data_1EN6
# 
_entry.id   1EN6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EN6         
RCSB  RCSB010742   
WWPDB D_1000010742 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1VEW 'native crystal structure'                                              unspecified 
PDB 1MMM 'iron-substituted native crystal structure'                             unspecified 
PDB 1EN4 'E. coli manganese superoxide dismutase Q146H mutant crystal structure' unspecified 
PDB 1EN5 'E. coli manganese superoxide dismutase Y34F mutant crystal structure'  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EN6 
_pdbx_database_status.recvd_initial_deposition_date   2000-03-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Edwards, R.A.'   1 
'Whittaker, M.M.' 2 
'Baker, E.N.'     3 
'Whittaker, J.W.' 4 
'Jameson, G.B.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Outer sphere mutations perturb metal reactivity in manganese superoxide dismutase.' Biochemistry       40 15   27   2001 
BICHAW US 0006-2960 0033 ? 11141052 10.1021/bi0018943     
1       
'Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.' 
Biochemistry       40 4622 4632 2001 BICHAW US 0006-2960 0033 ? ?        10.1021/bi002403h     
2       'Crystal Structure of Escherichia coli Manganese Superoxide Dismutase at 2.1 A Resolution' J.BIOL.INORG.CHEM. 3  161  171  
1998 JJBCFA GW 0949-8257 2154 ? ?        10.1007/s007750050217 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Edwards, R.A.'   1  
primary 'Whittaker, M.M.' 2  
primary 'Whittaker, J.W.' 3  
primary 'Baker, E.N.'     4  
primary 'Jameson, G.B.'   5  
1       'Edwards, R.A.'   6  
1       'Whittaker, M.M.' 7  
1       'Whittaker, J.W.' 8  
1       'Baker, E.N.'     9  
1       'Jameson, G.B.'   10 
2       'Edwards, R.A.'   11 
2       'Baker, H.M.'     12 
2       'Whittaker, M.M.' 13 
2       'Whittaker, J.W.' 14 
2       'Jameson, G.B.'   15 
2       'Baker, E.N.'     16 
# 
_cell.entry_id           1EN6 
_cell.length_a           101.698 
_cell.length_b           109.297 
_cell.length_c           181.722 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EN6 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MANGANESE SUPEROXIDE DISMUTASE' 22981.906 4   1.15.1.1 Q146L ? ? 
2 non-polymer syn 'MANGANESE (II) ION'             54.938    4   ?        ?     ? ? 
3 water       nat water                            18.015    344 ?        ?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANLDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANLDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   TYR n 
1 3   THR n 
1 4   LEU n 
1 5   PRO n 
1 6   SER n 
1 7   LEU n 
1 8   PRO n 
1 9   TYR n 
1 10  ALA n 
1 11  TYR n 
1 12  ASP n 
1 13  ALA n 
1 14  LEU n 
1 15  GLU n 
1 16  PRO n 
1 17  HIS n 
1 18  PHE n 
1 19  ASP n 
1 20  LYS n 
1 21  GLN n 
1 22  THR n 
1 23  MET n 
1 24  GLU n 
1 25  ILE n 
1 26  HIS n 
1 27  HIS n 
1 28  THR n 
1 29  LYS n 
1 30  HIS n 
1 31  HIS n 
1 32  GLN n 
1 33  THR n 
1 34  TYR n 
1 35  VAL n 
1 36  ASN n 
1 37  ASN n 
1 38  ALA n 
1 39  ASN n 
1 40  ALA n 
1 41  ALA n 
1 42  LEU n 
1 43  GLU n 
1 44  SER n 
1 45  LEU n 
1 46  PRO n 
1 47  GLU n 
1 48  PHE n 
1 49  ALA n 
1 50  ASN n 
1 51  LEU n 
1 52  PRO n 
1 53  VAL n 
1 54  GLU n 
1 55  GLU n 
1 56  LEU n 
1 57  ILE n 
1 58  THR n 
1 59  LYS n 
1 60  LEU n 
1 61  ASP n 
1 62  GLN n 
1 63  LEU n 
1 64  PRO n 
1 65  ALA n 
1 66  ASP n 
1 67  LYS n 
1 68  LYS n 
1 69  THR n 
1 70  VAL n 
1 71  LEU n 
1 72  ARG n 
1 73  ASN n 
1 74  ASN n 
1 75  ALA n 
1 76  GLY n 
1 77  GLY n 
1 78  HIS n 
1 79  ALA n 
1 80  ASN n 
1 81  HIS n 
1 82  SER n 
1 83  LEU n 
1 84  PHE n 
1 85  TRP n 
1 86  LYS n 
1 87  GLY n 
1 88  LEU n 
1 89  LYS n 
1 90  LYS n 
1 91  GLY n 
1 92  THR n 
1 93  THR n 
1 94  LEU n 
1 95  GLN n 
1 96  GLY n 
1 97  ASP n 
1 98  LEU n 
1 99  LYS n 
1 100 ALA n 
1 101 ALA n 
1 102 ILE n 
1 103 GLU n 
1 104 ARG n 
1 105 ASP n 
1 106 PHE n 
1 107 GLY n 
1 108 SER n 
1 109 VAL n 
1 110 ASP n 
1 111 ASN n 
1 112 PHE n 
1 113 LYS n 
1 114 ALA n 
1 115 GLU n 
1 116 PHE n 
1 117 GLU n 
1 118 LYS n 
1 119 ALA n 
1 120 ALA n 
1 121 ALA n 
1 122 SER n 
1 123 ARG n 
1 124 PHE n 
1 125 GLY n 
1 126 SER n 
1 127 GLY n 
1 128 TRP n 
1 129 ALA n 
1 130 TRP n 
1 131 LEU n 
1 132 VAL n 
1 133 LEU n 
1 134 LYS n 
1 135 GLY n 
1 136 ASP n 
1 137 LYS n 
1 138 LEU n 
1 139 ALA n 
1 140 VAL n 
1 141 VAL n 
1 142 SER n 
1 143 THR n 
1 144 ALA n 
1 145 ASN n 
1 146 LEU n 
1 147 ASP n 
1 148 SER n 
1 149 PRO n 
1 150 LEU n 
1 151 MET n 
1 152 GLY n 
1 153 GLU n 
1 154 ALA n 
1 155 ILE n 
1 156 SER n 
1 157 GLY n 
1 158 ALA n 
1 159 SER n 
1 160 GLY n 
1 161 PHE n 
1 162 PRO n 
1 163 ILE n 
1 164 MET n 
1 165 GLY n 
1 166 LEU n 
1 167 ASP n 
1 168 VAL n 
1 169 TRP n 
1 170 GLU n 
1 171 HIS n 
1 172 ALA n 
1 173 TYR n 
1 174 TYR n 
1 175 LEU n 
1 176 LYS n 
1 177 PHE n 
1 178 GLN n 
1 179 ASN n 
1 180 ARG n 
1 181 ARG n 
1 182 PRO n 
1 183 ASP n 
1 184 TYR n 
1 185 ILE n 
1 186 LYS n 
1 187 GLU n 
1 188 PHE n 
1 189 TRP n 
1 190 ASN n 
1 191 VAL n 
1 192 VAL n 
1 193 ASN n 
1 194 TRP n 
1 195 ASP n 
1 196 GLU n 
1 197 ALA n 
1 198 ALA n 
1 199 ALA n 
1 200 ARG n 
1 201 PHE n 
1 202 ALA n 
1 203 ALA n 
1 204 LYS n 
1 205 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PDT1-5 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    SODM_ECOLI 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00448 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EN6 A 1 ? 205 ? P00448 1 ? 205 ? 1 205 
2 1 1EN6 B 1 ? 205 ? P00448 1 ? 205 ? 1 205 
3 1 1EN6 C 1 ? 205 ? P00448 1 ? 205 ? 1 205 
4 1 1EN6 D 1 ? 205 ? P00448 1 ? 205 ? 1 205 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1EN6 LEU A 146 ? UNP P00448 GLN 146 ENGINEERED 146 1 
2 1EN6 LEU B 146 ? UNP P00448 GLN 146 ENGINEERED 146 2 
3 1EN6 LEU C 146 ? UNP P00448 GLN 146 ENGINEERED 146 3 
4 1EN6 LEU D 146 ? UNP P00448 GLN 146 ENGINEERED 146 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EN6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.20 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '20% w/v PEG 6000, 0.05 M bicine, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1998-03-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EN6 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   66399 
_reflns.number_all                   66399 
_reflns.percent_possible_obs         96.8 
_reflns.pdbx_Rmerge_I_obs            0.0670000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        34.4 
_reflns.B_iso_Wilson_estimate        29 
_reflns.pdbx_redundancy              9.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.05 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   87.4 
_reflns_shell.Rmerge_I_obs           0.2550000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.number_unique_all      3949 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1EN6 
_refine.ls_number_reflns_obs                     66366 
_refine.ls_number_reflns_all                     66366 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             40.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    96.9 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1790000 
_refine.ls_R_factor_R_free                       0.2070000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  3261 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -4.605 
_refine.aniso_B[2][2]                            -1.928 
_refine.aniso_B[3][3]                            6.534 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6632 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             340 
_refine_hist.number_atoms_total               6980 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        40.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d     0.005128 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg  1.21558  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  1.333    1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it 2.085    2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  2.075    2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it 3.154    2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1EN6 
_struct.title                     'CRYSTAL STRUCTURE ANALYSIS OF THE E. COLI MANGANESE SUPEROXIDE DISMUTASE Q146L MUTANT' 
_struct.pdbx_descriptor           
'CRYSTAL STRUCTURE ANALYSIS OF THE E. COLI MANGANESE SUPEROXIDE DISMUTASE Q146L MUTANT (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EN6 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'proton shuttle, Q146L, mutant, manganese superoxide dismutase, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 19  ? LYS A 29  ? ASP A 19  LYS A 29  1 ? 11 
HELX_P HELX_P2  2  LYS A 29  ? GLU A 43  ? LYS A 29  GLU A 43  1 ? 15 
HELX_P HELX_P3  3  LEU A 45  ? ASN A 50  ? LEU A 45  ASN A 50  1 ? 6  
HELX_P HELX_P4  4  PRO A 52  ? ILE A 57  ? PRO A 52  ILE A 57  1 ? 6  
HELX_P HELX_P5  5  THR A 58  ? LEU A 63  ? THR A 58  LEU A 63  5 ? 6  
HELX_P HELX_P6  6  LYS A 67  ? GLY A 87  ? LYS A 67  GLY A 87  1 ? 21 
HELX_P HELX_P7  7  GLN A 95  ? GLY A 107 ? GLN A 95  GLY A 107 1 ? 13 
HELX_P HELX_P8  8  SER A 108 ? ARG A 123 ? SER A 108 ARG A 123 1 ? 16 
HELX_P HELX_P9  9  SER A 148 ? MET A 151 ? SER A 148 MET A 151 5 ? 4  
HELX_P HELX_P10 10 GLY A 152 ? GLY A 157 ? GLY A 152 GLY A 157 1 ? 6  
HELX_P HELX_P11 11 TRP A 169 ? ALA A 172 ? TRP A 169 ALA A 172 5 ? 4  
HELX_P HELX_P12 12 TYR A 173 ? GLN A 178 ? TYR A 173 GLN A 178 1 ? 6  
HELX_P HELX_P13 13 ARG A 180 ? TRP A 189 ? ARG A 180 TRP A 189 1 ? 10 
HELX_P HELX_P14 14 ASN A 193 ? LYS A 204 ? ASN A 193 LYS A 204 1 ? 12 
HELX_P HELX_P15 15 ASP B 19  ? LYS B 29  ? ASP B 19  LYS B 29  1 ? 11 
HELX_P HELX_P16 16 LYS B 29  ? GLU B 43  ? LYS B 29  GLU B 43  1 ? 15 
HELX_P HELX_P17 17 LEU B 45  ? ASN B 50  ? LEU B 45  ASN B 50  1 ? 6  
HELX_P HELX_P18 18 PRO B 52  ? ILE B 57  ? PRO B 52  ILE B 57  1 ? 6  
HELX_P HELX_P19 19 THR B 58  ? LEU B 63  ? THR B 58  LEU B 63  5 ? 6  
HELX_P HELX_P20 20 LYS B 67  ? GLY B 87  ? LYS B 67  GLY B 87  1 ? 21 
HELX_P HELX_P21 21 GLN B 95  ? GLY B 107 ? GLN B 95  GLY B 107 1 ? 13 
HELX_P HELX_P22 22 SER B 108 ? ARG B 123 ? SER B 108 ARG B 123 1 ? 16 
HELX_P HELX_P23 23 SER B 148 ? MET B 151 ? SER B 148 MET B 151 5 ? 4  
HELX_P HELX_P24 24 GLY B 152 ? GLY B 157 ? GLY B 152 GLY B 157 1 ? 6  
HELX_P HELX_P25 25 TRP B 169 ? ALA B 172 ? TRP B 169 ALA B 172 5 ? 4  
HELX_P HELX_P26 26 TYR B 173 ? GLN B 178 ? TYR B 173 GLN B 178 1 ? 6  
HELX_P HELX_P27 27 ARG B 180 ? VAL B 192 ? ARG B 180 VAL B 192 1 ? 13 
HELX_P HELX_P28 28 ASN B 193 ? LYS B 204 ? ASN B 193 LYS B 204 1 ? 12 
HELX_P HELX_P29 29 ASP C 19  ? LYS C 29  ? ASP C 19  LYS C 29  1 ? 11 
HELX_P HELX_P30 30 LYS C 29  ? GLU C 43  ? LYS C 29  GLU C 43  1 ? 15 
HELX_P HELX_P31 31 LEU C 45  ? ASN C 50  ? LEU C 45  ASN C 50  1 ? 6  
HELX_P HELX_P32 32 PRO C 52  ? ILE C 57  ? PRO C 52  ILE C 57  1 ? 6  
HELX_P HELX_P33 33 THR C 58  ? LEU C 63  ? THR C 58  LEU C 63  5 ? 6  
HELX_P HELX_P34 34 PRO C 64  ? GLY C 87  ? PRO C 64  GLY C 87  1 ? 24 
HELX_P HELX_P35 35 GLN C 95  ? GLY C 107 ? GLN C 95  GLY C 107 1 ? 13 
HELX_P HELX_P36 36 SER C 108 ? ARG C 123 ? SER C 108 ARG C 123 1 ? 16 
HELX_P HELX_P37 37 SER C 148 ? MET C 151 ? SER C 148 MET C 151 5 ? 4  
HELX_P HELX_P38 38 GLY C 152 ? GLY C 157 ? GLY C 152 GLY C 157 1 ? 6  
HELX_P HELX_P39 39 TRP C 169 ? ALA C 172 ? TRP C 169 ALA C 172 5 ? 4  
HELX_P HELX_P40 40 TYR C 173 ? GLN C 178 ? TYR C 173 GLN C 178 1 ? 6  
HELX_P HELX_P41 41 ARG C 180 ? VAL C 192 ? ARG C 180 VAL C 192 1 ? 13 
HELX_P HELX_P42 42 ASN C 193 ? LYS C 204 ? ASN C 193 LYS C 204 1 ? 12 
HELX_P HELX_P43 43 ASP D 19  ? LYS D 29  ? ASP D 19  LYS D 29  1 ? 11 
HELX_P HELX_P44 44 LYS D 29  ? GLU D 43  ? LYS D 29  GLU D 43  1 ? 15 
HELX_P HELX_P45 45 GLU D 47  ? LEU D 51  ? GLU D 47  LEU D 51  5 ? 5  
HELX_P HELX_P46 46 PRO D 52  ? ILE D 57  ? PRO D 52  ILE D 57  1 ? 6  
HELX_P HELX_P47 47 THR D 58  ? LEU D 63  ? THR D 58  LEU D 63  5 ? 6  
HELX_P HELX_P48 48 PRO D 64  ? GLY D 87  ? PRO D 64  GLY D 87  1 ? 24 
HELX_P HELX_P49 49 GLN D 95  ? GLY D 107 ? GLN D 95  GLY D 107 1 ? 13 
HELX_P HELX_P50 50 SER D 108 ? ARG D 123 ? SER D 108 ARG D 123 1 ? 16 
HELX_P HELX_P51 51 SER D 148 ? MET D 151 ? SER D 148 MET D 151 5 ? 4  
HELX_P HELX_P52 52 GLY D 152 ? GLY D 157 ? GLY D 152 GLY D 157 1 ? 6  
HELX_P HELX_P53 53 TRP D 169 ? ALA D 172 ? TRP D 169 ALA D 172 5 ? 4  
HELX_P HELX_P54 54 TYR D 173 ? GLN D 178 ? TYR D 173 GLN D 178 1 ? 6  
HELX_P HELX_P55 55 ARG D 180 ? VAL D 192 ? ARG D 180 VAL D 192 1 ? 13 
HELX_P HELX_P56 56 ASN D 193 ? LYS D 204 ? ASN D 193 LYS D 204 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MN . MN ? ? ? 1_555 I HOH .   O   ? ? A MN 501 A HOH 600 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc2  metalc ? ? F MN . MN ? ? ? 1_555 J HOH .   O   ? ? B MN 502 B HOH 591 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc3  metalc ? ? G MN . MN ? ? ? 1_555 K HOH .   O   ? ? C MN 503 C HOH 586 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc4  metalc ? ? H MN . MN ? ? ? 1_555 L HOH .   O   ? ? D MN 504 D HOH 577 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc5  metalc ? ? E MN . MN ? ? ? 1_555 A HIS 26  NE2 ? ? A MN 501 A HIS 26  1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc6  metalc ? ? E MN . MN ? ? ? 1_555 A HIS 171 NE2 ? ? A MN 501 A HIS 171 1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc7  metalc ? ? E MN . MN ? ? ? 1_555 A HIS 81  NE2 ? ? A MN 501 A HIS 81  1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc8  metalc ? ? E MN . MN ? ? ? 1_555 A ASP 167 OD2 ? ? A MN 501 A ASP 167 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc9  metalc ? ? F MN . MN ? ? ? 1_555 B HIS 26  NE2 ? ? B MN 502 B HIS 26  1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc10 metalc ? ? F MN . MN ? ? ? 1_555 B HIS 171 NE2 ? ? B MN 502 B HIS 171 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc11 metalc ? ? F MN . MN ? ? ? 1_555 B HIS 81  NE2 ? ? B MN 502 B HIS 81  1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc12 metalc ? ? F MN . MN ? ? ? 1_555 B ASP 167 OD2 ? ? B MN 502 B ASP 167 1_555 ? ? ? ? ? ? ? 1.952 ? 
metalc13 metalc ? ? G MN . MN ? ? ? 1_555 C ASP 167 OD2 ? ? C MN 503 C ASP 167 1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc14 metalc ? ? G MN . MN ? ? ? 1_555 C HIS 171 NE2 ? ? C MN 503 C HIS 171 1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc15 metalc ? ? G MN . MN ? ? ? 1_555 C HIS 81  NE2 ? ? C MN 503 C HIS 81  1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc16 metalc ? ? G MN . MN ? ? ? 1_555 C HIS 26  NE2 ? ? C MN 503 C HIS 26  1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc17 metalc ? ? H MN . MN ? ? ? 1_555 D HIS 171 NE2 ? ? D MN 504 D HIS 171 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc18 metalc ? ? H MN . MN ? ? ? 1_555 D ASP 167 OD2 ? ? D MN 504 D ASP 167 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc19 metalc ? ? H MN . MN ? ? ? 1_555 D HIS 26  NE2 ? ? D MN 504 D HIS 26  1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc20 metalc ? ? H MN . MN ? ? ? 1_555 D HIS 81  NE2 ? ? D MN 504 D HIS 81  1_555 ? ? ? ? ? ? ? 2.219 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 15 A . ? GLU 15 A PRO 16 A ? PRO 16 A 1 0.26  
2 GLU 15 B . ? GLU 15 B PRO 16 B ? PRO 16 B 1 0.24  
3 GLU 15 C . ? GLU 15 C PRO 16 C ? PRO 16 C 1 -0.02 
4 GLU 15 D . ? GLU 15 D PRO 16 D ? PRO 16 D 1 0.24  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 137 ? ALA A 144 ? LYS A 137 ALA A 144 
A 2 GLY A 127 ? LYS A 134 ? GLY A 127 LYS A 134 
A 3 PHE A 161 ? ASP A 167 ? PHE A 161 ASP A 167 
B 1 LYS B 137 ? ALA B 144 ? LYS B 137 ALA B 144 
B 2 GLY B 127 ? LYS B 134 ? GLY B 127 LYS B 134 
B 3 PHE B 161 ? ASP B 167 ? PHE B 161 ASP B 167 
C 1 LYS C 137 ? ALA C 144 ? LYS C 137 ALA C 144 
C 2 GLY C 127 ? LYS C 134 ? GLY C 127 LYS C 134 
C 3 PHE C 161 ? ASP C 167 ? PHE C 161 ASP C 167 
D 1 LYS D 137 ? ALA D 144 ? LYS D 137 ALA D 144 
D 2 GLY D 127 ? LYS D 134 ? GLY D 127 LYS D 134 
D 3 PHE D 161 ? ASP D 167 ? PHE D 161 ASP D 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 143 ? N THR A 143 O TRP A 128 ? O TRP A 128 
A 2 3 O LEU A 133 ? O LEU A 133 N PHE A 161 ? N PHE A 161 
B 1 2 N THR B 143 ? N THR B 143 O TRP B 128 ? O TRP B 128 
B 2 3 O LEU B 133 ? O LEU B 133 N PHE B 161 ? N PHE B 161 
C 1 2 N THR C 143 ? N THR C 143 O TRP C 128 ? O TRP C 128 
C 2 3 O LEU C 133 ? O LEU C 133 N PHE C 161 ? N PHE C 161 
D 1 2 N THR D 143 ? N THR D 143 O TRP D 128 ? O TRP D 128 
D 2 3 O LEU D 133 ? O LEU D 133 N PHE D 161 ? N PHE D 161 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN A 501' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN B 502' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN C 503' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN D 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 26  ? HIS A 26  . ? 1_555 ? 
2  AC1 5 HIS A 81  ? HIS A 81  . ? 1_555 ? 
3  AC1 5 ASP A 167 ? ASP A 167 . ? 1_555 ? 
4  AC1 5 HIS A 171 ? HIS A 171 . ? 1_555 ? 
5  AC1 5 HOH I .   ? HOH A 600 . ? 1_555 ? 
6  AC2 5 HIS B 26  ? HIS B 26  . ? 1_555 ? 
7  AC2 5 HIS B 81  ? HIS B 81  . ? 1_555 ? 
8  AC2 5 ASP B 167 ? ASP B 167 . ? 1_555 ? 
9  AC2 5 HIS B 171 ? HIS B 171 . ? 1_555 ? 
10 AC2 5 HOH J .   ? HOH B 591 . ? 1_555 ? 
11 AC3 5 HIS C 26  ? HIS C 26  . ? 1_555 ? 
12 AC3 5 HIS C 81  ? HIS C 81  . ? 1_555 ? 
13 AC3 5 ASP C 167 ? ASP C 167 . ? 1_555 ? 
14 AC3 5 HIS C 171 ? HIS C 171 . ? 1_555 ? 
15 AC3 5 HOH K .   ? HOH C 586 . ? 1_555 ? 
16 AC4 5 HIS D 26  ? HIS D 26  . ? 1_555 ? 
17 AC4 5 HIS D 81  ? HIS D 81  . ? 1_555 ? 
18 AC4 5 ASP D 167 ? ASP D 167 . ? 1_555 ? 
19 AC4 5 HIS D 171 ? HIS D 171 . ? 1_555 ? 
20 AC4 5 HOH L .   ? HOH D 577 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EN6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EN6 
_atom_sites.fract_transf_matrix[1][1]   0.009833 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009149 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005503 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? 42.669  21.806  -9.697  1.00 31.19 ? 1   SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 41.436  21.567  -8.896  1.00 30.68 ? 1   SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 41.639  20.384  -7.965  1.00 28.85 ? 1   SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? 42.387  19.456  -8.286  1.00 30.19 ? 1   SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 40.253  21.267  -9.818  1.00 31.39 ? 1   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 39.941  22.384  -10.626 1.00 39.38 ? 1   SER A OG  1 
ATOM   7    N  N   . TYR A 1 2   ? 40.975  20.414  -6.815  1.00 24.77 ? 2   TYR A N   1 
ATOM   8    C  CA  . TYR A 1 2   ? 41.082  19.311  -5.869  1.00 23.53 ? 2   TYR A CA  1 
ATOM   9    C  C   . TYR A 1 2   ? 40.030  18.267  -6.210  1.00 22.01 ? 2   TYR A C   1 
ATOM   10   O  O   . TYR A 1 2   ? 39.017  18.579  -6.838  1.00 18.68 ? 2   TYR A O   1 
ATOM   11   C  CB  . TYR A 1 2   ? 40.821  19.777  -4.441  1.00 23.48 ? 2   TYR A CB  1 
ATOM   12   C  CG  . TYR A 1 2   ? 41.707  20.887  -3.946  1.00 27.74 ? 2   TYR A CG  1 
ATOM   13   C  CD1 . TYR A 1 2   ? 43.079  20.898  -4.209  1.00 27.24 ? 2   TYR A CD1 1 
ATOM   14   C  CD2 . TYR A 1 2   ? 41.180  21.901  -3.153  1.00 28.06 ? 2   TYR A CD2 1 
ATOM   15   C  CE1 . TYR A 1 2   ? 43.899  21.899  -3.683  1.00 31.84 ? 2   TYR A CE1 1 
ATOM   16   C  CE2 . TYR A 1 2   ? 41.984  22.893  -2.629  1.00 31.30 ? 2   TYR A CE2 1 
ATOM   17   C  CZ  . TYR A 1 2   ? 43.335  22.890  -2.891  1.00 30.87 ? 2   TYR A CZ  1 
ATOM   18   O  OH  . TYR A 1 2   ? 44.105  23.876  -2.331  1.00 36.94 ? 2   TYR A OH  1 
ATOM   19   N  N   . THR A 1 3   ? 40.276  17.027  -5.798  1.00 21.49 ? 3   THR A N   1 
ATOM   20   C  CA  . THR A 1 3   ? 39.312  15.951  -6.015  1.00 21.32 ? 3   THR A CA  1 
ATOM   21   C  C   . THR A 1 3   ? 39.235  15.141  -4.728  1.00 19.00 ? 3   THR A C   1 
ATOM   22   O  O   . THR A 1 3   ? 40.175  15.133  -3.940  1.00 19.46 ? 3   THR A O   1 
ATOM   23   C  CB  . THR A 1 3   ? 39.726  15.003  -7.157  1.00 24.87 ? 3   THR A CB  1 
ATOM   24   O  OG1 . THR A 1 3   ? 41.022  14.465  -6.877  1.00 27.93 ? 3   THR A OG1 1 
ATOM   25   C  CG2 . THR A 1 3   ? 39.738  15.738  -8.493  1.00 25.58 ? 3   THR A CG2 1 
ATOM   26   N  N   . LEU A 1 4   ? 38.108  14.475  -4.511  1.00 19.01 ? 4   LEU A N   1 
ATOM   27   C  CA  . LEU A 1 4   ? 37.940  13.661  -3.319  1.00 18.69 ? 4   LEU A CA  1 
ATOM   28   C  C   . LEU A 1 4   ? 38.865  12.458  -3.482  1.00 19.23 ? 4   LEU A C   1 
ATOM   29   O  O   . LEU A 1 4   ? 38.765  11.742  -4.472  1.00 18.01 ? 4   LEU A O   1 
ATOM   30   C  CB  . LEU A 1 4   ? 36.490  13.184  -3.222  1.00 18.99 ? 4   LEU A CB  1 
ATOM   31   C  CG  . LEU A 1 4   ? 36.134  12.352  -1.987  1.00 18.48 ? 4   LEU A CG  1 
ATOM   32   C  CD1 . LEU A 1 4   ? 36.103  13.261  -0.777  1.00 21.84 ? 4   LEU A CD1 1 
ATOM   33   C  CD2 . LEU A 1 4   ? 34.775  11.682  -2.167  1.00 17.25 ? 4   LEU A CD2 1 
ATOM   34   N  N   . PRO A 1 5   ? 39.780  12.220  -2.526  1.00 19.10 ? 5   PRO A N   1 
ATOM   35   C  CA  . PRO A 1 5   ? 40.669  11.062  -2.681  1.00 21.27 ? 5   PRO A CA  1 
ATOM   36   C  C   . PRO A 1 5   ? 39.901  9.768   -2.447  1.00 23.18 ? 5   PRO A C   1 
ATOM   37   O  O   . PRO A 1 5   ? 38.966  9.732   -1.653  1.00 20.96 ? 5   PRO A O   1 
ATOM   38   C  CB  . PRO A 1 5   ? 41.724  11.291  -1.609  1.00 21.81 ? 5   PRO A CB  1 
ATOM   39   C  CG  . PRO A 1 5   ? 40.920  11.917  -0.503  1.00 21.86 ? 5   PRO A CG  1 
ATOM   40   C  CD  . PRO A 1 5   ? 40.030  12.909  -1.247  1.00 20.33 ? 5   PRO A CD  1 
ATOM   41   N  N   . SER A 1 6   ? 40.288  8.704   -3.138  1.00 23.21 ? 6   SER A N   1 
ATOM   42   C  CA  . SER A 1 6   ? 39.607  7.434   -2.936  1.00 26.06 ? 6   SER A CA  1 
ATOM   43   C  C   . SER A 1 6   ? 40.148  6.826   -1.645  1.00 25.71 ? 6   SER A C   1 
ATOM   44   O  O   . SER A 1 6   ? 41.299  7.065   -1.268  1.00 24.35 ? 6   SER A O   1 
ATOM   45   C  CB  . SER A 1 6   ? 39.853  6.501   -4.120  1.00 28.41 ? 6   SER A CB  1 
ATOM   46   O  OG  . SER A 1 6   ? 41.239  6.298   -4.313  1.00 33.58 ? 6   SER A OG  1 
ATOM   47   N  N   . LEU A 1 7   ? 39.303  6.069   -0.958  1.00 25.55 ? 7   LEU A N   1 
ATOM   48   C  CA  . LEU A 1 7   ? 39.671  5.422   0.295   1.00 27.87 ? 7   LEU A CA  1 
ATOM   49   C  C   . LEU A 1 7   ? 40.583  4.227   0.022   1.00 27.80 ? 7   LEU A C   1 
ATOM   50   O  O   . LEU A 1 7   ? 40.433  3.541   -0.984  1.00 30.57 ? 7   LEU A O   1 
ATOM   51   C  CB  . LEU A 1 7   ? 38.403  4.952   1.007   1.00 29.60 ? 7   LEU A CB  1 
ATOM   52   C  CG  . LEU A 1 7   ? 38.081  5.472   2.406   1.00 31.86 ? 7   LEU A CG  1 
ATOM   53   C  CD1 . LEU A 1 7   ? 38.277  6.967   2.489   1.00 29.27 ? 7   LEU A CD1 1 
ATOM   54   C  CD2 . LEU A 1 7   ? 36.646  5.093   2.736   1.00 33.18 ? 7   LEU A CD2 1 
ATOM   55   N  N   . PRO A 1 8   ? 41.551  3.970   0.912   1.00 27.99 ? 8   PRO A N   1 
ATOM   56   C  CA  . PRO A 1 8   ? 42.467  2.842   0.727   1.00 27.87 ? 8   PRO A CA  1 
ATOM   57   C  C   . PRO A 1 8   ? 41.888  1.539   1.275   1.00 27.05 ? 8   PRO A C   1 
ATOM   58   O  O   . PRO A 1 8   ? 42.619  0.589   1.545   1.00 28.06 ? 8   PRO A O   1 
