data_1EN5
# 
_entry.id   1EN5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EN5         
RCSB  RCSB010741   
WWPDB D_1000010741 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1VEW 'native crystal structure'                                                          unspecified 
PDB 1MMM 'iron-substituted native crystal structure'                                         unspecified 
PDB 1EN4 'E. coli manganese superoxide dismutase active-site Q146H mutant crystal structure' unspecified 
PDB 1EN6 'E. coli manganese superoxide dismutase active-site Q146L mutant crystal structure' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EN5 
_pdbx_database_status.recvd_initial_deposition_date   2000-03-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Edwards, R.A.'   1 
'Whittaker, M.M.' 2 
'Baker, E.N.'     3 
'Whittaker, J.W.' 4 
'Jameson, G.B.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Outer sphere mutations perturb metal reactivity in manganese superoxide dismutase.' Biochemistry       40 15   27   2001 
BICHAW US 0006-2960 0033 ? 11141052 10.1021/bi0018943     
1       
'Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.' 
Biochemistry       40 4622 4632 2001 BICHAW US 0006-2960 0033 ? ?        10.1021/bi002403h     
2       'Crystal Structure of Escherichia coli Manganese Superoxide Dismutase at 2.1 A Resolution' J.BIOL.INORG.CHEM. 3  161  171  
1998 JJBCFA GW 0949-8257 2154 ? ?        10.1007/s007750050217 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Edwards, R.A.'   1  
primary 'Whittaker, M.M.' 2  
primary 'Whittaker, J.W.' 3  
primary 'Baker, E.N.'     4  
primary 'Jameson, G.B.'   5  
1       'Edwards, R.A.'   6  
1       'Whittaker, M.M.' 7  
1       'Whittaker, J.W.' 8  
1       'Baker, E.N.'     9  
1       'Jameson, G.B.'   10 
2       'Edwards, R.A.'   11 
2       'Baker, H.M.'     12 
2       'Whittaker, M.M.' 13 
2       'Whittaker, J.W.' 14 
2       'Jameson, G.B.'   15 
2       'Baker, E.N.'     16 
# 
_cell.entry_id           1EN5 
_cell.length_a           100.845 
_cell.length_b           108.893 
_cell.length_c           182.882 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EN5 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MANGANESE SUPEROXIDE DISMUTASE' 22980.879 4   1.15.1.1 Y34F ? ? 
2 non-polymer syn 'MANGANESE (II) ION'             54.938    4   ?        ?    ? ? 
3 water       nat water                            18.015    309 ?        ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTFVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTFVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   TYR n 
1 3   THR n 
1 4   LEU n 
1 5   PRO n 
1 6   SER n 
1 7   LEU n 
1 8   PRO n 
1 9   TYR n 
1 10  ALA n 
1 11  TYR n 
1 12  ASP n 
1 13  ALA n 
1 14  LEU n 
1 15  GLU n 
1 16  PRO n 
1 17  HIS n 
1 18  PHE n 
1 19  ASP n 
1 20  LYS n 
1 21  GLN n 
1 22  THR n 
1 23  MET n 
1 24  GLU n 
1 25  ILE n 
1 26  HIS n 
1 27  HIS n 
1 28  THR n 
1 29  LYS n 
1 30  HIS n 
1 31  HIS n 
1 32  GLN n 
1 33  THR n 
1 34  PHE n 
1 35  VAL n 
1 36  ASN n 
1 37  ASN n 
1 38  ALA n 
1 39  ASN n 
1 40  ALA n 
1 41  ALA n 
1 42  LEU n 
1 43  GLU n 
1 44  SER n 
1 45  LEU n 
1 46  PRO n 
1 47  GLU n 
1 48  PHE n 
1 49  ALA n 
1 50  ASN n 
1 51  LEU n 
1 52  PRO n 
1 53  VAL n 
1 54  GLU n 
1 55  GLU n 
1 56  LEU n 
1 57  ILE n 
1 58  THR n 
1 59  LYS n 
1 60  LEU n 
1 61  ASP n 
1 62  GLN n 
1 63  LEU n 
1 64  PRO n 
1 65  ALA n 
1 66  ASP n 
1 67  LYS n 
1 68  LYS n 
1 69  THR n 
1 70  VAL n 
1 71  LEU n 
1 72  ARG n 
1 73  ASN n 
1 74  ASN n 
1 75  ALA n 
1 76  GLY n 
1 77  GLY n 
1 78  HIS n 
1 79  ALA n 
1 80  ASN n 
1 81  HIS n 
1 82  SER n 
1 83  LEU n 
1 84  PHE n 
1 85  TRP n 
1 86  LYS n 
1 87  GLY n 
1 88  LEU n 
1 89  LYS n 
1 90  LYS n 
1 91  GLY n 
1 92  THR n 
1 93  THR n 
1 94  LEU n 
1 95  GLN n 
1 96  GLY n 
1 97  ASP n 
1 98  LEU n 
1 99  LYS n 
1 100 ALA n 
1 101 ALA n 
1 102 ILE n 
1 103 GLU n 
1 104 ARG n 
1 105 ASP n 
1 106 PHE n 
1 107 GLY n 
1 108 SER n 
1 109 VAL n 
1 110 ASP n 
1 111 ASN n 
1 112 PHE n 
1 113 LYS n 
1 114 ALA n 
1 115 GLU n 
1 116 PHE n 
1 117 GLU n 
1 118 LYS n 
1 119 ALA n 
1 120 ALA n 
1 121 ALA n 
1 122 SER n 
1 123 ARG n 
1 124 PHE n 
1 125 GLY n 
1 126 SER n 
1 127 GLY n 
1 128 TRP n 
1 129 ALA n 
1 130 TRP n 
1 131 LEU n 
1 132 VAL n 
1 133 LEU n 
1 134 LYS n 
1 135 GLY n 
1 136 ASP n 
1 137 LYS n 
1 138 LEU n 
1 139 ALA n 
1 140 VAL n 
1 141 VAL n 
1 142 SER n 
1 143 THR n 
1 144 ALA n 
1 145 ASN n 
1 146 GLN n 
1 147 ASP n 
1 148 SER n 
1 149 PRO n 
1 150 LEU n 
1 151 MET n 
1 152 GLY n 
1 153 GLU n 
1 154 ALA n 
1 155 ILE n 
1 156 SER n 
1 157 GLY n 
1 158 ALA n 
1 159 SER n 
1 160 GLY n 
1 161 PHE n 
1 162 PRO n 
1 163 ILE n 
1 164 MET n 
1 165 GLY n 
1 166 LEU n 
1 167 ASP n 
1 168 VAL n 
1 169 TRP n 
1 170 GLU n 
1 171 HIS n 
1 172 ALA n 
1 173 TYR n 
1 174 TYR n 
1 175 LEU n 
1 176 LYS n 
1 177 PHE n 
1 178 GLN n 
1 179 ASN n 
1 180 ARG n 
1 181 ARG n 
1 182 PRO n 
1 183 ASP n 
1 184 TYR n 
1 185 ILE n 
1 186 LYS n 
1 187 GLU n 
1 188 PHE n 
1 189 TRP n 
1 190 ASN n 
1 191 VAL n 
1 192 VAL n 
1 193 ASN n 
1 194 TRP n 
1 195 ASP n 
1 196 GLU n 
1 197 ALA n 
1 198 ALA n 
1 199 ALA n 
1 200 ARG n 
1 201 PHE n 
1 202 ALA n 
1 203 ALA n 
1 204 LYS n 
1 205 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PDT1-5 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    SODM_ECOLI 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00448 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EN5 A 1 ? 205 ? P00448 1 ? 205 ? 1 205 
2 1 1EN5 B 1 ? 205 ? P00448 1 ? 205 ? 1 205 
3 1 1EN5 C 1 ? 205 ? P00448 1 ? 205 ? 1 205 
4 1 1EN5 D 1 ? 205 ? P00448 1 ? 205 ? 1 205 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1EN5 PHE A 34 ? UNP P00448 TYR 34 ENGINEERED 34 1 
2 1EN5 PHE B 34 ? UNP P00448 TYR 34 ENGINEERED 34 2 
3 1EN5 PHE C 34 ? UNP P00448 TYR 34 ENGINEERED 34 3 
4 1EN5 PHE D 34 ? UNP P00448 TYR 34 ENGINEERED 34 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EN5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   54.94 
_exptl_crystal.density_Matthews      2.73 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.3 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'20% w/v PEG 6000, 0.1 M bicine, 25 mM sodium azide, pH 8.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1997-03-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EN5 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             38.85 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   43949 
_reflns.number_all                   43949 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            0.0870000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.2 
_reflns.B_iso_Wilson_estimate        16.7 
_reflns.pdbx_redundancy              5.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.33 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   79.2 
_reflns_shell.Rmerge_I_obs           0.2980000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.number_unique_all      1198 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1EN5 
_refine.ls_number_reflns_obs                     43928 
_refine.ls_number_reflns_all                     43928 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             40.0 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    97.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1670000 
_refine.ls_R_factor_R_free                       0.1950000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2220 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -3.882 
_refine.aniso_B[2][2]                            -0.303 
_refine.aniso_B[3][3]                            4.185 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6508 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             305 
_refine_hist.number_atoms_total               6821 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        40.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.05279 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.20524 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.1    ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.76    ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.187   1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.979   2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.036   2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.084   2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1EN5 
_struct.title                     'CRYSTAL STRUCTURE ANALYSIS OF THE E. COLI MANGANESE SUPEROXIDE DISMUTASE Y34F MUTANT' 
_struct.pdbx_descriptor           
'CRYSTAL STRUCTURE ANALYSIS OF THE E. COLI MANGANESE SUPEROXIDE DISMUTASE Y34F MUTANT (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EN5 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'proton shuttle, Y34F, mutant, manganese superoxide dismutase, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 19  ? LYS A 29  ? ASP A 19  LYS A 29  1 ? 11 
HELX_P HELX_P2  2  LYS A 29  ? GLU A 43  ? LYS A 29  GLU A 43  1 ? 15 
HELX_P HELX_P3  3  PRO A 52  ? ILE A 57  ? PRO A 52  ILE A 57  1 ? 6  
HELX_P HELX_P4  4  THR A 58  ? LEU A 63  ? THR A 58  LEU A 63  5 ? 6  
HELX_P HELX_P5  5  PRO A 64  ? GLY A 87  ? PRO A 64  GLY A 87  1 ? 24 
HELX_P HELX_P6  6  GLN A 95  ? GLY A 107 ? GLN A 95  GLY A 107 1 ? 13 
HELX_P HELX_P7  7  SER A 108 ? ARG A 123 ? SER A 108 ARG A 123 1 ? 16 
HELX_P HELX_P8  8  SER A 148 ? MET A 151 ? SER A 148 MET A 151 5 ? 4  
HELX_P HELX_P9  9  GLY A 152 ? GLY A 157 ? GLY A 152 GLY A 157 1 ? 6  
HELX_P HELX_P10 10 TRP A 169 ? ALA A 172 ? TRP A 169 ALA A 172 5 ? 4  
HELX_P HELX_P11 11 TYR A 173 ? GLN A 178 ? TYR A 173 GLN A 178 1 ? 6  
HELX_P HELX_P12 12 ARG A 180 ? TRP A 189 ? ARG A 180 TRP A 189 1 ? 10 
HELX_P HELX_P13 13 ASN A 193 ? LYS A 204 ? ASN A 193 LYS A 204 1 ? 12 
HELX_P HELX_P14 14 ASP B 19  ? LYS B 29  ? ASP B 19  LYS B 29  1 ? 11 
HELX_P HELX_P15 15 LYS B 29  ? GLU B 43  ? LYS B 29  GLU B 43  1 ? 15 
HELX_P HELX_P16 16 LEU B 45  ? ASN B 50  ? LEU B 45  ASN B 50  1 ? 6  
HELX_P HELX_P17 17 PRO B 52  ? ILE B 57  ? PRO B 52  ILE B 57  1 ? 6  
HELX_P HELX_P18 18 THR B 58  ? LEU B 63  ? THR B 58  LEU B 63  5 ? 6  
HELX_P HELX_P19 19 PRO B 64  ? GLY B 87  ? PRO B 64  GLY B 87  1 ? 24 
HELX_P HELX_P20 20 GLN B 95  ? GLY B 107 ? GLN B 95  GLY B 107 1 ? 13 
HELX_P HELX_P21 21 SER B 108 ? ARG B 123 ? SER B 108 ARG B 123 1 ? 16 
HELX_P HELX_P22 22 SER B 148 ? MET B 151 ? SER B 148 MET B 151 5 ? 4  
HELX_P HELX_P23 23 GLY B 152 ? GLY B 157 ? GLY B 152 GLY B 157 1 ? 6  
HELX_P HELX_P24 24 TRP B 169 ? ALA B 172 ? TRP B 169 ALA B 172 5 ? 4  
HELX_P HELX_P25 25 TYR B 173 ? GLN B 178 ? TYR B 173 GLN B 178 1 ? 6  
HELX_P HELX_P26 26 ARG B 180 ? TRP B 189 ? ARG B 180 TRP B 189 1 ? 10 
HELX_P HELX_P27 27 ASN B 193 ? LYS B 204 ? ASN B 193 LYS B 204 1 ? 12 
HELX_P HELX_P28 28 ASP C 19  ? LYS C 29  ? ASP C 19  LYS C 29  1 ? 11 
HELX_P HELX_P29 29 LYS C 29  ? GLU C 43  ? LYS C 29  GLU C 43  1 ? 15 
HELX_P HELX_P30 30 LEU C 45  ? ASN C 50  ? LEU C 45  ASN C 50  1 ? 6  
HELX_P HELX_P31 31 PRO C 52  ? ILE C 57  ? PRO C 52  ILE C 57  1 ? 6  
HELX_P HELX_P32 32 THR C 58  ? LEU C 63  ? THR C 58  LEU C 63  5 ? 6  
HELX_P HELX_P33 33 PRO C 64  ? GLY C 87  ? PRO C 64  GLY C 87  1 ? 24 
HELX_P HELX_P34 34 GLN C 95  ? GLY C 107 ? GLN C 95  GLY C 107 1 ? 13 
HELX_P HELX_P35 35 SER C 108 ? ARG C 123 ? SER C 108 ARG C 123 1 ? 16 
HELX_P HELX_P36 36 SER C 148 ? MET C 151 ? SER C 148 MET C 151 5 ? 4  
HELX_P HELX_P37 37 GLY C 152 ? GLY C 157 ? GLY C 152 GLY C 157 1 ? 6  
HELX_P HELX_P38 38 TRP C 169 ? ALA C 172 ? TRP C 169 ALA C 172 5 ? 4  
HELX_P HELX_P39 39 TYR C 173 ? GLN C 178 ? TYR C 173 GLN C 178 1 ? 6  
HELX_P HELX_P40 40 ARG C 180 ? TRP C 189 ? ARG C 180 TRP C 189 1 ? 10 
HELX_P HELX_P41 41 ASN C 193 ? LYS C 204 ? ASN C 193 LYS C 204 1 ? 12 
HELX_P HELX_P42 42 ASP D 19  ? LYS D 29  ? ASP D 19  LYS D 29  1 ? 11 
HELX_P HELX_P43 43 LYS D 29  ? GLU D 43  ? LYS D 29  GLU D 43  1 ? 15 
HELX_P HELX_P44 44 LEU D 45  ? ASN D 50  ? LEU D 45  ASN D 50  1 ? 6  
HELX_P HELX_P45 45 PRO D 52  ? ILE D 57  ? PRO D 52  ILE D 57  1 ? 6  
HELX_P HELX_P46 46 THR D 58  ? LEU D 63  ? THR D 58  LEU D 63  5 ? 6  
HELX_P HELX_P47 47 PRO D 64  ? GLY D 87  ? PRO D 64  GLY D 87  1 ? 24 
HELX_P HELX_P48 48 GLN D 95  ? GLY D 107 ? GLN D 95  GLY D 107 1 ? 13 
HELX_P HELX_P49 49 SER D 108 ? ARG D 123 ? SER D 108 ARG D 123 1 ? 16 
HELX_P HELX_P50 50 SER D 148 ? MET D 151 ? SER D 148 MET D 151 5 ? 4  
HELX_P HELX_P51 51 GLY D 152 ? GLY D 157 ? GLY D 152 GLY D 157 1 ? 6  
HELX_P HELX_P52 52 TRP D 169 ? ALA D 172 ? TRP D 169 ALA D 172 5 ? 4  
HELX_P HELX_P53 53 TYR D 173 ? GLN D 178 ? TYR D 173 GLN D 178 1 ? 6  
HELX_P HELX_P54 54 ARG D 180 ? TRP D 189 ? ARG D 180 TRP D 189 1 ? 10 
HELX_P HELX_P55 55 ASN D 193 ? LYS D 204 ? ASN D 193 LYS D 204 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MN . MN ? ? ? 1_555 I HOH .   O   ? ? A MN 501 A HOH 584 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc2  metalc ? ? F MN . MN ? ? ? 1_555 J HOH .   O   ? ? B MN 502 B HOH 567 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc3  metalc ? ? G MN . MN ? ? ? 1_555 K HOH .   O   ? ? C MN 503 C HOH 583 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc4  metalc ? ? H MN . MN ? ? ? 1_555 L HOH .   O   ? ? D MN 504 D HOH 585 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc5  metalc ? ? E MN . MN ? ? ? 1_555 A HIS 171 NE2 ? ? A MN 501 A HIS 171 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc6  metalc ? ? E MN . MN ? ? ? 1_555 A HIS 26  NE2 ? ? A MN 501 A HIS 26  1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc7  metalc ? ? E MN . MN ? ? ? 1_555 A HIS 81  NE2 ? ? A MN 501 A HIS 81  1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc8  metalc ? ? E MN . MN ? ? ? 1_555 A ASP 167 OD2 ? ? A MN 501 A ASP 167 1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc9  metalc ? ? F MN . MN ? ? ? 1_555 B HIS 26  NE2 ? ? B MN 502 B HIS 26  1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc10 metalc ? ? F MN . MN ? ? ? 1_555 B HIS 171 NE2 ? ? B MN 502 B HIS 171 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc11 metalc ? ? F MN . MN ? ? ? 1_555 B HIS 81  NE2 ? ? B MN 502 B HIS 81  1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc12 metalc ? ? F MN . MN ? ? ? 1_555 B ASP 167 OD2 ? ? B MN 502 B ASP 167 1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc13 metalc ? ? G MN . MN ? ? ? 1_555 C HIS 81  NE2 ? ? C MN 503 C HIS 81  1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc14 metalc ? ? G MN . MN ? ? ? 1_555 C HIS 26  NE2 ? ? C MN 503 C HIS 26  1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc15 metalc ? ? G MN . MN ? ? ? 1_555 C ASP 167 OD2 ? ? C MN 503 C ASP 167 1_555 ? ? ? ? ? ? ? 1.965 ? 
metalc16 metalc ? ? G MN . MN ? ? ? 1_555 C HIS 171 NE2 ? ? C MN 503 C HIS 171 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc17 metalc ? ? H MN . MN ? ? ? 1_555 D ASP 167 OD2 ? ? D MN 504 D ASP 167 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc18 metalc ? ? H MN . MN ? ? ? 1_555 D HIS 26  NE2 ? ? D MN 504 D HIS 26  1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc19 metalc ? ? H MN . MN ? ? ? 1_555 D HIS 171 NE2 ? ? D MN 504 D HIS 171 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc20 metalc ? ? H MN . MN ? ? ? 1_555 D HIS 81  NE2 ? ? D MN 504 D HIS 81  1_555 ? ? ? ? ? ? ? 2.176 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 15 A . ? GLU 15 A PRO 16 A ? PRO 16 A 1 0.15  
2 GLU 15 B . ? GLU 15 B PRO 16 B ? PRO 16 B 1 -0.05 
3 GLU 15 C . ? GLU 15 C PRO 16 C ? PRO 16 C 1 0.17  
4 GLU 15 D . ? GLU 15 D PRO 16 D ? PRO 16 D 1 0.11  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 137 ? ALA A 144 ? LYS A 137 ALA A 144 
A 2 GLY A 127 ? LYS A 134 ? GLY A 127 LYS A 134 
A 3 PHE A 161 ? ASP A 167 ? PHE A 161 ASP A 167 
B 1 LYS B 137 ? ALA B 144 ? LYS B 137 ALA B 144 
B 2 GLY B 127 ? LYS B 134 ? GLY B 127 LYS B 134 
B 3 PHE B 161 ? ASP B 167 ? PHE B 161 ASP B 167 
C 1 LYS C 137 ? ALA C 144 ? LYS C 137 ALA C 144 
C 2 GLY C 127 ? LYS C 134 ? GLY C 127 LYS C 134 
C 3 PHE C 161 ? ASP C 167 ? PHE C 161 ASP C 167 
D 1 LYS D 137 ? ALA D 144 ? LYS D 137 ALA D 144 
D 2 GLY D 127 ? LYS D 134 ? GLY D 127 LYS D 134 
D 3 PHE D 161 ? ASP D 167 ? PHE D 161 ASP D 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 143 ? O THR A 143 N TRP A 128 ? N TRP A 128 
A 2 3 O LEU A 133 ? O LEU A 133 N PHE A 161 ? N PHE A 161 
B 1 2 O THR B 143 ? O THR B 143 N TRP B 128 ? N TRP B 128 
B 2 3 O LEU B 133 ? O LEU B 133 N PHE B 161 ? N PHE B 161 
C 1 2 O THR C 143 ? O THR C 143 N TRP C 128 ? N TRP C 128 
C 2 3 N LEU C 133 ? N LEU C 133 O PHE C 161 ? O PHE C 161 
D 1 2 O THR D 143 ? O THR D 143 N TRP D 128 ? N TRP D 128 
D 2 3 O LEU D 133 ? O LEU D 133 N PHE D 161 ? N PHE D 161 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN A 501' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN B 502' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN C 503' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN D 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 26  ? HIS A 26  . ? 1_555 ? 
2  AC1 5 HIS A 81  ? HIS A 81  . ? 1_555 ? 
3  AC1 5 ASP A 167 ? ASP A 167 . ? 1_555 ? 
4  AC1 5 HIS A 171 ? HIS A 171 . ? 1_555 ? 
5  AC1 5 HOH I .   ? HOH A 584 . ? 1_555 ? 
6  AC2 5 HIS B 26  ? HIS B 26  . ? 1_555 ? 
7  AC2 5 HIS B 81  ? HIS B 81  . ? 1_555 ? 
8  AC2 5 ASP B 167 ? ASP B 167 . ? 1_555 ? 
9  AC2 5 HIS B 171 ? HIS B 171 . ? 1_555 ? 
10 AC2 5 HOH J .   ? HOH B 567 . ? 1_555 ? 
11 AC3 5 HIS C 26  ? HIS C 26  . ? 1_555 ? 
12 AC3 5 HIS C 81  ? HIS C 81  . ? 1_555 ? 
13 AC3 5 ASP C 167 ? ASP C 167 . ? 1_555 ? 
14 AC3 5 HIS C 171 ? HIS C 171 . ? 1_555 ? 
15 AC3 5 HOH K .   ? HOH C 583 . ? 1_555 ? 
16 AC4 5 HIS D 26  ? HIS D 26  . ? 1_555 ? 
17 AC4 5 HIS D 81  ? HIS D 81  . ? 1_555 ? 
18 AC4 5 ASP D 167 ? ASP D 167 . ? 1_555 ? 
19 AC4 5 HIS D 171 ? HIS D 171 . ? 1_555 ? 
20 AC4 5 HOH L .   ? HOH D 585 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EN5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EN5 
_atom_sites.fract_transf_matrix[1][1]   0.009916 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009183 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005468 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? 41.044  20.921  -10.240 1.00 28.71 ? 1   SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 39.895  20.737  -9.309  1.00 27.07 ? 1   SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 40.067  19.495  -8.436  1.00 25.14 ? 1   SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? 40.704  18.518  -8.834  1.00 24.06 ? 1   SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 38.588  20.619  -10.102 1.00 29.50 ? 1   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 38.226  21.855  -10.699 1.00 33.21 ? 1   SER A OG  1 
ATOM   7    N  N   . TYR A 1 2   ? 39.503  19.544  -7.236  1.00 21.27 ? 2   TYR A N   1 
ATOM   8    C  CA  . TYR A 1 2   ? 39.575  18.410  -6.337  1.00 17.73 ? 2   TYR A CA  1 
ATOM   9    C  C   . TYR A 1 2   ? 38.380  17.533  -6.659  1.00 16.34 ? 2   TYR A C   1 
ATOM   10   O  O   . TYR A 1 2   ? 37.436  17.974  -7.311  1.00 14.61 ? 2   TYR A O   1 
ATOM   11   C  CB  . TYR A 1 2   ? 39.478  18.857  -4.880  1.00 18.77 ? 2   TYR A CB  1 
ATOM   12   C  CG  . TYR A 1 2   ? 40.528  19.849  -4.449  1.00 19.77 ? 2   TYR A CG  1 
ATOM   13   C  CD1 . TYR A 1 2   ? 41.866  19.675  -4.801  1.00 21.23 ? 2   TYR A CD1 1 
ATOM   14   C  CD2 . TYR A 1 2   ? 40.194  20.936  -3.643  1.00 21.92 ? 2   TYR A CD2 1 
ATOM   15   C  CE1 . TYR A 1 2   ? 42.849  20.559  -4.358  1.00 23.20 ? 2   TYR A CE1 1 
ATOM   16   C  CE2 . TYR A 1 2   ? 41.169  21.826  -3.190  1.00 23.77 ? 2   TYR A CE2 1 
ATOM   17   C  CZ  . TYR A 1 2   ? 42.494  21.629  -3.552  1.00 25.26 ? 2   TYR A CZ  1 
ATOM   18   O  OH  . TYR A 1 2   ? 43.466  22.493  -3.100  1.00 30.82 ? 2   TYR A OH  1 
ATOM   19   N  N   . THR A 1 3   ? 38.433  16.284  -6.218  1.00 15.83 ? 3   THR A N   1 
ATOM   20   C  CA  . THR A 1 3   ? 37.326  15.364  -6.419  1.00 17.23 ? 3   THR A CA  1 
ATOM   21   C  C   . THR A 1 3   ? 37.184  14.594  -5.121  1.00 16.05 ? 3   THR A C   1 
ATOM   22   O  O   . THR A 1 3   ? 38.143  14.473  -4.365  1.00 16.12 ? 3   THR A O   1 
ATOM   23   C  CB  . THR A 1 3   ? 37.587  14.360  -7.559  1.00 17.91 ? 3   THR A CB  1 
ATOM   24   O  OG1 . THR A 1 3   ? 38.819  13.672  -7.315  1.00 18.19 ? 3   THR A OG1 1 
ATOM   25   C  CG2 . THR A 1 3   ? 37.648  15.071  -8.897  1.00 18.20 ? 3   THR A CG2 1 
ATOM   26   N  N   . LEU A 1 4   ? 35.985  14.093  -4.855  1.00 15.31 ? 4   LEU A N   1 
ATOM   27   C  CA  . LEU A 1 4   ? 35.760  13.329  -3.644  1.00 14.84 ? 4   LEU A CA  1 
ATOM   28   C  C   . LEU A 1 4   ? 36.508  12.013  -3.793  1.00 15.90 ? 4   LEU A C   1 
ATOM   29   O  O   . LEU A 1 4   ? 36.269  11.263  -4.736  1.00 17.04 ? 4   LEU A O   1 
ATOM   30   C  CB  . LEU A 1 4   ? 34.272  13.047  -3.461  1.00 11.70 ? 4   LEU A CB  1 
ATOM   31   C  CG  . LEU A 1 4   ? 33.912  12.275  -2.189  1.00 12.46 ? 4   LEU A CG  1 
ATOM   32   C  CD1 . LEU A 1 4   ? 34.062  13.181  -0.973  1.00 9.80  ? 4   LEU A CD1 1 
ATOM   33   C  CD2 . LEU A 1 4   ? 32.479  11.760  -2.302  1.00 10.77 ? 4   LEU A CD2 1 
ATOM   34   N  N   . PRO A 1 5   ? 37.448  11.727  -2.886  1.00 15.87 ? 5   PRO A N   1 
ATOM   35   C  CA  . PRO A 1 5   ? 38.161  10.456  -3.027  1.00 17.88 ? 5   PRO A CA  1 
ATOM   36   C  C   . PRO A 1 5   ? 37.227  9.309   -2.630  1.00 18.95 ? 5   PRO A C   1 
ATOM   37   O  O   . PRO A 1 5   ? 36.376  9.468   -1.753  1.00 20.42 ? 5   PRO A O   1 
ATOM   38   C  CB  . PRO A 1 5   ? 39.343  10.618  -2.071  1.00 16.49 ? 5   PRO A CB  1 
ATOM   39   C  CG  . PRO A 1 5   ? 38.778  11.481  -0.989  1.00 17.08 ? 5   PRO A CG  1 
ATOM   40   C  CD  . PRO A 1 5   ? 37.986  12.519  -1.766  1.00 15.68 ? 5   PRO A CD  1 
ATOM   41   N  N   . SER A 1 6   ? 37.356  8.164   -3.285  1.00 18.34 ? 6   SER A N   1 
ATOM   42   C  CA  . SER A 1 6   ? 36.508  7.031   -2.936  1.00 20.34 ? 6   SER A CA  1 
ATOM   43   C  C   . SER A 1 6   ? 37.079  6.372   -1.683  1.00 18.21 ? 6   SER A C   1 
ATOM   44   O  O   . SER A 1 6   ? 38.294  6.387   -1.466  1.00 16.26 ? 6   SER A O   1 
ATOM   45   C  CB  . SER A 1 6   ? 36.460  6.032   -4.091  1.00 22.77 ? 6   SER A CB  1 
ATOM   46   O  OG  . SER A 1 6   ? 37.773  5.659   -4.455  1.00 26.61 ? 6   SER A OG  1 
ATOM   47   N  N   . LEU A 1 7   ? 36.208  5.810   -0.850  1.00 18.91 ? 7   LEU A N   1 
ATOM   48   C  CA  . LEU A 1 7   ? 36.654  5.158   0.380   1.00 19.57 ? 7   LEU A CA  1 
ATOM   49   C  C   . LEU A 1 7   ? 37.482  3.914   0.095   1.00 19.22 ? 7   LEU A C   1 
ATOM   50   O  O   . LEU A 1 7   ? 37.256  3.226   -0.897  1.00 20.64 ? 7   LEU A O   1 
ATOM   51   C  CB  . LEU A 1 7   ? 35.459  4.765   1.253   1.00 19.46 ? 7   LEU A CB  1 
ATOM   52   C  CG  . LEU A 1 7   ? 34.627  5.879   1.887   1.00 20.58 ? 7   LEU A CG  1 
ATOM   53   C  CD1 . LEU A 1 7   ? 33.586  5.255   2.798   1.00 16.89 ? 7   LEU A CD1 1 
ATOM   54   C  CD2 . LEU A 1 7   ? 35.524  6.824   2.678   1.00 20.88 ? 7   LEU A CD2 1 
ATOM   55   N  N   . PRO A 1 8   ? 38.455  3.609   0.971   1.00 19.64 ? 8   PRO A N   1 
ATOM   56   C  CA  . PRO A 1 8   ? 39.339  2.441   0.842   1.00 18.15 ? 8   PRO A CA  1 
ATOM   57   C  C   . PRO A 1 8   ? 38.627  1.161   1.314   1.00 17.59 ? 8   PRO A C   1 
ATOM   58   O  O   . PRO A 1 8   ? 39.261  0.128   1.521   1.00 17.42 ? 8   PRO A O   1 
ATOM   59   C  CB  . PRO A 1 8   ? 40.523  2.782   1.761   1.00 18.47 ? 8   PRO A CB  1 
ATOM   60   C  CG  . PRO A 1 8   ? 40.329  4.238   2.139   1.00 19.17 ? 8   PRO A CG  1 
ATOM   61   C  CD  . PRO A 1 8   ? 38.843  4.420   2.135   1.00 19.17 ? 8   PRO A CD  1 
ATOM   62   N  N   . TYR A 1 9   ? 37.312  1.244   1.483   1.00 15.82 ? 9   TYR A N   1 
ATOM   63   C  CA  . TYR A 1 9   ? 36.511  0.121   1.953   1.00 15.27 ? 9   TYR A CA  1 
ATOM   64   C  C   . TYR A 1 9   ? 35.039  0.474   1.768   1.00 16.48 ? 9   TYR A C   1 
ATOM   65   O  O   . TYR A 1 9   ? 34.706  1.608   1.408   1.00 17.84 ? 9   TYR A O   1 
ATOM   66   C  CB  . TYR A 1 9   ? 36.812  -0.139  3.438   1.00 15.34 ? 9   TYR A CB  1 
ATOM   67   C  CG  . TYR A 1 9   ? 36.915  1.132   4.260   1.00 15.12 ? 9   TYR A CG  1 
ATOM   68   C  CD1 . TYR A 1 9   ? 35.782  1.900   4.545   1.00 16.27 ? 9   TYR A CD1 1 
ATOM   69   C  CD2 . TYR A 1 9   ? 38.158  1.613   4.682   1.00 16.44 ? 9   TYR A CD2 1 
ATOM   70   C  CE1 . TYR A 1 9   ? 35.886  3.123   5.227   1.00 16.20 ? 9   TYR A CE1 1 
ATOM   71   C  CE2 . TYR A 1 9   ? 38.277  2.833   5.362   1.00 14.94 ? 9   TYR A CE2 1 
ATOM   72   C  CZ  . TYR A 1 9   ? 37.137  3.584   5.625   1.00 16.91 ? 9   TYR A CZ  1 
ATOM   73   O  OH  . TYR A 1 9   ? 37.252  4.808   6.244   1.00 16.37 ? 9   TYR A OH  1 
ATOM   74   N  N   . ALA A 1 10  ? 34.165  -0.495  2.017   1.00 15.59 ? 10  ALA A N   1 
ATOM   75   C  CA  . ALA A 1 10  ? 32.727  -0.297  1.888   1.00 14.46 ? 10  ALA A CA  1 
ATOM   76   C  C   . ALA A 1 10  ? 32.202  0.482   3.088   1.00 14.54 ? 10  ALA A C   1 
ATOM   77   O  O   . ALA A 1 10  ? 32.816  0.477   4.154   1.00 15.61 ? 10  ALA A O   1 
ATOM   78   C  CB  . ALA A 1 10  ? 32.023  -1.647  1.792   1.00 15.32 ? 10  ALA A CB  1 
ATOM   79   N  N   . TYR A 1 11  ? 31.059  1.133   2.911   1.00 13.72 ? 11  TYR A N   1 
ATOM   80   C  CA  . TYR A 1 11  ? 30.448  1.937   3.963   1.00 16.36 ? 11  TYR A CA  1 
ATOM   81   C  C   . TYR A 1 11  ? 30.096  1.196   5.255   1.00 17.33 ? 11  TYR A C   1 
ATOM   82   O  O   . TYR A 1 11  ? 29.931  1.818   6.306   1.00 16.60 ? 11  TYR A O   1 
ATOM   83   C  CB  . TYR A 1 11  ? 29.197  2.626   3.416   1.00 16.89 ? 11  TYR A CB  1 
ATOM   84   C  CG  . TYR A 1 11  ? 29.509  3.699   2.398   1.00 19.90 ? 11  TYR A CG  1 
ATOM   85   C  CD1 . TYR A 1 11  ? 30.149  4.880   2.776   1.00 20.36 ? 11  TYR A CD1 1 
ATOM   86   C  CD2 . TYR A 1 11  ? 29.194  3.524   1.053   1.00 20.70 ? 11  TYR A CD2 1 
ATOM   87   C  CE1 . TYR A 1 11  ? 30.470  5.864   1.838   1.00 22.42 ? 11  TYR A CE1 1 
ATOM   88   C  CE2 . TYR A 1 11  ? 29.512  4.503   0.104   1.00 23.87 ? 11  TYR A CE2 1 
ATOM   89   C  CZ  . TYR A 1 11  ? 30.151  5.670   0.505   1.00 22.30 ? 11  TYR A CZ  1 
ATOM   90   O  OH  . TYR A 1 11  ? 30.474  6.631   -0.426  1.00 21.26 ? 11  TYR A OH  1 
ATOM   91   N  N   . ASP A 1 12  ? 29.980  -0.126  5.187   1.00 18.78 ? 12  ASP A N   1 
ATOM   92   C  CA  . ASP A 1 12  ? 29.637  -0.904  6.373   1.00 20.20 ? 12  ASP A CA  1 
ATOM   93   C  C   . ASP A 1 12  ? 30.834  -1.684  6.899   1.00 18.69 ? 12  ASP A C   1 
ATOM   94   O  O   . ASP A 1 12  ? 30.706  -2.477  7.825   1.00 20.04 ? 12  ASP A O   1 
ATOM   95   C  CB  . ASP A 1 12  ? 28.484  -1.862  6.050   1.00 23.65 ? 12  ASP A CB  1 
ATOM   96   C  CG  . ASP A 1 12  ? 28.897  -2.986  5.117   1.00 26.76 ? 12  ASP A CG  1 
ATOM   97   O  OD1 . ASP A 1 12  ? 29.678  -2.744  4.173   1.00 30.00 ? 12  ASP A OD1 1 
ATOM   98   O  OD2 . ASP A 1 12  ? 28.424  -4.120  5.320   1.00 32.99 ? 12  ASP A OD2 1 
ATOM   99   N  N   . ALA A 1 13  ? 32.002  -1.426  6.324   1.00 16.80 ? 13  ALA A N   1 
ATOM   100  C  CA  . ALA A 1 13  ? 33.229  -2.119  6.699   1.00 16.94 ? 13  ALA A CA  1 
ATOM   101  C  C   . ALA A 1 13  ? 33.734  -1.845  8.113   1.00 18.46 ? 13  ALA A C   1 
ATOM   102  O  O   . ALA A 1 13  ? 34.597  -2.563  8.617   1.00 19.67 ? 13  ALA A O   1 
ATOM   103  C  CB  . ALA A 1 13  ? 34.316  -1.787  5.698   1.00 14.98 ? 13  ALA A CB  1 
ATOM   104  N  N   . LEU A 1 14  ? 33.211  -0.810  8.759   1.00 19.48 ? 14  LEU A N   1 
ATOM   105  C  CA  . LEU A 1 14  ? 33.659  -0.490  10.106  1.00 19.32 ? 14  LEU A CA  1 
ATOM   106  C  C   . LEU A 1 14  ? 32.653  -0.904  11.172  1.00 19.16 ? 14  LEU A C   1 
ATOM   107  O  O   . LEU A 1 14  ? 32.837  -0.611  12.355  1.00 19.16 ? 14  LEU A O   1 
ATOM   108  C  CB  . LEU A 1 14  ? 33.981  1.007   10.217  1.00 19.70 ? 14  LEU A CB  1 
ATOM   109  C  CG  . LEU A 1 14  ? 35.086  1.479   9.260   1.00 20.41 ? 14  LEU A CG  1 
ATOM   110  C  CD1 . LEU A 1 14  ? 35.321  2.976   9.415   1.00 19.02 ? 14  LEU A CD1 1 
ATOM   111  C  CD2 . LEU A 1 14  ? 36.364  0.702   9.541   1.00 17.84 ? 14  LEU A CD2 1 
ATOM   112  N  N   . GLU A 1 15  ? 31.583  -1.573  10.754  1.00 18.27 ? 15  GLU A N   1 
ATOM   113  C  CA  . GLU A 1 15  ? 30.591  -2.053  11.706  1.00 18.85 ? 15  GLU A CA  1 
ATOM   114  C  C   . GLU A 1 15  ? 31.310  -3.117  12.534  1.00 18.05 ? 15  GLU A C   1 
ATOM   115  O  O   . GLU A 1 15  ? 32.235  -3.768  12.043  1.00 17.48 ? 15  GLU A O   1 
ATOM   116  C  CB  . GLU A 1 15  ? 29.397  -2.666  10.970  1.00 19.61 ? 15  GLU A CB  1 
ATOM   117  C  CG  . GLU A 1 15  ? 28.539  -1.652  10.232  1.00 19.00 ? 15  GLU A CG  1 
ATOM   118  C  CD  . GLU A 1 15  ? 27.557  -0.940  11.142  1.00 20.23 ? 15  GLU A CD  1 
ATOM   119  O  OE1 . GLU A 1 15  ? 27.732  -1.000  12.378  1.00 21.00 ? 15  GLU A OE1 1 
ATOM   120  O  OE2 . GLU A 1 15  ? 26.610  -0.311  10.619  1.00 21.40 ? 15  GLU A OE2 1 
ATOM   121  N  N   . PRO A 1 16  ? 30.893  -3.319  13.794  1.00 17.45 ? 16  PRO A N   1 
ATOM   122  C  CA  . PRO A 1 16  ? 29.806  -2.634  14.495  1.00 17.51 ? 16  PRO A CA  1 
ATOM   123  C  C   . PRO A 1 16  ? 30.269  -1.416  15.294  1.00 18.46 ? 16  PRO A C   1 
ATOM   124  O  O   . PRO A 1 16  ? 29.564  -0.966  16.196  1.00 20.26 ? 16  PRO A O   1 
ATOM   125  C  CB  . PRO A 1 16  ? 29.273  -3.725  15.404  1.00 17.21 ? 16  PRO A CB  1 
ATOM   126  C  CG  . PRO A 1 16  ? 30.569  -4.371  15.871  1.00 17.11 ? 16  PRO A CG  1 
ATOM   127  C  CD  . PRO A 1 16  ? 31.440  -4.418  14.618  1.00 14.60 ? 16  PRO A CD  1 
ATOM   128  N  N   . HIS A 1 17  ? 31.443  -0.882  14.968  1.00 17.52 ? 17  HIS A N   1 
ATOM   129  C  CA  . HIS A 1 17  ? 31.969  0.272   15.694  1.00 17.55 ? 17  HIS A CA  1 
ATOM   130  C  C   . HIS A 1 17  ? 31.443  1.603   15.173  1.00 17.32 ? 17  HIS A C   1 
ATOM   131  O  O   . HIS A 1 17  ? 30.858  2.374   15.932  1.00 16.90 ? 17  HIS A O   1 
ATOM   132  C  CB  . HIS A 1 17  ? 33.483  0.225   15.664  1.00 15.93 ? 17  HIS A CB  1 
ATOM   133  C  CG  . HIS A 1 17  ? 34.021  -1.119  16.026  1.00 17.55 ? 17  HIS A CG  1 
ATOM   134  N  ND1 . HIS A 1 17  ? 33.833  -1.678  17.272  1.00 17.00 ? 17  HIS A ND1 1 
ATOM   135  C  CD2 . HIS A 1 17  ? 34.667  -2.050  15.286  1.00 15.81 ? 17  HIS A CD2 1 
ATOM   136  C  CE1 . HIS A 1 17  ? 34.340  -2.898  17.283  1.00 17.48 ? 17  HIS A CE1 1 
ATOM   137  N  NE2 . HIS A 1 17  ? 34.851  -3.147  16.090  1.00 19.72 ? 17  HIS A NE2 1 
ATOM   138  N  N   . PHE A 1 18  ? 31.652  1.875   13.888  1.00 17.10 ? 18  PHE A N   1 
ATOM   139  C  CA  . PHE A 1 18  ? 31.148  3.105   13.265  1.00 15.32 ? 18  PHE A CA  1 
ATOM   140  C  C   . PHE A 1 18  ? 29.984  2.683   12.374  1.00 14.99 ? 18  PHE A C   1 
ATOM   141  O  O   . PHE A 1 18  ? 30.138  1.800   11.529  1.00 15.73 ? 18  PHE A O   1 
ATOM   142  C  CB  . PHE A 1 18  ? 32.234  3.780   12.418  1.00 12.70 ? 18  PHE A CB  1 
ATOM   143  C  CG  . PHE A 1 18  ? 33.240  4.564   13.216  1.00 12.36 ? 18  PHE A CG  1 
ATOM   144  C  CD1 . PHE A 1 18  ? 33.212  4.563   14.607  1.00 14.91 ? 18  PHE A CD1 1 
ATOM   145  C  CD2 . PHE A 1 18  ? 34.210  5.321   12.569  1.00 12.91 ? 18  PHE A CD2 1 
ATOM   146  C  CE1 . PHE A 1 18  ? 34.136  5.309   15.347  1.00 15.44 ? 18  PHE A CE1 1 
ATOM   147  C  CE2 . PHE A 1 18  ? 35.140  6.072   13.294  1.00 14.70 ? 18  PHE A CE2 1 
ATOM   148  C  CZ  . PHE A 1 18  ? 35.102  6.067   14.686  1.00 14.73 ? 18  PHE A CZ  1 
ATOM   149  N  N   . ASP A 1 19  ? 28.825  3.307   12.558  1.00 14.85 ? 19  ASP A N   1 
ATOM   150  C  CA  . ASP A 1 19  ? 27.648  2.938   11.781  1.00 15.92 ? 19  ASP A CA  1 
ATOM   151  C  C   . ASP A 1 19  ? 27.715  3.256   10.290  1.00 18.36 ? 19  ASP A C   1 
ATOM   152  O  O   . ASP A 1 19  ? 28.258  4.276   9.868   1.00 17.78 ? 19  ASP A O   1 
ATOM   153  C  CB  . ASP A 1 19  ? 26.389  3.565   12.382  1.00 13.98 ? 19  ASP A CB  1 
ATOM   154  C  CG  . ASP A 1 19  ? 26.472  5.075   12.469  1.00 15.72 ? 19  ASP A CG  1 
ATOM   155  O  OD1 . ASP A 1 19  ? 27.361  5.589   13.183  1.00 15.00 ? 19  ASP A OD1 1 
ATOM   156  O  OD2 . ASP A 1 19  ? 25.647  5.750   11.823  1.00 15.00 ? 19  ASP A OD2 1 
ATOM   157  N  N   . LYS A 1 20  ? 27.142  2.351   9.506   1.00 20.01 ? 20  LYS A N   1 
ATOM   158  C  CA  . LYS A 1 20  ? 27.088  2.451   8.058   1.00 21.05 ? 20  LYS A CA  1 
ATOM   159  C  C   . LYS A 1 20  ? 26.434  3.744   7.576   1.00 21.10 ? 20  LYS A C   1 
ATOM   160  O  O   . LYS A 1 20  ? 26.916  4.391   6.644   1.00 19.44 ? 20  LYS A O   1 
ATOM   161  C  CB  . LYS A 1 20  ? 26.302  1.256   7.509   1.00 24.87 ? 20  LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 20  ? 25.929  1.367   6.042   1.00 31.12 ? 20  LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 20  ? 24.950  0.274   5.645   1.00 36.33 ? 20  LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 20  ? 24.596  0.363   4.165   1.00 39.61 ? 20  LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 20  ? 25.792  0.150   3.293   1.00 42.49 ? 20  LYS A NZ  1 
ATOM   166  N  N   . GLN A 1 21  ? 25.325  4.108   8.209   1.00 19.51 ? 21  GLN A N   1 
ATOM   167  C  CA  . GLN A 1 21  ? 24.591  5.303   7.831   1.00 19.71 ? 21  GLN A CA  1 
ATOM   168  C  C   . GLN A 1 21  ? 25.440  6.567   7.906   1.00 19.60 ? 21  GLN A C   1 
ATOM   169  O  O   . GLN A 1 21  ? 25.439  7.386   6.983   1.00 20.56 ? 21  GLN A O   1 
ATOM   170  C  CB  . GLN A 1 21  ? 23.363  5.471   8.726   1.00 20.10 ? 21  GLN A CB  1 
ATOM   171  C  CG  . GLN A 1 21  ? 22.466  6.604   8.282   1.00 24.67 ? 21  GLN A CG  1 
ATOM   172  C  CD  . GLN A 1 21  ? 21.244  6.787   9.166   1.00 29.08 ? 21  GLN A CD  1 
ATOM   173  O  OE1 . GLN A 1 21  ? 20.297  7.472   8.781   1.00 33.98 ? 21  GLN A OE1 1 
ATOM   174  N  NE2 . GLN A 1 21  ? 21.261  6.187   10.358  1.00 28.00 ? 21  GLN A NE2 1 
ATOM   175  N  N   . THR A 1 22  ? 26.155  6.732   9.012   1.00 17.43 ? 22  THR A N   1 
ATOM   176  C  CA  . THR A 1 22  ? 26.994  7.903   9.194   1.00 15.00 ? 22  THR A CA  1 
ATOM   177  C  C   . THR A 1 22  ? 28.127  7.929   8.178   1.00 14.48 ? 22  THR A C   1 
ATOM   178  O  O   . THR A 1 22  ? 28.389  8.965   7.566   1.00 15.84 ? 22  THR A O   1 
ATOM   179  C  CB  . THR A 1 22  ? 27.575  7.956   10.631  1.00 16.25 ? 22  THR A CB  1 
ATOM   180  O  OG1 . THR A 1 22  ? 26.508  8.181   11.562  1.00 16.03 ? 22  THR A OG1 1 
ATOM   181  C  CG2 . THR A 1 22  ? 28.606  9.082   10.758  1.00 14.04 ? 22  THR A CG2 1 
ATOM   182  N  N   . MET A 1 23  ? 28.791  6.793   7.986   1.00 12.62 ? 23  MET A N   1 
ATOM   183  C  CA  . MET A 1 23  ? 29.888  6.725   7.031   1.00 15.20 ? 23  MET A CA  1 
ATOM   184  C  C   . MET A 1 23  ? 29.454  7.264   5.672   1.00 15.92 ? 23  MET A C   1 
ATOM   185  O  O   . MET A 1 23  ? 30.165  8.044   5.042   1.00 17.13 ? 23  MET A O   1 
ATOM   186  C  CB  . MET A 1 23  ? 30.375  5.284   6.875   1.00 14.48 ? 23  MET A CB  1 
ATOM   187  C  CG  . MET A 1 23  ? 31.107  4.735   8.088   1.00 15.77 ? 23  MET A CG  1 
ATOM   188  S  SD  . MET A 1 23  ? 32.556  5.711   8.477   1.00 17.04 ? 23  MET A SD  1 
ATOM   189  C  CE  . MET A 1 23  ? 33.609  5.333   7.101   1.00 16.67 ? 23  MET A CE  1 
ATOM   190  N  N   . GLU A 1 24  ? 28.272  6.850   5.242   1.00 16.28 ? 24  GLU A N   1 
ATOM   191  C  CA  . GLU A 1 24  ? 27.720  7.251   3.964   1.00 18.19 ? 24  GLU A CA  1 
ATOM   192  C  C   . GLU A 1 24  ? 27.435  8.752   3.877   1.00 15.93 ? 24  GLU A C   1 
ATOM   193  O  O   . GLU A 1 24  ? 27.827  9.409   2.912   1.00 15.53 ? 24  GLU A O   1 
ATOM   194  C  CB  . GLU A 1 24  ? 26.439  6.456   3.723   1.00 22.03 ? 24  GLU A CB  1 
ATOM   195  C  CG  . GLU A 1 24  ? 26.042  6.300   2.279   1.00 30.87 ? 24  GLU A CG  1 
ATOM   196  C  CD  . GLU A 1 24  ? 24.873  5.345   2.126   1.00 36.61 ? 24  GLU A CD  1 
ATOM   197  O  OE1 . GLU A 1 24  ? 24.886  4.277   2.786   1.00 38.26 ? 24  GLU A OE1 1 
ATOM   198  O  OE2 . GLU A 1 24  ? 23.949  5.659   1.344   1.00 40.35 ? 24  GLU A OE2 1 
ATOM   199  N  N   . ILE A 1 25  ? 26.744  9.284   4.880   1.00 14.04 ? 25  ILE A N   1 
ATOM   200  C  CA  . ILE A 1 25  ? 26.397  10.705  4.908   1.00 14.19 ? 25  ILE A CA  1 
ATOM   201  C  C   . ILE A 1 25  ? 27.644  11.566  5.070   1.00 13.63 ? 25  ILE A C   1 
ATOM   202  O  O   . ILE A 1 25  ? 27.822  12.575  4.386   1.00 11.44 ? 25  ILE A O   1 
ATOM   203  C  CB  . ILE A 1 25  ? 25.437  11.013  6.073   1.00 15.90 ? 25  ILE A CB  1 
ATOM   204  C  CG1 . ILE A 1 25  ? 24.100  10.307  5.836   1.00 16.37 ? 25  ILE A CG1 1 
ATOM   205  C  CG2 . ILE A 1 25  ? 25.255  12.528  6.229   1.00 14.48 ? 25  ILE A CG2 1 
ATOM   206  C  CD1 . ILE A 1 25  ? 23.111  10.481  6.969   1.00 18.07 ? 25  ILE A CD1 1 
ATOM   207  N  N   . HIS A 1 26  ? 28.511  11.142  5.978   1.00 12.87 ? 26  HIS A N   1 
ATOM   208  C  CA  . HIS A 1 26  ? 29.742  11.859  6.264   1.00 13.57 ? 26  HIS A CA  1 
ATOM   209  C  C   . HIS A 1 26  ? 30.592  12.008  4.990   1.00 13.77 ? 26  HIS A C   1 
ATOM   210  O  O   . HIS A 1 26  ? 31.182  13.060  4.738   1.00 14.17 ? 26  HIS A O   1 
ATOM   211  C  CB  . HIS A 1 26  ? 30.511  11.107  7.366   1.00 9.49  ? 26  HIS A CB  1 
ATOM   212  C  CG  . HIS A 1 26  ? 31.526  11.942  8.087   1.00 11.97 ? 26  HIS A CG  1 
ATOM   213  N  ND1 . HIS A 1 26  ? 32.328  11.435  9.088   1.00 11.89 ? 26  HIS A ND1 1 
ATOM   214  C  CD2 . HIS A 1 26  ? 31.859  13.249  7.966   1.00 11.22 ? 26  HIS A CD2 1 
ATOM   215  C  CE1 . HIS A 1 26  ? 33.110  12.392  9.552   1.00 9.90  ? 26  HIS A CE1 1 
ATOM   216  N  NE2 . HIS A 1 26  ? 32.846  13.502  8.887   1.00 10.56 ? 26  HIS A NE2 1 
ATOM   217  N  N   . HIS A 1 27  ? 30.620  10.958  4.176   1.00 14.00 ? 27  HIS A N   1 
ATOM   218  C  CA  . HIS A 1 27  ? 31.400  10.940  2.944   1.00 12.99 ? 27  HIS A CA  1 
ATOM   219  C  C   . HIS A 1 27  ? 30.733  11.652  1.768   1.00 13.63 ? 27  HIS A C   1 
ATOM   220  O  O   . HIS A 1 27  ? 31.270  12.624  1.238   1.00 13.70 ? 27  HIS A O   1 
ATOM   221  C  CB  . HIS A 1 27  ? 31.686  9.483   2.556   1.00 12.92 ? 27  HIS A CB  1 
ATOM   222  C  CG  . HIS A 1 27  ? 32.560  9.327   1.351   1.00 12.63 ? 27  HIS A CG  1 
ATOM   223  N  ND1 . HIS A 1 27  ? 32.197  8.558   0.264   1.00 13.88 ? 27  HIS A ND1 1 
ATOM   224  C  CD2 . HIS A 1 27  ? 33.787  9.823   1.066   1.00 12.23 ? 27  HIS A CD2 1 
ATOM   225  C  CE1 . HIS A 1 27  ? 33.161  8.590   -0.640  1.00 11.95 ? 27  HIS A CE1 1 
ATOM   226  N  NE2 . HIS A 1 27  ? 34.138  9.351   -0.178  1.00 12.74 ? 27  HIS A NE2 1 
ATOM   227  N  N   . THR A 1 28  ? 29.561  11.164  1.372   1.00 13.25 ? 28  THR A N   1 
ATOM   228  C  CA  . THR A 1 28  ? 28.844  11.711  0.222   1.00 14.08 ? 28  THR A CA  1 
ATOM   229  C  C   . THR A 1 28  ? 28.180  13.068  0.387   1.00 13.31 ? 28  THR A C   1 
ATOM   230  O  O   . THR A 1 28  ? 27.818  13.694  -0.603  1.00 14.39 ? 28  THR A O   1 
ATOM   231  C  CB  . THR A 1 28  ? 27.785  10.709  -0.285  1.00 13.95 ? 28  THR A CB  1 
ATOM   232  O  OG1 . THR A 1 28  ? 26.782  10.509  0.721   1.00 13.52 ? 28  THR A OG1 1 
ATOM   233  C  CG2 . THR A 1 28  ? 28.450  9.374   -0.617  1.00 11.28 ? 28  THR A CG2 1 
ATOM   234  N  N   . LYS A 1 29  ? 28.016  13.522  1.624   1.00 13.86 ? 29  LYS A N   1 
ATOM   235  C  CA  . LYS A 1 29  ? 27.392  14.817  1.875   1.00 14.86 ? 29  LYS A CA  1 
ATOM   236  C  C   . LYS A 1 29  ? 28.379  15.837  2.440   1.00 14.36 ? 29  LYS A C   1 
ATOM   237  O  O   . LYS A 1 29  ? 28.680  16.840  1.797   1.00 14.55 ? 29  LYS A O   1 
ATOM   238  C  CB  . LYS A 1 29  ? 26.214  14.666  2.847   1.00 18.76 ? 29  LYS A CB  1 
ATOM   239  C  CG  . LYS A 1 29  ? 25.058  13.837  2.314   1.00 22.50 ? 29  LYS A CG  1 
ATOM   240  C  CD  . LYS A 1 29  ? 24.418  14.506  1.117   1.00 28.68 ? 29  LYS A CD  1 
ATOM   241  C  CE  . LYS A 1 29  ? 23.200  13.729  0.638   1.00 31.67 ? 29  LYS A CE  1 
ATOM   242  N  NZ  . LYS A 1 29  ? 23.568  12.334  0.276   1.00 35.57 ? 29  LYS A NZ  1 
ATOM   243  N  N   . HIS A 1 30  ? 28.883  15.577  3.643   1.00 13.09 ? 30  HIS A N   1 
ATOM   244  C  CA  . HIS A 1 30  ? 29.810  16.495  4.290   1.00 12.99 ? 30  HIS A CA  1 
ATOM   245  C  C   . HIS A 1 30  ? 31.110  16.697  3.521   1.00 13.82 ? 30  HIS A C   1 
ATOM   246  O  O   . HIS A 1 30  ? 31.466  17.827  3.186   1.00 14.13 ? 30  HIS A O   1 
ATOM   247  C  CB  . HIS A 1 30  ? 30.104  16.020  5.714   1.00 11.95 ? 30  HIS A CB  1 
ATOM   248  C  CG  . HIS A 1 30  ? 28.928  16.129  6.638   1.00 13.11 ? 30  HIS A CG  1 
ATOM   249  N  ND1 . HIS A 1 30  ? 28.515  17.327  7.182   1.00 12.15 ? 30  HIS A ND1 1 
ATOM   250  C  CD2 . HIS A 1 30  ? 28.054  15.194  7.083   1.00 12.46 ? 30  HIS A CD2 1 
ATOM   251  C  CE1 . HIS A 1 30  ? 27.439  17.127  7.921   1.00 11.20 ? 30  HIS A CE1 1 
ATOM   252  N  NE2 . HIS A 1 30  ? 27.138  15.842  7.877   1.00 11.93 ? 30  HIS A NE2 1 
ATOM   253  N  N   . HIS A 1 31  ? 31.817  15.611  3.233   1.00 12.58 ? 31  HIS A N   1 
ATOM   254  C  CA  . HIS A 1 31  ? 33.070  15.721  2.507   1.00 12.33 ? 31  HIS A CA  1 
ATOM   255  C  C   . HIS A 1 31  ? 32.843  16.273  1.095   1.00 12.21 ? 31  HIS A C   1 
ATOM   256  O  O   . HIS A 1 31  ? 33.607  17.114  0.622   1.00 12.37 ? 31  HIS A O   1 
ATOM   257  C  CB  . HIS A 1 31  ? 33.759  14.362  2.451   1.00 10.98 ? 31  HIS A CB  1 
ATOM   258  C  CG  . HIS A 1 31  ? 35.191  14.433  2.024   1.00 12.20 ? 31  HIS A CG  1 
ATOM   259  N  ND1 . HIS A 1 31  ? 36.035  13.344  2.065   1.00 11.26 ? 31  HIS A ND1 1 
ATOM   260  C  CD2 . HIS A 1 31  ? 35.929  15.465  1.547   1.00 11.02 ? 31  HIS A CD2 1 
ATOM   261  C  CE1 . HIS A 1 31  ? 37.232  13.704  1.635   1.00 12.55 ? 31  HIS A CE1 1 
ATOM   262  N  NE2 . HIS A 1 31  ? 37.194  14.985  1.315   1.00 10.31 ? 31  HIS A NE2 1 
ATOM   263  N  N   . GLN A 1 32  ? 31.786  15.814  0.434   1.00 12.30 ? 32  GLN A N   1 
ATOM   264  C  CA  . GLN A 1 32  ? 31.471  16.282  -0.912  1.00 13.48 ? 32  GLN A CA  1 
ATOM   265  C  C   . GLN A 1 32  ? 31.308  17.801  -0.924  1.00 13.83 ? 32  GLN A C   1 
ATOM   266  O  O   . GLN A 1 32  ? 31.804  18.475  -1.824  1.00 16.10 ? 32  GLN A O   1 
ATOM   267  C  CB  . GLN A 1 32  ? 30.184  15.622  -1.425  1.00 11.84 ? 32  GLN A CB  1 
ATOM   268  C  CG  . GLN A 1 32  ? 29.847  15.980  -2.867  1.00 10.75 ? 32  GLN A CG  1 
ATOM   269  C  CD  . GLN A 1 32  ? 30.848  15.410  -3.855  1.00 10.61 ? 32  GLN A CD  1 
ATOM   270  O  OE1 . GLN A 1 32  ? 30.827  14.220  -4.155  1.00 13.38 ? 32  GLN A OE1 1 
ATOM   271  N  NE2 . GLN A 1 32  ? 31.736  16.258  -4.356  1.00 10.04 ? 32  GLN A NE2 1 
ATOM   272  N  N   . THR A 1 33  ? 30.617  18.337  0.079   1.00 13.17 ? 33  THR A N   1 
ATOM   273  C  CA  . THR A 1 33  ? 30.403  19.777  0.172   1.00 12.67 ? 33  THR A CA  1 
ATOM   274  C  C   . THR A 1 33  ? 31.718  20.552  0.306   1.00 12.96 ? 33  THR A C   1 
ATOM   275  O  O   . THR A 1 33  ? 31.878  21.616  -0.296  1.00 12.96 ? 33  THR A O   1 
ATOM   276  C  CB  . THR A 1 33  ? 29.462  20.105  1.354   1.00 14.35 ? 33  THR A CB  1 
ATOM   277  O  OG1 . THR A 1 33  ? 28.181  19.520  1.102   1.00 10.57 ? 33  THR A OG1 1 
ATOM   278  C  CG2 . THR A 1 33  ? 29.298  21.609  1.529   1.00 10.96 ? 33  THR A CG2 1 
ATOM   279  N  N   . PHE A 1 34  ? 32.660  20.022  1.082   1.00 11.82 ? 34  PHE A N   1 
ATOM   280  C  CA  . PHE A 1 34  ? 33.948  20.689  1.245   1.00 13.14 ? 34  PHE A CA  1 
ATOM   281  C  C   . PHE A 1 34  ? 34.658  20.755  -0.100  1.00 13.76 ? 34  PHE A C   1 
ATOM   282  O  O   . PHE A 1 34  ? 35.260  21.769  -0.447  1.00 14.85 ? 34  PHE A O   1 
ATOM   283  C  CB  . PHE A 1 34  ? 34.831  19.939  2.248   1.00 13.26 ? 34  PHE A CB  1 
ATOM   284  C  CG  . PHE A 1 34  ? 34.346  20.022  3.668   1.00 15.49 ? 34  PHE A CG  1 
ATOM   285  C  CD1 . PHE A 1 34  ? 33.952  21.244  4.214   1.00 16.44 ? 34  PHE A CD1 1 
ATOM   286  C  CD2 . PHE A 1 34  ? 34.295  18.882  4.466   1.00 14.34 ? 34  PHE A CD2 1 
ATOM   287  C  CE1 . PHE A 1 34  ? 33.511  21.331  5.538   1.00 17.78 ? 34  PHE A CE1 1 
ATOM   288  C  CE2 . PHE A 1 34  ? 33.856  18.955  5.791   1.00 14.76 ? 34  PHE A CE2 1 
ATOM   289  C  CZ  . PHE A 1 34  ? 33.464  20.181  6.329   1.00 17.03 ? 34  PHE A CZ  1 
ATOM   290  N  N   . VAL A 1 35  ? 34.594  19.658  -0.848  1.00 14.22 ? 35  VAL A N   1 
ATOM   291  C  CA  . VAL A 1 35  ? 35.219  19.578  -2.164  1.00 12.63 ? 35  VAL A CA  1 
ATOM   292  C  C   . VAL A 1 35  ? 34.565  20.587  -3.114  1.00 13.79 ? 35  VAL A C   1 
ATOM   293  O  O   . VAL A 1 35  ? 35.259  21.320  -3.819  1.00 14.32 ? 35  VAL A O   1 
ATOM   294  C  CB  . VAL A 1 35  ? 35.085  18.141  -2.744  1.00 12.57 ? 35  VAL A CB  1 
ATOM   295  C  CG1 . VAL A 1 35  ? 35.262  18.151  -4.252  1.00 12.81 ? 35  VAL A CG1 1 
ATOM   296  C  CG2 . VAL A 1 35  ? 36.125  17.229  -2.100  1.00 11.84 ? 35  VAL A CG2 1 
ATOM   297  N  N   . ASN A 1 36  ? 33.232  20.619  -3.126  1.00 12.46 ? 36  ASN A N   1 
ATOM   298  C  CA  . ASN A 1 36  ? 32.495  21.535  -3.991  1.00 14.14 ? 36  ASN A CA  1 
ATOM   299  C  C   . ASN A 1 36  ? 32.766  23.003  -3.651  1.00 15.00 ? 36  ASN A C   1 
ATOM   300  O  O   . ASN A 1 36  ? 32.972  23.821  -4.551  1.00 15.26 ? 36  ASN A O   1 
ATOM   301  C  CB  . ASN A 1 36  ? 30.979  21.287  -3.911  1.00 13.23 ? 36  ASN A CB  1 
ATOM   302  C  CG  . ASN A 1 36  ? 30.566  19.926  -4.458  1.00 15.00 ? 36  ASN A CG  1 
ATOM   303  O  OD1 . ASN A 1 36  ? 31.315  19.273  -5.184  1.00 15.03 ? 36  ASN A OD1 1 
ATOM   304  N  ND2 . ASN A 1 36  ? 29.354  19.504  -4.120  1.00 13.85 ? 36  ASN A ND2 1 
ATOM   305  N  N   . ASN A 1 37  ? 32.754  23.346  -2.365  1.00 14.23 ? 37  ASN A N   1 
ATOM   306  C  CA  . ASN A 1 37  ? 32.995  24.736  -1.980  1.00 15.39 ? 37  ASN A CA  1 
ATOM   307  C  C   . ASN A 1 37  ? 34.435  25.170  -2.228  1.00 15.09 ? 37  ASN A C   1 
ATOM   308  O  O   . ASN A 1 37  ? 34.692  26.332  -2.537  1.00 15.61 ? 37  ASN A O   1 
ATOM   309  C  CB  . ASN A 1 37  ? 32.644  24.976  -0.509  1.00 16.06 ? 37  ASN A CB  1 
ATOM   310  C  CG  . ASN A 1 37  ? 31.153  24.887  -0.242  1.00 19.97 ? 37  ASN A CG  1 
ATOM   311  O  OD1 . ASN A 1 37  ? 30.332  25.116  -1.139  1.00 17.67 ? 37  ASN A OD1 1 
ATOM   312  N  ND2 . ASN A 1 37  ? 30.793  24.568  1.003   1.00 19.19 ? 37  ASN A ND2 1 
ATOM   313  N  N   . ALA A 1 38  ? 35.371  24.239  -2.091  1.00 13.89 ? 38  ALA A N   1 
ATOM   314  C  CA  . ALA A 1 38  ? 36.770  24.561  -2.314  1.00 13.66 ? 38  ALA A CA  1 
ATOM   315  C  C   . ALA A 1 38  ? 36.992  24.817  -3.801  1.00 13.44 ? 38  ALA A C   1 
ATOM   316  O  O   . ALA A 1 38  ? 37.745  25.716  -4.174  1.00 11.73 ? 38  ALA A O   1 
ATOM   317  C  CB  . ALA A 1 38  ? 37.652  23.425  -1.836  1.00 12.10 ? 38  ALA A CB  1 
ATOM   318  N  N   . ASN A 1 39  ? 36.327  24.030  -4.646  1.00 13.18 ? 39  ASN A N   1 
ATOM   319  C  CA  . ASN A 1 39  ? 36.460  24.191  -6.088  1.00 12.81 ? 39  ASN A CA  1 
ATOM   320  C  C   . ASN A 1 39  ? 35.875  25.524  -6.548  1.00 14.41 ? 39  ASN A C   1 
ATOM   321  O  O   . ASN A 1 39  ? 36.457  26.203  -7.395  1.00 13.91 ? 39  ASN A O   1 
ATOM   322  C  CB  . ASN A 1 39  ? 35.768  23.040  -6.837  1.00 13.19 ? 39  ASN A CB  1 
ATOM   323  C  CG  . ASN A 1 39  ? 36.579  21.747  -6.810  1.00 14.73 ? 39  ASN A CG  1 
ATOM   324  O  OD1 . ASN A 1 39  ? 37.783  21.763  -6.545  1.00 13.47 ? 39  ASN A OD1 1 
ATOM   325  N  ND2 . ASN A 1 39  ? 35.922  20.626  -7.104  1.00 11.66 ? 39  ASN A ND2 1 
ATOM   326  N  N   . ALA A 1 40  ? 34.731  25.900  -5.981  1.00 14.35 ? 40  ALA A N   1 
ATOM   327  C  CA  . ALA A 1 40  ? 34.073  27.147  -6.351  1.00 15.52 ? 40  ALA A CA  1 
ATOM   328  C  C   . ALA A 1 40  ? 34.974  28.341  -6.080  1.00 17.57 ? 40  ALA A C   1 
ATOM   329  O  O   . ALA A 1 40  ? 35.039  29.269  -6.886  1.00 19.72 ? 40  ALA A O   1 
ATOM   330  C  CB  . ALA A 1 40  ? 32.750  27.303  -5.594  1.00 13.84 ? 40  ALA A CB  1 
ATOM   331  N  N   . ALA A 1 41  ? 35.679  28.311  -4.954  1.00 18.88 ? 41  ALA A N   1 
ATOM   332  C  CA  . ALA A 1 41  ? 36.573  29.405  -4.597  1.00 20.56 ? 41  ALA A CA  1 
ATOM   333  C  C   . ALA A 1 41  ? 37.842  29.417  -5.444  1.00 22.28 ? 41  ALA A C   1 
ATOM   334  O  O   . ALA A 1 41  ? 38.404  30.479  -5.710  1.00 24.31 ? 41  ALA A O   1 
ATOM   335  C  CB  . ALA A 1 41  ? 36.940  29.321  -3.120  1.00 19.51 ? 41  ALA A CB  1 
ATOM   336  N  N   . LEU A 1 42  ? 38.285  28.242  -5.880  1.00 22.79 ? 42  LEU A N   1 
ATOM   337  C  CA  . LEU A 1 42  ? 39.507  28.140  -6.668  1.00 23.04 ? 42  LEU A CA  1 
ATOM   338  C  C   . LEU A 1 42  ? 39.354  28.419  -8.160  1.00 23.82 ? 42  LEU A C   1 
ATOM   339  O  O   . LEU A 1 42  ? 40.356  28.578  -8.861  1.00 23.06 ? 42  LEU A O   1 
ATOM   340  C  CB  . LEU A 1 42  ? 40.138  26.760  -6.467  1.00 21.94 ? 42  LEU A CB  1 
ATOM   341  C  CG  . LEU A 1 42  ? 40.770  26.501  -5.096  1.00 23.17 ? 42  LEU A CG  1 
ATOM   342  C  CD1 . LEU A 1 42  ? 41.063  25.014  -4.933  1.00 22.71 ? 42  LEU A CD1 1 
ATOM   343  C  CD2 . LEU A 1 42  ? 42.042  27.322  -4.958  1.00 19.50 ? 42  LEU A CD2 1 
ATOM   344  N  N   . GLU A 1 43  ? 38.115  28.471  -8.645  1.00 23.88 ? 43  GLU A N   1 
ATOM   345  C  CA  . GLU A 1 43  ? 37.861  28.728  -10.064 1.00 25.76 ? 43  GLU A CA  1 
ATOM   346  C  C   . GLU A 1 43  ? 38.597  29.990  -10.525 1.00 28.74 ? 43  GLU A C   1 
ATOM   347  O  O   . GLU A 1 43  ? 39.111  30.056  -11.644 1.00 26.67 ? 43  GLU A O   1 
ATOM   348  C  CB  . GLU A 1 43  ? 36.354  28.887  -10.303 1.00 23.97 ? 43  GLU A CB  1 
ATOM   349  C  CG  . GLU A 1 43  ? 35.939  29.198  -11.745 1.00 22.98 ? 43  GLU A CG  1 
ATOM   350  C  CD  . GLU A 1 43  ? 36.219  28.058  -12.724 1.00 24.20 ? 43  GLU A CD  1 
ATOM   351  O  OE1 . GLU A 1 43  ? 36.049  26.877  -12.350 1.00 23.27 ? 43  GLU A OE1 1 
ATOM   352  O  OE2 . GLU A 1 43  ? 36.591  28.343  -13.881 1.00 25.55 ? 43  GLU A OE2 1 
ATOM   353  N  N   . SER A 1 44  ? 38.659  30.983  -9.644  1.00 32.33 ? 44  SER A N   1 
ATOM   354  C  CA  . SER A 1 44  ? 39.316  32.246  -9.959  1.00 36.96 ? 44  SER A CA  1 
ATOM   355  C  C   . SER A 1 44  ? 40.694  32.395  -9.315  1.00 38.67 ? 44  SER A C   1 
ATOM   356  O  O   . SER A 1 44  ? 41.088  33.496  -8.940  1.00 40.75 ? 44  SER A O   1 
ATOM   357  C  CB  . SER A 1 44  ? 38.420  33.409  -9.530  1.00 37.32 ? 44  SER A CB  1 
ATOM   358  O  OG  . SER A 1 44  ? 38.084  33.305  -8.155  1.00 41.20 ? 44  SER A OG  1 
ATOM   359  N  N   . LEU A 1 45  ? 41.420  31.288  -9.194  1.00 39.39 ? 45  LEU A N   1 
ATOM   360  C  CA  . LEU A 1 45  ? 42.757  31.285  -8.602  1.00 40.07 ? 45  LEU A CA  1 
ATOM   361  C  C   . LEU A 1 45  ? 43.568  30.151  -9.222  1.00 42.28 ? 45  LEU A C   1 
ATOM   362  O  O   . LEU A 1 45  ? 43.972  29.211  -8.535  1.00 42.82 ? 45  LEU A O   1 
ATOM   363  C  CB  . LEU A 1 45  ? 42.669  31.089  -7.089  1.00 39.07 ? 45  LEU A CB  1 
ATOM   364  C  CG  . LEU A 1 45  ? 42.026  32.229  -6.298  1.00 39.67 ? 45  LEU A CG  1 
ATOM   365  C  CD1 . LEU A 1 45  ? 41.721  31.793  -4.875  1.00 39.96 ? 45  LEU A CD1 1 
ATOM   366  C  CD2 . LEU A 1 45  ? 42.965  33.414  -6.302  1.00 41.14 ? 45  LEU A CD2 1 
ATOM   367  N  N   . PRO A 1 46  ? 43.816  30.232  -10.538 1.00 43.62 ? 46  PRO A N   1 
ATOM   368  C  CA  . PRO A 1 46  ? 44.571  29.242  -11.317 1.00 44.38 ? 46  PRO A CA  1 
ATOM   369  C  C   . PRO A 1 46  ? 45.929  28.822  -10.747 1.00 44.63 ? 46  PRO A C   1 
ATOM   370  O  O   . PRO A 1 46  ? 46.332  27.666  -10.885 1.00 43.95 ? 46  PRO A O   1 
ATOM   371  C  CB  . PRO A 1 46  ? 44.703  29.914  -12.683 1.00 45.09 ? 46  PRO A CB  1 
ATOM   372  C  CG  . PRO A 1 46  ? 43.437  30.719  -12.777 1.00 44.69 ? 46  PRO A CG  1 
ATOM   373  C  CD  . PRO A 1 46  ? 43.350  31.333  -11.403 1.00 43.79 ? 46  PRO A CD  1 
ATOM   374  N  N   . GLU A 1 47  ? 46.630  29.761  -10.115 1.00 45.98 ? 47  GLU A N   1 
ATOM   375  C  CA  . GLU A 1 47  ? 47.949  29.490  -9.542  1.00 47.82 ? 47  GLU A CA  1 
ATOM   376  C  C   . GLU A 1 47  ? 47.891  28.479  -8.403  1.00 47.96 ? 47  GLU A C   1 
ATOM   377  O  O   . GLU A 1 47  ? 48.794  27.654  -8.242  1.00 48.98 ? 47  GLU A O   1 
ATOM   378  C  CB  . GLU A 1 47  ? 48.587  30.773  -9.003  1.00 49.27 ? 47  GLU A CB  1 
ATOM   379  C  CG  . GLU A 1 47  ? 48.197  32.050  -9.718  1.00 52.74 ? 47  GLU A CG  1 
ATOM   380  C  CD  . GLU A 1 47  ? 46.839  32.569  -9.279  1.00 55.08 ? 47  GLU A CD  1 
ATOM   381  O  OE1 . GLU A 1 47  ? 45.815  31.944  -9.628  1.00 56.00 ? 47  GLU A OE1 1 
ATOM   382  O  OE2 . GLU A 1 47  ? 46.798  33.604  -8.575  1.00 56.94 ? 47  GLU A OE2 1 
ATOM   383  N  N   . PHE A 1 48  ? 46.826  28.548  -7.611  1.00 46.60 ? 48  PHE A N   1 
ATOM   384  C  CA  . PHE A 1 48  ? 46.668  27.651  -6.476  1.00 45.57 ? 48  PHE A CA  1 
ATOM   385  C  C   . PHE A 1 48  ? 45.792  26.436  -6.773  1.00 45.40 ? 48  PHE A C   1 
ATOM   386  O  O   . PHE A 1 48  ? 45.901  25.408  -6.106  1.00 45.24 ? 48  PHE A O   1 
ATOM   387  C  CB  . PHE A 1 48  ? 46.095  28.432  -5.291  1.00 44.66 ? 48  PHE A CB  1 
ATOM   388  C  CG  . PHE A 1 48  ? 46.983  29.551  -4.818  1.00 44.95 ? 48  PHE A CG  1 
ATOM   389  C  CD1 . PHE A 1 48  ? 48.196  29.279  -4.193  1.00 44.82 ? 48  PHE A CD1 1 
ATOM   390  C  CD2 . PHE A 1 48  ? 46.607  30.880  -4.999  1.00 44.38 ? 48  PHE A CD2 1 
ATOM   391  C  CE1 . PHE A 1 48  ? 49.023  30.314  -3.752  1.00 44.72 ? 48  PHE A CE1 1 
ATOM   392  C  CE2 . PHE A 1 48  ? 47.428  31.922  -4.562  1.00 43.90 ? 48  PHE A CE2 1 
ATOM   393  C  CZ  . PHE A 1 48  ? 48.637  31.637  -3.937  1.00 43.83 ? 48  PHE A CZ  1 
ATOM   394  N  N   . ALA A 1 49  ? 44.935  26.548  -7.782  1.00 45.20 ? 49  ALA A N   1 
ATOM   395  C  CA  . ALA A 1 49  ? 44.035  25.458  -8.140  1.00 45.29 ? 49  ALA A CA  1 
ATOM   396  C  C   . ALA A 1 49  ? 44.747  24.164  -8.537  1.00 45.38 ? 49  ALA A C   1 
ATOM   397  O  O   . ALA A 1 49  ? 44.124  23.104  -8.593  1.00 47.05 ? 49  ALA A O   1 
ATOM   398  C  CB  . ALA A 1 49  ? 43.105  25.907  -9.265  1.00 45.11 ? 49  ALA A CB  1 
ATOM   399  N  N   . ASN A 1 50  ? 46.045  24.241  -8.801  1.00 44.79 ? 50  ASN A N   1 
ATOM   400  C  CA  . ASN A 1 50  ? 46.796  23.059  -9.210  1.00 44.30 ? 50  ASN A CA  1 
ATOM   401  C  C   . ASN A 1 50  ? 47.561  22.379  -8.085  1.00 41.89 ? 50  ASN A C   1 
ATOM   402  O  O   . ASN A 1 50  ? 48.083  21.278  -8.261  1.00 41.85 ? 50  ASN A O   1 
ATOM   403  C  CB  . ASN A 1 50  ? 47.769  23.426  -10.329 1.00 48.72 ? 50  ASN A CB  1 
ATOM   404  C  CG  . ASN A 1 50  ? 47.058  23.857  -11.592 1.00 52.93 ? 50  ASN A CG  1 
ATOM   405  O  OD1 . ASN A 1 50  ? 46.300  23.083  -12.185 1.00 55.18 ? 50  ASN A OD1 1 
ATOM   406  N  ND2 . ASN A 1 50  ? 47.291  25.099  -12.011 1.00 54.48 ? 50  ASN A ND2 1 
ATOM   407  N  N   . LEU A 1 51  ? 47.626  23.027  -6.930  1.00 38.09 ? 51  LEU A N   1 
ATOM   408  C  CA  . LEU A 1 51  ? 48.345  22.468  -5.793  1.00 34.54 ? 51  LEU A CA  1 
ATOM   409  C  C   . LEU A 1 51  ? 47.596  21.341  -5.093  1.00 32.00 ? 51  LEU A C   1 
ATOM   410  O  O   . LEU A 1 51  ? 46.365  21.344  -5.022  1.00 30.79 ? 51  LEU A O   1 
ATOM   411  C  CB  . LEU A 1 51  ? 48.636  23.564  -4.764  1.00 33.88 ? 51  LEU A CB  1 
ATOM   412  C  CG  . LEU A 1 51  ? 49.595  24.690  -5.148  1.00 33.47 ? 51  LEU A CG  1 
ATOM   413  C  CD1 . LEU A 1 51  ? 49.671  25.713  -4.024  1.00 30.95 ? 51  LEU A CD1 1 
ATOM   414  C  CD2 . LEU A 1 51  ? 50.966  24.096  -5.430  1.00 33.69 ? 51  LEU A CD2 1 
ATOM   415  N  N   . PRO A 1 52  ? 48.336  20.341  -4.589  1.00 30.31 ? 52  PRO A N   1 
ATOM   416  C  CA  . PRO A 1 52  ? 47.700  19.224  -3.877  1.00 27.92 ? 52  PRO A CA  1 
ATOM   417  C  C   . PRO A 1 52  ? 47.072  19.882  -2.635  1.00 26.49 ? 52  PRO A C   1 
ATOM   418  O  O   . PRO A 1 52  ? 47.649  20.817  -2.079  1.00 24.20 ? 52  PRO A O   1 
ATOM   419  C  CB  . PRO A 1 52  ? 48.885  18.332  -3.512  1.00 29.76 ? 52  PRO A CB  1 
ATOM   420  C  CG  . PRO A 1 52  ? 49.879  18.610  -4.619  1.00 30.18 ? 52  PRO A CG  1 
ATOM   421  C  CD  . PRO A 1 52  ? 49.778  20.103  -4.780  1.00 28.65 ? 52  PRO A CD  1 
ATOM   422  N  N   . VAL A 1 53  ? 45.910  19.412  -2.188  1.00 25.31 ? 53  VAL A N   1 
ATOM   423  C  CA  . VAL A 1 53  ? 45.268  20.048  -1.039  1.00 22.34 ? 53  VAL A CA  1 
ATOM   424  C  C   . VAL A 1 53  ? 46.134  20.152  0.225   1.00 22.76 ? 53  VAL A C   1 
ATOM   425  O  O   . VAL A 1 53  ? 46.057  21.152  0.938   1.00 21.74 ? 53  VAL A O   1 
ATOM   426  C  CB  . VAL A 1 53  ? 43.904  19.370  -0.701  1.00 22.03 ? 53  VAL A CB  1 
ATOM   427  C  CG1 . VAL A 1 53  ? 44.118  17.991  -0.085  1.00 18.71 ? 53  VAL A CG1 1 
ATOM   428  C  CG2 . VAL A 1 53  ? 43.095  20.276  0.216   1.00 17.01 ? 53  VAL A CG2 1 
ATOM   429  N  N   . GLU A 1 54  ? 46.970  19.151  0.498   1.00 23.58 ? 54  GLU A N   1 
ATOM   430  C  CA  . GLU A 1 54  ? 47.823  19.197  1.688   1.00 26.02 ? 54  GLU A CA  1 
ATOM   431  C  C   . GLU A 1 54  ? 48.869  20.304  1.580   1.00 26.41 ? 54  GLU A C   1 
ATOM   432  O  O   . GLU A 1 54  ? 49.390  20.783  2.588   1.00 26.48 ? 54  GLU A O   1 
ATOM   433  C  CB  . GLU A 1 54  ? 48.552  17.868  1.902   1.00 28.55 ? 54  GLU A CB  1 
ATOM   434  C  CG  . GLU A 1 54  ? 47.669  16.652  2.113   1.00 33.91 ? 54  GLU A CG  1 
ATOM   435  C  CD  . GLU A 1 54  ? 46.925  16.241  0.852   1.00 38.09 ? 54  GLU A CD  1 
ATOM   436  O  OE1 . GLU A 1 54  ? 47.434  16.513  -0.265  1.00 38.68 ? 54  GLU A OE1 1 
ATOM   437  O  OE2 . GLU A 1 54  ? 45.838  15.630  0.980   1.00 39.33 ? 54  GLU A OE2 1 
ATOM   438  N  N   . GLU A 1 55  ? 49.180  20.700  0.352   1.00 25.75 ? 55  GLU A N   1 
ATOM   439  C  CA  . GLU A 1 55  ? 50.165  21.742  0.123   1.00 27.10 ? 55  GLU A CA  1 
ATOM   440  C  C   . GLU A 1 55  ? 49.519  23.127  0.191   1.00 25.93 ? 55  GLU A C   1 
ATOM   441  O  O   . GLU A 1 55  ? 50.106  24.081  0.706   1.00 25.01 ? 55  GLU A O   1 
ATOM   442  C  CB  . GLU A 1 55  ? 50.816  21.534  -1.242  1.00 30.70 ? 55  GLU A CB  1 
ATOM   443  C  CG  . GLU A 1 55  ? 52.048  22.371  -1.474  1.00 36.92 ? 55  GLU A CG  1 
ATOM   444  C  CD  . GLU A 1 55  ? 52.714  22.039  -2.789  1.00 41.37 ? 55  GLU A CD  1 
ATOM   445  O  OE1 . GLU A 1 55  ? 53.032  20.847  -3.010  1.00 42.33 ? 55  GLU A OE1 1 
ATOM   446  O  OE2 . GLU A 1 55  ? 52.918  22.971  -3.597  1.00 43.40 ? 55  GLU A OE2 1 
ATOM   447  N  N   . LEU A 1 56  ? 48.304  23.232  -0.331  1.00 23.79 ? 56  LEU A N   1 
ATOM   448  C  CA  . LEU A 1 56  ? 47.598  24.501  -0.322  1.00 23.65 ? 56  LEU A CA  1 
ATOM   449  C  C   . LEU A 1 56  ? 47.338  25.009  1.093   1.00 22.97 ? 56  LEU A C   1 
ATOM   450  O  O   . LEU A 1 56  ? 47.403  26.212  1.336   1.00 23.61 ? 56  LEU A O   1 
ATOM   451  C  CB  . LEU A 1 56  ? 46.265  24.374  -1.065  1.00 24.46 ? 56  LEU A CB  1 
ATOM   452  C  CG  . LEU A 1 56  ? 45.379  25.627  -1.071  1.00 25.90 ? 56  LEU A CG  1 
ATOM   453  C  CD1 . LEU A 1 56  ? 45.982  26.693  -1.976  1.00 26.22 ? 56  LEU A CD1 1 
ATOM   454  C  CD2 . LEU A 1 56  ? 43.992  25.257  -1.555  1.00 25.89 ? 56  LEU A CD2 1 
ATOM   455  N  N   . ILE A 1 57  ? 47.046  24.110  2.031   1.00 21.35 ? 57  ILE A N   1 
ATOM   456  C  CA  . ILE A 1 57  ? 46.765  24.564  3.386   1.00 21.55 ? 57  ILE A CA  1 
ATOM   457  C  C   . ILE A 1 57  ? 48.007  24.962  4.178   1.00 22.69 ? 57  ILE A C   1 
ATOM   458  O  O   . ILE A 1 57  ? 47.903  25.370  5.334   1.00 22.84 ? 57  ILE A O   1 
ATOM   459  C  CB  . ILE A 1 57  ? 45.929  23.527  4.200   1.00 20.99 ? 57  ILE A CB  1 
ATOM   460  C  CG1 . ILE A 1 57  ? 46.705  22.223  4.392   1.00 21.71 ? 57  ILE A CG1 1 
ATOM   461  C  CG2 . ILE A 1 57  ? 44.608  23.263  3.493   1.00 19.00 ? 57  ILE A CG2 1 
ATOM   462  C  CD1 . ILE A 1 57  ? 46.016  21.240  5.337   1.00 18.92 ? 57  ILE A CD1 1 
ATOM   463  N  N   . THR A 1 58  ? 49.179  24.849  3.558   1.00 23.43 ? 58  THR A N   1 
ATOM   464  C  CA  . THR A 1 58  ? 50.415  25.255  4.220   1.00 25.01 ? 58  THR A CA  1 
ATOM   465  C  C   . THR A 1 58  ? 50.750  26.663  3.726   1.00 26.74 ? 58  THR A C   1 
ATOM   466  O  O   . THR A 1 58  ? 51.651  27.319  4.248   1.00 27.56 ? 58  THR A O   1 
ATOM   467  C  CB  . THR A 1 58  ? 51.607  24.321  3.877   1.00 24.21 ? 58  THR A CB  1 
ATOM   468  O  OG1 . THR A 1 58  ? 51.889  24.389  2.472   1.00 23.16 ? 58  THR A OG1 1 
ATOM   469  C  CG2 . THR A 1 58  ? 51.294  22.884  4.269   1.00 22.42 ? 58  THR A CG2 1 
ATOM   470  N  N   . LYS A 1 59  ? 50.000  27.125  2.730   1.00 27.71 ? 59  LYS A N   1 
ATOM   471  C  CA  . LYS A 1 59  ? 50.224  28.442  2.141   1.00 30.52 ? 59  LYS A CA  1 
ATOM   472  C  C   . LYS A 1 59  ? 48.999  29.349  2.201   1.00 31.47 ? 59  LYS A C   1 
ATOM   473  O  O   . LYS A 1 59  ? 48.796  30.175  1.311   1.00 31.38 ? 59  LYS A O   1 
ATOM   474  C  CB  . LYS A 1 59  ? 50.657  28.285  0.680   1.00 32.28 ? 59  LYS A CB  1 
ATOM   475  C  CG  . LYS A 1 59  ? 51.902  27.433  0.498   1.00 34.83 ? 59  LYS A CG  1 
ATOM   476  C  CD  . LYS A 1 59  ? 52.258  27.277  -0.963  1.00 38.38 ? 59  LYS A CD  1 
ATOM   477  C  CE  . LYS A 1 59  ? 53.518  26.438  -1.119  1.00 41.24 ? 59  LYS A CE  1 
ATOM   478  N  NZ  . LYS A 1 59  ? 53.891  26.276  -2.550  1.00 42.33 ? 59  LYS A NZ  1 
ATOM   479  N  N   . LEU A 1 60  ? 48.189  29.203  3.244   1.00 32.03 ? 60  LEU A N   1 
ATOM   480  C  CA  . LEU A 1 60  ? 46.986  30.015  3.385   1.00 32.88 ? 60  LEU A CA  1 
ATOM   481  C  C   . LEU A 1 60  ? 47.283  31.509  3.431   1.00 35.62 ? 60  LEU A C   1 
ATOM   482  O  O   . LEU A 1 60  ? 46.457  32.323  3.017   1.00 35.42 ? 60  LEU A O   1 
ATOM   483  C  CB  . LEU A 1 60  ? 46.221  29.617  4.645   1.00 30.30 ? 60  LEU A CB  1 
ATOM   484  C  CG  . LEU A 1 60  ? 45.624  28.211  4.665   1.00 29.81 ? 60  LEU A CG  1 
ATOM   485  C  CD1 . LEU A 1 60  ? 45.073  27.911  6.050   1.00 27.77 ? 60  LEU A CD1 1 
ATOM   486  C  CD2 . LEU A 1 60  ? 44.533  28.104  3.611   1.00 28.40 ? 60  LEU A CD2 1 
ATOM   487  N  N   . ASP A 1 61  ? 48.460  31.868  3.935   1.00 38.22 ? 61  ASP A N   1 
ATOM   488  C  CA  . ASP A 1 61  ? 48.847  33.271  4.039   1.00 40.98 ? 61  ASP A CA  1 
ATOM   489  C  C   . ASP A 1 61  ? 49.091  33.938  2.684   1.00 40.40 ? 61  ASP A C   1 
ATOM   490  O  O   . ASP A 1 61  ? 48.947  35.150  2.555   1.00 40.16 ? 61  ASP A O   1 
ATOM   491  C  CB  . ASP A 1 61  ? 50.100  33.401  4.910   1.00 45.74 ? 61  ASP A CB  1 
ATOM   492  C  CG  . ASP A 1 61  ? 49.862  32.949  6.339   1.00 50.15 ? 61  ASP A CG  1 
ATOM   493  O  OD1 . ASP A 1 61  ? 49.101  33.633  7.063   1.00 51.07 ? 61  ASP A OD1 1 
ATOM   494  O  OD2 . ASP A 1 61  ? 50.429  31.903  6.735   1.00 54.27 ? 61  ASP A OD2 1 
ATOM   495  N  N   . GLN A 1 62  ? 49.449  33.149  1.677   1.00 40.46 ? 62  GLN A N   1 
ATOM   496  C  CA  . GLN A 1 62  ? 49.716  33.685  0.346   1.00 41.75 ? 62  GLN A CA  1 
ATOM   497  C  C   . GLN A 1 62  ? 48.459  33.956  -0.479  1.00 41.90 ? 62  GLN A C   1 
ATOM   498  O  O   . GLN A 1 62  ? 48.545  34.478  -1.590  1.00 42.27 ? 62  GLN A O   1 
ATOM   499  C  CB  . GLN A 1 62  ? 50.616  32.728  -0.435  1.00 43.21 ? 62  GLN A CB  1 
ATOM   500  C  CG  . GLN A 1 62  ? 51.929  32.412  0.249   1.00 48.01 ? 62  GLN A CG  1 
ATOM   501  C  CD  . GLN A 1 62  ? 52.801  31.487  -0.578  1.00 51.35 ? 62  GLN A CD  1 
ATOM   502  O  OE1 . GLN A 1 62  ? 53.868  31.063  -0.135  1.00 54.31 ? 62  GLN A OE1 1 
ATOM   503  N  NE2 . GLN A 1 62  ? 52.350  31.171  -1.789  1.00 52.97 ? 62  GLN A NE2 1 
ATOM   504  N  N   . LEU A 1 63  ? 47.297  33.604  0.060   1.00 41.17 ? 63  LEU A N   1 
ATOM   505  C  CA  . LEU A 1 63  ? 46.033  33.798  -0.647  1.00 40.61 ? 63  LEU A CA  1 
ATOM   506  C  C   . LEU A 1 63  ? 45.430  35.175  -0.411  1.00 40.53 ? 63  LEU A C   1 
ATOM   507  O  O   . LEU A 1 63  ? 45.607  35.765  0.653   1.00 42.15 ? 63  LEU A O   1 
ATOM   508  C  CB  . LEU A 1 63  ? 45.013  32.747  -0.198  1.00 40.69 ? 63  LEU A CB  1 
ATOM   509  C  CG  . LEU A 1 63  ? 45.300  31.263  -0.434  1.00 41.31 ? 63  LEU A CG  1 
ATOM   510  C  CD1 . LEU A 1 63  ? 44.328  30.416  0.383   1.00 40.02 ? 63  LEU A CD1 1 
ATOM   511  C  CD2 . LEU A 1 63  ? 45.182  30.948  -1.913  1.00 40.02 ? 63  LEU A CD2 1 
ATOM   512  N  N   . PRO A 1 64  ? 44.704  35.709  -1.404  1.00 40.13 ? 64  PRO A N   1 
ATOM   513  C  CA  . PRO A 1 64  ? 44.088  37.027  -1.228  1.00 40.48 ? 64  PRO A CA  1 
ATOM   514  C  C   . PRO A 1 64  ? 43.146  36.986  -0.028  1.00 40.81 ? 64  PRO A C   1 
ATOM   515  O  O   . PRO A 1 64  ? 42.355  36.059  0.112   1.00 42.19 ? 64  PRO A O   1 
ATOM   516  C  CB  . PRO A 1 64  ? 43.359  37.252  -2.555  1.00 39.95 ? 64  PRO A CB  1 
ATOM   517  C  CG  . PRO A 1 64  ? 43.112  35.869  -3.064  1.00 40.25 ? 64  PRO A CG  1 
ATOM   518  C  CD  . PRO A 1 64  ? 44.397  35.160  -2.733  1.00 39.92 ? 64  PRO A CD  1 
ATOM   519  N  N   . ALA A 1 65  ? 43.244  37.991  0.832   1.00 41.26 ? 65  ALA A N   1 
ATOM   520  C  CA  . ALA A 1 65  ? 42.445  38.079  2.053   1.00 41.85 ? 65  ALA A CA  1 
ATOM   521  C  C   . ALA A 1 65  ? 40.993  37.604  1.998   1.00 42.28 ? 65  ALA A C   1 
ATOM   522  O  O   . ALA A 1 65  ? 40.508  37.005  2.957   1.00 43.04 ? 65  ALA A O   1 
ATOM   523  C  CB  . ALA A 1 65  ? 42.494  39.506  2.590   1.00 42.98 ? 65  ALA A CB  1 
ATOM   524  N  N   . ASP A 1 66  ? 40.297  37.867  0.896   1.00 42.56 ? 66  ASP A N   1 
ATOM   525  C  CA  . ASP A 1 66  ? 38.895  37.469  0.776   1.00 42.45 ? 66  ASP A CA  1 
ATOM   526  C  C   . ASP A 1 66  ? 38.684  35.981  0.506   1.00 41.17 ? 66  ASP A C   1 
ATOM   527  O  O   . ASP A 1 66  ? 37.554  35.503  0.512   1.00 42.05 ? 66  ASP A O   1 
ATOM   528  C  CB  . ASP A 1 66  ? 38.211  38.269  -0.334  1.00 45.11 ? 66  ASP A CB  1 
ATOM   529  C  CG  . ASP A 1 66  ? 38.760  37.940  -1.704  1.00 48.64 ? 66  ASP A CG  1 
ATOM   530  O  OD1 . ASP A 1 66  ? 39.962  38.194  -1.936  1.00 51.22 ? 66  ASP A OD1 1 
ATOM   531  O  OD2 . ASP A 1 66  ? 37.996  37.421  -2.546  1.00 50.80 ? 66  ASP A OD2 1 
ATOM   532  N  N   . LYS A 1 67  ? 39.767  35.253  0.262   1.00 39.26 ? 67  LYS A N   1 
ATOM   533  C  CA  . LYS A 1 67  ? 39.679  33.823  -0.015  1.00 37.04 ? 67  LYS A CA  1 
ATOM   534  C  C   . LYS A 1 67  ? 40.283  32.982  1.107   1.00 35.16 ? 67  LYS A C   1 
ATOM   535  O  O   . LYS A 1 67  ? 39.993  31.795  1.220   1.00 34.28 ? 67  LYS A O   1 
ATOM   536  C  CB  . LYS A 1 67  ? 40.403  33.492  -1.326  1.00 38.57 ? 67  LYS A CB  1 
ATOM   537  C  CG  . LYS A 1 67  ? 39.793  34.118  -2.577  1.00 40.90 ? 67  LYS A CG  1 
ATOM   538  C  CD  . LYS A 1 67  ? 38.409  33.566  -2.867  1.00 41.59 ? 67  LYS A CD  1 
ATOM   539  C  CE  . LYS A 1 67  ? 37.855  34.122  -4.170  1.00 43.26 ? 67  LYS A CE  1 
ATOM   540  N  NZ  . LYS A 1 67  ? 36.493  33.592  -4.451  1.00 44.42 ? 67  LYS A NZ  1 
ATOM   541  N  N   . LYS A 1 68  ? 41.123  33.603  1.929   1.00 33.11 ? 68  LYS A N   1 
ATOM   542  C  CA  . LYS A 1 68  ? 41.791  32.915  3.025   1.00 32.01 ? 68  LYS A CA  1 
ATOM   543  C  C   . LYS A 1 68  ? 40.872  32.056  3.902   1.00 29.52 ? 68  LYS A C   1 
ATOM   544  O  O   . LYS A 1 68  ? 41.140  30.873  4.110   1.00 28.91 ? 68  LYS A O   1 
ATOM   545  C  CB  . LYS A 1 68  ? 42.541  33.933  3.892   1.00 34.53 ? 68  LYS A CB  1 
ATOM   546  C  CG  . LYS A 1 68  ? 43.494  33.307  4.900   1.00 39.01 ? 68  LYS A CG  1 
ATOM   547  C  CD  . LYS A 1 68  ? 44.299  34.364  5.659   1.00 42.68 ? 68  LYS A CD  1 
ATOM   548  C  CE  . LYS A 1 68  ? 45.238  33.719  6.680   1.00 44.85 ? 68  LYS A CE  1 
ATOM   549  N  NZ  . LYS A 1 68  ? 46.066  34.716  7.427   1.00 46.49 ? 68  LYS A NZ  1 
ATOM   550  N  N   . THR A 1 69  ? 39.789  32.640  4.406   1.00 26.40 ? 69  THR A N   1 
ATOM   551  C  CA  . THR A 1 69  ? 38.863  31.915  5.277   1.00 24.32 ? 69  THR A CA  1 
ATOM   552  C  C   . THR A 1 69  ? 38.088  30.778  4.605   1.00 24.06 ? 69  THR A C   1 
ATOM   553  O  O   . THR A 1 69  ? 38.004  29.672  5.147   1.00 21.40 ? 69  THR A O   1 
ATOM   554  C  CB  . THR A 1 69  ? 37.831  32.875  5.918   1.00 24.49 ? 69  THR A CB  1 
ATOM   555  O  OG1 . THR A 1 69  ? 38.517  33.863  6.693   1.00 26.67 ? 69  THR A OG1 1 
ATOM   556  C  CG2 . THR A 1 69  ? 36.868  32.110  6.826   1.00 23.41 ? 69  THR A CG2 1 
ATOM   557  N  N   . VAL A 1 70  ? 37.515  31.046  3.436   1.00 21.71 ? 70  VAL A N   1 
ATOM   558  C  CA  . VAL A 1 70  ? 36.747  30.020  2.748   1.00 20.84 ? 70  VAL A CA  1 
ATOM   559  C  C   . VAL A 1 70  ? 37.605  28.786  2.433   1.00 19.95 ? 70  VAL A C   1 
ATOM   560  O  O   . VAL A 1 70  ? 37.132  27.653  2.546   1.00 18.38 ? 70  VAL A O   1 
ATOM   561  C  CB  . VAL A 1 70  ? 36.081  30.581  1.452   1.00 20.87 ? 70  VAL A CB  1 
ATOM   562  C  CG1 . VAL A 1 70  ? 37.137  31.018  0.452   1.00 22.10 ? 70  VAL A CG1 1 
ATOM   563  C  CG2 . VAL A 1 70  ? 35.163  29.532  0.843   1.00 20.17 ? 70  VAL A CG2 1 
ATOM   564  N  N   . LEU A 1 71  ? 38.866  28.997  2.068   1.00 18.01 ? 71  LEU A N   1 
ATOM   565  C  CA  . LEU A 1 71  ? 39.742  27.872  1.755   1.00 18.00 ? 71  LEU A CA  1 
ATOM   566  C  C   . LEU A 1 71  ? 40.275  27.191  3.012   1.00 16.88 ? 71  LEU A C   1 
ATOM   567  O  O   . LEU A 1 71  ? 40.456  25.977  3.034   1.00 17.15 ? 71  LEU A O   1 
ATOM   568  C  CB  . LEU A 1 71  ? 40.873  28.333  0.828   1.00 16.31 ? 71  LEU A CB  1 
ATOM   569  C  CG  . LEU A 1 71  ? 40.337  28.594  -0.592  1.00 14.85 ? 71  LEU A CG  1 
ATOM   570  C  CD1 . LEU A 1 71  ? 41.410  29.223  -1.463  1.00 16.51 ? 71  LEU A CD1 1 
ATOM   571  C  CD2 . LEU A 1 71  ? 39.860  27.282  -1.202  1.00 12.11 ? 71  LEU A CD2 1 
ATOM   572  N  N   . ARG A 1 72  ? 40.504  27.975  4.062   1.00 17.27 ? 72  ARG A N   1 
ATOM   573  C  CA  . ARG A 1 72  ? 40.972  27.433  5.329   1.00 15.62 ? 72  ARG A CA  1 
ATOM   574  C  C   . ARG A 1 72  ? 39.938  26.419  5.803   1.00 15.48 ? 72  ARG A C   1 
ATOM   575  O  O   . ARG A 1 72  ? 40.277  25.310  6.215   1.00 16.18 ? 72  ARG A O   1 
ATOM   576  C  CB  . ARG A 1 72  ? 41.091  28.550  6.361   1.00 14.66 ? 72  ARG A CB  1 
ATOM   577  C  CG  . ARG A 1 72  ? 41.276  28.067  7.783   1.00 15.45 ? 72  ARG A CG  1 
ATOM   578  C  CD  . ARG A 1 72  ? 41.201  29.240  8.742   1.00 15.89 ? 72  ARG A CD  1 
ATOM   579  N  NE  . ARG A 1 72  ? 41.387  28.838  10.131  1.00 16.06 ? 72  ARG A NE  1 
ATOM   580  C  CZ  . ARG A 1 72  ? 41.559  29.694  11.134  1.00 18.51 ? 72  ARG A CZ  1 
ATOM   581  N  NH1 . ARG A 1 72  ? 41.571  31.001  10.902  1.00 18.17 ? 72  ARG A NH1 1 
ATOM   582  N  NH2 . ARG A 1 72  ? 41.722  29.248  12.371  1.00 19.42 ? 72  ARG A NH2 1 
ATOM   583  N  N   . ASN A 1 73  ? 38.670  26.808  5.731   1.00 14.66 ? 73  ASN A N   1 
ATOM   584  C  CA  . ASN A 1 73  ? 37.579  25.941  6.162   1.00 14.82 ? 73  ASN A CA  1 
ATOM   585  C  C   . ASN A 1 73  ? 37.290  24.758  5.233   1.00 15.27 ? 73  ASN A C   1 
ATOM   586  O  O   . ASN A 1 73  ? 37.129  23.628  5.688   1.00 15.26 ? 73  ASN A O   1 
ATOM   587  C  CB  . ASN A 1 73  ? 36.288  26.752  6.341   1.00 12.96 ? 73  ASN A CB  1 
ATOM   588  C  CG  . ASN A 1 73  ? 36.354  27.704  7.522   1.00 15.17 ? 73  ASN A CG  1 
ATOM   589  O  OD1 . ASN A 1 73  ? 37.141  27.510  8.452   1.00 17.46 ? 73  ASN A OD1 1 
ATOM   590  N  ND2 . ASN A 1 73  ? 35.512  28.729  7.502   1.00 13.20 ? 73  ASN A ND2 1 
ATOM   591  N  N   . ASN A 1 74  ? 37.230  25.015  3.932   1.00 14.89 ? 74  ASN A N   1 
ATOM   592  C  CA  . ASN A 1 74  ? 36.907  23.959  2.983   1.00 14.70 ? 74  ASN A CA  1 
ATOM   593  C  C   . ASN A 1 74  ? 38.067  23.107  2.500   1.00 14.05 ? 74  ASN A C   1 
ATOM   594  O  O   . ASN A 1 74  ? 37.923  21.885  2.384   1.00 14.85 ? 74  ASN A O   1 
ATOM   595  C  CB  . ASN A 1 74  ? 36.120  24.564  1.819   1.00 12.85 ? 74  ASN A CB  1 
ATOM   596  C  CG  . ASN A 1 74  ? 34.737  25.037  2.255   1.00 13.44 ? 74  ASN A CG  1 
ATOM   597  O  OD1 . ASN A 1 74  ? 33.840  24.230  2.470   1.00 18.73 ? 74  ASN A OD1 1 
ATOM   598  N  ND2 . ASN A 1 74  ? 34.572  26.340  2.418   1.00 13.14 ? 74  ASN A ND2 1 
ATOM   599  N  N   . ALA A 1 75  ? 39.210  23.725  2.220   1.00 12.48 ? 75  ALA A N   1 
ATOM   600  C  CA  . ALA A 1 75  ? 40.369  22.949  1.800   1.00 12.34 ? 75  ALA A CA  1 
ATOM   601  C  C   . ALA A 1 75  ? 40.801  22.172  3.049   1.00 12.20 ? 75  ALA A C   1 
ATOM   602  O  O   . ALA A 1 75  ? 41.235  21.026  2.962   1.00 13.35 ? 75  ALA A O   1 
ATOM   603  C  CB  . ALA A 1 75  ? 41.474  23.872  1.319   1.00 12.07 ? 75  ALA A CB  1 
ATOM   604  N  N   . GLY A 1 76  ? 40.667  22.810  4.212   1.00 12.23 ? 76  GLY A N   1 
ATOM   605  C  CA  . GLY A 1 76  ? 41.006  22.152  5.461   1.00 11.84 ? 76  GLY A CA  1 
ATOM   606  C  C   . GLY A 1 76  ? 40.083  20.958  5.656   1.00 11.89 ? 76  GLY A C   1 
ATOM   607  O  O   . GLY A 1 76  ? 40.525  19.868  6.014   1.00 10.54 ? 76  GLY A O   1 
ATOM   608  N  N   . GLY A 1 77  ? 38.792  21.160  5.402   1.00 12.32 ? 77  GLY A N   1 
ATOM   609  C  CA  . GLY A 1 77  ? 37.832  20.076  5.542   1.00 11.91 ? 77  GLY A CA  1 
ATOM   610  C  C   . GLY A 1 77  ? 38.139  18.922  4.600   1.00 12.63 ? 77  GLY A C   1 
ATOM   611  O  O   . GLY A 1 77  ? 37.987  17.755  4.959   1.00 11.69 ? 77  GLY A O   1 
ATOM   612  N  N   . HIS A 1 78  ? 38.572  19.248  3.386   1.00 13.03 ? 78  HIS A N   1 
ATOM   613  C  CA  . HIS A 1 78  ? 38.909  18.231  2.394   1.00 13.37 ? 78  HIS A CA  1 
ATOM   614  C  C   . HIS A 1 78  ? 40.154  17.440  2.827   1.00 14.00 ? 78  HIS A C   1 
ATOM   615  O  O   . HIS A 1 78  ? 40.172  16.202  2.779   1.00 12.84 ? 78  HIS A O   1 
ATOM   616  C  CB  . HIS A 1 78  ? 39.135  18.901  1.035   1.00 13.41 ? 78  HIS A CB  1 
ATOM   617  C  CG  . HIS A 1 78  ? 39.546  17.958  -0.052  1.00 13.94 ? 78  HIS A CG  1 
ATOM   618  N  ND1 . HIS A 1 78  ? 38.947  16.730  -0.240  1.00 13.85 ? 78  HIS A ND1 1 
ATOM   619  C  CD2 . HIS A 1 78  ? 40.468  18.082  -1.035  1.00 13.14 ? 78  HIS A CD2 1 
ATOM   620  C  CE1 . HIS A 1 78  ? 39.481  16.139  -1.294  1.00 13.73 ? 78  HIS A CE1 1 
ATOM   621  N  NE2 . HIS A 1 78  ? 40.405  16.938  -1.795  1.00 14.24 ? 78  HIS A NE2 1 
ATOM   622  N  N   . ALA A 1 79  ? 41.187  18.158  3.261   1.00 12.81 ? 79  ALA A N   1 
ATOM   623  C  CA  . ALA A 1 79  ? 42.421  17.522  3.709   1.00 12.90 ? 79  ALA A CA  1 
ATOM   624  C  C   . ALA A 1 79  ? 42.185  16.623  4.923   1.00 12.83 ? 79  ALA A C   1 
ATOM   625  O  O   . ALA A 1 79  ? 42.628  15.473  4.949   1.00 14.12 ? 79  ALA A O   1 
ATOM   626  C  CB  . ALA A 1 79  ? 43.462  18.584  4.047   1.00 11.92 ? 79  ALA A CB  1 
ATOM   627  N  N   . ASN A 1 80  ? 41.484  17.144  5.924   1.00 10.79 ? 80  ASN A N   1 
ATOM   628  C  CA  . ASN A 1 80  ? 41.222  16.375  7.133   1.00 11.59 ? 80  ASN A CA  1 
ATOM   629  C  C   . ASN A 1 80  ? 40.440  15.095  6.902   1.00 11.12 ? 80  ASN A C   1 
ATOM   630  O  O   . ASN A 1 80  ? 40.821  14.041  7.406   1.00 10.36 ? 80  ASN A O   1 
ATOM   631  C  CB  . ASN A 1 80  ? 40.496  17.235  8.171   1.00 11.81 ? 80  ASN A CB  1 
ATOM   632  C  CG  . ASN A 1 80  ? 41.349  18.376  8.657   1.00 12.95 ? 80  ASN A CG  1 
ATOM   633  O  OD1 . ASN A 1 80  ? 42.573  18.335  8.534   1.00 10.84 ? 80  ASN A OD1 1 
ATOM   634  N  ND2 . ASN A 1 80  ? 40.713  19.399  9.222   1.00 14.66 ? 80  ASN A ND2 1 
ATOM   635  N  N   . HIS A 1 81  ? 39.351  15.177  6.146   1.00 10.29 ? 81  HIS A N   1 
ATOM   636  C  CA  . HIS A 1 81  ? 38.546  13.992  5.892   1.00 12.47 ? 81  HIS A CA  1 
ATOM   637  C  C   . HIS A 1 81  ? 39.249  12.972  5.004   1.00 13.75 ? 81  HIS A C   1 
ATOM   638  O  O   . HIS A 1 81  ? 39.068  11.766  5.183   1.00 15.54 ? 81  HIS A O   1 
ATOM   639  C  CB  . HIS A 1 81  ? 37.179  14.379  5.309   1.00 10.01 ? 81  HIS A CB  1 
ATOM   640  C  CG  . HIS A 1 81  ? 36.278  15.038  6.308   1.00 11.64 ? 81  HIS A CG  1 
ATOM   641  N  ND1 . HIS A 1 81  ? 36.436  16.349  6.704   1.00 10.45 ? 81  HIS A ND1 1 
ATOM   642  C  CD2 . HIS A 1 81  ? 35.260  14.543  7.052   1.00 12.34 ? 81  HIS A CD2 1 
ATOM   643  C  CE1 . HIS A 1 81  ? 35.557  16.633  7.649   1.00 13.14 ? 81  HIS A CE1 1 
ATOM   644  N  NE2 . HIS A 1 81  ? 34.831  15.554  7.879   1.00 14.27 ? 81  HIS A NE2 1 
ATOM   645  N  N   . SER A 1 82  ? 40.052  13.443  4.057   1.00 12.72 ? 82  SER A N   1 
ATOM   646  C  CA  . SER A 1 82  ? 40.780  12.529  3.183   1.00 14.60 ? 82  SER A CA  1 
ATOM   647  C  C   . SER A 1 82  ? 41.704  11.676  4.046   1.00 15.21 ? 82  SER A C   1 
ATOM   648  O  O   . SER A 1 82  ? 41.829  10.465  3.850   1.00 14.96 ? 82  SER A O   1 
ATOM   649  C  CB  . SER A 1 82  ? 41.625  13.302  2.164   1.00 13.46 ? 82  SER A CB  1 
ATOM   650  O  OG  . SER A 1 82  ? 40.810  14.022  1.267   1.00 12.94 ? 82  SER A OG  1 
ATOM   651  N  N   . LEU A 1 83  ? 42.348  12.328  5.006   1.00 14.95 ? 83  LEU A N   1 
ATOM   652  C  CA  . LEU A 1 83  ? 43.260  11.650  5.907   1.00 17.28 ? 83  LEU A CA  1 
ATOM   653  C  C   . LEU A 1 83  ? 42.484  10.733  6.852   1.00 16.18 ? 83  LEU A C   1 
ATOM   654  O  O   . LEU A 1 83  ? 42.936  9.637   7.181   1.00 16.32 ? 83  LEU A O   1 
ATOM   655  C  CB  . LEU A 1 83  ? 44.073  12.694  6.683   1.00 19.28 ? 83  LEU A CB  1 
ATOM   656  C  CG  . LEU A 1 83  ? 45.125  12.210  7.682   1.00 22.90 ? 83  LEU A CG  1 
ATOM   657  C  CD1 . LEU A 1 83  ? 46.252  13.222  7.776   1.00 25.28 ? 83  LEU A CD1 1 
ATOM   658  C  CD2 . LEU A 1 83  ? 44.480  12.000  9.039   1.00 25.82 ? 83  LEU A CD2 1 
ATOM   659  N  N   . PHE A 1 84  ? 41.300  11.175  7.257   1.00 15.26 ? 84  PHE A N   1 
ATOM   660  C  CA  . PHE A 1 84  ? 40.457  10.405  8.165   1.00 14.01 ? 84  PHE A CA  1 
ATOM   661  C  C   . PHE A 1 84  ? 40.018  9.053   7.572   1.00 13.54 ? 84  PHE A C   1 
ATOM   662  O  O   . PHE A 1 84  ? 40.131  8.021   8.238   1.00 12.43 ? 84  PHE A O   1 
ATOM   663  C  CB  . PHE A 1 84  ? 39.235  11.249  8.558   1.00 11.33 ? 84  PHE A CB  1 
ATOM   664  C  CG  . PHE A 1 84  ? 38.392  10.643  9.645   1.00 12.12 ? 84  PHE A CG  1 
ATOM   665  C  CD1 . PHE A 1 84  ? 38.934  10.377  10.904  1.00 11.74 ? 84  PHE A CD1 1 
ATOM   666  C  CD2 . PHE A 1 84  ? 37.041  10.368  9.424   1.00 13.11 ? 84  PHE A CD2 1 
ATOM   667  C  CE1 . PHE A 1 84  ? 38.146  9.848   11.928  1.00 11.34 ? 84  PHE A CE1 1 
ATOM   668  C  CE2 . PHE A 1 84  ? 36.242  9.840   10.440  1.00 12.10 ? 84  PHE A CE2 1 
ATOM   669  C  CZ  . PHE A 1 84  ? 36.800  9.580   11.698  1.00 11.77 ? 84  PHE A CZ  1 
ATOM   670  N  N   . TRP A 1 85  ? 39.536  9.053   6.331   1.00 12.84 ? 85  TRP A N   1 
ATOM   671  C  CA  . TRP A 1 85  ? 39.078  7.815   5.695   1.00 14.28 ? 85  TRP A CA  1 
ATOM   672  C  C   . TRP A 1 85  ? 40.189  6.772   5.635   1.00 16.53 ? 85  TRP A C   1 
ATOM   673  O  O   . TRP A 1 85  ? 39.957  5.593   5.904   1.00 19.05 ? 85  TRP A O   1 
ATOM   674  C  CB  . TRP A 1 85  ? 38.575  8.093   4.278   1.00 11.21 ? 85  TRP A CB  1 
ATOM   675  C  CG  . TRP A 1 85  ? 37.520  9.159   4.199   1.00 12.28 ? 85  TRP A CG  1 
ATOM   676  C  CD1 . TRP A 1 85  ? 37.459  10.187  3.295   1.00 11.72 ? 85  TRP A CD1 1 
ATOM   677  C  CD2 . TRP A 1 85  ? 36.385  9.313   5.056   1.00 10.76 ? 85  TRP A CD2 1 
ATOM   678  N  NE1 . TRP A 1 85  ? 36.360  10.971  3.541   1.00 12.62 ? 85  TRP A NE1 1 
ATOM   679  C  CE2 . TRP A 1 85  ? 35.683  10.460  4.617   1.00 12.86 ? 85  TRP A CE2 1 
ATOM   680  C  CE3 . TRP A 1 85  ? 35.891  8.595   6.156   1.00 13.38 ? 85  TRP A CE3 1 
ATOM   681  C  CZ2 . TRP A 1 85  ? 34.511  10.909  5.241   1.00 9.50  ? 85  TRP A CZ2 1 
ATOM   682  C  CZ3 . TRP A 1 85  ? 34.723  9.042   6.775   1.00 11.85 ? 85  TRP A CZ3 1 
ATOM   683  C  CH2 . TRP A 1 85  ? 34.050  10.190  6.313   1.00 10.32 ? 85  TRP A CH2 1 
ATOM   684  N  N   . LYS A 1 86  ? 41.397  7.208   5.286   1.00 17.50 ? 86  LYS A N   1 
ATOM   685  C  CA  . LYS A 1 86  ? 42.535  6.300   5.187   1.00 19.62 ? 86  LYS A CA  1 
ATOM   686  C  C   . LYS A 1 86  ? 43.040  5.828   6.544   1.00 19.19 ? 86  LYS A C   1 
ATOM   687  O  O   . LYS A 1 86  ? 43.729  4.819   6.632   1.00 19.05 ? 86  LYS A O   1 
ATOM   688  C  CB  . LYS A 1 86  ? 43.699  6.966   4.451   1.00 22.17 ? 86  LYS A CB  1 
ATOM   689  C  CG  . LYS A 1 86  ? 43.478  7.216   2.979   1.00 27.42 ? 86  LYS A CG  1 
ATOM   690  C  CD  . LYS A 1 86  ? 44.756  7.764   2.359   1.00 32.79 ? 86  LYS A CD  1 
ATOM   691  C  CE  . LYS A 1 86  ? 44.573  8.092   0.887   1.00 36.78 ? 86  LYS A CE  1 
ATOM   692  N  NZ  . LYS A 1 86  ? 45.849  8.569   0.276   1.00 40.53 ? 86  LYS A NZ  1 
ATOM   693  N  N   . GLY A 1 87  ? 42.705  6.564   7.596   1.00 18.95 ? 87  GLY A N   1 
ATOM   694  C  CA  . GLY A 1 87  ? 43.158  6.195   8.922   1.00 17.22 ? 87  GLY A CA  1 
ATOM   695  C  C   . GLY A 1 87  ? 42.234  5.250   9.660   1.00 17.10 ? 87  GLY A C   1 
ATOM   696  O  O   . GLY A 1 87  ? 42.434  4.991   10.844  1.00 17.87 ? 87  GLY A O   1 
ATOM   697  N  N   . LEU A 1 88  ? 41.223  4.730   8.973   1.00 16.69 ? 88  LEU A N   1 
ATOM   698  C  CA  . LEU A 1 88  ? 40.282  3.814   9.603   1.00 17.37 ? 88  LEU A CA  1 
ATOM   699  C  C   . LEU A 1 88  ? 40.365  2.434   8.967   1.00 20.30 ? 88  LEU A C   1 
ATOM   700  O  O   . LEU A 1 88  ? 40.504  2.311   7.749   1.00 21.06 ? 88  LEU A O   1 
ATOM   701  C  CB  . LEU A 1 88  ? 38.853  4.351   9.487   1.00 14.03 ? 88  LEU A CB  1 
ATOM   702  C  CG  . LEU A 1 88  ? 38.585  5.731   10.105  1.00 14.64 ? 88  LEU A CG  1 
ATOM   703  C  CD1 . LEU A 1 88  ? 37.180  6.189   9.745   1.00 10.92 ? 88  LEU A CD1 1 
ATOM   704  C  CD2 . LEU A 1 88  ? 38.763  5.677   11.611  1.00 9.55  ? 88  LEU A CD2 1 
ATOM   705  N  N   . LYS A 1 89  ? 40.281  1.401   9.801   1.00 22.84 ? 89  LYS A N   1 
ATOM   706  C  CA  . LYS A 1 89  ? 40.341  0.015   9.339   1.00 24.15 ? 89  LYS A CA  1 
ATOM   707  C  C   . LYS A 1 89  ? 40.290  -0.945  10.524  1.00 24.60 ? 89  LYS A C   1 
ATOM   708  O  O   . LYS A 1 89  ? 40.934  -0.707  11.548  1.00 24.45 ? 89  LYS A O   1 
ATOM   709  C  CB  . LYS A 1 89  ? 41.632  -0.216  8.555   1.00 24.17 ? 89  LYS A CB  1 
ATOM   710  C  CG  . LYS A 1 89  ? 41.714  -1.557  7.862   1.00 26.83 ? 89  LYS A CG  1 
ATOM   711  C  CD  . LYS A 1 89  ? 43.097  -1.758  7.272   1.00 30.63 ? 89  LYS A CD  1 
ATOM   712  C  CE  . LYS A 1 89  ? 43.181  -3.063  6.515   1.00 33.91 ? 89  LYS A CE  1 
ATOM   713  N  NZ  . LYS A 1 89  ? 44.551  -3.258  5.960   1.00 39.15 ? 89  LYS A NZ  1 
ATOM   714  N  N   . LYS A 1 90  ? 39.523  -2.023  10.389  1.00 24.83 ? 90  LYS A N   1 
ATOM   715  C  CA  . LYS A 1 90  ? 39.414  -3.019  11.448  1.00 24.25 ? 90  LYS A CA  1 
ATOM   716  C  C   . LYS A 1 90  ? 40.516  -4.058  11.333  1.00 24.57 ? 90  LYS A C   1 
ATOM   717  O  O   . LYS A 1 90  ? 41.056  -4.285  10.249  1.00 24.22 ? 90  LYS A O   1 
ATOM   718  C  CB  . LYS A 1 90  ? 38.070  -3.736  11.370  1.00 24.98 ? 90  LYS A CB  1 
ATOM   719  C  CG  . LYS A 1 90  ? 36.891  -2.931  11.862  1.00 27.75 ? 90  LYS A CG  1 
ATOM   720  C  CD  . LYS A 1 90  ? 35.582  -3.670  11.603  1.00 31.21 ? 90  LYS A CD  1 
ATOM   721  C  CE  . LYS A 1 90  ? 35.541  -5.023  12.294  1.00 31.24 ? 90  LYS A CE  1 
ATOM   722  N  NZ  . LYS A 1 90  ? 34.227  -5.690  12.097  1.00 31.95 ? 90  LYS A NZ  1 
ATOM   723  N  N   . GLY A 1 91  ? 40.861  -4.672  12.459  1.00 25.04 ? 91  GLY A N   1 
ATOM   724  C  CA  . GLY A 1 91  ? 41.859  -5.728  12.452  1.00 26.49 ? 91  GLY A CA  1 
