ILE B . n 
B 1 244 PHE 244 244 244 PHE PHE B . n 
B 1 245 VAL 245 245 245 VAL VAL B . n 
B 1 246 TYR 246 246 246 TYR TYR B . n 
B 1 247 TRP 247 247 247 TRP TRP B . n 
B 1 248 THR 248 248 248 THR THR B . n 
B 1 249 HIS 249 249 249 HIS HIS B . n 
B 1 250 GLU 250 250 250 GLU GLU B . n 
B 1 251 ASP 251 251 251 ASP ASP B . n 
B 1 252 GLY 252 252 252 GLY GLY B . n 
B 1 253 VAL 253 253 253 VAL VAL B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 GLU 255 255 255 GLU GLU B . n 
B 1 256 LEU 256 256 256 LEU LEU B . n 
B 1 257 VAL 257 257 257 VAL VAL B . n 
B 1 258 THR 258 258 258 THR THR B . n 
B 1 259 PRO 259 259 259 PRO PRO B . n 
B 1 260 PRO 260 260 260 PRO PRO B . n 
B 1 261 LEU 261 261 261 LEU LEU B . n 
B 1 262 ASN 262 262 262 ASN ASN B . n 
B 1 263 GLY 263 263 263 GLY GLY B . n 
B 1 264 VAL 264 264 264 VAL VAL B . n 
B 1 265 ILE 265 265 265 ILE ILE B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 PRO 267 267 267 PRO PRO B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 VAL 269 269 269 VAL VAL B . n 
B 1 270 VAL 270 270 270 VAL VAL B . n 
B 1 271 ARG 271 271 271 ARG ARG B . n 
B 1 272 GLN 272 272 272 GLN GLN B . n 
B 1 273 SER 273 273 273 SER SER B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 LEU 275 275 275 LEU LEU B . n 
B 1 276 ASP 276 276 276 ASP ASP B . n 
B 1 277 MET 277 277 277 MET MET B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 THR 280 280 280 THR THR B . n 
B 1 281 TRP 281 281 281 TRP TRP B . n 
B 1 282 GLY 282 282 282 GLY GLY B . n 
B 1 283 GLU 283 283 283 GLU GLU B . n 
B 1 284 PHE 284 284 284 PHE PHE B . n 
B 1 285 ARG 285 285 285 ARG ARG B . n 
B 1 286 VAL 286 286 286 VAL VAL B . n 
B 1 287 VAL 287 287 287 VAL VAL B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 ARG 289 289 289 ARG ARG B . n 
B 1 290 THR 290 290 290 THR THR B . n 
B 1 291 ILE 291 291 291 ILE ILE B . n 
B 1 292 THR 292 292 292 THR THR B . n 
B 1 293 MET 293 293 293 MET MET B . n 
B 1 294 LYS 294 294 294 LYS LYS B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 LEU 296 296 296 LEU LEU B . n 
B 1 297 LEU 297 297 297 LEU LEU B . n 
B 1 298 ARG 298 298 298 ARG ARG B . n 
B 1 299 ALA 299 299 299 ALA ALA B . n 
B 1 300 LEU 300 300 300 LEU LEU B . n 
B 1 301 GLU 301 301 301 GLU GLU B . n 
B 1 302 GLU 302 302 302 GLU GLU B . n 
B 1 303 GLY 303 303 303 GLY GLY B . n 
B 1 304 ARG 304 304 304 ARG ARG B . n 
B 1 305 VAL 305 305 305 VAL VAL B . n 
B 1 306 ARG 306 306 306 ARG ARG B . n 
B 1 307 GLU 307 307 307 GLU GLU B . n 
B 1 308 VAL 308 308 308 VAL VAL B . n 
B 1 309 PHE 309 309 309 PHE PHE B . n 
B 1 310 GLY 310 310 310 GLY GLY B . n 
B 1 311 SER 311 311 311 SER SER B . n 
B 1 312 GLY 312 312 312 GLY GLY B . n 
B 1 313 THR 313 313 313 THR THR B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 CYS 315 315 315 CYS CYS B . n 
B 1 316 GLN 316 316 316 GLN GLN B . n 
B 1 317 VAL 317 317 317 VAL VAL B . n 
B 1 318 CYS 318 318 318 CYS CYS B . n 
B 1 319 PRO 319 319 319 PRO PRO B . n 
B 1 320 VAL 320 320 320 VAL VAL B . n 
B 1 321 HIS 321 321 321 HIS HIS B . n 
B 1 322 ARG 322 322 322 ARG ARG B . n 
B 1 323 ILE 323 323 323 ILE ILE B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 TYR 325 325 325 TYR TYR B . n 
B 1 326 LYS 326 326 326 LYS LYS B . n 
B 1 327 ASP 327 327 327 ASP ASP B . n 
B 1 328 ARG 328 328 328 ARG ARG B . n 
B 1 329 ASN 329 329 329 ASN ASN B . n 