ATOM   59   C  CB  . PRO A 1 8   ? 43.710  3.291   1.487   1.00 29.25 ? 8   PRO A CB  1 
ATOM   60   C  CG  . PRO A 1 8   ? 43.120  4.039   2.641   1.00 30.52 ? 8   PRO A CG  1 
ATOM   61   C  CD  . PRO A 1 8   ? 42.001  4.846   2.011   1.00 28.40 ? 8   PRO A CD  1 
ATOM   62   N  N   . TYR A 1 9   ? 40.570  1.510   1.437   1.00 24.73 ? 9   TYR A N   1 
ATOM   63   C  CA  . TYR A 1 9   ? 39.871  0.344   1.961   1.00 23.92 ? 9   TYR A CA  1 
ATOM   64   C  C   . TYR A 1 9   ? 38.377  0.536   1.746   1.00 22.78 ? 9   TYR A C   1 
ATOM   65   O  O   . TYR A 1 9   ? 37.947  1.591   1.277   1.00 21.32 ? 9   TYR A O   1 
ATOM   66   C  CB  . TYR A 1 9   ? 40.181  0.179   3.456   1.00 24.52 ? 9   TYR A CB  1 
ATOM   67   C  CG  . TYR A 1 9   ? 40.179  1.486   4.240   1.00 25.85 ? 9   TYR A CG  1 
ATOM   68   C  CD1 . TYR A 1 9   ? 38.998  2.195   4.457   1.00 26.51 ? 9   TYR A CD1 1 
ATOM   69   C  CD2 . TYR A 1 9   ? 41.369  2.034   4.720   1.00 26.37 ? 9   TYR A CD2 1 
ATOM   70   C  CE1 . TYR A 1 9   ? 39.004  3.428   5.130   1.00 24.92 ? 9   TYR A CE1 1 
ATOM   71   C  CE2 . TYR A 1 9   ? 41.386  3.264   5.392   1.00 25.52 ? 9   TYR A CE2 1 
ATOM   72   C  CZ  . TYR A 1 9   ? 40.200  3.954   5.589   1.00 24.44 ? 9   TYR A CZ  1 
ATOM   73   O  OH  . TYR A 1 9   ? 40.219  5.183   6.216   1.00 23.64 ? 9   TYR A OH  1 
ATOM   74   N  N   . ALA A 1 10  ? 37.588  -0.482  2.072   1.00 20.50 ? 10  ALA A N   1 
ATOM   75   C  CA  . ALA A 1 10  ? 36.138  -0.400  1.914   1.00 20.19 ? 10  ALA A CA  1 
ATOM   76   C  C   . ALA A 1 10  ? 35.530  0.368   3.090   1.00 19.73 ? 10  ALA A C   1 
ATOM   77   O  O   . ALA A 1 10  ? 36.146  0.470   4.152   1.00 19.73 ? 10  ALA A O   1 
ATOM   78   C  CB  . ALA A 1 10  ? 35.540  -1.808  1.846   1.00 19.53 ? 10  ALA A CB  1 
ATOM   79   N  N   . TYR A 1 11  ? 34.319  0.889   2.906   1.00 20.07 ? 11  TYR A N   1 
ATOM   80   C  CA  . TYR A 1 11  ? 33.647  1.649   3.966   1.00 22.02 ? 11  TYR A CA  1 
ATOM   81   C  C   . TYR A 1 11  ? 33.393  0.865   5.250   1.00 24.61 ? 11  TYR A C   1 
ATOM   82   O  O   . TYR A 1 11  ? 33.232  1.457   6.321   1.00 24.77 ? 11  TYR A O   1 
ATOM   83   C  CB  . TYR A 1 11  ? 32.326  2.227   3.444   1.00 19.54 ? 11  TYR A CB  1 
ATOM   84   C  CG  . TYR A 1 11  ? 32.536  3.331   2.435   1.00 23.11 ? 11  TYR A CG  1 
ATOM   85   C  CD1 . TYR A 1 11  ? 33.152  4.524   2.808   1.00 23.22 ? 11  TYR A CD1 1 
ATOM   86   C  CD2 . TYR A 1 11  ? 32.160  3.171   1.100   1.00 22.82 ? 11  TYR A CD2 1 
ATOM   87   C  CE1 . TYR A 1 11  ? 33.393  5.540   1.873   1.00 22.75 ? 11  TYR A CE1 1 
ATOM   88   C  CE2 . TYR A 1 11  ? 32.400  4.178   0.156   1.00 25.43 ? 11  TYR A CE2 1 
ATOM   89   C  CZ  . TYR A 1 11  ? 33.019  5.361   0.555   1.00 22.87 ? 11  TYR A CZ  1 
ATOM   90   O  OH  . TYR A 1 11  ? 33.278  6.353   -0.363  1.00 21.93 ? 11  TYR A OH  1 
ATOM   91   N  N   . ASP A 1 12  ? 33.358  -0.463  5.154   1.00 25.41 ? 12  ASP A N   1 
ATOM   92   C  CA  . ASP A 1 12  ? 33.124  -1.289  6.335   1.00 24.77 ? 12  ASP A CA  1 
ATOM   93   C  C   . ASP A 1 12  ? 34.412  -1.907  6.858   1.00 25.80 ? 12  ASP A C   1 
ATOM   94   O  O   . ASP A 1 12  ? 34.383  -2.775  7.732   1.00 27.72 ? 12  ASP A O   1 
ATOM   95   C  CB  . ASP A 1 12  ? 32.102  -2.392  6.019   1.00 25.99 ? 12  ASP A CB  1 
ATOM   96   C  CG  . ASP A 1 12  ? 32.591  -3.372  4.953   1.00 30.31 ? 12  ASP A CG  1 
ATOM   97   O  OD1 . ASP A 1 12  ? 33.696  -3.186  4.400   1.00 28.65 ? 12  ASP A OD1 1 
ATOM   98   O  OD2 . ASP A 1 12  ? 31.858  -4.340  4.665   1.00 32.21 ? 12  ASP A OD2 1 
ATOM   99   N  N   . ALA A 1 13  ? 35.545  -1.442  6.341   1.00 25.61 ? 13  ALA A N   1 
ATOM   100  C  CA  . ALA A 1 13  ? 36.844  -1.973  6.745   1.00 25.45 ? 13  ALA A CA  1 
ATOM   101  C  C   . ALA A 1 13  ? 37.261  -1.669  8.180   1.00 25.82 ? 13  ALA A C   1 
ATOM   102  O  O   . ALA A 1 13  ? 38.153  -2.331  8.715   1.00 25.04 ? 13  ALA A O   1 
ATOM   103  C  CB  . ALA A 1 13  ? 37.923  -1.488  5.786   1.00 26.79 ? 13  ALA A CB  1 
ATOM   104  N  N   . LEU A 1 14  ? 36.634  -0.680  8.811   1.00 22.94 ? 14  LEU A N   1 
ATOM   105  C  CA  . LEU A 1 14  ? 37.004  -0.346  10.187  1.00 22.65 ? 14  LEU A CA  1 
ATOM   106  C  C   . LEU A 1 14  ? 36.047  -0.918  11.227  1.00 21.66 ? 14  LEU A C   1 
ATOM   107  O  O   . LEU A 1 14  ? 36.185  -0.648  12.420  1.00 20.83 ? 14  LEU A O   1 
ATOM   108  C  CB  . LEU A 1 14  ? 37.118  1.176   10.362  1.00 21.85 ? 14  LEU A CB  1 
ATOM   109  C  CG  . LEU A 1 14  ? 38.210  1.837   9.512   1.00 24.02 ? 14  LEU A CG  1 
ATOM   110  C  CD1 . LEU A 1 14  ? 38.291  3.328   9.832   1.00 22.93 ? 14  LEU A CD1 1 
ATOM   111  C  CD2 . LEU A 1 14  ? 39.550  1.158   9.790   1.00 23.58 ? 14  LEU A CD2 1 
ATOM   112  N  N   . GLU A 1 15  ? 35.062  -1.683  10.770  1.00 21.86 ? 15  GLU A N   1 
ATOM   113  C  CA  . GLU A 1 15  ? 34.121  -2.318  11.682  1.00 23.62 ? 15  GLU A CA  1 
ATOM   114  C  C   . GLU A 1 15  ? 34.969  -3.281  12.499  1.00 23.42 ? 15  GLU A C   1 
ATOM   115  O  O   . GLU A 1 15  ? 35.983  -3.784  12.006  1.00 24.65 ? 15  GLU A O   1 
ATOM   116  C  CB  . GLU A 1 15  ? 33.059  -3.092  10.897  1.00 23.94 ? 15  GLU A CB  1 
ATOM   117  C  CG  . GLU A 1 15  ? 32.059  -2.212  10.173  1.00 22.88 ? 15  GLU A CG  1 
ATOM   118  C  CD  . GLU A 1 15  ? 31.009  -1.644  11.105  1.00 23.65 ? 15  GLU A CD  1 
ATOM   119  O  OE1 . GLU A 1 15  ? 31.145  -1.835  12.333  1.00 23.90 ? 15  GLU A OE1 1 
ATOM   120  O  OE2 . GLU A 1 15  ? 30.051  -1.008  10.611  1.00 21.62 ? 15  GLU A OE2 1 
ATOM   121  N  N   . PRO A 1 16  ? 34.563  -3.575  13.748  1.00 24.58 ? 16  PRO A N   1 
ATOM   122  C  CA  . PRO A 1 16  ? 33.376  -3.088  14.460  1.00 24.17 ? 16  PRO A CA  1 
ATOM   123  C  C   . PRO A 1 16  ? 33.605  -1.813  15.277  1.00 24.33 ? 16  PRO A C   1 
ATOM   124  O  O   . PRO A 1 16  ? 32.765  -1.441  16.099  1.00 24.46 ? 16  PRO A O   1 
ATOM   125  C  CB  . PRO A 1 16  ? 33.040  -4.262  15.358  1.00 23.89 ? 16  PRO A CB  1 
ATOM   126  C  CG  . PRO A 1 16  ? 34.420  -4.659  15.840  1.00 25.22 ? 16  PRO A CG  1 
ATOM   127  C  CD  . PRO A 1 16  ? 35.285  -4.566  14.573  1.00 24.10 ? 16  PRO A CD  1 
ATOM   128  N  N   . HIS A 1 17  ? 34.729  -1.142  15.046  1.00 23.34 ? 17  HIS A N   1 
ATOM   129  C  CA  . HIS A 1 17  ? 35.062  0.070   15.796  1.00 23.95 ? 17  HIS A CA  1 
ATOM   130  C  C   . HIS A 1 17  ? 34.392  1.336   15.262  1.00 23.97 ? 17  HIS A C   1 
ATOM   131  O  O   . HIS A 1 17  ? 33.676  2.002   16.004  1.00 23.86 ? 17  HIS A O   1 
ATOM   132  C  CB  . HIS A 1 17  ? 36.574  0.204   15.834  1.00 24.81 ? 17  HIS A CB  1 
ATOM   133  C  CG  . HIS A 1 17  ? 37.257  -1.067  16.233  1.00 26.88 ? 17  HIS A CG  1 
ATOM   134  N  ND1 . HIS A 1 17  ? 37.018  -1.688  17.441  1.00 26.79 ? 17  HIS A ND1 1 
ATOM   135  C  CD2 . HIS A 1 17  ? 38.137  -1.855  15.572  1.00 27.71 ? 17  HIS A CD2 1 
ATOM   136  C  CE1 . HIS A 1 17  ? 37.725  -2.802  17.508  1.00 27.91 ? 17  HIS A CE1 1 
ATOM   137  N  NE2 . HIS A 1 17  ? 38.413  -2.927  16.387  1.00 27.71 ? 17  HIS A NE2 1 
ATOM   138  N  N   . PHE A 1 18  ? 34.635  1.669   13.993  1.00 22.58 ? 18  PHE A N   1 
ATOM   139  C  CA  . PHE A 1 18  ? 34.003  2.827   13.352  1.00 22.67 ? 18  PHE A CA  1 
ATOM   140  C  C   . PHE A 1 18  ? 32.946  2.262   12.413  1.00 22.37 ? 18  PHE A C   1 
ATOM   141  O  O   . PHE A 1 18  ? 33.247  1.400   11.584  1.00 24.34 ? 18  PHE A O   1 
ATOM   142  C  CB  . PHE A 1 18  ? 35.023  3.641   12.548  1.00 22.03 ? 18  PHE A CB  1 
ATOM   143  C  CG  . PHE A 1 18  ? 35.891  4.542   13.388  1.00 20.46 ? 18  PHE A CG  1 
ATOM   144  C  CD1 . PHE A 1 18  ? 35.858  4.475   14.783  1.00 21.95 ? 18  PHE A CD1 1 
ATOM   145  C  CD2 . PHE A 1 18  ? 36.751  5.458   12.784  1.00 20.78 ? 18  PHE A CD2 1 
ATOM   146  C  CE1 . PHE A 1 18  ? 36.670  5.306   15.563  1.00 19.78 ? 18  PHE A CE1 1 
ATOM   147  C  CE2 . PHE A 1 18  ? 37.565  6.294   13.556  1.00 19.17 ? 18  PHE A CE2 1 
ATOM   148  C  CZ  . PHE A 1 18  ? 37.524  6.217   14.946  1.00 20.08 ? 18  PHE A CZ  1 
ATOM   149  N  N   . ASP A 1 19  ? 31.715  2.753   12.524  1.00 20.64 ? 19  ASP A N   1 
ATOM   150  C  CA  . ASP A 1 19  ? 30.628  2.242   11.703  1.00 21.09 ? 19  ASP A CA  1 
ATOM   151  C  C   . ASP A 1 19  ? 30.687  2.579   10.226  1.00 23.43 ? 19  ASP A C   1 
ATOM   152  O  O   . ASP A 1 19  ? 31.110  3.668   9.827   1.00 20.87 ? 19  ASP A O   1 
ATOM   153  C  CB  . ASP A 1 19  ? 29.276  2.680   12.272  1.00 19.65 ? 19  ASP A CB  1 
ATOM   154  C  CG  . ASP A 1 19  ? 29.167  4.189   12.444  1.00 18.32 ? 19  ASP A CG  1 
ATOM   155  O  OD1 . ASP A 1 19  ? 29.996  4.763   13.177  1.00 20.44 ? 19  ASP A OD1 1 
ATOM   156  O  OD2 . ASP A 1 19  ? 28.251  4.792   11.855  1.00 16.55 ? 19  ASP A OD2 1 
ATOM   157  N  N   . LYS A 1 20  ? 30.231  1.625   9.417   1.00 23.28 ? 20  LYS A N   1 
ATOM   158  C  CA  . LYS A 1 20  ? 30.212  1.762   7.966   1.00 24.20 ? 20  LYS A CA  1 
ATOM   159  C  C   . LYS A 1 20  ? 29.368  2.935   7.479   1.00 22.73 ? 20  LYS A C   1 
ATOM   160  O  O   . LYS A 1 20  ? 29.753  3.635   6.539   1.00 22.01 ? 20  LYS A O   1 
ATOM   161  C  CB  . LYS A 1 20  ? 29.670  0.471   7.334   1.00 27.65 ? 20  LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 20  ? 29.458  0.558   5.826   1.00 35.41 ? 20  LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 20  ? 28.745  -0.676  5.268   1.00 39.70 ? 20  LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 20  ? 28.494  -0.525  3.768   1.00 42.61 ? 20  LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 20  ? 27.677  -1.638  3.207   1.00 46.60 ? 20  LYS A NZ  1 
ATOM   166  N  N   . GLN A 1 21  ? 28.210  3.141   8.101   1.00 20.81 ? 21  GLN A N   1 
ATOM   167  C  CA  . GLN A 1 21  ? 27.324  4.223   7.690   1.00 21.57 ? 21  GLN A CA  1 
ATOM   168  C  C   . GLN A 1 21  ? 28.001  5.585   7.800   1.00 19.03 ? 21  GLN A C   1 
ATOM   169  O  O   . GLN A 1 21  ? 27.883  6.422   6.906   1.00 19.48 ? 21  GLN A O   1 
ATOM   170  C  CB  . GLN A 1 21  ? 26.049  4.241   8.536   1.00 24.21 ? 21  GLN A CB  1 
ATOM   171  C  CG  . GLN A 1 21  ? 25.038  5.241   8.010   1.00 31.35 ? 21  GLN A CG  1 
ATOM   172  C  CD  . GLN A 1 21  ? 23.784  5.350   8.861   1.00 36.80 ? 21  GLN A CD  1 
ATOM   173  O  OE1 . GLN A 1 21  ? 22.838  6.050   8.492   1.00 41.19 ? 21  GLN A OE1 1 
ATOM   174  N  NE2 . GLN A 1 21  ? 23.770  4.666   10.003  1.00 37.63 ? 21  GLN A NE2 1 
ATOM   175  N  N   . THR A 1 22  ? 28.694  5.808   8.908   1.00 17.62 ? 22  THR A N   1 
ATOM   176  C  CA  . THR A 1 22  ? 29.386  7.072   9.118   1.00 18.10 ? 22  THR A CA  1 
ATOM   177  C  C   . THR A 1 22  ? 30.551  7.230   8.145   1.00 18.75 ? 22  THR A C   1 
ATOM   178  O  O   . THR A 1 22  ? 30.740  8.301   7.579   1.00 18.43 ? 22  THR A O   1 
ATOM   179  C  CB  . THR A 1 22  ? 29.913  7.201   10.562  1.00 17.03 ? 22  THR A CB  1 
ATOM   180  O  OG1 . THR A 1 22  ? 28.800  7.334   11.458  1.00 19.01 ? 22  THR A OG1 1 
ATOM   181  C  CG2 . THR A 1 22  ? 30.801  8.451   10.697  1.00 16.94 ? 22  THR A CG2 1 
ATOM   182  N  N   . MET A 1 23  ? 31.330  6.170   7.952   1.00 18.17 ? 23  MET A N   1 
ATOM   183  C  CA  . MET A 1 23  ? 32.457  6.236   7.032   1.00 17.78 ? 23  MET A CA  1 
ATOM   184  C  C   . MET A 1 23  ? 31.998  6.708   5.652   1.00 19.50 ? 23  MET A C   1 
ATOM   185  O  O   . MET A 1 23  ? 32.639  7.553   5.020   1.00 18.17 ? 23  MET A O   1 
ATOM   186  C  CB  . MET A 1 23  ? 33.133  4.865   6.907   1.00 20.16 ? 23  MET A CB  1 
ATOM   187  C  CG  . MET A 1 23  ? 33.904  4.406   8.144   1.00 19.79 ? 23  MET A CG  1 
ATOM   188  S  SD  . MET A 1 23  ? 35.250  5.523   8.647   1.00 20.89 ? 23  MET A SD  1 
ATOM   189  C  CE  . MET A 1 23  ? 36.337  5.440   7.195   1.00 18.79 ? 23  MET A CE  1 
ATOM   190  N  N   . GLU A 1 24  ? 30.876  6.173   5.191   1.00 17.94 ? 24  GLU A N   1 
ATOM   191  C  CA  . GLU A 1 24  ? 30.346  6.531   3.886   1.00 21.27 ? 24  GLU A CA  1 
ATOM   192  C  C   . GLU A 1 24  ? 29.850  7.981   3.808   1.00 18.95 ? 24  GLU A C   1 
ATOM   193  O  O   . GLU A 1 24  ? 30.137  8.688   2.843   1.00 18.49 ? 24  GLU A O   1 
ATOM   194  C  CB  . GLU A 1 24  ? 29.224  5.553   3.524   1.00 25.73 ? 24  GLU A CB  1 
ATOM   195  C  CG  . GLU A 1 24  ? 28.655  5.720   2.137   1.00 33.66 ? 24  GLU A CG  1 
ATOM   196  C  CD  . GLU A 1 24  ? 27.955  4.457   1.654   1.00 39.59 ? 24  GLU A CD  1 
ATOM   197  O  OE1 . GLU A 1 24  ? 27.402  3.718   2.502   1.00 40.19 ? 24  GLU A OE1 1 
ATOM   198  O  OE2 . GLU A 1 24  ? 27.955  4.211   0.426   1.00 42.18 ? 24  GLU A OE2 1 
ATOM   199  N  N   . ILE A 1 25  ? 29.102  8.420   4.813   1.00 17.05 ? 25  ILE A N   1 
ATOM   200  C  CA  . ILE A 1 25  ? 28.590  9.792   4.818   1.00 17.71 ? 25  ILE A CA  1 
ATOM   201  C  C   . ILE A 1 25  ? 29.738  10.789  5.005   1.00 16.33 ? 25  ILE A C   1 
ATOM   202  O  O   . ILE A 1 25  ? 29.817  11.810  4.325   1.00 20.01 ? 25  ILE A O   1 
ATOM   203  C  CB  . ILE A 1 25  ? 27.557  9.990   5.943   1.00 17.91 ? 25  ILE A CB  1 
ATOM   204  C  CG1 . ILE A 1 25  ? 26.322  9.129   5.660   1.00 20.29 ? 25  ILE A CG1 1 
ATOM   205  C  CG2 . ILE A 1 25  ? 27.170  11.458  6.048   1.00 18.18 ? 25  ILE A CG2 1 
ATOM   206  C  CD1 . ILE A 1 25  ? 25.335  9.078   6.813   1.00 25.42 ? 25  ILE A CD1 1 
ATOM   207  N  N   . HIS A 1 26  ? 30.629  10.469  5.930   1.00 15.78 ? 26  HIS A N   1 
ATOM   208  C  CA  . HIS A 1 26  ? 31.772  11.313  6.249   1.00 15.68 ? 26  HIS A CA  1 
ATOM   209  C  C   . HIS A 1 26  ? 32.619  11.578  4.998   1.00 17.85 ? 26  HIS A C   1 
ATOM   210  O  O   . HIS A 1 26  ? 33.034  12.705  4.737   1.00 16.15 ? 26  HIS A O   1 
ATOM   211  C  CB  . HIS A 1 26  ? 32.611  10.607  7.318   1.00 14.23 ? 26  HIS A CB  1 
ATOM   212  C  CG  . HIS A 1 26  ? 33.457  11.524  8.142   1.00 15.82 ? 26  HIS A CG  1 
ATOM   213  N  ND1 . HIS A 1 26  ? 34.236  11.070  9.184   1.00 14.37 ? 26  HIS A ND1 1 
ATOM   214  C  CD2 . HIS A 1 26  ? 33.634  12.868  8.096   1.00 14.47 ? 26  HIS A CD2 1 
ATOM   215  C  CE1 . HIS A 1 26  ? 34.855  12.095  9.747   1.00 17.16 ? 26  HIS A CE1 1 
ATOM   216  N  NE2 . HIS A 1 26  ? 34.507  13.197  9.105   1.00 13.89 ? 26  HIS A NE2 1 
ATOM   217  N  N   . HIS A 1 27  ? 32.856  10.528  4.220   1.00 16.87 ? 27  HIS A N   1 
ATOM   218  C  CA  . HIS A 1 27  ? 33.669  10.627  3.010   1.00 17.42 ? 27  HIS A CA  1 
ATOM   219  C  C   . HIS A 1 27  ? 32.938  11.241  1.814   1.00 16.99 ? 27  HIS A C   1 
ATOM   220  O  O   . HIS A 1 27  ? 33.358  12.276  1.288   1.00 16.38 ? 27  HIS A O   1 
ATOM   221  C  CB  . HIS A 1 27  ? 34.202  9.224   2.647   1.00 16.09 ? 27  HIS A CB  1 
ATOM   222  C  CG  . HIS A 1 27  ? 35.096  9.192   1.445   1.00 17.46 ? 27  HIS A CG  1 
ATOM   223  N  ND1 . HIS A 1 27  ? 34.793  8.464   0.312   1.00 20.20 ? 27  HIS A ND1 1 
ATOM   224  C  CD2 . HIS A 1 27  ? 36.298  9.770   1.208   1.00 18.14 ? 27  HIS A CD2 1 
ATOM   225  C  CE1 . HIS A 1 27  ? 35.770  8.594   -0.568  1.00 18.22 ? 27  HIS A CE1 1 
ATOM   226  N  NE2 . HIS A 1 27  ? 36.695  9.381   -0.050  1.00 18.10 ? 27  HIS A NE2 1 
ATOM   227  N  N   . THR A 1 28  ? 31.828  10.630  1.411   1.00 17.09 ? 28  THR A N   1 
ATOM   228  C  CA  . THR A 1 28  ? 31.081  11.087  0.242   1.00 17.00 ? 28  THR A CA  1 
ATOM   229  C  C   . THR A 1 28  ? 30.244  12.350  0.377   1.00 18.51 ? 28  THR A C   1 
ATOM   230  O  O   . THR A 1 28  ? 29.876  12.947  -0.632  1.00 17.99 ? 28  THR A O   1 
ATOM   231  C  CB  . THR A 1 28  ? 30.159  9.969   -0.297  1.00 18.55 ? 28  THR A CB  1 
ATOM   232  O  OG1 . THR A 1 28  ? 29.124  9.699   0.654   1.00 18.47 ? 28  THR A OG1 1 
ATOM   233  C  CG2 . THR A 1 28  ? 30.964  8.690   -0.539  1.00 17.58 ? 28  THR A CG2 1 
ATOM   234  N  N   . LYS A 1 29  ? 29.924  12.751  1.604   1.00 17.85 ? 29  LYS A N   1 
ATOM   235  C  CA  . LYS A 1 29  ? 29.131  13.956  1.803   1.00 18.00 ? 29  LYS A CA  1 
ATOM   236  C  C   . LYS A 1 29  ? 29.962  15.067  2.434   1.00 18.11 ? 29  LYS A C   1 
ATOM   237  O  O   . LYS A 1 29  ? 30.097  16.148  1.852   1.00 20.01 ? 29  LYS A O   1 
ATOM   238  C  CB  . LYS A 1 29  ? 27.913  13.682  2.694   1.00 18.75 ? 29  LYS A CB  1 
ATOM   239  C  CG  . LYS A 1 29  ? 26.992  12.577  2.201   1.00 24.17 ? 29  LYS A CG  1 
ATOM   240  C  CD  . LYS A 1 29  ? 26.381  12.910  0.851   1.00 27.39 ? 29  LYS A CD  1 
ATOM   241  C  CE  . LYS A 1 29  ? 25.406  11.816  0.418   1.00 32.97 ? 29  LYS A CE  1 
ATOM   242  N  NZ  . LYS A 1 29  ? 24.761  12.133  -0.889  1.00 36.49 ? 29  LYS A NZ  1 
ATOM   243  N  N   . HIS A 1 30  ? 30.531  14.810  3.608   1.00 14.75 ? 30  HIS A N   1 
ATOM   244  C  CA  . HIS A 1 30  ? 31.299  15.858  4.268   1.00 16.22 ? 30  HIS A CA  1 
ATOM   245  C  C   . HIS A 1 30  ? 32.586  16.248  3.549   1.00 15.98 ? 30  HIS A C   1 
ATOM   246  O  O   . HIS A 1 30  ? 32.759  17.414  3.203   1.00 15.47 ? 30  HIS A O   1 
ATOM   247  C  CB  . HIS A 1 30  ? 31.567  15.485  5.731   1.00 16.26 ? 30  HIS A CB  1 
ATOM   248  C  CG  . HIS A 1 30  ? 30.344  15.562  6.596   1.00 17.23 ? 30  HIS A CG  1 
ATOM   249  N  ND1 . HIS A 1 30  ? 29.750  16.758  6.940   1.00 15.77 ? 30  HIS A ND1 1 
ATOM   250  C  CD2 . HIS A 1 30  ? 29.577  14.590  7.147   1.00 16.67 ? 30  HIS A CD2 1 
ATOM   251  C  CE1 . HIS A 1 30  ? 28.673  16.520  7.668   1.00 18.30 ? 30  HIS A CE1 1 
ATOM   252  N  NE2 . HIS A 1 30  ? 28.544  15.211  7.808   1.00 14.89 ? 30  HIS A NE2 1 
ATOM   253  N  N   . HIS A 1 31  ? 33.477  15.296  3.310   1.00 15.19 ? 31  HIS A N   1 
ATOM   254  C  CA  . HIS A 1 31  ? 34.731  15.610  2.628   1.00 15.59 ? 31  HIS A CA  1 
ATOM   255  C  C   . HIS A 1 31  ? 34.474  16.155  1.220   1.00 16.19 ? 31  HIS A C   1 
ATOM   256  O  O   . HIS A 1 31  ? 35.128  17.106  0.790   1.00 17.08 ? 31  HIS A O   1 
ATOM   257  C  CB  . HIS A 1 31  ? 35.612  14.361  2.576   1.00 13.32 ? 31  HIS A CB  1 
ATOM   258  C  CG  . HIS A 1 31  ? 37.045  14.641  2.236   1.00 12.24 ? 31  HIS A CG  1 
ATOM   259  N  ND1 . HIS A 1 31  ? 38.032  13.682  2.335   1.00 11.79 ? 31  HIS A ND1 1 
ATOM   260  C  CD2 . HIS A 1 31  ? 37.655  15.765  1.791   1.00 12.22 ? 31  HIS A CD2 1 
ATOM   261  C  CE1 . HIS A 1 31  ? 39.190  14.204  1.964   1.00 14.28 ? 31  HIS A CE1 1 
ATOM   262  N  NE2 . HIS A 1 31  ? 38.988  15.468  1.628   1.00 15.14 ? 31  HIS A NE2 1 
ATOM   263  N  N   . GLN A 1 32  ? 33.514  15.563  0.511   1.00 15.12 ? 32  GLN A N   1 
ATOM   264  C  CA  . GLN A 1 32  ? 33.187  16.014  -0.838  1.00 16.86 ? 32  GLN A CA  1 
ATOM   265  C  C   . GLN A 1 32  ? 32.791  17.488  -0.827  1.00 17.30 ? 32  GLN A C   1 
ATOM   266  O  O   . GLN A 1 32  ? 33.160  18.244  -1.727  1.00 15.59 ? 32  GLN A O   1 
ATOM   267  C  CB  . GLN A 1 32  ? 32.029  15.197  -1.418  1.00 15.50 ? 32  GLN A CB  1 
ATOM   268  C  CG  . GLN A 1 32  ? 31.702  15.559  -2.856  1.00 18.46 ? 32  GLN A CG  1 
ATOM   269  C  CD  . GLN A 1 32  ? 32.804  15.147  -3.819  1.00 19.67 ? 32  GLN A CD  1 
ATOM   270  O  OE1 . GLN A 1 32  ? 32.965  13.966  -4.118  1.00 17.71 ? 32  GLN A OE1 1 
ATOM   271  N  NE2 . GLN A 1 32  ? 33.575  16.117  -4.295  1.00 17.31 ? 32  GLN A NE2 1 
ATOM   272  N  N   . THR A 1 33  ? 32.035  17.891  0.189   1.00 17.06 ? 33  THR A N   1 
ATOM   273  C  CA  . THR A 1 33  ? 31.595  19.278  0.285   1.00 17.49 ? 33  THR A CA  1 
ATOM   274  C  C   . THR A 1 33  ? 32.754  20.258  0.459   1.00 17.04 ? 33  THR A C   1 
ATOM   275  O  O   . THR A 1 33  ? 32.740  21.340  -0.125  1.00 17.64 ? 33  THR A O   1 
ATOM   276  C  CB  . THR A 1 33  ? 30.589  19.459  1.424   1.00 18.72 ? 33  THR A CB  1 
ATOM   277  O  OG1 . THR A 1 33  ? 29.423  18.674  1.138   1.00 19.11 ? 33  THR A OG1 1 
ATOM   278  C  CG2 . THR A 1 33  ? 30.172  20.929  1.540   1.00 20.83 ? 33  THR A CG2 1 
ATOM   279  N  N   . TYR A 1 34  ? 33.759  19.886  1.249   1.00 15.95 ? 34  TYR A N   1 
ATOM   280  C  CA  . TYR A 1 34  ? 34.908  20.764  1.453   1.00 16.13 ? 34  TYR A CA  1 
ATOM   281  C  C   . TYR A 1 34  ? 35.653  20.935  0.134   1.00 17.32 ? 34  TYR A C   1 
ATOM   282  O  O   . TYR A 1 34  ? 36.102  22.030  -0.204  1.00 17.11 ? 34  TYR A O   1 
ATOM   283  C  CB  . TYR A 1 34  ? 35.857  20.184  2.515   1.00 17.61 ? 34  TYR A CB  1 
ATOM   284  C  CG  . TYR A 1 34  ? 35.183  19.933  3.846   1.00 17.73 ? 34  TYR A CG  1 
ATOM   285  C  CD1 . TYR A 1 34  ? 34.312  20.874  4.393   1.00 20.42 ? 34  TYR A CD1 1 
ATOM   286  C  CD2 . TYR A 1 34  ? 35.378  18.738  4.539   1.00 20.68 ? 34  TYR A CD2 1 
ATOM   287  C  CE1 . TYR A 1 34  ? 33.640  20.630  5.595   1.00 20.76 ? 34  TYR A CE1 1 
ATOM   288  C  CE2 . TYR A 1 34  ? 34.713  18.487  5.741   1.00 21.95 ? 34  TYR A CE2 1 
ATOM   289  C  CZ  . TYR A 1 34  ? 33.845  19.438  6.258   1.00 22.76 ? 34  TYR A CZ  1 
ATOM   290  O  OH  . TYR A 1 34  ? 33.174  19.196  7.436   1.00 26.19 ? 34  TYR A OH  1 
ATOM   291  N  N   . VAL A 1 35  ? 35.790  19.839  -0.606  1.00 16.98 ? 35  VAL A N   1 
ATOM   292  C  CA  . VAL A 1 35  ? 36.465  19.867  -1.895  1.00 16.30 ? 35  VAL A CA  1 
ATOM   293  C  C   . VAL A 1 35  ? 35.698  20.787  -2.855  1.00 17.82 ? 35  VAL A C   1 
ATOM   294  O  O   . VAL A 1 35  ? 36.285  21.653  -3.506  1.00 18.69 ? 35  VAL A O   1 
ATOM   295  C  CB  . VAL A 1 35  ? 36.542  18.433  -2.499  1.00 16.44 ? 35  VAL A CB  1 
ATOM   296  C  CG1 . VAL A 1 35  ? 36.918  18.501  -3.978  1.00 17.58 ? 35  VAL A CG1 1 
ATOM   297  C  CG2 . VAL A 1 35  ? 37.570  17.591  -1.727  1.00 15.46 ? 35  VAL A CG2 1 
ATOM   298  N  N   . ASN A 1 36  ? 34.383  20.601  -2.934  1.00 16.59 ? 36  ASN A N   1 
ATOM   299  C  CA  . ASN A 1 36  ? 33.570  21.420  -3.824  1.00 17.45 ? 36  ASN A CA  1 
ATOM   300  C  C   . ASN A 1 36  ? 33.664  22.908  -3.477  1.00 18.30 ? 36  ASN A C   1 
ATOM   301  O  O   . ASN A 1 36  ? 33.852  23.743  -4.366  1.00 18.31 ? 36  ASN A O   1 
ATOM   302  C  CB  . ASN A 1 36  ? 32.103  20.970  -3.791  1.00 16.09 ? 36  ASN A CB  1 
ATOM   303  C  CG  . ASN A 1 36  ? 31.895  19.580  -4.388  1.00 18.71 ? 36  ASN A CG  1 
ATOM   304  O  OD1 . ASN A 1 36  ? 32.797  19.008  -5.010  1.00 19.18 ? 36  ASN A OD1 1 
ATOM   305  N  ND2 . ASN A 1 36  ? 30.692  19.038  -4.211  1.00 18.12 ? 36  ASN A ND2 1 
ATOM   306  N  N   . ASN A 1 37  ? 33.540  23.238  -2.194  1.00 17.82 ? 37  ASN A N   1 
ATOM   307  C  CA  . ASN A 1 37  ? 33.608  24.634  -1.767  1.00 19.56 ? 37  ASN A CA  1 
ATOM   308  C  C   . ASN A 1 37  ? 34.978  25.260  -1.992  1.00 19.00 ? 37  ASN A C   1 
ATOM   309  O  O   . ASN A 1 37  ? 35.074  26.428  -2.369  1.00 19.21 ? 37  ASN A O   1 
ATOM   310  C  CB  . ASN A 1 37  ? 33.215  24.756  -0.297  1.00 20.13 ? 37  ASN A CB  1 
ATOM   311  C  CG  . ASN A 1 37  ? 31.749  24.480  -0.072  1.00 23.92 ? 37  ASN A CG  1 
ATOM   312  O  OD1 . ASN A 1 37  ? 30.940  24.602  -0.991  1.00 24.84 ? 37  ASN A OD1 1 
ATOM   313  N  ND2 . ASN A 1 37  ? 31.394  24.124  1.155   1.00 26.31 ? 37  ASN A ND2 1 
ATOM   314  N  N   . ALA A 1 38  ? 36.037  24.494  -1.752  1.00 17.43 ? 38  ALA A N   1 
ATOM   315  C  CA  . ALA A 1 38  ? 37.390  25.002  -1.959  1.00 16.98 ? 38  ALA A CA  1 
ATOM   316  C  C   . ALA A 1 38  ? 37.607  25.295  -3.447  1.00 19.45 ? 38  ALA A C   1 
ATOM   317  O  O   . ALA A 1 38  ? 38.136  26.351  -3.807  1.00 18.76 ? 38  ALA A O   1 