ATOM   725  C  C   . GLY A 1 91  ? 43.341  -5.412  12.466  1.00 27.86 ? 91  GLY A C   1 
ATOM   726  O  O   . GLY A 1 91  ? 44.152  -6.325  12.295  1.00 29.19 ? 91  GLY A O   1 
ATOM   727  N  N   . THR A 1 92  ? 43.723  -4.154  12.653  1.00 26.28 ? 92  THR A N   1 
ATOM   728  C  CA  . THR A 1 92  ? 45.145  -3.843  12.688  1.00 24.45 ? 92  THR A CA  1 
ATOM   729  C  C   . THR A 1 92  ? 45.600  -3.858  14.137  1.00 25.44 ? 92  THR A C   1 
ATOM   730  O  O   . THR A 1 92  ? 44.780  -3.872  15.049  1.00 25.63 ? 92  THR A O   1 
ATOM   731  C  CB  . THR A 1 92  ? 45.446  -2.467  12.083  1.00 23.24 ? 92  THR A CB  1 
ATOM   732  O  OG1 . THR A 1 92  ? 45.005  -1.440  12.981  1.00 21.51 ? 92  THR A OG1 1 
ATOM   733  C  CG2 . THR A 1 92  ? 44.735  -2.316  10.739  1.00 21.81 ? 92  THR A CG2 1 
ATOM   734  N  N   . THR A 1 93  ? 46.907  -3.864  14.351  1.00 27.43 ? 93  THR A N   1 
ATOM   735  C  CA  . THR A 1 93  ? 47.443  -3.870  15.703  1.00 30.33 ? 93  THR A CA  1 
ATOM   736  C  C   . THR A 1 93  ? 48.647  -2.942  15.802  1.00 30.31 ? 93  THR A C   1 
ATOM   737  O  O   . THR A 1 93  ? 49.486  -2.899  14.902  1.00 30.20 ? 93  THR A O   1 
ATOM   738  C  CB  . THR A 1 93  ? 47.866  -5.291  16.121  1.00 31.83 ? 93  THR A CB  1 
ATOM   739  O  OG1 . THR A 1 93  ? 48.690  -5.858  15.098  1.00 35.37 ? 93  THR A OG1 1 
ATOM   740  C  CG2 . THR A 1 93  ? 46.648  -6.178  16.319  1.00 34.01 ? 93  THR A CG2 1 
ATOM   741  N  N   . LEU A 1 94  ? 48.719  -2.191  16.894  1.00 30.16 ? 94  LEU A N   1 
ATOM   742  C  CA  . LEU A 1 94  ? 49.824  -1.271  17.112  1.00 30.99 ? 94  LEU A CA  1 
ATOM   743  C  C   . LEU A 1 94  ? 51.096  -2.076  17.378  1.00 33.60 ? 94  LEU A C   1 
ATOM   744  O  O   . LEU A 1 94  ? 51.106  -2.971  18.223  1.00 33.45 ? 94  LEU A O   1 
ATOM   745  C  CB  . LEU A 1 94  ? 49.511  -0.365  18.300  1.00 26.31 ? 94  LEU A CB  1 
ATOM   746  C  CG  . LEU A 1 94  ? 50.582  0.652   18.682  1.00 25.99 ? 94  LEU A CG  1 
ATOM   747  C  CD1 . LEU A 1 94  ? 50.892  1.564   17.494  1.00 24.11 ? 94  LEU A CD1 1 
ATOM   748  C  CD2 . LEU A 1 94  ? 50.088  1.455   19.877  1.00 24.58 ? 94  LEU A CD2 1 
ATOM   749  N  N   . GLN A 1 95  ? 52.167  -1.758  16.656  1.00 36.25 ? 95  GLN A N   1 
ATOM   750  C  CA  . GLN A 1 95  ? 53.424  -2.476  16.819  1.00 37.74 ? 95  GLN A CA  1 
ATOM   751  C  C   . GLN A 1 95  ? 54.576  -1.781  16.107  1.00 37.79 ? 95  GLN A C   1 
ATOM   752  O  O   . GLN A 1 95  ? 54.404  -0.708  15.526  1.00 38.37 ? 95  GLN A O   1 
ATOM   753  C  CB  . GLN A 1 95  ? 53.267  -3.890  16.272  1.00 39.91 ? 95  GLN A CB  1 
ATOM   754  C  CG  . GLN A 1 95  ? 52.909  -3.929  14.797  1.00 42.98 ? 95  GLN A CG  1 
ATOM   755  C  CD  . GLN A 1 95  ? 52.462  -5.303  14.347  1.00 45.81 ? 95  GLN A CD  1 
ATOM   756  O  OE1 . GLN A 1 95  ? 52.265  -5.545  13.155  1.00 46.59 ? 95  GLN A OE1 1 
ATOM   757  N  NE2 . GLN A 1 95  ? 52.289  -6.214  15.302  1.00 47.53 ? 95  GLN A NE2 1 
ATOM   758  N  N   . GLY A 1 96  ? 55.754  -2.397  16.163  1.00 37.65 ? 96  GLY A N   1 
ATOM   759  C  CA  . GLY A 1 96  ? 56.919  -1.836  15.500  1.00 37.14 ? 96  GLY A CA  1 
ATOM   760  C  C   . GLY A 1 96  ? 57.467  -0.552  16.087  1.00 36.59 ? 96  GLY A C   1 
ATOM   761  O  O   . GLY A 1 96  ? 57.315  -0.283  17.281  1.00 36.58 ? 96  GLY A O   1 
ATOM   762  N  N   . ASP A 1 97  ? 58.105  0.245   15.236  1.00 36.47 ? 97  ASP A N   1 
ATOM   763  C  CA  . ASP A 1 97  ? 58.703  1.503   15.657  1.00 37.70 ? 97  ASP A CA  1 
ATOM   764  C  C   . ASP A 1 97  ? 57.699  2.512   16.217  1.00 36.90 ? 97  ASP A C   1 
ATOM   765  O  O   . ASP A 1 97  ? 58.024  3.255   17.144  1.00 36.83 ? 97  ASP A O   1 
ATOM   766  C  CB  . ASP A 1 97  ? 59.488  2.120   14.494  1.00 41.30 ? 97  ASP A CB  1 
ATOM   767  C  CG  . ASP A 1 97  ? 60.581  1.190   13.969  1.00 45.48 ? 97  ASP A CG  1 
ATOM   768  O  OD1 . ASP A 1 97  ? 61.344  0.634   14.793  1.00 46.45 ? 97  ASP A OD1 1 
ATOM   769  O  OD2 . ASP A 1 97  ? 60.681  1.020   12.733  1.00 47.20 ? 97  ASP A OD2 1 
ATOM   770  N  N   . LEU A 1 98  ? 56.487  2.538   15.666  1.00 34.70 ? 98  LEU A N   1 
ATOM   771  C  CA  . LEU A 1 98  ? 55.466  3.470   16.144  1.00 33.36 ? 98  LEU A CA  1 
ATOM   772  C  C   . LEU A 1 98  ? 55.116  3.170   17.597  1.00 32.03 ? 98  LEU A C   1 
ATOM   773  O  O   . LEU A 1 98  ? 55.031  4.072   18.426  1.00 29.76 ? 98  LEU A O   1 
ATOM   774  C  CB  . LEU A 1 98  ? 54.200  3.378   15.281  1.00 31.17 ? 98  LEU A CB  1 
ATOM   775  C  CG  . LEU A 1 98  ? 53.063  4.310   15.711  1.00 28.94 ? 98  LEU A CG  1 
ATOM   776  C  CD1 . LEU A 1 98  ? 53.532  5.759   15.636  1.00 26.08 ? 98  LEU A CD1 1 
ATOM   777  C  CD2 . LEU A 1 98  ? 51.849  4.078   14.824  1.00 26.84 ? 98  LEU A CD2 1 
ATOM   778  N  N   . LYS A 1 99  ? 54.915  1.891   17.896  1.00 32.94 ? 99  LYS A N   1 
ATOM   779  C  CA  . LYS A 1 99  ? 54.586  1.461   19.248  1.00 33.82 ? 99  LYS A CA  1 
ATOM   780  C  C   . LYS A 1 99  ? 55.707  1.842   20.209  1.00 33.76 ? 99  LYS A C   1 
ATOM   781  O  O   . LYS A 1 99  ? 55.458  2.237   21.349  1.00 34.19 ? 99  LYS A O   1 
ATOM   782  C  CB  . LYS A 1 99  ? 54.369  -0.052  19.270  1.00 34.12 ? 99  LYS A CB  1 
ATOM   783  C  CG  . LYS A 1 99  ? 54.043  -0.633  20.634  1.00 34.71 ? 99  LYS A CG  1 
ATOM   784  C  CD  . LYS A 1 99  ? 53.535  -2.062  20.485  1.00 36.76 ? 99  LYS A CD  1 
ATOM   785  C  CE  . LYS A 1 99  ? 53.227  -2.701  21.826  1.00 36.42 ? 99  LYS A CE  1 
ATOM   786  N  NZ  . LYS A 1 99  ? 54.467  -2.938  22.601  1.00 39.54 ? 99  LYS A NZ  1 
ATOM   787  N  N   . ALA A 1 100 ? 56.944  1.729   19.736  1.00 33.56 ? 100 ALA A N   1 
ATOM   788  C  CA  . ALA A 1 100 ? 58.107  2.062   20.549  1.00 33.47 ? 100 ALA A CA  1 
ATOM   789  C  C   . ALA A 1 100 ? 58.166  3.562   20.817  1.00 31.99 ? 100 ALA A C   1 
ATOM   790  O  O   . ALA A 1 100 ? 58.428  3.989   21.942  1.00 32.03 ? 100 ALA A O   1 
ATOM   791  C  CB  . ALA A 1 100 ? 59.383  1.603   19.847  1.00 33.17 ? 100 ALA A CB  1 
ATOM   792  N  N   . ALA A 1 101 ? 57.921  4.355   19.779  1.00 30.22 ? 101 ALA A N   1 
ATOM   793  C  CA  . ALA A 1 101 ? 57.950  5.805   19.895  1.00 30.17 ? 101 ALA A CA  1 
ATOM   794  C  C   . ALA A 1 101 ? 56.870  6.296   20.859  1.00 30.12 ? 101 ALA A C   1 
ATOM   795  O  O   . ALA A 1 101 ? 57.080  7.248   21.615  1.00 30.87 ? 101 ALA A O   1 
ATOM   796  C  CB  . ALA A 1 101 ? 57.757  6.435   18.521  1.00 28.72 ? 101 ALA A CB  1 
ATOM   797  N  N   . ILE A 1 102 ? 55.715  5.641   20.830  1.00 28.40 ? 102 ILE A N   1 
ATOM   798  C  CA  . ILE A 1 102 ? 54.608  6.012   21.698  1.00 28.27 ? 102 ILE A CA  1 
ATOM   799  C  C   . ILE A 1 102 ? 54.961  5.752   23.161  1.00 29.89 ? 102 ILE A C   1 
ATOM   800  O  O   . ILE A 1 102 ? 54.741  6.604   24.023  1.00 28.98 ? 102 ILE A O   1 
ATOM   801  C  CB  . ILE A 1 102 ? 53.322  5.234   21.306  1.00 26.78 ? 102 ILE A CB  1 
ATOM   802  C  CG1 . ILE A 1 102 ? 52.717  5.853   20.037  1.00 27.24 ? 102 ILE A CG1 1 
ATOM   803  C  CG2 . ILE A 1 102 ? 52.321  5.238   22.454  1.00 24.99 ? 102 ILE A CG2 1 
ATOM   804  C  CD1 . ILE A 1 102 ? 51.512  5.106   19.482  1.00 26.40 ? 102 ILE A CD1 1 
ATOM   805  N  N   . GLU A 1 103 ? 55.517  4.578   23.441  1.00 31.26 ? 103 GLU A N   1 
ATOM   806  C  CA  . GLU A 1 103 ? 55.898  4.236   24.807  1.00 33.98 ? 103 GLU A CA  1 
ATOM   807  C  C   . GLU A 1 103 ? 57.024  5.154   25.272  1.00 34.18 ? 103 GLU A C   1 
ATOM   808  O  O   . GLU A 1 103 ? 57.130  5.478   26.453  1.00 34.35 ? 103 GLU A O   1 
ATOM   809  C  CB  . GLU A 1 103 ? 56.357  2.778   24.889  1.00 34.81 ? 103 GLU A CB  1 
ATOM   810  C  CG  . GLU A 1 103 ? 55.356  1.779   24.339  1.00 38.12 ? 103 GLU A CG  1 
ATOM   811  C  CD  . GLU A 1 103 ? 55.819  0.341   24.495  1.00 39.49 ? 103 GLU A CD  1 
ATOM   812  O  OE1 . GLU A 1 103 ? 56.987  0.047   24.162  1.00 41.25 ? 103 GLU A OE1 1 
ATOM   813  O  OE2 . GLU A 1 103 ? 55.010  -0.497  24.941  1.00 40.19 ? 103 GLU A OE2 1 
ATOM   814  N  N   . ARG A 1 104 ? 57.857  5.579   24.331  1.00 34.04 ? 104 ARG A N   1 
ATOM   815  C  CA  . ARG A 1 104 ? 58.970  6.455   24.647  1.00 35.32 ? 104 ARG A CA  1 
ATOM   816  C  C   . ARG A 1 104 ? 58.509  7.856   25.036  1.00 35.66 ? 104 ARG A C   1 
ATOM   817  O  O   . ARG A 1 104 ? 58.971  8.413   26.029  1.00 36.30 ? 104 ARG A O   1 
ATOM   818  C  CB  . ARG A 1 104 ? 59.916  6.548   23.452  1.00 36.14 ? 104 ARG A CB  1 
ATOM   819  C  CG  . ARG A 1 104 ? 61.138  7.411   23.688  1.00 38.65 ? 104 ARG A CG  1 
ATOM   820  C  CD  . ARG A 1 104 ? 61.784  7.735   22.364  1.00 42.13 ? 104 ARG A CD  1 
ATOM   821  N  NE  . ARG A 1 104 ? 60.908  8.581   21.558  1.00 45.93 ? 104 ARG A NE  1 
ATOM   822  C  CZ  . ARG A 1 104 ? 61.001  8.718   20.239  1.00 47.30 ? 104 ARG A CZ  1 
ATOM   823  N  NH1 . ARG A 1 104 ? 61.937  8.055   19.569  1.00 47.01 ? 104 ARG A NH1 1 
ATOM   824  N  NH2 . ARG A 1 104 ? 60.159  9.519   19.593  1.00 46.89 ? 104 ARG A NH2 1 
ATOM   825  N  N   . ASP A 1 105 ? 57.590  8.423   24.259  1.00 34.83 ? 105 ASP A N   1 
ATOM   826  C  CA  . ASP A 1 105 ? 57.112  9.774   24.526  1.00 33.85 ? 105 ASP A CA  1 
ATOM   827  C  C   . ASP A 1 105 ? 55.928  9.886   25.484  1.00 32.81 ? 105 ASP A C   1 
ATOM   828  O  O   . ASP A 1 105 ? 55.666  10.958  26.025  1.00 32.11 ? 105 ASP A O   1 
ATOM   829  C  CB  . ASP A 1 105 ? 56.765  10.477  23.207  1.00 34.65 ? 105 ASP A CB  1 
ATOM   830  C  CG  . ASP A 1 105 ? 57.961  10.592  22.272  1.00 34.79 ? 105 ASP A CG  1 
ATOM   831  O  OD1 . ASP A 1 105 ? 59.067  10.914  22.758  1.00 35.94 ? 105 ASP A OD1 1 
ATOM   832  O  OD2 . ASP A 1 105 ? 57.791  10.373  21.051  1.00 34.46 ? 105 ASP A OD2 1 
ATOM   833  N  N   . PHE A 1 106 ? 55.217  8.788   25.709  1.00 31.89 ? 106 PHE A N   1 
ATOM   834  C  CA  . PHE A 1 106 ? 54.058  8.816   26.597  1.00 30.95 ? 106 PHE A CA  1 
ATOM   835  C  C   . PHE A 1 106 ? 54.178  7.883   27.796  1.00 31.49 ? 106 PHE A C   1 
ATOM   836  O  O   . PHE A 1 106 ? 53.328  7.899   28.682  1.00 31.62 ? 106 PHE A O   1 
ATOM   837  C  CB  . PHE A 1 106 ? 52.787  8.469   25.812  1.00 27.20 ? 106 PHE A CB  1 
ATOM   838  C  CG  . PHE A 1 106 ? 52.375  9.525   24.833  1.00 25.10 ? 106 PHE A CG  1 
ATOM   839  C  CD1 . PHE A 1 106 ? 51.690  10.658  25.260  1.00 23.80 ? 106 PHE A CD1 1 
ATOM   840  C  CD2 . PHE A 1 106 ? 52.703  9.408   23.486  1.00 23.42 ? 106 PHE A CD2 1 
ATOM   841  C  CE1 . PHE A 1 106 ? 51.338  11.663  24.359  1.00 23.04 ? 106 PHE A CE1 1 
ATOM   842  C  CE2 . PHE A 1 106 ? 52.358  10.407  22.577  1.00 23.18 ? 106 PHE A CE2 1 
ATOM   843  C  CZ  . PHE A 1 106 ? 51.675  11.538  23.015  1.00 22.57 ? 106 PHE A CZ  1 
ATOM   844  N  N   . GLY A 1 107 ? 55.230  7.072   27.825  1.00 32.93 ? 107 GLY A N   1 
ATOM   845  C  CA  . GLY A 1 107 ? 55.412  6.152   28.933  1.00 33.13 ? 107 GLY A CA  1 
ATOM   846  C  C   . GLY A 1 107 ? 54.853  4.779   28.618  1.00 34.74 ? 107 GLY A C   1 
ATOM   847  O  O   . GLY A 1 107 ? 55.492  3.765   28.897  1.00 35.72 ? 107 GLY A O   1 
ATOM   848  N  N   . SER A 1 108 ? 53.657  4.746   28.036  1.00 34.57 ? 108 SER A N   1 
ATOM   849  C  CA  . SER A 1 108 ? 53.009  3.490   27.669  1.00 34.19 ? 108 SER A CA  1 
ATOM   850  C  C   . SER A 1 108 ? 51.855  3.769   26.722  1.00 34.26 ? 108 SER A C   1 
ATOM   851  O  O   . SER A 1 108 ? 51.425  4.913   26.577  1.00 34.47 ? 108 SER A O   1 
ATOM   852  C  CB  . SER A 1 108 ? 52.474  2.770   28.909  1.00 33.54 ? 108 SER A CB  1 
ATOM   853  O  OG  . SER A 1 108 ? 51.367  3.460   29.467  1.00 33.59 ? 108 SER A OG  1 
ATOM   854  N  N   . VAL A 1 109 ? 51.354  2.718   26.084  1.00 34.03 ? 109 VAL A N   1 
ATOM   855  C  CA  . VAL A 1 109 ? 50.243  2.850   25.156  1.00 34.62 ? 109 VAL A CA  1 
ATOM   856  C  C   . VAL A 1 109 ? 49.006  3.362   25.890  1.00 35.05 ? 109 VAL A C   1 
ATOM   857  O  O   . VAL A 1 109 ? 48.254  4.176   25.356  1.00 35.59 ? 109 VAL A O   1 
ATOM   858  C  CB  . VAL A 1 109 ? 49.924  1.497   24.473  1.00 34.39 ? 109 VAL A CB  1 
ATOM   859  C  CG1 . VAL A 1 109 ? 48.726  1.646   23.552  1.00 33.17 ? 109 VAL A CG1 1 
ATOM   860  C  CG2 . VAL A 1 109 ? 51.135  1.019   23.676  1.00 32.72 ? 109 VAL A CG2 1 
ATOM   861  N  N   . ASP A 1 110 ? 48.806  2.894   27.119  1.00 35.18 ? 110 ASP A N   1 
ATOM   862  C  CA  . ASP A 1 110 ? 47.660  3.320   27.918  1.00 35.47 ? 110 ASP A CA  1 
ATOM   863  C  C   . ASP A 1 110 ? 47.704  4.806   28.257  1.00 34.58 ? 110 ASP A C   1 
ATOM   864  O  O   . ASP A 1 110 ? 46.673  5.477   28.241  1.00 33.68 ? 110 ASP A O   1 
ATOM   865  C  CB  . ASP A 1 110 ? 47.574  2.520   29.214  1.00 37.04 ? 110 ASP A CB  1 
ATOM   866  C  CG  . ASP A 1 110 ? 47.258  1.069   28.974  1.00 39.28 ? 110 ASP A CG  1 
ATOM   867  O  OD1 . ASP A 1 110 ? 46.201  0.783   28.374  1.00 38.38 ? 110 ASP A OD1 1 
ATOM   868  O  OD2 . ASP A 1 110 ? 48.071  0.216   29.387  1.00 43.89 ? 110 ASP A OD2 1 
ATOM   869  N  N   . ASN A 1 111 ? 48.888  5.316   28.585  1.00 33.82 ? 111 ASN A N   1 
ATOM   870  C  CA  . ASN A 1 111 ? 49.016  6.732   28.900  1.00 33.76 ? 111 ASN A CA  1 
ATOM   871  C  C   . ASN A 1 111 ? 48.646  7.528   27.665  1.00 31.10 ? 111 ASN A C   1 
ATOM   872  O  O   . ASN A 1 111 ? 47.932  8.529   27.746  1.00 30.63 ? 111 ASN A O   1 
ATOM   873  C  CB  . ASN A 1 111 ? 50.446  7.088   29.309  1.00 37.38 ? 111 ASN A CB  1 
ATOM   874  C  CG  . ASN A 1 111 ? 50.709  6.833   30.773  1.00 41.84 ? 111 ASN A CG  1 
ATOM   875  O  OD1 . ASN A 1 111 ? 49.871  7.132   31.625  1.00 45.84 ? 111 ASN A OD1 1 
ATOM   876  N  ND2 . ASN A 1 111 ? 51.883  6.295   31.079  1.00 43.46 ? 111 ASN A ND2 1 
ATOM   877  N  N   . PHE A 1 112 ? 49.146  7.071   26.521  1.00 28.14 ? 112 PHE A N   1 
ATOM   878  C  CA  . PHE A 1 112 ? 48.871  7.720   25.250  1.00 25.57 ? 112 PHE A CA  1 
ATOM   879  C  C   . PHE A 1 112 ? 47.366  7.788   24.995  1.00 23.81 ? 112 PHE A C   1 
ATOM   880  O  O   . PHE A 1 112 ? 46.831  8.854   24.699  1.00 21.86 ? 112 PHE A O   1 
ATOM   881  C  CB  . PHE A 1 112 ? 49.542  6.960   24.108  1.00 22.85 ? 112 PHE A CB  1 
ATOM   882  C  CG  . PHE A 1 112 ? 48.935  7.247   22.773  1.00 22.68 ? 112 PHE A CG  1 
ATOM   883  C  CD1 . PHE A 1 112 ? 49.018  8.523   22.220  1.00 22.25 ? 112 PHE A CD1 1 
ATOM   884  C  CD2 . PHE A 1 112 ? 48.207  6.269   22.105  1.00 21.58 ? 112 PHE A CD2 1 
ATOM   885  C  CE1 . PHE A 1 112 ? 48.378  8.821   21.025  1.00 22.48 ? 112 PHE A CE1 1 
ATOM   886  C  CE2 . PHE A 1 112 ? 47.558  6.554   20.904  1.00 21.35 ? 112 PHE A CE2 1 
ATOM   887  C  CZ  . PHE A 1 112 ? 47.642  7.831   20.365  1.00 22.99 ? 112 PHE A CZ  1 
ATOM   888  N  N   . LYS A 1 113 ? 46.695  6.645   25.108  1.00 22.96 ? 113 LYS A N   1 
ATOM   889  C  CA  . LYS A 1 113 ? 45.255  6.584   24.884  1.00 24.29 ? 113 LYS A CA  1 
ATOM   890  C  C   . LYS A 1 113 ? 44.496  7.539   25.795  1.00 23.92 ? 113 LYS A C   1 
ATOM   891  O  O   . LYS A 1 113 ? 43.577  8.228   25.348  1.00 22.56 ? 113 LYS A O   1 
ATOM   892  C  CB  . LYS A 1 113 ? 44.732  5.160   25.083  1.00 23.83 ? 113 LYS A CB  1 
ATOM   893  C  CG  . LYS A 1 113 ? 45.148  4.193   23.984  1.00 27.37 ? 113 LYS A CG  1 
ATOM   894  C  CD  . LYS A 1 113 ? 44.408  2.865   24.096  1.00 29.16 ? 113 LYS A CD  1 
ATOM   895  C  CE  . LYS A 1 113 ? 44.704  1.980   22.905  1.00 32.41 ? 113 LYS A CE  1 
ATOM   896  N  NZ  . LYS A 1 113 ? 43.844  0.766   22.888  1.00 35.67 ? 113 LYS A NZ  1 
ATOM   897  N  N   . ALA A 1 114 ? 44.883  7.576   27.067  1.00 22.84 ? 114 ALA A N   1 
ATOM   898  C  CA  . ALA A 1 114 ? 44.241  8.453   28.038  1.00 22.38 ? 114 ALA A CA  1 
ATOM   899  C  C   . ALA A 1 114 ? 44.435  9.910   27.644  1.00 22.22 ? 114 ALA A C   1 
ATOM   900  O  O   . ALA A 1 114 ? 43.516  10.718  27.744  1.00 21.38 ? 114 ALA A O   1 
ATOM   901  C  CB  . ALA A 1 114 ? 44.822  8.213   29.423  1.00 20.33 ? 114 ALA A CB  1 
ATOM   902  N  N   . GLU A 1 115 ? 45.641  10.236  27.193  1.00 23.08 ? 115 GLU A N   1 
ATOM   903  C  CA  . GLU A 1 115 ? 45.969  11.597  26.787  1.00 24.66 ? 115 GLU A CA  1 
ATOM   904  C  C   . GLU A 1 115 ? 45.156  11.997  25.555  1.00 22.67 ? 115 GLU A C   1 
ATOM   905  O  O   . GLU A 1 115 ? 44.637  13.112  25.476  1.00 22.68 ? 115 GLU A O   1 
ATOM   906  C  CB  . GLU A 1 115 ? 47.467  11.697  26.483  1.00 28.67 ? 115 GLU A CB  1 
ATOM   907  C  CG  . GLU A 1 115 ? 48.071  13.062  26.751  1.00 36.44 ? 115 GLU A CG  1 
ATOM   908  C  CD  . GLU A 1 115 ? 47.822  13.516  28.180  1.00 42.70 ? 115 GLU A CD  1 
ATOM   909  O  OE1 . GLU A 1 115 ? 48.133  12.741  29.115  1.00 43.34 ? 115 GLU A OE1 1 
ATOM   910  O  OE2 . GLU A 1 115 ? 47.312  14.646  28.369  1.00 46.45 ? 115 GLU A OE2 1 
ATOM   911  N  N   . PHE A 1 116 ? 45.047  11.077  24.601  1.00 19.90 ? 116 PHE A N   1 
ATOM   912  C  CA  . PHE A 1 116 ? 44.304  11.329  23.373  1.00 19.45 ? 116 PHE A CA  1 
ATOM   913  C  C   . PHE A 1 116 ? 42.817  11.496  23.665  1.00 18.09 ? 116 PHE A C   1 
ATOM   914  O  O   . PHE A 1 116 ? 42.167  12.393  23.132  1.00 16.84 ? 116 PHE A O   1 
ATOM   915  C  CB  . PHE A 1 116 ? 44.498  10.181  22.378  1.00 17.38 ? 116 PHE A CB  1 
ATOM   916  C  CG  . PHE A 1 116 ? 43.960  10.480  21.008  1.00 16.80 ? 116 PHE A CG  1 
ATOM   917  C  CD1 . PHE A 1 116 ? 44.735  11.171  20.080  1.00 15.32 ? 116 PHE A CD1 1 
ATOM   918  C  CD2 . PHE A 1 116 ? 42.672  10.090  20.650  1.00 15.59 ? 116 PHE A CD2 1 
ATOM   919  C  CE1 . PHE A 1 116 ? 44.237  11.469  18.809  1.00 13.82 ? 116 PHE A CE1 1 
ATOM   920  C  CE2 . PHE A 1 116 ? 42.163  10.384  19.380  1.00 15.33 ? 116 PHE A CE2 1 
ATOM   921  C  CZ  . PHE A 1 116 ? 42.951  11.075  18.458  1.00 14.79 ? 116 PHE A CZ  1 
ATOM   922  N  N   . GLU A 1 117 ? 42.285  10.623  24.512  1.00 18.94 ? 117 GLU A N   1 
ATOM   923  C  CA  . GLU A 1 117 ? 40.879  10.683  24.880  1.00 20.92 ? 117 GLU A CA  1 
ATOM   924  C  C   . GLU A 1 117 ? 40.546  12.007  25.558  1.00 20.75 ? 117 GLU A C   1 
ATOM   925  O  O   . GLU A 1 117 ? 39.502  12.611  25.295  1.00 20.92 ? 117 GLU A O   1 
ATOM   926  C  CB  . GLU A 1 117 ? 40.537  9.517   25.805  1.00 20.96 ? 117 GLU A CB  1 
ATOM   927  C  CG  . GLU A 1 117 ? 40.382  8.210   25.061  1.00 26.89 ? 117 GLU A CG  1 
ATOM   928  C  CD  . GLU A 1 117 ? 40.001  7.053   25.957  1.00 30.09 ? 117 GLU A CD  1 
ATOM   929  O  OE1 . GLU A 1 117 ? 39.212  7.263   26.904  1.00 32.92 ? 117 GLU A OE1 1 
ATOM   930  O  OE2 . GLU A 1 117 ? 40.481  5.928   25.702  1.00 31.41 ? 117 GLU A OE2 1 
ATOM   931  N  N   . LYS A 1 118 ? 41.444  12.457  26.426  1.00 20.74 ? 118 LYS A N   1 
ATOM   932  C  CA  . LYS A 1 118 ? 41.250  13.708  27.140  1.00 20.86 ? 118 LYS A CA  1 
ATOM   933  C  C   . LYS A 1 118 ? 41.208  14.878  26.155  1.00 18.89 ? 118 LYS A C   1 
ATOM   934  O  O   . LYS A 1 118 ? 40.334  15.735  26.239  1.00 18.40 ? 118 LYS A O   1 
ATOM   935  C  CB  . LYS A 1 118 ? 42.374  13.897  28.157  1.00 24.14 ? 118 LYS A CB  1 
ATOM   936  C  CG  . LYS A 1 118 ? 42.098  14.964  29.204  1.00 31.51 ? 118 LYS A CG  1 
ATOM   937  C  CD  . LYS A 1 118 ? 43.092  14.872  30.366  1.00 36.59 ? 118 LYS A CD  1 
ATOM   938  C  CE  . LYS A 1 118 ? 44.534  15.095  29.901  1.00 39.03 ? 118 LYS A CE  1 
ATOM   939  N  NZ  . LYS A 1 118 ? 45.527  14.926  31.007  1.00 41.00 ? 118 LYS A NZ  1 
ATOM   940  N  N   . ALA A 1 119 ? 42.143  14.903  25.213  1.00 16.82 ? 119 ALA A N   1 
ATOM   941  C  CA  . ALA A 1 119 ? 42.181  15.964  24.217  1.00 17.19 ? 119 ALA A CA  1 
ATOM   942  C  C   . ALA A 1 119 ? 40.918  15.955  23.353  1.00 17.01 ? 119 ALA A C   1 
ATOM   943  O  O   . ALA A 1 119 ? 40.334  17.006  23.075  1.00 16.92 ? 119 ALA A O   1 
ATOM   944  C  CB  . ALA A 1 119 ? 43.409  15.807  23.338  1.00 17.11 ? 119 ALA A CB  1 
ATOM   945  N  N   . ALA A 1 120 ? 40.504  14.763  22.934  1.00 14.81 ? 120 ALA A N   1 
ATOM   946  C  CA  . ALA A 1 120 ? 39.321  14.607  22.103  1.00 14.61 ? 120 ALA A CA  1 
ATOM   947  C  C   . ALA A 1 120 ? 38.039  14.988  22.842  1.00 16.83 ? 120 ALA A C   1 
ATOM   948  O  O   . ALA A 1 120 ? 37.140  15.600  22.263  1.00 17.33 ? 120 ALA A O   1 
ATOM   949  C  CB  . ALA A 1 120 ? 39.231  13.172  21.604  1.00 12.07 ? 120 ALA A CB  1 
ATOM   950  N  N   . ALA A 1 121 ? 37.952  14.627  24.119  1.00 16.49 ? 121 ALA A N   1 
ATOM   951  C  CA  . ALA A 1 121 ? 36.759  14.934  24.898  1.00 17.70 ? 121 ALA A CA  1 
ATOM   952  C  C   . ALA A 1 121 ? 36.692  16.391  25.341  1.00 18.33 ? 121 ALA A C   1 
ATOM   953  O  O   . ALA A 1 121 ? 35.606  16.945  25.486  1.00 18.45 ? 121 ALA A O   1 
ATOM   954  C  CB  . ALA A 1 121 ? 36.678  14.020  26.116  1.00 15.43 ? 121 ALA A CB  1 
ATOM   955  N  N   . SER A 1 122 ? 37.848  17.016  25.542  1.00 19.09 ? 122 SER A N   1 
ATOM   956  C  CA  . SER A 1 122 ? 37.882  18.402  26.000  1.00 19.88 ? 122 SER A CA  1 
ATOM   957  C  C   . SER A 1 122 ? 37.790  19.450  24.892  1.00 19.91 ? 122 SER A C   1 
ATOM   958  O  O   . SER A 1 122 ? 37.708  20.643  25.177  1.00 20.15 ? 122 SER A O   1 
ATOM   959  C  CB  . SER A 1 122 ? 39.141  18.647  26.840  1.00 20.16 ? 122 SER A CB  1 
ATOM   960  O  OG  . SER A 1 122 ? 40.312  18.554  26.046  1.00 25.76 ? 122 SER A OG  1 
ATOM   961  N  N   . ARG A 1 123 ? 37.818  19.020  23.633  1.00 19.96 ? 123 ARG A N   1 
ATOM   962  C  CA  . ARG A 1 123 ? 37.694  19.962  22.521  1.00 18.60 ? 123 ARG A CA  1 
ATOM   963  C  C   . ARG A 1 123 ? 36.233  20.421  22.505  1.00 18.81 ? 123 ARG A C   1 
ATOM   964  O  O   . ARG A 1 123 ? 35.338  19.667  22.126  1.00 19.54 ? 123 ARG A O   1 
ATOM   965  C  CB  . ARG A 1 123 ? 38.067  19.280  21.201  1.00 19.68 ? 123 ARG A CB  1 
ATOM   966  C  CG  . ARG A 1 123 ? 37.590  20.003  19.941  1.00 21.06 ? 123 ARG A CG  1 
ATOM   967  C  CD  . ARG A 1 123 ? 37.994  21.473  19.920  1.00 20.73 ? 123 ARG A CD  1 
ATOM   968  N  NE  . ARG A 1 123 ? 39.435  21.669  20.063  1.00 21.81 ? 123 ARG A NE  1 
ATOM   969  C  CZ  . ARG A 1 123 ? 40.027  22.859  20.025  1.00 22.07 ? 123 ARG A CZ  1 
ATOM   970  N  NH1 . ARG A 1 123 ? 39.298  23.949  19.844  1.00 22.04 ? 123 ARG A NH1 1 
ATOM   971  N  NH2 . ARG A 1 123 ? 41.343  22.963  20.171  1.00 21.21 ? 123 ARG A NH2 1 
ATOM   972  N  N   . PHE A 1 124 ? 36.003  21.657  22.936  1.00 17.88 ? 124 PHE A N   1 
ATOM   973  C  CA  . PHE A 1 124 ? 34.658  22.212  23.014  1.00 15.16 ? 124 PHE A CA  1 
ATOM   974  C  C   . PHE A 1 124 ? 34.177  22.718  21.665  1.00 14.31 ? 124 PHE A C   1 
ATOM   975  O  O   . PHE A 1 124 ? 34.864  23.498  21.000  1.00 15.13 ? 124 PHE A O   1 
ATOM   976  C  CB  . PHE A 1 124 ? 34.626  23.356  24.028  1.00 14.54 ? 124 PHE A CB  1 
ATOM   977  C  CG  . PHE A 1 124 ? 33.238  23.753  24.440  1.00 14.95 ? 124 PHE A CG  1 
ATOM   978  C  CD1 . PHE A 1 124 ? 32.479  22.917  25.258  1.00 11.66 ? 124 PHE A CD1 1 
ATOM   979  C  CD2 . PHE A 1 124 ? 32.681  24.945  23.996  1.00 12.46 ? 124 PHE A CD2 1 
ATOM   980  C  CE1 . PHE A 1 124 ? 31.181  23.265  25.628  1.00 15.42 ? 124 PHE A CE1 1 
ATOM   981  C  CE2 . PHE A 1 124 ? 31.385  25.304  24.358  1.00 15.49 ? 124 PHE A CE2 1 
ATOM   982  C  CZ  . PHE A 1 124 ? 30.631  24.460  25.176  1.00 15.19 ? 124 PHE A CZ  1 
ATOM   983  N  N   . GLY A 1 125 ? 32.986  22.286  21.268  1.00 12.62 ? 125 GLY A N   1 
ATOM   984  C  CA  . GLY A 1 125 ? 32.457  22.697  19.984  1.00 12.00 ? 125 GLY A CA  1 
ATOM   985  C  C   . GLY A 1 125 ? 32.955  21.730  18.929  1.00 12.30 ? 125 GLY A C   1 
ATOM   986  O  O   . GLY A 1 125 ? 33.210  20.567  19.234  1.00 11.68 ? 125 GLY A O   1 
ATOM   987  N  N   . SER A 1 126 ? 33.104  22.202  17.693  1.00 12.27 ? 126 SER A N   1 
ATOM   988  C  CA  . SER A 1 126 ? 33.570  21.356  16.597  1.00 11.86 ? 126 SER A CA  1 
ATOM   989  C  C   . SER A 1 126 ? 35.088  21.348  16.497  1.00 12.83 ? 126 SER A C   1 
ATOM   990  O  O   . SER A 1 126 ? 35.740  22.366  16.738  1.00 12.39 ? 126 SER A O   1 
ATOM   991  C  CB  . SER A 1 126 ? 32.978  21.837  15.274  1.00 11.73 ? 126 SER A CB  1 
ATOM   992  O  OG  . SER A 1 126 ? 31.570  21.794  15.327  1.00 10.89 ? 126 SER A OG  1 
ATOM   993  N  N   . GLY A 1 127 ? 35.652  20.199  16.135  1.00 13.26 ? 127 GLY A N   1 
ATOM   994  C  CA  . GLY A 1 127 ? 37.095  20.109  16.017  1.00 12.45 ? 127 GLY A CA  1 
ATOM   995  C  C   . GLY A 1 127 ? 37.649  18.721  15.751  1.00 12.21 ? 127 GLY A C   1 
ATOM   996  O  O   . GLY A 1 127 ? 36.918  17.786  15.412  1.00 11.19 ? 127 GLY A O   1 
ATOM   997  N  N   . TRP A 1 128 ? 38.961  18.605  15.919  1.00 11.80 ? 128 TRP A N   1 
ATOM   998  C  CA  . TRP A 1 128 ? 39.702  17.368  15.695  1.00 11.26 ? 128 TRP A CA  1 
ATOM   999  C  C   . TRP A 1 128 ? 40.741  17.141  16.788  1.00 11.97 ? 128 TRP A C   1 
ATOM   1000 O  O   . TRP A 1 128 ? 41.245  18.090  17.388  1.00 13.37 ? 128 TRP A O   1 
ATOM   1001 C  CB  . TRP A 1 128 ? 40.463  17.431  14.364  1.00 9.48  ? 128 TRP A CB  1 
ATOM   1002 C  CG  . TRP A 1 128 ? 39.620  17.426  13.137  1.00 8.92  ? 128 TRP A CG  1 
ATOM   1003 C  CD1 . TRP A 1 128 ? 38.865  18.455  12.649  1.00 10.10 ? 128 TRP A CD1 1 
ATOM   1004 C  CD2 . TRP A 1 128 ? 39.412  16.319  12.254  1.00 8.85  ? 128 TRP A CD2 1 
ATOM   1005 N  NE1 . TRP A 1 128 ? 38.191  18.053  11.516  1.00 10.32 ? 128 TRP A NE1 1 
ATOM   1006 C  CE2 . TRP A 1 128 ? 38.509  16.745  11.252  1.00 9.74  ? 128 TRP A CE2 1 
ATOM   1007 C  CE3 . TRP A 1 128 ? 39.902  15.004  12.212  1.00 8.62  ? 128 TRP A CE3 1 
ATOM   1008 C  CZ2 . TRP A 1 128 ? 38.080  15.900  10.218  1.00 9.67  ? 128 TRP A CZ2 1 
ATOM   1009 C  CZ3 . TRP A 1 128 ? 39.477  14.162  11.184  1.00 8.96  ? 128 TRP A CZ3 1 
ATOM   1010 C  CH2 . TRP A 1 128 ? 38.572  14.618  10.200  1.00 9.88  ? 128 TRP A CH2 1 
ATOM   1011 N  N   . ALA A 1 129 ? 41.068  15.876  17.027  1.00 12.57 ? 129 ALA A N   1 
ATOM   1012 C  CA  . ALA A 1 129 ? 42.094  15.505  17.995  1.00 12.74 ? 129 ALA A CA  1 
ATOM   1013 C  C   . ALA A 1 129 ? 43.175  14.835  17.147  1.00 13.42 ? 129 ALA A C   1 
ATOM   1014 O  O   . ALA A 1 129 ? 42.867  14.004  16.285  1.00 11.88 ? 129 ALA A O   1 
ATOM   1015 C  CB  . ALA A 1 129 ? 41.540  14.525  19.020  1.00 11.98 ? 129 ALA A CB  1 
ATOM   1016 N  N   . TRP A 1 130 ? 44.433  15.198  17.371  1.00 13.53 ? 130 TRP A N   1 
ATOM   1017 C  CA  . TRP A 1 130 ? 45.525  14.624  16.587  1.00 14.86 ? 130 TRP A CA  1 
ATOM   1018 C  C   . TRP A 1 130 ? 46.698  14.050  17.366  1.00 16.05 ? 130 TRP A C   1 
ATOM   1019 O  O   . TRP A 1 130 ? 46.966  14.417  18.510  1.00 16.88 ? 130 TRP A O   1 
ATOM   1020 C  CB  . TRP A 1 130 ? 46.154  15.664  15.643  1.00 14.14 ? 130 TRP A CB  1 
ATOM   1021 C  CG  . TRP A 1 130 ? 45.224  16.560  14.918  1.00 13.44 ? 130 TRP A CG  1 
ATOM   1022 C  CD1 . TRP A 1 130 ? 44.694  17.737  15.370  1.00 12.83 ? 130 TRP A CD1 1 
ATOM   1023 C  CD2 . TRP A 1 130 ? 44.698  16.356  13.609  1.00 12.11 ? 130 TRP A CD2 1 
ATOM   1024 N  NE1 . TRP A 1 130 ? 43.868  18.279  14.419  1.00 11.67 ? 130 TRP A NE1 1 
ATOM   1025 C  CE2 . TRP A 1 130 ? 43.847  17.450  13.327  1.00 13.61 ? 130 TRP A CE2 1 
ATOM   1026 C  CE3 . TRP A 1 130 ? 44.859  15.355  12.644  1.00 11.61 ? 130 TRP A CE3 1 
ATOM   1027 C  CZ2 . TRP A 1 130 ? 43.155  17.569  12.116  1.00 12.99 ? 130 TRP A CZ2 1 
ATOM   1028 C  CZ3 . TRP A 1 130 ? 44.172  15.473  11.440  1.00 13.95 ? 130 TRP A CZ3 1 
ATOM   1029 C  CH2 . TRP A 1 130 ? 43.329  16.573  11.188  1.00 14.03 ? 130 TRP A CH2 1 
ATOM   1030 N  N   . LEU A 1 131 ? 47.401  13.146  16.699  1.00 16.67 ? 131 LEU A N   1 
ATOM   1031 C  CA  . LEU A 1 131 ? 48.631  12.571  17.211  1.00 17.48 ? 131 LEU A CA  1 
ATOM   1032 C  C   . LEU A 1 131 ? 49.577  13.120  16.144  1.00 18.38 ? 131 LEU A C   1 
ATOM   1033 O  O   . LEU A 1 131 ? 49.479  12.737  14.980  1.00 18.26 ? 131 LEU A O   1 
ATOM   1034 C  CB  . LEU A 1 131 ? 48.619  11.045  17.150  1.00 16.41 ? 131 LEU A CB  1 
ATOM   1035 C  CG  . LEU A 1 131 ? 50.006  10.428  17.370  1.00 17.60 ? 131 LEU A CG  1 
ATOM   1036 C  CD1 . LEU A 1 131 ? 50.506  10.777  18.766  1.00 17.20 ? 131 LEU A CD1 1 
ATOM   1037 C  CD2 . LEU A 1 131 ? 49.946  8.919   17.185  1.00 17.84 ? 131 LEU A CD2 1 
ATOM   1038 N  N   . VAL A 1 132 ? 50.445  14.055  16.518  1.00 19.13 ? 132 VAL A N   1 
ATOM   1039 C  CA  . VAL A 1 132 ? 51.370  14.637  15.548  1.00 20.98 ? 132 VAL A CA  1 
ATOM   1040 C  C   . VAL A 1 132 ? 52.829  14.369  15.891  1.00 22.97 ? 132 VAL A C   1 
ATOM   1041 O  O   . VAL A 1 132 ? 53.173  14.016  17.018  1.00 22.86 ? 132 VAL A O   1 
ATOM   1042 C  CB  . VAL A 1 132 ? 51.194  16.182  15.402  1.00 20.04 ? 132 VAL A CB  1 
ATOM   1043 C  CG1 . VAL A 1 132 ? 49.771  16.519  14.996  1.00 19.53 ? 132 VAL A CG1 1 
ATOM   1044 C  CG2 . VAL A 1 132 ? 51.558  16.879  16.705  1.00 18.25 ? 132 VAL A CG2 1 
ATOM   1045 N  N   . LEU A 1 133 ? 53.684  14.529  14.891  1.00 25.27 ? 133 LEU A N   1 
ATOM   1046 C  CA  . LEU A 1 133 ? 55.113  14.333  15.060  1.00 25.39 ? 133 LEU A CA  1 
ATOM   1047 C  C   . LEU A 1 133 ? 55.773  15.700  14.934  1.00 26.56 ? 133 LEU A C   1 
ATOM   1048 O  O   . LEU A 1 133 ? 55.678  16.352  13.895  1.00 27.17 ? 133 LEU A O   1 
ATOM   1049 C  CB  . LEU A 1 133 ? 55.651  13.385  13.984  1.00 25.04 ? 133 LEU A CB  1 
ATOM   1050 C  CG  . LEU A 1 133 ? 57.164  13.137  13.932  1.00 25.29 ? 133 LEU A CG  1 
ATOM   1051 C  CD1 . LEU A 1 133 ? 57.623  12.396  15.181  1.00 24.40 ? 133 LEU A CD1 1 
ATOM   1052 C  CD2 . LEU A 1 133 ? 57.493  12.333  12.689  1.00 24.75 ? 133 LEU A CD2 1 
ATOM   1053 N  N   . LYS A 1 134 ? 56.452  16.132  15.989  1.00 27.87 ? 134 LYS A N   1 
ATOM   1054 C  CA  . LYS A 1 134 ? 57.122  17.424  15.976  1.00 30.43 ? 134 LYS A CA  1 
ATOM   1055 C  C   . LYS A 1 134 ? 58.424  17.380  16.768  1.00 30.67 ? 134 LYS A C   1 
ATOM   1056 O  O   . LYS A 1 134 ? 58.442  16.991  17.933  1.00 29.41 ? 134 LYS A O   1 
ATOM   1057 C  CB  . LYS A 1 134 ? 56.206  18.504  16.558  1.00 32.64 ? 134 LYS A CB  1 
ATOM   1058 C  CG  . LYS A 1 134 ? 56.788  19.901  16.426  1.00 37.16 ? 134 LYS A CG  1 
ATOM   1059 C  CD  . LYS A 1 134 ? 55.784  20.987  16.771  1.00 40.76 ? 134 LYS A CD  1 
ATOM   1060 C  CE  . LYS A 1 134 ? 56.363  22.368  16.464  1.00 42.66 ? 134 LYS A CE  1 
ATOM   1061 N  NZ  . LYS A 1 134 ? 56.796  22.482  15.035  1.00 43.29 ? 134 LYS A NZ  1 
ATOM   1062 N  N   . GLY A 1 135 ? 59.516  17.789  16.134  1.00 32.23 ? 135 GLY A N   1 
ATOM   1063 C  CA  . GLY A 1 135 ? 60.797  17.769  16.814  1.00 34.24 ? 135 GLY A CA  1 
ATOM   1064 C  C   . GLY A 1 135 ? 61.185  16.359  17.223  1.00 35.61 ? 135 GLY A C   1 
ATOM   1065 O  O   . GLY A 1 135 ? 61.632  16.128  18.350  1.00 35.55 ? 135 GLY A O   1 
ATOM   1066 N  N   . ASP A 1 136 ? 60.999  15.414  16.303  1.00 36.39 ? 136 ASP A N   1 
ATOM   1067 C  CA  . ASP A 1 136 ? 61.333  14.011  16.536  1.00 38.05 ? 136 ASP A CA  1 
ATOM   1068 C  C   . ASP A 1 136 ? 60.588  13.404  17.715  1.00 37.18 ? 136 ASP A C   1 
ATOM   1069 O  O   . ASP A 1 136 ? 60.898  12.298  18.159  1.00 37.24 ? 136 ASP A O   1 
ATOM   1070 C  CB  . ASP A 1 136 ? 62.843  13.861  16.737  1.00 40.53 ? 136 ASP A CB  1 
ATOM   1071 C  CG  . ASP A 1 136 ? 63.638  14.445  15.583  1.00 44.11 ? 136 ASP A CG  1 
ATOM   1072 O  OD1 . ASP A 1 136 ? 63.374  14.051  14.424  1.00 45.28 ? 136 ASP A OD1 1 
ATOM   1073 O  OD2 . ASP A 1 136 ? 64.518  15.301  15.831  1.00 46.77 ? 136 ASP A OD2 1 
ATOM   1074 N  N   . LYS A 1 137 ? 59.610  14.143  18.226  1.00 37.40 ? 137 LYS A N   1 
ATOM   1075 C  CA  . LYS A 1 137 ? 58.796  13.682  19.342  1.00 36.47 ? 137 LYS A CA  1 
ATOM   1076 C  C   . LYS A 1 137 ? 57.313  13.698  18.982  1.00 34.18 ? 137 LYS A C   1 
ATOM   1077 O  O   . LYS A 1 137 ? 56.853  14.551  18.226  1.00 33.39 ? 137 LYS A O   1 
ATOM   1078 C  CB  . LYS A 1 137 ? 59.037  14.549  20.580  1.00 37.98 ? 137 LYS A CB  1 
ATOM   1079 C  CG  . LYS A 1 137 ? 60.443  14.419  21.153  1.00 43.70 ? 137 LYS A CG  1 
ATOM   1080 C  CD  . LYS A 1 137 ? 60.617  15.230  22.433  1.00 47.76 ? 137 LYS A CD  1 
ATOM   1081 C  CE  . LYS A 1 137 ? 59.663  14.753  23.522  1.00 50.77 ? 137 LYS A CE  1 
ATOM   1082 N  NZ  . LYS A 1 137 ? 59.877  15.471  24.813  1.00 53.77 ? 137 LYS A NZ  1 
ATOM   1083 N  N   . LEU A 1 138 ? 56.577  12.732  19.522  1.00 31.50 ? 138 LEU A N   1 
ATOM   1084 C  CA  . LEU A 1 138 ? 55.142  12.616  19.292  1.00 29.69 ? 138 LEU A CA  1 
ATOM   1085 C  C   . LEU A 1 138 ? 54.397  13.446  20.325  1.00 28.05 ? 138 LEU A C   1 
ATOM   1086 O  O   . LEU A 1 138 ? 54.836  13.562  21.468  1.00 28.14 ? 138 LEU A O   1 
ATOM   1087 C  CB  . LEU A 1 138 ? 54.690  11.159  19.422  1.00 27.62 ? 138 LEU A CB  1 
ATOM   1088 C  CG  . LEU A 1 138 ? 55.173  10.156  18.374  1.00 28.35 ? 138 LEU A CG  1 
ATOM   1089 C  CD1 . LEU A 1 138 ? 54.752  8.753   18.781  1.00 27.09 ? 138 LEU A CD1 1 
ATOM   1090 C  CD2 . LEU A 1 138 ? 54.596  10.519  17.015  1.00 28.56 ? 138 LEU A CD2 1 
ATOM   1091 N  N   . ALA A 1 139 ? 53.263  14.009  19.922  1.00 26.14 ? 139 ALA A N   1 
ATOM   1092 C  CA  . ALA A 1 139 ? 52.456  14.823  20.820  1.00 24.15 ? 139 ALA A CA  1 
ATOM   1093 C  C   . ALA A 1 139 ? 50.985  14.787  20.426  1.00 23.05 ? 139 ALA A C   1 
ATOM   1094 O  O   . ALA A 1 139 ? 50.640  14.555  19.266  1.00 21.99 ? 139 ALA A O   1 
ATOM   1095 C  CB  . ALA A 1 139 ? 52.960  16.258  20.821  1.00 22.34 ? 139 ALA A CB  1 
ATOM   1096 N  N   . VAL A 1 140 ? 50.124  15.006  21.411  1.00 21.68 ? 140 VAL A N   1 
ATOM   1097 C  CA  . VAL A 1 140 ? 48.685  15.027  21.204  1.00 21.89 ? 140 VAL A CA  1 
ATOM   1098 C  C   . VAL A 1 140 ? 48.220  16.480  21.227  1.00 21.72 ? 140 VAL A C   1 
ATOM   1099 O  O   . VAL A 1 140 ? 48.528  17.217  22.162  1.00 22.09 ? 140 VAL A O   1 
ATOM   1100 C  CB  . VAL A 1 140 ? 47.949  14.241  22.329  1.00 22.27 ? 140 VAL A CB  1 
ATOM   1101 C  CG1 . VAL A 1 140 ? 46.461  14.565  22.326  1.00 21.15 ? 140 VAL A CG1 1 
ATOM   1102 C  CG2 . VAL A 1 140 ? 48.152  12.746  22.133  1.00 21.61 ? 140 VAL A CG2 1 
ATOM   1103 N  N   . VAL A 1 141 ? 47.501  16.894  20.189  1.00 20.16 ? 141 VAL A N   1 
ATOM   1104 C  CA  . VAL A 1 141 ? 46.977  18.258  20.109  1.00 19.32 ? 141 VAL A CA  1 
ATOM   1105 C  C   . VAL A 1 141 ? 45.582  18.204  19.492  1.00 19.45 ? 141 VAL A C   1 
ATOM   1106 O  O   . VAL A 1 141 ? 45.161  17.167  18.984  1.00 18.96 ? 141 VAL A O   1 
ATOM   1107 C  CB  . VAL A 1 141 ? 47.872  19.182  19.221  1.00 19.32 ? 141 VAL A CB  1 
ATOM   1108 C  CG1 . VAL A 1 141 ? 49.271  19.292  19.815  1.00 19.97 ? 141 VAL A CG1 1 
ATOM   1109 C  CG2 . VAL A 1 141 ? 47.950  18.640  17.798  1.00 16.83 ? 141 VAL A CG2 1 
ATOM   1110 N  N   . SER A 1 142 ? 44.854  19.310  19.550  1.00 18.68 ? 142 SER A N   1 
ATOM   1111 C  CA  . SER A 1 142 ? 43.532  19.348  18.943  1.00 18.45 ? 142 SER A CA  1 
ATOM   1112 C  C   . SER A 1 142 ? 43.375  20.687  18.250  1.00 17.32 ? 142 SER A C   1 
ATOM   1113 O  O   . SER A 1 142 ? 44.058  21.651  18.591  1.00 17.96 ? 142 SER A O   1 
ATOM   1114 C  CB  . SER A 1 142 ? 42.428  19.159  19.992  1.00 18.31 ? 142 SER A CB  1 
ATOM   1115 O  OG  . SER A 1 142 ? 42.271  20.311  20.797  1.00 18.61 ? 142 SER A OG  1 
ATOM   1116 N  N   . THR A 1 143 ? 42.497  20.737  17.259  1.00 15.02 ? 143 THR A N   1 
ATOM   1117 C  CA  . THR A 1 143 ? 42.253  21.971  16.536  1.00 15.40 ? 143 THR A CA  1 
ATOM   1118 C  C   . THR A 1 143 ? 40.753  22.213  16.451  1.00 14.47 ? 143 THR A C   1 
ATOM   1119 O  O   . THR A 1 143 ? 39.950  21.310  16.690  1.00 12.54 ? 143 THR A O   1 
ATOM   1120 C  CB  . THR A 1 143 ? 42.847  21.925  15.111  1.00 15.95 ? 143 THR A CB  1 
ATOM   1121 O  OG1 . THR A 1 143 ? 42.310  20.802  14.405  1.00 15.43 ? 143 THR A OG1 1 
ATOM   1122 C  CG2 . THR A 1 143 ? 44.377  21.823  15.167  1.00 15.14 ? 143 THR A CG2 1 
ATOM   1123 N  N   . ALA A 1 144 ? 40.386  23.442  16.116  1.00 12.96 ? 144 ALA A N   1 
ATOM   1124 C  CA  . ALA A 1 144 ? 38.988  23.815  16.007  1.00 11.59 ? 144 ALA A CA  1 
ATOM   1125 C  C   . ALA A 1 144 ? 38.494  23.657  14.582  1.00 11.73 ? 144 ALA A C   1 
ATOM   1126 O  O   . ALA A 1 144 ? 39.276  23.731  13.633  1.00 10.24 ? 144 ALA A O   1 
ATOM   1127 C  CB  . ALA A 1 144 ? 38.794  25.259  16.467  1.00 8.98  ? 144 ALA A CB  1 
ATOM   1128 N  N   . ASN A 1 145 ? 37.192  23.417  14.455  1.00 12.10 ? 145 ASN A N   1 
ATOM   1129 C  CA  . ASN A 1 145 ? 36.520  23.275  13.172  1.00 11.95 ? 145 ASN A CA  1 
ATOM   1130 C  C   . ASN A 1 145 ? 37.266  22.409  12.154  1.00 11.51 ? 145 ASN A C   1 
ATOM   1131 O  O   . ASN A 1 145 ? 37.410  21.209  12.371  1.00 12.16 ? 145 ASN A O   1 
ATOM   1132 C  CB  . ASN A 1 145 ? 36.234  24.675  12.655  1.00 12.73 ? 145 ASN A CB  1 
ATOM   1133 C  CG  . ASN A 1 145 ? 35.553  25.529  13.715  1.00 15.92 ? 145 ASN A CG  1 
ATOM   1134 O  OD1 . ASN A 1 145 ? 34.644  25.055  14.405  1.00 14.75 ? 145 ASN A OD1 1 
ATOM   1135 N  ND2 . ASN A 1 145 ? 35.988  26.779  13.860  1.00 14.26 ? 145 ASN A ND2 1 
ATOM   1136 N  N   . GLN A 1 146 ? 37.721  22.980  11.042  1.00 10.94 ? 146 GLN A N   1 
ATOM   1137 C  CA  . GLN A 1 146 ? 38.457  22.169  10.073  1.00 11.89 ? 146 GLN A CA  1 
ATOM   1138 C  C   . GLN A 1 146 ? 39.937  22.557  9.982   1.00 13.27 ? 146 GLN A C   1 
ATOM   1139 O  O   . GLN A 1 146 ? 40.585  22.297  8.969   1.00 13.54 ? 146 GLN A O   1 
ATOM   1140 C  CB  . GLN A 1 146 ? 37.826  22.243  8.671   1.00 9.58  ? 146 GLN A CB  1 
ATOM   1141 C  CG  . GLN A 1 146 ? 36.421  21.643  8.530   1.00 10.82 ? 146 GLN A CG  1 
ATOM   1142 C  CD  . GLN A 1 146 ? 36.308  20.186  9.000   1.00 12.38 ? 146 GLN A CD  1 
ATOM   1143 O  OE1 . GLN A 1 146 ? 37.284  19.432  8.993   1.00 10.79 ? 146 GLN A OE1 1 
ATOM   1144 N  NE2 . GLN A 1 146 ? 35.101  19.787  9.393   1.00 10.73 ? 146 GLN A NE2 1 
ATOM   1145 N  N   . ASP A 1 147 ? 40.469  23.178  11.032  1.00 13.48 ? 147 ASP A N   1 
ATOM   1146 C  CA  . ASP A 1 147 ? 41.878  23.554  11.032  1.00 14.94 ? 147 ASP A CA  1 
ATOM   1147 C  C   . ASP A 1 147 ? 42.728  22.300  11.160  1.00 15.89 ? 147 ASP A C   1 
ATOM   1148 O  O   . ASP A 1 147 ? 42.304  21.300  11.738  1.00 15.71 ? 147 ASP A O   1 
ATOM   1149 C  CB  . ASP A 1 147 ? 42.218  24.491  12.196  1.00 14.32 ? 147 ASP A CB  1 
ATOM   1150 C  CG  . ASP A 1 147 ? 41.559  25.847  12.070  1.00 15.49 ? 147 ASP A CG  1 
ATOM   1151 O  OD1 . ASP A 1 147 ? 41.144  26.207  10.950  1.00 16.56 ? 147 ASP A OD1 1 
ATOM   1152 O  OD2 . ASP A 1 147 ? 41.472  26.558  13.093  1.00 12.98 ? 147 ASP A OD2 1 
ATOM   1153 N  N   . SER A 1 148 ? 43.937  22.370  10.628  1.00 16.06 ? 148 SER A N   1 
ATOM   1154 C  CA  . SER A 1 148 ? 44.862  21.254  10.670  1.00 16.99 ? 148 SER A CA  1 
ATOM   1155 C  C   . SER A 1 148 ? 46.208  21.744  11.180  1.00 17.91 ? 148 SER A C   1 
ATOM   1156 O  O   . SER A 1 148 ? 46.604  22.878  10.906  1.00 17.24 ? 148 SER A O   1 
ATOM   1157 C  CB  . SER A 1 148 ? 45.034  20.674  9.266   1.00 15.12 ? 148 SER A CB  1 
ATOM   1158 O  OG  . SER A 1 148 ? 46.238  19.931  9.177   1.00 16.37 ? 148 SER A OG  1 
ATOM   1159 N  N   . PRO A 1 149 ? 46.932  20.901  11.933  1.00 19.29 ? 149 PRO A N   1 
ATOM   1160 C  CA  . PRO A 1 149 ? 48.240  21.341  12.434  1.00 19.36 ? 149 PRO A CA  1 
ATOM   1161 C  C   . PRO A 1 149 ? 49.195  21.696  11.287  1.00 19.72 ? 149 PRO A C   1 
ATOM   1162 O  O   . PRO A 1 149 ? 50.182  22.402  11.487  1.00 20.70 ? 149 PRO A O   1 
ATOM   1163 C  CB  . PRO A 1 149 ? 48.716  20.151  13.271  1.00 19.26 ? 149 PRO A CB  1 
ATOM   1164 C  CG  . PRO A 1 149 ? 47.958  18.980  12.688  1.00 21.19 ? 149 PRO A CG  1 
ATOM   1165 C  CD  . PRO A 1 149 ? 46.597  19.551  12.415  1.00 18.33 ? 149 PRO A CD  1 
ATOM   1166 N  N   . LEU A 1 150 ? 48.891  21.213  10.086  1.00 18.69 ? 150 LEU A N   1 
ATOM   1167 C  CA  . LEU A 1 150 ? 49.715  21.505  8.916   1.00 19.38 ? 150 LEU A CA  1 
ATOM   1168 C  C   . LEU A 1 150 ? 49.640  22.982  8.545   1.00 20.99 ? 150 LEU A C   1 
ATOM   1169 O  O   . LEU A 1 150 ? 50.479  23.481  7.797   1.00 21.62 ? 150 LEU A O   1 
ATOM   1170 C  CB  . LEU A 1 150 ? 49.261  20.684  7.706   1.00 17.21 ? 150 LEU A CB  1 
ATOM   1171 C  CG  . LEU A 1 150 ? 49.643  19.209  7.629   1.00 18.11 ? 150 LEU A CG  1 
ATOM   1172 C  CD1 . LEU A 1 150 ? 49.066  18.618  6.356   1.00 18.78 ? 150 LEU A CD1 1 
ATOM   1173 C  CD2 . LEU A 1 150 ? 51.157  19.059  7.640   1.00 17.92 ? 150 LEU A CD2 1 
ATOM   1174 N  N   . MET A 1 151 ? 48.629  23.675  9.058   1.00 21.31 ? 151 MET A N   1 
ATOM   1175 C  CA  . MET A 1 151 ? 48.460  25.093  8.760   1.00 22.01 ? 151 MET A CA  1 
ATOM   1176 C  C   . MET A 1 151 ? 49.401  25.973  9.578   1.00 22.50 ? 151 MET A C   1 
ATOM   1177 O  O   . MET A 1 151 ? 49.577  27.148  9.262   1.00 22.45 ? 151 MET A O   1 
ATOM   1178 C  CB  . MET A 1 151 ? 47.015  25.525  9.023   1.00 20.88 ? 151 MET A CB  1 
ATOM   1179 C  CG  . MET A 1 151 ? 45.974  24.832  8.152   1.00 19.34 ? 151 MET A CG  1 
ATOM   1180 S  SD  . MET A 1 151 ? 44.306  25.229  8.722   1.00 15.59 ? 151 MET A SD  1 
ATOM   1181 C  CE  . MET A 1 151 ? 43.301  24.556  7.388   1.00 10.99 ? 151 MET A CE  1 
ATOM   1182 N  N   . GLY A 1 152 ? 49.998  25.406  10.624  1.00 22.56 ? 152 GLY A N   1 
ATOM   1183 C  CA  . GLY A 1 152 ? 50.903  26.175  11.460  1.00 24.01 ? 152 GLY A CA  1 
ATOM   1184 C  C   . GLY A 1 152 ? 50.221  26.672  12.718  1.00 25.14 ? 152 GLY A C   1 
ATOM   1185 O  O   . GLY A 1 152 ? 48.997  26.733  12.783  1.00 26.83 ? 152 GLY A O   1 
ATOM   1186 N  N   . GLU A 1 153 ? 51.016  27.046  13.712  1.00 26.26 ? 153 GLU A N   1 
ATOM   1187 C  CA  . GLU A 1 153 ? 50.497  27.511  14.989  1.00 28.61 ? 153 GLU A CA  1 
ATOM   1188 C  C   . GLU A 1 153 ? 49.764  28.847  14.915  1.00 27.37 ? 153 GLU A C   1 
ATOM   1189 O  O   . GLU A 1 153 ? 48.749  29.049  15.582  1.00 26.80 ? 153 GLU A O   1 
ATOM   1190 C  CB  . GLU A 1 153 ? 51.655  27.596  15.980  1.00 32.52 ? 153 GLU A CB  1 
ATOM   1191 C  CG  . GLU A 1 153 ? 51.315  27.122  17.377  1.00 39.78 ? 153 GLU A CG  1 
ATOM   1192 C  CD  . GLU A 1 153 ? 52.545  26.651  18.133  1.00 44.89 ? 153 GLU A CD  1 
ATOM   1193 O  OE1 . GLU A 1 153 ? 53.508  27.443  18.253  1.00 46.19 ? 153 GLU A OE1 1 
ATOM   1194 O  OE2 . GLU A 1 153 ? 52.548  25.489  18.603  1.00 46.29 ? 153 GLU A OE2 1 
ATOM   1195 N  N   . ALA A 1 154 ? 50.277  29.758  14.099  1.00 26.93 ? 154 ALA A N   1 
ATOM   1196 C  CA  . ALA A 1 154 ? 49.669  31.073  13.965  1.00 26.98 ? 154 ALA A CA  1 
ATOM   1197 C  C   . ALA A 1 154 ? 48.202  30.962  13.587  1.00 27.56 ? 154 ALA A C   1 
ATOM   1198 O  O   . ALA A 1 154 ? 47.360  31.708  14.091  1.00 27.85 ? 154 ALA A O   1 
ATOM   1199 C  CB  . ALA A 1 154 ? 50.413  31.888  12.914  1.00 26.19 ? 154 ALA A CB  1 
ATOM   1200 N  N   . ILE A 1 155 ? 47.898  30.022  12.701  1.00 26.18 ? 155 ILE A N   1 
ATOM   1201 C  CA  . ILE A 1 155 ? 46.532  29.836  12.239  1.00 24.98 ? 155 ILE A CA  1 
ATOM   1202 C  C   . ILE A 1 155 ? 45.697  28.851  13.050  1.00 25.42 ? 155 ILE A C   1 
ATOM   1203 O  O   . ILE A 1 155 ? 44.603  29.191  13.503  1.00 25.06 ? 155 ILE A O   1 
ATOM   1204 C  CB  . ILE A 1 155 ? 46.516  29.390  10.756  1.00 24.97 ? 155 ILE A CB  1 
ATOM   1205 C  CG1 . ILE A 1 155 ? 47.040  30.527  9.874   1.00 25.32 ? 155 ILE A CG1 1 
ATOM   1206 C  CG2 . ILE A 1 155 ? 45.108  28.980  10.338  1.00 22.20 ? 155 ILE A CG2 1 
ATOM   1207 C  CD1 . ILE A 1 155 ? 47.141  30.182  8.402   1.00 25.80 ? 155 ILE A CD1 1 
ATOM   1208 N  N   . SER A 1 156 ? 46.207  27.640  13.245  1.00 23.70 ? 156 SER A N   1 
ATOM   1209 C  CA  . SER A 1 156 ? 45.452  26.613  13.960  1.00 23.13 ? 156 SER A CA  1 
ATOM   1210 C  C   . SER A 1 156 ? 45.705  26.490  15.455  1.00 22.43 ? 156 SER A C   1 
ATOM   1211 O  O   . SER A 1 156 ? 44.948  25.811  16.152  1.00 22.23 ? 156 SER A O   1 
ATOM   1212 C  CB  . SER A 1 156 ? 45.712  25.250  13.328  1.00 21.84 ? 156 SER A CB  1 
ATOM   1213 O  OG  . SER A 1 156 ? 47.018  24.802  13.648  1.00 22.70 ? 156 SER A OG  1 
ATOM   1214 N  N   . GLY A 1 157 ? 46.766  27.118  15.946  1.00 21.15 ? 157 GLY A N   1 
ATOM   1215 C  CA  . GLY A 1 157 ? 47.077  27.020  17.362  1.00 20.89 ? 157 GLY A CA  1 
ATOM   1216 C  C   . GLY A 1 157 ? 47.871  25.759  17.658  1.00 22.06 ? 157 GLY A C   1 
ATOM   1217 O  O   . GLY A 1 157 ? 48.182  25.460  18.811  1.00 22.18 ? 157 GLY A O   1 
ATOM   1218 N  N   . ALA A 1 158 ? 48.204  25.014  16.608  1.00 22.15 ? 158 ALA A N   1 
ATOM   1219 C  CA  . ALA A 1 158 ? 48.966  23.780  16.757  1.00 23.13 ? 158 ALA A CA  1 
ATOM   1220 C  C   . ALA A 1 158 ? 49.866  23.581  15.547  1.00 23.46 ? 158 ALA A C   1 
ATOM   1221 O  O   . ALA A 1 158 ? 49.710  24.256  14.532  1.00 23.13 ? 158 ALA A O   1 
ATOM   1222 C  CB  . ALA A 1 158 ? 48.017  22.594  16.893  1.00 22.21 ? 158 ALA A CB  1 
ATOM   1223 N  N   . SER A 1 159 ? 50.812  22.656  15.657  1.00 23.13 ? 159 SER A N   1 
ATOM   1224 C  CA  . SER A 1 159 ? 51.705  22.369  14.545  1.00 23.98 ? 159 SER A CA  1 
ATOM   1225 C  C   . SER A 1 159 ? 52.225  20.945  14.650  1.00 23.57 ? 159 SER A C   1 
ATOM   1226 O  O   . SER A 1 159 ? 52.058  20.284  15.674  1.00 23.79 ? 159 SER A O   1 
ATOM   1227 C  CB  . SER A 1 159 ? 52.871  23.366  14.507  1.00 25.71 ? 159 SER A CB  1 
ATOM   1228 O  OG  . SER A 1 159 ? 53.633  23.314  15.700  1.00 28.45 ? 159 SER A OG  1 
ATOM   1229 N  N   . GLY A 1 160 ? 52.848  20.473  13.579  1.00 23.31 ? 160 GLY A N   1 
ATOM   1230 C  CA  . GLY A 1 160 ? 53.366  19.119  13.569  1.00 23.43 ? 160 GLY A CA  1 
ATOM   1231 C  C   . GLY A 1 160 ? 52.792  18.334  12.406  1.00 23.27 ? 160 GLY A C   1 
ATOM   1232 O  O   . GLY A 1 160 ? 51.835  18.770  11.761  1.00 22.91 ? 160 GLY A O   1 
ATOM   1233 N  N   . PHE A 1 161 ? 53.381  17.175  12.136  1.00 22.08 ? 161 PHE A N   1 
ATOM   1234 C  CA  . PHE A 1 161 ? 52.937  16.324  11.046  1.00 22.08 ? 161 PHE A CA  1 
ATOM   1235 C  C   . PHE A 1 161 ? 51.901  15.335  11.572  1.00 22.20 ? 161 PHE A C   1 
ATOM   1236 O  O   . PHE A 1 161 ? 52.186  14.557  12.481  1.00 21.88 ? 161 PHE A O   1 
ATOM   1237 C  CB  . PHE A 1 161 ? 54.138  15.577  10.466  1.00 22.25 ? 161 PHE A CB  1 
ATOM   1238 C  CG  . PHE A 1 161 ? 53.791  14.647  9.351   1.00 22.68 ? 161 PHE A CG  1 
ATOM   1239 C  CD1 . PHE A 1 161 ? 53.371  15.140  8.124   1.00 23.58 ? 161 PHE A CD1 1 
ATOM   1240 C  CD2 . PHE A 1 161 ? 53.879  13.267  9.529   1.00 24.98 ? 161 PHE A CD2 1 
ATOM   1241 C  CE1 . PHE A 1 161 ? 53.041  14.274  7.086   1.00 24.59 ? 161 PHE A CE1 1 
ATOM   1242 C  CE2 . PHE A 1 161 ? 53.552  12.391  8.499   1.00 25.03 ? 161 PHE A CE2 1 
ATOM   1243 C  CZ  . PHE A 1 161 ? 53.132  12.895  7.274   1.00 25.44 ? 161 PHE A CZ  1 
ATOM   1244 N  N   . PRO A 1 162 ? 50.679  15.360  11.010  1.00 22.26 ? 162 PRO A N   1 
ATOM   1245 C  CA  . PRO A 1 162 ? 49.603  14.458  11.435  1.00 21.29 ? 162 PRO A CA  1 
ATOM   1246 C  C   . PRO A 1 162 ? 49.901  12.986  11.158  1.00 21.38 ? 162 PRO A C   1 
ATOM   1247 O  O   . PRO A 1 162 ? 50.127  12.591  10.014  1.00 22.13 ? 162 PRO A O   1 
ATOM   1248 C  CB  . PRO A 1 162 ? 48.391  14.948  10.634  1.00 20.05 ? 162 PRO A CB  1 
ATOM   1249 C  CG  . PRO A 1 162 ? 48.695  16.378  10.364  1.00 22.89 ? 162 PRO A CG  1 
ATOM   1250 C  CD  . PRO A 1 162 ? 50.174  16.345  10.036  1.00 22.55 ? 162 PRO A CD  1 
ATOM   1251 N  N   . ILE A 1 163 ? 49.905  12.182  12.214  1.00 19.63 ? 163 ILE A N   1 
ATOM   1252 C  CA  . ILE A 1 163 ? 50.136  10.751  12.098  1.00 19.35 ? 163 ILE A CA  1 
ATOM   1253 C  C   . ILE A 1 163 ? 48.759  10.075  12.008  1.00 20.65 ? 163 ILE A C   1 
ATOM   1254 O  O   . ILE A 1 163 ? 48.543  9.142   11.228  1.00 19.74 ? 163 ILE A O   1 
ATOM   1255 C  CB  . ILE A 1 163 ? 50.888  10.216  13.349  1.00 18.67 ? 163 ILE A CB  1 
ATOM   1256 C  CG1 . ILE A 1 163 ? 52.282  10.842  13.431  1.00 18.44 ? 163 ILE A CG1 1 
ATOM   1257 C  CG2 . ILE A 1 163 ? 50.968  8.704   13.315  1.00 15.52 ? 163 ILE A CG2 1 
ATOM   1258 C  CD1 . ILE A 1 163 ? 53.157  10.578  12.220  1.00 18.03 ? 163 ILE A CD1 1 
ATOM   1259 N  N   . MET A 1 164 ? 47.827  10.582  12.808  1.00 19.46 ? 164 MET A N   1 
ATOM   1260 C  CA  . MET A 1 164 ? 46.478  10.051  12.858  1.00 20.49 ? 164 MET A CA  1 
ATOM   1261 C  C   . MET A 1 164 ? 45.561  11.082  13.530  1.00 19.09 ? 164 MET A C   1 
ATOM   1262 O  O   . MET A 1 164 ? 46.020  11.906  14.320  1.00 18.52 ? 164 MET A O   1 
ATOM   1263 C  CB  . MET A 1 164 ? 46.513  8.721   13.619  1.00 22.85 ? 164 MET A CB  1 
ATOM   1264 C  CG  . MET A 1 164 ? 45.247  8.337   14.334  1.00 28.45 ? 164 MET A CG  1 
ATOM   1265 S  SD  . MET A 1 164 ? 45.270  8.914   16.029  1.00 31.77 ? 164 MET A SD  1 
ATOM   1266 C  CE  . MET A 1 164 ? 45.929  7.483   16.877  1.00 30.45 ? 164 MET A CE  1 
ATOM   1267 N  N   . GLY A 1 165 ? 44.274  11.060  13.202  1.00 17.92 ? 165 GLY A N   1 
ATOM   1268 C  CA  . GLY A 1 165 ? 43.365  12.017  13.809  1.00 17.04 ? 165 GLY A CA  1 
ATOM   1269 C  C   . GLY A 1 165 ? 41.942  11.526  13.988  1.00 16.33 ? 165 GLY A C   1 
ATOM   1270 O  O   . GLY A 1 165 ? 41.511  10.586  13.325  1.00 17.11 ? 165 GLY A O   1 
ATOM   1271 N  N   . LEU A 1 166 ? 41.211  12.163  14.898  1.00 14.87 ? 166 LEU A N   1 
ATOM   1272 C  CA  . LEU A 1 166 ? 39.822  11.808  15.159  1.00 12.86 ? 166 LEU A CA  1 
ATOM   1273 C  C   . LEU A 1 166 ? 38.922  13.025  14.980  1.00 12.29 ? 166 LEU A C   1 
ATOM   1274 O  O   . LEU A 1 166 ? 39.157  14.074  15.569  1.00 11.47 ? 166 LEU A O   1 
ATOM   1275 C  CB  . LEU A 1 166 ? 39.653  11.262  16.582  1.00 11.13 ? 166 LEU A CB  1 
ATOM   1276 C  CG  . LEU A 1 166 ? 38.217  10.911  17.000  1.00 10.16 ? 166 LEU A CG  1 
ATOM   1277 C  CD1 . LEU A 1 166 ? 37.680  9.786   16.105  1.00 10.02 ? 166 LEU A CD1 1 
ATOM   1278 C  CD2 . LEU A 1 166 ? 38.187  10.487  18.461  1.00 9.94  ? 166 LEU A CD2 1 
ATOM   1279 N  N   . ASP A 1 167 ? 37.889  12.864  14.161  1.00 13.24 ? 167 ASP A N   1 
ATOM   1280 C  CA  . ASP A 1 167 ? 36.918  13.916  13.878  1.00 12.65 ? 167 ASP A CA  1 
ATOM   1281 C  C   . ASP A 1 167 ? 35.939  13.977  15.053  1.00 13.16 ? 167 ASP A C   1 
ATOM   1282 O  O   . ASP A 1 167 ? 35.249  12.995  15.337  1.00 14.29 ? 167 ASP A O   1 
ATOM   1283 C  CB  . ASP A 1 167 ? 36.187  13.548  12.584  1.00 12.77 ? 167 ASP A CB  1 
ATOM   1284 C  CG  . ASP A 1 167 ? 35.231  14.620  12.101  1.00 13.92 ? 167 ASP A CG  1 
ATOM   1285 O  OD1 . ASP A 1 167 ? 35.053  15.653  12.788  1.00 13.97 ? 167 ASP A OD1 1 
ATOM   1286 O  OD2 . ASP A 1 167 ? 34.649  14.409  11.012  1.00 11.31 ? 167 ASP A OD2 1 
ATOM   1287 N  N   . VAL A 1 168 ? 35.890  15.103  15.758  1.00 12.43 ? 168 VAL A N   1 
ATOM   1288 C  CA  . VAL A 1 168 ? 34.953  15.205  16.872  1.00 12.25 ? 168 VAL A CA  1 
ATOM   1289 C  C   . VAL A 1 168 ? 33.787  16.175  16.641  1.00 12.24 ? 168 VAL A C   1 
ATOM   1290 O  O   . VAL A 1 168 ? 33.167  16.654  17.593  1.00 13.05 ? 168 VAL A O   1 
ATOM   1291 C  CB  . VAL A 1 168 ? 35.667  15.517  18.219  1.00 10.98 ? 168 VAL A CB  1 
ATOM   1292 C  CG1 . VAL A 1 168 ? 36.451  14.299  18.666  1.00 11.35 ? 168 VAL A CG1 1 
ATOM   1293 C  CG2 . VAL A 1 168 ? 36.581  16.710  18.086  1.00 11.83 ? 168 VAL A CG2 1 
ATOM   1294 N  N   . TRP A 1 169 ? 33.495  16.468  15.372  1.00 9.99  ? 169 TRP A N   1 
ATOM   1295 C  CA  . TRP A 1 169 ? 32.336  17.289  15.046  1.00 8.02  ? 169 TRP A CA  1 
ATOM   1296 C  C   . TRP A 1 169 ? 31.190  16.365  15.416  1.00 8.79  ? 169 TRP A C   1 
ATOM   1297 O  O   . TRP A 1 169 ? 31.318  15.145  15.276  1.00 9.18  ? 169 TRP A O   1 
ATOM   1298 C  CB  . TRP A 1 169 ? 32.241  17.563  13.556  1.00 6.17  ? 169 TRP A CB  1 
ATOM   1299 C  CG  . TRP A 1 169 ? 33.076  18.698  13.088  1.00 8.93  ? 169 TRP A CG  1 
ATOM   1300 C  CD1 . TRP A 1 169 ? 34.422  18.857  13.263  1.00 6.93  ? 169 TRP A CD1 1 
ATOM   1301 C  CD2 . TRP A 1 169 ? 32.629  19.833  12.338  1.00 7.79  ? 169 TRP A CD2 1 
ATOM   1302 N  NE1 . TRP A 1 169 ? 34.839  20.020  12.666  1.00 8.30  ? 169 TRP A NE1 1 
ATOM   1303 C  CE2 . TRP A 1 169 ? 33.761  20.640  12.089  1.00 8.54  ? 169 TRP A CE2 1 
ATOM   1304 C  CE3 . TRP A 1 169 ? 31.383  20.244  11.849  1.00 7.13  ? 169 TRP A CE3 1 
ATOM   1305 C  CZ2 . TRP A 1 169 ? 33.686  21.840  11.371  1.00 7.39  ? 169 TRP A CZ2 1 
ATOM   1306 C  CZ3 . TRP A 1 169 ? 31.306  21.438  11.133  1.00 9.25  ? 169 TRP A CZ3 1 
ATOM   1307 C  CH2 . TRP A 1 169 ? 32.454  22.221  10.902  1.00 10.10 ? 169 TRP A CH2 1 
ATOM   1308 N  N   . GLU A 1 170 ? 30.073  16.916  15.875  1.00 9.08  ? 170 GLU A N   1 
ATOM   1309 C  CA  . GLU A 1 170 ? 28.947  16.072  16.256  1.00 10.00 ? 170 GLU A CA  1 
ATOM   1310 C  C   . GLU A 1 170 ? 28.388  15.200  15.129  1.00 10.95 ? 170 GLU A C   1 
ATOM   1311 O  O   . GLU A 1 170 ? 27.882  14.110  15.398  1.00 12.48 ? 170 GLU A O   1 
ATOM   1312 C  CB  . GLU A 1 170 ? 27.842  16.927  16.886  1.00 10.37 ? 170 GLU A CB  1 
ATOM   1313 C  CG  . GLU A 1 170 ? 28.280  17.537  18.224  1.00 10.81 ? 170 GLU A CG  1 
ATOM   1314 C  CD  . GLU A 1 170 ? 27.234  18.448  18.847  1.00 11.88 ? 170 GLU A CD  1 
ATOM   1315 O  OE1 . GLU A 1 170 ? 26.742  19.360  18.149  1.00 11.00 ? 170 GLU A OE1 1 
ATOM   1316 O  OE2 . GLU A 1 170 ? 26.913  18.257  20.043  1.00 11.72 ? 170 GLU A OE2 1 
ATOM   1317 N  N   . HIS A 1 171 ? 28.492  15.650  13.876  1.00 10.31 ? 171 HIS A N   1 
ATOM   1318 C  CA  . HIS A 1 171 ? 27.977  14.852  12.759  1.00 10.89 ? 171 HIS A CA  1 
ATOM   1319 C  C   . HIS A 1 171 ? 28.695  13.511  12.612  1.00 10.58 ? 171 HIS A C   1 
ATOM   1320 O  O   . HIS A 1 171 ? 28.170  12.581  12.007  1.00 11.95 ? 171 HIS A O   1 
ATOM   1321 C  CB  . HIS A 1 171 ? 28.047  15.633  11.430  1.00 9.33  ? 171 HIS A CB  1 
ATOM   1322 C  CG  . HIS A 1 171 ? 29.438  15.920  10.943  1.00 9.34  ? 171 HIS A CG  1 
ATOM   1323 N  ND1 . HIS A 1 171 ? 29.879  17.198  10.672  1.00 10.11 ? 171 HIS A ND1 1 
ATOM   1324 C  CD2 . HIS A 1 171 ? 30.467  15.096  10.629  1.00 9.77  ? 171 HIS A CD2 1 
ATOM   1325 C  CE1 . HIS A 1 171 ? 31.116  17.150  10.211  1.00 8.60  ? 171 HIS A CE1 1 
ATOM   1326 N  NE2 . HIS A 1 171 ? 31.496  15.885  10.174  1.00 10.84 ? 171 HIS A NE2 1 
ATOM   1327 N  N   . ALA A 1 172 ? 29.890  13.408  13.182  1.00 10.39 ? 172 ALA A N   1 
ATOM   1328 C  CA  . ALA A 1 172 ? 30.661  12.174  13.085  1.00 11.09 ? 172 ALA A CA  1 
ATOM   1329 C  C   . ALA A 1 172 ? 30.190  11.093  14.049  1.00 11.86 ? 172 ALA A C   1 
ATOM   1330 O  O   . ALA A 1 172 ? 30.576  9.938   13.905  1.00 12.57 ? 172 ALA A O   1 
ATOM   1331 C  CB  . ALA A 1 172 ? 32.145  12.462  13.322  1.00 8.60  ? 172 ALA A CB  1 
ATOM   1332 N  N   . TYR A 1 173 ? 29.353  11.452  15.023  1.00 12.03 ? 173 TYR A N   1 
ATOM   1333 C  CA  . TYR A 1 173 ? 28.900  10.458  15.990  1.00 12.56 ? 173 TYR A CA  1 
ATOM   1334 C  C   . TYR A 1 173 ? 27.490  10.627  16.533  1.00 12.16 ? 173 TYR A C   1 
ATOM   1335 O  O   . TYR A 1 173 ? 27.058  9.831   17.362  1.00 13.42 ? 173 TYR A O   1 
ATOM   1336 C  CB  . TYR A 1 173 ? 29.872  10.429  17.173  1.00 11.17 ? 173 TYR A CB  1 
ATOM   1337 C  CG  . TYR A 1 173 ? 29.938  11.729  17.953  1.00 10.42 ? 173 TYR A CG  1 
ATOM   1338 C  CD1 . TYR A 1 173 ? 28.975  12.044  18.917  1.00 9.69  ? 173 TYR A CD1 1 
ATOM   1339 C  CD2 . TYR A 1 173 ? 30.983  12.635  17.747  1.00 10.75 ? 173 TYR A CD2 1 
ATOM   1340 C  CE1 . TYR A 1 173 ? 29.060  13.234  19.668  1.00 8.81  ? 173 TYR A CE1 1 
ATOM   1341 C  CE2 . TYR A 1 173 ? 31.077  13.825  18.489  1.00 9.00  ? 173 TYR A CE2 1 
ATOM   1342 C  CZ  . TYR A 1 173 ? 30.118  14.114  19.448  1.00 8.88  ? 173 TYR A CZ  1 
ATOM   1343 O  OH  . TYR A 1 173 ? 30.244  15.259  20.206  1.00 7.85  ? 173 TYR A OH  1 
ATOM   1344 N  N   . TYR A 1 174 ? 26.757  11.632  16.075  1.00 11.91 ? 174 TYR A N   1 
ATOM   1345 C  CA  . TYR A 1 174 ? 25.433  11.838  16.645  1.00 13.12 ? 174 TYR A CA  1 
ATOM   1346 C  C   . TYR A 1 174 ? 24.343  10.827  16.324  1.00 14.63 ? 174 TYR A C   1 
ATOM   1347 O  O   . TYR A 1 174 ? 23.533  10.516  17.192  1.00 15.34 ? 174 TYR A O   1 
ATOM   1348 C  CB  . TYR A 1 174 ? 24.914  13.238  16.338  1.00 12.26 ? 174 TYR A CB  1 
ATOM   1349 C  CG  . TYR A 1 174 ? 24.215  13.835  17.532  1.00 13.43 ? 174 TYR A CG  1 
ATOM   1350 C  CD1 . TYR A 1 174 ? 24.946  14.274  18.636  1.00 11.62 ? 174 TYR A CD1 1 
ATOM   1351 C  CD2 . TYR A 1 174 ? 22.821  13.908  17.591  1.00 12.72 ? 174 TYR A CD2 1 
ATOM   1352 C  CE1 . TYR A 1 174 ? 24.311  14.771  19.769  1.00 11.49 ? 174 TYR A CE1 1 
ATOM   1353 C  CE2 . TYR A 1 174 ? 22.173  14.402  18.727  1.00 12.35 ? 174 TYR A CE2 1 
ATOM   1354 C  CZ  . TYR A 1 174 ? 22.924  14.831  19.813  1.00 12.39 ? 174 TYR A CZ  1 
ATOM   1355 O  OH  . TYR A 1 174 ? 22.292  15.311  20.946  1.00 9.83  ? 174 TYR A OH  1 
ATOM   1356 N  N   . LEU A 1 175 ? 24.306  10.313  15.099  1.00 15.47 ? 175 LEU A N   1 
ATOM   1357 C  CA  . LEU A 1 175 ? 23.271  9.352   14.742  1.00 16.11 ? 175 LEU A CA  1 
ATOM   1358 C  C   . LEU A 1 175 ? 23.303  8.116   15.635  1.00 16.84 ? 175 LEU A C   1 
ATOM   1359 O  O   . LEU A 1 175 ? 22.259  7.584   16.007  1.00 17.93 ? 175 LEU A O   1 
ATOM   1360 C  CB  . LEU A 1 175 ? 23.398  8.942   13.269  1.00 16.12 ? 175 LEU A CB  1 
ATOM   1361 C  CG  . LEU A 1 175 ? 23.027  10.023  12.242  1.00 16.63 ? 175 LEU A CG  1 
ATOM   1362 C  CD1 . LEU A 1 175 ? 23.207  9.492   10.823  1.00 14.79 ? 175 LEU A CD1 1 
ATOM   1363 C  CD2 . LEU A 1 175 ? 21.587  10.458  12.461  1.00 15.94 ? 175 LEU A CD2 1 
ATOM   1364 N  N   . LYS A 1 176 ? 24.497  7.671   16.004  1.00 17.09 ? 176 LYS A N   1 
ATOM   1365 C  CA  . LYS A 1 176 ? 24.612  6.488   16.843  1.00 15.78 ? 176 LYS A CA  1 
ATOM   1366 C  C   . LYS A 1 176 ? 24.841  6.756   18.334  1.00 16.05 ? 176 LYS A C   1 
ATOM   1367 O  O   . LYS A 1 176 ? 24.221  6.115   19.181  1.00 16.49 ? 176 LYS A O   1 
ATOM   1368 C  CB  . LYS A 1 176 ? 25.724  5.579   16.313  1.00 14.57 ? 176 LYS A CB  1 
ATOM   1369 C  CG  . LYS A 1 176 ? 25.994  4.383   17.205  1.00 15.24 ? 176 LYS A CG  1 
ATOM   1370 C  CD  . LYS A 1 176 ? 27.047  3.466   16.619  1.00 15.45 ? 176 LYS A CD  1 
ATOM   1371 C  CE  . LYS A 1 176 ? 27.243  2.263   17.510  1.00 13.60 ? 176 LYS A CE  1 
ATOM   1372 N  NZ  . LYS A 1 176 ? 28.294  1.353   16.993  1.00 16.82 ? 176 LYS A NZ  1 
ATOM   1373 N  N   . PHE A 1 177 ? 25.713  7.704   18.660  1.00 14.87 ? 177 PHE A N   1 
ATOM   1374 C  CA  . PHE A 1 177 ? 26.014  7.979   20.060  1.00 14.82 ? 177 PHE A CA  1 
ATOM   1375 C  C   . PHE A 1 177 ? 25.356  9.220   20.662  1.00 15.00 ? 177 PHE A C   1 
ATOM   1376 O  O   . PHE A 1 177 ? 25.433  9.436   21.872  1.00 14.34 ? 177 PHE A O   1 
ATOM   1377 C  CB  . PHE A 1 177 ? 27.528  8.101   20.258  1.00 14.19 ? 177 PHE A CB  1 
ATOM   1378 C  CG  . PHE A 1 177 ? 28.321  6.969   19.672  1.00 13.36 ? 177 PHE A CG  1 
ATOM   1379 C  CD1 . PHE A 1 177 ? 28.652  6.960   18.321  1.00 13.51 ? 177 PHE A CD1 1 
ATOM   1380 C  CD2 . PHE A 1 177 ? 28.779  5.930   20.480  1.00 15.00 ? 177 PHE A CD2 1 
ATOM   1381 C  CE1 . PHE A 1 177 ? 29.435  5.936   17.784  1.00 12.49 ? 177 PHE A CE1 1 
ATOM   1382 C  CE2 . PHE A 1 177 ? 29.560  4.903   19.952  1.00 11.16 ? 177 PHE A CE2 1 
ATOM   1383 C  CZ  . PHE A 1 177 ? 29.888  4.910   18.601  1.00 12.72 ? 177 PHE A CZ  1 
ATOM   1384 N  N   . GLN A 1 178 ? 24.705  10.025  19.829  1.00 15.29 ? 178 GLN A N   1 
ATOM   1385 C  CA  . GLN A 1 178 ? 24.085  11.259  20.296  1.00 16.56 ? 178 GLN A CA  1 
ATOM   1386 C  C   . GLN A 1 178 ? 25.108  12.091  21.078  1.00 15.90 ? 178 GLN A C   1 
ATOM   1387 O  O   . GLN A 1 178 ? 26.183  12.388  20.571  1.00 15.94 ? 178 GLN A O   1 
ATOM   1388 C  CB  . GLN A 1 178 ? 22.858  10.984  21.179  1.00 18.31 ? 178 GLN A CB  1 
ATOM   1389 C  CG  . GLN A 1 178 ? 21.662  10.402  20.449  1.00 22.37 ? 178 GLN A CG  1 
ATOM   1390 C  CD  . GLN A 1 178 ? 21.816  8.923   20.191  1.00 24.72 ? 178 GLN A CD  1 
ATOM   1391 O  OE1 . GLN A 1 178 ? 21.955  8.132   21.128  1.00 28.45 ? 178 GLN A OE1 1 
ATOM   1392 N  NE2 . GLN A 1 178 ? 21.799  8.535   18.920  1.00 25.58 ? 178 GLN A NE2 1 
ATOM   1393 N  N   . ASN A 1 179 ? 24.773  12.448  22.315  1.00 14.21 ? 179 ASN A N   1 
ATOM   1394 C  CA  . ASN A 1 179 ? 25.642  13.266  23.155  1.00 15.03 ? 179 ASN A CA  1 
ATOM   1395 C  C   . ASN A 1 179 ? 26.830  12.529  23.767  1.00 15.51 ? 179 ASN A C   1 
ATOM   1396 O  O   . ASN A 1 179 ? 27.731  13.157  24.311  1.00 16.37 ? 179 ASN A O   1 
ATOM   1397 C  CB  . ASN A 1 179 ? 24.831  13.878  24.301  1.00 15.80 ? 179 ASN A CB  1 
ATOM   1398 C  CG  . ASN A 1 179 ? 24.380  12.832  25.315  1.00 18.46 ? 179 ASN A CG  1 
ATOM   1399 O  OD1 . ASN A 1 179 ? 23.529  11.995  25.027  1.00 18.28 ? 179 ASN A OD1 1 
ATOM   1400 N  ND2 . ASN A 1 179 ? 24.969  12.868  26.505  1.00 21.45 ? 179 ASN A ND2 1 
ATOM   1401 N  N   . ARG A 1 180 ? 26.840  11.207  23.684  1.00 15.71 ? 180 ARG A N   1 
ATOM   1402 C  CA  . ARG A 1 180 ? 27.916  10.432  24.291  1.00 17.10 ? 180 ARG A CA  1 
ATOM   1403 C  C   . ARG A 1 180 ? 29.223  10.374  23.505  1.00 16.63 ? 180 ARG A C   1 
ATOM   1404 O  O   . ARG A 1 180 ? 29.642  9.309   23.038  1.00 16.40 ? 180 ARG A O   1 
ATOM   1405 C  CB  . ARG A 1 180 ? 27.421  9.012   24.586  1.00 17.62 ? 180 ARG A CB  1 
ATOM   1406 C  CG  . ARG A 1 180 ? 26.137  8.984   25.415  1.00 17.70 ? 180 ARG A CG  1 
ATOM   1407 C  CD  . ARG A 1 180 ? 25.784  7.570   25.807  1.00 20.07 ? 180 ARG A CD  1 
ATOM   1408 N  NE  . ARG A 1 180 ? 25.732  6.680   24.648  1.00 26.15 ? 180 ARG A NE  1 
ATOM   1409 C  CZ  . ARG A 1 180 ? 24.766  6.692   23.738  1.00 26.72 ? 180 ARG A CZ  1 
ATOM   1410 N  NH1 . ARG A 1 180 ? 23.757  7.549   23.846  1.00 28.69 ? 180 ARG A NH1 1 
ATOM   1411 N  NH2 . ARG A 1 180 ? 24.811  5.844   22.717  1.00 29.06 ? 180 ARG A NH2 1 
ATOM   1412 N  N   . ARG A 1 181 ? 29.880  11.519  23.374  1.00 15.78 ? 181 ARG A N   1 
ATOM   1413 C  CA  . ARG A 1 181 ? 31.143  11.565  22.652  1.00 16.20 ? 181 ARG A CA  1 
ATOM   1414 C  C   . ARG A 1 181 ? 32.168  10.595  23.249  1.00 16.86 ? 181 ARG A C   1 
ATOM   1415 O  O   . ARG A 1 181 ? 32.949  9.989   22.517  1.00 17.53 ? 181 ARG A O   1 
ATOM   1416 C  CB  . ARG A 1 181 ? 31.724  12.985  22.651  1.00 16.14 ? 181 ARG A CB  1 
ATOM   1417 C  CG  . ARG A 1 181 ? 32.961  13.098  21.767  1.00 16.07 ? 181 ARG A CG  1 
ATOM   1418 C  CD  . ARG A 1 181 ? 33.719  14.397  21.957  1.00 15.12 ? 181 ARG A CD  1 
ATOM   1419 N  NE  . ARG A 1 181 ? 33.015  15.563  21.435  1.00 12.82 ? 181 ARG A NE  1 
ATOM   1420 C  CZ  . ARG A 1 181 ? 33.550  16.779  21.366  1.00 13.40 ? 181 ARG A CZ  1 
ATOM   1421 N  NH1 . ARG A 1 181 ? 34.797  16.982  21.780  1.00 12.78 ? 181 ARG A NH1 1 
ATOM   1422 N  NH2 . ARG A 1 181 ? 32.838  17.798  20.907  1.00 11.36 ? 181 ARG A NH2 1 
ATOM   1423 N  N   . PRO A 1 182 ? 32.191  10.446  24.590  1.00 17.87 ? 182 PRO A N   1 
ATOM   1424 C  CA  . PRO A 1 182 ? 33.153  9.526   25.207  1.00 18.27 ? 182 PRO A CA  1 
ATOM   1425 C  C   . PRO A 1 182 ? 33.046  8.091   24.692  1.00 18.29 ? 182 PRO A C   1 
ATOM   1426 O  O   . PRO A 1 182 ? 34.066  7.421   24.511  1.00 19.08 ? 182 PRO A O   1 
ATOM   1427 C  CB  . PRO A 1 182 ? 32.831  9.641   26.693  1.00 19.68 ? 182 PRO A CB  1 
ATOM   1428 C  CG  . PRO A 1 182 ? 32.435  11.079  26.825  1.00 18.82 ? 182 PRO A CG  1 
ATOM   1429 C  CD  . PRO A 1 182 ? 31.522  11.260  25.623  1.00 17.92 ? 182 PRO A CD  1 
ATOM   1430 N  N   . ASP A 1 183 ? 31.824  7.616   24.461  1.00 17.58 ? 183 ASP A N   1 
ATOM   1431 C  CA  . ASP A 1 183 ? 31.643  6.254   23.957  1.00 18.72 ? 183 ASP A CA  1 
ATOM   1432 C  C   . ASP A 1 183 ? 32.173  6.152   22.532  1.00 17.86 ? 183 ASP A C   1 
ATOM   1433 O  O   . ASP A 1 183 ? 32.750  5.138   22.142  1.00 19.60 ? 183 ASP A O   1 
ATOM   1434 C  CB  . ASP A 1 183 ? 30.169  5.840   23.999  1.00 19.53 ? 183 ASP A CB  1 
ATOM   1435 C  CG  . ASP A 1 183 ? 29.632  5.743   25.416  1.00 21.90 ? 183 ASP A CG  1 
ATOM   1436 O  OD1 . ASP A 1 183 ? 30.439  5.524   26.340  1.00 25.06 ? 183 ASP A OD1 1 
ATOM   1437 O  OD2 . ASP A 1 183 ? 28.405  5.870   25.608  1.00 25.23 ? 183 ASP A OD2 1 
ATOM   1438 N  N   . TYR A 1 184 ? 31.974  7.218   21.766  1.00 15.76 ? 184 TYR A N   1 
ATOM   1439 C  CA  . TYR A 1 184 ? 32.439  7.285   20.395  1.00 14.32 ? 184 TYR A CA  1 
ATOM   1440 C  C   . TYR A 1 184 ? 33.966  7.206   20.378  1.00 14.26 ? 184 TYR A C   1 
ATOM   1441 O  O   . TYR A 1 184 ? 34.553  6.472   19.585  1.00 13.69 ? 184 TYR A O   1 
ATOM   1442 C  CB  . TYR A 1 184 ? 31.954  8.599   19.768  1.00 12.78 ? 184 TYR A CB  1 
ATOM   1443 C  CG  . TYR A 1 184 ? 32.650  9.002   18.485  1.00 12.81 ? 184 TYR A CG  1 
ATOM   1444 C  CD1 . TYR A 1 184 ? 32.518  8.242   17.319  1.00 12.34 ? 184 TYR A CD1 1 
ATOM   1445 C  CD2 . TYR A 1 184 ? 33.423  10.164  18.433  1.00 11.47 ? 184 TYR A CD2 1 
ATOM   1446 C  CE1 . TYR A 1 184 ? 33.139  8.636   16.130  1.00 13.44 ? 184 TYR A CE1 1 
ATOM   1447 C  CE2 . TYR A 1 184 ? 34.043  10.565  17.258  1.00 12.09 ? 184 TYR A CE2 1 
ATOM   1448 C  CZ  . TYR A 1 184 ? 33.899  9.802   16.110  1.00 13.40 ? 184 TYR A CZ  1 
ATOM   1449 O  OH  . TYR A 1 184 ? 34.511  10.220  14.948  1.00 14.14 ? 184 TYR A OH  1 
ATOM   1450 N  N   . ILE A 1 185 ? 34.604  7.966   21.261  1.00 15.31 ? 185 ILE A N   1 
ATOM   1451 C  CA  . ILE A 1 185 ? 36.059  7.980   21.344  1.00 16.97 ? 185 ILE A CA  1 
ATOM   1452 C  C   . ILE A 1 185 ? 36.623  6.600   21.675  1.00 18.70 ? 185 ILE A C   1 
ATOM   1453 O  O   . ILE A 1 185 ? 37.627  6.181   21.098  1.00 18.12 ? 185 ILE A O   1 
ATOM   1454 C  CB  . ILE A 1 185 ? 36.541  8.993   22.405  1.00 17.43 ? 185 ILE A CB  1 
ATOM   1455 C  CG1 . ILE A 1 185 ? 36.096  10.406  22.009  1.00 16.97 ? 185 ILE A CG1 1 
ATOM   1456 C  CG2 . ILE A 1 185 ? 38.055  8.924   22.540  1.00 16.60 ? 185 ILE A CG2 1 
ATOM   1457 C  CD1 . ILE A 1 185 ? 36.397  11.463  23.056  1.00 18.35 ? 185 ILE A CD1 1 
ATOM   1458 N  N   . LYS A 1 186 ? 35.981  5.891   22.598  1.00 20.33 ? 186 LYS A N   1 
ATOM   1459 C  CA  . LYS A 1 186 ? 36.456  4.566   22.968  1.00 22.62 ? 186 LYS A CA  1 
ATOM   1460 C  C   . LYS A 1 186 ? 36.276  3.581   21.821  1.00 21.81 ? 186 LYS A C   1 
ATOM   1461 O  O   . LYS A 1 186 ? 37.136  2.729   21.583  1.00 20.32 ? 186 LYS A O   1 
ATOM   1462 C  CB  . LYS A 1 186 ? 35.755  4.088   24.239  1.00 26.42 ? 186 LYS A CB  1 
ATOM   1463 C  CG  . LYS A 1 186 ? 36.283  4.820   25.465  1.00 32.39 ? 186 LYS A CG  1 
ATOM   1464 C  CD  . LYS A 1 186 ? 35.575  4.426   26.744  1.00 37.31 ? 186 LYS A CD  1 
ATOM   1465 C  CE  . LYS A 1 186 ? 36.196  5.148   27.937  1.00 39.70 ? 186 LYS A CE  1 
ATOM   1466 N  NZ  . LYS A 1 186 ? 37.654  4.839   28.061  1.00 39.46 ? 186 LYS A NZ  1 
ATOM   1467 N  N   . GLU A 1 187 ? 35.171  3.711   21.091  1.00 20.66 ? 187 GLU A N   1 
ATOM   1468 C  CA  . GLU A 1 187 ? 34.924  2.834   19.951  1.00 20.66 ? 187 GLU A CA  1 
ATOM   1469 C  C   . GLU A 1 187 ? 35.978  3.054   18.868  1.00 19.68 ? 187 GLU A C   1 
ATOM   1470 O  O   . GLU A 1 187 ? 36.287  2.140   18.107  1.00 18.11 ? 187 GLU A O   1 
ATOM   1471 C  CB  . GLU A 1 187 ? 33.527  3.070   19.364  1.00 21.91 ? 187 GLU A CB  1 
ATOM   1472 C  CG  . GLU A 1 187 ? 32.418  2.352   20.115  1.00 27.15 ? 187 GLU A CG  1 
ATOM   1473 C  CD  . GLU A 1 187 ? 32.354  0.871   19.790  1.00 28.19 ? 187 GLU A CD  1 
ATOM   1474 O  OE1 . GLU A 1 187 ? 33.414  0.224   19.701  1.00 30.85 ? 187 GLU A OE1 1 
ATOM   1475 O  OE2 . GLU A 1 187 ? 31.235  0.344   19.624  1.00 35.04 ? 187 GLU A OE2 1 
ATOM   1476 N  N   . PHE A 1 188 ? 36.533  4.265   18.816  1.00 17.84 ? 188 PHE A N   1 
ATOM   1477 C  CA  . PHE A 1 188 ? 37.551  4.618   17.827  1.00 16.49 ? 188 PHE A CA  1 
ATOM   1478 C  C   . PHE A 1 188 ? 38.779  3.704   17.883  1.00 17.06 ? 188 PHE A C   1 
ATOM   1479 O  O   . PHE A 1 188 ? 39.372  3.379   16.852  1.00 15.89 ? 188 PHE A O   1 
ATOM   1480 C  CB  . PHE A 1 188 ? 37.980  6.077   18.032  1.00 15.64 ? 188 PHE A CB  1 
ATOM   1481 C  CG  . PHE A 1 188 ? 39.111  6.523   17.139  1.00 16.10 ? 188 PHE A CG  1 
ATOM   1482 C  CD1 . PHE A 1 188 ? 38.982  6.497   15.753  1.00 15.96 ? 188 PHE A CD1 1 
ATOM   1483 C  CD2 . PHE A 1 188 ? 40.297  7.005   17.689  1.00 18.12 ? 188 PHE A CD2 1 
ATOM   1484 C  CE1 . PHE A 1 188 ? 40.016  6.947   14.927  1.00 15.70 ? 188 PHE A CE1 1 
ATOM   1485 C  CE2 . PHE A 1 188 ? 41.342  7.461   16.870  1.00 16.34 ? 188 PHE A CE2 1 
ATOM   1486 C  CZ  . PHE A 1 188 ? 41.200  7.432   15.490  1.00 16.40 ? 188 PHE A CZ  1 
ATOM   1487 N  N   . TRP A 1 189 ? 39.163  3.287   19.083  1.00 16.95 ? 189 TRP A N   1 
ATOM   1488 C  CA  . TRP A 1 189 ? 40.332  2.429   19.228  1.00 17.80 ? 189 TRP A CA  1 
ATOM   1489 C  C   . TRP A 1 189 ? 40.194  1.116   18.462  1.00 18.00 ? 189 TRP A C   1 
ATOM   1490 O  O   . TRP A 1 189 ? 41.191  0.493   18.104  1.00 18.10 ? 189 TRP A O   1 
ATOM   1491 C  CB  . TRP A 1 189 ? 40.598  2.153   20.709  1.00 16.92 ? 189 TRP A CB  1 
ATOM   1492 C  CG  . TRP A 1 189 ? 40.949  3.393   21.472  1.00 15.66 ? 189 TRP A CG  1 
ATOM   1493 C  CD1 . TRP A 1 189 ? 40.357  3.844   22.609  1.00 15.09 ? 189 TRP A CD1 1 
ATOM   1494 C  CD2 . TRP A 1 189 ? 41.965  4.348   21.138  1.00 15.08 ? 189 TRP A CD2 1 
ATOM   1495 N  NE1 . TRP A 1 189 ? 40.937  5.025   23.010  1.00 17.95 ? 189 TRP A NE1 1 
ATOM   1496 C  CE2 . TRP A 1 189 ? 41.927  5.358   22.126  1.00 15.44 ? 189 TRP A CE2 1 
ATOM   1497 C  CE3 . TRP A 1 189 ? 42.904  4.449   20.100  1.00 15.87 ? 189 TRP A CE3 1 
ATOM   1498 C  CZ2 . TRP A 1 189 ? 42.790  6.457   22.111  1.00 13.75 ? 189 TRP A CZ2 1 
ATOM   1499 C  CZ3 . TRP A 1 189 ? 43.769  5.549   20.082  1.00 15.23 ? 189 TRP A CZ3 1 
ATOM   1500 C  CH2 . TRP A 1 189 ? 43.702  6.537   21.084  1.00 15.97 ? 189 TRP A CH2 1 
ATOM   1501 N  N   . ASN A 1 190 ? 38.957  0.706   18.203  1.00 17.05 ? 190 ASN A N   1 
ATOM   1502 C  CA  . ASN A 1 190 ? 38.709  -0.529  17.472  1.00 18.85 ? 190 ASN A CA  1 
ATOM   1503 C  C   . ASN A 1 190 ? 38.857  -0.369  15.962  1.00 18.85 ? 190 ASN A C   1 
ATOM   1504 O  O   . ASN A 1 190 ? 38.982  -1.359  15.244  1.00 19.62 ? 190 ASN A O   1 
ATOM   1505 C  CB  . ASN A 1 190 ? 37.306  -1.062  17.784  1.00 17.53 ? 190 ASN A CB  1 
ATOM   1506 C  CG  . ASN A 1 190 ? 37.168  -1.520  19.221  1.00 19.56 ? 190 ASN A CG  1 
ATOM   1507 O  OD1 . ASN A 1 190 ? 37.943  -2.352  19.689  1.00 20.49 ? 190 ASN A OD1 1 
ATOM   1508 N  ND2 . ASN A 1 190 ? 36.180  -0.981  19.930  1.00 18.33 ? 190 ASN A ND2 1 
ATOM   1509 N  N   . VAL A 1 191 ? 38.835  0.866   15.471  1.00 19.36 ? 191 VAL A N   1 
ATOM   1510 C  CA  . VAL A 1 191 ? 38.958  1.077   14.033  1.00 17.75 ? 191 VAL A CA  1 
ATOM   1511 C  C   . VAL A 1 191 ? 40.124  1.953   13.578  1.00 19.42 ? 191 VAL A C   1 
ATOM   1512 O  O   . VAL A 1 191 ? 40.214  2.294   12.402  1.00 19.47 ? 191 VAL A O   1 
ATOM   1513 C  CB  . VAL A 1 191 ? 37.633  1.626   13.421  1.00 16.30 ? 191 VAL A CB  1 
ATOM   1514 C  CG1 . VAL A 1 191 ? 36.562  0.538   13.455  1.00 15.57 ? 191 VAL A CG1 1 
ATOM   1515 C  CG2 . VAL A 1 191 ? 37.155  2.869   14.182  1.00 11.59 ? 191 VAL A CG2 1 
ATOM   1516 N  N   . VAL A 1 192 ? 41.019  2.316   14.491  1.00 19.40 ? 192 VAL A N   1 
ATOM   1517 C  CA  . VAL A 1 192 ? 42.170  3.120   14.100  1.00 21.13 ? 192 VAL A CA  1 
ATOM   1518 C  C   . VAL A 1 192 ? 43.068  2.232   13.243  1.00 20.95 ? 192 VAL A C   1 
ATOM   1519 O  O   . VAL A 1 192 ? 43.420  1.126   13.651  1.00 21.76 ? 192 VAL A O   1 
ATOM   1520 C  CB  . VAL A 1 192 ? 43.006  3.584   15.308  1.00 21.67 ? 192 VAL A CB  1 
ATOM   1521 C  CG1 . VAL A 1 192 ? 44.037  4.599   14.852  1.00 23.57 ? 192 VAL A CG1 1 
ATOM   1522 C  CG2 . VAL A 1 192 ? 42.120  4.177   16.368  1.00 25.46 ? 192 VAL A CG2 1 
ATOM   1523 N  N   . ASN A 1 193 ? 43.441  2.711   12.062  1.00 18.89 ? 193 ASN A N   1 
ATOM   1524 C  CA  . ASN A 1 193 ? 44.303  1.938   11.175  1.00 18.92 ? 193 ASN A CA  1 
ATOM   1525 C  C   . ASN A 1 193 ? 45.763  2.139   11.565  1.00 18.90 ? 193 ASN A C   1 
ATOM   1526 O  O   . ASN A 1 193 ? 46.404  3.082   11.103  1.00 18.72 ? 193 ASN A O   1 
ATOM   1527 C  CB  . ASN A 1 193 ? 44.106  2.389   9.733   1.00 19.15 ? 193 ASN A CB  1 
ATOM   1528 C  CG  . ASN A 1 193 ? 44.828  1.500   8.744   1.00 19.36 ? 193 ASN A CG  1 
ATOM   1529 O  OD1 . ASN A 1 193 ? 45.768  0.782   9.101   1.00 18.86 ? 193 ASN A OD1 1 
ATOM   1530 N  ND2 . ASN A 1 193 ? 44.403  1.554   7.487   1.00 15.07 ? 193 ASN A ND2 1 
ATOM   1531 N  N   . TRP A 1 194 ? 46.292  1.258   12.409  1.00 18.19 ? 194 TRP A N   1 
ATOM   1532 C  CA  . TRP A 1 194 ? 47.676  1.386   12.842  1.00 18.36 ? 194 TRP A CA  1 
ATOM   1533 C  C   . TRP A 1 194 ? 48.695  1.179   11.723  1.00 19.25 ? 194 TRP A C   1 
ATOM   1534 O  O   . TRP A 1 194 ? 49.800  1.715   11.793  1.00 21.11 ? 194 TRP A O   1 
ATOM   1535 C  CB  . TRP A 1 194 ? 47.956  0.436   14.007  1.00 17.24 ? 194 TRP A CB  1 
ATOM   1536 C  CG  . TRP A 1 194 ? 47.214  0.814   15.250  1.00 17.39 ? 194 TRP A CG  1 
ATOM   1537 C  CD1 . TRP A 1 194 ? 46.201  0.120   15.844  1.00 16.25 ? 194 TRP A CD1 1 
ATOM   1538 C  CD2 . TRP A 1 194 ? 47.416  1.989   16.047  1.00 16.45 ? 194 TRP A CD2 1 
ATOM   1539 N  NE1 . TRP A 1 194 ? 45.761  0.786   16.961  1.00 16.26 ? 194 TRP A NE1 1 
ATOM   1540 C  CE2 . TRP A 1 194 ? 46.489  1.938   17.109  1.00 16.83 ? 194 TRP A CE2 1 
ATOM   1541 C  CE3 . TRP A 1 194 ? 48.292  3.082   15.965  1.00 18.06 ? 194 TRP A CE3 1 
ATOM   1542 C  CZ2 . TRP A 1 194 ? 46.410  2.939   18.088  1.00 16.56 ? 194 TRP A CZ2 1 
ATOM   1543 C  CZ3 . TRP A 1 194 ? 48.212  4.081   16.943  1.00 18.05 ? 194 TRP A CZ3 1 
ATOM   1544 C  CH2 . TRP A 1 194 ? 47.277  3.998   17.986  1.00 16.61 ? 194 TRP A CH2 1 
ATOM   1545 N  N   . ASP A 1 195 ? 48.338  0.424   10.687  1.00 19.22 ? 195 ASP A N   1 
ATOM   1546 C  CA  . ASP A 1 195 ? 49.276  0.223   9.583   1.00 20.57 ? 195 ASP A CA  1 
ATOM   1547 C  C   . ASP A 1 195 ? 49.515  1.550   8.867   1.00 20.39 ? 195 ASP A C   1 
ATOM   1548 O  O   . ASP A 1 195 ? 50.659  1.908   8.579   1.00 19.75 ? 195 ASP A O   1 
ATOM   1549 C  CB  . ASP A 1 195 ? 48.750  -0.806  8.581   1.00 21.65 ? 195 ASP A CB  1 
ATOM   1550 C  CG  . ASP A 1 195 ? 48.479  -2.149  9.217   1.00 24.21 ? 195 ASP A CG  1 
ATOM   1551 O  OD1 . ASP A 1 195 ? 49.185  -2.502  10.183  1.00 24.64 ? 195 ASP A OD1 1 
ATOM   1552 O  OD2 . ASP A 1 195 ? 47.564  -2.856  8.745   1.00 28.05 ? 195 ASP A OD2 1 
ATOM   1553 N  N   . GLU A 1 196 ? 48.436  2.285   8.593   1.00 18.95 ? 196 GLU A N   1 
ATOM   1554 C  CA  . GLU A 1 196 ? 48.558  3.572   7.917   1.00 19.21 ? 196 GLU A CA  1 
ATOM   1555 C  C   . GLU A 1 196 ? 49.289  4.557   8.828   1.00 19.76 ? 196 GLU A C   1 
ATOM   1556 O  O   . GLU A 1 196 ? 50.102  5.356   8.364   1.00 18.71 ? 196 GLU A O   1 
ATOM   1557 C  CB  . GLU A 1 196 ? 47.178  4.120   7.550   1.00 21.65 ? 196 GLU A CB  1 
ATOM   1558 C  CG  . GLU A 1 196 ? 47.192  5.424   6.739   1.00 24.12 ? 196 GLU A CG  1 
ATOM   1559 C  CD  . GLU A 1 196 ? 47.939  5.297   5.413   1.00 27.05 ? 196 GLU A CD  1 
ATOM   1560 O  OE1 . GLU A 1 196 ? 48.088  4.163   4.915   1.00 30.13 ? 196 GLU A OE1 1 
ATOM   1561 O  OE2 . GLU A 1 196 ? 48.367  6.332   4.860   1.00 27.05 ? 196 GLU A OE2 1 
ATOM   1562 N  N   . ALA A 1 197 ? 49.007  4.491   10.127  1.00 19.11 ? 197 ALA A N   1 
ATOM   1563 C  CA  . ALA A 1 197 ? 49.659  5.376   11.088  1.00 20.47 ? 197 ALA A CA  1 
ATOM   1564 C  C   . ALA A 1 197 ? 51.159  5.102   11.090  1.00 21.15 ? 197 ALA A C   1 
ATOM   1565 O  O   . ALA A 1 197 ? 51.968  6.029   11.109  1.00 19.32 ? 197 ALA A O   1 
ATOM   1566 C  CB  . ALA A 1 197 ? 49.085  5.166   12.491  1.00 17.26 ? 197 ALA A CB  1 
ATOM   1567 N  N   . ALA A 1 198 ? 51.523  3.822   11.067  1.00 21.93 ? 198 ALA A N   1 
ATOM   1568 C  CA  . ALA A 1 198 ? 52.926  3.429   11.054  1.00 22.65 ? 198 ALA A CA  1 
ATOM   1569 C  C   . ALA A 1 198 ? 53.582  3.910   9.761   1.00 23.61 ? 198 ALA A C   1 
ATOM   1570 O  O   . ALA A 1 198 ? 54.711  4.406   9.773   1.00 24.33 ? 198 ALA A O   1 
ATOM   1571 C  CB  . ALA A 1 198 ? 53.043  1.917   11.175  1.00 21.95 ? 198 ALA A CB  1 
ATOM   1572 N  N   . ALA A 1 199 ? 52.866  3.772   8.648   1.00 23.40 ? 199 ALA A N   1 
ATOM   1573 C  CA  . ALA A 1 199 ? 53.385  4.204   7.355   1.00 23.86 ? 199 ALA A CA  1 
ATOM   1574 C  C   . ALA A 1 199 ? 53.709  5.693   7.366   1.00 24.99 ? 199 ALA A C   1 
ATOM   1575 O  O   . ALA A 1 199 ? 54.783  6.100   6.925   1.00 26.14 ? 199 ALA A O   1 
ATOM   1576 C  CB  . ALA A 1 199 ? 52.378  3.898   6.252   1.00 22.18 ? 199 ALA A CB  1 
ATOM   1577 N  N   . ARG A 1 200 ? 52.777  6.505   7.863   1.00 25.37 ? 200 ARG A N   1 
ATOM   1578 C  CA  . ARG A 1 200 ? 52.984  7.950   7.919   1.00 25.44 ? 200 ARG A CA  1 
ATOM   1579 C  C   . ARG A 1 200 ? 54.134  8.297   8.857   1.00 26.18 ? 200 ARG A C   1 
ATOM   1580 O  O   . ARG A 1 200 ? 54.893  9.228   8.603   1.00 26.81 ? 200 ARG A O   1 
ATOM   1581 C  CB  . ARG A 1 200 ? 51.708  8.662   8.381   1.00 23.33 ? 200 ARG A CB  1 
ATOM   1582 C  CG  . ARG A 1 200 ? 50.554  8.583   7.388   1.00 22.25 ? 200 ARG A CG  1 
ATOM   1583 C  CD  . ARG A 1 200 ? 49.308  9.262   7.948   1.00 21.85 ? 200 ARG A CD  1 
ATOM   1584 N  NE  . ARG A 1 200 ? 49.489  10.702  8.087   1.00 19.04 ? 200 ARG A NE  1 
ATOM   1585 C  CZ  . ARG A 1 200 ? 49.462  11.560  7.070   1.00 19.82 ? 200 ARG A CZ  1 
ATOM   1586 N  NH1 . ARG A 1 200 ? 49.252  11.120  5.835   1.00 18.84 ? 200 ARG A NH1 1 
ATOM   1587 N  NH2 . ARG A 1 200 ? 49.660  12.854  7.286   1.00 16.78 ? 200 ARG A NH2 1 
ATOM   1588 N  N   . PHE A 1 201 ? 54.262  7.543   9.942   1.00 27.89 ? 201 PHE A N   1 
ATOM   1589 C  CA  . PHE A 1 201 ? 55.333  7.776   10.905  1.00 29.92 ? 201 PHE A CA  1 
ATOM   1590 C  C   . PHE A 1 201 ? 56.695  7.522   10.254  1.00 32.60 ? 201 PHE A C   1 
ATOM   1591 O  O   . PHE A 1 201 ? 57.674  8.210   10.545  1.00 33.65 ? 201 PHE A O   1 
ATOM   1592 C  CB  . PHE A 1 201 ? 55.157  6.860   12.119  1.00 27.18 ? 201 PHE A CB  1 
ATOM   1593 C  CG  . PHE A 1 201 ? 56.234  7.010   13.157  1.00 27.25 ? 201 PHE A CG  1 
ATOM   1594 C  CD1 . PHE A 1 201 ? 56.389  8.205   13.852  1.00 26.79 ? 201 PHE A CD1 1 
ATOM   1595 C  CD2 . PHE A 1 201 ? 57.094  5.951   13.442  1.00 27.09 ? 201 PHE A CD2 1 
ATOM   1596 C  CE1 . PHE A 1 201 ? 57.383  8.346   14.817  1.00 27.29 ? 201 PHE A CE1 1 
ATOM   1597 C  CE2 . PHE A 1 201 ? 58.095  6.080   14.407  1.00 27.11 ? 201 PHE A CE2 1 
ATOM   1598 C  CZ  . PHE A 1 201 ? 58.240  7.279   15.096  1.00 27.53 ? 201 PHE A CZ  1 
ATOM   1599 N  N   . ALA A 1 202 ? 56.747  6.532   9.370   1.00 35.25 ? 202 ALA A N   1 
ATOM   1600 C  CA  . ALA A 1 202 ? 57.980  6.184   8.678   1.00 38.53 ? 202 ALA A CA  1 
ATOM   1601 C  C   . ALA A 1 202 ? 58.364  7.253   7.654   1.00 40.68 ? 202 ALA A C   1 
ATOM   1602 O  O   . ALA A 1 202 ? 59.534  7.605   7.526   1.00 40.81 ? 202 ALA A O   1 
ATOM   1603 C  CB  . ALA A 1 202 ? 57.825  4.826   7.996   1.00 37.29 ? 202 ALA A CB  1 
ATOM   1604 N  N   . ALA A 1 203 ? 57.372  7.769   6.933   1.00 43.69 ? 203 ALA A N   1 
ATOM   1605 C  CA  . ALA A 1 203 ? 57.607  8.793   5.920   1.00 46.02 ? 203 ALA A CA  1 
ATOM   1606 C  C   . ALA A 1 203 ? 58.037  10.116  6.547   1.00 48.50 ? 203 ALA A C   1 
ATOM   1607 O  O   . ALA A 1 203 ? 58.948  10.778  6.049   1.00 49.14 ? 203 ALA A O   1 
ATOM   1608 C  CB  . ALA A 1 203 ? 56.350  8.992   5.085   1.00 44.15 ? 203 ALA A CB  1 
ATOM   1609 N  N   . LYS A 1 204 ? 57.371  10.497  7.634   1.00 51.53 ? 204 LYS A N   1 
ATOM   1610 C  CA  . LYS A 1 204 ? 57.671  11.740  8.344   1.00 54.26 ? 204 LYS A CA  1 
ATOM   1611 C  C   . LYS A 1 204 ? 57.331  13.001  7.544   1.00 56.91 ? 204 LYS A C   1 
ATOM   1612 O  O   . LYS A 1 204 ? 57.560  14.119  8.009   1.00 57.34 ? 204 LYS A O   1 
ATOM   1613 C  CB  . LYS A 1 204 ? 59.144  11.759  8.758   1.00 52.67 ? 204 LYS A CB  1 
ATOM   1614 C  CG  . LYS A 1 204 ? 59.450  10.807  9.892   1.00 52.40 ? 204 LYS A CG  1 
ATOM   1615 C  CD  . LYS A 1 204 ? 60.932  10.675  10.155  1.00 51.97 ? 204 LYS A CD  1 
ATOM   1616 C  CE  . LYS A 1 204 ? 61.170  9.975   11.485  1.00 52.70 ? 204 LYS A CE  1 
ATOM   1617 N  NZ  . LYS A 1 204 ? 60.376  8.718   11.619  1.00 51.53 ? 204 LYS A NZ  1 
ATOM   1618 N  N   . LYS A 1 205 ? 56.774  12.809  6.349   1.00 59.81 ? 205 LYS A N   1 
ATOM   1619 C  CA  . LYS A 1 205 ? 56.374  13.909  5.467   1.00 62.43 ? 205 LYS A CA  1 
ATOM   1620 C  C   . LYS A 1 205 ? 55.310  13.447  4.468   1.00 63.51 ? 205 LYS A C   1 
ATOM   1621 O  O   . LYS A 1 205 ? 55.034  12.228  4.411   1.00 63.77 ? 205 LYS A O   1 
ATOM   1622 C  CB  . LYS A 1 205 ? 57.577  14.453  4.689   1.00 64.05 ? 205 LYS A CB  1 
ATOM   1623 C  CG  . LYS A 1 205 ? 58.524  15.318  5.498   1.00 66.53 ? 205 LYS A CG  1 
ATOM   1624 C  CD  . LYS A 1 205 ? 59.642  15.871  4.622   1.00 68.01 ? 205 LYS A CD  1 
ATOM   1625 C  CE  . LYS A 1 205 ? 60.582  16.766  5.421   1.00 69.31 ? 205 LYS A CE  1 
ATOM   1626 N  NZ  . LYS A 1 205 ? 61.687  17.319  4.587   1.00 68.71 ? 205 LYS A NZ  1 
ATOM   1627 O  OXT . LYS A 1 205 ? 54.773  14.312  3.741   1.00 64.27 ? 205 LYS A OXT 1 
ATOM   1628 N  N   . SER B 1 1   ? 23.150  28.124  43.344  1.00 27.66 ? 1   SER B N   1 
ATOM   1629 C  CA  . SER B 1 1   ? 23.384  27.171  42.227  1.00 27.65 ? 1   SER B CA  1 
ATOM   1630 C  C   . SER B 1 1   ? 22.286  27.322  41.181  1.00 26.52 ? 1   SER B C   1 
ATOM   1631 O  O   . SER B 1 1   ? 21.178  27.756  41.495  1.00 26.55 ? 1   SER B O   1 
ATOM   1632 C  CB  . SER B 1 1   ? 23.385  25.731  42.754  1.00 29.73 ? 1   SER B CB  1 
ATOM   1633 O  OG  . SER B 1 1   ? 22.096  25.357  43.222  1.00 30.73 ? 1   SER B OG  1 
ATOM   1634 N  N   . TYR B 1 2   ? 22.595  26.965  39.939  1.00 23.55 ? 2   TYR B N   1 
ATOM   1635 C  CA  . TYR B 1 2   ? 21.612  27.052  38.869  1.00 21.21 ? 2   TYR B CA  1 
ATOM   1636 C  C   . TYR B 1 2   ? 20.781  25.781  38.837  1.00 19.63 ? 2   TYR B C   1 
ATOM   1637 O  O   . TYR B 1 2   ? 21.269  24.700  39.162  1.00 18.56 ? 2   TYR B O   1 
ATOM   1638 C  CB  . TYR B 1 2   ? 22.295  27.234  37.514  1.00 21.36 ? 2   TYR B CB  1 
ATOM   1639 C  CG  . TYR B 1 2   ? 23.142  28.476  37.415  1.00 24.33 ? 2   TYR B CG  1 
ATOM   1640 C  CD1 . TYR B 1 2   ? 22.662  29.705  37.862  1.00 26.07 ? 2   TYR B CD1 1 
ATOM   1641 C  CD2 . TYR B 1 2   ? 24.423  28.428  36.866  1.00 25.17 ? 2   TYR B CD2 1 
ATOM   1642 C  CE1 . TYR B 1 2   ? 23.436  30.857  37.768  1.00 28.40 ? 2   TYR B CE1 1 
ATOM   1643 C  CE2 . TYR B 1 2   ? 25.206  29.574  36.765  1.00 27.14 ? 2   TYR B CE2 1 
ATOM   1644 C  CZ  . TYR B 1 2   ? 24.707  30.785  37.219  1.00 30.06 ? 2   TYR B CZ  1 
ATOM   1645 O  OH  . TYR B 1 2   ? 25.477  31.923  37.136  1.00 34.53 ? 2   TYR B OH  1 
ATOM   1646 N  N   . THR B 1 3   ? 19.520  25.923  38.455  1.00 19.42 ? 3   THR B N   1 
ATOM   1647 C  CA  . THR B 1 3   ? 18.612  24.791  38.346  1.00 18.57 ? 3   THR B CA  1 
ATOM   1648 C  C   . THR B 1 3   ? 18.274  24.618  36.866  1.00 18.48 ? 3   THR B C   1 
ATOM   1649 O  O   . THR B 1 3   ? 18.055  25.603  36.162  1.00 19.73 ? 3   THR B O   1 
ATOM   1650 C  CB  . THR B 1 3   ? 17.291  25.047  39.118  1.00 17.85 ? 3   THR B CB  1 
ATOM   1651 O  OG1 . THR B 1 3   ? 17.576  25.266  40.503  1.00 18.95 ? 3   THR B OG1 1 
ATOM   1652 C  CG2 . THR B 1 3   ? 16.350  23.857  38.991  1.00 15.13 ? 3   THR B CG2 1 
ATOM   1653 N  N   . LEU B 1 4   ? 18.256  23.377  36.388  1.00 17.78 ? 4   LEU B N   1 