B 1 330 LEU 330 330 330 LEU LEU B . n 
B 1 331 HIS 331 331 331 HIS HIS B . n 
B 1 332 ILE 332 332 332 ILE ILE B . n 
B 1 333 PRO 333 333 333 PRO PRO B . n 
B 1 334 THR 334 334 334 THR THR B . n 
B 1 335 MET 335 335 335 MET MET B . n 
B 1 336 GLU 336 336 336 GLU GLU B . n 
B 1 337 ASN 337 337 337 ASN ASN B . n 
B 1 338 GLY 338 338 338 GLY GLY B . n 
B 1 339 PRO 339 339 339 PRO PRO B . n 
B 1 340 GLU 340 340 340 GLU GLU B . n 
B 1 341 LEU 341 341 341 LEU LEU B . n 
B 1 342 ILE 342 342 342 ILE ILE B . n 
B 1 343 LEU 343 343 343 LEU LEU B . n 
B 1 344 ARG 344 344 344 ARG ARG B . n 
B 1 345 PHE 345 345 345 PHE PHE B . n 
B 1 346 GLN 346 346 346 GLN GLN B . n 
B 1 347 LYS 347 347 347 LYS LYS B . n 
B 1 348 GLU 348 348 348 GLU GLU B . n 
B 1 349 LEU 349 349 349 LEU LEU B . n 
B 1 350 LYS 350 350 350 LYS LYS B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 ILE 352 352 352 ILE ILE B . n 
B 1 353 GLN 353 353 353 GLN GLN B . n 
B 1 354 TYR 354 354 354 TYR TYR B . n 
B 1 355 GLY 355 355 355 GLY GLY B . n 
B 1 356 ILE 356 356 356 ILE ILE B . n 
B 1 357 ARG 357 357 357 ARG ARG B . n 
B 1 358 ALA 358 358 358 ALA ALA B . n 
B 1 359 HIS 359 359 359 HIS HIS B . n 
B 1 360 GLU 360 360 360 GLU GLU B . n 
B 1 361 TRP 361 361 361 TRP TRP B . n 
B 1 362 MET 362 362 362 MET MET B . n 
B 1 363 PHE 363 363 363 PHE PHE B . n 
B 1 364 PRO 364 364 364 PRO PRO B . n 
B 1 365 VAL 365 365 365 VAL VAL B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6420  ? 
1 MORE         -18   ? 
1 'SSA (A^2)'  27160 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-03-09 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       0.9 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B GLY 199 ? ? O B HOH 469 ? ? 2.13 
2 1 OG1 A THR 180 ? ? O A HOH 431 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A GLU 26  ? ? N  A PRO 27  ? ? CA A PRO 27  ? ? 129.06 119.30 9.76 1.50 Y 
2 1 CA B CYS 168 ? ? CB B CYS 168 ? ? SG B CYS 168 ? ? 121.52 114.20 7.32 1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 2   ? ? 155.19  28.35   
2  1 SER A 3   ? ? -121.92 -76.52  
3  1 LYS A 17  ? ? -150.70 58.66   
4  1 PRO A 24  ? ? -48.18  -1.83   
5  1 GLU A 26  ? ? -36.72  125.50  
6  1 LEU A 28  ? ? 87.73   48.69   
7  1 PHE A 30  ? ? 5.56    -95.30  
8  1 ASP A 45  ? ? -71.65  39.49   
9  1 GLN A 86  ? ? 47.58   22.38   
10 1 ASP A 134 ? ? -152.69 15.98   
11 1 PRO A 151 ? ? -79.08  49.91   
12 1 THR A 236 ? ? -107.40 -68.51  
13 1 VAL A 238 ? ? -106.62 77.30   
14 1 THR A 240 ? ? -72.50  49.16   
15 1 PRO A 267 ? ? -65.06  66.66   
16 1 GLN A 316 ? ? 70.59   -69.44  
17 1 PRO A 333 ? ? -65.79  9.77    
18 1 SER B 2   ? ? 59.26   164.09  
19 1 SER B 4   ? ? -41.28  153.65  
20 1 LYS B 21  ? ? -36.29  157.25  
21 1 PRO B 24  ? ? -48.54  4.57    
22 1 PRO B 27  ? ? -53.58  105.54  
23 1 PHE B 30  ? ? -39.72  138.33  
24 1 ASN B 44  ? ? -159.43 -151.88 
25 1 THR B 236 ? ? -109.85 -69.18  
26 1 VAL B 238 ? ? -106.92 76.92   
27 1 THR B 240 ? ? -70.48  48.75   
28 1 PRO B 267 ? ? -66.72  67.42   
29 1 GLN B 316 ? ? 71.71   -68.40  
30 1 PRO B 333 ? ? -65.99  9.54    
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "PYRIDOXAL-5'-PHOSPHATE"                 PLP 
3 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 
4 water                                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PLP 1   370 370 PLP PLP A . 