ATOM   318  C  CB  . ALA A 1 38  ? 38.430  23.983  -1.465  1.00 18.28 ? 38  ALA A CB  1 
ATOM   319  N  N   . ASN A 1 39  ? 37.193  24.363  -4.308  1.00 17.94 ? 39  ASN A N   1 
ATOM   320  C  CA  . ASN A 1 39  ? 37.349  24.546  -5.751  1.00 19.89 ? 39  ASN A CA  1 
ATOM   321  C  C   . ASN A 1 39  ? 36.592  25.776  -6.249  1.00 20.19 ? 39  ASN A C   1 
ATOM   322  O  O   . ASN A 1 39  ? 37.100  26.535  -7.073  1.00 19.34 ? 39  ASN A O   1 
ATOM   323  C  CB  . ASN A 1 39  ? 36.856  23.319  -6.530  1.00 19.50 ? 39  ASN A CB  1 
ATOM   324  C  CG  . ASN A 1 39  ? 37.829  22.148  -6.469  1.00 20.01 ? 39  ASN A CG  1 
ATOM   325  O  OD1 . ASN A 1 39  ? 39.022  22.325  -6.233  1.00 20.91 ? 39  ASN A OD1 1 
ATOM   326  N  ND2 . ASN A 1 39  ? 37.320  20.947  -6.704  1.00 19.99 ? 39  ASN A ND2 1 
ATOM   327  N  N   . ALA A 1 40  ? 35.375  25.969  -5.752  1.00 18.87 ? 40  ALA A N   1 
ATOM   328  C  CA  . ALA A 1 40  ? 34.562  27.108  -6.162  1.00 20.30 ? 40  ALA A CA  1 
ATOM   329  C  C   . ALA A 1 40  ? 35.269  28.419  -5.834  1.00 22.49 ? 40  ALA A C   1 
ATOM   330  O  O   . ALA A 1 40  ? 35.237  29.365  -6.620  1.00 20.30 ? 40  ALA A O   1 
ATOM   331  C  CB  . ALA A 1 40  ? 33.212  27.064  -5.467  1.00 21.93 ? 40  ALA A CB  1 
ATOM   332  N  N   . ALA A 1 41  ? 35.916  28.466  -4.675  1.00 20.84 ? 41  ALA A N   1 
ATOM   333  C  CA  . ALA A 1 41  ? 36.618  29.671  -4.253  1.00 24.52 ? 41  ALA A CA  1 
ATOM   334  C  C   . ALA A 1 41  ? 37.906  29.895  -5.037  1.00 26.12 ? 41  ALA A C   1 
ATOM   335  O  O   . ALA A 1 41  ? 38.288  31.036  -5.294  1.00 27.00 ? 41  ALA A O   1 
ATOM   336  C  CB  . ALA A 1 41  ? 36.924  29.604  -2.759  1.00 22.47 ? 41  ALA A CB  1 
ATOM   337  N  N   . LEU A 1 42  ? 38.568  28.808  -5.421  1.00 25.40 ? 42  LEU A N   1 
ATOM   338  C  CA  . LEU A 1 42  ? 39.820  28.898  -6.163  1.00 25.36 ? 42  LEU A CA  1 
ATOM   339  C  C   . LEU A 1 42  ? 39.665  29.196  -7.655  1.00 28.35 ? 42  LEU A C   1 
ATOM   340  O  O   . LEU A 1 42  ? 40.648  29.506  -8.328  1.00 28.53 ? 42  LEU A O   1 
ATOM   341  C  CB  . LEU A 1 42  ? 40.620  27.610  -5.981  1.00 22.68 ? 42  LEU A CB  1 
ATOM   342  C  CG  . LEU A 1 42  ? 41.213  27.460  -4.577  1.00 24.43 ? 42  LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1 42  ? 41.782  26.063  -4.395  1.00 24.53 ? 42  LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1 42  ? 42.289  28.519  -4.371  1.00 24.76 ? 42  LEU A CD2 1 
ATOM   345  N  N   . GLU A 1 43  ? 38.438  29.114  -8.170  1.00 28.96 ? 43  GLU A N   1 
ATOM   346  C  CA  . GLU A 1 43  ? 38.176  29.375  -9.589  1.00 30.14 ? 43  GLU A CA  1 
ATOM   347  C  C   . GLU A 1 43  ? 38.696  30.749  -10.003 1.00 33.22 ? 43  GLU A C   1 
ATOM   348  O  O   . GLU A 1 43  ? 39.241  30.909  -11.094 1.00 33.81 ? 43  GLU A O   1 
ATOM   349  C  CB  . GLU A 1 43  ? 36.671  29.285  -9.879  1.00 28.38 ? 43  GLU A CB  1 
ATOM   350  C  CG  . GLU A 1 43  ? 36.247  29.606  -11.328 1.00 26.43 ? 43  GLU A CG  1 
ATOM   351  C  CD  . GLU A 1 43  ? 36.776  28.618  -12.360 1.00 25.68 ? 43  GLU A CD  1 
ATOM   352  O  OE1 . GLU A 1 43  ? 37.007  27.443  -12.017 1.00 24.40 ? 43  GLU A OE1 1 
ATOM   353  O  OE2 . GLU A 1 43  ? 36.943  29.007  -13.532 1.00 27.18 ? 43  GLU A OE2 1 
ATOM   354  N  N   . SER A 1 44  ? 38.535  31.734  -9.127  1.00 35.50 ? 44  SER A N   1 
ATOM   355  C  CA  . SER A 1 44  ? 38.989  33.085  -9.422  1.00 40.79 ? 44  SER A CA  1 
ATOM   356  C  C   . SER A 1 44  ? 40.384  33.392  -8.878  1.00 41.71 ? 44  SER A C   1 
ATOM   357  O  O   . SER A 1 44  ? 40.771  34.558  -8.786  1.00 44.39 ? 44  SER A O   1 
ATOM   358  C  CB  . SER A 1 44  ? 37.988  34.106  -8.869  1.00 42.29 ? 44  SER A CB  1 
ATOM   359  O  OG  . SER A 1 44  ? 37.937  34.067  -7.452  1.00 45.99 ? 44  SER A OG  1 
ATOM   360  N  N   . LEU A 1 45  ? 41.138  32.359  -8.515  1.00 41.30 ? 45  LEU A N   1 
ATOM   361  C  CA  . LEU A 1 45  ? 42.489  32.553  -7.991  1.00 41.37 ? 45  LEU A CA  1 
ATOM   362  C  C   . LEU A 1 45  ? 43.489  31.598  -8.632  1.00 42.69 ? 45  LEU A C   1 
ATOM   363  O  O   . LEU A 1 45  ? 44.013  30.696  -7.978  1.00 41.28 ? 45  LEU A O   1 
ATOM   364  C  CB  . LEU A 1 45  ? 42.518  32.365  -6.475  1.00 43.31 ? 45  LEU A CB  1 
ATOM   365  C  CG  . LEU A 1 45  ? 41.946  33.473  -5.593  1.00 45.25 ? 45  LEU A CG  1 
ATOM   366  C  CD1 . LEU A 1 45  ? 40.435  33.543  -5.738  1.00 47.71 ? 45  LEU A CD1 1 
ATOM   367  C  CD2 . LEU A 1 45  ? 42.318  33.191  -4.154  1.00 46.92 ? 45  LEU A CD2 1 
ATOM   368  N  N   . PRO A 1 46  ? 43.777  31.797  -9.926  1.00 43.66 ? 46  PRO A N   1 
ATOM   369  C  CA  . PRO A 1 46  ? 44.714  30.967  -10.691 1.00 44.47 ? 46  PRO A CA  1 
ATOM   370  C  C   . PRO A 1 46  ? 46.072  30.748  -10.027 1.00 44.66 ? 46  PRO A C   1 
ATOM   371  O  O   . PRO A 1 46  ? 46.650  29.666  -10.132 1.00 44.74 ? 46  PRO A O   1 
ATOM   372  C  CB  . PRO A 1 46  ? 44.843  31.726  -12.008 1.00 45.03 ? 46  PRO A CB  1 
ATOM   373  C  CG  . PRO A 1 46  ? 43.493  32.354  -12.159 1.00 45.24 ? 46  PRO A CG  1 
ATOM   374  C  CD  . PRO A 1 46  ? 43.226  32.873  -10.768 1.00 44.37 ? 46  PRO A CD  1 
ATOM   375  N  N   . GLU A 1 47  ? 46.577  31.773  -9.345  1.00 45.15 ? 47  GLU A N   1 
ATOM   376  C  CA  . GLU A 1 47  ? 47.884  31.691  -8.694  1.00 46.33 ? 47  GLU A CA  1 
ATOM   377  C  C   . GLU A 1 47  ? 47.929  30.681  -7.553  1.00 45.28 ? 47  GLU A C   1 
ATOM   378  O  O   . GLU A 1 47  ? 48.992  30.155  -7.225  1.00 44.51 ? 47  GLU A O   1 
ATOM   379  C  CB  . GLU A 1 47  ? 48.302  33.056  -8.140  1.00 49.52 ? 47  GLU A CB  1 
ATOM   380  C  CG  . GLU A 1 47  ? 47.795  34.259  -8.912  1.00 54.93 ? 47  GLU A CG  1 
ATOM   381  C  CD  . GLU A 1 47  ? 46.417  34.705  -8.452  1.00 57.92 ? 47  GLU A CD  1 
ATOM   382  O  OE1 . GLU A 1 47  ? 45.434  33.970  -8.692  1.00 59.09 ? 47  GLU A OE1 1 
ATOM   383  O  OE2 . GLU A 1 47  ? 46.322  35.793  -7.841  1.00 60.33 ? 47  GLU A OE2 1 
ATOM   384  N  N   . PHE A 1 48  ? 46.777  30.418  -6.946  1.00 43.08 ? 48  PHE A N   1 
ATOM   385  C  CA  . PHE A 1 48  ? 46.704  29.489  -5.825  1.00 42.28 ? 48  PHE A CA  1 
ATOM   386  C  C   . PHE A 1 48  ? 45.979  28.199  -6.172  1.00 41.66 ? 48  PHE A C   1 
ATOM   387  O  O   . PHE A 1 48  ? 46.175  27.174  -5.525  1.00 40.70 ? 48  PHE A O   1 
ATOM   388  C  CB  . PHE A 1 48  ? 45.996  30.168  -4.652  1.00 41.63 ? 48  PHE A CB  1 
ATOM   389  C  CG  . PHE A 1 48  ? 46.719  31.370  -4.130  1.00 42.30 ? 48  PHE A CG  1 
ATOM   390  C  CD1 . PHE A 1 48  ? 47.849  31.224  -3.331  1.00 42.26 ? 48  PHE A CD1 1 
ATOM   391  C  CD2 . PHE A 1 48  ? 46.294  32.651  -4.461  1.00 42.48 ? 48  PHE A CD2 1 
ATOM   392  C  CE1 . PHE A 1 48  ? 48.546  32.338  -2.872  1.00 42.56 ? 48  PHE A CE1 1 
ATOM   393  C  CE2 . PHE A 1 48  ? 46.986  33.770  -4.007  1.00 42.65 ? 48  PHE A CE2 1 
ATOM   394  C  CZ  . PHE A 1 48  ? 48.114  33.612  -3.211  1.00 40.96 ? 48  PHE A CZ  1 
ATOM   395  N  N   . ALA A 1 49  ? 45.144  28.264  -7.201  1.00 41.82 ? 49  ALA A N   1 
ATOM   396  C  CA  . ALA A 1 49  ? 44.352  27.124  -7.639  1.00 42.92 ? 49  ALA A CA  1 
ATOM   397  C  C   . ALA A 1 49  ? 45.129  25.831  -7.876  1.00 43.77 ? 49  ALA A C   1 
ATOM   398  O  O   . ALA A 1 49  ? 44.589  24.740  -7.692  1.00 44.63 ? 49  ALA A O   1 
ATOM   399  C  CB  . ALA A 1 49  ? 43.580  27.497  -8.901  1.00 43.25 ? 49  ALA A CB  1 
ATOM   400  N  N   . ASN A 1 50  ? 46.393  25.941  -8.268  1.00 44.18 ? 50  ASN A N   1 
ATOM   401  C  CA  . ASN A 1 50  ? 47.178  24.747  -8.557  1.00 44.17 ? 50  ASN A CA  1 
ATOM   402  C  C   . ASN A 1 50  ? 48.202  24.299  -7.520  1.00 42.54 ? 50  ASN A C   1 
ATOM   403  O  O   . ASN A 1 50  ? 49.092  23.513  -7.834  1.00 43.98 ? 50  ASN A O   1 
ATOM   404  C  CB  . ASN A 1 50  ? 47.859  24.907  -9.918  1.00 46.55 ? 50  ASN A CB  1 
ATOM   405  C  CG  . ASN A 1 50  ? 46.860  24.979  -11.059 1.00 49.05 ? 50  ASN A CG  1 
ATOM   406  O  OD1 . ASN A 1 50  ? 46.149  24.011  -11.338 1.00 49.94 ? 50  ASN A OD1 1 
ATOM   407  N  ND2 . ASN A 1 50  ? 46.792  26.133  -11.719 1.00 50.54 ? 50  ASN A ND2 1 
ATOM   408  N  N   . LEU A 1 51  ? 48.085  24.782  -6.290  1.00 39.03 ? 51  LEU A N   1 
ATOM   409  C  CA  . LEU A 1 51  ? 49.016  24.371  -5.243  1.00 36.96 ? 51  LEU A CA  1 
ATOM   410  C  C   . LEU A 1 51  ? 48.449  23.169  -4.494  1.00 35.57 ? 51  LEU A C   1 
ATOM   411  O  O   . LEU A 1 51  ? 47.232  22.999  -4.418  1.00 34.50 ? 51  LEU A O   1 
ATOM   412  C  CB  . LEU A 1 51  ? 49.228  25.494  -4.228  1.00 36.02 ? 51  LEU A CB  1 
ATOM   413  C  CG  . LEU A 1 51  ? 49.813  26.833  -4.659  1.00 37.03 ? 51  LEU A CG  1 
ATOM   414  C  CD1 . LEU A 1 51  ? 49.847  27.765  -3.453  1.00 35.02 ? 51  LEU A CD1 1 
ATOM   415  C  CD2 . LEU A 1 51  ? 51.214  26.629  -5.226  1.00 38.74 ? 51  LEU A CD2 1 
ATOM   416  N  N   . PRO A 1 52  ? 49.324  22.302  -3.955  1.00 33.53 ? 52  PRO A N   1 
ATOM   417  C  CA  . PRO A 1 52  ? 48.814  21.146  -3.211  1.00 31.54 ? 52  PRO A CA  1 
ATOM   418  C  C   . PRO A 1 52  ? 48.086  21.757  -2.012  1.00 29.68 ? 52  PRO A C   1 
ATOM   419  O  O   . PRO A 1 52  ? 48.476  22.829  -1.533  1.00 25.71 ? 52  PRO A O   1 
ATOM   420  C  CB  . PRO A 1 52  ? 50.086  20.417  -2.794  1.00 33.35 ? 52  PRO A CB  1 
ATOM   421  C  CG  . PRO A 1 52  ? 51.049  20.750  -3.905  1.00 33.48 ? 52  PRO A CG  1 
ATOM   422  C  CD  . PRO A 1 52  ? 50.785  22.220  -4.126  1.00 33.50 ? 52  PRO A CD  1 
ATOM   423  N  N   . VAL A 1 53  ? 47.039  21.098  -1.524  1.00 27.78 ? 53  VAL A N   1 
ATOM   424  C  CA  . VAL A 1 53  ? 46.292  21.656  -0.401  1.00 26.27 ? 53  VAL A CA  1 
ATOM   425  C  C   . VAL A 1 53  ? 47.143  21.879  0.852   1.00 26.57 ? 53  VAL A C   1 
ATOM   426  O  O   . VAL A 1 53  ? 46.940  22.856  1.570   1.00 25.18 ? 53  VAL A O   1 
ATOM   427  C  CB  . VAL A 1 53  ? 45.054  20.776  -0.050  1.00 25.35 ? 53  VAL A CB  1 
ATOM   428  C  CG1 . VAL A 1 53  ? 45.494  19.420  0.484   1.00 24.05 ? 53  VAL A CG1 1 
ATOM   429  C  CG2 . VAL A 1 53  ? 44.178  21.501  0.961   1.00 24.00 ? 53  VAL A CG2 1 
ATOM   430  N  N   . GLU A 1 54  ? 48.102  20.994  1.111   1.00 27.69 ? 54  GLU A N   1 
ATOM   431  C  CA  . GLU A 1 54  ? 48.951  21.138  2.292   1.00 31.00 ? 54  GLU A CA  1 
ATOM   432  C  C   . GLU A 1 54  ? 49.850  22.366  2.190   1.00 31.26 ? 54  GLU A C   1 
ATOM   433  O  O   . GLU A 1 54  ? 50.333  22.873  3.203   1.00 31.59 ? 54  GLU A O   1 
ATOM   434  C  CB  . GLU A 1 54  ? 49.819  19.892  2.501   1.00 36.57 ? 54  GLU A CB  1 
ATOM   435  C  CG  . GLU A 1 54  ? 49.055  18.578  2.447   1.00 42.70 ? 54  GLU A CG  1 
ATOM   436  C  CD  . GLU A 1 54  ? 48.960  18.024  1.035   1.00 46.50 ? 54  GLU A CD  1 
ATOM   437  O  OE1 . GLU A 1 54  ? 48.518  18.753  0.124   1.00 47.33 ? 54  GLU A OE1 1 
ATOM   438  O  OE2 . GLU A 1 54  ? 49.332  16.850  0.833   1.00 52.73 ? 54  GLU A OE2 1 
ATOM   439  N  N   . GLU A 1 55  ? 50.078  22.838  0.967   1.00 29.64 ? 55  GLU A N   1 
ATOM   440  C  CA  . GLU A 1 55  ? 50.904  24.019  0.755   1.00 29.47 ? 55  GLU A CA  1 
ATOM   441  C  C   . GLU A 1 55  ? 50.025  25.260  0.830   1.00 26.90 ? 55  GLU A C   1 
ATOM   442  O  O   . GLU A 1 55  ? 50.409  26.280  1.398   1.00 27.15 ? 55  GLU A O   1 
ATOM   443  C  CB  . GLU A 1 55  ? 51.585  23.962  -0.612  1.00 31.93 ? 55  GLU A CB  1 
ATOM   444  C  CG  . GLU A 1 55  ? 52.631  25.052  -0.804  1.00 38.71 ? 55  GLU A CG  1 
ATOM   445  C  CD  . GLU A 1 55  ? 53.275  25.007  -2.179  1.00 41.57 ? 55  GLU A CD  1 
ATOM   446  O  OE1 . GLU A 1 55  ? 53.591  23.892  -2.653  1.00 42.51 ? 55  GLU A OE1 1 
ATOM   447  O  OE2 . GLU A 1 55  ? 53.470  26.087  -2.777  1.00 42.90 ? 55  GLU A OE2 1 
ATOM   448  N  N   . LEU A 1 56  ? 48.836  25.174  0.251   1.00 25.97 ? 56  LEU A N   1 
ATOM   449  C  CA  . LEU A 1 56  ? 47.920  26.301  0.280   1.00 24.76 ? 56  LEU A CA  1 
ATOM   450  C  C   . LEU A 1 56  ? 47.620  26.764  1.702   1.00 24.50 ? 56  LEU A C   1 
ATOM   451  O  O   . LEU A 1 56  ? 47.583  27.965  1.966   1.00 24.73 ? 56  LEU A O   1 
ATOM   452  C  CB  . LEU A 1 56  ? 46.605  25.941  -0.406  1.00 27.17 ? 56  LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 56  ? 45.547  27.042  -0.288  1.00 29.69 ? 56  LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 56  ? 45.954  28.230  -1.140  1.00 32.99 ? 56  LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 56  ? 44.201  26.514  -0.730  1.00 31.62 ? 56  LEU A CD2 1 
ATOM   456  N  N   . ILE A 1 57  ? 47.417  25.822  2.623   1.00 23.88 ? 57  ILE A N   1 
ATOM   457  C  CA  . ILE A 1 57  ? 47.083  26.193  3.998   1.00 23.65 ? 57  ILE A CA  1 
ATOM   458  C  C   . ILE A 1 57  ? 48.228  26.786  4.811   1.00 25.88 ? 57  ILE A C   1 
ATOM   459  O  O   . ILE A 1 57  ? 48.015  27.255  5.930   1.00 24.45 ? 57  ILE A O   1 
ATOM   460  C  CB  . ILE A 1 57  ? 46.456  25.006  4.783   1.00 24.10 ? 57  ILE A CB  1 
ATOM   461  C  CG1 . ILE A 1 57  ? 47.447  23.853  4.908   1.00 22.41 ? 57  ILE A CG1 1 
ATOM   462  C  CG2 . ILE A 1 57  ? 45.191  24.529  4.067   1.00 23.32 ? 57  ILE A CG2 1 
ATOM   463  C  CD1 . ILE A 1 57  ? 46.929  22.721  5.799   1.00 25.66 ? 57  ILE A CD1 1 
ATOM   464  N  N   . THR A 1 58  ? 49.440  26.766  4.262   1.00 28.10 ? 58  THR A N   1 
ATOM   465  C  CA  . THR A 1 58  ? 50.574  27.369  4.957   1.00 30.65 ? 58  THR A CA  1 
ATOM   466  C  C   . THR A 1 58  ? 50.723  28.812  4.465   1.00 31.87 ? 58  THR A C   1 
ATOM   467  O  O   . THR A 1 58  ? 51.556  29.567  4.971   1.00 33.28 ? 58  THR A O   1 
ATOM   468  C  CB  . THR A 1 58  ? 51.908  26.624  4.679   1.00 31.68 ? 58  THR A CB  1 
ATOM   469  O  OG1 . THR A 1 58  ? 52.261  26.761  3.295   1.00 30.25 ? 58  THR A OG1 1 
ATOM   470  C  CG2 . THR A 1 58  ? 51.783  25.145  5.029   1.00 31.54 ? 58  THR A CG2 1 
ATOM   471  N  N   . LYS A 1 59  ? 49.893  29.198  3.497   1.00 32.64 ? 59  LYS A N   1 
ATOM   472  C  CA  . LYS A 1 59  ? 49.955  30.542  2.913   1.00 34.22 ? 59  LYS A CA  1 
ATOM   473  C  C   . LYS A 1 59  ? 48.637  31.318  2.935   1.00 34.62 ? 59  LYS A C   1 
ATOM   474  O  O   . LYS A 1 59  ? 48.405  32.183  2.082   1.00 33.62 ? 59  LYS A O   1 
ATOM   475  C  CB  . LYS A 1 59  ? 50.436  30.443  1.464   1.00 37.85 ? 59  LYS A CB  1 
ATOM   476  C  CG  . LYS A 1 59  ? 51.769  29.736  1.296   1.00 40.15 ? 59  LYS A CG  1 
ATOM   477  C  CD  . LYS A 1 59  ? 52.145  29.617  -0.168  1.00 44.55 ? 59  LYS A CD  1 
ATOM   478  C  CE  . LYS A 1 59  ? 53.521  28.987  -0.327  1.00 47.34 ? 59  LYS A CE  1 
ATOM   479  N  NZ  . LYS A 1 59  ? 53.940  28.910  -1.755  1.00 50.21 ? 59  LYS A NZ  1 
ATOM   480  N  N   . LEU A 1 60  ? 47.779  31.021  3.903   1.00 32.65 ? 60  LEU A N   1 
ATOM   481  C  CA  . LEU A 1 60  ? 46.489  31.696  3.992   1.00 33.71 ? 60  LEU A CA  1 
ATOM   482  C  C   . LEU A 1 60  ? 46.611  33.216  4.090   1.00 35.82 ? 60  LEU A C   1 
ATOM   483  O  O   . LEU A 1 60  ? 45.724  33.939  3.640   1.00 34.85 ? 60  LEU A O   1 
ATOM   484  C  CB  . LEU A 1 60  ? 45.697  31.155  5.186   1.00 30.13 ? 60  LEU A CB  1 
ATOM   485  C  CG  . LEU A 1 60  ? 45.359  29.661  5.114   1.00 28.40 ? 60  LEU A CG  1 
ATOM   486  C  CD1 . LEU A 1 60  ? 44.683  29.226  6.404   1.00 28.56 ? 60  LEU A CD1 1 
ATOM   487  C  CD2 . LEU A 1 60  ? 44.452  29.394  3.923   1.00 26.57 ? 60  LEU A CD2 1 
ATOM   488  N  N   . ASP A 1 61  ? 47.705  33.698  4.672   1.00 39.08 ? 61  ASP A N   1 
ATOM   489  C  CA  . ASP A 1 61  ? 47.914  35.139  4.814   1.00 43.79 ? 61  ASP A CA  1 
ATOM   490  C  C   . ASP A 1 61  ? 48.111  35.865  3.487   1.00 44.77 ? 61  ASP A C   1 
ATOM   491  O  O   . ASP A 1 61  ? 47.867  37.068  3.394   1.00 45.69 ? 61  ASP A O   1 
ATOM   492  C  CB  . ASP A 1 61  ? 49.119  35.425  5.712   1.00 47.52 ? 61  ASP A CB  1 
ATOM   493  C  CG  . ASP A 1 61  ? 48.827  35.175  7.174   1.00 52.23 ? 61  ASP A CG  1 
ATOM   494  O  OD1 . ASP A 1 61  ? 47.844  35.751  7.690   1.00 55.30 ? 61  ASP A OD1 1 
ATOM   495  O  OD2 . ASP A 1 61  ? 49.580  34.406  7.811   1.00 56.36 ? 61  ASP A OD2 1 
ATOM   496  N  N   . GLN A 1 62  ? 48.545  35.137  2.463   1.00 45.54 ? 62  GLN A N   1 
ATOM   497  C  CA  . GLN A 1 62  ? 48.786  35.731  1.152   1.00 46.24 ? 62  GLN A CA  1 
ATOM   498  C  C   . GLN A 1 62  ? 47.534  35.820  0.291   1.00 46.20 ? 62  GLN A C   1 
ATOM   499  O  O   . GLN A 1 62  ? 47.568  36.388  -0.800  1.00 46.22 ? 62  GLN A O   1 
ATOM   500  C  CB  . GLN A 1 62  ? 49.844  34.928  0.401   1.00 47.29 ? 62  GLN A CB  1 
ATOM   501  C  CG  . GLN A 1 62  ? 51.132  34.732  1.174   1.00 51.40 ? 62  GLN A CG  1 
ATOM   502  C  CD  . GLN A 1 62  ? 52.156  33.915  0.405   1.00 53.59 ? 62  GLN A CD  1 
ATOM   503  O  OE1 . GLN A 1 62  ? 53.212  33.570  0.934   1.00 55.52 ? 62  GLN A OE1 1 
ATOM   504  N  NE2 . GLN A 1 62  ? 51.848  33.605  -0.852  1.00 53.22 ? 62  GLN A NE2 1 
ATOM   505  N  N   . LEU A 1 63  ? 46.434  35.259  0.780   1.00 44.54 ? 63  LEU A N   1 
ATOM   506  C  CA  . LEU A 1 63  ? 45.178  35.264  0.037   1.00 44.21 ? 63  LEU A CA  1 
ATOM   507  C  C   . LEU A 1 63  ? 44.397  36.559  0.202   1.00 44.16 ? 63  LEU A C   1 
ATOM   508  O  O   . LEU A 1 63  ? 44.559  37.271  1.191   1.00 44.24 ? 63  LEU A O   1 
ATOM   509  C  CB  . LEU A 1 63  ? 44.282  34.109  0.498   1.00 42.83 ? 63  LEU A CB  1 
ATOM   510  C  CG  . LEU A 1 63  ? 44.699  32.661  0.240   1.00 42.39 ? 63  LEU A CG  1 
ATOM   511  C  CD1 . LEU A 1 63  ? 43.755  31.730  0.986   1.00 41.78 ? 63  LEU A CD1 1 
ATOM   512  C  CD2 . LEU A 1 63  ? 44.674  32.371  -1.253  1.00 42.26 ? 63  LEU A CD2 1 
ATOM   513  N  N   . PRO A 1 64  ? 43.540  36.884  -0.780  1.00 44.14 ? 64  PRO A N   1 
ATOM   514  C  CA  . PRO A 1 64  ? 42.736  38.102  -0.697  1.00 44.08 ? 64  PRO A CA  1 
ATOM   515  C  C   . PRO A 1 64  ? 41.890  38.003  0.570   1.00 44.33 ? 64  PRO A C   1 
ATOM   516  O  O   . PRO A 1 64  ? 41.411  36.923  0.924   1.00 44.15 ? 64  PRO A O   1 
ATOM   517  C  CB  . PRO A 1 64  ? 41.894  38.040  -1.965  1.00 44.64 ? 64  PRO A CB  1 
ATOM   518  C  CG  . PRO A 1 64  ? 42.826  37.383  -2.936  1.00 44.49 ? 64  PRO A CG  1 
ATOM   519  C  CD  . PRO A 1 64  ? 43.408  36.259  -2.109  1.00 44.68 ? 64  PRO A CD  1 
ATOM   520  N  N   . ALA A 1 65  ? 41.712  39.128  1.251   1.00 43.06 ? 65  ALA A N   1 
ATOM   521  C  CA  . ALA A 1 65  ? 40.953  39.168  2.494   1.00 42.16 ? 65  ALA A CA  1 
ATOM   522  C  C   . ALA A 1 65  ? 39.572  38.525  2.427   1.00 41.55 ? 65  ALA A C   1 
ATOM   523  O  O   . ALA A 1 65  ? 39.092  37.985  3.423   1.00 40.67 ? 65  ALA A O   1 
ATOM   524  C  CB  . ALA A 1 65  ? 40.825  40.613  2.969   1.00 42.97 ? 65  ALA A CB  1 
ATOM   525  N  N   . ASP A 1 66  ? 38.934  38.578  1.263   1.00 40.29 ? 66  ASP A N   1 
ATOM   526  C  CA  . ASP A 1 66  ? 37.598  38.007  1.116   1.00 39.59 ? 66  ASP A CA  1 
ATOM   527  C  C   . ASP A 1 66  ? 37.574  36.512  0.784   1.00 38.10 ? 66  ASP A C   1 
ATOM   528  O  O   . ASP A 1 66  ? 36.499  35.918  0.685   1.00 35.94 ? 66  ASP A O   1 
ATOM   529  C  CB  . ASP A 1 66  ? 36.813  38.780  0.049   1.00 42.58 ? 66  ASP A CB  1 
ATOM   530  C  CG  . ASP A 1 66  ? 37.338  38.541  -1.355  1.00 44.49 ? 66  ASP A CG  1 
ATOM   531  O  OD1 . ASP A 1 66  ? 38.552  38.719  -1.582  1.00 46.79 ? 66  ASP A OD1 1 
ATOM   532  O  OD2 . ASP A 1 66  ? 36.529  38.179  -2.236  1.00 48.12 ? 66  ASP A OD2 1 
ATOM   533  N  N   . LYS A 1 67  ? 38.749  35.909  0.619   1.00 34.96 ? 67  LYS A N   1 
ATOM   534  C  CA  . LYS A 1 67  ? 38.846  34.485  0.291   1.00 35.28 ? 67  LYS A CA  1 
ATOM   535  C  C   . LYS A 1 67  ? 39.478  33.672  1.420   1.00 34.28 ? 67  LYS A C   1 
ATOM   536  O  O   . LYS A 1 67  ? 39.327  32.453  1.487   1.00 33.98 ? 67  LYS A O   1 
ATOM   537  C  CB  . LYS A 1 67  ? 39.690  34.293  -0.972  1.00 35.46 ? 67  LYS A CB  1 
ATOM   538  C  CG  . LYS A 1 67  ? 39.094  34.880  -2.237  1.00 38.60 ? 67  LYS A CG  1 
ATOM   539  C  CD  . LYS A 1 67  ? 37.909  34.076  -2.718  1.00 38.70 ? 67  LYS A CD  1 
ATOM   540  C  CE  . LYS A 1 67  ? 37.454  34.549  -4.086  1.00 42.29 ? 67  LYS A CE  1 
ATOM   541  N  NZ  . LYS A 1 67  ? 36.356  33.702  -4.622  1.00 41.87 ? 67  LYS A NZ  1 
ATOM   542  N  N   . LYS A 1 68  ? 40.188  34.363  2.300   1.00 33.25 ? 68  LYS A N   1 
ATOM   543  C  CA  . LYS A 1 68  ? 40.888  33.743  3.418   1.00 33.83 ? 68  LYS A CA  1 
ATOM   544  C  C   . LYS A 1 68  ? 40.067  32.795  4.291   1.00 31.77 ? 68  LYS A C   1 
ATOM   545  O  O   . LYS A 1 68  ? 40.495  31.677  4.567   1.00 30.73 ? 68  LYS A O   1 
ATOM   546  C  CB  . LYS A 1 68  ? 41.506  34.828  4.301   1.00 35.99 ? 68  LYS A CB  1 
ATOM   547  C  CG  . LYS A 1 68  ? 42.416  34.302  5.397   1.00 40.10 ? 68  LYS A CG  1 
ATOM   548  C  CD  . LYS A 1 68  ? 43.136  35.448  6.094   1.00 44.04 ? 68  LYS A CD  1 
ATOM   549  C  CE  . LYS A 1 68  ? 44.127  34.941  7.130   1.00 47.38 ? 68  LYS A CE  1 
ATOM   550  N  NZ  . LYS A 1 68  ? 44.935  36.058  7.699   1.00 48.12 ? 68  LYS A NZ  1 
ATOM   551  N  N   . THR A 1 69  ? 38.895  33.235  4.731   1.00 30.50 ? 69  THR A N   1 
ATOM   552  C  CA  . THR A 1 69  ? 38.073  32.399  5.595   1.00 30.11 ? 69  THR A CA  1 
ATOM   553  C  C   . THR A 1 69  ? 37.509  31.160  4.912   1.00 27.32 ? 69  THR A C   1 
ATOM   554  O  O   . THR A 1 69  ? 37.571  30.066  5.469   1.00 24.83 ? 69  THR A O   1 
ATOM   555  C  CB  . THR A 1 69  ? 36.916  33.205  6.220   1.00 31.61 ? 69  THR A CB  1 
ATOM   556  O  OG1 . THR A 1 69  ? 37.456  34.206  7.091   1.00 32.36 ? 69  THR A OG1 1 
ATOM   557  C  CG2 . THR A 1 69  ? 36.005  32.294  7.033   1.00 30.94 ? 69  THR A CG2 1 
ATOM   558  N  N   . VAL A 1 70  ? 36.970  31.328  3.710   1.00 27.21 ? 70  VAL A N   1 
ATOM   559  C  CA  . VAL A 1 70  ? 36.399  30.206  2.985   1.00 26.09 ? 70  VAL A CA  1 
ATOM   560  C  C   . VAL A 1 70  ? 37.450  29.130  2.709   1.00 24.71 ? 70  VAL A C   1 
ATOM   561  O  O   . VAL A 1 70  ? 37.166  27.938  2.834   1.00 23.52 ? 70  VAL A O   1 
ATOM   562  C  CB  . VAL A 1 70  ? 35.736  30.683  1.663   1.00 27.86 ? 70  VAL A CB  1 
ATOM   563  C  CG1 . VAL A 1 70  ? 36.778  31.223  0.712   1.00 29.12 ? 70  VAL A CG1 1 
ATOM   564  C  CG2 . VAL A 1 70  ? 34.963  29.546  1.031   1.00 29.13 ? 70  VAL A CG2 1 
ATOM   565  N  N   . LEU A 1 71  ? 38.666  29.540  2.356   1.00 22.05 ? 71  LEU A N   1 
ATOM   566  C  CA  . LEU A 1 71  ? 39.718  28.569  2.079   1.00 21.99 ? 71  LEU A CA  1 
ATOM   567  C  C   . LEU A 1 71  ? 40.301  27.994  3.370   1.00 21.81 ? 71  LEU A C   1 
ATOM   568  O  O   . LEU A 1 71  ? 40.672  26.823  3.423   1.00 22.62 ? 71  LEU A O   1 
ATOM   569  C  CB  . LEU A 1 71  ? 40.799  29.200  1.192   1.00 22.18 ? 71  LEU A CB  1 
ATOM   570  C  CG  . LEU A 1 71  ? 40.304  29.381  -0.254  1.00 23.56 ? 71  LEU A CG  1 
ATOM   571  C  CD1 . LEU A 1 71  ? 41.296  30.201  -1.063  1.00 22.85 ? 71  LEU A CD1 1 
ATOM   572  C  CD2 . LEU A 1 71  ? 40.103  28.001  -0.891  1.00 23.10 ? 71  LEU A CD2 1 
ATOM   573  N  N   . ARG A 1 72  ? 40.367  28.806  4.419   1.00 19.98 ? 72  ARG A N   1 
ATOM   574  C  CA  . ARG A 1 72  ? 40.864  28.316  5.695   1.00 18.86 ? 72  ARG A CA  1 
ATOM   575  C  C   . ARG A 1 72  ? 39.989  27.142  6.141   1.00 19.77 ? 72  ARG A C   1 
ATOM   576  O  O   . ARG A 1 72  ? 40.490  26.082  6.535   1.00 18.90 ? 72  ARG A O   1 