ATOM   1654 C  CA  . LEU B 1 4   ? 17.891  23.117  35.002  1.00 17.17 ? 4   LEU B CA  1 
ATOM   1655 C  C   . LEU B 1 4   ? 16.409  23.508  34.890  1.00 17.74 ? 4   LEU B C   1 
ATOM   1656 O  O   . LEU B 1 4   ? 15.560  22.943  35.576  1.00 17.25 ? 4   LEU B O   1 
ATOM   1657 C  CB  . LEU B 1 4   ? 18.049  21.628  34.681  1.00 16.38 ? 4   LEU B CB  1 
ATOM   1658 C  CG  . LEU B 1 4   ? 17.659  21.206  33.259  1.00 16.69 ? 4   LEU B CG  1 
ATOM   1659 C  CD1 . LEU B 1 4   ? 18.679  21.737  32.275  1.00 11.56 ? 4   LEU B CD1 1 
ATOM   1660 C  CD2 . LEU B 1 4   ? 17.586  19.691  33.167  1.00 16.74 ? 4   LEU B CD2 1 
ATOM   1661 N  N   . PRO B 1 5   ? 16.078  24.484  34.034  1.00 18.93 ? 5   PRO B N   1 
ATOM   1662 C  CA  . PRO B 1 5   ? 14.669  24.870  33.918  1.00 19.32 ? 5   PRO B CA  1 
ATOM   1663 C  C   . PRO B 1 5   ? 13.858  23.823  33.178  1.00 19.78 ? 5   PRO B C   1 
ATOM   1664 O  O   . PRO B 1 5   ? 14.351  23.183  32.248  1.00 20.64 ? 5   PRO B O   1 
ATOM   1665 C  CB  . PRO B 1 5   ? 14.738  26.180  33.144  1.00 19.03 ? 5   PRO B CB  1 
ATOM   1666 C  CG  . PRO B 1 5   ? 15.885  25.926  32.212  1.00 19.73 ? 5   PRO B CG  1 
ATOM   1667 C  CD  . PRO B 1 5   ? 16.918  25.270  33.111  1.00 18.34 ? 5   PRO B CD  1 
ATOM   1668 N  N   . SER B 1 6   ? 12.616  23.638  33.593  1.00 20.83 ? 6   SER B N   1 
ATOM   1669 C  CA  . SER B 1 6   ? 11.753  22.680  32.924  1.00 24.15 ? 6   SER B CA  1 
ATOM   1670 C  C   . SER B 1 6   ? 11.217  23.383  31.678  1.00 23.73 ? 6   SER B C   1 
ATOM   1671 O  O   . SER B 1 6   ? 11.140  24.611  31.643  1.00 22.25 ? 6   SER B O   1 
ATOM   1672 C  CB  . SER B 1 6   ? 10.603  22.285  33.845  1.00 26.87 ? 6   SER B CB  1 
ATOM   1673 O  OG  . SER B 1 6   ? 9.901   23.446  34.263  1.00 33.01 ? 6   SER B OG  1 
ATOM   1674 N  N   . LEU B 1 7   ? 10.871  22.616  30.650  1.00 25.72 ? 7   LEU B N   1 
ATOM   1675 C  CA  . LEU B 1 7   ? 10.342  23.208  29.427  1.00 26.00 ? 7   LEU B CA  1 
ATOM   1676 C  C   . LEU B 1 7   ? 8.919   23.709  29.648  1.00 26.52 ? 7   LEU B C   1 
ATOM   1677 O  O   . LEU B 1 7   ? 8.160   23.135  30.438  1.00 26.06 ? 7   LEU B O   1 
ATOM   1678 C  CB  . LEU B 1 7   ? 10.363  22.193  28.281  1.00 26.26 ? 7   LEU B CB  1 
ATOM   1679 C  CG  . LEU B 1 7   ? 11.749  21.797  27.775  1.00 28.11 ? 7   LEU B CG  1 
ATOM   1680 C  CD1 . LEU B 1 7   ? 11.624  21.010  26.483  1.00 28.25 ? 7   LEU B CD1 1 
ATOM   1681 C  CD2 . LEU B 1 7   ? 12.566  23.051  27.528  1.00 30.48 ? 7   LEU B CD2 1 
ATOM   1682 N  N   . PRO B 1 8   ? 8.539   24.793  28.949  1.00 26.73 ? 8   PRO B N   1 
ATOM   1683 C  CA  . PRO B 1 8   ? 7.204   25.394  29.053  1.00 25.46 ? 8   PRO B CA  1 
ATOM   1684 C  C   . PRO B 1 8   ? 6.165   24.643  28.217  1.00 25.46 ? 8   PRO B C   1 
ATOM   1685 O  O   . PRO B 1 8   ? 5.031   25.108  28.058  1.00 26.48 ? 8   PRO B O   1 
ATOM   1686 C  CB  . PRO B 1 8   ? 7.417   26.820  28.531  1.00 25.49 ? 8   PRO B CB  1 
ATOM   1687 C  CG  . PRO B 1 8   ? 8.927   27.007  28.506  1.00 26.94 ? 8   PRO B CG  1 
ATOM   1688 C  CD  . PRO B 1 8   ? 9.421   25.643  28.137  1.00 26.16 ? 8   PRO B CD  1 
ATOM   1689 N  N   . TYR B 1 9   ? 6.553   23.483  27.694  1.00 22.35 ? 9   TYR B N   1 
ATOM   1690 C  CA  . TYR B 1 9   ? 5.670   22.691  26.853  1.00 20.95 ? 9   TYR B CA  1 
ATOM   1691 C  C   . TYR B 1 9   ? 6.154   21.253  26.749  1.00 20.86 ? 9   TYR B C   1 
ATOM   1692 O  O   . TYR B 1 9   ? 7.256   20.929  27.183  1.00 21.21 ? 9   TYR B O   1 
ATOM   1693 C  CB  . TYR B 1 9   ? 5.612   23.317  25.456  1.00 23.63 ? 9   TYR B CB  1 
ATOM   1694 C  CG  . TYR B 1 9   ? 6.970   23.793  24.971  1.00 24.53 ? 9   TYR B CG  1 
ATOM   1695 C  CD1 . TYR B 1 9   ? 7.977   22.882  24.643  1.00 23.99 ? 9   TYR B CD1 1 
ATOM   1696 C  CD2 . TYR B 1 9   ? 7.272   25.153  24.920  1.00 24.31 ? 9   TYR B CD2 1 
ATOM   1697 C  CE1 . TYR B 1 9   ? 9.256   23.316  24.284  1.00 25.47 ? 9   TYR B CE1 1 
ATOM   1698 C  CE2 . TYR B 1 9   ? 8.547   25.601  24.563  1.00 27.36 ? 9   TYR B CE2 1 
ATOM   1699 C  CZ  . TYR B 1 9   ? 9.537   24.676  24.250  1.00 27.03 ? 9   TYR B CZ  1 
ATOM   1700 O  OH  . TYR B 1 9   ? 10.808  25.118  23.944  1.00 25.82 ? 9   TYR B OH  1 
ATOM   1701 N  N   . ALA B 1 10  ? 5.323   20.392  26.171  1.00 20.42 ? 10  ALA B N   1 
ATOM   1702 C  CA  . ALA B 1 10  ? 5.671   18.987  26.003  1.00 21.74 ? 10  ALA B CA  1 
ATOM   1703 C  C   . ALA B 1 10  ? 6.856   18.874  25.042  1.00 23.14 ? 10  ALA B C   1 
ATOM   1704 O  O   . ALA B 1 10  ? 7.116   19.795  24.267  1.00 22.68 ? 10  ALA B O   1 
ATOM   1705 C  CB  . ALA B 1 10  ? 4.472   18.219  25.455  1.00 20.64 ? 10  ALA B CB  1 
ATOM   1706 N  N   . TYR B 1 11  ? 7.566   17.749  25.091  1.00 24.33 ? 11  TYR B N   1 
ATOM   1707 C  CA  . TYR B 1 11  ? 8.720   17.538  24.222  1.00 25.89 ? 11  TYR B CA  1 
ATOM   1708 C  C   . TYR B 1 11  ? 8.331   17.394  22.755  1.00 27.08 ? 11  TYR B C   1 
ATOM   1709 O  O   . TYR B 1 11  ? 9.185   17.480  21.869  1.00 26.98 ? 11  TYR B O   1 
ATOM   1710 C  CB  . TYR B 1 11  ? 9.522   16.309  24.678  1.00 27.51 ? 11  TYR B CB  1 
ATOM   1711 C  CG  . TYR B 1 11  ? 10.353  16.562  25.921  1.00 30.09 ? 11  TYR B CG  1 
ATOM   1712 C  CD1 . TYR B 1 11  ? 11.223  17.649  25.985  1.00 29.75 ? 11  TYR B CD1 1 
ATOM   1713 C  CD2 . TYR B 1 11  ? 10.263  15.728  27.037  1.00 30.57 ? 11  TYR B CD2 1 
ATOM   1714 C  CE1 . TYR B 1 11  ? 11.981  17.905  27.126  1.00 30.12 ? 11  TYR B CE1 1 
ATOM   1715 C  CE2 . TYR B 1 11  ? 11.022  15.977  28.189  1.00 30.36 ? 11  TYR B CE2 1 
ATOM   1716 C  CZ  . TYR B 1 11  ? 11.876  17.071  28.224  1.00 30.84 ? 11  TYR B CZ  1 
ATOM   1717 O  OH  . TYR B 1 11  ? 12.612  17.357  29.355  1.00 29.55 ? 11  TYR B OH  1 
ATOM   1718 N  N   . ASP B 1 12  ? 7.042   17.186  22.495  1.00 27.14 ? 12  ASP B N   1 
ATOM   1719 C  CA  . ASP B 1 12  ? 6.559   17.042  21.124  1.00 26.63 ? 12  ASP B CA  1 
ATOM   1720 C  C   . ASP B 1 12  ? 5.694   18.234  20.724  1.00 25.10 ? 12  ASP B C   1 
ATOM   1721 O  O   . ASP B 1 12  ? 5.083   18.244  19.659  1.00 25.48 ? 12  ASP B O   1 
ATOM   1722 C  CB  . ASP B 1 12  ? 5.760   15.739  20.976  1.00 29.21 ? 12  ASP B CB  1 
ATOM   1723 C  CG  . ASP B 1 12  ? 4.495   15.715  21.839  1.00 32.32 ? 12  ASP B CG  1 
ATOM   1724 O  OD1 . ASP B 1 12  ? 4.318   16.624  22.680  1.00 32.24 ? 12  ASP B OD1 1 
ATOM   1725 O  OD2 . ASP B 1 12  ? 3.678   14.778  21.680  1.00 33.69 ? 12  ASP B OD2 1 
ATOM   1726 N  N   . ALA B 1 13  ? 5.652   19.246  21.580  1.00 22.87 ? 13  ALA B N   1 
ATOM   1727 C  CA  . ALA B 1 13  ? 4.849   20.430  21.308  1.00 22.88 ? 13  ALA B CA  1 
ATOM   1728 C  C   . ALA B 1 13  ? 5.284   21.200  20.061  1.00 23.03 ? 13  ALA B C   1 
ATOM   1729 O  O   . ALA B 1 13  ? 4.542   22.049  19.562  1.00 22.88 ? 13  ALA B O   1 
ATOM   1730 C  CB  . ALA B 1 13  ? 4.870   21.353  22.518  1.00 22.09 ? 13  ALA B CB  1 
ATOM   1731 N  N   . LEU B 1 14  ? 6.480   20.917  19.555  1.00 22.32 ? 14  LEU B N   1 
ATOM   1732 C  CA  . LEU B 1 14  ? 6.960   21.628  18.379  1.00 20.87 ? 14  LEU B CA  1 
ATOM   1733 C  C   . LEU B 1 14  ? 6.877   20.790  17.108  1.00 21.22 ? 14  LEU B C   1 
ATOM   1734 O  O   . LEU B 1 14  ? 7.326   21.215  16.043  1.00 21.03 ? 14  LEU B O   1 
ATOM   1735 C  CB  . LEU B 1 14  ? 8.389   22.123  18.614  1.00 20.82 ? 14  LEU B CB  1 
ATOM   1736 C  CG  . LEU B 1 14  ? 8.541   23.064  19.817  1.00 19.19 ? 14  LEU B CG  1 
ATOM   1737 C  CD1 . LEU B 1 14  ? 9.992   23.472  19.982  1.00 17.67 ? 14  LEU B CD1 1 
ATOM   1738 C  CD2 . LEU B 1 14  ? 7.659   24.289  19.622  1.00 19.71 ? 14  LEU B CD2 1 
ATOM   1739 N  N   . GLU B 1 15  ? 6.305   19.596  17.219  1.00 20.92 ? 15  GLU B N   1 
ATOM   1740 C  CA  . GLU B 1 15  ? 6.135   18.742  16.051  1.00 23.42 ? 15  GLU B CA  1 
ATOM   1741 C  C   . GLU B 1 15  ? 5.136   19.464  15.144  1.00 24.28 ? 15  GLU B C   1 
ATOM   1742 O  O   . GLU B 1 15  ? 4.292   20.224  15.627  1.00 24.96 ? 15  GLU B O   1 
ATOM   1743 C  CB  . GLU B 1 15  ? 5.582   17.383  16.470  1.00 24.26 ? 15  GLU B CB  1 
ATOM   1744 C  CG  . GLU B 1 15  ? 6.562   16.559  17.284  1.00 27.41 ? 15  GLU B CG  1 
ATOM   1745 C  CD  . GLU B 1 15  ? 7.563   15.829  16.412  1.00 30.33 ? 15  GLU B CD  1 
ATOM   1746 O  OE1 . GLU B 1 15  ? 7.932   16.370  15.347  1.00 32.40 ? 15  GLU B OE1 1 
ATOM   1747 O  OE2 . GLU B 1 15  ? 7.984   14.718  16.795  1.00 31.06 ? 15  GLU B OE2 1 
ATOM   1748 N  N   . PRO B 1 16  ? 5.220   19.251  13.820  1.00 23.48 ? 16  PRO B N   1 
ATOM   1749 C  CA  . PRO B 1 16  ? 6.174   18.392  13.115  1.00 23.65 ? 16  PRO B CA  1 
ATOM   1750 C  C   . PRO B 1 16  ? 7.428   19.131  12.641  1.00 22.76 ? 16  PRO B C   1 
ATOM   1751 O  O   . PRO B 1 16  ? 8.120   18.657  11.745  1.00 24.52 ? 16  PRO B O   1 
ATOM   1752 C  CB  . PRO B 1 16  ? 5.348   17.886  11.945  1.00 23.56 ? 16  PRO B CB  1 
ATOM   1753 C  CG  . PRO B 1 16  ? 4.615   19.139  11.550  1.00 22.73 ? 16  PRO B CG  1 
ATOM   1754 C  CD  . PRO B 1 16  ? 4.156   19.697  12.900  1.00 23.96 ? 16  PRO B CD  1 
ATOM   1755 N  N   . HIS B 1 17  ? 7.717   20.284  13.236  1.00 22.19 ? 17  HIS B N   1 
ATOM   1756 C  CA  . HIS B 1 17  ? 8.881   21.078  12.849  1.00 22.71 ? 17  HIS B CA  1 
ATOM   1757 C  C   . HIS B 1 17  ? 10.172  20.599  13.514  1.00 22.77 ? 17  HIS B C   1 
ATOM   1758 O  O   . HIS B 1 17  ? 11.129  20.250  12.827  1.00 23.74 ? 17  HIS B O   1 
ATOM   1759 C  CB  . HIS B 1 17  ? 8.616   22.544  13.177  1.00 24.97 ? 17  HIS B CB  1 
ATOM   1760 C  CG  . HIS B 1 17  ? 7.297   23.038  12.668  1.00 28.11 ? 17  HIS B CG  1 
ATOM   1761 N  ND1 . HIS B 1 17  ? 6.999   23.109  11.324  1.00 29.72 ? 17  HIS B ND1 1 
ATOM   1762 C  CD2 . HIS B 1 17  ? 6.186   23.451  13.323  1.00 28.57 ? 17  HIS B CD2 1 
ATOM   1763 C  CE1 . HIS B 1 17  ? 5.760   23.545  11.173  1.00 29.56 ? 17  HIS B CE1 1 
ATOM   1764 N  NE2 . HIS B 1 17  ? 5.245   23.759  12.370  1.00 30.20 ? 17  HIS B NE2 1 
ATOM   1765 N  N   . PHE B 1 18  ? 10.201  20.602  14.845  1.00 22.08 ? 18  PHE B N   1 
ATOM   1766 C  CA  . PHE B 1 18  ? 11.361  20.126  15.601  1.00 20.17 ? 18  PHE B CA  1 
ATOM   1767 C  C   . PHE B 1 18  ? 10.954  18.790  16.210  1.00 20.69 ? 18  PHE B C   1 
ATOM   1768 O  O   . PHE B 1 18  ? 9.916   18.696  16.870  1.00 21.53 ? 18  PHE B O   1 
ATOM   1769 C  CB  . PHE B 1 18  ? 11.736  21.120  16.702  1.00 18.00 ? 18  PHE B CB  1 
ATOM   1770 C  CG  . PHE B 1 18  ? 12.466  22.343  16.202  1.00 19.69 ? 18  PHE B CG  1 
ATOM   1771 C  CD1 . PHE B 1 18  ? 12.614  22.582  14.840  1.00 19.83 ? 18  PHE B CD1 1 
ATOM   1772 C  CD2 . PHE B 1 18  ? 13.010  23.257  17.101  1.00 20.67 ? 18  PHE B CD2 1 
ATOM   1773 C  CE1 . PHE B 1 18  ? 13.295  23.715  14.382  1.00 21.76 ? 18  PHE B CE1 1 
ATOM   1774 C  CE2 . PHE B 1 18  ? 13.692  24.392  16.654  1.00 20.96 ? 18  PHE B CE2 1 
ATOM   1775 C  CZ  . PHE B 1 18  ? 13.835  24.622  15.296  1.00 20.42 ? 18  PHE B CZ  1 
ATOM   1776 N  N   . ASP B 1 19  ? 11.760  17.758  15.983  1.00 19.54 ? 19  ASP B N   1 
ATOM   1777 C  CA  . ASP B 1 19  ? 11.446  16.427  16.484  1.00 20.04 ? 19  ASP B CA  1 
ATOM   1778 C  C   . ASP B 1 19  ? 11.487  16.269  18.004  1.00 21.70 ? 19  ASP B C   1 
ATOM   1779 O  O   . ASP B 1 19  ? 12.328  16.846  18.696  1.00 20.28 ? 19  ASP B O   1 
ATOM   1780 C  CB  . ASP B 1 19  ? 12.369  15.399  15.834  1.00 18.89 ? 19  ASP B CB  1 
ATOM   1781 C  CG  . ASP B 1 19  ? 13.836  15.707  16.067  1.00 20.27 ? 19  ASP B CG  1 
ATOM   1782 O  OD1 . ASP B 1 19  ? 14.261  16.846  15.760  1.00 15.05 ? 19  ASP B OD1 1 
ATOM   1783 O  OD2 . ASP B 1 19  ? 14.557  14.804  16.551  1.00 19.19 ? 19  ASP B OD2 1 
ATOM   1784 N  N   . LYS B 1 20  ? 10.557  15.461  18.499  1.00 23.46 ? 20  LYS B N   1 
ATOM   1785 C  CA  . LYS B 1 20  ? 10.407  15.166  19.916  1.00 24.90 ? 20  LYS B CA  1 
ATOM   1786 C  C   . LYS B 1 20  ? 11.677  14.586  20.531  1.00 23.74 ? 20  LYS B C   1 
ATOM   1787 O  O   . LYS B 1 20  ? 12.089  14.990  21.622  1.00 23.20 ? 20  LYS B O   1 
ATOM   1788 C  CB  . LYS B 1 20  ? 9.259   14.167  20.099  1.00 28.41 ? 20  LYS B CB  1 
ATOM   1789 C  CG  . LYS B 1 20  ? 9.111   13.608  21.502  1.00 34.41 ? 20  LYS B CG  1 
ATOM   1790 C  CD  . LYS B 1 20  ? 8.105   12.460  21.512  1.00 41.40 ? 20  LYS B CD  1 
ATOM   1791 C  CE  . LYS B 1 20  ? 7.839   11.931  22.928  1.00 43.93 ? 20  LYS B CE  1 
ATOM   1792 N  NZ  . LYS B 1 20  ? 7.074   12.900  23.772  1.00 46.49 ? 20  LYS B NZ  1 
ATOM   1793 N  N   . GLN B 1 21  ? 12.288  13.635  19.830  1.00 22.12 ? 21  GLN B N   1 
ATOM   1794 C  CA  . GLN B 1 21  ? 13.492  12.986  20.328  1.00 22.21 ? 21  GLN B CA  1 
ATOM   1795 C  C   . GLN B 1 21  ? 14.625  13.973  20.613  1.00 20.93 ? 21  GLN B C   1 
ATOM   1796 O  O   . GLN B 1 21  ? 15.268  13.906  21.661  1.00 19.21 ? 21  GLN B O   1 
ATOM   1797 C  CB  . GLN B 1 21  ? 13.965  11.924  19.340  1.00 24.49 ? 21  GLN B CB  1 
ATOM   1798 C  CG  . GLN B 1 21  ? 15.066  11.041  19.902  1.00 32.15 ? 21  GLN B CG  1 
ATOM   1799 C  CD  . GLN B 1 21  ? 15.622  10.058  18.884  1.00 36.87 ? 21  GLN B CD  1 
ATOM   1800 O  OE1 . GLN B 1 21  ? 16.427  9.189   19.226  1.00 39.80 ? 21  GLN B OE1 1 
ATOM   1801 N  NE2 . GLN B 1 21  ? 15.198  10.192  17.627  1.00 37.49 ? 21  GLN B NE2 1 
ATOM   1802 N  N   . THR B 1 22  ? 14.865  14.889  19.679  1.00 19.79 ? 22  THR B N   1 
ATOM   1803 C  CA  . THR B 1 22  ? 15.918  15.886  19.843  1.00 18.67 ? 22  THR B CA  1 
ATOM   1804 C  C   . THR B 1 22  ? 15.616  16.818  21.012  1.00 18.24 ? 22  THR B C   1 
ATOM   1805 O  O   . THR B 1 22  ? 16.494  17.090  21.833  1.00 18.31 ? 22  THR B O   1 
ATOM   1806 C  CB  . THR B 1 22  ? 16.099  16.724  18.550  1.00 18.08 ? 22  THR B CB  1 
ATOM   1807 O  OG1 . THR B 1 22  ? 16.629  15.886  17.516  1.00 16.34 ? 22  THR B OG1 1 
ATOM   1808 C  CG2 . THR B 1 22  ? 17.049  17.894  18.785  1.00 15.68 ? 22  THR B CG2 1 
ATOM   1809 N  N   . MET B 1 23  ? 14.379  17.303  21.090  1.00 18.43 ? 23  MET B N   1 
ATOM   1810 C  CA  . MET B 1 23  ? 13.992  18.203  22.177  1.00 20.34 ? 23  MET B CA  1 
ATOM   1811 C  C   . MET B 1 23  ? 14.341  17.586  23.530  1.00 20.61 ? 23  MET B C   1 
ATOM   1812 O  O   . MET B 1 23  ? 14.893  18.254  24.407  1.00 19.88 ? 23  MET B O   1 
ATOM   1813 C  CB  . MET B 1 23  ? 12.488  18.509  22.132  1.00 20.44 ? 23  MET B CB  1 
ATOM   1814 C  CG  . MET B 1 23  ? 12.052  19.376  20.964  1.00 19.29 ? 23  MET B CG  1 
ATOM   1815 S  SD  . MET B 1 23  ? 12.835  21.007  20.967  1.00 23.25 ? 23  MET B SD  1 
ATOM   1816 C  CE  . MET B 1 23  ? 12.097  21.754  22.418  1.00 18.36 ? 23  MET B CE  1 
ATOM   1817 N  N   . GLU B 1 24  ? 14.032  16.302  23.686  1.00 20.48 ? 24  GLU B N   1 
ATOM   1818 C  CA  . GLU B 1 24  ? 14.303  15.595  24.929  1.00 21.01 ? 24  GLU B CA  1 
ATOM   1819 C  C   . GLU B 1 24  ? 15.798  15.452  25.246  1.00 19.80 ? 24  GLU B C   1 
ATOM   1820 O  O   . GLU B 1 24  ? 16.229  15.734  26.364  1.00 19.26 ? 24  GLU B O   1 
ATOM   1821 C  CB  . GLU B 1 24  ? 13.653  14.215  24.884  1.00 25.00 ? 24  GLU B CB  1 
ATOM   1822 C  CG  . GLU B 1 24  ? 13.814  13.424  26.167  1.00 33.97 ? 24  GLU B CG  1 
ATOM   1823 C  CD  . GLU B 1 24  ? 13.191  12.049  26.069  1.00 41.08 ? 24  GLU B CD  1 
ATOM   1824 O  OE1 . GLU B 1 24  ? 11.997  11.971  25.698  1.00 44.35 ? 24  GLU B OE1 1 
ATOM   1825 O  OE2 . GLU B 1 24  ? 13.891  11.050  26.360  1.00 44.03 ? 24  GLU B OE2 1 
ATOM   1826 N  N   . ILE B 1 25  ? 16.581  15.002  24.271  1.00 17.71 ? 25  ILE B N   1 
ATOM   1827 C  CA  . ILE B 1 25  ? 18.021  14.830  24.460  1.00 18.11 ? 25  ILE B CA  1 
ATOM   1828 C  C   . ILE B 1 25  ? 18.704  16.185  24.662  1.00 16.91 ? 25  ILE B C   1 
ATOM   1829 O  O   . ILE B 1 25  ? 19.542  16.352  25.541  1.00 16.96 ? 25  ILE B O   1 
ATOM   1830 C  CB  . ILE B 1 25  ? 18.673  14.148  23.231  1.00 19.36 ? 25  ILE B CB  1 
ATOM   1831 C  CG1 . ILE B 1 25  ? 18.050  12.775  22.998  1.00 20.66 ? 25  ILE B CG1 1 
ATOM   1832 C  CG2 . ILE B 1 25  ? 20.170  13.996  23.448  1.00 19.98 ? 25  ILE B CG2 1 
ATOM   1833 C  CD1 . ILE B 1 25  ? 18.522  12.102  21.718  1.00 21.46 ? 25  ILE B CD1 1 
ATOM   1834 N  N   . HIS B 1 26  ? 18.331  17.148  23.831  1.00 15.66 ? 26  HIS B N   1 
ATOM   1835 C  CA  . HIS B 1 26  ? 18.902  18.481  23.883  1.00 15.12 ? 26  HIS B CA  1 
ATOM   1836 C  C   . HIS B 1 26  ? 18.722  19.096  25.273  1.00 16.90 ? 26  HIS B C   1 
ATOM   1837 O  O   . HIS B 1 26  ? 19.631  19.739  25.809  1.00 16.73 ? 26  HIS B O   1 
ATOM   1838 C  CB  . HIS B 1 26  ? 18.224  19.350  22.822  1.00 13.73 ? 26  HIS B CB  1 
ATOM   1839 C  CG  . HIS B 1 26  ? 19.016  20.554  22.414  1.00 13.99 ? 26  HIS B CG  1 
ATOM   1840 N  ND1 . HIS B 1 26  ? 18.623  21.384  21.387  1.00 14.08 ? 26  HIS B ND1 1 
ATOM   1841 C  CD2 . HIS B 1 26  ? 20.173  21.073  22.892  1.00 15.35 ? 26  HIS B CD2 1 
ATOM   1842 C  CE1 . HIS B 1 26  ? 19.501  22.362  21.249  1.00 14.52 ? 26  HIS B CE1 1 
ATOM   1843 N  NE2 . HIS B 1 26  ? 20.452  22.196  22.150  1.00 12.98 ? 26  HIS B NE2 1 
ATOM   1844 N  N   . HIS B 1 27  ? 17.549  18.882  25.860  1.00 17.91 ? 27  HIS B N   1 
ATOM   1845 C  CA  . HIS B 1 27  ? 17.229  19.428  27.175  1.00 16.02 ? 27  HIS B CA  1 
ATOM   1846 C  C   . HIS B 1 27  ? 17.806  18.644  28.352  1.00 15.58 ? 27  HIS B C   1 
ATOM   1847 O  O   . HIS B 1 27  ? 18.579  19.179  29.146  1.00 14.28 ? 27  HIS B O   1 
ATOM   1848 C  CB  . HIS B 1 27  ? 15.708  19.516  27.344  1.00 16.68 ? 27  HIS B CB  1 
ATOM   1849 C  CG  . HIS B 1 27  ? 15.276  20.071  28.665  1.00 18.12 ? 27  HIS B CG  1 
ATOM   1850 N  ND1 . HIS B 1 27  ? 14.416  19.399  29.508  1.00 19.89 ? 27  HIS B ND1 1 
ATOM   1851 C  CD2 . HIS B 1 27  ? 15.567  21.243  29.279  1.00 17.65 ? 27  HIS B CD2 1 
ATOM   1852 C  CE1 . HIS B 1 27  ? 14.193  20.135  30.583  1.00 19.47 ? 27  HIS B CE1 1 
ATOM   1853 N  NE2 . HIS B 1 27  ? 14.880  21.259  30.469  1.00 18.85 ? 27  HIS B NE2 1 
ATOM   1854 N  N   . THR B 1 28  ? 17.431  17.373  28.451  1.00 15.57 ? 28  THR B N   1 
ATOM   1855 C  CA  . THR B 1 28  ? 17.852  16.521  29.559  1.00 16.25 ? 28  THR B CA  1 
ATOM   1856 C  C   . THR B 1 28  ? 19.301  16.051  29.553  1.00 16.45 ? 28  THR B C   1 
ATOM   1857 O  O   . THR B 1 28  ? 19.799  15.586  30.580  1.00 17.63 ? 28  THR B O   1 
ATOM   1858 C  CB  . THR B 1 28  ? 16.938  15.280  29.659  1.00 16.88 ? 28  THR B CB  1 
ATOM   1859 O  OG1 . THR B 1 28  ? 17.206  14.399  28.563  1.00 18.70 ? 28  THR B OG1 1 
ATOM   1860 C  CG2 . THR B 1 28  ? 15.465  15.697  29.603  1.00 14.99 ? 28  THR B CG2 1 
ATOM   1861 N  N   . LYS B 1 29  ? 19.974  16.151  28.411  1.00 13.50 ? 29  LYS B N   1 
ATOM   1862 C  CA  . LYS B 1 29  ? 21.368  15.730  28.337  1.00 14.75 ? 29  LYS B CA  1 
ATOM   1863 C  C   . LYS B 1 29  ? 22.320  16.911  28.134  1.00 14.76 ? 29  LYS B C   1 
ATOM   1864 O  O   . LYS B 1 29  ? 23.140  17.210  29.002  1.00 16.02 ? 29  LYS B O   1 
ATOM   1865 C  CB  . LYS B 1 29  ? 21.575  14.704  27.213  1.00 16.69 ? 29  LYS B CB  1 
ATOM   1866 C  CG  . LYS B 1 29  ? 20.890  13.355  27.417  1.00 19.40 ? 29  LYS B CG  1 
ATOM   1867 C  CD  . LYS B 1 29  ? 21.246  12.744  28.760  1.00 24.43 ? 29  LYS B CD  1 
ATOM   1868 C  CE  . LYS B 1 29  ? 20.795  11.290  28.850  1.00 28.38 ? 29  LYS B CE  1 
ATOM   1869 N  NZ  . LYS B 1 29  ? 19.382  11.115  28.412  1.00 31.63 ? 29  LYS B NZ  1 
ATOM   1870 N  N   . HIS B 1 30  ? 22.212  17.586  26.993  1.00 14.11 ? 30  HIS B N   1 
ATOM   1871 C  CA  . HIS B 1 30  ? 23.093  18.715  26.703  1.00 13.91 ? 30  HIS B CA  1 
ATOM   1872 C  C   . HIS B 1 30  ? 22.955  19.870  27.691  1.00 14.71 ? 30  HIS B C   1 
ATOM   1873 O  O   . HIS B 1 30  ? 23.942  20.286  28.297  1.00 15.99 ? 30  HIS B O   1 
ATOM   1874 C  CB  . HIS B 1 30  ? 22.860  19.222  25.280  1.00 12.15 ? 30  HIS B CB  1 
ATOM   1875 C  CG  . HIS B 1 30  ? 23.279  18.250  24.221  1.00 14.31 ? 30  HIS B CG  1 
ATOM   1876 N  ND1 . HIS B 1 30  ? 24.589  18.108  23.817  1.00 14.31 ? 30  HIS B ND1 1 
ATOM   1877 C  CD2 . HIS B 1 30  ? 22.567  17.344  23.509  1.00 14.42 ? 30  HIS B CD2 1 
ATOM   1878 C  CE1 . HIS B 1 30  ? 24.666  17.159  22.901  1.00 14.35 ? 30  HIS B CE1 1 
ATOM   1879 N  NE2 . HIS B 1 30  ? 23.453  16.679  22.697  1.00 14.15 ? 30  HIS B NE2 1 
ATOM   1880 N  N   . HIS B 1 31  ? 21.742  20.386  27.868  1.00 14.45 ? 31  HIS B N   1 
ATOM   1881 C  CA  . HIS B 1 31  ? 21.547  21.502  28.786  1.00 14.08 ? 31  HIS B CA  1 
ATOM   1882 C  C   . HIS B 1 31  ? 21.900  21.087  30.215  1.00 14.44 ? 31  HIS B C   1 
ATOM   1883 O  O   . HIS B 1 31  ? 22.550  21.838  30.950  1.00 13.45 ? 31  HIS B O   1 
ATOM   1884 C  CB  . HIS B 1 31  ? 20.102  22.012  28.712  1.00 12.53 ? 31  HIS B CB  1 
ATOM   1885 C  CG  . HIS B 1 31  ? 19.894  23.338  29.379  1.00 13.38 ? 31  HIS B CG  1 
ATOM   1886 N  ND1 . HIS B 1 31  ? 18.697  24.021  29.322  1.00 12.91 ? 31  HIS B ND1 1 
ATOM   1887 C  CD2 . HIS B 1 31  ? 20.726  24.103  30.125  1.00 14.20 ? 31  HIS B CD2 1 
ATOM   1888 C  CE1 . HIS B 1 31  ? 18.802  25.147  30.004  1.00 13.66 ? 31  HIS B CE1 1 
ATOM   1889 N  NE2 . HIS B 1 31  ? 20.023  25.221  30.502  1.00 13.96 ? 31  HIS B NE2 1 
ATOM   1890 N  N   . GLN B 1 32  ? 21.485  19.883  30.599  1.00 15.02 ? 32  GLN B N   1 
ATOM   1891 C  CA  . GLN B 1 32  ? 21.767  19.356  31.934  1.00 14.27 ? 32  GLN B CA  1 
ATOM   1892 C  C   . GLN B 1 32  ? 23.270  19.394  32.214  1.00 15.96 ? 32  GLN B C   1 
ATOM   1893 O  O   . GLN B 1 32  ? 23.704  19.806  33.295  1.00 17.41 ? 32  GLN B O   1 
ATOM   1894 C  CB  . GLN B 1 32  ? 21.260  17.909  32.045  1.00 15.41 ? 32  GLN B CB  1 
ATOM   1895 C  CG  . GLN B 1 32  ? 21.648  17.183  33.341  1.00 15.37 ? 32  GLN B CG  1 
ATOM   1896 C  CD  . GLN B 1 32  ? 20.908  17.710  34.569  1.00 17.31 ? 32  GLN B CD  1 
ATOM   1897 O  OE1 . GLN B 1 32  ? 19.715  17.457  34.748  1.00 16.70 ? 32  GLN B OE1 1 
ATOM   1898 N  NE2 . GLN B 1 32  ? 21.617  18.453  35.413  1.00 14.73 ? 32  GLN B NE2 1 
ATOM   1899 N  N   . THR B 1 33  ? 24.063  18.960  31.237  1.00 15.49 ? 33  THR B N   1 
ATOM   1900 C  CA  . THR B 1 33  ? 25.520  18.951  31.390  1.00 15.34 ? 33  THR B CA  1 
ATOM   1901 C  C   . THR B 1 33  ? 26.095  20.353  31.614  1.00 15.32 ? 33  THR B C   1 
ATOM   1902 O  O   . THR B 1 33  ? 26.999  20.533  32.431  1.00 13.23 ? 33  THR B O   1 
ATOM   1903 C  CB  . THR B 1 33  ? 26.214  18.316  30.161  1.00 16.09 ? 33  THR B CB  1 
ATOM   1904 O  OG1 . THR B 1 33  ? 26.003  16.901  30.179  1.00 16.24 ? 33  THR B OG1 1 
ATOM   1905 C  CG2 . THR B 1 33  ? 27.717  18.602  30.176  1.00 15.26 ? 33  THR B CG2 1 
ATOM   1906 N  N   . PHE B 1 34  ? 25.582  21.343  30.888  1.00 15.05 ? 34  PHE B N   1 
ATOM   1907 C  CA  . PHE B 1 34  ? 26.065  22.709  31.059  1.00 15.99 ? 34  PHE B CA  1 
ATOM   1908 C  C   . PHE B 1 34  ? 25.797  23.179  32.483  1.00 16.58 ? 34  PHE B C   1 
ATOM   1909 O  O   . PHE B 1 34  ? 26.651  23.810  33.113  1.00 16.44 ? 34  PHE B O   1 
ATOM   1910 C  CB  . PHE B 1 34  ? 25.382  23.658  30.067  1.00 15.61 ? 34  PHE B CB  1 
ATOM   1911 C  CG  . PHE B 1 34  ? 25.780  23.432  28.635  1.00 17.41 ? 34  PHE B CG  1 
ATOM   1912 C  CD1 . PHE B 1 34  ? 27.125  23.322  28.280  1.00 18.24 ? 34  PHE B CD1 1 
ATOM   1913 C  CD2 . PHE B 1 34  ? 24.815  23.335  27.636  1.00 17.55 ? 34  PHE B CD2 1 
ATOM   1914 C  CE1 . PHE B 1 34  ? 27.499  23.116  26.949  1.00 19.33 ? 34  PHE B CE1 1 
ATOM   1915 C  CE2 . PHE B 1 34  ? 25.179  23.132  26.302  1.00 16.80 ? 34  PHE B CE2 1 
ATOM   1916 C  CZ  . PHE B 1 34  ? 26.520  23.022  25.959  1.00 18.67 ? 34  PHE B CZ  1 
ATOM   1917 N  N   . VAL B 1 35  ? 24.606  22.865  32.987  1.00 15.87 ? 35  VAL B N   1 
ATOM   1918 C  CA  . VAL B 1 35  ? 24.231  23.255  34.340  1.00 14.94 ? 35  VAL B CA  1 
ATOM   1919 C  C   . VAL B 1 35  ? 25.145  22.578  35.351  1.00 14.56 ? 35  VAL B C   1 
ATOM   1920 O  O   . VAL B 1 35  ? 25.618  23.208  36.295  1.00 12.46 ? 35  VAL B O   1 
ATOM   1921 C  CB  . VAL B 1 35  ? 22.756  22.898  34.642  1.00 14.74 ? 35  VAL B CB  1 
ATOM   1922 C  CG1 . VAL B 1 35  ? 22.463  23.086  36.118  1.00 16.15 ? 35  VAL B CG1 1 
ATOM   1923 C  CG2 . VAL B 1 35  ? 21.837  23.785  33.822  1.00 11.87 ? 35  VAL B CG2 1 
ATOM   1924 N  N   . ASN B 1 36  ? 25.405  21.294  35.148  1.00 15.66 ? 36  ASN B N   1 
ATOM   1925 C  CA  . ASN B 1 36  ? 26.276  20.586  36.065  1.00 15.74 ? 36  ASN B CA  1 
ATOM   1926 C  C   . ASN B 1 36  ? 27.683  21.193  36.103  1.00 16.62 ? 36  ASN B C   1 
ATOM   1927 O  O   . ASN B 1 36  ? 28.212  21.466  37.184  1.00 17.55 ? 36  ASN B O   1 
ATOM   1928 C  CB  . ASN B 1 36  ? 26.335  19.101  35.699  1.00 15.08 ? 36  ASN B CB  1 
ATOM   1929 C  CG  . ASN B 1 36  ? 25.035  18.375  36.019  1.00 18.75 ? 36  ASN B CG  1 
ATOM   1930 O  OD1 . ASN B 1 36  ? 24.227  18.852  36.821  1.00 18.20 ? 36  ASN B OD1 1 
ATOM   1931 N  ND2 . ASN B 1 36  ? 24.836  17.209  35.412  1.00 17.49 ? 36  ASN B ND2 1 
ATOM   1932 N  N   . ASN B 1 37  ? 28.281  21.431  34.937  1.00 16.81 ? 37  ASN B N   1 
ATOM   1933 C  CA  . ASN B 1 37  ? 29.632  21.986  34.900  1.00 17.86 ? 37  ASN B CA  1 
ATOM   1934 C  C   . ASN B 1 37  ? 29.706  23.421  35.401  1.00 18.42 ? 37  ASN B C   1 
ATOM   1935 O  O   . ASN B 1 37  ? 30.701  23.814  36.007  1.00 20.17 ? 37  ASN B O   1 
ATOM   1936 C  CB  . ASN B 1 37  ? 30.230  21.882  33.489  1.00 18.14 ? 37  ASN B CB  1 
ATOM   1937 C  CG  . ASN B 1 37  ? 30.501  20.435  33.074  1.00 19.65 ? 37  ASN B CG  1 
ATOM   1938 O  OD1 . ASN B 1 37  ? 30.814  19.588  33.907  1.00 21.60 ? 37  ASN B OD1 1 
ATOM   1939 N  ND2 . ASN B 1 37  ? 30.393  20.156  31.782  1.00 20.80 ? 37  ASN B ND2 1 
ATOM   1940 N  N   . ALA B 1 38  ? 28.664  24.209  35.156  1.00 19.00 ? 38  ALA B N   1 
ATOM   1941 C  CA  . ALA B 1 38  ? 28.658  25.590  35.639  1.00 18.09 ? 38  ALA B CA  1 
ATOM   1942 C  C   . ALA B 1 38  ? 28.604  25.587  37.170  1.00 18.08 ? 38  ALA B C   1 
ATOM   1943 O  O   . ALA B 1 38  ? 29.350  26.318  37.828  1.00 16.31 ? 38  ALA B O   1 
ATOM   1944 C  CB  . ALA B 1 38  ? 27.463  26.345  35.076  1.00 17.72 ? 38  ALA B CB  1 
ATOM   1945 N  N   . ASN B 1 39  ? 27.728  24.756  37.732  1.00 17.95 ? 39  ASN B N   1 
ATOM   1946 C  CA  . ASN B 1 39  ? 27.594  24.669  39.185  1.00 19.78 ? 39  ASN B CA  1 
ATOM   1947 C  C   . ASN B 1 39  ? 28.871  24.175  39.861  1.00 20.53 ? 39  ASN B C   1 
ATOM   1948 O  O   . ASN B 1 39  ? 29.223  24.650  40.937  1.00 21.07 ? 39  ASN B O   1 
ATOM   1949 C  CB  . ASN B 1 39  ? 26.423  23.755  39.583  1.00 17.53 ? 39  ASN B CB  1 
ATOM   1950 C  CG  . ASN B 1 39  ? 25.072  24.423  39.402  1.00 18.43 ? 39  ASN B CG  1 
ATOM   1951 O  OD1 . ASN B 1 39  ? 24.943  25.637  39.569  1.00 18.53 ? 39  ASN B OD1 1 
ATOM   1952 N  ND2 . ASN B 1 39  ? 24.053  23.630  39.077  1.00 15.17 ? 39  ASN B ND2 1 
ATOM   1953 N  N   . ALA B 1 40  ? 29.560  23.222  39.240  1.00 20.13 ? 40  ALA B N   1 
ATOM   1954 C  CA  . ALA B 1 40  ? 30.793  22.701  39.822  1.00 22.02 ? 40  ALA B CA  1 
ATOM   1955 C  C   . ALA B 1 40  ? 31.885  23.772  39.857  1.00 22.42 ? 40  ALA B C   1 
ATOM   1956 O  O   . ALA B 1 40  ? 32.644  23.858  40.818  1.00 22.62 ? 40  ALA B O   1 
ATOM   1957 C  CB  . ALA B 1 40  ? 31.274  21.483  39.037  1.00 20.89 ? 40  ALA B CB  1 
ATOM   1958 N  N   . ALA B 1 41  ? 31.953  24.597  38.818  1.00 24.49 ? 41  ALA B N   1 
ATOM   1959 C  CA  . ALA B 1 41  ? 32.968  25.648  38.748  1.00 27.16 ? 41  ALA B CA  1 
ATOM   1960 C  C   . ALA B 1 41  ? 32.686  26.805  39.703  1.00 29.67 ? 41  ALA B C   1 
ATOM   1961 O  O   . ALA B 1 41  ? 33.601  27.532  40.094  1.00 31.39 ? 41  ALA B O   1 
ATOM   1962 C  CB  . ALA B 1 41  ? 33.079  26.172  37.316  1.00 25.68 ? 41  ALA B CB  1 
ATOM   1963 N  N   . LEU B 1 42  ? 31.420  26.971  40.074  1.00 31.41 ? 42  LEU B N   1 
ATOM   1964 C  CA  . LEU B 1 42  ? 31.014  28.045  40.976  1.00 33.78 ? 42  LEU B CA  1 
ATOM   1965 C  C   . LEU B 1 42  ? 31.003  27.627  42.444  1.00 36.39 ? 42  LEU B C   1 
ATOM   1966 O  O   . LEU B 1 42  ? 30.805  28.461  43.328  1.00 35.88 ? 42  LEU B O   1 
ATOM   1967 C  CB  . LEU B 1 42  ? 29.624  28.550  40.588  1.00 32.13 ? 42  LEU B CB  1 
ATOM   1968 C  CG  . LEU B 1 42  ? 29.536  29.294  39.255  1.00 32.22 ? 42  LEU B CG  1 
ATOM   1969 C  CD1 . LEU B 1 42  ? 28.081  29.486  38.853  1.00 31.05 ? 42  LEU B CD1 1 
ATOM   1970 C  CD2 . LEU B 1 42  ? 30.248  30.633  39.383  1.00 30.86 ? 42  LEU B CD2 1 
ATOM   1971 N  N   . GLU B 1 43  ? 31.213  26.339  42.695  1.00 39.10 ? 43  GLU B N   1 
ATOM   1972 C  CA  . GLU B 1 43  ? 31.219  25.799  44.048  1.00 44.00 ? 43  GLU B CA  1 
ATOM   1973 C  C   . GLU B 1 43  ? 32.119  26.577  45.007  1.00 45.58 ? 43  GLU B C   1 
ATOM   1974 O  O   . GLU B 1 43  ? 31.748  26.824  46.153  1.00 45.70 ? 43  GLU B O   1 
ATOM   1975 C  CB  . GLU B 1 43  ? 31.667  24.337  44.020  1.00 46.70 ? 43  GLU B CB  1 
ATOM   1976 C  CG  . GLU B 1 43  ? 31.694  23.671  45.387  1.00 52.76 ? 43  GLU B CG  1 
ATOM   1977 C  CD  . GLU B 1 43  ? 32.425  22.340  45.373  1.00 56.39 ? 43  GLU B CD  1 
ATOM   1978 O  OE1 . GLU B 1 43  ? 32.016  21.436  44.609  1.00 58.37 ? 43  GLU B OE1 1 
ATOM   1979 O  OE2 . GLU B 1 43  ? 33.413  22.199  46.126  1.00 58.41 ? 43  GLU B OE2 1 
ATOM   1980 N  N   . SER B 1 44  ? 33.296  26.967  44.529  1.00 47.49 ? 44  SER B N   1 
ATOM   1981 C  CA  . SER B 1 44  ? 34.259  27.691  45.350  1.00 50.15 ? 44  SER B CA  1 
ATOM   1982 C  C   . SER B 1 44  ? 34.097  29.210  45.362  1.00 51.30 ? 44  SER B C   1 
ATOM   1983 O  O   . SER B 1 44  ? 34.577  29.879  46.280  1.00 52.23 ? 44  SER B O   1 
ATOM   1984 C  CB  . SER B 1 44  ? 35.683  27.338  44.900  1.00 51.69 ? 44  SER B CB  1 
ATOM   1985 O  OG  . SER B 1 44  ? 35.881  27.638  43.526  1.00 54.01 ? 44  SER B OG  1 
ATOM   1986 N  N   . LEU B 1 45  ? 33.423  29.753  44.353  1.00 51.60 ? 45  LEU B N   1 
ATOM   1987 C  CA  . LEU B 1 45  ? 33.231  31.198  44.256  1.00 51.82 ? 45  LEU B CA  1 
ATOM   1988 C  C   . LEU B 1 45  ? 31.828  31.655  44.657  1.00 52.45 ? 45  LEU B C   1 
ATOM   1989 O  O   . LEU B 1 45  ? 30.944  31.784  43.811  1.00 52.04 ? 45  LEU B O   1 
ATOM   1990 C  CB  . LEU B 1 45  ? 33.521  31.659  42.827  1.00 52.01 ? 45  LEU B CB  1 
ATOM   1991 C  CG  . LEU B 1 45  ? 34.863  31.230  42.230  1.00 52.08 ? 45  LEU B CG  1 
ATOM   1992 C  CD1 . LEU B 1 45  ? 34.950  31.720  40.795  1.00 50.66 ? 45  LEU B CD1 1 
ATOM   1993 C  CD2 . LEU B 1 45  ? 36.011  31.785  43.069  1.00 52.36 ? 45  LEU B CD2 1 
ATOM   1994 N  N   . PRO B 1 46  ? 31.611  31.928  45.955  1.00 53.67 ? 46  PRO B N   1 
ATOM   1995 C  CA  . PRO B 1 46  ? 30.298  32.373  46.438  1.00 53.64 ? 46  PRO B CA  1 
ATOM   1996 C  C   . PRO B 1 46  ? 29.861  33.745  45.918  1.00 53.45 ? 46  PRO B C   1 
ATOM   1997 O  O   . PRO B 1 46  ? 28.667  34.014  45.796  1.00 53.13 ? 46  PRO B O   1 
ATOM   1998 C  CB  . PRO B 1 46  ? 30.468  32.350  47.955  1.00 53.84 ? 46  PRO B CB  1 
ATOM   1999 C  CG  . PRO B 1 46  ? 31.916  32.702  48.126  1.00 55.04 ? 46  PRO B CG  1 
ATOM   2000 C  CD  . PRO B 1 46  ? 32.577  31.849  47.067  1.00 54.51 ? 46  PRO B CD  1 
ATOM   2001 N  N   . GLU B 1 47  ? 30.826  34.606  45.608  1.00 53.70 ? 47  GLU B N   1 
ATOM   2002 C  CA  . GLU B 1 47  ? 30.525  35.946  45.108  1.00 54.61 ? 47  GLU B CA  1 
ATOM   2003 C  C   . GLU B 1 47  ? 29.626  35.893  43.877  1.00 54.00 ? 47  GLU B C   1 
ATOM   2004 O  O   . GLU B 1 47  ? 28.548  36.493  43.845  1.00 53.66 ? 47  GLU B O   1 
ATOM   2005 C  CB  . GLU B 1 47  ? 31.813  36.687  44.730  1.00 57.41 ? 47  GLU B CB  1 
ATOM   2006 C  CG  . GLU B 1 47  ? 32.974  36.521  45.699  1.00 62.25 ? 47  GLU B CG  1 
ATOM   2007 C  CD  . GLU B 1 47  ? 33.880  35.353  45.336  1.00 65.09 ? 47  GLU B CD  1 
ATOM   2008 O  OE1 . GLU B 1 47  ? 33.391  34.204  45.284  1.00 66.48 ? 47  GLU B OE1 1 
ATOM   2009 O  OE2 . GLU B 1 47  ? 35.086  35.587  45.101  1.00 67.36 ? 47  GLU B OE2 1 
ATOM   2010 N  N   . PHE B 1 48  ? 30.088  35.162  42.868  1.00 52.34 ? 48  PHE B N   1 
ATOM   2011 C  CA  . PHE B 1 48  ? 29.383  35.023  41.599  1.00 50.78 ? 48  PHE B CA  1 
ATOM   2012 C  C   . PHE B 1 48  ? 28.248  34.005  41.610  1.00 49.84 ? 48  PHE B C   1 
ATOM   2013 O  O   . PHE B 1 48  ? 27.313  34.104  40.816  1.00 49.84 ? 48  PHE B O   1 
ATOM   2014 C  CB  . PHE B 1 48  ? 30.386  34.646  40.510  1.00 50.95 ? 48  PHE B CB  1 
ATOM   2015 C  CG  . PHE B 1 48  ? 31.532  35.612  40.379  1.00 51.57 ? 48  PHE B CG  1 
ATOM   2016 C  CD1 . PHE B 1 48  ? 31.344  36.864  39.797  1.00 50.65 ? 48  PHE B CD1 1 
ATOM   2017 C  CD2 . PHE B 1 48  ? 32.800  35.272  40.846  1.00 50.83 ? 48  PHE B CD2 1 
ATOM   2018 C  CE1 . PHE B 1 48  ? 32.403  37.763  39.679  1.00 51.33 ? 48  PHE B CE1 1 
ATOM   2019 C  CE2 . PHE B 1 48  ? 33.867  36.164  40.734  1.00 50.69 ? 48  PHE B CE2 1 
ATOM   2020 C  CZ  . PHE B 1 48  ? 33.668  37.412  40.149  1.00 51.12 ? 48  PHE B CZ  1 
ATOM   2021 N  N   . ALA B 1 49  ? 28.331  33.026  42.504  1.00 48.39 ? 49  ALA B N   1 
ATOM   2022 C  CA  . ALA B 1 49  ? 27.309  31.989  42.591  1.00 47.53 ? 49  ALA B CA  1 
ATOM   2023 C  C   . ALA B 1 49  ? 25.894  32.539  42.787  1.00 46.97 ? 49  ALA B C   1 
ATOM   2024 O  O   . ALA B 1 49  ? 24.923  31.938  42.331  1.00 46.52 ? 49  ALA B O   1 
ATOM   2025 C  CB  . ALA B 1 49  ? 27.653  31.020  43.715  1.00 45.98 ? 49  ALA B CB  1 
ATOM   2026 N  N   . ASN B 1 50  ? 25.781  33.684  43.451  1.00 47.00 ? 50  ASN B N   1 
ATOM   2027 C  CA  . ASN B 1 50  ? 24.474  34.283  43.717  1.00 47.39 ? 50  ASN B CA  1 
ATOM   2028 C  C   . ASN B 1 50  ? 23.878  35.035  42.527  1.00 45.49 ? 50  ASN B C   1 
ATOM   2029 O  O   . ASN B 1 50  ? 22.665  35.253  42.468  1.00 45.31 ? 50  ASN B O   1 
ATOM   2030 C  CB  . ASN B 1 50  ? 24.570  35.240  44.910  1.00 50.69 ? 50  ASN B CB  1 
ATOM   2031 C  CG  . ASN B 1 50  ? 25.489  34.723  46.004  1.00 54.35 ? 50  ASN B CG  1 
ATOM   2032 O  OD1 . ASN B 1 50  ? 25.391  33.567  46.427  1.00 54.70 ? 50  ASN B OD1 1 
ATOM   2033 N  ND2 . ASN B 1 50  ? 26.388  35.586  46.476  1.00 56.32 ? 50  ASN B ND2 1 
ATOM   2034 N  N   . LEU B 1 51  ? 24.728  35.431  41.585  1.00 42.70 ? 51  LEU B N   1 
ATOM   2035 C  CA  . LEU B 1 51  ? 24.288  36.176  40.407  1.00 40.37 ? 51  LEU B CA  1 
ATOM   2036 C  C   . LEU B 1 51  ? 23.468  35.372  39.410  1.00 37.55 ? 51  LEU B C   1 
ATOM   2037 O  O   . LEU B 1 51  ? 23.685  34.175  39.236  1.00 37.35 ? 51  LEU B O   1 
ATOM   2038 C  CB  . LEU B 1 51  ? 25.495  36.743  39.661  1.00 41.56 ? 51  LEU B CB  1 
ATOM   2039 C  CG  . LEU B 1 51  ? 26.362  37.805  40.326  1.00 42.64 ? 51  LEU B CG  1 
ATOM   2040 C  CD1 . LEU B 1 51  ? 27.574  38.070  39.448  1.00 42.40 ? 51  LEU B CD1 1 
ATOM   2041 C  CD2 . LEU B 1 51  ? 25.553  39.076  40.532  1.00 44.13 ? 51  LEU B CD2 1 
ATOM   2042 N  N   . PRO B 1 52  ? 22.499  36.027  38.749  1.00 35.36 ? 52  PRO B N   1 
ATOM   2043 C  CA  . PRO B 1 52  ? 21.667  35.345  37.753  1.00 33.47 ? 52  PRO B CA  1 
ATOM   2044 C  C   . PRO B 1 52  ? 22.636  34.991  36.625  1.00 32.00 ? 52  PRO B C   1 
ATOM   2045 O  O   . PRO B 1 52  ? 23.633  35.686  36.434  1.00 31.56 ? 52  PRO B O   1 
ATOM   2046 C  CB  . PRO B 1 52  ? 20.674  36.429  37.332  1.00 32.62 ? 52  PRO B CB  1 
ATOM   2047 C  CG  . PRO B 1 52  ? 20.549  37.267  38.565  1.00 34.28 ? 52  PRO B CG  1 
ATOM   2048 C  CD  . PRO B 1 52  ? 21.985  37.379  39.024  1.00 34.67 ? 52  PRO B CD  1 
ATOM   2049 N  N   . VAL B 1 53  ? 22.362  33.933  35.873  1.00 30.70 ? 53  VAL B N   1 
ATOM   2050 C  CA  . VAL B 1 53  ? 23.283  33.549  34.808  1.00 29.90 ? 53  VAL B CA  1 
ATOM   2051 C  C   . VAL B 1 53  ? 23.492  34.637  33.743  1.00 29.13 ? 53  VAL B C   1 
ATOM   2052 O  O   . VAL B 1 53  ? 24.610  34.823  33.262  1.00 25.59 ? 53  VAL B O   1 
ATOM   2053 C  CB  . VAL B 1 53  ? 22.837  32.222  34.134  1.00 29.86 ? 53  VAL B CB  1 
ATOM   2054 C  CG1 . VAL B 1 53  ? 21.559  32.430  33.345  1.00 28.87 ? 53  VAL B CG1 1 
ATOM   2055 C  CG2 . VAL B 1 53  ? 23.951  31.692  33.249  1.00 27.71 ? 53  VAL B CG2 1 
ATOM   2056 N  N   . GLU B 1 54  ? 22.430  35.361  33.390  1.00 30.29 ? 54  GLU B N   1 
ATOM   2057 C  CA  . GLU B 1 54  ? 22.530  36.422  32.387  1.00 32.05 ? 54  GLU B CA  1 
ATOM   2058 C  C   . GLU B 1 54  ? 23.510  37.506  32.822  1.00 32.31 ? 54  GLU B C   1 
ATOM   2059 O  O   . GLU B 1 54  ? 24.138  38.151  31.984  1.00 33.06 ? 54  GLU B O   1 
ATOM   2060 C  CB  . GLU B 1 54  ? 21.168  37.081  32.128  1.00 34.39 ? 54  GLU B CB  1 
ATOM   2061 C  CG  . GLU B 1 54  ? 20.058  36.169  31.630  1.00 37.38 ? 54  GLU B CG  1 
ATOM   2062 C  CD  . GLU B 1 54  ? 19.517  35.250  32.715  1.00 41.06 ? 54  GLU B CD  1 
ATOM   2063 O  OE1 . GLU B 1 54  ? 19.454  35.682  33.890  1.00 40.42 ? 54  GLU B OE1 1 
ATOM   2064 O  OE2 . GLU B 1 54  ? 19.139  34.101  32.386  1.00 42.64 ? 54  GLU B OE2 1 
ATOM   2065 N  N   . GLU B 1 55  ? 23.627  37.720  34.130  1.00 32.71 ? 55  GLU B N   1 
ATOM   2066 C  CA  . GLU B 1 55  ? 24.542  38.729  34.660  1.00 33.99 ? 55  GLU B CA  1 
ATOM   2067 C  C   . GLU B 1 55  ? 25.969  38.213  34.709  1.00 32.27 ? 55  GLU B C   1 
ATOM   2068 O  O   . GLU B 1 55  ? 26.908  38.918  34.343  1.00 32.01 ? 55  GLU B O   1 
ATOM   2069 C  CB  . GLU B 1 55  ? 24.135  39.154  36.072  1.00 36.91 ? 55  GLU B CB  1 
ATOM   2070 C  CG  . GLU B 1 55  ? 23.256  40.381  36.139  1.00 42.60 ? 55  GLU B CG  1 
ATOM   2071 C  CD  . GLU B 1 55  ? 22.982  40.810  37.573  1.00 45.62 ? 55  GLU B CD  1 
ATOM   2072 O  OE1 . GLU B 1 55  ? 23.960  41.083  38.313  1.00 45.39 ? 55  GLU B OE1 1 
ATOM   2073 O  OE2 . GLU B 1 55  ? 21.788  40.871  37.951  1.00 46.61 ? 55  GLU B OE2 1 
ATOM   2074 N  N   . LEU B 1 56  ? 26.128  36.982  35.177  1.00 31.06 ? 56  LEU B N   1 
ATOM   2075 C  CA  . LEU B 1 56  ? 27.448  36.384  35.283  1.00 30.45 ? 56  LEU B CA  1 
ATOM   2076 C  C   . LEU B 1 56  ? 28.240  36.470  33.983  1.00 29.83 ? 56  LEU B C   1 
ATOM   2077 O  O   . LEU B 1 56  ? 29.409  36.863  33.991  1.00 29.91 ? 56  LEU B O   1 
ATOM   2078 C  CB  . LEU B 1 56  ? 27.344  34.916  35.707  1.00 30.62 ? 56  LEU B CB  1 
ATOM   2079 C  CG  . LEU B 1 56  ? 28.687  34.173  35.758  1.00 31.39 ? 56  LEU B CG  1 
ATOM   2080 C  CD1 . LEU B 1 56  ? 29.544  34.753  36.869  1.00 31.44 ? 56  LEU B CD1 1 
ATOM   2081 C  CD2 . LEU B 1 56  ? 28.461  32.694  35.989  1.00 32.74 ? 56  LEU B CD2 1 
ATOM   2082 N  N   . ILE B 1 57  ? 27.608  36.120  32.866  1.00 29.16 ? 57  ILE B N   1 
ATOM   2083 C  CA  . ILE B 1 57  ? 28.312  36.136  31.588  1.00 28.95 ? 57  ILE B CA  1 
ATOM   2084 C  C   . ILE B 1 57  ? 28.719  37.513  31.068  1.00 29.41 ? 57  ILE B C   1 
ATOM   2085 O  O   . ILE B 1 57  ? 29.380  37.612  30.034  1.00 29.07 ? 57  ILE B O   1 
ATOM   2086 C  CB  . ILE B 1 57  ? 27.511  35.398  30.496  1.00 27.96 ? 57  ILE B CB  1 
ATOM   2087 C  CG1 . ILE B 1 57  ? 26.189  36.114  30.220  1.00 29.47 ? 57  ILE B CG1 1 
ATOM   2088 C  CG2 . ILE B 1 57  ? 27.262  33.972  30.934  1.00 26.09 ? 57  ILE B CG2 1 
ATOM   2089 C  CD1 . ILE B 1 57  ? 25.385  35.491  29.088  1.00 28.44 ? 57  ILE B CD1 1 
ATOM   2090 N  N   . THR B 1 58  ? 28.340  38.572  31.781  1.00 29.06 ? 58  THR B N   1 
ATOM   2091 C  CA  . THR B 1 58  ? 28.712  39.923  31.368  1.00 31.06 ? 58  THR B CA  1 
ATOM   2092 C  C   . THR B 1 58  ? 29.886  40.397  32.224  1.00 33.21 ? 58  THR B C   1 
ATOM   2093 O  O   . THR B 1 58  ? 30.344  41.527  32.088  1.00 34.66 ? 58  THR B O   1 
ATOM   2094 C  CB  . THR B 1 58  ? 27.554  40.928  31.550  1.00 30.19 ? 58  THR B CB  1 
ATOM   2095 O  OG1 . THR B 1 58  ? 27.300  41.108  32.947  1.00 32.11 ? 58  THR B OG1 1 
ATOM   2096 C  CG2 . THR B 1 58  ? 26.287  40.426  30.871  1.00 28.06 ? 58  THR B CG2 1 
ATOM   2097 N  N   . LYS B 1 59  ? 30.370  39.523  33.101  1.00 34.51 ? 59  LYS B N   1 
ATOM   2098 C  CA  . LYS B 1 59  ? 31.477  39.858  33.987  1.00 36.26 ? 59  LYS B CA  1 
ATOM   2099 C  C   . LYS B 1 59  ? 32.559  38.777  33.968  1.00 36.34 ? 59  LYS B C   1 
ATOM   2100 O  O   . LYS B 1 59  ? 33.187  38.498  34.986  1.00 34.74 ? 59  LYS B O   1 
ATOM   2101 C  CB  . LYS B 1 59  ? 30.941  40.051  35.411  1.00 38.35 ? 59  LYS B CB  1 
ATOM   2102 C  CG  . LYS B 1 59  ? 29.872  41.136  35.510  1.00 41.51 ? 59  LYS B CG  1 
ATOM   2103 C  CD  . LYS B 1 59  ? 29.152  41.130  36.852  1.00 43.68 ? 59  LYS B CD  1 
ATOM   2104 C  CE  . LYS B 1 59  ? 28.073  42.213  36.884  1.00 46.69 ? 59  LYS B CE  1 
ATOM   2105 N  NZ  . LYS B 1 59  ? 27.158  42.094  38.060  1.00 49.12 ? 59  LYS B NZ  1 
ATOM   2106 N  N   . LEU B 1 60  ? 32.779  38.183  32.799  1.00 37.65 ? 60  LEU B N   1 
ATOM   2107 C  CA  . LEU B 1 60  ? 33.769  37.121  32.644  1.00 39.26 ? 60  LEU B CA  1 
ATOM   2108 C  C   . LEU B 1 60  ? 35.211  37.549  32.908  1.00 41.98 ? 60  LEU B C   1 
ATOM   2109 O  O   . LEU B 1 60  ? 36.015  36.753  33.400  1.00 42.67 ? 60  LEU B O   1 
ATOM   2110 C  CB  . LEU B 1 60  ? 33.664  36.504  31.243  1.00 35.77 ? 60  LEU B CB  1 
ATOM   2111 C  CG  . LEU B 1 60  ? 32.384  35.718  30.949  1.00 34.56 ? 60  LEU B CG  1 
ATOM   2112 C  CD1 . LEU B 1 60  ? 32.381  35.251  29.504  1.00 31.84 ? 60  LEU B CD1 1 
ATOM   2113 C  CD2 . LEU B 1 60  ? 32.286  34.530  31.895  1.00 32.49 ? 60  LEU B CD2 1 
ATOM   2114 N  N   . ASP B 1 61  ? 35.547  38.794  32.585  1.00 44.67 ? 61  ASP B N   1 
ATOM   2115 C  CA  . ASP B 1 61  ? 36.906  39.274  32.808  1.00 47.90 ? 61  ASP B CA  1 
ATOM   2116 C  C   . ASP B 1 61  ? 37.216  39.501  34.282  1.00 48.67 ? 61  ASP B C   1 
ATOM   2117 O  O   . ASP B 1 61  ? 38.366  39.741  34.650  1.00 49.15 ? 61  ASP B O   1 
ATOM   2118 C  CB  . ASP B 1 61  ? 37.156  40.555  32.012  1.00 50.42 ? 61  ASP B CB  1 
ATOM   2119 C  CG  . ASP B 1 61  ? 37.355  40.283  30.534  1.00 53.69 ? 61  ASP B CG  1 
ATOM   2120 O  OD1 . ASP B 1 61  ? 38.246  39.467  30.200  1.00 54.21 ? 61  ASP B OD1 1 
ATOM   2121 O  OD2 . ASP B 1 61  ? 36.627  40.876  29.707  1.00 56.65 ? 61  ASP B OD2 1 
ATOM   2122 N  N   . GLN B 1 62  ? 36.186  39.412  35.120  1.00 49.33 ? 62  GLN B N   1 
ATOM   2123 C  CA  . GLN B 1 62  ? 36.339  39.591  36.559  1.00 49.89 ? 62  GLN B CA  1 
ATOM   2124 C  C   . GLN B 1 62  ? 36.492  38.246  37.261  1.00 49.07 ? 62  GLN B C   1 
ATOM   2125 O  O   . GLN B 1 62  ? 36.353  38.155  38.479  1.00 49.77 ? 62  GLN B O   1 
ATOM   2126 C  CB  . GLN B 1 62  ? 35.126  40.319  37.136  1.00 52.44 ? 62  GLN B CB  1 
ATOM   2127 C  CG  . GLN B 1 62  ? 34.981  41.758  36.679  1.00 56.98 ? 62  GLN B CG  1 
ATOM   2128 C  CD  . GLN B 1 62  ? 33.721  42.406  37.222  1.00 60.04 ? 62  GLN B CD  1 
ATOM   2129 O  OE1 . GLN B 1 62  ? 33.484  42.411  38.432  1.00 61.52 ? 62  GLN B OE1 1 
ATOM   2130 N  NE2 . GLN B 1 62  ? 32.906  42.958  36.328  1.00 61.90 ? 62  GLN B NE2 1 
ATOM   2131 N  N   . LEU B 1 63  ? 36.769  37.202  36.489  1.00 48.02 ? 63  LEU B N   1 
ATOM   2132 C  CA  . LEU B 1 63  ? 36.938  35.864  37.047  1.00 46.61 ? 63  LEU B CA  1 
ATOM   2133 C  C   . LEU B 1 63  ? 38.394  35.430  36.972  1.00 45.93 ? 63  LEU B C   1 
ATOM   2134 O  O   . LEU B 1 63  ? 39.138  35.870  36.095  1.00 46.84 ? 63  LEU B O   1 
ATOM   2135 C  CB  . LEU B 1 63  ? 36.094  34.847  36.271  1.00 45.90 ? 63  LEU B CB  1 
ATOM   2136 C  CG  . LEU B 1 63  ? 34.566  34.907  36.309  1.00 45.64 ? 63  LEU B CG  1 
ATOM   2137 C  CD1 . LEU B 1 63  ? 34.005  33.909  35.306  1.00 44.18 ? 63  LEU B CD1 1 
ATOM   2138 C  CD2 . LEU B 1 63  ? 34.065  34.593  37.706  1.00 44.45 ? 63  LEU B CD2 1 
ATOM   2139 N  N   . PRO B 1 64  ? 38.825  34.562  37.897  1.00 45.12 ? 64  PRO B N   1 
ATOM   2140 C  CA  . PRO B 1 64  ? 40.215  34.101  37.865  1.00 45.65 ? 64  PRO B CA  1 
ATOM   2141 C  C   . PRO B 1 64  ? 40.468  33.363  36.553  1.00 45.80 ? 64  PRO B C   1 
ATOM   2142 O  O   . PRO B 1 64  ? 39.621  32.602  36.088  1.00 45.41 ? 64  PRO B O   1 
ATOM   2143 C  CB  . PRO B 1 64  ? 40.309  33.192  39.092  1.00 45.69 ? 64  PRO B CB  1 
ATOM   2144 C  CG  . PRO B 1 64  ? 38.889  32.735  39.303  1.00 46.33 ? 64  PRO B CG  1 
ATOM   2145 C  CD  . PRO B 1 64  ? 38.103  33.987  39.044  1.00 45.11 ? 64  PRO B CD  1 
ATOM   2146 N  N   . ALA B 1 65  ? 41.631  33.603  35.957  1.00 46.03 ? 65  ALA B N   1 
ATOM   2147 C  CA  . ALA B 1 65  ? 41.997  32.990  34.683  1.00 46.11 ? 65  ALA B CA  1 
ATOM   2148 C  C   . ALA B 1 65  ? 41.615  31.516  34.515  1.00 45.40 ? 65  ALA B C   1 
ATOM   2149 O  O   . ALA B 1 65  ? 41.124  31.115  33.457  1.00 44.51 ? 65  ALA B O   1 
ATOM   2150 C  CB  . ALA B 1 65  ? 43.496  33.165  34.446  1.00 47.38 ? 65  ALA B CB  1 
ATOM   2151 N  N   . ASP B 1 66  ? 41.839  30.715  35.554  1.00 44.67 ? 66  ASP B N   1 
ATOM   2152 C  CA  . ASP B 1 66  ? 41.542  29.282  35.504  1.00 44.33 ? 66  ASP B CA  1 
ATOM   2153 C  C   . ASP B 1 66  ? 40.052  28.926  35.494  1.00 43.25 ? 66  ASP B C   1 
ATOM   2154 O  O   . ASP B 1 66  ? 39.686  27.778  35.248  1.00 43.75 ? 66  ASP B O   1 
ATOM   2155 C  CB  . ASP B 1 66  ? 42.220  28.569  36.680  1.00 45.73 ? 66  ASP B CB  1 
ATOM   2156 C  CG  . ASP B 1 66  ? 41.666  29.006  38.028  1.00 47.06 ? 66  ASP B CG  1 
ATOM   2157 O  OD1 . ASP B 1 66  ? 41.696  30.220  38.315  1.00 47.72 ? 66  ASP B OD1 1 
ATOM   2158 O  OD2 . ASP B 1 66  ? 41.203  28.136  38.799  1.00 47.77 ? 66  ASP B OD2 1 
ATOM   2159 N  N   . LYS B 1 67  ? 39.194  29.904  35.762  1.00 41.39 ? 67  LYS B N   1 
ATOM   2160 C  CA  . LYS B 1 67  ? 37.754  29.664  35.788  1.00 39.97 ? 67  LYS B CA  1 
ATOM   2161 C  C   . LYS B 1 67  ? 37.040  30.341  34.617  1.00 38.23 ? 67  LYS B C   1 
ATOM   2162 O  O   . LYS B 1 67  ? 35.886  30.033  34.315  1.00 38.36 ? 67  LYS B O   1 
ATOM   2163 C  CB  . LYS B 1 67  ? 37.157  30.195  37.097  1.00 40.75 ? 67  LYS B CB  1 
ATOM   2164 C  CG  . LYS B 1 67  ? 37.630  29.500  38.366  1.00 41.67 ? 67  LYS B CG  1 
ATOM   2165 C  CD  . LYS B 1 67  ? 37.068  28.100  38.462  1.00 41.89 ? 67  LYS B CD  1 
ATOM   2166 C  CE  . LYS B 1 67  ? 37.299  27.506  39.835  1.00 42.47 ? 67  LYS B CE  1 
ATOM   2167 N  NZ  . LYS B 1 67  ? 36.754  26.127  39.908  1.00 43.43 ? 67  LYS B NZ  1 
ATOM   2168 N  N   . LYS B 1 68  ? 37.735  31.258  33.956  1.00 34.99 ? 68  LYS B N   1 
ATOM   2169 C  CA  . LYS B 1 68  ? 37.146  32.007  32.856  1.00 33.40 ? 68  LYS B CA  1 
ATOM   2170 C  C   . LYS B 1 68  ? 36.590  31.174  31.697  1.00 30.97 ? 68  LYS B C   1 
ATOM   2171 O  O   . LYS B 1 68  ? 35.431  31.342  31.318  1.00 29.58 ? 68  LYS B O   1 
ATOM   2172 C  CB  . LYS B 1 68  ? 38.154  33.038  32.329  1.00 34.90 ? 68  LYS B CB  1 
ATOM   2173 C  CG  . LYS B 1 68  ? 37.557  34.066  31.379  1.00 38.21 ? 68  LYS B CG  1 
ATOM   2174 C  CD  . LYS B 1 68  ? 38.591  35.107  30.958  1.00 42.52 ? 68  LYS B CD  1 
ATOM   2175 C  CE  . LYS B 1 68  ? 38.026  36.064  29.908  1.00 44.81 ? 68  LYS B CE  1 
ATOM   2176 N  NZ  . LYS B 1 68  ? 39.048  37.031  29.402  1.00 45.49 ? 68  LYS B NZ  1 
ATOM   2177 N  N   . THR B 1 69  ? 37.394  30.270  31.147  1.00 28.21 ? 69  THR B N   1 
ATOM   2178 C  CA  . THR B 1 69  ? 36.948  29.462  30.017  1.00 26.17 ? 69  THR B CA  1 
ATOM   2179 C  C   . THR B 1 69  ? 35.847  28.448  30.331  1.00 24.46 ? 69  THR B C   1 
ATOM   2180 O  O   . THR B 1 69  ? 34.871  28.337  29.583  1.00 21.40 ? 69  THR B O   1 
ATOM   2181 C  CB  . THR B 1 69  ? 38.137  28.736  29.365  1.00 26.71 ? 69  THR B CB  1 
ATOM   2182 O  OG1 . THR B 1 69  ? 39.117  29.705  28.978  1.00 27.30 ? 69  THR B OG1 1 
ATOM   2183 C  CG2 . THR B 1 69  ? 37.683  27.971  28.121  1.00 27.05 ? 69  THR B CG2 1 
ATOM   2184 N  N   . VAL B 1 70  ? 35.993  27.716  31.432  1.00 22.22 ? 70  VAL B N   1 
ATOM   2185 C  CA  . VAL B 1 70  ? 34.990  26.723  31.800  1.00 22.42 ? 70  VAL B CA  1 
ATOM   2186 C  C   . VAL B 1 70  ? 33.607  27.367  31.984  1.00 21.10 ? 70  VAL B C   1 
ATOM   2187 O  O   . VAL B 1 70  ? 32.590  26.800  31.578  1.00 20.25 ? 70  VAL B O   1 
ATOM   2188 C  CB  . VAL B 1 70  ? 35.394  25.978  33.104  1.00 22.92 ? 70  VAL B CB  1 
ATOM   2189 C  CG1 . VAL B 1 70  ? 35.317  26.923  34.297  1.00 24.38 ? 70  VAL B CG1 1 
ATOM   2190 C  CG2 . VAL B 1 70  ? 34.497  24.770  33.314  1.00 22.81 ? 70  VAL B CG2 1 
ATOM   2191 N  N   . LEU B 1 71  ? 33.572  28.555  32.585  1.00 19.22 ? 71  LEU B N   1 
ATOM   2192 C  CA  . LEU B 1 71  ? 32.308  29.253  32.814  1.00 18.05 ? 71  LEU B CA  1 
ATOM   2193 C  C   . LEU B 1 71  ? 31.778  29.912  31.554  1.00 17.45 ? 71  LEU B C   1 
ATOM   2194 O  O   . LEU B 1 71  ? 30.567  29.968  31.335  1.00 17.60 ? 71  LEU B O   1 
ATOM   2195 C  CB  . LEU B 1 71  ? 32.464  30.296  33.920  1.00 18.19 ? 71  LEU B CB  1 
ATOM   2196 C  CG  . LEU B 1 71  ? 32.534  29.678  35.317  1.00 20.33 ? 71  LEU B CG  1 
ATOM   2197 C  CD1 . LEU B 1 71  ? 32.761  30.764  36.358  1.00 20.55 ? 71  LEU B CD1 1 
ATOM   2198 C  CD2 . LEU B 1 71  ? 31.231  28.924  35.593  1.00 21.00 ? 71  LEU B CD2 1 
ATOM   2199 N  N   . ARG B 1 72  ? 32.685  30.413  30.724  1.00 17.40 ? 72  ARG B N   1 
ATOM   2200 C  CA  . ARG B 1 72  ? 32.298  31.034  29.459  1.00 16.19 ? 72  ARG B CA  1 
ATOM   2201 C  C   . ARG B 1 72  ? 31.534  29.994  28.644  1.00 16.15 ? 72  ARG B C   1 
ATOM   2202 O  O   . ARG B 1 72  ? 30.474  30.277  28.082  1.00 17.17 ? 72  ARG B O   1 
ATOM   2203 C  CB  . ARG B 1 72  ? 33.542  31.468  28.678  1.00 15.50 ? 72  ARG B CB  1 
ATOM   2204 C  CG  . ARG B 1 72  ? 33.292  31.792  27.205  1.00 15.84 ? 72  ARG B CG  1 
ATOM   2205 C  CD  . ARG B 1 72  ? 34.609  32.091  26.500  1.00 16.21 ? 72  ARG B CD  1 
ATOM   2206 N  NE  . ARG B 1 72  ? 34.442  32.505  25.109  1.00 17.12 ? 72  ARG B NE  1 
ATOM   2207 C  CZ  . ARG B 1 72  ? 35.442  32.911  24.329  1.00 16.98 ? 72  ARG B CZ  1 
ATOM   2208 N  NH1 . ARG B 1 72  ? 36.680  32.957  24.801  1.00 16.91 ? 72  ARG B NH1 1 
ATOM   2209 N  NH2 . ARG B 1 72  ? 35.208  33.280  23.079  1.00 16.33 ? 72  ARG B NH2 1 
ATOM   2210 N  N   . ASN B 1 73  ? 32.078  28.782  28.598  1.00 14.66 ? 73  ASN B N   1 
ATOM   2211 C  CA  . ASN B 1 73  ? 31.460  27.698  27.843  1.00 14.31 ? 73  ASN B CA  1 
ATOM   2212 C  C   . ASN B 1 73  ? 30.184  27.134  28.475  1.00 13.17 ? 73  ASN B C   1 
ATOM   2213 O  O   . ASN B 1 73  ? 29.176  26.960  27.799  1.00 13.70 ? 73  ASN B O   1 
ATOM   2214 C  CB  . ASN B 1 73  ? 32.470  26.555  27.635  1.00 10.90 ? 73  ASN B CB  1 
ATOM   2215 C  CG  . ASN B 1 73  ? 33.598  26.928  26.677  1.00 12.49 ? 73  ASN B CG  1 
ATOM   2216 O  OD1 . ASN B 1 73  ? 33.478  27.865  25.891  1.00 13.72 ? 73  ASN B OD1 1 
ATOM   2217 N  ND2 . ASN B 1 73  ? 34.690  26.177  26.728  1.00 11.33 ? 73  ASN B ND2 1 
ATOM   2218 N  N   . ASN B 1 74  ? 30.222  26.863  29.773  1.00 13.43 ? 74  ASN B N   1 
ATOM   2219 C  CA  . ASN B 1 74  ? 29.076  26.261  30.435  1.00 14.90 ? 74  ASN B CA  1 
ATOM   2220 C  C   . ASN B 1 74  ? 28.006  27.217  30.941  1.00 14.71 ? 74  ASN B C   1 
ATOM   2221 O  O   . ASN B 1 74  ? 26.821  26.928  30.813  1.00 15.46 ? 74  ASN B O   1 
ATOM   2222 C  CB  . ASN B 1 74  ? 29.577  25.332  31.536  1.00 16.12 ? 74  ASN B CB  1 
ATOM   2223 C  CG  . ASN B 1 74  ? 30.337  24.140  30.966  1.00 19.05 ? 74  ASN B CG  1 
ATOM   2224 O  OD1 . ASN B 1 74  ? 29.734  23.159  30.535  1.00 21.77 ? 74  ASN B OD1 1 
ATOM   2225 N  ND2 . ASN B 1 74  ? 31.664  24.236  30.932  1.00 16.89 ? 74  ASN B ND2 1 
ATOM   2226 N  N   . ALA B 1 75  ? 28.403  28.349  31.510  1.00 15.37 ? 75  ALA B N   1 
ATOM   2227 C  CA  . ALA B 1 75  ? 27.410  29.312  31.962  1.00 14.81 ? 75  ALA B CA  1 
ATOM   2228 C  C   . ALA B 1 75  ? 26.807  29.874  30.677  1.00 15.55 ? 75  ALA B C   1 
ATOM   2229 O  O   . ALA B 1 75  ? 25.615  30.165  30.607  1.00 16.82 ? 75  ALA B O   1 
ATOM   2230 C  CB  . ALA B 1 75  ? 28.065  30.415  32.782  1.00 13.91 ? 75  ALA B CB  1 
ATOM   2231 N  N   . GLY B 1 76  ? 27.642  30.010  29.649  1.00 15.17 ? 76  GLY B N   1 
ATOM   2232 C  CA  . GLY B 1 76  ? 27.154  30.500  28.374  1.00 13.82 ? 76  GLY B CA  1 
ATOM   2233 C  C   . GLY B 1 76  ? 26.141  29.511  27.822  1.00 13.68 ? 76  GLY B C   1 
ATOM   2234 O  O   . GLY B 1 76  ? 25.067  29.894  27.359  1.00 12.19 ? 76  GLY B O   1 
ATOM   2235 N  N   . GLY B 1 77  ? 26.483  28.226  27.881  1.00 14.87 ? 77  GLY B N   1 
ATOM   2236 C  CA  . GLY B 1 77  ? 25.584  27.197  27.393  1.00 14.43 ? 77  GLY B CA  1 
ATOM   2237 C  C   . GLY B 1 77  ? 24.259  27.208  28.140  1.00 15.75 ? 77  GLY B C   1 
ATOM   2238 O  O   . GLY B 1 77  ? 23.199  27.015  27.538  1.00 14.83 ? 77  GLY B O   1 
ATOM   2239 N  N   . HIS B 1 78  ? 24.315  27.433  29.452  1.00 15.15 ? 78  HIS B N   1 
ATOM   2240 C  CA  . HIS B 1 78  ? 23.108  27.475  30.279  1.00 16.02 ? 78  HIS B CA  1 
ATOM   2241 C  C   . HIS B 1 78  ? 22.235  28.682  29.913  1.00 15.27 ? 78  HIS B C   1 
ATOM   2242 O  O   . HIS B 1 78  ? 21.019  28.554  29.743  1.00 14.99 ? 78  HIS B O   1 
ATOM   2243 C  CB  . HIS B 1 78  ? 23.495  27.521  31.765  1.00 15.67 ? 78  HIS B CB  1 
ATOM   2244 C  CG  . HIS B 1 78  ? 22.333  27.694  32.697  1.00 17.38 ? 78  HIS B CG  1 
ATOM   2245 N  ND1 . HIS B 1 78  ? 21.152  26.994  32.558  1.00 16.56 ? 78  HIS B ND1 1 
ATOM   2246 C  CD2 . HIS B 1 78  ? 22.184  28.469  33.799  1.00 15.88 ? 78  HIS B CD2 1 
ATOM   2247 C  CE1 . HIS B 1 78  ? 20.327  27.331  33.532  1.00 16.31 ? 78  HIS B CE1 1 
ATOM   2248 N  NE2 . HIS B 1 78  ? 20.928  28.225  34.298  1.00 17.28 ? 78  HIS B NE2 1 
ATOM   2249 N  N   . ALA B 1 79  ? 22.862  29.847  29.777  1.00 14.59 ? 79  ALA B N   1 
ATOM   2250 C  CA  . ALA B 1 79  ? 22.134  31.062  29.428  1.00 15.59 ? 79  ALA B CA  1 
ATOM   2251 C  C   . ALA B 1 79  ? 21.493  30.964  28.046  1.00 16.36 ? 79  ALA B C   1 
ATOM   2252 O  O   . ALA B 1 79  ? 20.316  31.276  27.880  1.00 16.91 ? 79  ALA B O   1 
ATOM   2253 C  CB  . ALA B 1 79  ? 23.065  32.263  29.477  1.00 16.43 ? 79  ALA B CB  1 
ATOM   2254 N  N   . ASN B 1 80  ? 22.267  30.530  27.055  1.00 15.36 ? 80  ASN B N   1 
ATOM   2255 C  CA  . ASN B 1 80  ? 21.749  30.417  25.700  1.00 15.06 ? 80  ASN B CA  1 
ATOM   2256 C  C   . ASN B 1 80  ? 20.576  29.459  25.561  1.00 14.81 ? 80  ASN B C   1 
ATOM   2257 O  O   . ASN B 1 80  ? 19.578  29.795  24.921  1.00 14.53 ? 80  ASN B O   1 
ATOM   2258 C  CB  . ASN B 1 80  ? 22.856  30.004  24.723  1.00 16.09 ? 80  ASN B CB  1 
ATOM   2259 C  CG  . ASN B 1 80  ? 23.944  31.051  24.605  1.00 17.50 ? 80  ASN B CG  1 
ATOM   2260 O  OD1 . ASN B 1 80  ? 23.763  32.195  25.022  1.00 17.01 ? 80  ASN B OD1 1 
ATOM   2261 N  ND2 . ASN B 1 80  ? 25.077  30.669  24.028  1.00 16.00 ? 80  ASN B ND2 1 
ATOM   2262 N  N   . HIS B 1 81  ? 20.684  28.272  26.149  1.00 13.64 ? 81  HIS B N   1 
ATOM   2263 C  CA  . HIS B 1 81  ? 19.608  27.297  26.041  1.00 14.59 ? 81  HIS B CA  1 
ATOM   2264 C  C   . HIS B 1 81  ? 18.369  27.703  26.833  1.00 15.42 ? 81  HIS B C   1 
ATOM   2265 O  O   . HIS B 1 81  ? 17.247  27.419  26.416  1.00 17.10 ? 81  HIS B O   1 
ATOM   2266 C  CB  . HIS B 1 81  ? 20.105  25.896  26.452  1.00 14.36 ? 81  HIS B CB  1 
ATOM   2267 C  CG  . HIS B 1 81  ? 21.061  25.285  25.468  1.00 15.08 ? 81  HIS B CG  1 
ATOM   2268 N  ND1 . HIS B 1 81  ? 22.391  25.644  25.397  1.00 14.02 ? 81  HIS B ND1 1 
ATOM   2269 C  CD2 . HIS B 1 81  ? 20.859  24.401  24.460  1.00 15.24 ? 81  HIS B CD2 1 
ATOM   2270 C  CE1 . HIS B 1 81  ? 22.965  25.012  24.388  1.00 14.15 ? 81  HIS B CE1 1 
ATOM   2271 N  NE2 . HIS B 1 81  ? 22.057  24.253  23.802  1.00 15.23 ? 81  HIS B NE2 1 
ATOM   2272 N  N   . SER B 1 82  ? 18.561  28.378  27.963  1.00 16.57 ? 82  SER B N   1 
ATOM   2273 C  CA  . SER B 1 82  ? 17.420  28.826  28.760  1.00 17.16 ? 82  SER B CA  1 
ATOM   2274 C  C   . SER B 1 82  ? 16.594  29.788  27.912  1.00 18.17 ? 82  SER B C   1 
ATOM   2275 O  O   . SER B 1 82  ? 15.365  29.722  27.895  1.00 18.08 ? 82  SER B O   1 
ATOM   2276 C  CB  . SER B 1 82  ? 17.889  29.541  30.029  1.00 16.05 ? 82  SER B CB  1 
ATOM   2277 O  OG  . SER B 1 82  ? 18.500  28.633  30.928  1.00 17.77 ? 82  SER B OG  1 
ATOM   2278 N  N   . LEU B 1 83  ? 17.288  30.677  27.206  1.00 17.60 ? 83  LEU B N   1 
ATOM   2279 C  CA  . LEU B 1 83  ? 16.642  31.658  26.346  1.00 18.05 ? 83  LEU B CA  1 
ATOM   2280 C  C   . LEU B 1 83  ? 16.003  30.959  25.153  1.00 18.48 ? 83  LEU B C   1 
ATOM   2281 O  O   . LEU B 1 83  ? 14.923  31.342  24.699  1.00 18.13 ? 83  LEU B O   1 
ATOM   2282 C  CB  . LEU B 1 83  ? 17.676  32.682  25.861  1.00 20.74 ? 83  LEU B CB  1 
ATOM   2283 C  CG  . LEU B 1 83  ? 17.264  33.889  25.011  1.00 22.43 ? 83  LEU B CG  1 
ATOM   2284 C  CD1 . LEU B 1 83  ? 18.410  34.888  24.998  1.00 26.24 ? 83  LEU B CD1 1 
ATOM   2285 C  CD2 . LEU B 1 83  ? 16.919  33.468  23.599  1.00 24.83 ? 83  LEU B CD2 1 
ATOM   2286 N  N   . PHE B 1 84  ? 16.674  29.928  24.654  1.00 17.42 ? 84  PHE B N   1 
ATOM   2287 C  CA  . PHE B 1 84  ? 16.192  29.175  23.507  1.00 17.18 ? 84  PHE B CA  1 
ATOM   2288 C  C   . PHE B 1 84  ? 14.835  28.502  23.753  1.00 18.25 ? 84  PHE B C   1 
ATOM   2289 O  O   . PHE B 1 84  ? 13.920  28.630  22.933  1.00 18.21 ? 84  PHE B O   1 
ATOM   2290 C  CB  . PHE B 1 84  ? 17.235  28.124  23.114  1.00 16.76 ? 84  PHE B CB  1 
ATOM   2291 C  CG  . PHE B 1 84  ? 16.969  27.463  21.789  1.00 17.48 ? 84  PHE B CG  1 
ATOM   2292 C  CD1 . PHE B 1 84  ? 16.809  28.227  20.632  1.00 16.45 ? 84  PHE B CD1 1 
ATOM   2293 C  CD2 . PHE B 1 84  ? 16.911  26.077  21.689  1.00 16.34 ? 84  PHE B CD2 1 
ATOM   2294 C  CE1 . PHE B 1 84  ? 16.598  27.618  19.392  1.00 15.61 ? 84  PHE B CE1 1 
ATOM   2295 C  CE2 . PHE B 1 84  ? 16.702  25.459  20.458  1.00 16.47 ? 84  PHE B CE2 1 
ATOM   2296 C  CZ  . PHE B 1 84  ? 16.546  26.234  19.306  1.00 16.85 ? 84  PHE B CZ  1 
ATOM   2297 N  N   . TRP B 1 85  ? 14.700  27.793  24.875  1.00 17.58 ? 85  TRP B N   1 
ATOM   2298 C  CA  . TRP B 1 85  ? 13.442  27.103  25.192  1.00 19.08 ? 85  TRP B CA  1 
ATOM   2299 C  C   . TRP B 1 85  ? 12.259  28.071  25.238  1.00 19.67 ? 85  TRP B C   1 
ATOM   2300 O  O   . TRP B 1 85  ? 11.174  27.765  24.743  1.00 21.58 ? 85  TRP B O   1 
ATOM   2301 C  CB  . TRP B 1 85  ? 13.529  26.383  26.545  1.00 18.14 ? 85  TRP B CB  1 
ATOM   2302 C  CG  . TRP B 1 85  ? 14.701  25.456  26.703  1.00 17.41 ? 85  TRP B CG  1 
ATOM   2303 C  CD1 . TRP B 1 85  ? 15.508  25.351  27.797  1.00 17.75 ? 85  TRP B CD1 1 
ATOM   2304 C  CD2 . TRP B 1 85  ? 15.201  24.514  25.747  1.00 18.49 ? 85  TRP B CD2 1 
ATOM   2305 N  NE1 . TRP B 1 85  ? 16.484  24.411  27.583  1.00 18.63 ? 85  TRP B NE1 1 
ATOM   2306 C  CE2 . TRP B 1 85  ? 16.321  23.878  26.333  1.00 18.87 ? 85  TRP B CE2 1 
ATOM   2307 C  CE3 . TRP B 1 85  ? 14.815  24.144  24.448  1.00 19.04 ? 85  TRP B CE3 1 
ATOM   2308 C  CZ2 . TRP B 1 85  ? 17.064  22.892  25.668  1.00 17.74 ? 85  TRP B CZ2 1 
ATOM   2309 C  CZ3 . TRP B 1 85  ? 15.557  23.159  23.783  1.00 18.93 ? 85  TRP B CZ3 1 
ATOM   2310 C  CH2 . TRP B 1 85  ? 16.669  22.547  24.399  1.00 18.59 ? 85  TRP B CH2 1 
ATOM   2311 N  N   . LYS B 1 86  ? 12.470  29.235  25.839  1.00 19.99 ? 86  LYS B N   1 
ATOM   2312 C  CA  . LYS B 1 86  ? 11.417  30.234  25.956  1.00 22.36 ? 86  LYS B CA  1 
ATOM   2313 C  C   . LYS B 1 86  ? 11.100  30.920  24.636  1.00 22.94 ? 86  LYS B C   1 
ATOM   2314 O  O   . LYS B 1 86  ? 10.023  31.496  24.478  1.00 23.92 ? 86  LYS B O   1 
ATOM   2315 C  CB  . LYS B 1 86  ? 11.805  31.303  26.977  1.00 22.73 ? 86  LYS B CB  1 
ATOM   2316 C  CG  . LYS B 1 86  ? 11.756  30.861  28.420  1.00 26.67 ? 86  LYS B CG  1 
ATOM   2317 C  CD  . LYS B 1 86  ? 12.018  32.059  29.314  1.00 32.55 ? 86  LYS B CD  1 
ATOM   2318 C  CE  . LYS B 1 86  ? 11.714  31.755  30.769  1.00 36.92 ? 86  LYS B CE  1 
ATOM   2319 N  NZ  . LYS B 1 86  ? 11.886  32.978  31.616  1.00 41.83 ? 86  LYS B NZ  1 
ATOM   2320 N  N   . GLY B 1 87  ? 12.040  30.864  23.697  1.00 21.84 ? 87  GLY B N   1 
ATOM   2321 C  CA  . GLY B 1 87  ? 11.842  31.510  22.414  1.00 19.84 ? 87  GLY B CA  1 
ATOM   2322 C  C   . GLY B 1 87  ? 11.166  30.645  21.376  1.00 20.18 ? 87  GLY B C   1 
ATOM   2323 O  O   . GLY B 1 87  ? 11.080  31.031  20.209  1.00 20.37 ? 87  GLY B O   1 
ATOM   2324 N  N   . LEU B 1 88  ? 10.681  29.478  21.789  1.00 20.06 ? 88  LEU B N   1 
ATOM   2325 C  CA  . LEU B 1 88  ? 10.014  28.573  20.862  1.00 21.89 ? 88  LEU B CA  1 
ATOM   2326 C  C   . LEU B 1 88  ? 8.547   28.383  21.234  1.00 24.26 ? 88  LEU B C   1 
ATOM   2327 O  O   . LEU B 1 88  ? 8.206   28.270  22.412  1.00 24.37 ? 88  LEU B O   1 
ATOM   2328 C  CB  . LEU B 1 88  ? 10.722  27.214  20.841  1.00 21.24 ? 88  LEU B CB  1 
ATOM   2329 C  CG  . LEU B 1 88  ? 12.204  27.223  20.442  1.00 22.29 ? 88  LEU B CG  1 
ATOM   2330 C  CD1 . LEU B 1 88  ? 12.809  25.838  20.677  1.00 21.04 ? 88  LEU B CD1 1 
ATOM   2331 C  CD2 . LEU B 1 88  ? 12.347  27.647  18.986  1.00 18.91 ? 88  LEU B CD2 1 
ATOM   2332 N  N   . LYS B 1 89  ? 7.687   28.344  20.216  1.00 26.81 ? 89  LYS B N   1 
ATOM   2333 C  CA  . LYS B 1 89  ? 6.250   28.177  20.409  1.00 28.37 ? 89  LYS B CA  1 
ATOM   2334 C  C   . LYS B 1 89  ? 5.515   28.239  19.072  1.00 28.54 ? 89  LYS B C   1 
ATOM   2335 O  O   . LYS B 1 89  ? 5.822   29.080  18.227  1.00 28.15 ? 89  LYS B O   1 
ATOM   2336 C  CB  . LYS B 1 89  ? 5.710   29.278  21.323  1.00 29.88 ? 89  LYS B CB  1 
ATOM   2337 C  CG  . LYS B 1 89  ? 4.244   29.122  21.685  1.00 33.48 ? 89  LYS B CG  1 
ATOM   2338 C  CD  . LYS B 1 89  ? 3.784   30.260  22.582  1.00 36.56 ? 89  LYS B CD  1 
ATOM   2339 C  CE  . LYS B 1 89  ? 2.317   30.125  22.949  1.00 38.36 ? 89  LYS B CE  1 
ATOM   2340 N  NZ  . LYS B 1 89  ? 1.878   31.259  23.809  1.00 40.49 ? 89  LYS B NZ  1 
ATOM   2341 N  N   . LYS B 1 90  ? 4.548   27.347  18.881  1.00 28.75 ? 90  LYS B N   1 
ATOM   2342 C  CA  . LYS B 1 90  ? 3.766   27.338  17.646  1.00 30.20 ? 90  LYS B CA  1 
ATOM   2343 C  C   . LYS B 1 90  ? 2.573   28.288  17.747  1.00 29.64 ? 90  LYS B C   1 
ATOM   2344 O  O   . LYS B 1 90  ? 2.105   28.605  18.840  1.00 29.93 ? 90  LYS B O   1 
ATOM   2345 C  CB  . LYS B 1 90  ? 3.233   25.934  17.348  1.00 29.10 ? 90  LYS B CB  1 
ATOM   2346 C  CG  . LYS B 1 90  ? 4.295   24.901  17.087  1.00 31.53 ? 90  LYS B CG  1 
ATOM   2347 C  CD  . LYS B 1 90  ? 3.688   23.510  16.943  1.00 33.01 ? 90  LYS B CD  1 
ATOM   2348 C  CE  . LYS B 1 90  ? 2.778   23.406  15.729  1.00 33.58 ? 90  LYS B CE  1 
ATOM   2349 N  NZ  . LYS B 1 90  ? 2.271   22.014  15.543  1.00 34.05 ? 90  LYS B NZ  1 
ATOM   2350 N  N   . GLY B 1 91  ? 2.100   28.754  16.597  1.00 30.45 ? 91  GLY B N   1 
ATOM   2351 C  CA  . GLY B 1 91  ? 0.934   29.617  16.566  1.00 30.13 ? 91  GLY B CA  1 
ATOM   2352 C  C   . GLY B 1 91  ? 1.047   31.101  16.848  1.00 30.20 ? 91  GLY B C   1 
ATOM   2353 O  O   . GLY B 1 91  ? 0.020   31.771  16.960  1.00 31.47 ? 91  GLY B O   1 
ATOM   2354 N  N   . THR B 1 92  ? 2.255   31.636  16.972  1.00 29.60 ? 92  THR B N   1 
ATOM   2355 C  CA  . THR B 1 92  ? 2.380   33.066  17.231  1.00 29.66 ? 92  THR B CA  1 
ATOM   2356 C  C   . THR B 1 92  ? 2.528   33.783  15.894  1.00 30.46 ? 92  THR B C   1 
ATOM   2357 O  O   . THR B 1 92  ? 2.755   33.146  14.868  1.00 30.34 ? 92  THR B O   1 
ATOM   2358 C  CB  . THR B 1 92  ? 3.610   33.388  18.118  1.00 31.16 ? 92  THR B CB  1 
ATOM   2359 O  OG1 . THR B 1 92  ? 4.814   33.262  17.346  1.00 30.22 ? 92  THR B OG1 1 
ATOM   2360 C  CG2 . THR B 1 92  ? 3.668   32.438  19.313  1.00 28.73 ? 92  THR B CG2 1 
ATOM   2361 N  N   . THR B 1 93  ? 2.389   35.104  15.901  1.00 31.47 ? 93  THR B N   1 
ATOM   2362 C  CA  . THR B 1 93  ? 2.525   35.875  14.672  1.00 33.75 ? 93  THR B CA  1 
ATOM   2363 C  C   . THR B 1 93  ? 3.285   37.168  14.940  1.00 33.49 ? 93  THR B C   1 
ATOM   2364 O  O   . THR B 1 93  ? 3.061   37.830  15.953  1.00 32.58 ? 93  THR B O   1 
ATOM   2365 C  CB  . THR B 1 93  ? 1.152   36.240  14.069  1.00 35.86 ? 93  THR B CB  1 
ATOM   2366 O  OG1 . THR B 1 93  ? 0.438   37.072  14.989  1.00 39.67 ? 93  THR B OG1 1 
ATOM   2367 C  CG2 . THR B 1 93  ? 0.334   34.981  13.784  1.00 37.35 ? 93  THR B CG2 1 
ATOM   2368 N  N   . LEU B 1 94  ? 4.193   37.519  14.033  1.00 33.75 ? 94  LEU B N   1 
ATOM   2369 C  CA  . LEU B 1 94  ? 4.974   38.742  14.184  1.00 35.09 ? 94  LEU B CA  1 
ATOM   2370 C  C   . LEU B 1 94  ? 4.047   39.943  13.977  1.00 36.76 ? 94  LEU B C   1 
ATOM   2371 O  O   . LEU B 1 94  ? 3.305   40.005  12.995  1.00 36.95 ? 94  LEU B O   1 
ATOM   2372 C  CB  . LEU B 1 94  ? 6.127   38.767  13.172  1.00 33.15 ? 94  LEU B CB  1 
ATOM   2373 C  CG  . LEU B 1 94  ? 7.002   40.025  13.159  1.00 34.06 ? 94  LEU B CG  1 
ATOM   2374 C  CD1 . LEU B 1 94  ? 7.608   40.254  14.536  1.00 32.31 ? 94  LEU B CD1 1 
ATOM   2375 C  CD2 . LEU B 1 94  ? 8.093   39.881  12.107  1.00 32.20 ? 94  LEU B CD2 1 
ATOM   2376 N  N   . GLN B 1 95  ? 4.092   40.893  14.903  1.00 37.93 ? 95  GLN B N   1 
ATOM   2377 C  CA  . GLN B 1 95  ? 3.223   42.061  14.828  1.00 39.19 ? 95  GLN B CA  1 
ATOM   2378 C  C   . GLN B 1 95  ? 3.649   43.142  15.817  1.00 39.51 ? 95  GLN B C   1 
ATOM   2379 O  O   . GLN B 1 95  ? 4.645   42.997  16.526  1.00 40.25 ? 95  GLN B O   1 
ATOM   2380 C  CB  . GLN B 1 95  ? 1.794   41.637  15.158  1.00 40.80 ? 95  GLN B CB  1 
ATOM   2381 C  CG  . GLN B 1 95  ? 1.634   41.158  16.601  1.00 43.92 ? 95  GLN B CG  1 
ATOM   2382 C  CD  . GLN B 1 95  ? 0.321   40.436  16.847  1.00 47.67 ? 95  GLN B CD  1 
ATOM   2383 O  OE1 . GLN B 1 95  ? -0.756  40.950  16.532  1.00 50.16 ? 95  GLN B OE1 1 
ATOM   2384 N  NE2 . GLN B 1 95  ? 0.403   39.237  17.419  1.00 47.58 ? 95  GLN B NE2 1 
ATOM   2385 N  N   . GLY B 1 96  ? 2.880   44.226  15.859  1.00 38.30 ? 96  GLY B N   1 
ATOM   2386 C  CA  . GLY B 1 96  ? 3.166   45.304  16.786  1.00 36.98 ? 96  GLY B CA  1 
ATOM   2387 C  C   . GLY B 1 96  ? 4.445   46.078  16.546  1.00 37.67 ? 96  GLY B C   1 
ATOM   2388 O  O   . GLY B 1 96  ? 4.925   46.184  15.416  1.00 37.27 ? 96  GLY B O   1 
ATOM   2389 N  N   . ASP B 1 97  ? 4.993   46.625  17.628  1.00 37.56 ? 97  ASP B N   1 
ATOM   2390 C  CA  . ASP B 1 97  ? 6.218   47.415  17.576  1.00 38.28 ? 97  ASP B CA  1 
ATOM   2391 C  C   . ASP B 1 97  ? 7.427   46.659  17.031  1.00 38.31 ? 97  ASP B C   1 
ATOM   2392 O  O   . ASP B 1 97  ? 8.261   47.236  16.329  1.00 38.98 ? 97  ASP B O   1 
ATOM   2393 C  CB  . ASP B 1 97  ? 6.559   47.950  18.971  1.00 38.87 ? 97  ASP B CB  1 
ATOM   2394 C  CG  . ASP B 1 97  ? 5.570   48.994  19.457  1.00 40.24 ? 97  ASP B CG  1 
ATOM   2395 O  OD1 . ASP B 1 97  ? 5.354   49.992  18.734  1.00 40.46 ? 97  ASP B OD1 1 
ATOM   2396 O  OD2 . ASP B 1 97  ? 5.017   48.823  20.564  1.00 40.56 ? 97  ASP B OD2 1 
ATOM   2397 N  N   . LEU B 1 98  ? 7.534   45.376  17.364  1.00 36.62 ? 98  LEU B N   1 
ATOM   2398 C  CA  . LEU B 1 98  ? 8.662   44.582  16.896  1.00 35.76 ? 98  LEU B CA  1 
ATOM   2399 C  C   . LEU B 1 98  ? 8.635   44.473  15.378  1.00 35.42 ? 98  LEU B C   1 
ATOM   2400 O  O   . LEU B 1 98  ? 9.660   44.646  14.720  1.00 35.33 ? 98  LEU B O   1 
ATOM   2401 C  CB  . LEU B 1 98  ? 8.648   43.182  17.527  1.00 34.56 ? 98  LEU B CB  1 
ATOM   2402 C  CG  . LEU B 1 98  ? 9.781   42.225  17.124  1.00 33.34 ? 98  LEU B CG  1 
ATOM   2403 C  CD1 . LEU B 1 98  ? 11.144  42.879  17.360  1.00 31.71 ? 98  LEU B CD1 1 
ATOM   2404 C  CD2 . LEU B 1 98  ? 9.658   40.936  17.923  1.00 31.86 ? 98  LEU B CD2 1 
ATOM   2405 N  N   . LYS B 1 99  ? 7.459   44.192  14.823  1.00 35.96 ? 99  LYS B N   1 
ATOM   2406 C  CA  . LYS B 1 99  ? 7.313   44.072  13.375  1.00 36.65 ? 99  LYS B CA  1 
ATOM   2407 C  C   . LYS B 1 99  ? 7.691   45.393  12.707  1.00 36.39 ? 99  LYS B C   1 
ATOM   2408 O  O   . LYS B 1 99  ? 8.297   45.412  11.638  1.00 37.13 ? 99  LYS B O   1 
ATOM   2409 C  CB  . LYS B 1 99  ? 5.871   43.700  13.010  1.00 37.53 ? 99  LYS B CB  1 
ATOM   2410 C  CG  . LYS B 1 99  ? 5.643   43.432  11.521  1.00 39.38 ? 99  LYS B CG  1 
ATOM   2411 C  CD  . LYS B 1 99  ? 4.238   42.889  11.269  1.00 41.90 ? 99  LYS B CD  1 
ATOM   2412 C  CE  . LYS B 1 99  ? 4.030   42.493  9.812   1.00 43.29 ? 99  LYS B CE  1 
ATOM   2413 N  NZ  . LYS B 1 99  ? 4.218   43.638  8.874   1.00 45.76 ? 99  LYS B NZ  1 
ATOM   2414 N  N   . ALA B 1 100 ? 7.334   46.495  13.355  1.00 35.78 ? 100 ALA B N   1 
ATOM   2415 C  CA  . ALA B 1 100 ? 7.630   47.823  12.835  1.00 35.78 ? 100 ALA B CA  1 
ATOM   2416 C  C   . ALA B 1 100 ? 9.132   48.088  12.841  1.00 34.94 ? 100 ALA B C   1 
ATOM   2417 O  O   . ALA B 1 100 ? 9.689   48.589  11.862  1.00 33.65 ? 100 ALA B O   1 
ATOM   2418 C  CB  . ALA B 1 100 ? 6.913   48.878  13.676  1.00 35.04 ? 100 ALA B CB  1 
ATOM   2419 N  N   . ALA B 1 101 ? 9.778   47.752  13.955  1.00 34.33 ? 101 ALA B N   1 
ATOM   2420 C  CA  . ALA B 1 101 ? 11.218  47.959  14.100  1.00 33.89 ? 101 ALA B CA  1 
ATOM   2421 C  C   . ALA B 1 101 ? 12.001  47.122  13.091  1.00 33.04 ? 101 ALA B C   1 
ATOM   2422 O  O   . ALA B 1 101 ? 13.028  47.562  12.573  1.00 33.35 ? 101 ALA B O   1 
ATOM   2423 C  CB  . ALA B 1 101 ? 11.664  47.619  15.524  1.00 32.87 ? 101 ALA B CB  1 
ATOM   2424 N  N   . ILE B 1 102 ? 11.511  45.919  12.813  1.00 31.95 ? 102 ILE B N   1 
ATOM   2425 C  CA  . ILE B 1 102 ? 12.167  45.039  11.858  1.00 32.83 ? 102 ILE B CA  1 
ATOM   2426 C  C   . ILE B 1 102 ? 12.103  45.623  10.443  1.00 34.01 ? 102 ILE B C   1 
ATOM   2427 O  O   . ILE B 1 102 ? 13.111  45.657  9.731   1.00 32.77 ? 102 ILE B O   1 
ATOM   2428 C  CB  . ILE B 1 102 ? 11.528  43.629  11.889  1.00 31.39 ? 102 ILE B CB  1 
ATOM   2429 C  CG1 . ILE B 1 102 ? 12.012  42.881  13.137  1.00 29.98 ? 102 ILE B CG1 1 
ATOM   2430 C  CG2 . ILE B 1 102 ? 11.866  42.864  10.621  1.00 30.87 ? 102 ILE B CG2 1 
ATOM   2431 C  CD1 . ILE B 1 102 ? 11.435  41.500  13.290  1.00 29.04 ? 102 ILE B CD1 1 
ATOM   2432 N  N   . GLU B 1 103 ? 10.922  46.092  10.044  1.00 34.28 ? 103 GLU B N   1 
ATOM   2433 C  CA  . GLU B 1 103 ? 10.749  46.683  8.721   1.00 35.71 ? 103 GLU B CA  1 
ATOM   2434 C  C   . GLU B 1 103 ? 11.562  47.966  8.623   1.00 34.91 ? 103 GLU B C   1 
ATOM   2435 O  O   . GLU B 1 103 ? 12.054  48.327  7.558   1.00 35.28 ? 103 GLU B O   1 
ATOM   2436 C  CB  . GLU B 1 103 ? 9.276   46.992  8.463   1.00 36.69 ? 103 GLU B CB  1 
ATOM   2437 C  CG  . GLU B 1 103 ? 8.376   45.788  8.581   1.00 40.26 ? 103 GLU B CG  1 
ATOM   2438 C  CD  . GLU B 1 103 ? 6.934   46.114  8.274   1.00 43.44 ? 103 GLU B CD  1 
ATOM   2439 O  OE1 . GLU B 1 103 ? 6.422   47.113  8.824   1.00 44.77 ? 103 GLU B OE1 1 
ATOM   2440 O  OE2 . GLU B 1 103 ? 6.309   45.367  7.489   1.00 45.83 ? 103 GLU B OE2 1 
ATOM   2441 N  N   . ARG B 1 104 ? 11.708  48.645  9.751   1.00 35.23 ? 104 ARG B N   1 
ATOM   2442 C  CA  . ARG B 1 104 ? 12.462  49.888  9.804   1.00 36.78 ? 104 ARG B CA  1 
ATOM   2443 C  C   . ARG B 1 104 ? 13.960  49.669  9.599   1.00 36.63 ? 104 ARG B C   1 
ATOM   2444 O  O   . ARG B 1 104 ? 14.597  50.369  8.813   1.00 37.39 ? 104 ARG B O   1 
ATOM   2445 C  CB  . ARG B 1 104 ? 12.237  50.574  11.152  1.00 35.68 ? 104 ARG B CB  1 
ATOM   2446 C  CG  . ARG B 1 104 ? 12.965  51.895  11.295  1.00 38.96 ? 104 ARG B CG  1 
ATOM   2447 C  CD  . ARG B 1 104 ? 13.012  52.327  12.742  1.00 41.04 ? 104 ARG B CD  1 
ATOM   2448 N  NE  . ARG B 1 104 ? 13.695  51.327  13.552  1.00 45.28 ? 104 ARG B NE  1 
ATOM   2449 C  CZ  . ARG B 1 104 ? 14.004  51.483  14.834  1.00 47.08 ? 104 ARG B CZ  1 
ATOM   2450 N  NH1 . ARG B 1 104 ? 13.688  52.611  15.456  1.00 48.59 ? 104 ARG B NH1 1 
ATOM   2451 N  NH2 . ARG B 1 104 ? 14.630  50.513  15.491  1.00 46.89 ? 104 ARG B NH2 1 
ATOM   2452 N  N   . ASP B 1 105 ? 14.518  48.695  10.309  1.00 37.25 ? 105 ASP B N   1 
ATOM   2453 C  CA  . ASP B 1 105 ? 15.946  48.424  10.221  1.00 36.49 ? 105 ASP B CA  1 
ATOM   2454 C  C   . ASP B 1 105 ? 16.375  47.446  9.126   1.00 35.45 ? 105 ASP B C   1 
ATOM   2455 O  O   . ASP B 1 105 ? 17.550  47.405  8.765   1.00 36.13 ? 105 ASP B O   1 
ATOM   2456 C  CB  . ASP B 1 105 ? 16.463  47.943  11.584  1.00 37.95 ? 105 ASP B CB  1 
ATOM   2457 C  CG  . ASP B 1 105 ? 16.251  48.974  12.690  1.00 39.75 ? 105 ASP B CG  1 
ATOM   2458 O  OD1 . ASP B 1 105 ? 16.468  50.180  12.434  1.00 42.00 ? 105 ASP B OD1 1 
ATOM   2459 O  OD2 . ASP B 1 105 ? 15.882  48.584  13.817  1.00 38.22 ? 105 ASP B OD2 1 
ATOM   2460 N  N   . PHE B 1 106 ? 15.437  46.676  8.584   1.00 34.16 ? 106 PHE B N   1 
ATOM   2461 C  CA  . PHE B 1 106 ? 15.774  45.708  7.543   1.00 34.43 ? 106 PHE B CA  1 
ATOM   2462 C  C   . PHE B 1 106 ? 15.045  45.938  6.221   1.00 35.25 ? 106 PHE B C   1 
ATOM   2463 O  O   . PHE B 1 106 ? 15.334  45.275  5.224   1.00 34.88 ? 106 PHE B O   1 
ATOM   2464 C  CB  . PHE B 1 106 ? 15.492  44.291  8.051   1.00 34.08 ? 106 PHE B CB  1 
ATOM   2465 C  CG  . PHE B 1 106 ? 16.361  43.880  9.208   1.00 34.32 ? 106 PHE B CG  1 
ATOM   2466 C  CD1 . PHE B 1 106 ? 17.670  43.463  8.998   1.00 33.30 ? 106 PHE B CD1 1 
ATOM   2467 C  CD2 . PHE B 1 106 ? 15.877  43.932  10.512  1.00 34.97 ? 106 PHE B CD2 1 
ATOM   2468 C  CE1 . PHE B 1 106 ? 18.484  43.103  10.066  1.00 33.70 ? 106 PHE B CE1 1 
ATOM   2469 C  CE2 . PHE B 1 106 ? 16.686  43.574  11.591  1.00 34.37 ? 106 PHE B CE2 1 
ATOM   2470 C  CZ  . PHE B 1 106 ? 17.991  43.159  11.366  1.00 34.76 ? 106 PHE B CZ  1 
ATOM   2471 N  N   . GLY B 1 107 ? 14.106  46.878  6.210   1.00 36.49 ? 107 GLY B N   1 
ATOM   2472 C  CA  . GLY B 1 107 ? 13.362  47.159  4.993   1.00 36.00 ? 107 GLY B CA  1 
ATOM   2473 C  C   . GLY B 1 107 ? 12.047  46.407  4.958   1.00 36.86 ? 107 GLY B C   1 
ATOM   2474 O  O   . GLY B 1 107 ? 11.012  46.964  4.599   1.00 38.58 ? 107 GLY B O   1 
ATOM   2475 N  N   . SER B 1 108 ? 12.087  45.133  5.328   1.00 36.40 ? 108 SER B N   1 
ATOM   2476 C  CA  . SER B 1 108 ? 10.888  44.310  5.354   1.00 36.62 ? 108 SER B CA  1 
ATOM   2477 C  C   . SER B 1 108 ? 11.170  43.032  6.130   1.00 37.72 ? 108 SER B C   1 
ATOM   2478 O  O   . SER B 1 108 ? 12.324  42.712  6.413   1.00 37.95 ? 108 SER B O   1 
ATOM   2479 C  CB  . SER B 1 108 ? 10.437  43.960  3.935   1.00 36.25 ? 108 SER B CB  1 
ATOM   2480 O  OG  . SER B 1 108 ? 11.351  43.083  3.302   1.00 35.64 ? 108 SER B OG  1 
ATOM   2481 N  N   . VAL B 1 109 ? 10.109  42.310  6.476   1.00 37.85 ? 109 VAL B N   1 
ATOM   2482 C  CA  . VAL B 1 109 ? 10.242  41.064  7.213   1.00 37.47 ? 109 VAL B CA  1 
ATOM   2483 C  C   . VAL B 1 109 ? 11.036  40.051  6.394   1.00 38.54 ? 109 VAL B C   1 
ATOM   2484 O  O   . VAL B 1 109 ? 11.853  39.305  6.935   1.00 38.20 ? 109 VAL B O   1 
ATOM   2485 C  CB  . VAL B 1 109 ? 8.855   40.477  7.551   1.00 37.21 ? 109 VAL B CB  1 
ATOM   2486 C  CG1 . VAL B 1 109 ? 8.995   39.060  8.093   1.00 36.62 ? 109 VAL B CG1 1 
ATOM   2487 C  CG2 . VAL B 1 109 ? 8.162   41.365  8.580   1.00 37.35 ? 109 VAL B CG2 1 
ATOM   2488 N  N   . ASP B 1 110 ? 10.801  40.039  5.086   1.00 38.34 ? 110 ASP B N   1 
ATOM   2489 C  CA  . ASP B 1 110 ? 11.492  39.117  4.200   1.00 38.51 ? 110 ASP B CA  1 
ATOM   2490 C  C   . ASP B 1 110 ? 12.996  39.374  4.142   1.00 37.32 ? 110 ASP B C   1 
ATOM   2491 O  O   . ASP B 1 110 ? 13.787  38.432  4.124   1.00 36.20 ? 110 ASP B O   1 
ATOM   2492 C  CB  . ASP B 1 110 ? 10.875  39.192  2.808   1.00 40.59 ? 110 ASP B CB  1 
ATOM   2493 C  CG  . ASP B 1 110 ? 9.425   38.749  2.800   1.00 44.54 ? 110 ASP B CG  1 
ATOM   2494 O  OD1 . ASP B 1 110 ? 9.160   37.589  3.190   1.00 45.59 ? 110 ASP B OD1 1 
ATOM   2495 O  OD2 . ASP B 1 110 ? 8.551   39.556  2.412   1.00 47.15 ? 110 ASP B OD2 1 
ATOM   2496 N  N   . ASN B 1 111 ? 13.393  40.643  4.112   1.00 37.05 ? 111 ASN B N   1 
ATOM   2497 C  CA  . ASN B 1 111 ? 14.815  40.973  4.081   1.00 36.85 ? 111 ASN B CA  1 
ATOM   2498 C  C   . ASN B 1 111 ? 15.443  40.483  5.376   1.00 35.23 ? 111 ASN B C   1 
ATOM   2499 O  O   . ASN B 1 111 ? 16.539  39.921  5.374   1.00 34.19 ? 111 ASN B O   1 
ATOM   2500 C  CB  . ASN B 1 111 ? 15.038  42.482  3.953   1.00 40.85 ? 111 ASN B CB  1 
ATOM   2501 C  CG  . ASN B 1 111 ? 14.582  43.032  2.615   1.00 45.61 ? 111 ASN B CG  1 
ATOM   2502 O  OD1 . ASN B 1 111 ? 14.931  42.499  1.559   1.00 47.19 ? 111 ASN B OD1 1 
ATOM   2503 N  ND2 . ASN B 1 111 ? 13.805  44.113  2.651   1.00 48.69 ? 111 ASN B ND2 1 
ATOM   2504 N  N   . PHE B 1 112 ? 14.738  40.702  6.484   1.00 32.70 ? 112 PHE B N   1 
ATOM   2505 C  CA  . PHE B 1 112 ? 15.222  40.271  7.783   1.00 30.08 ? 112 PHE B CA  1 
ATOM   2506 C  C   . PHE B 1 112 ? 15.444  38.758  7.797   1.00 28.90 ? 112 PHE B C   1 
ATOM   2507 O  O   . PHE B 1 112 ? 16.515  38.290  8.183   1.00 27.51 ? 112 PHE B O   1 
ATOM   2508 C  CB  . PHE B 1 112 ? 14.230  40.642  8.884   1.00 29.14 ? 112 PHE B CB  1 
ATOM   2509 C  CG  . PHE B 1 112 ? 14.447  39.881  10.151  1.00 27.98 ? 112 PHE B CG  1 
ATOM   2510 C  CD1 . PHE B 1 112 ? 15.621  40.045  10.878  1.00 27.29 ? 112 PHE B CD1 1 
ATOM   2511 C  CD2 . PHE B 1 112 ? 13.517  38.938  10.575  1.00 27.27 ? 112 PHE B CD2 1 
ATOM   2512 C  CE1 . PHE B 1 112 ? 15.869  39.274  12.009  1.00 28.70 ? 112 PHE B CE1 1 
ATOM   2513 C  CE2 . PHE B 1 112 ? 13.755  38.161  11.704  1.00 27.68 ? 112 PHE B CE2 1 
ATOM   2514 C  CZ  . PHE B 1 112 ? 14.931  38.327  12.422  1.00 27.95 ? 112 PHE B CZ  1 
ATOM   2515 N  N   . LYS B 1 113 ? 14.429  38.003  7.385   1.00 27.15 ? 113 LYS B N   1 
ATOM   2516 C  CA  . LYS B 1 113 ? 14.526  36.550  7.355   1.00 27.61 ? 113 LYS B CA  1 
ATOM   2517 C  C   . LYS B 1 113 ? 15.721  36.085  6.526   1.00 28.27 ? 113 LYS B C   1 
ATOM   2518 O  O   . LYS B 1 113 ? 16.457  35.183  6.934   1.00 28.70 ? 113 LYS B O   1 
ATOM   2519 C  CB  . LYS B 1 113 ? 13.247  35.934  6.784   1.00 28.49 ? 113 LYS B CB  1 
ATOM   2520 C  CG  . LYS B 1 113 ? 12.072  35.906  7.742   1.00 30.91 ? 113 LYS B CG  1 
ATOM   2521 C  CD  . LYS B 1 113 ? 10.945  35.064  7.168   1.00 34.05 ? 113 LYS B CD  1 
ATOM   2522 C  CE  . LYS B 1 113 ? 9.823   34.854  8.175   1.00 37.33 ? 113 LYS B CE  1 
ATOM   2523 N  NZ  . LYS B 1 113 ? 8.750   33.969  7.630   1.00 37.64 ? 113 LYS B NZ  1 
ATOM   2524 N  N   . ALA B 1 114 ? 15.904  36.698  5.360   1.00 26.49 ? 114 ALA B N   1 
ATOM   2525 C  CA  . ALA B 1 114 ? 17.010  36.345  4.478   1.00 26.18 ? 114 ALA B CA  1 
ATOM   2526 C  C   . ALA B 1 114 ? 18.343  36.613  5.165   1.00 25.90 ? 114 ALA B C   1 
ATOM   2527 O  O   . ALA B 1 114 ? 19.271  35.813  5.073   1.00 26.67 ? 114 ALA B O   1 
ATOM   2528 C  CB  . ALA B 1 114 ? 16.922  37.146  3.181   1.00 24.31 ? 114 ALA B CB  1 
ATOM   2529 N  N   . GLU B 1 115 ? 18.429  37.748  5.851   1.00 26.24 ? 115 GLU B N   1 
ATOM   2530 C  CA  . GLU B 1 115 ? 19.651  38.135  6.552   1.00 28.17 ? 115 GLU B CA  1 
ATOM   2531 C  C   . GLU B 1 115 ? 19.950  37.158  7.698   1.00 26.91 ? 115 GLU B C   1 
ATOM   2532 O  O   . GLU B 1 115 ? 21.099  36.764  7.914   1.00 25.55 ? 115 GLU B O   1 
ATOM   2533 C  CB  . GLU B 1 115 ? 19.503  39.557  7.107   1.00 31.85 ? 115 GLU B CB  1 
ATOM   2534 C  CG  . GLU B 1 115 ? 20.790  40.355  7.119   1.00 40.69 ? 115 GLU B CG  1 
ATOM   2535 C  CD  . GLU B 1 115 ? 21.370  40.513  5.721   1.00 46.04 ? 115 GLU B CD  1 
ATOM   2536 O  OE1 . GLU B 1 115 ? 20.655  41.037  4.837   1.00 49.57 ? 115 GLU B OE1 1 
ATOM   2537 O  OE2 . GLU B 1 115 ? 22.535  40.114  5.502   1.00 48.66 ? 115 GLU B OE2 1 
ATOM   2538 N  N   . PHE B 1 116 ? 18.905  36.770  8.425   1.00 25.16 ? 116 PHE B N   1 
ATOM   2539 C  CA  . PHE B 1 116 ? 19.036  35.848  9.548   1.00 23.97 ? 116 PHE B CA  1 
ATOM   2540 C  C   . PHE B 1 116 ? 19.466  34.469  9.052   1.00 22.94 ? 116 PHE B C   1 
ATOM   2541 O  O   . PHE B 1 116 ? 20.357  33.844  9.623   1.00 22.53 ? 116 PHE B O   1 
ATOM   2542 C  CB  . PHE B 1 116 ? 17.704  35.728  10.292  1.00 23.47 ? 116 PHE B CB  1 
ATOM   2543 C  CG  . PHE B 1 116 ? 17.805  34.990  11.596  1.00 23.59 ? 116 PHE B CG  1 
ATOM   2544 C  CD1 . PHE B 1 116 ? 18.264  35.638  12.741  1.00 22.97 ? 116 PHE B CD1 1 
ATOM   2545 C  CD2 . PHE B 1 116 ? 17.463  33.642  11.677  1.00 21.89 ? 116 PHE B CD2 1 
ATOM   2546 C  CE1 . PHE B 1 116 ? 18.381  34.954  13.949  1.00 23.10 ? 116 PHE B CE1 1 
ATOM   2547 C  CE2 . PHE B 1 116 ? 17.577  32.948  12.878  1.00 22.76 ? 116 PHE B CE2 1 
ATOM   2548 C  CZ  . PHE B 1 116 ? 18.037  33.604  14.018  1.00 22.71 ? 116 PHE B CZ  1 
ATOM   2549 N  N   . GLU B 1 117 ? 18.821  34.002  7.988   1.00 23.15 ? 117 GLU B N   1 
ATOM   2550 C  CA  . GLU B 1 117 ? 19.136  32.703  7.403   1.00 24.20 ? 117 GLU B CA  1 
ATOM   2551 C  C   . GLU B 1 117 ? 20.587  32.648  6.933   1.00 23.54 ? 117 GLU B C   1 
ATOM   2552 O  O   . GLU B 1 117 ? 21.277  31.644  7.114   1.00 21.76 ? 117 GLU B O   1 
ATOM   2553 C  CB  . GLU B 1 117 ? 18.190  32.415  6.230   1.00 25.76 ? 117 GLU B CB  1 
ATOM   2554 C  CG  . GLU B 1 117 ? 16.768  32.086  6.668   1.00 30.54 ? 117 GLU B CG  1 
ATOM   2555 C  CD  . GLU B 1 117 ? 15.839  31.768  5.512   1.00 32.63 ? 117 GLU B CD  1 
ATOM   2556 O  OE1 . GLU B 1 117 ? 16.249  31.021  4.600   1.00 36.43 ? 117 GLU B OE1 1 
ATOM   2557 O  OE2 . GLU B 1 117 ? 14.690  32.252  5.523   1.00 34.08 ? 117 GLU B OE2 1 
ATOM   2558 N  N   . LYS B 1 118 ? 21.045  33.740  6.336   1.00 23.53 ? 118 LYS B N   1 
ATOM   2559 C  CA  . LYS B 1 118 ? 22.410  33.826  5.842   1.00 23.88 ? 118 LYS B CA  1 
ATOM   2560 C  C   . LYS B 1 118 ? 23.402  33.720  7.002   1.00 21.23 ? 118 LYS B C   1 
ATOM   2561 O  O   . LYS B 1 118 ? 24.380  32.978  6.929   1.00 20.86 ? 118 LYS B O   1 
ATOM   2562 C  CB  . LYS B 1 118 ? 22.598  35.148  5.099   1.00 27.30 ? 118 LYS B CB  1 
ATOM   2563 C  CG  . LYS B 1 118 ? 23.864  35.238  4.271   1.00 33.33 ? 118 LYS B CG  1 
ATOM   2564 C  CD  . LYS B 1 118 ? 23.951  36.589  3.571   1.00 38.84 ? 118 LYS B CD  1 
ATOM   2565 C  CE  . LYS B 1 118 ? 22.741  36.827  2.670   1.00 40.78 ? 118 LYS B CE  1 
ATOM   2566 N  NZ  . LYS B 1 118 ? 22.711  38.227  2.160   1.00 42.99 ? 118 LYS B NZ  1 
ATOM   2567 N  N   . ALA B 1 119 ? 23.145  34.458  8.074   1.00 19.67 ? 119 ALA B N   1 
ATOM   2568 C  CA  . ALA B 1 119 ? 24.025  34.428  9.234   1.00 19.32 ? 119 ALA B CA  1 
ATOM   2569 C  C   . ALA B 1 119 ? 24.042  33.036  9.868   1.00 19.79 ? 119 ALA B C   1 
ATOM   2570 O  O   . ALA B 1 119 ? 25.101  32.533  10.247  1.00 19.63 ? 119 ALA B O   1 
ATOM   2571 C  CB  . ALA B 1 119 ? 23.581  35.466  10.258  1.00 19.38 ? 119 ALA B CB  1 
ATOM   2572 N  N   . ALA B 1 120 ? 22.867  32.417  9.971   1.00 17.42 ? 120 ALA B N   1 
ATOM   2573 C  CA  . ALA B 1 120 ? 22.741  31.090  10.560  1.00 17.43 ? 120 ALA B CA  1 
ATOM   2574 C  C   . ALA B 1 120 ? 23.416  30.014  9.711   1.00 19.31 ? 120 ALA B C   1 
ATOM   2575 O  O   . ALA B 1 120 ? 24.046  29.095  10.237  1.00 19.43 ? 120 ALA B O   1 
ATOM   2576 C  CB  . ALA B 1 120 ? 21.264  30.742  10.754  1.00 14.32 ? 120 ALA B CB  1 
ATOM   2577 N  N   . ALA B 1 121 ? 23.278  30.123  8.396   1.00 19.80 ? 121 ALA B N   1 
ATOM   2578 C  CA  . ALA B 1 121 ? 23.869  29.143  7.502   1.00 20.04 ? 121 ALA B CA  1 
ATOM   2579 C  C   . ALA B 1 121 ? 25.373  29.318  7.333   1.00 20.21 ? 121 ALA B C   1 
ATOM   2580 O  O   . ALA B 1 121 ? 26.081  28.340  7.136   1.00 21.08 ? 121 ALA B O   1 
ATOM   2581 C  CB  . ALA B 1 121 ? 23.185  29.195  6.143   1.00 20.27 ? 121 ALA B CB  1 
ATOM   2582 N  N   . SER B 1 122 ? 25.867  30.549  7.425   1.00 20.45 ? 122 SER B N   1 