D 3 TRS 1   371 371 TRS TRS A . 
E 2 PLP 1   370 370 PLP PLP B . 
F 3 TRS 1   371 371 TRS TRS B . 
G 4 HOH 1   372 1   HOH HOH A . 
G 4 HOH 2   373 2   HOH HOH A . 
G 4 HOH 3   374 6   HOH HOH A . 
G 4 HOH 4   375 8   HOH HOH A . 
G 4 HOH 5   376 9   HOH HOH A . 
G 4 HOH 6   377 12  HOH HOH A . 
G 4 HOH 7   378 15  HOH HOH A . 
G 4 HOH 8   379 17  HOH HOH A . 
G 4 HOH 9   380 20  HOH HOH A . 
G 4 HOH 10  381 22  HOH HOH A . 
G 4 HOH 11  382 25  HOH HOH A . 
G 4 HOH 12  383 27  HOH HOH A . 
G 4 HOH 13  384 30  HOH HOH A . 
G 4 HOH 14  385 33  HOH HOH A . 
G 4 HOH 15  386 35  HOH HOH A . 
G 4 HOH 16  387 36  HOH HOH A . 
G 4 HOH 17  388 41  HOH HOH A . 
G 4 HOH 18  389 42  HOH HOH A . 
G 4 HOH 19  390 43  HOH HOH A . 
G 4 HOH 20  391 44  HOH HOH A . 
G 4 HOH 21  392 45  HOH HOH A . 
G 4 HOH 22  393 46  HOH HOH A . 
G 4 HOH 23  394 48  HOH HOH A . 
G 4 HOH 24  395 49  HOH HOH A . 
G 4 HOH 25  396 51  HOH HOH A . 
G 4 HOH 26  397 53  HOH HOH A . 
G 4 HOH 27  398 54  HOH HOH A . 
G 4 HOH 28  399 56  HOH HOH A . 
G 4 HOH 29  400 57  HOH HOH A . 
G 4 HOH 30  401 58  HOH HOH A . 
G 4 HOH 31  402 64  HOH HOH A . 
G 4 HOH 32  403 65  HOH HOH A . 
G 4 HOH 33  404 66  HOH HOH A . 
G 4 HOH 34  405 67  HOH HOH A . 
G 4 HOH 35  406 71  HOH HOH A . 
G 4 HOH 36  407 72  HOH HOH A . 
G 4 HOH 37  408 73  HOH HOH A . 
G 4 HOH 38  409 76  HOH HOH A . 
G 4 HOH 39  410 78  HOH HOH A . 
G 4 HOH 40  411 79  HOH HOH A . 
G 4 HOH 41  412 81  HOH HOH A . 
G 4 HOH 42  413 82  HOH HOH A . 
G 4 HOH 43  414 84  HOH HOH A . 
G 4 HOH 44  415 85  HOH HOH A . 
G 4 HOH 45  416 87  HOH HOH A . 
G 4 HOH 46  417 91  HOH HOH A . 
G 4 HOH 47  418 95  HOH HOH A . 
G 4 HOH 48  419 97  HOH HOH A . 
G 4 HOH 49  420 98  HOH HOH A . 
G 4 HOH 50  421 100 HOH HOH A . 
G 4 HOH 51  422 103 HOH HOH A . 
G 4 HOH 52  423 104 HOH HOH A . 
G 4 HOH 53  424 105 HOH HOH A . 
G 4 HOH 54  425 107 HOH HOH A . 
G 4 HOH 55  426 110 HOH HOH A . 
G 4 HOH 56  427 112 HOH HOH A . 
G 4 HOH 57  428 113 HOH HOH A . 
G 4 HOH 58  429 117 HOH HOH A . 
G 4 HOH 59  430 119 HOH HOH A . 
G 4 HOH 60  431 120 HOH HOH A . 
G 4 HOH 61  432 121 HOH HOH A . 