ATOM   577  C  CB  . ARG A 1 72  ? 40.794  29.416  6.748   1.00 19.30 ? 72  ARG A CB  1 
ATOM   578  C  CG  . ARG A 1 72  ? 40.980  28.935  8.175   1.00 18.65 ? 72  ARG A CG  1 
ATOM   579  C  CD  . ARG A 1 72  ? 40.914  30.113  9.153   1.00 22.73 ? 72  ARG A CD  1 
ATOM   580  N  NE  . ARG A 1 72  ? 40.998  29.694  10.552  1.00 21.07 ? 72  ARG A NE  1 
ATOM   581  C  CZ  . ARG A 1 72  ? 41.008  30.539  11.580  1.00 27.60 ? 72  ARG A CZ  1 
ATOM   582  N  NH1 . ARG A 1 72  ? 40.942  31.848  11.364  1.00 23.95 ? 72  ARG A NH1 1 
ATOM   583  N  NH2 . ARG A 1 72  ? 41.072  30.081  12.826  1.00 25.63 ? 72  ARG A NH2 1 
ATOM   584  N  N   . ASN A 1 73  ? 38.677  27.338  6.071   1.00 17.32 ? 73  ASN A N   1 
ATOM   585  C  CA  . ASN A 1 73  ? 37.747  26.300  6.487   1.00 18.27 ? 73  ASN A CA  1 
ATOM   586  C  C   . ASN A 1 73  ? 37.681  25.097  5.560   1.00 18.47 ? 73  ASN A C   1 
ATOM   587  O  O   . ASN A 1 73  ? 37.784  23.957  6.011   1.00 19.83 ? 73  ASN A O   1 
ATOM   588  C  CB  . ASN A 1 73  ? 36.338  26.878  6.654   1.00 17.08 ? 73  ASN A CB  1 
ATOM   589  C  CG  . ASN A 1 73  ? 36.251  27.864  7.801   1.00 17.18 ? 73  ASN A CG  1 
ATOM   590  O  OD1 . ASN A 1 73  ? 37.056  27.815  8.731   1.00 18.45 ? 73  ASN A OD1 1 
ATOM   591  N  ND2 . ASN A 1 73  ? 35.266  28.752  7.751   1.00 17.25 ? 73  ASN A ND2 1 
ATOM   592  N  N   . ASN A 1 74  ? 37.524  25.344  4.266   1.00 16.60 ? 74  ASN A N   1 
ATOM   593  C  CA  . ASN A 1 74  ? 37.397  24.247  3.313   1.00 16.95 ? 74  ASN A CA  1 
ATOM   594  C  C   . ASN A 1 74  ? 38.692  23.577  2.860   1.00 17.60 ? 74  ASN A C   1 
ATOM   595  O  O   . ASN A 1 74  ? 38.716  22.354  2.675   1.00 16.12 ? 74  ASN A O   1 
ATOM   596  C  CB  . ASN A 1 74  ? 36.551  24.721  2.133   1.00 15.23 ? 74  ASN A CB  1 
ATOM   597  C  CG  . ASN A 1 74  ? 35.109  25.004  2.545   1.00 20.43 ? 74  ASN A CG  1 
ATOM   598  O  OD1 . ASN A 1 74  ? 34.324  24.081  2.760   1.00 19.96 ? 74  ASN A OD1 1 
ATOM   599  N  ND2 . ASN A 1 74  ? 34.766  26.283  2.688   1.00 18.24 ? 74  ASN A ND2 1 
ATOM   600  N  N   . ALA A 1 75  ? 39.766  24.345  2.676   1.00 15.64 ? 75  ALA A N   1 
ATOM   601  C  CA  . ALA A 1 75  ? 41.034  23.726  2.297   1.00 16.02 ? 75  ALA A CA  1 
ATOM   602  C  C   . ALA A 1 75  ? 41.509  23.019  3.566   1.00 16.45 ? 75  ALA A C   1 
ATOM   603  O  O   . ALA A 1 75  ? 42.112  21.945  3.510   1.00 15.40 ? 75  ALA A O   1 
ATOM   604  C  CB  . ALA A 1 75  ? 42.052  24.778  1.847   1.00 17.99 ? 75  ALA A CB  1 
ATOM   605  N  N   . GLY A 1 76  ? 41.231  23.629  4.714   1.00 15.96 ? 76  GLY A N   1 
ATOM   606  C  CA  . GLY A 1 76  ? 41.605  23.008  5.973   1.00 16.35 ? 76  GLY A CA  1 
ATOM   607  C  C   . GLY A 1 76  ? 40.850  21.692  6.090   1.00 16.46 ? 76  GLY A C   1 
ATOM   608  O  O   . GLY A 1 76  ? 41.416  20.669  6.472   1.00 16.66 ? 76  GLY A O   1 
ATOM   609  N  N   . GLY A 1 77  ? 39.566  21.718  5.736   1.00 16.22 ? 77  GLY A N   1 
ATOM   610  C  CA  . GLY A 1 77  ? 38.763  20.506  5.806   1.00 16.23 ? 77  GLY A CA  1 
ATOM   611  C  C   . GLY A 1 77  ? 39.299  19.416  4.890   1.00 17.14 ? 77  GLY A C   1 
ATOM   612  O  O   . GLY A 1 77  ? 39.365  18.247  5.267   1.00 15.49 ? 77  GLY A O   1 
ATOM   613  N  N   . HIS A 1 78  ? 39.687  19.800  3.680   1.00 14.46 ? 78  HIS A N   1 
ATOM   614  C  CA  . HIS A 1 78  ? 40.212  18.847  2.714   1.00 16.79 ? 78  HIS A CA  1 
ATOM   615  C  C   . HIS A 1 78  ? 41.534  18.243  3.210   1.00 17.17 ? 78  HIS A C   1 
ATOM   616  O  O   . HIS A 1 78  ? 41.722  17.026  3.171   1.00 16.99 ? 78  HIS A O   1 
ATOM   617  C  CB  . HIS A 1 78  ? 40.375  19.544  1.357   1.00 15.62 ? 78  HIS A CB  1 
ATOM   618  C  CG  . HIS A 1 78  ? 40.927  18.667  0.276   1.00 17.38 ? 78  HIS A CG  1 
ATOM   619  N  ND1 . HIS A 1 78  ? 40.581  17.340  0.139   1.00 17.67 ? 78  HIS A ND1 1 
ATOM   620  C  CD2 . HIS A 1 78  ? 41.772  18.943  -0.747  1.00 19.58 ? 78  HIS A CD2 1 
ATOM   621  C  CE1 . HIS A 1 78  ? 41.189  16.834  -0.920  1.00 20.00 ? 78  HIS A CE1 1 
ATOM   622  N  NE2 . HIS A 1 78  ? 41.917  17.786  -1.477  1.00 19.63 ? 78  HIS A NE2 1 
ATOM   623  N  N   . ALA A 1 79  ? 42.437  19.088  3.696   1.00 17.82 ? 79  ALA A N   1 
ATOM   624  C  CA  . ALA A 1 79  ? 43.724  18.613  4.202   1.00 16.71 ? 79  ALA A CA  1 
ATOM   625  C  C   . ALA A 1 79  ? 43.555  17.656  5.385   1.00 17.80 ? 79  ALA A C   1 
ATOM   626  O  O   . ALA A 1 79  ? 44.147  16.571  5.412   1.00 16.76 ? 79  ALA A O   1 
ATOM   627  C  CB  . ALA A 1 79  ? 44.585  19.794  4.619   1.00 15.37 ? 79  ALA A CB  1 
ATOM   628  N  N   . ASN A 1 80  ? 42.748  18.061  6.362   1.00 16.40 ? 80  ASN A N   1 
ATOM   629  C  CA  . ASN A 1 80  ? 42.532  17.249  7.556   1.00 16.09 ? 80  ASN A CA  1 
ATOM   630  C  C   . ASN A 1 80  ? 41.888  15.893  7.267   1.00 15.48 ? 80  ASN A C   1 
ATOM   631  O  O   . ASN A 1 80  ? 42.351  14.862  7.759   1.00 16.26 ? 80  ASN A O   1 
ATOM   632  C  CB  . ASN A 1 80  ? 41.686  18.025  8.569   1.00 15.78 ? 80  ASN A CB  1 
ATOM   633  C  CG  . ASN A 1 80  ? 42.441  19.196  9.186   1.00 19.49 ? 80  ASN A CG  1 
ATOM   634  O  OD1 . ASN A 1 80  ? 43.594  19.464  8.833   1.00 18.48 ? 80  ASN A OD1 1 
ATOM   635  N  ND2 . ASN A 1 80  ? 41.793  19.896  10.115  1.00 18.90 ? 80  ASN A ND2 1 
ATOM   636  N  N   . HIS A 1 81  ? 40.830  15.883  6.466   1.00 14.81 ? 81  HIS A N   1 
ATOM   637  C  CA  . HIS A 1 81  ? 40.175  14.619  6.168   1.00 15.57 ? 81  HIS A CA  1 
ATOM   638  C  C   . HIS A 1 81  ? 41.025  13.704  5.294   1.00 16.81 ? 81  HIS A C   1 
ATOM   639  O  O   . HIS A 1 81  ? 40.983  12.483  5.442   1.00 16.85 ? 81  HIS A O   1 
ATOM   640  C  CB  . HIS A 1 81  ? 38.812  14.869  5.539   1.00 14.62 ? 81  HIS A CB  1 
ATOM   641  C  CG  . HIS A 1 81  ? 37.814  15.415  6.512   1.00 14.44 ? 81  HIS A CG  1 
ATOM   642  N  ND1 . HIS A 1 81  ? 37.743  16.753  6.836   1.00 13.80 ? 81  HIS A ND1 1 
ATOM   643  C  CD2 . HIS A 1 81  ? 36.899  14.790  7.292   1.00 14.92 ? 81  HIS A CD2 1 
ATOM   644  C  CE1 . HIS A 1 81  ? 36.827  16.929  7.775   1.00 14.35 ? 81  HIS A CE1 1 
ATOM   645  N  NE2 . HIS A 1 81  ? 36.302  15.753  8.070   1.00 13.93 ? 81  HIS A NE2 1 
ATOM   646  N  N   . SER A 1 82  ? 41.802  14.283  4.385   1.00 16.84 ? 82  SER A N   1 
ATOM   647  C  CA  . SER A 1 82  ? 42.655  13.467  3.534   1.00 18.81 ? 82  SER A CA  1 
ATOM   648  C  C   . SER A 1 82  ? 43.653  12.719  4.417   1.00 18.94 ? 82  SER A C   1 
ATOM   649  O  O   . SER A 1 82  ? 43.917  11.534  4.217   1.00 20.20 ? 82  SER A O   1 
ATOM   650  C  CB  . SER A 1 82  ? 43.395  14.348  2.519   1.00 17.46 ? 82  SER A CB  1 
ATOM   651  O  OG  . SER A 1 82  ? 42.489  14.873  1.560   1.00 18.47 ? 82  SER A OG  1 
ATOM   652  N  N   . LEU A 1 83  ? 44.198  13.420  5.403   1.00 20.53 ? 83  LEU A N   1 
ATOM   653  C  CA  . LEU A 1 83  ? 45.160  12.825  6.326   1.00 21.52 ? 83  LEU A CA  1 
ATOM   654  C  C   . LEU A 1 83  ? 44.477  11.763  7.198   1.00 21.69 ? 83  LEU A C   1 
ATOM   655  O  O   . LEU A 1 83  ? 45.046  10.700  7.464   1.00 20.09 ? 83  LEU A O   1 
ATOM   656  C  CB  . LEU A 1 83  ? 45.763  13.925  7.201   1.00 26.28 ? 83  LEU A CB  1 
ATOM   657  C  CG  . LEU A 1 83  ? 47.005  13.644  8.050   1.00 30.98 ? 83  LEU A CG  1 
ATOM   658  C  CD1 . LEU A 1 83  ? 47.649  14.974  8.447   1.00 34.71 ? 83  LEU A CD1 1 
ATOM   659  C  CD2 . LEU A 1 83  ? 46.628  12.849  9.285   1.00 33.37 ? 83  LEU A CD2 1 
ATOM   660  N  N   . PHE A 1 84  ? 43.250  12.054  7.624   1.00 17.56 ? 84  PHE A N   1 
ATOM   661  C  CA  . PHE A 1 84  ? 42.469  11.150  8.470   1.00 18.06 ? 84  PHE A CA  1 
ATOM   662  C  C   . PHE A 1 84  ? 42.254  9.767   7.831   1.00 17.79 ? 84  PHE A C   1 
ATOM   663  O  O   . PHE A 1 84  ? 42.494  8.749   8.473   1.00 19.47 ? 84  PHE A O   1 
ATOM   664  C  CB  . PHE A 1 84  ? 41.109  11.789  8.784   1.00 17.42 ? 84  PHE A CB  1 
ATOM   665  C  CG  . PHE A 1 84  ? 40.317  11.081  9.866   1.00 15.10 ? 84  PHE A CG  1 
ATOM   666  C  CD1 . PHE A 1 84  ? 40.854  10.893  11.132  1.00 16.23 ? 84  PHE A CD1 1 
ATOM   667  C  CD2 . PHE A 1 84  ? 39.010  10.667  9.627   1.00 16.85 ? 84  PHE A CD2 1 
ATOM   668  C  CE1 . PHE A 1 84  ? 40.098  10.304  12.156  1.00 16.15 ? 84  PHE A CE1 1 
ATOM   669  C  CE2 . PHE A 1 84  ? 38.243  10.078  10.636  1.00 17.61 ? 84  PHE A CE2 1 
ATOM   670  C  CZ  . PHE A 1 84  ? 38.788  9.899   11.904  1.00 16.01 ? 84  PHE A CZ  1 
ATOM   671  N  N   . TRP A 1 85  ? 41.814  9.729   6.572   1.00 18.93 ? 85  TRP A N   1 
ATOM   672  C  CA  . TRP A 1 85  ? 41.561  8.447   5.911   1.00 18.64 ? 85  TRP A CA  1 
ATOM   673  C  C   . TRP A 1 85  ? 42.809  7.572   5.869   1.00 19.62 ? 85  TRP A C   1 
ATOM   674  O  O   . TRP A 1 85  ? 42.736  6.370   6.137   1.00 17.85 ? 85  TRP A O   1 
ATOM   675  C  CB  . TRP A 1 85  ? 41.050  8.641   4.478   1.00 18.20 ? 85  TRP A CB  1 
ATOM   676  C  CG  . TRP A 1 85  ? 39.884  9.574   4.343   1.00 17.06 ? 85  TRP A CG  1 
ATOM   677  C  CD1 . TRP A 1 85  ? 39.734  10.552  3.406   1.00 17.52 ? 85  TRP A CD1 1 
ATOM   678  C  CD2 . TRP A 1 85  ? 38.717  9.632   5.173   1.00 17.65 ? 85  TRP A CD2 1 
ATOM   679  N  NE1 . TRP A 1 85  ? 38.553  11.224  3.599   1.00 16.57 ? 85  TRP A NE1 1 
ATOM   680  C  CE2 . TRP A 1 85  ? 37.906  10.681  4.677   1.00 18.14 ? 85  TRP A CE2 1 
ATOM   681  C  CE3 . TRP A 1 85  ? 38.275  8.901   6.288   1.00 18.60 ? 85  TRP A CE3 1 
ATOM   682  C  CZ2 . TRP A 1 85  ? 36.677  11.022  5.256   1.00 18.24 ? 85  TRP A CZ2 1 
ATOM   683  C  CZ3 . TRP A 1 85  ? 37.046  9.240   6.867   1.00 19.66 ? 85  TRP A CZ3 1 
ATOM   684  C  CH2 . TRP A 1 85  ? 36.265  10.292  6.347   1.00 21.46 ? 85  TRP A CH2 1 
ATOM   685  N  N   . LYS A 1 86  ? 43.945  8.172   5.524   1.00 18.93 ? 86  LYS A N   1 
ATOM   686  C  CA  . LYS A 1 86  ? 45.210  7.444   5.450   1.00 22.48 ? 86  LYS A CA  1 
ATOM   687  C  C   . LYS A 1 86  ? 45.716  7.019   6.822   1.00 23.01 ? 86  LYS A C   1 
ATOM   688  O  O   . LYS A 1 86  ? 46.540  6.106   6.930   1.00 24.02 ? 86  LYS A O   1 
ATOM   689  C  CB  . LYS A 1 86  ? 46.296  8.303   4.804   1.00 24.29 ? 86  LYS A CB  1 
ATOM   690  C  CG  . LYS A 1 86  ? 46.117  8.577   3.330   1.00 30.12 ? 86  LYS A CG  1 
ATOM   691  C  CD  . LYS A 1 86  ? 47.302  9.381   2.824   1.00 35.90 ? 86  LYS A CD  1 
ATOM   692  C  CE  . LYS A 1 86  ? 47.170  9.712   1.351   1.00 42.29 ? 86  LYS A CE  1 
ATOM   693  N  NZ  . LYS A 1 86  ? 48.293  10.582  0.882   1.00 45.72 ? 86  LYS A NZ  1 
ATOM   694  N  N   . GLY A 1 87  ? 45.225  7.678   7.868   1.00 19.64 ? 87  GLY A N   1 
ATOM   695  C  CA  . GLY A 1 87  ? 45.663  7.369   9.218   1.00 18.82 ? 87  GLY A CA  1 
ATOM   696  C  C   . GLY A 1 87  ? 44.839  6.345   9.981   1.00 20.46 ? 87  GLY A C   1 
ATOM   697  O  O   . GLY A 1 87  ? 44.996  6.200   11.199  1.00 20.66 ? 87  GLY A O   1 
ATOM   698  N  N   . LEU A 1 88  ? 43.974  5.625   9.273   1.00 19.88 ? 88  LEU A N   1 
ATOM   699  C  CA  . LEU A 1 88  ? 43.131  4.612   9.899   1.00 21.26 ? 88  LEU A CA  1 
ATOM   700  C  C   . LEU A 1 88  ? 43.358  3.249   9.257   1.00 23.35 ? 88  LEU A C   1 
ATOM   701  O  O   . LEU A 1 88  ? 43.392  3.129   8.030   1.00 22.54 ? 88  LEU A O   1 
ATOM   702  C  CB  . LEU A 1 88  ? 41.659  4.979   9.750   1.00 20.77 ? 88  LEU A CB  1 
ATOM   703  C  CG  . LEU A 1 88  ? 41.187  6.312   10.331  1.00 18.18 ? 88  LEU A CG  1 
ATOM   704  C  CD1 . LEU A 1 88  ? 39.781  6.594   9.838   1.00 20.60 ? 88  LEU A CD1 1 
ATOM   705  C  CD2 . LEU A 1 88  ? 41.236  6.265   11.849  1.00 20.69 ? 88  LEU A CD2 1 
ATOM   706  N  N   . LYS A 1 89  ? 43.507  2.230   10.097  1.00 24.21 ? 89  LYS A N   1 
ATOM   707  C  CA  . LYS A 1 89  ? 43.704  0.858   9.638   1.00 26.96 ? 89  LYS A CA  1 
ATOM   708  C  C   . LYS A 1 89  ? 43.748  -0.081  10.843  1.00 27.40 ? 89  LYS A C   1 
ATOM   709  O  O   . LYS A 1 89  ? 44.385  0.225   11.847  1.00 27.67 ? 89  LYS A O   1 
ATOM   710  C  CB  . LYS A 1 89  ? 45.010  0.733   8.852   1.00 29.66 ? 89  LYS A CB  1 
ATOM   711  C  CG  . LYS A 1 89  ? 45.174  -0.615  8.164   1.00 34.21 ? 89  LYS A CG  1 
ATOM   712  C  CD  . LYS A 1 89  ? 46.586  -0.791  7.638   1.00 39.55 ? 89  LYS A CD  1 
ATOM   713  C  CE  . LYS A 1 89  ? 46.750  -2.143  6.961   1.00 43.66 ? 89  LYS A CE  1 
ATOM   714  N  NZ  . LYS A 1 89  ? 48.172  -2.381  6.576   1.00 46.17 ? 89  LYS A NZ  1 
ATOM   715  N  N   . LYS A 1 90  ? 43.063  -1.215  10.742  1.00 29.66 ? 90  LYS A N   1 
ATOM   716  C  CA  . LYS A 1 90  ? 43.038  -2.200  11.821  1.00 31.05 ? 90  LYS A CA  1 
ATOM   717  C  C   . LYS A 1 90  ? 44.273  -3.098  11.802  1.00 33.11 ? 90  LYS A C   1 
ATOM   718  O  O   . LYS A 1 90  ? 44.947  -3.228  10.780  1.00 32.59 ? 90  LYS A O   1 
ATOM   719  C  CB  . LYS A 1 90  ? 41.804  -3.093  11.695  1.00 32.30 ? 90  LYS A CB  1 
ATOM   720  C  CG  . LYS A 1 90  ? 40.481  -2.411  11.970  1.00 33.25 ? 90  LYS A CG  1 
ATOM   721  C  CD  . LYS A 1 90  ? 39.315  -3.335  11.620  1.00 35.40 ? 90  LYS A CD  1 
ATOM   722  C  CE  . LYS A 1 90  ? 39.387  -4.662  12.367  1.00 35.45 ? 90  LYS A CE  1 
ATOM   723  N  NZ  . LYS A 1 90  ? 38.265  -5.570  11.982  1.00 36.09 ? 90  LYS A NZ  1 
ATOM   724  N  N   . GLY A 1 91  ? 44.568  -3.705  12.947  1.00 34.58 ? 91  GLY A N   1 
ATOM   725  C  CA  . GLY A 1 91  ? 45.684  -4.629  13.039  1.00 37.35 ? 91  GLY A CA  1 
ATOM   726  C  C   . GLY A 1 91  ? 47.115  -4.127  13.010  1.00 38.58 ? 91  GLY A C   1 
ATOM   727  O  O   . GLY A 1 91  ? 48.024  -4.908  12.720  1.00 38.85 ? 91  GLY A O   1 
ATOM   728  N  N   . THR A 1 92  ? 47.343  -2.849  13.294  1.00 37.60 ? 92  THR A N   1 
ATOM   729  C  CA  . THR A 1 92  ? 48.712  -2.346  13.303  1.00 36.77 ? 92  THR A CA  1 
ATOM   730  C  C   . THR A 1 92  ? 49.170  -2.303  14.749  1.00 37.22 ? 92  THR A C   1 
ATOM   731  O  O   . THR A 1 92  ? 48.358  -2.418  15.660  1.00 37.10 ? 92  THR A O   1 
ATOM   732  C  CB  . THR A 1 92  ? 48.823  -0.921  12.721  1.00 36.70 ? 92  THR A CB  1 
ATOM   733  O  OG1 . THR A 1 92  ? 48.115  -0.006  13.564  1.00 35.83 ? 92  THR A OG1 1 
ATOM   734  C  CG2 . THR A 1 92  ? 48.259  -0.872  11.303  1.00 35.47 ? 92  THR A CG2 1 
ATOM   735  N  N   . THR A 1 93  ? 50.470  -2.143  14.963  1.00 38.56 ? 93  THR A N   1 
ATOM   736  C  CA  . THR A 1 93  ? 50.996  -2.078  16.318  1.00 40.67 ? 93  THR A CA  1 
ATOM   737  C  C   . THR A 1 93  ? 52.074  -1.012  16.437  1.00 40.42 ? 93  THR A C   1 
ATOM   738  O  O   . THR A 1 93  ? 52.924  -0.872  15.559  1.00 40.91 ? 93  THR A O   1 
ATOM   739  C  CB  . THR A 1 93  ? 51.585  -3.439  16.767  1.00 42.35 ? 93  THR A CB  1 
ATOM   740  O  OG1 . THR A 1 93  ? 52.575  -3.867  15.827  1.00 44.94 ? 93  THR A OG1 1 
ATOM   741  C  CG2 . THR A 1 93  ? 50.493  -4.493  16.858  1.00 42.51 ? 93  THR A CG2 1 
ATOM   742  N  N   . LEU A 1 94  ? 52.021  -0.255  17.526  1.00 41.21 ? 94  LEU A N   1 
ATOM   743  C  CA  . LEU A 1 94  ? 52.995  0.797   17.782  1.00 42.76 ? 94  LEU A CA  1 
ATOM   744  C  C   . LEU A 1 94  ? 54.335  0.138   18.085  1.00 44.29 ? 94  LEU A C   1 
ATOM   745  O  O   . LEU A 1 94  ? 54.424  -0.732  18.951  1.00 44.90 ? 94  LEU A O   1 
ATOM   746  C  CB  . LEU A 1 94  ? 52.538  1.639   18.971  1.00 42.45 ? 94  LEU A CB  1 
ATOM   747  C  CG  . LEU A 1 94  ? 53.432  2.786   19.439  1.00 43.15 ? 94  LEU A CG  1 
ATOM   748  C  CD1 . LEU A 1 94  ? 53.732  3.736   18.288  1.00 41.55 ? 94  LEU A CD1 1 
ATOM   749  C  CD2 . LEU A 1 94  ? 52.727  3.515   20.569  1.00 42.64 ? 94  LEU A CD2 1 
ATOM   750  N  N   . GLN A 1 95  ? 55.379  0.552   17.377  1.00 44.53 ? 95  GLN A N   1 
ATOM   751  C  CA  . GLN A 1 95  ? 56.690  -0.046  17.578  1.00 45.91 ? 95  GLN A CA  1 
ATOM   752  C  C   . GLN A 1 95  ? 57.801  0.826   17.021  1.00 45.44 ? 95  GLN A C   1 
ATOM   753  O  O   . GLN A 1 95  ? 57.566  1.948   16.574  1.00 45.41 ? 95  GLN A O   1 
ATOM   754  C  CB  . GLN A 1 95  ? 56.736  -1.404  16.881  1.00 47.44 ? 95  GLN A CB  1 
ATOM   755  C  CG  . GLN A 1 95  ? 56.588  -1.294  15.370  1.00 50.48 ? 95  GLN A CG  1 
ATOM   756  C  CD  . GLN A 1 95  ? 56.381  -2.632  14.692  1.00 53.18 ? 95  GLN A CD  1 
ATOM   757  O  OE1 . GLN A 1 95  ? 57.219  -3.528  14.788  1.00 55.38 ? 95  GLN A OE1 1 
ATOM   758  N  NE2 . GLN A 1 95  ? 55.258  -2.774  13.996  1.00 53.94 ? 95  GLN A NE2 1 
ATOM   759  N  N   . GLY A 1 96  ? 59.016  0.291   17.054  1.00 44.51 ? 96  GLY A N   1 
ATOM   760  C  CA  . GLY A 1 96  ? 60.161  1.007   16.527  1.00 42.94 ? 96  GLY A CA  1 
ATOM   761  C  C   . GLY A 1 96  ? 60.434  2.366   17.133  1.00 41.89 ? 96  GLY A C   1 
ATOM   762  O  O   . GLY A 1 96  ? 60.145  2.615   18.305  1.00 41.25 ? 96  GLY A O   1 
ATOM   763  N  N   . ASP A 1 97  ? 60.996  3.247   16.311  1.00 41.71 ? 97  ASP A N   1 
ATOM   764  C  CA  . ASP A 1 97  ? 61.354  4.599   16.722  1.00 43.20 ? 97  ASP A CA  1 
ATOM   765  C  C   . ASP A 1 97  ? 60.192  5.435   17.248  1.00 41.86 ? 97  ASP A C   1 
ATOM   766  O  O   . ASP A 1 97  ? 60.359  6.213   18.187  1.00 40.65 ? 97  ASP A O   1 
ATOM   767  C  CB  . ASP A 1 97  ? 62.010  5.336   15.554  1.00 46.60 ? 97  ASP A CB  1 
ATOM   768  C  CG  . ASP A 1 97  ? 63.235  4.616   15.029  1.00 51.46 ? 97  ASP A CG  1 
ATOM   769  O  OD1 . ASP A 1 97  ? 63.095  3.466   14.553  1.00 53.17 ? 97  ASP A OD1 1 
ATOM   770  O  OD2 . ASP A 1 97  ? 64.337  5.201   15.094  1.00 53.55 ? 97  ASP A OD2 1 
ATOM   771  N  N   . LEU A 1 98  ? 59.020  5.289   16.643  1.00 41.39 ? 98  LEU A N   1 
ATOM   772  C  CA  . LEU A 1 98  ? 57.871  6.067   17.088  1.00 41.02 ? 98  LEU A CA  1 
ATOM   773  C  C   . LEU A 1 98  ? 57.539  5.741   18.534  1.00 40.95 ? 98  LEU A C   1 
ATOM   774  O  O   . LEU A 1 98  ? 57.380  6.640   19.359  1.00 40.69 ? 98  LEU A O   1 
ATOM   775  C  CB  . LEU A 1 98  ? 56.649  5.798   16.208  1.00 38.24 ? 98  LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 98  ? 55.423  6.646   16.570  1.00 38.43 ? 98  LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 98  ? 55.792  8.127   16.526  1.00 36.28 ? 98  LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 98  ? 54.282  6.345   15.611  1.00 36.60 ? 98  LEU A CD2 1 
ATOM   779  N  N   . LYS A 1 99  ? 57.437  4.452   18.841  1.00 41.50 ? 99  LYS A N   1 
ATOM   780  C  CA  . LYS A 1 99  ? 57.126  4.033   20.199  1.00 42.93 ? 99  LYS A CA  1 
ATOM   781  C  C   . LYS A 1 99  ? 58.169  4.556   21.178  1.00 42.73 ? 99  LYS A C   1 
ATOM   782  O  O   . LYS A 1 99  ? 57.835  5.019   22.269  1.00 42.65 ? 99  LYS A O   1 
ATOM   783  C  CB  . LYS A 1 99  ? 57.058  2.509   20.295  1.00 42.87 ? 99  LYS A CB  1 
ATOM   784  C  CG  . LYS A 1 99  ? 56.783  2.030   21.707  1.00 45.72 ? 99  LYS A CG  1 
ATOM   785  C  CD  . LYS A 1 99  ? 56.620  0.531   21.791  1.00 46.90 ? 99  LYS A CD  1 
ATOM   786  C  CE  . LYS A 1 99  ? 56.377  0.112   23.231  1.00 48.70 ? 99  LYS A CE  1 
ATOM   787  N  NZ  . LYS A 1 99  ? 56.129  -1.347  23.349  1.00 51.23 ? 99  LYS A NZ  1 
ATOM   788  N  N   . ALA A 1 100 ? 59.434  4.485   20.779  1.00 42.56 ? 100 ALA A N   1 
ATOM   789  C  CA  . ALA A 1 100 ? 60.527  4.954   21.620  1.00 42.65 ? 100 ALA A CA  1 
ATOM   790  C  C   . ALA A 1 100 ? 60.389  6.447   21.903  1.00 42.73 ? 100 ALA A C   1 
ATOM   791  O  O   . ALA A 1 100 ? 60.564  6.894   23.037  1.00 41.93 ? 100 ALA A O   1 
ATOM   792  C  CB  . ALA A 1 100 ? 61.861  4.668   20.942  1.00 42.62 ? 100 ALA A CB  1 
ATOM   793  N  N   . ALA A 1 101 ? 60.073  7.217   20.866  1.00 42.62 ? 101 ALA A N   1 
ATOM   794  C  CA  . ALA A 1 101 ? 59.912  8.660   21.009  1.00 42.98 ? 101 ALA A CA  1 
ATOM   795  C  C   . ALA A 1 101 ? 58.740  8.983   21.930  1.00 42.73 ? 101 ALA A C   1 
ATOM   796  O  O   . ALA A 1 101 ? 58.807  9.915   22.729  1.00 42.51 ? 101 ALA A O   1 
ATOM   797  C  CB  . ALA A 1 101 ? 59.694  9.301   19.644  1.00 43.16 ? 101 ALA A CB  1 
ATOM   798  N  N   . ILE A 1 102 ? 57.665  8.212   21.810  1.00 43.40 ? 102 ILE A N   1 
ATOM   799  C  CA  . ILE A 1 102 ? 56.483  8.413   22.641  1.00 43.34 ? 102 ILE A CA  1 
ATOM   800  C  C   . ILE A 1 102 ? 56.847  8.222   24.111  1.00 45.25 ? 102 ILE A C   1 
ATOM   801  O  O   . ILE A 1 102 ? 56.594  9.091   24.948  1.00 44.39 ? 102 ILE A O   1 
ATOM   802  C  CB  . ILE A 1 102 ? 55.365  7.397   22.290  1.00 42.75 ? 102 ILE A CB  1 
ATOM   803  C  CG1 . ILE A 1 102 ? 54.845  7.646   20.872  1.00 41.83 ? 102 ILE A CG1 1 
ATOM   804  C  CG2 . ILE A 1 102 ? 54.226  7.498   23.300  1.00 41.39 ? 102 ILE A CG2 1 
ATOM   805  C  CD1 . ILE A 1 102 ? 54.178  8.978   20.691  1.00 42.82 ? 102 ILE A CD1 1 
ATOM   806  N  N   . GLU A 1 103 ? 57.440  7.074   24.417  1.00 46.00 ? 103 GLU A N   1 
ATOM   807  C  CA  . GLU A 1 103 ? 57.830  6.764   25.785  1.00 48.05 ? 103 GLU A CA  1 
ATOM   808  C  C   . GLU A 1 103 ? 58.809  7.803   26.309  1.00 48.43 ? 103 GLU A C   1 
ATOM   809  O  O   . GLU A 1 103 ? 58.800  8.139   27.491  1.00 48.70 ? 103 GLU A O   1 
ATOM   810  C  CB  . GLU A 1 103 ? 58.466  5.376   25.844  1.00 48.47 ? 103 GLU A CB  1 
ATOM   811  C  CG  . GLU A 1 103 ? 57.594  4.292   25.245  1.00 50.35 ? 103 GLU A CG  1 
ATOM   812  C  CD  . GLU A 1 103 ? 58.231  2.923   25.318  1.00 51.99 ? 103 GLU A CD  1 
ATOM   813  O  OE1 . GLU A 1 103 ? 59.393  2.783   24.881  1.00 52.94 ? 103 GLU A OE1 1 
ATOM   814  O  OE2 . GLU A 1 103 ? 57.566  1.985   25.805  1.00 52.66 ? 103 GLU A OE2 1 
ATOM   815  N  N   . ARG A 1 104 ? 59.648  8.318   25.419  1.00 49.42 ? 104 ARG A N   1 
ATOM   816  C  CA  . ARG A 1 104 ? 60.635  9.322   25.793  1.00 50.32 ? 104 ARG A CA  1 
ATOM   817  C  C   . ARG A 1 104 ? 60.000  10.653  26.181  1.00 50.07 ? 104 ARG A C   1 
ATOM   818  O  O   . ARG A 1 104 ? 60.320  11.219  27.224  1.00 49.79 ? 104 ARG A O   1 
ATOM   819  C  CB  . ARG A 1 104 ? 61.608  9.562   24.640  1.00 52.58 ? 104 ARG A CB  1 
ATOM   820  C  CG  . ARG A 1 104 ? 62.641  10.647  24.915  1.00 55.55 ? 104 ARG A CG  1 
ATOM   821  C  CD  . ARG A 1 104 ? 63.313  11.090  23.627  1.00 58.97 ? 104 ARG A CD  1 
ATOM   822  N  NE  . ARG A 1 104 ? 62.366  11.758  22.737  1.00 61.85 ? 104 ARG A NE  1 
ATOM   823  C  CZ  . ARG A 1 104 ? 62.588  11.997  21.448  1.00 63.27 ? 104 ARG A CZ  1 
ATOM   824  N  NH1 . ARG A 1 104 ? 63.729  11.619  20.889  1.00 63.47 ? 104 ARG A NH1 1 
ATOM   825  N  NH2 . ARG A 1 104 ? 61.665  12.609  20.716  1.00 63.92 ? 104 ARG A NH2 1 
ATOM   826  N  N   . ASP A 1 105 ? 59.102  11.154  25.338  1.00 49.15 ? 105 ASP A N   1 
ATOM   827  C  CA  . ASP A 1 105 ? 58.453  12.437  25.594  1.00 49.21 ? 105 ASP A CA  1 
ATOM   828  C  C   . ASP A 1 105 ? 57.233  12.389  26.508  1.00 47.61 ? 105 ASP A C   1 
ATOM   829  O  O   . ASP A 1 105 ? 56.843  13.409  27.072  1.00 47.35 ? 105 ASP A O   1 
ATOM   830  C  CB  . ASP A 1 105 ? 58.044  13.099  24.274  1.00 49.82 ? 105 ASP A CB  1 
ATOM   831  C  CG  . ASP A 1 105 ? 59.220  13.357  23.360  1.00 51.66 ? 105 ASP A CG  1 
ATOM   832  O  OD1 . ASP A 1 105 ? 60.269  13.825  23.854  1.00 52.31 ? 105 ASP A OD1 1 
ATOM   833  O  OD2 . ASP A 1 105 ? 59.092  13.103  22.144  1.00 51.64 ? 105 ASP A OD2 1 
ATOM   834  N  N   . PHE A 1 106 ? 56.629  11.217  26.655  1.00 46.36 ? 106 PHE A N   1 
ATOM   835  C  CA  . PHE A 1 106 ? 55.445  11.087  27.498  1.00 46.41 ? 106 PHE A CA  1 