ATOM   2583 C  CA  . SER B 1 122 ? 27.294  30.787  7.246   1.00 20.71 ? 122 SER B CA  1 
ATOM   2584 C  C   . SER B 1 122 ? 28.144  30.618  8.509   1.00 21.15 ? 122 SER B C   1 
ATOM   2585 O  O   . SER B 1 122 ? 29.369  30.712  8.450   1.00 22.93 ? 122 SER B O   1 
ATOM   2586 C  CB  . SER B 1 122 ? 27.532  32.173  6.625   1.00 22.88 ? 122 SER B CB  1 
ATOM   2587 O  OG  . SER B 1 122 ? 27.109  33.220  7.479   1.00 27.50 ? 122 SER B OG  1 
ATOM   2588 N  N   . ARG B 1 123 ? 27.509  30.376  9.650   1.00 20.10 ? 123 ARG B N   1 
ATOM   2589 C  CA  . ARG B 1 123 ? 28.262  30.159  10.883  1.00 18.71 ? 123 ARG B CA  1 
ATOM   2590 C  C   . ARG B 1 123 ? 28.917  28.781  10.742  1.00 18.12 ? 123 ARG B C   1 
ATOM   2591 O  O   . ARG B 1 123 ? 28.246  27.752  10.811  1.00 17.08 ? 123 ARG B O   1 
ATOM   2592 C  CB  . ARG B 1 123 ? 27.322  30.205  12.094  1.00 16.62 ? 123 ARG B CB  1 
ATOM   2593 C  CG  . ARG B 1 123 ? 27.888  29.615  13.383  1.00 17.40 ? 123 ARG B CG  1 
ATOM   2594 C  CD  . ARG B 1 123 ? 29.282  30.133  13.718  1.00 17.85 ? 123 ARG B CD  1 
ATOM   2595 N  NE  . ARG B 1 123 ? 29.333  31.581  13.879  1.00 15.66 ? 123 ARG B NE  1 
ATOM   2596 C  CZ  . ARG B 1 123 ? 30.431  32.244  14.220  1.00 17.29 ? 123 ARG B CZ  1 
ATOM   2597 N  NH1 . ARG B 1 123 ? 31.562  31.584  14.435  1.00 18.27 ? 123 ARG B NH1 1 
ATOM   2598 N  NH2 . ARG B 1 123 ? 30.404  33.562  14.347  1.00 17.99 ? 123 ARG B NH2 1 
ATOM   2599 N  N   . PHE B 1 124 ? 30.227  28.775  10.520  1.00 16.62 ? 124 PHE B N   1 
ATOM   2600 C  CA  . PHE B 1 124 ? 30.986  27.539  10.327  1.00 15.06 ? 124 PHE B CA  1 
ATOM   2601 C  C   . PHE B 1 124 ? 31.326  26.869  11.655  1.00 13.76 ? 124 PHE B C   1 
ATOM   2602 O  O   . PHE B 1 124 ? 31.888  27.493  12.549  1.00 14.27 ? 124 PHE B O   1 
ATOM   2603 C  CB  . PHE B 1 124 ? 32.276  27.844  9.558   1.00 14.12 ? 124 PHE B CB  1 
ATOM   2604 C  CG  . PHE B 1 124 ? 32.962  26.622  9.014   1.00 13.94 ? 124 PHE B CG  1 
ATOM   2605 C  CD1 . PHE B 1 124 ? 32.410  25.919  7.947   1.00 13.11 ? 124 PHE B CD1 1 
ATOM   2606 C  CD2 . PHE B 1 124 ? 34.152  26.167  9.577   1.00 11.71 ? 124 PHE B CD2 1 
ATOM   2607 C  CE1 . PHE B 1 124 ? 33.033  24.776  7.448   1.00 15.15 ? 124 PHE B CE1 1 
ATOM   2608 C  CE2 . PHE B 1 124 ? 34.784  25.024  9.087   1.00 13.38 ? 124 PHE B CE2 1 
ATOM   2609 C  CZ  . PHE B 1 124 ? 34.226  24.327  8.022   1.00 13.17 ? 124 PHE B CZ  1 
ATOM   2610 N  N   . GLY B 1 125 ? 31.003  25.588  11.772  1.00 13.39 ? 125 GLY B N   1 
ATOM   2611 C  CA  . GLY B 1 125 ? 31.262  24.884  13.012  1.00 13.06 ? 125 GLY B CA  1 
ATOM   2612 C  C   . GLY B 1 125 ? 30.067  25.058  13.935  1.00 13.56 ? 125 GLY B C   1 
ATOM   2613 O  O   . GLY B 1 125 ? 28.943  25.223  13.466  1.00 14.31 ? 125 GLY B O   1 
ATOM   2614 N  N   . SER B 1 126 ? 30.305  25.034  15.243  1.00 13.56 ? 126 SER B N   1 
ATOM   2615 C  CA  . SER B 1 126 ? 29.242  25.186  16.232  1.00 13.26 ? 126 SER B CA  1 
ATOM   2616 C  C   . SER B 1 126 ? 28.991  26.653  16.568  1.00 13.91 ? 126 SER B C   1 
ATOM   2617 O  O   . SER B 1 126 ? 29.930  27.448  16.634  1.00 14.30 ? 126 SER B O   1 
ATOM   2618 C  CB  . SER B 1 126 ? 29.628  24.442  17.509  1.00 11.97 ? 126 SER B CB  1 
ATOM   2619 O  OG  . SER B 1 126 ? 30.134  23.160  17.197  1.00 9.95  ? 126 SER B OG  1 
ATOM   2620 N  N   . GLY B 1 127 ? 27.730  27.010  16.794  1.00 14.75 ? 127 GLY B N   1 
ATOM   2621 C  CA  . GLY B 1 127 ? 27.424  28.389  17.129  1.00 15.29 ? 127 GLY B CA  1 
ATOM   2622 C  C   . GLY B 1 127 ? 25.950  28.743  17.214  1.00 16.50 ? 127 GLY B C   1 
ATOM   2623 O  O   . GLY B 1 127 ? 25.077  27.867  17.229  1.00 16.23 ? 127 GLY B O   1 
ATOM   2624 N  N   . TRP B 1 128 ? 25.686  30.048  17.262  1.00 15.26 ? 128 TRP B N   1 
ATOM   2625 C  CA  . TRP B 1 128 ? 24.337  30.589  17.358  1.00 15.54 ? 128 TRP B CA  1 
ATOM   2626 C  C   . TRP B 1 128 ? 24.151  31.787  16.431  1.00 15.33 ? 128 TRP B C   1 
ATOM   2627 O  O   . TRP B 1 128 ? 25.106  32.498  16.115  1.00 15.86 ? 128 TRP B O   1 
ATOM   2628 C  CB  . TRP B 1 128 ? 24.051  31.063  18.788  1.00 16.47 ? 128 TRP B CB  1 
ATOM   2629 C  CG  . TRP B 1 128 ? 23.950  29.983  19.824  1.00 17.18 ? 128 TRP B CG  1 
ATOM   2630 C  CD1 . TRP B 1 128 ? 24.976  29.274  20.379  1.00 16.49 ? 128 TRP B CD1 1 
ATOM   2631 C  CD2 . TRP B 1 128 ? 22.747  29.494  20.436  1.00 17.01 ? 128 TRP B CD2 1 
ATOM   2632 N  NE1 . TRP B 1 128 ? 24.489  28.374  21.300  1.00 17.34 ? 128 TRP B NE1 1 
ATOM   2633 C  CE2 . TRP B 1 128 ? 23.124  28.487  21.352  1.00 16.93 ? 128 TRP B CE2 1 
ATOM   2634 C  CE3 . TRP B 1 128 ? 21.387  29.812  20.297  1.00 16.25 ? 128 TRP B CE3 1 
ATOM   2635 C  CZ2 . TRP B 1 128 ? 22.190  27.791  22.126  1.00 16.51 ? 128 TRP B CZ2 1 
ATOM   2636 C  CZ3 . TRP B 1 128 ? 20.458  29.120  21.068  1.00 16.60 ? 128 TRP B CZ3 1 
ATOM   2637 C  CH2 . TRP B 1 128 ? 20.866  28.119  21.971  1.00 17.13 ? 128 TRP B CH2 1 
ATOM   2638 N  N   . ALA B 1 129 ? 22.912  32.002  16.005  1.00 16.39 ? 129 ALA B N   1 
ATOM   2639 C  CA  . ALA B 1 129 ? 22.563  33.143  15.162  1.00 16.72 ? 129 ALA B CA  1 
ATOM   2640 C  C   . ALA B 1 129 ? 21.618  33.973  16.031  1.00 17.31 ? 129 ALA B C   1 
ATOM   2641 O  O   . ALA B 1 129 ? 20.710  33.422  16.661  1.00 16.41 ? 129 ALA B O   1 
ATOM   2642 C  CB  . ALA B 1 129 ? 21.854  32.677  13.902  1.00 14.97 ? 129 ALA B CB  1 
ATOM   2643 N  N   . TRP B 1 130 ? 21.825  35.286  16.075  1.00 18.87 ? 130 TRP B N   1 
ATOM   2644 C  CA  . TRP B 1 130 ? 20.981  36.138  16.905  1.00 19.29 ? 130 TRP B CA  1 
ATOM   2645 C  C   . TRP B 1 130 ? 20.396  37.375  16.248  1.00 20.31 ? 130 TRP B C   1 
ATOM   2646 O  O   . TRP B 1 130 ? 20.914  37.895  15.262  1.00 21.25 ? 130 TRP B O   1 
ATOM   2647 C  CB  . TRP B 1 130 ? 21.756  36.649  18.119  1.00 19.99 ? 130 TRP B CB  1 
ATOM   2648 C  CG  . TRP B 1 130 ? 22.578  35.650  18.844  1.00 20.90 ? 130 TRP B CG  1 
ATOM   2649 C  CD1 . TRP B 1 130 ? 23.855  35.274  18.554  1.00 21.62 ? 130 TRP B CD1 1 
ATOM   2650 C  CD2 . TRP B 1 130 ? 22.201  34.927  20.017  1.00 21.10 ? 130 TRP B CD2 1 
ATOM   2651 N  NE1 . TRP B 1 130 ? 24.303  34.362  19.480  1.00 21.46 ? 130 TRP B NE1 1 
ATOM   2652 C  CE2 . TRP B 1 130 ? 23.306  34.130  20.390  1.00 20.95 ? 130 TRP B CE2 1 
ATOM   2653 C  CE3 . TRP B 1 130 ? 21.035  34.874  20.793  1.00 19.83 ? 130 TRP B CE3 1 
ATOM   2654 C  CZ2 . TRP B 1 130 ? 23.282  33.291  21.506  1.00 19.25 ? 130 TRP B CZ2 1 
ATOM   2655 C  CZ3 . TRP B 1 130 ? 21.011  34.040  21.900  1.00 19.17 ? 130 TRP B CZ3 1 
ATOM   2656 C  CH2 . TRP B 1 130 ? 22.129  33.260  22.246  1.00 20.96 ? 130 TRP B CH2 1 
ATOM   2657 N  N   . LEU B 1 131 ? 19.300  37.838  16.837  1.00 22.38 ? 131 LEU B N   1 
ATOM   2658 C  CA  . LEU B 1 131 ? 18.656  39.079  16.443  1.00 22.50 ? 131 LEU B CA  1 
ATOM   2659 C  C   . LEU B 1 131 ? 18.885  39.850  17.735  1.00 22.73 ? 131 LEU B C   1 
ATOM   2660 O  O   . LEU B 1 131 ? 18.336  39.492  18.776  1.00 21.61 ? 131 LEU B O   1 
ATOM   2661 C  CB  . LEU B 1 131 ? 17.155  38.902  16.196  1.00 23.74 ? 131 LEU B CB  1 
ATOM   2662 C  CG  . LEU B 1 131 ? 16.351  40.217  16.177  1.00 25.32 ? 131 LEU B CG  1 
ATOM   2663 C  CD1 . LEU B 1 131 ? 16.962  41.211  15.194  1.00 24.30 ? 131 LEU B CD1 1 
ATOM   2664 C  CD2 . LEU B 1 131 ? 14.904  39.925  15.806  1.00 25.59 ? 131 LEU B CD2 1 
ATOM   2665 N  N   . VAL B 1 132 ? 19.732  40.871  17.682  1.00 24.69 ? 132 VAL B N   1 
ATOM   2666 C  CA  . VAL B 1 132 ? 20.035  41.660  18.871  1.00 26.31 ? 132 VAL B CA  1 
ATOM   2667 C  C   . VAL B 1 132 ? 19.601  43.117  18.745  1.00 28.65 ? 132 VAL B C   1 
ATOM   2668 O  O   . VAL B 1 132 ? 19.377  43.626  17.643  1.00 29.10 ? 132 VAL B O   1 
ATOM   2669 C  CB  . VAL B 1 132 ? 21.541  41.643  19.170  1.00 25.58 ? 132 VAL B CB  1 
ATOM   2670 C  CG1 . VAL B 1 132 ? 21.999  40.222  19.457  1.00 24.79 ? 132 VAL B CG1 1 
ATOM   2671 C  CG2 . VAL B 1 132 ? 22.306  42.224  17.985  1.00 23.16 ? 132 VAL B CG2 1 
ATOM   2672 N  N   . LEU B 1 133 ? 19.486  43.774  19.891  1.00 29.89 ? 133 LEU B N   1 
ATOM   2673 C  CA  . LEU B 1 133 ? 19.112  45.177  19.956  1.00 31.95 ? 133 LEU B CA  1 
ATOM   2674 C  C   . LEU B 1 133 ? 20.374  45.910  20.376  1.00 32.62 ? 133 LEU B C   1 
ATOM   2675 O  O   . LEU B 1 133 ? 20.818  45.791  21.513  1.00 32.74 ? 133 LEU B O   1 
ATOM   2676 C  CB  . LEU B 1 133 ? 18.007  45.380  21.001  1.00 31.90 ? 133 LEU B CB  1 
ATOM   2677 C  CG  . LEU B 1 133 ? 17.486  46.805  21.190  1.00 32.34 ? 133 LEU B CG  1 
ATOM   2678 C  CD1 . LEU B 1 133 ? 17.086  47.391  19.844  1.00 33.05 ? 133 LEU B CD1 1 
ATOM   2679 C  CD2 . LEU B 1 133 ? 16.304  46.790  22.148  1.00 33.14 ? 133 LEU B CD2 1 
ATOM   2680 N  N   . LYS B 1 134 ? 20.968  46.642  19.446  1.00 35.69 ? 134 LYS B N   1 
ATOM   2681 C  CA  . LYS B 1 134 ? 22.190  47.364  19.741  1.00 39.83 ? 134 LYS B CA  1 
ATOM   2682 C  C   . LYS B 1 134 ? 21.849  48.844  19.898  1.00 41.72 ? 134 LYS B C   1 
ATOM   2683 O  O   . LYS B 1 134 ? 21.907  49.621  18.942  1.00 42.09 ? 134 LYS B O   1 
ATOM   2684 C  CB  . LYS B 1 134 ? 23.195  47.136  18.608  1.00 41.92 ? 134 LYS B CB  1 
ATOM   2685 C  CG  . LYS B 1 134 ? 24.642  47.094  19.065  1.00 45.02 ? 134 LYS B CG  1 
ATOM   2686 C  CD  . LYS B 1 134 ? 25.563  46.651  17.943  1.00 46.14 ? 134 LYS B CD  1 
ATOM   2687 C  CE  . LYS B 1 134 ? 25.231  45.244  17.486  1.00 46.53 ? 134 LYS B CE  1 
ATOM   2688 N  NZ  . LYS B 1 134 ? 26.166  44.797  16.421  1.00 48.28 ? 134 LYS B NZ  1 
ATOM   2689 N  N   . GLY B 1 135 ? 21.485  49.221  21.120  1.00 43.58 ? 135 GLY B N   1 
ATOM   2690 C  CA  . GLY B 1 135 ? 21.106  50.594  21.384  1.00 45.33 ? 135 GLY B CA  1 
ATOM   2691 C  C   . GLY B 1 135 ? 19.651  50.768  20.996  1.00 46.95 ? 135 GLY B C   1 
ATOM   2692 O  O   . GLY B 1 135 ? 18.748  50.377  21.736  1.00 48.25 ? 135 GLY B O   1 
ATOM   2693 N  N   . ASP B 1 136 ? 19.419  51.338  19.820  1.00 48.08 ? 136 ASP B N   1 
ATOM   2694 C  CA  . ASP B 1 136 ? 18.060  51.551  19.342  1.00 49.40 ? 136 ASP B CA  1 
ATOM   2695 C  C   . ASP B 1 136 ? 17.798  50.877  17.996  1.00 48.01 ? 136 ASP B C   1 
ATOM   2696 O  O   . ASP B 1 136 ? 16.704  51.000  17.446  1.00 48.72 ? 136 ASP B O   1 
ATOM   2697 C  CB  . ASP B 1 136 ? 17.773  53.054  19.240  1.00 53.35 ? 136 ASP B CB  1 
ATOM   2698 C  CG  . ASP B 1 136 ? 18.963  53.842  18.713  1.00 56.48 ? 136 ASP B CG  1 
ATOM   2699 O  OD1 . ASP B 1 136 ? 19.469  53.505  17.620  1.00 58.16 ? 136 ASP B OD1 1 
ATOM   2700 O  OD2 . ASP B 1 136 ? 19.393  54.799  19.395  1.00 58.57 ? 136 ASP B OD2 1 
ATOM   2701 N  N   . LYS B 1 137 ? 18.797  50.168  17.469  1.00 45.58 ? 137 LYS B N   1 
ATOM   2702 C  CA  . LYS B 1 137 ? 18.657  49.474  16.189  1.00 43.20 ? 137 LYS B CA  1 
ATOM   2703 C  C   . LYS B 1 137 ? 18.822  47.965  16.302  1.00 40.07 ? 137 LYS B C   1 
ATOM   2704 O  O   . LYS B 1 137 ? 19.611  47.473  17.107  1.00 40.23 ? 137 LYS B O   1 
ATOM   2705 C  CB  . LYS B 1 137 ? 19.667  50.007  15.167  1.00 45.75 ? 137 LYS B CB  1 
ATOM   2706 C  CG  . LYS B 1 137 ? 19.267  51.328  14.530  1.00 50.34 ? 137 LYS B CG  1 
ATOM   2707 C  CD  . LYS B 1 137 ? 20.125  51.641  13.311  1.00 53.39 ? 137 LYS B CD  1 
ATOM   2708 C  CE  . LYS B 1 137 ? 19.720  52.968  12.680  1.00 55.30 ? 137 LYS B CE  1 
ATOM   2709 N  NZ  . LYS B 1 137 ? 20.575  53.324  11.511  1.00 56.90 ? 137 LYS B NZ  1 
ATOM   2710 N  N   . LEU B 1 138 ? 18.065  47.238  15.487  1.00 36.56 ? 138 LEU B N   1 
ATOM   2711 C  CA  . LEU B 1 138 ? 18.129  45.784  15.464  1.00 33.55 ? 138 LEU B CA  1 
ATOM   2712 C  C   . LEU B 1 138 ? 19.209  45.332  14.490  1.00 32.69 ? 138 LEU B C   1 
ATOM   2713 O  O   . LEU B 1 138 ? 19.460  45.989  13.479  1.00 33.83 ? 138 LEU B O   1 
ATOM   2714 C  CB  . LEU B 1 138 ? 16.789  45.197  15.035  1.00 30.32 ? 138 LEU B CB  1 
ATOM   2715 C  CG  . LEU B 1 138 ? 15.667  45.326  16.053  1.00 30.63 ? 138 LEU B CG  1 
ATOM   2716 C  CD1 . LEU B 1 138 ? 14.417  44.657  15.504  1.00 30.42 ? 138 LEU B CD1 1 
ATOM   2717 C  CD2 . LEU B 1 138 ? 16.095  44.681  17.363  1.00 28.90 ? 138 LEU B CD2 1 
ATOM   2718 N  N   . ALA B 1 139 ? 19.843  44.205  14.795  1.00 30.19 ? 139 ALA B N   1 
ATOM   2719 C  CA  . ALA B 1 139 ? 20.894  43.674  13.942  1.00 28.20 ? 139 ALA B CA  1 
ATOM   2720 C  C   . ALA B 1 139 ? 20.997  42.167  14.077  1.00 26.40 ? 139 ALA B C   1 
ATOM   2721 O  O   . ALA B 1 139 ? 20.633  41.597  15.103  1.00 25.89 ? 139 ALA B O   1 
ATOM   2722 C  CB  . ALA B 1 139 ? 22.235  44.320  14.297  1.00 27.04 ? 139 ALA B CB  1 
ATOM   2723 N  N   . VAL B 1 140 ? 21.489  41.527  13.024  1.00 26.33 ? 140 VAL B N   1 
ATOM   2724 C  CA  . VAL B 1 140 ? 21.676  40.084  13.022  1.00 25.26 ? 140 VAL B CA  1 
ATOM   2725 C  C   . VAL B 1 140 ? 23.165  39.804  13.169  1.00 24.05 ? 140 VAL B C   1 
ATOM   2726 O  O   . VAL B 1 140 ? 23.983  40.373  12.447  1.00 24.14 ? 140 VAL B O   1 
ATOM   2727 C  CB  . VAL B 1 140 ? 21.167  39.439  11.711  1.00 24.72 ? 140 VAL B CB  1 
ATOM   2728 C  CG1 . VAL B 1 140 ? 21.555  37.959  11.668  1.00 25.74 ? 140 VAL B CG1 1 
ATOM   2729 C  CG2 . VAL B 1 140 ? 19.657  39.579  11.620  1.00 23.90 ? 140 VAL B CG2 1 
ATOM   2730 N  N   . VAL B 1 141 ? 23.509  38.951  14.127  1.00 22.72 ? 141 VAL B N   1 
ATOM   2731 C  CA  . VAL B 1 141 ? 24.901  38.579  14.362  1.00 22.92 ? 141 VAL B CA  1 
ATOM   2732 C  C   . VAL B 1 141 ? 24.947  37.100  14.740  1.00 22.68 ? 141 VAL B C   1 
ATOM   2733 O  O   . VAL B 1 141 ? 23.911  36.484  14.981  1.00 21.12 ? 141 VAL B O   1 
ATOM   2734 C  CB  . VAL B 1 141 ? 25.527  39.405  15.514  1.00 23.93 ? 141 VAL B CB  1 
ATOM   2735 C  CG1 . VAL B 1 141 ? 25.452  40.894  15.196  1.00 24.15 ? 141 VAL B CG1 1 
ATOM   2736 C  CG2 . VAL B 1 141 ? 24.809  39.108  16.820  1.00 24.77 ? 141 VAL B CG2 1 
ATOM   2737 N  N   . SER B 1 142 ? 26.141  36.522  14.773  1.00 21.70 ? 142 SER B N   1 
ATOM   2738 C  CA  . SER B 1 142 ? 26.271  35.125  15.159  1.00 20.67 ? 142 SER B CA  1 
ATOM   2739 C  C   . SER B 1 142 ? 27.492  34.996  16.050  1.00 19.45 ? 142 SER B C   1 
ATOM   2740 O  O   . SER B 1 142 ? 28.391  35.838  16.011  1.00 19.44 ? 142 SER B O   1 
ATOM   2741 C  CB  . SER B 1 142 ? 26.419  34.214  13.933  1.00 22.45 ? 142 SER B CB  1 
ATOM   2742 O  OG  . SER B 1 142 ? 27.700  34.340  13.349  1.00 24.33 ? 142 SER B OG  1 
ATOM   2743 N  N   . THR B 1 143 ? 27.507  33.955  16.874  1.00 16.67 ? 143 THR B N   1 
ATOM   2744 C  CA  . THR B 1 143 ? 28.628  33.716  17.771  1.00 14.48 ? 143 THR B CA  1 
ATOM   2745 C  C   . THR B 1 143 ? 29.061  32.265  17.642  1.00 13.83 ? 143 THR B C   1 
ATOM   2746 O  O   . THR B 1 143 ? 28.326  31.426  17.114  1.00 11.89 ? 143 THR B O   1 
ATOM   2747 C  CB  . THR B 1 143 ? 28.261  33.981  19.246  1.00 13.74 ? 143 THR B CB  1 
ATOM   2748 O  OG1 . THR B 1 143 ? 27.119  33.191  19.599  1.00 13.23 ? 143 THR B OG1 1 
ATOM   2749 C  CG2 . THR B 1 143 ? 27.959  35.465  19.476  1.00 12.59 ? 143 THR B CG2 1 
ATOM   2750 N  N   . ALA B 1 144 ? 30.259  31.980  18.132  1.00 12.34 ? 144 ALA B N   1 
ATOM   2751 C  CA  . ALA B 1 144 ? 30.808  30.637  18.075  1.00 13.24 ? 144 ALA B CA  1 
ATOM   2752 C  C   . ALA B 1 144 ? 30.510  29.866  19.353  1.00 12.80 ? 144 ALA B C   1 
ATOM   2753 O  O   . ALA B 1 144 ? 30.346  30.451  20.420  1.00 12.26 ? 144 ALA B O   1 
ATOM   2754 C  CB  . ALA B 1 144 ? 32.329  30.697  17.851  1.00 11.56 ? 144 ALA B CB  1 
ATOM   2755 N  N   . ASN B 1 145 ? 30.436  28.546  19.220  1.00 12.82 ? 145 ASN B N   1 
ATOM   2756 C  CA  . ASN B 1 145 ? 30.202  27.655  20.344  1.00 13.60 ? 145 ASN B CA  1 
ATOM   2757 C  C   . ASN B 1 145 ? 29.076  28.115  21.271  1.00 14.27 ? 145 ASN B C   1 
ATOM   2758 O  O   . ASN B 1 145 ? 27.925  28.167  20.851  1.00 15.46 ? 145 ASN B O   1 
ATOM   2759 C  CB  . ASN B 1 145 ? 31.521  27.479  21.106  1.00 13.42 ? 145 ASN B CB  1 
ATOM   2760 C  CG  . ASN B 1 145 ? 32.675  27.114  20.176  1.00 15.25 ? 145 ASN B CG  1 
ATOM   2761 O  OD1 . ASN B 1 145 ? 32.504  26.328  19.241  1.00 13.99 ? 145 ASN B OD1 1 
ATOM   2762 N  ND2 . ASN B 1 145 ? 33.847  27.680  20.426  1.00 14.32 ? 145 ASN B ND2 1 
ATOM   2763 N  N   . GLN B 1 146 ? 29.385  28.424  22.528  1.00 14.60 ? 146 GLN B N   1 
ATOM   2764 C  CA  . GLN B 1 146 ? 28.340  28.875  23.444  1.00 15.74 ? 146 GLN B CA  1 
ATOM   2765 C  C   . GLN B 1 146 ? 28.496  30.341  23.837  1.00 16.63 ? 146 GLN B C   1 
ATOM   2766 O  O   . GLN B 1 146 ? 27.992  30.761  24.879  1.00 17.47 ? 146 GLN B O   1 
ATOM   2767 C  CB  . GLN B 1 146 ? 28.290  28.013  24.718  1.00 13.50 ? 146 GLN B CB  1 
ATOM   2768 C  CG  . GLN B 1 146 ? 27.817  26.565  24.535  1.00 15.11 ? 146 GLN B CG  1 
ATOM   2769 C  CD  . GLN B 1 146 ? 26.472  26.428  23.813  1.00 15.83 ? 146 GLN B CD  1 
ATOM   2770 O  OE1 . GLN B 1 146 ? 25.615  27.315  23.875  1.00 15.17 ? 146 GLN B OE1 1 
ATOM   2771 N  NE2 . GLN B 1 146 ? 26.281  25.298  23.140  1.00 12.30 ? 146 GLN B NE2 1 
ATOM   2772 N  N   . ASP B 1 147 ? 29.200  31.117  23.017  1.00 16.48 ? 147 ASP B N   1 
ATOM   2773 C  CA  . ASP B 1 147 ? 29.369  32.537  23.302  1.00 16.94 ? 147 ASP B CA  1 
ATOM   2774 C  C   . ASP B 1 147 ? 28.031  33.238  23.099  1.00 17.68 ? 147 ASP B C   1 
ATOM   2775 O  O   . ASP B 1 147 ? 27.199  32.798  22.304  1.00 16.22 ? 147 ASP B O   1 
ATOM   2776 C  CB  . ASP B 1 147 ? 30.401  33.179  22.369  1.00 16.66 ? 147 ASP B CB  1 
ATOM   2777 C  CG  . ASP B 1 147 ? 31.822  32.777  22.697  1.00 18.94 ? 147 ASP B CG  1 
ATOM   2778 O  OD1 . ASP B 1 147 ? 32.046  32.233  23.800  1.00 18.38 ? 147 ASP B OD1 1 
ATOM   2779 O  OD2 . ASP B 1 147 ? 32.716  33.023  21.855  1.00 17.45 ? 147 ASP B OD2 1 
ATOM   2780 N  N   . SER B 1 148 ? 27.839  34.337  23.816  1.00 19.24 ? 148 SER B N   1 
ATOM   2781 C  CA  . SER B 1 148 ? 26.613  35.115  23.726  1.00 18.94 ? 148 SER B CA  1 
ATOM   2782 C  C   . SER B 1 148 ? 26.985  36.579  23.539  1.00 19.52 ? 148 SER B C   1 
ATOM   2783 O  O   . SER B 1 148 ? 27.989  37.040  24.080  1.00 19.40 ? 148 SER B O   1 
ATOM   2784 C  CB  . SER B 1 148 ? 25.795  34.941  25.011  1.00 19.11 ? 148 SER B CB  1 
ATOM   2785 O  OG  . SER B 1 148 ? 24.706  35.847  25.068  1.00 20.14 ? 148 SER B OG  1 
ATOM   2786 N  N   . PRO B 1 149 ? 26.192  37.329  22.756  1.00 20.08 ? 149 PRO B N   1 
ATOM   2787 C  CA  . PRO B 1 149 ? 26.532  38.741  22.570  1.00 20.71 ? 149 PRO B CA  1 
ATOM   2788 C  C   . PRO B 1 149 ? 26.553  39.513  23.900  1.00 21.53 ? 149 PRO B C   1 
ATOM   2789 O  O   . PRO B 1 149 ? 27.150  40.588  23.996  1.00 21.22 ? 149 PRO B O   1 
ATOM   2790 C  CB  . PRO B 1 149 ? 25.465  39.235  21.582  1.00 21.31 ? 149 PRO B CB  1 
ATOM   2791 C  CG  . PRO B 1 149 ? 24.332  38.252  21.744  1.00 22.67 ? 149 PRO B CG  1 
ATOM   2792 C  CD  . PRO B 1 149 ? 25.039  36.941  21.927  1.00 20.57 ? 149 PRO B CD  1 
ATOM   2793 N  N   . LEU B 1 150 ? 25.923  38.949  24.930  1.00 20.99 ? 150 LEU B N   1 
ATOM   2794 C  CA  . LEU B 1 150 ? 25.905  39.584  26.243  1.00 21.63 ? 150 LEU B CA  1 
ATOM   2795 C  C   . LEU B 1 150 ? 27.301  39.604  26.863  1.00 23.47 ? 150 LEU B C   1 
ATOM   2796 O  O   . LEU B 1 150 ? 27.552  40.338  27.820  1.00 25.25 ? 150 LEU B O   1 
ATOM   2797 C  CB  . LEU B 1 150 ? 24.949  38.848  27.182  1.00 21.82 ? 150 LEU B CB  1 
ATOM   2798 C  CG  . LEU B 1 150 ? 23.450  39.001  26.908  1.00 23.36 ? 150 LEU B CG  1 
ATOM   2799 C  CD1 . LEU B 1 150 ? 22.682  38.061  27.818  1.00 23.56 ? 150 LEU B CD1 1 
ATOM   2800 C  CD2 . LEU B 1 150 ? 23.014  40.445  27.140  1.00 22.22 ? 150 LEU B CD2 1 
ATOM   2801 N  N   . MET B 1 151 ? 28.208  38.798  26.318  1.00 23.14 ? 151 MET B N   1 
ATOM   2802 C  CA  . MET B 1 151 ? 29.570  38.727  26.831  1.00 23.89 ? 151 MET B CA  1 
ATOM   2803 C  C   . MET B 1 151 ? 30.430  39.892  26.354  1.00 24.55 ? 151 MET B C   1 
ATOM   2804 O  O   . MET B 1 151 ? 31.506  40.137  26.898  1.00 25.82 ? 151 MET B O   1 
ATOM   2805 C  CB  . MET B 1 151 ? 30.223  37.409  26.407  1.00 24.05 ? 151 MET B CB  1 
ATOM   2806 C  CG  . MET B 1 151 ? 29.608  36.177  27.051  1.00 23.11 ? 151 MET B CG  1 
ATOM   2807 S  SD  . MET B 1 151 ? 30.202  34.633  26.330  1.00 20.85 ? 151 MET B SD  1 
ATOM   2808 C  CE  . MET B 1 151 ? 29.280  33.452  27.301  1.00 17.99 ? 151 MET B CE  1 
ATOM   2809 N  N   . GLY B 1 152 ? 29.955  40.605  25.337  1.00 25.03 ? 152 GLY B N   1 
ATOM   2810 C  CA  . GLY B 1 152 ? 30.706  41.728  24.807  1.00 25.31 ? 152 GLY B CA  1 
ATOM   2811 C  C   . GLY B 1 152 ? 31.487  41.348  23.563  1.00 26.99 ? 152 GLY B C   1 
ATOM   2812 O  O   . GLY B 1 152 ? 31.727  40.167  23.311  1.00 26.81 ? 152 GLY B O   1 
ATOM   2813 N  N   . GLU B 1 153 ? 31.902  42.344  22.786  1.00 27.69 ? 153 GLU B N   1 
ATOM   2814 C  CA  . GLU B 1 153 ? 32.642  42.083  21.557  1.00 29.17 ? 153 GLU B CA  1 
ATOM   2815 C  C   . GLU B 1 153 ? 34.037  41.523  21.770  1.00 27.78 ? 153 GLU B C   1 
ATOM   2816 O  O   . GLU B 1 153 ? 34.489  40.684  21.000  1.00 28.56 ? 153 GLU B O   1 
ATOM   2817 C  CB  . GLU B 1 153 ? 32.741  43.347  20.697  1.00 31.55 ? 153 GLU B CB  1 
ATOM   2818 C  CG  . GLU B 1 153 ? 31.404  43.989  20.401  1.00 38.58 ? 153 GLU B CG  1 
ATOM   2819 C  CD  . GLU B 1 153 ? 31.400  44.763  19.097  1.00 43.04 ? 153 GLU B CD  1 
ATOM   2820 O  OE1 . GLU B 1 153 ? 32.407  45.452  18.809  1.00 45.51 ? 153 GLU B OE1 1 
ATOM   2821 O  OE2 . GLU B 1 153 ? 30.381  44.687  18.367  1.00 42.58 ? 153 GLU B OE2 1 
ATOM   2822 N  N   . ALA B 1 154 ? 34.720  41.984  22.810  1.00 28.23 ? 154 ALA B N   1 
ATOM   2823 C  CA  . ALA B 1 154 ? 36.076  41.518  23.084  1.00 27.57 ? 154 ALA B CA  1 
ATOM   2824 C  C   . ALA B 1 154 ? 36.114  40.008  23.197  1.00 27.67 ? 154 ALA B C   1 
ATOM   2825 O  O   . ALA B 1 154 ? 37.040  39.362  22.706  1.00 27.90 ? 154 ALA B O   1 
ATOM   2826 C  CB  . ALA B 1 154 ? 36.602  42.144  24.370  1.00 26.85 ? 154 ALA B CB  1 
ATOM   2827 N  N   . ILE B 1 155 ? 35.098  39.443  23.837  1.00 27.44 ? 155 ILE B N   1 
ATOM   2828 C  CA  . ILE B 1 155 ? 35.044  38.002  24.023  1.00 25.55 ? 155 ILE B CA  1 
ATOM   2829 C  C   . ILE B 1 155 ? 34.320  37.224  22.926  1.00 25.76 ? 155 ILE B C   1 
ATOM   2830 O  O   . ILE B 1 155 ? 34.879  36.282  22.367  1.00 24.97 ? 155 ILE B O   1 
ATOM   2831 C  CB  . ILE B 1 155 ? 34.401  37.657  25.378  1.00 26.65 ? 155 ILE B CB  1 
ATOM   2832 C  CG1 . ILE B 1 155 ? 35.263  38.229  26.509  1.00 26.43 ? 155 ILE B CG1 1 
ATOM   2833 C  CG2 . ILE B 1 155 ? 34.249  36.147  25.517  1.00 24.92 ? 155 ILE B CG2 1 
ATOM   2834 C  CD1 . ILE B 1 155 ? 34.677  38.044  27.891  1.00 26.89 ? 155 ILE B CD1 1 
ATOM   2835 N  N   . SER B 1 156 ? 33.094  37.624  22.601  1.00 24.70 ? 156 SER B N   1 
ATOM   2836 C  CA  . SER B 1 156 ? 32.312  36.901  21.604  1.00 24.60 ? 156 SER B CA  1 
ATOM   2837 C  C   . SER B 1 156 ? 32.388  37.407  20.170  1.00 24.62 ? 156 SER B C   1 
ATOM   2838 O  O   . SER B 1 156 ? 31.947  36.720  19.247  1.00 24.09 ? 156 SER B O   1 
ATOM   2839 C  CB  . SER B 1 156 ? 30.845  36.873  22.025  1.00 25.21 ? 156 SER B CB  1 
ATOM   2840 O  OG  . SER B 1 156 ? 30.233  38.129  21.784  1.00 27.53 ? 156 SER B OG  1 
ATOM   2841 N  N   . GLY B 1 157 ? 32.932  38.604  19.978  1.00 24.91 ? 157 GLY B N   1 
ATOM   2842 C  CA  . GLY B 1 157 ? 33.016  39.158  18.638  1.00 24.72 ? 157 GLY B CA  1 
ATOM   2843 C  C   . GLY B 1 157 ? 31.713  39.840  18.243  1.00 25.30 ? 157 GLY B C   1 
ATOM   2844 O  O   . GLY B 1 157 ? 31.558  40.317  17.121  1.00 25.48 ? 157 GLY B O   1 
ATOM   2845 N  N   . ALA B 1 158 ? 30.769  39.888  19.177  1.00 25.03 ? 158 ALA B N   1 
ATOM   2846 C  CA  . ALA B 1 158 ? 29.474  40.512  18.929  1.00 25.18 ? 158 ALA B CA  1 
ATOM   2847 C  C   . ALA B 1 158 ? 28.964  41.166  20.210  1.00 25.10 ? 158 ALA B C   1 
ATOM   2848 O  O   . ALA B 1 158 ? 29.487  40.918  21.295  1.00 25.82 ? 158 ALA B O   1 
ATOM   2849 C  CB  . ALA B 1 158 ? 28.472  39.460  18.439  1.00 23.31 ? 158 ALA B CB  1 
ATOM   2850 N  N   . SER B 1 159 ? 27.940  42.000  20.082  1.00 26.24 ? 159 SER B N   1 
ATOM   2851 C  CA  . SER B 1 159 ? 27.366  42.678  21.239  1.00 26.71 ? 159 SER B CA  1 
ATOM   2852 C  C   . SER B 1 159 ? 25.909  43.005  20.976  1.00 26.37 ? 159 SER B C   1 
ATOM   2853 O  O   . SER B 1 159 ? 25.442  42.930  19.842  1.00 26.63 ? 159 SER B O   1 
ATOM   2854 C  CB  . SER B 1 159 ? 28.134  43.970  21.538  1.00 27.21 ? 159 SER B CB  1 
ATOM   2855 O  OG  . SER B 1 159 ? 28.195  44.801  20.391  1.00 29.94 ? 159 SER B OG  1 
ATOM   2856 N  N   . GLY B 1 160 ? 25.194  43.367  22.032  1.00 26.23 ? 160 GLY B N   1 
ATOM   2857 C  CA  . GLY B 1 160 ? 23.791  43.698  21.886  1.00 26.34 ? 160 GLY B CA  1 
ATOM   2858 C  C   . GLY B 1 160 ? 22.922  42.847  22.785  1.00 26.16 ? 160 GLY B C   1 
ATOM   2859 O  O   . GLY B 1 160 ? 23.378  41.845  23.338  1.00 25.91 ? 160 GLY B O   1 
ATOM   2860 N  N   . PHE B 1 161 ? 21.666  43.251  22.936  1.00 25.85 ? 161 PHE B N   1 
ATOM   2861 C  CA  . PHE B 1 161 ? 20.725  42.525  23.771  1.00 25.32 ? 161 PHE B CA  1 
ATOM   2862 C  C   . PHE B 1 161 ? 19.993  41.502  22.912  1.00 25.76 ? 161 PHE B C   1 
ATOM   2863 O  O   . PHE B 1 161 ? 19.338  41.856  21.931  1.00 26.82 ? 161 PHE B O   1 
ATOM   2864 C  CB  . PHE B 1 161 ? 19.723  43.493  24.400  1.00 25.52 ? 161 PHE B CB  1 
ATOM   2865 C  CG  . PHE B 1 161 ? 18.732  42.829  25.303  1.00 24.64 ? 161 PHE B CG  1 
ATOM   2866 C  CD1 . PHE B 1 161 ? 19.145  42.250  26.500  1.00 25.81 ? 161 PHE B CD1 1 
ATOM   2867 C  CD2 . PHE B 1 161 ? 17.391  42.747  24.943  1.00 23.62 ? 161 PHE B CD2 1 
ATOM   2868 C  CE1 . PHE B 1 161 ? 18.232  41.592  27.327  1.00 26.41 ? 161 PHE B CE1 1 
ATOM   2869 C  CE2 . PHE B 1 161 ? 16.470  42.094  25.759  1.00 24.07 ? 161 PHE B CE2 1 
ATOM   2870 C  CZ  . PHE B 1 161 ? 16.891  41.514  26.954  1.00 24.67 ? 161 PHE B CZ  1 
ATOM   2871 N  N   . PRO B 1 162 ? 20.087  40.215  23.277  1.00 25.75 ? 162 PRO B N   1 
ATOM   2872 C  CA  . PRO B 1 162 ? 19.433  39.137  22.528  1.00 24.79 ? 162 PRO B CA  1 
ATOM   2873 C  C   . PRO B 1 162 ? 17.911  39.202  22.571  1.00 24.34 ? 162 PRO B C   1 
ATOM   2874 O  O   . PRO B 1 162 ? 17.311  39.148  23.644  1.00 22.30 ? 162 PRO B O   1 
ATOM   2875 C  CB  . PRO B 1 162 ? 19.949  37.865  23.209  1.00 25.75 ? 162 PRO B CB  1 
ATOM   2876 C  CG  . PRO B 1 162 ? 21.187  38.310  23.947  1.00 26.44 ? 162 PRO B CG  1 
ATOM   2877 C  CD  . PRO B 1 162 ? 20.809  39.676  24.440  1.00 25.32 ? 162 PRO B CD  1 
ATOM   2878 N  N   . ILE B 1 163 ? 17.291  39.317  21.401  1.00 23.98 ? 163 ILE B N   1 
ATOM   2879 C  CA  . ILE B 1 163 ? 15.838  39.345  21.319  1.00 23.74 ? 163 ILE B CA  1 
ATOM   2880 C  C   . ILE B 1 163 ? 15.371  37.920  21.034  1.00 24.03 ? 163 ILE B C   1 
ATOM   2881 O  O   . ILE B 1 163 ? 14.365  37.457  21.570  1.00 25.30 ? 163 ILE B O   1 
ATOM   2882 C  CB  . ILE B 1 163 ? 15.349  40.283  20.190  1.00 24.13 ? 163 ILE B CB  1 
ATOM   2883 C  CG1 . ILE B 1 163 ? 15.765  41.726  20.494  1.00 23.32 ? 163 ILE B CG1 1 
ATOM   2884 C  CG2 . ILE B 1 163 ? 13.840  40.176  20.039  1.00 22.08 ? 163 ILE B CG2 1 
ATOM   2885 C  CD1 . ILE B 1 163 ? 15.276  42.244  21.830  1.00 24.93 ? 163 ILE B CD1 1 
ATOM   2886 N  N   . MET B 1 164 ? 16.126  37.221  20.198  1.00 23.55 ? 164 MET B N   1 
ATOM   2887 C  CA  . MET B 1 164 ? 15.804  35.848  19.834  1.00 24.92 ? 164 MET B CA  1 
ATOM   2888 C  C   . MET B 1 164 ? 17.043  35.186  19.221  1.00 24.35 ? 164 MET B C   1 
ATOM   2889 O  O   . MET B 1 164 ? 17.908  35.868  18.669  1.00 24.46 ? 164 MET B O   1 
ATOM   2890 C  CB  . MET B 1 164 ? 14.622  35.852  18.858  1.00 26.86 ? 164 MET B CB  1 
ATOM   2891 C  CG  . MET B 1 164 ? 14.610  34.724  17.851  1.00 34.27 ? 164 MET B CG  1 
ATOM   2892 S  SD  . MET B 1 164 ? 15.151  35.290  16.223  1.00 40.29 ? 164 MET B SD  1 
ATOM   2893 C  CE  . MET B 1 164 ? 13.561  35.538  15.428  1.00 38.50 ? 164 MET B CE  1 
ATOM   2894 N  N   . GLY B 1 165 ? 17.144  33.865  19.329  1.00 22.99 ? 165 GLY B N   1 
ATOM   2895 C  CA  . GLY B 1 165 ? 18.305  33.193  18.771  1.00 21.40 ? 165 GLY B CA  1 
ATOM   2896 C  C   . GLY B 1 165 ? 18.065  31.779  18.279  1.00 20.19 ? 165 GLY B C   1 
ATOM   2897 O  O   . GLY B 1 165 ? 17.107  31.128  18.678  1.00 20.40 ? 165 GLY B O   1 
ATOM   2898 N  N   . LEU B 1 166 ? 18.938  31.302  17.398  1.00 18.81 ? 166 LEU B N   1 
ATOM   2899 C  CA  . LEU B 1 166 ? 18.823  29.950  16.873  1.00 16.82 ? 166 LEU B CA  1 
ATOM   2900 C  C   . LEU B 1 166 ? 20.116  29.171  17.111  1.00 16.60 ? 166 LEU B C   1 
ATOM   2901 O  O   . LEU B 1 166 ? 21.210  29.625  16.761  1.00 16.28 ? 166 LEU B O   1 
ATOM   2902 C  CB  . LEU B 1 166 ? 18.509  29.969  15.375  1.00 17.40 ? 166 LEU B CB  1 
ATOM   2903 C  CG  . LEU B 1 166 ? 18.394  28.578  14.743  1.00 16.99 ? 166 LEU B CG  1 
ATOM   2904 C  CD1 . LEU B 1 166 ? 17.202  27.833  15.350  1.00 15.25 ? 166 LEU B CD1 1 
ATOM   2905 C  CD2 . LEU B 1 166 ? 18.236  28.712  13.231  1.00 18.46 ? 166 LEU B CD2 1 
ATOM   2906 N  N   . ASP B 1 167 ? 19.976  27.998  17.715  1.00 14.97 ? 167 ASP B N   1 
ATOM   2907 C  CA  . ASP B 1 167 ? 21.106  27.125  18.013  1.00 15.11 ? 167 ASP B CA  1 
ATOM   2908 C  C   . ASP B 1 167 ? 21.491  26.390  16.726  1.00 14.41 ? 167 ASP B C   1 
ATOM   2909 O  O   . ASP B 1 167 ? 20.670  25.667  16.161  1.00 15.02 ? 167 ASP B O   1 
ATOM   2910 C  CB  . ASP B 1 167 ? 20.689  26.125  19.115  1.00 15.63 ? 167 ASP B CB  1 
ATOM   2911 C  CG  . ASP B 1 167 ? 21.827  25.201  19.563  1.00 16.50 ? 167 ASP B CG  1 
ATOM   2912 O  OD1 . ASP B 1 167 ? 22.989  25.404  19.158  1.00 16.40 ? 167 ASP B OD1 1 
ATOM   2913 O  OD2 . ASP B 1 167 ? 21.555  24.263  20.341  1.00 16.68 ? 167 ASP B OD2 1 
ATOM   2914 N  N   . VAL B 1 168 ? 22.713  26.589  16.235  1.00 13.36 ? 168 VAL B N   1 
ATOM   2915 C  CA  . VAL B 1 168 ? 23.109  25.875  15.025  1.00 13.65 ? 168 VAL B CA  1 
ATOM   2916 C  C   . VAL B 1 168 ? 24.186  24.813  15.237  1.00 13.40 ? 168 VAL B C   1 
ATOM   2917 O  O   . VAL B 1 168 ? 24.888  24.432  14.304  1.00 14.81 ? 168 VAL B O   1 
ATOM   2918 C  CB  . VAL B 1 168 ? 23.504  26.828  13.852  1.00 12.66 ? 168 VAL B CB  1 
ATOM   2919 C  CG1 . VAL B 1 168 ? 22.263  27.583  13.387  1.00 14.35 ? 168 VAL B CG1 1 
ATOM   2920 C  CG2 . VAL B 1 168 ? 24.606  27.791  14.261  1.00 12.91 ? 168 VAL B CG2 1 
ATOM   2921 N  N   . TRP B 1 169 ? 24.313  24.335  16.473  1.00 12.78 ? 169 TRP B N   1 
ATOM   2922 C  CA  . TRP B 1 169 ? 25.239  23.244  16.758  1.00 11.18 ? 169 TRP B CA  1 
ATOM   2923 C  C   . TRP B 1 169 ? 24.556  22.081  16.046  1.00 11.07 ? 169 TRP B C   1 
ATOM   2924 O  O   . TRP B 1 169 ? 23.327  22.046  15.978  1.00 11.05 ? 169 TRP B O   1 
ATOM   2925 C  CB  . TRP B 1 169 ? 25.286  22.934  18.252  1.00 9.91  ? 169 TRP B CB  1 
ATOM   2926 C  CG  . TRP B 1 169 ? 26.214  23.796  19.046  1.00 11.08 ? 169 TRP B CG  1 
ATOM   2927 C  CD1 . TRP B 1 169 ? 26.205  25.159  19.133  1.00 11.19 ? 169 TRP B CD1 1 
ATOM   2928 C  CD2 . TRP B 1 169 ? 27.270  23.346  19.904  1.00 11.72 ? 169 TRP B CD2 1 
ATOM   2929 N  NE1 . TRP B 1 169 ? 27.188  25.586  19.996  1.00 12.38 ? 169 TRP B NE1 1 
ATOM   2930 C  CE2 . TRP B 1 169 ? 27.857  24.493  20.483  1.00 11.36 ? 169 TRP B CE2 1 
ATOM   2931 C  CE3 . TRP B 1 169 ? 27.776  22.082  20.241  1.00 12.31 ? 169 TRP B CE3 1 
ATOM   2932 C  CZ2 . TRP B 1 169 ? 28.926  24.415  21.383  1.00 11.20 ? 169 TRP B CZ2 1 
ATOM   2933 C  CZ3 . TRP B 1 169 ? 28.840  22.004  21.139  1.00 12.81 ? 169 TRP B CZ3 1 
ATOM   2934 C  CH2 . TRP B 1 169 ? 29.402  23.166  21.699  1.00 12.34 ? 169 TRP B CH2 1 
ATOM   2935 N  N   . GLU B 1 170 ? 25.324  21.128  15.528  1.00 10.31 ? 170 GLU B N   1 
ATOM   2936 C  CA  . GLU B 1 170 ? 24.720  20.009  14.814  1.00 9.44  ? 170 GLU B CA  1 
ATOM   2937 C  C   . GLU B 1 170 ? 23.768  19.153  15.660  1.00 11.41 ? 170 GLU B C   1 
ATOM   2938 O  O   . GLU B 1 170 ? 22.831  18.568  15.119  1.00 11.28 ? 170 GLU B O   1 
ATOM   2939 C  CB  . GLU B 1 170 ? 25.811  19.134  14.183  1.00 8.08  ? 170 GLU B CB  1 
ATOM   2940 C  CG  . GLU B 1 170 ? 26.532  19.816  13.025  1.00 7.61  ? 170 GLU B CG  1 
ATOM   2941 C  CD  . GLU B 1 170 ? 27.716  19.015  12.490  1.00 10.45 ? 170 GLU B CD  1 
ATOM   2942 O  OE1 . GLU B 1 170 ? 28.507  18.479  13.301  1.00 11.34 ? 170 GLU B OE1 1 
ATOM   2943 O  OE2 . GLU B 1 170 ? 27.868  18.936  11.253  1.00 10.09 ? 170 GLU B OE2 1 
ATOM   2944 N  N   . HIS B 1 171 ? 23.983  19.087  16.975  1.00 10.86 ? 171 HIS B N   1 
ATOM   2945 C  CA  . HIS B 1 171 ? 23.102  18.285  17.824  1.00 11.61 ? 171 HIS B CA  1 
ATOM   2946 C  C   . HIS B 1 171 ? 21.666  18.811  17.843  1.00 13.28 ? 171 HIS B C   1 
ATOM   2947 O  O   . HIS B 1 171 ? 20.732  18.082  18.187  1.00 12.48 ? 171 HIS B O   1 
ATOM   2948 C  CB  . HIS B 1 171 ? 23.650  18.192  19.263  1.00 11.30 ? 171 HIS B CB  1 
ATOM   2949 C  CG  . HIS B 1 171 ? 23.635  19.486  20.027  1.00 11.62 ? 171 HIS B CG  1 
ATOM   2950 N  ND1 . HIS B 1 171 ? 24.767  20.011  20.618  1.00 12.88 ? 171 HIS B ND1 1 
ATOM   2951 C  CD2 . HIS B 1 171 ? 22.619  20.320  20.360  1.00 13.21 ? 171 HIS B CD2 1 
ATOM   2952 C  CE1 . HIS B 1 171 ? 24.449  21.109  21.283  1.00 12.76 ? 171 HIS B CE1 1 
ATOM   2953 N  NE2 . HIS B 1 171 ? 23.152  21.318  21.143  1.00 14.64 ? 171 HIS B NE2 1 
ATOM   2954 N  N   . ALA B 1 172 ? 21.489  20.073  17.460  1.00 12.36 ? 172 ALA B N   1 
ATOM   2955 C  CA  . ALA B 1 172 ? 20.162  20.678  17.448  1.00 13.19 ? 172 ALA B CA  1 
ATOM   2956 C  C   . ALA B 1 172 ? 19.323  20.265  16.242  1.00 13.76 ? 172 ALA B C   1 
ATOM   2957 O  O   . ALA B 1 172 ? 18.108  20.483  16.226  1.00 13.96 ? 172 ALA B O   1 
ATOM   2958 C  CB  . ALA B 1 172 ? 20.279  22.208  17.488  1.00 11.39 ? 172 ALA B CB  1 
ATOM   2959 N  N   . TYR B 1 173 ? 19.949  19.658  15.239  1.00 12.69 ? 173 TYR B N   1 
ATOM   2960 C  CA  . TYR B 1 173 ? 19.200  19.286  14.047  1.00 13.78 ? 173 TYR B CA  1 
ATOM   2961 C  C   . TYR B 1 173 ? 19.649  18.028  13.324  1.00 14.91 ? 173 TYR B C   1 
ATOM   2962 O  O   . TYR B 1 173 ? 19.066  17.669  12.302  1.00 16.48 ? 173 TYR B O   1 
ATOM   2963 C  CB  . TYR B 1 173 ? 19.246  20.447  13.050  1.00 14.54 ? 173 TYR B CB  1 
ATOM   2964 C  CG  . TYR B 1 173 ? 20.647  20.802  12.559  1.00 11.87 ? 173 TYR B CG  1 
ATOM   2965 C  CD1 . TYR B 1 173 ? 21.272  20.065  11.546  1.00 11.40 ? 173 TYR B CD1 1 
ATOM   2966 C  CD2 . TYR B 1 173 ? 21.331  21.896  13.087  1.00 11.64 ? 173 TYR B CD2 1 
ATOM   2967 C  CE1 . TYR B 1 173 ? 22.546  20.421  11.068  1.00 11.02 ? 173 TYR B CE1 1 
ATOM   2968 C  CE2 . TYR B 1 173 ? 22.596  22.259  12.623  1.00 9.26  ? 173 TYR B CE2 1 
ATOM   2969 C  CZ  . TYR B 1 173 ? 23.198  21.524  11.614  1.00 10.90 ? 173 TYR B CZ  1 
ATOM   2970 O  OH  . TYR B 1 173 ? 24.440  21.916  11.152  1.00 9.58  ? 173 TYR B OH  1 
ATOM   2971 N  N   . TYR B 1 174 ? 20.661  17.340  13.838  1.00 14.79 ? 174 TYR B N   1 
ATOM   2972 C  CA  . TYR B 1 174 ? 21.152  16.177  13.120  1.00 14.83 ? 174 TYR B CA  1 
ATOM   2973 C  C   . TYR B 1 174 ? 20.270  14.934  13.074  1.00 16.01 ? 174 TYR B C   1 
ATOM   2974 O  O   . TYR B 1 174 ? 20.229  14.255  12.052  1.00 16.47 ? 174 TYR B O   1 
ATOM   2975 C  CB  . TYR B 1 174 ? 22.544  15.789  13.616  1.00 14.06 ? 174 TYR B CB  1 
ATOM   2976 C  CG  . TYR B 1 174 ? 23.435  15.345  12.480  1.00 14.61 ? 174 TYR B CG  1 
ATOM   2977 C  CD1 . TYR B 1 174 ? 24.004  16.283  11.608  1.00 14.28 ? 174 TYR B CD1 1 
ATOM   2978 C  CD2 . TYR B 1 174 ? 23.647  13.992  12.222  1.00 10.37 ? 174 TYR B CD2 1 
ATOM   2979 C  CE1 . TYR B 1 174 ? 24.753  15.883  10.508  1.00 14.18 ? 174 TYR B CE1 1 
ATOM   2980 C  CE2 . TYR B 1 174 ? 24.394  13.581  11.122  1.00 13.81 ? 174 TYR B CE2 1 
ATOM   2981 C  CZ  . TYR B 1 174 ? 24.940  14.529  10.269  1.00 15.85 ? 174 TYR B CZ  1 
ATOM   2982 O  OH  . TYR B 1 174 ? 25.646  14.122  9.160   1.00 18.59 ? 174 TYR B OH  1 
ATOM   2983 N  N   . LEU B 1 175 ? 19.571  14.618  14.158  1.00 16.22 ? 175 LEU B N   1 
ATOM   2984 C  CA  . LEU B 1 175 ? 18.725  13.429  14.149  1.00 17.08 ? 175 LEU B CA  1 
ATOM   2985 C  C   . LEU B 1 175 ? 17.654  13.494  13.058  1.00 17.67 ? 175 LEU B C   1 
ATOM   2986 O  O   . LEU B 1 175 ? 17.344  12.485  12.429  1.00 19.08 ? 175 LEU B O   1 
ATOM   2987 C  CB  . LEU B 1 175 ? 18.064  13.214  15.523  1.00 17.30 ? 175 LEU B CB  1 
ATOM   2988 C  CG  . LEU B 1 175 ? 18.976  12.815  16.696  1.00 17.60 ? 175 LEU B CG  1 
ATOM   2989 C  CD1 . LEU B 1 175 ? 18.139  12.623  17.956  1.00 17.61 ? 175 LEU B CD1 1 
ATOM   2990 C  CD2 . LEU B 1 175 ? 19.721  11.531  16.369  1.00 16.14 ? 175 LEU B CD2 1 
ATOM   2991 N  N   . LYS B 1 176 ? 17.100  14.678  12.818  1.00 18.07 ? 176 LYS B N   1 
ATOM   2992 C  CA  . LYS B 1 176 ? 16.058  14.817  11.807  1.00 17.68 ? 176 LYS B CA  1 
ATOM   2993 C  C   . LYS B 1 176 ? 16.525  15.332  10.448  1.00 18.14 ? 176 LYS B C   1 
ATOM   2994 O  O   . LYS B 1 176 ? 16.124  14.804  9.416   1.00 18.25 ? 176 LYS B O   1 
ATOM   2995 C  CB  . LYS B 1 176 ? 14.949  15.733  12.319  1.00 18.93 ? 176 LYS B CB  1 
ATOM   2996 C  CG  . LYS B 1 176 ? 13.804  15.896  11.338  1.00 18.70 ? 176 LYS B CG  1 
ATOM   2997 C  CD  . LYS B 1 176 ? 12.736  16.815  11.889  1.00 20.03 ? 176 LYS B CD  1 
ATOM   2998 C  CE  . LYS B 1 176 ? 11.628  17.017  10.872  1.00 22.00 ? 176 LYS B CE  1 
ATOM   2999 N  NZ  . LYS B 1 176 ? 10.743  18.144  11.261  1.00 22.34 ? 176 LYS B NZ  1 
ATOM   3000 N  N   . PHE B 1 177 ? 17.372  16.357  10.441  1.00 17.46 ? 177 PHE B N   1 
ATOM   3001 C  CA  . PHE B 1 177 ? 17.832  16.932  9.179   1.00 18.10 ? 177 PHE B CA  1 
ATOM   3002 C  C   . PHE B 1 177 ? 19.236  16.543  8.725   1.00 17.64 ? 177 PHE B C   1 
ATOM   3003 O  O   . PHE B 1 177 ? 19.634  16.869  7.606   1.00 18.25 ? 177 PHE B O   1 
ATOM   3004 C  CB  . PHE B 1 177 ? 17.767  18.456  9.249   1.00 17.99 ? 177 PHE B CB  1 
ATOM   3005 C  CG  . PHE B 1 177 ? 16.455  18.988  9.740   1.00 19.22 ? 177 PHE B CG  1 
ATOM   3006 C  CD1 . PHE B 1 177 ? 16.213  19.126  11.102  1.00 18.22 ? 177 PHE B CD1 1 
ATOM   3007 C  CD2 . PHE B 1 177 ? 15.465  19.370  8.841   1.00 20.57 ? 177 PHE B CD2 1 
ATOM   3008 C  CE1 . PHE B 1 177 ? 15.003  19.643  11.564  1.00 18.44 ? 177 PHE B CE1 1 
ATOM   3009 C  CE2 . PHE B 1 177 ? 14.249  19.890  9.295   1.00 21.12 ? 177 PHE B CE2 1 
ATOM   3010 C  CZ  . PHE B 1 177 ? 14.021  20.026  10.661  1.00 19.46 ? 177 PHE B CZ  1 
ATOM   3011 N  N   . GLN B 1 178 ? 19.976  15.841  9.577   1.00 17.95 ? 178 GLN B N   1 
ATOM   3012 C  CA  . GLN B 1 178 ? 21.357  15.466  9.274   1.00 18.83 ? 178 GLN B CA  1 
ATOM   3013 C  C   . GLN B 1 178 ? 22.145  16.697  8.817   1.00 18.23 ? 178 GLN B C   1 
ATOM   3014 O  O   . GLN B 1 178 ? 22.197  17.700  9.530   1.00 18.47 ? 178 GLN B O   1 
ATOM   3015 C  CB  . GLN B 1 178 ? 21.434  14.369  8.205   1.00 20.56 ? 178 GLN B CB  1 
ATOM   3016 C  CG  . GLN B 1 178 ? 20.935  13.005  8.658   1.00 24.48 ? 178 GLN B CG  1 
ATOM   3017 C  CD  . GLN B 1 178 ? 19.424  12.909  8.630   1.00 28.08 ? 178 GLN B CD  1 
ATOM   3018 O  OE1 . GLN B 1 178 ? 18.799  13.178  7.601   1.00 32.83 ? 178 GLN B OE1 1 
ATOM   3019 N  NE2 . GLN B 1 178 ? 18.825  12.523  9.756   1.00 27.49 ? 178 GLN B NE2 1 
ATOM   3020 N  N   . ASN B 1 179 ? 22.738  16.633  7.628   1.00 17.05 ? 179 ASN B N   1 
ATOM   3021 C  CA  . ASN B 1 179 ? 23.543  17.740  7.114   1.00 17.25 ? 179 ASN B CA  1 
ATOM   3022 C  C   . ASN B 1 179 ? 22.748  18.924  6.556   1.00 18.50 ? 179 ASN B C   1 
ATOM   3023 O  O   . ASN B 1 179 ? 23.318  19.979  6.275   1.00 18.27 ? 179 ASN B O   1 
ATOM   3024 C  CB  . ASN B 1 179 ? 24.476  17.232  6.022   1.00 16.25 ? 179 ASN B CB  1 
ATOM   3025 C  CG  . ASN B 1 179 ? 23.724  16.814  4.773   1.00 18.30 ? 179 ASN B CG  1 
ATOM   3026 O  OD1 . ASN B 1 179 ? 22.954  15.848  4.782   1.00 15.05 ? 179 ASN B OD1 1 
ATOM   3027 N  ND2 . ASN B 1 179 ? 23.939  17.547  3.688   1.00 17.64 ? 179 ASN B ND2 1 
ATOM   3028 N  N   . ARG B 1 180 ? 21.439  18.761  6.403   1.00 18.10 ? 180 ARG B N   1 
ATOM   3029 C  CA  . ARG B 1 180 ? 20.616  19.821  5.841   1.00 19.50 ? 180 ARG B CA  1 
ATOM   3030 C  C   . ARG B 1 180 ? 20.257  20.953  6.797   1.00 19.63 ? 180 ARG B C   1 
ATOM   3031 O  O   . ARG B 1 180 ? 19.085  21.155  7.118   1.00 19.90 ? 180 ARG B O   1 
ATOM   3032 C  CB  . ARG B 1 180 ? 19.338  19.220  5.251   1.00 21.14 ? 180 ARG B CB  1 
ATOM   3033 C  CG  . ARG B 1 180 ? 19.597  18.090  4.257   1.00 24.05 ? 180 ARG B CG  1 
ATOM   3034 C  CD  . ARG B 1 180 ? 18.324  17.691  3.531   1.00 27.34 ? 180 ARG B CD  1 
ATOM   3035 N  NE  . ARG B 1 180 ? 17.277  17.235  4.443   1.00 32.18 ? 180 ARG B NE  1 
ATOM   3036 C  CZ  . ARG B 1 180 ? 17.313  16.085  5.110   1.00 33.73 ? 180 ARG B CZ  1 
ATOM   3037 N  NH1 . ARG B 1 180 ? 18.347  15.265  4.969   1.00 35.78 ? 180 ARG B NH1 1 
ATOM   3038 N  NH2 . ARG B 1 180 ? 16.313  15.752  5.918   1.00 32.73 ? 180 ARG B NH2 1 
ATOM   3039 N  N   . ARG B 1 181 ? 21.261  21.706  7.237   1.00 19.08 ? 181 ARG B N   1 
ATOM   3040 C  CA  . ARG B 1 181 ? 21.009  22.817  8.145   1.00 18.72 ? 181 ARG B CA  1 
ATOM   3041 C  C   . ARG B 1 181 ? 20.016  23.834  7.551   1.00 19.94 ? 181 ARG B C   1 
ATOM   3042 O  O   . ARG B 1 181 ? 19.204  24.407  8.281   1.00 19.85 ? 181 ARG B O   1 
ATOM   3043 C  CB  . ARG B 1 181 ? 22.314  23.534  8.520   1.00 15.07 ? 181 ARG B CB  1 
ATOM   3044 C  CG  . ARG B 1 181 ? 22.107  24.559  9.632   1.00 13.59 ? 181 ARG B CG  1 
ATOM   3045 C  CD  . ARG B 1 181 ? 23.269  25.517  9.793   1.00 12.96 ? 181 ARG B CD  1 
ATOM   3046 N  NE  . ARG B 1 181 ? 24.437  24.911  10.419  1.00 15.10 ? 181 ARG B NE  1 
ATOM   3047 C  CZ  . ARG B 1 181 ? 25.566  25.570  10.664  1.00 14.76 ? 181 ARG B CZ  1 
ATOM   3048 N  NH1 . ARG B 1 181 ? 25.669  26.849  10.339  1.00 14.41 ? 181 ARG B NH1 1 
ATOM   3049 N  NH2 . ARG B 1 181 ? 26.592  24.951  11.224  1.00 15.00 ? 181 ARG B NH2 1 
ATOM   3050 N  N   . PRO B 1 182 ? 20.073  24.079  6.225   1.00 20.11 ? 182 PRO B N   1 
ATOM   3051 C  CA  . PRO B 1 182 ? 19.135  25.042  5.636   1.00 19.18 ? 182 PRO B CA  1 
ATOM   3052 C  C   . PRO B 1 182 ? 17.666  24.665  5.845   1.00 19.52 ? 182 PRO B C   1 
ATOM   3053 O  O   . PRO B 1 182 ? 16.829  25.544  6.061   1.00 20.94 ? 182 PRO B O   1 
ATOM   3054 C  CB  . PRO B 1 182 ? 19.534  25.057  4.165   1.00 19.23 ? 182 PRO B CB  1 
ATOM   3055 C  CG  . PRO B 1 182 ? 21.020  24.804  4.231   1.00 18.53 ? 182 PRO B CG  1 
ATOM   3056 C  CD  . PRO B 1 182 ? 21.079  23.668  5.227   1.00 20.18 ? 182 PRO B CD  1 
ATOM   3057 N  N   . ASP B 1 183 ? 17.347  23.373  5.782   1.00 18.95 ? 183 ASP B N   1 
ATOM   3058 C  CA  . ASP B 1 183 ? 15.966  22.939  5.994   1.00 20.17 ? 183 ASP B CA  1 
ATOM   3059 C  C   . ASP B 1 183 ? 15.571  23.199  7.445   1.00 20.32 ? 183 ASP B C   1 
ATOM   3060 O  O   . ASP B 1 183 ? 14.434  23.563  7.744   1.00 21.21 ? 183 ASP B O   1 
ATOM   3061 C  CB  . ASP B 1 183 ? 15.794  21.445  5.700   1.00 20.95 ? 183 ASP B CB  1 
ATOM   3062 C  CG  . ASP B 1 183 ? 15.982  21.107  4.234   1.00 24.15 ? 183 ASP B CG  1 
ATOM   3063 O  OD1 . ASP B 1 183 ? 15.788  22.002  3.386   1.00 25.68 ? 183 ASP B OD1 1 
ATOM   3064 O  OD2 . ASP B 1 183 ? 16.308  19.938  3.930   1.00 26.30 ? 183 ASP B OD2 1 
ATOM   3065 N  N   . TYR B 1 184 ? 16.526  22.996  8.342   1.00 19.07 ? 184 TYR B N   1 
ATOM   3066 C  CA  . TYR B 1 184 ? 16.304  23.209  9.762   1.00 19.34 ? 184 TYR B CA  1 
ATOM   3067 C  C   . TYR B 1 184 ? 15.996  24.681  10.021  1.00 19.31 ? 184 TYR B C   1 
ATOM   3068 O  O   . TYR B 1 184 ? 15.062  25.015  10.754  1.00 18.26 ? 184 TYR B O   1 
ATOM   3069 C  CB  . TYR B 1 184 ? 17.552  22.777  10.535  1.00 18.67 ? 184 TYR B CB  1 
ATOM   3070 C  CG  . TYR B 1 184 ? 17.621  23.273  11.957  1.00 19.07 ? 184 TYR B CG  1 
ATOM   3071 C  CD1 . TYR B 1 184 ? 16.718  22.828  12.926  1.00 19.10 ? 184 TYR B CD1 1 
ATOM   3072 C  CD2 . TYR B 1 184 ? 18.622  24.157  12.346  1.00 17.23 ? 184 TYR B CD2 1 
ATOM   3073 C  CE1 . TYR B 1 184 ? 16.823  23.252  14.252  1.00 17.93 ? 184 TYR B CE1 1 
ATOM   3074 C  CE2 . TYR B 1 184 ? 18.733  24.586  13.659  1.00 17.72 ? 184 TYR B CE2 1 
ATOM   3075 C  CZ  . TYR B 1 184 ? 17.837  24.132  14.609  1.00 18.37 ? 184 TYR B CZ  1 
ATOM   3076 O  OH  . TYR B 1 184 ? 17.974  24.563  15.911  1.00 17.51 ? 184 TYR B OH  1 
ATOM   3077 N  N   . ILE B 1 185 ? 16.783  25.558  9.407   1.00 18.80 ? 185 ILE B N   1 
ATOM   3078 C  CA  . ILE B 1 185 ? 16.597  26.990  9.567   1.00 19.97 ? 185 ILE B CA  1 
ATOM   3079 C  C   . ILE B 1 185 ? 15.222  27.453  9.068   1.00 22.14 ? 185 ILE B C   1 
ATOM   3080 O  O   . ILE B 1 185 ? 14.575  28.298  9.692   1.00 21.18 ? 185 ILE B O   1 
ATOM   3081 C  CB  . ILE B 1 185 ? 17.690  27.762  8.827   1.00 19.61 ? 185 ILE B CB  1 
ATOM   3082 C  CG1 . ILE B 1 185 ? 19.056  27.395  9.412   1.00 20.13 ? 185 ILE B CG1 1 
ATOM   3083 C  CG2 . ILE B 1 185 ? 17.440  29.247  8.949   1.00 19.25 ? 185 ILE B CG2 1 
ATOM   3084 C  CD1 . ILE B 1 185 ? 20.227  28.004  8.675   1.00 21.17 ? 185 ILE B CD1 1 
ATOM   3085 N  N   . LYS B 1 186 ? 14.778  26.892  7.949   1.00 23.07 ? 186 LYS B N   1 
ATOM   3086 C  CA  . LYS B 1 186 ? 13.485  27.242  7.371   1.00 25.80 ? 186 LYS B CA  1 
ATOM   3087 C  C   . LYS B 1 186 ? 12.364  26.801  8.313   1.00 25.46 ? 186 LYS B C   1 
ATOM   3088 O  O   . LYS B 1 186 ? 11.387  27.522  8.535   1.00 25.97 ? 186 LYS B O   1 
ATOM   3089 C  CB  . LYS B 1 186 ? 13.328  26.539  6.017   1.00 28.08 ? 186 LYS B CB  1 
ATOM   3090 C  CG  . LYS B 1 186 ? 12.576  27.338  4.968   1.00 34.21 ? 186 LYS B CG  1 
ATOM   3091 C  CD  . LYS B 1 186 ? 13.383  28.550  4.504   1.00 38.28 ? 186 LYS B CD  1 
ATOM   3092 C  CE  . LYS B 1 186 ? 12.653  29.307  3.395   1.00 41.44 ? 186 LYS B CE  1 
ATOM   3093 N  NZ  . LYS B 1 186 ? 13.410  30.499  2.915   1.00 42.42 ? 186 LYS B NZ  1 
ATOM   3094 N  N   . GLU B 1 187 ? 12.520  25.604  8.863   1.00 23.67 ? 187 GLU B N   1 
ATOM   3095 C  CA  . GLU B 1 187 ? 11.542  25.041  9.777   1.00 23.53 ? 187 GLU B CA  1 
ATOM   3096 C  C   . GLU B 1 187 ? 11.422  25.906  11.042  1.00 22.19 ? 187 GLU B C   1 
ATOM   3097 O  O   . GLU B 1 187 ? 10.361  25.982  11.661  1.00 22.07 ? 187 GLU B O   1 
ATOM   3098 C  CB  . GLU B 1 187 ? 11.967  23.614  10.123  1.00 25.46 ? 187 GLU B CB  1 
ATOM   3099 C  CG  . GLU B 1 187 ? 10.839  22.616  10.293  1.00 30.39 ? 187 GLU B CG  1 
ATOM   3100 C  CD  . GLU B 1 187 ? 9.915   22.548  9.092   1.00 30.58 ? 187 GLU B CD  1 
ATOM   3101 O  OE1 . GLU B 1 187 ? 9.084   23.464  8.941   1.00 32.81 ? 187 GLU B OE1 1 
ATOM   3102 O  OE2 . GLU B 1 187 ? 10.018  21.586  8.300   1.00 32.67 ? 187 GLU B OE2 1 
ATOM   3103 N  N   . PHE B 1 188 ? 12.514  26.572  11.405  1.00 20.56 ? 188 PHE B N   1 
ATOM   3104 C  CA  . PHE B 1 188 ? 12.562  27.434  12.587  1.00 19.48 ? 188 PHE B CA  1 
ATOM   3105 C  C   . PHE B 1 188 ? 11.501  28.541  12.573  1.00 20.89 ? 188 PHE B C   1 
ATOM   3106 O  O   . PHE B 1 188 ? 10.940  28.897  13.616  1.00 20.50 ? 188 PHE B O   1 
ATOM   3107 C  CB  . PHE B 1 188 ? 13.963  28.056  12.700  1.00 16.90 ? 188 PHE B CB  1 
ATOM   3108 C  CG  . PHE B 1 188 ? 14.110  29.072  13.805  1.00 15.22 ? 188 PHE B CG  1 
ATOM   3109 C  CD1 . PHE B 1 188 ? 13.808  28.748  15.121  1.00 15.38 ? 188 PHE B CD1 1 
ATOM   3110 C  CD2 . PHE B 1 188 ? 14.594  30.346  13.528  1.00 16.23 ? 188 PHE B CD2 1 
ATOM   3111 C  CE1 . PHE B 1 188 ? 13.990  29.677  16.148  1.00 14.48 ? 188 PHE B CE1 1 
ATOM   3112 C  CE2 . PHE B 1 188 ? 14.779  31.281  14.545  1.00 16.45 ? 188 PHE B CE2 1 
ATOM   3113 C  CZ  . PHE B 1 188 ? 14.477  30.943  15.860  1.00 15.31 ? 188 PHE B CZ  1 
ATOM   3114 N  N   . TRP B 1 189 ? 11.226  29.088  11.396  1.00 22.10 ? 189 TRP B N   1 
ATOM   3115 C  CA  . TRP B 1 189 ? 10.244  30.162  11.281  1.00 23.83 ? 189 TRP B CA  1 
ATOM   3116 C  C   . TRP B 1 189 ? 8.856   29.742  11.762  1.00 24.14 ? 189 TRP B C   1 
ATOM   3117 O  O   . TRP B 1 189 ? 8.047   30.582  12.160  1.00 24.05 ? 189 TRP B O   1 
ATOM   3118 C  CB  . TRP B 1 189 ? 10.173  30.659  9.833   1.00 23.71 ? 189 TRP B CB  1 
ATOM   3119 C  CG  . TRP B 1 189 ? 11.468  31.249  9.354   1.00 24.33 ? 189 TRP B CG  1 
ATOM   3120 C  CD1 . TRP B 1 189 ? 12.164  30.899  8.227   1.00 24.70 ? 189 TRP B CD1 1 
ATOM   3121 C  CD2 . TRP B 1 189 ? 12.224  32.292  9.984   1.00 23.48 ? 189 TRP B CD2 1 
ATOM   3122 N  NE1 . TRP B 1 189 ? 13.305  31.659  8.121   1.00 23.15 ? 189 TRP B NE1 1 
ATOM   3123 C  CE2 . TRP B 1 189 ? 13.366  32.522  9.184   1.00 23.28 ? 189 TRP B CE2 1 
ATOM   3124 C  CE3 . TRP B 1 189 ? 12.047  33.054  11.147  1.00 24.40 ? 189 TRP B CE3 1 
ATOM   3125 C  CZ2 . TRP B 1 189 ? 14.331  33.486  9.512   1.00 23.44 ? 189 TRP B CZ2 1 
ATOM   3126 C  CZ3 . TRP B 1 189 ? 13.008  34.014  11.472  1.00 24.31 ? 189 TRP B CZ3 1 
ATOM   3127 C  CH2 . TRP B 1 189 ? 14.135  34.220  10.655  1.00 23.08 ? 189 TRP B CH2 1 
ATOM   3128 N  N   . ASN B 1 190 ? 8.583   28.443  11.736  1.00 23.52 ? 190 ASN B N   1 
ATOM   3129 C  CA  . ASN B 1 190 ? 7.291   27.957  12.177  1.00 23.64 ? 190 ASN B CA  1 
ATOM   3130 C  C   . ASN B 1 190 ? 7.197   27.816  13.693  1.00 24.99 ? 190 ASN B C   1 
ATOM   3131 O  O   . ASN B 1 190 ? 6.099   27.692  14.230  1.00 25.92 ? 190 ASN B O   1 
ATOM   3132 C  CB  . ASN B 1 190 ? 6.978   26.626  11.497  1.00 24.69 ? 190 ASN B CB  1 
ATOM   3133 C  CG  . ASN B 1 190 ? 6.924   26.753  9.986   1.00 26.80 ? 190 ASN B CG  1 
ATOM   3134 O  OD1 . ASN B 1 190 ? 6.175   27.571  9.449   1.00 26.66 ? 190 ASN B OD1 1 
ATOM   3135 N  ND2 . ASN B 1 190 ? 7.724   25.952  9.293   1.00 26.12 ? 190 ASN B ND2 1 
ATOM   3136 N  N   . VAL B 1 191 ? 8.331   27.858  14.389  1.00 24.37 ? 191 VAL B N   1 
ATOM   3137 C  CA  . VAL B 1 191 ? 8.299   27.717  15.842  1.00 24.36 ? 191 VAL B CA  1 
ATOM   3138 C  C   . VAL B 1 191 ? 8.899   28.874  16.638  1.00 24.71 ? 191 VAL B C   1 
ATOM   3139 O  O   . VAL B 1 191 ? 9.014   28.791  17.859  1.00 23.73 ? 191 VAL B O   1 
ATOM   3140 C  CB  . VAL B 1 191 ? 8.974   26.398  16.286  1.00 25.35 ? 191 VAL B CB  1 
ATOM   3141 C  CG1 . VAL B 1 191 ? 8.210   25.212  15.714  1.00 24.44 ? 191 VAL B CG1 1 
ATOM   3142 C  CG2 . VAL B 1 191 ? 10.423  26.362  15.818  1.00 25.42 ? 191 VAL B CG2 1 
ATOM   3143 N  N   . VAL B 1 192 ? 9.280   29.954  15.963  1.00 25.18 ? 192 VAL B N   1 
ATOM   3144 C  CA  . VAL B 1 192 ? 9.836   31.100  16.676  1.00 26.12 ? 192 VAL B CA  1 
ATOM   3145 C  C   . VAL B 1 192 ? 8.710   31.723  17.490  1.00 26.73 ? 192 VAL B C   1 
ATOM   3146 O  O   . VAL B 1 192 ? 7.641   32.010  16.950  1.00 27.60 ? 192 VAL B O   1 
ATOM   3147 C  CB  . VAL B 1 192 ? 10.373  32.177  15.719  1.00 27.05 ? 192 VAL B CB  1 
ATOM   3148 C  CG1 . VAL B 1 192 ? 11.077  33.265  16.518  1.00 27.32 ? 192 VAL B CG1 1 
ATOM   3149 C  CG2 . VAL B 1 192 ? 11.317  31.562  14.714  1.00 29.68 ? 192 VAL B CG2 1 
ATOM   3150 N  N   . ASN B 1 193 ? 8.940   31.932  18.782  1.00 25.99 ? 193 ASN B N   1 
ATOM   3151 C  CA  . ASN B 1 193 ? 7.918   32.526  19.634  1.00 25.38 ? 193 ASN B CA  1 
ATOM   3152 C  C   . ASN B 1 193 ? 7.966   34.041  19.530  1.00 24.75 ? 193 ASN B C   1 
ATOM   3153 O  O   . ASN B 1 193 ? 8.717   34.694  20.254  1.00 24.25 ? 193 ASN B O   1 
ATOM   3154 C  CB  . ASN B 1 193 ? 8.129   32.136  21.091  1.00 27.08 ? 193 ASN B CB  1 
ATOM   3155 C  CG  . ASN B 1 193 ? 6.974   32.567  21.970  1.00 29.56 ? 193 ASN B CG  1 
ATOM   3156 O  OD1 . ASN B 1 193 ? 6.386   33.639  21.770  1.00 29.28 ? 193 ASN B OD1 1 
ATOM   3157 N  ND2 . ASN B 1 193 ? 6.644   31.740  22.952  1.00 28.37 ? 193 ASN B ND2 1 
ATOM   3158 N  N   . TRP B 1 194 ? 7.157   34.607  18.643  1.00 24.19 ? 194 TRP B N   1 
ATOM   3159 C  CA  . TRP B 1 194 ? 7.155   36.051  18.473  1.00 23.88 ? 194 TRP B CA  1 
ATOM   3160 C  C   . TRP B 1 194 ? 6.637   36.814  19.688  1.00 24.11 ? 194 TRP B C   1 
ATOM   3161 O  O   . TRP B 1 194 ? 7.023   37.966  19.901  1.00 24.58 ? 194 TRP B O   1 
ATOM   3162 C  CB  . TRP B 1 194 ? 6.366   36.439  17.221  1.00 24.34 ? 194 TRP B CB  1 
ATOM   3163 C  CG  . TRP B 1 194 ? 7.035   35.985  15.960  1.00 22.18 ? 194 TRP B CG  1 
ATOM   3164 C  CD1 . TRP B 1 194 ? 6.588   35.032  15.089  1.00 21.45 ? 194 TRP B CD1 1 
ATOM   3165 C  CD2 . TRP B 1 194 ? 8.293   36.441  15.447  1.00 20.94 ? 194 TRP B CD2 1 
ATOM   3166 N  NE1 . TRP B 1 194 ? 7.490   34.867  14.066  1.00 21.33 ? 194 TRP B NE1 1 
ATOM   3167 C  CE2 . TRP B 1 194 ? 8.546   35.719  14.260  1.00 21.72 ? 194 TRP B CE2 1 
ATOM   3168 C  CE3 . TRP B 1 194 ? 9.232   37.388  15.877  1.00 21.61 ? 194 TRP B CE3 1 
ATOM   3169 C  CZ2 . TRP B 1 194 ? 9.703   35.916  13.493  1.00 21.74 ? 194 TRP B CZ2 1 
ATOM   3170 C  CZ3 . TRP B 1 194 ? 10.383  37.584  15.115  1.00 21.93 ? 194 TRP B CZ3 1 
ATOM   3171 C  CH2 . TRP B 1 194 ? 10.606  36.849  13.935  1.00 21.42 ? 194 TRP B CH2 1 
ATOM   3172 N  N   . ASP B 1 195 ? 5.780   36.191  20.494  1.00 24.33 ? 195 ASP B N   1 
ATOM   3173 C  CA  . ASP B 1 195 ? 5.275   36.885  21.679  1.00 26.01 ? 195 ASP B CA  1 
ATOM   3174 C  C   . ASP B 1 195 ? 6.424   37.133  22.659  1.00 26.45 ? 195 ASP B C   1 
ATOM   3175 O  O   . ASP B 1 195 ? 6.570   38.236  23.193  1.00 26.93 ? 195 ASP B O   1 
ATOM   3176 C  CB  . ASP B 1 195 ? 4.158   36.086  22.367  1.00 28.03 ? 195 ASP B CB  1 
ATOM   3177 C  CG  . ASP B 1 195 ? 2.967   35.828  21.449  1.00 29.99 ? 195 ASP B CG  1 
ATOM   3178 O  OD1 . ASP B 1 195 ? 2.659   36.694  20.605  1.00 31.17 ? 195 ASP B OD1 1 
ATOM   3179 O  OD2 . ASP B 1 195 ? 2.331   34.759  21.578  1.00 32.93 ? 195 ASP B OD2 1 
ATOM   3180 N  N   . GLU B 1 196 ? 7.248   36.110  22.880  1.00 26.55 ? 196 GLU B N   1 
ATOM   3181 C  CA  . GLU B 1 196 ? 8.386   36.234  23.783  1.00 25.46 ? 196 GLU B CA  1 
ATOM   3182 C  C   . GLU B 1 196 ? 9.383   37.237  23.201  1.00 24.68 ? 196 GLU B C   1 
ATOM   3183 O  O   . GLU B 1 196 ? 9.961   38.053  23.927  1.00 24.09 ? 196 GLU B O   1 
ATOM   3184 C  CB  . GLU B 1 196 ? 9.047   34.867  23.974  1.00 27.68 ? 196 GLU B CB  1 
ATOM   3185 C  CG  . GLU B 1 196 ? 10.161  34.845  25.009  1.00 31.17 ? 196 GLU B CG  1 
ATOM   3186 C  CD  . GLU B 1 196 ? 9.692   35.280  26.390  1.00 34.12 ? 196 GLU B CD  1 
ATOM   3187 O  OE1 . GLU B 1 196 ? 8.661   34.760  26.867  1.00 35.50 ? 196 GLU B OE1 1 
ATOM   3188 O  OE2 . GLU B 1 196 ? 10.364  36.137  27.003  1.00 35.37 ? 196 GLU B OE2 1 
ATOM   3189 N  N   . ALA B 1 197 ? 9.574   37.177  21.887  1.00 23.66 ? 197 ALA B N   1 
ATOM   3190 C  CA  . ALA B 1 197 ? 10.486  38.091  21.209  1.00 23.85 ? 197 ALA B CA  1 
ATOM   3191 C  C   . ALA B 1 197 ? 10.009  39.529  21.416  1.00 24.22 ? 197 ALA B C   1 
ATOM   3192 O  O   . ALA B 1 197 ? 10.803  40.423  21.718  1.00 24.40 ? 197 ALA B O   1 
ATOM   3193 C  CB  . ALA B 1 197 ? 10.538  37.764  19.721  1.00 21.86 ? 197 ALA B CB  1 
ATOM   3194 N  N   . ALA B 1 198 ? 8.705   39.744  21.252  1.00 24.59 ? 198 ALA B N   1 
ATOM   3195 C  CA  . ALA B 1 198 ? 8.124   41.072  21.428  1.00 25.35 ? 198 ALA B CA  1 
ATOM   3196 C  C   . ALA B 1 198 ? 8.304   41.527  22.870  1.00 24.97 ? 198 ALA B C   1 
ATOM   3197 O  O   . ALA B 1 198 ? 8.644   42.681  23.126  1.00 25.72 ? 198 ALA B O   1 
ATOM   3198 C  CB  . ALA B 1 198 ? 6.645   41.054  21.068  1.00 25.84 ? 198 ALA B CB  1 
ATOM   3199 N  N   . ALA B 1 199 ? 8.085   40.611  23.810  1.00 24.76 ? 199 ALA B N   1 
ATOM   3200 C  CA  . ALA B 1 199 ? 8.237   40.924  25.228  1.00 26.11 ? 199 ALA B CA  1 
ATOM   3201 C  C   . ALA B 1 199 ? 9.652   41.412  25.538  1.00 27.79 ? 199 ALA B C   1 
ATOM   3202 O  O   . ALA B 1 199 ? 9.834   42.434  26.206  1.00 28.45 ? 199 ALA B O   1 
ATOM   3203 C  CB  . ALA B 1 199 ? 7.912   39.699  26.070  1.00 25.68 ? 199 ALA B CB  1 
ATOM   3204 N  N   . ARG B 1 200 ? 10.653  40.682  25.050  1.00 28.70 ? 200 ARG B N   1 
ATOM   3205 C  CA  . ARG B 1 200 ? 12.045  41.051  25.287  1.00 28.20 ? 200 ARG B CA  1 
ATOM   3206 C  C   . ARG B 1 200 ? 12.371  42.388  24.629  1.00 29.43 ? 200 ARG B C   1 
ATOM   3207 O  O   . ARG B 1 200 ? 13.134  43.188  25.172  1.00 29.54 ? 200 ARG B O   1 
ATOM   3208 C  CB  . ARG B 1 200 ? 12.983  39.960  24.756  1.00 27.47 ? 200 ARG B CB  1 
ATOM   3209 C  CG  . ARG B 1 200 ? 12.830  38.610  25.453  1.00 26.14 ? 200 ARG B CG  1 
ATOM   3210 C  CD  . ARG B 1 200 ? 13.820  37.590  24.913  1.00 25.96 ? 200 ARG B CD  1 
ATOM   3211 N  NE  . ARG B 1 200 ? 15.208  38.001  25.120  1.00 25.70 ? 200 ARG B NE  1 
ATOM   3212 C  CZ  . ARG B 1 200 ? 15.891  37.824  26.249  1.00 26.69 ? 200 ARG B CZ  1 
ATOM   3213 N  NH1 . ARG B 1 200 ? 15.325  37.231  27.293  1.00 25.88 ? 200 ARG B NH1 1 
ATOM   3214 N  NH2 . ARG B 1 200 ? 17.147  38.245  26.336  1.00 25.12 ? 200 ARG B NH2 1 
ATOM   3215 N  N   . PHE B 1 201 ? 11.788  42.632  23.461  1.00 31.43 ? 201 PHE B N   1 
ATOM   3216 C  CA  . PHE B 1 201 ? 12.030  43.881  22.752  1.00 34.19 ? 201 PHE B CA  1 
ATOM   3217 C  C   . PHE B 1 201 ? 11.482  45.063  23.551  1.00 36.13 ? 201 PHE B C   1 
ATOM   3218 O  O   . PHE B 1 201 ? 12.057  46.154  23.546  1.00 36.24 ? 201 PHE B O   1 
ATOM   3219 C  CB  . PHE B 1 201 ? 11.376  43.851  21.371  1.00 34.73 ? 201 PHE B CB  1 
ATOM   3220 C  CG  . PHE B 1 201 ? 11.644  45.081  20.558  1.00 36.88 ? 201 PHE B CG  1 
ATOM   3221 C  CD1 . PHE B 1 201 ? 12.925  45.349  20.084  1.00 37.51 ? 201 PHE B CD1 1 
ATOM   3222 C  CD2 . PHE B 1 201 ? 10.625  45.989  20.287  1.00 37.73 ? 201 PHE B CD2 1 
ATOM   3223 C  CE1 . PHE B 1 201 ? 13.189  46.504  19.351  1.00 38.74 ? 201 PHE B CE1 1 
ATOM   3224 C  CE2 . PHE B 1 201 ? 10.877  47.147  19.556  1.00 38.24 ? 201 PHE B CE2 1 
ATOM   3225 C  CZ  . PHE B 1 201 ? 12.161  47.406  19.087  1.00 38.87 ? 201 PHE B CZ  1 
ATOM   3226 N  N   . ALA B 1 202 ? 10.367  44.836  24.238  1.00 37.78 ? 202 ALA B N   1 
ATOM   3227 C  CA  . ALA B 1 202 ? 9.737   45.872  25.046  1.00 39.99 ? 202 ALA B CA  1 
ATOM   3228 C  C   . ALA B 1 202 ? 10.569  46.185  26.289  1.00 41.96 ? 202 ALA B C   1 
ATOM   3229 O  O   . ALA B 1 202 ? 10.728  47.346  26.664  1.00 42.61 ? 202 ALA B O   1 
ATOM   3230 C  CB  . ALA B 1 202 ? 8.338   45.427  25.451  1.00 38.77 ? 202 ALA B CB  1 
ATOM   3231 N  N   . ALA B 1 203 ? 11.100  45.144  26.924  1.00 44.18 ? 203 ALA B N   1 
ATOM   3232 C  CA  . ALA B 1 203 ? 11.909  45.306  28.128  1.00 45.97 ? 203 ALA B CA  1 
ATOM   3233 C  C   . ALA B 1 203 ? 13.236  45.991  27.827  1.00 48.30 ? 203 ALA B C   1 
ATOM   3234 O  O   . ALA B 1 203 ? 13.679  46.860  28.578  1.00 47.95 ? 203 ALA B O   1 
ATOM   3235 C  CB  . ALA B 1 203 ? 12.159  43.951  28.769  1.00 45.65 ? 203 ALA B CB  1 
ATOM   3236 N  N   . LYS B 1 204 ? 13.870  45.586  26.729  1.00 51.80 ? 204 LYS B N   1 
ATOM   3237 C  CA  . LYS B 1 204 ? 15.153  46.149  26.306  1.00 54.60 ? 204 LYS B CA  1 
ATOM   3238 C  C   . LYS B 1 204 ? 16.290  45.838  27.268  1.00 56.88 ? 204 LYS B C   1 
ATOM   3239 O  O   . LYS B 1 204 ? 17.430  46.255  27.049  1.00 57.30 ? 204 LYS B O   1 
ATOM   3240 C  CB  . LYS B 1 204 ? 15.035  47.666  26.137  1.00 54.87 ? 204 LYS B CB  1 
ATOM   3241 C  CG  . LYS B 1 204 ? 14.267  48.076  24.898  1.00 55.54 ? 204 LYS B CG  1 
ATOM   3242 C  CD  . LYS B 1 204 ? 14.017  49.569  24.855  1.00 55.15 ? 204 LYS B CD  1 
ATOM   3243 C  CE  . LYS B 1 204 ? 13.474  49.972  23.492  1.00 55.65 ? 204 LYS B CE  1 
ATOM   3244 N  NZ  . LYS B 1 204 ? 12.338  49.107  23.058  1.00 54.32 ? 204 LYS B NZ  1 
ATOM   3245 N  N   . LYS B 1 205 ? 15.975  45.104  28.330  1.00 59.09 ? 205 LYS B N   1 
ATOM   3246 C  CA  . LYS B 1 205 ? 16.971  44.751  29.332  1.00 61.10 ? 205 LYS B CA  1 
ATOM   3247 C  C   . LYS B 1 205 ? 16.592  43.433  30.001  1.00 61.41 ? 205 LYS B C   1 
ATOM   3248 O  O   . LYS B 1 205 ? 15.508  42.898  29.678  1.00 61.35 ? 205 LYS B O   1 
ATOM   3249 C  CB  . LYS B 1 205 ? 17.064  45.871  30.377  1.00 62.89 ? 205 LYS B CB  1 
ATOM   3250 C  CG  . LYS B 1 205 ? 18.275  45.788  31.297  1.00 65.03 ? 205 LYS B CG  1 
ATOM   3251 C  CD  . LYS B 1 205 ? 18.309  46.952  32.288  1.00 66.15 ? 205 LYS B CD  1 
ATOM   3252 C  CE  . LYS B 1 205 ? 17.111  46.924  33.233  1.00 67.06 ? 205 LYS B CE  1 
ATOM   3253 N  NZ  . LYS B 1 205 ? 17.194  47.986  34.275  1.00 67.05 ? 205 LYS B NZ  1 
ATOM   3254 O  OXT . LYS B 1 205 ? 17.382  42.949  30.839  1.00 62.84 ? 205 LYS B OXT 1 
ATOM   3255 N  N   . SER C 1 1   ? 79.336  11.725  55.352  1.00 28.71 ? 1   SER C N   1 
ATOM   3256 C  CA  . SER C 1 1   ? 79.533  12.872  54.420  1.00 28.51 ? 1   SER C CA  1 
ATOM   3257 C  C   . SER C 1 1   ? 80.801  12.704  53.593  1.00 26.96 ? 1   SER C C   1 
ATOM   3258 O  O   . SER C 1 1   ? 81.756  12.056  54.024  1.00 27.03 ? 1   SER C O   1 
ATOM   3259 C  CB  . SER C 1 1   ? 79.603  14.190  55.207  1.00 29.31 ? 1   SER C CB  1 
ATOM   3260 O  OG  . SER C 1 1   ? 78.306  14.638  55.589  1.00 30.18 ? 1   SER C OG  1 
ATOM   3261 N  N   . TYR C 1 2   ? 80.806  13.279  52.395  1.00 24.78 ? 2   TYR C N   1 
ATOM   3262 C  CA  . TYR C 1 2   ? 81.977  13.196  51.537  1.00 22.22 ? 2   TYR C CA  1 
ATOM   3263 C  C   . TYR C 1 2   ? 82.947  14.301  51.930  1.00 20.38 ? 2   TYR C C   1 
ATOM   3264 O  O   . TYR C 1 2   ? 82.565  15.280  52.568  1.00 18.27 ? 2   TYR C O   1 
ATOM   3265 C  CB  . TYR C 1 2   ? 81.596  13.377  50.069  1.00 22.55 ? 2   TYR C CB  1 
ATOM   3266 C  CG  . TYR C 1 2   ? 80.573  12.397  49.551  1.00 23.84 ? 2   TYR C CG  1 
ATOM   3267 C  CD1 . TYR C 1 2   ? 80.654  11.040  49.859  1.00 25.09 ? 2   TYR C CD1 1 
ATOM   3268 C  CD2 . TYR C 1 2   ? 79.547  12.819  48.709  1.00 25.28 ? 2   TYR C CD2 1 
ATOM   3269 C  CE1 . TYR C 1 2   ? 79.735  10.125  49.339  1.00 25.88 ? 2   TYR C CE1 1 
ATOM   3270 C  CE2 . TYR C 1 2   ? 78.627  11.915  48.182  1.00 26.33 ? 2   TYR C CE2 1 
ATOM   3271 C  CZ  . TYR C 1 2   ? 78.727  10.572  48.501  1.00 26.24 ? 2   TYR C CZ  1 
ATOM   3272 O  OH  . TYR C 1 2   ? 77.820  9.682   47.979  1.00 28.46 ? 2   TYR C OH  1 
ATOM   3273 N  N   . THR C 1 3   ? 84.206  14.133  51.552  1.00 20.04 ? 3   THR C N   1 
ATOM   3274 C  CA  . THR C 1 3   ? 85.230  15.125  51.835  1.00 18.74 ? 3   THR C CA  1 
ATOM   3275 C  C   . THR C 1 3   ? 85.986  15.341  50.536  1.00 17.34 ? 3   THR C C   1 
ATOM   3276 O  O   . THR C 1 3   ? 86.023  14.458  49.679  1.00 17.76 ? 3   THR C O   1 
ATOM   3277 C  CB  . THR C 1 3   ? 86.235  14.635  52.913  1.00 20.65 ? 3   THR C CB  1 
ATOM   3278 O  OG1 . THR C 1 3   ? 86.771  13.366  52.517  1.00 23.45 ? 3   THR C OG1 1 
ATOM   3279 C  CG2 . THR C 1 3   ? 85.559  14.498  54.276  1.00 18.91 ? 3   THR C CG2 1 
ATOM   3280 N  N   . LEU C 1 4   ? 86.574  16.518  50.380  1.00 15.54 ? 4   LEU C N   1 
ATOM   3281 C  CA  . LEU C 1 4   ? 87.341  16.800  49.183  1.00 15.60 ? 4   LEU C CA  1 
ATOM   3282 C  C   . LEU C 1 4   ? 88.594  15.938  49.277  1.00 15.92 ? 4   LEU C C   1 
ATOM   3283 O  O   . LEU C 1 4   ? 89.337  16.011  50.257  1.00 17.47 ? 4   LEU C O   1 
ATOM   3284 C  CB  . LEU C 1 4   ? 87.735  18.279  49.136  1.00 14.05 ? 4   LEU C CB  1 
ATOM   3285 C  CG  . LEU C 1 4   ? 88.499  18.720  47.881  1.00 14.31 ? 4   LEU C CG  1 
ATOM   3286 C  CD1 . LEU C 1 4   ? 87.552  18.720  46.704  1.00 10.77 ? 4   LEU C CD1 1 
ATOM   3287 C  CD2 . LEU C 1 4   ? 89.096  20.104  48.082  1.00 11.09 ? 4   LEU C CD2 1 
ATOM   3288 N  N   . PRO C 1 5   ? 88.835  15.082  48.280  1.00 15.82 ? 5   PRO C N   1 
ATOM   3289 C  CA  . PRO C 1 5   ? 90.047  14.265  48.379  1.00 15.51 ? 5   PRO C CA  1 
ATOM   3290 C  C   . PRO C 1 5   ? 91.291  15.139  48.164  1.00 16.63 ? 5   PRO C C   1 
ATOM   3291 O  O   . PRO C 1 5   ? 91.252  16.125  47.420  1.00 15.35 ? 5   PRO C O   1 
ATOM   3292 C  CB  . PRO C 1 5   ? 89.854  13.237  47.267  1.00 15.43 ? 5   PRO C CB  1 
ATOM   3293 C  CG  . PRO C 1 5   ? 89.076  14.010  46.240  1.00 15.72 ? 5   PRO C CG  1 
ATOM   3294 C  CD  . PRO C 1 5   ? 88.060  14.742  47.075  1.00 14.85 ? 5   PRO C CD  1 
ATOM   3295 N  N   . SER C 1 6   ? 92.386  14.802  48.831  1.00 15.23 ? 6   SER C N   1 
ATOM   3296 C  CA  . SER C 1 6   ? 93.605  15.570  48.649  1.00 17.56 ? 6   SER C CA  1 
ATOM   3297 C  C   . SER C 1 6   ? 94.288  15.002  47.404  1.00 18.26 ? 6   SER C C   1 
ATOM   3298 O  O   . SER C 1 6   ? 94.229  13.797  47.152  1.00 18.71 ? 6   SER C O   1 
ATOM   3299 C  CB  . SER C 1 6   ? 94.503  15.427  49.875  1.00 19.86 ? 6   SER C CB  1 
ATOM   3300 O  OG  . SER C 1 6   ? 94.809  14.065  50.112  1.00 23.72 ? 6   SER C OG  1 
ATOM   3301 N  N   . LEU C 1 7   ? 94.915  15.866  46.614  1.00 18.42 ? 7   LEU C N   1 
ATOM   3302 C  CA  . LEU C 1 7   ? 95.585  15.423  45.397  1.00 18.83 ? 7   LEU C CA  1 
ATOM   3303 C  C   . LEU C 1 7   ? 96.799  14.565  45.703  1.00 17.84 ? 7   LEU C C   1 
ATOM   3304 O  O   . LEU C 1 7   ? 97.415  14.706  46.755  1.00 18.94 ? 7   LEU C O   1 
ATOM   3305 C  CB  . LEU C 1 7   ? 96.032  16.622  44.565  1.00 19.47 ? 7   LEU C CB  1 
ATOM   3306 C  CG  . LEU C 1 7   ? 94.965  17.562  44.005  1.00 20.95 ? 7   LEU C CG  1 
ATOM   3307 C  CD1 . LEU C 1 7   ? 95.662  18.648  43.180  1.00 20.24 ? 7   LEU C CD1 1 
ATOM   3308 C  CD2 . LEU C 1 7   ? 93.969  16.784  43.149  1.00 17.64 ? 7   LEU C CD2 1 
ATOM   3309 N  N   . PRO C 1 8   ? 97.151  13.653  44.786  1.00 17.11 ? 8   PRO C N   1 
ATOM   3310 C  CA  . PRO C 1 8   ? 98.310  12.773  44.972  1.00 17.23 ? 8   PRO C CA  1 
ATOM   3311 C  C   . PRO C 1 8   ? 99.592  13.378  44.385  1.00 15.79 ? 8   PRO C C   1 
ATOM   3312 O  O   . PRO C 1 8   ? 100.538 12.667  44.058  1.00 17.10 ? 8   PRO C O   1 
ATOM   3313 C  CB  . PRO C 1 8   ? 97.874  11.495  44.262  1.00 17.83 ? 8   PRO C CB  1 
ATOM   3314 C  CG  . PRO C 1 8   ? 97.113  12.030  43.095  1.00 17.80 ? 8   PRO C CG  1 
ATOM   3315 C  CD  . PRO C 1 8   ? 96.288  13.158  43.697  1.00 17.22 ? 8   PRO C CD  1 
ATOM   3316 N  N   . TYR C 1 9   ? 99.601  14.699  44.252  1.00 15.15 ? 9   TYR C N   1 
ATOM   3317 C  CA  . TYR C 1 9   ? 100.737 15.448  43.719  1.00 14.69 ? 9   TYR C CA  1 
ATOM   3318 C  C   . TYR C 1 9   ? 100.435 16.918  43.951  1.00 13.51 ? 9   TYR C C   1 
ATOM   3319 O  O   . TYR C 1 9   ? 99.310  17.270  44.324  1.00 14.43 ? 9   TYR C O   1 
ATOM   3320 C  CB  . TYR C 1 9   ? 100.920 15.179  42.211  1.00 14.58 ? 9   TYR C CB  1 
ATOM   3321 C  CG  . TYR C 1 9   ? 99.624  15.163  41.434  1.00 14.53 ? 9   TYR C CG  1 
ATOM   3322 C  CD1 . TYR C 1 9   ? 98.872  16.328  41.261  1.00 15.01 ? 9   TYR C CD1 1 
ATOM   3323 C  CD2 . TYR C 1 9   ? 99.096  13.963  40.958  1.00 13.27 ? 9   TYR C CD2 1 
ATOM   3324 C  CE1 . TYR C 1 9   ? 97.616  16.291  40.644  1.00 14.06 ? 9   TYR C CE1 1 
ATOM   3325 C  CE2 . TYR C 1 9   ? 97.849  13.913  40.345  1.00 13.38 ? 9   TYR C CE2 1 
ATOM   3326 C  CZ  . TYR C 1 9   ? 97.112  15.077  40.194  1.00 14.16 ? 9   TYR C CZ  1 
ATOM   3327 O  OH  . TYR C 1 9   ? 95.859  15.013  39.633  1.00 13.74 ? 9   TYR C OH  1 
ATOM   3328 N  N   . ALA C 1 10  ? 101.431 17.774  43.737  1.00 12.87 ? 10  ALA C N   1 
ATOM   3329 C  CA  . ALA C 1 10  ? 101.260 19.214  43.926  1.00 12.42 ? 10  ALA C CA  1 
ATOM   3330 C  C   . ALA C 1 10  ? 100.500 19.838  42.753  1.00 12.69 ? 10  ALA C C   1 
ATOM   3331 O  O   . ALA C 1 10  ? 100.447 19.273  41.660  1.00 13.83 ? 10  ALA C O   1 
ATOM   3332 C  CB  . ALA C 1 10  ? 102.613 19.883  44.088  1.00 11.65 ? 10  ALA C CB  1 
ATOM   3333 N  N   . TYR C 1 11  ? 99.918  21.006  42.982  1.00 12.01 ? 11  TYR C N   1 
ATOM   3334 C  CA  . TYR C 1 11  ? 99.157  21.681  41.946  1.00 15.12 ? 11  TYR C CA  1 
ATOM   3335 C  C   . TYR C 1 11  ? 99.958  21.990  40.680  1.00 17.23 ? 11  TYR C C   1 
ATOM   3336 O  O   . TYR C 1 11  ? 99.377  22.156  39.606  1.00 18.52 ? 11  TYR C O   1 
ATOM   3337 C  CB  . TYR C 1 11  ? 98.545  22.970  42.509  1.00 15.17 ? 11  TYR C CB  1 
ATOM   3338 C  CG  . TYR C 1 11  ? 97.439  22.719  43.511  1.00 14.30 ? 11  TYR C CG  1 
ATOM   3339 C  CD1 . TYR C 1 11  ? 96.260  22.081  43.125  1.00 13.89 ? 11  TYR C CD1 1 
ATOM   3340 C  CD2 . TYR C 1 11  ? 97.573  23.104  44.849  1.00 14.48 ? 11  TYR C CD2 1 
ATOM   3341 C  CE1 . TYR C 1 11  ? 95.239  21.827  44.041  1.00 14.74 ? 11  TYR C CE1 1 
ATOM   3342 C  CE2 . TYR C 1 11  ? 96.555  22.855  45.777  1.00 14.80 ? 11  TYR C CE2 1 
ATOM   3343 C  CZ  . TYR C 1 11  ? 95.391  22.213  45.361  1.00 15.02 ? 11  TYR C CZ  1 
ATOM   3344 O  OH  . TYR C 1 11  ? 94.390  21.936  46.261  1.00 15.51 ? 11  TYR C OH  1 
ATOM   3345 N  N   . ASP C 1 12  ? 101.283 22.070  40.795  1.00 16.99 ? 12  ASP C N   1 
ATOM   3346 C  CA  . ASP C 1 12  ? 102.116 22.356  39.627  1.00 16.25 ? 12  ASP C CA  1 
ATOM   3347 C  C   . ASP C 1 12  ? 102.844 21.115  39.110  1.00 15.64 ? 12  ASP C C   1 
ATOM   3348 O  O   . ASP C 1 12  ? 103.718 21.212  38.251  1.00 16.94 ? 12  ASP C O   1 
ATOM   3349 C  CB  . ASP C 1 12  ? 103.133 23.466  39.949  1.00 17.80 ? 12  ASP C CB  1 
ATOM   3350 C  CG  . ASP C 1 12  ? 104.135 23.070  41.045  1.00 19.85 ? 12  ASP C CG  1 
ATOM   3351 O  OD1 . ASP C 1 12  ? 104.085 21.935  41.565  1.00 18.87 ? 12  ASP C OD1 1 
ATOM   3352 O  OD2 . ASP C 1 12  ? 104.986 23.914  41.389  1.00 21.96 ? 12  ASP C OD2 1 
ATOM   3353 N  N   . ALA C 1 13  ? 102.468 19.949  39.618  1.00 15.40 ? 13  ALA C N   1 
ATOM   3354 C  CA  . ALA C 1 13  ? 103.109 18.706  39.212  1.00 17.04 ? 13  ALA C CA  1 
ATOM   3355 C  C   . ALA C 1 13  ? 102.810 18.282  37.778  1.00 18.12 ? 13  ALA C C   1 
ATOM   3356 O  O   . ALA C 1 13  ? 103.466 17.387  37.242  1.00 18.54 ? 13  ALA C O   1 
ATOM   3357 C  CB  . ALA C 1 13  ? 102.731 17.580  40.172  1.00 17.39 ? 13  ALA C CB  1 
ATOM   3358 N  N   . LEU C 1 14  ? 101.824 18.907  37.148  1.00 18.03 ? 14  LEU C N   1 
ATOM   3359 C  CA  . LEU C 1 14  ? 101.499 18.535  35.778  1.00 17.57 ? 14  LEU C CA  1 
ATOM   3360 C  C   . LEU C 1 14  ? 102.015 19.549  34.758  1.00 17.49 ? 14  LEU C C   1 
ATOM   3361 O  O   . LEU C 1 14  ? 101.747 19.429  33.562  1.00 17.14 ? 14  LEU C O   1 
ATOM   3362 C  CB  . LEU C 1 14  ? 99.987  18.325  35.635  1.00 16.99 ? 14  LEU C CB  1 
ATOM   3363 C  CG  . LEU C 1 14  ? 99.436  17.257  36.594  1.00 16.65 ? 14  LEU C CG  1 
ATOM   3364 C  CD1 . LEU C 1 14  ? 97.968  17.031  36.319  1.00 14.23 ? 14  LEU C CD1 1 
ATOM   3365 C  CD2 . LEU C 1 14  ? 100.217 15.954  36.437  1.00 15.21 ? 14  LEU C CD2 1 
ATOM   3366 N  N   . GLU C 1 15  ? 102.753 20.550  35.232  1.00 16.02 ? 15  GLU C N   1 
ATOM   3367 C  CA  . GLU C 1 15  ? 103.331 21.542  34.332  1.00 18.08 ? 15  GLU C CA  1 
ATOM   3368 C  C   . GLU C 1 15  ? 104.340 20.784  33.476  1.00 18.47 ? 15  GLU C C   1 
ATOM   3369 O  O   . GLU C 1 15  ? 104.915 19.796  33.926  1.00 20.03 ? 15  GLU C O   1 
ATOM   3370 C  CB  . GLU C 1 15  ? 104.054 22.631  35.122  1.00 17.92 ? 15  GLU C CB  1 
ATOM   3371 C  CG  . GLU C 1 15  ? 103.135 23.541  35.928  1.00 19.72 ? 15  GLU C CG  1 
ATOM   3372 C  CD  . GLU C 1 15  ? 102.455 24.579  35.073  1.00 19.39 ? 15  GLU C CD  1 
ATOM   3373 O  OE1 . GLU C 1 15  ? 102.536 24.467  33.830  1.00 21.70 ? 15  GLU C OE1 1 
ATOM   3374 O  OE2 . GLU C 1 15  ? 101.838 25.504  35.638  1.00 20.30 ? 15  GLU C OE2 1 
ATOM   3375 N  N   . PRO C 1 16  ? 104.580 21.236  32.236  1.00 19.01 ? 16  PRO C N   1 
ATOM   3376 C  CA  . PRO C 1 16  ? 103.993 22.398  31.562  1.00 18.73 ? 16  PRO C CA  1 
ATOM   3377 C  C   . PRO C 1 16  ? 102.750 22.051  30.737  1.00 19.01 ? 16  PRO C C   1 
ATOM   3378 O  O   . PRO C 1 16  ? 102.354 22.814  29.860  1.00 20.28 ? 16  PRO C O   1 
ATOM   3379 C  CB  . PRO C 1 16  ? 105.129 22.857  30.666  1.00 17.85 ? 16  PRO C CB  1 
ATOM   3380 C  CG  . PRO C 1 16  ? 105.641 21.523  30.147  1.00 17.62 ? 16  PRO C CG  1 
ATOM   3381 C  CD  . PRO C 1 16  ? 105.646 20.638  31.403  1.00 18.82 ? 16  PRO C CD  1 
ATOM   3382 N  N   . HIS C 1 17  ? 102.141 20.906  31.012  1.00 18.64 ? 17  HIS C N   1 
ATOM   3383 C  CA  . HIS C 1 17  ? 100.965 20.469  30.264  1.00 18.50 ? 17  HIS C CA  1 
ATOM   3384 C  C   . HIS C 1 17  ? 99.668  21.096  30.773  1.00 18.47 ? 17  HIS C C   1 
ATOM   3385 O  O   . HIS C 1 17  ? 98.964  21.779  30.023  1.00 18.26 ? 17  HIS C O   1 
ATOM   3386 C  CB  . HIS C 1 17  ? 100.888 18.948  30.319  1.00 20.33 ? 17  HIS C CB  1 
ATOM   3387 C  CG  . HIS C 1 17  ? 102.200 18.283  30.042  1.00 23.89 ? 17  HIS C CG  1 
ATOM   3388 N  ND1 . HIS C 1 17  ? 102.898 18.480  28.870  1.00 24.33 ? 17  HIS C ND1 1 
ATOM   3389 C  CD2 . HIS C 1 17  ? 102.961 17.458  30.799  1.00 25.87 ? 17  HIS C CD2 1 
ATOM   3390 C  CE1 . HIS C 1 17  ? 104.033 17.806  28.916  1.00 25.32 ? 17  HIS C CE1 1 
ATOM   3391 N  NE2 . HIS C 1 17  ? 104.097 17.178  30.076  1.00 26.79 ? 17  HIS C NE2 1 
ATOM   3392 N  N   . PHE C 1 18  ? 99.345  20.847  32.039  1.00 17.12 ? 18  PHE C N   1 
ATOM   3393 C  CA  . PHE C 1 18  ? 98.151  21.420  32.662  1.00 15.04 ? 18  PHE C CA  1 
ATOM   3394 C  C   . PHE C 1 18  ? 98.647  22.511  33.608  1.00 15.20 ? 18  PHE C C   1 
ATOM   3395 O  O   . PHE C 1 18  ? 99.517  22.261  34.448  1.00 13.64 ? 18  PHE C O   1 
ATOM   3396 C  CB  . PHE C 1 18  ? 97.381  20.351  33.444  1.00 13.77 ? 18  PHE C CB  1 
ATOM   3397 C  CG  . PHE C 1 18  ? 96.566  19.423  32.580  1.00 13.32 ? 18  PHE C CG  1 
ATOM   3398 C  CD1 . PHE C 1 18  ? 96.645  19.481  31.193  1.00 14.14 ? 18  PHE C CD1 1 
ATOM   3399 C  CD2 . PHE C 1 18  ? 95.703  18.499  33.160  1.00 15.57 ? 18  PHE C CD2 1 
ATOM   3400 C  CE1 . PHE C 1 18  ? 95.873  18.635  30.395  1.00 14.27 ? 18  PHE C CE1 1 
ATOM   3401 C  CE2 . PHE C 1 18  ? 94.925  17.646  32.369  1.00 16.28 ? 18  PHE C CE2 1 
ATOM   3402 C  CZ  . PHE C 1 18  ? 95.012  17.716  30.985  1.00 13.76 ? 18  PHE C CZ  1 
ATOM   3403 N  N   . ASP C 1 19  ? 98.101  23.718  33.471  1.00 14.78 ? 19  ASP C N   1 
ATOM   3404 C  CA  . ASP C 1 19  ? 98.540  24.840  34.292  1.00 13.39 ? 19  ASP C CA  1 
ATOM   3405 C  C   . ASP C 1 19  ? 98.187  24.733  35.770  1.00 15.75 ? 19  ASP C C   1 
ATOM   3406 O  O   . ASP C 1 19  ? 97.121  24.241  36.153  1.00 14.93 ? 19  ASP C O   1 
ATOM   3407 C  CB  . ASP C 1 19  ? 98.014  26.159  33.717  1.00 11.31 ? 19  ASP C CB  1 
ATOM   3408 C  CG  . ASP C 1 19  ? 96.506  26.187  33.599  1.00 12.56 ? 19  ASP C CG  1 
ATOM   3409 O  OD1 . ASP C 1 19  ? 95.948  25.317  32.900  1.00 12.33 ? 19  ASP C OD1 1 
ATOM   3410 O  OD2 . ASP C 1 19  ? 95.876  27.079  34.204  1.00 13.53 ? 19  ASP C OD2 1 
ATOM   3411 N  N   . LYS C 1 20  ? 99.116  25.206  36.591  1.00 17.87 ? 20  LYS C N   1 
ATOM   3412 C  CA  . LYS C 1 20  ? 98.995  25.198  38.042  1.00 19.49 ? 20  LYS C CA  1 
ATOM   3413 C  C   . LYS C 1 20  ? 97.745  25.933  38.542  1.00 18.43 ? 20  LYS C C   1 
ATOM   3414 O  O   . LYS C 1 20  ? 97.044  25.453  39.436  1.00 16.70 ? 20  LYS C O   1 
ATOM   3415 C  CB  . LYS C 1 20  ? 100.251 25.844  38.630  1.00 23.04 ? 20  LYS C CB  1 
ATOM   3416 C  CG  . LYS C 1 20  ? 100.246 25.995  40.129  1.00 29.38 ? 20  LYS C CG  1 
ATOM   3417 C  CD  . LYS C 1 20  ? 101.316 26.978  40.578  1.00 34.09 ? 20  LYS C CD  1 
ATOM   3418 C  CE  . LYS C 1 20  ? 101.454 26.946  42.090  1.00 36.88 ? 20  LYS C CE  1 
ATOM   3419 N  NZ  . LYS C 1 20  ? 100.112 26.998  42.739  1.00 41.38 ? 20  LYS C NZ  1 
ATOM   3420 N  N   . GLN C 1 21  ? 97.471  27.097  37.963  1.00 16.61 ? 21  GLN C N   1 
ATOM   3421 C  CA  . GLN C 1 21  ? 96.324  27.898  38.368  1.00 17.31 ? 21  GLN C CA  1 
ATOM   3422 C  C   . GLN C 1 21  ? 94.994  27.154  38.205  1.00 16.28 ? 21  GLN C C   1 
ATOM   3423 O  O   . GLN C 1 21  ? 94.146  27.185  39.094  1.00 16.77 ? 21  GLN C O   1 
ATOM   3424 C  CB  . GLN C 1 21  ? 96.299  29.198  37.569  1.00 20.55 ? 21  GLN C CB  1 
ATOM   3425 C  CG  . GLN C 1 21  ? 95.315  30.223  38.099  1.00 27.11 ? 21  GLN C CG  1 
ATOM   3426 C  CD  . GLN C 1 21  ? 95.234  31.470  37.229  1.00 30.58 ? 21  GLN C CD  1 
ATOM   3427 O  OE1 . GLN C 1 21  ? 94.644  32.473  37.626  1.00 33.09 ? 21  GLN C OE1 1 
ATOM   3428 N  NE2 . GLN C 1 21  ? 95.818  31.407  36.032  1.00 32.59 ? 21  GLN C NE2 1 
ATOM   3429 N  N   . THR C 1 22  ? 94.814  26.485  37.071  1.00 14.73 ? 22  THR C N   1 
ATOM   3430 C  CA  . THR C 1 22  ? 93.591  25.736  36.818  1.00 13.77 ? 22  THR C CA  1 
ATOM   3431 C  C   . THR C 1 22  ? 93.453  24.560  37.790  1.00 13.90 ? 22  THR C C   1 
ATOM   3432 O  O   . THR C 1 22  ? 92.381  24.339  38.358  1.00 13.75 ? 22  THR C O   1 
ATOM   3433 C  CB  . THR C 1 22  ? 93.558  25.216  35.362  1.00 13.18 ? 22  THR C CB  1 
ATOM   3434 O  OG1 . THR C 1 22  ? 93.521  26.330  34.466  1.00 13.89 ? 22  THR C OG1 1 
ATOM   3435 C  CG2 . THR C 1 22  ? 92.332  24.348  35.120  1.00 10.88 ? 22  THR C CG2 1 
ATOM   3436 N  N   . MET C 1 23  ? 94.535  23.810  37.982  1.00 13.10 ? 23  MET C N   1 
ATOM   3437 C  CA  . MET C 1 23  ? 94.506  22.671  38.892  1.00 15.46 ? 23  MET C CA  1 
ATOM   3438 C  C   . MET C 1 23  ? 93.976  23.100  40.254  1.00 15.23 ? 23  MET C C   1 
ATOM   3439 O  O   . MET C 1 23  ? 93.135  22.431  40.847  1.00 16.33 ? 23  MET C O   1 
ATOM   3440 C  CB  . MET C 1 23  ? 95.909  22.075  39.072  1.00 15.95 ? 23  MET C CB  1 
ATOM   3441 C  CG  . MET C 1 23  ? 96.473  21.377  37.846  1.00 15.21 ? 23  MET C CG  1 
ATOM   3442 S  SD  . MET C 1 23  ? 95.447  20.013  37.271  1.00 15.83 ? 23  MET C SD  1 
ATOM   3443 C  CE  . MET C 1 23  ? 95.570  18.895  38.663  1.00 16.60 ? 23  MET C CE  1 
ATOM   3444 N  N   . GLU C 1 24  ? 94.466  24.233  40.735  1.00 16.04 ? 24  GLU C N   1 
ATOM   3445 C  CA  . GLU C 1 24  ? 94.065  24.753  42.033  1.00 18.51 ? 24  GLU C CA  1 
ATOM   3446 C  C   . GLU C 1 24  ? 92.591  25.147  42.109  1.00 17.04 ? 24  GLU C C   1 
ATOM   3447 O  O   . GLU C 1 24  ? 91.884  24.763  43.045  1.00 16.91 ? 24  GLU C O   1 
ATOM   3448 C  CB  . GLU C 1 24  ? 94.932  25.954  42.383  1.00 20.57 ? 24  GLU C CB  1 
ATOM   3449 C  CG  . GLU C 1 24  ? 95.326  26.013  43.833  1.00 29.58 ? 24  GLU C CG  1 
ATOM   3450 C  CD  . GLU C 1 24  ? 96.220  27.200  44.126  1.00 35.37 ? 24  GLU C CD  1 
ATOM   3451 O  OE1 . GLU C 1 24  ? 97.163  27.443  43.332  1.00 36.64 ? 24  GLU C OE1 1 
ATOM   3452 O  OE2 . GLU C 1 24  ? 95.982  27.881  45.151  1.00 37.15 ? 24  GLU C OE2 1 
ATOM   3453 N  N   . ILE C 1 25  ? 92.134  25.924  41.132  1.00 15.28 ? 25  ILE C N   1 
ATOM   3454 C  CA  . ILE C 1 25  ? 90.746  26.370  41.097  1.00 14.51 ? 25  ILE C CA  1 
ATOM   3455 C  C   . ILE C 1 25  ? 89.806  25.189  40.874  1.00 13.85 ? 25  ILE C C   1 
ATOM   3456 O  O   . ILE C 1 25  ? 88.782  25.053  41.538  1.00 12.93 ? 25  ILE C O   1 
ATOM   3457 C  CB  . ILE C 1 25  ? 90.532  27.397  39.966  1.00 14.79 ? 25  ILE C CB  1 
ATOM   3458 C  CG1 . ILE C 1 25  ? 91.274  28.694  40.298  1.00 15.44 ? 25  ILE C CG1 1 
ATOM   3459 C  CG2 . ILE C 1 25  ? 89.048  27.659  39.768  1.00 14.54 ? 25  ILE C CG2 1 
ATOM   3460 C  CD1 . ILE C 1 25  ? 91.344  29.659  39.132  1.00 17.11 ? 25  ILE C CD1 1 
ATOM   3461 N  N   . HIS C 1 26  ? 90.177  24.333  39.934  1.00 12.55 ? 26  HIS C N   1 
ATOM   3462 C  CA  . HIS C 1 26  ? 89.382  23.170  39.588  1.00 12.69 ? 26  HIS C CA  1 
ATOM   3463 C  C   . HIS C 1 26  ? 89.139  22.287  40.821  1.00 13.00 ? 26  HIS C C   1 
ATOM   3464 O  O   . HIS C 1 26  ? 88.044  21.771  41.030  1.00 12.06 ? 26  HIS C O   1 
ATOM   3465 C  CB  . HIS C 1 26  ? 90.121  22.390  38.498  1.00 9.55  ? 26  HIS C CB  1 
ATOM   3466 C  CG  . HIS C 1 26  ? 89.247  21.473  37.709  1.00 8.60  ? 26  HIS C CG  1 
ATOM   3467 N  ND1 . HIS C 1 26  ? 89.720  20.729  36.649  1.00 9.96  ? 26  HIS C ND1 1 
ATOM   3468 C  CD2 . HIS C 1 26  ? 87.927  21.193  37.806  1.00 6.92  ? 26  HIS C CD2 1 
ATOM   3469 C  CE1 . HIS C 1 26  ? 88.728  20.032  36.127  1.00 8.79  ? 26  HIS C CE1 1 
ATOM   3470 N  NE2 . HIS C 1 26  ? 87.630  20.295  36.810  1.00 7.84  ? 26  HIS C NE2 1 
ATOM   3471 N  N   . HIS C 1 27  ? 90.171  22.144  41.645  1.00 13.40 ? 27  HIS C N   1 
ATOM   3472 C  CA  . HIS C 1 27  ? 90.112  21.320  42.839  1.00 11.78 ? 27  HIS C CA  1 
ATOM   3473 C  C   . HIS C 1 27  ? 89.424  21.971  44.036  1.00 13.19 ? 27  HIS C C   1 
ATOM   3474 O  O   . HIS C 1 27  ? 88.417  21.455  44.543  1.00 12.98 ? 27  HIS C O   1 
ATOM   3475 C  CB  . HIS C 1 27  ? 91.535  20.919  43.236  1.00 11.84 ? 27  HIS C CB  1 
ATOM   3476 C  CG  . HIS C 1 27  ? 91.607  19.997  44.416  1.00 12.36 ? 27  HIS C CG  1 
ATOM   3477 N  ND1 . HIS C 1 27  ? 92.422  20.243  45.502  1.00 11.37 ? 27  HIS C ND1 1 
ATOM   3478 C  CD2 . HIS C 1 27  ? 91.005  18.807  44.659  1.00 11.25 ? 27  HIS C CD2 1 
ATOM   3479 C  CE1 . HIS C 1 27  ? 92.321  19.245  46.361  1.00 11.30 ? 27  HIS C CE1 1 
ATOM   3480 N  NE2 . HIS C 1 27  ? 91.467  18.360  45.874  1.00 11.62 ? 27  HIS C NE2 1 
ATOM   3481 N  N   . THR C 1 28  ? 89.967  23.103  44.482  1.00 11.48 ? 28  THR C N   1 
ATOM   3482 C  CA  . THR C 1 28  ? 89.452  23.793  45.660  1.00 11.26 ? 28  THR C CA  1 
ATOM   3483 C  C   . THR C 1 28  ? 88.152  24.564  45.491  1.00 12.47 ? 28  THR C C   1 
ATOM   3484 O  O   . THR C 1 28  ? 87.528  24.936  46.483  1.00 13.98 ? 28  THR C O   1 
ATOM   3485 C  CB  . THR C 1 28  ? 90.510  24.753  46.248  1.00 11.02 ? 28  THR C CB  1 
ATOM   3486 O  OG1 . THR C 1 28  ? 90.743  25.834  45.332  1.00 10.92 ? 28  THR C OG1 1 
ATOM   3487 C  CG2 . THR C 1 28  ? 91.819  24.008  46.495  1.00 6.76  ? 28  THR C CG2 1 
ATOM   3488 N  N   . LYS C 1 29  ? 87.741  24.812  44.251  1.00 13.06 ? 29  LYS C N   1 
ATOM   3489 C  CA  . LYS C 1 29  ? 86.500  25.542  44.010  1.00 12.64 ? 29  LYS C CA  1 
ATOM   3490 C  C   . LYS C 1 29  ? 85.429  24.660  43.379  1.00 12.85 ? 29  LYS C C   1 
ATOM   3491 O  O   . LYS C 1 29  ? 84.390  24.403  43.987  1.00 12.62 ? 29  LYS C O   1 
ATOM   3492 C  CB  . LYS C 1 29  ? 86.748  26.756  43.110  1.00 15.15 ? 29  LYS C CB  1 
ATOM   3493 C  CG  . LYS C 1 29  ? 87.662  27.825  43.702  1.00 17.68 ? 29  LYS C CG  1 
ATOM   3494 C  CD  . LYS C 1 29  ? 87.196  28.241  45.085  1.00 23.29 ? 29  LYS C CD  1 
ATOM   3495 C  CE  . LYS C 1 29  ? 87.751  29.610  45.467  1.00 28.45 ? 29  LYS C CE  1 
ATOM   3496 N  NZ  . LYS C 1 29  ? 89.225  29.685  45.297  1.00 31.24 ? 29  LYS C NZ  1 
ATOM   3497 N  N   . HIS C 1 30  ? 85.684  24.187  42.163  1.00 11.49 ? 30  HIS C N   1 
ATOM   3498 C  CA  . HIS C 1 30  ? 84.720  23.352  41.459  1.00 11.71 ? 30  HIS C CA  1 
ATOM   3499 C  C   . HIS C 1 30  ? 84.411  22.042  42.169  1.00 11.83 ? 30  HIS C C   1 
ATOM   3500 O  O   . HIS C 1 30  ? 83.254  21.758  42.465  1.00 12.85 ? 30  HIS C O   1 
ATOM   3501 C  CB  . HIS C 1 30  ? 85.214  23.078  40.040  1.00 9.49  ? 30  HIS C CB  1 
ATOM   3502 C  CG  . HIS C 1 30  ? 85.260  24.299  39.175  1.00 12.08 ? 30  HIS C CG  1 
ATOM   3503 N  ND1 . HIS C 1 30  ? 84.147  24.805  38.540  1.00 10.16 ? 30  HIS C ND1 1 
ATOM   3504 C  CD2 . HIS C 1 30  ? 86.283  25.132  38.860  1.00 12.25 ? 30  HIS C CD2 1 
ATOM   3505 C  CE1 . HIS C 1 30  ? 84.480  25.894  37.869  1.00 12.54 ? 30  HIS C CE1 1 
ATOM   3506 N  NE2 . HIS C 1 30  ? 85.771  26.114  38.046  1.00 10.38 ? 30  HIS C NE2 1 
ATOM   3507 N  N   . HIS C 1 31  ? 85.437  21.244  42.449  1.00 12.41 ? 31  HIS C N   1 
ATOM   3508 C  CA  . HIS C 1 31  ? 85.210  19.971  43.111  1.00 12.21 ? 31  HIS C CA  1 
ATOM   3509 C  C   . HIS C 1 31  ? 84.649  20.180  44.519  1.00 12.03 ? 31  HIS C C   1 
ATOM   3510 O  O   . HIS C 1 31  ? 83.741  19.466  44.934  1.00 10.82 ? 31  HIS C O   1 
ATOM   3511 C  CB  . HIS C 1 31  ? 86.502  19.147  43.146  1.00 10.81 ? 31  HIS C CB  1 