G 4 HOH 62  433 122 HOH HOH A . 
G 4 HOH 63  434 123 HOH HOH A . 
G 4 HOH 64  435 124 HOH HOH A . 
G 4 HOH 65  436 125 HOH HOH A . 
G 4 HOH 66  437 126 HOH HOH A . 
G 4 HOH 67  438 127 HOH HOH A . 
G 4 HOH 68  439 129 HOH HOH A . 
G 4 HOH 69  440 130 HOH HOH A . 
G 4 HOH 70  441 133 HOH HOH A . 
G 4 HOH 71  442 134 HOH HOH A . 
G 4 HOH 72  443 138 HOH HOH A . 
G 4 HOH 73  444 140 HOH HOH A . 
G 4 HOH 74  445 144 HOH HOH A . 
G 4 HOH 75  446 146 HOH HOH A . 
G 4 HOH 76  447 147 HOH HOH A . 
G 4 HOH 77  448 149 HOH HOH A . 
G 4 HOH 78  449 151 HOH HOH A . 
G 4 HOH 79  450 154 HOH HOH A . 
G 4 HOH 80  451 159 HOH HOH A . 
G 4 HOH 81  452 161 HOH HOH A . 
G 4 HOH 82  453 162 HOH HOH A . 
G 4 HOH 83  454 164 HOH HOH A . 
G 4 HOH 84  455 165 HOH HOH A . 
G 4 HOH 85  456 169 HOH HOH A . 
G 4 HOH 86  457 172 HOH HOH A . 
G 4 HOH 87  458 173 HOH HOH A . 
G 4 HOH 88  459 176 HOH HOH A . 
G 4 HOH 89  460 177 HOH HOH A . 
G 4 HOH 90  461 179 HOH HOH A . 
G 4 HOH 91  462 180 HOH HOH A . 
G 4 HOH 92  463 182 HOH HOH A . 
G 4 HOH 93  464 185 HOH HOH A . 
G 4 HOH 94  465 188 HOH HOH A . 
G 4 HOH 95  466 190 HOH HOH A . 
G 4 HOH 96  467 195 HOH HOH A . 
G 4 HOH 97  468 197 HOH HOH A . 
G 4 HOH 98  469 199 HOH HOH A . 
G 4 HOH 99  470 200 HOH HOH A . 
G 4 HOH 100 471 203 HOH HOH A . 
G 4 HOH 101 472 205 HOH HOH A . 
G 4 HOH 102 473 206 HOH HOH A . 
G 4 HOH 103 474 207 HOH HOH A . 
G 4 HOH 104 475 208 HOH HOH A . 
G 4 HOH 105 476 209 HOH HOH A . 
G 4 HOH 106 477 210 HOH HOH A . 
G 4 HOH 107 478 212 HOH HOH A . 
H 4 HOH 1   372 3   HOH HOH B . 
H 4 HOH 2   373 4   HOH HOH B . 
H 4 HOH 3   374 5   HOH HOH B . 
H 4 HOH 4   375 7   HOH HOH B . 
H 4 HOH 5   376 10  HOH HOH B . 
H 4 HOH 6   377 11  HOH HOH B . 
H 4 HOH 7   378 13  HOH HOH B . 
H 4 HOH 8   379 14  HOH HOH B . 
H 4 HOH 9   380 16  HOH HOH B . 
H 4 HOH 10  381 18  HOH HOH B . 
H 4 HOH 11  382 19  HOH HOH B . 
H 4 HOH 12  383 21  HOH HOH B . 
H 4 HOH 13  384 23  HOH HOH B . 
H 4 HOH 14  385 24  HOH HOH B . 
H 4 HOH 15  386 26  HOH HOH B . 
H 4 HOH 16  387 28  HOH HOH B . 
H 4 HOH 17  388 29  HOH HOH B . 
H 4 HOH 18  389 31  HOH HOH B . 
H 4 HOH 19  390 32  HOH HOH B . 
H 4 HOH 20  391 34  HOH HOH B . 
H 4 HOH 21  392 37  HOH HOH B . 
H 4 HOH 22  393 38  HOH HOH B . 
H 4 HOH 23  394 39  HOH HOH B . 
H 4 HOH 24  395 40  HOH HOH B . 
H 4 HOH 25  396 47  HOH HOH B . 
H 4 HOH 26  397 50  HOH HOH B . 
H 4 HOH 27  398 52  HOH HOH B . 
H 4 HOH 28  399 55  HOH HOH B . 
H 4 HOH 29  400 59  HOH HOH B . 