ATOM   836  C  C   . PHE A 1 106 ? 55.640  10.151  28.686  1.00 47.44 ? 106 PHE A C   1 
ATOM   837  O  O   . PHE A 1 106 ? 54.744  9.999   29.516  1.00 48.17 ? 106 PHE A O   1 
ATOM   838  C  CB  . PHE A 1 106 ? 54.255  10.611  26.657  1.00 43.88 ? 106 PHE A CB  1 
ATOM   839  C  CG  . PHE A 1 106 ? 53.799  11.611  25.635  1.00 42.41 ? 106 PHE A CG  1 
ATOM   840  C  CD1 . PHE A 1 106 ? 53.125  12.763  26.023  1.00 42.63 ? 106 PHE A CD1 1 
ATOM   841  C  CD2 . PHE A 1 106 ? 54.063  11.414  24.284  1.00 42.15 ? 106 PHE A CD2 1 
ATOM   842  C  CE1 . PHE A 1 106 ? 52.719  13.709  25.081  1.00 42.55 ? 106 PHE A CE1 1 
ATOM   843  C  CE2 . PHE A 1 106 ? 53.661  12.355  23.332  1.00 42.70 ? 106 PHE A CE2 1 
ATOM   844  C  CZ  . PHE A 1 106 ? 52.988  13.503  23.732  1.00 41.20 ? 106 PHE A CZ  1 
ATOM   845  N  N   . GLY A 1 107 ? 56.811  9.529   28.771  1.00 48.43 ? 107 GLY A N   1 
ATOM   846  C  CA  . GLY A 1 107 ? 57.077  8.620   29.872  1.00 49.01 ? 107 GLY A CA  1 
ATOM   847  C  C   . GLY A 1 107 ? 56.670  7.198   29.545  1.00 49.64 ? 107 GLY A C   1 
ATOM   848  O  O   . GLY A 1 107 ? 57.394  6.249   29.848  1.00 50.62 ? 107 GLY A O   1 
ATOM   849  N  N   . SER A 1 108 ? 55.504  7.045   28.927  1.00 48.79 ? 108 SER A N   1 
ATOM   850  C  CA  . SER A 1 108 ? 55.007  5.729   28.551  1.00 47.89 ? 108 SER A CA  1 
ATOM   851  C  C   . SER A 1 108 ? 53.875  5.877   27.545  1.00 47.33 ? 108 SER A C   1 
ATOM   852  O  O   . SER A 1 108 ? 53.333  6.966   27.365  1.00 46.18 ? 108 SER A O   1 
ATOM   853  C  CB  . SER A 1 108 ? 54.493  4.986   29.783  1.00 48.73 ? 108 SER A CB  1 
ATOM   854  O  OG  . SER A 1 108 ? 53.350  5.633   30.317  1.00 48.13 ? 108 SER A OG  1 
ATOM   855  N  N   . VAL A 1 109 ? 53.524  4.778   26.888  1.00 46.26 ? 109 VAL A N   1 
ATOM   856  C  CA  . VAL A 1 109 ? 52.450  4.798   25.909  1.00 46.74 ? 109 VAL A CA  1 
ATOM   857  C  C   . VAL A 1 109 ? 51.127  5.131   26.591  1.00 47.08 ? 109 VAL A C   1 
ATOM   858  O  O   . VAL A 1 109 ? 50.303  5.857   26.038  1.00 46.53 ? 109 VAL A O   1 
ATOM   859  C  CB  . VAL A 1 109 ? 52.321  3.439   25.197  1.00 46.31 ? 109 VAL A CB  1 
ATOM   860  C  CG1 . VAL A 1 109 ? 51.081  3.423   24.319  1.00 44.82 ? 109 VAL A CG1 1 
ATOM   861  C  CG2 . VAL A 1 109 ? 53.560  3.180   24.359  1.00 46.49 ? 109 VAL A CG2 1 
ATOM   862  N  N   . ASP A 1 110 ? 50.929  4.602   27.795  1.00 47.03 ? 110 ASP A N   1 
ATOM   863  C  CA  . ASP A 1 110 ? 49.699  4.856   28.535  1.00 47.44 ? 110 ASP A CA  1 
ATOM   864  C  C   . ASP A 1 110 ? 49.546  6.327   28.896  1.00 45.98 ? 110 ASP A C   1 
ATOM   865  O  O   . ASP A 1 110 ? 48.440  6.865   28.857  1.00 44.54 ? 110 ASP A O   1 
ATOM   866  C  CB  . ASP A 1 110 ? 49.644  4.006   29.804  1.00 50.30 ? 110 ASP A CB  1 
ATOM   867  C  CG  . ASP A 1 110 ? 49.508  2.527   29.505  1.00 53.20 ? 110 ASP A CG  1 
ATOM   868  O  OD1 . ASP A 1 110 ? 48.712  2.174   28.610  1.00 54.59 ? 110 ASP A OD1 1 
ATOM   869  O  OD2 . ASP A 1 110 ? 50.188  1.717   30.170  1.00 56.16 ? 110 ASP A OD2 1 
ATOM   870  N  N   . ASN A 1 111 ? 50.650  6.975   29.254  1.00 44.14 ? 111 ASN A N   1 
ATOM   871  C  CA  . ASN A 1 111 ? 50.599  8.390   29.596  1.00 43.54 ? 111 ASN A CA  1 
ATOM   872  C  C   . ASN A 1 111 ? 50.220  9.178   28.352  1.00 40.71 ? 111 ASN A C   1 
ATOM   873  O  O   . ASN A 1 111 ? 49.448  10.129  28.425  1.00 39.25 ? 111 ASN A O   1 
ATOM   874  C  CB  . ASN A 1 111 ? 51.947  8.886   30.123  1.00 46.48 ? 111 ASN A CB  1 
ATOM   875  C  CG  . ASN A 1 111 ? 52.280  8.327   31.490  1.00 50.27 ? 111 ASN A CG  1 
ATOM   876  O  OD1 . ASN A 1 111 ? 51.443  8.333   32.395  1.00 52.03 ? 111 ASN A OD1 1 
ATOM   877  N  ND2 . ASN A 1 111 ? 53.511  7.850   31.655  1.00 52.48 ? 111 ASN A ND2 1 
ATOM   878  N  N   . PHE A 1 112 ? 50.774  8.775   27.212  1.00 38.27 ? 112 PHE A N   1 
ATOM   879  C  CA  . PHE A 1 112 ? 50.477  9.431   25.946  1.00 36.83 ? 112 PHE A CA  1 
ATOM   880  C  C   . PHE A 1 112 ? 48.984  9.342   25.655  1.00 35.30 ? 112 PHE A C   1 
ATOM   881  O  O   . PHE A 1 112 ? 48.334  10.352  25.392  1.00 34.35 ? 112 PHE A O   1 
ATOM   882  C  CB  . PHE A 1 112 ? 51.240  8.763   24.801  1.00 35.23 ? 112 PHE A CB  1 
ATOM   883  C  CG  . PHE A 1 112 ? 50.656  9.048   23.445  1.00 34.26 ? 112 PHE A CG  1 
ATOM   884  C  CD1 . PHE A 1 112 ? 50.594  10.351  22.960  1.00 33.42 ? 112 PHE A CD1 1 
ATOM   885  C  CD2 . PHE A 1 112 ? 50.132  8.017   22.670  1.00 34.45 ? 112 PHE A CD2 1 
ATOM   886  C  CE1 . PHE A 1 112 ? 50.015  10.627  21.724  1.00 33.88 ? 112 PHE A CE1 1 
ATOM   887  C  CE2 . PHE A 1 112 ? 49.550  8.280   21.433  1.00 34.84 ? 112 PHE A CE2 1 
ATOM   888  C  CZ  . PHE A 1 112 ? 49.491  9.589   20.958  1.00 34.50 ? 112 PHE A CZ  1 
ATOM   889  N  N   . LYS A 1 113 ? 48.453  8.123   25.695  1.00 34.28 ? 113 LYS A N   1 
ATOM   890  C  CA  . LYS A 1 113 ? 47.036  7.901   25.432  1.00 35.25 ? 113 LYS A CA  1 
ATOM   891  C  C   . LYS A 1 113 ? 46.164  8.755   26.338  1.00 33.94 ? 113 LYS A C   1 
ATOM   892  O  O   . LYS A 1 113 ? 45.166  9.317   25.896  1.00 33.36 ? 113 LYS A O   1 
ATOM   893  C  CB  . LYS A 1 113 ? 46.675  6.423   25.613  1.00 35.62 ? 113 LYS A CB  1 
ATOM   894  C  CG  . LYS A 1 113 ? 47.274  5.510   24.553  1.00 38.64 ? 113 LYS A CG  1 
ATOM   895  C  CD  . LYS A 1 113 ? 46.709  4.100   24.634  1.00 41.00 ? 113 LYS A CD  1 
ATOM   896  C  CE  . LYS A 1 113 ? 47.276  3.223   23.524  1.00 43.39 ? 113 LYS A CE  1 
ATOM   897  N  NZ  . LYS A 1 113 ? 46.726  1.835   23.552  1.00 46.07 ? 113 LYS A NZ  1 
ATOM   898  N  N   . ALA A 1 114 ? 46.547  8.853   27.606  1.00 32.93 ? 114 ALA A N   1 
ATOM   899  C  CA  . ALA A 1 114 ? 45.788  9.642   28.568  1.00 32.71 ? 114 ALA A CA  1 
ATOM   900  C  C   . ALA A 1 114 ? 45.788  11.116  28.177  1.00 31.60 ? 114 ALA A C   1 
ATOM   901  O  O   . ALA A 1 114 ? 44.759  11.784  28.253  1.00 31.20 ? 114 ALA A O   1 
ATOM   902  C  CB  . ALA A 1 114 ? 46.371  9.470   29.968  1.00 32.78 ? 114 ALA A CB  1 
ATOM   903  N  N   . GLU A 1 115 ? 46.945  11.619  27.760  1.00 30.25 ? 115 GLU A N   1 
ATOM   904  C  CA  . GLU A 1 115 ? 47.063  13.015  27.359  1.00 30.05 ? 115 GLU A CA  1 
ATOM   905  C  C   . GLU A 1 115 ? 46.265  13.289  26.095  1.00 28.28 ? 115 GLU A C   1 
ATOM   906  O  O   . GLU A 1 115 ? 45.615  14.326  25.976  1.00 27.46 ? 115 GLU A O   1 
ATOM   907  C  CB  . GLU A 1 115 ? 48.525  13.386  27.116  1.00 33.38 ? 115 GLU A CB  1 
ATOM   908  C  CG  . GLU A 1 115 ? 49.307  13.668  28.383  1.00 38.95 ? 115 GLU A CG  1 
ATOM   909  C  CD  . GLU A 1 115 ? 48.710  14.812  29.180  1.00 41.94 ? 115 GLU A CD  1 
ATOM   910  O  OE1 . GLU A 1 115 ? 48.552  15.914  28.610  1.00 43.47 ? 115 GLU A OE1 1 
ATOM   911  O  OE2 . GLU A 1 115 ? 48.399  14.608  30.374  1.00 45.57 ? 115 GLU A OE2 1 
ATOM   912  N  N   . PHE A 1 116 ? 46.322  12.358  25.151  1.00 26.31 ? 116 PHE A N   1 
ATOM   913  C  CA  . PHE A 1 116 ? 45.598  12.511  23.896  1.00 27.36 ? 116 PHE A CA  1 
ATOM   914  C  C   . PHE A 1 116 ? 44.090  12.514  24.152  1.00 26.98 ? 116 PHE A C   1 
ATOM   915  O  O   . PHE A 1 116 ? 43.365  13.359  23.636  1.00 27.14 ? 116 PHE A O   1 
ATOM   916  C  CB  . PHE A 1 116 ? 45.946  11.367  22.946  1.00 24.74 ? 116 PHE A CB  1 
ATOM   917  C  CG  . PHE A 1 116 ? 45.463  11.585  21.549  1.00 24.76 ? 116 PHE A CG  1 
ATOM   918  C  CD1 . PHE A 1 116 ? 46.185  12.387  20.666  1.00 23.42 ? 116 PHE A CD1 1 
ATOM   919  C  CD2 . PHE A 1 116 ? 44.265  11.022  21.119  1.00 22.59 ? 116 PHE A CD2 1 
ATOM   920  C  CE1 . PHE A 1 116 ? 45.720  12.626  19.374  1.00 24.61 ? 116 PHE A CE1 1 
ATOM   921  C  CE2 . PHE A 1 116 ? 43.789  11.256  19.826  1.00 23.46 ? 116 PHE A CE2 1 
ATOM   922  C  CZ  . PHE A 1 116 ? 44.516  12.058  18.953  1.00 23.93 ? 116 PHE A CZ  1 
ATOM   923  N  N   . GLU A 1 117 ? 43.623  11.558  24.948  1.00 26.96 ? 117 GLU A N   1 
ATOM   924  C  CA  . GLU A 1 117 ? 42.199  11.463  25.257  1.00 28.36 ? 117 GLU A CA  1 
ATOM   925  C  C   . GLU A 1 117 ? 41.694  12.722  25.954  1.00 27.23 ? 117 GLU A C   1 
ATOM   926  O  O   . GLU A 1 117 ? 40.584  13.183  25.693  1.00 27.43 ? 117 GLU A O   1 
ATOM   927  C  CB  . GLU A 1 117 ? 41.927  10.234  26.131  1.00 28.93 ? 117 GLU A CB  1 
ATOM   928  C  CG  . GLU A 1 117 ? 42.111  8.916   25.396  1.00 33.04 ? 117 GLU A CG  1 
ATOM   929  C  CD  . GLU A 1 117 ? 41.842  7.709   26.275  1.00 38.98 ? 117 GLU A CD  1 
ATOM   930  O  OE1 . GLU A 1 117 ? 40.931  7.785   27.130  1.00 40.33 ? 117 GLU A OE1 1 
ATOM   931  O  OE2 . GLU A 1 117 ? 42.528  6.678   26.097  1.00 38.44 ? 117 GLU A OE2 1 
ATOM   932  N  N   . LYS A 1 118 ? 42.513  13.279  26.838  1.00 28.09 ? 118 LYS A N   1 
ATOM   933  C  CA  . LYS A 1 118 ? 42.132  14.482  27.559  1.00 29.31 ? 118 LYS A CA  1 
ATOM   934  C  C   . LYS A 1 118 ? 41.978  15.652  26.593  1.00 28.14 ? 118 LYS A C   1 
ATOM   935  O  O   . LYS A 1 118 ? 41.024  16.430  26.690  1.00 27.00 ? 118 LYS A O   1 
ATOM   936  C  CB  . LYS A 1 118 ? 43.175  14.815  28.632  1.00 34.34 ? 118 LYS A CB  1 
ATOM   937  C  CG  . LYS A 1 118 ? 42.797  16.015  29.489  1.00 40.59 ? 118 LYS A CG  1 
ATOM   938  C  CD  . LYS A 1 118 ? 43.795  16.254  30.625  1.00 46.32 ? 118 LYS A CD  1 
ATOM   939  C  CE  . LYS A 1 118 ? 45.176  16.653  30.109  1.00 49.37 ? 118 LYS A CE  1 
ATOM   940  N  NZ  . LYS A 1 118 ? 46.136  16.937  31.223  1.00 52.08 ? 118 LYS A NZ  1 
ATOM   941  N  N   . ALA A 1 119 ? 42.910  15.772  25.652  1.00 26.85 ? 119 ALA A N   1 
ATOM   942  C  CA  . ALA A 1 119 ? 42.851  16.853  24.677  1.00 25.98 ? 119 ALA A CA  1 
ATOM   943  C  C   . ALA A 1 119 ? 41.651  16.677  23.750  1.00 23.61 ? 119 ALA A C   1 
ATOM   944  O  O   . ALA A 1 119 ? 40.959  17.638  23.435  1.00 23.52 ? 119 ALA A O   1 
ATOM   945  C  CB  . ALA A 1 119 ? 44.144  16.902  23.864  1.00 25.73 ? 119 ALA A CB  1 
ATOM   946  N  N   . ALA A 1 120 ? 41.404  15.445  23.324  1.00 21.93 ? 120 ALA A N   1 
ATOM   947  C  CA  . ALA A 1 120 ? 40.287  15.164  22.426  1.00 22.94 ? 120 ALA A CA  1 
ATOM   948  C  C   . ALA A 1 120 ? 38.937  15.385  23.105  1.00 23.37 ? 120 ALA A C   1 
ATOM   949  O  O   . ALA A 1 120 ? 38.002  15.904  22.497  1.00 23.93 ? 120 ALA A O   1 
ATOM   950  C  CB  . ALA A 1 120 ? 40.388  13.724  21.907  1.00 20.23 ? 120 ALA A CB  1 
ATOM   951  N  N   . ALA A 1 121 ? 38.840  15.000  24.370  1.00 23.80 ? 121 ALA A N   1 
ATOM   952  C  CA  . ALA A 1 121 ? 37.590  15.155  25.103  1.00 27.07 ? 121 ALA A CA  1 
ATOM   953  C  C   . ALA A 1 121 ? 37.319  16.582  25.564  1.00 27.53 ? 121 ALA A C   1 
ATOM   954  O  O   . ALA A 1 121 ? 36.161  16.979  25.700  1.00 29.01 ? 121 ALA A O   1 
ATOM   955  C  CB  . ALA A 1 121 ? 37.574  14.211  26.305  1.00 27.19 ? 121 ALA A CB  1 
ATOM   956  N  N   A SER A 1 122 ? 38.379  17.357  25.790  0.50 27.22 ? 122 SER A N   1 
ATOM   957  N  N   B SER A 1 122 ? 38.384  17.351  25.783  0.50 27.61 ? 122 SER A N   1 
ATOM   958  C  CA  A SER A 1 122 ? 38.225  18.733  26.260  0.50 26.63 ? 122 SER A CA  1 
ATOM   959  C  CA  B SER A 1 122 ? 38.259  18.730  26.255  0.50 27.40 ? 122 SER A CA  1 
ATOM   960  C  C   A SER A 1 122 ? 37.983  19.774  25.165  0.50 26.95 ? 122 SER A C   1 
ATOM   961  C  C   B SER A 1 122 ? 38.000  19.773  25.167  0.50 27.37 ? 122 SER A C   1 
ATOM   962  O  O   A SER A 1 122 ? 37.607  20.909  25.466  0.50 27.43 ? 122 SER A O   1 
ATOM   963  O  O   B SER A 1 122 ? 37.626  20.907  25.474  0.50 27.80 ? 122 SER A O   1 
ATOM   964  C  CB  A SER A 1 122 ? 39.441  19.149  27.098  0.50 26.43 ? 122 SER A CB  1 
ATOM   965  C  CB  B SER A 1 122 ? 39.513  19.128  27.041  0.50 27.83 ? 122 SER A CB  1 
ATOM   966  O  OG  A SER A 1 122 ? 40.631  19.136  26.330  0.50 24.65 ? 122 SER A OG  1 
ATOM   967  O  OG  B SER A 1 122 ? 39.718  18.265  28.145  0.50 28.05 ? 122 SER A OG  1 
ATOM   968  N  N   . ARG A 1 123 ? 38.204  19.402  23.906  1.00 25.13 ? 123 ARG A N   1 
ATOM   969  C  CA  . ARG A 1 123 ? 37.979  20.333  22.798  1.00 23.74 ? 123 ARG A CA  1 
ATOM   970  C  C   . ARG A 1 123 ? 36.485  20.620  22.749  1.00 23.70 ? 123 ARG A C   1 
ATOM   971  O  O   . ARG A 1 123 ? 35.684  19.749  22.397  1.00 24.05 ? 123 ARG A O   1 
ATOM   972  C  CB  . ARG A 1 123 ? 38.466  19.730  21.471  1.00 24.73 ? 123 ARG A CB  1 
ATOM   973  C  CG  . ARG A 1 123 ? 37.989  20.444  20.200  1.00 24.64 ? 123 ARG A CG  1 
ATOM   974  C  CD  . ARG A 1 123 ? 38.204  21.962  20.228  1.00 25.67 ? 123 ARG A CD  1 
ATOM   975  N  NE  . ARG A 1 123 ? 39.602  22.345  20.396  1.00 25.59 ? 123 ARG A NE  1 
ATOM   976  C  CZ  . ARG A 1 123 ? 40.035  23.604  20.408  1.00 26.34 ? 123 ARG A CZ  1 
ATOM   977  N  NH1 . ARG A 1 123 ? 39.179  24.608  20.259  1.00 27.06 ? 123 ARG A NH1 1 
ATOM   978  N  NH2 . ARG A 1 123 ? 41.322  23.862  20.580  1.00 25.09 ? 123 ARG A NH2 1 
ATOM   979  N  N   . PHE A 1 124 ? 36.119  21.843  23.123  1.00 21.69 ? 124 PHE A N   1 
ATOM   980  C  CA  . PHE A 1 124 ? 34.724  22.266  23.163  1.00 21.70 ? 124 PHE A CA  1 
ATOM   981  C  C   . PHE A 1 124 ? 34.247  22.696  21.786  1.00 21.47 ? 124 PHE A C   1 
ATOM   982  O  O   . PHE A 1 124 ? 34.884  23.518  21.126  1.00 21.69 ? 124 PHE A O   1 
ATOM   983  C  CB  . PHE A 1 124 ? 34.561  23.428  24.146  1.00 23.41 ? 124 PHE A CB  1 
ATOM   984  C  CG  . PHE A 1 124 ? 33.131  23.782  24.426  1.00 25.48 ? 124 PHE A CG  1 
ATOM   985  C  CD1 . PHE A 1 124 ? 32.325  22.926  25.166  1.00 28.57 ? 124 PHE A CD1 1 
ATOM   986  C  CD2 . PHE A 1 124 ? 32.579  24.952  23.920  1.00 28.70 ? 124 PHE A CD2 1 
ATOM   987  C  CE1 . PHE A 1 124 ? 30.980  23.232  25.396  1.00 30.56 ? 124 PHE A CE1 1 
ATOM   988  C  CE2 . PHE A 1 124 ? 31.242  25.266  24.143  1.00 29.41 ? 124 PHE A CE2 1 
ATOM   989  C  CZ  . PHE A 1 124 ? 30.443  24.402  24.881  1.00 28.49 ? 124 PHE A CZ  1 
ATOM   990  N  N   . GLY A 1 125 ? 33.115  22.158  21.351  1.00 18.93 ? 125 GLY A N   1 
ATOM   991  C  CA  . GLY A 1 125 ? 32.621  22.510  20.033  1.00 16.54 ? 125 GLY A CA  1 
ATOM   992  C  C   . GLY A 1 125 ? 33.271  21.610  18.999  1.00 17.12 ? 125 GLY A C   1 
ATOM   993  O  O   . GLY A 1 125 ? 33.705  20.512  19.332  1.00 18.26 ? 125 GLY A O   1 
ATOM   994  N  N   . SER A 1 126 ? 33.344  22.062  17.751  1.00 17.81 ? 126 SER A N   1 
ATOM   995  C  CA  . SER A 1 126 ? 33.938  21.254  16.693  1.00 15.07 ? 126 SER A CA  1 
ATOM   996  C  C   . SER A 1 126 ? 35.447  21.440  16.682  1.00 16.59 ? 126 SER A C   1 
ATOM   997  O  O   . SER A 1 126 ? 35.944  22.542  16.915  1.00 14.76 ? 126 SER A O   1 
ATOM   998  C  CB  . SER A 1 126 ? 33.351  21.655  15.340  1.00 14.01 ? 126 SER A CB  1 
ATOM   999  O  OG  . SER A 1 126 ? 31.931  21.612  15.370  1.00 18.47 ? 126 SER A OG  1 
ATOM   1000 N  N   . GLY A 1 127 ? 36.177  20.367  16.402  1.00 16.38 ? 127 GLY A N   1 
ATOM   1001 C  CA  . GLY A 1 127 ? 37.621  20.465  16.382  1.00 15.12 ? 127 GLY A CA  1 
ATOM   1002 C  C   . GLY A 1 127 ? 38.343  19.175  16.056  1.00 16.79 ? 127 GLY A C   1 
ATOM   1003 O  O   . GLY A 1 127 ? 37.727  18.170  15.679  1.00 15.36 ? 127 GLY A O   1 
ATOM   1004 N  N   A TRP A 1 128 ? 39.664  19.208  16.202  0.50 15.10 ? 128 TRP A N   1 
ATOM   1005 N  N   B TRP A 1 128 ? 39.660  19.206  16.226  0.50 14.94 ? 128 TRP A N   1 
ATOM   1006 C  CA  A TRP A 1 128 ? 40.517  18.057  15.936  0.50 15.08 ? 128 TRP A CA  1 
ATOM   1007 C  CA  B TRP A 1 128 ? 40.521  18.070  15.928  0.50 14.81 ? 128 TRP A CA  1 
ATOM   1008 C  C   A TRP A 1 128 ? 41.581  17.953  17.022  0.50 15.80 ? 128 TRP A C   1 
ATOM   1009 C  C   B TRP A 1 128 ? 41.591  17.956  17.012  0.50 15.64 ? 128 TRP A C   1 
ATOM   1010 O  O   A TRP A 1 128 ? 41.987  18.961  17.599  0.50 15.33 ? 128 TRP A O   1 
ATOM   1011 O  O   B TRP A 1 128 ? 42.012  18.963  17.578  0.50 15.25 ? 128 TRP A O   1 
ATOM   1012 C  CB  A TRP A 1 128 ? 41.205  18.205  14.575  0.50 17.08 ? 128 TRP A CB  1 
ATOM   1013 C  CB  B TRP A 1 128 ? 41.180  18.311  14.570  0.50 16.40 ? 128 TRP A CB  1 
ATOM   1014 C  CG  A TRP A 1 128 ? 40.306  17.972  13.400  0.50 16.89 ? 128 TRP A CG  1 
ATOM   1015 C  CG  B TRP A 1 128 ? 41.465  17.088  13.770  0.50 15.60 ? 128 TRP A CG  1 
ATOM   1016 C  CD1 A TRP A 1 128 ? 39.221  18.713  13.033  0.50 18.69 ? 128 TRP A CD1 1 
ATOM   1017 C  CD1 B TRP A 1 128 ? 42.489  16.206  13.947  0.50 16.81 ? 128 TRP A CD1 1 
ATOM   1018 C  CD2 A TRP A 1 128 ? 40.407  16.909  12.448  0.50 17.00 ? 128 TRP A CD2 1 
ATOM   1019 C  CD2 B TRP A 1 128 ? 40.735  16.632  12.627  0.50 16.26 ? 128 TRP A CD2 1 
ATOM   1020 N  NE1 A TRP A 1 128 ? 38.637  18.176  11.910  0.50 18.38 ? 128 TRP A NE1 1 
ATOM   1021 N  NE1 B TRP A 1 128 ? 42.448  15.231  12.977  0.50 17.59 ? 128 TRP A NE1 1 
ATOM   1022 C  CE2 A TRP A 1 128 ? 39.346  17.067  11.530  0.50 17.48 ? 128 TRP A CE2 1 
ATOM   1023 C  CE2 B TRP A 1 128 ? 41.379  15.469  12.155  0.50 16.54 ? 128 TRP A CE2 1 
ATOM   1024 C  CE3 A TRP A 1 128 ? 41.294  15.836  12.280  0.50 17.73 ? 128 TRP A CE3 1 
ATOM   1025 C  CE3 B TRP A 1 128 ? 39.598  17.096  11.954  0.50 15.29 ? 128 TRP A CE3 1 
ATOM   1026 C  CZ2 A TRP A 1 128 ? 39.146  16.192  10.461  0.50 16.94 ? 128 TRP A CZ2 1 
ATOM   1027 C  CZ2 B TRP A 1 128 ? 40.924  14.763  11.038  0.50 18.23 ? 128 TRP A CZ2 1 
ATOM   1028 C  CZ3 A TRP A 1 128 ? 41.095  14.968  11.216  0.50 18.34 ? 128 TRP A CZ3 1 
ATOM   1029 C  CZ3 B TRP A 1 128 ? 39.145  16.393  10.845  0.50 15.08 ? 128 TRP A CZ3 1 
ATOM   1030 C  CH2 A TRP A 1 128 ? 40.027  15.152  10.319  0.50 17.55 ? 128 TRP A CH2 1 
ATOM   1031 C  CH2 B TRP A 1 128 ? 39.808  15.239  10.398  0.50 15.72 ? 128 TRP A CH2 1 
ATOM   1032 N  N   . ALA A 1 129 ? 42.022  16.732  17.302  1.00 16.35 ? 129 ALA A N   1 
ATOM   1033 C  CA  . ALA A 1 129 ? 43.057  16.501  18.313  1.00 18.63 ? 129 ALA A CA  1 
ATOM   1034 C  C   . ALA A 1 129 ? 44.257  15.956  17.547  1.00 19.49 ? 129 ALA A C   1 
ATOM   1035 O  O   . ALA A 1 129 ? 44.093  15.116  16.660  1.00 19.40 ? 129 ALA A O   1 
ATOM   1036 C  CB  . ALA A 1 129 ? 42.589  15.482  19.342  1.00 20.24 ? 129 ALA A CB  1 
ATOM   1037 N  N   . TRP A 1 130 ? 45.457  16.411  17.897  1.00 20.06 ? 130 TRP A N   1 
ATOM   1038 C  CA  . TRP A 1 130 ? 46.652  15.986  17.175  1.00 20.84 ? 130 TRP A CA  1 
ATOM   1039 C  C   . TRP A 1 130 ? 47.856  15.548  18.000  1.00 23.18 ? 130 TRP A C   1 
ATOM   1040 O  O   . TRP A 1 130 ? 48.029  15.952  19.149  1.00 25.33 ? 130 TRP A O   1 
ATOM   1041 C  CB  . TRP A 1 130 ? 47.169  17.126  16.286  1.00 19.37 ? 130 TRP A CB  1 
ATOM   1042 C  CG  . TRP A 1 130 ? 46.169  17.840  15.441  1.00 18.74 ? 130 TRP A CG  1 
ATOM   1043 C  CD1 . TRP A 1 130 ? 45.382  18.898  15.805  1.00 18.95 ? 130 TRP A CD1 1 
ATOM   1044 C  CD2 . TRP A 1 130 ? 45.873  17.571  14.070  1.00 18.98 ? 130 TRP A CD2 1 
ATOM   1045 N  NE1 . TRP A 1 130 ? 44.614  19.305  14.736  1.00 18.28 ? 130 TRP A NE1 1 
ATOM   1046 C  CE2 . TRP A 1 130 ? 44.895  18.505  13.660  1.00 17.23 ? 130 TRP A CE2 1 
ATOM   1047 C  CE3 . TRP A 1 130 ? 46.343  16.628  13.142  1.00 20.46 ? 130 TRP A CE3 1 
ATOM   1048 C  CZ2 . TRP A 1 130 ? 44.375  18.523  12.362  1.00 18.48 ? 130 TRP A CZ2 1 
ATOM   1049 C  CZ3 . TRP A 1 130 ? 45.826  16.647  11.850  1.00 22.15 ? 130 TRP A CZ3 1 
ATOM   1050 C  CH2 . TRP A 1 130 ? 44.850  17.592  11.475  1.00 20.14 ? 130 TRP A CH2 1 
ATOM   1051 N  N   . LEU A 1 131 ? 48.683  14.719  17.373  1.00 23.00 ? 131 LEU A N   1 
ATOM   1052 C  CA  . LEU A 1 131 ? 49.955  14.301  17.933  1.00 23.11 ? 131 LEU A CA  1 
ATOM   1053 C  C   . LEU A 1 131 ? 50.867  14.981  16.913  1.00 23.55 ? 131 LEU A C   1 
ATOM   1054 O  O   . LEU A 1 131 ? 50.860  14.619  15.736  1.00 22.79 ? 131 LEU A O   1 
ATOM   1055 C  CB  . LEU A 1 131 ? 50.168  12.787  17.862  1.00 23.23 ? 131 LEU A CB  1 
ATOM   1056 C  CG  . LEU A 1 131 ? 51.614  12.405  18.228  1.00 23.71 ? 131 LEU A CG  1 
ATOM   1057 C  CD1 . LEU A 1 131 ? 51.903  12.835  19.658  1.00 23.48 ? 131 LEU A CD1 1 
ATOM   1058 C  CD2 . LEU A 1 131 ? 51.829  10.914  18.068  1.00 23.78 ? 131 LEU A CD2 1 
ATOM   1059 N  N   . VAL A 1 132 ? 51.607  15.994  17.342  1.00 24.37 ? 132 VAL A N   1 
ATOM   1060 C  CA  . VAL A 1 132 ? 52.491  16.705  16.426  1.00 26.76 ? 132 VAL A CA  1 
ATOM   1061 C  C   . VAL A 1 132 ? 53.955  16.595  16.829  1.00 28.72 ? 132 VAL A C   1 
ATOM   1062 O  O   . VAL A 1 132 ? 54.285  16.229  17.959  1.00 28.18 ? 132 VAL A O   1 
ATOM   1063 C  CB  . VAL A 1 132 ? 52.155  18.219  16.336  1.00 25.32 ? 132 VAL A CB  1 
ATOM   1064 C  CG1 . VAL A 1 132 ? 50.729  18.421  15.825  1.00 25.88 ? 132 VAL A CG1 1 
ATOM   1065 C  CG2 . VAL A 1 132 ? 52.351  18.875  17.692  1.00 24.38 ? 132 VAL A CG2 1 
ATOM   1066 N  N   . LEU A 1 133 ? 54.823  16.920  15.883  1.00 30.01 ? 133 LEU A N   1 
ATOM   1067 C  CA  . LEU A 1 133 ? 56.257  16.893  16.110  1.00 32.98 ? 133 LEU A CA  1 
ATOM   1068 C  C   . LEU A 1 133 ? 56.739  18.329  16.009  1.00 34.15 ? 133 LEU A C   1 
ATOM   1069 O  O   . LEU A 1 133 ? 56.688  18.928  14.936  1.00 32.86 ? 133 LEU A O   1 
ATOM   1070 C  CB  . LEU A 1 133 ? 56.935  16.031  15.043  1.00 32.24 ? 133 LEU A CB  1 
ATOM   1071 C  CG  . LEU A 1 133 ? 58.453  15.843  15.112  1.00 31.86 ? 133 LEU A CG  1 
ATOM   1072 C  CD1 . LEU A 1 133 ? 58.854  15.326  16.484  1.00 31.58 ? 133 LEU A CD1 1 
ATOM   1073 C  CD2 . LEU A 1 133 ? 58.882  14.869  14.022  1.00 30.75 ? 133 LEU A CD2 1 
ATOM   1074 N  N   . LYS A 1 134 ? 57.155  18.901  17.133  1.00 37.39 ? 134 LYS A N   1 
ATOM   1075 C  CA  . LYS A 1 134 ? 57.665  20.259  17.112  1.00 40.58 ? 134 LYS A CA  1 
ATOM   1076 C  C   . LYS A 1 134 ? 59.138  20.238  17.512  1.00 41.14 ? 134 LYS A C   1 
ATOM   1077 O  O   . LYS A 1 134 ? 59.487  19.800  18.594  1.00 39.64 ? 134 LYS A O   1 
ATOM   1078 C  CB  . LYS A 1 134 ? 56.866  21.180  18.033  1.00 42.83 ? 134 LYS A CB  1 
ATOM   1079 C  CG  . LYS A 1 134 ? 57.122  22.647  17.713  1.00 49.17 ? 134 LYS A CG  1 
ATOM   1080 C  CD  . LYS A 1 134 ? 56.183  23.582  18.446  1.00 52.43 ? 134 LYS A CD  1 
ATOM   1081 C  CE  . LYS A 1 134 ? 56.482  25.028  18.071  1.00 55.02 ? 134 LYS A CE  1 
ATOM   1082 N  NZ  . LYS A 1 134 ? 55.571  25.992  18.759  1.00 57.64 ? 134 LYS A NZ  1 
ATOM   1083 N  N   . GLY A 1 135 ? 60.021  20.730  16.658  1.00 41.64 ? 135 GLY A N   1 
ATOM   1084 C  CA  . GLY A 1 135 ? 61.428  20.737  17.021  1.00 43.52 ? 135 GLY A CA  1 
ATOM   1085 C  C   . GLY A 1 135 ? 61.949  19.491  17.728  1.00 43.96 ? 135 GLY A C   1 
ATOM   1086 O  O   . GLY A 1 135 ? 62.460  19.574  18.844  1.00 44.09 ? 135 GLY A O   1 
ATOM   1087 N  N   . ASP A 1 136 ? 61.803  18.337  17.081  1.00 45.33 ? 136 ASP A N   1 
ATOM   1088 C  CA  . ASP A 1 136 ? 62.277  17.048  17.598  1.00 47.07 ? 136 ASP A CA  1 
ATOM   1089 C  C   . ASP A 1 136 ? 61.541  16.418  18.790  1.00 46.87 ? 136 ASP A C   1 
ATOM   1090 O  O   . ASP A 1 136 ? 61.888  15.313  19.214  1.00 46.22 ? 136 ASP A O   1 
ATOM   1091 C  CB  . ASP A 1 136 ? 63.772  17.138  17.912  1.00 50.18 ? 136 ASP A CB  1 
ATOM   1092 C  CG  . ASP A 1 136 ? 64.577  17.670  16.740  1.00 52.43 ? 136 ASP A CG  1 
ATOM   1093 O  OD1 . ASP A 1 136 ? 64.421  17.135  15.619  1.00 53.74 ? 136 ASP A OD1 1 
ATOM   1094 O  OD2 . ASP A 1 136 ? 65.363  18.621  16.943  1.00 54.02 ? 136 ASP A OD2 1 