ATOM   3512 C  CG  . HIS C 1 31  ? 86.282  17.704  43.490  1.00 12.04 ? 31  HIS C CG  1 
ATOM   3513 N  ND1 . HIS C 1 31  ? 87.269  16.749  43.370  1.00 8.95  ? 31  HIS C ND1 1 
ATOM   3514 C  CD2 . HIS C 1 31  ? 85.189  17.058  43.965  1.00 10.85 ? 31  HIS C CD2 1 
ATOM   3515 C  CE1 . HIS C 1 31  ? 86.794  15.578  43.757  1.00 11.12 ? 31  HIS C CE1 1 
ATOM   3516 N  NE2 . HIS C 1 31  ? 85.534  15.738  44.124  1.00 10.92 ? 31  HIS C NE2 1 
ATOM   3517 N  N   . GLN C 1 32  ? 85.174  21.166  45.241  1.00 12.17 ? 32  GLN C N   1 
ATOM   3518 C  CA  . GLN C 1 32  ? 84.684  21.440  46.588  1.00 12.80 ? 32  GLN C CA  1 
ATOM   3519 C  C   . GLN C 1 32  ? 83.181  21.713  46.571  1.00 14.10 ? 32  GLN C C   1 
ATOM   3520 O  O   . GLN C 1 32  ? 82.453  21.232  47.435  1.00 15.12 ? 32  GLN C O   1 
ATOM   3521 C  CB  . GLN C 1 32  ? 85.394  22.641  47.207  1.00 11.28 ? 32  GLN C CB  1 
ATOM   3522 C  CG  . GLN C 1 32  ? 84.897  22.948  48.609  1.00 11.91 ? 32  GLN C CG  1 
ATOM   3523 C  CD  . GLN C 1 32  ? 85.316  21.891  49.610  1.00 11.17 ? 32  GLN C CD  1 
ATOM   3524 O  OE1 . GLN C 1 32  ? 86.495  21.758  49.918  1.00 12.90 ? 32  GLN C OE1 1 
ATOM   3525 N  NE2 . GLN C 1 32  ? 84.353  21.130  50.118  1.00 10.22 ? 32  GLN C NE2 1 
ATOM   3526 N  N   . THR C 1 33  ? 82.721  22.486  45.591  1.00 12.51 ? 33  THR C N   1 
ATOM   3527 C  CA  . THR C 1 33  ? 81.301  22.808  45.480  1.00 13.56 ? 33  THR C CA  1 
ATOM   3528 C  C   . THR C 1 33  ? 80.432  21.555  45.279  1.00 13.62 ? 33  THR C C   1 
ATOM   3529 O  O   . THR C 1 33  ? 79.341  21.451  45.843  1.00 13.64 ? 33  THR C O   1 
ATOM   3530 C  CB  . THR C 1 33  ? 81.056  23.802  44.326  1.00 13.34 ? 33  THR C CB  1 
ATOM   3531 O  OG1 . THR C 1 33  ? 81.664  25.057  44.650  1.00 12.99 ? 33  THR C OG1 1 
ATOM   3532 C  CG2 . THR C 1 33  ? 79.573  24.013  44.101  1.00 13.90 ? 33  THR C CG2 1 
ATOM   3533 N  N   . PHE C 1 34  ? 80.903  20.611  44.473  1.00 11.91 ? 34  PHE C N   1 
ATOM   3534 C  CA  . PHE C 1 34  ? 80.149  19.382  44.258  1.00 12.69 ? 34  PHE C CA  1 
ATOM   3535 C  C   . PHE C 1 34  ? 80.024  18.632  45.579  1.00 14.38 ? 34  PHE C C   1 
ATOM   3536 O  O   . PHE C 1 34  ? 78.960  18.085  45.894  1.00 12.64 ? 34  PHE C O   1 
ATOM   3537 C  CB  . PHE C 1 34  ? 80.836  18.473  43.234  1.00 12.00 ? 34  PHE C CB  1 
ATOM   3538 C  CG  . PHE C 1 34  ? 80.811  19.012  41.837  1.00 12.78 ? 34  PHE C CG  1 
ATOM   3539 C  CD1 . PHE C 1 34  ? 79.625  19.486  41.283  1.00 13.15 ? 34  PHE C CD1 1 
ATOM   3540 C  CD2 . PHE C 1 34  ? 81.966  19.041  41.072  1.00 13.04 ? 34  PHE C CD2 1 
ATOM   3541 C  CE1 . PHE C 1 34  ? 79.588  19.982  39.988  1.00 14.77 ? 34  PHE C CE1 1 
ATOM   3542 C  CE2 . PHE C 1 34  ? 81.942  19.538  39.769  1.00 15.56 ? 34  PHE C CE2 1 
ATOM   3543 C  CZ  . PHE C 1 34  ? 80.750  20.009  39.227  1.00 16.02 ? 34  PHE C CZ  1 
ATOM   3544 N  N   . VAL C 1 35  ? 81.116  18.602  46.343  1.00 13.87 ? 35  VAL C N   1 
ATOM   3545 C  CA  . VAL C 1 35  ? 81.131  17.928  47.635  1.00 14.53 ? 35  VAL C CA  1 
ATOM   3546 C  C   . VAL C 1 35  ? 80.124  18.576  48.589  1.00 16.32 ? 35  VAL C C   1 
ATOM   3547 O  O   . VAL C 1 35  ? 79.348  17.880  49.245  1.00 16.35 ? 35  VAL C O   1 
ATOM   3548 C  CB  . VAL C 1 35  ? 82.543  17.970  48.277  1.00 15.16 ? 35  VAL C CB  1 
ATOM   3549 C  CG1 . VAL C 1 35  ? 82.466  17.583  49.752  1.00 13.48 ? 35  VAL C CG1 1 
ATOM   3550 C  CG2 . VAL C 1 35  ? 83.473  17.006  47.543  1.00 11.63 ? 35  VAL C CG2 1 
ATOM   3551 N  N   . ASN C 1 36  ? 80.125  19.904  48.666  1.00 15.93 ? 36  ASN C N   1 
ATOM   3552 C  CA  . ASN C 1 36  ? 79.194  20.596  49.549  1.00 15.99 ? 36  ASN C CA  1 
ATOM   3553 C  C   . ASN C 1 36  ? 77.743  20.303  49.171  1.00 16.06 ? 36  ASN C C   1 
ATOM   3554 O  O   . ASN C 1 36  ? 76.921  19.994  50.030  1.00 15.90 ? 36  ASN C O   1 
ATOM   3555 C  CB  . ASN C 1 36  ? 79.398  22.118  49.510  1.00 14.43 ? 36  ASN C CB  1 
ATOM   3556 C  CG  . ASN C 1 36  ? 80.785  22.546  49.938  1.00 14.75 ? 36  ASN C CG  1 
ATOM   3557 O  OD1 . ASN C 1 36  ? 81.477  21.833  50.665  1.00 16.38 ? 36  ASN C OD1 1 
ATOM   3558 N  ND2 . ASN C 1 36  ? 81.192  23.734  49.501  1.00 13.05 ? 36  ASN C ND2 1 
ATOM   3559 N  N   . ASN C 1 37  ? 77.427  20.420  47.886  1.00 16.65 ? 37  ASN C N   1 
ATOM   3560 C  CA  . ASN C 1 37  ? 76.062  20.188  47.428  1.00 17.21 ? 37  ASN C CA  1 
ATOM   3561 C  C   . ASN C 1 37  ? 75.578  18.760  47.635  1.00 16.55 ? 37  ASN C C   1 
ATOM   3562 O  O   . ASN C 1 37  ? 74.435  18.539  48.033  1.00 18.50 ? 37  ASN C O   1 
ATOM   3563 C  CB  . ASN C 1 37  ? 75.912  20.576  45.957  1.00 16.93 ? 37  ASN C CB  1 
ATOM   3564 C  CG  . ASN C 1 37  ? 76.051  22.067  45.737  1.00 20.25 ? 37  ASN C CG  1 
ATOM   3565 O  OD1 . ASN C 1 37  ? 75.809  22.869  46.647  1.00 19.76 ? 37  ASN C OD1 1 
ATOM   3566 N  ND2 . ASN C 1 37  ? 76.427  22.452  44.523  1.00 19.98 ? 37  ASN C ND2 1 
ATOM   3567 N  N   . ALA C 1 38  ? 76.437  17.788  47.362  1.00 15.31 ? 38  ALA C N   1 
ATOM   3568 C  CA  . ALA C 1 38  ? 76.051  16.402  47.545  1.00 14.73 ? 38  ALA C CA  1 
ATOM   3569 C  C   . ALA C 1 38  ? 75.779  16.149  49.027  1.00 16.46 ? 38  ALA C C   1 
ATOM   3570 O  O   . ALA C 1 38  ? 74.802  15.483  49.379  1.00 15.64 ? 38  ALA C O   1 
ATOM   3571 C  CB  . ALA C 1 38  ? 77.143  15.486  47.041  1.00 13.17 ? 38  ALA C CB  1 
ATOM   3572 N  N   . ASN C 1 39  ? 76.632  16.698  49.894  1.00 15.39 ? 39  ASN C N   1 
ATOM   3573 C  CA  . ASN C 1 39  ? 76.466  16.514  51.329  1.00 15.51 ? 39  ASN C CA  1 
ATOM   3574 C  C   . ASN C 1 39  ? 75.166  17.104  51.852  1.00 15.72 ? 39  ASN C C   1 
ATOM   3575 O  O   . ASN C 1 39  ? 74.511  16.503  52.705  1.00 15.77 ? 39  ASN C O   1 
ATOM   3576 C  CB  . ASN C 1 39  ? 77.637  17.120  52.106  1.00 14.25 ? 39  ASN C CB  1 
ATOM   3577 C  CG  . ASN C 1 39  ? 78.878  16.256  52.056  1.00 15.38 ? 39  ASN C CG  1 
ATOM   3578 O  OD1 . ASN C 1 39  ? 78.810  15.069  51.728  1.00 16.20 ? 39  ASN C OD1 1 
ATOM   3579 N  ND2 . ASN C 1 39  ? 80.023  16.841  52.399  1.00 12.57 ? 39  ASN C ND2 1 
ATOM   3580 N  N   . ALA C 1 40  ? 74.795  18.276  51.346  1.00 15.69 ? 40  ALA C N   1 
ATOM   3581 C  CA  . ALA C 1 40  ? 73.567  18.937  51.774  1.00 15.79 ? 40  ALA C CA  1 
ATOM   3582 C  C   . ALA C 1 40  ? 72.341  18.077  51.471  1.00 17.21 ? 40  ALA C C   1 
ATOM   3583 O  O   . ALA C 1 40  ? 71.443  17.944  52.298  1.00 17.39 ? 40  ALA C O   1 
ATOM   3584 C  CB  . ALA C 1 40  ? 73.441  20.284  51.090  1.00 13.35 ? 40  ALA C CB  1 
ATOM   3585 N  N   . ALA C 1 41  ? 72.314  17.476  50.288  1.00 18.93 ? 41  ALA C N   1 
ATOM   3586 C  CA  . ALA C 1 41  ? 71.187  16.637  49.893  1.00 20.87 ? 41  ALA C CA  1 
ATOM   3587 C  C   . ALA C 1 41  ? 71.133  15.295  50.626  1.00 22.28 ? 41  ALA C C   1 
ATOM   3588 O  O   . ALA C 1 41  ? 70.054  14.750  50.839  1.00 23.17 ? 41  ALA C O   1 
ATOM   3589 C  CB  . ALA C 1 41  ? 71.222  16.404  48.385  1.00 21.19 ? 41  ALA C CB  1 
ATOM   3590 N  N   . LEU C 1 42  ? 72.291  14.768  51.019  1.00 22.84 ? 42  LEU C N   1 
ATOM   3591 C  CA  . LEU C 1 42  ? 72.340  13.478  51.705  1.00 23.03 ? 42  LEU C CA  1 
ATOM   3592 C  C   . LEU C 1 42  ? 72.044  13.548  53.204  1.00 24.23 ? 42  LEU C C   1 
ATOM   3593 O  O   . LEU C 1 42  ? 71.783  12.523  53.836  1.00 22.43 ? 42  LEU C O   1 
ATOM   3594 C  CB  . LEU C 1 42  ? 73.700  12.806  51.471  1.00 21.39 ? 42  LEU C CB  1 
ATOM   3595 C  CG  . LEU C 1 42  ? 73.963  12.317  50.041  1.00 20.89 ? 42  LEU C CG  1 
ATOM   3596 C  CD1 . LEU C 1 42  ? 75.361  11.736  49.943  1.00 19.91 ? 42  LEU C CD1 1 
ATOM   3597 C  CD2 . LEU C 1 42  ? 72.927  11.274  49.655  1.00 19.85 ? 42  LEU C CD2 1 
ATOM   3598 N  N   . GLU C 1 43  ? 72.079  14.753  53.766  1.00 26.13 ? 43  GLU C N   1 
ATOM   3599 C  CA  . GLU C 1 43  ? 71.803  14.939  55.189  1.00 28.22 ? 43  GLU C CA  1 
ATOM   3600 C  C   . GLU C 1 43  ? 70.449  14.305  55.545  1.00 29.79 ? 43  GLU C C   1 
ATOM   3601 O  O   . GLU C 1 43  ? 70.293  13.716  56.612  1.00 29.66 ? 43  GLU C O   1 
ATOM   3602 C  CB  . GLU C 1 43  ? 71.801  16.435  55.522  1.00 27.80 ? 43  GLU C CB  1 
ATOM   3603 C  CG  . GLU C 1 43  ? 71.656  16.790  57.001  1.00 29.16 ? 43  GLU C CG  1 
ATOM   3604 C  CD  . GLU C 1 43  ? 72.771  16.225  57.861  1.00 30.80 ? 43  GLU C CD  1 
ATOM   3605 O  OE1 . GLU C 1 43  ? 73.938  16.244  57.420  1.00 32.74 ? 43  GLU C OE1 1 
ATOM   3606 O  OE2 . GLU C 1 43  ? 72.487  15.771  58.988  1.00 32.95 ? 43  GLU C OE2 1 
ATOM   3607 N  N   . SER C 1 44  ? 69.484  14.405  54.637  1.00 32.30 ? 44  SER C N   1 
ATOM   3608 C  CA  . SER C 1 44  ? 68.161  13.837  54.878  1.00 35.21 ? 44  SER C CA  1 
ATOM   3609 C  C   . SER C 1 44  ? 67.981  12.416  54.337  1.00 36.20 ? 44  SER C C   1 
ATOM   3610 O  O   . SER C 1 44  ? 66.890  11.856  54.411  1.00 37.58 ? 44  SER C O   1 
ATOM   3611 C  CB  . SER C 1 44  ? 67.076  14.752  54.293  1.00 35.72 ? 44  SER C CB  1 
ATOM   3612 O  OG  . SER C 1 44  ? 67.207  14.895  52.889  1.00 37.17 ? 44  SER C OG  1 
ATOM   3613 N  N   . LEU C 1 45  ? 69.046  11.826  53.802  1.00 36.88 ? 45  LEU C N   1 
ATOM   3614 C  CA  . LEU C 1 45  ? 68.961  10.470  53.267  1.00 37.38 ? 45  LEU C CA  1 
ATOM   3615 C  C   . LEU C 1 45  ? 69.996  9.556   53.920  1.00 38.79 ? 45  LEU C C   1 
ATOM   3616 O  O   . LEU C 1 45  ? 70.934  9.089   53.271  1.00 39.66 ? 45  LEU C O   1 
ATOM   3617 C  CB  . LEU C 1 45  ? 69.159  10.488  51.749  1.00 37.33 ? 45  LEU C CB  1 
ATOM   3618 C  CG  . LEU C 1 45  ? 68.173  11.338  50.943  1.00 37.76 ? 45  LEU C CG  1 
ATOM   3619 C  CD1 . LEU C 1 45  ? 68.530  11.277  49.471  1.00 37.82 ? 45  LEU C CD1 1 
ATOM   3620 C  CD2 . LEU C 1 45  ? 66.758  10.831  51.161  1.00 39.83 ? 45  LEU C CD2 1 
ATOM   3621 N  N   . PRO C 1 46  ? 69.831  9.286   55.223  1.00 39.53 ? 46  PRO C N   1 
ATOM   3622 C  CA  . PRO C 1 46  ? 70.732  8.431   56.000  1.00 41.04 ? 46  PRO C CA  1 
ATOM   3623 C  C   . PRO C 1 46  ? 71.093  7.086   55.361  1.00 42.57 ? 46  PRO C C   1 
ATOM   3624 O  O   . PRO C 1 46  ? 72.244  6.647   55.438  1.00 43.11 ? 46  PRO C O   1 
ATOM   3625 C  CB  . PRO C 1 46  ? 69.982  8.263   57.316  1.00 41.60 ? 46  PRO C CB  1 
ATOM   3626 C  CG  . PRO C 1 46  ? 69.295  9.585   57.465  1.00 40.45 ? 46  PRO C CG  1 
ATOM   3627 C  CD  . PRO C 1 46  ? 68.753  9.819   56.077  1.00 39.93 ? 46  PRO C CD  1 
ATOM   3628 N  N   . GLU C 1 47  ? 70.117  6.441   54.728  1.00 43.77 ? 47  GLU C N   1 
ATOM   3629 C  CA  . GLU C 1 47  ? 70.347  5.140   54.101  1.00 46.35 ? 47  GLU C CA  1 
ATOM   3630 C  C   . GLU C 1 47  ? 71.328  5.217   52.938  1.00 46.39 ? 47  GLU C C   1 
ATOM   3631 O  O   . GLU C 1 47  ? 72.011  4.240   52.625  1.00 47.14 ? 47  GLU C O   1 
ATOM   3632 C  CB  . GLU C 1 47  ? 69.030  4.541   53.594  1.00 48.43 ? 47  GLU C CB  1 
ATOM   3633 C  CG  . GLU C 1 47  ? 67.797  5.041   54.320  1.00 53.01 ? 47  GLU C CG  1 
ATOM   3634 C  CD  . GLU C 1 47  ? 67.394  6.434   53.872  1.00 54.93 ? 47  GLU C CD  1 
ATOM   3635 O  OE1 . GLU C 1 47  ? 66.886  6.569   52.737  1.00 55.61 ? 47  GLU C OE1 1 
ATOM   3636 O  OE2 . GLU C 1 47  ? 67.596  7.393   54.649  1.00 55.80 ? 47  GLU C OE2 1 
ATOM   3637 N  N   . PHE C 1 48  ? 71.395  6.380   52.300  1.00 45.07 ? 48  PHE C N   1 
ATOM   3638 C  CA  . PHE C 1 48  ? 72.282  6.569   51.163  1.00 44.52 ? 48  PHE C CA  1 
ATOM   3639 C  C   . PHE C 1 48  ? 73.564  7.309   51.520  1.00 44.19 ? 48  PHE C C   1 
ATOM   3640 O  O   . PHE C 1 48  ? 74.588  7.140   50.862  1.00 43.79 ? 48  PHE C O   1 
ATOM   3641 C  CB  . PHE C 1 48  ? 71.545  7.327   50.061  1.00 44.18 ? 48  PHE C CB  1 
ATOM   3642 C  CG  . PHE C 1 48  ? 70.405  6.560   49.458  1.00 44.04 ? 48  PHE C CG  1 
ATOM   3643 C  CD1 . PHE C 1 48  ? 70.647  5.475   48.623  1.00 43.59 ? 48  PHE C CD1 1 
ATOM   3644 C  CD2 . PHE C 1 48  ? 69.090  6.913   49.733  1.00 43.79 ? 48  PHE C CD2 1 
ATOM   3645 C  CE1 . PHE C 1 48  ? 69.594  4.754   48.070  1.00 44.87 ? 48  PHE C CE1 1 
ATOM   3646 C  CE2 . PHE C 1 48  ? 68.030  6.199   49.187  1.00 44.43 ? 48  PHE C CE2 1 
ATOM   3647 C  CZ  . PHE C 1 48  ? 68.282  5.116   48.352  1.00 44.83 ? 48  PHE C CZ  1 
ATOM   3648 N  N   . ALA C 1 49  ? 73.503  8.118   52.571  1.00 44.24 ? 49  ALA C N   1 
ATOM   3649 C  CA  . ALA C 1 49  ? 74.651  8.907   53.002  1.00 43.97 ? 49  ALA C CA  1 
ATOM   3650 C  C   . ALA C 1 49  ? 75.915  8.092   53.266  1.00 44.96 ? 49  ALA C C   1 
ATOM   3651 O  O   . ALA C 1 49  ? 77.023  8.590   53.069  1.00 45.98 ? 49  ALA C O   1 
ATOM   3652 C  CB  . ALA C 1 49  ? 74.282  9.708   54.239  1.00 43.21 ? 49  ALA C CB  1 
ATOM   3653 N  N   . ASN C 1 50  ? 75.752  6.844   53.700  1.00 44.86 ? 50  ASN C N   1 
ATOM   3654 C  CA  . ASN C 1 50  ? 76.891  5.977   54.008  1.00 43.61 ? 50  ASN C CA  1 
ATOM   3655 C  C   . ASN C 1 50  ? 77.522  5.256   52.825  1.00 40.57 ? 50  ASN C C   1 
ATOM   3656 O  O   . ASN C 1 50  ? 78.572  4.629   52.969  1.00 39.78 ? 50  ASN C O   1 
ATOM   3657 C  CB  . ASN C 1 50  ? 76.485  4.931   55.050  1.00 47.93 ? 50  ASN C CB  1 
ATOM   3658 C  CG  . ASN C 1 50  ? 76.552  5.463   56.466  1.00 52.61 ? 50  ASN C CG  1 
ATOM   3659 O  OD1 . ASN C 1 50  ? 76.126  4.793   57.414  1.00 55.58 ? 50  ASN C OD1 1 
ATOM   3660 N  ND2 . ASN C 1 50  ? 77.096  6.670   56.623  1.00 53.46 ? 50  ASN C ND2 1 
ATOM   3661 N  N   . LEU C 1 51  ? 76.891  5.335   51.661  1.00 37.40 ? 51  LEU C N   1 
ATOM   3662 C  CA  . LEU C 1 51  ? 77.414  4.658   50.481  1.00 34.90 ? 51  LEU C CA  1 
ATOM   3663 C  C   . LEU C 1 51  ? 78.575  5.381   49.817  1.00 33.17 ? 51  LEU C C   1 
ATOM   3664 O  O   . LEU C 1 51  ? 78.660  6.609   49.853  1.00 32.56 ? 51  LEU C O   1 
ATOM   3665 C  CB  . LEU C 1 51  ? 76.315  4.483   49.429  1.00 34.84 ? 51  LEU C CB  1 
ATOM   3666 C  CG  . LEU C 1 51  ? 75.111  3.587   49.703  1.00 35.91 ? 51  LEU C CG  1 
ATOM   3667 C  CD1 . LEU C 1 51  ? 74.172  3.642   48.506  1.00 34.51 ? 51  LEU C CD1 1 
ATOM   3668 C  CD2 . LEU C 1 51  ? 75.576  2.161   49.956  1.00 35.24 ? 51  LEU C CD2 1 
ATOM   3669 N  N   . PRO C 1 52  ? 79.503  4.617   49.219  1.00 32.03 ? 52  PRO C N   1 
ATOM   3670 C  CA  . PRO C 1 52  ? 80.654  5.205   48.527  1.00 30.63 ? 52  PRO C CA  1 
ATOM   3671 C  C   . PRO C 1 52  ? 80.036  5.900   47.307  1.00 29.89 ? 52  PRO C C   1 
ATOM   3672 O  O   . PRO C 1 52  ? 79.138  5.345   46.668  1.00 29.55 ? 52  PRO C O   1 
ATOM   3673 C  CB  . PRO C 1 52  ? 81.480  3.983   48.133  1.00 30.55 ? 52  PRO C CB  1 
ATOM   3674 C  CG  . PRO C 1 52  ? 81.148  2.991   49.213  1.00 31.25 ? 52  PRO C CG  1 
ATOM   3675 C  CD  . PRO C 1 52  ? 79.660  3.158   49.351  1.00 31.00 ? 52  PRO C CD  1 
ATOM   3676 N  N   . VAL C 1 53  ? 80.505  7.100   46.981  1.00 29.08 ? 53  VAL C N   1 
ATOM   3677 C  CA  . VAL C 1 53  ? 79.937  7.852   45.865  1.00 27.30 ? 53  VAL C CA  1 
ATOM   3678 C  C   . VAL C 1 53  ? 79.799  7.075   44.552  1.00 27.05 ? 53  VAL C C   1 
ATOM   3679 O  O   . VAL C 1 53  ? 78.831  7.289   43.819  1.00 25.41 ? 53  VAL C O   1 
ATOM   3680 C  CB  . VAL C 1 53  ? 80.726  9.175   45.621  1.00 26.88 ? 53  VAL C CB  1 
ATOM   3681 C  CG1 . VAL C 1 53  ? 82.119  8.883   45.100  1.00 24.75 ? 53  VAL C CG1 1 
ATOM   3682 C  CG2 . VAL C 1 53  ? 79.952  10.067  44.667  1.00 26.29 ? 53  VAL C CG2 1 
ATOM   3683 N  N   . GLU C 1 54  ? 80.739  6.170   44.264  1.00 27.27 ? 54  GLU C N   1 
ATOM   3684 C  CA  . GLU C 1 54  ? 80.692  5.375   43.031  1.00 28.40 ? 54  GLU C CA  1 
ATOM   3685 C  C   . GLU C 1 54  ? 79.506  4.414   43.019  1.00 29.16 ? 54  GLU C C   1 
ATOM   3686 O  O   . GLU C 1 54  ? 79.002  4.041   41.958  1.00 29.33 ? 54  GLU C O   1 
ATOM   3687 C  CB  . GLU C 1 54  ? 81.964  4.543   42.851  1.00 30.32 ? 54  GLU C CB  1 
ATOM   3688 C  CG  . GLU C 1 54  ? 83.269  5.307   42.852  1.00 33.89 ? 54  GLU C CG  1 
ATOM   3689 C  CD  . GLU C 1 54  ? 83.700  5.729   44.245  1.00 37.39 ? 54  GLU C CD  1 
ATOM   3690 O  OE1 . GLU C 1 54  ? 83.451  4.963   45.203  1.00 36.47 ? 54  GLU C OE1 1 
ATOM   3691 O  OE2 . GLU C 1 54  ? 84.303  6.819   44.379  1.00 39.21 ? 54  GLU C OE2 1 
ATOM   3692 N  N   . GLU C 1 55  ? 79.076  4.005   44.207  1.00 29.39 ? 55  GLU C N   1 
ATOM   3693 C  CA  . GLU C 1 55  ? 77.960  3.083   44.346  1.00 29.65 ? 55  GLU C CA  1 
ATOM   3694 C  C   . GLU C 1 55  ? 76.641  3.853   44.342  1.00 27.77 ? 55  GLU C C   1 
ATOM   3695 O  O   . GLU C 1 55  ? 75.633  3.377   43.826  1.00 27.06 ? 55  GLU C O   1 
ATOM   3696 C  CB  . GLU C 1 55  ? 78.112  2.297   45.651  1.00 32.38 ? 55  GLU C CB  1 
ATOM   3697 C  CG  . GLU C 1 55  ? 77.146  1.137   45.809  1.00 38.63 ? 55  GLU C CG  1 
ATOM   3698 C  CD  . GLU C 1 55  ? 77.331  0.409   47.132  1.00 41.37 ? 55  GLU C CD  1 
ATOM   3699 O  OE1 . GLU C 1 55  ? 78.487  0.040   47.450  1.00 42.02 ? 55  GLU C OE1 1 
ATOM   3700 O  OE2 . GLU C 1 55  ? 76.323  0.204   47.846  1.00 41.52 ? 55  GLU C OE2 1 
ATOM   3701 N  N   . LEU C 1 56  ? 76.660  5.051   44.915  1.00 25.75 ? 56  LEU C N   1 
ATOM   3702 C  CA  . LEU C 1 56  ? 75.468  5.882   44.975  1.00 24.97 ? 56  LEU C CA  1 
ATOM   3703 C  C   . LEU C 1 56  ? 74.951  6.258   43.590  1.00 24.66 ? 56  LEU C C   1 
ATOM   3704 O  O   . LEU C 1 56  ? 73.747  6.206   43.333  1.00 24.58 ? 56  LEU C O   1 
ATOM   3705 C  CB  . LEU C 1 56  ? 75.751  7.159   45.772  1.00 25.03 ? 56  LEU C CB  1 
ATOM   3706 C  CG  . LEU C 1 56  ? 74.587  8.153   45.859  1.00 26.02 ? 56  LEU C CG  1 
ATOM   3707 C  CD1 . LEU C 1 56  ? 73.432  7.524   46.621  1.00 27.31 ? 56  LEU C CD1 1 
ATOM   3708 C  CD2 . LEU C 1 56  ? 75.041  9.418   46.550  1.00 25.96 ? 56  LEU C CD2 1 
ATOM   3709 N  N   . ILE C 1 57  ? 75.856  6.631   42.692  1.00 24.12 ? 57  ILE C N   1 
ATOM   3710 C  CA  . ILE C 1 57  ? 75.449  7.032   41.348  1.00 23.21 ? 57  ILE C CA  1 
ATOM   3711 C  C   . ILE C 1 57  ? 74.910  5.888   40.485  1.00 23.79 ? 57  ILE C C   1 
ATOM   3712 O  O   . ILE C 1 57  ? 74.389  6.124   39.393  1.00 23.25 ? 57  ILE C O   1 
ATOM   3713 C  CB  . ILE C 1 57  ? 76.601  7.755   40.604  1.00 20.94 ? 57  ILE C CB  1 
ATOM   3714 C  CG1 . ILE C 1 57  ? 77.836  6.856   40.512  1.00 20.94 ? 57  ILE C CG1 1 
ATOM   3715 C  CG2 . ILE C 1 57  ? 76.957  9.031   41.342  1.00 21.29 ? 57  ILE C CG2 1 
ATOM   3716 C  CD1 . ILE C 1 57  ? 78.976  7.465   39.703  1.00 18.78 ? 57  ILE C CD1 1 
ATOM   3717 N  N   . THR C 1 58  ? 75.035  4.654   40.966  1.00 24.38 ? 58  THR C N   1 
ATOM   3718 C  CA  . THR C 1 58  ? 74.515  3.504   40.221  1.00 26.82 ? 58  THR C CA  1 
ATOM   3719 C  C   . THR C 1 58  ? 73.102  3.216   40.733  1.00 28.00 ? 58  THR C C   1 
ATOM   3720 O  O   . THR C 1 58  ? 72.400  2.361   40.199  1.00 28.75 ? 58  THR C O   1 
ATOM   3721 C  CB  . THR C 1 58  ? 75.365  2.220   40.436  1.00 25.63 ? 58  THR C CB  1 
ATOM   3722 O  OG1 . THR C 1 58  ? 75.295  1.825   41.813  1.00 26.49 ? 58  THR C OG1 1 
ATOM   3723 C  CG2 . THR C 1 58  ? 76.814  2.457   40.057  1.00 22.09 ? 58  THR C CG2 1 
ATOM   3724 N  N   . LYS C 1 59  ? 72.694  3.947   41.768  1.00 28.74 ? 59  LYS C N   1 
ATOM   3725 C  CA  . LYS C 1 59  ? 71.379  3.764   42.370  1.00 30.58 ? 59  LYS C CA  1 
ATOM   3726 C  C   . LYS C 1 59  ? 70.505  5.017   42.327  1.00 30.69 ? 59  LYS C C   1 
ATOM   3727 O  O   . LYS C 1 59  ? 69.638  5.199   43.182  1.00 30.33 ? 59  LYS C O   1 
ATOM   3728 C  CB  . LYS C 1 59  ? 71.542  3.315   43.824  1.00 31.49 ? 59  LYS C CB  1 
ATOM   3729 C  CG  . LYS C 1 59  ? 72.376  2.062   43.984  1.00 33.62 ? 59  LYS C CG  1 
ATOM   3730 C  CD  . LYS C 1 59  ? 72.417  1.618   45.426  1.00 36.52 ? 59  LYS C CD  1 
ATOM   3731 C  CE  . LYS C 1 59  ? 73.125  0.286   45.557  1.00 38.15 ? 59  LYS C CE  1 
ATOM   3732 N  NZ  . LYS C 1 59  ? 73.105  -0.192  46.966  1.00 40.75 ? 59  LYS C NZ  1 
ATOM   3733 N  N   . LEU C 1 60  ? 70.719  5.866   41.327  1.00 31.26 ? 60  LEU C N   1 
ATOM   3734 C  CA  . LEU C 1 60  ? 69.955  7.105   41.200  1.00 32.17 ? 60  LEU C CA  1 
ATOM   3735 C  C   . LEU C 1 60  ? 68.446  6.905   41.082  1.00 33.96 ? 60  LEU C C   1 
ATOM   3736 O  O   . LEU C 1 60  ? 67.666  7.767   41.498  1.00 32.54 ? 60  LEU C O   1 
ATOM   3737 C  CB  . LEU C 1 60  ? 70.460  7.918   40.000  1.00 30.03 ? 60  LEU C CB  1 
ATOM   3738 C  CG  . LEU C 1 60  ? 71.906  8.421   40.079  1.00 28.52 ? 60  LEU C CG  1 
ATOM   3739 C  CD1 . LEU C 1 60  ? 72.255  9.176   38.810  1.00 27.53 ? 60  LEU C CD1 1 
ATOM   3740 C  CD2 . LEU C 1 60  ? 72.077  9.315   41.290  1.00 25.96 ? 60  LEU C CD2 1 
ATOM   3741 N  N   . ASP C 1 61  ? 68.031  5.772   40.523  1.00 36.61 ? 61  ASP C N   1 
ATOM   3742 C  CA  . ASP C 1 61  ? 66.607  5.501   40.364  1.00 39.98 ? 61  ASP C CA  1 
ATOM   3743 C  C   . ASP C 1 61  ? 65.916  5.130   41.670  1.00 40.61 ? 61  ASP C C   1 
ATOM   3744 O  O   . ASP C 1 61  ? 64.691  5.122   41.744  1.00 40.55 ? 61  ASP C O   1 
ATOM   3745 C  CB  . ASP C 1 61  ? 66.389  4.397   39.328  1.00 43.40 ? 61  ASP C CB  1 
ATOM   3746 C  CG  . ASP C 1 61  ? 66.694  4.863   37.915  1.00 47.59 ? 61  ASP C CG  1 
ATOM   3747 O  OD1 . ASP C 1 61  ? 66.153  5.920   37.517  1.00 48.27 ? 61  ASP C OD1 1 
ATOM   3748 O  OD2 . ASP C 1 61  ? 67.467  4.178   37.204  1.00 51.13 ? 61  ASP C OD2 1 
ATOM   3749 N  N   . GLN C 1 62  ? 66.705  4.832   42.698  1.00 41.67 ? 62  GLN C N   1 
ATOM   3750 C  CA  . GLN C 1 62  ? 66.166  4.464   44.002  1.00 42.09 ? 62  GLN C CA  1 
ATOM   3751 C  C   . GLN C 1 62  ? 65.945  5.682   44.895  1.00 42.81 ? 62  GLN C C   1 
ATOM   3752 O  O   . GLN C 1 62  ? 65.309  5.584   45.946  1.00 43.49 ? 62  GLN C O   1 
ATOM   3753 C  CB  . GLN C 1 62  ? 67.109  3.483   44.697  1.00 42.89 ? 62  GLN C CB  1 
ATOM   3754 C  CG  . GLN C 1 62  ? 67.196  2.127   44.020  1.00 46.84 ? 62  GLN C CG  1 
ATOM   3755 C  CD  . GLN C 1 62  ? 68.283  1.251   44.615  1.00 49.80 ? 62  GLN C CD  1 
ATOM   3756 O  OE1 . GLN C 1 62  ? 68.433  1.170   45.837  1.00 52.31 ? 62  GLN C OE1 1 
ATOM   3757 N  NE2 . GLN C 1 62  ? 69.043  0.582   43.754  1.00 50.67 ? 62  GLN C NE2 1 
ATOM   3758 N  N   . LEU C 1 63  ? 66.473  6.828   44.476  1.00 42.01 ? 63  LEU C N   1 
ATOM   3759 C  CA  . LEU C 1 63  ? 66.333  8.062   45.244  1.00 41.53 ? 63  LEU C CA  1 
ATOM   3760 C  C   . LEU C 1 63  ? 64.987  8.716   44.974  1.00 41.62 ? 63  LEU C C   1 
ATOM   3761 O  O   . LEU C 1 63  ? 64.389  8.503   43.921  1.00 42.03 ? 63  LEU C O   1 
ATOM   3762 C  CB  . LEU C 1 63  ? 67.432  9.056   44.860  1.00 40.93 ? 63  LEU C CB  1 
ATOM   3763 C  CG  . LEU C 1 63  ? 68.893  8.682   45.109  1.00 40.72 ? 63  LEU C CG  1 
ATOM   3764 C  CD1 . LEU C 1 63  ? 69.796  9.710   44.442  1.00 39.69 ? 63  LEU C CD1 1 
ATOM   3765 C  CD2 . LEU C 1 63  ? 69.160  8.613   46.604  1.00 39.70 ? 63  LEU C CD2 1 
ATOM   3766 N  N   . PRO C 1 64  ? 64.486  9.515   45.930  1.00 41.05 ? 64  PRO C N   1 
ATOM   3767 C  CA  . PRO C 1 64  ? 63.200  10.193  45.743  1.00 41.18 ? 64  PRO C CA  1 
ATOM   3768 C  C   . PRO C 1 64  ? 63.309  11.232  44.624  1.00 41.92 ? 64  PRO C C   1 
ATOM   3769 O  O   . PRO C 1 64  ? 64.313  11.934  44.509  1.00 42.37 ? 64  PRO C O   1 
ATOM   3770 C  CB  . PRO C 1 64  ? 62.932  10.820  47.114  1.00 41.77 ? 64  PRO C CB  1 
ATOM   3771 C  CG  . PRO C 1 64  ? 64.300  10.999  47.696  1.00 41.07 ? 64  PRO C CG  1 
ATOM   3772 C  CD  . PRO C 1 64  ? 65.001  9.729   47.294  1.00 40.88 ? 64  PRO C CD  1 
ATOM   3773 N  N   . ALA C 1 65  ? 62.268  11.315  43.803  1.00 41.77 ? 65  ALA C N   1 
ATOM   3774 C  CA  . ALA C 1 65  ? 62.218  12.231  42.665  1.00 41.49 ? 65  ALA C CA  1 
ATOM   3775 C  C   . ALA C 1 65  ? 62.846  13.615  42.847  1.00 40.96 ? 65  ALA C C   1 
ATOM   3776 O  O   . ALA C 1 65  ? 63.561  14.088  41.963  1.00 40.94 ? 65  ALA C O   1 
ATOM   3777 C  CB  . ALA C 1 65  ? 60.772  12.385  42.204  1.00 41.44 ? 65  ALA C CB  1 
ATOM   3778 N  N   . ASP C 1 66  ? 62.578  14.265  43.976  1.00 39.47 ? 66  ASP C N   1 
ATOM   3779 C  CA  . ASP C 1 66  ? 63.111  15.603  44.216  1.00 39.50 ? 66  ASP C CA  1 
ATOM   3780 C  C   . ASP C 1 66  ? 64.606  15.669  44.526  1.00 38.83 ? 66  ASP C C   1 
ATOM   3781 O  O   . ASP C 1 66  ? 65.185  16.754  44.553  1.00 39.94 ? 66  ASP C O   1 
ATOM   3782 C  CB  . ASP C 1 66  ? 62.329  16.289  45.343  1.00 41.26 ? 66  ASP C CB  1 
ATOM   3783 C  CG  . ASP C 1 66  ? 62.413  15.538  46.655  1.00 43.21 ? 66  ASP C CG  1 
ATOM   3784 O  OD1 . ASP C 1 66  ? 61.964  14.374  46.705  1.00 45.94 ? 66  ASP C OD1 1 
ATOM   3785 O  OD2 . ASP C 1 66  ? 62.926  16.112  47.639  1.00 44.54 ? 66  ASP C OD2 1 
ATOM   3786 N  N   . LYS C 1 67  ? 65.231  14.517  44.755  1.00 36.61 ? 67  LYS C N   1 
ATOM   3787 C  CA  . LYS C 1 67  ? 66.661  14.465  45.063  1.00 34.66 ? 67  LYS C CA  1 
ATOM   3788 C  C   . LYS C 1 67  ? 67.477  13.917  43.892  1.00 33.28 ? 67  LYS C C   1 
ATOM   3789 O  O   . LYS C 1 67  ? 68.690  14.104  43.832  1.00 32.24 ? 67  LYS C O   1 
ATOM   3790 C  CB  . LYS C 1 67  ? 66.914  13.565  46.282  1.00 34.99 ? 67  LYS C CB  1 
ATOM   3791 C  CG  . LYS C 1 67  ? 66.407  14.085  47.620  1.00 36.55 ? 67  LYS C CG  1 
ATOM   3792 C  CD  . LYS C 1 67  ? 67.316  15.165  48.176  1.00 38.78 ? 67  LYS C CD  1 
ATOM   3793 C  CE  . LYS C 1 67  ? 67.066  15.392  49.663  1.00 39.20 ? 67  LYS C CE  1 
ATOM   3794 N  NZ  . LYS C 1 67  ? 65.674  15.835  49.941  1.00 42.81 ? 67  LYS C NZ  1 
ATOM   3795 N  N   . LYS C 1 68  ? 66.799  13.249  42.963  1.00 31.59 ? 68  LYS C N   1 
ATOM   3796 C  CA  . LYS C 1 68  ? 67.449  12.618  41.824  1.00 30.68 ? 68  LYS C CA  1 
ATOM   3797 C  C   . LYS C 1 68  ? 68.407  13.490  41.009  1.00 29.06 ? 68  LYS C C   1 
ATOM   3798 O  O   . LYS C 1 68  ? 69.567  13.127  40.818  1.00 26.73 ? 68  LYS C O   1 
ATOM   3799 C  CB  . LYS C 1 68  ? 66.386  12.014  40.900  1.00 32.67 ? 68  LYS C CB  1 
ATOM   3800 C  CG  . LYS C 1 68  ? 66.964  11.110  39.830  1.00 36.67 ? 68  LYS C CG  1 
ATOM   3801 C  CD  . LYS C 1 68  ? 65.887  10.330  39.091  1.00 40.25 ? 68  LYS C CD  1 
ATOM   3802 C  CE  . LYS C 1 68  ? 66.521  9.361   38.091  1.00 43.70 ? 68  LYS C CE  1 
ATOM   3803 N  NZ  . LYS C 1 68  ? 65.530  8.473   37.409  1.00 45.11 ? 68  LYS C NZ  1 
ATOM   3804 N  N   . THR C 1 69  ? 67.926  14.634  40.532  1.00 27.06 ? 69  THR C N   1 
ATOM   3805 C  CA  . THR C 1 69  ? 68.743  15.531  39.717  1.00 26.07 ? 69  THR C CA  1 
ATOM   3806 C  C   . THR C 1 69  ? 69.917  16.183  40.451  1.00 24.41 ? 69  THR C C   1 
ATOM   3807 O  O   . THR C 1 69  ? 71.042  16.194  39.949  1.00 23.33 ? 69  THR C O   1 
ATOM   3808 C  CB  . THR C 1 69  ? 67.877  16.647  39.095  1.00 27.55 ? 69  THR C CB  1 
ATOM   3809 O  OG1 . THR C 1 69  ? 66.926  16.064  38.193  1.00 32.06 ? 69  THR C OG1 1 
ATOM   3810 C  CG2 . THR C 1 69  ? 68.748  17.642  38.328  1.00 28.85 ? 69  THR C CG2 1 
ATOM   3811 N  N   . VAL C 1 70  ? 69.658  16.736  41.630  1.00 21.39 ? 70  VAL C N   1 
ATOM   3812 C  CA  . VAL C 1 70  ? 70.708  17.383  42.402  1.00 21.12 ? 70  VAL C CA  1 
ATOM   3813 C  C   . VAL C 1 70  ? 71.877  16.431  42.697  1.00 19.90 ? 70  VAL C C   1 
ATOM   3814 O  O   . VAL C 1 70  ? 73.041  16.829  42.639  1.00 18.69 ? 70  VAL C O   1 
ATOM   3815 C  CB  . VAL C 1 70  ? 70.153  17.940  43.736  1.00 21.90 ? 70  VAL C CB  1 
ATOM   3816 C  CG1 . VAL C 1 70  ? 69.558  16.820  44.566  1.00 22.17 ? 70  VAL C CG1 1 
ATOM   3817 C  CG2 . VAL C 1 70  ? 71.255  18.640  44.502  1.00 22.70 ? 70  VAL C CG2 1 
ATOM   3818 N  N   . LEU C 1 71  ? 71.568  15.174  43.001  1.00 16.88 ? 71  LEU C N   1 
ATOM   3819 C  CA  . LEU C 1 71  ? 72.603  14.188  43.293  1.00 16.76 ? 71  LEU C CA  1 
ATOM   3820 C  C   . LEU C 1 71  ? 73.275  13.664  42.031  1.00 16.72 ? 71  LEU C C   1 
ATOM   3821 O  O   . LEU C 1 71  ? 74.473  13.377  42.029  1.00 16.36 ? 71  LEU C O   1 
ATOM   3822 C  CB  . LEU C 1 71  ? 72.027  13.020  44.107  1.00 16.39 ? 71  LEU C CB  1 
ATOM   3823 C  CG  . LEU C 1 71  ? 71.882  13.315  45.608  1.00 18.50 ? 71  LEU C CG  1 
ATOM   3824 C  CD1 . LEU C 1 71  ? 71.232  12.139  46.322  1.00 18.85 ? 71  LEU C CD1 1 
ATOM   3825 C  CD2 . LEU C 1 71  ? 73.261  13.585  46.200  1.00 17.44 ? 71  LEU C CD2 1 
ATOM   3826 N  N   . ARG C 1 72  ? 72.504  13.531  40.959  1.00 16.30 ? 72  ARG C N   1 
ATOM   3827 C  CA  . ARG C 1 72  ? 73.051  13.079  39.687  1.00 14.84 ? 72  ARG C CA  1 
ATOM   3828 C  C   . ARG C 1 72  ? 74.152  14.062  39.274  1.00 14.83 ? 72  ARG C C   1 
ATOM   3829 O  O   . ARG C 1 72  ? 75.247  13.664  38.873  1.00 15.22 ? 72  ARG C O   1 
ATOM   3830 C  CB  . ARG C 1 72  ? 71.948  13.063  38.630  1.00 15.06 ? 72  ARG C CB  1 
ATOM   3831 C  CG  . ARG C 1 72  ? 72.422  12.833  37.208  1.00 16.11 ? 72  ARG C CG  1 
ATOM   3832 C  CD  . ARG C 1 72  ? 71.282  13.073  36.243  1.00 14.84 ? 72  ARG C CD  1 
ATOM   3833 N  NE  . ARG C 1 72  ? 71.685  12.920  34.852  1.00 16.66 ? 72  ARG C NE  1 
ATOM   3834 C  CZ  . ARG C 1 72  ? 70.837  12.975  33.829  1.00 18.99 ? 72  ARG C CZ  1 
ATOM   3835 N  NH1 . ARG C 1 72  ? 69.547  13.179  34.056  1.00 18.44 ? 72  ARG C NH1 1 
ATOM   3836 N  NH2 . ARG C 1 72  ? 71.272  12.826  32.581  1.00 17.60 ? 72  ARG C NH2 1 
ATOM   3837 N  N   . ASN C 1 73  ? 73.858  15.352  39.394  1.00 14.29 ? 73  ASN C N   1 
ATOM   3838 C  CA  . ASN C 1 73  ? 74.811  16.393  39.027  1.00 14.62 ? 73  ASN C CA  1 
ATOM   3839 C  C   . ASN C 1 73  ? 75.987  16.543  39.994  1.00 14.39 ? 73  ASN C C   1 
ATOM   3840 O  O   . ASN C 1 73  ? 77.141  16.620  39.571  1.00 13.47 ? 73  ASN C O   1 
ATOM   3841 C  CB  . ASN C 1 73  ? 74.107  17.751  38.909  1.00 12.56 ? 73  ASN C CB  1 
ATOM   3842 C  CG  . ASN C 1 73  ? 73.127  17.807  37.755  1.00 13.37 ? 73  ASN C CG  1 
ATOM   3843 O  OD1 . ASN C 1 73  ? 73.248  17.054  36.793  1.00 13.71 ? 73  ASN C OD1 1 
ATOM   3844 N  ND2 . ASN C 1 73  ? 72.163  18.716  37.836  1.00 12.12 ? 73  ASN C ND2 1 
ATOM   3845 N  N   . ASN C 1 74  ? 75.696  16.580  41.290  1.00 13.52 ? 74  ASN C N   1 
ATOM   3846 C  CA  . ASN C 1 74  ? 76.741  16.778  42.285  1.00 12.85 ? 74  ASN C CA  1 
ATOM   3847 C  C   . ASN C 1 74  ? 77.494  15.540  42.732  1.00 13.04 ? 74  ASN C C   1 
ATOM   3848 O  O   . ASN C 1 74  ? 78.714  15.587  42.883  1.00 14.38 ? 74  ASN C O   1 
ATOM   3849 C  CB  . ASN C 1 74  ? 76.152  17.524  43.474  1.00 11.19 ? 74  ASN C CB  1 
ATOM   3850 C  CG  . ASN C 1 74  ? 75.737  18.925  43.100  1.00 12.32 ? 74  ASN C CG  1 
ATOM   3851 O  OD1 . ASN C 1 74  ? 76.583  19.785  42.865  1.00 15.09 ? 74  ASN C OD1 1 
ATOM   3852 N  ND2 . ASN C 1 74  ? 74.436  19.159  43.010  1.00 11.03 ? 74  ASN C ND2 1 
ATOM   3853 N  N   . ALA C 1 75  ? 76.790  14.436  42.954  1.00 12.69 ? 75  ALA C N   1 
ATOM   3854 C  CA  . ALA C 1 75  ? 77.477  13.210  43.343  1.00 13.65 ? 75  ALA C CA  1 
ATOM   3855 C  C   . ALA C 1 75  ? 78.248  12.775  42.092  1.00 13.74 ? 75  ALA C C   1 
ATOM   3856 O  O   . ALA C 1 75  ? 79.357  12.235  42.174  1.00 14.24 ? 75  ALA C O   1 
ATOM   3857 C  CB  . ALA C 1 75  ? 76.474  12.131  43.757  1.00 12.49 ? 75  ALA C CB  1 
ATOM   3858 N  N   . GLY C 1 76  ? 77.649  13.023  40.930  1.00 12.63 ? 76  GLY C N   1 
ATOM   3859 C  CA  . GLY C 1 76  ? 78.302  12.682  39.680  1.00 12.13 ? 76  GLY C CA  1 
ATOM   3860 C  C   . GLY C 1 76  ? 79.570  13.507  39.553  1.00 12.91 ? 76  GLY C C   1 
ATOM   3861 O  O   . GLY C 1 76  ? 80.637  12.990  39.205  1.00 12.94 ? 76  GLY C O   1 
ATOM   3862 N  N   . GLY C 1 77  ? 79.457  14.801  39.843  1.00 11.49 ? 77  GLY C N   1 
ATOM   3863 C  CA  . GLY C 1 77  ? 80.618  15.670  39.774  1.00 11.11 ? 77  GLY C CA  1 
ATOM   3864 C  C   . GLY C 1 77  ? 81.716  15.241  40.734  1.00 11.71 ? 77  GLY C C   1 
ATOM   3865 O  O   . GLY C 1 77  ? 82.897  15.318  40.399  1.00 11.51 ? 77  GLY C O   1 
ATOM   3866 N  N   . HIS C 1 78  ? 81.334  14.787  41.929  1.00 11.74 ? 78  HIS C N   1 
ATOM   3867 C  CA  . HIS C 1 78  ? 82.307  14.351  42.926  1.00 11.29 ? 78  HIS C CA  1 
ATOM   3868 C  C   . HIS C 1 78  ? 83.004  13.065  42.480  1.00 11.39 ? 78  HIS C C   1 
ATOM   3869 O  O   . HIS C 1 78  ? 84.226  12.947  42.571  1.00 11.71 ? 78  HIS C O   1 
ATOM   3870 C  CB  . HIS C 1 78  ? 81.617  14.163  44.280  1.00 12.53 ? 78  HIS C CB  1 
ATOM   3871 C  CG  . HIS C 1 78  ? 82.508  13.600  45.342  1.00 14.50 ? 78  HIS C CG  1 
ATOM   3872 N  ND1 . HIS C 1 78  ? 83.811  14.013  45.517  1.00 15.77 ? 78  HIS C ND1 1 
ATOM   3873 C  CD2 . HIS C 1 78  ? 82.278  12.663  46.292  1.00 14.34 ? 78  HIS C CD2 1 
ATOM   3874 C  CE1 . HIS C 1 78  ? 84.346  13.355  46.529  1.00 15.65 ? 78  HIS C CE1 1 
ATOM   3875 N  NE2 . HIS C 1 78  ? 83.437  12.529  47.017  1.00 17.14 ? 78  HIS C NE2 1 
ATOM   3876 N  N   . ALA C 1 79  ? 82.227  12.114  41.975  1.00 11.63 ? 79  ALA C N   1 
ATOM   3877 C  CA  . ALA C 1 79  ? 82.770  10.847  41.491  1.00 12.70 ? 79  ALA C CA  1 
ATOM   3878 C  C   . ALA C 1 79  ? 83.721  11.054  40.313  1.00 13.23 ? 79  ALA C C   1 
ATOM   3879 O  O   . ALA C 1 79  ? 84.832  10.531  40.297  1.00 13.49 ? 79  ALA C O   1 
ATOM   3880 C  CB  . ALA C 1 79  ? 81.624  9.918   41.070  1.00 13.02 ? 79  ALA C CB  1 
ATOM   3881 N  N   . ASN C 1 80  ? 83.279  11.821  39.321  1.00 13.81 ? 80  ASN C N   1 
ATOM   3882 C  CA  . ASN C 1 80  ? 84.093  12.071  38.139  1.00 12.70 ? 80  ASN C CA  1 
ATOM   3883 C  C   . ASN C 1 80  ? 85.423  12.752  38.438  1.00 12.12 ? 80  ASN C C   1 
ATOM   3884 O  O   . ASN C 1 80  ? 86.460  12.321  37.936  1.00 11.22 ? 80  ASN C O   1 
ATOM   3885 C  CB  . ASN C 1 80  ? 83.317  12.905  37.109  1.00 14.85 ? 80  ASN C CB  1 
ATOM   3886 C  CG  . ASN C 1 80  ? 82.133  12.157  36.517  1.00 15.95 ? 80  ASN C CG  1 
ATOM   3887 O  OD1 . ASN C 1 80  ? 82.045  10.929  36.612  1.00 15.71 ? 80  ASN C OD1 1 
ATOM   3888 N  ND2 . ASN C 1 80  ? 81.222  12.894  35.885  1.00 14.84 ? 80  ASN C ND2 1 
ATOM   3889 N  N   . HIS C 1 81  ? 85.402  13.809  39.246  1.00 11.09 ? 81  HIS C N   1 
ATOM   3890 C  CA  . HIS C 1 81  ? 86.639  14.516  39.558  1.00 12.54 ? 81  HIS C CA  1 
ATOM   3891 C  C   . HIS C 1 81  ? 87.581  13.715  40.450  1.00 13.89 ? 81  HIS C C   1 
ATOM   3892 O  O   . HIS C 1 81  ? 88.801  13.818  40.314  1.00 14.46 ? 81  HIS C O   1 
ATOM   3893 C  CB  . HIS C 1 81  ? 86.341  15.889  40.169  1.00 13.00 ? 81  HIS C CB  1 
ATOM   3894 C  CG  . HIS C 1 81  ? 85.761  16.864  39.188  1.00 15.15 ? 81  HIS C CG  1 
ATOM   3895 N  ND1 . HIS C 1 81  ? 84.411  16.934  38.915  1.00 11.85 ? 81  HIS C ND1 1 
ATOM   3896 C  CD2 . HIS C 1 81  ? 86.357  17.764  38.369  1.00 13.49 ? 81  HIS C CD2 1 
ATOM   3897 C  CE1 . HIS C 1 81  ? 84.200  17.834  37.971  1.00 13.54 ? 81  HIS C CE1 1 
ATOM   3898 N  NE2 . HIS C 1 81  ? 85.364  18.352  37.621  1.00 14.60 ? 81  HIS C NE2 1 
ATOM   3899 N  N   . SER C 1 82  ? 87.025  12.907  41.348  1.00 14.93 ? 82  SER C N   1 
ATOM   3900 C  CA  . SER C 1 82  ? 87.853  12.079  42.224  1.00 15.47 ? 82  SER C CA  1 
ATOM   3901 C  C   . SER C 1 82  ? 88.664  11.130  41.337  1.00 15.54 ? 82  SER C C   1 
ATOM   3902 O  O   . SER C 1 82  ? 89.861  10.929  41.540  1.00 17.09 ? 82  SER C O   1 
ATOM   3903 C  CB  . SER C 1 82  ? 86.972  11.264  43.183  1.00 14.39 ? 82  SER C CB  1 
ATOM   3904 O  OG  . SER C 1 82  ? 86.270  12.098  44.090  1.00 14.01 ? 82  SER C OG  1 
ATOM   3905 N  N   . LEU C 1 83  ? 87.994  10.558  40.344  1.00 15.76 ? 83  LEU C N   1 
ATOM   3906 C  CA  . LEU C 1 83  ? 88.623  9.635   39.410  1.00 15.68 ? 83  LEU C CA  1 
ATOM   3907 C  C   . LEU C 1 83  ? 89.635  10.377  38.538  1.00 15.15 ? 83  LEU C C   1 
ATOM   3908 O  O   . LEU C 1 83  ? 90.704  9.854   38.219  1.00 14.28 ? 83  LEU C O   1 
ATOM   3909 C  CB  . LEU C 1 83  ? 87.547  8.980   38.532  1.00 16.71 ? 83  LEU C CB  1 
ATOM   3910 C  CG  . LEU C 1 83  ? 87.970  7.872   37.557  1.00 21.25 ? 83  LEU C CG  1 
ATOM   3911 C  CD1 . LEU C 1 83  ? 86.747  7.068   37.139  1.00 23.23 ? 83  LEU C CD1 1 
ATOM   3912 C  CD2 . LEU C 1 83  ? 88.655  8.462   36.338  1.00 23.26 ? 83  LEU C CD2 1 
ATOM   3913 N  N   . PHE C 1 84  ? 89.293  11.605  38.167  1.00 14.08 ? 84  PHE C N   1 
ATOM   3914 C  CA  . PHE C 1 84  ? 90.149  12.426  37.325  1.00 13.51 ? 84  PHE C CA  1 
ATOM   3915 C  C   . PHE C 1 84  ? 91.509  12.741  37.964  1.00 14.60 ? 84  PHE C C   1 
ATOM   3916 O  O   . PHE C 1 84  ? 92.547  12.571  37.320  1.00 14.94 ? 84  PHE C O   1 
ATOM   3917 C  CB  . PHE C 1 84  ? 89.413  13.723  36.970  1.00 12.07 ? 84  PHE C CB  1 
ATOM   3918 C  CG  . PHE C 1 84  ? 90.082  14.537  35.898  1.00 11.94 ? 84  PHE C CG  1 
ATOM   3919 C  CD1 . PHE C 1 84  ? 90.359  13.980  34.648  1.00 12.02 ? 84  PHE C CD1 1 
ATOM   3920 C  CD2 . PHE C 1 84  ? 90.425  15.872  36.130  1.00 13.09 ? 84  PHE C CD2 1 
ATOM   3921 C  CE1 . PHE C 1 84  ? 90.970  14.743  33.642  1.00 10.78 ? 84  PHE C CE1 1 
ATOM   3922 C  CE2 . PHE C 1 84  ? 91.036  16.641  35.130  1.00 10.59 ? 84  PHE C CE2 1 
ATOM   3923 C  CZ  . PHE C 1 84  ? 91.307  16.071  33.885  1.00 8.82  ? 84  PHE C CZ  1 
ATOM   3924 N  N   . TRP C 1 85  ? 91.513  13.187  39.221  1.00 14.02 ? 85  TRP C N   1 
ATOM   3925 C  CA  . TRP C 1 85  ? 92.772  13.524  39.894  1.00 15.01 ? 85  TRP C CA  1 
ATOM   3926 C  C   . TRP C 1 85  ? 93.720  12.325  39.946  1.00 16.30 ? 85  TRP C C   1 
ATOM   3927 O  O   . TRP C 1 85  ? 94.923  12.475  39.731  1.00 16.98 ? 85  TRP C O   1 
ATOM   3928 C  CB  . TRP C 1 85  ? 92.527  14.032  41.325  1.00 12.24 ? 85  TRP C CB  1 
ATOM   3929 C  CG  . TRP C 1 85  ? 91.516  15.140  41.443  1.00 12.48 ? 85  TRP C CG  1 
ATOM   3930 C  CD1 . TRP C 1 85  ? 90.479  15.202  42.326  1.00 11.74 ? 85  TRP C CD1 1 
ATOM   3931 C  CD2 . TRP C 1 85  ? 91.430  16.329  40.641  1.00 11.45 ? 85  TRP C CD2 1 
ATOM   3932 N  NE1 . TRP C 1 85  ? 89.748  16.346  42.124  1.00 12.87 ? 85  TRP C NE1 1 
ATOM   3933 C  CE2 . TRP C 1 85  ? 90.309  17.057  41.096  1.00 12.43 ? 85  TRP C CE2 1 
ATOM   3934 C  CE3 . TRP C 1 85  ? 92.190  16.847  39.582  1.00 11.70 ? 85  TRP C CE3 1 
ATOM   3935 C  CZ2 . TRP C 1 85  ? 89.926  18.277  40.531  1.00 13.24 ? 85  TRP C CZ2 1 
ATOM   3936 C  CZ3 . TRP C 1 85  ? 91.814  18.056  39.019  1.00 12.55 ? 85  TRP C CZ3 1 
ATOM   3937 C  CH2 . TRP C 1 85  ? 90.689  18.760  39.495  1.00 14.55 ? 85  TRP C CH2 1 
ATOM   3938 N  N   . LYS C 1 86  ? 93.180  11.143  40.230  1.00 16.91 ? 86  LYS C N   1 
ATOM   3939 C  CA  . LYS C 1 86  ? 93.994  9.932   40.310  1.00 18.58 ? 86  LYS C CA  1 
ATOM   3940 C  C   . LYS C 1 86  ? 94.467  9.439   38.954  1.00 17.79 ? 86  LYS C C   1 
ATOM   3941 O  O   . LYS C 1 86  ? 95.426  8.679   38.869  1.00 18.29 ? 86  LYS C O   1 
ATOM   3942 C  CB  . LYS C 1 86  ? 93.217  8.799   40.980  1.00 20.67 ? 86  LYS C CB  1 
ATOM   3943 C  CG  . LYS C 1 86  ? 93.097  8.896   42.483  1.00 23.67 ? 86  LYS C CG  1 
ATOM   3944 C  CD  . LYS C 1 86  ? 92.432  7.638   43.017  1.00 27.05 ? 86  LYS C CD  1 
ATOM   3945 C  CE  . LYS C 1 86  ? 92.388  7.627   44.528  1.00 31.76 ? 86  LYS C CE  1 
ATOM   3946 N  NZ  . LYS C 1 86  ? 91.787  6.357   45.029  1.00 36.95 ? 86  LYS C NZ  1 
ATOM   3947 N  N   . GLY C 1 87  ? 93.784  9.859   37.897  1.00 18.88 ? 87  GLY C N   1 
ATOM   3948 C  CA  . GLY C 1 87  ? 94.152  9.420   36.561  1.00 16.28 ? 87  GLY C CA  1 
ATOM   3949 C  C   . GLY C 1 87  ? 95.183  10.300  35.882  1.00 17.56 ? 87  GLY C C   1 
ATOM   3950 O  O   . GLY C 1 87  ? 95.459  10.128  34.697  1.00 16.40 ? 87  GLY C O   1 
ATOM   3951 N  N   . LEU C 1 88  ? 95.761  11.237  36.628  1.00 18.28 ? 88  LEU C N   1 
ATOM   3952 C  CA  . LEU C 1 88  ? 96.758  12.143  36.074  1.00 19.12 ? 88  LEU C CA  1 
ATOM   3953 C  C   . LEU C 1 88  ? 98.118  11.926  36.729  1.00 20.87 ? 88  LEU C C   1 
ATOM   3954 O  O   . LEU C 1 88  ? 98.203  11.725  37.938  1.00 20.73 ? 88  LEU C O   1 
ATOM   3955 C  CB  . LEU C 1 88  ? 96.310  13.593  36.280  1.00 17.21 ? 88  LEU C CB  1 
ATOM   3956 C  CG  . LEU C 1 88  ? 95.011  14.015  35.585  1.00 16.83 ? 88  LEU C CG  1 
ATOM   3957 C  CD1 . LEU C 1 88  ? 94.588  15.406  36.053  1.00 14.69 ? 88  LEU C CD1 1 
ATOM   3958 C  CD2 . LEU C 1 88  ? 95.222  13.992  34.082  1.00 15.88 ? 88  LEU C CD2 1 
ATOM   3959 N  N   . LYS C 1 89  ? 99.175  11.973  35.923  1.00 22.39 ? 89  LYS C N   1 
ATOM   3960 C  CA  . LYS C 1 89  ? 100.535 11.788  36.412  1.00 24.19 ? 89  LYS C CA  1 
ATOM   3961 C  C   . LYS C 1 89  ? 101.529 11.810  35.249  1.00 25.23 ? 89  LYS C C   1 
ATOM   3962 O  O   . LYS C 1 89  ? 101.269 11.231  34.195  1.00 24.06 ? 89  LYS C O   1 
ATOM   3963 C  CB  . LYS C 1 89  ? 100.641 10.455  37.151  1.00 24.96 ? 89  LYS C CB  1 
ATOM   3964 C  CG  . LYS C 1 89  ? 101.961 10.220  37.850  1.00 27.69 ? 89  LYS C CG  1 
ATOM   3965 C  CD  . LYS C 1 89  ? 101.953 8.849   38.502  1.00 32.10 ? 89  LYS C CD  1 
ATOM   3966 C  CE  . LYS C 1 89  ? 103.272 8.535   39.183  1.00 35.43 ? 89  LYS C CE  1 
ATOM   3967 N  NZ  . LYS C 1 89  ? 103.251 7.157   39.768  1.00 39.27 ? 89  LYS C NZ  1 
ATOM   3968 N  N   . LYS C 1 90  ? 102.661 12.481  35.440  1.00 25.70 ? 90  LYS C N   1 
ATOM   3969 C  CA  . LYS C 1 90  ? 103.685 12.543  34.403  1.00 27.49 ? 90  LYS C CA  1 
ATOM   3970 C  C   . LYS C 1 90  ? 104.640 11.356  34.508  1.00 27.99 ? 90  LYS C C   1 
ATOM   3971 O  O   . LYS C 1 90  ? 104.791 10.757  35.572  1.00 28.44 ? 90  LYS C O   1 
ATOM   3972 C  CB  . LYS C 1 90  ? 104.500 13.833  34.524  1.00 27.62 ? 90  LYS C CB  1 
ATOM   3973 C  CG  . LYS C 1 90  ? 103.769 15.096  34.130  1.00 29.68 ? 90  LYS C CG  1 
ATOM   3974 C  CD  . LYS C 1 90  ? 104.630 16.331  34.391  1.00 32.36 ? 90  LYS C CD  1 
ATOM   3975 C  CE  . LYS C 1 90  ? 105.907 16.327  33.561  1.00 32.38 ? 90  LYS C CE  1 
ATOM   3976 N  NZ  . LYS C 1 90  ? 106.734 17.532  33.840  1.00 31.72 ? 90  LYS C NZ  1 
ATOM   3977 N  N   . GLY C 1 91  ? 105.267 11.010  33.389  1.00 28.38 ? 91  GLY C N   1 
ATOM   3978 C  CA  . GLY C 1 91  ? 106.243 9.934   33.389  1.00 28.88 ? 91  GLY C CA  1 
ATOM   3979 C  C   . GLY C 1 91  ? 105.810 8.482   33.309  1.00 29.81 ? 91  GLY C C   1 
ATOM   3980 O  O   . GLY C 1 91  ? 106.650 7.595   33.459  1.00 31.59 ? 91  GLY C O   1 
ATOM   3981 N  N   . THR C 1 92  ? 104.530 8.208   33.089  1.00 28.88 ? 92  THR C N   1 
ATOM   3982 C  CA  . THR C 1 92  ? 104.106 6.818   32.992  1.00 27.90 ? 92  THR C CA  1 
ATOM   3983 C  C   . THR C 1 92  ? 104.132 6.416   31.524  1.00 28.52 ? 92  THR C C   1 
ATOM   3984 O  O   . THR C 1 92  ? 104.246 7.270   30.643  1.00 27.76 ? 92  THR C O   1 
ATOM   3985 C  CB  . THR C 1 92  ? 102.676 6.601   33.564  1.00 27.82 ? 92  THR C CB  1 
ATOM   3986 O  OG1 . THR C 1 92  ? 101.712 7.265   32.739  1.00 27.39 ? 92  THR C OG1 1 
ATOM   3987 C  CG2 . THR C 1 92  ? 102.582 7.141   34.984  1.00 26.40 ? 92  THR C CG2 1 
ATOM   3988 N  N   . THR C 1 93  ? 104.045 5.117   31.259  1.00 28.69 ? 93  THR C N   1 
ATOM   3989 C  CA  . THR C 1 93  ? 104.050 4.630   29.885  1.00 30.42 ? 93  THR C CA  1 
ATOM   3990 C  C   . THR C 1 93  ? 103.038 3.506   29.716  1.00 29.82 ? 93  THR C C   1 
ATOM   3991 O  O   . THR C 1 93  ? 102.902 2.646   30.584  1.00 29.69 ? 93  THR C O   1 
ATOM   3992 C  CB  . THR C 1 93  ? 105.452 4.111   29.473  1.00 31.55 ? 93  THR C CB  1 
ATOM   3993 O  OG1 . THR C 1 93  ? 105.867 3.085   30.380  1.00 34.97 ? 93  THR C OG1 1 
ATOM   3994 C  CG2 . THR C 1 93  ? 106.470 5.238   29.500  1.00 30.61 ? 93  THR C CG2 1 
ATOM   3995 N  N   . LEU C 1 94  ? 102.320 3.526   28.601  1.00 31.14 ? 94  LEU C N   1 
ATOM   3996 C  CA  . LEU C 1 94  ? 101.323 2.501   28.321  1.00 32.89 ? 94  LEU C CA  1 
ATOM   3997 C  C   . LEU C 1 94  ? 102.041 1.185   28.041  1.00 34.53 ? 94  LEU C C   1 
ATOM   3998 O  O   . LEU C 1 94  ? 102.965 1.136   27.233  1.00 35.29 ? 94  LEU C O   1 
ATOM   3999 C  CB  . LEU C 1 94  ? 100.478 2.911   27.112  1.00 30.49 ? 94  LEU C CB  1 
ATOM   4000 C  CG  . LEU C 1 94  ? 99.391  1.939   26.657  1.00 30.11 ? 94  LEU C CG  1 
ATOM   4001 C  CD1 . LEU C 1 94  ? 98.442  1.637   27.800  1.00 29.93 ? 94  LEU C CD1 1 
ATOM   4002 C  CD2 . LEU C 1 94  ? 98.638  2.553   25.488  1.00 31.46 ? 94  LEU C CD2 1 
ATOM   4003 N  N   . GLN C 1 95  ? 101.618 0.118   28.708  1.00 37.03 ? 95  GLN C N   1 
ATOM   4004 C  CA  . GLN C 1 95  ? 102.257 -1.181  28.523  1.00 39.13 ? 95  GLN C CA  1 
ATOM   4005 C  C   . GLN C 1 95  ? 101.447 -2.302  29.162  1.00 39.00 ? 95  GLN C C   1 
ATOM   4006 O  O   . GLN C 1 95  ? 100.368 -2.071  29.712  1.00 39.60 ? 95  GLN C O   1 
ATOM   4007 C  CB  . GLN C 1 95  ? 103.645 -1.146  29.153  1.00 41.41 ? 95  GLN C CB  1 
ATOM   4008 C  CG  . GLN C 1 95  ? 103.596 -0.885  30.649  1.00 44.82 ? 95  GLN C CG  1 
ATOM   4009 C  CD  . GLN C 1 95  ? 104.912 -0.390  31.210  1.00 48.20 ? 95  GLN C CD  1 
ATOM   4010 O  OE1 . GLN C 1 95  ? 105.022 -0.116  32.405  1.00 50.36 ? 95  GLN C OE1 1 
ATOM   4011 N  NE2 . GLN C 1 95  ? 105.919 -0.266  30.350  1.00 49.70 ? 95  GLN C NE2 1 
ATOM   4012 N  N   . GLY C 1 96  ? 101.975 -3.520  29.084  1.00 38.46 ? 96  GLY C N   1 
ATOM   4013 C  CA  . GLY C 1 96  ? 101.304 -4.659  29.686  1.00 37.87 ? 96  GLY C CA  1 
ATOM   4014 C  C   . GLY C 1 96  ? 99.998  -5.087  29.049  1.00 37.69 ? 96  GLY C C   1 
ATOM   4015 O  O   . GLY C 1 96  ? 99.772  -4.878  27.857  1.00 37.19 ? 96  GLY C O   1 
ATOM   4016 N  N   . ASP C 1 97  ? 99.133  -5.689  29.859  1.00 38.01 ? 97  ASP C N   1 
ATOM   4017 C  CA  . ASP C 1 97  ? 97.848  -6.177  29.383  1.00 39.10 ? 97  ASP C CA  1 
ATOM   4018 C  C   . ASP C 1 97  ? 96.927  -5.084  28.843  1.00 38.34 ? 97  ASP C C   1 
ATOM   4019 O  O   . ASP C 1 97  ? 96.175  -5.322  27.897  1.00 39.87 ? 97  ASP C O   1 
ATOM   4020 C  CB  . ASP C 1 97  ? 97.142  -6.967  30.495  1.00 41.89 ? 97  ASP C CB  1 
ATOM   4021 C  CG  . ASP C 1 97  ? 97.961  -8.169  30.977  1.00 45.56 ? 97  ASP C CG  1 
ATOM   4022 O  OD1 . ASP C 1 97  ? 98.827  -8.657  30.211  1.00 45.47 ? 97  ASP C OD1 1 
ATOM   4023 O  OD2 . ASP C 1 97  ? 97.726  -8.636  32.116  1.00 45.62 ? 97  ASP C OD2 1 
ATOM   4024 N  N   . LEU C 1 98  ? 96.982  -3.892  29.430  1.00 36.21 ? 98  LEU C N   1 
ATOM   4025 C  CA  . LEU C 1 98  ? 96.138  -2.796  28.964  1.00 34.82 ? 98  LEU C CA  1 
ATOM   4026 C  C   . LEU C 1 98  ? 96.515  -2.416  27.533  1.00 34.40 ? 98  LEU C C   1 
ATOM   4027 O  O   . LEU C 1 98  ? 95.646  -2.237  26.679  1.00 34.15 ? 98  LEU C O   1 
ATOM   4028 C  CB  . LEU C 1 98  ? 96.279  -1.574  29.879  1.00 32.83 ? 98  LEU C CB  1 
ATOM   4029 C  CG  . LEU C 1 98  ? 95.408  -0.374  29.489  1.00 31.31 ? 98  LEU C CG  1 
ATOM   4030 C  CD1 . LEU C 1 98  ? 93.938  -0.756  29.579  1.00 30.10 ? 98  LEU C CD1 1 
ATOM   4031 C  CD2 . LEU C 1 98  ? 95.710  0.800   30.401  1.00 30.63 ? 98  LEU C CD2 1 
ATOM   4032 N  N   . LYS C 1 99  ? 97.814  -2.300  27.275  1.00 33.93 ? 99  LYS C N   1 
ATOM   4033 C  CA  . LYS C 1 99  ? 98.292  -1.950  25.946  1.00 34.71 ? 99  LYS C CA  1 
ATOM   4034 C  C   . LYS C 1 99  ? 97.862  -3.007  24.936  1.00 35.40 ? 99  LYS C C   1 
ATOM   4035 O  O   . LYS C 1 99  ? 97.528  -2.689  23.792  1.00 35.82 ? 99  LYS C O   1 
ATOM   4036 C  CB  . LYS C 1 99  ? 99.812  -1.820  25.955  1.00 34.90 ? 99  LYS C CB  1 
ATOM   4037 C  CG  . LYS C 1 99  ? 100.420 -1.439  24.617  1.00 36.01 ? 99  LYS C CG  1 
ATOM   4038 C  CD  . LYS C 1 99  ? 101.809 -0.856  24.824  1.00 39.05 ? 99  LYS C CD  1 
ATOM   4039 C  CE  . LYS C 1 99  ? 102.536 -0.639  23.511  1.00 40.34 ? 99  LYS C CE  1 
ATOM   4040 N  NZ  . LYS C 1 99  ? 102.882 -1.939  22.876  1.00 42.69 ? 99  LYS C NZ  1 
ATOM   4041 N  N   . ALA C 1 100 ? 97.864  -4.264  25.369  1.00 34.72 ? 100 ALA C N   1 
ATOM   4042 C  CA  . ALA C 1 100 ? 97.474  -5.370  24.506  1.00 34.49 ? 100 ALA C CA  1 
ATOM   4043 C  C   . ALA C 1 100 ? 95.983  -5.304  24.197  1.00 34.23 ? 100 ALA C C   1 
ATOM   4044 O  O   . ALA C 1 100 ? 95.572  -5.482  23.049  1.00 34.73 ? 100 ALA C O   1 
ATOM   4045 C  CB  . ALA C 1 100 ? 97.813  -6.695  25.172  1.00 34.39 ? 100 ALA C CB  1 
ATOM   4046 N  N   . ALA C 1 101 ? 95.180  -5.046  25.224  1.00 33.25 ? 101 ALA C N   1 
ATOM   4047 C  CA  . ALA C 1 101 ? 93.736  -4.960  25.061  1.00 32.81 ? 101 ALA C CA  1 
ATOM   4048 C  C   . ALA C 1 101 ? 93.350  -3.808  24.139  1.00 32.42 ? 101 ALA C C   1 
ATOM   4049 O  O   . ALA C 1 101 ? 92.393  -3.912  23.370  1.00 32.74 ? 101 ALA C O   1 
ATOM   4050 C  CB  . ALA C 1 101 ? 93.070  -4.791  26.417  1.00 33.93 ? 101 ALA C CB  1 
ATOM   4051 N  N   . ILE C 1 102 ? 94.094  -2.709  24.218  1.00 31.75 ? 102 ILE C N   1 
ATOM   4052 C  CA  . ILE C 1 102 ? 93.815  -1.553  23.377  1.00 32.06 ? 102 ILE C CA  1 
ATOM   4053 C  C   . ILE C 1 102 ? 94.096  -1.869  21.911  1.00 33.36 ? 102 ILE C C   1 
ATOM   4054 O  O   . ILE C 1 102 ? 93.288  -1.550  21.038  1.00 32.96 ? 102 ILE C O   1 
ATOM   4055 C  CB  . ILE C 1 102 ? 94.643  -0.327  23.819  1.00 31.21 ? 102 ILE C CB  1 
ATOM   4056 C  CG1 . ILE C 1 102 ? 94.019  0.281   25.080  1.00 31.72 ? 102 ILE C CG1 1 
ATOM   4057 C  CG2 . ILE C 1 102 ? 94.715  0.695   22.695  1.00 29.13 ? 102 ILE C CG2 1 
ATOM   4058 C  CD1 . ILE C 1 102 ? 94.797  1.448   25.667  1.00 31.79 ? 102 ILE C CD1 1 
ATOM   4059 N  N   . GLU C 1 103 ? 95.237  -2.500  21.644  1.00 34.18 ? 103 GLU C N   1 
ATOM   4060 C  CA  . GLU C 1 103 ? 95.599  -2.869  20.279  1.00 35.46 ? 103 GLU C CA  1 
ATOM   4061 C  C   . GLU C 1 103 ? 94.610  -3.898  19.747  1.00 35.13 ? 103 GLU C C   1 
ATOM   4062 O  O   . GLU C 1 103 ? 94.311  -3.935  18.555  1.00 35.66 ? 103 GLU C O   1 
ATOM   4063 C  CB  . GLU C 1 103 ? 97.007  -3.456  20.246  1.00 35.89 ? 103 GLU C CB  1 
ATOM   4064 C  CG  . GLU C 1 103 ? 98.071  -2.514  20.763  1.00 38.79 ? 103 GLU C CG  1 
ATOM   4065 C  CD  . GLU C 1 103 ? 99.455  -3.113  20.682  1.00 39.79 ? 103 GLU C CD  1 
ATOM   4066 O  OE1 . GLU C 1 103 ? 99.625  -4.270  21.127  1.00 42.17 ? 103 GLU C OE1 1 
ATOM   4067 O  OE2 . GLU C 1 103 ? 100.372 -2.426  20.183  1.00 39.81 ? 103 GLU C OE2 1 
ATOM   4068 N  N   . ARG C 1 104 ? 94.098  -4.727  20.647  1.00 34.56 ? 104 ARG C N   1 
ATOM   4069 C  CA  . ARG C 1 104 ? 93.145  -5.758  20.277  1.00 37.11 ? 104 ARG C CA  1 
ATOM   4070 C  C   . ARG C 1 104 ? 91.798  -5.176  19.861  1.00 37.43 ? 104 ARG C C   1 
ATOM   4071 O  O   . ARG C 1 104 ? 91.238  -5.560  18.832  1.00 36.95 ? 104 ARG C O   1 
ATOM   4072 C  CB  . ARG C 1 104 ? 92.932  -6.724  21.448  1.00 39.14 ? 104 ARG C CB  1 
ATOM   4073 C  CG  . ARG C 1 104 ? 91.897  -7.804  21.174  1.00 42.82 ? 104 ARG C CG  1 
ATOM   4074 C  CD  . ARG C 1 104 ? 91.493  -8.523  22.450  1.00 48.20 ? 104 ARG C CD  1 
ATOM   4075 N  NE  . ARG C 1 104 ? 91.009  -7.586  23.461  1.00 53.54 ? 104 ARG C NE  1 
ATOM   4076 C  CZ  . ARG C 1 104 ? 90.376  -7.939  24.577  1.00 55.35 ? 104 ARG C CZ  1 
ATOM   4077 N  NH1 . ARG C 1 104 ? 90.138  -9.219  24.839  1.00 55.43 ? 104 ARG C NH1 1 
ATOM   4078 N  NH2 . ARG C 1 104 ? 89.979  -7.005  25.434  1.00 56.49 ? 104 ARG C NH2 1 
ATOM   4079 N  N   . ASP C 1 105 ? 91.280  -4.248  20.662  1.00 36.73 ? 105 ASP C N   1 
ATOM   4080 C  CA  . ASP C 1 105 ? 89.982  -3.653  20.380  1.00 35.62 ? 105 ASP C CA  1 
ATOM   4081 C  C   . ASP C 1 105 ? 89.986  -2.434  19.462  1.00 34.51 ? 105 ASP C C   1 
ATOM   4082 O  O   . ASP C 1 105 ? 88.943  -2.068  18.919  1.00 35.01 ? 105 ASP C O   1 
ATOM   4083 C  CB  . ASP C 1 105 ? 89.276  -3.297  21.693  1.00 36.54 ? 105 ASP C CB  1 
ATOM   4084 C  CG  . ASP C 1 105 ? 88.976  -4.517  22.548  1.00 39.06 ? 105 ASP C CG  1 
ATOM   4085 O  OD1 . ASP C 1 105 ? 88.654  -5.585  21.976  1.00 39.96 ? 105 ASP C OD1 1 
ATOM   4086 O  OD2 . ASP C 1 105 ? 89.045  -4.406  23.794  1.00 39.10 ? 105 ASP C OD2 1 
ATOM   4087 N  N   . PHE C 1 106 ? 91.142  -1.807  19.275  1.00 32.92 ? 106 PHE C N   1 
ATOM   4088 C  CA  . PHE C 1 106 ? 91.212  -0.621  18.424  1.00 32.58 ? 106 PHE C CA  1 
ATOM   4089 C  C   . PHE C 1 106 ? 92.169  -0.762  17.252  1.00 34.35 ? 106 PHE C C   1 
ATOM   4090 O  O   . PHE C 1 106 ? 92.232  0.112   16.384  1.00 34.22 ? 106 PHE C O   1 
ATOM   4091 C  CB  . PHE C 1 106 ? 91.602  0.599   19.259  1.00 31.61 ? 106 PHE C CB  1 
ATOM   4092 C  CG  . PHE C 1 106 ? 90.542  1.025   20.235  1.00 31.73 ? 106 PHE C CG  1 
ATOM   4093 C  CD1 . PHE C 1 106 ? 89.415  1.716   19.800  1.00 30.57 ? 106 PHE C CD1 1 
ATOM   4094 C  CD2 . PHE C 1 106 ? 90.656  0.711   21.586  1.00 30.84 ? 106 PHE C CD2 1 
ATOM   4095 C  CE1 . PHE C 1 106 ? 88.417  2.089   20.695  1.00 29.48 ? 106 PHE C CE1 1 
ATOM   4096 C  CE2 . PHE C 1 106 ? 89.660  1.080   22.489  1.00 30.25 ? 106 PHE C CE2 1 
ATOM   4097 C  CZ  . PHE C 1 106 ? 88.539  1.770   22.040  1.00 28.32 ? 106 PHE C CZ  1 
ATOM   4098 N  N   . GLY C 1 107 ? 92.912  -1.863  17.223  1.00 35.31 ? 107 GLY C N   1 
ATOM   4099 C  CA  . GLY C 1 107 ? 93.850  -2.083  16.138  1.00 35.77 ? 107 GLY C CA  1 
ATOM   4100 C  C   . GLY C 1 107 ? 95.246  -1.638  16.506  1.00 36.92 ? 107 GLY C C   1 
ATOM   4101 O  O   . GLY C 1 107 ? 96.222  -2.334  16.237  1.00 37.99 ? 107 GLY C O   1 
ATOM   4102 N  N   . SER C 1 108 ? 95.344  -0.469  17.126  1.00 36.94 ? 108 SER C N   1 
ATOM   4103 C  CA  . SER C 1 108 ? 96.631  0.069   17.540  1.00 36.91 ? 108 SER C CA  1 
ATOM   4104 C  C   . SER C 1 108 ? 96.409  1.205   18.524  1.00 37.43 ? 108 SER C C   1 
ATOM   4105 O  O   . SER C 1 108 ? 95.295  1.713   18.658  1.00 37.63 ? 108 SER C O   1 
ATOM   4106 C  CB  . SER C 1 108 ? 97.400  0.598   16.331  1.00 37.17 ? 108 SER C CB  1 
ATOM   4107 O  OG  . SER C 1 108 ? 96.704  1.672   15.721  1.00 37.51 ? 108 SER C OG  1 
ATOM   4108 N  N   . VAL C 1 109 ? 97.477  1.602   19.207  1.00 37.38 ? 109 VAL C N   1 
ATOM   4109 C  CA  . VAL C 1 109 ? 97.400  2.687   20.170  1.00 36.59 ? 109 VAL C CA  1 
ATOM   4110 C  C   . VAL C 1 109 ? 97.007  3.983   19.467  1.00 37.04 ? 109 VAL C C   1 
ATOM   4111 O  O   . VAL C 1 109 ? 96.241  4.781   20.009  1.00 36.52 ? 109 VAL C O   1 
ATOM   4112 C  CB  . VAL C 1 109 ? 98.748  2.883   20.890  1.00 35.04 ? 109 VAL C CB  1 
ATOM   4113 C  CG1 . VAL C 1 109 ? 98.697  4.122   21.771  1.00 33.21 ? 109 VAL C CG1 1 
ATOM   4114 C  CG2 . VAL C 1 109 ? 99.063  1.650   21.726  1.00 34.62 ? 109 VAL C CG2 1 
ATOM   4115 N  N   . ASP C 1 110 ? 97.525  4.184   18.256  1.00 37.15 ? 110 ASP C N   1 
ATOM   4116 C  CA  . ASP C 1 110 ? 97.221  5.388   17.491  1.00 37.55 ? 110 ASP C CA  1 
ATOM   4117 C  C   . ASP C 1 110 ? 95.747  5.476   17.117  1.00 36.39 ? 110 ASP C C   1 
ATOM   4118 O  O   . ASP C 1 110 ? 95.157  6.553   17.155  1.00 36.07 ? 110 ASP C O   1 
ATOM   4119 C  CB  . ASP C 1 110 ? 98.074  5.448   16.226  1.00 40.26 ? 110 ASP C CB  1 
ATOM   4120 C  CG  . ASP C 1 110 ? 99.546  5.622   16.530  1.00 44.25 ? 110 ASP C CG  1 
ATOM   4121 O  OD1 . ASP C 1 110 ? 99.888  6.533   17.314  1.00 47.03 ? 110 ASP C OD1 1 
ATOM   4122 O  OD2 . ASP C 1 110 ? 100.363 4.854   15.981  1.00 47.25 ? 110 ASP C OD2 1 
ATOM   4123 N  N   . ASN C 1 111 ? 95.159  4.345   16.746  1.00 35.46 ? 111 ASN C N   1 
ATOM   4124 C  CA  . ASN C 1 111 ? 93.748  4.306   16.391  1.00 34.91 ? 111 ASN C CA  1 
ATOM   4125 C  C   . ASN C 1 111 ? 92.939  4.710   17.611  1.00 33.39 ? 111 ASN C C   1 
ATOM   4126 O  O   . ASN C 1 111 ? 91.993  5.496   17.526  1.00 33.03 ? 111 ASN C O   1 
ATOM   4127 C  CB  . ASN C 1 111 ? 93.346  2.893   15.986  1.00 37.95 ? 111 ASN C CB  1 
ATOM   4128 C  CG  . ASN C 1 111 ? 93.154  2.750   14.503  1.00 42.75 ? 111 ASN C CG  1 
ATOM   4129 O  OD1 . ASN C 1 111 ? 92.385  3.499   13.894  1.00 46.39 ? 111 ASN C OD1 1 
ATOM   4130 N  ND2 . ASN C 1 111 ? 93.842  1.782   13.905  1.00 43.50 ? 111 ASN C ND2 1 
ATOM   4131 N  N   . PHE C 1 112 ? 93.317  4.142   18.750  1.00 30.92 ? 112 PHE C N   1 
ATOM   4132 C  CA  . PHE C 1 112 ? 92.646  4.431   20.000  1.00 27.66 ? 112 PHE C CA  1 
ATOM   4133 C  C   . PHE C 1 112 ? 92.699  5.925   20.303  1.00 26.60 ? 112 PHE C C   1 
ATOM   4134 O  O   . PHE C 1 112 ? 91.670  6.539   20.579  1.00 26.02 ? 112 PHE C O   1 
ATOM   4135 C  CB  . PHE C 1 112 ? 93.292  3.654   21.148  1.00 26.13 ? 112 PHE C CB  1 
ATOM   4136 C  CG  . PHE C 1 112 ? 92.964  4.211   22.503  1.00 26.27 ? 112 PHE C CG  1 
ATOM   4137 C  CD1 . PHE C 1 112 ? 91.652  4.234   22.959  1.00 24.32 ? 112 PHE C CD1 1 
ATOM   4138 C  CD2 . PHE C 1 112 ? 93.959  4.776   23.296  1.00 25.70 ? 112 PHE C CD2 1 
ATOM   4139 C  CE1 . PHE C 1 112 ? 91.335  4.817   24.182  1.00 24.45 ? 112 PHE C CE1 1 
ATOM   4140 C  CE2 . PHE C 1 112 ? 93.650  5.362   24.524  1.00 24.29 ? 112 PHE C CE2 1 
ATOM   4141 C  CZ  . PHE C 1 112 ? 92.337  5.383   24.964  1.00 24.35 ? 112 PHE C CZ  1 
ATOM   4142 N  N   . LYS C 1 113 ? 93.897  6.504   20.255  1.00 25.39 ? 113 LYS C N   1 
ATOM   4143 C  CA  . LYS C 1 113 ? 94.061  7.925   20.528  1.00 25.14 ? 113 LYS C CA  1 
ATOM   4144 C  C   . LYS C 1 113 ? 93.182  8.781   19.622  1.00 24.83 ? 113 LYS C C   1 
ATOM   4145 O  O   . LYS C 1 113 ? 92.539  9.725   20.078  1.00 23.60 ? 113 LYS C O   1 
ATOM   4146 C  CB  . LYS C 1 113 ? 95.520  8.346   20.357  1.00 25.09 ? 113 LYS C CB  1 
ATOM   4147 C  CG  . LYS C 1 113 ? 96.422  7.986   21.517  1.00 28.69 ? 113 LYS C CG  1 
ATOM   4148 C  CD  . LYS C 1 113 ? 97.721  8.770   21.428  1.00 31.36 ? 113 LYS C CD  1 
ATOM   4149 C  CE  . LYS C 1 113 ? 98.598  8.540   22.642  1.00 34.33 ? 113 LYS C CE  1 
ATOM   4150 N  NZ  . LYS C 1 113 ? 99.836  9.367   22.571  1.00 37.56 ? 113 LYS C NZ  1 
ATOM   4151 N  N   . ALA C 1 114 ? 93.163  8.447   18.335  1.00 24.06 ? 114 ALA C N   1 
ATOM   4152 C  CA  . ALA C 1 114 ? 92.364  9.185   17.368  1.00 24.67 ? 114 ALA C CA  1 
ATOM   4153 C  C   . ALA C 1 114 ? 90.884  9.092   17.723  1.00 24.07 ? 114 ALA C C   1 
ATOM   4154 O  O   . ALA C 1 114 ? 90.154  10.075  17.647  1.00 23.93 ? 114 ALA C O   1 
ATOM   4155 C  CB  . ALA C 1 114 ? 92.602  8.627   15.969  1.00 23.92 ? 114 ALA C CB  1 
ATOM   4156 N  N   . GLU C 1 115 ? 90.452  7.900   18.111  1.00 24.23 ? 115 GLU C N   1 
ATOM   4157 C  CA  . GLU C 1 115 ? 89.063  7.663   18.473  1.00 26.06 ? 115 GLU C CA  1 
ATOM   4158 C  C   . GLU C 1 115 ? 88.689  8.458   19.730  1.00 25.17 ? 115 GLU C C   1 
ATOM   4159 O  O   . GLU C 1 115 ? 87.611  9.045   19.811  1.00 24.79 ? 115 GLU C O   1 
ATOM   4160 C  CB  . GLU C 1 115 ? 88.856  6.163   18.711  1.00 30.52 ? 115 GLU C CB  1 
ATOM   4161 C  CG  . GLU C 1 115 ? 87.468  5.642   18.352  1.00 38.44 ? 115 GLU C CG  1 
ATOM   4162 C  CD  . GLU C 1 115 ? 87.093  5.953   16.910  1.00 42.90 ? 115 GLU C CD  1 
ATOM   4163 O  OE1 . GLU C 1 115 ? 87.946  5.753   16.017  1.00 45.22 ? 115 GLU C OE1 1 
ATOM   4164 O  OE2 . GLU C 1 115 ? 85.948  6.394   16.667  1.00 45.34 ? 115 GLU C OE2 1 
ATOM   4165 N  N   . PHE C 1 116 ? 89.590  8.473   20.709  1.00 24.10 ? 116 PHE C N   1 
ATOM   4166 C  CA  . PHE C 1 116 ? 89.354  9.189   21.958  1.00 21.86 ? 116 PHE C CA  1 
ATOM   4167 C  C   . PHE C 1 116 ? 89.306  10.692  21.711  1.00 21.36 ? 116 PHE C C   1 
ATOM   4168 O  O   . PHE C 1 116 ? 88.429  11.389  22.228  1.00 19.74 ? 116 PHE C O   1 
ATOM   4169 C  CB  . PHE C 1 116 ? 90.459  8.889   22.958  1.00 21.07 ? 116 PHE C CB  1 
ATOM   4170 C  CG  . PHE C 1 116 ? 90.185  9.412   24.332  1.00 21.14 ? 116 PHE C CG  1 
ATOM   4171 C  CD1 . PHE C 1 116 ? 89.397  8.685   25.220  1.00 19.99 ? 116 PHE C CD1 1 
ATOM   4172 C  CD2 . PHE C 1 116 ? 90.727  10.623  24.751  1.00 21.69 ? 116 PHE C CD2 1 
ATOM   4173 C  CE1 . PHE C 1 116 ? 89.155  9.152   26.505  1.00 19.91 ? 116 PHE C CE1 1 
ATOM   4174 C  CE2 . PHE C 1 116 ? 90.490  11.100  26.035  1.00 21.05 ? 116 PHE C CE2 1 
ATOM   4175 C  CZ  . PHE C 1 116 ? 89.703  10.361  26.916  1.00 20.07 ? 116 PHE C CZ  1 
ATOM   4176 N  N   . GLU C 1 117 ? 90.254  11.189  20.924  1.00 21.20 ? 117 GLU C N   1 
ATOM   4177 C  CA  . GLU C 1 117 ? 90.301  12.611  20.606  1.00 23.07 ? 117 GLU C CA  1 
ATOM   4178 C  C   . GLU C 1 117 ? 89.028  13.065  19.896  1.00 22.55 ? 117 GLU C C   1 
ATOM   4179 O  O   . GLU C 1 117 ? 88.499  14.144  20.174  1.00 21.82 ? 117 GLU C O   1 
ATOM   4180 C  CB  . GLU C 1 117 ? 91.525  12.913  19.743  1.00 24.42 ? 117 GLU C CB  1 
ATOM   4181 C  CG  . GLU C 1 117 ? 92.830  12.872  20.524  1.00 30.02 ? 117 GLU C CG  1 
ATOM   4182 C  CD  . GLU C 1 117 ? 94.043  13.119  19.650  1.00 33.03 ? 117 GLU C CD  1 
ATOM   4183 O  OE1 . GLU C 1 117 ? 93.951  13.967  18.736  1.00 38.57 ? 117 GLU C OE1 1 
ATOM   4184 O  OE2 . GLU C 1 117 ? 95.088  12.479  19.884  1.00 32.29 ? 117 GLU C OE2 1 
ATOM   4185 N  N   . LYS C 1 118 ? 88.536  12.228  18.989  1.00 22.20 ? 118 LYS C N   1 
ATOM   4186 C  CA  . LYS C 1 118 ? 87.327  12.528  18.244  1.00 22.40 ? 118 LYS C CA  1 
ATOM   4187 C  C   . LYS C 1 118 ? 86.135  12.636  19.193  1.00 19.85 ? 118 LYS C C   1 
ATOM   4188 O  O   . LYS C 1 118 ? 85.345  13.570  19.103  1.00 18.50 ? 118 LYS C O   1 
ATOM   4189 C  CB  . LYS C 1 118 ? 87.087  11.439  17.191  1.00 26.62 ? 118 LYS C CB  1 
ATOM   4190 C  CG  . LYS C 1 118 ? 85.819  11.630  16.358  1.00 34.00 ? 118 LYS C CG  1 
ATOM   4191 C  CD  . LYS C 1 118 ? 85.852  10.803  15.061  1.00 39.41 ? 118 LYS C CD  1 
ATOM   4192 C  CE  . LYS C 1 118 ? 85.958  9.300   15.331  1.00 42.56 ? 118 LYS C CE  1 
ATOM   4193 N  NZ  . LYS C 1 118 ? 85.996  8.495   14.071  1.00 43.84 ? 118 LYS C NZ  1 
ATOM   4194 N  N   . ALA C 1 119 ? 86.014  11.682  20.107  1.00 18.09 ? 119 ALA C N   1 
ATOM   4195 C  CA  . ALA C 1 119 ? 84.916  11.692  21.066  1.00 18.49 ? 119 ALA C CA  1 
ATOM   4196 C  C   . ALA C 1 119 ? 85.001  12.913  21.983  1.00 18.32 ? 119 ALA C C   1 
ATOM   4197 O  O   . ALA C 1 119 ? 83.989  13.555  22.272  1.00 18.17 ? 119 ALA C O   1 
ATOM   4198 C  CB  . ALA C 1 119 ? 84.933  10.415  21.892  1.00 16.30 ? 119 ALA C CB  1 
ATOM   4199 N  N   . ALA C 1 120 ? 86.214  13.233  22.429  1.00 17.08 ? 120 ALA C N   1 
ATOM   4200 C  CA  . ALA C 1 120 ? 86.435  14.369  23.317  1.00 16.77 ? 120 ALA C CA  1 
ATOM   4201 C  C   . ALA C 1 120 ? 86.168  15.695  22.622  1.00 17.93 ? 120 ALA C C   1 
ATOM   4202 O  O   . ALA C 1 120 ? 85.606  16.610  23.217  1.00 18.21 ? 120 ALA C O   1 
ATOM   4203 C  CB  . ALA C 1 120 ? 87.866  14.345  23.851  1.00 15.28 ? 120 ALA C CB  1 
ATOM   4204 N  N   . ALA C 1 121 ? 86.575  15.800  21.362  1.00 18.18 ? 121 ALA C N   1 
ATOM   4205 C  CA  . ALA C 1 121 ? 86.383  17.033  20.614  1.00 18.90 ? 121 ALA C CA  1 
ATOM   4206 C  C   . ALA C 1 121 ? 84.948  17.232  20.139  1.00 19.60 ? 121 ALA C C   1 
ATOM   4207 O  O   . ALA C 1 121 ? 84.486  18.365  20.027  1.00 19.91 ? 121 ALA C O   1 
ATOM   4208 C  CB  . ALA C 1 121 ? 87.336  17.070  19.420  1.00 18.44 ? 121 ALA C CB  1 
ATOM   4209 N  N   . SER C 1 122 ? 84.237  16.139  19.876  1.00 19.59 ? 122 SER C N   1 
ATOM   4210 C  CA  . SER C 1 122 ? 82.869  16.240  19.385  1.00 20.91 ? 122 SER C CA  1 
ATOM   4211 C  C   . SER C 1 122 ? 81.799  16.366  20.474  1.00 20.88 ? 122 SER C C   1 
ATOM   4212 O  O   . SER C 1 122 ? 80.625  16.555  20.163  1.00 21.55 ? 122 SER C O   1 
ATOM   4213 C  CB  . SER C 1 122 ? 82.555  15.055  18.470  1.00 20.95 ? 122 SER C CB  1 
ATOM   4214 O  OG  . SER C 1 122 ? 82.633  13.843  19.190  1.00 29.38 ? 122 SER C OG  1 
ATOM   4215 N  N   . ARG C 1 123 ? 82.189  16.251  21.742  1.00 18.93 ? 123 ARG C N   1 
ATOM   4216 C  CA  . ARG C 1 123 ? 81.229  16.409  22.834  1.00 17.80 ? 123 ARG C CA  1 
ATOM   4217 C  C   . ARG C 1 123 ? 80.881  17.897  22.880  1.00 17.26 ? 123 ARG C C   1 
ATOM   4218 O  O   . ARG C 1 123 ? 81.694  18.720  23.301  1.00 18.07 ? 123 ARG C O   1 
ATOM   4219 C  CB  . ARG C 1 123 ? 81.845  15.953  24.164  1.00 18.70 ? 123 ARG C CB  1 
ATOM   4220 C  CG  . ARG C 1 123 ? 81.110  16.406  25.431  1.00 18.79 ? 123 ARG C CG  1 
ATOM   4221 C  CD  . ARG C 1 123 ? 79.598  16.164  25.384  1.00 20.47 ? 123 ARG C CD  1 
ATOM   4222 N  NE  . ARG C 1 123 ? 79.228  14.763  25.196  1.00 18.39 ? 123 ARG C NE  1 
ATOM   4223 C  CZ  . ARG C 1 123 ? 77.971  14.327  25.160  1.00 18.86 ? 123 ARG C CZ  1 
ATOM   4224 N  NH1 . ARG C 1 123 ? 76.964  15.180  25.302  1.00 15.42 ? 123 ARG C NH1 1 
ATOM   4225 N  NH2 . ARG C 1 123 ? 77.719  13.038  24.978  1.00 19.59 ? 123 ARG C NH2 1 
ATOM   4226 N  N   . PHE C 1 124 ? 79.677  18.236  22.425  1.00 16.17 ? 124 PHE C N   1 
ATOM   4227 C  CA  . PHE C 1 124 ? 79.231  19.624  22.377  1.00 13.99 ? 124 PHE C CA  1 
ATOM   4228 C  C   . PHE C 1 124 ? 78.713  20.095  23.729  1.00 13.64 ? 124 PHE C C   1 
ATOM   4229 O  O   . PHE C 1 124 ? 77.860  19.448  24.337  1.00 13.67 ? 124 PHE C O   1 
ATOM   4230 C  CB  . PHE C 1 124 ? 78.141  19.783  21.312  1.00 14.10 ? 124 PHE C CB  1 
ATOM   4231 C  CG  . PHE C 1 124 ? 77.911  21.208  20.888  1.00 13.56 ? 124 PHE C CG  1 
ATOM   4232 C  CD1 . PHE C 1 124 ? 78.883  21.896  20.161  1.00 13.49 ? 124 PHE C CD1 1 
ATOM   4233 C  CD2 . PHE C 1 124 ? 76.731  21.869  21.227  1.00 12.02 ? 124 PHE C CD2 1 
ATOM   4234 C  CE1 . PHE C 1 124 ? 78.684  23.226  19.778  1.00 14.11 ? 124 PHE C CE1 1 
ATOM   4235 C  CE2 . PHE C 1 124 ? 76.519  23.197  20.852  1.00 11.70 ? 124 PHE C CE2 1 
ATOM   4236 C  CZ  . PHE C 1 124 ? 77.499  23.877  20.125  1.00 14.20 ? 124 PHE C CZ  1 
ATOM   4237 N  N   . GLY C 1 125 ? 79.225  21.234  24.192  1.00 12.51 ? 125 GLY C N   1 
ATOM   4238 C  CA  . GLY C 1 125 ? 78.812  21.748  25.483  1.00 12.31 ? 125 GLY C CA  1 
ATOM   4239 C  C   . GLY C 1 125 ? 79.716  21.152  26.546  1.00 12.99 ? 125 GLY C C   1 
ATOM   4240 O  O   . GLY C 1 125 ? 80.875  20.847  26.263  1.00 12.61 ? 125 GLY C O   1 
ATOM   4241 N  N   . SER C 1 126 ? 79.194  20.974  27.758  1.00 12.76 ? 126 SER C N   1 
ATOM   4242 C  CA  . SER C 1 126 ? 79.976  20.416  28.865  1.00 12.52 ? 126 SER C CA  1 
ATOM   4243 C  C   . SER C 1 126 ? 79.874  18.895  28.918  1.00 13.37 ? 126 SER C C   1 
ATOM   4244 O  O   . SER C 1 126 ? 78.816  18.324  28.638  1.00 13.50 ? 126 SER C O   1 
ATOM   4245 C  CB  . SER C 1 126 ? 79.493  20.995  30.201  1.00 11.27 ? 126 SER C CB  1 
ATOM   4246 O  OG  . SER C 1 126 ? 79.574  22.409  30.215  1.00 9.33  ? 126 SER C OG  1 
ATOM   4247 N  N   . GLY C 1 127 ? 80.968  18.237  29.292  1.00 13.03 ? 127 GLY C N   1 
ATOM   4248 C  CA  . GLY C 1 127 ? 80.940  16.789  29.369  1.00 13.51 ? 127 GLY C CA  1 
ATOM   4249 C  C   . GLY C 1 127 ? 82.272  16.117  29.630  1.00 14.01 ? 127 GLY C C   1 
ATOM   4250 O  O   . GLY C 1 127 ? 83.253  16.765  30.011  1.00 13.49 ? 127 GLY C O   1 
ATOM   4251 N  N   . TRP C 1 128 ? 82.293  14.802  29.420  1.00 14.43 ? 128 TRP C N   1 
ATOM   4252 C  CA  . TRP C 1 128 ? 83.483  13.976  29.630  1.00 12.16 ? 128 TRP C CA  1 
ATOM   4253 C  C   . TRP C 1 128 ? 83.641  12.963  28.509  1.00 13.28 ? 128 TRP C C   1 
ATOM   4254 O  O   . TRP C 1 128 ? 82.663  12.572  27.869  1.00 13.55 ? 128 TRP C O   1 
ATOM   4255 C  CB  . TRP C 1 128 ? 83.374  13.177  30.931  1.00 11.13 ? 128 TRP C CB  1 
ATOM   4256 C  CG  . TRP C 1 128 ? 83.381  13.977  32.179  1.00 11.60 ? 128 TRP C CG  1 
ATOM   4257 C  CD1 . TRP C 1 128 ? 82.366  14.745  32.670  1.00 9.96  ? 128 TRP C CD1 1 
ATOM   4258 C  CD2 . TRP C 1 128 ? 84.465  14.099  33.103  1.00 11.28 ? 128 TRP C CD2 1 
ATOM   4259 N  NE1 . TRP C 1 128 ? 82.752  15.340  33.846  1.00 11.92 ? 128 TRP C NE1 1 
ATOM   4260 C  CE2 . TRP C 1 128 ? 84.037  14.962  34.135  1.00 11.59 ? 128 TRP C CE2 1 
ATOM   4261 C  CE3 . TRP C 1 128 ? 85.759  13.562  33.159  1.00 11.36 ? 128 TRP C CE3 1 
ATOM   4262 C  CZ2 . TRP C 1 128 ? 84.858  15.306  35.215  1.00 12.13 ? 128 TRP C CZ2 1 
ATOM   4263 C  CZ3 . TRP C 1 128 ? 86.578  13.903  34.235  1.00 12.64 ? 128 TRP C CZ3 1 
ATOM   4264 C  CH2 . TRP C 1 128 ? 86.120  14.769  35.249  1.00 13.86 ? 128 TRP C CH2 1 
ATOM   4265 N  N   . ALA C 1 129 ? 84.878  12.534  28.290  1.00 12.99 ? 129 ALA C N   1 
ATOM   4266 C  CA  . ALA C 1 129 ? 85.181  11.517  27.289  1.00 14.24 ? 129 ALA C CA  1 
ATOM   4267 C  C   . ALA C 1 129 ? 85.765  10.365  28.109  1.00 15.28 ? 129 ALA C C   1 
ATOM   4268 O  O   . ALA C 1 129 ? 86.596  10.584  28.994  1.00 14.69 ? 129 ALA C O   1 
ATOM   4269 C  CB  . ALA C 1 129 ? 86.200  12.042  26.270  1.00 13.72 ? 129 ALA C CB  1 
ATOM   4270 N  N   . TRP C 1 130 ? 85.324  9.144   27.829  1.00 17.35 ? 130 TRP C N   1 
ATOM   4271 C  CA  . TRP C 1 130 ? 85.798  7.990   28.587  1.00 17.45 ? 130 TRP C CA  1 
ATOM   4272 C  C   . TRP C 1 130 ? 86.302  6.800   27.786  1.00 18.71 ? 130 TRP C C   1 
ATOM   4273 O  O   . TRP C 1 130 ? 85.947  6.599   26.624  1.00 18.11 ? 130 TRP C O   1 
ATOM   4274 C  CB  . TRP C 1 130 ? 84.686  7.437   29.484  1.00 17.11 ? 130 TRP C CB  1 
ATOM   4275 C  CG  . TRP C 1 130 ? 83.874  8.439   30.214  1.00 17.51 ? 130 TRP C CG  1 
ATOM   4276 C  CD1 . TRP C 1 130 ? 82.775  9.097   29.752  1.00 15.89 ? 130 TRP C CD1 1 
ATOM   4277 C  CD2 . TRP C 1 130 ? 84.084  8.891   31.554  1.00 17.05 ? 130 TRP C CD2 1 
ATOM   4278 N  NE1 . TRP C 1 130 ? 82.281  9.930   30.723  1.00 15.54 ? 130 TRP C NE1 1 
ATOM   4279 C  CE2 . TRP C 1 130 ? 83.066  9.826   31.841  1.00 16.58 ? 130 TRP C CE2 1 
ATOM   4280 C  CE3 . TRP C 1 130 ? 85.033  8.597   32.542  1.00 15.63 ? 130 TRP C CE3 1 
ATOM   4281 C  CZ2 . TRP C 1 130 ? 82.970  10.476  33.079  1.00 16.24 ? 130 TRP C CZ2 1 
ATOM   4282 C  CZ3 . TRP C 1 130 ? 84.937  9.242   33.773  1.00 17.16 ? 130 TRP C CZ3 1 
ATOM   4283 C  CH2 . TRP C 1 130 ? 83.912  10.171  34.028  1.00 16.65 ? 130 TRP C CH2 1 
ATOM   4284 N  N   . LEU C 1 131 ? 87.134  6.008   28.453  1.00 19.84 ? 131 LEU C N   1 
ATOM   4285 C  CA  . LEU C 1 131 ? 87.632  4.750   27.920  1.00 21.20 ? 131 LEU C CA  1 
ATOM   4286 C  C   . LEU C 1 131 ? 86.979  3.819   28.936  1.00 21.88 ? 131 LEU C C   1 
ATOM   4287 O  O   . LEU C 1 131 ? 87.344  3.836   30.112  1.00 22.64 ? 131 LEU C O   1 
ATOM   4288 C  CB  . LEU C 1 131 ? 89.151  4.632   28.033  1.00 21.23 ? 131 LEU C CB  1 
ATOM   4289 C  CG  . LEU C 1 131 ? 89.673  3.200   27.823  1.00 23.26 ? 131 LEU C CG  1 
ATOM   4290 C  CD1 . LEU C 1 131 ? 89.293  2.696   26.437  1.00 21.76 ? 131 LEU C CD1 1 
ATOM   4291 C  CD2 . LEU C 1 131 ? 91.185  3.165   28.001  1.00 23.14 ? 131 LEU C CD2 1 
ATOM   4292 N  N   . VAL C 1 132 ? 85.993  3.045   28.502  1.00 22.06 ? 132 VAL C N   1 
ATOM   4293 C  CA  . VAL C 1 132 ? 85.294  2.136   29.404  1.00 23.59 ? 132 VAL C CA  1 
ATOM   4294 C  C   . VAL C 1 132 ? 85.484  0.671   29.034  1.00 24.93 ? 132 VAL C C   1 
ATOM   4295 O  O   . VAL C 1 132 ? 85.852  0.342   27.907  1.00 24.01 ? 132 VAL C O   1 
ATOM   4296 C  CB  . VAL C 1 132 ? 83.773  2.410   29.411  1.00 21.71 ? 132 VAL C CB  1 
ATOM   4297 C  CG1 . VAL C 1 132 ? 83.488  3.795   29.964  1.00 20.68 ? 132 VAL C CG1 1 
ATOM   4298 C  CG2 . VAL C 1 132 ? 83.224  2.277   28.001  1.00 19.08 ? 132 VAL C CG2 1 
ATOM   4299 N  N   . LEU C 1 133 ? 85.225  -0.198  30.002  1.00 27.17 ? 133 LEU C N   1 
ATOM   4300 C  CA  . LEU C 1 133 ? 85.315  -1.632  29.799  1.00 29.20 ? 133 LEU C CA  1 
ATOM   4301 C  C   . LEU C 1 133 ? 83.874  -2.128  29.826  1.00 30.64 ? 133 LEU C C   1 
ATOM   4302 O  O   . LEU C 1 133 ? 83.232  -2.127  30.876  1.00 29.89 ? 133 LEU C O   1 
ATOM   4303 C  CB  . LEU C 1 133 ? 86.116  -2.287  30.929  1.00 29.20 ? 133 LEU C CB  1 
ATOM   4304 C  CG  . LEU C 1 133 ? 86.390  -3.786  30.777  1.00 29.05 ? 133 LEU C CG  1 
ATOM   4305 C  CD1 . LEU C 1 133 ? 87.215  -4.021  29.527  1.00 27.78 ? 133 LEU C CD1 1 
ATOM   4306 C  CD2 . LEU C 1 133 ? 87.127  -4.304  32.000  1.00 28.19 ? 133 LEU C CD2 1 
ATOM   4307 N  N   . LYS C 1 134 ? 83.354  -2.501  28.662  1.00 34.08 ? 134 LYS C N   1 
ATOM   4308 C  CA  . LYS C 1 134 ? 81.985  -3.006  28.566  1.00 38.03 ? 134 LYS C CA  1 
ATOM   4309 C  C   . LYS C 1 134 ? 82.045  -4.523  28.417  1.00 39.46 ? 134 LYS C C   1 
ATOM   4310 O  O   . LYS C 1 134 ? 82.063  -5.052  27.302  1.00 40.05 ? 134 LYS C O   1 
ATOM   4311 C  CB  . LYS C 1 134 ? 81.263  -2.397  27.360  1.00 39.13 ? 134 LYS C CB  1 
ATOM   4312 C  CG  . LYS C 1 134 ? 81.252  -0.878  27.332  1.00 42.99 ? 134 LYS C CG  1 
ATOM   4313 C  CD  . LYS C 1 134 ? 80.397  -0.336  26.189  1.00 44.53 ? 134 LYS C CD  1 
ATOM   4314 C  CE  . LYS C 1 134 ? 78.923  -0.649  26.399  1.00 46.98 ? 134 LYS C CE  1 
ATOM   4315 N  NZ  . LYS C 1 134 ? 78.081  -0.078  25.307  1.00 50.34 ? 134 LYS C NZ  1 
ATOM   4316 N  N   . GLY C 1 135 ? 82.087  -5.217  29.547  1.00 40.18 ? 135 GLY C N   1 
ATOM   4317 C  CA  . GLY C 1 135 ? 82.161  -6.663  29.517  1.00 40.70 ? 135 GLY C CA  1 
ATOM   4318 C  C   . GLY C 1 135 ? 83.580  -7.149  29.283  1.00 41.04 ? 135 GLY C C   1 
ATOM   4319 O  O   . GLY C 1 135 ? 84.412  -7.138  30.192  1.00 41.09 ? 135 GLY C O   1 
ATOM   4320 N  N   . ASP C 1 136 ? 83.860  -7.572  28.056  1.00 40.58 ? 136 ASP C N   1 
ATOM   4321 C  CA  . ASP C 1 136 ? 85.181  -8.078  27.710  1.00 41.83 ? 136 ASP C CA  1 
ATOM   4322 C  C   . ASP C 1 136 ? 85.813  -7.206  26.640  1.00 41.07 ? 136 ASP C C   1 
ATOM   4323 O  O   . ASP C 1 136 ? 86.836  -7.567  26.051  1.00 40.53 ? 136 ASP C O   1 
ATOM   4324 C  CB  . ASP C 1 136 ? 85.066  -9.518  27.201  1.00 44.36 ? 136 ASP C CB  1 
ATOM   4325 C  CG  . ASP C 1 136 ? 84.179  -9.634  25.967  1.00 47.12 ? 136 ASP C CG  1 
ATOM   4326 O  OD1 . ASP C 1 136 ? 83.092  -9.016  25.956  1.00 49.93 ? 136 ASP C OD1 1 
ATOM   4327 O  OD2 . ASP C 1 136 ? 84.559  -10.347 25.012  1.00 46.63 ? 136 ASP C OD2 1 
ATOM   4328 N  N   . LYS C 1 137 ? 85.210  -6.050  26.389  1.00 39.90 ? 137 LYS C N   1 
ATOM   4329 C  CA  . LYS C 1 137 ? 85.748  -5.171  25.367  1.00 39.24 ? 137 LYS C CA  1 
ATOM   4330 C  C   . LYS C 1 137 ? 85.826  -3.708  25.782  1.00 36.54 ? 137 LYS C C   1 
ATOM   4331 O  O   . LYS C 1 137 ? 84.975  -3.204  26.514  1.00 35.81 ? 137 LYS C O   1 
ATOM   4332 C  CB  . LYS C 1 137 ? 84.931  -5.310  24.077  1.00 41.83 ? 137 LYS C CB  1 
ATOM   4333 C  CG  . LYS C 1 137 ? 85.512  -4.545  22.892  1.00 45.10 ? 137 LYS C CG  1 
ATOM   4334 C  CD  . LYS C 1 137 ? 85.048  -5.130  21.565  1.00 48.40 ? 137 LYS C CD  1 
ATOM   4335 C  CE  . LYS C 1 137 ? 85.589  -6.546  21.366  1.00 50.23 ? 137 LYS C CE  1 
ATOM   4336 N  NZ  . LYS C 1 137 ? 85.182  -7.129  20.051  1.00 51.40 ? 137 LYS C NZ  1 
ATOM   4337 N  N   . LEU C 1 138 ? 86.872  -3.039  25.310  1.00 33.83 ? 138 LEU C N   1 
ATOM   4338 C  CA  . LEU C 1 138 ? 87.090  -1.629  25.595  1.00 31.43 ? 138 LEU C CA  1 
ATOM   4339 C  C   . LEU C 1 138 ? 86.348  -0.789  24.561  1.00 30.95 ? 138 LEU C C   1 
ATOM   4340 O  O   . LEU C 1 138 ? 86.220  -1.184  23.400  1.00 31.33 ? 138 LEU C O   1 
ATOM   4341 C  CB  . LEU C 1 138 ? 88.581  -1.303  25.537  1.00 29.99 ? 138 LEU C CB  1 
ATOM   4342 C  CG  . LEU C 1 138 ? 89.469  -1.990  26.573  1.00 29.45 ? 138 LEU C CG  1 
ATOM   4343 C  CD1 . LEU C 1 138 ? 90.924  -1.762  26.212  1.00 29.74 ? 138 LEU C CD1 1 
ATOM   4344 C  CD2 . LEU C 1 138 ? 89.161  -1.448  27.969  1.00 29.06 ? 138 LEU C CD2 1 
ATOM   4345 N  N   . ALA C 1 139 ? 85.867  0.374   24.988  1.00 28.97 ? 139 ALA C N   1 
ATOM   4346 C  CA  . ALA C 1 139 ? 85.135  1.270   24.105  1.00 26.34 ? 139 ALA C CA  1 
ATOM   4347 C  C   . ALA C 1 139 ? 85.290  2.720   24.543  1.00 26.06 ? 139 ALA C C   1 
ATOM   4348 O  O   . ALA C 1 139 ? 85.510  3.008   25.719  1.00 24.97 ? 139 ALA C O   1 
ATOM   4349 C  CB  . ALA C 1 139 ? 83.661  0.895   24.100  1.00 22.32 ? 139 ALA C CB  1 
ATOM   4350 N  N   . VAL C 1 140 ? 85.172  3.629   23.583  1.00 25.01 ? 140 VAL C N   1 
ATOM   4351 C  CA  . VAL C 1 140 ? 85.261  5.053   23.856  1.00 24.59 ? 140 VAL C CA  1 
ATOM   4352 C  C   . VAL C 1 140 ? 83.854  5.633   23.798  1.00 23.76 ? 140 VAL C C   1 
ATOM   4353 O  O   . VAL C 1 140 ? 83.129  5.402   22.837  1.00 25.05 ? 140 VAL C O   1 
ATOM   4354 C  CB  . VAL C 1 140 ? 86.151  5.768   22.814  1.00 24.84 ? 140 VAL C CB  1 
ATOM   4355 C  CG1 . VAL C 1 140 ? 85.882  7.267   22.836  1.00 25.24 ? 140 VAL C CG1 1 
ATOM   4356 C  CG2 . VAL C 1 140 ? 87.623  5.499   23.124  1.00 23.11 ? 140 VAL C CG2 1 
ATOM   4357 N  N   . VAL C 1 141 ? 83.463  6.360   24.840  1.00 22.22 ? 141 VAL C N   1 
ATOM   4358 C  CA  . VAL C 1 141 ? 82.144  6.986   24.896  1.00 20.42 ? 141 VAL C CA  1 
ATOM   4359 C  C   . VAL C 1 141 ? 82.289  8.339   25.575  1.00 19.96 ? 141 VAL C C   1 
ATOM   4360 O  O   . VAL C 1 141 ? 83.343  8.649   26.131  1.00 18.40 ? 141 VAL C O   1 
ATOM   4361 C  CB  . VAL C 1 141 ? 81.127  6.149   25.719  1.00 21.86 ? 141 VAL C CB  1 
ATOM   4362 C  CG1 . VAL C 1 141 ? 81.058  4.726   25.187  1.00 22.29 ? 141 VAL C CG1 1 
ATOM   4363 C  CG2 . VAL C 1 141 ? 81.514  6.153   27.199  1.00 21.37 ? 141 VAL C CG2 1 
ATOM   4364 N  N   . SER C 1 142 ? 81.241  9.154   25.520  1.00 18.54 ? 142 SER C N   1 
ATOM   4365 C  CA  . SER C 1 142 ? 81.282  10.452  26.177  1.00 17.50 ? 142 SER C CA  1 
ATOM   4366 C  C   . SER C 1 142 ? 79.938  10.693  26.833  1.00 16.65 ? 142 SER C C   1 
ATOM   4367 O  O   . SER C 1 142 ? 78.936  10.102  26.443  1.00 16.26 ? 142 SER C O   1 
ATOM   4368 C  CB  . SER C 1 142 ? 81.596  11.578  25.184  1.00 15.62 ? 142 SER C CB  1 
ATOM   4369 O  OG  . SER C 1 142 ? 80.492  11.863  24.348  1.00 19.22 ? 142 SER C OG  1 
ATOM   4370 N  N   . THR C 1 143 ? 79.927  11.544  27.850  1.00 15.31 ? 143 THR C N   1 
ATOM   4371 C  CA  . THR C 1 143 ? 78.703  11.861  28.558  1.00 15.07 ? 143 THR C CA  1 
ATOM   4372 C  C   . THR C 1 143 ? 78.581  13.368  28.681  1.00 15.14 ? 143 THR C C   1 
ATOM   4373 O  O   . THR C 1 143 ? 79.558  14.099  28.501  1.00 14.81 ? 143 THR C O   1 
ATOM   4374 C  CB  . THR C 1 143 ? 78.693  11.251  29.973  1.00 15.68 ? 143 THR C CB  1 
ATOM   4375 O  OG1 . THR C 1 143 ? 79.882  11.646  30.669  1.00 14.89 ? 143 THR C OG1 1 
ATOM   4376 C  CG2 . THR C 1 143 ? 78.625  9.730   29.903  1.00 14.84 ? 143 THR C CG2 1 
ATOM   4377 N  N   . ALA C 1 144 ? 77.375  13.823  28.994  1.00 14.54 ? 144 ALA C N   1 
ATOM   4378 C  CA  . ALA C 1 144 ? 77.100  15.243  29.146  1.00 13.09 ? 144 ALA C CA  1 
ATOM   4379 C  C   . ALA C 1 144 ? 77.245  15.686  30.596  1.00 12.94 ? 144 ALA C C   1 
ATOM   4380 O  O   . ALA C 1 144 ? 77.072  14.894  31.524  1.00 12.99 ? 144 ALA C O   1 
ATOM   4381 C  CB  . ALA C 1 144 ? 75.688  15.554  28.653  1.00 9.66  ? 144 ALA C CB  1 
ATOM   4382 N  N   . ASN C 1 145 ? 77.580  16.959  30.771  1.00 11.68 ? 145 ASN C N   1 
ATOM   4383 C  CA  . ASN C 1 145 ? 77.723  17.566  32.085  1.00 11.88 ? 145 ASN C CA  1 
ATOM   4384 C  C   . ASN C 1 145 ? 78.503  16.712  33.082  1.00 11.30 ? 145 ASN C C   1 
ATOM   4385 O  O   . ASN C 1 145 ? 79.690  16.479  32.880  1.00 11.84 ? 145 ASN C O   1 
ATOM   4386 C  CB  . ASN C 1 145 ? 76.326  17.927  32.593  1.00 10.29 ? 145 ASN C CB  1 
ATOM   4387 C  CG  . ASN C 1 145 ? 75.525  18.702  31.539  1.00 14.16 ? 145 ASN C CG  1 
ATOM   4388 O  OD1 . ASN C 1 145 ? 76.045  19.632  30.913  1.00 9.24  ? 145 ASN C OD1 1 
ATOM   4389 N  ND2 . ASN C 1 145 ? 74.269  18.316  31.334  1.00 14.79 ? 145 ASN C ND2 1 
ATOM   4390 N  N   . GLN C 1 146 ? 77.864  16.261  34.159  1.00 12.54 ? 146 GLN C N   1 
ATOM   4391 C  CA  . GLN C 1 146 ? 78.562  15.430  35.138  1.00 13.65 ? 146 GLN C CA  1 
ATOM   4392 C  C   . GLN C 1 146 ? 78.066  13.985  35.152  1.00 14.91 ? 146 GLN C C   1 
ATOM   4393 O  O   . GLN C 1 146 ? 78.246  13.280  36.141  1.00 15.34 ? 146 GLN C O   1 
ATOM   4394 C  CB  . GLN C 1 146 ? 78.439  16.011  36.557  1.00 13.29 ? 146 GLN C CB  1 
ATOM   4395 C  CG  . GLN C 1 146 ? 79.168  17.333  36.795  1.00 12.33 ? 146 GLN C CG  1 
ATOM   4396 C  CD  . GLN C 1 146 ? 80.646  17.306  36.388  1.00 13.51 ? 146 GLN C CD  1 
ATOM   4397 O  OE1 . GLN C 1 146 ? 81.274  16.247  36.322  1.00 10.99 ? 146 GLN C OE1 1 
ATOM   4398 N  NE2 . GLN C 1 146 ? 81.205  18.485  36.136  1.00 13.43 ? 146 GLN C NE2 1 
ATOM   4399 N  N   . ASP C 1 147 ? 77.440  13.541  34.066  1.00 14.91 ? 147 ASP C N   1 
ATOM   4400 C  CA  . ASP C 1 147 ? 76.961  12.163  33.999  1.00 15.62 ? 147 ASP C CA  1 
ATOM   4401 C  C   . ASP C 1 147 ? 78.158  11.227  33.897  1.00 16.29 ? 147 ASP C C   1 
ATOM   4402 O  O   . ASP C 1 147 ? 79.213  11.600  33.388  1.00 16.70 ? 147 ASP C O   1 
ATOM   4403 C  CB  . ASP C 1 147 ? 76.067  11.931  32.776  1.00 15.33 ? 147 ASP C CB  1 
ATOM   4404 C  CG  . ASP C 1 147 ? 74.741  12.652  32.866  1.00 18.03 ? 147 ASP C CG  1 
ATOM   4405 O  OD1 . ASP C 1 147 ? 74.402  13.164  33.952  1.00 18.50 ? 147 ASP C OD1 1 
ATOM   4406 O  OD2 . ASP C 1 147 ? 74.027  12.691  31.842  1.00 19.29 ? 147 ASP C OD2 1 
ATOM   4407 N  N   . SER C 1 148 ? 77.979  10.003  34.377  1.00 17.12 ? 148 SER C N   1 
ATOM   4408 C  CA  . SER C 1 148 ? 79.027  8.996   34.333  1.00 17.81 ? 148 SER C CA  1 
ATOM   4409 C  C   . SER C 1 148 ? 78.450  7.714   33.751  1.00 19.53 ? 148 SER C C   1 
ATOM   4410 O  O   . SER C 1 148 ? 77.280  7.407   33.971  1.00 19.20 ? 148 SER C O   1 
ATOM   4411 C  CB  . SER C 1 148 ? 79.543  8.712   35.741  1.00 16.96 ? 148 SER C CB  1 
ATOM   4412 O  OG  . SER C 1 148 ? 80.350  7.548   35.754  1.00 18.86 ? 148 SER C OG  1 
ATOM   4413 N  N   . PRO C 1 149 ? 79.257  6.951   32.991  1.00 21.12 ? 149 PRO C N   1 
ATOM   4414 C  CA  . PRO C 1 149 ? 78.719  5.706   32.431  1.00 20.99 ? 149 PRO C CA  1 
ATOM   4415 C  C   . PRO C 1 149 ? 78.268  4.733   33.530  1.00 22.45 ? 149 PRO C C   1 
ATOM   4416 O  O   . PRO C 1 149 ? 77.497  3.808   33.270  1.00 25.33 ? 149 PRO C O   1 
ATOM   4417 C  CB  . PRO C 1 149 ? 79.875  5.170   31.579  1.00 20.12 ? 149 PRO C CB  1 
ATOM   4418 C  CG  . PRO C 1 149 ? 81.094  5.807   32.185  1.00 22.05 ? 149 PRO C CG  1 
ATOM   4419 C  CD  . PRO C 1 149 ? 80.631  7.195   32.523  1.00 19.98 ? 149 PRO C CD  1 
ATOM   4420 N  N   . LEU C 1 150 ? 78.730  4.953   34.759  1.00 21.22 ? 150 LEU C N   1 
ATOM   4421 C  CA  . LEU C 1 150 ? 78.336  4.101   35.875  1.00 21.84 ? 150 LEU C CA  1 
ATOM   4422 C  C   . LEU C 1 150 ? 76.858  4.296   36.214  1.00 22.39 ? 150 LEU C C   1 
ATOM   4423 O  O   . LEU C 1 150 ? 76.266  3.483   36.921  1.00 22.94 ? 150 LEU C O   1 
ATOM   4424 C  CB  . LEU C 1 150 ? 79.180  4.400   37.118  1.00 22.02 ? 150 LEU C CB  1 
ATOM   4425 C  CG  . LEU C 1 150 ? 80.637  3.926   37.123  1.00 23.21 ? 150 LEU C CG  1 
ATOM   4426 C  CD1 . LEU C 1 150 ? 81.308  4.418   38.393  1.00 22.23 ? 150 LEU C CD1 1 
ATOM   4427 C  CD2 . LEU C 1 150 ? 80.703  2.400   37.037  1.00 22.20 ? 150 LEU C CD2 1 
ATOM   4428 N  N   . MET C 1 151 ? 76.266  5.375   35.712  1.00 21.97 ? 151 MET C N   1 
ATOM   4429 C  CA  . MET C 1 151 ? 74.857  5.652   35.973  1.00 22.55 ? 151 MET C CA  1 
ATOM   4430 C  C   . MET C 1 151 ? 73.936  4.810   35.102  1.00 23.10 ? 151 MET C C   1 
ATOM   4431 O  O   . MET C 1 151 ? 72.740  4.722   35.371  1.00 23.14 ? 151 MET C O   1 
ATOM   4432 C  CB  . MET C 1 151 ? 74.547  7.127   35.727  1.00 20.03 ? 151 MET C CB  1 
ATOM   4433 C  CG  . MET C 1 151 ? 75.323  8.078   36.612  1.00 20.33 ? 151 MET C CG  1 
ATOM   4434 S  SD  . MET C 1 151 ? 74.936  9.800   36.240  1.00 17.44 ? 151 MET C SD  1 
ATOM   4435 C  CE  . MET C 1 151 ? 76.007  10.638  37.439  1.00 15.79 ? 151 MET C CE  1 
ATOM   4436 N  N   . GLY C 1 152 ? 74.493  4.206   34.053  1.00 24.06 ? 152 GLY C N   1 
ATOM   4437 C  CA  . GLY C 1 152 ? 73.693  3.389   33.156  1.00 25.43 ? 152 GLY C CA  1 
ATOM   4438 C  C   . GLY C 1 152 ? 73.276  4.154   31.913  1.00 26.83 ? 152 GLY C C   1 
ATOM   4439 O  O   . GLY C 1 152 ? 73.301  5.388   31.903  1.00 26.34 ? 152 GLY C O   1 
ATOM   4440 N  N   . GLU C 1 153 ? 72.878  3.429   30.870  1.00 27.58 ? 153 GLU C N   1 