H 4 HOH 30  401 60  HOH HOH B . 
H 4 HOH 31  402 61  HOH HOH B . 
H 4 HOH 32  403 62  HOH HOH B . 
H 4 HOH 33  404 63  HOH HOH B . 
H 4 HOH 34  405 68  HOH HOH B . 
H 4 HOH 35  406 69  HOH HOH B . 
H 4 HOH 36  407 70  HOH HOH B . 
H 4 HOH 37  408 74  HOH HOH B . 
H 4 HOH 38  409 75  HOH HOH B . 
H 4 HOH 39  410 77  HOH HOH B . 
H 4 HOH 40  411 80  HOH HOH B . 
H 4 HOH 41  412 83  HOH HOH B . 
H 4 HOH 42  413 86  HOH HOH B . 
H 4 HOH 43  414 88  HOH HOH B . 
H 4 HOH 44  415 89  HOH HOH B . 
H 4 HOH 45  416 90  HOH HOH B . 
H 4 HOH 46  417 92  HOH HOH B . 
H 4 HOH 47  418 93  HOH HOH B . 
H 4 HOH 48  419 94  HOH HOH B . 
H 4 HOH 49  420 96  HOH HOH B . 
H 4 HOH 50  421 99  HOH HOH B . 
H 4 HOH 51  422 101 HOH HOH B . 
H 4 HOH 52  423 102 HOH HOH B . 
H 4 HOH 53  424 106 HOH HOH B . 
H 4 HOH 54  425 108 HOH HOH B . 
H 4 HOH 55  426 109 HOH HOH B . 
H 4 HOH 56  427 111 HOH HOH B . 
H 4 HOH 57  428 114 HOH HOH B . 
H 4 HOH 58  429 115 HOH HOH B . 
H 4 HOH 59  430 116 HOH HOH B . 
H 4 HOH 60  431 118 HOH HOH B . 
H 4 HOH 61  432 128 HOH HOH B . 
H 4 HOH 62  433 131 HOH HOH B . 
H 4 HOH 63  434 132 HOH HOH B . 
H 4 HOH 64  435 135 HOH HOH B . 
H 4 HOH 65  436 136 HOH HOH B . 
H 4 HOH 66  437 137 HOH HOH B . 
H 4 HOH 67  438 139 HOH HOH B . 
H 4 HOH 68  439 141 HOH HOH B . 
H 4 HOH 69  440 142 HOH HOH B . 
H 4 HOH 70  441 143 HOH HOH B . 
H 4 HOH 71  442 145 HOH HOH B . 
H 4 HOH 72  443 148 HOH HOH B . 
H 4 HOH 73  444 150 HOH HOH B . 
H 4 HOH 74  445 152 HOH HOH B . 
H 4 HOH 75  446 153 HOH HOH B . 
H 4 HOH 76  447 155 HOH HOH B . 
H 4 HOH 77  448 156 HOH HOH B . 
H 4 HOH 78  449 157 HOH HOH B . 
H 4 HOH 79  450 158 HOH HOH B . 
H 4 HOH 80  451 160 HOH HOH B . 
H 4 HOH 81  452 163 HOH HOH B . 
H 4 HOH 82  453 166 HOH HOH B . 
H 4 HOH 83  454 167 HOH HOH B . 
H 4 HOH 84  455 168 HOH HOH B . 
H 4 HOH 85  456 170 HOH HOH B . 
H 4 HOH 86  457 171 HOH HOH B . 
H 4 HOH 87  458 174 HOH HOH B . 
H 4 HOH 88  459 175 HOH HOH B . 
H 4 HOH 89  460 178 HOH HOH B . 
H 4 HOH 90  461 181 HOH HOH B . 
H 4 HOH 91  462 183 HOH HOH B . 
H 4 HOH 92  463 184 HOH HOH B . 
H 4 HOH 93  464 186 HOH HOH B . 
H 4 HOH 94  465 187 HOH HOH B . 
H 4 HOH 95  466 189 HOH HOH B . 
H 4 HOH 96  467 191 HOH HOH B . 
H 4 HOH 97  468 192 HOH HOH B . 
H 4 HOH 98  469 193 HOH HOH B . 
H 4 HOH 99  470 194 HOH HOH B . 
H 4 HOH 100 471 196 HOH HOH B . 
H 4 HOH 101 472 198 HOH HOH B . 
H 4 HOH 102 473 201 HOH HOH B . 
H 4 HOH 103 474 202 HOH HOH B . 
H 4 HOH 104 475 204 HOH HOH B . 
H 4 HOH 105 476 211 HOH HOH B . 
#