ATOM   1095 N  N   . LYS A 1 137 ? 60.544  17.111  19.332  1.00 45.16 ? 137 LYS A N   1 
ATOM   1096 C  CA  . LYS A 1 137 ? 59.756  16.584  20.445  1.00 43.87 ? 137 LYS A CA  1 
ATOM   1097 C  C   . LYS A 1 137 ? 58.296  16.393  20.030  1.00 40.85 ? 137 LYS A C   1 
ATOM   1098 O  O   . LYS A 1 137 ? 57.753  17.181  19.261  1.00 39.58 ? 137 LYS A O   1 
ATOM   1099 C  CB  . LYS A 1 137 ? 59.805  17.532  21.646  1.00 46.27 ? 137 LYS A CB  1 
ATOM   1100 C  CG  . LYS A 1 137 ? 61.175  17.684  22.287  1.00 51.44 ? 137 LYS A CG  1 
ATOM   1101 C  CD  . LYS A 1 137 ? 61.113  18.648  23.467  1.00 53.68 ? 137 LYS A CD  1 
ATOM   1102 C  CE  . LYS A 1 137 ? 62.493  18.899  24.061  1.00 56.42 ? 137 LYS A CE  1 
ATOM   1103 N  NZ  . LYS A 1 137 ? 62.430  19.862  25.201  1.00 58.00 ? 137 LYS A NZ  1 
ATOM   1104 N  N   . LEU A 1 138 ? 57.671  15.341  20.544  1.00 37.44 ? 138 LEU A N   1 
ATOM   1105 C  CA  . LEU A 1 138 ? 56.271  15.061  20.245  1.00 34.89 ? 138 LEU A CA  1 
ATOM   1106 C  C   . LEU A 1 138 ? 55.393  15.805  21.242  1.00 33.73 ? 138 LEU A C   1 
ATOM   1107 O  O   . LEU A 1 138 ? 55.776  15.997  22.394  1.00 33.46 ? 138 LEU A O   1 
ATOM   1108 C  CB  . LEU A 1 138 ? 55.997  13.563  20.340  1.00 32.81 ? 138 LEU A CB  1 
ATOM   1109 C  CG  . LEU A 1 138 ? 56.614  12.711  19.233  1.00 31.14 ? 138 LEU A CG  1 
ATOM   1110 C  CD1 . LEU A 1 138 ? 56.480  11.239  19.587  1.00 30.46 ? 138 LEU A CD1 1 
ATOM   1111 C  CD2 . LEU A 1 138 ? 55.933  13.029  17.905  1.00 30.20 ? 138 LEU A CD2 1 
ATOM   1112 N  N   . ALA A 1 139 ? 54.218  16.232  20.796  1.00 30.96 ? 139 ALA A N   1 
ATOM   1113 C  CA  . ALA A 1 139 ? 53.301  16.948  21.668  1.00 29.93 ? 139 ALA A CA  1 
ATOM   1114 C  C   . ALA A 1 139 ? 51.855  16.732  21.235  1.00 28.97 ? 139 ALA A C   1 
ATOM   1115 O  O   . ALA A 1 139 ? 51.585  16.393  20.085  1.00 28.61 ? 139 ALA A O   1 
ATOM   1116 C  CB  . ALA A 1 139 ? 53.629  18.436  21.661  1.00 28.02 ? 139 ALA A CB  1 
ATOM   1117 N  N   . VAL A 1 140 ? 50.933  16.925  22.170  1.00 28.68 ? 140 VAL A N   1 
ATOM   1118 C  CA  . VAL A 1 140 ? 49.515  16.778  21.881  1.00 28.16 ? 140 VAL A CA  1 
ATOM   1119 C  C   . VAL A 1 140 ? 48.880  18.157  21.898  1.00 27.62 ? 140 VAL A C   1 
ATOM   1120 O  O   . VAL A 1 140 ? 49.075  18.928  22.839  1.00 28.46 ? 140 VAL A O   1 
ATOM   1121 C  CB  . VAL A 1 140 ? 48.806  15.881  22.920  1.00 29.14 ? 140 VAL A CB  1 
ATOM   1122 C  CG1 . VAL A 1 140 ? 47.297  15.954  22.723  1.00 29.83 ? 140 VAL A CG1 1 
ATOM   1123 C  CG2 . VAL A 1 140 ? 49.280  14.447  22.773  1.00 28.16 ? 140 VAL A CG2 1 
ATOM   1124 N  N   . VAL A 1 141 ? 48.140  18.476  20.841  1.00 25.15 ? 141 VAL A N   1 
ATOM   1125 C  CA  . VAL A 1 141 ? 47.461  19.762  20.735  1.00 25.21 ? 141 VAL A CA  1 
ATOM   1126 C  C   . VAL A 1 141 ? 46.102  19.539  20.083  1.00 24.33 ? 141 VAL A C   1 
ATOM   1127 O  O   . VAL A 1 141 ? 45.822  18.454  19.577  1.00 23.33 ? 141 VAL A O   1 
ATOM   1128 C  CB  . VAL A 1 141 ? 48.262  20.767  19.862  1.00 25.81 ? 141 VAL A CB  1 
ATOM   1129 C  CG1 . VAL A 1 141 ? 49.574  21.109  20.528  1.00 29.97 ? 141 VAL A CG1 1 
ATOM   1130 C  CG2 . VAL A 1 141 ? 48.513  20.174  18.480  1.00 27.20 ? 141 VAL A CG2 1 
ATOM   1131 N  N   . SER A 1 142 ? 45.252  20.557  20.115  1.00 23.30 ? 142 SER A N   1 
ATOM   1132 C  CA  . SER A 1 142 ? 43.939  20.455  19.485  1.00 22.51 ? 142 SER A CA  1 
ATOM   1133 C  C   . SER A 1 142 ? 43.666  21.772  18.788  1.00 22.71 ? 142 SER A C   1 
ATOM   1134 O  O   . SER A 1 142 ? 44.213  22.812  19.171  1.00 23.19 ? 142 SER A O   1 
ATOM   1135 C  CB  . SER A 1 142 ? 42.847  20.179  20.520  1.00 22.76 ? 142 SER A CB  1 
ATOM   1136 O  OG  . SER A 1 142 ? 42.689  21.282  21.389  1.00 28.61 ? 142 SER A OG  1 
ATOM   1137 N  N   . THR A 1 143 ? 42.832  21.724  17.758  1.00 20.02 ? 143 THR A N   1 
ATOM   1138 C  CA  . THR A 1 143 ? 42.482  22.909  16.996  1.00 18.20 ? 143 THR A CA  1 
ATOM   1139 C  C   . THR A 1 143 ? 40.969  22.999  16.853  1.00 18.82 ? 143 THR A C   1 
ATOM   1140 O  O   . THR A 1 143 ? 40.266  21.997  16.993  1.00 16.61 ? 143 THR A O   1 
ATOM   1141 C  CB  . THR A 1 143 ? 43.107  22.864  15.586  1.00 18.54 ? 143 THR A CB  1 
ATOM   1142 O  OG1 . THR A 1 143 ? 42.809  21.603  14.970  1.00 18.47 ? 143 THR A OG1 1 
ATOM   1143 C  CG2 . THR A 1 143 ? 44.619  23.045  15.666  1.00 18.14 ? 143 THR A CG2 1 
ATOM   1144 N  N   . ALA A 1 144 ? 40.484  24.202  16.567  1.00 17.68 ? 144 ALA A N   1 
ATOM   1145 C  CA  . ALA A 1 144 ? 39.060  24.446  16.398  1.00 19.41 ? 144 ALA A CA  1 
ATOM   1146 C  C   . ALA A 1 144 ? 38.626  24.201  14.969  1.00 19.15 ? 144 ALA A C   1 
ATOM   1147 O  O   . ALA A 1 144 ? 39.416  24.327  14.035  1.00 19.05 ? 144 ALA A O   1 
ATOM   1148 C  CB  . ALA A 1 144 ? 38.722  25.882  16.784  1.00 19.23 ? 144 ALA A CB  1 
ATOM   1149 N  N   . ASN A 1 145 ? 37.351  23.861  14.813  1.00 18.25 ? 145 ASN A N   1 
ATOM   1150 C  CA  . ASN A 1 145 ? 36.767  23.623  13.515  1.00 16.35 ? 145 ASN A CA  1 
ATOM   1151 C  C   . ASN A 1 145 ? 37.673  22.823  12.602  1.00 15.53 ? 145 ASN A C   1 
ATOM   1152 O  O   . ASN A 1 145 ? 38.038  21.704  12.947  1.00 14.24 ? 145 ASN A O   1 
ATOM   1153 C  CB  . ASN A 1 145 ? 36.374  24.970  12.918  1.00 17.80 ? 145 ASN A CB  1 
ATOM   1154 C  CG  . ASN A 1 145 ? 35.440  25.737  13.848  1.00 22.06 ? 145 ASN A CG  1 
ATOM   1155 O  OD1 . ASN A 1 145 ? 34.531  25.148  14.437  1.00 20.60 ? 145 ASN A OD1 1 
ATOM   1156 N  ND2 . ASN A 1 145 ? 35.661  27.041  13.990  1.00 22.38 ? 145 ASN A ND2 1 
ATOM   1157 N  N   . LEU A 1 146 ? 38.033  23.365  11.442  1.00 15.33 ? 146 LEU A N   1 
ATOM   1158 C  CA  . LEU A 1 146 ? 38.903  22.609  10.547  1.00 15.40 ? 146 LEU A CA  1 
ATOM   1159 C  C   . LEU A 1 146 ? 40.284  23.221  10.363  1.00 17.13 ? 146 LEU A C   1 
ATOM   1160 O  O   . LEU A 1 146 ? 40.908  23.071  9.312   1.00 16.93 ? 146 LEU A O   1 
ATOM   1161 C  CB  . LEU A 1 146 ? 38.216  22.389  9.193   1.00 15.32 ? 146 LEU A CB  1 
ATOM   1162 C  CG  . LEU A 1 146 ? 37.035  21.403  9.325   1.00 19.07 ? 146 LEU A CG  1 
ATOM   1163 C  CD1 . LEU A 1 146 ? 36.269  21.301  8.026   1.00 19.06 ? 146 LEU A CD1 1 
ATOM   1164 C  CD2 . LEU A 1 146 ? 37.562  20.038  9.743   1.00 17.56 ? 146 LEU A CD2 1 
ATOM   1165 N  N   . ASP A 1 147 ? 40.764  23.910  11.393  1.00 17.91 ? 147 ASP A N   1 
ATOM   1166 C  CA  . ASP A 1 147 ? 42.100  24.487  11.333  1.00 18.50 ? 147 ASP A CA  1 
ATOM   1167 C  C   . ASP A 1 147 ? 43.095  23.340  11.389  1.00 19.62 ? 147 ASP A C   1 
ATOM   1168 O  O   . ASP A 1 147 ? 42.730  22.200  11.710  1.00 18.97 ? 147 ASP A O   1 
ATOM   1169 C  CB  . ASP A 1 147 ? 42.361  25.421  12.518  1.00 18.80 ? 147 ASP A CB  1 
ATOM   1170 C  CG  . ASP A 1 147 ? 41.531  26.684  12.457  1.00 17.54 ? 147 ASP A CG  1 
ATOM   1171 O  OD1 . ASP A 1 147 ? 41.012  27.001  11.371  1.00 17.87 ? 147 ASP A OD1 1 
ATOM   1172 O  OD2 . ASP A 1 147 ? 41.405  27.358  13.492  1.00 21.71 ? 147 ASP A OD2 1 
ATOM   1173 N  N   . SER A 1 148 ? 44.350  23.644  11.074  1.00 18.32 ? 148 SER A N   1 
ATOM   1174 C  CA  . SER A 1 148 ? 45.415  22.648  11.104  1.00 19.09 ? 148 SER A CA  1 
ATOM   1175 C  C   . SER A 1 148 ? 46.676  23.275  11.691  1.00 20.14 ? 148 SER A C   1 
ATOM   1176 O  O   . SER A 1 148 ? 46.916  24.471  11.521  1.00 20.48 ? 148 SER A O   1 
ATOM   1177 C  CB  . SER A 1 148 ? 45.710  22.145  9.691   1.00 19.19 ? 148 SER A CB  1 
ATOM   1178 O  OG  . SER A 1 148 ? 46.932  21.428  9.657   1.00 22.09 ? 148 SER A OG  1 
ATOM   1179 N  N   . PRO A 1 149 ? 47.493  22.477  12.394  1.00 20.99 ? 149 PRO A N   1 
ATOM   1180 C  CA  . PRO A 1 149 ? 48.731  22.989  12.990  1.00 23.60 ? 149 PRO A CA  1 
ATOM   1181 C  C   . PRO A 1 149 ? 49.630  23.540  11.880  1.00 24.22 ? 149 PRO A C   1 
ATOM   1182 O  O   . PRO A 1 149 ? 50.480  24.392  12.125  1.00 25.01 ? 149 PRO A O   1 
ATOM   1183 C  CB  . PRO A 1 149 ? 49.345  21.751  13.649  1.00 22.27 ? 149 PRO A CB  1 
ATOM   1184 C  CG  . PRO A 1 149 ? 48.164  20.871  13.909  1.00 23.33 ? 149 PRO A CG  1 
ATOM   1185 C  CD  . PRO A 1 149 ? 47.344  21.037  12.663  1.00 20.85 ? 149 PRO A CD  1 
ATOM   1186 N  N   . LEU A 1 150 ? 49.429  23.044  10.662  1.00 24.93 ? 150 LEU A N   1 
ATOM   1187 C  CA  . LEU A 1 150 ? 50.217  23.485  9.513   1.00 25.93 ? 150 LEU A CA  1 
ATOM   1188 C  C   . LEU A 1 150 ? 49.932  24.933  9.131   1.00 27.08 ? 150 LEU A C   1 
ATOM   1189 O  O   . LEU A 1 150 ? 50.701  25.542  8.383   1.00 26.94 ? 150 LEU A O   1 
ATOM   1190 C  CB  . LEU A 1 150 ? 49.954  22.589  8.298   1.00 24.73 ? 150 LEU A CB  1 
ATOM   1191 C  CG  . LEU A 1 150 ? 50.506  21.165  8.348   1.00 26.02 ? 150 LEU A CG  1 
ATOM   1192 C  CD1 . LEU A 1 150 ? 50.066  20.410  7.106   1.00 28.39 ? 150 LEU A CD1 1 
ATOM   1193 C  CD2 . LEU A 1 150 ? 52.022  21.206  8.435   1.00 27.79 ? 150 LEU A CD2 1 
ATOM   1194 N  N   . MET A 1 151 ? 48.833  25.484  9.638   1.00 26.10 ? 151 MET A N   1 
ATOM   1195 C  CA  . MET A 1 151 ? 48.472  26.865  9.328   1.00 25.07 ? 151 MET A CA  1 
ATOM   1196 C  C   . MET A 1 151 ? 49.281  27.867  10.138  1.00 27.05 ? 151 MET A C   1 
ATOM   1197 O  O   . MET A 1 151 ? 49.340  29.049  9.796   1.00 27.89 ? 151 MET A O   1 
ATOM   1198 C  CB  . MET A 1 151 ? 46.984  27.099  9.586   1.00 21.60 ? 151 MET A CB  1 
ATOM   1199 C  CG  . MET A 1 151 ? 46.082  26.216  8.755   1.00 20.31 ? 151 MET A CG  1 
ATOM   1200 S  SD  . MET A 1 151 ? 44.367  26.489  9.194   1.00 19.41 ? 151 MET A SD  1 
ATOM   1201 C  CE  . MET A 1 151 ? 43.551  25.663  7.829   1.00 19.94 ? 151 MET A CE  1 
ATOM   1202 N  N   . GLY A 1 152 ? 49.891  27.402  11.220  1.00 28.29 ? 152 GLY A N   1 
ATOM   1203 C  CA  . GLY A 1 152 ? 50.678  28.297  12.045  1.00 29.78 ? 152 GLY A CA  1 
ATOM   1204 C  C   . GLY A 1 152 ? 49.990  28.650  13.345  1.00 31.71 ? 152 GLY A C   1 
ATOM   1205 O  O   . GLY A 1 152 ? 48.765  28.547  13.472  1.00 28.01 ? 152 GLY A O   1 
ATOM   1206 N  N   . GLU A 1 153 ? 50.785  29.084  14.316  1.00 32.16 ? 153 GLU A N   1 
ATOM   1207 C  CA  . GLU A 1 153 ? 50.265  29.442  15.624  1.00 35.19 ? 153 GLU A CA  1 
ATOM   1208 C  C   . GLU A 1 153 ? 49.341  30.653  15.573  1.00 34.15 ? 153 GLU A C   1 
ATOM   1209 O  O   . GLU A 1 153 ? 48.319  30.696  16.258  1.00 34.25 ? 153 GLU A O   1 
ATOM   1210 C  CB  . GLU A 1 153 ? 51.427  29.715  16.577  1.00 39.68 ? 153 GLU A CB  1 
ATOM   1211 C  CG  . GLU A 1 153 ? 51.049  29.654  18.041  1.00 48.08 ? 153 GLU A CG  1 
ATOM   1212 C  CD  . GLU A 1 153 ? 52.229  29.928  18.951  1.00 53.21 ? 153 GLU A CD  1 
ATOM   1213 O  OE1 . GLU A 1 153 ? 52.661  31.100  19.030  1.00 55.81 ? 153 GLU A OE1 1 
ATOM   1214 O  OE2 . GLU A 1 153 ? 52.729  28.971  19.581  1.00 56.23 ? 153 GLU A OE2 1 
ATOM   1215 N  N   . ALA A 1 154 ? 49.693  31.634  14.752  1.00 33.50 ? 154 ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 154 ? 48.894  32.851  14.639  1.00 34.04 ? 154 ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 154 ? 47.446  32.577  14.254  1.00 33.75 ? 154 ALA A C   1 
ATOM   1218 O  O   . ALA A 1 154 ? 46.519  33.174  14.805  1.00 34.29 ? 154 ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 154 ? 49.526  33.801  13.620  1.00 33.16 ? 154 ALA A CB  1 
ATOM   1220 N  N   . ILE A 1 155 ? 47.257  31.667  13.308  1.00 32.62 ? 155 ILE A N   1 
ATOM   1221 C  CA  . ILE A 1 155 ? 45.925  31.335  12.829  1.00 31.78 ? 155 ILE A CA  1 
ATOM   1222 C  C   . ILE A 1 155 ? 45.207  30.254  13.625  1.00 31.38 ? 155 ILE A C   1 
ATOM   1223 O  O   . ILE A 1 155 ? 44.084  30.459  14.089  1.00 32.10 ? 155 ILE A O   1 
ATOM   1224 C  CB  . ILE A 1 155 ? 45.972  30.877  11.354  1.00 32.81 ? 155 ILE A CB  1 
ATOM   1225 C  CG1 . ILE A 1 155 ? 46.421  32.041  10.465  1.00 33.67 ? 155 ILE A CG1 1 
ATOM   1226 C  CG2 . ILE A 1 155 ? 44.606  30.340  10.926  1.00 30.96 ? 155 ILE A CG2 1 
ATOM   1227 C  CD1 . ILE A 1 155 ? 46.485  31.703  8.987   1.00 34.56 ? 155 ILE A CD1 1 
ATOM   1228 N  N   . SER A 1 156 ? 45.864  29.111  13.792  1.00 29.10 ? 156 SER A N   1 
ATOM   1229 C  CA  . SER A 1 156 ? 45.253  27.972  14.466  1.00 29.03 ? 156 SER A CA  1 
ATOM   1230 C  C   . SER A 1 156 ? 45.487  27.824  15.962  1.00 29.96 ? 156 SER A C   1 
ATOM   1231 O  O   . SER A 1 156 ? 44.845  26.993  16.604  1.00 26.91 ? 156 SER A O   1 
ATOM   1232 C  CB  . SER A 1 156 ? 45.698  26.686  13.779  1.00 25.94 ? 156 SER A CB  1 
ATOM   1233 O  OG  . SER A 1 156 ? 47.038  26.385  14.116  1.00 24.95 ? 156 SER A OG  1 
ATOM   1234 N  N   . GLY A 1 157 ? 46.408  28.607  16.515  1.00 28.93 ? 157 GLY A N   1 
ATOM   1235 C  CA  . GLY A 1 157 ? 46.689  28.508  17.936  1.00 28.60 ? 157 GLY A CA  1 
ATOM   1236 C  C   . GLY A 1 157 ? 47.588  27.323  18.243  1.00 29.09 ? 157 GLY A C   1 
ATOM   1237 O  O   . GLY A 1 157 ? 47.827  26.994  19.403  1.00 30.19 ? 157 GLY A O   1 
ATOM   1238 N  N   . ALA A 1 158 ? 48.087  26.679  17.195  1.00 28.54 ? 158 ALA A N   1 
ATOM   1239 C  CA  . ALA A 1 158 ? 48.964  25.527  17.350  1.00 28.97 ? 158 ALA A CA  1 
ATOM   1240 C  C   . ALA A 1 158 ? 49.927  25.459  16.171  1.00 29.27 ? 158 ALA A C   1 
ATOM   1241 O  O   . ALA A 1 158 ? 49.712  26.106  15.149  1.00 28.93 ? 158 ALA A O   1 
ATOM   1242 C  CB  . ALA A 1 158 ? 48.135  24.247  17.419  1.00 31.54 ? 158 ALA A CB  1 
ATOM   1243 N  N   . SER A 1 159 ? 50.993  24.682  16.320  1.00 29.32 ? 159 SER A N   1 
ATOM   1244 C  CA  . SER A 1 159 ? 51.971  24.528  15.252  1.00 31.60 ? 159 SER A CA  1 
ATOM   1245 C  C   . SER A 1 159 ? 52.647  23.167  15.391  1.00 31.43 ? 159 SER A C   1 
ATOM   1246 O  O   . SER A 1 159 ? 52.522  22.509  16.423  1.00 33.07 ? 159 SER A O   1 
ATOM   1247 C  CB  . SER A 1 159 ? 53.017  25.648  15.320  1.00 33.16 ? 159 SER A CB  1 
ATOM   1248 O  OG  . SER A 1 159 ? 53.795  25.542  16.500  1.00 36.36 ? 159 SER A OG  1 
ATOM   1249 N  N   . GLY A 1 160 ? 53.363  22.748  14.354  1.00 29.94 ? 160 GLY A N   1 
ATOM   1250 C  CA  . GLY A 1 160 ? 54.025  21.458  14.393  1.00 29.35 ? 160 GLY A CA  1 
ATOM   1251 C  C   . GLY A 1 160 ? 53.566  20.596  13.233  1.00 29.69 ? 160 GLY A C   1 
ATOM   1252 O  O   . GLY A 1 160 ? 52.543  20.888  12.609  1.00 30.99 ? 160 GLY A O   1 
ATOM   1253 N  N   . PHE A 1 161 ? 54.316  19.536  12.949  1.00 27.74 ? 161 PHE A N   1 
ATOM   1254 C  CA  . PHE A 1 161 ? 54.013  18.620  11.852  1.00 27.84 ? 161 PHE A CA  1 
ATOM   1255 C  C   . PHE A 1 161 ? 53.107  17.508  12.366  1.00 27.53 ? 161 PHE A C   1 
ATOM   1256 O  O   . PHE A 1 161 ? 53.481  16.775  13.276  1.00 27.16 ? 161 PHE A O   1 
ATOM   1257 C  CB  . PHE A 1 161 ? 55.320  18.022  11.314  1.00 28.99 ? 161 PHE A CB  1 
ATOM   1258 C  CG  . PHE A 1 161 ? 55.132  17.038  10.192  1.00 29.30 ? 161 PHE A CG  1 
ATOM   1259 C  CD1 . PHE A 1 161 ? 54.653  17.454  8.953   1.00 30.14 ? 161 PHE A CD1 1 
ATOM   1260 C  CD2 . PHE A 1 161 ? 55.440  15.692  10.376  1.00 28.14 ? 161 PHE A CD2 1 
ATOM   1261 C  CE1 . PHE A 1 161 ? 54.481  16.545  7.909   1.00 31.09 ? 161 PHE A CE1 1 
ATOM   1262 C  CE2 . PHE A 1 161 ? 55.273  14.773  9.341   1.00 30.10 ? 161 PHE A CE2 1 
ATOM   1263 C  CZ  . PHE A 1 161 ? 54.791  15.201  8.104   1.00 30.29 ? 161 PHE A CZ  1 
ATOM   1264 N  N   . PRO A 1 162 ? 51.903  17.366  11.784  1.00 27.68 ? 162 PRO A N   1 
ATOM   1265 C  CA  . PRO A 1 162 ? 50.956  16.327  12.211  1.00 27.03 ? 162 PRO A CA  1 
ATOM   1266 C  C   . PRO A 1 162 ? 51.417  14.902  11.923  1.00 26.99 ? 162 PRO A C   1 
ATOM   1267 O  O   . PRO A 1 162 ? 51.700  14.556  10.777  1.00 29.94 ? 162 PRO A O   1 
ATOM   1268 C  CB  . PRO A 1 162 ? 49.689  16.658  11.422  1.00 25.45 ? 162 PRO A CB  1 
ATOM   1269 C  CG  . PRO A 1 162 ? 49.830  18.128  11.113  1.00 29.04 ? 162 PRO A CG  1 
ATOM   1270 C  CD  . PRO A 1 162 ? 51.292  18.232  10.762  1.00 26.17 ? 162 PRO A CD  1 
ATOM   1271 N  N   . ILE A 1 163 ? 51.484  14.083  12.965  1.00 26.24 ? 163 ILE A N   1 
ATOM   1272 C  CA  . ILE A 1 163 ? 51.867  12.683  12.822  1.00 26.27 ? 163 ILE A CA  1 
ATOM   1273 C  C   . ILE A 1 163 ? 50.571  11.891  12.651  1.00 25.73 ? 163 ILE A C   1 
ATOM   1274 O  O   . ILE A 1 163 ? 50.471  11.005  11.805  1.00 26.13 ? 163 ILE A O   1 
ATOM   1275 C  CB  . ILE A 1 163 ? 52.605  12.173  14.076  1.00 26.11 ? 163 ILE A CB  1 
ATOM   1276 C  CG1 . ILE A 1 163 ? 53.930  12.925  14.243  1.00 27.03 ? 163 ILE A CG1 1 
ATOM   1277 C  CG2 . ILE A 1 163 ? 52.838  10.672  13.971  1.00 26.57 ? 163 ILE A CG2 1 
ATOM   1278 C  CD1 . ILE A 1 163 ? 54.859  12.804  13.052  1.00 25.79 ? 163 ILE A CD1 1 
ATOM   1279 N  N   . MET A 1 164 ? 49.580  12.226  13.470  1.00 25.38 ? 164 MET A N   1 
ATOM   1280 C  CA  . MET A 1 164 ? 48.270  11.587  13.406  1.00 25.81 ? 164 MET A CA  1 
ATOM   1281 C  C   . MET A 1 164 ? 47.251  12.502  14.085  1.00 25.08 ? 164 MET A C   1 
ATOM   1282 O  O   . MET A 1 164 ? 47.616  13.386  14.860  1.00 23.39 ? 164 MET A O   1 
ATOM   1283 C  CB  . MET A 1 164 ? 48.307  10.210  14.082  1.00 27.56 ? 164 MET A CB  1 
ATOM   1284 C  CG  . MET A 1 164 ? 48.554  10.241  15.575  1.00 34.16 ? 164 MET A CG  1 
ATOM   1285 S  SD  . MET A 1 164 ? 47.024  10.358  16.511  1.00 39.04 ? 164 MET A SD  1 
ATOM   1286 C  CE  . MET A 1 164 ? 47.121  8.887   17.497  1.00 40.71 ? 164 MET A CE  1 
ATOM   1287 N  N   . GLY A 1 165 ? 45.974  12.309  13.780  1.00 23.91 ? 165 GLY A N   1 
ATOM   1288 C  CA  . GLY A 1 165 ? 44.965  13.151  14.390  1.00 22.67 ? 165 GLY A CA  1 
ATOM   1289 C  C   . GLY A 1 165 ? 43.614  12.479  14.473  1.00 21.11 ? 165 GLY A C   1 
ATOM   1290 O  O   . GLY A 1 165 ? 43.369  11.481  13.799  1.00 20.59 ? 165 GLY A O   1 
ATOM   1291 N  N   . LEU A 1 166 ? 42.741  13.030  15.309  1.00 21.02 ? 166 LEU A N   1 
ATOM   1292 C  CA  . LEU A 1 166 ? 41.397  12.494  15.481  1.00 20.12 ? 166 LEU A CA  1 
ATOM   1293 C  C   . LEU A 1 166 ? 40.368  13.600  15.309  1.00 19.33 ? 166 LEU A C   1 
ATOM   1294 O  O   . LEU A 1 166 ? 40.447  14.646  15.953  1.00 20.00 ? 166 LEU A O   1 
ATOM   1295 C  CB  . LEU A 1 166 ? 41.235  11.865  16.867  1.00 21.30 ? 166 LEU A CB  1 
ATOM   1296 C  CG  . LEU A 1 166 ? 39.839  11.327  17.205  1.00 19.92 ? 166 LEU A CG  1 
ATOM   1297 C  CD1 . LEU A 1 166 ? 39.468  10.197  16.260  1.00 22.17 ? 166 LEU A CD1 1 
ATOM   1298 C  CD2 . LEU A 1 166 ? 39.825  10.835  18.630  1.00 21.51 ? 166 LEU A CD2 1 
ATOM   1299 N  N   . ASP A 1 167 ? 39.401  13.348  14.436  1.00 18.29 ? 167 ASP A N   1 
ATOM   1300 C  CA  . ASP A 1 167 ? 38.324  14.285  14.155  1.00 15.90 ? 167 ASP A CA  1 
ATOM   1301 C  C   . ASP A 1 167 ? 37.325  14.206  15.313  1.00 17.61 ? 167 ASP A C   1 
ATOM   1302 O  O   . ASP A 1 167 ? 36.798  13.123  15.598  1.00 16.67 ? 167 ASP A O   1 
ATOM   1303 C  CB  . ASP A 1 167 ? 37.655  13.865  12.836  1.00 16.27 ? 167 ASP A CB  1 
ATOM   1304 C  CG  . ASP A 1 167 ? 36.555  14.806  12.390  1.00 17.67 ? 167 ASP A CG  1 
ATOM   1305 O  OD1 . ASP A 1 167 ? 36.304  15.820  13.078  1.00 16.05 ? 167 ASP A OD1 1 
ATOM   1306 O  OD2 . ASP A 1 167 ? 35.940  14.530  11.331  1.00 14.12 ? 167 ASP A OD2 1 
ATOM   1307 N  N   . VAL A 1 168 ? 37.072  15.317  16.005  1.00 15.28 ? 168 VAL A N   1 
ATOM   1308 C  CA  . VAL A 1 168 ? 36.090  15.260  17.076  1.00 14.74 ? 168 VAL A CA  1 
ATOM   1309 C  C   . VAL A 1 168 ? 34.837  16.092  16.821  1.00 14.90 ? 168 VAL A C   1 
ATOM   1310 O  O   . VAL A 1 168 ? 34.134  16.466  17.752  1.00 15.59 ? 168 VAL A O   1 
ATOM   1311 C  CB  . VAL A 1 168 ? 36.683  15.569  18.487  1.00 17.18 ? 168 VAL A CB  1 
ATOM   1312 C  CG1 . VAL A 1 168 ? 37.617  14.427  18.903  1.00 16.60 ? 168 VAL A CG1 1 
ATOM   1313 C  CG2 . VAL A 1 168 ? 37.402  16.897  18.509  1.00 18.34 ? 168 VAL A CG2 1 
ATOM   1314 N  N   . TRP A 1 169 ? 34.567  16.379  15.548  1.00 12.11 ? 169 TRP A N   1 
ATOM   1315 C  CA  . TRP A 1 169 ? 33.333  17.056  15.168  1.00 12.60 ? 169 TRP A CA  1 
ATOM   1316 C  C   . TRP A 1 169 ? 32.282  15.987  15.487  1.00 14.63 ? 169 TRP A C   1 
ATOM   1317 O  O   . TRP A 1 169 ? 32.560  14.789  15.357  1.00 14.10 ? 169 TRP A O   1 
ATOM   1318 C  CB  . TRP A 1 169 ? 33.292  17.312  13.665  1.00 12.03 ? 169 TRP A CB  1 
ATOM   1319 C  CG  . TRP A 1 169 ? 33.999  18.564  13.223  1.00 14.27 ? 169 TRP A CG  1 
ATOM   1320 C  CD1 . TRP A 1 169 ? 35.297  18.910  13.465  1.00 15.02 ? 169 TRP A CD1 1 
ATOM   1321 C  CD2 . TRP A 1 169 ? 33.435  19.619  12.441  1.00 14.37 ? 169 TRP A CD2 1 
ATOM   1322 N  NE1 . TRP A 1 169 ? 35.579  20.130  12.874  1.00 16.93 ? 169 TRP A NE1 1 
ATOM   1323 C  CE2 . TRP A 1 169 ? 34.451  20.582  12.238  1.00 14.43 ? 169 TRP A CE2 1 
ATOM   1324 C  CE3 . TRP A 1 169 ? 32.166  19.846  11.889  1.00 14.81 ? 169 TRP A CE3 1 
ATOM   1325 C  CZ2 . TRP A 1 169 ? 34.234  21.755  11.505  1.00 14.84 ? 169 TRP A CZ2 1 
ATOM   1326 C  CZ3 . TRP A 1 169 ? 31.950  21.013  11.159  1.00 17.05 ? 169 TRP A CZ3 1 
ATOM   1327 C  CH2 . TRP A 1 169 ? 32.985  21.953  10.976  1.00 16.40 ? 169 TRP A CH2 1 
ATOM   1328 N  N   . GLU A 1 170 ? 31.081  16.397  15.870  1.00 13.76 ? 170 GLU A N   1 
ATOM   1329 C  CA  . GLU A 1 170 ? 30.051  15.421  16.204  1.00 14.19 ? 170 GLU A CA  1 
ATOM   1330 C  C   . GLU A 1 170 ? 29.662  14.499  15.040  1.00 14.46 ? 170 GLU A C   1 
ATOM   1331 O  O   . GLU A 1 170 ? 29.311  13.346  15.274  1.00 15.73 ? 170 GLU A O   1 
ATOM   1332 C  CB  . GLU A 1 170 ? 28.823  16.137  16.797  1.00 14.58 ? 170 GLU A CB  1 
ATOM   1333 C  CG  . GLU A 1 170 ? 29.164  16.829  18.136  1.00 14.71 ? 170 GLU A CG  1 
ATOM   1334 C  CD  . GLU A 1 170 ? 28.012  17.630  18.740  1.00 15.07 ? 170 GLU A CD  1 
ATOM   1335 O  OE1 . GLU A 1 170 ? 27.326  18.358  17.991  1.00 12.65 ? 170 GLU A OE1 1 
ATOM   1336 O  OE2 . GLU A 1 170 ? 27.809  17.538  19.975  1.00 16.01 ? 170 GLU A OE2 1 
ATOM   1337 N  N   . HIS A 1 171 ? 29.751  14.965  13.793  1.00 14.45 ? 171 HIS A N   1 
ATOM   1338 C  CA  . HIS A 1 171 ? 29.400  14.084  12.673  1.00 14.18 ? 171 HIS A CA  1 
ATOM   1339 C  C   . HIS A 1 171 ? 30.304  12.853  12.559  1.00 14.78 ? 171 HIS A C   1 
ATOM   1340 O  O   . HIS A 1 171 ? 29.948  11.870  11.896  1.00 15.48 ? 171 HIS A O   1 
ATOM   1341 C  CB  . HIS A 1 171 ? 29.381  14.844  11.327  1.00 15.74 ? 171 HIS A CB  1 
ATOM   1342 C  CG  . HIS A 1 171 ? 30.713  15.379  10.885  1.00 16.06 ? 171 HIS A CG  1 
ATOM   1343 N  ND1 . HIS A 1 171 ? 30.910  16.711  10.589  1.00 15.51 ? 171 HIS A ND1 1 
ATOM   1344 C  CD2 . HIS A 1 171 ? 31.890  14.759  10.622  1.00 17.91 ? 171 HIS A CD2 1 
ATOM   1345 C  CE1 . HIS A 1 171 ? 32.150  16.890  10.163  1.00 17.30 ? 171 HIS A CE1 1 
ATOM   1346 N  NE2 . HIS A 1 171 ? 32.766  15.721  10.173  1.00 16.58 ? 171 HIS A NE2 1 
ATOM   1347 N  N   . ALA A 1 172 ? 31.462  12.896  13.211  1.00 12.85 ? 172 ALA A N   1 
ATOM   1348 C  CA  . ALA A 1 172 ? 32.399  11.780  13.154  1.00 13.55 ? 172 ALA A CA  1 
ATOM   1349 C  C   . ALA A 1 172 ? 32.028  10.621  14.066  1.00 14.03 ? 172 ALA A C   1 
ATOM   1350 O  O   . ALA A 1 172 ? 32.520  9.501   13.878  1.00 15.16 ? 172 ALA A O   1 
ATOM   1351 C  CB  . ALA A 1 172 ? 33.801  12.263  13.501  1.00 12.81 ? 172 ALA A CB  1 
ATOM   1352 N  N   . TYR A 1 173 ? 31.159  10.879  15.043  1.00 12.89 ? 173 TYR A N   1 
ATOM   1353 C  CA  . TYR A 1 173 ? 30.780  9.847   16.005  1.00 13.70 ? 173 TYR A CA  1 
ATOM   1354 C  C   . TYR A 1 173 ? 29.330  9.806   16.471  1.00 14.10 ? 173 TYR A C   1 