ATOM   4441 C  CA  . GLU C 1 153 ? 72.476  4.052   29.612  1.00 28.66 ? 153 GLU C CA  1 
ATOM   4442 C  C   . GLU C 1 153 ? 71.204  4.874   29.684  1.00 27.34 ? 153 GLU C C   1 
ATOM   4443 O  O   . GLU C 1 153 ? 71.096  5.920   29.051  1.00 27.70 ? 153 GLU C O   1 
ATOM   4444 C  CB  . GLU C 1 153 ? 72.299  3.004   28.522  1.00 32.22 ? 153 GLU C CB  1 
ATOM   4445 C  CG  . GLU C 1 153 ? 73.564  2.286   28.143  1.00 38.82 ? 153 GLU C CG  1 
ATOM   4446 C  CD  . GLU C 1 153 ? 73.483  1.709   26.748  1.00 44.17 ? 153 GLU C CD  1 
ATOM   4447 O  OE1 . GLU C 1 153 ? 72.471  1.037   26.445  1.00 46.77 ? 153 GLU C OE1 1 
ATOM   4448 O  OE2 . GLU C 1 153 ? 74.430  1.925   25.956  1.00 46.56 ? 153 GLU C OE2 1 
ATOM   4449 N  N   . ALA C 1 154 ? 70.232  4.394   30.444  1.00 27.28 ? 154 ALA C N   1 
ATOM   4450 C  CA  . ALA C 1 154 ? 68.965  5.093   30.574  1.00 27.14 ? 154 ALA C CA  1 
ATOM   4451 C  C   . ALA C 1 154 ? 69.181  6.533   31.010  1.00 27.57 ? 154 ALA C C   1 
ATOM   4452 O  O   . ALA C 1 154 ? 68.524  7.446   30.514  1.00 28.15 ? 154 ALA C O   1 
ATOM   4453 C  CB  . ALA C 1 154 ? 68.080  4.379   31.584  1.00 26.62 ? 154 ALA C CB  1 
ATOM   4454 N  N   . ILE C 1 155 ? 70.108  6.734   31.938  1.00 26.23 ? 155 ILE C N   1 
ATOM   4455 C  CA  . ILE C 1 155 ? 70.379  8.069   32.441  1.00 25.84 ? 155 ILE C CA  1 
ATOM   4456 C  C   . ILE C 1 155 ? 71.463  8.850   31.695  1.00 25.78 ? 155 ILE C C   1 
ATOM   4457 O  O   . ILE C 1 155 ? 71.232  9.980   31.271  1.00 25.46 ? 155 ILE C O   1 
ATOM   4458 C  CB  . ILE C 1 155 ? 70.744  8.019   33.939  1.00 26.44 ? 155 ILE C CB  1 
ATOM   4459 C  CG1 . ILE C 1 155 ? 69.536  7.527   34.739  1.00 26.41 ? 155 ILE C CG1 1 
ATOM   4460 C  CG2 . ILE C 1 155 ? 71.187  9.395   34.425  1.00 25.08 ? 155 ILE C CG2 1 
ATOM   4461 C  CD1 . ILE C 1 155 ? 69.798  7.362   36.212  1.00 25.75 ? 155 ILE C CD1 1 
ATOM   4462 N  N   . SER C 1 156 ? 72.634  8.250   31.514  1.00 24.41 ? 156 SER C N   1 
ATOM   4463 C  CA  . SER C 1 156 ? 73.737  8.947   30.865  1.00 23.60 ? 156 SER C CA  1 
ATOM   4464 C  C   . SER C 1 156 ? 73.890  8.739   29.367  1.00 23.67 ? 156 SER C C   1 
ATOM   4465 O  O   . SER C 1 156 ? 74.649  9.463   28.721  1.00 23.20 ? 156 SER C O   1 
ATOM   4466 C  CB  . SER C 1 156 ? 75.049  8.557   31.535  1.00 23.43 ? 156 SER C CB  1 
ATOM   4467 O  OG  . SER C 1 156 ? 75.367  7.207   31.240  1.00 25.34 ? 156 SER C OG  1 
ATOM   4468 N  N   . GLY C 1 157 ? 73.196  7.749   28.817  1.00 22.89 ? 157 GLY C N   1 
ATOM   4469 C  CA  . GLY C 1 157 ? 73.314  7.480   27.396  1.00 21.55 ? 157 GLY C CA  1 
ATOM   4470 C  C   . GLY C 1 157 ? 74.519  6.605   27.101  1.00 23.51 ? 157 GLY C C   1 
ATOM   4471 O  O   . GLY C 1 157 ? 74.830  6.328   25.943  1.00 24.17 ? 157 GLY C O   1 
ATOM   4472 N  N   . ALA C 1 158 ? 75.203  6.169   28.155  1.00 23.03 ? 158 ALA C N   1 
ATOM   4473 C  CA  . ALA C 1 158 ? 76.380  5.320   28.016  1.00 22.69 ? 158 ALA C CA  1 
ATOM   4474 C  C   . ALA C 1 158 ? 76.473  4.361   29.197  1.00 23.63 ? 158 ALA C C   1 
ATOM   4475 O  O   . ALA C 1 158 ? 75.776  4.520   30.200  1.00 24.35 ? 158 ALA C O   1 
ATOM   4476 C  CB  . ALA C 1 158 ? 77.637  6.176   27.944  1.00 23.02 ? 158 ALA C CB  1 
ATOM   4477 N  N   . SER C 1 159 ? 77.336  3.363   29.079  1.00 23.94 ? 159 SER C N   1 
ATOM   4478 C  CA  . SER C 1 159 ? 77.506  2.393   30.152  1.00 25.09 ? 159 SER C CA  1 
ATOM   4479 C  C   . SER C 1 159 ? 78.898  1.790   30.089  1.00 25.03 ? 159 SER C C   1 
ATOM   4480 O  O   . SER C 1 159 ? 79.616  1.964   29.105  1.00 25.68 ? 159 SER C O   1 
ATOM   4481 C  CB  . SER C 1 159 ? 76.454  1.291   30.038  1.00 24.82 ? 159 SER C CB  1 
ATOM   4482 O  OG  . SER C 1 159 ? 76.464  0.728   28.740  1.00 27.07 ? 159 SER C OG  1 
ATOM   4483 N  N   . GLY C 1 160 ? 79.279  1.086   31.146  1.00 25.69 ? 160 GLY C N   1 
ATOM   4484 C  CA  . GLY C 1 160 ? 80.593  0.476   31.177  1.00 25.57 ? 160 GLY C CA  1 
ATOM   4485 C  C   . GLY C 1 160 ? 81.382  0.935   32.384  1.00 26.04 ? 160 GLY C C   1 
ATOM   4486 O  O   . GLY C 1 160 ? 81.003  1.895   33.053  1.00 26.90 ? 160 GLY C O   1 
ATOM   4487 N  N   . PHE C 1 161 ? 82.482  0.245   32.664  1.00 25.46 ? 161 PHE C N   1 
ATOM   4488 C  CA  . PHE C 1 161 ? 83.325  0.581   33.799  1.00 25.19 ? 161 PHE C CA  1 
ATOM   4489 C  C   . PHE C 1 161 ? 84.407  1.545   33.334  1.00 25.34 ? 161 PHE C C   1 
ATOM   4490 O  O   . PHE C 1 161 ? 85.186  1.223   32.437  1.00 24.26 ? 161 PHE C O   1 
ATOM   4491 C  CB  . PHE C 1 161 ? 83.965  -0.687  34.376  1.00 24.81 ? 161 PHE C CB  1 
ATOM   4492 C  CG  . PHE C 1 161 ? 84.895  -0.428  35.527  1.00 23.85 ? 161 PHE C CG  1 
ATOM   4493 C  CD1 . PHE C 1 161 ? 84.420  0.125   36.714  1.00 24.64 ? 161 PHE C CD1 1 
ATOM   4494 C  CD2 . PHE C 1 161 ? 86.251  -0.732  35.423  1.00 23.15 ? 161 PHE C CD2 1 
ATOM   4495 C  CE1 . PHE C 1 161 ? 85.282  0.371   37.782  1.00 23.72 ? 161 PHE C CE1 1 
ATOM   4496 C  CE2 . PHE C 1 161 ? 87.121  -0.491  36.482  1.00 22.88 ? 161 PHE C CE2 1 
ATOM   4497 C  CZ  . PHE C 1 161 ? 86.635  0.062   37.665  1.00 23.04 ? 161 PHE C CZ  1 
ATOM   4498 N  N   . PRO C 1 162 ? 84.466  2.743   33.942  1.00 25.36 ? 162 PRO C N   1 
ATOM   4499 C  CA  . PRO C 1 162 ? 85.454  3.770   33.593  1.00 24.26 ? 162 PRO C CA  1 
ATOM   4500 C  C   . PRO C 1 162 ? 86.891  3.357   33.897  1.00 23.52 ? 162 PRO C C   1 
ATOM   4501 O  O   . PRO C 1 162 ? 87.231  3.075   35.046  1.00 23.16 ? 162 PRO C O   1 
ATOM   4502 C  CB  . PRO C 1 162 ? 85.031  4.969   34.445  1.00 23.69 ? 162 PRO C CB  1 
ATOM   4503 C  CG  . PRO C 1 162 ? 83.573  4.721   34.720  1.00 25.02 ? 162 PRO C CG  1 
ATOM   4504 C  CD  . PRO C 1 162 ? 83.544  3.244   34.976  1.00 25.06 ? 162 PRO C CD  1 
ATOM   4505 N  N   . ILE C 1 163 ? 87.727  3.323   32.867  1.00 22.41 ? 163 ILE C N   1 
ATOM   4506 C  CA  . ILE C 1 163 ? 89.132  2.978   33.043  1.00 23.07 ? 163 ILE C CA  1 
ATOM   4507 C  C   . ILE C 1 163 ? 89.913  4.289   33.177  1.00 23.56 ? 163 ILE C C   1 
ATOM   4508 O  O   . ILE C 1 163 ? 90.841  4.406   33.979  1.00 22.80 ? 163 ILE C O   1 
ATOM   4509 C  CB  . ILE C 1 163 ? 89.676  2.176   31.831  1.00 23.91 ? 163 ILE C CB  1 
ATOM   4510 C  CG1 . ILE C 1 163 ? 88.981  0.810   31.757  1.00 25.20 ? 163 ILE C CG1 1 
ATOM   4511 C  CG2 . ILE C 1 163 ? 91.188  2.029   31.932  1.00 22.99 ? 163 ILE C CG2 1 
ATOM   4512 C  CD1 . ILE C 1 163 ? 89.091  -0.021  33.032  1.00 25.01 ? 163 ILE C CD1 1 
ATOM   4513 N  N   . MET C 1 164 ? 89.509  5.280   32.391  1.00 22.56 ? 164 MET C N   1 
ATOM   4514 C  CA  . MET C 1 164 ? 90.149  6.582   32.404  1.00 22.75 ? 164 MET C CA  1 
ATOM   4515 C  C   . MET C 1 164 ? 89.217  7.600   31.736  1.00 22.17 ? 164 MET C C   1 
ATOM   4516 O  O   . MET C 1 164 ? 88.392  7.235   30.901  1.00 23.40 ? 164 MET C O   1 
ATOM   4517 C  CB  . MET C 1 164 ? 91.504  6.467   31.692  1.00 25.42 ? 164 MET C CB  1 
ATOM   4518 C  CG  . MET C 1 164 ? 91.998  7.708   30.992  1.00 29.65 ? 164 MET C CG  1 
ATOM   4519 S  SD  . MET C 1 164 ? 91.525  7.700   29.258  1.00 33.97 ? 164 MET C SD  1 
ATOM   4520 C  CE  . MET C 1 164 ? 92.990  7.007   28.502  1.00 34.21 ? 164 MET C CE  1 
ATOM   4521 N  N   . GLY C 1 165 ? 89.321  8.869   32.118  1.00 20.70 ? 165 GLY C N   1 
ATOM   4522 C  CA  . GLY C 1 165 ? 88.452  9.869   31.520  1.00 19.08 ? 165 GLY C CA  1 
ATOM   4523 C  C   . GLY C 1 165 ? 89.051  11.256  31.407  1.00 18.30 ? 165 GLY C C   1 
ATOM   4524 O  O   . GLY C 1 165 ? 90.006  11.589  32.110  1.00 19.07 ? 165 GLY C O   1 
ATOM   4525 N  N   . LEU C 1 166 ? 88.494  12.067  30.511  1.00 16.55 ? 166 LEU C N   1 
ATOM   4526 C  CA  . LEU C 1 166 ? 88.966  13.432  30.316  1.00 15.22 ? 166 LEU C CA  1 
ATOM   4527 C  C   . LEU C 1 166 ? 87.825  14.432  30.486  1.00 14.77 ? 166 LEU C C   1 
ATOM   4528 O  O   . LEU C 1 166 ? 86.781  14.318  29.842  1.00 14.42 ? 166 LEU C O   1 
ATOM   4529 C  CB  . LEU C 1 166 ? 89.584  13.599  28.925  1.00 14.21 ? 166 LEU C CB  1 
ATOM   4530 C  CG  . LEU C 1 166 ? 90.106  15.008  28.596  1.00 14.90 ? 166 LEU C CG  1 
ATOM   4531 C  CD1 . LEU C 1 166 ? 91.194  15.414  29.599  1.00 10.54 ? 166 LEU C CD1 1 
ATOM   4532 C  CD2 . LEU C 1 166 ? 90.653  15.031  27.162  1.00 15.81 ? 166 LEU C CD2 1 
ATOM   4533 N  N   . ASP C 1 167 ? 88.039  15.410  31.360  1.00 13.21 ? 167 ASP C N   1 
ATOM   4534 C  CA  . ASP C 1 167 ? 87.061  16.463  31.633  1.00 10.99 ? 167 ASP C CA  1 
ATOM   4535 C  C   . ASP C 1 167 ? 87.110  17.476  30.481  1.00 12.20 ? 167 ASP C C   1 
ATOM   4536 O  O   . ASP C 1 167 ? 88.151  18.089  30.246  1.00 11.91 ? 167 ASP C O   1 
ATOM   4537 C  CB  . ASP C 1 167 ? 87.433  17.159  32.948  1.00 8.63  ? 167 ASP C CB  1 
ATOM   4538 C  CG  . ASP C 1 167 ? 86.393  18.169  33.411  1.00 10.77 ? 167 ASP C CG  1 
ATOM   4539 O  OD1 . ASP C 1 167 ? 85.391  18.394  32.704  1.00 11.93 ? 167 ASP C OD1 1 
ATOM   4540 O  OD2 . ASP C 1 167 ? 86.581  18.750  34.503  1.00 11.36 ? 167 ASP C OD2 1 
ATOM   4541 N  N   . VAL C 1 168 ? 86.009  17.648  29.750  1.00 10.87 ? 168 VAL C N   1 
ATOM   4542 C  CA  . VAL C 1 168 ? 86.024  18.621  28.669  1.00 12.05 ? 168 VAL C CA  1 
ATOM   4543 C  C   . VAL C 1 168 ? 85.140  19.842  28.912  1.00 12.11 ? 168 VAL C C   1 
ATOM   4544 O  O   . VAL C 1 168 ? 84.735  20.527  27.974  1.00 11.89 ? 168 VAL C O   1 
ATOM   4545 C  CB  . VAL C 1 168 ? 85.704  17.980  27.277  1.00 14.13 ? 168 VAL C CB  1 
ATOM   4546 C  CG1 . VAL C 1 168 ? 86.853  17.068  26.862  1.00 13.24 ? 168 VAL C CG1 1 
ATOM   4547 C  CG2 . VAL C 1 168 ? 84.401  17.207  27.319  1.00 15.84 ? 168 VAL C CG2 1 
ATOM   4548 N  N   . TRP C 1 169 ? 84.831  20.106  30.179  1.00 11.23 ? 169 TRP C N   1 
ATOM   4549 C  CA  . TRP C 1 169 ? 84.089  21.312  30.529  1.00 10.80 ? 169 TRP C CA  1 
ATOM   4550 C  C   . TRP C 1 169 ? 85.114  22.405  30.225  1.00 10.14 ? 169 TRP C C   1 
ATOM   4551 O  O   . TRP C 1 169 ? 86.315  22.177  30.379  1.00 8.30  ? 169 TRP C O   1 
ATOM   4552 C  CB  . TRP C 1 169 ? 83.775  21.356  32.021  1.00 9.84  ? 169 TRP C CB  1 
ATOM   4553 C  CG  . TRP C 1 169 ? 82.548  20.613  32.412  1.00 11.86 ? 169 TRP C CG  1 
ATOM   4554 C  CD1 . TRP C 1 169 ? 82.287  19.290  32.205  1.00 8.22  ? 169 TRP C CD1 1 
ATOM   4555 C  CD2 . TRP C 1 169 ? 81.421  21.143  33.118  1.00 9.87  ? 169 TRP C CD2 1 
ATOM   4556 N  NE1 . TRP C 1 169 ? 81.066  18.962  32.743  1.00 11.59 ? 169 TRP C NE1 1 
ATOM   4557 C  CE2 . TRP C 1 169 ? 80.512  20.081  33.309  1.00 9.29  ? 169 TRP C CE2 1 
ATOM   4558 C  CE3 . TRP C 1 169 ? 81.091  22.415  33.607  1.00 10.61 ? 169 TRP C CE3 1 
ATOM   4559 C  CZ2 . TRP C 1 169 ? 79.291  20.248  33.968  1.00 8.02  ? 169 TRP C CZ2 1 
ATOM   4560 C  CZ3 . TRP C 1 169 ? 79.874  22.582  34.264  1.00 9.95  ? 169 TRP C CZ3 1 
ATOM   4561 C  CH2 . TRP C 1 169 ? 78.991  21.502  34.437  1.00 10.21 ? 169 TRP C CH2 1 
ATOM   4562 N  N   . GLU C 1 170 ? 84.661  23.584  29.813  1.00 9.45  ? 170 GLU C N   1 
ATOM   4563 C  CA  . GLU C 1 170 ? 85.601  24.649  29.490  1.00 9.76  ? 170 GLU C CA  1 
ATOM   4564 C  C   . GLU C 1 170 ? 86.477  25.094  30.658  1.00 10.54 ? 170 GLU C C   1 
ATOM   4565 O  O   . GLU C 1 170 ? 87.608  25.516  30.440  1.00 11.54 ? 170 GLU C O   1 
ATOM   4566 C  CB  . GLU C 1 170 ? 84.860  25.847  28.882  1.00 8.12  ? 170 GLU C CB  1 
ATOM   4567 C  CG  . GLU C 1 170 ? 84.327  25.562  27.475  1.00 7.56  ? 170 GLU C CG  1 
ATOM   4568 C  CD  . GLU C 1 170 ? 83.497  26.701  26.905  1.00 9.57  ? 170 GLU C CD  1 
ATOM   4569 O  OE1 . GLU C 1 170 ? 82.624  27.231  27.631  1.00 7.81  ? 170 GLU C OE1 1 
ATOM   4570 O  OE2 . GLU C 1 170 ? 83.711  27.062  25.726  1.00 10.33 ? 170 GLU C OE2 1 
ATOM   4571 N  N   . HIS C 1 171 ? 85.985  24.980  31.893  1.00 10.96 ? 171 HIS C N   1 
ATOM   4572 C  CA  . HIS C 1 171 ? 86.794  25.395  33.042  1.00 11.39 ? 171 HIS C CA  1 
ATOM   4573 C  C   . HIS C 1 171 ? 88.067  24.570  33.203  1.00 10.94 ? 171 HIS C C   1 
ATOM   4574 O  O   . HIS C 1 171 ? 89.019  24.999  33.862  1.00 9.95  ? 171 HIS C O   1 
ATOM   4575 C  CB  . HIS C 1 171 ? 85.985  25.358  34.353  1.00 9.55  ? 171 HIS C CB  1 
ATOM   4576 C  CG  . HIS C 1 171 ? 85.553  23.987  34.783  1.00 13.25 ? 171 HIS C CG  1 
ATOM   4577 N  ND1 . HIS C 1 171 ? 84.235  23.673  35.049  1.00 12.28 ? 171 HIS C ND1 1 
ATOM   4578 C  CD2 . HIS C 1 171 ? 86.265  22.866  35.056  1.00 13.03 ? 171 HIS C CD2 1 
ATOM   4579 C  CE1 . HIS C 1 171 ? 84.155  22.422  35.469  1.00 11.07 ? 171 HIS C CE1 1 
ATOM   4580 N  NE2 . HIS C 1 171 ? 85.372  21.910  35.483  1.00 11.68 ? 171 HIS C NE2 1 
ATOM   4581 N  N   . ALA C 1 172 ? 88.094  23.395  32.588  1.00 9.74  ? 172 ALA C N   1 
ATOM   4582 C  CA  . ALA C 1 172 ? 89.258  22.531  32.698  1.00 9.95  ? 172 ALA C CA  1 
ATOM   4583 C  C   . ALA C 1 172 ? 90.398  22.944  31.779  1.00 11.42 ? 172 ALA C C   1 
ATOM   4584 O  O   . ALA C 1 172 ? 91.520  22.469  31.941  1.00 11.73 ? 172 ALA C O   1 
ATOM   4585 C  CB  . ALA C 1 172 ? 88.864  21.088  32.418  1.00 8.50  ? 172 ALA C CB  1 
ATOM   4586 N  N   . TYR C 1 173 ? 90.132  23.838  30.828  1.00 10.43 ? 173 TYR C N   1 
ATOM   4587 C  CA  . TYR C 1 173 ? 91.187  24.236  29.901  1.00 11.11 ? 173 TYR C CA  1 
ATOM   4588 C  C   . TYR C 1 173 ? 91.150  25.671  29.409  1.00 11.85 ? 173 TYR C C   1 
ATOM   4589 O  O   . TYR C 1 173 ? 92.010  26.073  28.627  1.00 9.92  ? 173 TYR C O   1 
ATOM   4590 C  CB  . TYR C 1 173 ? 91.173  23.301  28.683  1.00 10.32 ? 173 TYR C CB  1 
ATOM   4591 C  CG  . TYR C 1 173 ? 89.899  23.367  27.858  1.00 11.54 ? 173 TYR C CG  1 
ATOM   4592 C  CD1 . TYR C 1 173 ? 89.701  24.373  26.903  1.00 11.74 ? 173 TYR C CD1 1 
ATOM   4593 C  CD2 . TYR C 1 173 ? 88.884  22.422  28.034  1.00 11.02 ? 173 TYR C CD2 1 
ATOM   4594 C  CE1 . TYR C 1 173 ? 88.521  24.431  26.142  1.00 9.44  ? 173 TYR C CE1 1 
ATOM   4595 C  CE2 . TYR C 1 173 ? 87.707  22.470  27.287  1.00 9.34  ? 173 TYR C CE2 1 
ATOM   4596 C  CZ  . TYR C 1 173 ? 87.530  23.473  26.344  1.00 12.82 ? 173 TYR C CZ  1 
ATOM   4597 O  OH  . TYR C 1 173 ? 86.361  23.509  25.614  1.00 10.55 ? 173 TYR C OH  1 
ATOM   4598 N  N   . TYR C 1 174 ? 90.187  26.460  29.872  1.00 13.15 ? 174 TYR C N   1 
ATOM   4599 C  CA  . TYR C 1 174 ? 90.082  27.817  29.369  1.00 14.05 ? 174 TYR C CA  1 
ATOM   4600 C  C   . TYR C 1 174 ? 91.180  28.815  29.749  1.00 15.27 ? 174 TYR C C   1 
ATOM   4601 O  O   . TYR C 1 174 ? 91.584  29.629  28.917  1.00 15.81 ? 174 TYR C O   1 
ATOM   4602 C  CB  . TYR C 1 174 ? 88.714  28.407  29.712  1.00 12.69 ? 174 TYR C CB  1 
ATOM   4603 C  CG  . TYR C 1 174 ? 88.183  29.243  28.570  1.00 13.81 ? 174 TYR C CG  1 
ATOM   4604 C  CD1 . TYR C 1 174 ? 87.699  28.634  27.412  1.00 13.26 ? 174 TYR C CD1 1 
ATOM   4605 C  CD2 . TYR C 1 174 ? 88.265  30.633  28.596  1.00 10.93 ? 174 TYR C CD2 1 
ATOM   4606 C  CE1 . TYR C 1 174 ? 87.321  29.380  26.309  1.00 12.98 ? 174 TYR C CE1 1 
ATOM   4607 C  CE2 . TYR C 1 174 ? 87.888  31.394  27.490  1.00 12.77 ? 174 TYR C CE2 1 
ATOM   4608 C  CZ  . TYR C 1 174 ? 87.419  30.758  26.349  1.00 13.26 ? 174 TYR C CZ  1 
ATOM   4609 O  OH  . TYR C 1 174 ? 87.058  31.487  25.237  1.00 11.47 ? 174 TYR C OH  1 
ATOM   4610 N  N   . LEU C 1 175 ? 91.667  28.769  30.983  1.00 14.85 ? 175 LEU C N   1 
ATOM   4611 C  CA  . LEU C 1 175 ? 92.700  29.719  31.387  1.00 14.94 ? 175 LEU C CA  1 
ATOM   4612 C  C   . LEU C 1 175 ? 93.953  29.614  30.532  1.00 14.46 ? 175 LEU C C   1 
ATOM   4613 O  O   . LEU C 1 175 ? 94.586  30.619  30.224  1.00 15.78 ? 175 LEU C O   1 
ATOM   4614 C  CB  . LEU C 1 175 ? 93.059  29.542  32.869  1.00 12.90 ? 175 LEU C CB  1 
ATOM   4615 C  CG  . LEU C 1 175 ? 91.939  29.941  33.842  1.00 15.46 ? 175 LEU C CG  1 
ATOM   4616 C  CD1 . LEU C 1 175 ? 92.425  29.856  35.288  1.00 10.16 ? 175 LEU C CD1 1 
ATOM   4617 C  CD2 . LEU C 1 175 ? 91.473  31.364  33.521  1.00 11.54 ? 175 LEU C CD2 1 
ATOM   4618 N  N   . LYS C 1 176 ? 94.308  28.402  30.128  1.00 15.10 ? 176 LYS C N   1 
ATOM   4619 C  CA  . LYS C 1 176 ? 95.503  28.220  29.321  1.00 15.30 ? 176 LYS C CA  1 
ATOM   4620 C  C   . LYS C 1 176 ? 95.273  28.067  27.817  1.00 14.88 ? 176 LYS C C   1 
ATOM   4621 O  O   . LYS C 1 176 ? 95.992  28.660  27.015  1.00 14.89 ? 176 LYS C O   1 
ATOM   4622 C  CB  . LYS C 1 176 ? 96.299  27.015  29.824  1.00 15.09 ? 176 LYS C CB  1 
ATOM   4623 C  CG  . LYS C 1 176 ? 97.511  26.705  28.961  1.00 15.36 ? 176 LYS C CG  1 
ATOM   4624 C  CD  . LYS C 1 176 ? 98.322  25.555  29.510  1.00 15.58 ? 176 LYS C CD  1 
ATOM   4625 C  CE  . LYS C 1 176 ? 99.457  25.219  28.570  1.00 14.88 ? 176 LYS C CE  1 
ATOM   4626 N  NZ  . LYS C 1 176 ? 100.365 24.203  29.154  1.00 15.98 ? 176 LYS C NZ  1 
ATOM   4627 N  N   . PHE C 1 177 ? 94.276  27.282  27.430  1.00 13.95 ? 177 PHE C N   1 
ATOM   4628 C  CA  . PHE C 1 177 ? 94.016  27.052  26.010  1.00 13.16 ? 177 PHE C CA  1 
ATOM   4629 C  C   . PHE C 1 177 ? 92.847  27.830  25.407  1.00 13.50 ? 177 PHE C C   1 
ATOM   4630 O  O   . PHE C 1 177 ? 92.655  27.803  24.190  1.00 14.74 ? 177 PHE C O   1 
ATOM   4631 C  CB  . PHE C 1 177 ? 93.765  25.565  25.753  1.00 10.26 ? 177 PHE C CB  1 
ATOM   4632 C  CG  . PHE C 1 177 ? 94.789  24.651  26.367  1.00 10.79 ? 177 PHE C CG  1 
ATOM   4633 C  CD1 . PHE C 1 177 ? 94.697  24.282  27.707  1.00 9.60  ? 177 PHE C CD1 1 
ATOM   4634 C  CD2 . PHE C 1 177 ? 95.839  24.150  25.603  1.00 10.01 ? 177 PHE C CD2 1 
ATOM   4635 C  CE1 . PHE C 1 177 ? 95.640  23.420  28.283  1.00 10.47 ? 177 PHE C CE1 1 
ATOM   4636 C  CE2 . PHE C 1 177 ? 96.789  23.288  26.165  1.00 12.04 ? 177 PHE C CE2 1 
ATOM   4637 C  CZ  . PHE C 1 177 ? 96.688  22.922  27.508  1.00 10.79 ? 177 PHE C CZ  1 
ATOM   4638 N  N   . GLN C 1 178 ? 92.075  28.519  26.241  1.00 13.50 ? 178 GLN C N   1 
ATOM   4639 C  CA  . GLN C 1 178 ? 90.900  29.245  25.764  1.00 16.50 ? 178 GLN C CA  1 
ATOM   4640 C  C   . GLN C 1 178 ? 90.018  28.317  24.922  1.00 15.14 ? 178 GLN C C   1 
ATOM   4641 O  O   . GLN C 1 178 ? 89.629  27.243  25.373  1.00 15.36 ? 178 GLN C O   1 
ATOM   4642 C  CB  . GLN C 1 178 ? 91.292  30.475  24.931  1.00 18.25 ? 178 GLN C CB  1 
ATOM   4643 C  CG  . GLN C 1 178 ? 91.892  31.621  25.744  1.00 24.03 ? 178 GLN C CG  1 
ATOM   4644 C  CD  . GLN C 1 178 ? 93.336  31.365  26.133  1.00 28.03 ? 178 GLN C CD  1 
ATOM   4645 O  OE1 . GLN C 1 178 ? 94.199  31.204  25.270  1.00 29.84 ? 178 GLN C OE1 1 
ATOM   4646 N  NE2 . GLN C 1 178 ? 93.608  31.325  27.438  1.00 28.89 ? 178 GLN C NE2 1 
ATOM   4647 N  N   . ASN C 1 179 ? 89.729  28.726  23.694  1.00 14.34 ? 179 ASN C N   1 
ATOM   4648 C  CA  . ASN C 1 179 ? 88.874  27.954  22.797  1.00 15.75 ? 179 ASN C CA  1 
ATOM   4649 C  C   . ASN C 1 179 ? 89.531  26.728  22.167  1.00 16.30 ? 179 ASN C C   1 
ATOM   4650 O  O   . ASN C 1 179 ? 88.847  25.897  21.572  1.00 16.10 ? 179 ASN C O   1 
ATOM   4651 C  CB  . ASN C 1 179 ? 88.397  28.848  21.661  1.00 18.20 ? 179 ASN C CB  1 
ATOM   4652 C  CG  . ASN C 1 179 ? 89.537  29.264  20.746  1.00 19.29 ? 179 ASN C CG  1 
ATOM   4653 O  OD1 . ASN C 1 179 ? 90.430  30.005  21.151  1.00 21.22 ? 179 ASN C OD1 1 
ATOM   4654 N  ND2 . ASN C 1 179 ? 89.524  28.766  19.515  1.00 19.12 ? 179 ASN C ND2 1 
ATOM   4655 N  N   . ARG C 1 180 ? 90.849  26.613  22.285  1.00 15.59 ? 180 ARG C N   1 
ATOM   4656 C  CA  . ARG C 1 180 ? 91.560  25.505  21.658  1.00 16.31 ? 180 ARG C CA  1 
ATOM   4657 C  C   . ARG C 1 180 ? 91.492  24.168  22.391  1.00 17.22 ? 180 ARG C C   1 
ATOM   4658 O  O   . ARG C 1 180 ? 92.513  23.655  22.872  1.00 17.24 ? 180 ARG C O   1 
ATOM   4659 C  CB  . ARG C 1 180 ? 93.021  25.902  21.432  1.00 16.61 ? 180 ARG C CB  1 
ATOM   4660 C  CG  . ARG C 1 180 ? 93.168  27.267  20.778  1.00 21.20 ? 180 ARG C CG  1 
ATOM   4661 C  CD  . ARG C 1 180 ? 94.608  27.543  20.414  1.00 25.54 ? 180 ARG C CD  1 
ATOM   4662 N  NE  . ARG C 1 180 ? 95.507  27.399  21.556  1.00 30.67 ? 180 ARG C NE  1 
ATOM   4663 C  CZ  . ARG C 1 180 ? 95.550  28.235  22.588  1.00 33.16 ? 180 ARG C CZ  1 
ATOM   4664 N  NH1 . ARG C 1 180 ? 94.739  29.287  22.630  1.00 34.24 ? 180 ARG C NH1 1 
ATOM   4665 N  NH2 . ARG C 1 180 ? 96.412  28.024  23.574  1.00 34.62 ? 180 ARG C NH2 1 
ATOM   4666 N  N   . ARG C 1 181 ? 90.294  23.594  22.462  1.00 15.58 ? 181 ARG C N   1 
ATOM   4667 C  CA  . ARG C 1 181 ? 90.126  22.313  23.132  1.00 15.79 ? 181 ARG C CA  1 
ATOM   4668 C  C   . ARG C 1 181 ? 91.027  21.232  22.526  1.00 16.54 ? 181 ARG C C   1 
ATOM   4669 O  O   . ARG C 1 181 ? 91.537  20.374  23.246  1.00 17.02 ? 181 ARG C O   1 
ATOM   4670 C  CB  . ARG C 1 181 ? 88.669  21.842  23.074  1.00 15.79 ? 181 ARG C CB  1 
ATOM   4671 C  CG  . ARG C 1 181 ? 88.441  20.574  23.906  1.00 17.42 ? 181 ARG C CG  1 
ATOM   4672 C  CD  . ARG C 1 181 ? 87.078  19.933  23.677  1.00 16.19 ? 181 ARG C CD  1 
ATOM   4673 N  NE  . ARG C 1 181 ? 85.981  20.757  24.177  1.00 16.89 ? 181 ARG C NE  1 
ATOM   4674 C  CZ  . ARG C 1 181 ? 84.705  20.386  24.170  1.00 17.41 ? 181 ARG C CZ  1 
ATOM   4675 N  NH1 . ARG C 1 181 ? 84.352  19.199  23.687  1.00 17.84 ? 181 ARG C NH1 1 
ATOM   4676 N  NH2 . ARG C 1 181 ? 83.779  21.200  24.650  1.00 18.75 ? 181 ARG C NH2 1 
ATOM   4677 N  N   . PRO C 1 182 ? 91.224  21.247  21.192  1.00 16.59 ? 182 PRO C N   1 
ATOM   4678 C  CA  . PRO C 1 182 ? 92.085  20.228  20.578  1.00 16.27 ? 182 PRO C CA  1 
ATOM   4679 C  C   . PRO C 1 182 ? 93.509  20.209  21.137  1.00 17.25 ? 182 PRO C C   1 
ATOM   4680 O  O   . PRO C 1 182 ? 94.094  19.135  21.304  1.00 17.30 ? 182 PRO C O   1 
ATOM   4681 C  CB  . PRO C 1 182 ? 92.045  20.587  19.093  1.00 16.20 ? 182 PRO C CB  1 
ATOM   4682 C  CG  . PRO C 1 182 ? 90.648  21.131  18.933  1.00 15.15 ? 182 PRO C CG  1 
ATOM   4683 C  CD  . PRO C 1 182 ? 90.524  22.029  20.153  1.00 14.74 ? 182 PRO C CD  1 
ATOM   4684 N  N   . ASP C 1 183 ? 94.069  21.383  21.428  1.00 16.95 ? 183 ASP C N   1 
ATOM   4685 C  CA  . ASP C 1 183 ? 95.421  21.448  21.979  1.00 18.24 ? 183 ASP C CA  1 
ATOM   4686 C  C   . ASP C 1 183 ? 95.425  20.857  23.377  1.00 17.94 ? 183 ASP C C   1 
ATOM   4687 O  O   . ASP C 1 183 ? 96.378  20.198  23.787  1.00 18.85 ? 183 ASP C O   1 
ATOM   4688 C  CB  . ASP C 1 183 ? 95.927  22.890  22.057  1.00 19.43 ? 183 ASP C CB  1 
ATOM   4689 C  CG  . ASP C 1 183 ? 96.104  23.515  20.703  1.00 21.31 ? 183 ASP C CG  1 
ATOM   4690 O  OD1 . ASP C 1 183 ? 96.030  22.778  19.702  1.00 23.32 ? 183 ASP C OD1 1 
ATOM   4691 O  OD2 . ASP C 1 183 ? 96.325  24.743  20.640  1.00 25.92 ? 183 ASP C OD2 1 
ATOM   4692 N  N   . TYR C 1 184 ? 94.351  21.116  24.111  1.00 17.48 ? 184 TYR C N   1 
ATOM   4693 C  CA  . TYR C 1 184 ? 94.205  20.606  25.467  1.00 17.30 ? 184 TYR C CA  1 
ATOM   4694 C  C   . TYR C 1 184 ? 94.166  19.078  25.438  1.00 16.30 ? 184 TYR C C   1 
ATOM   4695 O  O   . TYR C 1 184 ? 94.826  18.414  26.234  1.00 14.25 ? 184 TYR C O   1 
ATOM   4696 C  CB  . TYR C 1 184 ? 92.918  21.165  26.072  1.00 15.41 ? 184 TYR C CB  1 
ATOM   4697 C  CG  . TYR C 1 184 ? 92.425  20.454  27.308  1.00 14.05 ? 184 TYR C CG  1 
ATOM   4698 C  CD1 . TYR C 1 184 ? 93.123  20.526  28.515  1.00 12.88 ? 184 TYR C CD1 1 
ATOM   4699 C  CD2 . TYR C 1 184 ? 91.217  19.762  27.285  1.00 12.45 ? 184 TYR C CD2 1 
ATOM   4700 C  CE1 . TYR C 1 184 ? 92.618  19.930  29.674  1.00 10.51 ? 184 TYR C CE1 1 
ATOM   4701 C  CE2 . TYR C 1 184 ? 90.705  19.168  28.428  1.00 13.09 ? 184 TYR C CE2 1 
ATOM   4702 C  CZ  . TYR C 1 184 ? 91.406  19.258  29.622  1.00 13.01 ? 184 TYR C CZ  1 
ATOM   4703 O  OH  . TYR C 1 184 ? 90.858  18.696  30.759  1.00 12.54 ? 184 TYR C OH  1 
ATOM   4704 N  N   . ILE C 1 185 ? 93.390  18.531  24.508  1.00 16.54 ? 185 ILE C N   1 
ATOM   4705 C  CA  . ILE C 1 185 ? 93.262  17.088  24.365  1.00 18.14 ? 185 ILE C CA  1 
ATOM   4706 C  C   . ILE C 1 185 ? 94.608  16.428  24.044  1.00 20.02 ? 185 ILE C C   1 
ATOM   4707 O  O   . ILE C 1 185 ? 94.926  15.371  24.583  1.00 19.72 ? 185 ILE C O   1 
ATOM   4708 C  CB  . ILE C 1 185 ? 92.234  16.738  23.257  1.00 17.72 ? 185 ILE C CB  1 
ATOM   4709 C  CG1 . ILE C 1 185 ? 90.834  17.206  23.681  1.00 17.84 ? 185 ILE C CG1 1 
ATOM   4710 C  CG2 . ILE C 1 185 ? 92.248  15.243  22.985  1.00 17.94 ? 185 ILE C CG2 1 
ATOM   4711 C  CD1 . ILE C 1 185 ? 89.779  17.147  22.574  1.00 15.17 ? 185 ILE C CD1 1 
ATOM   4712 N  N   . LYS C 1 186 ? 95.399  17.048  23.172  1.00 21.52 ? 186 LYS C N   1 
ATOM   4713 C  CA  . LYS C 1 186 ? 96.697  16.480  22.823  1.00 24.46 ? 186 LYS C CA  1 
ATOM   4714 C  C   . LYS C 1 186 ? 97.650  16.531  24.006  1.00 23.48 ? 186 LYS C C   1 
ATOM   4715 O  O   . LYS C 1 186 ? 98.421  15.601  24.239  1.00 23.74 ? 186 LYS C O   1 
ATOM   4716 C  CB  . LYS C 1 186 ? 97.296  17.204  21.617  1.00 28.64 ? 186 LYS C CB  1 
ATOM   4717 C  CG  . LYS C 1 186 ? 96.557  16.866  20.334  1.00 35.76 ? 186 LYS C CG  1 
ATOM   4718 C  CD  . LYS C 1 186 ? 97.263  17.372  19.093  1.00 39.71 ? 186 LYS C CD  1 
ATOM   4719 C  CE  . LYS C 1 186 ? 96.468  16.974  17.858  1.00 42.72 ? 186 LYS C CE  1 
ATOM   4720 N  NZ  . LYS C 1 186 ? 96.216  15.500  17.828  1.00 43.37 ? 186 LYS C NZ  1 
ATOM   4721 N  N   . GLU C 1 187 ? 97.573  17.616  24.763  1.00 21.96 ? 187 GLU C N   1 
ATOM   4722 C  CA  . GLU C 1 187 ? 98.404  17.801  25.938  1.00 21.69 ? 187 GLU C CA  1 
ATOM   4723 C  C   . GLU C 1 187 ? 98.097  16.711  26.979  1.00 19.72 ? 187 GLU C C   1 
ATOM   4724 O  O   . GLU C 1 187 ? 98.974  16.284  27.733  1.00 19.05 ? 187 GLU C O   1 
ATOM   4725 C  CB  . GLU C 1 187 ? 98.132  19.193  26.513  1.00 22.34 ? 187 GLU C CB  1 
ATOM   4726 C  CG  . GLU C 1 187 ? 99.303  19.802  27.248  1.00 27.02 ? 187 GLU C CG  1 
ATOM   4727 C  CD  . GLU C 1 187 ? 100.535 19.920  26.373  1.00 26.93 ? 187 GLU C CD  1 
ATOM   4728 O  OE1 . GLU C 1 187 ? 100.494 20.661  25.373  1.00 29.39 ? 187 GLU C OE1 1 
ATOM   4729 O  OE2 . GLU C 1 187 ? 101.544 19.264  26.686  1.00 28.33 ? 187 GLU C OE2 1 
ATOM   4730 N  N   . PHE C 1 188 ? 96.847  16.257  26.998  1.00 18.39 ? 188 PHE C N   1 
ATOM   4731 C  CA  . PHE C 1 188 ? 96.394  15.225  27.931  1.00 16.80 ? 188 PHE C CA  1 
ATOM   4732 C  C   . PHE C 1 188 ? 97.198  13.923  27.853  1.00 18.14 ? 188 PHE C C   1 
ATOM   4733 O  O   . PHE C 1 188 ? 97.424  13.265  28.872  1.00 17.66 ? 188 PHE C O   1 
ATOM   4734 C  CB  . PHE C 1 188 ? 94.914  14.927  27.684  1.00 14.67 ? 188 PHE C CB  1 
ATOM   4735 C  CG  . PHE C 1 188 ? 94.363  13.794  28.513  1.00 14.09 ? 188 PHE C CG  1 
ATOM   4736 C  CD1 . PHE C 1 188 ? 94.351  13.865  29.905  1.00 12.15 ? 188 PHE C CD1 1 
ATOM   4737 C  CD2 . PHE C 1 188 ? 93.802  12.674  27.894  1.00 15.20 ? 188 PHE C CD2 1 
ATOM   4738 C  CE1 . PHE C 1 188 ? 93.781  12.842  30.671  1.00 11.94 ? 188 PHE C CE1 1 
ATOM   4739 C  CE2 . PHE C 1 188 ? 93.228  11.641  28.653  1.00 12.70 ? 188 PHE C CE2 1 
ATOM   4740 C  CZ  . PHE C 1 188 ? 93.218  11.729  30.043  1.00 12.49 ? 188 PHE C CZ  1 
ATOM   4741 N  N   . TRP C 1 189 ? 97.633  13.550  26.653  1.00 18.03 ? 189 TRP C N   1 
ATOM   4742 C  CA  . TRP C 1 189 ? 98.396  12.319  26.489  1.00 17.30 ? 189 TRP C CA  1 
ATOM   4743 C  C   . TRP C 1 189 ? 99.695  12.330  27.290  1.00 17.11 ? 189 TRP C C   1 
ATOM   4744 O  O   . TRP C 1 189 ? 100.231 11.278  27.619  1.00 18.94 ? 189 TRP C O   1 
ATOM   4745 C  CB  . TRP C 1 189 ? 98.681  12.076  25.008  1.00 16.31 ? 189 TRP C CB  1 
ATOM   4746 C  CG  . TRP C 1 189 ? 97.430  11.832  24.205  1.00 15.57 ? 189 TRP C CG  1 
ATOM   4747 C  CD1 . TRP C 1 189 ? 97.026  12.507  23.091  1.00 15.52 ? 189 TRP C CD1 1 
ATOM   4748 C  CD2 . TRP C 1 189 ? 96.422  10.844  24.462  1.00 14.76 ? 189 TRP C CD2 1 
ATOM   4749 N  NE1 . TRP C 1 189 ? 95.831  12.003  22.638  1.00 14.57 ? 189 TRP C NE1 1 
ATOM   4750 C  CE2 . TRP C 1 189 ? 95.438  10.981  23.461  1.00 14.31 ? 189 TRP C CE2 1 
ATOM   4751 C  CE3 . TRP C 1 189 ? 96.257  9.855   25.445  1.00 15.01 ? 189 TRP C CE3 1 
ATOM   4752 C  CZ2 . TRP C 1 189 ? 94.300  10.166  23.410  1.00 16.21 ? 189 TRP C CZ2 1 
ATOM   4753 C  CZ3 . TRP C 1 189 ? 95.125  9.043   25.396  1.00 14.84 ? 189 TRP C CZ3 1 
ATOM   4754 C  CH2 . TRP C 1 189 ? 94.161  9.205   24.383  1.00 15.66 ? 189 TRP C CH2 1 
ATOM   4755 N  N   . ASN C 1 190 ? 100.189 13.519  27.614  1.00 18.36 ? 190 ASN C N   1 
ATOM   4756 C  CA  . ASN C 1 190 ? 101.422 13.650  28.381  1.00 19.48 ? 190 ASN C CA  1 
ATOM   4757 C  C   . ASN C 1 190 ? 101.203 13.443  29.876  1.00 21.30 ? 190 ASN C C   1 
ATOM   4758 O  O   . ASN C 1 190 ? 102.155 13.193  30.615  1.00 23.22 ? 190 ASN C O   1 
ATOM   4759 C  CB  . ASN C 1 190 ? 102.031 15.038  28.186  1.00 18.95 ? 190 ASN C CB  1 
ATOM   4760 C  CG  . ASN C 1 190 ? 102.516 15.271  26.779  1.00 21.66 ? 190 ASN C CG  1 
ATOM   4761 O  OD1 . ASN C 1 190 ? 103.383 14.550  26.281  1.00 22.34 ? 190 ASN C OD1 1 
ATOM   4762 N  ND2 . ASN C 1 190 ? 101.968 16.288  26.127  1.00 22.08 ? 190 ASN C ND2 1 
ATOM   4763 N  N   . VAL C 1 191 ? 99.959  13.557  30.329  1.00 20.61 ? 191 VAL C N   1 
ATOM   4764 C  CA  . VAL C 1 191 ? 99.686  13.403  31.749  1.00 20.50 ? 191 VAL C CA  1 
ATOM   4765 C  C   . VAL C 1 191 ? 98.715  12.297  32.139  1.00 21.95 ? 191 VAL C C   1 
ATOM   4766 O  O   . VAL C 1 191 ? 98.334  12.198  33.303  1.00 23.97 ? 191 VAL C O   1 
ATOM   4767 C  CB  . VAL C 1 191 ? 99.199  14.737  32.362  1.00 19.16 ? 191 VAL C CB  1 
ATOM   4768 C  CG1 . VAL C 1 191 ? 100.336 15.745  32.363  1.00 17.85 ? 191 VAL C CG1 1 
ATOM   4769 C  CG2 . VAL C 1 191 ? 98.024  15.282  31.573  1.00 18.05 ? 191 VAL C CG2 1 
ATOM   4770 N  N   . VAL C 1 192 ? 98.311  11.463  31.188  1.00 22.95 ? 192 VAL C N   1 
ATOM   4771 C  CA  . VAL C 1 192 ? 97.408  10.366  31.520  1.00 24.83 ? 192 VAL C CA  1 
ATOM   4772 C  C   . VAL C 1 192 ? 98.205  9.374   32.366  1.00 24.46 ? 192 VAL C C   1 
ATOM   4773 O  O   . VAL C 1 192 ? 99.300  8.967   31.984  1.00 24.51 ? 192 VAL C O   1 
ATOM   4774 C  CB  . VAL C 1 192 ? 96.903  9.621   30.262  1.00 27.81 ? 192 VAL C CB  1 
ATOM   4775 C  CG1 . VAL C 1 192 ? 95.844  8.600   30.653  1.00 27.40 ? 192 VAL C CG1 1 
ATOM   4776 C  CG2 . VAL C 1 192 ? 96.338  10.604  29.262  1.00 30.41 ? 192 VAL C CG2 1 
ATOM   4777 N  N   . ASN C 1 193 ? 97.663  8.993   33.516  1.00 23.94 ? 193 ASN C N   1 
ATOM   4778 C  CA  . ASN C 1 193 ? 98.340  8.045   34.391  1.00 22.23 ? 193 ASN C CA  1 
ATOM   4779 C  C   . ASN C 1 193 ? 98.033  6.619   33.946  1.00 21.31 ? 193 ASN C C   1 
ATOM   4780 O  O   . ASN C 1 193 ? 97.031  6.037   34.357  1.00 19.75 ? 193 ASN C O   1 
ATOM   4781 C  CB  . ASN C 1 193 ? 97.875  8.232   35.834  1.00 22.69 ? 193 ASN C CB  1 
ATOM   4782 C  CG  . ASN C 1 193 ? 98.616  7.339   36.800  1.00 22.22 ? 193 ASN C CG  1 
ATOM   4783 O  OD1 . ASN C 1 193 ? 99.132  6.288   36.421  1.00 24.42 ? 193 ASN C OD1 1 
ATOM   4784 N  ND2 . ASN C 1 193 ? 98.662  7.744   38.059  1.00 21.14 ? 193 ASN C ND2 1 
ATOM   4785 N  N   . TRP C 1 194 ? 98.902  6.054   33.114  1.00 21.12 ? 194 TRP C N   1 
ATOM   4786 C  CA  . TRP C 1 194 ? 98.698  4.701   32.620  1.00 20.98 ? 194 TRP C CA  1 
ATOM   4787 C  C   . TRP C 1 194 ? 98.771  3.630   33.710  1.00 22.35 ? 194 TRP C C   1 
ATOM   4788 O  O   . TRP C 1 194 ? 98.149  2.570   33.585  1.00 22.26 ? 194 TRP C O   1 
ATOM   4789 C  CB  . TRP C 1 194 ? 99.701  4.401   31.504  1.00 20.99 ? 194 TRP C CB  1 
ATOM   4790 C  CG  . TRP C 1 194 ? 99.427  5.194   30.257  1.00 19.52 ? 194 TRP C CG  1 
ATOM   4791 C  CD1 . TRP C 1 194 ? 100.248 6.112   29.667  1.00 19.93 ? 194 TRP C CD1 1 
ATOM   4792 C  CD2 . TRP C 1 194 ? 98.233  5.157   29.465  1.00 17.59 ? 194 TRP C CD2 1 
ATOM   4793 N  NE1 . TRP C 1 194 ? 99.638  6.649   28.557  1.00 17.63 ? 194 TRP C NE1 1 
ATOM   4794 C  CE2 . TRP C 1 194 ? 98.401  6.080   28.412  1.00 17.49 ? 194 TRP C CE2 1 
ATOM   4795 C  CE3 . TRP C 1 194 ? 97.037  4.435   29.546  1.00 16.78 ? 194 TRP C CE3 1 
ATOM   4796 C  CZ2 . TRP C 1 194 ? 97.417  6.300   27.448  1.00 18.10 ? 194 TRP C CZ2 1 
ATOM   4797 C  CZ3 . TRP C 1 194 ? 96.057  4.655   28.586  1.00 18.36 ? 194 TRP C CZ3 1 
ATOM   4798 C  CH2 . TRP C 1 194 ? 96.255  5.580   27.551  1.00 17.39 ? 194 TRP C CH2 1 
ATOM   4799 N  N   . ASP C 1 195 ? 99.516  3.899   34.779  1.00 21.57 ? 195 ASP C N   1 
ATOM   4800 C  CA  . ASP C 1 195 ? 99.613  2.932   35.865  1.00 23.51 ? 195 ASP C CA  1 
ATOM   4801 C  C   . ASP C 1 195 ? 98.248  2.757   36.524  1.00 23.52 ? 195 ASP C C   1 
ATOM   4802 O  O   . ASP C 1 195 ? 97.801  1.629   36.760  1.00 24.13 ? 195 ASP C O   1 
ATOM   4803 C  CB  . ASP C 1 195 ? 100.637 3.381   36.912  1.00 24.66 ? 195 ASP C CB  1 
ATOM   4804 C  CG  . ASP C 1 195 ? 102.049 3.420   36.363  1.00 26.20 ? 195 ASP C CG  1 
ATOM   4805 O  OD1 . ASP C 1 195 ? 102.306 2.735   35.353  1.00 28.85 ? 195 ASP C OD1 1 
ATOM   4806 O  OD2 . ASP C 1 195 ? 102.905 4.124   36.942  1.00 27.27 ? 195 ASP C OD2 1 
ATOM   4807 N  N   . GLU C 1 196 ? 97.587  3.874   36.813  1.00 22.19 ? 196 GLU C N   1 
ATOM   4808 C  CA  . GLU C 1 196 ? 96.269  3.836   37.439  1.00 22.27 ? 196 GLU C CA  1 
ATOM   4809 C  C   . GLU C 1 196 ? 95.268  3.203   36.478  1.00 22.38 ? 196 GLU C C   1 
ATOM   4810 O  O   . GLU C 1 196 ? 94.407  2.423   36.886  1.00 22.08 ? 196 GLU C O   1 
ATOM   4811 C  CB  . GLU C 1 196 ? 95.818  5.250   37.809  1.00 22.21 ? 196 GLU C CB  1 
ATOM   4812 C  CG  . GLU C 1 196 ? 94.522  5.307   38.601  1.00 23.98 ? 196 GLU C CG  1 
ATOM   4813 C  CD  . GLU C 1 196 ? 94.577  4.511   39.898  1.00 23.59 ? 196 GLU C CD  1 
ATOM   4814 O  OE1 . GLU C 1 196 ? 95.675  4.364   40.471  1.00 26.14 ? 196 GLU C OE1 1 
ATOM   4815 O  OE2 . GLU C 1 196 ? 93.515  4.046   40.358  1.00 24.59 ? 196 GLU C OE2 1 
ATOM   4816 N  N   . ALA C 1 197 ? 95.387  3.541   35.196  1.00 21.80 ? 197 ALA C N   1 
ATOM   4817 C  CA  . ALA C 1 197 ? 94.499  2.984   34.178  1.00 22.52 ? 197 ALA C CA  1 
ATOM   4818 C  C   . ALA C 1 197 ? 94.649  1.464   34.153  1.00 22.46 ? 197 ALA C C   1 
ATOM   4819 O  O   . ALA C 1 197 ? 93.662  0.728   34.102  1.00 23.15 ? 197 ALA C O   1 
ATOM   4820 C  CB  . ALA C 1 197 ? 94.841  3.557   32.804  1.00 19.71 ? 197 ALA C CB  1 
ATOM   4821 N  N   . ALA C 1 198 ? 95.893  1.001   34.182  1.00 22.49 ? 198 ALA C N   1 
ATOM   4822 C  CA  . ALA C 1 198 ? 96.169  -0.428  34.162  1.00 23.98 ? 198 ALA C CA  1 
ATOM   4823 C  C   . ALA C 1 198 ? 95.600  -1.085  35.415  1.00 24.99 ? 198 ALA C C   1 
ATOM   4824 O  O   . ALA C 1 198 ? 95.027  -2.172  35.347  1.00 25.68 ? 198 ALA C O   1 
ATOM   4825 C  CB  . ALA C 1 198 ? 97.665  -0.667  34.073  1.00 25.07 ? 198 ALA C CB  1 
ATOM   4826 N  N   . ALA C 1 199 ? 95.753  -0.416  36.556  1.00 24.98 ? 199 ALA C N   1 
ATOM   4827 C  CA  . ALA C 1 199 ? 95.247  -0.935  37.822  1.00 25.79 ? 199 ALA C CA  1 
ATOM   4828 C  C   . ALA C 1 199 ? 93.739  -1.144  37.762  1.00 26.93 ? 199 ALA C C   1 
ATOM   4829 O  O   . ALA C 1 199 ? 93.237  -2.193  38.163  1.00 28.44 ? 199 ALA C O   1 
ATOM   4830 C  CB  . ALA C 1 199 ? 95.591  0.022   38.956  1.00 25.21 ? 199 ALA C CB  1 
ATOM   4831 N  N   . ARG C 1 200 ? 93.020  -0.143  37.259  1.00 27.39 ? 200 ARG C N   1 
ATOM   4832 C  CA  . ARG C 1 200 ? 91.569  -0.221  37.152  1.00 27.58 ? 200 ARG C CA  1 
ATOM   4833 C  C   . ARG C 1 200 ? 91.159  -1.317  36.172  1.00 28.73 ? 200 ARG C C   1 
ATOM   4834 O  O   . ARG C 1 200 ? 90.159  -2.006  36.373  1.00 27.85 ? 200 ARG C O   1 
ATOM   4835 C  CB  . ARG C 1 200 ? 90.996  1.126   36.691  1.00 26.44 ? 200 ARG C CB  1 
ATOM   4836 C  CG  . ARG C 1 200 ? 91.232  2.278   37.659  1.00 26.64 ? 200 ARG C CG  1 
ATOM   4837 C  CD  . ARG C 1 200 ? 90.571  3.563   37.157  1.00 26.40 ? 200 ARG C CD  1 
ATOM   4838 N  NE  . ARG C 1 200 ? 89.114  3.440   37.057  1.00 24.69 ? 200 ARG C NE  1 
ATOM   4839 C  CZ  . ARG C 1 200 ? 88.271  3.546   38.083  1.00 24.03 ? 200 ARG C CZ  1 
ATOM   4840 N  NH1 . ARG C 1 200 ? 88.728  3.790   39.307  1.00 21.25 ? 200 ARG C NH1 1 
ATOM   4841 N  NH2 . ARG C 1 200 ? 86.966  3.387   37.887  1.00 20.80 ? 200 ARG C NH2 1 
ATOM   4842 N  N   . PHE C 1 201 ? 91.937  -1.470  35.108  1.00 30.41 ? 201 PHE C N   1 
ATOM   4843 C  CA  . PHE C 1 201 ? 91.662  -2.481  34.096  1.00 33.31 ? 201 PHE C CA  1 
ATOM   4844 C  C   . PHE C 1 201 ? 91.776  -3.880  34.702  1.00 34.55 ? 201 PHE C C   1 
ATOM   4845 O  O   . PHE C 1 201 ? 91.017  -4.785  34.353  1.00 33.98 ? 201 PHE C O   1 
ATOM   4846 C  CB  . PHE C 1 201 ? 92.654  -2.329  32.937  1.00 33.76 ? 201 PHE C CB  1 
ATOM   4847 C  CG  . PHE C 1 201 ? 92.450  -3.318  31.824  1.00 35.18 ? 201 PHE C CG  1 
ATOM   4848 C  CD1 . PHE C 1 201 ? 91.263  -3.335  31.099  1.00 35.64 ? 201 PHE C CD1 1 
ATOM   4849 C  CD2 . PHE C 1 201 ? 93.448  -4.236  31.501  1.00 35.75 ? 201 PHE C CD2 1 
ATOM   4850 C  CE1 . PHE C 1 201 ? 91.070  -4.253  30.063  1.00 37.03 ? 201 PHE C CE1 1 
ATOM   4851 C  CE2 . PHE C 1 201 ? 93.265  -5.159  30.468  1.00 36.11 ? 201 PHE C CE2 1 
ATOM   4852 C  CZ  . PHE C 1 201 ? 92.074  -5.166  29.749  1.00 35.62 ? 201 PHE C CZ  1 
ATOM   4853 N  N   . ALA C 1 202 ? 92.729  -4.043  35.613  1.00 36.69 ? 202 ALA C N   1 
ATOM   4854 C  CA  . ALA C 1 202 ? 92.954  -5.322  36.273  1.00 39.79 ? 202 ALA C CA  1 
ATOM   4855 C  C   . ALA C 1 202 ? 91.828  -5.655  37.249  1.00 42.06 ? 202 ALA C C   1 
ATOM   4856 O  O   . ALA C 1 202 ? 91.379  -6.800  37.322  1.00 42.91 ? 202 ALA C O   1 
ATOM   4857 C  CB  . ALA C 1 202 ? 94.289  -5.298  37.002  1.00 39.90 ? 202 ALA C CB  1 
ATOM   4858 N  N   . ALA C 1 203 ? 91.371  -4.654  37.994  1.00 44.71 ? 203 ALA C N   1 
ATOM   4859 C  CA  . ALA C 1 203 ? 90.300  -4.852  38.966  1.00 47.30 ? 203 ALA C CA  1 
ATOM   4860 C  C   . ALA C 1 203 ? 88.966  -5.145  38.285  1.00 49.50 ? 203 ALA C C   1 
ATOM   4861 O  O   . ALA C 1 203 ? 88.211  -6.011  38.733  1.00 50.01 ? 203 ALA C O   1 
ATOM   4862 C  CB  . ALA C 1 203 ? 90.172  -3.624  39.859  1.00 46.78 ? 203 ALA C CB  1 
ATOM   4863 N  N   . LYS C 1 204 ? 88.683  -4.413  37.208  1.00 52.28 ? 204 LYS C N   1 
ATOM   4864 C  CA  . LYS C 1 204 ? 87.447  -4.569  36.438  1.00 54.87 ? 204 LYS C CA  1 
ATOM   4865 C  C   . LYS C 1 204 ? 86.188  -4.218  37.227  1.00 56.87 ? 204 LYS C C   1 
ATOM   4866 O  O   . LYS C 1 204 ? 85.073  -4.310  36.711  1.00 57.55 ? 204 LYS C O   1 
ATOM   4867 C  CB  . LYS C 1 204 ? 87.344  -5.998  35.894  1.00 54.11 ? 204 LYS C CB  1 
ATOM   4868 C  CG  . LYS C 1 204 ? 88.338  -6.298  34.788  1.00 54.34 ? 204 LYS C CG  1 
ATOM   4869 C  CD  . LYS C 1 204 ? 88.310  -7.759  34.390  1.00 55.30 ? 204 LYS C CD  1 
ATOM   4870 C  CE  . LYS C 1 204 ? 89.065  -7.983  33.088  1.00 55.99 ? 204 LYS C CE  1 
ATOM   4871 N  NZ  . LYS C 1 204 ? 90.454  -7.453  33.140  1.00 56.86 ? 204 LYS C NZ  1 
ATOM   4872 N  N   . LYS C 1 205 ? 86.371  -3.809  38.477  1.00 59.14 ? 205 LYS C N   1 
ATOM   4873 C  CA  . LYS C 1 205 ? 85.248  -3.457  39.335  1.00 61.53 ? 205 LYS C CA  1 
ATOM   4874 C  C   . LYS C 1 205 ? 85.638  -2.333  40.293  1.00 61.93 ? 205 LYS C C   1 
ATOM   4875 O  O   . LYS C 1 205 ? 86.833  -1.963  40.306  1.00 61.67 ? 205 LYS C O   1 
ATOM   4876 C  CB  . LYS C 1 205 ? 84.804  -4.694  40.119  1.00 63.34 ? 205 LYS C CB  1 
ATOM   4877 C  CG  . LYS C 1 205 ? 83.645  -4.475  41.085  1.00 66.56 ? 205 LYS C CG  1 
ATOM   4878 C  CD  . LYS C 1 205 ? 83.293  -5.772  41.804  1.00 68.19 ? 205 LYS C CD  1 
ATOM   4879 C  CE  . LYS C 1 205 ? 84.512  -6.356  42.513  1.00 69.70 ? 205 LYS C CE  1 
ATOM   4880 N  NZ  . LYS C 1 205 ? 84.247  -7.708  43.075  1.00 70.40 ? 205 LYS C NZ  1 
ATOM   4881 O  OXT . LYS C 1 205 ? 84.748  -1.836  41.018  1.00 62.75 ? 205 LYS C OXT 1 
ATOM   4882 N  N   . SER D 1 1   ? 74.936  31.395  2.797   1.00 23.92 ? 1   SER D N   1 
ATOM   4883 C  CA  . SER D 1 1   ? 76.262  31.703  3.396   1.00 23.81 ? 1   SER D CA  1 
ATOM   4884 C  C   . SER D 1 1   ? 76.095  32.736  4.505   1.00 23.42 ? 1   SER D C   1 
ATOM   4885 O  O   . SER D 1 1   ? 75.597  33.838  4.267   1.00 24.06 ? 1   SER D O   1 
ATOM   4886 C  CB  . SER D 1 1   ? 77.204  32.246  2.319   1.00 24.63 ? 1   SER D CB  1 
ATOM   4887 O  OG  . SER D 1 1   ? 78.475  32.561  2.853   1.00 25.24 ? 1   SER D OG  1 
ATOM   4888 N  N   . TYR D 1 2   ? 76.494  32.372  5.721   1.00 20.90 ? 2   TYR D N   1 
ATOM   4889 C  CA  . TYR D 1 2   ? 76.394  33.286  6.850   1.00 18.65 ? 2   TYR D CA  1 
ATOM   4890 C  C   . TYR D 1 2   ? 77.676  34.091  6.990   1.00 17.78 ? 2   TYR D C   1 
ATOM   4891 O  O   . TYR D 1 2   ? 78.777  33.582  6.754   1.00 15.71 ? 2   TYR D O   1 
ATOM   4892 C  CB  . TYR D 1 2   ? 76.167  32.528  8.158   1.00 20.66 ? 2   TYR D CB  1 
ATOM   4893 C  CG  . TYR D 1 2   ? 74.893  31.725  8.232   1.00 22.28 ? 2   TYR D CG  1 
ATOM   4894 C  CD1 . TYR D 1 2   ? 73.684  32.243  7.765   1.00 24.24 ? 2   TYR D CD1 1 
ATOM   4895 C  CD2 . TYR D 1 2   ? 74.885  30.465  8.825   1.00 24.30 ? 2   TYR D CD2 1 
ATOM   4896 C  CE1 . TYR D 1 2   ? 72.498  31.523  7.891   1.00 23.99 ? 2   TYR D CE1 1 
ATOM   4897 C  CE2 . TYR D 1 2   ? 73.711  29.739  8.958   1.00 24.08 ? 2   TYR D CE2 1 
ATOM   4898 C  CZ  . TYR D 1 2   ? 72.523  30.272  8.493   1.00 25.35 ? 2   TYR D CZ  1 
ATOM   4899 O  OH  . TYR D 1 2   ? 71.362  29.554  8.657   1.00 26.30 ? 2   TYR D OH  1 
ATOM   4900 N  N   . THR D 1 3   ? 77.527  35.346  7.389   1.00 15.43 ? 3   THR D N   1 
ATOM   4901 C  CA  . THR D 1 3   ? 78.669  36.223  7.584   1.00 14.45 ? 3   THR D CA  1 
ATOM   4902 C  C   . THR D 1 3   ? 78.845  36.500  9.075   1.00 14.39 ? 3   THR D C   1 
ATOM   4903 O  O   . THR D 1 3   ? 77.867  36.705  9.796   1.00 13.92 ? 3   THR D O   1 
ATOM   4904 C  CB  . THR D 1 3   ? 78.463  37.569  6.847   1.00 12.47 ? 3   THR D CB  1 
ATOM   4905 O  OG1 . THR D 1 3   ? 78.455  37.341  5.436   1.00 14.88 ? 3   THR D OG1 1 
ATOM   4906 C  CG2 . THR D 1 3   ? 79.573  38.555  7.192   1.00 12.05 ? 3   THR D CG2 1 
ATOM   4907 N  N   . LEU D 1 4   ? 80.084  36.488  9.546   1.00 14.62 ? 4   LEU D N   1 
ATOM   4908 C  CA  . LEU D 1 4   ? 80.329  36.795  10.945  1.00 15.81 ? 4   LEU D CA  1 
ATOM   4909 C  C   . LEU D 1 4   ? 80.025  38.285  11.085  1.00 16.33 ? 4   LEU D C   1 
ATOM   4910 O  O   . LEU D 1 4   ? 80.713  39.118  10.499  1.00 17.71 ? 4   LEU D O   1 
ATOM   4911 C  CB  . LEU D 1 4   ? 81.788  36.532  11.311  1.00 14.16 ? 4   LEU D CB  1 
ATOM   4912 C  CG  . LEU D 1 4   ? 82.129  36.920  12.752  1.00 15.35 ? 4   LEU D CG  1 
ATOM   4913 C  CD1 . LEU D 1 4   ? 81.357  36.025  13.713  1.00 13.50 ? 4   LEU D CD1 1 
ATOM   4914 C  CD2 . LEU D 1 4   ? 83.633  36.797  12.980  1.00 14.45 ? 4   LEU D CD2 1 
ATOM   4915 N  N   . PRO D 1 5   ? 78.985  38.644  11.852  1.00 17.68 ? 5   PRO D N   1 
ATOM   4916 C  CA  . PRO D 1 5   ? 78.675  40.069  11.994  1.00 18.84 ? 5   PRO D CA  1 
ATOM   4917 C  C   . PRO D 1 5   ? 79.747  40.809  12.779  1.00 20.82 ? 5   PRO D C   1 
ATOM   4918 O  O   . PRO D 1 5   ? 80.384  40.237  13.662  1.00 22.17 ? 5   PRO D O   1 
ATOM   4919 C  CB  . PRO D 1 5   ? 77.329  40.054  12.716  1.00 18.39 ? 5   PRO D CB  1 
ATOM   4920 C  CG  . PRO D 1 5   ? 77.451  38.844  13.596  1.00 17.90 ? 5   PRO D CG  1 
ATOM   4921 C  CD  . PRO D 1 5   ? 78.084  37.819  12.678  1.00 15.68 ? 5   PRO D CD  1 
ATOM   4922 N  N   . SER D 1 6   ? 79.969  42.074  12.448  1.00 22.38 ? 6   SER D N   1 
ATOM   4923 C  CA  . SER D 1 6   ? 80.963  42.847  13.182  1.00 24.23 ? 6   SER D CA  1 
ATOM   4924 C  C   . SER D 1 6   ? 80.229  43.390  14.403  1.00 21.49 ? 6   SER D C   1 
ATOM   4925 O  O   . SER D 1 6   ? 79.007  43.520  14.380  1.00 19.51 ? 6   SER D O   1 
ATOM   4926 C  CB  . SER D 1 6   ? 81.517  43.988  12.316  1.00 25.07 ? 6   SER D CB  1 
ATOM   4927 O  OG  . SER D 1 6   ? 80.485  44.864  11.911  1.00 28.93 ? 6   SER D OG  1 
ATOM   4928 N  N   . LEU D 1 7   ? 80.959  43.683  15.473  1.00 21.15 ? 7   LEU D N   1 
ATOM   4929 C  CA  . LEU D 1 7   ? 80.324  44.187  16.684  1.00 21.21 ? 7   LEU D CA  1 
ATOM   4930 C  C   . LEU D 1 7   ? 79.856  45.627  16.551  1.00 21.78 ? 7   LEU D C   1 
ATOM   4931 O  O   . LEU D 1 7   ? 80.405  46.405  15.770  1.00 22.29 ? 7   LEU D O   1 
ATOM   4932 C  CB  . LEU D 1 7   ? 81.276  44.075  17.873  1.00 21.96 ? 7   LEU D CB  1 
ATOM   4933 C  CG  . LEU D 1 7   ? 81.787  42.679  18.242  1.00 24.78 ? 7   LEU D CG  1 
ATOM   4934 C  CD1 . LEU D 1 7   ? 82.621  42.796  19.510  1.00 23.65 ? 7   LEU D CD1 1 
ATOM   4935 C  CD2 . LEU D 1 7   ? 80.623  41.711  18.447  1.00 22.56 ? 7   LEU D CD2 1 
ATOM   4936 N  N   . PRO D 1 8   ? 78.822  46.001  17.318  1.00 21.53 ? 8   PRO D N   1 
ATOM   4937 C  CA  . PRO D 1 8   ? 78.273  47.358  17.291  1.00 20.50 ? 8   PRO D CA  1 
ATOM   4938 C  C   . PRO D 1 8   ? 79.133  48.300  18.132  1.00 20.00 ? 8   PRO D C   1 
ATOM   4939 O  O   . PRO D 1 8   ? 78.720  49.419  18.429  1.00 20.30 ? 8   PRO D O   1 
ATOM   4940 C  CB  . PRO D 1 8   ? 76.878  47.189  17.909  1.00 20.32 ? 8   PRO D CB  1 
ATOM   4941 C  CG  . PRO D 1 8   ? 76.614  45.697  17.862  1.00 21.20 ? 8   PRO D CG  1 
ATOM   4942 C  CD  . PRO D 1 8   ? 77.968  45.116  18.125  1.00 21.20 ? 8   PRO D CD  1 
ATOM   4943 N  N   . TYR D 1 9   ? 80.322  47.843  18.518  1.00 19.02 ? 9   TYR D N   1 
ATOM   4944 C  CA  . TYR D 1 9   ? 81.209  48.649  19.354  1.00 19.67 ? 9   TYR D CA  1 
ATOM   4945 C  C   . TYR D 1 9   ? 82.598  48.034  19.448  1.00 20.94 ? 9   TYR D C   1 
ATOM   4946 O  O   . TYR D 1 9   ? 82.825  46.907  19.002  1.00 22.67 ? 9   TYR D O   1 
ATOM   4947 C  CB  . TYR D 1 9   ? 80.606  48.773  20.755  1.00 20.77 ? 9   TYR D CB  1 
ATOM   4948 C  CG  . TYR D 1 9   ? 80.008  47.469  21.247  1.00 21.92 ? 9   TYR D CG  1 
ATOM   4949 C  CD1 . TYR D 1 9   ? 80.824  46.384  21.569  1.00 21.95 ? 9   TYR D CD1 1 
ATOM   4950 C  CD2 . TYR D 1 9   ? 78.626  47.295  21.308  1.00 21.03 ? 9   TYR D CD2 1 
ATOM   4951 C  CE1 . TYR D 1 9   ? 80.279  45.157  21.931  1.00 23.29 ? 9   TYR D CE1 1 
ATOM   4952 C  CE2 . TYR D 1 9   ? 78.069  46.071  21.668  1.00 22.21 ? 9   TYR D CE2 1 
ATOM   4953 C  CZ  . TYR D 1 9   ? 78.903  45.006  21.974  1.00 24.11 ? 9   TYR D CZ  1 
ATOM   4954 O  OH  . TYR D 1 9   ? 78.367  43.779  22.288  1.00 24.99 ? 9   TYR D OH  1 
ATOM   4955 N  N   . ALA D 1 10  ? 83.531  48.783  20.025  1.00 21.27 ? 10  ALA D N   1 
ATOM   4956 C  CA  . ALA D 1 10  ? 84.897  48.302  20.186  1.00 20.94 ? 10  ALA D CA  1 
ATOM   4957 C  C   . ALA D 1 10  ? 84.901  47.200  21.243  1.00 20.97 ? 10  ALA D C   1 
ATOM   4958 O  O   . ALA D 1 10  ? 83.976  47.100  22.043  1.00 19.37 ? 10  ALA D O   1 
ATOM   4959 C  CB  . ALA D 1 10  ? 85.804  49.448  20.614  1.00 22.41 ? 10  ALA D CB  1 
ATOM   4960 N  N   . TYR D 1 11  ? 85.948  46.383  21.248  1.00 20.89 ? 11  TYR D N   1 
ATOM   4961 C  CA  . TYR D 1 11  ? 86.050  45.289  22.200  1.00 22.81 ? 11  TYR D CA  1 
ATOM   4962 C  C   . TYR D 1 11  ? 86.082  45.722  23.668  1.00 23.10 ? 11  TYR D C   1 
ATOM   4963 O  O   . TYR D 1 11  ? 85.645  44.973  24.544  1.00 23.86 ? 11  TYR D O   1 
ATOM   4964 C  CB  . TYR D 1 11  ? 87.270  44.418  21.866  1.00 21.78 ? 11  TYR D CB  1 
ATOM   4965 C  CG  . TYR D 1 11  ? 87.074  43.609  20.604  1.00 24.05 ? 11  TYR D CG  1 
ATOM   4966 C  CD1 . TYR D 1 11  ? 86.022  42.700  20.501  1.00 25.33 ? 11  TYR D CD1 1 
ATOM   4967 C  CD2 . TYR D 1 11  ? 87.906  43.779  19.496  1.00 25.19 ? 11  TYR D CD2 1 
ATOM   4968 C  CE1 . TYR D 1 11  ? 85.793  41.984  19.327  1.00 26.26 ? 11  TYR D CE1 1 
ATOM   4969 C  CE2 . TYR D 1 11  ? 87.685  43.061  18.305  1.00 25.81 ? 11  TYR D CE2 1 
ATOM   4970 C  CZ  . TYR D 1 11  ? 86.622  42.169  18.231  1.00 26.33 ? 11  TYR D CZ  1 
ATOM   4971 O  OH  . TYR D 1 11  ? 86.356  41.481  17.062  1.00 25.25 ? 11  TYR D OH  1 
ATOM   4972 N  N   . ASP D 1 12  ? 86.576  46.927  23.939  1.00 22.85 ? 12  ASP D N   1 
ATOM   4973 C  CA  . ASP D 1 12  ? 86.643  47.423  25.314  1.00 22.99 ? 12  ASP D CA  1 
ATOM   4974 C  C   . ASP D 1 12  ? 85.481  48.343  25.678  1.00 22.32 ? 12  ASP D C   1 
ATOM   4975 O  O   . ASP D 1 12  ? 85.524  49.020  26.701  1.00 23.55 ? 12  ASP D O   1 
ATOM   4976 C  CB  . ASP D 1 12  ? 87.946  48.186  25.544  1.00 25.30 ? 12  ASP D CB  1 
ATOM   4977 C  CG  . ASP D 1 12  ? 88.125  49.347  24.573  1.00 28.04 ? 12  ASP D CG  1 
ATOM   4978 O  OD1 . ASP D 1 12  ? 87.122  49.835  24.003  1.00 28.56 ? 12  ASP D OD1 1 
ATOM   4979 O  OD2 . ASP D 1 12  ? 89.281  49.782  24.386  1.00 31.70 ? 12  ASP D OD2 1 
ATOM   4980 N  N   . ALA D 1 13  ? 84.446  48.366  24.848  1.00 20.43 ? 13  ALA D N   1 
ATOM   4981 C  CA  . ALA D 1 13  ? 83.304  49.233  25.095  1.00 20.66 ? 13  ALA D CA  1 
ATOM   4982 C  C   . ALA D 1 13  ? 82.456  48.829  26.294  1.00 21.78 ? 13  ALA D C   1 
ATOM   4983 O  O   . ALA D 1 13  ? 81.650  49.621  26.785  1.00 22.79 ? 13  ALA D O   1 
ATOM   4984 C  CB  . ALA D 1 13  ? 82.432  49.300  23.847  1.00 19.46 ? 13  ALA D CB  1 
ATOM   4985 N  N   . LEU D 1 14  ? 82.619  47.600  26.768  1.00 22.15 ? 14  LEU D N   1 
ATOM   4986 C  CA  . LEU D 1 14  ? 81.822  47.155  27.900  1.00 20.68 ? 14  LEU D CA  1 
ATOM   4987 C  C   . LEU D 1 14  ? 82.611  47.140  29.210  1.00 21.21 ? 14  LEU D C   1 
ATOM   4988 O  O   . LEU D 1 14  ? 82.104  46.700  30.243  1.00 20.16 ? 14  LEU D O   1 
ATOM   4989 C  CB  . LEU D 1 14  ? 81.207  45.785  27.601  1.00 17.89 ? 14  LEU D CB  1 
ATOM   4990 C  CG  . LEU D 1 14  ? 80.288  45.761  26.369  1.00 18.62 ? 14  LEU D CG  1 
ATOM   4991 C  CD1 . LEU D 1 14  ? 79.760  44.343  26.133  1.00 15.57 ? 14  LEU D CD1 1 
ATOM   4992 C  CD2 . LEU D 1 14  ? 79.130  46.731  26.561  1.00 16.72 ? 14  LEU D CD2 1 
ATOM   4993 N  N   . GLU D 1 15  ? 83.851  47.624  29.165  1.00 20.88 ? 15  GLU D N   1 
ATOM   4994 C  CA  . GLU D 1 15  ? 84.666  47.697  30.371  1.00 22.48 ? 15  GLU D CA  1 
ATOM   4995 C  C   . GLU D 1 15  ? 83.967  48.709  31.277  1.00 23.19 ? 15  GLU D C   1 
ATOM   4996 O  O   . GLU D 1 15  ? 83.293  49.618  30.788  1.00 24.59 ? 15  GLU D O   1 
ATOM   4997 C  CB  . GLU D 1 15  ? 86.072  48.183  30.029  1.00 22.00 ? 15  GLU D CB  1 
ATOM   4998 C  CG  . GLU D 1 15  ? 86.896  47.191  29.223  1.00 22.73 ? 15  GLU D CG  1 
ATOM   4999 C  CD  . GLU D 1 15  ? 87.497  46.091  30.077  1.00 23.09 ? 15  GLU D CD  1 
ATOM   5000 O  OE1 . GLU D 1 15  ? 87.192  46.033  31.288  1.00 24.73 ? 15  GLU D OE1 1 
ATOM   5001 O  OE2 . GLU D 1 15  ? 88.279  45.282  29.534  1.00 22.90 ? 15  GLU D OE2 1 
ATOM   5002 N  N   . PRO D 1 16  ? 84.118  48.573  32.605  1.00 22.90 ? 16  PRO D N   1 
ATOM   5003 C  CA  . PRO D 1 16  ? 84.892  47.549  33.312  1.00 22.75 ? 16  PRO D CA  1 
ATOM   5004 C  C   . PRO D 1 16  ? 84.049  46.341  33.722  1.00 21.64 ? 16  PRO D C   1 
ATOM   5005 O  O   . PRO D 1 16  ? 84.438  45.589  34.613  1.00 21.58 ? 16  PRO D O   1 
ATOM   5006 C  CB  . PRO D 1 16  ? 85.396  48.309  34.524  1.00 22.67 ? 16  PRO D CB  1 
ATOM   5007 C  CG  . PRO D 1 16  ? 84.148  49.077  34.907  1.00 21.67 ? 16  PRO D CG  1 
ATOM   5008 C  CD  . PRO D 1 16  ? 83.624  49.586  33.559  1.00 23.53 ? 16  PRO D CD  1 
ATOM   5009 N  N   . HIS D 1 17  ? 82.903  46.155  33.073  1.00 21.38 ? 17  HIS D N   1 
ATOM   5010 C  CA  . HIS D 1 17  ? 82.007  45.047  33.394  1.00 20.20 ? 17  HIS D CA  1 
ATOM   5011 C  C   . HIS D 1 17  ? 82.413  43.741  32.711  1.00 20.25 ? 17  HIS D C   1 
ATOM   5012 O  O   . HIS D 1 17  ? 82.663  42.740  33.388  1.00 19.08 ? 17  HIS D O   1 
ATOM   5013 C  CB  . HIS D 1 17  ? 80.582  45.448  33.032  1.00 21.92 ? 17  HIS D CB  1 
ATOM   5014 C  CG  . HIS D 1 17  ? 80.176  46.765  33.617  1.00 24.41 ? 17  HIS D CG  1 
ATOM   5015 N  ND1 . HIS D 1 17  ? 80.198  47.012  34.972  1.00 25.78 ? 17  HIS D ND1 1 
ATOM   5016 C  CD2 . HIS D 1 17  ? 79.780  47.918  33.031  1.00 25.57 ? 17  HIS D CD2 1 
ATOM   5017 C  CE1 . HIS D 1 17  ? 79.834  48.261  35.196  1.00 26.18 ? 17  HIS D CE1 1 
ATOM   5018 N  NE2 . HIS D 1 17  ? 79.575  48.833  34.035  1.00 26.85 ? 17  HIS D NE2 1 
ATOM   5019 N  N   . PHE D 1 18  ? 82.467  43.750  31.380  1.00 18.51 ? 18  PHE D N   1 
ATOM   5020 C  CA  . PHE D 1 18  ? 82.890  42.577  30.616  1.00 17.23 ? 18  PHE D CA  1 
ATOM   5021 C  C   . PHE D 1 18  ? 84.278  42.900  30.068  1.00 18.50 ? 18  PHE D C   1 
ATOM   5022 O  O   . PHE D 1 18  ? 84.473  43.937  29.432  1.00 19.39 ? 18  PHE D O   1 
ATOM   5023 C  CB  . PHE D 1 18  ? 81.921  42.288  29.464  1.00 15.91 ? 18  PHE D CB  1 
ATOM   5024 C  CG  . PHE D 1 18  ? 80.644  41.605  29.892  1.00 14.76 ? 18  PHE D CG  1 
ATOM   5025 C  CD1 . PHE D 1 18  ? 80.355  41.402  31.242  1.00 13.85 ? 18  PHE D CD1 1 
ATOM   5026 C  CD2 . PHE D 1 18  ? 79.723  41.176  28.942  1.00 14.28 ? 18  PHE D CD2 1 
ATOM   5027 C  CE1 . PHE D 1 18  ? 79.171  40.787  31.637  1.00 13.04 ? 18  PHE D CE1 1 
ATOM   5028 C  CE2 . PHE D 1 18  ? 78.528  40.556  29.326  1.00 15.28 ? 18  PHE D CE2 1 
ATOM   5029 C  CZ  . PHE D 1 18  ? 78.252  40.361  30.677  1.00 14.44 ? 18  PHE D CZ  1 
ATOM   5030 N  N   . ASP D 1 19  ? 85.239  42.018  30.320  1.00 18.12 ? 19  ASP D N   1 
ATOM   5031 C  CA  . ASP D 1 19  ? 86.613  42.237  29.886  1.00 18.40 ? 19  ASP D CA  1 
ATOM   5032 C  C   . ASP D 1 19  ? 86.833  42.225  28.379  1.00 20.13 ? 19  ASP D C   1 
ATOM   5033 O  O   . ASP D 1 19  ? 86.241  41.435  27.643  1.00 19.40 ? 19  ASP D O   1 
ATOM   5034 C  CB  . ASP D 1 19  ? 87.534  41.208  30.536  1.00 17.53 ? 19  ASP D CB  1 
ATOM   5035 C  CG  . ASP D 1 19  ? 87.092  39.790  30.262  1.00 16.74 ? 19  ASP D CG  1 
ATOM   5036 O  OD1 . ASP D 1 19  ? 85.942  39.447  30.607  1.00 14.63 ? 19  ASP D OD1 1 
ATOM   5037 O  OD2 . ASP D 1 19  ? 87.893  39.020  29.701  1.00 19.08 ? 19  ASP D OD2 1 
ATOM   5038 N  N   . LYS D 1 20  ? 87.717  43.113  27.941  1.00 21.19 ? 20  LYS D N   1 
ATOM   5039 C  CA  . LYS D 1 20  ? 88.062  43.260  26.542  1.00 22.74 ? 20  LYS D CA  1 
ATOM   5040 C  C   . LYS D 1 20  ? 88.593  41.968  25.922  1.00 21.37 ? 20  LYS D C   1 
ATOM   5041 O  O   . LYS D 1 20  ? 88.219  41.617  24.803  1.00 21.20 ? 20  LYS D O   1 
ATOM   5042 C  CB  . LYS D 1 20  ? 89.097  44.380  26.396  1.00 27.65 ? 20  LYS D CB  1 
ATOM   5043 C  CG  . LYS D 1 20  ? 89.995  44.256  25.181  1.00 34.58 ? 20  LYS D CG  1 
ATOM   5044 C  CD  . LYS D 1 20  ? 91.050  45.350  25.159  1.00 40.54 ? 20  LYS D CD  1 
ATOM   5045 C  CE  . LYS D 1 20  ? 92.063  45.096  24.047  1.00 43.11 ? 20  LYS D CE  1 
ATOM   5046 N  NZ  . LYS D 1 20  ? 91.395  44.849  22.736  1.00 44.96 ? 20  LYS D NZ  1 
ATOM   5047 N  N   . GLN D 1 21  ? 89.458  41.262  26.645  1.00 19.85 ? 21  GLN D N   1 
ATOM   5048 C  CA  . GLN D 1 21  ? 90.039  40.032  26.119  1.00 20.62 ? 21  GLN D CA  1 
ATOM   5049 C  C   . GLN D 1 21  ? 88.983  38.981  25.774  1.00 19.51 ? 21  GLN D C   1 
ATOM   5050 O  O   . GLN D 1 21  ? 89.043  38.356  24.719  1.00 17.95 ? 21  GLN D O   1 
ATOM   5051 C  CB  . GLN D 1 21  ? 91.053  39.431  27.099  1.00 22.62 ? 21  GLN D CB  1 
ATOM   5052 C  CG  . GLN D 1 21  ? 91.850  38.293  26.472  1.00 31.07 ? 21  GLN D CG  1 
ATOM   5053 C  CD  . GLN D 1 21  ? 92.806  37.622  27.440  1.00 38.30 ? 21  GLN D CD  1 
ATOM   5054 O  OE1 . GLN D 1 21  ? 93.675  36.843  27.029  1.00 41.38 ? 21  GLN D OE1 1 
ATOM   5055 N  NE2 . GLN D 1 21  ? 92.648  37.911  28.732  1.00 40.61 ? 21  GLN D NE2 1 
ATOM   5056 N  N   . THR D 1 22  ? 88.019  38.785  26.664  1.00 17.32 ? 22  THR D N   1 
ATOM   5057 C  CA  . THR D 1 22  ? 86.967  37.815  26.419  1.00 16.81 ? 22  THR D CA  1 
ATOM   5058 C  C   . THR D 1 22  ? 86.121  38.224  25.210  1.00 16.41 ? 22  THR D C   1 
ATOM   5059 O  O   . THR D 1 22  ? 85.849  37.409  24.325  1.00 16.10 ? 22  THR D O   1 
ATOM   5060 C  CB  . THR D 1 22  ? 86.052  37.655  27.663  1.00 15.38 ? 22  THR D CB  1 
ATOM   5061 O  OG1 . THR D 1 22  ? 86.783  37.000  28.702  1.00 15.72 ? 22  THR D OG1 1 
ATOM   5062 C  CG2 . THR D 1 22  ? 84.820  36.831  27.329  1.00 12.07 ? 22  THR D CG2 1 
ATOM   5063 N  N   . MET D 1 23  ? 85.706  39.484  25.173  1.00 14.91 ? 23  MET D N   1 
ATOM   5064 C  CA  . MET D 1 23  ? 84.897  39.964  24.062  1.00 17.06 ? 23  MET D CA  1 
ATOM   5065 C  C   . MET D 1 23  ? 85.544  39.598  22.731  1.00 18.32 ? 23  MET D C   1 
ATOM   5066 O  O   . MET D 1 23  ? 84.875  39.119  21.813  1.00 18.50 ? 23  MET D O   1 
ATOM   5067 C  CB  . MET D 1 23  ? 84.722  41.484  24.138  1.00 15.97 ? 23  MET D CB  1 
ATOM   5068 C  CG  . MET D 1 23  ? 83.866  41.970  25.291  1.00 14.26 ? 23  MET D CG  1 
ATOM   5069 S  SD  . MET D 1 23  ? 82.189  41.319  25.234  1.00 18.87 ? 23  MET D SD  1 
ATOM   5070 C  CE  . MET D 1 23  ? 81.563  42.097  23.738  1.00 15.51 ? 23  MET D CE  1 
ATOM   5071 N  N   . GLU D 1 24  ? 86.853  39.816  22.636  1.00 19.09 ? 24  GLU D N   1 
ATOM   5072 C  CA  . GLU D 1 24  ? 87.583  39.528  21.411  1.00 19.73 ? 24  GLU D CA  1 
ATOM   5073 C  C   . GLU D 1 24  ? 87.638  38.043  21.058  1.00 18.54 ? 24  GLU D C   1 
ATOM   5074 O  O   . GLU D 1 24  ? 87.388  37.668  19.912  1.00 18.19 ? 24  GLU D O   1 
ATOM   5075 C  CB  . GLU D 1 24  ? 89.006  40.072  21.500  1.00 22.56 ? 24  GLU D CB  1 
ATOM   5076 C  CG  . GLU D 1 24  ? 89.726  40.020  20.168  1.00 28.70 ? 24  GLU D CG  1 
ATOM   5077 C  CD  . GLU D 1 24  ? 91.147  40.521  20.257  1.00 33.11 ? 24  GLU D CD  1 
ATOM   5078 O  OE1 . GLU D 1 24  ? 91.382  41.517  20.983  1.00 34.65 ? 24  GLU D OE1 1 
ATOM   5079 O  OE2 . GLU D 1 24  ? 92.021  39.923  19.592  1.00 35.73 ? 24  GLU D OE2 1 
ATOM   5080 N  N   . ILE D 1 25  ? 87.976  37.204  22.035  1.00 16.90 ? 25  ILE D N   1 
ATOM   5081 C  CA  . ILE D 1 25  ? 88.060  35.765  21.804  1.00 15.93 ? 25  ILE D CA  1 
ATOM   5082 C  C   . ILE D 1 25  ? 86.674  35.187  21.533  1.00 14.23 ? 25  ILE D C   1 
ATOM   5083 O  O   . ILE D 1 25  ? 86.486  34.379  20.623  1.00 12.27 ? 25  ILE D O   1 
ATOM   5084 C  CB  . ILE D 1 25  ? 88.670  35.032  23.026  1.00 17.00 ? 25  ILE D CB  1 
ATOM   5085 C  CG1 . ILE D 1 25  ? 90.103  35.505  23.254  1.00 17.13 ? 25  ILE D CG1 1 
ATOM   5086 C  CG2 . ILE D 1 25  ? 88.663  33.522  22.794  1.00 15.26 ? 25  ILE D CG2 1 
ATOM   5087 C  CD1 . ILE D 1 25  ? 90.793  34.806  24.411  1.00 19.02 ? 25  ILE D CD1 1 
ATOM   5088 N  N   . HIS D 1 26  ? 85.708  35.617  22.333  1.00 12.04 ? 26  HIS D N   1 
ATOM   5089 C  CA  . HIS D 1 26  ? 84.335  35.150  22.212  1.00 12.60 ? 26  HIS D CA  1 
ATOM   5090 C  C   . HIS D 1 26  ? 83.797  35.409  20.799  1.00 12.72 ? 26  HIS D C   1 
ATOM   5091 O  O   . HIS D 1 26  ? 83.118  34.566  20.209  1.00 13.49 ? 26  HIS D O   1 
ATOM   5092 C  CB  . HIS D 1 26  ? 83.471  35.868  23.262  1.00 9.97  ? 26  HIS D CB  1 
ATOM   5093 C  CG  . HIS D 1 26  ? 82.190  35.163  23.583  1.00 11.38 ? 26  HIS D CG  1 
ATOM   5094 N  ND1 . HIS D 1 26  ? 81.311  35.620  24.543  1.00 10.25 ? 26  HIS D ND1 1 
ATOM   5095 C  CD2 . HIS D 1 26  ? 81.639  34.033  23.075  1.00 8.66  ? 26  HIS D CD2 1 
ATOM   5096 C  CE1 . HIS D 1 26  ? 80.275  34.803  24.613  1.00 10.75 ? 26  HIS D CE1 1 
ATOM   5097 N  NE2 . HIS D 1 26  ? 80.450  33.832  23.733  1.00 11.35 ? 26  HIS D NE2 1 
ATOM   5098 N  N   . HIS D 1 27  ? 84.124  36.576  20.256  1.00 13.40 ? 27  HIS D N   1 
ATOM   5099 C  CA  . HIS D 1 27  ? 83.667  36.962  18.929  1.00 13.43 ? 27  HIS D CA  1 
ATOM   5100 C  C   . HIS D 1 27  ? 84.460  36.363  17.767  1.00 13.73 ? 27  HIS D C   1 
ATOM   5101 O  O   . HIS D 1 27  ? 83.898  35.658  16.930  1.00 11.97 ? 27  HIS D O   1 
ATOM   5102 C  CB  . HIS D 1 27  ? 83.675  38.486  18.806  1.00 15.06 ? 27  HIS D CB  1 
ATOM   5103 C  CG  . HIS D 1 27  ? 83.234  38.985  17.466  1.00 16.59 ? 27  HIS D CG  1 
ATOM   5104 N  ND1 . HIS D 1 27  ? 84.045  39.748  16.652  1.00 17.07 ? 27  HIS D ND1 1 
ATOM   5105 C  CD2 . HIS D 1 27  ? 82.068  38.826  16.796  1.00 15.39 ? 27  HIS D CD2 1 
ATOM   5106 C  CE1 . HIS D 1 27  ? 83.397  40.038  15.538  1.00 16.15 ? 27  HIS D CE1 1 
ATOM   5107 N  NE2 . HIS D 1 27  ? 82.195  39.490  15.600  1.00 16.37 ? 27  HIS D NE2 1 
ATOM   5108 N  N   . THR D 1 28  ? 85.761  36.643  17.724  1.00 13.07 ? 28  THR D N   1 
ATOM   5109 C  CA  . THR D 1 28  ? 86.618  36.180  16.636  1.00 13.03 ? 28  THR D CA  1 
ATOM   5110 C  C   . THR D 1 28  ? 86.980  34.695  16.630  1.00 13.97 ? 28  THR D C   1 
ATOM   5111 O  O   . THR D 1 28  ? 87.458  34.180  15.616  1.00 12.74 ? 28  THR D O   1 
ATOM   5112 C  CB  . THR D 1 28  ? 87.941  36.982  16.587  1.00 13.93 ? 28  THR D CB  1 
ATOM   5113 O  OG1 . THR D 1 28  ? 88.751  36.643  17.721  1.00 12.81 ? 28  THR D OG1 1 
ATOM   5114 C  CG2 . THR D 1 28  ? 87.662  38.484  16.597  1.00 11.67 ? 28  THR D CG2 1 
ATOM   5115 N  N   . LYS D 1 29  ? 86.770  34.011  17.750  1.00 12.91 ? 29  LYS D N   1 
ATOM   5116 C  CA  . LYS D 1 29  ? 87.089  32.588  17.832  1.00 13.43 ? 29  LYS D CA  1 
ATOM   5117 C  C   . LYS D 1 29  ? 85.839  31.719  17.940  1.00 13.59 ? 29  LYS D C   1 
ATOM   5118 O  O   . LYS D 1 29  ? 85.527  30.948  17.032  1.00 14.60 ? 29  LYS D O   1 
ATOM   5119 C  CB  . LYS D 1 29  ? 88.006  32.305  19.036  1.00 15.65 ? 29  LYS D CB  1 
ATOM   5120 C  CG  . LYS D 1 29  ? 89.423  32.880  18.931  1.00 16.87 ? 29  LYS D CG  1 
ATOM   5121 C  CD  . LYS D 1 29  ? 90.113  32.401  17.667  1.00 19.26 ? 29  LYS D CD  1 
ATOM   5122 C  CE  . LYS D 1 29  ? 91.583  32.783  17.655  1.00 24.17 ? 29  LYS D CE  1 
ATOM   5123 N  NZ  . LYS D 1 29  ? 91.765  34.248  17.743  1.00 28.21 ? 29  LYS D NZ  1 
ATOM   5124 N  N   . HIS D 1 30  ? 85.124  31.847  19.053  1.00 12.22 ? 30  HIS D N   1 
ATOM   5125 C  CA  . HIS D 1 30  ? 83.922  31.055  19.278  1.00 12.45 ? 30  HIS D CA  1 
ATOM   5126 C  C   . HIS D 1 30  ? 82.820  31.301  18.247  1.00 12.99 ? 30  HIS D C   1 
ATOM   5127 O  O   . HIS D 1 30  ? 82.347  30.364  17.611  1.00 12.81 ? 30  HIS D O   1 
ATOM   5128 C  CB  . HIS D 1 30  ? 83.382  31.310  20.690  1.00 10.28 ? 30  HIS D CB  1 
ATOM   5129 C  CG  . HIS D 1 30  ? 84.264  30.780  21.777  1.00 11.01 ? 30  HIS D CG  1 
ATOM   5130 N  ND1 . HIS D 1 30  ? 84.308  29.445  22.115  1.00 12.13 ? 30  HIS D ND1 1 
ATOM   5131 C  CD2 . HIS D 1 30  ? 85.158  31.400  22.584  1.00 11.32 ? 30  HIS D CD2 1 
ATOM   5132 C  CE1 . HIS D 1 30  ? 85.191  29.265  23.082  1.00 10.38 ? 30  HIS D CE1 1 
ATOM   5133 N  NE2 . HIS D 1 30  ? 85.721  30.436  23.384  1.00 11.33 ? 30  HIS D NE2 1 
ATOM   5134 N  N   . HIS D 1 31  ? 82.410  32.554  18.072  1.00 13.32 ? 31  HIS D N   1 
ATOM   5135 C  CA  . HIS D 1 31  ? 81.348  32.847  17.116  1.00 12.78 ? 31  HIS D CA  1 
ATOM   5136 C  C   . HIS D 1 31  ? 81.796  32.512  15.690  1.00 13.59 ? 31  HIS D C   1 
ATOM   5137 O  O   . HIS D 1 31  ? 81.027  31.956  14.897  1.00 11.76 ? 31  HIS D O   1 
ATOM   5138 C  CB  . HIS D 1 31  ? 80.926  34.317  17.225  1.00 12.00 ? 31  HIS D CB  1 
ATOM   5139 C  CG  . HIS D 1 31  ? 79.655  34.637  16.498  1.00 13.06 ? 31  HIS D CG  1 
ATOM   5140 N  ND1 . HIS D 1 31  ? 79.016  35.852  16.618  1.00 11.55 ? 31  HIS D ND1 1 
ATOM   5141 C  CD2 . HIS D 1 31  ? 78.902  33.897  15.647  1.00 12.82 ? 31  HIS D CD2 1 
ATOM   5142 C  CE1 . HIS D 1 31  ? 77.923  35.847  15.874  1.00 10.70 ? 31  HIS D CE1 1 
ATOM   5143 N  NE2 . HIS D 1 31  ? 77.831  34.674  15.275  1.00 11.09 ? 31  HIS D NE2 1 
ATOM   5144 N  N   . GLN D 1 32  ? 83.047  32.832  15.371  1.00 13.38 ? 32  GLN D N   1 
ATOM   5145 C  CA  . GLN D 1 32  ? 83.588  32.549  14.048  1.00 13.92 ? 32  GLN D CA  1 
ATOM   5146 C  C   . GLN D 1 32  ? 83.459  31.062  13.725  1.00 14.18 ? 32  GLN D C   1 
ATOM   5147 O  O   . GLN D 1 32  ? 83.066  30.687  12.621  1.00 15.99 ? 32  GLN D O   1 
ATOM   5148 C  CB  . GLN D 1 32  ? 85.067  32.959  13.975  1.00 14.68 ? 32  GLN D CB  1 
ATOM   5149 C  CG  . GLN D 1 32  ? 85.779  32.521  12.691  1.00 14.02 ? 32  GLN D CG  1 
ATOM   5150 C  CD  . GLN D 1 32  ? 85.341  33.307  11.459  1.00 15.98 ? 32  GLN D CD  1 
ATOM   5151 O  OE1 . GLN D 1 32  ? 85.698  34.470  11.297  1.00 17.54 ? 32  GLN D OE1 1 
ATOM   5152 N  NE2 . GLN D 1 32  ? 84.563  32.672  10.591  1.00 15.97 ? 32  GLN D NE2 1 
ATOM   5153 N  N   . THR D 1 33  ? 83.797  30.215  14.691  1.00 14.21 ? 33  THR D N   1 
ATOM   5154 C  CA  . THR D 1 33  ? 83.718  28.771  14.495  1.00 13.19 ? 33  THR D CA  1 
ATOM   5155 C  C   . THR D 1 33  ? 82.293  28.297  14.209  1.00 13.57 ? 33  THR D C   1 
ATOM   5156 O  O   . THR D 1 33  ? 82.091  27.415  13.375  1.00 12.62 ? 33  THR D O   1 
ATOM   5157 C  CB  . THR D 1 33  ? 84.300  28.015  15.718  1.00 14.42 ? 33  THR D CB  1 
ATOM   5158 O  OG1 . THR D 1 33  ? 85.727  28.160  15.719  1.00 15.15 ? 33  THR D OG1 1 
ATOM   5159 C  CG2 . THR D 1 33  ? 83.951  26.531  15.668  1.00 13.14 ? 33  THR D CG2 1 
ATOM   5160 N  N   . PHE D 1 34  ? 81.305  28.873  14.893  1.00 12.65 ? 34  PHE D N   1 
ATOM   5161 C  CA  . PHE D 1 34  ? 79.919  28.483  14.647  1.00 13.78 ? 34  PHE D CA  1 
ATOM   5162 C  C   . PHE D 1 34  ? 79.540  28.825  13.219  1.00 14.25 ? 34  PHE D C   1 
ATOM   5163 O  O   . PHE D 1 34  ? 78.855  28.049  12.545  1.00 14.94 ? 34  PHE D O   1 
ATOM   5164 C  CB  . PHE D 1 34  ? 78.952  29.203  15.592  1.00 13.99 ? 34  PHE D CB  1 
ATOM   5165 C  CG  . PHE D 1 34  ? 79.048  28.754  17.015  1.00 15.76 ? 34  PHE D CG  1 
ATOM   5166 C  CD1 . PHE D 1 34  ? 79.024  27.397  17.331  1.00 14.01 ? 34  PHE D CD1 1 
ATOM   5167 C  CD2 . PHE D 1 34  ? 79.158  29.686  18.047  1.00 14.31 ? 34  PHE D CD2 1 
ATOM   5168 C  CE1 . PHE D 1 34  ? 79.109  26.971  18.661  1.00 16.66 ? 34  PHE D CE1 1 
ATOM   5169 C  CE2 . PHE D 1 34  ? 79.242  29.270  19.379  1.00 17.55 ? 34  PHE D CE2 1 
ATOM   5170 C  CZ  . PHE D 1 34  ? 79.218  27.907  19.686  1.00 15.79 ? 34  PHE D CZ  1 
ATOM   5171 N  N   . VAL D 1 35  ? 79.978  29.998  12.764  1.00 12.99 ? 35  VAL D N   1 
ATOM   5172 C  CA  . VAL D 1 35  ? 79.685  30.444  11.410  1.00 12.38 ? 35  VAL D CA  1 
ATOM   5173 C  C   . VAL D 1 35  ? 80.332  29.507  10.395  1.00 12.84 ? 35  VAL D C   1 
ATOM   5174 O  O   . VAL D 1 35  ? 79.704  29.123  9.414   1.00 13.09 ? 35  VAL D O   1 
ATOM   5175 C  CB  . VAL D 1 35  ? 80.162  31.901  11.198  1.00 10.60 ? 35  VAL D CB  1 
ATOM   5176 C  CG1 . VAL D 1 35  ? 80.225  32.236  9.719   1.00 10.07 ? 35  VAL D CG1 1 
ATOM   5177 C  CG2 . VAL D 1 35  ? 79.194  32.851  11.896  1.00 9.53  ? 35  VAL D CG2 1 
ATOM   5178 N  N   . ASN D 1 36  ? 81.579  29.122  10.650  1.00 12.95 ? 36  ASN D N   1 
ATOM   5179 C  CA  . ASN D 1 36  ? 82.293  28.224  9.752   1.00 12.58 ? 36  ASN D CA  1 
ATOM   5180 C  C   . ASN D 1 36  ? 81.646  26.851  9.652   1.00 13.66 ? 36  ASN D C   1 
ATOM   5181 O  O   . ASN D 1 36  ? 81.433  26.338  8.550   1.00 12.73 ? 36  ASN D O   1 
ATOM   5182 C  CB  . ASN D 1 36  ? 83.745  28.061  10.198  1.00 11.02 ? 36  ASN D CB  1 
ATOM   5183 C  CG  . ASN D 1 36  ? 84.562  29.310  9.966   1.00 13.43 ? 36  ASN D CG  1 
ATOM   5184 O  OD1 . ASN D 1 36  ? 84.183  30.166  9.164   1.00 14.08 ? 36  ASN D OD1 1 
ATOM   5185 N  ND2 . ASN D 1 36  ? 85.697  29.420  10.654  1.00 9.16  ? 36  ASN D ND2 1 
ATOM   5186 N  N   . ASN D 1 37  ? 81.333  26.255  10.799  1.00 12.71 ? 37  ASN D N   1 
ATOM   5187 C  CA  . ASN D 1 37  ? 80.723  24.934  10.800  1.00 14.43 ? 37  ASN D CA  1 
ATOM   5188 C  C   . ASN D 1 37  ? 79.339  24.933  10.165  1.00 14.58 ? 37  ASN D C   1 
ATOM   5189 O  O   . ASN D 1 37  ? 78.982  23.997  9.448   1.00 15.18 ? 37  ASN D O   1 
ATOM   5190 C  CB  . ASN D 1 37  ? 80.658  24.371  12.221  1.00 13.13 ? 37  ASN D CB  1 
ATOM   5191 C  CG  . ASN D 1 37  ? 82.020  23.994  12.745  1.00 15.88 ? 37  ASN D CG  1 
ATOM   5192 O  OD1 . ASN D 1 37  ? 82.913  23.648  11.970  1.00 17.12 ? 37  ASN D OD1 1 
ATOM   5193 N  ND2 . ASN D 1 37  ? 82.191  24.042  14.059  1.00 16.28 ? 37  ASN D ND2 1 
ATOM   5194 N  N   . ALA D 1 38  ? 78.565  25.981  10.426  1.00 13.63 ? 38  ALA D N   1 
ATOM   5195 C  CA  . ALA D 1 38  ? 77.233  26.088  9.849   1.00 13.79 ? 38  ALA D CA  1 
ATOM   5196 C  C   . ALA D 1 38  ? 77.358  26.200  8.328   1.00 14.24 ? 38  ALA D C   1 
ATOM   5197 O  O   . ALA D 1 38  ? 76.671  25.492  7.585   1.00 14.38 ? 38  ALA D O   1 
ATOM   5198 C  CB  . ALA D 1 38  ? 76.513  27.309  10.410  1.00 11.62 ? 38  ALA D CB  1 
ATOM   5199 N  N   . ASN D 1 39  ? 78.239  27.086  7.867   1.00 13.75 ? 39  ASN D N   1 
ATOM   5200 C  CA  . ASN D 1 39  ? 78.443  27.272  6.435   1.00 15.24 ? 39  ASN D CA  1 
ATOM   5201 C  C   . ASN D 1 39  ? 78.887  25.983  5.746   1.00 17.30 ? 39  ASN D C   1 
ATOM   5202 O  O   . ASN D 1 39  ? 78.399  25.656  4.663   1.00 17.75 ? 39  ASN D O   1 
ATOM   5203 C  CB  . ASN D 1 39  ? 79.475  28.371  6.172   1.00 14.64 ? 39  ASN D CB  1 
ATOM   5204 C  CG  . ASN D 1 39  ? 78.898  29.763  6.341   1.00 16.69 ? 39  ASN D CG  1 
ATOM   5205 O  OD1 . ASN D 1 39  ? 77.703  29.979  6.124   1.00 16.06 ? 39  ASN D OD1 1 
ATOM   5206 N  ND2 . ASN D 1 39  ? 79.746  30.721  6.711   1.00 15.55 ? 39  ASN D ND2 1 
ATOM   5207 N  N   . ALA D 1 40  ? 79.813  25.257  6.369   1.00 17.09 ? 40  ALA D N   1 
ATOM   5208 C  CA  . ALA D 1 40  ? 80.305  24.008  5.801   1.00 18.42 ? 40  ALA D CA  1 
ATOM   5209 C  C   . ALA D 1 40  ? 79.151  23.032  5.590   1.00 20.28 ? 40  ALA D C   1 
ATOM   5210 O  O   . ALA D 1 40  ? 79.090  22.336  4.574   1.00 21.53 ? 40  ALA D O   1 
ATOM   5211 C  CB  . ALA D 1 40  ? 81.351  23.385  6.723   1.00 16.04 ? 40  ALA D CB  1 
ATOM   5212 N  N   . ALA D 1 41  ? 78.233  22.998  6.553   1.00 21.69 ? 41  ALA D N   1 
ATOM   5213 C  CA  . ALA D 1 41  ? 77.075  22.110  6.502   1.00 22.63 ? 41  ALA D CA  1 
ATOM   5214 C  C   . ALA D 1 41  ? 75.997  22.564  5.526   1.00 23.59 ? 41  ALA D C   1 
ATOM   5215 O  O   . ALA D 1 41  ? 75.229  21.745  5.029   1.00 24.03 ? 41  ALA D O   1 
ATOM   5216 C  CB  . ALA D 1 41  ? 76.471  21.968  7.898   1.00 22.37 ? 41  ALA D CB  1 
ATOM   5217 N  N   . LEU D 1 42  ? 75.928  23.864  5.262   1.00 25.43 ? 42  LEU D N   1 
ATOM   5218 C  CA  . LEU D 1 42  ? 74.921  24.397  4.345   1.00 28.07 ? 42  LEU D CA  1 
ATOM   5219 C  C   . LEU D 1 42  ? 75.362  24.352  2.885   1.00 29.75 ? 42  LEU D C   1 
ATOM   5220 O  O   . LEU D 1 42  ? 74.574  24.616  1.981   1.00 29.96 ? 42  LEU D O   1 
ATOM   5221 C  CB  . LEU D 1 42  ? 74.568  25.837  4.721   1.00 26.91 ? 42  LEU D CB  1 
ATOM   5222 C  CG  . LEU D 1 42  ? 73.717  26.057  5.977   1.00 27.04 ? 42  LEU D CG  1 
ATOM   5223 C  CD1 . LEU D 1 42  ? 73.515  27.541  6.176   1.00 25.66 ? 42  LEU D CD1 1 
ATOM   5224 C  CD2 . LEU D 1 42  ? 72.371  25.358  5.833   1.00 23.69 ? 42  LEU D CD2 1 
ATOM   5225 N  N   . GLU D 1 43  ? 76.623  24.017  2.660   1.00 32.48 ? 43  GLU D N   1 
ATOM   5226 C  CA  . GLU D 1 43  ? 77.167  23.943  1.313   1.00 35.83 ? 43  GLU D CA  1 
ATOM   5227 C  C   . GLU D 1 43  ? 76.304  23.067  0.407   1.00 36.25 ? 43  GLU D C   1 
ATOM   5228 O  O   . GLU D 1 43  ? 76.094  23.387  -0.757  1.00 35.69 ? 43  GLU D O   1 
ATOM   5229 C  CB  . GLU D 1 43  ? 78.593  23.394  1.374   1.00 38.79 ? 43  GLU D CB  1 
ATOM   5230 C  CG  . GLU D 1 43  ? 79.241  23.131  0.029   1.00 45.17 ? 43  GLU D CG  1 
ATOM   5231 C  CD  . GLU D 1 43  ? 80.626  22.517  0.172   1.00 49.43 ? 43  GLU D CD  1 
ATOM   5232 O  OE1 . GLU D 1 43  ? 80.753  21.495  0.884   1.00 51.87 ? 43  GLU D OE1 1 
ATOM   5233 O  OE2 . GLU D 1 43  ? 81.586  23.050  -0.428  1.00 52.02 ? 43  GLU D OE2 1 
ATOM   5234 N  N   . SER D 1 44  ? 75.792  21.970  0.954   1.00 37.49 ? 44  SER D N   1 
ATOM   5235 C  CA  . SER D 1 44  ? 74.974  21.041  0.183   1.00 38.45 ? 44  SER D CA  1 
ATOM   5236 C  C   . SER D 1 44  ? 73.463  21.218  0.340   1.00 38.30 ? 44  SER D C   1 
ATOM   5237 O  O   . SER D 1 44  ? 72.696  20.321  -0.009  1.00 39.27 ? 44  SER D O   1 
ATOM   5238 C  CB  . SER D 1 44  ? 75.354  19.602  0.544   1.00 39.90 ? 44  SER D CB  1 
ATOM   5239 O  OG  . SER D 1 44  ? 75.181  19.364  1.933   1.00 42.82 ? 44  SER D OG  1 
ATOM   5240 N  N   . LEU D 1 45  ? 73.033  22.363  0.862   1.00 37.11 ? 45  LEU D N   1 
ATOM   5241 C  CA  . LEU D 1 45  ? 71.606  22.624  1.036   1.00 36.63 ? 45  LEU D CA  1 
ATOM   5242 C  C   . LEU D 1 45  ? 71.256  24.005  0.495   1.00 36.72 ? 45  LEU D C   1 
ATOM   5243 O  O   . LEU D 1 45  ? 70.905  24.909  1.253   1.00 35.03 ? 45  LEU D O   1 
ATOM   5244 C  CB  . LEU D 1 45  ? 71.220  22.535  2.516   1.00 36.63 ? 45  LEU D CB  1 
ATOM   5245 C  CG  . LEU D 1 45  ? 71.558  21.225  3.236   1.00 36.92 ? 45  LEU D CG  1 
ATOM   5246 C  CD1 . LEU D 1 45  ? 71.175  21.340  4.705   1.00 35.46 ? 45  LEU D CD1 1 
ATOM   5247 C  CD2 . LEU D 1 45  ? 70.834  20.063  2.569   1.00 35.16 ? 45  LEU D CD2 1 
ATOM   5248 N  N   . PRO D 1 46  ? 71.341  24.181  -0.834  1.00 38.14 ? 46  PRO D N   1 
ATOM   5249 C  CA  . PRO D 1 46  ? 71.045  25.443  -1.519  1.00 39.83 ? 46  PRO D CA  1 
ATOM   5250 C  C   . PRO D 1 46  ? 69.735  26.094  -1.081  1.00 41.78 ? 46  PRO D C   1 
ATOM   5251 O  O   . PRO D 1 46  ? 69.650  27.317  -0.967  1.00 41.26 ? 46  PRO D O   1 
ATOM   5252 C  CB  . PRO D 1 46  ? 71.017  25.035  -2.988  1.00 39.72 ? 46  PRO D CB  1 
ATOM   5253 C  CG  . PRO D 1 46  ? 72.002  23.915  -3.040  1.00 38.99 ? 46  PRO D CG  1 
ATOM   5254 C  CD  . PRO D 1 46  ? 71.659  23.122  -1.810  1.00 38.05 ? 46  PRO D CD  1 
ATOM   5255 N  N   . GLU D 1 47  ? 68.719  25.273  -0.835  1.00 45.08 ? 47  GLU D N   1 
ATOM   5256 C  CA  . GLU D 1 47  ? 67.414  25.777  -0.420  1.00 49.82 ? 47  GLU D CA  1 
ATOM   5257 C  C   . GLU D 1 47  ? 67.503  26.570  0.879   1.00 50.66 ? 47  GLU D C   1 
ATOM   5258 O  O   . GLU D 1 47  ? 67.093  27.730  0.939   1.00 51.39 ? 47  GLU D O   1 
ATOM   5259 C  CB  . GLU D 1 47  ? 66.422  24.624  -0.221  1.00 53.67 ? 47  GLU D CB  1 
ATOM   5260 C  CG  . GLU D 1 47  ? 66.501  23.516  -1.263  1.00 60.46 ? 47  GLU D CG  1 
ATOM   5261 C  CD  . GLU D 1 47  ? 67.666  22.563  -1.021  1.00 63.90 ? 47  GLU D CD  1 
ATOM   5262 O  OE1 . GLU D 1 47  ? 67.710  21.943  0.066   1.00 66.29 ? 47  GLU D OE1 1 
ATOM   5263 O  OE2 . GLU D 1 47  ? 68.534  22.428  -1.915  1.00 64.45 ? 47  GLU D OE2 1 
ATOM   5264 N  N   . PHE D 1 48  ? 68.049  25.932  1.912   1.00 50.91 ? 48  PHE D N   1 
ATOM   5265 C  CA  . PHE D 1 48  ? 68.175  26.534  3.238   1.00 50.35 ? 48  PHE D CA  1 
ATOM   5266 C  C   . PHE D 1 48  ? 69.352  27.493  3.419   1.00 49.86 ? 48  PHE D C   1 
ATOM   5267 O  O   . PHE D 1 48  ? 69.390  28.253  4.384   1.00 49.18 ? 48  PHE D O   1 
ATOM   5268 C  CB  . PHE D 1 48  ? 68.273  25.428  4.293   1.00 50.16 ? 48  PHE D CB  1 
ATOM   5269 C  CG  . PHE D 1 48  ? 67.130  24.451  4.261   1.00 51.86 ? 48  PHE D CG  1 
ATOM   5270 C  CD1 . PHE D 1 48  ? 65.836  24.858  4.580   1.00 52.74 ? 48  PHE D CD1 1 
ATOM   5271 C  CD2 . PHE D 1 48  ? 67.346  23.120  3.915   1.00 52.19 ? 48  PHE D CD2 1 
ATOM   5272 C  CE1 . PHE D 1 48  ? 64.772  23.950  4.557   1.00 52.68 ? 48  PHE D CE1 1 
ATOM   5273 C  CE2 . PHE D 1 48  ? 66.290  22.204  3.888   1.00 52.87 ? 48  PHE D CE2 1 
ATOM   5274 C  CZ  . PHE D 1 48  ? 65.001  22.622  4.211   1.00 52.50 ? 48  PHE D CZ  1 
ATOM   5275 N  N   . ALA D 1 49  ? 70.303  27.466  2.494   1.00 49.72 ? 49  ALA D N   1 
ATOM   5276 C  CA  . ALA D 1 49  ? 71.485  28.315  2.594   1.00 49.92 ? 49  ALA D CA  1 
ATOM   5277 C  C   . ALA D 1 49  ? 71.245  29.822  2.675   1.00 49.64 ? 49  ALA D C   1 
ATOM   5278 O  O   . ALA D 1 49  ? 71.940  30.513  3.417   1.00 49.98 ? 49  ALA D O   1 
ATOM   5279 C  CB  . ALA D 1 49  ? 72.434  28.012  1.444   1.00 50.51 ? 49  ALA D CB  1 
ATOM   5280 N  N   . ASN D 1 50  ? 70.276  30.340  1.925   1.00 49.50 ? 50  ASN D N   1 
ATOM   5281 C  CA  . ASN D 1 50  ? 70.022  31.780  1.942   1.00 49.21 ? 50  ASN D CA  1 
ATOM   5282 C  C   . ASN D 1 50  ? 68.928  32.279  2.894   1.00 46.24 ? 50  ASN D C   1 
ATOM   5283 O  O   . ASN D 1 50  ? 68.592  33.467  2.887   1.00 44.53 ? 50  ASN D O   1 
ATOM   5284 C  CB  . ASN D 1 50  ? 69.737  32.279  0.521   1.00 55.09 ? 50  ASN D CB  1 
ATOM   5285 C  CG  . ASN D 1 50  ? 68.666  31.465  -0.182  1.00 60.84 ? 50  ASN D CG  1 
ATOM   5286 O  OD1 . ASN D 1 50  ? 67.549  31.308  0.326   1.00 64.16 ? 50  ASN D OD1 1 
ATOM   5287 N  ND2 . ASN D 1 50  ? 68.999  30.944  -1.362  1.00 62.88 ? 50  ASN D ND2 1 
ATOM   5288 N  N   . LEU D 1 51  ? 68.374  31.385  3.709   1.00 42.25 ? 51  LEU D N   1 
ATOM   5289 C  CA  . LEU D 1 51  ? 67.351  31.777  4.677   1.00 38.81 ? 51  LEU D CA  1 
ATOM   5290 C  C   . LEU D 1 51  ? 68.014  32.458  5.867   1.00 36.26 ? 51  LEU D C   1 
ATOM   5291 O  O   . LEU D 1 51  ? 69.140  32.122  6.230   1.00 35.48 ? 51  LEU D O   1 
ATOM   5292 C  CB  . LEU D 1 51  ? 66.599  30.557  5.206   1.00 39.05 ? 51  LEU D CB  1 
ATOM   5293 C  CG  . LEU D 1 51  ? 65.584  29.834  4.330   1.00 40.53 ? 51  LEU D CG  1 
ATOM   5294 C  CD1 . LEU D 1 51  ? 65.019  28.661  5.115   1.00 39.44 ? 51  LEU D CD1 1 
ATOM   5295 C  CD2 . LEU D 1 51  ? 64.473  30.798  3.921   1.00 41.53 ? 51  LEU D CD2 1 
ATOM   5296 N  N   . PRO D 1 52  ? 67.332  33.434  6.488   1.00 33.63 ? 52  PRO D N   1 
ATOM   5297 C  CA  . PRO D 1 52  ? 67.951  34.089  7.646   1.00 30.31 ? 52  PRO D CA  1 
ATOM   5298 C  C   . PRO D 1 52  ? 68.149  32.998  8.702   1.00 27.82 ? 52  PRO D C   1 
ATOM   5299 O  O   . PRO D 1 52  ? 67.323  32.090  8.817   1.00 26.73 ? 52  PRO D O   1 
ATOM   5300 C  CB  . PRO D 1 52  ? 66.902  35.113  8.065   1.00 30.91 ? 52  PRO D CB  1 
ATOM   5301 C  CG  . PRO D 1 52  ? 66.217  35.441  6.766   1.00 31.99 ? 52  PRO D CG  1 
ATOM   5302 C  CD  . PRO D 1 52  ? 66.061  34.084  6.130   1.00 33.04 ? 52  PRO D CD  1 
ATOM   5303 N  N   . VAL D 1 53  ? 69.230  33.080  9.469   1.00 25.26 ? 53  VAL D N   1 
ATOM   5304 C  CA  . VAL D 1 53  ? 69.502  32.062  10.477  1.00 22.92 ? 53  VAL D CA  1 
ATOM   5305 C  C   . VAL D 1 53  ? 68.370  31.920  11.501  1.00 22.55 ? 53  VAL D C   1 
ATOM   5306 O  O   . VAL D 1 53  ? 68.035  30.805  11.899  1.00 19.69 ? 53  VAL D O   1 
ATOM   5307 C  CB  . VAL D 1 53  ? 70.861  32.334  11.197  1.00 21.61 ? 53  VAL D CB  1 
ATOM   5308 C  CG1 . VAL D 1 53  ? 70.757  33.547  12.109  1.00 19.57 ? 53  VAL D CG1 1 
ATOM   5309 C  CG2 . VAL D 1 53  ? 71.296  31.092  11.971  1.00 19.79 ? 53  VAL D CG2 1 
ATOM   5310 N  N   . GLU D 1 54  ? 67.771  33.038  11.908  1.00 23.07 ? 54  GLU D N   1 
ATOM   5311 C  CA  . GLU D 1 54  ? 66.678  32.998  12.880  1.00 26.07 ? 54  GLU D CA  1 
ATOM   5312 C  C   . GLU D 1 54  ? 65.486  32.224  12.331  1.00 26.34 ? 54  GLU D C   1 
ATOM   5313 O  O   . GLU D 1 54  ? 64.650  31.741  13.087  1.00 27.76 ? 54  GLU D O   1 
ATOM   5314 C  CB  . GLU D 1 54  ? 66.212  34.406  13.252  1.00 28.23 ? 54  GLU D CB  1 
ATOM   5315 C  CG  . GLU D 1 54  ? 67.281  35.326  13.814  1.00 32.84 ? 54  GLU D CG  1 
ATOM   5316 C  CD  . GLU D 1 54  ? 68.277  35.791  12.757  1.00 36.79 ? 54  GLU D CD  1 
ATOM   5317 O  OE1 . GLU D 1 54  ? 67.988  35.640  11.545  1.00 35.62 ? 54  GLU D OE1 1 
ATOM   5318 O  OE2 . GLU D 1 54  ? 69.345  36.320  13.142  1.00 39.73 ? 54  GLU D OE2 1 
ATOM   5319 N  N   . GLU D 1 55  ? 65.404  32.107  11.012  1.00 27.48 ? 55  GLU D N   1 
ATOM   5320 C  CA  . GLU D 1 55  ? 64.296  31.392  10.396  1.00 28.53 ? 55  GLU D CA  1 
ATOM   5321 C  C   . GLU D 1 55  ? 64.649  29.917  10.258  1.00 26.90 ? 55  GLU D C   1 
ATOM   5322 O  O   . GLU D 1 55  ? 63.813  29.033  10.476  1.00 26.18 ? 55  GLU D O   1 
ATOM   5323 C  CB  . GLU D 1 55  ? 63.986  31.994  9.024   1.00 31.46 ? 55  GLU D CB  1 
ATOM   5324 C  CG  . GLU D 1 55  ? 62.651  31.569  8.447   1.00 37.88 ? 55  GLU D CG  1 
ATOM   5325 C  CD  . GLU D 1 55  ? 62.351  32.260  7.129   1.00 42.72 ? 55  GLU D CD  1 
ATOM   5326 O  OE1 . GLU D 1 55  ? 62.440  33.511  7.079   1.00 42.71 ? 55  GLU D OE1 1 
ATOM   5327 O  OE2 . GLU D 1 55  ? 62.024  31.550  6.149   1.00 44.50 ? 55  GLU D OE2 1 
ATOM   5328 N  N   . LEU D 1 56  ? 65.901  29.658  9.905   1.00 24.02 ? 56  LEU D N   1 
ATOM   5329 C  CA  . LEU D 1 56  ? 66.372  28.296  9.746   1.00 22.37 ? 56  LEU D CA  1 
ATOM   5330 C  C   . LEU D 1 56  ? 66.177  27.475  11.020  1.00 21.80 ? 56  LEU D C   1 
ATOM   5331 O  O   . LEU D 1 56  ? 65.797  26.306  10.958  1.00 20.09 ? 56  LEU D O   1 
ATOM   5332 C  CB  . LEU D 1 56  ? 67.855  28.286  9.371   1.00 22.02 ? 56  LEU D CB  1 
ATOM   5333 C  CG  . LEU D 1 56  ? 68.430  26.877  9.176   1.00 25.13 ? 56  LEU D CG  1 
ATOM   5334 C  CD1 . LEU D 1 56  ? 67.949  26.329  7.838   1.00 25.34 ? 56  LEU D CD1 1 
ATOM   5335 C  CD2 . LEU D 1 56  ? 69.949  26.902  9.216   1.00 25.11 ? 56  LEU D CD2 1 
ATOM   5336 N  N   . ILE D 1 57  ? 66.431  28.078  12.178  1.00 21.30 ? 57  ILE D N   1 
ATOM   5337 C  CA  . ILE D 1 57  ? 66.293  27.334  13.426  1.00 22.14 ? 57  ILE D CA  1 
ATOM   5338 C  C   . ILE D 1 57  ? 64.858  27.035  13.852  1.00 23.36 ? 57  ILE D C   1 
ATOM   5339 O  O   . ILE D 1 57  ? 64.644  26.286  14.800  1.00 25.15 ? 57  ILE D O   1 
ATOM   5340 C  CB  . ILE D 1 57  ? 67.034  28.026  14.595  1.00 20.16 ? 57  ILE D CB  1 
ATOM   5341 C  CG1 . ILE D 1 57  ? 66.457  29.411  14.857  1.00 19.58 ? 57  ILE D CG1 1 
ATOM   5342 C  CG2 . ILE D 1 57  ? 68.516  28.124  14.277  1.00 18.74 ? 57  ILE D CG2 1 
ATOM   5343 C  CD1 . ILE D 1 57  ? 67.057  30.081  16.076  1.00 18.93 ? 57  ILE D CD1 1 
ATOM   5344 N  N   . THR D 1 58  ? 63.875  27.605  13.159  1.00 24.55 ? 58  THR D N   1 
ATOM   5345 C  CA  . THR D 1 58  ? 62.478  27.336  13.497  1.00 25.92 ? 58  THR D CA  1 
ATOM   5346 C  C   . THR D 1 58  ? 61.969  26.240  12.573  1.00 28.07 ? 58  THR D C   1 
ATOM   5347 O  O   . THR D 1 58  ? 60.816  25.826  12.667  1.00 29.91 ? 58  THR D O   1 
ATOM   5348 C  CB  . THR D 1 58  ? 61.579  28.556  13.287  1.00 24.07 ? 58  THR D CB  1 
ATOM   5349 O  OG1 . THR D 1 58  ? 61.483  28.830  11.886  1.00 23.92 ? 58  THR D OG1 1 
ATOM   5350 C  CG2 . THR D 1 58  ? 62.139  29.769  14.011  1.00 23.43 ? 58  THR D CG2 1 
ATOM   5351 N  N   . LYS D 1 59  ? 62.841  25.774  11.685  1.00 29.11 ? 59  LYS D N   1 
ATOM   5352 C  CA  . LYS D 1 59  ? 62.484  24.738  10.726  1.00 30.52 ? 59  LYS D CA  1 
ATOM   5353 C  C   . LYS D 1 59  ? 63.470  23.576  10.735  1.00 31.08 ? 59  LYS D C   1 
ATOM   5354 O  O   . LYS D 1 59  ? 63.761  22.999  9.689   1.00 31.79 ? 59  LYS D O   1 
ATOM   5355 C  CB  . LYS D 1 59  ? 62.416  25.345  9.321   1.00 32.31 ? 59  LYS D CB  1 
ATOM   5356 C  CG  . LYS D 1 59  ? 61.367  26.437  9.187   1.00 36.76 ? 59  LYS D CG  1 
ATOM   5357 C  CD  . LYS D 1 59  ? 61.415  27.109  7.824   1.00 40.73 ? 59  LYS D CD  1 
ATOM   5358 C  CE  . LYS D 1 59  ? 60.369  28.215  7.730   1.00 43.41 ? 59  LYS D CE  1 
ATOM   5359 N  NZ  . LYS D 1 59  ? 60.472  28.978  6.455   1.00 46.44 ? 59  LYS D NZ  1 
ATOM   5360 N  N   . LEU D 1 60  ? 63.978  23.228  11.914  1.00 31.09 ? 60  LEU D N   1 
ATOM   5361 C  CA  . LEU D 1 60  ? 64.938  22.134  12.035  1.00 32.38 ? 60  LEU D CA  1 
ATOM   5362 C  C   . LEU D 1 60  ? 64.355  20.777  11.649  1.00 33.91 ? 60  LEU D C   1 
ATOM   5363 O  O   . LEU D 1 60  ? 65.086  19.887  11.221  1.00 33.09 ? 60  LEU D O   1 
ATOM   5364 C  CB  . LEU D 1 60  ? 65.497  22.070  13.464  1.00 31.05 ? 60  LEU D CB  1 
ATOM   5365 C  CG  . LEU D 1 60  ? 66.414  23.228  13.876  1.00 30.74 ? 60  LEU D CG  1 
ATOM   5366 C  CD1 . LEU D 1 60  ? 66.753  23.148  15.358  1.00 29.90 ? 60  LEU D CD1 1 
ATOM   5367 C  CD2 . LEU D 1 60  ? 67.677  23.185  13.033  1.00 29.49 ? 60  LEU D CD2 1 
ATOM   5368 N  N   . ASP D 1 61  ? 63.041  20.620  11.794  1.00 36.00 ? 61  ASP D N   1 
ATOM   5369 C  CA  . ASP D 1 61  ? 62.388  19.360  11.455  1.00 38.07 ? 61  ASP D CA  1 