ATOM   1355 O  O   . TYR A 1 173 ? 28.949  8.883   17.197  1.00 16.99 ? 173 TYR A O   1 
ATOM   1356 C  CB  . TYR A 1 173 ? 31.663  9.983   17.251  1.00 15.11 ? 173 TYR A CB  1 
ATOM   1357 C  CG  . TYR A 1 173 ? 31.506  11.302  18.017  1.00 15.19 ? 173 TYR A CG  1 
ATOM   1358 C  CD1 . TYR A 1 173 ? 30.498  11.473  18.978  1.00 16.81 ? 173 TYR A CD1 1 
ATOM   1359 C  CD2 . TYR A 1 173 ? 32.395  12.355  17.811  1.00 13.72 ? 173 TYR A CD2 1 
ATOM   1360 C  CE1 . TYR A 1 173 ? 30.398  12.665  19.720  1.00 16.42 ? 173 TYR A CE1 1 
ATOM   1361 C  CE2 . TYR A 1 173 ? 32.306  13.549  18.542  1.00 15.01 ? 173 TYR A CE2 1 
ATOM   1362 C  CZ  . TYR A 1 173 ? 31.311  13.696  19.496  1.00 17.49 ? 173 TYR A CZ  1 
ATOM   1363 O  OH  . TYR A 1 173 ? 31.262  14.858  20.237  1.00 17.37 ? 173 TYR A OH  1 
ATOM   1364 N  N   . TYR A 1 174 ? 28.508  10.763  16.064  1.00 14.39 ? 174 TYR A N   1 
ATOM   1365 C  CA  . TYR A 1 174 ? 27.150  10.783  16.581  1.00 16.04 ? 174 TYR A CA  1 
ATOM   1366 C  C   . TYR A 1 174 ? 26.212  9.630   16.240  1.00 18.57 ? 174 TYR A C   1 
ATOM   1367 O  O   . TYR A 1 174 ? 25.413  9.222   17.089  1.00 18.31 ? 174 TYR A O   1 
ATOM   1368 C  CB  . TYR A 1 174 ? 26.450  12.098  16.239  1.00 15.08 ? 174 TYR A CB  1 
ATOM   1369 C  CG  . TYR A 1 174 ? 25.633  12.619  17.410  1.00 17.51 ? 174 TYR A CG  1 
ATOM   1370 C  CD1 . TYR A 1 174 ? 26.259  13.193  18.519  1.00 16.18 ? 174 TYR A CD1 1 
ATOM   1371 C  CD2 . TYR A 1 174 ? 24.242  12.472  17.443  1.00 18.03 ? 174 TYR A CD2 1 
ATOM   1372 C  CE1 . TYR A 1 174 ? 25.513  13.605  19.646  1.00 18.52 ? 174 TYR A CE1 1 
ATOM   1373 C  CE2 . TYR A 1 174 ? 23.492  12.878  18.564  1.00 19.30 ? 174 TYR A CE2 1 
ATOM   1374 C  CZ  . TYR A 1 174 ? 24.137  13.439  19.659  1.00 18.66 ? 174 TYR A CZ  1 
ATOM   1375 O  OH  . TYR A 1 174 ? 23.411  13.812  20.775  1.00 19.04 ? 174 TYR A OH  1 
ATOM   1376 N  N   . LEU A 1 175 ? 26.291  9.099   15.025  1.00 17.18 ? 175 LEU A N   1 
ATOM   1377 C  CA  . LEU A 1 175 ? 25.376  8.020   14.654  1.00 18.37 ? 175 LEU A CA  1 
ATOM   1378 C  C   . LEU A 1 175 ? 25.550  6.779   15.523  1.00 20.15 ? 175 LEU A C   1 
ATOM   1379 O  O   . LEU A 1 175 ? 24.570  6.148   15.916  1.00 20.07 ? 175 LEU A O   1 
ATOM   1380 C  CB  . LEU A 1 175 ? 25.537  7.665   13.173  1.00 17.63 ? 175 LEU A CB  1 
ATOM   1381 C  CG  . LEU A 1 175 ? 25.064  8.735   12.182  1.00 19.59 ? 175 LEU A CG  1 
ATOM   1382 C  CD1 . LEU A 1 175 ? 25.267  8.236   10.758  1.00 19.51 ? 175 LEU A CD1 1 
ATOM   1383 C  CD2 . LEU A 1 175 ? 23.587  9.054   12.433  1.00 19.63 ? 175 LEU A CD2 1 
ATOM   1384 N  N   . LYS A 1 176 ? 26.792  6.440   15.844  1.00 19.33 ? 176 LYS A N   1 
ATOM   1385 C  CA  . LYS A 1 176 ? 27.042  5.266   16.663  1.00 21.51 ? 176 LYS A CA  1 
ATOM   1386 C  C   . LYS A 1 176 ? 27.193  5.539   18.159  1.00 21.89 ? 176 LYS A C   1 
ATOM   1387 O  O   . LYS A 1 176 ? 26.723  4.747   18.976  1.00 21.31 ? 176 LYS A O   1 
ATOM   1388 C  CB  . LYS A 1 176 ? 28.289  4.530   16.159  1.00 21.65 ? 176 LYS A CB  1 
ATOM   1389 C  CG  . LYS A 1 176 ? 28.680  3.339   17.029  1.00 24.13 ? 176 LYS A CG  1 
ATOM   1390 C  CD  . LYS A 1 176 ? 29.860  2.584   16.455  1.00 24.00 ? 176 LYS A CD  1 
ATOM   1391 C  CE  . LYS A 1 176 ? 30.192  1.377   17.317  1.00 27.94 ? 176 LYS A CE  1 
ATOM   1392 N  NZ  . LYS A 1 176 ? 31.332  0.598   16.760  1.00 27.39 ? 176 LYS A NZ  1 
ATOM   1393 N  N   . PHE A 1 177 ? 27.824  6.655   18.524  1.00 18.35 ? 177 PHE A N   1 
ATOM   1394 C  CA  . PHE A 1 177 ? 28.057  6.956   19.937  1.00 18.01 ? 177 PHE A CA  1 
ATOM   1395 C  C   . PHE A 1 177 ? 27.247  8.093   20.532  1.00 18.49 ? 177 PHE A C   1 
ATOM   1396 O  O   . PHE A 1 177 ? 27.323  8.327   21.737  1.00 19.70 ? 177 PHE A O   1 
ATOM   1397 C  CB  . PHE A 1 177 ? 29.535  7.286   20.178  1.00 16.93 ? 177 PHE A CB  1 
ATOM   1398 C  CG  . PHE A 1 177 ? 30.488  6.289   19.593  1.00 19.16 ? 177 PHE A CG  1 
ATOM   1399 C  CD1 . PHE A 1 177 ? 30.875  6.376   18.258  1.00 19.42 ? 177 PHE A CD1 1 
ATOM   1400 C  CD2 . PHE A 1 177 ? 31.011  5.270   20.380  1.00 21.01 ? 177 PHE A CD2 1 
ATOM   1401 C  CE1 . PHE A 1 177 ? 31.777  5.460   17.713  1.00 21.20 ? 177 PHE A CE1 1 
ATOM   1402 C  CE2 . PHE A 1 177 ? 31.912  4.348   19.847  1.00 22.34 ? 177 PHE A CE2 1 
ATOM   1403 C  CZ  . PHE A 1 177 ? 32.296  4.444   18.509  1.00 21.86 ? 177 PHE A CZ  1 
ATOM   1404 N  N   . GLN A 1 178 ? 26.487  8.798   19.703  1.00 20.46 ? 178 GLN A N   1 
ATOM   1405 C  CA  . GLN A 1 178 ? 25.722  9.947   20.166  1.00 21.48 ? 178 GLN A CA  1 
ATOM   1406 C  C   . GLN A 1 178 ? 26.619  10.882  20.993  1.00 21.53 ? 178 GLN A C   1 
ATOM   1407 O  O   . GLN A 1 178 ? 27.704  11.261  20.553  1.00 21.48 ? 178 GLN A O   1 
ATOM   1408 C  CB  . GLN A 1 178 ? 24.504  9.505   20.990  1.00 24.57 ? 178 GLN A CB  1 
ATOM   1409 C  CG  . GLN A 1 178 ? 23.443  8.750   20.190  1.00 26.18 ? 178 GLN A CG  1 
ATOM   1410 C  CD  . GLN A 1 178 ? 23.787  7.285   20.014  1.00 29.41 ? 178 GLN A CD  1 
ATOM   1411 O  OE1 . GLN A 1 178 ? 24.041  6.580   20.990  1.00 31.68 ? 178 GLN A OE1 1 
ATOM   1412 N  NE2 . GLN A 1 178 ? 23.796  6.817   18.769  1.00 30.03 ? 178 GLN A NE2 1 
ATOM   1413 N  N   . ASN A 1 179 ? 26.179  11.236  22.194  1.00 20.89 ? 179 ASN A N   1 
ATOM   1414 C  CA  . ASN A 1 179 ? 26.934  12.144  23.061  1.00 21.44 ? 179 ASN A CA  1 
ATOM   1415 C  C   . ASN A 1 179 ? 28.182  11.558  23.721  1.00 21.15 ? 179 ASN A C   1 
ATOM   1416 O  O   . ASN A 1 179 ? 28.989  12.297  24.277  1.00 21.38 ? 179 ASN A O   1 
ATOM   1417 C  CB  . ASN A 1 179 ? 26.037  12.639  24.186  1.00 21.65 ? 179 ASN A CB  1 
ATOM   1418 C  CG  . ASN A 1 179 ? 25.588  11.506  25.096  1.00 23.97 ? 179 ASN A CG  1 
ATOM   1419 O  OD1 . ASN A 1 179 ? 24.767  10.676  24.711  1.00 23.13 ? 179 ASN A OD1 1 
ATOM   1420 N  ND2 . ASN A 1 179 ? 26.144  11.457  26.300  1.00 22.83 ? 179 ASN A ND2 1 
ATOM   1421 N  N   A ARG A 1 180 ? 28.337  10.240  23.670  0.50 20.70 ? 180 ARG A N   1 
ATOM   1422 N  N   B ARG A 1 180 ? 28.335  10.240  23.646  0.50 21.04 ? 180 ARG A N   1 
ATOM   1423 C  CA  A ARG A 1 180 ? 29.474  9.592   24.319  0.50 20.49 ? 180 ARG A CA  1 
ATOM   1424 C  CA  B ARG A 1 180 ? 29.465  9.558   24.270  0.50 21.20 ? 180 ARG A CA  1 
ATOM   1425 C  C   A ARG A 1 180 ? 30.804  9.688   23.575  0.50 20.38 ? 180 ARG A C   1 
ATOM   1426 C  C   B ARG A 1 180 ? 30.795  9.687   23.529  0.50 20.88 ? 180 ARG A C   1 
ATOM   1427 O  O   A ARG A 1 180 ? 31.358  8.679   23.146  0.50 18.38 ? 180 ARG A O   1 
ATOM   1428 O  O   B ARG A 1 180 ? 31.343  8.695   23.054  0.50 19.27 ? 180 ARG A O   1 
ATOM   1429 C  CB  A ARG A 1 180 ? 29.134  8.124   24.597  0.50 21.76 ? 180 ARG A CB  1 
ATOM   1430 C  CB  B ARG A 1 180 ? 29.121  8.075   24.458  0.50 22.93 ? 180 ARG A CB  1 
ATOM   1431 C  CG  A ARG A 1 180 ? 27.895  7.944   25.474  0.50 22.65 ? 180 ARG A CG  1 
ATOM   1432 C  CG  B ARG A 1 180 ? 27.874  7.844   25.310  0.50 25.13 ? 180 ARG A CG  1 
ATOM   1433 C  CD  A ARG A 1 180 ? 27.598  6.471   25.709  0.50 25.59 ? 180 ARG A CD  1 
ATOM   1434 C  CD  B ARG A 1 180 ? 27.513  6.365   25.416  0.50 28.29 ? 180 ARG A CD  1 
ATOM   1435 N  NE  A ARG A 1 180 ? 27.247  5.777   24.472  0.50 26.45 ? 180 ARG A NE  1 
ATOM   1436 N  NE  B ARG A 1 180 ? 26.963  5.823   24.174  0.50 29.79 ? 180 ARG A NE  1 
ATOM   1437 C  CZ  A ARG A 1 180 ? 26.117  5.970   23.799  0.50 27.09 ? 180 ARG A CZ  1 
ATOM   1438 C  CZ  B ARG A 1 180 ? 27.584  4.942   23.394  0.50 31.45 ? 180 ARG A CZ  1 
ATOM   1439 N  NH1 A ARG A 1 180 ? 25.216  6.838   24.242  0.50 27.86 ? 180 ARG A NH1 1 
ATOM   1440 N  NH1 B ARG A 1 180 ? 28.790  4.492   23.717  0.50 30.99 ? 180 ARG A NH1 1 
ATOM   1441 N  NH2 A ARG A 1 180 ? 25.888  5.298   22.678  0.50 25.86 ? 180 ARG A NH2 1 
ATOM   1442 N  NH2 B ARG A 1 180 ? 26.995  4.504   22.290  0.50 31.52 ? 180 ARG A NH2 1 
ATOM   1443 N  N   . ARG A 1 181 ? 31.325  10.906  23.449  1.00 21.07 ? 181 ARG A N   1 
ATOM   1444 C  CA  . ARG A 1 181 ? 32.596  11.123  22.762  1.00 20.41 ? 181 ARG A CA  1 
ATOM   1445 C  C   . ARG A 1 181 ? 33.743  10.302  23.375  1.00 21.05 ? 181 ARG A C   1 
ATOM   1446 O  O   . ARG A 1 181 ? 34.614  9.816   22.656  1.00 21.27 ? 181 ARG A O   1 
ATOM   1447 C  CB  . ARG A 1 181 ? 32.977  12.612  22.766  1.00 21.02 ? 181 ARG A CB  1 
ATOM   1448 C  CG  . ARG A 1 181 ? 34.196  12.903  21.894  1.00 20.00 ? 181 ARG A CG  1 
ATOM   1449 C  CD  . ARG A 1 181 ? 34.789  14.289  22.130  1.00 17.94 ? 181 ARG A CD  1 
ATOM   1450 N  NE  . ARG A 1 181 ? 33.937  15.370  21.650  1.00 17.44 ? 181 ARG A NE  1 
ATOM   1451 C  CZ  . ARG A 1 181 ? 34.286  16.653  21.699  1.00 19.98 ? 181 ARG A CZ  1 
ATOM   1452 N  NH1 . ARG A 1 181 ? 35.463  16.999  22.201  1.00 17.53 ? 181 ARG A NH1 1 
ATOM   1453 N  NH2 . ARG A 1 181 ? 33.470  17.590  21.240  1.00 19.61 ? 181 ARG A NH2 1 
ATOM   1454 N  N   . PRO A 1 182 ? 33.767  10.147  24.714  1.00 21.39 ? 182 PRO A N   1 
ATOM   1455 C  CA  . PRO A 1 182 ? 34.851  9.365   25.323  1.00 22.69 ? 182 PRO A CA  1 
ATOM   1456 C  C   . PRO A 1 182 ? 34.909  7.921   24.814  1.00 23.03 ? 182 PRO A C   1 
ATOM   1457 O  O   . PRO A 1 182 ? 35.991  7.355   24.668  1.00 23.87 ? 182 PRO A O   1 
ATOM   1458 C  CB  . PRO A 1 182 ? 34.548  9.455   26.819  1.00 23.48 ? 182 PRO A CB  1 
ATOM   1459 C  CG  . PRO A 1 182 ? 33.902  10.817  26.938  1.00 23.89 ? 182 PRO A CG  1 
ATOM   1460 C  CD  . PRO A 1 182 ? 32.959  10.815  25.750  1.00 21.68 ? 182 PRO A CD  1 
ATOM   1461 N  N   . ASP A 1 183 ? 33.751  7.324   24.544  1.00 22.87 ? 183 ASP A N   1 
ATOM   1462 C  CA  . ASP A 1 183 ? 33.722  5.954   24.033  1.00 23.73 ? 183 ASP A CA  1 
ATOM   1463 C  C   . ASP A 1 183 ? 34.310  5.914   22.620  1.00 22.23 ? 183 ASP A C   1 
ATOM   1464 O  O   . ASP A 1 183 ? 35.010  4.971   22.254  1.00 18.95 ? 183 ASP A O   1 
ATOM   1465 C  CB  . ASP A 1 183 ? 32.289  5.411   24.005  1.00 27.51 ? 183 ASP A CB  1 
ATOM   1466 C  CG  . ASP A 1 183 ? 31.689  5.259   25.396  1.00 30.56 ? 183 ASP A CG  1 
ATOM   1467 O  OD1 . ASP A 1 183 ? 32.442  5.294   26.390  1.00 32.74 ? 183 ASP A OD1 1 
ATOM   1468 O  OD2 . ASP A 1 183 ? 30.459  5.089   25.491  1.00 33.90 ? 183 ASP A OD2 1 
ATOM   1469 N  N   . TYR A 1 184 ? 34.006  6.943   21.834  1.00 19.79 ? 184 TYR A N   1 
ATOM   1470 C  CA  . TYR A 1 184 ? 34.510  7.064   20.463  1.00 19.36 ? 184 TYR A CA  1 
ATOM   1471 C  C   . TYR A 1 184 ? 36.034  7.166   20.500  1.00 19.77 ? 184 TYR A C   1 
ATOM   1472 O  O   . TYR A 1 184 ? 36.730  6.508   19.727  1.00 19.61 ? 184 TYR A O   1 
ATOM   1473 C  CB  . TYR A 1 184 ? 33.912  8.317   19.813  1.00 17.06 ? 184 TYR A CB  1 
ATOM   1474 C  CG  . TYR A 1 184 ? 34.597  8.814   18.554  1.00 19.32 ? 184 TYR A CG  1 
ATOM   1475 C  CD1 . TYR A 1 184 ? 34.595  8.060   17.379  1.00 18.59 ? 184 TYR A CD1 1 
ATOM   1476 C  CD2 . TYR A 1 184 ? 35.199  10.075  18.526  1.00 19.85 ? 184 TYR A CD2 1 
ATOM   1477 C  CE1 . TYR A 1 184 ? 35.175  8.553   16.200  1.00 18.84 ? 184 TYR A CE1 1 
ATOM   1478 C  CE2 . TYR A 1 184 ? 35.778  10.580  17.357  1.00 20.65 ? 184 TYR A CE2 1 
ATOM   1479 C  CZ  . TYR A 1 184 ? 35.764  9.819   16.200  1.00 20.76 ? 184 TYR A CZ  1 
ATOM   1480 O  OH  . TYR A 1 184 ? 36.342  10.321  15.048  1.00 20.77 ? 184 TYR A OH  1 
ATOM   1481 N  N   . ILE A 1 185 ? 36.538  7.997   21.408  1.00 21.42 ? 185 ILE A N   1 
ATOM   1482 C  CA  . ILE A 1 185 ? 37.973  8.201   21.572  1.00 24.25 ? 185 ILE A CA  1 
ATOM   1483 C  C   . ILE A 1 185 ? 38.672  6.876   21.879  1.00 26.03 ? 185 ILE A C   1 
ATOM   1484 O  O   . ILE A 1 185 ? 39.744  6.596   21.345  1.00 25.78 ? 185 ILE A O   1 
ATOM   1485 C  CB  . ILE A 1 185 ? 38.287  9.178   22.737  1.00 25.63 ? 185 ILE A CB  1 
ATOM   1486 C  CG1 . ILE A 1 185 ? 37.595  10.527  22.525  1.00 28.34 ? 185 ILE A CG1 1 
ATOM   1487 C  CG2 . ILE A 1 185 ? 39.796  9.386   22.849  1.00 26.08 ? 185 ILE A CG2 1 
ATOM   1488 C  CD1 . ILE A 1 185 ? 38.017  11.258  21.296  1.00 32.09 ? 185 ILE A CD1 1 
ATOM   1489 N  N   . LYS A 1 186 ? 38.068  6.060   22.741  1.00 26.69 ? 186 LYS A N   1 
ATOM   1490 C  CA  . LYS A 1 186 ? 38.677  4.783   23.088  1.00 28.47 ? 186 LYS A CA  1 
ATOM   1491 C  C   . LYS A 1 186 ? 38.691  3.810   21.917  1.00 26.67 ? 186 LYS A C   1 
ATOM   1492 O  O   . LYS A 1 186 ? 39.666  3.089   21.728  1.00 27.45 ? 186 LYS A O   1 
ATOM   1493 C  CB  . LYS A 1 186 ? 37.982  4.175   24.308  1.00 31.56 ? 186 LYS A CB  1 
ATOM   1494 C  CG  . LYS A 1 186 ? 38.350  4.908   25.590  1.00 37.53 ? 186 LYS A CG  1 
ATOM   1495 C  CD  . LYS A 1 186 ? 37.548  4.435   26.786  1.00 44.18 ? 186 LYS A CD  1 
ATOM   1496 C  CE  . LYS A 1 186 ? 37.928  5.230   28.029  1.00 46.51 ? 186 LYS A CE  1 
ATOM   1497 N  NZ  . LYS A 1 186 ? 37.085  4.873   29.203  1.00 51.27 ? 186 LYS A NZ  1 
ATOM   1498 N  N   . GLU A 1 187 ? 37.622  3.794   21.124  1.00 25.59 ? 187 GLU A N   1 
ATOM   1499 C  CA  . GLU A 1 187 ? 37.562  2.906   19.961  1.00 26.08 ? 187 GLU A CA  1 
ATOM   1500 C  C   . GLU A 1 187 ? 38.632  3.287   18.938  1.00 26.56 ? 187 GLU A C   1 
ATOM   1501 O  O   . GLU A 1 187 ? 39.139  2.438   18.208  1.00 26.32 ? 187 GLU A O   1 
ATOM   1502 C  CB  . GLU A 1 187 ? 36.190  2.982   19.286  1.00 26.90 ? 187 GLU A CB  1 
ATOM   1503 C  CG  . GLU A 1 187 ? 35.084  2.240   20.011  1.00 32.47 ? 187 GLU A CG  1 
ATOM   1504 C  CD  . GLU A 1 187 ? 35.236  0.724   19.943  1.00 35.38 ? 187 GLU A CD  1 
ATOM   1505 O  OE1 . GLU A 1 187 ? 36.242  0.235   19.388  1.00 36.17 ? 187 GLU A OE1 1 
ATOM   1506 O  OE2 . GLU A 1 187 ? 34.341  0.022   20.451  1.00 38.75 ? 187 GLU A OE2 1 
ATOM   1507 N  N   . PHE A 1 188 ? 38.965  4.572   18.890  1.00 25.66 ? 188 PHE A N   1 
ATOM   1508 C  CA  . PHE A 1 188 ? 39.968  5.084   17.964  1.00 25.10 ? 188 PHE A CA  1 
ATOM   1509 C  C   . PHE A 1 188 ? 41.290  4.330   18.073  1.00 24.46 ? 188 PHE A C   1 
ATOM   1510 O  O   . PHE A 1 188 ? 41.954  4.085   17.069  1.00 25.89 ? 188 PHE A O   1 
ATOM   1511 C  CB  . PHE A 1 188 ? 40.203  6.575   18.230  1.00 23.59 ? 188 PHE A CB  1 
ATOM   1512 C  CG  . PHE A 1 188 ? 41.334  7.173   17.433  1.00 24.77 ? 188 PHE A CG  1 
ATOM   1513 C  CD1 . PHE A 1 188 ? 41.301  7.181   16.042  1.00 24.26 ? 188 PHE A CD1 1 
ATOM   1514 C  CD2 . PHE A 1 188 ? 42.428  7.743   18.079  1.00 24.33 ? 188 PHE A CD2 1 
ATOM   1515 C  CE1 . PHE A 1 188 ? 42.342  7.753   15.308  1.00 24.15 ? 188 PHE A CE1 1 
ATOM   1516 C  CE2 . PHE A 1 188 ? 43.470  8.314   17.356  1.00 24.11 ? 188 PHE A CE2 1 
ATOM   1517 C  CZ  . PHE A 1 188 ? 43.429  8.320   15.971  1.00 23.55 ? 188 PHE A CZ  1 
ATOM   1518 N  N   . TRP A 1 189 ? 41.669  3.954   19.290  1.00 24.81 ? 189 TRP A N   1 
ATOM   1519 C  CA  . TRP A 1 189 ? 42.926  3.243   19.503  1.00 24.87 ? 189 TRP A CA  1 
ATOM   1520 C  C   . TRP A 1 189 ? 42.996  1.913   18.754  1.00 25.85 ? 189 TRP A C   1 
ATOM   1521 O  O   . TRP A 1 189 ? 44.085  1.413   18.482  1.00 27.53 ? 189 TRP A O   1 
ATOM   1522 C  CB  . TRP A 1 189 ? 43.159  3.016   21.004  1.00 27.52 ? 189 TRP A CB  1 
ATOM   1523 C  CG  . TRP A 1 189 ? 43.365  4.294   21.781  1.00 27.83 ? 189 TRP A CG  1 
ATOM   1524 C  CD1 . TRP A 1 189 ? 42.684  4.694   22.897  1.00 28.00 ? 189 TRP A CD1 1 
ATOM   1525 C  CD2 . TRP A 1 189 ? 44.294  5.346   21.482  1.00 27.95 ? 189 TRP A CD2 1 
ATOM   1526 N  NE1 . TRP A 1 189 ? 43.126  5.930   23.309  1.00 27.41 ? 189 TRP A NE1 1 
ATOM   1527 C  CE2 . TRP A 1 189 ? 44.114  6.354   22.458  1.00 28.88 ? 189 TRP A CE2 1 
ATOM   1528 C  CE3 . TRP A 1 189 ? 45.259  5.537   20.484  1.00 27.77 ? 189 TRP A CE3 1 
ATOM   1529 C  CZ2 . TRP A 1 189 ? 44.864  7.537   22.463  1.00 28.02 ? 189 TRP A CZ2 1 
ATOM   1530 C  CZ3 . TRP A 1 189 ? 46.007  6.720   20.490  1.00 27.56 ? 189 TRP A CZ3 1 
ATOM   1531 C  CH2 . TRP A 1 189 ? 45.801  7.701   21.474  1.00 27.98 ? 189 TRP A CH2 1 
ATOM   1532 N  N   . ASN A 1 190 ? 41.842  1.348   18.407  1.00 24.51 ? 190 ASN A N   1 
ATOM   1533 C  CA  . ASN A 1 190 ? 41.808  0.080   17.682  1.00 26.11 ? 190 ASN A CA  1 
ATOM   1534 C  C   . ASN A 1 190 ? 41.946  0.253   16.175  1.00 26.91 ? 190 ASN A C   1 
ATOM   1535 O  O   . ASN A 1 190 ? 42.167  -0.725  15.454  1.00 25.97 ? 190 ASN A O   1 
ATOM   1536 C  CB  . ASN A 1 190 ? 40.500  -0.666  17.959  1.00 28.46 ? 190 ASN A CB  1 
ATOM   1537 C  CG  . ASN A 1 190 ? 40.345  -1.049  19.413  1.00 30.45 ? 190 ASN A CG  1 
ATOM   1538 O  OD1 . ASN A 1 190 ? 41.211  -1.705  19.985  1.00 32.71 ? 190 ASN A OD1 1 
ATOM   1539 N  ND2 . ASN A 1 190 ? 39.234  -0.643  20.020  1.00 31.54 ? 190 ASN A ND2 1 
ATOM   1540 N  N   . VAL A 1 191 ? 41.813  1.487   15.695  1.00 24.24 ? 191 VAL A N   1 
ATOM   1541 C  CA  . VAL A 1 191 ? 41.891  1.740   14.264  1.00 22.83 ? 191 VAL A CA  1 
ATOM   1542 C  C   . VAL A 1 191 ? 42.947  2.756   13.831  1.00 23.17 ? 191 VAL A C   1 
ATOM   1543 O  O   . VAL A 1 191 ? 43.073  3.052   12.649  1.00 23.64 ? 191 VAL A O   1 
ATOM   1544 C  CB  . VAL A 1 191 ? 40.516  2.188   13.720  1.00 24.23 ? 191 VAL A CB  1 
ATOM   1545 C  CG1 . VAL A 1 191 ? 39.515  1.047   13.838  1.00 23.47 ? 191 VAL A CG1 1 
ATOM   1546 C  CG2 . VAL A 1 191 ? 40.016  3.391   14.502  1.00 24.48 ? 191 VAL A CG2 1 
ATOM   1547 N  N   . VAL A 1 192 ? 43.703  3.296   14.775  1.00 24.55 ? 192 VAL A N   1 
ATOM   1548 C  CA  . VAL A 1 192 ? 44.738  4.253   14.415  1.00 26.38 ? 192 VAL A CA  1 
ATOM   1549 C  C   . VAL A 1 192 ? 45.830  3.485   13.661  1.00 27.58 ? 192 VAL A C   1 
ATOM   1550 O  O   . VAL A 1 192 ? 46.342  2.466   14.141  1.00 27.84 ? 192 VAL A O   1 
ATOM   1551 C  CB  . VAL A 1 192 ? 45.315  4.946   15.675  1.00 28.55 ? 192 VAL A CB  1 
ATOM   1552 C  CG1 . VAL A 1 192 ? 45.915  3.918   16.612  1.00 29.77 ? 192 VAL A CG1 1 
ATOM   1553 C  CG2 . VAL A 1 192 ? 46.338  5.991   15.275  1.00 29.96 ? 192 VAL A CG2 1 
ATOM   1554 N  N   . ASN A 1 193 ? 46.157  3.959   12.465  1.00 25.87 ? 193 ASN A N   1 
ATOM   1555 C  CA  . ASN A 1 193 ? 47.169  3.323   11.627  1.00 25.23 ? 193 ASN A CA  1 
ATOM   1556 C  C   . ASN A 1 193 ? 48.577  3.700   12.083  1.00 26.02 ? 193 ASN A C   1 
ATOM   1557 O  O   . ASN A 1 193 ? 49.120  4.721   11.659  1.00 25.52 ? 193 ASN A O   1 
ATOM   1558 C  CB  . ASN A 1 193 ? 46.967  3.752   10.174  1.00 25.62 ? 193 ASN A CB  1 
ATOM   1559 C  CG  . ASN A 1 193 ? 47.900  3.037   9.214   1.00 28.92 ? 193 ASN A CG  1 
ATOM   1560 O  OD1 . ASN A 1 193 ? 48.858  2.375   9.625   1.00 28.56 ? 193 ASN A OD1 1 
ATOM   1561 N  ND2 . ASN A 1 193 ? 47.629  3.179   7.921   1.00 28.37 ? 193 ASN A ND2 1 
ATOM   1562 N  N   . TRP A 1 194 ? 49.171  2.874   12.940  1.00 27.36 ? 194 TRP A N   1 
ATOM   1563 C  CA  . TRP A 1 194 ? 50.513  3.147   13.445  1.00 28.84 ? 194 TRP A CA  1 
ATOM   1564 C  C   . TRP A 1 194 ? 51.604  3.074   12.381  1.00 29.39 ? 194 TRP A C   1 
ATOM   1565 O  O   . TRP A 1 194 ? 52.654  3.699   12.523  1.00 30.63 ? 194 TRP A O   1 
ATOM   1566 C  CB  . TRP A 1 194 ? 50.845  2.202   14.603  1.00 28.98 ? 194 TRP A CB  1 
ATOM   1567 C  CG  . TRP A 1 194 ? 50.073  2.518   15.853  1.00 29.59 ? 194 TRP A CG  1 
ATOM   1568 C  CD1 . TRP A 1 194 ? 49.171  1.712   16.490  1.00 28.90 ? 194 TRP A CD1 1 
ATOM   1569 C  CD2 . TRP A 1 194 ? 50.130  3.731   16.609  1.00 29.18 ? 194 TRP A CD2 1 
ATOM   1570 N  NE1 . TRP A 1 194 ? 48.664  2.349   17.595  1.00 29.41 ? 194 TRP A NE1 1 
ATOM   1571 C  CE2 . TRP A 1 194 ? 49.236  3.590   17.693  1.00 29.99 ? 194 TRP A CE2 1 
ATOM   1572 C  CE3 . TRP A 1 194 ? 50.851  4.926   16.476  1.00 30.02 ? 194 TRP A CE3 1 
ATOM   1573 C  CZ2 . TRP A 1 194 ? 49.043  4.598   18.640  1.00 29.82 ? 194 TRP A CZ2 1 
ATOM   1574 C  CZ3 . TRP A 1 194 ? 50.658  5.928   17.418  1.00 29.96 ? 194 TRP A CZ3 1 
ATOM   1575 C  CH2 . TRP A 1 194 ? 49.761  5.757   18.487  1.00 30.55 ? 194 TRP A CH2 1 
ATOM   1576 N  N   . ASP A 1 195 ? 51.365  2.315   11.316  1.00 30.03 ? 195 ASP A N   1 
ATOM   1577 C  CA  . ASP A 1 195 ? 52.353  2.211   10.246  1.00 30.73 ? 195 ASP A CA  1 
ATOM   1578 C  C   . ASP A 1 195 ? 52.491  3.561   9.549   1.00 31.41 ? 195 ASP A C   1 
ATOM   1579 O  O   . ASP A 1 195 ? 53.601  4.024   9.279   1.00 28.99 ? 195 ASP A O   1 
ATOM   1580 C  CB  . ASP A 1 195 ? 51.944  1.155   9.211   1.00 32.14 ? 195 ASP A CB  1 
ATOM   1581 C  CG  . ASP A 1 195 ? 51.944  -0.255  9.775   1.00 34.53 ? 195 ASP A CG  1 
ATOM   1582 O  OD1 . ASP A 1 195 ? 52.596  -0.484  10.817  1.00 36.10 ? 195 ASP A OD1 1 
ATOM   1583 O  OD2 . ASP A 1 195 ? 51.300  -1.139  9.168   1.00 37.46 ? 195 ASP A OD2 1 
ATOM   1584 N  N   . GLU A 1 196 ? 51.356  4.193   9.259   1.00 30.62 ? 196 GLU A N   1 
ATOM   1585 C  CA  . GLU A 1 196 ? 51.366  5.490   8.593   1.00 29.17 ? 196 GLU A CA  1 
ATOM   1586 C  C   . GLU A 1 196 ? 51.957  6.542   9.528   1.00 29.11 ? 196 GLU A C   1 
ATOM   1587 O  O   . GLU A 1 196 ? 52.708  7.420   9.096   1.00 29.89 ? 196 GLU A O   1 
ATOM   1588 C  CB  . GLU A 1 196 ? 49.941  5.874   8.182   1.00 29.03 ? 196 GLU A CB  1 
ATOM   1589 C  CG  . GLU A 1 196 ? 49.821  7.143   7.340   1.00 30.05 ? 196 GLU A CG  1 
ATOM   1590 C  CD  . GLU A 1 196 ? 50.572  7.069   6.011   1.00 31.90 ? 196 GLU A CD  1 
ATOM   1591 O  OE1 . GLU A 1 196 ? 50.728  5.960   5.455   1.00 31.78 ? 196 GLU A OE1 1 
ATOM   1592 O  OE2 . GLU A 1 196 ? 50.990  8.134   5.514   1.00 30.83 ? 196 GLU A OE2 1 
ATOM   1593 N  N   . ALA A 1 197 ? 51.621  6.450   10.811  1.00 27.93 ? 197 ALA A N   1 
ATOM   1594 C  CA  . ALA A 1 197 ? 52.138  7.392   11.797  1.00 28.08 ? 197 ALA A CA  1 
ATOM   1595 C  C   . ALA A 1 197 ? 53.663  7.280   11.849  1.00 29.86 ? 197 ALA A C   1 
ATOM   1596 O  O   . ALA A 1 197 ? 54.368  8.287   11.904  1.00 26.81 ? 197 ALA A O   1 
ATOM   1597 C  CB  . ALA A 1 197 ? 51.548  7.095   13.168  1.00 27.92 ? 197 ALA A CB  1 
ATOM   1598 N  N   . ALA A 1 198 ? 54.163  6.046   11.833  1.00 30.50 ? 198 ALA A N   1 
ATOM   1599 C  CA  . ALA A 1 198 ? 55.604  5.804   11.872  1.00 32.97 ? 198 ALA A CA  1 
ATOM   1600 C  C   . ALA A 1 198 ? 56.260  6.396   10.631  1.00 33.32 ? 198 ALA A C   1 
ATOM   1601 O  O   . ALA A 1 198 ? 57.296  7.053   10.719  1.00 35.87 ? 198 ALA A O   1 
ATOM   1602 C  CB  . ALA A 1 198 ? 55.887  4.306   11.949  1.00 32.45 ? 198 ALA A CB  1 
ATOM   1603 N  N   . ALA A 1 199 ? 55.644  6.168   9.476   1.00 32.43 ? 199 ALA A N   1 
ATOM   1604 C  CA  . ALA A 1 199 ? 56.169  6.683   8.217   1.00 33.10 ? 199 ALA A CA  1 
ATOM   1605 C  C   . ALA A 1 199 ? 56.302  8.203   8.257   1.00 34.08 ? 199 ALA A C   1 
ATOM   1606 O  O   . ALA A 1 199 ? 57.327  8.755   7.855   1.00 33.66 ? 199 ALA A O   1 
ATOM   1607 C  CB  . ALA A 1 199 ? 55.264  6.265   7.067   1.00 31.88 ? 199 ALA A CB  1 
ATOM   1608 N  N   . ARG A 1 200 ? 55.266  8.881   8.745   1.00 32.32 ? 200 ARG A N   1 
ATOM   1609 C  CA  . ARG A 1 200 ? 55.292  10.333  8.827   1.00 32.94 ? 200 ARG A CA  1 
ATOM   1610 C  C   . ARG A 1 200 ? 56.345  10.807  9.823   1.00 35.27 ? 200 ARG A C   1 
ATOM   1611 O  O   . ARG A 1 200 ? 56.996  11.827  9.603   1.00 34.30 ? 200 ARG A O   1 
ATOM   1612 C  CB  . ARG A 1 200 ? 53.910  10.876  9.214   1.00 30.26 ? 200 ARG A CB  1 
ATOM   1613 C  CG  . ARG A 1 200 ? 52.832  10.654  8.152   1.00 27.51 ? 200 ARG A CG  1 