ATOM   5370 C  C   . ASP D 1 61  ? 62.341  19.071  9.955   1.00 38.78 ? 61  ASP D C   1 
ATOM   5371 O  O   . ASP D 1 61  ? 62.110  17.937  9.548   1.00 39.97 ? 61  ASP D O   1 
ATOM   5372 C  CB  . ASP D 1 61  ? 60.963  19.325  12.020  1.00 39.53 ? 61  ASP D CB  1 
ATOM   5373 C  CG  . ASP D 1 61  ? 60.939  19.205  13.532  1.00 41.67 ? 61  ASP D CG  1 
ATOM   5374 O  OD1 . ASP D 1 61  ? 61.832  18.524  14.082  1.00 43.11 ? 61  ASP D OD1 1 
ATOM   5375 O  OD2 . ASP D 1 61  ? 60.026  19.775  14.170  1.00 43.05 ? 61  ASP D OD2 1 
ATOM   5376 N  N   . GLN D 1 62  ? 62.566  20.089  9.135   1.00 39.62 ? 62  GLN D N   1 
ATOM   5377 C  CA  . GLN D 1 62  ? 62.537  19.915  7.687   1.00 40.58 ? 62  GLN D CA  1 
ATOM   5378 C  C   . GLN D 1 62  ? 63.903  19.526  7.117   1.00 40.81 ? 62  GLN D C   1 
ATOM   5379 O  O   . GLN D 1 62  ? 64.028  19.251  5.923   1.00 41.89 ? 62  GLN D O   1 
ATOM   5380 C  CB  . GLN D 1 62  ? 62.059  21.205  7.024   1.00 41.49 ? 62  GLN D CB  1 
ATOM   5381 C  CG  . GLN D 1 62  ? 60.776  21.750  7.616   1.00 45.72 ? 62  GLN D CG  1 
ATOM   5382 C  CD  . GLN D 1 62  ? 60.335  23.036  6.950   1.00 48.73 ? 62  GLN D CD  1 
ATOM   5383 O  OE1 . GLN D 1 62  ? 59.337  23.641  7.342   1.00 51.55 ? 62  GLN D OE1 1 
ATOM   5384 N  NE2 . GLN D 1 62  ? 61.078  23.462  5.932   1.00 50.37 ? 62  GLN D NE2 1 
ATOM   5385 N  N   . LEU D 1 63  ? 64.921  19.497  7.970   1.00 39.60 ? 63  LEU D N   1 
ATOM   5386 C  CA  . LEU D 1 63  ? 66.276  19.153  7.540   1.00 39.55 ? 63  LEU D CA  1 
ATOM   5387 C  C   . LEU D 1 63  ? 66.550  17.653  7.543   1.00 39.25 ? 63  LEU D C   1 
ATOM   5388 O  O   . LEU D 1 63  ? 65.944  16.899  8.304   1.00 39.63 ? 63  LEU D O   1 
ATOM   5389 C  CB  . LEU D 1 63  ? 67.314  19.823  8.452   1.00 38.45 ? 63  LEU D CB  1 
ATOM   5390 C  CG  . LEU D 1 63  ? 67.398  21.348  8.531   1.00 38.56 ? 63  LEU D CG  1 
ATOM   5391 C  CD1 . LEU D 1 63  ? 68.297  21.745  9.694   1.00 37.29 ? 63  LEU D CD1 1 
ATOM   5392 C  CD2 . LEU D 1 63  ? 67.922  21.906  7.221   1.00 37.50 ? 63  LEU D CD2 1 
ATOM   5393 N  N   . PRO D 1 64  ? 67.476  17.202  6.683   1.00 39.16 ? 64  PRO D N   1 
ATOM   5394 C  CA  . PRO D 1 64  ? 67.804  15.775  6.637   1.00 39.26 ? 64  PRO D CA  1 
ATOM   5395 C  C   . PRO D 1 64  ? 68.413  15.330  7.971   1.00 39.66 ? 64  PRO D C   1 
ATOM   5396 O  O   . PRO D 1 64  ? 69.187  16.062  8.588   1.00 39.46 ? 64  PRO D O   1 
ATOM   5397 C  CB  . PRO D 1 64  ? 68.787  15.679  5.465   1.00 39.27 ? 64  PRO D CB  1 
ATOM   5398 C  CG  . PRO D 1 64  ? 69.369  17.065  5.368   1.00 39.63 ? 64  PRO D CG  1 
ATOM   5399 C  CD  . PRO D 1 64  ? 68.177  17.942  5.620   1.00 38.19 ? 64  PRO D CD  1 
ATOM   5400 N  N   . ALA D 1 65  ? 68.052  14.130  8.408   1.00 39.45 ? 65  ALA D N   1 
ATOM   5401 C  CA  . ALA D 1 65  ? 68.527  13.587  9.675   1.00 39.70 ? 65  ALA D CA  1 
ATOM   5402 C  C   . ALA D 1 65  ? 70.007  13.806  9.975   1.00 39.01 ? 65  ALA D C   1 
ATOM   5403 O  O   . ALA D 1 65  ? 70.361  14.167  11.090  1.00 39.10 ? 65  ALA D O   1 
ATOM   5404 C  CB  . ALA D 1 65  ? 68.201  12.094  9.749   1.00 40.28 ? 65  ALA D CB  1 
ATOM   5405 N  N   . ASP D 1 66  ? 70.864  13.596  8.982   1.00 39.13 ? 66  ASP D N   1 
ATOM   5406 C  CA  . ASP D 1 66  ? 72.306  13.735  9.168   1.00 39.78 ? 66  ASP D CA  1 
ATOM   5407 C  C   . ASP D 1 66  ? 72.838  15.168  9.248   1.00 39.48 ? 66  ASP D C   1 
ATOM   5408 O  O   . ASP D 1 66  ? 74.040  15.372  9.411   1.00 39.85 ? 66  ASP D O   1 
ATOM   5409 C  CB  . ASP D 1 66  ? 73.043  12.985  8.053   1.00 41.20 ? 66  ASP D CB  1 
ATOM   5410 C  CG  . ASP D 1 66  ? 72.888  13.653  6.701   1.00 43.83 ? 66  ASP D CG  1 
ATOM   5411 O  OD1 . ASP D 1 66  ? 71.741  13.972  6.317   1.00 45.36 ? 66  ASP D OD1 1 
ATOM   5412 O  OD2 . ASP D 1 66  ? 73.914  13.856  6.016   1.00 46.01 ? 66  ASP D OD2 1 
ATOM   5413 N  N   . LYS D 1 67  ? 71.955  16.156  9.131   1.00 38.58 ? 67  LYS D N   1 
ATOM   5414 C  CA  . LYS D 1 67  ? 72.366  17.561  9.192   1.00 37.40 ? 67  LYS D CA  1 
ATOM   5415 C  C   . LYS D 1 67  ? 71.670  18.294  10.339  1.00 35.91 ? 67  LYS D C   1 
ATOM   5416 O  O   . LYS D 1 67  ? 72.045  19.411  10.691  1.00 35.88 ? 67  LYS D O   1 
ATOM   5417 C  CB  . LYS D 1 67  ? 72.022  18.277  7.880   1.00 37.22 ? 67  LYS D CB  1 
ATOM   5418 C  CG  . LYS D 1 67  ? 72.761  17.786  6.649   1.00 38.65 ? 67  LYS D CG  1 
ATOM   5419 C  CD  . LYS D 1 67  ? 74.175  18.325  6.567   1.00 37.89 ? 67  LYS D CD  1 
ATOM   5420 C  CE  . LYS D 1 67  ? 74.782  17.986  5.213   1.00 40.49 ? 67  LYS D CE  1 
ATOM   5421 N  NZ  . LYS D 1 67  ? 76.146  18.555  5.033   1.00 42.37 ? 67  LYS D NZ  1 
ATOM   5422 N  N   . LYS D 1 68  ? 70.658  17.655  10.912  1.00 33.52 ? 68  LYS D N   1 
ATOM   5423 C  CA  . LYS D 1 68  ? 69.872  18.238  11.991  1.00 32.96 ? 68  LYS D CA  1 
ATOM   5424 C  C   . LYS D 1 68  ? 70.678  18.711  13.206  1.00 29.79 ? 68  LYS D C   1 
ATOM   5425 O  O   . LYS D 1 68  ? 70.561  19.861  13.623  1.00 28.14 ? 68  LYS D O   1 
ATOM   5426 C  CB  . LYS D 1 68  ? 68.801  17.228  12.426  1.00 35.79 ? 68  LYS D CB  1 
ATOM   5427 C  CG  . LYS D 1 68  ? 67.443  17.837  12.736  1.00 39.95 ? 68  LYS D CG  1 
ATOM   5428 C  CD  . LYS D 1 68  ? 66.367  16.759  12.843  1.00 44.52 ? 68  LYS D CD  1 
ATOM   5429 C  CE  . LYS D 1 68  ? 64.992  17.364  13.116  1.00 49.11 ? 68  LYS D CE  1 
ATOM   5430 N  NZ  . LYS D 1 68  ? 63.904  16.337  13.193  1.00 50.27 ? 68  LYS D NZ  1 
ATOM   5431 N  N   . THR D 1 69  ? 71.498  17.831  13.768  1.00 27.82 ? 69  THR D N   1 
ATOM   5432 C  CA  . THR D 1 69  ? 72.275  18.188  14.947  1.00 26.11 ? 69  THR D CA  1 
ATOM   5433 C  C   . THR D 1 69  ? 73.397  19.202  14.705  1.00 24.45 ? 69  THR D C   1 
ATOM   5434 O  O   . THR D 1 69  ? 73.547  20.152  15.478  1.00 22.95 ? 69  THR D O   1 
ATOM   5435 C  CB  . THR D 1 69  ? 72.833  16.925  15.628  1.00 26.80 ? 69  THR D CB  1 
ATOM   5436 O  OG1 . THR D 1 69  ? 71.738  16.079  15.998  1.00 28.54 ? 69  THR D OG1 1 
ATOM   5437 C  CG2 . THR D 1 69  ? 73.615  17.288  16.884  1.00 26.06 ? 69  THR D CG2 1 
ATOM   5438 N  N   . VAL D 1 70  ? 74.176  19.024  13.643  1.00 22.51 ? 70  VAL D N   1 
ATOM   5439 C  CA  . VAL D 1 70  ? 75.254  19.968  13.366  1.00 22.01 ? 70  VAL D CA  1 
ATOM   5440 C  C   . VAL D 1 70  ? 74.724  21.397  13.196  1.00 20.40 ? 70  VAL D C   1 
ATOM   5441 O  O   . VAL D 1 70  ? 75.342  22.355  13.666  1.00 20.94 ? 70  VAL D O   1 
ATOM   5442 C  CB  . VAL D 1 70  ? 76.072  19.560  12.109  1.00 21.67 ? 70  VAL D CB  1 
ATOM   5443 C  CG1 . VAL D 1 70  ? 75.154  19.360  10.921  1.00 23.74 ? 70  VAL D CG1 1 
ATOM   5444 C  CG2 . VAL D 1 70  ? 77.113  20.634  11.795  1.00 21.82 ? 70  VAL D CG2 1 
ATOM   5445 N  N   . LEU D 1 71  ? 73.574  21.542  12.548  1.00 18.29 ? 71  LEU D N   1 
ATOM   5446 C  CA  . LEU D 1 71  ? 72.992  22.864  12.335  1.00 17.80 ? 71  LEU D CA  1 
ATOM   5447 C  C   . LEU D 1 71  ? 72.305  23.404  13.587  1.00 16.55 ? 71  LEU D C   1 
ATOM   5448 O  O   . LEU D 1 71  ? 72.332  24.605  13.850  1.00 16.34 ? 71  LEU D O   1 
ATOM   5449 C  CB  . LEU D 1 71  ? 72.027  22.827  11.144  1.00 17.12 ? 71  LEU D CB  1 
ATOM   5450 C  CG  . LEU D 1 71  ? 72.805  22.830  9.822   1.00 18.41 ? 71  LEU D CG  1 
ATOM   5451 C  CD1 . LEU D 1 71  ? 71.911  22.458  8.652   1.00 18.95 ? 71  LEU D CD1 1 
ATOM   5452 C  CD2 . LEU D 1 71  ? 73.422  24.215  9.624   1.00 18.00 ? 71  LEU D CD2 1 
ATOM   5453 N  N   . ARG D 1 72  ? 71.695  22.515  14.361  1.00 15.17 ? 72  ARG D N   1 
ATOM   5454 C  CA  . ARG D 1 72  ? 71.046  22.925  15.599  1.00 14.44 ? 72  ARG D CA  1 
ATOM   5455 C  C   . ARG D 1 72  ? 72.112  23.565  16.488  1.00 15.12 ? 72  ARG D C   1 
ATOM   5456 O  O   . ARG D 1 72  ? 71.899  24.628  17.070  1.00 15.13 ? 72  ARG D O   1 
ATOM   5457 C  CB  . ARG D 1 72  ? 70.439  21.710  16.304  1.00 13.00 ? 72  ARG D CB  1 
ATOM   5458 C  CG  . ARG D 1 72  ? 69.980  21.953  17.740  1.00 12.43 ? 72  ARG D CG  1 
ATOM   5459 C  CD  . ARG D 1 72  ? 69.479  20.649  18.354  1.00 13.20 ? 72  ARG D CD  1 
ATOM   5460 N  NE  . ARG D 1 72  ? 69.109  20.777  19.761  1.00 15.47 ? 72  ARG D NE  1 
ATOM   5461 C  CZ  . ARG D 1 72  ? 68.530  19.811  20.471  1.00 17.11 ? 72  ARG D CZ  1 
ATOM   5462 N  NH1 . ARG D 1 72  ? 68.256  18.642  19.901  1.00 18.26 ? 72  ARG D NH1 1 
ATOM   5463 N  NH2 . ARG D 1 72  ? 68.205  20.015  21.743  1.00 13.41 ? 72  ARG D NH2 1 
ATOM   5464 N  N   . ASN D 1 73  ? 73.269  22.917  16.575  1.00 14.08 ? 73  ASN D N   1 
ATOM   5465 C  CA  . ASN D 1 73  ? 74.362  23.421  17.398  1.00 14.41 ? 73  ASN D CA  1 
ATOM   5466 C  C   . ASN D 1 73  ? 75.061  24.665  16.841  1.00 14.36 ? 73  ASN D C   1 
ATOM   5467 O  O   . ASN D 1 73  ? 75.300  25.629  17.567  1.00 15.31 ? 73  ASN D O   1 
ATOM   5468 C  CB  . ASN D 1 73  ? 75.414  22.323  17.618  1.00 13.06 ? 73  ASN D CB  1 
ATOM   5469 C  CG  . ASN D 1 73  ? 74.905  21.180  18.486  1.00 14.50 ? 73  ASN D CG  1 
ATOM   5470 O  OD1 . ASN D 1 73  ? 73.969  21.347  19.270  1.00 15.87 ? 73  ASN D OD1 1 
ATOM   5471 N  ND2 . ASN D 1 73  ? 75.537  20.017  18.366  1.00 13.52 ? 73  ASN D ND2 1 
ATOM   5472 N  N   . ASN D 1 74  ? 75.376  24.653  15.551  1.00 14.24 ? 74  ASN D N   1 
ATOM   5473 C  CA  . ASN D 1 74  ? 76.096  25.769  14.954  1.00 14.31 ? 74  ASN D CA  1 
ATOM   5474 C  C   . ASN D 1 74  ? 75.247  26.929  14.456  1.00 14.28 ? 74  ASN D C   1 
ATOM   5475 O  O   . ASN D 1 74  ? 75.622  28.090  14.646  1.00 14.94 ? 74  ASN D O   1 
ATOM   5476 C  CB  . ASN D 1 74  ? 77.017  25.235  13.859  1.00 13.93 ? 74  ASN D CB  1 
ATOM   5477 C  CG  . ASN D 1 74  ? 78.111  24.349  14.427  1.00 16.86 ? 74  ASN D CG  1 
ATOM   5478 O  OD1 . ASN D 1 74  ? 79.041  24.837  15.078  1.00 18.30 ? 74  ASN D OD1 1 
ATOM   5479 N  ND2 . ASN D 1 74  ? 77.994  23.040  14.209  1.00 13.77 ? 74  ASN D ND2 1 
ATOM   5480 N  N   . ALA D 1 75  ? 74.114  26.641  13.823  1.00 12.48 ? 75  ALA D N   1 
ATOM   5481 C  CA  . ALA D 1 75  ? 73.252  27.728  13.373  1.00 13.40 ? 75  ALA D CA  1 
ATOM   5482 C  C   . ALA D 1 75  ? 72.678  28.327  14.654  1.00 13.34 ? 75  ALA D C   1 
ATOM   5483 O  O   . ALA D 1 75  ? 72.461  29.537  14.749  1.00 12.18 ? 75  ALA D O   1 
ATOM   5484 C  CB  . ALA D 1 75  ? 72.125  27.205  12.473  1.00 14.17 ? 75  ALA D CB  1 
ATOM   5485 N  N   . GLY D 1 76  ? 72.446  27.466  15.644  1.00 13.47 ? 76  GLY D N   1 
ATOM   5486 C  CA  . GLY D 1 76  ? 71.932  27.933  16.919  1.00 12.98 ? 76  GLY D CA  1 
ATOM   5487 C  C   . GLY D 1 76  ? 72.966  28.849  17.554  1.00 13.77 ? 76  GLY D C   1 
ATOM   5488 O  O   . GLY D 1 76  ? 72.638  29.929  18.055  1.00 12.94 ? 76  GLY D O   1 
ATOM   5489 N  N   . GLY D 1 77  ? 74.226  28.422  17.516  1.00 12.94 ? 77  GLY D N   1 
ATOM   5490 C  CA  . GLY D 1 77  ? 75.299  29.221  18.086  1.00 12.97 ? 77  GLY D CA  1 
ATOM   5491 C  C   . GLY D 1 77  ? 75.422  30.566  17.395  1.00 13.77 ? 77  GLY D C   1 
ATOM   5492 O  O   . GLY D 1 77  ? 75.660  31.584  18.043  1.00 14.58 ? 77  GLY D O   1 
ATOM   5493 N  N   . HIS D 1 78  ? 75.259  30.572  16.075  1.00 14.06 ? 78  HIS D N   1 
ATOM   5494 C  CA  . HIS D 1 78  ? 75.344  31.802  15.291  1.00 13.86 ? 78  HIS D CA  1 
ATOM   5495 C  C   . HIS D 1 78  ? 74.192  32.758  15.636  1.00 13.38 ? 78  HIS D C   1 
ATOM   5496 O  O   . HIS D 1 78  ? 74.404  33.953  15.852  1.00 14.54 ? 78  HIS D O   1 
ATOM   5497 C  CB  . HIS D 1 78  ? 75.343  31.457  13.794  1.00 13.31 ? 78  HIS D CB  1 
ATOM   5498 C  CG  . HIS D 1 78  ? 75.323  32.653  12.893  1.00 15.26 ? 78  HIS D CG  1 
ATOM   5499 N  ND1 . HIS D 1 78  ? 76.062  33.790  13.144  1.00 15.68 ? 78  HIS D ND1 1 
ATOM   5500 C  CD2 . HIS D 1 78  ? 74.670  32.880  11.728  1.00 14.55 ? 78  HIS D CD2 1 
ATOM   5501 C  CE1 . HIS D 1 78  ? 75.866  34.664  12.174  1.00 13.99 ? 78  HIS D CE1 1 
ATOM   5502 N  NE2 . HIS D 1 78  ? 75.025  34.137  11.303  1.00 14.94 ? 78  HIS D NE2 1 
ATOM   5503 N  N   . ALA D 1 79  ? 72.980  32.222  15.706  1.00 11.97 ? 79  ALA D N   1 
ATOM   5504 C  CA  . ALA D 1 79  ? 71.802  33.014  16.036  1.00 12.62 ? 79  ALA D CA  1 
ATOM   5505 C  C   . ALA D 1 79  ? 71.891  33.604  17.440  1.00 13.05 ? 79  ALA D C   1 
ATOM   5506 O  O   . ALA D 1 79  ? 71.664  34.798  17.638  1.00 14.11 ? 79  ALA D O   1 
ATOM   5507 C  CB  . ALA D 1 79  ? 70.537  32.152  15.926  1.00 11.27 ? 79  ALA D CB  1 
ATOM   5508 N  N   . ASN D 1 80  ? 72.222  32.768  18.418  1.00 11.86 ? 80  ASN D N   1 
ATOM   5509 C  CA  . ASN D 1 80  ? 72.300  33.234  19.795  1.00 11.17 ? 80  ASN D CA  1 
ATOM   5510 C  C   . ASN D 1 80  ? 73.350  34.322  20.018  1.00 11.31 ? 80  ASN D C   1 
ATOM   5511 O  O   . ASN D 1 80  ? 73.075  35.315  20.679  1.00 10.57 ? 80  ASN D O   1 
ATOM   5512 C  CB  . ASN D 1 80  ? 72.551  32.059  20.751  1.00 10.18 ? 80  ASN D CB  1 
ATOM   5513 C  CG  . ASN D 1 80  ? 71.403  31.060  20.769  1.00 13.33 ? 80  ASN D CG  1 
ATOM   5514 O  OD1 . ASN D 1 80  ? 70.273  31.378  20.384  1.00 12.66 ? 80  ASN D OD1 1 
ATOM   5515 N  ND2 . ASN D 1 80  ? 71.683  29.848  21.236  1.00 11.55 ? 80  ASN D ND2 1 
ATOM   5516 N  N   . HIS D 1 81  ? 74.551  34.140  19.477  1.00 12.62 ? 81  HIS D N   1 
ATOM   5517 C  CA  . HIS D 1 81  ? 75.602  35.139  19.653  1.00 13.59 ? 81  HIS D CA  1 
ATOM   5518 C  C   . HIS D 1 81  ? 75.325  36.435  18.904  1.00 14.01 ? 81  HIS D C   1 
ATOM   5519 O  O   . HIS D 1 81  ? 75.668  37.513  19.385  1.00 16.88 ? 81  HIS D O   1 
ATOM   5520 C  CB  . HIS D 1 81  ? 76.970  34.566  19.245  1.00 12.15 ? 81  HIS D CB  1 
ATOM   5521 C  CG  . HIS D 1 81  ? 77.502  33.565  20.222  1.00 13.34 ? 81  HIS D CG  1 
ATOM   5522 N  ND1 . HIS D 1 81  ? 77.037  32.268  20.285  1.00 12.26 ? 81  HIS D ND1 1 
ATOM   5523 C  CD2 . HIS D 1 81  ? 78.374  33.701  21.249  1.00 11.16 ? 81  HIS D CD2 1 
ATOM   5524 C  CE1 . HIS D 1 81  ? 77.595  31.651  21.311  1.00 12.84 ? 81  HIS D CE1 1 
ATOM   5525 N  NE2 . HIS D 1 81  ? 78.408  32.498  21.914  1.00 12.61 ? 81  HIS D NE2 1 
ATOM   5526 N  N   . SER D 1 82  ? 74.704  36.339  17.734  1.00 14.10 ? 82  SER D N   1 
ATOM   5527 C  CA  . SER D 1 82  ? 74.387  37.541  16.973  1.00 15.75 ? 82  SER D CA  1 
ATOM   5528 C  C   . SER D 1 82  ? 73.439  38.400  17.805  1.00 15.87 ? 82  SER D C   1 
ATOM   5529 O  O   . SER D 1 82  ? 73.591  39.620  17.877  1.00 16.61 ? 82  SER D O   1 
ATOM   5530 C  CB  . SER D 1 82  ? 73.740  37.178  15.630  1.00 14.75 ? 82  SER D CB  1 
ATOM   5531 O  OG  . SER D 1 82  ? 74.693  36.573  14.771  1.00 15.12 ? 82  SER D OG  1 
ATOM   5532 N  N   . LEU D 1 83  ? 72.477  37.748  18.448  1.00 15.46 ? 83  LEU D N   1 
ATOM   5533 C  CA  . LEU D 1 83  ? 71.501  38.434  19.281  1.00 16.78 ? 83  LEU D CA  1 
ATOM   5534 C  C   . LEU D 1 83  ? 72.184  38.973  20.535  1.00 17.06 ? 83  LEU D C   1 
ATOM   5535 O  O   . LEU D 1 83  ? 71.860  40.063  21.012  1.00 15.99 ? 83  LEU D O   1 
ATOM   5536 C  CB  . LEU D 1 83  ? 70.383  37.460  19.657  1.00 19.56 ? 83  LEU D CB  1 
ATOM   5537 C  CG  . LEU D 1 83  ? 69.179  37.974  20.449  1.00 22.64 ? 83  LEU D CG  1 
ATOM   5538 C  CD1 . LEU D 1 83  ? 68.094  36.916  20.406  1.00 24.12 ? 83  LEU D CD1 1 
ATOM   5539 C  CD2 . LEU D 1 83  ? 69.563  38.283  21.884  1.00 23.02 ? 83  LEU D CD2 1 
ATOM   5540 N  N   . PHE D 1 84  ? 73.142  38.210  21.054  1.00 15.51 ? 84  PHE D N   1 
ATOM   5541 C  CA  . PHE D 1 84  ? 73.874  38.600  22.259  1.00 16.11 ? 84  PHE D CA  1 
ATOM   5542 C  C   . PHE D 1 84  ? 74.666  39.903  22.086  1.00 16.64 ? 84  PHE D C   1 
ATOM   5543 O  O   . PHE D 1 84  ? 74.578  40.795  22.929  1.00 16.33 ? 84  PHE D O   1 
ATOM   5544 C  CB  . PHE D 1 84  ? 74.821  37.470  22.683  1.00 15.61 ? 84  PHE D CB  1 
ATOM   5545 C  CG  . PHE D 1 84  ? 75.445  37.665  24.040  1.00 14.81 ? 84  PHE D CG  1 
ATOM   5546 C  CD1 . PHE D 1 84  ? 74.658  37.933  25.155  1.00 15.46 ? 84  PHE D CD1 1 
ATOM   5547 C  CD2 . PHE D 1 84  ? 76.819  37.525  24.214  1.00 15.49 ? 84  PHE D CD2 1 
ATOM   5548 C  CE1 . PHE D 1 84  ? 75.227  38.055  26.424  1.00 12.64 ? 84  PHE D CE1 1 
ATOM   5549 C  CE2 . PHE D 1 84  ? 77.396  37.645  25.477  1.00 13.14 ? 84  PHE D CE2 1 
ATOM   5550 C  CZ  . PHE D 1 84  ? 76.595  37.910  26.584  1.00 12.71 ? 84  PHE D CZ  1 
ATOM   5551 N  N   . TRP D 1 85  ? 75.433  40.015  21.003  1.00 17.14 ? 85  TRP D N   1 
ATOM   5552 C  CA  . TRP D 1 85  ? 76.233  41.222  20.753  1.00 17.78 ? 85  TRP D CA  1 
ATOM   5553 C  C   . TRP D 1 85  ? 75.360  42.479  20.720  1.00 19.34 ? 85  TRP D C   1 
ATOM   5554 O  O   . TRP D 1 85  ? 75.724  43.513  21.281  1.00 21.62 ? 85  TRP D O   1 
ATOM   5555 C  CB  . TRP D 1 85  ? 76.978  41.127  19.412  1.00 16.24 ? 85  TRP D CB  1 
ATOM   5556 C  CG  . TRP D 1 85  ? 77.819  39.899  19.216  1.00 12.57 ? 85  TRP D CG  1 
ATOM   5557 C  CD1 . TRP D 1 85  ? 77.884  39.137  18.089  1.00 12.60 ? 85  TRP D CD1 1 
ATOM   5558 C  CD2 . TRP D 1 85  ? 78.703  39.286  20.165  1.00 11.85 ? 85  TRP D CD2 1 
ATOM   5559 N  NE1 . TRP D 1 85  ? 78.744  38.086  18.273  1.00 12.78 ? 85  TRP D NE1 1 
ATOM   5560 C  CE2 . TRP D 1 85  ? 79.261  38.150  19.539  1.00 12.41 ? 85  TRP D CE2 1 
ATOM   5561 C  CE3 . TRP D 1 85  ? 79.075  39.584  21.486  1.00 13.13 ? 85  TRP D CE3 1 
ATOM   5562 C  CZ2 . TRP D 1 85  ? 80.172  37.304  20.188  1.00 12.58 ? 85  TRP D CZ2 1 
ATOM   5563 C  CZ3 . TRP D 1 85  ? 79.982  38.744  22.133  1.00 13.28 ? 85  TRP D CZ3 1 
ATOM   5564 C  CH2 . TRP D 1 85  ? 80.518  37.616  21.482  1.00 13.60 ? 85  TRP D CH2 1 
ATOM   5565 N  N   . LYS D 1 86  ? 74.215  42.394  20.052  1.00 20.13 ? 86  LYS D N   1 
ATOM   5566 C  CA  . LYS D 1 86  ? 73.319  43.538  19.949  1.00 21.20 ? 86  LYS D CA  1 
ATOM   5567 C  C   . LYS D 1 86  ? 72.586  43.844  21.241  1.00 21.37 ? 86  LYS D C   1 
ATOM   5568 O  O   . LYS D 1 86  ? 72.077  44.952  21.419  1.00 22.31 ? 86  LYS D O   1 
ATOM   5569 C  CB  . LYS D 1 86  ? 72.290  43.318  18.844  1.00 23.97 ? 86  LYS D CB  1 
ATOM   5570 C  CG  . LYS D 1 86  ? 72.843  43.430  17.447  1.00 28.53 ? 86  LYS D CG  1 
ATOM   5571 C  CD  . LYS D 1 86  ? 71.721  43.332  16.440  1.00 33.60 ? 86  LYS D CD  1 
ATOM   5572 C  CE  . LYS D 1 86  ? 72.255  43.421  15.029  1.00 39.77 ? 86  LYS D CE  1 
ATOM   5573 N  NZ  . LYS D 1 86  ? 71.161  43.305  14.019  1.00 45.55 ? 86  LYS D NZ  1 
ATOM   5574 N  N   . GLY D 1 87  ? 72.531  42.868  22.141  1.00 19.86 ? 87  GLY D N   1 
ATOM   5575 C  CA  . GLY D 1 87  ? 71.837  43.071  23.399  1.00 18.85 ? 87  GLY D CA  1 
ATOM   5576 C  C   . GLY D 1 87  ? 72.702  43.641  24.503  1.00 18.74 ? 87  GLY D C   1 
ATOM   5577 O  O   . GLY D 1 87  ? 72.274  43.706  25.653  1.00 18.83 ? 87  GLY D O   1 
ATOM   5578 N  N   . LEU D 1 88  ? 73.915  44.060  24.161  1.00 18.97 ? 88  LEU D N   1 
ATOM   5579 C  CA  . LEU D 1 88  ? 74.832  44.616  25.151  1.00 20.45 ? 88  LEU D CA  1 
ATOM   5580 C  C   . LEU D 1 88  ? 75.155  46.072  24.848  1.00 22.24 ? 88  LEU D C   1 
ATOM   5581 O  O   . LEU D 1 88  ? 75.355  46.443  23.692  1.00 22.60 ? 88  LEU D O   1 
ATOM   5582 C  CB  . LEU D 1 88  ? 76.133  43.810  25.184  1.00 17.97 ? 88  LEU D CB  1 
ATOM   5583 C  CG  . LEU D 1 88  ? 76.013  42.323  25.518  1.00 18.23 ? 88  LEU D CG  1 
ATOM   5584 C  CD1 . LEU D 1 88  ? 77.378  41.640  25.370  1.00 16.92 ? 88  LEU D CD1 1 
ATOM   5585 C  CD2 . LEU D 1 88  ? 75.471  42.162  26.930  1.00 17.01 ? 88  LEU D CD2 1 
ATOM   5586 N  N   . LYS D 1 89  ? 75.211  46.888  25.896  1.00 25.13 ? 89  LYS D N   1 
ATOM   5587 C  CA  . LYS D 1 89  ? 75.509  48.311  25.764  1.00 27.15 ? 89  LYS D CA  1 
ATOM   5588 C  C   . LYS D 1 89  ? 75.433  48.999  27.118  1.00 27.65 ? 89  LYS D C   1 
ATOM   5589 O  O   . LYS D 1 89  ? 74.528  48.726  27.906  1.00 28.42 ? 89  LYS D O   1 
ATOM   5590 C  CB  . LYS D 1 89  ? 74.514  48.981  24.814  1.00 28.56 ? 89  LYS D CB  1 
ATOM   5591 C  CG  . LYS D 1 89  ? 74.769  50.460  24.598  1.00 31.62 ? 89  LYS D CG  1 
ATOM   5592 C  CD  . LYS D 1 89  ? 73.803  51.037  23.581  1.00 32.84 ? 89  LYS D CD  1 
ATOM   5593 C  CE  . LYS D 1 89  ? 74.140  52.483  23.281  1.00 35.86 ? 89  LYS D CE  1 
ATOM   5594 N  NZ  . LYS D 1 89  ? 73.322  53.000  22.151  1.00 38.63 ? 89  LYS D NZ  1 
ATOM   5595 N  N   . LYS D 1 90  ? 76.381  49.892  27.383  1.00 27.98 ? 90  LYS D N   1 
ATOM   5596 C  CA  . LYS D 1 90  ? 76.405  50.634  28.640  1.00 29.37 ? 90  LYS D CA  1 
ATOM   5597 C  C   . LYS D 1 90  ? 75.547  51.891  28.545  1.00 29.21 ? 90  LYS D C   1 
ATOM   5598 O  O   . LYS D 1 90  ? 75.314  52.414  27.453  1.00 29.47 ? 90  LYS D O   1 
ATOM   5599 C  CB  . LYS D 1 90  ? 77.833  51.061  28.984  1.00 28.81 ? 90  LYS D CB  1 
ATOM   5600 C  CG  . LYS D 1 90  ? 78.796  49.919  29.201  1.00 32.49 ? 90  LYS D CG  1 
ATOM   5601 C  CD  . LYS D 1 90  ? 80.209  50.432  29.415  1.00 34.22 ? 90  LYS D CD  1 
ATOM   5602 C  CE  . LYS D 1 90  ? 80.300  51.312  30.647  1.00 33.79 ? 90  LYS D CE  1 
ATOM   5603 N  NZ  . LYS D 1 90  ? 81.678  51.838  30.812  1.00 33.90 ? 90  LYS D NZ  1 
ATOM   5604 N  N   . GLY D 1 91  ? 75.069  52.361  29.693  1.00 29.44 ? 91  GLY D N   1 
ATOM   5605 C  CA  . GLY D 1 91  ? 74.296  53.590  29.730  1.00 29.53 ? 91  GLY D CA  1 
ATOM   5606 C  C   . GLY D 1 91  ? 72.821  53.607  29.381  1.00 29.89 ? 91  GLY D C   1 
ATOM   5607 O  O   . GLY D 1 91  ? 72.241  54.686  29.273  1.00 30.96 ? 91  GLY D O   1 
ATOM   5608 N  N   . THR D 1 92  ? 72.196  52.453  29.198  1.00 28.50 ? 92  THR D N   1 
ATOM   5609 C  CA  . THR D 1 92  ? 70.777  52.461  28.875  1.00 28.26 ? 92  THR D CA  1 
ATOM   5610 C  C   . THR D 1 92  ? 69.994  52.313  30.171  1.00 28.86 ? 92  THR D C   1 
ATOM   5611 O  O   . THR D 1 92  ? 70.564  51.985  31.211  1.00 28.25 ? 92  THR D O   1 
ATOM   5612 C  CB  . THR D 1 92  ? 70.405  51.314  27.905  1.00 28.36 ? 92  THR D CB  1 
ATOM   5613 O  OG1 . THR D 1 92  ? 70.438  50.057  28.591  1.00 26.63 ? 92  THR D OG1 1 
ATOM   5614 C  CG2 . THR D 1 92  ? 71.387  51.277  26.744  1.00 27.69 ? 92  THR D CG2 1 
ATOM   5615 N  N   . THR D 1 93  ? 68.694  52.578  30.120  1.00 29.24 ? 93  THR D N   1 
ATOM   5616 C  CA  . THR D 1 93  ? 67.866  52.441  31.312  1.00 31.60 ? 93  THR D CA  1 
ATOM   5617 C  C   . THR D 1 93  ? 66.521  51.808  30.951  1.00 31.15 ? 93  THR D C   1 
ATOM   5618 O  O   . THR D 1 93  ? 65.933  52.118  29.914  1.00 30.73 ? 93  THR D O   1 
ATOM   5619 C  CB  . THR D 1 93  ? 67.630  53.815  32.022  1.00 32.67 ? 93  THR D CB  1 
ATOM   5620 O  OG1 . THR D 1 93  ? 66.687  54.593  31.278  1.00 34.98 ? 93  THR D OG1 1 
ATOM   5621 C  CG2 . THR D 1 93  ? 68.942  54.599  32.135  1.00 31.00 ? 93  THR D CG2 1 
ATOM   5622 N  N   . LEU D 1 94  ? 66.055  50.902  31.802  1.00 30.92 ? 94  LEU D N   1 
ATOM   5623 C  CA  . LEU D 1 94  ? 64.787  50.224  31.574  1.00 32.96 ? 94  LEU D CA  1 
ATOM   5624 C  C   . LEU D 1 94  ? 63.656  51.231  31.758  1.00 35.94 ? 94  LEU D C   1 
ATOM   5625 O  O   . LEU D 1 94  ? 63.601  51.939  32.767  1.00 36.03 ? 94  LEU D O   1 
ATOM   5626 C  CB  . LEU D 1 94  ? 64.627  49.057  32.554  1.00 29.98 ? 94  LEU D CB  1 
ATOM   5627 C  CG  . LEU D 1 94  ? 63.310  48.275  32.496  1.00 29.98 ? 94  LEU D CG  1 
ATOM   5628 C  CD1 . LEU D 1 94  ? 63.134  47.638  31.126  1.00 28.59 ? 94  LEU D CD1 1 
ATOM   5629 C  CD2 . LEU D 1 94  ? 63.302  47.215  33.588  1.00 27.86 ? 94  LEU D CD2 1 
ATOM   5630 N  N   . GLN D 1 95  ? 62.753  51.292  30.784  1.00 38.29 ? 95  GLN D N   1 
ATOM   5631 C  CA  . GLN D 1 95  ? 61.647  52.240  30.840  1.00 39.63 ? 95  GLN D CA  1 
ATOM   5632 C  C   . GLN D 1 95  ? 60.589  51.936  29.785  1.00 39.55 ? 95  GLN D C   1 
ATOM   5633 O  O   . GLN D 1 95  ? 60.701  50.967  29.037  1.00 39.50 ? 95  GLN D O   1 
ATOM   5634 C  CB  . GLN D 1 95  ? 62.184  53.648  30.602  1.00 41.83 ? 95  GLN D CB  1 
ATOM   5635 C  CG  . GLN D 1 95  ? 62.815  53.811  29.227  1.00 46.57 ? 95  GLN D CG  1 
ATOM   5636 C  CD  . GLN D 1 95  ? 63.581  55.111  29.072  1.00 50.14 ? 95  GLN D CD  1 
ATOM   5637 O  OE1 . GLN D 1 95  ? 64.105  55.409  27.998  1.00 52.10 ? 95  GLN D OE1 1 
ATOM   5638 N  NE2 . GLN D 1 95  ? 63.655  55.892  30.147  1.00 53.35 ? 95  GLN D NE2 1 
ATOM   5639 N  N   . GLY D 1 96  ? 59.562  52.778  29.732  1.00 39.03 ? 96  GLY D N   1 
ATOM   5640 C  CA  . GLY D 1 96  ? 58.509  52.609  28.747  1.00 37.36 ? 96  GLY D CA  1 
ATOM   5641 C  C   . GLY D 1 96  ? 57.620  51.393  28.906  1.00 36.64 ? 96  GLY D C   1 
ATOM   5642 O  O   . GLY D 1 96  ? 57.418  50.890  30.012  1.00 36.53 ? 96  GLY D O   1 
ATOM   5643 N  N   . ASP D 1 97  ? 57.081  50.924  27.785  1.00 36.00 ? 97  ASP D N   1 
ATOM   5644 C  CA  . ASP D 1 97  ? 56.188  49.770  27.781  1.00 36.93 ? 97  ASP D CA  1 
ATOM   5645 C  C   . ASP D 1 97  ? 56.831  48.486  28.292  1.00 36.77 ? 97  ASP D C   1 
ATOM   5646 O  O   . ASP D 1 97  ? 56.164  47.672  28.931  1.00 37.10 ? 97  ASP D O   1 
ATOM   5647 C  CB  . ASP D 1 97  ? 55.630  49.520  26.375  1.00 37.93 ? 97  ASP D CB  1 
ATOM   5648 C  CG  . ASP D 1 97  ? 54.669  50.609  25.918  1.00 40.46 ? 97  ASP D CG  1 
ATOM   5649 O  OD1 . ASP D 1 97  ? 53.785  51.011  26.711  1.00 41.38 ? 97  ASP D OD1 1 
ATOM   5650 O  OD2 . ASP D 1 97  ? 54.790  51.053  24.758  1.00 40.54 ? 97  ASP D OD2 1 
ATOM   5651 N  N   . LEU D 1 98  ? 58.116  48.294  28.006  1.00 35.88 ? 98  LEU D N   1 
ATOM   5652 C  CA  . LEU D 1 98  ? 58.810  47.092  28.459  1.00 34.62 ? 98  LEU D CA  1 
ATOM   5653 C  C   . LEU D 1 98  ? 58.852  47.048  29.985  1.00 34.24 ? 98  LEU D C   1 
ATOM   5654 O  O   . LEU D 1 98  ? 58.571  46.014  30.593  1.00 32.84 ? 98  LEU D O   1 
ATOM   5655 C  CB  . LEU D 1 98  ? 60.235  47.045  27.896  1.00 34.01 ? 98  LEU D CB  1 
ATOM   5656 C  CG  . LEU D 1 98  ? 61.080  45.831  28.300  1.00 31.59 ? 98  LEU D CG  1 
ATOM   5657 C  CD1 . LEU D 1 98  ? 60.347  44.550  27.937  1.00 29.67 ? 98  LEU D CD1 1 
ATOM   5658 C  CD2 . LEU D 1 98  ? 62.434  45.891  27.611  1.00 31.17 ? 98  LEU D CD2 1 
ATOM   5659 N  N   . LYS D 1 99  ? 59.198  48.177  30.598  1.00 34.68 ? 99  LYS D N   1 
ATOM   5660 C  CA  . LYS D 1 99  ? 59.262  48.264  32.054  1.00 35.67 ? 99  LYS D CA  1 
ATOM   5661 C  C   . LYS D 1 99  ? 57.886  47.979  32.652  1.00 35.47 ? 99  LYS D C   1 
ATOM   5662 O  O   . LYS D 1 99  ? 57.772  47.341  33.698  1.00 36.21 ? 99  LYS D O   1 
ATOM   5663 C  CB  . LYS D 1 99  ? 59.738  49.655  32.488  1.00 35.76 ? 99  LYS D CB  1 
ATOM   5664 C  CG  . LYS D 1 99  ? 59.908  49.808  33.997  1.00 37.45 ? 99  LYS D CG  1 
ATOM   5665 C  CD  . LYS D 1 99  ? 60.413  51.199  34.364  1.00 39.02 ? 99  LYS D CD  1 
ATOM   5666 C  CE  . LYS D 1 99  ? 60.659  51.331  35.859  1.00 40.33 ? 99  LYS D CE  1 
ATOM   5667 N  NZ  . LYS D 1 99  ? 59.423  51.046  36.642  1.00 42.88 ? 99  LYS D NZ  1 
ATOM   5668 N  N   . ALA D 1 100 ? 56.843  48.448  31.976  1.00 35.20 ? 100 ALA D N   1 
ATOM   5669 C  CA  . ALA D 1 100 ? 55.474  48.238  32.437  1.00 34.79 ? 100 ALA D CA  1 
ATOM   5670 C  C   . ALA D 1 100 ? 55.094  46.763  32.351  1.00 33.63 ? 100 ALA D C   1 
ATOM   5671 O  O   . ALA D 1 100 ? 54.509  46.205  33.282  1.00 33.45 ? 100 ALA D O   1 
ATOM   5672 C  CB  . ALA D 1 100 ? 54.507  49.079  31.603  1.00 33.90 ? 100 ALA D CB  1 
ATOM   5673 N  N   . ALA D 1 101 ? 55.430  46.137  31.227  1.00 33.24 ? 101 ALA D N   1 
ATOM   5674 C  CA  . ALA D 1 101 ? 55.123  44.726  31.009  1.00 32.30 ? 101 ALA D CA  1 
ATOM   5675 C  C   . ALA D 1 101 ? 55.843  43.841  32.025  1.00 31.95 ? 101 ALA D C   1 
ATOM   5676 O  O   . ALA D 1 101 ? 55.299  42.836  32.481  1.00 31.82 ? 101 ALA D O   1 
ATOM   5677 C  CB  . ALA D 1 101 ? 55.509  44.324  29.591  1.00 32.88 ? 101 ALA D CB  1 
ATOM   5678 N  N   . ILE D 1 102 ? 57.067  44.220  32.376  1.00 31.40 ? 102 ILE D N   1 
ATOM   5679 C  CA  . ILE D 1 102 ? 57.850  43.461  33.343  1.00 31.79 ? 102 ILE D CA  1 
ATOM   5680 C  C   . ILE D 1 102 ? 57.204  43.522  34.729  1.00 32.65 ? 102 ILE D C   1 
ATOM   5681 O  O   . ILE D 1 102 ? 57.055  42.498  35.398  1.00 31.94 ? 102 ILE D O   1 
ATOM   5682 C  CB  . ILE D 1 102 ? 59.316  43.990  33.395  1.00 31.11 ? 102 ILE D CB  1 
ATOM   5683 C  CG1 . ILE D 1 102 ? 60.083  43.480  32.167  1.00 29.88 ? 102 ILE D CG1 1 
ATOM   5684 C  CG2 . ILE D 1 102 ? 60.001  43.568  34.694  1.00 29.12 ? 102 ILE D CG2 1 
ATOM   5685 C  CD1 . ILE D 1 102 ? 61.499  43.995  32.058  1.00 30.29 ? 102 ILE D CD1 1 
ATOM   5686 N  N   . GLU D 1 103 ? 56.813  44.721  35.153  1.00 34.21 ? 103 GLU D N   1 
ATOM   5687 C  CA  . GLU D 1 103 ? 56.177  44.895  36.456  1.00 35.76 ? 103 GLU D CA  1 
ATOM   5688 C  C   . GLU D 1 103 ? 54.832  44.182  36.469  1.00 35.61 ? 103 GLU D C   1 
ATOM   5689 O  O   . GLU D 1 103 ? 54.391  43.677  37.499  1.00 36.66 ? 103 GLU D O   1 
ATOM   5690 C  CB  . GLU D 1 103 ? 55.993  46.384  36.762  1.00 35.85 ? 103 GLU D CB  1 
ATOM   5691 C  CG  . GLU D 1 103 ? 57.307  47.145  36.805  1.00 38.66 ? 103 GLU D CG  1 
ATOM   5692 C  CD  . GLU D 1 103 ? 57.133  48.628  37.052  1.00 40.51 ? 103 GLU D CD  1 
ATOM   5693 O  OE1 . GLU D 1 103 ? 56.362  49.272  36.312  1.00 42.42 ? 103 GLU D OE1 1 
ATOM   5694 O  OE2 . GLU D 1 103 ? 57.776  49.156  37.981  1.00 42.03 ? 103 GLU D OE2 1 
ATOM   5695 N  N   . ARG D 1 104 ? 54.193  44.125  35.309  1.00 35.81 ? 104 ARG D N   1 
ATOM   5696 C  CA  . ARG D 1 104 ? 52.901  43.473  35.188  1.00 36.74 ? 104 ARG D CA  1 
ATOM   5697 C  C   . ARG D 1 104 ? 53.002  41.960  35.336  1.00 37.23 ? 104 ARG D C   1 
ATOM   5698 O  O   . ARG D 1 104 ? 52.224  41.351  36.066  1.00 37.88 ? 104 ARG D O   1 
ATOM   5699 C  CB  . ARG D 1 104 ? 52.276  43.804  33.835  1.00 37.57 ? 104 ARG D CB  1 
ATOM   5700 C  CG  . ARG D 1 104 ? 50.895  43.215  33.621  1.00 39.44 ? 104 ARG D CG  1 
ATOM   5701 C  CD  . ARG D 1 104 ? 50.534  43.275  32.153  1.00 41.89 ? 104 ARG D CD  1 
ATOM   5702 N  NE  . ARG D 1 104 ? 51.389  42.392  31.363  1.00 44.40 ? 104 ARG D NE  1 
ATOM   5703 C  CZ  . ARG D 1 104 ? 51.570  42.501  30.051  1.00 45.75 ? 104 ARG D CZ  1 
ATOM   5704 N  NH1 . ARG D 1 104 ? 50.956  43.464  29.374  1.00 44.81 ? 104 ARG D NH1 1 
ATOM   5705 N  NH2 . ARG D 1 104 ? 52.362  41.644  29.413  1.00 45.14 ? 104 ARG D NH2 1 
ATOM   5706 N  N   . ASP D 1 105 ? 53.962  41.353  34.646  1.00 37.46 ? 105 ASP D N   1 
ATOM   5707 C  CA  . ASP D 1 105 ? 54.110  39.904  34.694  1.00 36.96 ? 105 ASP D CA  1 
ATOM   5708 C  C   . ASP D 1 105 ? 55.002  39.360  35.811  1.00 36.45 ? 105 ASP D C   1 
ATOM   5709 O  O   . ASP D 1 105 ? 54.943  38.172  36.128  1.00 36.46 ? 105 ASP D O   1 
ATOM   5710 C  CB  . ASP D 1 105 ? 54.600  39.387  33.336  1.00 38.26 ? 105 ASP D CB  1 
ATOM   5711 C  CG  . ASP D 1 105 ? 53.646  39.736  32.193  1.00 39.74 ? 105 ASP D CG  1 
ATOM   5712 O  OD1 . ASP D 1 105 ? 52.426  39.488  32.321  1.00 41.51 ? 105 ASP D OD1 1 
ATOM   5713 O  OD2 . ASP D 1 105 ? 54.121  40.249  31.157  1.00 39.03 ? 105 ASP D OD2 1 
ATOM   5714 N  N   . PHE D 1 106 ? 55.816  40.215  36.420  1.00 35.38 ? 106 PHE D N   1 
ATOM   5715 C  CA  . PHE D 1 106 ? 56.700  39.759  37.488  1.00 35.88 ? 106 PHE D CA  1 
ATOM   5716 C  C   . PHE D 1 106 ? 56.466  40.466  38.823  1.00 37.24 ? 106 PHE D C   1 
ATOM   5717 O  O   . PHE D 1 106 ? 57.058  40.097  39.840  1.00 37.04 ? 106 PHE D O   1 
ATOM   5718 C  CB  . PHE D 1 106 ? 58.160  39.934  37.064  1.00 34.85 ? 106 PHE D CB  1 
ATOM   5719 C  CG  . PHE D 1 106 ? 58.564  39.064  35.906  1.00 33.69 ? 106 PHE D CG  1 
ATOM   5720 C  CD1 . PHE D 1 106 ? 58.752  37.697  36.077  1.00 33.63 ? 106 PHE D CD1 1 
ATOM   5721 C  CD2 . PHE D 1 106 ? 58.748  39.610  34.641  1.00 32.46 ? 106 PHE D CD2 1 
ATOM   5722 C  CE1 . PHE D 1 106 ? 59.120  36.886  35.003  1.00 33.92 ? 106 PHE D CE1 1 
ATOM   5723 C  CE2 . PHE D 1 106 ? 59.115  38.810  33.562  1.00 32.92 ? 106 PHE D CE2 1 
ATOM   5724 C  CZ  . PHE D 1 106 ? 59.302  37.445  33.743  1.00 33.41 ? 106 PHE D CZ  1 
ATOM   5725 N  N   . GLY D 1 107 ? 55.602  41.478  38.820  1.00 38.10 ? 107 GLY D N   1 
ATOM   5726 C  CA  . GLY D 1 107 ? 55.319  42.207  40.044  1.00 37.89 ? 107 GLY D CA  1 
ATOM   5727 C  C   . GLY D 1 107 ? 56.169  43.456  40.165  1.00 38.65 ? 107 GLY D C   1 
ATOM   5728 O  O   . GLY D 1 107 ? 55.674  44.525  40.530  1.00 39.01 ? 107 GLY D O   1 
ATOM   5729 N  N   . SER D 1 108 ? 57.456  43.321  39.860  1.00 38.05 ? 108 SER D N   1 
ATOM   5730 C  CA  . SER D 1 108 ? 58.379  44.448  39.926  1.00 37.74 ? 108 SER D CA  1 
ATOM   5731 C  C   . SER D 1 108 ? 59.660  44.098  39.186  1.00 37.63 ? 108 SER D C   1 
ATOM   5732 O  O   . SER D 1 108 ? 59.901  42.933  38.869  1.00 38.10 ? 108 SER D O   1 
ATOM   5733 C  CB  . SER D 1 108 ? 58.706  44.786  41.381  1.00 37.78 ? 108 SER D CB  1 
ATOM   5734 O  OG  . SER D 1 108 ? 59.398  43.722  42.005  1.00 37.15 ? 108 SER D OG  1 
ATOM   5735 N  N   . VAL D 1 109 ? 60.479  45.108  38.913  1.00 37.38 ? 109 VAL D N   1 
ATOM   5736 C  CA  . VAL D 1 109 ? 61.736  44.887  38.217  1.00 37.05 ? 109 VAL D CA  1 
ATOM   5737 C  C   . VAL D 1 109 ? 62.652  44.001  39.051  1.00 38.15 ? 109 VAL D C   1 
ATOM   5738 O  O   . VAL D 1 109 ? 63.360  43.151  38.508  1.00 38.45 ? 109 VAL D O   1 
ATOM   5739 C  CB  . VAL D 1 109 ? 62.451  46.217  37.912  1.00 36.45 ? 109 VAL D CB  1 
ATOM   5740 C  CG1 . VAL D 1 109 ? 63.858  45.951  37.399  1.00 32.87 ? 109 VAL D CG1 1 
ATOM   5741 C  CG2 . VAL D 1 109 ? 61.658  46.993  36.876  1.00 35.83 ? 109 VAL D CG2 1 
ATOM   5742 N  N   . ASP D 1 110 ? 62.628  44.193  40.367  1.00 38.13 ? 110 ASP D N   1 
ATOM   5743 C  CA  . ASP D 1 110 ? 63.458  43.397  41.262  1.00 38.24 ? 110 ASP D CA  1 
ATOM   5744 C  C   . ASP D 1 110 ? 63.077  41.921  41.249  1.00 36.70 ? 110 ASP D C   1 
ATOM   5745 O  O   . ASP D 1 110 ? 63.953  41.059  41.287  1.00 36.92 ? 110 ASP D O   1 
ATOM   5746 C  CB  . ASP D 1 110 ? 63.385  43.949  42.686  1.00 41.73 ? 110 ASP D CB  1 
ATOM   5747 C  CG  . ASP D 1 110 ? 64.090  45.284  42.823  1.00 44.65 ? 110 ASP D CG  1 
ATOM   5748 O  OD1 . ASP D 1 110 ? 65.275  45.371  42.434  1.00 46.77 ? 110 ASP D OD1 1 
ATOM   5749 O  OD2 . ASP D 1 110 ? 63.463  46.243  43.319  1.00 47.11 ? 110 ASP D OD2 1 
ATOM   5750 N  N   . ASN D 1 111 ? 61.780  41.626  41.202  1.00 34.90 ? 111 ASN D N   1 
ATOM   5751 C  CA  . ASN D 1 111 ? 61.333  40.238  41.163  1.00 34.83 ? 111 ASN D CA  1 
ATOM   5752 C  C   . ASN D 1 111 ? 61.836  39.613  39.875  1.00 33.12 ? 111 ASN D C   1 
ATOM   5753 O  O   . ASN D 1 111 ? 62.307  38.476  39.865  1.00 33.09 ? 111 ASN D O   1 
ATOM   5754 C  CB  . ASN D 1 111 ? 59.807  40.140  41.203  1.00 37.66 ? 111 ASN D CB  1 
ATOM   5755 C  CG  . ASN D 1 111 ? 59.238  40.523  42.548  1.00 41.25 ? 111 ASN D CG  1 
ATOM   5756 O  OD1 . ASN D 1 111 ? 59.694  40.037  43.582  1.00 43.29 ? 111 ASN D OD1 1 
ATOM   5757 N  ND2 . ASN D 1 111 ? 58.231  41.393  42.546  1.00 43.04 ? 111 ASN D ND2 1 
ATOM   5758 N  N   . PHE D 1 112 ? 61.727  40.370  38.787  1.00 30.51 ? 112 PHE D N   1 
ATOM   5759 C  CA  . PHE D 1 112 ? 62.179  39.909  37.485  1.00 28.17 ? 112 PHE D CA  1 
ATOM   5760 C  C   . PHE D 1 112 ? 63.663  39.564  37.534  1.00 27.27 ? 112 PHE D C   1 
ATOM   5761 O  O   . PHE D 1 112 ? 64.061  38.468  37.135  1.00 26.84 ? 112 PHE D O   1 
ATOM   5762 C  CB  . PHE D 1 112 ? 61.945  40.987  36.423  1.00 27.65 ? 112 PHE D CB  1 
ATOM   5763 C  CG  . PHE D 1 112 ? 62.821  40.838  35.211  1.00 26.14 ? 112 PHE D CG  1 
ATOM   5764 C  CD1 . PHE D 1 112 ? 62.704  39.727  34.383  1.00 25.88 ? 112 PHE D CD1 1 
ATOM   5765 C  CD2 . PHE D 1 112 ? 63.790  41.792  34.919  1.00 25.85 ? 112 PHE D CD2 1 
ATOM   5766 C  CE1 . PHE D 1 112 ? 63.546  39.569  33.280  1.00 26.85 ? 112 PHE D CE1 1 
ATOM   5767 C  CE2 . PHE D 1 112 ? 64.640  41.644  33.814  1.00 25.90 ? 112 PHE D CE2 1 
ATOM   5768 C  CZ  . PHE D 1 112 ? 64.517  40.533  32.997  1.00 25.57 ? 112 PHE D CZ  1 
ATOM   5769 N  N   . LYS D 1 113 ? 64.475  40.502  38.019  1.00 25.94 ? 113 LYS D N   1 
ATOM   5770 C  CA  . LYS D 1 113 ? 65.915  40.287  38.119  1.00 26.29 ? 113 LYS D CA  1 
ATOM   5771 C  C   . LYS D 1 113 ? 66.240  39.028  38.916  1.00 25.45 ? 113 LYS D C   1 
ATOM   5772 O  O   . LYS D 1 113 ? 67.098  38.241  38.519  1.00 25.56 ? 113 LYS D O   1 
ATOM   5773 C  CB  . LYS D 1 113 ? 66.602  41.478  38.792  1.00 27.63 ? 113 LYS D CB  1 
ATOM   5774 C  CG  . LYS D 1 113 ? 66.854  42.687  37.908  1.00 30.10 ? 113 LYS D CG  1 
ATOM   5775 C  CD  . LYS D 1 113 ? 67.769  43.663  38.642  1.00 31.98 ? 113 LYS D CD  1 
ATOM   5776 C  CE  . LYS D 1 113 ? 68.159  44.848  37.778  1.00 35.91 ? 113 LYS D CE  1 
ATOM   5777 N  NZ  . LYS D 1 113 ? 69.194  45.692  38.454  1.00 38.50 ? 113 LYS D NZ  1 
ATOM   5778 N  N   . ALA D 1 114 ? 65.559  38.845  40.043  1.00 24.22 ? 114 ALA D N   1 
ATOM   5779 C  CA  . ALA D 1 114 ? 65.800  37.683  40.890  1.00 23.83 ? 114 ALA D CA  1 
ATOM   5780 C  C   . ALA D 1 114 ? 65.454  36.401  40.151  1.00 23.32 ? 114 ALA D C   1 
ATOM   5781 O  O   . ALA D 1 114 ? 66.170  35.404  40.251  1.00 23.70 ? 114 ALA D O   1 
ATOM   5782 C  CB  . ALA D 1 114 ? 64.983  37.782  42.171  1.00 23.60 ? 114 ALA D CB  1 
ATOM   5783 N  N   . GLU D 1 115 ? 64.356  36.435  39.408  1.00 22.49 ? 115 GLU D N   1 
ATOM   5784 C  CA  . GLU D 1 115 ? 63.914  35.272  38.655  1.00 24.56 ? 115 GLU D CA  1 
ATOM   5785 C  C   . GLU D 1 115 ? 64.902  34.944  37.537  1.00 22.85 ? 115 GLU D C   1 
ATOM   5786 O  O   . GLU D 1 115 ? 65.205  33.777  37.283  1.00 22.25 ? 115 GLU D O   1 
ATOM   5787 C  CB  . GLU D 1 115 ? 62.523  35.525  38.066  1.00 28.43 ? 115 GLU D CB  1 
ATOM   5788 C  CG  . GLU D 1 115 ? 61.635  34.289  38.028  1.00 35.72 ? 115 GLU D CG  1 
ATOM   5789 C  CD  . GLU D 1 115 ? 61.537  33.614  39.392  1.00 40.72 ? 115 GLU D CD  1 
ATOM   5790 O  OE1 . GLU D 1 115 ? 61.249  34.315  40.387  1.00 43.68 ? 115 GLU D OE1 1 
ATOM   5791 O  OE2 . GLU D 1 115 ? 61.749  32.383  39.475  1.00 43.31 ? 115 GLU D OE2 1 
ATOM   5792 N  N   . PHE D 1 116 ? 65.407  35.979  36.876  1.00 21.91 ? 116 PHE D N   1 
ATOM   5793 C  CA  . PHE D 1 116 ? 66.358  35.800  35.783  1.00 21.53 ? 116 PHE D CA  1 
ATOM   5794 C  C   . PHE D 1 116 ? 67.675  35.250  36.317  1.00 20.78 ? 116 PHE D C   1 
ATOM   5795 O  O   . PHE D 1 116 ? 68.253  34.332  35.735  1.00 20.91 ? 116 PHE D O   1 
ATOM   5796 C  CB  . PHE D 1 116 ? 66.608  37.132  35.072  1.00 20.22 ? 116 PHE D CB  1 
ATOM   5797 C  CG  . PHE D 1 116 ? 67.413  37.006  33.807  1.00 20.72 ? 116 PHE D CG  1 
ATOM   5798 C  CD1 . PHE D 1 116 ? 66.810  36.601  32.621  1.00 21.30 ? 116 PHE D CD1 1 
ATOM   5799 C  CD2 . PHE D 1 116 ? 68.776  37.285  33.803  1.00 20.61 ? 116 PHE D CD2 1 
ATOM   5800 C  CE1 . PHE D 1 116 ? 67.553  36.475  31.442  1.00 21.10 ? 116 PHE D CE1 1 
ATOM   5801 C  CE2 . PHE D 1 116 ? 69.530  37.162  32.632  1.00 20.95 ? 116 PHE D CE2 1 
ATOM   5802 C  CZ  . PHE D 1 116 ? 68.915  36.756  31.449  1.00 20.00 ? 116 PHE D CZ  1 
ATOM   5803 N  N   . GLU D 1 117 ? 68.147  35.816  37.424  1.00 20.66 ? 117 GLU D N   1 
ATOM   5804 C  CA  . GLU D 1 117 ? 69.395  35.368  38.030  1.00 22.59 ? 117 GLU D CA  1 
ATOM   5805 C  C   . GLU D 1 117 ? 69.306  33.908  38.458  1.00 21.95 ? 117 GLU D C   1 
ATOM   5806 O  O   . GLU D 1 117 ? 70.255  33.145  38.289  1.00 21.38 ? 117 GLU D O   1 
ATOM   5807 C  CB  . GLU D 1 117 ? 69.756  36.259  39.222  1.00 24.27 ? 117 GLU D CB  1 
ATOM   5808 C  CG  . GLU D 1 117 ? 70.286  37.625  38.802  1.00 29.89 ? 117 GLU D CG  1 
ATOM   5809 C  CD  . GLU D 1 117 ? 70.630  38.521  39.978  1.00 32.80 ? 117 GLU D CD  1 
ATOM   5810 O  OE1 . GLU D 1 117 ? 71.140  38.004  40.994  1.00 35.28 ? 117 GLU D OE1 1 
ATOM   5811 O  OE2 . GLU D 1 117 ? 70.405  39.746  39.879  1.00 35.88 ? 117 GLU D OE2 1 
ATOM   5812 N  N   . LYS D 1 118 ? 68.157  33.521  39.002  1.00 22.15 ? 118 LYS D N   1 
ATOM   5813 C  CA  . LYS D 1 118 ? 67.937  32.147  39.441  1.00 22.93 ? 118 LYS D CA  1 
ATOM   5814 C  C   . LYS D 1 118 ? 68.032  31.196  38.245  1.00 22.05 ? 118 LYS D C   1 
ATOM   5815 O  O   . LYS D 1 118 ? 68.688  30.155  38.312  1.00 21.66 ? 118 LYS D O   1 
ATOM   5816 C  CB  . LYS D 1 118 ? 66.552  32.020  40.083  1.00 25.85 ? 118 LYS D CB  1 
ATOM   5817 C  CG  . LYS D 1 118 ? 66.268  30.662  40.712  1.00 30.76 ? 118 LYS D CG  1 
ATOM   5818 C  CD  . LYS D 1 118 ? 64.840  30.590  41.246  1.00 35.98 ? 118 LYS D CD  1 
ATOM   5819 C  CE  . LYS D 1 118 ? 64.534  31.746  42.201  1.00 38.29 ? 118 LYS D CE  1 
ATOM   5820 N  NZ  . LYS D 1 118 ? 63.084  31.794  42.581  1.00 41.83 ? 118 LYS D NZ  1 
ATOM   5821 N  N   . ALA D 1 119 ? 67.366  31.560  37.152  1.00 18.48 ? 119 ALA D N   1 
ATOM   5822 C  CA  . ALA D 1 119 ? 67.378  30.749  35.942  1.00 17.91 ? 119 ALA D CA  1 
ATOM   5823 C  C   . ALA D 1 119 ? 68.797  30.623  35.389  1.00 17.56 ? 119 ALA D C   1 
ATOM   5824 O  O   . ALA D 1 119 ? 69.237  29.535  35.014  1.00 15.68 ? 119 ALA D O   1 
ATOM   5825 C  CB  . ALA D 1 119 ? 66.469  31.375  34.884  1.00 16.59 ? 119 ALA D CB  1 
ATOM   5826 N  N   . ALA D 1 120 ? 69.507  31.745  35.345  1.00 16.16 ? 120 ALA D N   1 
ATOM   5827 C  CA  . ALA D 1 120 ? 70.871  31.769  34.829  1.00 16.78 ? 120 ALA D CA  1 
ATOM   5828 C  C   . ALA D 1 120 ? 71.849  30.990  35.709  1.00 18.81 ? 120 ALA D C   1 
ATOM   5829 O  O   . ALA D 1 120 ? 72.749  30.316  35.208  1.00 18.20 ? 120 ALA D O   1 
ATOM   5830 C  CB  . ALA D 1 120 ? 71.345  33.210  34.679  1.00 14.19 ? 120 ALA D CB  1 
ATOM   5831 N  N   . ALA D 1 121 ? 71.677  31.088  37.022  1.00 19.42 ? 121 ALA D N   1 
ATOM   5832 C  CA  . ALA D 1 121 ? 72.558  30.394  37.953  1.00 20.24 ? 121 ALA D CA  1 
ATOM   5833 C  C   . ALA D 1 121 ? 72.272  28.902  38.051  1.00 21.28 ? 121 ALA D C   1 
ATOM   5834 O  O   . ALA D 1 121 ? 73.186  28.113  38.283  1.00 22.60 ? 121 ALA D O   1 
ATOM   5835 C  CB  . ALA D 1 121 ? 72.451  31.023  39.341  1.00 20.39 ? 121 ALA D CB  1 
ATOM   5836 N  N   . SER D 1 122 ? 71.012  28.514  37.872  1.00 20.73 ? 122 SER D N   1 
ATOM   5837 C  CA  . SER D 1 122 ? 70.631  27.110  37.975  1.00 20.20 ? 122 SER D CA  1 
ATOM   5838 C  C   . SER D 1 122 ? 70.809  26.293  36.692  1.00 20.47 ? 122 SER D C   1 
ATOM   5839 O  O   . SER D 1 122 ? 70.604  25.079  36.697  1.00 20.99 ? 122 SER D O   1 
ATOM   5840 C  CB  . SER D 1 122 ? 69.182  27.001  38.446  1.00 21.86 ? 122 SER D CB  1 
ATOM   5841 O  OG  . SER D 1 122 ? 68.295  27.526  37.472  1.00 28.56 ? 122 SER D OG  1 
ATOM   5842 N  N   . ARG D 1 123 ? 71.164  26.946  35.590  1.00 18.62 ? 123 ARG D N   1 
ATOM   5843 C  CA  . ARG D 1 123 ? 71.386  26.228  34.338  1.00 16.76 ? 123 ARG D CA  1 
ATOM   5844 C  C   . ARG D 1 123 ? 72.699  25.457  34.519  1.00 16.75 ? 123 ARG D C   1 
ATOM   5845 O  O   . ARG D 1 123 ? 73.774  26.050  34.519  1.00 16.57 ? 123 ARG D O   1 
ATOM   5846 C  CB  . ARG D 1 123 ? 71.486  27.223  33.173  1.00 15.62 ? 123 ARG D CB  1 
ATOM   5847 C  CG  . ARG D 1 123 ? 72.075  26.670  31.870  1.00 13.64 ? 123 ARG D CG  1 
ATOM   5848 C  CD  . ARG D 1 123 ? 71.456  25.337  31.447  1.00 13.52 ? 123 ARG D CD  1 
ATOM   5849 N  NE  . ARG D 1 123 ? 70.019  25.426  31.214  1.00 14.22 ? 123 ARG D NE  1 
ATOM   5850 C  CZ  . ARG D 1 123 ? 69.265  24.409  30.807  1.00 16.53 ? 123 ARG D CZ  1 
ATOM   5851 N  NH1 . ARG D 1 123 ? 69.812  23.218  30.588  1.00 14.32 ? 123 ARG D NH1 1 
ATOM   5852 N  NH2 . ARG D 1 123 ? 67.961  24.584  30.616  1.00 15.26 ? 123 ARG D NH2 1 
ATOM   5853 N  N   . PHE D 1 124 ? 72.600  24.140  34.690  1.00 15.96 ? 124 PHE D N   1 
ATOM   5854 C  CA  . PHE D 1 124 ? 73.775  23.295  34.913  1.00 14.65 ? 124 PHE D CA  1 
ATOM   5855 C  C   . PHE D 1 124 ? 74.464  22.938  33.604  1.00 13.54 ? 124 PHE D C   1 
ATOM   5856 O  O   . PHE D 1 124 ? 73.830  22.467  32.663  1.00 13.59 ? 124 PHE D O   1 
ATOM   5857 C  CB  . PHE D 1 124 ? 73.379  22.009  35.655  1.00 13.58 ? 124 PHE D CB  1 
ATOM   5858 C  CG  . PHE D 1 124 ? 74.546  21.277  36.270  1.00 12.48 ? 124 PHE D CG  1 
ATOM   5859 C  CD1 . PHE D 1 124 ? 75.226  21.816  37.358  1.00 10.60 ? 124 PHE D CD1 1 
ATOM   5860 C  CD2 . PHE D 1 124 ? 74.960  20.047  35.765  1.00 11.95 ? 124 PHE D CD2 1 
ATOM   5861 C  CE1 . PHE D 1 124 ? 76.299  21.141  37.938  1.00 11.46 ? 124 PHE D CE1 1 
ATOM   5862 C  CE2 . PHE D 1 124 ? 76.037  19.360  36.339  1.00 11.42 ? 124 PHE D CE2 1 
ATOM   5863 C  CZ  . PHE D 1 124 ? 76.704  19.910  37.428  1.00 11.13 ? 124 PHE D CZ  1 
ATOM   5864 N  N   . GLY D 1 125 ? 75.773  23.156  33.557  1.00 12.29 ? 125 GLY D N   1 
ATOM   5865 C  CA  . GLY D 1 125 ? 76.512  22.882  32.340  1.00 12.19 ? 125 GLY D CA  1 
ATOM   5866 C  C   . GLY D 1 125 ? 76.457  24.119  31.457  1.00 12.54 ? 125 GLY D C   1 
ATOM   5867 O  O   . GLY D 1 125 ? 76.337  25.234  31.967  1.00 13.31 ? 125 GLY D O   1 
ATOM   5868 N  N   . SER D 1 126 ? 76.523  23.930  30.141  1.00 11.59 ? 126 SER D N   1 
ATOM   5869 C  CA  . SER D 1 126 ? 76.491  25.042  29.190  1.00 10.70 ? 126 SER D CA  1 
ATOM   5870 C  C   . SER D 1 126 ? 75.069  25.408  28.799  1.00 10.44 ? 126 SER D C   1 
ATOM   5871 O  O   . SER D 1 126 ? 74.215  24.535  28.660  1.00 11.70 ? 126 SER D O   1 
ATOM   5872 C  CB  . SER D 1 126 ? 77.269  24.671  27.929  1.00 9.42  ? 126 SER D CB  1 
ATOM   5873 O  OG  . SER D 1 126 ? 78.571  24.231  28.258  1.00 10.99 ? 126 SER D OG  1 
ATOM   5874 N  N   . GLY D 1 127 ? 74.816  26.699  28.609  1.00 10.64 ? 127 GLY D N   1 
ATOM   5875 C  CA  . GLY D 1 127 ? 73.483  27.119  28.221  1.00 10.73 ? 127 GLY D CA  1 
ATOM   5876 C  C   . GLY D 1 127 ? 73.255  28.617  28.177  1.00 11.41 ? 127 GLY D C   1 
ATOM   5877 O  O   . GLY D 1 127 ? 74.198  29.409  28.213  1.00 12.65 ? 127 GLY D O   1 
ATOM   5878 N  N   . TRP D 1 128 ? 71.983  28.994  28.103  1.00 11.47 ? 128 TRP D N   1 
ATOM   5879 C  CA  . TRP D 1 128 ? 71.563  30.389  28.035  1.00 11.12 ? 128 TRP D CA  1 
ATOM   5880 C  C   . TRP D 1 128 ? 70.338  30.631  28.905  1.00 12.96 ? 128 TRP D C   1 
ATOM   5881 O  O   . TRP D 1 128 ? 69.545  29.721  29.148  1.00 15.44 ? 128 TRP D O   1 
ATOM   5882 C  CB  . TRP D 1 128 ? 71.180  30.770  26.603  1.00 11.36 ? 128 TRP D CB  1 
ATOM   5883 C  CG  . TRP D 1 128 ? 72.303  30.810  25.612  1.00 12.71 ? 128 TRP D CG  1 
ATOM   5884 C  CD1 . TRP D 1 128 ? 72.948  29.746  25.049  1.00 10.95 ? 128 TRP D CD1 1 
ATOM   5885 C  CD2 . TRP D 1 128 ? 72.911  31.986  25.061  1.00 13.18 ? 128 TRP D CD2 1 
ATOM   5886 N  NE1 . TRP D 1 128 ? 73.922  30.186  24.179  1.00 11.35 ? 128 TRP D NE1 1 
ATOM   5887 C  CE2 . TRP D 1 128 ? 73.923  31.556  24.169  1.00 13.80 ? 128 TRP D CE2 1 
ATOM   5888 C  CE3 . TRP D 1 128 ? 72.701  33.361  25.236  1.00 13.87 ? 128 TRP D CE3 1 
ATOM   5889 C  CZ2 . TRP D 1 128 ? 74.725  32.457  23.451  1.00 12.78 ? 128 TRP D CZ2 1 
ATOM   5890 C  CZ3 . TRP D 1 128 ? 73.500  34.258  24.520  1.00 13.61 ? 128 TRP D CZ3 1 
ATOM   5891 C  CH2 . TRP D 1 128 ? 74.499  33.797  23.640  1.00 13.54 ? 128 TRP D CH2 1 
ATOM   5892 N  N   . ALA D 1 129 ? 70.190  31.866  29.370  1.00 13.68 ? 129 ALA D N   1 
ATOM   5893 C  CA  . ALA D 1 129 ? 69.030  32.265  30.162  1.00 15.48 ? 129 ALA D CA  1 
ATOM   5894 C  C   . ALA D 1 129 ? 68.324  33.310  29.296  1.00 15.56 ? 129 ALA D C   1 
ATOM   5895 O  O   . ALA D 1 129 ? 68.973  34.184  28.713  1.00 14.92 ? 129 ALA D O   1 
ATOM   5896 C  CB  . ALA D 1 129 ? 69.464  32.872  31.496  1.00 15.91 ? 129 ALA D CB  1 
ATOM   5897 N  N   . TRP D 1 130 ? 67.002  33.214  29.195  1.00 16.59 ? 130 TRP D N   1 
ATOM   5898 C  CA  . TRP D 1 130 ? 66.256  34.145  28.360  1.00 16.63 ? 130 TRP D CA  1 
ATOM   5899 C  C   . TRP D 1 130 ? 65.043  34.804  28.986  1.00 18.91 ? 130 TRP D C   1 
ATOM   5900 O  O   . TRP D 1 130 ? 64.437  34.292  29.928  1.00 18.66 ? 130 TRP D O   1 
ATOM   5901 C  CB  . TRP D 1 130 ? 65.730  33.447  27.103  1.00 15.54 ? 130 TRP D CB  1 
ATOM   5902 C  CG  . TRP D 1 130 ? 66.683  32.570  26.394  1.00 14.50 ? 130 TRP D CG  1 
ATOM   5903 C  CD1 . TRP D 1 130 ? 66.922  31.249  26.638  1.00 12.92 ? 130 TRP D CD1 1 
ATOM   5904 C  CD2 . TRP D 1 130 ? 67.498  32.928  25.276  1.00 14.95 ? 130 TRP D CD2 1 
ATOM   5905 N  NE1 . TRP D 1 130 ? 67.832  30.758  25.734  1.00 13.82 ? 130 TRP D NE1 1 
ATOM   5906 C  CE2 . TRP D 1 130 ? 68.205  31.768  24.887  1.00 13.89 ? 130 TRP D CE2 1 
ATOM   5907 C  CE3 . TRP D 1 130 ? 67.700  34.118  24.563  1.00 13.84 ? 130 TRP D CE3 1 
ATOM   5908 C  CZ2 . TRP D 1 130 ? 69.099  31.762  23.816  1.00 13.97 ? 130 TRP D CZ2 1 
ATOM   5909 C  CZ3 . TRP D 1 130 ? 68.590  34.111  23.496  1.00 16.28 ? 130 TRP D CZ3 1 
ATOM   5910 C  CH2 . TRP D 1 130 ? 69.279  32.939  23.134  1.00 15.33 ? 130 TRP D CH2 1 
ATOM   5911 N  N   . LEU D 1 131 ? 64.699  35.954  28.418  1.00 20.03 ? 131 LEU D N   1 
ATOM   5912 C  CA  . LEU D 1 131 ? 63.496  36.681  28.777  1.00 21.17 ? 131 LEU D CA  1 
ATOM   5913 C  C   . LEU D 1 131 ? 62.762  36.554  27.445  1.00 21.84 ? 131 LEU D C   1 
ATOM   5914 O  O   . LEU D 1 131 ? 63.201  37.106  26.438  1.00 21.15 ? 131 LEU D O   1 
ATOM   5915 C  CB  . LEU D 1 131 ? 63.777  38.154  29.077  1.00 20.76 ? 131 LEU D CB  1 
ATOM   5916 C  CG  . LEU D 1 131 ? 62.496  39.005  29.098  1.00 22.89 ? 131 LEU D CG  1 
ATOM   5917 C  CD1 . LEU D 1 131 ? 61.469  38.388  30.042  1.00 21.88 ? 131 LEU D CD1 1 
ATOM   5918 C  CD2 . LEU D 1 131 ? 62.824  40.428  29.517  1.00 22.69 ? 131 LEU D CD2 1 
ATOM   5919 N  N   . VAL D 1 132 ? 61.678  35.789  27.426  1.00 23.31 ? 132 VAL D N   1 
ATOM   5920 C  CA  . VAL D 1 132 ? 60.932  35.589  26.192  1.00 23.64 ? 132 VAL D CA  1 
ATOM   5921 C  C   . VAL D 1 132 ? 59.505  36.122  26.274  1.00 26.00 ? 132 VAL D C   1 
ATOM   5922 O  O   . VAL D 1 132 ? 58.962  36.335  27.361  1.00 25.92 ? 132 VAL D O   1 
ATOM   5923 C  CB  . VAL D 1 132 ? 60.867  34.086  25.823  1.00 22.59 ? 132 VAL D CB  1 
ATOM   5924 C  CG1 . VAL D 1 132 ? 62.268  33.517  25.685  1.00 21.77 ? 132 VAL D CG1 1 
ATOM   5925 C  CG2 . VAL D 1 132 ? 60.078  33.323  26.879  1.00 20.71 ? 132 VAL D CG2 1 
ATOM   5926 N  N   . LEU D 1 133 ? 58.909  36.336  25.108  1.00 27.82 ? 133 LEU D N   1 
ATOM   5927 C  CA  . LEU D 1 133 ? 57.542  36.811  25.014  1.00 30.49 ? 133 LEU D CA  1 
ATOM   5928 C  C   . LEU D 1 133 ? 56.708  35.641  24.497  1.00 32.46 ? 133 LEU D C   1 
ATOM   5929 O  O   . LEU D 1 133 ? 56.851  35.228  23.345  1.00 31.66 ? 133 LEU D O   1 
ATOM   5930 C  CB  . LEU D 1 133 ? 57.461  37.995  24.045  1.00 30.07 ? 133 LEU D CB  1 
ATOM   5931 C  CG  . LEU D 1 133 ? 56.076  38.585  23.763  1.00 31.93 ? 133 LEU D CG  1 
ATOM   5932 C  CD1 . LEU D 1 133 ? 55.444  39.068  25.061  1.00 29.72 ? 133 LEU D CD1 1 
ATOM   5933 C  CD2 . LEU D 1 133 ? 56.208  39.733  22.762  1.00 30.80 ? 133 LEU D CD2 1 
ATOM   5934 N  N   . LYS D 1 134 ? 55.873  35.088  25.373  1.00 36.68 ? 134 LYS D N   1 
ATOM   5935 C  CA  . LYS D 1 134 ? 54.993  33.975  25.023  1.00 41.39 ? 134 LYS D CA  1 
ATOM   5936 C  C   . LYS D 1 134 ? 53.582  34.520  24.818  1.00 43.62 ? 134 LYS D C   1 
ATOM   5937 O  O   . LYS D 1 134 ? 52.802  34.625  25.770  1.00 43.71 ? 134 LYS D O   1 
ATOM   5938 C  CB  . LYS D 1 134 ? 54.957  32.931  26.141  1.00 42.43 ? 134 LYS D CB  1 
ATOM   5939 C  CG  . LYS D 1 134 ? 56.230  32.139  26.341  1.00 44.13 ? 134 LYS D CG  1 
ATOM   5940 C  CD  . LYS D 1 134 ? 55.986  31.034  27.361  1.00 46.80 ? 134 LYS D CD  1 
ATOM   5941 C  CE  . LYS D 1 134 ? 57.200  30.138  27.540  1.00 49.55 ? 134 LYS D CE  1 
ATOM   5942 N  NZ  . LYS D 1 134 ? 56.916  29.027  28.494  1.00 51.89 ? 134 LYS D NZ  1 
ATOM   5943 N  N   . GLY D 1 135 ? 53.257  34.863  23.575  1.00 45.69 ? 135 GLY D N   1 
ATOM   5944 C  CA  . GLY D 1 135 ? 51.944  35.405  23.289  1.00 46.94 ? 135 GLY D CA  1 
ATOM   5945 C  C   . GLY D 1 135 ? 51.894  36.850  23.732  1.00 48.12 ? 135 GLY D C   1 
ATOM   5946 O  O   . GLY D 1 135 ? 52.344  37.742  23.011  1.00 48.52 ? 135 GLY D O   1 
ATOM   5947 N  N   . ASP D 1 136 ? 51.366  37.087  24.927  1.00 48.48 ? 136 ASP D N   1 
ATOM   5948 C  CA  . ASP D 1 136 ? 51.270  38.441  25.452  1.00 49.84 ? 136 ASP D CA  1 
ATOM   5949 C  C   . ASP D 1 136 ? 51.925  38.566  26.826  1.00 48.40 ? 136 ASP D C   1 
ATOM   5950 O  O   . ASP D 1 136 ? 51.914  39.644  27.424  1.00 49.07 ? 136 ASP D O   1 
ATOM   5951 C  CB  . ASP D 1 136 ? 49.802  38.861  25.555  1.00 53.95 ? 136 ASP D CB  1 
ATOM   5952 C  CG  . ASP D 1 136 ? 49.023  38.010  26.545  1.00 58.15 ? 136 ASP D CG  1 
ATOM   5953 O  OD1 . ASP D 1 136 ? 48.912  36.780  26.322  1.00 58.55 ? 136 ASP D OD1 1 
ATOM   5954 O  OD2 . ASP D 1 136 ? 48.528  38.572  27.549  1.00 60.79 ? 136 ASP D OD2 1 
ATOM   5955 N  N   . LYS D 1 137 ? 52.493  37.469  27.323  1.00 45.08 ? 137 LYS D N   1 
ATOM   5956 C  CA  . LYS D 1 137 ? 53.140  37.480  28.632  1.00 42.65 ? 137 LYS D CA  1 
ATOM   5957 C  C   . LYS D 1 137 ? 54.642  37.222  28.559  1.00 39.28 ? 137 LYS D C   1 
ATOM   5958 O  O   . LYS D 1 137 ? 55.110  36.438  27.736  1.00 36.88 ? 137 LYS D O   1 
ATOM   5959 C  CB  . LYS D 1 137 ? 52.505  36.428  29.549  1.00 44.88 ? 137 LYS D CB  1 
ATOM   5960 C  CG  . LYS D 1 137 ? 51.040  36.664  29.879  1.00 49.95 ? 137 LYS D CG  1 
ATOM   5961 C  CD  . LYS D 1 137 ? 50.539  35.631  30.885  1.00 53.04 ? 137 LYS D CD  1 
ATOM   5962 C  CE  . LYS D 1 137 ? 49.041  35.763  31.143  1.00 55.27 ? 137 LYS D CE  1 
ATOM   5963 N  NZ  . LYS D 1 137 ? 48.227  35.463  29.927  1.00 56.27 ? 137 LYS D NZ  1 
ATOM   5964 N  N   . LEU D 1 138 ? 55.390  37.889  29.431  1.00 36.36 ? 138 LEU D N   1 
ATOM   5965 C  CA  . LEU D 1 138 ? 56.834  37.712  29.492  1.00 33.51 ? 138 LEU D CA  1 
ATOM   5966 C  C   . LEU D 1 138 ? 57.159  36.576  30.457  1.00 31.89 ? 138 LEU D C   1 
ATOM   5967 O  O   . LEU D 1 138 ? 56.441  36.352  31.437  1.00 32.03 ? 138 LEU D O   1 
ATOM   5968 C  CB  . LEU D 1 138 ? 57.513  39.000  29.958  1.00 32.01 ? 138 LEU D CB  1 
ATOM   5969 C  CG  . LEU D 1 138 ? 57.480  40.171  28.976  1.00 31.92 ? 138 LEU D CG  1 
ATOM   5970 C  CD1 . LEU D 1 138 ? 58.086  41.405  29.639  1.00 31.47 ? 138 LEU D CD1 1 
ATOM   5971 C  CD2 . LEU D 1 138 ? 58.239  39.804  27.705  1.00 29.23 ? 138 LEU D CD2 1 
ATOM   5972 N  N   . ALA D 1 139 ? 58.240  35.859  30.171  1.00 29.44 ? 139 ALA D N   1 
ATOM   5973 C  CA  . ALA D 1 139 ? 58.658  34.745  31.010  1.00 27.25 ? 139 ALA D CA  1 
ATOM   5974 C  C   . ALA D 1 139 ? 60.160  34.529  30.936  1.00 26.25 ? 139 ALA D C   1 
ATOM   5975 O  O   . ALA D 1 139 ? 60.804  34.880  29.947  1.00 25.42 ? 139 ALA D O   1 
ATOM   5976 C  CB  . ALA D 1 139 ? 57.939  33.478  30.586  1.00 26.27 ? 139 ALA D CB  1 
ATOM   5977 N  N   . VAL D 1 140 ? 60.710  33.955  32.000  1.00 25.31 ? 140 VAL D N   1 
ATOM   5978 C  CA  . VAL D 1 140 ? 62.132  33.658  32.069  1.00 24.57 ? 140 VAL D CA  1 
ATOM   5979 C  C   . VAL D 1 140 ? 62.301  32.157  31.867  1.00 24.01 ? 140 VAL D C   1 
ATOM   5980 O  O   . VAL D 1 140 ? 61.640  31.362  32.534  1.00 23.74 ? 140 VAL D O   1 
ATOM   5981 C  CB  . VAL D 1 140 ? 62.721  34.042  33.443  1.00 24.33 ? 140 VAL D CB  1 
ATOM   5982 C  CG1 . VAL D 1 140 ? 64.142  33.516  33.567  1.00 25.02 ? 140 VAL D CG1 1 
ATOM   5983 C  CG2 . VAL D 1 140 ? 62.713  35.553  33.608  1.00 23.28 ? 140 VAL D CG2 1 
ATOM   5984 N  N   . VAL D 1 141 ? 63.170  31.781  30.935  1.00 22.56 ? 141 VAL D N   1 
ATOM   5985 C  CA  . VAL D 1 141 ? 63.441  30.374  30.644  1.00 21.31 ? 141 VAL D CA  1 
ATOM   5986 C  C   . VAL D 1 141 ? 64.928  30.225  30.345  1.00 21.14 ? 141 VAL D C   1 
ATOM   5987 O  O   . VAL D 1 141 ? 65.629  31.222  30.166  1.00 21.60 ? 141 VAL D O   1 
ATOM   5988 C  CB  . VAL D 1 141 ? 62.666  29.888  29.396  1.00 21.19 ? 141 VAL D CB  1 
ATOM   5989 C  CG1 . VAL D 1 141 ? 61.183  30.154  29.562  1.00 22.85 ? 141 VAL D CG1 1 
ATOM   5990 C  CG2 . VAL D 1 141 ? 63.189  30.592  28.148  1.00 20.33 ? 141 VAL D CG2 1 
ATOM   5991 N  N   . SER D 1 142 ? 65.412  28.988  30.294  1.00 18.74 ? 142 SER D N   1 
ATOM   5992 C  CA  . SER D 1 142 ? 66.812  28.762  29.968  1.00 18.17 ? 142 SER D CA  1 
ATOM   5993 C  C   . SER D 1 142 ? 66.887  27.569  29.037  1.00 16.95 ? 142 SER D C   1 
ATOM   5994 O  O   . SER D 1 142 ? 65.990  26.731  29.024  1.00 17.54 ? 142 SER D O   1 
ATOM   5995 C  CB  . SER D 1 142 ? 67.642  28.490  31.226  1.00 17.84 ? 142 SER D CB  1 
ATOM   5996 O  OG  . SER D 1 142 ? 67.427  27.177  31.701  1.00 20.32 ? 142 SER D OG  1 
ATOM   5997 N  N   . THR D 1 143 ? 67.948  27.510  28.242  1.00 14.84 ? 143 THR D N   1 
ATOM   5998 C  CA  . THR D 1 143 ? 68.148  26.410  27.313  1.00 14.97 ? 143 THR D CA  1 
ATOM   5999 C  C   . THR D 1 143 ? 69.554  25.853  27.494  1.00 14.50 ? 143 THR D C   1 
ATOM   6000 O  O   . THR D 1 143 ? 70.419  26.498  28.097  1.00 12.18 ? 143 THR D O   1 
ATOM   6001 C  CB  . THR D 1 143 ? 67.978  26.855  25.830  1.00 16.83 ? 143 THR D CB  1 
ATOM   6002 O  OG1 . THR D 1 143 ? 68.822  27.983  25.561  1.00 15.05 ? 143 THR D OG1 1 
ATOM   6003 C  CG2 . THR D 1 143 ? 66.523  27.218  25.535  1.00 16.55 ? 143 THR D CG2 1 
ATOM   6004 N  N   . ALA D 1 144 ? 69.769  24.652  26.971  1.00 12.85 ? 144 ALA D N   1 
ATOM   6005 C  CA  . ALA D 1 144 ? 71.059  23.994  27.066  1.00 12.94 ? 144 ALA D CA  1 
ATOM   6006 C  C   . ALA D 1 144 ? 71.901  24.273  25.832  1.00 13.00 ? 144 ALA D C   1 
ATOM   6007 O  O   . ALA D 1 144 ? 71.370  24.521  24.748  1.00 13.11 ? 144 ALA D O   1 
ATOM   6008 C  CB  . ALA D 1 144 ? 70.861  22.490  27.219  1.00 11.80 ? 144 ALA D CB  1 
ATOM   6009 N  N   . ASN D 1 145 ? 73.216  24.241  26.019  1.00 12.65 ? 145 ASN D N   1 
ATOM   6010 C  CA  . ASN D 1 145 ? 74.172  24.430  24.943  1.00 12.57 ? 145 ASN D CA  1 
ATOM   6011 C  C   . ASN D 1 145 ? 73.852  25.618  24.040  1.00 12.41 ? 145 ASN D C   1 
ATOM   6012 O  O   . ASN D 1 145 ? 73.871  26.752  24.503  1.00 13.74 ? 145 ASN D O   1 
ATOM   6013 C  CB  . ASN D 1 145 ? 74.258  23.120  24.157  1.00 14.52 ? 145 ASN D CB  1 
ATOM   6014 C  CG  . ASN D 1 145 ? 74.462  21.917  25.077  1.00 17.59 ? 145 ASN D CG  1 
ATOM   6015 O  OD1 . ASN D 1 145 ? 75.250  21.980  26.025  1.00 16.51 ? 145 ASN D OD1 1 
ATOM   6016 N  ND2 . ASN D 1 145 ? 73.747  20.825  24.810  1.00 16.76 ? 145 ASN D ND2 1 
ATOM   6017 N  N   . GLN D 1 146 ? 73.580  25.379  22.760  1.00 12.80 ? 146 GLN D N   1 
ATOM   6018 C  CA  . GLN D 1 146 ? 73.243  26.485  21.864  1.00 13.82 ? 146 GLN D CA  1 
ATOM   6019 C  C   . GLN D 1 146 ? 71.787  26.447  21.400  1.00 14.58 ? 146 GLN D C   1 
ATOM   6020 O  O   . GLN D 1 146 ? 71.454  26.999  20.351  1.00 14.48 ? 146 GLN D O   1 
ATOM   6021 C  CB  . GLN D 1 146 ? 74.169  26.519  20.639  1.00 11.60 ? 146 GLN D CB  1 
ATOM   6022 C  CG  . GLN D 1 146 ? 75.623  26.904  20.927  1.00 10.77 ? 146 GLN D CG  1 
ATOM   6023 C  CD  . GLN D 1 146 ? 75.773  28.222  21.688  1.00 12.30 ? 146 GLN D CD  1 
ATOM   6024 O  OE1 . GLN D 1 146 ? 74.927  29.115  21.600  1.00 12.85 ? 146 GLN D OE1 1 
ATOM   6025 N  NE2 . GLN D 1 146 ? 76.869  28.350  22.428  1.00 11.06 ? 146 GLN D NE2 1 
ATOM   6026 N  N   . ASP D 1 147 ? 70.919  25.792  22.168  1.00 15.18 ? 147 ASP D N   1 
ATOM   6027 C  CA  . ASP D 1 147 ? 69.506  25.741  21.799  1.00 15.33 ? 147 ASP D CA  1 
ATOM   6028 C  C   . ASP D 1 147 ? 68.895  27.116  22.031  1.00 15.52 ? 147 ASP D C   1 
ATOM   6029 O  O   . ASP D 1 147 ? 69.355  27.884  22.875  1.00 16.65 ? 147 ASP D O   1 
ATOM   6030 C  CB  . ASP D 1 147 ? 68.734  24.714  22.633  1.00 15.28 ? 147 ASP D CB  1 
ATOM   6031 C  CG  . ASP D 1 147 ? 69.111  23.282  22.308  1.00 16.50 ? 147 ASP D CG  1 
ATOM   6032 O  OD1 . ASP D 1 147 ? 69.701  23.039  21.233  1.00 16.53 ? 147 ASP D OD1 1 
ATOM   6033 O  OD2 . ASP D 1 147 ? 68.802  22.394  23.132  1.00 14.73 ? 147 ASP D OD2 1 
ATOM   6034 N  N   . SER D 1 148 ? 67.846  27.412  21.280  1.00 15.78 ? 148 SER D N   1 
ATOM   6035 C  CA  . SER D 1 148 ? 67.154  28.682  21.385  1.00 16.05 ? 148 SER D CA  1 
ATOM   6036 C  C   . SER D 1 148 ? 65.659  28.423  21.512  1.00 17.28 ? 148 SER D C   1 
ATOM   6037 O  O   . SER D 1 148 ? 65.142  27.461  20.938  1.00 16.90 ? 148 SER D O   1 
ATOM   6038 C  CB  . SER D 1 148 ? 67.419  29.511  20.131  1.00 14.97 ? 148 SER D CB  1 
ATOM   6039 O  OG  . SER D 1 148 ? 66.501  30.580  20.027  1.00 17.66 ? 148 SER D OG  1 
ATOM   6040 N  N   . PRO D 1 149 ? 64.945  29.263  22.280  1.00 18.05 ? 149 PRO D N   1 
ATOM   6041 C  CA  . PRO D 1 149 ? 63.502  29.030  22.403  1.00 19.00 ? 149 PRO D CA  1 
ATOM   6042 C  C   . PRO D 1 149 ? 62.791  29.114  21.041  1.00 19.03 ? 149 PRO D C   1 
ATOM   6043 O  O   . PRO D 1 149 ? 61.675  28.619  20.880  1.00 19.03 ? 149 PRO D O   1 
ATOM   6044 C  CB  . PRO D 1 149 ? 63.050  30.102  23.408  1.00 18.82 ? 149 PRO D CB  1 
ATOM   6045 C  CG  . PRO D 1 149 ? 64.159  31.133  23.385  1.00 18.28 ? 149 PRO D CG  1 
ATOM   6046 C  CD  . PRO D 1 149 ? 65.400  30.317  23.205  1.00 16.96 ? 149 PRO D CD  1 
ATOM   6047 N  N   . LEU D 1 150 ? 63.453  29.719  20.058  1.00 18.32 ? 150 LEU D N   1 
ATOM   6048 C  CA  . LEU D 1 150 ? 62.888  29.827  18.714  1.00 20.28 ? 150 LEU D CA  1 
ATOM   6049 C  C   . LEU D 1 150 ? 62.772  28.453  18.057  1.00 21.53 ? 150 LEU D C   1 
ATOM   6050 O  O   . LEU D 1 150 ? 62.053  28.287  17.070  1.00 22.12 ? 150 LEU D O   1 
ATOM   6051 C  CB  . LEU D 1 150 ? 63.767  30.703  17.820  1.00 19.15 ? 150 LEU D CB  1 
ATOM   6052 C  CG  . LEU D 1 150 ? 63.721  32.218  17.983  1.00 21.12 ? 150 LEU D CG  1 
ATOM   6053 C  CD1 . LEU D 1 150 ? 64.632  32.852  16.939  1.00 18.74 ? 150 LEU D CD1 1 
ATOM   6054 C  CD2 . LEU D 1 150 ? 62.288  32.711  17.806  1.00 20.89 ? 150 LEU D CD2 1 
ATOM   6055 N  N   . MET D 1 151 ? 63.495  27.474  18.595  1.00 20.88 ? 151 MET D N   1 
ATOM   6056 C  CA  . MET D 1 151 ? 63.475  26.126  18.039  1.00 21.19 ? 151 MET D CA  1 
ATOM   6057 C  C   . MET D 1 151 ? 62.227  25.350  18.445  1.00 22.81 ? 151 MET D C   1 
ATOM   6058 O  O   . MET D 1 151 ? 61.924  24.309  17.860  1.00 23.26 ? 151 MET D O   1 
ATOM   6059 C  CB  . MET D 1 151 ? 64.716  25.354  18.483  1.00 19.66 ? 151 MET D CB  1 
ATOM   6060 C  CG  . MET D 1 151 ? 66.031  25.992  18.063  1.00 18.27 ? 151 MET D CG  1 
ATOM   6061 S  SD  . MET D 1 151 ? 67.436  25.066  18.680  1.00 14.80 ? 151 MET D SD  1 
ATOM   6062 C  CE  . MET D 1 151 ? 68.793  25.820  17.764  1.00 11.84 ? 151 MET D CE  1 
ATOM   6063 N  N   . GLY D 1 152 ? 61.506  25.854  19.443  1.00 22.50 ? 152 GLY D N   1 
ATOM   6064 C  CA  . GLY D 1 152 ? 60.308  25.176  19.900  1.00 23.71 ? 152 GLY D CA  1 
ATOM   6065 C  C   . GLY D 1 152 ? 60.574  24.321  21.124  1.00 25.67 ? 152 GLY D C   1 
ATOM   6066 O  O   . GLY D 1 152 ? 61.725  23.974  21.406  1.00 24.23 ? 152 GLY D O   1 
ATOM   6067 N  N   . GLU D 1 153 ? 59.510  23.967  21.843  1.00 26.81 ? 153 GLU D N   1 
ATOM   6068 C  CA  . GLU D 1 153 ? 59.633  23.161  23.054  1.00 28.60 ? 153 GLU D CA  1 
ATOM   6069 C  C   . GLU D 1 153 ? 60.117  21.745  22.825  1.00 27.17 ? 153 GLU D C   1 
ATOM   6070 O  O   . GLU D 1 153 ? 60.895  21.216  23.620  1.00 27.26 ? 153 GLU D O   1 
ATOM   6071 C  CB  . GLU D 1 153 ? 58.298  23.084  23.790  1.00 31.81 ? 153 GLU D CB  1 
ATOM   6072 C  CG  . GLU D 1 153 ? 57.804  24.400  24.332  1.00 41.30 ? 153 GLU D CG  1 
ATOM   6073 C  CD  . GLU D 1 153 ? 56.886  24.211  25.527  1.00 45.96 ? 153 GLU D CD  1 
ATOM   6074 O  OE1 . GLU D 1 153 ? 55.920  23.421  25.416  1.00 49.11 ? 153 GLU D OE1 1 
ATOM   6075 O  OE2 . GLU D 1 153 ? 57.133  24.850  26.575  1.00 47.30 ? 153 GLU D OE2 1 
ATOM   6076 N  N   . ALA D 1 154 ? 59.644  21.123  21.752  1.00 25.73 ? 154 ALA D N   1 
ATOM   6077 C  CA  . ALA D 1 154 ? 60.022  19.747  21.459  1.00 26.00 ? 154 ALA D CA  1 
ATOM   6078 C  C   . ALA D 1 154 ? 61.535  19.590  21.392  1.00 25.22 ? 154 ALA D C   1 
ATOM   6079 O  O   . ALA D 1 154 ? 62.089  18.600  21.866  1.00 25.17 ? 154 ALA D O   1 
ATOM   6080 C  CB  . ALA D 1 154 ? 59.380  19.291  20.145  1.00 26.25 ? 154 ALA D CB  1 
ATOM   6081 N  N   . ILE D 1 155 ? 62.200  20.584  20.819  1.00 24.81 ? 155 ILE D N   1 
ATOM   6082 C  CA  . ILE D 1 155 ? 63.642  20.542  20.673  1.00 24.30 ? 155 ILE D CA  1 
ATOM   6083 C  C   . ILE D 1 155 ? 64.432  21.153  21.825  1.00 23.61 ? 155 ILE D C   1 
ATOM   6084 O  O   . ILE D 1 155 ? 65.308  20.502  22.389  1.00 24.15 ? 155 ILE D O   1 
ATOM   6085 C  CB  . ILE D 1 155 ? 64.054  21.233  19.361  1.00 24.56 ? 155 ILE D CB  1 
ATOM   6086 C  CG1 . ILE D 1 155 ? 63.507  20.435  18.177  1.00 24.25 ? 155 ILE D CG1 1 
ATOM   6087 C  CG2 . ILE D 1 155 ? 65.570  21.372  19.285  1.00 24.48 ? 155 ILE D CG2 1 
ATOM   6088 C  CD1 . ILE D 1 155 ? 63.686  21.114  16.834  1.00 24.90 ? 155 ILE D CD1 1 
ATOM   6089 N  N   . SER D 1 156 ? 64.118  22.393  22.184  1.00 23.55 ? 156 SER D N   1 
ATOM   6090 C  CA  . SER D 1 156 ? 64.866  23.080  23.235  1.00 23.36 ? 156 SER D CA  1 
ATOM   6091 C  C   . SER D 1 156 ? 64.295  23.011  24.644  1.00 23.02 ? 156 SER D C   1 
ATOM   6092 O  O   . SER D 1 156 ? 64.980  23.370  25.606  1.00 22.58 ? 156 SER D O   1 
ATOM   6093 C  CB  . SER D 1 156 ? 65.051  24.547  22.854  1.00 23.37 ? 156 SER D CB  1 
ATOM   6094 O  OG  . SER D 1 156 ? 63.808  25.224  22.882  1.00 26.52 ? 156 SER D OG  1 
ATOM   6095 N  N   . GLY D 1 157 ? 63.051  22.562  24.773  1.00 21.28 ? 157 GLY D N   1 
ATOM   6096 C  CA  . GLY D 1 157 ? 62.441  22.484  26.088  1.00 21.69 ? 157 GLY D CA  1 
ATOM   6097 C  C   . GLY D 1 157 ? 61.837  23.813  26.500  1.00 22.35 ? 157 GLY D C   1 
ATOM   6098 O  O   . GLY D 1 157 ? 61.321  23.961  27.605  1.00 23.27 ? 157 GLY D O   1 
ATOM   6099 N  N   . ALA D 1 158 ? 61.902  24.791  25.605  1.00 22.19 ? 158 ALA D N   1 
ATOM   6100 C  CA  . ALA D 1 158 ? 61.347  26.111  25.871  1.00 21.84 ? 158 ALA D CA  1 
ATOM   6101 C  C   . ALA D 1 158 ? 60.808  26.716  24.581  1.00 22.93 ? 158 ALA D C   1 
ATOM   6102 O  O   . ALA D 1 158 ? 61.071  26.217  23.487  1.00 22.63 ? 158 ALA D O   1 
ATOM   6103 C  CB  . ALA D 1 158 ? 62.411  27.020  26.472  1.00 20.92 ? 158 ALA D CB  1 
ATOM   6104 N  N   . SER D 1 159 ? 60.050  27.797  24.712  1.00 23.25 ? 159 SER D N   1 
ATOM   6105 C  CA  . SER D 1 159 ? 59.484  28.458  23.546  1.00 25.45 ? 159 SER D CA  1 
ATOM   6106 C  C   . SER D 1 159 ? 59.247  29.923  23.852  1.00 24.62 ? 159 SER D C   1 
ATOM   6107 O  O   . SER D 1 159 ? 59.296  30.340  25.005  1.00 25.43 ? 159 SER D O   1 
ATOM   6108 C  CB  . SER D 1 159 ? 58.163  27.795  23.145  1.00 26.22 ? 159 SER D CB  1 
ATOM   6109 O  OG  . SER D 1 159 ? 57.231  27.852  24.212  1.00 28.87 ? 159 SER D OG  1 
ATOM   6110 N  N   . GLY D 1 160 ? 58.984  30.701  22.812  1.00 25.43 ? 160 GLY D N   1 
ATOM   6111 C  CA  . GLY D 1 160 ? 58.745  32.118  22.992  1.00 25.73 ? 160 GLY D CA  1 
ATOM   6112 C  C   . GLY D 1 160 ? 59.699  32.948  22.158  1.00 25.58 ? 160 GLY D C   1 
ATOM   6113 O  O   . GLY D 1 160 ? 60.691  32.437  21.635  1.00 25.34 ? 160 GLY D O   1 
ATOM   6114 N  N   . PHE D 1 161 ? 59.397  34.233  22.030  1.00 24.90 ? 161 PHE D N   1 
ATOM   6115 C  CA  . PHE D 1 161 ? 60.233  35.131  21.255  1.00 24.86 ? 161 PHE D CA  1 
ATOM   6116 C  C   . PHE D 1 161 ? 61.274  35.763  22.180  1.00 24.54 ? 161 PHE D C   1 
ATOM   6117 O  O   . PHE D 1 161 ? 60.927  36.422  23.161  1.00 24.56 ? 161 PHE D O   1 
ATOM   6118 C  CB  . PHE D 1 161 ? 59.372  36.214  20.603  1.00 24.02 ? 161 PHE D CB  1 
ATOM   6119 C  CG  . PHE D 1 161 ? 60.143  37.145  19.725  1.00 23.46 ? 161 PHE D CG  1 
ATOM   6120 C  CD1 . PHE D 1 161 ? 60.679  36.700  18.522  1.00 25.22 ? 161 PHE D CD1 1 
ATOM   6121 C  CD2 . PHE D 1 161 ? 60.347  38.466  20.104  1.00 24.06 ? 161 PHE D CD2 1 
ATOM   6122 C  CE1 . PHE D 1 161 ? 61.411  37.560  17.704  1.00 24.78 ? 161 PHE D CE1 1 
ATOM   6123 C  CE2 . PHE D 1 161 ? 61.077  39.334  19.297  1.00 24.90 ? 161 PHE D CE2 1 
ATOM   6124 C  CZ  . PHE D 1 161 ? 61.611  38.879  18.093  1.00 23.95 ? 161 PHE D CZ  1 
ATOM   6125 N  N   . PRO D 1 162 ? 62.569  35.569  21.874  1.00 24.13 ? 162 PRO D N   1 
ATOM   6126 C  CA  . PRO D 1 162 ? 63.660  36.120  22.685  1.00 23.77 ? 162 PRO D CA  1 
ATOM   6127 C  C   . PRO D 1 162 ? 63.710  37.643  22.686  1.00 23.52 ? 162 PRO D C   1 
ATOM   6128 O  O   . PRO D 1 162 ? 63.842  38.270  21.634  1.00 24.10 ? 162 PRO D O   1 
ATOM   6129 C  CB  . PRO D 1 162 ? 64.920  35.522  22.044  1.00 24.16 ? 162 PRO D CB  1 
ATOM   6130 C  CG  . PRO D 1 162 ? 64.414  34.305  21.307  1.00 24.70 ? 162 PRO D CG  1 
ATOM   6131 C  CD  . PRO D 1 162 ? 63.104  34.781  20.750  1.00 22.66 ? 162 PRO D CD  1 
ATOM   6132 N  N   . ILE D 1 163 ? 63.601  38.231  23.871  1.00 22.50 ? 163 ILE D N   1 
ATOM   6133 C  CA  . ILE D 1 163 ? 63.674  39.677  24.014  1.00 22.60 ? 163 ILE D CA  1 
ATOM   6134 C  C   . ILE D 1 163 ? 65.123  40.031  24.358  1.00 23.48 ? 163 ILE D C   1 
ATOM   6135 O  O   . ILE D 1 163 ? 65.679  41.018  23.876  1.00 23.07 ? 163 ILE D O   1 
ATOM   6136 C  CB  . ILE D 1 163 ? 62.756  40.172  25.150  1.00 22.13 ? 163 ILE D CB  1 
ATOM   6137 C  CG1 . ILE D 1 163 ? 61.292  39.947  24.764  1.00 23.30 ? 163 ILE D CG1 1 
ATOM   6138 C  CG2 . ILE D 1 163 ? 63.054  41.630  25.464  1.00 20.79 ? 163 ILE D CG2 1 
ATOM   6139 C  CD1 . ILE D 1 163 ? 60.900  40.564  23.424  1.00 21.36 ? 163 ILE D CD1 1 
ATOM   6140 N  N   . MET D 1 164 ? 65.730  39.199  25.193  1.00 22.93 ? 164 MET D N   1 
ATOM   6141 C  CA  . MET D 1 164 ? 67.101  39.406  25.620  1.00 23.51 ? 164 MET D CA  1 
ATOM   6142 C  C   . MET D 1 164 ? 67.631  38.102  26.225  1.00 22.47 ? 164 MET D C   1 
ATOM   6143 O  O   . MET D 1 164 ? 66.855  37.284  26.716  1.00 22.97 ? 164 MET D O   1 
ATOM   6144 C  CB  . MET D 1 164 ? 67.125  40.565  26.617  1.00 26.54 ? 164 MET D CB  1 
ATOM   6145 C  CG  . MET D 1 164 ? 68.249  40.554  27.612  1.00 33.39 ? 164 MET D CG  1 
ATOM   6146 S  SD  . MET D 1 164 ? 67.734  39.739  29.128  1.00 39.03 ? 164 MET D SD  1 
ATOM   6147 C  CE  . MET D 1 164 ? 66.794  41.029  29.882  1.00 39.26 ? 164 MET D CE  1 
ATOM   6148 N  N   . GLY D 1 165 ? 68.942  37.889  26.165  1.00 21.06 ? 165 GLY D N   1 
ATOM   6149 C  CA  . GLY D 1 165 ? 69.497  36.662  26.714  1.00 18.92 ? 165 GLY D CA  1 
ATOM   6150 C  C   . GLY D 1 165 ? 70.904  36.784  27.267  1.00 17.87 ? 165 GLY D C   1 
ATOM   6151 O  O   . GLY D 1 165 ? 71.643  37.706  26.926  1.00 17.92 ? 165 GLY D O   1 
ATOM   6152 N  N   . LEU D 1 166 ? 71.274  35.852  28.137  1.00 16.34 ? 166 LEU D N   1 
ATOM   6153 C  CA  . LEU D 1 166 ? 72.607  35.840  28.731  1.00 14.75 ? 166 LEU D CA  1 
ATOM   6154 C  C   . LEU D 1 166 ? 73.296  34.497  28.479  1.00 13.45 ? 166 LEU D C   1 
ATOM   6155 O  O   . LEU D 1 166 ? 72.747  33.435  28.767  1.00 13.31 ? 166 LEU D O   1 
ATOM   6156 C  CB  . LEU D 1 166 ? 72.521  36.110  30.237  1.00 13.91 ? 166 LEU D CB  1 
ATOM   6157 C  CG  . LEU D 1 166 ? 73.819  36.017  31.040  1.00 12.92 ? 166 LEU D CG  1 
ATOM   6158 C  CD1 . LEU D 1 166 ? 74.798  37.092  30.584  1.00 12.91 ? 166 LEU D CD1 1 
ATOM   6159 C  CD2 . LEU D 1 166 ? 73.506  36.175  32.517  1.00 12.49 ? 166 LEU D CD2 1 
ATOM   6160 N  N   . ASP D 1 167 ? 74.498  34.564  27.925  1.00 12.79 ? 167 ASP D N   1 
ATOM   6161 C  CA  . ASP D 1 167 ? 75.304  33.387  27.616  1.00 11.37 ? 167 ASP D CA  1 
ATOM   6162 C  C   . ASP D 1 167 ? 75.940  32.911  28.922  1.00 11.55 ? 167 ASP D C   1 
ATOM   6163 O  O   . ASP D 1 167 ? 76.696  33.658  29.547  1.00 11.61 ? 167 ASP D O   1 
ATOM   6164 C  CB  . ASP D 1 167 ? 76.398  33.793  26.610  1.00 10.96 ? 167 ASP D CB  1 
ATOM   6165 C  CG  . ASP D 1 167 ? 77.260  32.622  26.137  1.00 14.06 ? 167 ASP D CG  1 
ATOM   6166 O  OD1 . ASP D 1 167 ? 77.053  31.468  26.583  1.00 13.37 ? 167 ASP D OD1 1 
ATOM   6167 O  OD2 . ASP D 1 167 ? 78.159  32.874  25.301  1.00 11.42 ? 167 ASP D OD2 1 
ATOM   6168 N  N   . VAL D 1 168 ? 75.627  31.692  29.361  1.00 11.05 ? 168 VAL D N   1 
ATOM   6169 C  CA  . VAL D 1 168 ? 76.248  31.198  30.584  1.00 10.62 ? 168 VAL D CA  1 
ATOM   6170 C  C   . VAL D 1 168 ? 77.237  30.048  30.370  1.00 10.76 ? 168 VAL D C   1 
ATOM   6171 O  O   . VAL D 1 168 ? 77.524  29.280  31.292  1.00 11.23 ? 168 VAL D O   1 
ATOM   6172 C  CB  . VAL D 1 168 ? 75.204  30.825  31.684  1.00 10.87 ? 168 VAL D CB  1 
ATOM   6173 C  CG1 . VAL D 1 168 ? 74.572  32.095  32.234  1.00 10.59 ? 168 VAL D CG1 1 
ATOM   6174 C  CG2 . VAL D 1 168 ? 74.133  29.915  31.130  1.00 11.27 ? 168 VAL D CG2 1 
ATOM   6175 N  N   . TRP D 1 169 ? 77.751  29.925  29.147  1.00 9.05  ? 169 TRP D N   1 
ATOM   6176 C  CA  . TRP D 1 169 ? 78.785  28.932  28.871  1.00 8.79  ? 169 TRP D CA  1 
ATOM   6177 C  C   . TRP D 1 169 ? 79.975  29.496  29.650  1.00 8.89  ? 169 TRP D C   1 
ATOM   6178 O  O   . TRP D 1 169 ? 80.111  30.717  29.774  1.00 7.48  ? 169 TRP D O   1 
ATOM   6179 C  CB  . TRP D 1 169 ? 79.135  28.910  27.386  1.00 7.69  ? 169 TRP D CB  1 
ATOM   6180 C  CG  . TRP D 1 169 ? 78.207  28.089  26.552  1.00 9.58  ? 169 TRP D CG  1 
ATOM   6181 C  CD1 . TRP D 1 169 ? 76.844  28.197  26.479  1.00 9.86  ? 169 TRP D CD1 1 
ATOM   6182 C  CD2 . TRP D 1 169 ? 78.576  27.031  25.660  1.00 8.57  ? 169 TRP D CD2 1 
ATOM   6183 N  NE1 . TRP D 1 169 ? 76.343  27.269  25.595  1.00 9.82  ? 169 TRP D NE1 1 
ATOM   6184 C  CE2 . TRP D 1 169 ? 77.383  26.541  25.076  1.00 8.17  ? 169 TRP D CE2 1 
ATOM   6185 C  CE3 . TRP D 1 169 ? 79.800  26.451  25.295  1.00 7.97  ? 169 TRP D CE3 1 
ATOM   6186 C  CZ2 . TRP D 1 169 ? 77.377  25.494  24.144  1.00 8.11  ? 169 TRP D CZ2 1 
ATOM   6187 C  CZ3 . TRP D 1 169 ? 79.798  25.408  24.367  1.00 9.65  ? 169 TRP D CZ3 1 
ATOM   6188 C  CH2 . TRP D 1 169 ? 78.589  24.942  23.802  1.00 9.46  ? 169 TRP D CH2 1 
ATOM   6189 N  N   . GLU D 1 170 ? 80.839  28.634  30.169  1.00 8.54  ? 170 GLU D N   1 
ATOM   6190 C  CA  . GLU D 1 170 ? 81.979  29.124  30.940  1.00 9.68  ? 170 GLU D CA  1 
ATOM   6191 C  C   . GLU D 1 170 ? 82.931  30.040  30.174  1.00 10.01 ? 170 GLU D C   1 
ATOM   6192 O  O   . GLU D 1 170 ? 83.551  30.912  30.773  1.00 11.36 ? 170 GLU D O   1 
ATOM   6193 C  CB  . GLU D 1 170 ? 82.749  27.945  31.550  1.00 8.73  ? 170 GLU D CB  1 
ATOM   6194 C  CG  . GLU D 1 170 ? 81.925  27.209  32.610  1.00 9.61  ? 170 GLU D CG  1 
ATOM   6195 C  CD  . GLU D 1 170 ? 82.642  26.018  33.210  1.00 11.30 ? 170 GLU D CD  1 
ATOM   6196 O  OE1 . GLU D 1 170 ? 83.172  25.197  32.430  1.00 9.64  ? 170 GLU D OE1 1 
ATOM   6197 O  OE2 . GLU D 1 170 ? 82.665  25.900  34.461  1.00 11.19 ? 170 GLU D OE2 1 
ATOM   6198 N  N   . HIS D 1 171 ? 83.039  29.862  28.859  1.00 10.37 ? 171 HIS D N   1 
ATOM   6199 C  CA  . HIS D 1 171 ? 83.938  30.702  28.068  1.00 10.26 ? 171 HIS D CA  1 
ATOM   6200 C  C   . HIS D 1 171 ? 83.529  32.171  28.081  1.00 11.57 ? 171 HIS D C   1 
ATOM   6201 O  O   . HIS D 1 171 ? 84.344  33.054  27.792  1.00 11.19 ? 171 HIS D O   1 
ATOM   6202 C  CB  . HIS D 1 171 ? 84.041  30.196  26.609  1.00 9.39  ? 171 HIS D CB  1 
ATOM   6203 C  CG  . HIS D 1 171 ? 82.770  30.305  25.812  1.00 9.79  ? 171 HIS D CG  1 
ATOM   6204 N  ND1 . HIS D 1 171 ? 82.184  29.216  25.200  1.00 6.44  ? 171 HIS D ND1 1 
ATOM   6205 C  CD2 . HIS D 1 171 ? 82.015  31.378  25.465  1.00 10.38 ? 171 HIS D CD2 1 
ATOM   6206 C  CE1 . HIS D 1 171 ? 81.128  29.613  24.509  1.00 8.26  ? 171 HIS D CE1 1 
ATOM   6207 N  NE2 . HIS D 1 171 ? 81.003  30.920  24.652  1.00 7.24  ? 171 HIS D NE2 1 
ATOM   6208 N  N   . ALA D 1 172 ? 82.272  32.437  28.425  1.00 11.25 ? 172 ALA D N   1 
ATOM   6209 C  CA  . ALA D 1 172 ? 81.777  33.809  28.456  1.00 12.23 ? 172 ALA D CA  1 
ATOM   6210 C  C   . ALA D 1 172 ? 82.200  34.575  29.696  1.00 12.58 ? 172 ALA D C   1 
ATOM   6211 O  O   . ALA D 1 172 ? 82.091  35.801  29.728  1.00 13.92 ? 172 ALA D O   1 
ATOM   6212 C  CB  . ALA D 1 172 ? 80.254  33.825  28.349  1.00 12.56 ? 172 ALA D CB  1 
ATOM   6213 N  N   . TYR D 1 173 ? 82.702  33.875  30.710  1.00 12.66 ? 173 TYR D N   1 
ATOM   6214 C  CA  . TYR D 1 173 ? 83.084  34.555  31.943  1.00 12.55 ? 173 TYR D CA  1 
ATOM   6215 C  C   . TYR D 1 173 ? 84.274  33.976  32.702  1.00 12.62 ? 173 TYR D C   1 
ATOM   6216 O  O   . TYR D 1 173 ? 84.642  34.494  33.752  1.00 13.49 ? 173 TYR D O   1 
ATOM   6217 C  CB  . TYR D 1 173 ? 81.871  34.600  32.878  1.00 11.84 ? 173 TYR D CB  1 
ATOM   6218 C  CG  . TYR D 1 173 ? 81.381  33.232  33.312  1.00 13.20 ? 173 TYR D CG  1 
ATOM   6219 C  CD1 . TYR D 1 173 ? 82.037  32.517  34.321  1.00 12.58 ? 173 TYR D CD1 1 
ATOM   6220 C  CD2 . TYR D 1 173 ? 80.257  32.657  32.725  1.00 12.83 ? 173 TYR D CD2 1 
ATOM   6221 C  CE1 . TYR D 1 173 ? 81.579  31.267  34.737  1.00 11.37 ? 173 TYR D CE1 1 
ATOM   6222 C  CE2 . TYR D 1 173 ? 79.789  31.405  33.134  1.00 13.40 ? 173 TYR D CE2 1 
ATOM   6223 C  CZ  . TYR D 1 173 ? 80.450  30.719  34.141  1.00 12.55 ? 173 TYR D CZ  1 
ATOM   6224 O  OH  . TYR D 1 173 ? 79.953  29.508  34.576  1.00 12.92 ? 173 TYR D OH  1 
ATOM   6225 N  N   . TYR D 1 174 ? 84.899  32.931  32.177  1.00 13.24 ? 174 TYR D N   1 
ATOM   6226 C  CA  . TYR D 1 174 ? 85.997  32.323  32.912  1.00 14.52 ? 174 TYR D CA  1 
ATOM   6227 C  C   . TYR D 1 174 ? 87.300  33.116  33.047  1.00 15.91 ? 174 TYR D C   1 
ATOM   6228 O  O   . TYR D 1 174 ? 87.941  33.079  34.102  1.00 15.54 ? 174 TYR D O   1 
ATOM   6229 C  CB  . TYR D 1 174 ? 86.312  30.934  32.355  1.00 13.06 ? 174 TYR D CB  1 
ATOM   6230 C  CG  . TYR D 1 174 ? 86.651  29.972  33.465  1.00 12.74 ? 174 TYR D CG  1 
ATOM   6231 C  CD1 . TYR D 1 174 ? 85.646  29.445  34.278  1.00 11.92 ? 174 TYR D CD1 1 
ATOM   6232 C  CD2 . TYR D 1 174 ? 87.980  29.667  33.775  1.00 12.02 ? 174 TYR D CD2 1 
ATOM   6233 C  CE1 . TYR D 1 174 ? 85.948  28.648  35.372  1.00 10.65 ? 174 TYR D CE1 1 
ATOM   6234 C  CE2 . TYR D 1 174 ? 88.297  28.867  34.876  1.00 11.85 ? 174 TYR D CE2 1 
ATOM   6235 C  CZ  . TYR D 1 174 ? 87.271  28.364  35.670  1.00 11.83 ? 174 TYR D CZ  1 
ATOM   6236 O  OH  . TYR D 1 174 ? 87.556  27.594  36.771  1.00 10.58 ? 174 TYR D OH  1 
ATOM   6237 N  N   . LEU D 1 175 ? 87.705  33.826  32.001  1.00 15.07 ? 175 LEU D N   1 
ATOM   6238 C  CA  . LEU D 1 175 ? 88.949  34.583  32.087  1.00 15.64 ? 175 LEU D CA  1 
ATOM   6239 C  C   . LEU D 1 175 ? 88.924  35.622  33.206  1.00 14.93 ? 175 LEU D C   1 
ATOM   6240 O  O   . LEU D 1 175 ? 89.928  35.841  33.878  1.00 14.54 ? 175 LEU D O   1 
ATOM   6241 C  CB  . LEU D 1 175 ? 89.264  35.258  30.745  1.00 14.64 ? 175 LEU D CB  1 
ATOM   6242 C  CG  . LEU D 1 175 ? 89.647  34.306  29.603  1.00 17.51 ? 175 LEU D CG  1 
ATOM   6243 C  CD1 . LEU D 1 175 ? 90.000  35.116  28.366  1.00 17.46 ? 175 LEU D CD1 1 
ATOM   6244 C  CD2 . LEU D 1 175 ? 90.824  33.423  30.019  1.00 14.82 ? 175 LEU D CD2 1 
ATOM   6245 N  N   . LYS D 1 176 ? 87.773  36.250  33.421  1.00 15.52 ? 176 LYS D N   1 
ATOM   6246 C  CA  . LYS D 1 176 ? 87.670  37.267  34.458  1.00 15.82 ? 176 LYS D CA  1 
ATOM   6247 C  C   . LYS D 1 176 ? 87.065  36.798  35.782  1.00 16.33 ? 176 LYS D C   1 
ATOM   6248 O  O   . LYS D 1 176 ? 87.579  37.125  36.845  1.00 17.77 ? 176 LYS D O   1 
ATOM   6249 C  CB  . LYS D 1 176 ? 86.864  38.463  33.936  1.00 16.80 ? 176 LYS D CB  1 
ATOM   6250 C  CG  . LYS D 1 176 ? 86.743  39.607  34.939  1.00 18.43 ? 176 LYS D CG  1 
ATOM   6251 C  CD  . LYS D 1 176 ? 85.834  40.714  34.431  1.00 21.24 ? 176 LYS D CD  1 
ATOM   6252 C  CE  . LYS D 1 176 ? 85.685  41.816  35.472  1.00 21.96 ? 176 LYS D CE  1 
ATOM   6253 N  NZ  . LYS D 1 176 ? 84.646  42.819  35.107  1.00 23.90 ? 176 LYS D NZ  1 
ATOM   6254 N  N   . PHE D 1 177 ? 85.980  36.033  35.724  1.00 15.72 ? 177 PHE D N   1 
ATOM   6255 C  CA  . PHE D 1 177 ? 85.323  35.579  36.944  1.00 15.07 ? 177 PHE D CA  1 
ATOM   6256 C  C   . PHE D 1 177 ? 85.594  34.134  37.363  1.00 14.88 ? 177 PHE D C   1 
ATOM   6257 O  O   . PHE D 1 177 ? 85.194  33.726  38.453  1.00 15.45 ? 177 PHE D O   1 
ATOM   6258 C  CB  . PHE D 1 177 ? 83.809  35.761  36.819  1.00 14.65 ? 177 PHE D CB  1 
ATOM   6259 C  CG  . PHE D 1 177 ? 83.391  37.125  36.354  1.00 16.34 ? 177 PHE D CG  1 
ATOM   6260 C  CD1 . PHE D 1 177 ? 83.441  37.461  35.003  1.00 16.32 ? 177 PHE D CD1 1 
ATOM   6261 C  CD2 . PHE D 1 177 ? 82.919  38.070  37.262  1.00 15.90 ? 177 PHE D CD2 1 
ATOM   6262 C  CE1 . PHE D 1 177 ? 83.018  38.721  34.561  1.00 17.12 ? 177 PHE D CE1 1 
ATOM   6263 C  CE2 . PHE D 1 177 ? 82.496  39.331  36.830  1.00 16.32 ? 177 PHE D CE2 1 
ATOM   6264 C  CZ  . PHE D 1 177 ? 82.545  39.654  35.474  1.00 15.43 ? 177 PHE D CZ  1 
ATOM   6265 N  N   . GLN D 1 178 ? 86.273  33.370  36.514  1.00 14.98 ? 178 GLN D N   1 
ATOM   6266 C  CA  . GLN D 1 178 ? 86.532  31.963  36.796  1.00 16.32 ? 178 GLN D CA  1 
ATOM   6267 C  C   . GLN D 1 178 ? 85.228  31.242  37.171  1.00 15.51 ? 178 GLN D C   1 
ATOM   6268 O  O   . GLN D 1 178 ? 84.261  31.271  36.410  1.00 15.05 ? 178 GLN D O   1 
ATOM   6269 C  CB  . GLN D 1 178 ? 87.573  31.802  37.911  1.00 17.33 ? 178 GLN D CB  1 
ATOM   6270 C  CG  . GLN D 1 178 ? 88.996  32.146  37.494  1.00 19.98 ? 178 GLN D CG  1 
ATOM   6271 C  CD  . GLN D 1 178 ? 89.304  33.628  37.612  1.00 23.25 ? 178 GLN D CD  1 
ATOM   6272 O  OE1 . GLN D 1 178 ? 89.153  34.218  38.681  1.00 27.21 ? 178 GLN D OE1 1 
ATOM   6273 N  NE2 . GLN D 1 178 ? 89.742  34.237  36.514  1.00 25.10 ? 178 GLN D NE2 1 
ATOM   6274 N  N   . ASN D 1 179 ? 85.198  30.611  38.342  1.00 14.82 ? 179 ASN D N   1 
ATOM   6275 C  CA  . ASN D 1 179 ? 84.020  29.872  38.800  1.00 16.16 ? 179 ASN D CA  1 
ATOM   6276 C  C   . ASN D 1 179 ? 82.872  30.739  39.327  1.00 16.65 ? 179 ASN D C   1 
ATOM   6277 O  O   . ASN D 1 179 ? 81.770  30.239  39.555  1.00 18.19 ? 179 ASN D O   1 
ATOM   6278 C  CB  . ASN D 1 179 ? 84.423  28.900  39.910  1.00 16.74 ? 179 ASN D CB  1 
ATOM   6279 C  CG  . ASN D 1 179 ? 84.936  29.620  41.150  1.00 19.16 ? 179 ASN D CG  1 
ATOM   6280 O  OD1 . ASN D 1 179 ? 85.995  30.252  41.125  1.00 21.80 ? 179 ASN D OD1 1 
ATOM   6281 N  ND2 . ASN D 1 179 ? 84.178  29.541  42.238  1.00 19.57 ? 179 ASN D ND2 1 
ATOM   6282 N  N   . ARG D 1 180 ? 83.116  32.030  39.514  1.00 15.75 ? 180 ARG D N   1 
ATOM   6283 C  CA  . ARG D 1 180 ? 82.091  32.907  40.069  1.00 17.04 ? 180 ARG D CA  1 
ATOM   6284 C  C   . ARG D 1 180 ? 81.026  33.389  39.087  1.00 16.56 ? 180 ARG D C   1 
ATOM   6285 O  O   . ARG D 1 180 ? 80.926  34.585  38.808  1.00 16.62 ? 180 ARG D O   1 
ATOM   6286 C  CB  . ARG D 1 180 ? 82.769  34.100  40.746  1.00 18.72 ? 180 ARG D CB  1 
ATOM   6287 C  CG  . ARG D 1 180 ? 83.939  33.689  41.643  1.00 21.04 ? 180 ARG D CG  1 
ATOM   6288 C  CD  . ARG D 1 180 ? 84.444  34.851  42.482  1.00 25.14 ? 180 ARG D CD  1 
ATOM   6289 N  NE  . ARG D 1 180 ? 84.816  36.009  41.671  1.00 30.20 ? 180 ARG D NE  1 
ATOM   6290 C  CZ  . ARG D 1 180 ? 85.886  36.063  40.888  1.00 31.19 ? 180 ARG D CZ  1 
ATOM   6291 N  NH1 . ARG D 1 180 ? 86.703  35.022  40.805  1.00 33.60 ? 180 ARG D NH1 1 
ATOM   6292 N  NH2 . ARG D 1 180 ? 86.134  37.160  40.185  1.00 34.17 ? 180 ARG D NH2 1 
ATOM   6293 N  N   . ARG D 1 181 ? 80.223  32.460  38.573  1.00 15.84 ? 181 ARG D N   1 
ATOM   6294 C  CA  . ARG D 1 181 ? 79.166  32.826  37.635  1.00 16.76 ? 181 ARG D CA  1 
ATOM   6295 C  C   . ARG D 1 181 ? 78.219  33.880  38.229  1.00 17.13 ? 181 ARG D C   1 
ATOM   6296 O  O   . ARG D 1 181 ? 77.746  34.765  37.517  1.00 17.00 ? 181 ARG D O   1 
ATOM   6297 C  CB  . ARG D 1 181 ? 78.344  31.601  37.206  1.00 14.37 ? 181 ARG D CB  1 
ATOM   6298 C  CG  . ARG D 1 181 ? 77.323  31.939  36.115  1.00 13.24 ? 181 ARG D CG  1 
ATOM   6299 C  CD  . ARG D 1 181 ? 76.296  30.850  35.884  1.00 13.33 ? 181 ARG D CD  1 
ATOM   6300 N  NE  . ARG D 1 181 ? 76.862  29.653  35.275  1.00 13.25 ? 181 ARG D NE  1 
ATOM   6301 C  CZ  . ARG D 1 181 ? 76.143  28.599  34.901  1.00 14.89 ? 181 ARG D CZ  1 
ATOM   6302 N  NH1 . ARG D 1 181 ? 74.828  28.597  35.071  1.00 16.08 ? 181 ARG D NH1 1 
ATOM   6303 N  NH2 . ARG D 1 181 ? 76.735  27.542  34.361  1.00 13.66 ? 181 ARG D NH2 1 
ATOM   6304 N  N   . PRO D 1 182 ? 77.927  33.795  39.541  1.00 18.11 ? 182 PRO D N   1 
ATOM   6305 C  CA  . PRO D 1 182 ? 77.029  34.777  40.161  1.00 18.37 ? 182 PRO D CA  1 
ATOM   6306 C  C   . PRO D 1 182 ? 77.499  36.219  39.983  1.00 18.63 ? 182 PRO D C   1 
ATOM   6307 O  O   . PRO D 1 182 ? 76.685  37.116  39.759  1.00 18.97 ? 182 PRO D O   1 
ATOM   6308 C  CB  . PRO D 1 182 ? 77.019  34.356  41.632  1.00 19.34 ? 182 PRO D CB  1 
ATOM   6309 C  CG  . PRO D 1 182 ? 77.219  32.861  41.556  1.00 18.13 ? 182 PRO D CG  1 
ATOM   6310 C  CD  . PRO D 1 182 ? 78.316  32.758  40.519  1.00 17.40 ? 182 PRO D CD  1 
ATOM   6311 N  N   . ASP D 1 183 ? 78.808  36.442  40.092  1.00 19.54 ? 183 ASP D N   1 
ATOM   6312 C  CA  . ASP D 1 183 ? 79.362  37.788  39.937  1.00 19.67 ? 183 ASP D CA  1 
ATOM   6313 C  C   . ASP D 1 183 ? 79.184  38.256  38.507  1.00 19.46 ? 183 ASP D C   1 
ATOM   6314 O  O   . ASP D 1 183 ? 78.914  39.432  38.246  1.00 19.73 ? 183 ASP D O   1 
ATOM   6315 C  CB  . ASP D 1 183 ? 80.852  37.815  40.275  1.00 20.75 ? 183 ASP D CB  1 
ATOM   6316 C  CG  . ASP D 1 183 ? 81.124  37.542  41.736  1.00 25.23 ? 183 ASP D CG  1 
ATOM   6317 O  OD1 . ASP D 1 183 ? 80.240  37.821  42.575  1.00 25.40 ? 183 ASP D OD1 1 
ATOM   6318 O  OD2 . ASP D 1 183 ? 82.234  37.060  42.048  1.00 28.91 ? 183 ASP D OD2 1 
ATOM   6319 N  N   . TYR D 1 184 ? 79.362  37.320  37.582  1.00 17.92 ? 184 TYR D N   1 
ATOM   6320 C  CA  . TYR D 1 184 ? 79.221  37.599  36.163  1.00 16.16 ? 184 TYR D CA  1 
ATOM   6321 C  C   . TYR D 1 184 ? 77.784  38.023  35.868  1.00 16.12 ? 184 TYR D C   1 
ATOM   6322 O  O   . TYR D 1 184 ? 77.547  38.996  35.155  1.00 17.02 ? 184 TYR D O   1 
ATOM   6323 C  CB  . TYR D 1 184 ? 79.588  36.344  35.366  1.00 14.15 ? 184 TYR D CB  1 
ATOM   6324 C  CG  . TYR D 1 184 ? 79.153  36.350  33.922  1.00 12.12 ? 184 TYR D CG  1 
ATOM   6325 C  CD1 . TYR D 1 184 ? 79.667  37.277  33.017  1.00 11.86 ? 184 TYR D CD1 1 
ATOM   6326 C  CD2 . TYR D 1 184 ? 78.259  35.388  33.446  1.00 13.54 ? 184 TYR D CD2 1 
ATOM   6327 C  CE1 . TYR D 1 184 ? 79.309  37.241  31.665  1.00 11.80 ? 184 TYR D CE1 1 
ATOM   6328 C  CE2 . TYR D 1 184 ? 77.893  35.341  32.099  1.00 13.33 ? 184 TYR D CE2 1 
ATOM   6329 C  CZ  . TYR D 1 184 ? 78.423  36.267  31.216  1.00 14.21 ? 184 TYR D CZ  1 
ATOM   6330 O  OH  . TYR D 1 184 ? 78.087  36.202  29.883  1.00 15.63 ? 184 TYR D OH  1 
ATOM   6331 N  N   . ILE D 1 185 ? 76.829  37.286  36.427  1.00 16.08 ? 185 ILE D N   1 
ATOM   6332 C  CA  . ILE D 1 185 ? 75.414  37.581  36.228  1.00 18.30 ? 185 ILE D CA  1 
ATOM   6333 C  C   . ILE D 1 185 ? 75.041  38.976  36.744  1.00 19.66 ? 185 ILE D C   1 
ATOM   6334 O  O   . ILE D 1 185 ? 74.279  39.694  36.100  1.00 20.00 ? 185 ILE D O   1 
ATOM   6335 C  CB  . ILE D 1 185 ? 74.537  36.513  36.920  1.00 16.67 ? 185 ILE D CB  1 
ATOM   6336 C  CG1 . ILE D 1 185 ? 74.756  35.160  36.240  1.00 15.98 ? 185 ILE D CG1 1 
ATOM   6337 C  CG2 . ILE D 1 185 ? 73.075  36.905  36.855  1.00 16.29 ? 185 ILE D CG2 1 
ATOM   6338 C  CD1 . ILE D 1 185 ? 74.108  33.997  36.954  1.00 15.68 ? 185 ILE D CD1 1 
ATOM   6339 N  N   . LYS D 1 186 ? 75.583  39.354  37.900  1.00 21.57 ? 186 LYS D N   1 
ATOM   6340 C  CA  . LYS D 1 186 ? 75.317  40.669  38.493  1.00 24.46 ? 186 LYS D CA  1 
ATOM   6341 C  C   . LYS D 1 186 ? 75.876  41.765  37.601  1.00 23.27 ? 186 LYS D C   1 
ATOM   6342 O  O   . LYS D 1 186 ? 75.252  42.802  37.391  1.00 24.08 ? 186 LYS D O   1 
ATOM   6343 C  CB  . LYS D 1 186 ? 75.998  40.801  39.861  1.00 27.63 ? 186 LYS D CB  1 
ATOM   6344 C  CG  . LYS D 1 186 ? 75.469  39.892  40.950  1.00 33.19 ? 186 LYS D CG  1 
ATOM   6345 C  CD  . LYS D 1 186 ? 74.081  40.308  41.407  1.00 37.88 ? 186 LYS D CD  1 
ATOM   6346 C  CE  . LYS D 1 186 ? 73.629  39.455  42.593  1.00 39.99 ? 186 LYS D CE  1 
ATOM   6347 N  NZ  . LYS D 1 186 ? 72.245  39.788  43.031  1.00 41.02 ? 186 LYS D NZ  1 
ATOM   6348 N  N   . GLU D 1 187 ? 77.078  41.529  37.100  1.00 22.73 ? 187 GLU D N   1 
ATOM   6349 C  CA  . GLU D 1 187 ? 77.749  42.489  36.244  1.00 23.65 ? 187 GLU D CA  1 
ATOM   6350 C  C   . GLU D 1 187 ? 76.951  42.716  34.956  1.00 22.49 ? 187 GLU D C   1 
ATOM   6351 O  O   . GLU D 1 187 ? 76.976  43.805  34.378  1.00 22.15 ? 187 GLU D O   1 
ATOM   6352 C  CB  . GLU D 1 187 ? 79.151  41.974  35.926  1.00 24.45 ? 187 GLU D CB  1 
ATOM   6353 C  CG  . GLU D 1 187 ? 80.168  43.058  35.713  1.00 30.17 ? 187 GLU D CG  1 
ATOM   6354 C  CD  . GLU D 1 187 ? 80.332  43.944  36.927  1.00 31.18 ? 187 GLU D CD  1 
ATOM   6355 O  OE1 . GLU D 1 187 ? 80.748  43.437  37.988  1.00 33.07 ? 187 GLU D OE1 1 
ATOM   6356 O  OE2 . GLU D 1 187 ? 80.042  45.151  36.818  1.00 33.60 ? 187 GLU D OE2 1 
ATOM   6357 N  N   . PHE D 1 188 ? 76.230  41.685  34.525  1.00 20.55 ? 188 PHE D N   1 
ATOM   6358 C  CA  . PHE D 1 188 ? 75.421  41.740  33.307  1.00 19.08 ? 188 PHE D CA  1 
ATOM   6359 C  C   . PHE D 1 188 ? 74.389  42.880  33.315  1.00 19.28 ? 188 PHE D C   1 
ATOM   6360 O  O   . PHE D 1 188 ? 74.105  43.485  32.281  1.00 18.28 ? 188 PHE D O   1 
ATOM   6361 C  CB  . PHE D 1 188 ? 74.725  40.381  33.117  1.00 18.22 ? 188 PHE D CB  1 
ATOM   6362 C  CG  . PHE D 1 188 ? 73.725  40.343  31.992  1.00 17.06 ? 188 PHE D CG  1 
ATOM   6363 C  CD1 . PHE D 1 188 ? 74.119  40.560  30.675  1.00 18.18 ? 188 PHE D CD1 1 
ATOM   6364 C  CD2 . PHE D 1 188 ? 72.386  40.063  32.251  1.00 17.76 ? 188 PHE D CD2 1 
ATOM   6365 C  CE1 . PHE D 1 188 ? 73.196  40.494  29.631  1.00 17.53 ? 188 PHE D CE1 1 
ATOM   6366 C  CE2 . PHE D 1 188 ? 71.453  39.997  31.216  1.00 17.81 ? 188 PHE D CE2 1 
ATOM   6367 C  CZ  . PHE D 1 188 ? 71.858  40.211  29.905  1.00 17.83 ? 188 PHE D CZ  1 
ATOM   6368 N  N   . TRP D 1 189 ? 73.830  43.176  34.481  1.00 19.91 ? 189 TRP D N   1 
ATOM   6369 C  CA  . TRP D 1 189 ? 72.827  44.230  34.584  1.00 20.14 ? 189 TRP D CA  1 
ATOM   6370 C  C   . TRP D 1 189 ? 73.364  45.591  34.169  1.00 19.97 ? 189 TRP D C   1 
ATOM   6371 O  O   . TRP D 1 189 ? 72.605  46.471  33.778  1.00 21.32 ? 189 TRP D O   1 
ATOM   6372 C  CB  . TRP D 1 189 ? 72.281  44.289  36.013  1.00 18.27 ? 189 TRP D CB  1 
ATOM   6373 C  CG  . TRP D 1 189 ? 71.568  43.038  36.397  1.00 19.35 ? 189 TRP D CG  1 
ATOM   6374 C  CD1 . TRP D 1 189 ? 71.828  42.243  37.475  1.00 20.44 ? 189 TRP D CD1 1 
ATOM   6375 C  CD2 . TRP D 1 189 ? 70.489  42.417  35.691  1.00 18.18 ? 189 TRP D CD2 1 
ATOM   6376 N  NE1 . TRP D 1 189 ? 70.977  41.164  37.483  1.00 19.65 ? 189 TRP D NE1 1 
ATOM   6377 C  CE2 . TRP D 1 189 ? 70.145  41.248  36.398  1.00 19.54 ? 189 TRP D CE2 1 
ATOM   6378 C  CE3 . TRP D 1 189 ? 69.779  42.737  34.528  1.00 20.92 ? 189 TRP D CE3 1 
ATOM   6379 C  CZ2 . TRP D 1 189 ? 69.121  40.393  35.979  1.00 21.62 ? 189 TRP D CZ2 1 
ATOM   6380 C  CZ3 . TRP D 1 189 ? 68.759  41.885  34.111  1.00 22.26 ? 189 TRP D CZ3 1 
ATOM   6381 C  CH2 . TRP D 1 189 ? 68.441  40.728  34.836  1.00 20.90 ? 189 TRP D CH2 1 
ATOM   6382 N  N   . ASN D 1 190 ? 74.676  45.761  34.247  1.00 20.45 ? 190 ASN D N   1 
ATOM   6383 C  CA  . ASN D 1 190 ? 75.287  47.022  33.874  1.00 21.30 ? 190 ASN D CA  1 
ATOM   6384 C  C   . ASN D 1 190 ? 75.490  47.157  32.370  1.00 23.30 ? 190 ASN D C   1 
ATOM   6385 O  O   . ASN D 1 190 ? 75.720  48.260  31.872  1.00 25.66 ? 190 ASN D O   1 
ATOM   6386 C  CB  . ASN D 1 190 ? 76.622  47.185  34.596  1.00 23.04 ? 190 ASN D CB  1 
ATOM   6387 C  CG  . ASN D 1 190 ? 76.462  47.195  36.099  1.00 24.36 ? 190 ASN D CG  1 
ATOM   6388 O  OD1 . ASN D 1 190 ? 75.691  47.985  36.641  1.00 26.21 ? 190 ASN D OD1 1 
ATOM   6389 N  ND2 . ASN D 1 190 ? 77.185  46.318  36.782  1.00 23.92 ? 190 ASN D ND2 1 
ATOM   6390 N  N   . VAL D 1 191 ? 75.390  46.051  31.635  1.00 22.67 ? 191 VAL D N   1 
ATOM   6391 C  CA  . VAL D 1 191 ? 75.591  46.114  30.192  1.00 22.47 ? 191 VAL D CA  1 
ATOM   6392 C  C   . VAL D 1 191 ? 74.429  45.633  29.334  1.00 22.49 ? 191 VAL D C   1 
ATOM   6393 O  O   . VAL D 1 191 ? 74.555  45.546  28.117  1.00 23.94 ? 191 VAL D O   1 
ATOM   6394 C  CB  . VAL D 1 191 ? 76.859  45.348  29.788  1.00 21.50 ? 191 VAL D CB  1 
ATOM   6395 C  CG1 . VAL D 1 191 ? 78.078  46.001  30.427  1.00 19.44 ? 191 VAL D CG1 1 
ATOM   6396 C  CG2 . VAL D 1 191 ? 76.743  43.895  30.225  1.00 22.14 ? 191 VAL D CG2 1 
ATOM   6397 N  N   . VAL D 1 192 ? 73.299  45.317  29.955  1.00 23.82 ? 192 VAL D N   1 
ATOM   6398 C  CA  . VAL D 1 192 ? 72.125  44.880  29.194  1.00 25.43 ? 192 VAL D CA  1 
ATOM   6399 C  C   . VAL D 1 192 ? 71.646  46.078  28.384  1.00 24.53 ? 192 VAL D C   1 
ATOM   6400 O  O   . VAL D 1 192 ? 71.431  47.148  28.948  1.00 25.39 ? 192 VAL D O   1 
ATOM   6401 C  CB  . VAL D 1 192 ? 70.944  44.480  30.113  1.00 26.86 ? 192 VAL D CB  1 
ATOM   6402 C  CG1 . VAL D 1 192 ? 69.786  43.965  29.269  1.00 27.30 ? 192 VAL D CG1 1 
ATOM   6403 C  CG2 . VAL D 1 192 ? 71.378  43.440  31.112  1.00 29.29 ? 192 VAL D CG2 1 
ATOM   6404 N  N   . ASN D 1 193 ? 71.468  45.906  27.079  1.00 23.90 ? 193 ASN D N   1 
ATOM   6405 C  CA  . ASN D 1 193 ? 71.004  47.005  26.233  1.00 22.84 ? 193 ASN D CA  1 
ATOM   6406 C  C   . ASN D 1 193 ? 69.479  47.061  26.275  1.00 23.30 ? 193 ASN D C   1 
ATOM   6407 O  O   . ASN D 1 193 ? 68.802  46.369  25.514  1.00 21.40 ? 193 ASN D O   1 
ATOM   6408 C  CB  . ASN D 1 193 ? 71.465  46.796  24.790  1.00 25.12 ? 193 ASN D CB  1 
ATOM   6409 C  CG  . ASN D 1 193 ? 71.154  47.988  23.892  1.00 26.07 ? 193 ASN D CG  1 
ATOM   6410 O  OD1 . ASN D 1 193 ? 70.163  48.700  24.091  1.00 26.09 ? 193 ASN D OD1 1 
ATOM   6411 N  ND2 . ASN D 1 193 ? 71.993  48.196  22.886  1.00 23.90 ? 193 ASN D ND2 1 
ATOM   6412 N  N   . TRP D 1 194 ? 68.937  47.890  27.160  1.00 23.04 ? 194 TRP D N   1 
ATOM   6413 C  CA  . TRP D 1 194 ? 67.491  48.004  27.281  1.00 22.95 ? 194 TRP D CA  1 
ATOM   6414 C  C   . TRP D 1 194 ? 66.822  48.605  26.055  1.00 23.19 ? 194 TRP D C   1 
ATOM   6415 O  O   . TRP D 1 194 ? 65.654  48.316  25.782  1.00 24.28 ? 194 TRP D O   1 
ATOM   6416 C  CB  . TRP D 1 194 ? 67.118  48.815  28.527  1.00 24.00 ? 194 TRP D CB  1 
ATOM   6417 C  CG  . TRP D 1 194 ? 67.443  48.096  29.797  1.00 23.37 ? 194 TRP D CG  1 
ATOM   6418 C  CD1 . TRP D 1 194 ? 68.369  48.459  30.735  1.00 24.29 ? 194 TRP D CD1 1 
ATOM   6419 C  CD2 . TRP D 1 194 ? 66.882  46.854  30.243  1.00 22.70 ? 194 TRP D CD2 1 
ATOM   6420 N  NE1 . TRP D 1 194 ? 68.420  47.516  31.737  1.00 24.59 ? 194 TRP D NE1 1 
ATOM   6421 C  CE2 . TRP D 1 194 ? 67.519  46.521  31.458  1.00 23.08 ? 194 TRP D CE2 1 
ATOM   6422 C  CE3 . TRP D 1 194 ? 65.905  45.988  29.729  1.00 23.89 ? 194 TRP D CE3 1 
ATOM   6423 C  CZ2 . TRP D 1 194 ? 67.211  45.355  32.171  1.00 22.88 ? 194 TRP D CZ2 1 
ATOM   6424 C  CZ3 . TRP D 1 194 ? 65.598  44.827  30.439  1.00 23.19 ? 194 TRP D CZ3 1 
ATOM   6425 C  CH2 . TRP D 1 194 ? 66.252  44.524  31.647  1.00 22.29 ? 194 TRP D CH2 1 
ATOM   6426 N  N   . ASP D 1 195 ? 67.547  49.431  25.307  1.00 23.17 ? 195 ASP D N   1 
ATOM   6427 C  CA  . ASP D 1 195 ? 66.968  50.031  24.107  1.00 24.19 ? 195 ASP D CA  1 
ATOM   6428 C  C   . ASP D 1 195 ? 66.651  48.932  23.090  1.00 24.76 ? 195 ASP D C   1 
ATOM   6429 O  O   . ASP D 1 195 ? 65.557  48.890  22.519  1.00 24.96 ? 195 ASP D O   1 
ATOM   6430 C  CB  . ASP D 1 195 ? 67.935  51.052  23.485  1.00 26.25 ? 195 ASP D CB  1 
ATOM   6431 C  CG  . ASP D 1 195 ? 68.270  52.195  24.429  1.00 27.32 ? 195 ASP D CG  1 
ATOM   6432 O  OD1 . ASP D 1 195 ? 67.387  52.591  25.219  1.00 26.71 ? 195 ASP D OD1 1 
ATOM   6433 O  OD2 . ASP D 1 195 ? 69.412  52.703  24.372  1.00 29.35 ? 195 ASP D OD2 1 
ATOM   6434 N  N   . GLU D 1 196 ? 67.614  48.040  22.872  1.00 24.62 ? 196 GLU D N   1 
ATOM   6435 C  CA  . GLU D 1 196 ? 67.444  46.937  21.931  1.00 23.72 ? 196 GLU D CA  1 
ATOM   6436 C  C   . GLU D 1 196 ? 66.345  46.006  22.432  1.00 23.18 ? 196 GLU D C   1 
ATOM   6437 O  O   . GLU D 1 196 ? 65.530  45.516  21.655  1.00 22.63 ? 196 GLU D O   1 
ATOM   6438 C  CB  . GLU D 1 196 ? 68.760  46.170  21.794  1.00 26.32 ? 196 GLU D CB  1 
ATOM   6439 C  CG  . GLU D 1 196 ? 68.761  45.110  20.717  1.00 28.72 ? 196 GLU D CG  1 
ATOM   6440 C  CD  . GLU D 1 196 ? 68.415  45.678  19.362  1.00 31.17 ? 196 GLU D CD  1 
ATOM   6441 O  OE1 . GLU D 1 196 ? 68.894  46.791  19.052  1.00 32.45 ? 196 GLU D OE1 1 
ATOM   6442 O  OE2 . GLU D 1 196 ? 67.674  45.013  18.606  1.00 31.52 ? 196 GLU D OE2 1 
ATOM   6443 N  N   . ALA D 1 197 ? 66.329  45.768  23.738  1.00 22.98 ? 197 ALA D N   1 
ATOM   6444 C  CA  . ALA D 1 197 ? 65.317  44.907  24.338  1.00 24.57 ? 197 ALA D CA  1 
ATOM   6445 C  C   . ALA D 1 197 ? 63.931  45.504  24.096  1.00 25.28 ? 197 ALA D C   1 
ATOM   6446 O  O   . ALA D 1 197 ? 62.991  44.792  23.735  1.00 25.77 ? 197 ALA D O   1 
ATOM   6447 C  CB  . ALA D 1 197 ? 65.573  44.760  25.831  1.00 23.09 ? 197 ALA D CB  1 
ATOM   6448 N  N   . ALA D 1 198 ? 63.814  46.813  24.302  1.00 25.15 ? 198 ALA D N   1 
ATOM   6449 C  CA  . ALA D 1 198 ? 62.550  47.517  24.096  1.00 24.98 ? 198 ALA D CA  1 
ATOM   6450 C  C   . ALA D 1 198 ? 62.133  47.412  22.632  1.00 24.88 ? 198 ALA D C   1 
ATOM   6451 O  O   . ALA D 1 198 ? 60.962  47.179  22.323  1.00 25.01 ? 198 ALA D O   1 
ATOM   6452 C  CB  . ALA D 1 198 ? 62.700  48.986  24.493  1.00 24.01 ? 198 ALA D CB  1 
ATOM   6453 N  N   . ALA D 1 199 ? 63.102  47.583  21.737  1.00 24.20 ? 199 ALA D N   1 
ATOM   6454 C  CA  . ALA D 1 199 ? 62.848  47.504  20.305  1.00 25.24 ? 199 ALA D CA  1 
ATOM   6455 C  C   . ALA D 1 199 ? 62.266  46.143  19.918  1.00 26.79 ? 199 ALA D C   1 
ATOM   6456 O  O   . ALA D 1 199 ? 61.275  46.065  19.191  1.00 26.35 ? 199 ALA D O   1 
ATOM   6457 C  CB  . ALA D 1 199 ? 64.137  47.758  19.538  1.00 23.73 ? 199 ALA D CB  1 
ATOM   6458 N  N   . ARG D 1 200 ? 62.886  45.072  20.407  1.00 28.12 ? 200 ARG D N   1 
ATOM   6459 C  CA  . ARG D 1 200 ? 62.423  43.723  20.100  1.00 28.60 ? 200 ARG D CA  1 
ATOM   6460 C  C   . ARG D 1 200 ? 61.042  43.479  20.700  1.00 29.19 ? 200 ARG D C   1 
ATOM   6461 O  O   . ARG D 1 200 ? 60.211  42.794  20.105  1.00 28.09 ? 200 ARG D O   1 
ATOM   6462 C  CB  . ARG D 1 200 ? 63.428  42.679  20.618  1.00 27.88 ? 200 ARG D CB  1 
ATOM   6463 C  CG  . ARG D 1 200 ? 64.801  42.742  19.934  1.00 27.76 ? 200 ARG D CG  1 
ATOM   6464 C  CD  . ARG D 1 200 ? 65.758  41.690  20.478  1.00 25.54 ? 200 ARG D CD  1 
ATOM   6465 N  NE  . ARG D 1 200 ? 65.263  40.338  20.239  1.00 23.92 ? 200 ARG D NE  1 
ATOM   6466 C  CZ  . ARG D 1 200 ? 65.405  39.679  19.093  1.00 23.80 ? 200 ARG D CZ  1 
ATOM   6467 N  NH1 . ARG D 1 200 ? 66.040  40.243  18.070  1.00 20.26 ? 200 ARG D NH1 1 
ATOM   6468 N  NH2 . ARG D 1 200 ? 64.899  38.457  18.964  1.00 20.72 ? 200 ARG D NH2 1 
ATOM   6469 N  N   . PHE D 1 201 ? 60.795  44.047  21.875  1.00 30.71 ? 201 PHE D N   1 
ATOM   6470 C  CA  . PHE D 1 201 ? 59.499  43.884  22.525  1.00 33.25 ? 201 PHE D CA  1 
ATOM   6471 C  C   . PHE D 1 201 ? 58.397  44.547  21.697  1.00 34.93 ? 201 PHE D C   1 
ATOM   6472 O  O   . PHE D 1 201 ? 57.267  44.056  21.641  1.00 34.55 ? 201 PHE D O   1 
ATOM   6473 C  CB  . PHE D 1 201 ? 59.518  44.499  23.923  1.00 32.25 ? 201 PHE D CB  1 
ATOM   6474 C  CG  . PHE D 1 201 ? 58.208  44.388  24.646  1.00 32.88 ? 201 PHE D CG  1 
ATOM   6475 C  CD1 . PHE D 1 201 ? 57.725  43.150  25.049  1.00 32.95 ? 201 PHE D CD1 1 
ATOM   6476 C  CD2 . PHE D 1 201 ? 57.448  45.522  24.917  1.00 33.98 ? 201 PHE D CD2 1 
ATOM   6477 C  CE1 . PHE D 1 201 ? 56.504  43.041  25.714  1.00 33.74 ? 201 PHE D CE1 1 
ATOM   6478 C  CE2 . PHE D 1 201 ? 56.223  45.423  25.581  1.00 32.92 ? 201 PHE D CE2 1 
ATOM   6479 C  CZ  . PHE D 1 201 ? 55.753  44.180  25.980  1.00 32.76 ? 201 PHE D CZ  1 
ATOM   6480 N  N   . ALA D 1 202 ? 58.738  45.663  21.058  1.00 36.72 ? 202 ALA D N   1 
ATOM   6481 C  CA  . ALA D 1 202 ? 57.792  46.401  20.231  1.00 39.72 ? 202 ALA D CA  1 
ATOM   6482 C  C   . ALA D 1 202 ? 57.468  45.641  18.948  1.00 42.05 ? 202 ALA D C   1 
ATOM   6483 O  O   . ALA D 1 202 ? 56.315  45.588  18.523  1.00 43.19 ? 202 ALA D O   1 
ATOM   6484 C  CB  . ALA D 1 202 ? 58.360  47.774  19.894  1.00 37.61 ? 202 ALA D CB  1 
ATOM   6485 N  N   . ALA D 1 203 ? 58.490  45.049  18.336  1.00 44.98 ? 203 ALA D N   1 
ATOM   6486 C  CA  . ALA D 1 203 ? 58.311  44.295  17.100  1.00 47.26 ? 203 ALA D CA  1 
ATOM   6487 C  C   . ALA D 1 203 ? 57.520  43.009  17.327  1.00 49.84 ? 203 ALA D C   1 
ATOM   6488 O  O   . ALA D 1 203 ? 56.648  42.663  16.530  1.00 49.98 ? 203 ALA D O   1 
ATOM   6489 C  CB  . ALA D 1 203 ? 59.667  43.970  16.491  1.00 46.28 ? 203 ALA D CB  1 
ATOM   6490 N  N   . LYS D 1 204 ? 57.836  42.309  18.415  1.00 53.43 ? 204 LYS D N   1 
ATOM   6491 C  CA  . LYS D 1 204 ? 57.174  41.054  18.776  1.00 56.23 ? 204 LYS D CA  1 
ATOM   6492 C  C   . LYS D 1 204 ? 57.425  39.915  17.788  1.00 58.56 ? 204 LYS D C   1 
ATOM   6493 O  O   . LYS D 1 204 ? 56.899  38.812  17.953  1.00 58.77 ? 204 LYS D O   1 
ATOM   6494 C  CB  . LYS D 1 204 ? 55.667  41.276  18.939  1.00 56.60 ? 204 LYS D CB  1 
ATOM   6495 C  CG  . LYS D 1 204 ? 55.303  42.071  20.182  1.00 57.59 ? 204 LYS D CG  1 
ATOM   6496 C  CD  . LYS D 1 204 ? 53.812  42.325  20.273  1.00 57.51 ? 204 LYS D CD  1 
ATOM   6497 C  CE  . LYS D 1 204 ? 53.445  42.893  21.637  1.00 58.29 ? 204 LYS D CE  1 
ATOM   6498 N  NZ  . LYS D 1 204 ? 54.223  44.120  21.975  1.00 57.81 ? 204 LYS D NZ  1 
ATOM   6499 N  N   . LYS D 1 205 ? 58.235  40.177  16.767  1.00 60.96 ? 205 LYS D N   1 
ATOM   6500 C  CA  . LYS D 1 205 ? 58.542  39.163  15.764  1.00 63.63 ? 205 LYS D CA  1 
ATOM   6501 C  C   . LYS D 1 205 ? 59.752  39.567  14.926  1.00 64.44 ? 205 LYS D C   1 
ATOM   6502 O  O   . LYS D 1 205 ? 60.338  40.635  15.208  1.00 64.96 ? 205 LYS D O   1 
ATOM   6503 C  CB  . LYS D 1 205 ? 57.326  38.934  14.853  1.00 65.27 ? 205 LYS D CB  1 
ATOM   6504 C  CG  . LYS D 1 205 ? 56.896  40.157  14.043  1.00 67.25 ? 205 LYS D CG  1 
ATOM   6505 C  CD  . LYS D 1 205 ? 55.555  39.933  13.348  1.00 68.69 ? 205 LYS D CD  1 
ATOM   6506 C  CE  . LYS D 1 205 ? 55.613  38.769  12.365  1.00 70.55 ? 205 LYS D CE  1 
ATOM   6507 N  NZ  . LYS D 1 205 ? 54.299  38.522  11.702  1.00 70.58 ? 205 LYS D NZ  1 
ATOM   6508 O  OXT . LYS D 1 205 ? 60.101  38.808  13.999  1.00 65.90 ? 205 LYS D OXT 1 
HETATM 6509 MN MN  . MN  E 2 .   ? 33.561  15.401  9.653   1.00 11.69 ? 501 MN  A MN  1 
HETATM 6510 MN MN  . MN  F 2 .   ? 22.291  23.272  21.874  1.00 13.04 ? 502 MN  B MN  1 
HETATM 6511 MN MN  . MN  G 2 .   ? 85.729  19.710  35.991  1.00 10.35 ? 503 MN  C MN  1 
HETATM 6512 MN MN  . MN  H 2 .   ? 79.206  32.071  23.893  1.00 10.59 ? 504 MN  D MN  1 
HETATM 6513 O  O   . HOH I 3 .   ? 33.656  14.780  -6.356  1.00 25.60 ? 502 HOH A O   1 
HETATM 6514 O  O   . HOH I 3 .   ? 40.322  7.302   0.559   1.00 28.46 ? 503 HOH A O   1 
HETATM 6515 O  O   . HOH I 3 .   ? 33.533  5.667   -1.992  1.00 20.90 ? 504 HOH A O   1 
HETATM 6516 O  O   . HOH I 3 .   ? 30.856  1.058   8.716   1.00 14.60 ? 505 HOH A O   1 
HETATM 6517 O  O   . HOH I 3 .   ? 26.874  0.596   14.432  1.00 25.19 ? 506 HOH A O   1 
HETATM 6518 O  O   . HOH I 3 .   ? 24.316  0.369   11.592  1.00 28.11 ? 507 HOH A O   1 
HETATM 6519 O  O   . HOH I 3 .   ? 27.066  8.009   14.529  1.00 13.06 ? 508 HOH A O   1 
HETATM 6520 O  O   . HOH I 3 .   ? 23.031  4.913   12.137  1.00 22.51 ? 509 HOH A O   1 
HETATM 6521 O  O   . HOH I 3 .   ? 23.570  2.655   10.092  1.00 22.51 ? 510 HOH A O   1 
HETATM 6522 O  O   . HOH I 3 .   ? 32.300  8.832   9.770   1.00 14.21 ? 511 HOH A O   1 
HETATM 6523 O  O   . HOH I 3 .   ? 30.252  19.961  4.796   1.00 21.86 ? 512 HOH A O   1 
HETATM 6524 O  O   . HOH I 3 .   ? 31.681  12.780  -6.317  1.00 16.15 ? 513 HOH A O   1 
HETATM 6525 O  O   . HOH I 3 .   ? 44.652  17.347  -3.496  1.00 25.55 ? 514 HOH A O   1 
HETATM 6526 O  O   . HOH I 3 .   ? 38.544  25.513  9.941   1.00 13.00 ? 515 HOH A O   1 
HETATM 6527 O  O   . HOH I 3 .   ? 45.179  17.780  7.844   1.00 28.74 ? 516 HOH A O   1 
HETATM 6528 O  O   . HOH I 3 .   ? 41.007  9.791   1.283   1.00 17.97 ? 517 HOH A O   1 
HETATM 6529 O  O   . HOH I 3 .   ? 42.744  10.752  -0.566  1.00 33.93 ? 518 HOH A O   1 
HETATM 6530 O  O   . HOH I 3 .   ? 42.077  13.597  -1.394  1.00 36.95 ? 519 HOH A O   1 
HETATM 6531 O  O   . HOH I 3 .   ? 45.531  8.479   7.312   1.00 13.35 ? 520 HOH A O   1 
HETATM 6532 O  O   . HOH I 3 .   ? 42.115  -1.910  13.430  1.00 20.96 ? 521 HOH A O   1 
HETATM 6533 O  O   . HOH I 3 .   ? 48.344  -4.664  12.066  1.00 35.39 ? 522 HOH A O   1 
HETATM 6534 O  O   . HOH I 3 .   ? 41.474  19.381  23.313  1.00 25.44 ? 523 HOH A O   1 
HETATM 6535 O  O   . HOH I 3 .   ? 38.180  23.498  23.272  1.00 21.51 ? 524 HOH A O   1 
HETATM 6536 O  O   . HOH I 3 .   ? 36.106  24.260  18.700  1.00 12.42 ? 525 HOH A O   1 
HETATM 6537 O  O   . HOH I 3 .   ? 31.723  20.381  22.744  1.00 11.55 ? 526 HOH A O   1 
HETATM 6538 O  O   . HOH I 3 .   ? 28.099  21.259  16.759  1.00 7.03  ? 527 HOH A O   1 
HETATM 6539 O  O   . HOH I 3 .   ? 51.033  15.698  23.963  1.00 36.01 ? 528 HOH A O   1 
HETATM 6540 O  O   . HOH I 3 .   ? 38.763  27.494  13.050  1.00 18.57 ? 529 HOH A O   1 
HETATM 6541 O  O   . HOH I 3 .   ? 49.893  29.197  10.875  1.00 36.54 ? 530 HOH A O   1 
HETATM 6542 O  O   . HOH I 3 .   ? 42.361  25.533  15.558  1.00 17.31 ? 531 HOH A O   1 
HETATM 6543 O  O   . HOH I 3 .   ? 46.514  7.901   9.824   1.00 21.83 ? 532 HOH A O   1 
HETATM 6544 O  O   . HOH I 3 .   ? 27.914  12.354  9.220   1.00 20.55 ? 533 HOH A O   1 
HETATM 6545 O  O   . HOH I 3 .   ? 32.521  8.840   12.408  1.00 19.64 ? 534 HOH A O   1 
HETATM 6546 O  O   . HOH I 3 .   ? 42.491  -0.526  15.908  1.00 25.34 ? 535 HOH A O   1 
HETATM 6547 O  O   . HOH I 3 .   ? 45.451  5.894   11.433  1.00 15.51 ? 536 HOH A O   1 
HETATM 6548 O  O   . HOH I 3 .   ? 47.425  8.861   5.037   1.00 27.07 ? 537 HOH A O   1 
HETATM 6549 O  O   . HOH I 3 .   ? 33.242  20.867  -8.017  1.00 12.91 ? 538 HOH A O   1 
HETATM 6550 O  O   . HOH I 3 .   ? 33.587  19.115  24.960  1.00 36.47 ? 539 HOH A O   1 
HETATM 6551 O  O   . HOH I 3 .   ? 27.657  19.608  5.005   1.00 38.43 ? 540 HOH A O   1 
HETATM 6552 O  O   . HOH I 3 .   ? 32.921  28.587  -2.005  1.00 29.99 ? 541 HOH A O   1 
HETATM 6553 O  O   . HOH I 3 .   ? 35.308  32.002  -7.725  1.00 42.23 ? 542 HOH A O   1 
HETATM 6554 O  O   . HOH I 3 .   ? 48.665  27.989  6.234   1.00 30.45 ? 543 HOH A O   1 
HETATM 6555 O  O   . HOH I 3 .   ? 33.808  29.293  5.753   1.00 34.95 ? 544 HOH A O   1 
HETATM 6556 O  O   . HOH I 3 .   ? 41.758  16.213  -4.111  1.00 32.29 ? 545 HOH A O   1 
HETATM 6557 O  O   . HOH I 3 .   ? 37.658  -2.292  8.131   1.00 28.24 ? 546 HOH A O   1 
HETATM 6558 O  O   . HOH I 3 .   ? 44.040  -2.411  17.236  1.00 31.58 ? 547 HOH A O   1 
HETATM 6559 O  O   . HOH I 3 .   ? 51.714  -0.259  14.371  1.00 26.27 ? 548 HOH A O   1 
HETATM 6560 O  O   . HOH I 3 .   ? 55.432  0.681   13.447  1.00 36.10 ? 549 HOH A O   1 
HETATM 6561 O  O   . HOH I 3 .   ? 44.700  24.151  18.557  1.00 34.52 ? 550 HOH A O   1 
HETATM 6562 O  O   . HOH I 3 .   ? 32.927  24.991  16.712  1.00 7.09  ? 551 HOH A O   1 
HETATM 6563 O  O   . HOH I 3 .   ? 50.648  -2.007  12.370  1.00 31.43 ? 552 HOH A O   1 
HETATM 6564 O  O   . HOH I 3 .   ? 31.341  23.827  4.124   1.00 39.92 ? 553 HOH A O   1 
HETATM 6565 O  O   . HOH I 3 .   ? 35.075  3.228   -2.696  1.00 24.66 ? 554 HOH A O   1 
HETATM 6566 O  O   . HOH I 3 .   ? 29.793  0.000   0.000   0.50 6.62  ? 555 HOH A O   1 
HETATM 6567 O  O   . HOH I 3 .   ? 28.387  -1.444  1.830   1.00 35.71 ? 556 HOH A O   1 
HETATM 6568 O  O   . HOH I 3 .   ? 34.673  30.982  9.428   1.00 34.86 ? 557 HOH A O   1 
HETATM 6569 O  O   . HOH I 3 .   ? 45.053  14.660  3.687   1.00 42.21 ? 558 HOH A O   1 
HETATM 6570 O  O   . HOH I 3 .   ? 42.081  1.890   5.486   1.00 28.34 ? 559 HOH A O   1 
HETATM 6571 O  O   . HOH I 3 .   ? 52.760  0.061   26.341  1.00 39.02 ? 560 HOH A O   1 
HETATM 6572 O  O   . HOH I 3 .   ? 45.639  15.669  26.470  1.00 42.22 ? 561 HOH A O   1 
HETATM 6573 O  O   . HOH I 3 .   ? 36.695  8.154   26.495  1.00 39.80 ? 562 HOH A O   1 
HETATM 6574 O  O   . HOH I 3 .   ? 46.016  21.193  21.447  1.00 31.57 ? 563 HOH A O   1 
HETATM 6575 O  O   . HOH I 3 .   ? 43.405  0.291   19.226  1.00 22.63 ? 564 HOH A O   1 
HETATM 6576 O  O   . HOH I 3 .   ? 46.213  16.384  5.588   1.00 28.05 ? 565 HOH A O   1 
HETATM 6577 O  O   . HOH I 3 .   ? 59.304  2.795   10.989  1.00 46.03 ? 566 HOH A O   1 
HETATM 6578 O  O   . HOH I 3 .   ? 59.663  15.703  13.710  1.00 35.77 ? 567 HOH A O   1 
HETATM 6579 O  O   . HOH I 3 .   ? 52.934  22.165  11.118  1.00 36.33 ? 568 HOH A O   1 
HETATM 6580 O  O   . HOH I 3 .   ? 22.247  9.731   25.234  1.00 35.81 ? 569 HOH A O   1 
HETATM 6581 O  O   . HOH I 3 .   ? 37.739  0.469   23.280  1.00 30.81 ? 570 HOH A O   1 
HETATM 6582 O  O   . HOH I 3 .   ? 56.570  2.695   11.243  1.00 36.28 ? 571 HOH A O   1 
HETATM 6583 O  O   . HOH I 3 .   ? 26.388  10.512  13.010  1.00 11.32 ? 572 HOH A O   1 
HETATM 6584 O  O   . HOH I 3 .   ? 31.341  18.816  18.324  1.00 18.76 ? 573 HOH A O   1 
HETATM 6585 O  O   . HOH I 3 .   ? 29.979  19.731  15.232  1.00 12.27 ? 574 HOH A O   1 
HETATM 6586 O  O   . HOH I 3 .   ? 34.531  28.235  16.128  1.00 16.41 ? 575 HOH A O   1 
HETATM 6587 O  O   . HOH I 3 .   ? 19.986  16.937  20.823  1.00 28.35 ? 576 HOH A O   1 
HETATM 6588 O  O   . HOH I 3 .   ? 28.191  16.262  21.473  1.00 15.46 ? 577 HOH A O   1 
HETATM 6589 O  O   . HOH I 3 .   ? 28.094  15.775  24.112  1.00 37.65 ? 578 HOH A O   1 
HETATM 6590 O  O   . HOH I 3 .   ? 30.398  18.907  21.160  1.00 42.55 ? 579 HOH A O   1 
HETATM 6591 O  O   . HOH I 3 .   ? 36.869  25.741  21.608  1.00 40.76 ? 580 HOH A O   1 
HETATM 6592 O  O   . HOH I 3 .   ? 29.357  20.132  24.320  1.00 39.05 ? 581 HOH A O   1 
HETATM 6593 O  O   . HOH I 3 .   ? 29.239  19.774  26.910  1.00 30.08 ? 582 HOH A O   1 
HETATM 6594 O  O   . HOH I 3 .   ? 30.611  17.056  28.420  1.00 49.35 ? 583 HOH A O   1 
HETATM 6595 O  O   . HOH I 3 .   ? 34.278  17.201  10.563  1.00 8.18  ? 584 HOH A O   1 
HETATM 6596 O  O   . HOH J 3 .   ? 19.177  16.206  16.636  1.00 13.24 ? 503 HOH B O   1 
HETATM 6597 O  O   . HOH J 3 .   ? 27.285  23.038  13.708  1.00 17.23 ? 504 HOH B O   1 
HETATM 6598 O  O   . HOH J 3 .   ? 36.027  26.857  18.188  1.00 33.60 ? 505 HOH B O   1 
HETATM 6599 O  O   . HOH J 3 .   ? 25.739  20.136  9.685   1.00 20.99 ? 506 HOH B O   1 
HETATM 6600 O  O   . HOH J 3 .   ? 26.186  20.462  7.171   1.00 30.84 ? 507 HOH B O   1 
HETATM 6601 O  O   . HOH J 3 .   ? 27.891  22.309  10.834  1.00 38.73 ? 508 HOH B O   1 
HETATM 6602 O  O   . HOH J 3 .   ? 33.817  29.896  12.287  1.00 26.17 ? 509 HOH B O   1 
HETATM 6603 O  O   . HOH J 3 .   ? 18.681  21.137  38.170  1.00 14.61 ? 510 HOH B O   1 
HETATM 6604 O  O   . HOH J 3 .   ? 11.895  27.173  30.087  1.00 34.74 ? 511 HOH B O   1 
HETATM 6605 O  O   . HOH J 3 .   ? 10.880  19.644  30.911  1.00 32.83 ? 512 HOH B O   1 
HETATM 6606 O  O   . HOH J 3 .   ? 8.482   18.892  19.433  1.00 21.67 ? 513 HOH B O   1 
HETATM 6607 O  O   . HOH J 3 .   ? 9.763   16.214  13.159  1.00 34.76 ? 514 HOH B O   1 
HETATM 6608 O  O   . HOH J 3 .   ? 9.446   13.160  15.547  1.00 34.55 ? 515 HOH B O   1 
HETATM 6609 O  O   . HOH J 3 .   ? 16.927  16.916  14.856  1.00 16.08 ? 516 HOH B O   1 
HETATM 6610 O  O   . HOH J 3 .   ? 14.195  12.216  15.764  1.00 28.23 ? 517 HOH B O   1 
HETATM 6611 O  O   . HOH J 3 .   ? 11.519  12.000  17.500  1.00 31.69 ? 518 HOH B O   1 
HETATM 6612 O  O   . HOH J 3 .   ? 16.147  21.377  20.294  1.00 14.76 ? 519 HOH B O   1 
HETATM 6613 O  O   . HOH J 3 .   ? 26.438  19.348  26.543  1.00 34.48 ? 520 HOH B O   1 
HETATM 6614 O  O   . HOH J 3 .   ? 17.747  17.495  36.977  1.00 29.23 ? 521 HOH B O   1 
HETATM 6615 O  O   . HOH J 3 .   ? 19.969  32.577  36.288  1.00 31.71 ? 522 HOH B O   1 
HETATM 6616 O  O   . HOH J 3 .   ? 31.585  29.255  24.195  1.00 8.91  ? 523 HOH B O   1 
HETATM 6617 O  O   . HOH J 3 .   ? 22.668  34.625  26.030  1.00 23.57 ? 524 HOH B O   1 
HETATM 6618 O  O   . HOH J 3 .   ? 14.323  28.328  30.093  1.00 26.39 ? 525 HOH B O   1 
HETATM 6619 O  O   . HOH J 3 .   ? 14.589  29.932  32.357  1.00 29.19 ? 526 HOH B O   1 
HETATM 6620 O  O   . HOH J 3 .   ? 17.542  30.003  33.464  1.00 36.08 ? 527 HOH B O   1 
HETATM 6621 O  O   . HOH J 3 .   ? 13.453  33.667  24.882  1.00 20.30 ? 528 HOH B O   1 
HETATM 6622 O  O   . HOH J 3 .   ? 4.855   30.704  16.300  1.00 22.41 ? 529 HOH B O   1 
HETATM 6623 O  O   . HOH J 3 .   ? 1.356   36.176  18.194  1.00 40.64 ? 530 HOH B O   1 
HETATM 6624 O  O   . HOH J 3 .   ? 27.544  33.811  10.713  1.00 24.19 ? 531 HOH B O   1 
HETATM 6625 O  O   . HOH J 3 .   ? 31.762  31.298  10.920  1.00 19.60 ? 532 HOH B O   1 
HETATM 6626 O  O   . HOH J 3 .   ? 31.929  28.412  15.172  1.00 20.30 ? 533 HOH B O   1 
HETATM 6627 O  O   . HOH J 3 .   ? 29.511  24.216  9.741   1.00 16.54 ? 534 HOH B O   1 
HETATM 6628 O  O   . HOH J 3 .   ? 22.235  43.283  10.935  1.00 36.75 ? 535 HOH B O   1 
HETATM 6629 O  O   . HOH J 3 .   ? 34.113  30.225  21.701  1.00 12.84 ? 536 HOH B O   1 
HETATM 6630 O  O   . HOH J 3 .   ? 33.630  41.219  25.872  1.00 34.09 ? 537 HOH B O   1 
HETATM 6631 O  O   . HOH J 3 .   ? 31.940  33.931  19.504  1.00 15.27 ? 538 HOH B O   1 
HETATM 6632 O  O   . HOH J 3 .   ? 13.033  34.849  22.453  1.00 22.04 ? 539 HOH B O   1 
HETATM 6633 O  O   . HOH J 3 .   ? 16.496  21.836  17.709  1.00 24.44 ? 540 HOH B O   1 
HETATM 6634 O  O   . HOH J 3 .   ? 6.716   31.509  14.502  1.00 27.99 ? 541 HOH B O   1 
HETATM 6635 O  O   . HOH J 3 .   ? 11.625  34.167  20.366  1.00 21.78 ? 542 HOH B O   1 
HETATM 6636 O  O   . HOH J 3 .   ? 13.130  35.277  27.323  1.00 31.06 ? 543 HOH B O   1 
HETATM 6637 O  O   . HOH J 3 .   ? 23.634  20.860  38.645  1.00 12.56 ? 544 HOH B O   1 
HETATM 6638 O  O   . HOH J 3 .   ? 28.551  26.141  7.916   1.00 32.76 ? 545 HOH B O   1 
HETATM 6639 O  O   . HOH J 3 .   ? 26.560  16.557  26.495  1.00 38.84 ? 546 HOH B O   1 
HETATM 6640 O  O   . HOH J 3 .   ? 33.191  22.333  35.787  1.00 38.10 ? 547 HOH B O   1 
HETATM 6641 O  O   . HOH J 3 .   ? 31.717  38.926  29.777  1.00 29.90 ? 548 HOH B O   1 
HETATM 6642 O  O   . HOH J 3 .   ? 35.040  23.971  28.495  1.00 33.78 ? 549 HOH B O   1 
HETATM 6643 O  O   . HOH J 3 .   ? 19.524  29.884  36.223  1.00 31.13 ? 550 HOH B O   1 
HETATM 6644 O  O   . HOH J 3 .   ? 31.231  36.542  16.672  1.00 48.31 ? 551 HOH B O   1 
HETATM 6645 O  O   . HOH J 3 .   ? 30.640  21.378  28.819  1.00 25.74 ? 552 HOH B O   1 
HETATM 6646 O  O   . HOH J 3 .   ? 1.832   17.052  23.452  1.00 35.15 ? 553 HOH B O   1 
HETATM 6647 O  O   . HOH J 3 .   ? 18.582  15.687  33.122  1.00 26.55 ? 554 HOH B O   1 
HETATM 6648 O  O   . HOH J 3 .   ? 27.468  26.285  42.889  1.00 42.27 ? 555 HOH B O   1 
HETATM 6649 O  O   . HOH J 3 .   ? 25.637  19.597  3.274   1.00 37.97 ? 556 HOH B O   1 
HETATM 6650 O  O   . HOH J 3 .   ? 19.039  33.468  29.448  1.00 36.77 ? 557 HOH B O   1 
HETATM 6651 O  O   . HOH J 3 .   ? 7.563   43.694  6.026   1.00 37.37 ? 558 HOH B O   1 
HETATM 6652 O  O   . HOH J 3 .   ? 23.480  37.944  7.452   1.00 31.44 ? 559 HOH B O   1 
HETATM 6653 O  O   . HOH J 3 .   ? 8.275   19.185  28.778  1.00 31.71 ? 560 HOH B O   1 
HETATM 6654 O  O   . HOH J 3 .   ? 35.147  28.753  23.528  1.00 33.62 ? 561 HOH B O   1 
HETATM 6655 O  O   . HOH J 3 .   ? 33.679  22.150  30.228  1.00 43.12 ? 562 HOH B O   1 
HETATM 6656 O  O   . HOH J 3 .   ? 30.714  29.154  6.205   1.00 37.51 ? 563 HOH B O   1 
HETATM 6657 O  O   . HOH J 3 .   ? 2.546   21.869  25.900  1.00 31.23 ? 564 HOH B O   1 
HETATM 6658 O  O   . HOH J 3 .   ? 28.349  43.375  17.064  1.00 37.92 ? 565 HOH B O   1 
HETATM 6659 O  O   . HOH J 3 .   ? 35.730  35.155  20.066  1.00 35.95 ? 566 HOH B O   1 
HETATM 6660 O  O   . HOH J 3 .   ? 24.094  24.395  21.456  1.00 11.50 ? 567 HOH B O   1 
HETATM 6661 O  O   . HOH K 3 .   ? 86.150  18.644  52.028  1.00 36.88 ? 504 HOH C O   1 
HETATM 6662 O  O   . HOH K 3 .   ? 93.290  11.866  44.894  1.00 30.27 ? 505 HOH C O   1 
HETATM 6663 O  O   . HOH K 3 .   ? 95.223  18.099  48.255  1.00 33.54 ? 506 HOH C O   1 
HETATM 6664 O  O   . HOH K 3 .   ? 100.214 21.261  37.223  1.00 17.01 ? 507 HOH C O   1 
HETATM 6665 O  O   . HOH K 3 .   ? 101.203 25.948  31.684  1.00 32.97 ? 508 HOH C O   1 
HETATM 6666 O  O   . HOH K 3 .   ? 101.134 27.891  34.558  1.00 29.38 ? 509 HOH C O   1 
HETATM 6667 O  O   . HOH K 3 .   ? 93.713  25.885  31.519  1.00 10.46 ? 510 HOH C O   1 
HETATM 6668 O  O   . HOH K 3 .   ? 97.045  29.465  34.018  1.00 20.61 ? 511 HOH C O   1 
HETATM 6669 O  O   . HOH K 3 .   ? 99.168  28.681  36.058  1.00 22.15 ? 512 HOH C O   1 
HETATM 6670 O  O   . HOH K 3 .   ? 92.295  20.437  36.092  1.00 10.50 ? 513 HOH C O   1 
HETATM 6671 O  O   . HOH K 3 .   ? 81.231  23.281  40.815  1.00 24.33 ? 514 HOH C O   1 
HETATM 6672 O  O   . HOH K 3 .   ? 87.465  20.946  52.358  1.00 26.33 ? 515 HOH C O   1 
HETATM 6673 O  O   . HOH K 3 .   ? 82.656  8.107   48.448  1.00 25.95 ? 516 HOH C O   1 
HETATM 6674 O  O   . HOH K 3 .   ? 75.135  15.624  35.058  1.00 11.80 ? 517 HOH C O   1 
HETATM 6675 O  O   . HOH K 3 .   ? 82.322  8.213   37.176  1.00 24.21 ? 518 HOH C O   1 
HETATM 6676 O  O   . HOH K 3 .   ? 90.753  11.450  44.080  1.00 21.29 ? 519 HOH C O   1 
HETATM 6677 O  O   . HOH K 3 .   ? 89.357  9.667   45.699  1.00 25.32 ? 520 HOH C O   1 
HETATM 6678 O  O   . HOH K 3 .   ? 86.698  10.552  46.306  1.00 31.23 ? 521 HOH C O   1 
HETATM 6679 O  O   . HOH K 3 .   ? 91.643  7.221   38.099  1.00 15.81 ? 522 HOH C O   1 
HETATM 6680 O  O   . HOH K 3 .   ? 102.358 9.734   32.177  1.00 23.13 ? 523 HOH C O   1 
HETATM 6681 O  O   . HOH K 3 .   ? 104.478 3.664   33.774  1.00 37.00 ? 524 HOH C O   1 
HETATM 6682 O  O   . HOH K 3 .   ? 81.537  12.643  21.799  1.00 20.38 ? 525 HOH C O   1 
HETATM 6683 O  O   . HOH K 3 .   ? 77.465  16.225  21.983  1.00 25.87 ? 526 HOH C O   1 
HETATM 6684 O  O   . HOH K 3 .   ? 76.891  18.175  26.533  1.00 20.42 ? 527 HOH C O   1 
HETATM 6685 O  O   . HOH K 3 .   ? 81.421  22.676  22.765  1.00 9.62  ? 528 HOH C O   1 
HETATM 6686 O  O   . HOH K 3 .   ? 84.815  2.664   20.764  1.00 28.77 ? 529 HOH C O   1 
HETATM 6687 O  O   . HOH K 3 .   ? 73.020  15.934  32.043  1.00 23.40 ? 530 HOH C O   1 
HETATM 6688 O  O   . HOH K 3 .   ? 70.489  4.390   33.649  1.00 30.84 ? 531 HOH C O   1 
HETATM 6689 O  O   . HOH K 3 .   ? 75.197  12.057  29.479  1.00 16.73 ? 532 HOH C O   1 
HETATM 6690 O  O   . HOH K 3 .   ? 92.249  6.333   35.526  1.00 16.99 ? 533 HOH C O   1 
HETATM 6691 O  O   . HOH K 3 .   ? 92.651  20.283  33.427  1.00 25.85 ? 534 HOH C O   1 
HETATM 6692 O  O   . HOH K 3 .   ? 100.825 9.634   29.812  1.00 16.26 ? 535 HOH C O   1 
HETATM 6693 O  O   . HOH K 3 .   ? 94.434  7.169   34.090  1.00 16.69 ? 536 HOH C O   1 
HETATM 6694 O  O   . HOH K 3 .   ? 91.010  5.588   40.071  1.00 21.01 ? 537 HOH C O   1 
HETATM 6695 O  O   . HOH K 3 .   ? 79.863  19.648  53.466  1.00 15.52 ? 538 HOH C O   1 
HETATM 6696 O  O   . HOH K 3 .   ? 82.322  20.619  20.702  1.00 42.19 ? 539 HOH C O   1 
HETATM 6697 O  O   . HOH K 3 .   ? 81.843  25.873  40.912  1.00 34.98 ? 540 HOH C O   1 
HETATM 6698 O  O   . HOH K 3 .   ? 68.847  17.428  52.768  1.00 31.21 ? 541 HOH C O   1 
HETATM 6699 O  O   . HOH K 3 .   ? 71.768  5.265   38.662  1.00 32.59 ? 542 HOH C O   1 
HETATM 6700 O  O   . HOH K 3 .   ? 84.129  11.066  49.253  1.00 35.81 ? 543 HOH C O   1 
HETATM 6701 O  O   . HOH K 3 .   ? 103.091 14.144  37.780  1.00 31.91 ? 544 HOH C O   1 
HETATM 6702 O  O   . HOH K 3 .   ? 102.914 8.149   28.412  1.00 38.19 ? 545 HOH C O   1 
HETATM 6703 O  O   . HOH K 3 .   ? 99.667  0.579   31.238  1.00 34.64 ? 546 HOH C O   1 
HETATM 6704 O  O   . HOH K 3 .   ? 99.029  -3.114  31.814  1.00 30.02 ? 547 HOH C O   1 
HETATM 6705 O  O   . HOH K 3 .   ? 101.943 1.659   32.749  1.00 37.27 ? 548 HOH C O   1 
HETATM 6706 O  O   . HOH K 3 .   ? 76.614  21.934  41.194  1.00 34.91 ? 549 HOH C O   1 
HETATM 6707 O  O   . HOH K 3 .   ? 106.282 20.786  42.724  1.00 21.60 ? 550 HOH C O   1 
HETATM 6708 O  O   . HOH K 3 .   ? 88.283  23.895  49.249  1.00 22.89 ? 551 HOH C O   1 
HETATM 6709 O  O   . HOH K 3 .   ? 75.584  14.288  54.406  1.00 40.96 ? 552 HOH C O   1 
HETATM 6710 O  O   . HOH K 3 .   ? 87.372  27.770  18.124  1.00 32.82 ? 553 HOH C O   1 
HETATM 6711 O  O   . HOH K 3 .   ? 97.729  16.575  48.437  1.00 21.49 ? 554 HOH C O   1 
HETATM 6712 O  O   . HOH K 3 .   ? 100.846 22.284  45.720  0.50 3.91  ? 555 HOH C O   1 
HETATM 6713 O  O   . HOH K 3 .   ? 102.239 23.614  43.784  1.00 29.61 ? 556 HOH C O   1 
HETATM 6714 O  O   . HOH K 3 .   ? 98.683  10.031  40.294  1.00 32.40 ? 557 HOH C O   1 
HETATM 6715 O  O   . HOH K 3 .   ? 93.072  16.576  19.500  1.00 39.47 ? 558 HOH C O   1 
HETATM 6716 O  O   . HOH K 3 .   ? 79.325  8.408   23.553  1.00 33.54 ? 559 HOH C O   1 
HETATM 6717 O  O   . HOH K 3 .   ? 72.000  16.867  34.418  1.00 33.59 ? 560 HOH C O   1 
HETATM 6718 O  O   . HOH K 3 .   ? 73.728  22.014  41.731  1.00 30.24 ? 561 HOH C O   1 
HETATM 6719 O  O   . HOH K 3 .   ? 79.737  18.162  17.876  1.00 28.83 ? 562 HOH C O   1 
HETATM 6720 O  O   . HOH K 3 .   ? 78.482  23.608  40.460  1.00 24.93 ? 563 HOH C O   1 
HETATM 6721 O  O   . HOH K 3 .   ? 102.676 24.329  27.227  1.00 39.40 ? 564 HOH C O   1 
HETATM 6722 O  O   . HOH K 3 .   ? 104.651 12.295  30.911  1.00 25.83 ? 565 HOH C O   1 
HETATM 6723 O  O   . HOH K 3 .   ? 107.145 23.877  42.847  1.00 26.30 ? 566 HOH C O   1 
HETATM 6724 O  O   . HOH K 3 .   ? 73.672  23.374  48.311  1.00 40.54 ? 567 HOH C O   1 
HETATM 6725 O  O   . HOH K 3 .   ? 101.763 -5.041  25.364  1.00 39.37 ? 568 HOH C O   1 
HETATM 6726 O  O   . HOH K 3 .   ? 99.000  21.130  22.890  1.00 28.92 ? 569 HOH C O   1 
HETATM 6727 O  O   . HOH K 3 .   ? 69.994  16.656  60.266  1.00 43.86 ? 570 HOH C O   1 
HETATM 6728 O  O   . HOH K 3 .   ? 81.726  23.261  38.001  1.00 43.09 ? 571 HOH C O   1 
HETATM 6729 O  O   . HOH K 3 .   ? 91.034  26.709  33.034  1.00 8.76  ? 572 HOH C O   1 
HETATM 6730 O  O   . HOH K 3 .   ? 82.917  22.411  27.262  1.00 18.80 ? 573 HOH C O   1 
HETATM 6731 O  O   . HOH K 3 .   ? 73.008  20.077  29.079  1.00 22.32 ? 574 HOH C O   1 
HETATM 6732 O  O   . HOH K 3 .   ? 85.412  33.520  25.236  1.00 13.59 ? 575 HOH C O   1 
HETATM 6733 O  O   . HOH K 3 .   ? 85.760  25.658  24.318  1.00 16.60 ? 576 HOH C O   1 
HETATM 6734 O  O   . HOH K 3 .   ? 86.177  26.119  21.649  1.00 31.38 ? 577 HOH C O   1 
HETATM 6735 O  O   . HOH K 3 .   ? 83.008  23.846  24.496  1.00 38.82 ? 578 HOH C O   1 
HETATM 6736 O  O   . HOH K 3 .   ? 85.231  27.261  19.479  1.00 37.44 ? 579 HOH C O   1 
HETATM 6737 O  O   . HOH K 3 .   ? 75.616  17.689  23.452  1.00 33.35 ? 580 HOH C O   1 
HETATM 6738 O  O   . HOH K 3 .   ? 76.352  21.400  28.644  1.00 9.66  ? 581 HOH C O   1 
HETATM 6739 O  O   . HOH K 3 .   ? 81.874  25.271  21.167  1.00 33.06 ? 582 HOH C O   1 
HETATM 6740 O  O   . HOH K 3 .   ? 83.798  19.044  35.058  1.00 11.49 ? 583 HOH C O   1 
HETATM 6741 O  O   . HOH L 3 .   ? 86.071  34.397  29.548  1.00 9.36  ? 505 HOH D O   1 
HETATM 6742 O  O   . HOH L 3 .   ? 78.810  26.722  31.988  1.00 28.29 ? 506 HOH D O   1 
HETATM 6743 O  O   . HOH L 3 .   ? 80.578  25.897  28.813  1.00 7.29  ? 507 HOH D O   1 
HETATM 6744 O  O   . HOH L 3 .   ? 74.339  18.783  27.176  1.00 25.91 ? 508 HOH D O   1 
HETATM 6745 O  O   . HOH L 3 .   ? 89.229  25.262  36.839  1.00 19.01 ? 509 HOH D O   1 
HETATM 6746 O  O   . HOH L 3 .   ? 81.614  27.853  36.141  1.00 23.06 ? 510 HOH D O   1 
HETATM 6747 O  O   . HOH L 3 .   ? 81.027  27.411  38.615  1.00 30.83 ? 511 HOH D O   1 
HETATM 6748 O  O   . HOH L 3 .   ? 79.206  25.952  34.832  1.00 29.42 ? 512 HOH D O   1 
HETATM 6749 O  O   . HOH L 3 .   ? 78.934  23.841  37.855  1.00 28.11 ? 513 HOH D O   1 
HETATM 6750 O  O   . HOH L 3 .   ? 82.190  35.803  7.744   1.00 22.36 ? 514 HOH D O   1 
HETATM 6751 O  O   . HOH L 3 .   ? 76.553  43.050  15.653  1.00 27.05 ? 515 HOH D O   1 
HETATM 6752 O  O   . HOH L 3 .   ? 83.889  43.375  15.028  1.00 27.99 ? 516 HOH D O   1 
HETATM 6753 O  O   . HOH L 3 .   ? 84.475  45.396  26.965  1.00 13.37 ? 517 HOH D O   1 
HETATM 6754 O  O   . HOH L 3 .   ? 87.136  43.839  33.126  1.00 28.98 ? 518 HOH D O   1 
HETATM 6755 O  O   . HOH L 3 .   ? 90.112  43.843  30.929  1.00 26.88 ? 519 HOH D O   1 
HETATM 6756 O  O   . HOH L 3 .   ? 85.511  36.828  31.490  1.00 16.86 ? 520 HOH D O   1 
HETATM 6757 O  O   . HOH L 3 .   ? 90.392  39.152  30.693  1.00 33.81 ? 521 HOH D O   1 
HETATM 6758 O  O   . HOH L 3 .   ? 90.913  41.745  29.211  1.00 30.56 ? 522 HOH D O   1 
HETATM 6759 O  O   . HOH L 3 .   ? 81.390  38.134  25.734  1.00 16.51 ? 523 HOH D O   1 
HETATM 6760 O  O   . HOH L 3 .   ? 82.716  27.731  19.080  1.00 17.68 ? 524 HOH D O   1 
HETATM 6761 O  O   . HOH L 3 .   ? 85.911  36.613  9.425   1.00 25.65 ? 525 HOH D O   1 
HETATM 6762 O  O   . HOH L 3 .   ? 70.880  35.071  9.027   1.00 36.54 ? 526 HOH D O   1 
HETATM 6763 O  O   . HOH L 3 .   ? 72.637  23.181  20.899  1.00 12.28 ? 527 HOH D O   1 
HETATM 6764 O  O   . HOH L 3 .   ? 68.020  32.505  19.305  1.00 15.91 ? 528 HOH D O   1 
HETATM 6765 O  O   . HOH L 3 .   ? 75.102  40.718  15.627  1.00 15.95 ? 529 HOH D O   1 
HETATM 6766 O  O   . HOH L 3 .   ? 73.865  40.454  13.429  1.00 25.85 ? 530 HOH D O   1 
HETATM 6767 O  O   . HOH L 3 .   ? 73.539  37.447  12.363  1.00 32.22 ? 531 HOH D O   1 
HETATM 6768 O  O   . HOH L 3 .   ? 69.640  41.695  20.825  1.00 17.91 ? 532 HOH D O   1 
HETATM 6769 O  O   . HOH L 3 .   ? 73.096  49.910  29.961  1.00 25.36 ? 533 HOH D O   1 
HETATM 6770 O  O   . HOH L 3 .   ? 68.052  53.840  27.559  1.00 31.25 ? 534 HOH D O   1 
HETATM 6771 O  O   . HOH L 3 .   ? 67.791  27.410  34.549  1.00 35.74 ? 535 HOH D O   1 
HETATM 6772 O  O   . HOH L 3 .   ? 70.139  22.676  34.176  1.00 21.49 ? 536 HOH D O   1 
HETATM 6773 O  O   . HOH L 3 .   ? 73.047  22.549  30.157  1.00 14.60 ? 537 HOH D O   1 
HETATM 6774 O  O   . HOH L 3 .   ? 77.147  24.441  35.839  1.00 12.87 ? 538 HOH D O   1 
HETATM 6775 O  O   . HOH L 3 .   ? 81.769  24.052  30.450  1.00 10.13 ? 539 HOH D O   1 
HETATM 6776 O  O   . HOH L 3 .   ? 58.951  33.462  34.317  1.00 33.51 ? 540 HOH D O   1 
HETATM 6777 O  O   . HOH L 3 .   ? 71.200  20.781  23.439  1.00 23.09 ? 541 HOH D O   1 
HETATM 6778 O  O   . HOH L 3 .   ? 60.374  21.982  18.442  1.00 26.12 ? 542 HOH D O   1 
HETATM 6779 O  O   . HOH L 3 .   ? 67.861  23.082  25.451  1.00 11.04 ? 543 HOH D O   1 
HETATM 6780 O  O   . HOH L 3 .   ? 68.357  42.026  23.185  1.00 20.96 ? 544 HOH D O   1 
HETATM 6781 O  O   . HOH L 3 .   ? 80.662  37.681  28.316  1.00 28.22 ? 545 HOH D O   1 
HETATM 6782 O  O   . HOH L 3 .   ? 71.951  48.172  31.694  1.00 37.64 ? 546 HOH D O   1 
HETATM 6783 O  O   . HOH L 3 .   ? 69.260  43.582  25.395  1.00 25.36 ? 547 HOH D O   1 
HETATM 6784 O  O   . HOH L 3 .   ? 68.412  42.309  18.502  1.00 34.88 ? 548 HOH D O   1 
HETATM 6785 O  O   . HOH L 3 .   ? 82.511  30.902  7.129   1.00 9.10  ? 549 HOH D O   1 
HETATM 6786 O  O   . HOH L 3 .   ? 75.174  25.807  37.524  1.00 35.29 ? 550 HOH D O   1 
HETATM 6787 O  O   . HOH L 3 .   ? 80.138  21.361  9.625   1.00 35.72 ? 551 HOH D O   1 
HETATM 6788 O  O   . HOH L 3 .   ? 77.564  20.109  3.362   1.00 47.40 ? 552 HOH D O   1 
HETATM 6789 O  O   . HOH L 3 .   ? 77.729  19.774  16.733  1.00 30.09 ? 553 HOH D O   1 
HETATM 6790 O  O   . HOH L 3 .   ? 78.604  50.682  25.712  1.00 33.25 ? 554 HOH D O   1 
HETATM 6791 O  O   . HOH L 3 .   ? 70.322  49.848  33.092  1.00 42.32 ? 555 HOH D O   1 
HETATM 6792 O  O   . HOH L 3 .   ? 63.536  50.236  27.869  1.00 35.89 ? 556 HOH D O   1 
HETATM 6793 O  O   . HOH L 3 .   ? 59.722  49.993  26.378  1.00 26.27 ? 557 HOH D O   1 
HETATM 6794 O  O   . HOH L 3 .   ? 64.952  24.306  28.208  1.00 38.93 ? 558 HOH D O   1 
HETATM 6795 O  O   . HOH L 3 .   ? 65.604  51.836  27.108  1.00 28.44 ? 559 HOH D O   1 
HETATM 6796 O  O   . HOH L 3 .   ? 86.569  52.468  22.902  1.00 37.61 ? 560 HOH D O   1 
HETATM 6797 O  O   . HOH L 3 .   ? 87.296  35.684  13.210  1.00 23.69 ? 561 HOH D O   1 
HETATM 6798 O  O   . HOH L 3 .   ? 77.814  27.865  2.797   1.00 33.71 ? 562 HOH D O   1 
HETATM 6799 O  O   . HOH L 3 .   ? 82.060  27.821  43.084  1.00 38.76 ? 563 HOH D O   1 
HETATM 6800 O  O   . HOH L 3 .   ? 75.434  17.423  20.033  1.00 27.46 ? 564 HOH D O   1 
HETATM 6801 O  O   . HOH L 3 .   ? 69.765  46.816  34.255  1.00 29.97 ? 565 HOH D O   1 
HETATM 6802 O  O   . HOH L 3 .   ? 84.569  45.436  17.491  1.00 44.64 ? 566 HOH D O   1 
HETATM 6803 O  O   . HOH L 3 .   ? 83.771  43.906  37.496  1.00 40.56 ? 567 HOH D O   1 
HETATM 6804 O  O   . HOH L 3 .   ? 75.980  51.000  32.188  1.00 41.37 ? 568 HOH D O   1 
HETATM 6805 O  O   . HOH L 3 .   ? 69.840  29.657  6.810   1.00 26.59 ? 569 HOH D O   1 
HETATM 6806 O  O   . HOH L 3 .   ? 75.700  38.317  9.852   1.00 36.95 ? 570 HOH D O   1 
HETATM 6807 O  O   . HOH L 3 .   ? 80.747  41.642  8.493   1.00 36.50 ? 571 HOH D O   1 
HETATM 6808 O  O   . HOH L 3 .   ? 83.221  39.935  10.514  1.00 33.61 ? 572 HOH D O   1 
HETATM 6809 O  O   . HOH L 3 .   ? 84.998  51.372  28.130  1.00 35.18 ? 573 HOH D O   1 
HETATM 6810 O  O   . HOH L 3 .   ? 83.169  38.899  30.531  1.00 34.94 ? 574 HOH D O   1 
HETATM 6811 O  O   . HOH L 3 .   ? 83.959  37.899  8.505   1.00 32.90 ? 575 HOH D O   1 
HETATM 6812 O  O   . HOH L 3 .   ? 87.543  30.294  14.884  1.00 33.63 ? 576 HOH D O   1 
HETATM 6813 O  O   . HOH L 3 .   ? 60.923  22.383  12.701  1.00 42.03 ? 577 HOH D O   1 
HETATM 6814 O  O   . HOH L 3 .   ? 71.922  14.722  12.908  1.00 34.52 ? 578 HOH D O   1 
HETATM 6815 O  O   . HOH L 3 .   ? 74.001  16.446  12.400  1.00 35.67 ? 579 HOH D O   1 
HETATM 6816 O  O   . HOH L 3 .   ? 68.542  17.183  17.145  1.00 32.45 ? 580 HOH D O   1 
HETATM 6817 O  O   . HOH L 3 .   ? 67.563  50.440  33.906  1.00 31.60 ? 581 HOH D O   1 
HETATM 6818 O  O   . HOH L 3 .   ? 58.554  54.116  32.327  1.00 35.88 ? 582 HOH D O   1 
HETATM 6819 O  O   . HOH L 3 .   ? 56.814  24.892  20.769  1.00 35.95 ? 583 HOH D O   1 
HETATM 6820 O  O   . HOH L 3 .   ? 71.247  40.403  25.457  1.00 35.17 ? 584 HOH D O   1 
HETATM 6821 O  O   . HOH L 3 .   ? 77.803  30.322  24.051  1.00 11.07 ? 585 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  HIS 78  78  78  HIS HIS A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  HIS 81  81  81  HIS HIS A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  TRP 85  85  85  TRP TRP A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 TRP 128 128 128 TRP TRP A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 TRP 130 130 130 TRP TRP A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 MET 151 151 151 MET MET A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 TYR 174 174 174 TYR TYR A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 TRP 189 189 189 TRP TRP A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 ARG 200 200 200 ARG ARG A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
B 1 1   SER 1   1   1   SER SER B . n 
B 1 2   TYR 2   2   2   TYR TYR B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   SER 6   6   6   SER SER B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   TYR 9   9   9   TYR TYR B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  TYR 11  11  11  TYR TYR B . n 
B 1 12  ASP 12  12  12  ASP ASP B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  PRO 16  16  16  PRO PRO B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  PHE 18  18  18  PHE PHE B . n 
B 1 19  ASP 19  19  19  ASP ASP B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  THR 22  22  22  THR THR B . n 
B 1 23  MET 23  23  23  MET MET B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  THR 28  28  28  THR THR B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  HIS 30  30  30  HIS HIS B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  GLN 32  32  32  GLN GLN B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  PHE 34  34  34  PHE PHE B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  ASN 36  36  36  ASN ASN B . n 
B 1 37  ASN 37  37  37  ASN ASN B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  PRO 46  46  46  PRO PRO B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  PHE 48  48  48  PHE PHE B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  ILE 57  57  57  ILE ILE B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  GLN 62  62  62  GLN GLN B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  ALA 65  65  65  ALA ALA B . n 
B 1 66  ASP 66  66  66  ASP ASP B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  GLY 76  76  76  GLY GLY B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  HIS 78  78  78  HIS HIS B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  HIS 81  81  81  HIS HIS B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  TRP 85  85  85  TRP TRP B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  THR 92  92  92  THR THR B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  LEU 94  94  94  LEU LEU B . n 
B 1 95  GLN 95  95  95  GLN GLN B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 ILE 102 102 102 ILE ILE B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 ARG 104 104 104 ARG ARG B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 GLY 107 107 107 GLY GLY B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 ASN 111 111 111 ASN ASN B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 LYS 113 113 113 LYS LYS B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 GLU 117 117 117 GLU GLU B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 ALA 119 119 119 ALA ALA B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 PHE 124 124 124 PHE PHE B . n 
B 1 125 GLY 125 125 125 GLY GLY B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 TRP 128 128 128 TRP TRP B . n 
B 1 129 ALA 129 129 129 ALA ALA B . n 
B 1 130 TRP 130 130 130 TRP TRP B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 LYS 134 134 134 LYS LYS B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 LYS 137 137 137 LYS LYS B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 SER 142 142 142 SER SER B . n 
B 1 143 THR 143 143 143 THR THR B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 GLN 146 146 146 GLN GLN B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 MET 151 151 151 MET MET B . n 
B 1 152 GLY 152 152 152 GLY GLY B . n 
B 1 153 GLU 153 153 153 GLU GLU B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 ILE 155 155 155 ILE ILE B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 SER 159 159 159 SER SER B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 PHE 161 161 161 PHE PHE B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 ILE 163 163 163 ILE ILE B . n 
B 1 164 MET 164 164 164 MET MET B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 TRP 169 169 169 TRP TRP B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 HIS 171 171 171 HIS HIS B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 TYR 174 174 174 TYR TYR B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 PHE 177 177 177 PHE PHE B . n 
B 1 178 GLN 178 178 178 GLN GLN B . n 
B 1 179 ASN 179 179 179 ASN ASN B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 PRO 182 182 182 PRO PRO B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 TYR 184 184 184 TYR TYR B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 GLU 187 187 187 GLU GLU B . n 
B 1 188 PHE 188 188 188 PHE PHE B . n 
B 1 189 TRP 189 189 189 TRP TRP B . n 
B 1 190 ASN 190 190 190 ASN ASN B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 VAL 192 192 192 VAL VAL B . n 
B 1 193 ASN 193 193 193 ASN ASN B . n 
B 1 194 TRP 194 194 194 TRP TRP B . n 
B 1 195 ASP 195 195 195 ASP ASP B . n 
B 1 196 GLU 196 196 196 GLU GLU B . n 
B 1 197 ALA 197 197 197 ALA ALA B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 ARG 200 200 200 ARG ARG B . n 
B 1 201 PHE 201 201 201 PHE PHE B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 LYS 205 205 205 LYS LYS B . n 
C 1 1   SER 1   1   1   SER SER C . n 
C 1 2   TYR 2   2   2   TYR TYR C . n 
C 1 3   THR 3   3   3   THR THR C . n 
C 1 4   LEU 4   4   4   LEU LEU C . n 
C 1 5   PRO 5   5   5   PRO PRO C . n 
C 1 6   SER 6   6   6   SER SER C . n 
C 1 7   LEU 7   7   7   LEU LEU C . n 
C 1 8   PRO 8   8   8   PRO PRO C . n 
C 1 9   TYR 9   9   9   TYR TYR C . n 
C 1 10  ALA 10  10  10  ALA ALA C . n 
C 1 11  TYR 11  11  11  TYR TYR C . n 
C 1 12  ASP 12  12  12  ASP ASP C . n 
C 1 13  ALA 13  13  13  ALA ALA C . n 
C 1 14  LEU 14  14  14  LEU LEU C . n 
C 1 15  GLU 15  15  15  GLU GLU C . n 
C 1 16  PRO 16  16  16  PRO PRO C . n 
C 1 17  HIS 17  17  17  HIS HIS C . n 
C 1 18  PHE 18  18  18  PHE PHE C . n 
C 1 19  ASP 19  19  19  ASP ASP C . n 
C 1 20  LYS 20  20  20  LYS LYS C . n 
C 1 21  GLN 21  21  21  GLN GLN C . n 
C 1 22  THR 22  22  22  THR THR C . n 
C 1 23  MET 23  23  23  MET MET C . n 
C 1 24  GLU 24  24  24  GLU GLU C . n 
C 1 25  ILE 25  25  25  ILE ILE C . n 
C 1 26  HIS 26  26  26  HIS HIS C . n 
C 1 27  HIS 27  27  27  HIS HIS C . n 
C 1 28  THR 28  28  28  THR THR C . n 
C 1 29  LYS 29  29  29  LYS LYS C . n 
C 1 30  HIS 30  30  30  HIS HIS C . n 
C 1 31  HIS 31  31  31  HIS HIS C . n 
C 1 32  GLN 32  32  32  GLN GLN C . n 
C 1 33  THR 33  33  33  THR THR C . n 
C 1 34  PHE 34  34  34  PHE PHE C . n 
C 1 35  VAL 35  35  35  VAL VAL C . n 
C 1 36  ASN 36  36  36  ASN ASN C . n 
C 1 37  ASN 37  37  37  ASN ASN C . n 
C 1 38  ALA 38  38  38  ALA ALA C . n 
C 1 39  ASN 39  39  39  ASN ASN C . n 
C 1 40  ALA 40  40  40  ALA ALA C . n 
C 1 41  ALA 41  41  41  ALA ALA C . n 
C 1 42  LEU 42  42  42  LEU LEU C . n 
C 1 43  GLU 43  43  43  GLU GLU C . n 
C 1 44  SER 44  44  44  SER SER C . n 
C 1 45  LEU 45  45  45  LEU LEU C . n 
C 1 46  PRO 46  46  46  PRO PRO C . n 
C 1 47  GLU 47  47  47  GLU GLU C . n 
C 1 48  PHE 48  48  48  PHE PHE C . n 
C 1 49  ALA 49  49  49  ALA ALA C . n 
C 1 50  ASN 50  50  50  ASN ASN C . n 
C 1 51  LEU 51  51  51  LEU LEU C . n 
C 1 52  PRO 52  52  52  PRO PRO C . n 
C 1 53  VAL 53  53  53  VAL VAL C . n 
C 1 54  GLU 54  54  54  GLU GLU C . n 
C 1 55  GLU 55  55  55  GLU GLU C . n 
C 1 56  LEU 56  56  56  LEU LEU C . n 
C 1 57  ILE 57  57  57  ILE ILE C . n 
C 1 58  THR 58  58  58  THR THR C . n 
C 1 59  LYS 59  59  59  LYS LYS C . n 
C 1 60  LEU 60  60  60  LEU LEU C . n 
C 1 61  ASP 61  61  61  ASP ASP C . n 
C 1 62  GLN 62  62  62  GLN GLN C . n 
C 1 63  LEU 63  63  63  LEU LEU C . n 
C 1 64  PRO 64  64  64  PRO PRO C . n 
C 1 65  ALA 65  65  65  ALA ALA C . n 
C 1 66  ASP 66  66  66  ASP ASP C . n 
C 1 67  LYS 67  67  67  LYS LYS C . n 
C 1 68  LYS 68  68  68  LYS LYS C . n 
C 1 69  THR 69  69  69  THR THR C . n 
C 1 70  VAL 70  70  70  VAL VAL C . n 
C 1 71  LEU 71  71  71  LEU LEU C . n 
C 1 72  ARG 72  72  72  ARG ARG C . n 
C 1 73  ASN 73  73  73  ASN ASN C . n 
C 1 74  ASN 74  74  74  ASN ASN C . n 
C 1 75  ALA 75  75  75  ALA ALA C . n 
C 1 76  GLY 76  76  76  GLY GLY C . n 
C 1 77  GLY 77  77  77  GLY GLY C . n 
C 1 78  HIS 78  78  78  HIS HIS C . n 
C 1 79  ALA 79  79  79  ALA ALA C . n 
C 1 80  ASN 80  80  80  ASN ASN C . n 
C 1 81  HIS 81  81  81  HIS HIS C . n 
C 1 82  SER 82  82  82  SER SER C . n 
C 1 83  LEU 83  83  83  LEU LEU C . n 
C 1 84  PHE 84  84  84  PHE PHE C . n 
C 1 85  TRP 85  85  85  TRP TRP C . n 
C 1 86  LYS 86  86  86  LYS LYS C . n 
C 1 87  GLY 87  87  87  GLY GLY C . n 
C 1 88  LEU 88  88  88  LEU LEU C . n 
C 1 89  LYS 89  89  89  LYS LYS C . n 
C 1 90  LYS 90  90  90  LYS LYS C . n 
C 1 91  GLY 91  91  91  GLY GLY C . n 
C 1 92  THR 92  92  92  THR THR C . n 
C 1 93  THR 93  93  93  THR THR C . n 
C 1 94  LEU 94  94  94  LEU LEU C . n 
C 1 95  GLN 95  95  95  GLN GLN C . n 
C 1 96  GLY 96  96  96  GLY GLY C . n 
C 1 97  ASP 97  97  97  ASP ASP C . n 
C 1 98  LEU 98  98  98  LEU LEU C . n 
C 1 99  LYS 99  99  99  LYS LYS C . n 
C 1 100 ALA 100 100 100 ALA ALA C . n 
C 1 101 ALA 101 101 101 ALA ALA C . n 
C 1 102 ILE 102 102 102 ILE ILE C . n 
C 1 103 GLU 103 103 103 GLU GLU C . n 
C 1 104 ARG 104 104 104 ARG ARG C . n 
C 1 105 ASP 105 105 105 ASP ASP C . n 
C 1 106 PHE 106 106 106 PHE PHE C . n 
C 1 107 GLY 107 107 107 GLY GLY C . n 
C 1 108 SER 108 108 108 SER SER C . n 
C 1 109 VAL 109 109 109 VAL VAL C . n 
C 1 110 ASP 110 110 110 ASP ASP C . n 
C 1 111 ASN 111 111 111 ASN ASN C . n 
C 1 112 PHE 112 112 112 PHE PHE C . n 
C 1 113 LYS 113 113 113 LYS LYS C . n 
C 1 114 ALA 114 114 114 ALA ALA C . n 
C 1 115 GLU 115 115 115 GLU GLU C . n 
C 1 116 PHE 116 116 116 PHE PHE C . n 
C 1 117 GLU 117 117 117 GLU GLU C . n 
C 1 118 LYS 118 118 118 LYS LYS C . n 
C 1 119 ALA 119 119 119 ALA ALA C . n 
C 1 120 ALA 120 120 120 ALA ALA C . n 
C 1 121 ALA 121 121 121 ALA ALA C . n 
C 1 122 SER 122 122 122 SER SER C . n 
C 1 123 ARG 123 123 123 ARG ARG C . n 
C 1 124 PHE 124 124 124 PHE PHE C . n 
C 1 125 GLY 125 125 125 GLY GLY C . n 
C 1 126 SER 126 126 126 SER SER C . n 
C 1 127 GLY 127 127 127 GLY GLY C . n 
C 1 128 TRP 128 128 128 TRP TRP C . n 
C 1 129 ALA 129 129 129 ALA ALA C . n 
C 1 130 TRP 130 130 130 TRP TRP C . n 
C 1 131 LEU 131 131 131 LEU LEU C . n 
C 1 132 VAL 132 132 132 VAL VAL C . n 
C 1 133 LEU 133 133 133 LEU LEU C . n 
C 1 134 LYS 134 134 134 LYS LYS C . n 
C 1 135 GLY 135 135 135 GLY GLY C . n 
C 1 136 ASP 136 136 136 ASP ASP C . n 
C 1 137 LYS 137 137 137 LYS LYS C . n 
C 1 138 LEU 138 138 138 LEU LEU C . n 
C 1 139 ALA 139 139 139 ALA ALA C . n 
C 1 140 VAL 140 140 140 VAL VAL C . n 
C 1 141 VAL 141 141 141 VAL VAL C . n 
C 1 142 SER 142 142 142 SER SER C . n 
C 1 143 THR 143 143 143 THR THR C . n 
C 1 144 ALA 144 144 144 ALA ALA C . n 
C 1 145 ASN 145 145 145 ASN ASN C . n 
C 1 146 GLN 146 146 146 GLN GLN C . n 
C 1 147 ASP 147 147 147 ASP ASP C . n 
C 1 148 SER 148 148 148 SER SER C . n 
C 1 149 PRO 149 149 149 PRO PRO C . n 
C 1 150 LEU 150 150 150 LEU LEU C . n 
C 1 151 MET 151 151 151 MET MET C . n 
C 1 152 GLY 152 152 152 GLY GLY C . n 
C 1 153 GLU 153 153 153 GLU GLU C . n 
C 1 154 ALA 154 154 154 ALA ALA C . n 
C 1 155 ILE 155 155 155 ILE ILE C . n 
C 1 156 SER 156 156 156 SER SER C . n 
C 1 157 GLY 157 157 157 GLY GLY C . n 
C 1 158 ALA 158 158 158 ALA ALA C . n 
C 1 159 SER 159 159 159 SER SER C . n 
C 1 160 GLY 160 160 160 GLY GLY C . n 
C 1 161 PHE 161 161 161 PHE PHE C . n 
C 1 162 PRO 162 162 162 PRO PRO C . n 
C 1 163 ILE 163 163 163 ILE ILE C . n 
C 1 164 MET 164 164 164 MET MET C . n 
C 1 165 GLY 165 165 165 GLY GLY C . n 
C 1 166 LEU 166 166 166 LEU LEU C . n 
C 1 167 ASP 167 167 167 ASP ASP C . n 
C 1 168 VAL 168 168 168 VAL VAL C . n 
C 1 169 TRP 169 169 169 TRP TRP C . n 
C 1 170 GLU 170 170 170 GLU GLU C . n 
C 1 171 HIS 171 171 171 HIS HIS C . n 
C 1 172 ALA 172 172 172 ALA ALA C . n 
C 1 173 TYR 173 173 173 TYR TYR C . n 
C 1 174 TYR 174 174 174 TYR TYR C . n 
C 1 175 LEU 175 175 175 LEU LEU C . n 
C 1 176 LYS 176 176 176 LYS LYS C . n 
C 1 177 PHE 177 177 177 PHE PHE C . n 
C 1 178 GLN 178 178 178 GLN GLN C . n 
C 1 179 ASN 179 179 179 ASN ASN C . n 
C 1 180 ARG 180 180 180 ARG ARG C . n 
C 1 181 ARG 181 181 181 ARG ARG C . n 
C 1 182 PRO 182 182 182 PRO PRO C . n 
C 1 183 ASP 183 183 183 ASP ASP C . n 
C 1 184 TYR 184 184 184 TYR TYR C . n 
C 1 185 ILE 185 185 185 ILE ILE C . n 
C 1 186 LYS 186 186 186 LYS LYS C . n 
C 1 187 GLU 187 187 187 GLU GLU C . n 
C 1 188 PHE 188 188 188 PHE PHE C . n 
C 1 189 TRP 189 189 189 TRP TRP C . n 
C 1 190 ASN 190 190 190 ASN ASN C . n 
C 1 191 VAL 191 191 191 VAL VAL C . n 
C 1 192 VAL 192 192 192 VAL VAL C . n 
C 1 193 ASN 193 193 193 ASN ASN C . n 
C 1 194 TRP 194 194 194 TRP TRP C . n 
C 1 195 ASP 195 195 195 ASP ASP C . n 
C 1 196 GLU 196 196 196 GLU GLU C . n 
C 1 197 ALA 197 197 197 ALA ALA C . n 
C 1 198 ALA 198 198 198 ALA ALA C . n 
C 1 199 ALA 199 199 199 ALA ALA C . n 
C 1 200 ARG 200 200 200 ARG ARG C . n 
C 1 201 PHE 201 201 201 PHE PHE C . n 
C 1 202 ALA 202 202 202 ALA ALA C . n 
C 1 203 ALA 203 203 203 ALA ALA C . n 
C 1 204 LYS 204 204 204 LYS LYS C . n 
C 1 205 LYS 205 205 205 LYS LYS C . n 
D 1 1   SER 1   1   1   SER SER D . n 
D 1 2   TYR 2   2   2   TYR TYR D . n 
D 1 3   THR 3   3   3   THR THR D . n 
D 1 4   LEU 4   4   4   LEU LEU D . n 
D 1 5   PRO 5   5   5   PRO PRO D . n 
D 1 6   SER 6   6   6   SER SER D . n 
D 1 7   LEU 7   7   7   LEU LEU D . n 
D 1 8   PRO 8   8   8   PRO PRO D . n 
D 1 9   TYR 9   9   9   TYR TYR D . n 
D 1 10  ALA 10  10  10  ALA ALA D . n 
D 1 11  TYR 11  11  11  TYR TYR D . n 
D 1 12  ASP 12  12  12  ASP ASP D . n 
D 1 13  ALA 13  13  13  ALA ALA D . n 
D 1 14  LEU 14  14  14  LEU LEU D . n 
D 1 15  GLU 15  15  15  GLU GLU D . n 
D 1 16  PRO 16  16  16  PRO PRO D . n 
D 1 17  HIS 17  17  17  HIS HIS D . n 
D 1 18  PHE 18  18  18  PHE PHE D . n 
D 1 19  ASP 19  19  19  ASP ASP D . n 
D 1 20  LYS 20  20  20  LYS LYS D . n 
D 1 21  GLN 21  21  21  GLN GLN D . n 
D 1 22  THR 22  22  22  THR THR D . n 
D 1 23  MET 23  23  23  MET MET D . n 
D 1 24  GLU 24  24  24  GLU GLU D . n 
D 1 25  ILE 25  25  25  ILE ILE D . n 
D 1 26  HIS 26  26  26  HIS HIS D . n 
D 1 27  HIS 27  27  27  HIS HIS D . n 
D 1 28  THR 28  28  28  THR THR D . n 
D 1 29  LYS 29  29  29  LYS LYS D . n 
D 1 30  HIS 30  30  30  HIS HIS D . n 
D 1 31  HIS 31  31  31  HIS HIS D . n 
D 1 32  GLN 32  32  32  GLN GLN D . n 
D 1 33  THR 33  33  33  THR THR D . n 
D 1 34  PHE 34  34  34  PHE PHE D . n 
D 1 35  VAL 35  35  35  VAL VAL D . n 
D 1 36  ASN 36  36  36  ASN ASN D . n 
D 1 37  ASN 37  37  37  ASN ASN D . n 
D 1 38  ALA 38  38  38  ALA ALA D . n 
D 1 39  ASN 39  39  39  ASN ASN D . n 
D 1 40  ALA 40  40  40  ALA ALA D . n 
D 1 41  ALA 41  41  41  ALA ALA D . n 
D 1 42  LEU 42  42  42  LEU LEU D . n 
D 1 43  GLU 43  43  43  GLU GLU D . n 
D 1 44  SER 44  44  44  SER SER D . n 
D 1 45  LEU 45  45  45  LEU LEU D . n 
D 1 46  PRO 46  46  46  PRO PRO D . n 
D 1 47  GLU 47  47  47  GLU GLU D . n 
D 1 48  PHE 48  48  48  PHE PHE D . n 
D 1 49  ALA 49  49  49  ALA ALA D . n 
D 1 50  ASN 50  50  50  ASN ASN D . n 
D 1 51  LEU 51  51  51  LEU LEU D . n 
D 1 52  PRO 52  52  52  PRO PRO D . n 
D 1 53  VAL 53  53  53  VAL VAL D . n 
D 1 54  GLU 54  54  54  GLU GLU D . n 
D 1 55  GLU 55  55  55  GLU GLU D . n 
D 1 56  LEU 56  56  56  LEU LEU D . n 
D 1 57  ILE 57  57  57  ILE ILE D . n 
D 1 58  THR 58  58  58  THR THR D . n 
D 1 59  LYS 59  59  59  LYS LYS D . n 
D 1 60  LEU 60  60  60  LEU LEU D . n 
D 1 61  ASP 61  61  61  ASP ASP D . n 
D 1 62  GLN 62  62  62  GLN GLN D . n 
D 1 63  LEU 63  63  63  LEU LEU D . n 
D 1 64  PRO 64  64  64  PRO PRO D . n 
D 1 65  ALA 65  65  65  ALA ALA D . n 
D 1 66  ASP 66  66  66  ASP ASP D . n 
D 1 67  LYS 67  67  67  LYS LYS D . n 
D 1 68  LYS 68  68  68  LYS LYS D . n 
D 1 69  THR 69  69  69  THR THR D . n 
D 1 70  VAL 70  70  70  VAL VAL D . n 
D 1 71  LEU 71  71  71  LEU LEU D . n 
D 1 72  ARG 72  72  72  ARG ARG D . n 
D 1 73  ASN 73  73  73  ASN ASN D . n 
D 1 74  ASN 74  74  74  ASN ASN D . n 
D 1 75  ALA 75  75  75  ALA ALA D . n 
D 1 76  GLY 76  76  76  GLY GLY D . n 
D 1 77  GLY 77  77  77  GLY GLY D . n 
D 1 78  HIS 78  78  78  HIS HIS D . n 
D 1 79  ALA 79  79  79  ALA ALA D . n 
D 1 80  ASN 80  80  80  ASN ASN D . n 
D 1 81  HIS 81  81  81  HIS HIS D . n 
D 1 82  SER 82  82  82  SER SER D . n 
D 1 83  LEU 83  83  83  LEU LEU D . n 
D 1 84  PHE 84  84  84  PHE PHE D . n 
D 1 85  TRP 85  85  85  TRP TRP D . n 
D 1 86  LYS 86  86  86  LYS LYS D . n 
D 1 87  GLY 87  87  87  GLY GLY D . n 
D 1 88  LEU 88  88  88  LEU LEU D . n 
D 1 89  LYS 89  89  89  LYS LYS D . n 
D 1 90  LYS 90  90  90  LYS LYS D . n 
D 1 91  GLY 91  91  91  GLY GLY D . n 
D 1 92  THR 92  92  92  THR THR D . n 
D 1 93  THR 93  93  93  THR THR D . n 
D 1 94  LEU 94  94  94  LEU LEU D . n 
D 1 95  GLN 95  95  95  GLN GLN D . n 
D 1 96  GLY 96  96  96  GLY GLY D . n 
D 1 97  ASP 97  97  97  ASP ASP D . n 
D 1 98  LEU 98  98  98  LEU LEU D . n 
D 1 99  LYS 99  99  99  LYS LYS D . n 
D 1 100 ALA 100 100 100 ALA ALA D . n 
D 1 101 ALA 101 101 101 ALA ALA D . n 
D 1 102 ILE 102 102 102 ILE ILE D . n 
D 1 103 GLU 103 103 103 GLU GLU D . n 
D 1 104 ARG 104 104 104 ARG ARG D . n 
D 1 105 ASP 105 105 105 ASP ASP D . n 
D 1 106 PHE 106 106 106 PHE PHE D . n 
D 1 107 GLY 107 107 107 GLY GLY D . n 
D 1 108 SER 108 108 108 SER SER D . n 
D 1 109 VAL 109 109 109 VAL VAL D . n 
D 1 110 ASP 110 110 110 ASP ASP D . n 
D 1 111 ASN 111 111 111 ASN ASN D . n 
D 1 112 PHE 112 112 112 PHE PHE D . n 
D 1 113 LYS 113 113 113 LYS LYS D . n 
D 1 114 ALA 114 114 114 ALA ALA D . n 
D 1 115 GLU 115 115 115 GLU GLU D . n 
D 1 116 PHE 116 116 116 PHE PHE D . n 
D 1 117 GLU 117 117 117 GLU GLU D . n 
D 1 118 LYS 118 118 118 LYS LYS D . n 
D 1 119 ALA 119 119 119 ALA ALA D . n 
D 1 120 ALA 120 120 120 ALA ALA D . n 
D 1 121 ALA 121 121 121 ALA ALA D . n 
D 1 122 SER 122 122 122 SER SER D . n 
D 1 123 ARG 123 123 123 ARG ARG D . n 
D 1 124 PHE 124 124 124 PHE PHE D . n 
D 1 125 GLY 125 125 125 GLY GLY D . n 
D 1 126 SER 126 126 126 SER SER D . n 
D 1 127 GLY 127 127 127 GLY GLY D . n 
D 1 128 TRP 128 128 128 TRP TRP D . n 
D 1 129 ALA 129 129 129 ALA ALA D . n 
D 1 130 TRP 130 130 130 TRP TRP D . n 
D 1 131 LEU 131 131 131 LEU LEU D . n 
D 1 132 VAL 132 132 132 VAL VAL D . n 
D 1 133 LEU 133 133 133 LEU LEU D . n 
D 1 134 LYS 134 134 134 LYS LYS D . n 
D 1 135 GLY 135 135 135 GLY GLY D . n 
D 1 136 ASP 136 136 136 ASP ASP D . n 
D 1 137 LYS 137 137 137 LYS LYS D . n 
D 1 138 LEU 138 138 138 LEU LEU D . n 
D 1 139 ALA 139 139 139 ALA ALA D . n 
D 1 140 VAL 140 140 140 VAL VAL D . n 
D 1 141 VAL 141 141 141 VAL VAL D . n 
D 1 142 SER 142 142 142 SER SER D . n 
D 1 143 THR 143 143 143 THR THR D . n 
D 1 144 ALA 144 144 144 ALA ALA D . n 
D 1 145 ASN 145 145 145 ASN ASN D . n 
D 1 146 GLN 146 146 146 GLN GLN D . n 
D 1 147 ASP 147 147 147 ASP ASP D . n 
D 1 148 SER 148 148 148 SER SER D . n 
D 1 149 PRO 149 149 149 PRO PRO D . n 
D 1 150 LEU 150 150 150 LEU LEU D . n 
D 1 151 MET 151 151 151 MET MET D . n 
D 1 152 GLY 152 152 152 GLY GLY D . n 
D 1 153 GLU 153 153 153 GLU GLU D . n 
D 1 154 ALA 154 154 154 ALA ALA D . n 
D 1 155 ILE 155 155 155 ILE ILE D . n 
D 1 156 SER 156 156 156 SER SER D . n 
D 1 157 GLY 157 157 157 GLY GLY D . n 
D 1 158 ALA 158 158 158 ALA ALA D . n 
D 1 159 SER 159 159 159 SER SER D . n 
D 1 160 GLY 160 160 160 GLY GLY D . n 
D 1 161 PHE 161 161 161 PHE PHE D . n 
D 1 162 PRO 162 162 162 PRO PRO D . n 
D 1 163 ILE 163 163 163 ILE ILE D . n 
D 1 164 MET 164 164 164 MET MET D . n 
D 1 165 GLY 165 165 165 GLY GLY D . n 
D 1 166 LEU 166 166 166 LEU LEU D . n 
D 1 167 ASP 167 167 167 ASP ASP D . n 
D 1 168 VAL 168 168 168 VAL VAL D . n 
D 1 169 TRP 169 169 169 TRP TRP D . n 
D 1 170 GLU 170 170 170 GLU GLU D . n 
D 1 171 HIS 171 171 171 HIS HIS D . n 
D 1 172 ALA 172 172 172 ALA ALA D . n 
D 1 173 TYR 173 173 173 TYR TYR D . n 
D 1 174 TYR 174 174 174 TYR TYR D . n 
D 1 175 LEU 175 175 175 LEU LEU D . n 
D 1 176 LYS 176 176 176 LYS LYS D . n 
D 1 177 PHE 177 177 177 PHE PHE D . n 
D 1 178 GLN 178 178 178 GLN GLN D . n 
D 1 179 ASN 179 179 179 ASN ASN D . n 
D 1 180 ARG 180 180 180 ARG ARG D . n 
D 1 181 ARG 181 181 181 ARG ARG D . n 
D 1 182 PRO 182 182 182 PRO PRO D . n 
D 1 183 ASP 183 183 183 ASP ASP D . n 
D 1 184 TYR 184 184 184 TYR TYR D . n 
D 1 185 ILE 185 185 185 ILE ILE D . n 
D 1 186 LYS 186 186 186 LYS LYS D . n 
D 1 187 GLU 187 187 187 GLU GLU D . n 
D 1 188 PHE 188 188 188 PHE PHE D . n 
D 1 189 TRP 189 189 189 TRP TRP D . n 
D 1 190 ASN 190 190 190 ASN ASN D . n 
D 1 191 VAL 191 191 191 VAL VAL D . n 
D 1 192 VAL 192 192 192 VAL VAL D . n 
D 1 193 ASN 193 193 193 ASN ASN D . n 
D 1 194 TRP 194 194 194 TRP TRP D . n 
D 1 195 ASP 195 195 195 ASP ASP D . n 
D 1 196 GLU 196 196 196 GLU GLU D . n 
D 1 197 ALA 197 197 197 ALA ALA D . n 
D 1 198 ALA 198 198 198 ALA ALA D . n 
D 1 199 ALA 199 199 199 ALA ALA D . n 
D 1 200 ARG 200 200 200 ARG ARG D . n 
D 1 201 PHE 201 201 201 PHE PHE D . n 
D 1 202 ALA 202 202 202 ALA ALA D . n 
D 1 203 ALA 203 203 203 ALA ALA D . n 
D 1 204 LYS 204 204 204 LYS LYS D . n 
D 1 205 LYS 205 205 205 LYS LYS D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 MN  1  501 206 MN  MN3 A . 
F 2 MN  1  502 206 MN  MN3 B . 
G 2 MN  1  503 206 MN  MN3 C . 
H 2 MN  1  504 206 MN  MN3 D . 
I 3 HOH 1  502 1   HOH HOH A . 
I 3 HOH 2  503 2   HOH HOH A . 
I 3 HOH 3  504 3   HOH HOH A . 
I 3 HOH 4  505 4   HOH HOH A . 
I 3 HOH 5  506 5   HOH HOH A . 
I 3 HOH 6  507 6   HOH HOH A . 
I 3 HOH 7  508 7   HOH HOH A . 
I 3 HOH 8  509 8   HOH HOH A . 
I 3 HOH 9  510 9   HOH HOH A . 
I 3 HOH 10 511 11  HOH HOH A . 
I 3 HOH 11 512 12  HOH HOH A . 
I 3 HOH 12 513 13  HOH HOH A . 
I 3 HOH 13 514 14  HOH HOH A . 
I 3 HOH 14 515 15  HOH HOH A . 
I 3 HOH 15 516 16  HOH HOH A . 
I 3 HOH 16 517 17  HOH HOH A . 
I 3 HOH 17 518 18  HOH HOH A . 
I 3 HOH 18 519 19  HOH HOH A . 
I 3 HOH 19 520 20  HOH HOH A . 
I 3 HOH 20 521 21  HOH HOH A . 
I 3 HOH 21 522 22  HOH HOH A . 
I 3 HOH 22 523 23  HOH HOH A . 
I 3 HOH 23 524 24  HOH HOH A . 
I 3 HOH 24 525 25  HOH HOH A . 
I 3 HOH 25 526 26  HOH HOH A . 
I 3 HOH 26 527 28  HOH HOH A . 
I 3 HOH 27 528 29  HOH HOH A . 
I 3 HOH 28 529 31  HOH HOH A . 
I 3 HOH 29 530 32  HOH HOH A . 
I 3 HOH 30 531 33  HOH HOH A . 
I 3 HOH 31 532 34  HOH HOH A . 
I 3 HOH 32 533 35  HOH HOH A . 
I 3 HOH 33 534 36  HOH HOH A . 
I 3 HOH 34 535 40  HOH HOH A . 
I 3 HOH 35 536 41  HOH HOH A . 
I 3 HOH 36 537 42  HOH HOH A . 
I 3 HOH 37 538 43  HOH HOH A . 
I 3 HOH 38 539 44  HOH HOH A . 
I 3 HOH 39 540 45  HOH HOH A . 
I 3 HOH 40 541 46  HOH HOH A . 
I 3 HOH 41 542 47  HOH HOH A . 
I 3 HOH 42 543 48  HOH HOH A . 
I 3 HOH 43 544 49  HOH HOH A . 
I 3 HOH 44 545 50  HOH HOH A . 
I 3 HOH 45 546 51  HOH HOH A . 
I 3 HOH 46 547 52  HOH HOH A . 
I 3 HOH 47 548 53  HOH HOH A . 
I 3 HOH 48 549 54  HOH HOH A . 
I 3 HOH 49 550 56  HOH HOH A . 
I 3 HOH 50 551 57  HOH HOH A . 
I 3 HOH 51 552 58  HOH HOH A . 
I 3 HOH 52 553 59  HOH HOH A . 
I 3 HOH 53 554 65  HOH HOH A . 
I 3 HOH 54 555 66  HOH HOH A . 
I 3 HOH 55 556 67  HOH HOH A . 
I 3 HOH 56 557 68  HOH HOH A . 
I 3 HOH 57 558 69  HOH HOH A . 
I 3 HOH 58 559 70  HOH HOH A . 
I 3 HOH 59 560 71  HOH HOH A . 
I 3 HOH 60 561 72  HOH HOH A . 
I 3 HOH 61 562 73  HOH HOH A . 
I 3 HOH 62 563 74  HOH HOH A . 
I 3 HOH 63 564 75  HOH HOH A . 
I 3 HOH 64 565 83  HOH HOH A . 
I 3 HOH 65 566 84  HOH HOH A . 
I 3 HOH 66 567 85  HOH HOH A . 
I 3 HOH 67 568 86  HOH HOH A . 
I 3 HOH 68 569 87  HOH HOH A . 
I 3 HOH 69 570 88  HOH HOH A . 
I 3 HOH 70 571 89  HOH HOH A . 
I 3 HOH 71 572 10  HOH HOH A . 
I 3 HOH 72 573 27  HOH HOH A . 
I 3 HOH 73 574 28  HOH HOH A . 
I 3 HOH 74 575 30  HOH HOH A . 
I 3 HOH 75 576 35  HOH HOH A . 
I 3 HOH 76 577 37  HOH HOH A . 
I 3 HOH 77 578 38  HOH HOH A . 
I 3 HOH 78 579 39  HOH HOH A . 
I 3 HOH 79 580 55  HOH HOH A . 
I 3 HOH 80 581 60  HOH HOH A . 
I 3 HOH 81 582 80  HOH HOH A . 
I 3 HOH 82 583 93  HOH HOH A . 
I 3 HOH 83 584 207 HOH OH  A . 
J 3 HOH 1  503 10  HOH HOH B . 
J 3 HOH 2  504 27  HOH HOH B . 
J 3 HOH 3  505 30  HOH HOH B . 
J 3 HOH 4  506 37  HOH HOH B . 
J 3 HOH 5  507 38  HOH HOH B . 
J 3 HOH 6  508 39  HOH HOH B . 
J 3 HOH 7  509 55  HOH HOH B . 
J 3 HOH 8  510 1   HOH HOH B . 
J 3 HOH 9  511 2   HOH HOH B . 
J 3 HOH 10 512 3   HOH HOH B . 
J 3 HOH 11 513 4   HOH HOH B . 
J 3 HOH 12 514 5   HOH HOH B . 
J 3 HOH 13 515 6   HOH HOH B . 
J 3 HOH 14 516 7   HOH HOH B . 
J 3 HOH 15 517 8   HOH HOH B . 
J 3 HOH 16 518 9   HOH HOH B . 
J 3 HOH 17 519 11  HOH HOH B . 
J 3 HOH 18 520 12  HOH HOH B . 
J 3 HOH 19 521 13  HOH HOH B . 
J 3 HOH 20 522 14  HOH HOH B . 
J 3 HOH 21 523 15  HOH HOH B . 
J 3 HOH 22 524 16  HOH HOH B . 
J 3 HOH 23 525 17  HOH HOH B . 
J 3 HOH 24 526 18  HOH HOH B . 
J 3 HOH 25 527 19  HOH HOH B . 
J 3 HOH 26 528 20  HOH HOH B . 
J 3 HOH 27 529 21  HOH HOH B . 
J 3 HOH 28 530 22  HOH HOH B . 
J 3 HOH 29 531 23  HOH HOH B . 
J 3 HOH 30 532 24  HOH HOH B . 
J 3 HOH 31 533 25  HOH HOH B . 
J 3 HOH 32 534 26  HOH HOH B . 
J 3 HOH 33 535 29  HOH HOH B . 
J 3 HOH 34 536 31  HOH HOH B . 
J 3 HOH 35 537 32  HOH HOH B . 
J 3 HOH 36 538 33  HOH HOH B . 
J 3 HOH 37 539 34  HOH HOH B . 
J 3 HOH 38 540 36  HOH HOH B . 
J 3 HOH 39 541 40  HOH HOH B . 
J 3 HOH 40 542 41  HOH HOH B . 
J 3 HOH 41 543 42  HOH HOH B . 
J 3 HOH 42 544 43  HOH HOH B . 
J 3 HOH 43 545 44  HOH HOH B . 
J 3 HOH 44 546 45  HOH HOH B . 
J 3 HOH 45 547 46  HOH HOH B . 
J 3 HOH 46 548 48  HOH HOH B . 
J 3 HOH 47 549 49  HOH HOH B . 
J 3 HOH 48 550 50  HOH HOH B . 
J 3 HOH 49 551 56  HOH HOH B . 
J 3 HOH 50 552 59  HOH HOH B . 
J 3 HOH 51 553 61  HOH HOH B . 
J 3 HOH 52 554 62  HOH HOH B . 
J 3 HOH 53 555 63  HOH HOH B . 
J 3 HOH 54 556 64  HOH HOH B . 
J 3 HOH 55 557 69  HOH HOH B . 
J 3 HOH 56 558 71  HOH HOH B . 
J 3 HOH 57 559 72  HOH HOH B . 
J 3 HOH 58 560 76  HOH HOH B . 
J 3 HOH 59 561 77  HOH HOH B . 
J 3 HOH 60 562 78  HOH HOH B . 
J 3 HOH 61 563 79  HOH HOH B . 
J 3 HOH 62 564 90  HOH HOH B . 
J 3 HOH 63 565 91  HOH HOH B . 
J 3 HOH 64 566 92  HOH HOH B . 
J 3 HOH 65 567 207 HOH OH  B . 
K 3 HOH 1  504 1   HOH HOH C . 
K 3 HOH 2  505 2   HOH HOH C . 
K 3 HOH 3  506 3   HOH HOH C . 
K 3 HOH 4  507 4   HOH HOH C . 
K 3 HOH 5  508 5   HOH HOH C . 
K 3 HOH 6  509 6   HOH HOH C . 
K 3 HOH 7  510 7   HOH HOH C . 
K 3 HOH 8  511 8   HOH HOH C . 
K 3 HOH 9  512 9   HOH HOH C . 
K 3 HOH 10 513 11  HOH HOH C . 
K 3 HOH 11 514 12  HOH HOH C . 
K 3 HOH 12 515 13  HOH HOH C . 
K 3 HOH 13 516 14  HOH HOH C . 
K 3 HOH 14 517 15  HOH HOH C . 
K 3 HOH 15 518 16  HOH HOH C . 
K 3 HOH 16 519 17  HOH HOH C . 
K 3 HOH 17 520 18  HOH HOH C . 
K 3 HOH 18 521 19  HOH HOH C . 
K 3 HOH 19 522 20  HOH HOH C . 
K 3 HOH 20 523 21  HOH HOH C . 
K 3 HOH 21 524 22  HOH HOH C . 
K 3 HOH 22 525 23  HOH HOH C . 
K 3 HOH 23 526 24  HOH HOH C . 
K 3 HOH 24 527 25  HOH HOH C . 
K 3 HOH 25 528 26  HOH HOH C . 
K 3 HOH 26 529 29  HOH HOH C . 
K 3 HOH 27 530 31  HOH HOH C . 
K 3 HOH 28 531 32  HOH HOH C . 
K 3 HOH 29 532 33  HOH HOH C . 
K 3 HOH 30 533 34  HOH HOH C . 
K 3 HOH 31 534 36  HOH HOH C . 
K 3 HOH 32 535 40  HOH HOH C . 
K 3 HOH 33 536 41  HOH HOH C . 
K 3 HOH 34 537 42  HOH HOH C . 
K 3 HOH 35 538 43  HOH HOH C . 
K 3 HOH 36 539 44  HOH HOH C . 
K 3 HOH 37 540 45  HOH HOH C . 
K 3 HOH 38 541 47  HOH HOH C . 
K 3 HOH 39 542 48  HOH HOH C . 
K 3 HOH 40 543 50  HOH HOH C . 
K 3 HOH 41 544 51  HOH HOH C . 
K 3 HOH 42 545 52  HOH HOH C . 
K 3 HOH 43 546 53  HOH HOH C . 
K 3 HOH 44 547 54  HOH HOH C . 
K 3 HOH 45 548 58  HOH HOH C . 
K 3 HOH 46 549 59  HOH HOH C . 
K 3 HOH 47 550 61  HOH HOH C . 
K 3 HOH 48 551 62  HOH HOH C . 
K 3 HOH 49 552 63  HOH HOH C . 
K 3 HOH 50 553 64  HOH HOH C . 
K 3 HOH 51 554 65  HOH HOH C . 
K 3 HOH 52 555 66  HOH HOH C . 
K 3 HOH 53 556 67  HOH HOH C . 
K 3 HOH 54 557 70  HOH HOH C . 
K 3 HOH 55 558 73  HOH HOH C . 
K 3 HOH 56 559 74  HOH HOH C . 
K 3 HOH 57 560 77  HOH HOH C . 
K 3 HOH 58 561 78  HOH HOH C . 
K 3 HOH 59 562 79  HOH HOH C . 
K 3 HOH 60 563 80  HOH HOH C . 
K 3 HOH 61 564 81  HOH HOH C . 
K 3 HOH 62 565 82  HOH HOH C . 
K 3 HOH 63 566 94  HOH HOH C . 
K 3 HOH 64 567 95  HOH HOH C . 
K 3 HOH 65 568 96  HOH HOH C . 
K 3 HOH 66 569 97  HOH HOH C . 
K 3 HOH 67 570 98  HOH HOH C . 
K 3 HOH 68 571 99  HOH HOH C . 
K 3 HOH 69 572 10  HOH HOH C . 
K 3 HOH 70 573 27  HOH HOH C . 
K 3 HOH 71 574 30  HOH HOH C . 
K 3 HOH 72 575 35  HOH HOH C . 
K 3 HOH 73 576 37  HOH HOH C . 
K 3 HOH 74 577 38  HOH HOH C . 
K 3 HOH 75 578 39  HOH HOH C . 
K 3 HOH 76 579 45  HOH HOH C . 
K 3 HOH 77 580 55  HOH HOH C . 
K 3 HOH 78 581 57  HOH HOH C . 
K 3 HOH 79 582 60  HOH HOH C . 
K 3 HOH 80 583 207 HOH OH  C . 
L 3 HOH 1  505 10  HOH HOH D . 
L 3 HOH 2  506 27  HOH HOH D . 
L 3 HOH 3  507 28  HOH HOH D . 
L 3 HOH 4  508 30  HOH HOH D . 
L 3 HOH 5  509 35  HOH HOH D . 
L 3 HOH 6  510 37  HOH HOH D . 
L 3 HOH 7  511 38  HOH HOH D . 
L 3 HOH 8  512 39  HOH HOH D . 
L 3 HOH 9  513 60  HOH HOH D . 
L 3 HOH 10 514 1   HOH HOH D . 
L 3 HOH 11 515 2   HOH HOH D . 
L 3 HOH 12 516 3   HOH HOH D . 
L 3 HOH 13 517 4   HOH HOH D . 
L 3 HOH 14 518 5   HOH HOH D . 
L 3 HOH 15 519 6   HOH HOH D . 
L 3 HOH 16 520 7   HOH HOH D . 
L 3 HOH 17 521 8   HOH HOH D . 
L 3 HOH 18 522 9   HOH HOH D . 
L 3 HOH 19 523 11  HOH HOH D . 
L 3 HOH 20 524 12  HOH HOH D . 
L 3 HOH 21 525 13  HOH HOH D . 
L 3 HOH 22 526 14  HOH HOH D . 
L 3 HOH 23 527 15  HOH HOH D . 
L 3 HOH 24 528 16  HOH HOH D . 
L 3 HOH 25 529 17  HOH HOH D . 
L 3 HOH 26 530 18  HOH HOH D . 
L 3 HOH 27 531 19  HOH HOH D . 
L 3 HOH 28 532 20  HOH HOH D . 
L 3 HOH 29 533 21  HOH HOH D . 
L 3 HOH 30 534 22  HOH HOH D . 
L 3 HOH 31 535 23  HOH HOH D . 
L 3 HOH 32 536 24  HOH HOH D . 
L 3 HOH 33 537 25  HOH HOH D . 
L 3 HOH 34 538 26  HOH HOH D . 
L 3 HOH 35 539 28  HOH HOH D . 
L 3 HOH 36 540 29  HOH HOH D . 
L 3 HOH 37 541 31  HOH HOH D . 
L 3 HOH 38 542 32  HOH HOH D . 
L 3 HOH 39 543 33  HOH HOH D . 
L 3 HOH 40 544 34  HOH HOH D . 
L 3 HOH 41 545 36  HOH HOH D . 
L 3 HOH 42 546 40  HOH HOH D . 
L 3 HOH 43 547 41  HOH HOH D . 
L 3 HOH 44 548 42  HOH HOH D . 
L 3 HOH 45 549 43  HOH HOH D . 
L 3 HOH 46 550 44  HOH HOH D . 
L 3 HOH 47 551 46  HOH HOH D . 
L 3 HOH 48 552 47  HOH HOH D . 
L 3 HOH 49 553 49  HOH HOH D . 
L 3 HOH 50 554 51  HOH HOH D . 
L 3 HOH 51 555 52  HOH HOH D . 
L 3 HOH 52 556 53  HOH HOH D . 
L 3 HOH 53 557 54  HOH HOH D . 
L 3 HOH 54 558 56  HOH HOH D . 
L 3 HOH 55 559 58  HOH HOH D . 
L 3 HOH 56 560 61  HOH HOH D . 
L 3 HOH 57 561 62  HOH HOH D . 
L 3 HOH 58 562 63  HOH HOH D . 
L 3 HOH 59 563 64  HOH HOH D . 
L 3 HOH 60 564 68  HOH HOH D . 
L 3 HOH 61 565 75  HOH HOH D . 
L 3 HOH 62 566 76  HOH HOH D . 
L 3 HOH 63 567 81  HOH HOH D . 
L 3 HOH 64 568 82  HOH HOH D . 
L 3 HOH 65 569 100 HOH HOH D . 
L 3 HOH 66 570 101 HOH HOH D . 
L 3 HOH 67 571 102 HOH HOH D . 
L 3 HOH 68 572 103 HOH HOH D . 
L 3 HOH 69 573 104 HOH HOH D . 
L 3 HOH 70 574 105 HOH HOH D . 
L 3 HOH 71 575 106 HOH HOH D . 
L 3 HOH 72 576 107 HOH HOH D . 
L 3 HOH 73 577 108 HOH HOH D . 
L 3 HOH 74 578 109 HOH HOH D . 
L 3 HOH 75 579 110 HOH HOH D . 
L 3 HOH 76 580 111 HOH HOH D . 
L 3 HOH 77 581 112 HOH HOH D . 
L 3 HOH 78 582 113 HOH HOH D . 
L 3 HOH 79 583 114 HOH HOH D . 
L 3 HOH 80 584 115 HOH HOH D . 
L 3 HOH 81 585 207 HOH OH  D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J 
2 1 C,D,G,H,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1720  ? 
1 MORE         -12   ? 
1 'SSA (A^2)'  17680 ? 
2 'ABSA (A^2)' 1720  ? 
2 MORE         -12   ? 
2 'SSA (A^2)'  17590 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 555 ? I HOH . 
2 1 C HOH 555 ? K HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? I HOH .   ? A HOH 584 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 91.7  ? 
2  O   ? I HOH .   ? A HOH 584 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 26  ? A HIS 26  ? 1_555 175.4 ? 
3  NE2 ? A HIS 171 ? A HIS 171 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 26  ? A HIS 26  ? 1_555 88.1  ? 
4  O   ? I HOH .   ? A HOH 584 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 95.2  ? 
5  NE2 ? A HIS 171 ? A HIS 171 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 136.6 ? 
6  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 88.1  ? 
7  O   ? I HOH .   ? A HOH 584 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 86.9  ? 
8  NE2 ? A HIS 171 ? A HIS 171 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 117.5 ? 
9  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 89.1  ? 
10 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 105.6 ? 
11 O   ? J HOH .   ? B HOH 567 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 175.9 ? 
12 O   ? J HOH .   ? B HOH 567 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 93.9  ? 
13 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 86.2  ? 
14 O   ? J HOH .   ? B HOH 567 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 91.5  ? 
15 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 91.1  ? 
16 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 135.9 ? 
17 O   ? J HOH .   ? B HOH 567 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 84.3  ? 
18 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 91.8  ? 
19 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 109.0 ? 
20 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 115.0 ? 
21 O   ? K HOH .   ? C HOH 583 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 89.0  ? 
22 O   ? K HOH .   ? C HOH 583 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 177.2 ? 
23 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 91.9  ? 
24 O   ? K HOH .   ? C HOH 583 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 85.0  ? 
25 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 109.8 ? 
26 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 92.2  ? 
27 O   ? K HOH .   ? C HOH 583 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 93.4  ? 
28 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 138.5 ? 
29 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 87.8  ? 
30 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 111.7 ? 
31 O   ? L HOH .   ? D HOH 585 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 86.2  ? 
32 O   ? L HOH .   ? D HOH 585 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 176.5 ? 
33 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 91.6  ? 
34 O   ? L HOH .   ? D HOH 585 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 94.4  ? 
35 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 113.4 ? 
36 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 89.0  ? 
37 O   ? L HOH .   ? D HOH 585 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 89.3  ? 
38 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 112.5 ? 
39 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 89.1  ? 
40 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 134.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-06-27 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       1.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 45  ? ? -151.10 63.69   
2  1 ALA A 65  ? ? -37.50  -38.26  
3  1 LYS A 89  ? ? 177.14  137.76  
4  1 ASP A 136 ? ? 59.14   9.97    
5  1 ASN A 145 ? ? 44.25   -115.02 
6  1 GLN A 178 ? ? 52.03   -124.80 
7  1 LYS B 89  ? ? 177.20  137.40  
8  1 ASN B 145 ? ? 45.85   -116.55 
9  1 GLN B 178 ? ? 50.29   -123.57 
10 1 LYS C 89  ? ? 176.56  137.97  
11 1 ASN C 145 ? ? 44.96   -115.78 
12 1 GLN C 178 ? ? 51.32   -124.66 
13 1 LYS D 89  ? ? 177.05  138.34  
14 1 ASN D 145 ? ? 46.55   -116.92 
15 1 GLN D 178 ? ? 51.08   -123.85 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 water                HOH 
#