ATOM   1614 C  CD  . ARG A 1 200 ? 51.485  11.223  8.597   1.00 28.13 ? 200 ARG A CD  1 
ATOM   1615 N  NE  . ARG A 1 200 ? 51.523  12.676  8.756   1.00 25.23 ? 200 ARG A NE  1 
ATOM   1616 C  CZ  . ARG A 1 200 ? 51.391  13.546  7.759   1.00 27.20 ? 200 ARG A CZ  1 
ATOM   1617 N  NH1 . ARG A 1 200 ? 51.207  13.117  6.518   1.00 26.35 ? 200 ARG A NH1 1 
ATOM   1618 N  NH2 . ARG A 1 200 ? 51.446  14.848  8.004   1.00 26.76 ? 200 ARG A NH2 1 
ATOM   1619 N  N   . PHE A 1 201 ? 56.515  10.062  10.914  1.00 36.33 ? 201 PHE A N   1 
ATOM   1620 C  CA  . PHE A 1 201 ? 57.500  10.422  11.929  1.00 39.45 ? 201 PHE A CA  1 
ATOM   1621 C  C   . PHE A 1 201 ? 58.913  10.316  11.355  1.00 42.08 ? 201 PHE A C   1 
ATOM   1622 O  O   . PHE A 1 201 ? 59.786  11.128  11.670  1.00 41.11 ? 201 PHE A O   1 
ATOM   1623 C  CB  . PHE A 1 201 ? 57.378  9.512   13.152  1.00 38.53 ? 201 PHE A CB  1 
ATOM   1624 C  CG  . PHE A 1 201 ? 58.418  9.775   14.207  1.00 39.55 ? 201 PHE A CG  1 
ATOM   1625 C  CD1 . PHE A 1 201 ? 58.432  10.977  14.907  1.00 40.20 ? 201 PHE A CD1 1 
ATOM   1626 C  CD2 . PHE A 1 201 ? 59.391  8.822   14.495  1.00 40.66 ? 201 PHE A CD2 1 
ATOM   1627 C  CE1 . PHE A 1 201 ? 59.397  11.227  15.880  1.00 40.07 ? 201 PHE A CE1 1 
ATOM   1628 C  CE2 . PHE A 1 201 ? 60.361  9.064   15.467  1.00 40.13 ? 201 PHE A CE2 1 
ATOM   1629 C  CZ  . PHE A 1 201 ? 60.361  10.270  16.160  1.00 40.77 ? 201 PHE A CZ  1 
ATOM   1630 N  N   . ALA A 1 202 ? 59.131  9.312   10.512  1.00 44.14 ? 202 ALA A N   1 
ATOM   1631 C  CA  . ALA A 1 202 ? 60.432  9.106   9.893   1.00 47.14 ? 202 ALA A CA  1 
ATOM   1632 C  C   . ALA A 1 202 ? 60.748  10.247  8.928   1.00 49.06 ? 202 ALA A C   1 
ATOM   1633 O  O   . ALA A 1 202 ? 61.842  10.808  8.955   1.00 50.46 ? 202 ALA A O   1 
ATOM   1634 C  CB  . ALA A 1 202 ? 60.451  7.773   9.159   1.00 46.01 ? 202 ALA A CB  1 
ATOM   1635 N  N   . ALA A 1 203 ? 59.777  10.600  8.090   1.00 50.36 ? 203 ALA A N   1 
ATOM   1636 C  CA  . ALA A 1 203 ? 59.950  11.673  7.114   1.00 51.89 ? 203 ALA A CA  1 
ATOM   1637 C  C   . ALA A 1 203 ? 60.206  13.024  7.777   1.00 53.64 ? 203 ALA A C   1 
ATOM   1638 O  O   . ALA A 1 203 ? 61.102  13.766  7.369   1.00 53.56 ? 203 ALA A O   1 
ATOM   1639 C  CB  . ALA A 1 203 ? 58.720  11.761  6.218   1.00 50.91 ? 203 ALA A CB  1 
ATOM   1640 N  N   . LYS A 1 204 ? 59.402  13.339  8.790   1.00 55.73 ? 204 LYS A N   1 
ATOM   1641 C  CA  . LYS A 1 204 ? 59.512  14.593  9.533   1.00 57.68 ? 204 LYS A CA  1 
ATOM   1642 C  C   . LYS A 1 204 ? 59.022  15.826  8.769   1.00 58.83 ? 204 LYS A C   1 
ATOM   1643 O  O   . LYS A 1 204 ? 58.847  16.896  9.356   1.00 58.85 ? 204 LYS A O   1 
ATOM   1644 C  CB  . LYS A 1 204 ? 60.955  14.800  10.005  1.00 58.17 ? 204 LYS A CB  1 
ATOM   1645 C  CG  . LYS A 1 204 ? 61.363  13.844  11.111  1.00 58.86 ? 204 LYS A CG  1 
ATOM   1646 C  CD  . LYS A 1 204 ? 62.798  14.057  11.547  1.00 60.17 ? 204 LYS A CD  1 
ATOM   1647 C  CE  . LYS A 1 204 ? 63.086  13.303  12.837  1.00 60.68 ? 204 LYS A CE  1 
ATOM   1648 N  NZ  . LYS A 1 204 ? 62.747  11.857  12.730  1.00 61.82 ? 204 LYS A NZ  1 
ATOM   1649 N  N   . LYS A 1 205 ? 58.798  15.673  7.465   1.00 60.31 ? 205 LYS A N   1 
ATOM   1650 C  CA  . LYS A 1 205 ? 58.309  16.768  6.622   1.00 62.34 ? 205 LYS A CA  1 
ATOM   1651 C  C   . LYS A 1 205 ? 57.130  16.316  5.761   1.00 62.97 ? 205 LYS A C   1 
ATOM   1652 O  O   . LYS A 1 205 ? 56.844  15.097  5.738   1.00 62.83 ? 205 LYS A O   1 
ATOM   1653 C  CB  . LYS A 1 205 ? 59.420  17.293  5.703   1.00 63.53 ? 205 LYS A CB  1 
ATOM   1654 C  CG  . LYS A 1 205 ? 60.299  18.387  6.305   1.00 66.80 ? 205 LYS A CG  1 
ATOM   1655 C  CD  . LYS A 1 205 ? 61.181  17.869  7.433   1.00 68.86 ? 205 LYS A CD  1 
ATOM   1656 C  CE  . LYS A 1 205 ? 62.079  18.973  7.982   1.00 70.26 ? 205 LYS A CE  1 
ATOM   1657 N  NZ  . LYS A 1 205 ? 62.990  18.477  9.055   1.00 71.23 ? 205 LYS A NZ  1 
ATOM   1658 O  OXT . LYS A 1 205 ? 56.513  17.186  5.107   1.00 62.46 ? 205 LYS A OXT 1 
ATOM   1659 N  N   . SER B 1 1   ? 22.028  27.561  42.674  1.00 34.81 ? 1   SER B N   1 
ATOM   1660 C  CA  . SER B 1 1   ? 22.316  26.487  41.686  1.00 34.48 ? 1   SER B CA  1 
ATOM   1661 C  C   . SER B 1 1   ? 21.217  26.432  40.632  1.00 33.78 ? 1   SER B C   1 
ATOM   1662 O  O   . SER B 1 1   ? 20.052  26.731  40.911  1.00 32.85 ? 1   SER B O   1 
ATOM   1663 C  CB  . SER B 1 1   ? 22.414  25.128  42.388  1.00 35.90 ? 1   SER B CB  1 
ATOM   1664 O  OG  . SER B 1 1   ? 21.146  24.703  42.856  1.00 37.45 ? 1   SER B OG  1 
ATOM   1665 N  N   . TYR B 1 2   ? 21.595  26.047  39.418  1.00 30.89 ? 2   TYR B N   1 
ATOM   1666 C  CA  . TYR B 1 2   ? 20.644  25.946  38.327  1.00 28.17 ? 2   TYR B CA  1 
ATOM   1667 C  C   . TYR B 1 2   ? 19.971  24.582  38.312  1.00 27.47 ? 2   TYR B C   1 
ATOM   1668 O  O   . TYR B 1 2   ? 20.589  23.560  38.607  1.00 25.46 ? 2   TYR B O   1 
ATOM   1669 C  CB  . TYR B 1 2   ? 21.342  26.160  36.986  1.00 30.49 ? 2   TYR B CB  1 
ATOM   1670 C  CG  . TYR B 1 2   ? 22.063  27.478  36.852  1.00 32.87 ? 2   TYR B CG  1 
ATOM   1671 C  CD1 . TYR B 1 2   ? 21.451  28.677  37.216  1.00 34.74 ? 2   TYR B CD1 1 
ATOM   1672 C  CD2 . TYR B 1 2   ? 23.345  27.531  36.310  1.00 35.59 ? 2   TYR B CD2 1 
ATOM   1673 C  CE1 . TYR B 1 2   ? 22.101  29.897  37.036  1.00 36.17 ? 2   TYR B CE1 1 
ATOM   1674 C  CE2 . TYR B 1 2   ? 24.000  28.737  36.127  1.00 36.01 ? 2   TYR B CE2 1 
ATOM   1675 C  CZ  . TYR B 1 2   ? 23.375  29.913  36.487  1.00 37.28 ? 2   TYR B CZ  1 
ATOM   1676 O  OH  . TYR B 1 2   ? 24.020  31.102  36.263  1.00 39.67 ? 2   TYR B OH  1 
ATOM   1677 N  N   . THR B 1 3   ? 18.692  24.576  37.966  1.00 25.15 ? 3   THR B N   1 
ATOM   1678 C  CA  . THR B 1 3   ? 17.935  23.341  37.878  1.00 24.01 ? 3   THR B CA  1 
ATOM   1679 C  C   . THR B 1 3   ? 17.714  23.041  36.398  1.00 23.65 ? 3   THR B C   1 
ATOM   1680 O  O   . THR B 1 3   ? 17.454  23.953  35.610  1.00 23.56 ? 3   THR B O   1 
ATOM   1681 C  CB  . THR B 1 3   ? 16.564  23.485  38.580  1.00 25.59 ? 3   THR B CB  1 
ATOM   1682 O  OG1 . THR B 1 3   ? 16.775  23.704  39.982  1.00 25.43 ? 3   THR B OG1 1 
ATOM   1683 C  CG2 . THR B 1 3   ? 15.716  22.232  38.379  1.00 23.63 ? 3   THR B CG2 1 
ATOM   1684 N  N   . LEU B 1 4   ? 17.851  21.776  36.013  1.00 21.62 ? 4   LEU B N   1 
ATOM   1685 C  CA  . LEU B 1 4   ? 17.612  21.395  34.629  1.00 22.19 ? 4   LEU B CA  1 
ATOM   1686 C  C   . LEU B 1 4   ? 16.100  21.509  34.465  1.00 22.75 ? 4   LEU B C   1 
ATOM   1687 O  O   . LEU B 1 4   ? 15.343  20.800  35.128  1.00 21.50 ? 4   LEU B O   1 
ATOM   1688 C  CB  . LEU B 1 4   ? 18.044  19.949  34.377  1.00 22.54 ? 4   LEU B CB  1 
ATOM   1689 C  CG  . LEU B 1 4   ? 17.705  19.400  32.983  1.00 27.24 ? 4   LEU B CG  1 
ATOM   1690 C  CD1 . LEU B 1 4   ? 18.588  20.079  31.934  1.00 24.40 ? 4   LEU B CD1 1 
ATOM   1691 C  CD2 . LEU B 1 4   ? 17.917  17.885  32.955  1.00 26.72 ? 4   LEU B CD2 1 
ATOM   1692 N  N   . PRO B 1 5   ? 15.638  22.409  33.590  1.00 23.81 ? 5   PRO B N   1 
ATOM   1693 C  CA  . PRO B 1 5   ? 14.188  22.532  33.426  1.00 25.04 ? 5   PRO B CA  1 
ATOM   1694 C  C   . PRO B 1 5   ? 13.584  21.325  32.739  1.00 26.72 ? 5   PRO B C   1 
ATOM   1695 O  O   . PRO B 1 5   ? 14.239  20.666  31.935  1.00 26.04 ? 5   PRO B O   1 
ATOM   1696 C  CB  . PRO B 1 5   ? 14.046  23.796  32.588  1.00 25.58 ? 5   PRO B CB  1 
ATOM   1697 C  CG  . PRO B 1 5   ? 15.268  23.745  31.714  1.00 25.75 ? 5   PRO B CG  1 
ATOM   1698 C  CD  . PRO B 1 5   ? 16.356  23.332  32.692  1.00 24.53 ? 5   PRO B CD  1 
ATOM   1699 N  N   . SER B 1 6   ? 12.337  21.014  33.071  1.00 26.23 ? 6   SER B N   1 
ATOM   1700 C  CA  . SER B 1 6   ? 11.674  19.901  32.416  1.00 27.43 ? 6   SER B CA  1 
ATOM   1701 C  C   . SER B 1 6   ? 11.096  20.502  31.133  1.00 25.21 ? 6   SER B C   1 
ATOM   1702 O  O   . SER B 1 6   ? 10.880  21.712  31.059  1.00 25.67 ? 6   SER B O   1 
ATOM   1703 C  CB  . SER B 1 6   ? 10.562  19.341  33.308  1.00 29.67 ? 6   SER B CB  1 
ATOM   1704 O  OG  . SER B 1 6   ? 9.602   20.341  33.600  1.00 35.98 ? 6   SER B OG  1 
ATOM   1705 N  N   . LEU B 1 7   ? 10.873  19.677  30.118  1.00 25.79 ? 7   LEU B N   1 
ATOM   1706 C  CA  . LEU B 1 7   ? 10.325  20.171  28.859  1.00 27.52 ? 7   LEU B CA  1 
ATOM   1707 C  C   . LEU B 1 7   ? 8.837   20.450  29.013  1.00 28.08 ? 7   LEU B C   1 
ATOM   1708 O  O   . LEU B 1 7   ? 8.150   19.787  29.791  1.00 27.04 ? 7   LEU B O   1 
ATOM   1709 C  CB  . LEU B 1 7   ? 10.514  19.144  27.741  1.00 28.88 ? 7   LEU B CB  1 
ATOM   1710 C  CG  . LEU B 1 7   ? 11.932  18.739  27.352  1.00 32.68 ? 7   LEU B CG  1 
ATOM   1711 C  CD1 . LEU B 1 7   ? 11.861  17.839  26.130  1.00 33.74 ? 7   LEU B CD1 1 
ATOM   1712 C  CD2 . LEU B 1 7   ? 12.768  19.972  27.049  1.00 31.20 ? 7   LEU B CD2 1 
ATOM   1713 N  N   . PRO B 1 8   ? 8.320   21.439  28.272  1.00 28.81 ? 8   PRO B N   1 
ATOM   1714 C  CA  . PRO B 1 8   ? 6.896   21.767  28.356  1.00 27.71 ? 8   PRO B CA  1 
ATOM   1715 C  C   . PRO B 1 8   ? 6.017   20.854  27.484  1.00 27.73 ? 8   PRO B C   1 
ATOM   1716 O  O   . PRO B 1 8   ? 4.872   21.185  27.192  1.00 27.88 ? 8   PRO B O   1 
ATOM   1717 C  CB  . PRO B 1 8   ? 6.860   23.226  27.917  1.00 28.74 ? 8   PRO B CB  1 
ATOM   1718 C  CG  . PRO B 1 8   ? 7.951   23.286  26.894  1.00 29.17 ? 8   PRO B CG  1 
ATOM   1719 C  CD  . PRO B 1 8   ? 9.060   22.460  27.503  1.00 28.18 ? 8   PRO B CD  1 
ATOM   1720 N  N   . TYR B 1 9   ? 6.557   19.704  27.085  1.00 26.70 ? 9   TYR B N   1 
ATOM   1721 C  CA  . TYR B 1 9   ? 5.831   18.738  26.254  1.00 25.97 ? 9   TYR B CA  1 
ATOM   1722 C  C   . TYR B 1 9   ? 6.530   17.384  26.293  1.00 25.05 ? 9   TYR B C   1 
ATOM   1723 O  O   . TYR B 1 9   ? 7.630   17.266  26.833  1.00 24.56 ? 9   TYR B O   1 
ATOM   1724 C  CB  . TYR B 1 9   ? 5.751   19.238  24.803  1.00 28.16 ? 9   TYR B CB  1 
ATOM   1725 C  CG  . TYR B 1 9   ? 7.024   19.906  24.326  1.00 26.56 ? 9   TYR B CG  1 
ATOM   1726 C  CD1 . TYR B 1 9   ? 8.209   19.183  24.194  1.00 28.74 ? 9   TYR B CD1 1 
ATOM   1727 C  CD2 . TYR B 1 9   ? 7.061   21.280  24.085  1.00 28.47 ? 9   TYR B CD2 1 
ATOM   1728 C  CE1 . TYR B 1 9   ? 9.406   19.815  23.843  1.00 28.88 ? 9   TYR B CE1 1 
ATOM   1729 C  CE2 . TYR B 1 9   ? 8.251   21.923  23.735  1.00 27.73 ? 9   TYR B CE2 1 
ATOM   1730 C  CZ  . TYR B 1 9   ? 9.417   21.185  23.621  1.00 27.42 ? 9   TYR B CZ  1 
ATOM   1731 O  OH  . TYR B 1 9   ? 10.601  21.822  23.331  1.00 27.85 ? 9   TYR B OH  1 
ATOM   1732 N  N   . ALA B 1 10  ? 5.890   16.363  25.731  1.00 23.88 ? 10  ALA B N   1 
ATOM   1733 C  CA  . ALA B 1 10  ? 6.481   15.027  25.695  1.00 25.12 ? 10  ALA B CA  1 
ATOM   1734 C  C   . ALA B 1 10  ? 7.637   15.022  24.693  1.00 24.48 ? 10  ALA B C   1 
ATOM   1735 O  O   . ALA B 1 10  ? 7.697   15.874  23.810  1.00 24.80 ? 10  ALA B O   1 
ATOM   1736 C  CB  . ALA B 1 10  ? 5.429   13.991  25.285  1.00 26.44 ? 10  ALA B CB  1 
ATOM   1737 N  N   . TYR B 1 11  ? 8.544   14.060  24.817  1.00 25.22 ? 11  TYR B N   1 
ATOM   1738 C  CA  . TYR B 1 11  ? 9.685   13.993  23.903  1.00 26.66 ? 11  TYR B CA  1 
ATOM   1739 C  C   . TYR B 1 11  ? 9.283   13.777  22.444  1.00 26.14 ? 11  TYR B C   1 
ATOM   1740 O  O   . TYR B 1 11  ? 10.058  14.063  21.533  1.00 23.17 ? 11  TYR B O   1 
ATOM   1741 C  CB  . TYR B 1 11  ? 10.660  12.894  24.352  1.00 29.41 ? 11  TYR B CB  1 
ATOM   1742 C  CG  . TYR B 1 11  ? 11.434  13.265  25.600  1.00 31.74 ? 11  TYR B CG  1 
ATOM   1743 C  CD1 . TYR B 1 11  ? 12.272  14.378  25.612  1.00 32.67 ? 11  TYR B CD1 1 
ATOM   1744 C  CD2 . TYR B 1 11  ? 11.296  12.533  26.779  1.00 34.86 ? 11  TYR B CD2 1 
ATOM   1745 C  CE1 . TYR B 1 11  ? 12.951  14.760  26.769  1.00 35.74 ? 11  TYR B CE1 1 
ATOM   1746 C  CE2 . TYR B 1 11  ? 11.975  12.909  27.950  1.00 35.45 ? 11  TYR B CE2 1 
ATOM   1747 C  CZ  . TYR B 1 11  ? 12.798  14.025  27.935  1.00 35.35 ? 11  TYR B CZ  1 
ATOM   1748 O  OH  . TYR B 1 11  ? 13.461  14.419  29.083  1.00 35.19 ? 11  TYR B OH  1 
ATOM   1749 N  N   . ASP B 1 12  ? 8.065   13.292  22.217  1.00 26.09 ? 12  ASP B N   1 
ATOM   1750 C  CA  . ASP B 1 12  ? 7.605   13.051  20.855  1.00 26.19 ? 12  ASP B CA  1 
ATOM   1751 C  C   . ASP B 1 12  ? 6.596   14.085  20.368  1.00 25.82 ? 12  ASP B C   1 
ATOM   1752 O  O   . ASP B 1 12  ? 6.005   13.928  19.301  1.00 27.72 ? 12  ASP B O   1 
ATOM   1753 C  CB  . ASP B 1 12  ? 6.994   11.649  20.749  1.00 29.68 ? 12  ASP B CB  1 
ATOM   1754 C  CG  . ASP B 1 12  ? 5.782   11.464  21.660  1.00 31.94 ? 12  ASP B CG  1 
ATOM   1755 O  OD1 . ASP B 1 12  ? 5.423   12.408  22.395  1.00 28.31 ? 12  ASP B OD1 1 
ATOM   1756 O  OD2 . ASP B 1 12  ? 5.191   10.365  21.638  1.00 34.47 ? 12  ASP B OD2 1 
ATOM   1757 N  N   . ALA B 1 13  ? 6.417   15.154  21.133  1.00 26.08 ? 13  ALA B N   1 
ATOM   1758 C  CA  . ALA B 1 13  ? 5.453   16.191  20.776  1.00 25.66 ? 13  ALA B CA  1 
ATOM   1759 C  C   . ALA B 1 13  ? 5.796   16.996  19.523  1.00 27.35 ? 13  ALA B C   1 
ATOM   1760 O  O   . ALA B 1 13  ? 4.941   17.706  18.989  1.00 25.47 ? 13  ALA B O   1 
ATOM   1761 C  CB  . ALA B 1 13  ? 5.257   17.136  21.955  1.00 26.98 ? 13  ALA B CB  1 
ATOM   1762 N  N   . LEU B 1 14  ? 7.038   16.901  19.051  1.00 26.63 ? 14  LEU B N   1 
ATOM   1763 C  CA  . LEU B 1 14  ? 7.434   17.650  17.860  1.00 26.60 ? 14  LEU B CA  1 
ATOM   1764 C  C   . LEU B 1 14  ? 7.491   16.791  16.598  1.00 26.31 ? 14  LEU B C   1 
ATOM   1765 O  O   . LEU B 1 14  ? 7.794   17.290  15.517  1.00 25.52 ? 14  LEU B O   1 
ATOM   1766 C  CB  . LEU B 1 14  ? 8.778   18.353  18.097  1.00 26.25 ? 14  LEU B CB  1 
ATOM   1767 C  CG  . LEU B 1 14  ? 8.757   19.339  19.279  1.00 28.00 ? 14  LEU B CG  1 
ATOM   1768 C  CD1 . LEU B 1 14  ? 10.131  19.955  19.478  1.00 27.13 ? 14  LEU B CD1 1 
ATOM   1769 C  CD2 . LEU B 1 14  ? 7.716   20.430  19.026  1.00 26.82 ? 14  LEU B CD2 1 
ATOM   1770 N  N   . GLU B 1 15  ? 7.211   15.499  16.739  1.00 26.75 ? 15  GLU B N   1 
ATOM   1771 C  CA  . GLU B 1 15  ? 7.190   14.602  15.589  1.00 27.86 ? 15  GLU B CA  1 
ATOM   1772 C  C   . GLU B 1 15  ? 6.088   15.155  14.687  1.00 28.45 ? 15  GLU B C   1 
ATOM   1773 O  O   . GLU B 1 15  ? 5.143   15.774  15.175  1.00 28.65 ? 15  GLU B O   1 
ATOM   1774 C  CB  . GLU B 1 15  ? 6.831   13.180  16.029  1.00 27.96 ? 15  GLU B CB  1 
ATOM   1775 C  CG  . GLU B 1 15  ? 7.913   12.468  16.835  1.00 29.24 ? 15  GLU B CG  1 
ATOM   1776 C  CD  . GLU B 1 15  ? 9.027   11.923  15.963  1.00 29.21 ? 15  GLU B CD  1 
ATOM   1777 O  OE1 . GLU B 1 15  ? 9.011   12.196  14.745  1.00 29.43 ? 15  GLU B OE1 1 
ATOM   1778 O  OE2 . GLU B 1 15  ? 9.916   11.222  16.494  1.00 27.13 ? 15  GLU B OE2 1 
ATOM   1779 N  N   . PRO B 1 16  ? 6.186   14.937  13.365  1.00 27.92 ? 16  PRO B N   1 
ATOM   1780 C  CA  . PRO B 1 16  ? 7.239   14.213  12.650  1.00 28.60 ? 16  PRO B CA  1 
ATOM   1781 C  C   . PRO B 1 16  ? 8.391   15.115  12.201  1.00 29.14 ? 16  PRO B C   1 
ATOM   1782 O  O   . PRO B 1 16  ? 9.208   14.711  11.376  1.00 30.04 ? 16  PRO B O   1 
ATOM   1783 C  CB  . PRO B 1 16  ? 6.485   13.640  11.461  1.00 28.85 ? 16  PRO B CB  1 
ATOM   1784 C  CG  . PRO B 1 16  ? 5.609   14.811  11.087  1.00 29.45 ? 16  PRO B CG  1 
ATOM   1785 C  CD  . PRO B 1 16  ? 5.095   15.306  12.439  1.00 29.28 ? 16  PRO B CD  1 
ATOM   1786 N  N   . HIS B 1 17  ? 8.452   16.328  12.742  1.00 27.04 ? 17  HIS B N   1 
ATOM   1787 C  CA  . HIS B 1 17  ? 9.492   17.285  12.373  1.00 26.78 ? 17  HIS B CA  1 
ATOM   1788 C  C   . HIS B 1 17  ? 10.832  17.032  13.074  1.00 26.23 ? 17  HIS B C   1 
ATOM   1789 O  O   . HIS B 1 17  ? 11.849  16.831  12.409  1.00 25.44 ? 17  HIS B O   1 
ATOM   1790 C  CB  . HIS B 1 17  ? 8.982   18.697  12.649  1.00 28.01 ? 17  HIS B CB  1 
ATOM   1791 C  CG  . HIS B 1 17  ? 7.614   18.947  12.095  1.00 30.54 ? 17  HIS B CG  1 
ATOM   1792 N  ND1 . HIS B 1 17  ? 7.334   18.873  10.747  1.00 30.83 ? 17  HIS B ND1 1 
ATOM   1793 C  CD2 . HIS B 1 17  ? 6.437   19.213  12.710  1.00 29.75 ? 17  HIS B CD2 1 
ATOM   1794 C  CE1 . HIS B 1 17  ? 6.044   19.083  10.555  1.00 31.81 ? 17  HIS B CE1 1 
ATOM   1795 N  NE2 . HIS B 1 17  ? 5.477   19.292  11.731  1.00 31.63 ? 17  HIS B NE2 1 
ATOM   1796 N  N   . PHE B 1 18  ? 10.833  17.062  14.405  1.00 23.77 ? 18  PHE B N   1 
ATOM   1797 C  CA  . PHE B 1 18  ? 12.040  16.796  15.192  1.00 23.22 ? 18  PHE B CA  1 
ATOM   1798 C  C   . PHE B 1 18  ? 11.825  15.437  15.851  1.00 23.45 ? 18  PHE B C   1 
ATOM   1799 O  O   . PHE B 1 18  ? 10.802  15.220  16.506  1.00 25.48 ? 18  PHE B O   1 
ATOM   1800 C  CB  . PHE B 1 18  ? 12.238  17.857  16.280  1.00 21.65 ? 18  PHE B CB  1 
ATOM   1801 C  CG  . PHE B 1 18  ? 12.810  19.155  15.784  1.00 21.45 ? 18  PHE B CG  1 
ATOM   1802 C  CD1 . PHE B 1 18  ? 12.936  19.416  14.421  1.00 21.11 ? 18  PHE B CD1 1 
ATOM   1803 C  CD2 . PHE B 1 18  ? 13.202  20.138  16.690  1.00 20.16 ? 18  PHE B CD2 1 
ATOM   1804 C  CE1 . PHE B 1 18  ? 13.440  20.638  13.971  1.00 20.52 ? 18  PHE B CE1 1 
ATOM   1805 C  CE2 . PHE B 1 18  ? 13.706  21.362  16.246  1.00 20.07 ? 18  PHE B CE2 1 
ATOM   1806 C  CZ  . PHE B 1 18  ? 13.824  21.610  14.885  1.00 18.69 ? 18  PHE B CZ  1 
ATOM   1807 N  N   . ASP B 1 19  ? 12.783  14.535  15.680  1.00 22.05 ? 19  ASP B N   1 
ATOM   1808 C  CA  . ASP B 1 19  ? 12.693  13.187  16.221  1.00 22.20 ? 19  ASP B CA  1 
ATOM   1809 C  C   . ASP B 1 19  ? 12.782  13.073  17.739  1.00 23.78 ? 19  ASP B C   1 
ATOM   1810 O  O   . ASP B 1 19  ? 13.575  13.757  18.389  1.00 21.80 ? 19  ASP B O   1 
ATOM   1811 C  CB  . ASP B 1 19  ? 13.769  12.307  15.584  1.00 23.03 ? 19  ASP B CB  1 
ATOM   1812 C  CG  . ASP B 1 19  ? 15.169  12.841  15.824  1.00 23.31 ? 19  ASP B CG  1 
ATOM   1813 O  OD1 . ASP B 1 19  ? 15.442  13.988  15.405  1.00 23.23 ? 19  ASP B OD1 1 
ATOM   1814 O  OD2 . ASP B 1 19  ? 15.982  12.117  16.433  1.00 23.28 ? 19  ASP B OD2 1 
ATOM   1815 N  N   . LYS B 1 20  ? 11.965  12.174  18.285  1.00 23.26 ? 20  LYS B N   1 
ATOM   1816 C  CA  . LYS B 1 20  ? 11.893  11.908  19.716  1.00 24.84 ? 20  LYS B CA  1 
ATOM   1817 C  C   . LYS B 1 20  ? 13.226  11.475  20.333  1.00 23.37 ? 20  LYS B C   1 
ATOM   1818 O  O   . LYS B 1 20  ? 13.560  11.871  21.450  1.00 22.39 ? 20  LYS B O   1 
ATOM   1819 C  CB  . LYS B 1 20  ? 10.831  10.820  19.964  1.00 28.16 ? 20  LYS B CB  1 
ATOM   1820 C  CG  . LYS B 1 20  ? 10.947  10.104  21.299  1.00 36.73 ? 20  LYS B CG  1 
ATOM   1821 C  CD  . LYS B 1 20  ? 9.998   8.906   21.370  1.00 42.97 ? 20  LYS B CD  1 
ATOM   1822 C  CE  . LYS B 1 20  ? 10.273  8.039   22.601  1.00 46.12 ? 20  LYS B CE  1 
ATOM   1823 N  NZ  . LYS B 1 20  ? 10.129  8.799   23.878  1.00 48.17 ? 20  LYS B NZ  1 
ATOM   1824 N  N   . GLN B 1 21  ? 13.983  10.651  19.615  1.00 21.18 ? 21  GLN B N   1 
ATOM   1825 C  CA  . GLN B 1 21  ? 15.259  10.174  20.130  1.00 22.04 ? 21  GLN B CA  1 
ATOM   1826 C  C   . GLN B 1 21  ? 16.220  11.325  20.413  1.00 21.10 ? 21  GLN B C   1 
ATOM   1827 O  O   . GLN B 1 21  ? 16.889  11.352  21.449  1.00 20.79 ? 21  GLN B O   1 
ATOM   1828 C  CB  . GLN B 1 21  ? 15.906  9.203   19.141  1.00 25.72 ? 21  GLN B CB  1 
ATOM   1829 C  CG  . GLN B 1 21  ? 17.149  8.522   19.699  1.00 33.98 ? 21  GLN B CG  1 
ATOM   1830 C  CD  . GLN B 1 21  ? 17.816  7.567   18.711  1.00 38.14 ? 21  GLN B CD  1 
ATOM   1831 O  OE1 . GLN B 1 21  ? 18.729  6.825   19.078  1.00 40.00 ? 21  GLN B OE1 1 
ATOM   1832 N  NE2 . GLN B 1 21  ? 17.371  7.590   17.455  1.00 39.97 ? 21  GLN B NE2 1 
ATOM   1833 N  N   . THR B 1 22  ? 16.293  12.273  19.486  1.00 19.62 ? 22  THR B N   1 
ATOM   1834 C  CA  . THR B 1 22  ? 17.175  13.420  19.654  1.00 20.09 ? 22  THR B CA  1 
ATOM   1835 C  C   . THR B 1 22  ? 16.688  14.319  20.790  1.00 19.99 ? 22  THR B C   1 
ATOM   1836 O  O   . THR B 1 22  ? 17.483  14.769  21.609  1.00 19.43 ? 22  THR B O   1 
ATOM   1837 C  CB  . THR B 1 22  ? 17.278  14.232  18.344  1.00 20.01 ? 22  THR B CB  1 
ATOM   1838 O  OG1 . THR B 1 22  ? 17.969  13.451  17.359  1.00 16.91 ? 22  THR B OG1 1 
ATOM   1839 C  CG2 . THR B 1 22  ? 18.036  15.544  18.576  1.00 19.73 ? 22  THR B CG2 1 
ATOM   1840 N  N   . MET B 1 23  ? 15.386  14.578  20.847  1.00 20.43 ? 23  MET B N   1 
ATOM   1841 C  CA  . MET B 1 23  ? 14.847  15.422  21.913  1.00 21.73 ? 23  MET B CA  1 
ATOM   1842 C  C   . MET B 1 23  ? 15.262  14.891  23.287  1.00 20.83 ? 23  MET B C   1 
ATOM   1843 O  O   . MET B 1 23  ? 15.660  15.651  24.164  1.00 20.95 ? 23  MET B O   1 
ATOM   1844 C  CB  . MET B 1 23  ? 13.319  15.485  21.833  1.00 23.67 ? 23  MET B CB  1 
ATOM   1845 C  CG  . MET B 1 23  ? 12.776  16.203  20.606  1.00 23.55 ? 23  MET B CG  1 
ATOM   1846 S  SD  . MET B 1 23  ? 13.338  17.924  20.485  1.00 24.88 ? 23  MET B SD  1 
ATOM   1847 C  CE  . MET B 1 23  ? 12.713  18.603  22.019  1.00 24.76 ? 23  MET B CE  1 
ATOM   1848 N  N   . GLU B 1 24  ? 15.182  13.579  23.465  1.00 21.65 ? 24  GLU B N   1 
ATOM   1849 C  CA  . GLU B 1 24  ? 15.542  12.966  24.740  1.00 22.72 ? 24  GLU B CA  1 
ATOM   1850 C  C   . GLU B 1 24  ? 17.037  13.052  25.054  1.00 21.57 ? 24  GLU B C   1 
ATOM   1851 O  O   . GLU B 1 24  ? 17.419  13.373  26.179  1.00 21.90 ? 24  GLU B O   1 
ATOM   1852 C  CB  . GLU B 1 24  ? 15.101  11.502  24.765  1.00 27.16 ? 24  GLU B CB  1 
ATOM   1853 C  CG  . GLU B 1 24  ? 15.081  10.906  26.155  1.00 33.90 ? 24  GLU B CG  1 
ATOM   1854 C  CD  . GLU B 1 24  ? 14.690  9.446   26.150  1.00 37.60 ? 24  GLU B CD  1 
ATOM   1855 O  OE1 . GLU B 1 24  ? 13.804  9.070   25.352  1.00 40.94 ? 24  GLU B OE1 1 
ATOM   1856 O  OE2 . GLU B 1 24  ? 15.262  8.677   26.949  1.00 41.39 ? 24  GLU B OE2 1 
ATOM   1857 N  N   . ILE B 1 25  ? 17.881  12.751  24.074  1.00 19.01 ? 25  ILE B N   1 
ATOM   1858 C  CA  . ILE B 1 25  ? 19.335  12.818  24.274  1.00 19.69 ? 25  ILE B CA  1 
ATOM   1859 C  C   . ILE B 1 25  ? 19.768  14.269  24.495  1.00 17.33 ? 25  ILE B C   1 
ATOM   1860 O  O   . ILE B 1 25  ? 20.548  14.581  25.393  1.00 18.02 ? 25  ILE B O   1 
ATOM   1861 C  CB  . ILE B 1 25  ? 20.103  12.307  23.029  1.00 20.00 ? 25  ILE B CB  1 
ATOM   1862 C  CG1 . ILE B 1 25  ? 19.819  10.822  22.797  1.00 25.13 ? 25  ILE B CG1 1 
ATOM   1863 C  CG2 . ILE B 1 25  ? 21.601  12.540  23.206  1.00 18.42 ? 25  ILE B CG2 1 
ATOM   1864 C  CD1 . ILE B 1 25  ? 20.281  9.931   23.912  1.00 30.11 ? 25  ILE B CD1 1 
ATOM   1865 N  N   . HIS B 1 26  ? 19.256  15.143  23.643  1.00 17.88 ? 26  HIS B N   1 
ATOM   1866 C  CA  . HIS B 1 26  ? 19.580  16.563  23.683  1.00 17.94 ? 26  HIS B CA  1 
ATOM   1867 C  C   . HIS B 1 26  ? 19.285  17.162  25.061  1.00 19.66 ? 26  HIS B C   1 
ATOM   1868 O  O   . HIS B 1 26  ? 20.087  17.915  25.620  1.00 19.50 ? 26  HIS B O   1 
ATOM   1869 C  CB  . HIS B 1 26  ? 18.770  17.272  22.596  1.00 16.49 ? 26  HIS B CB  1 
ATOM   1870 C  CG  . HIS B 1 26  ? 19.362  18.568  22.142  1.00 15.08 ? 26  HIS B CG  1 
ATOM   1871 N  ND1 . HIS B 1 26  ? 18.751  19.372  21.204  1.00 16.95 ? 26  HIS B ND1 1 
ATOM   1872 C  CD2 . HIS B 1 26  ? 20.495  19.213  22.512  1.00 13.72 ? 26  HIS B CD2 1 
ATOM   1873 C  CE1 . HIS B 1 26  ? 19.479  20.460  21.019  1.00 15.65 ? 26  HIS B CE1 1 
ATOM   1874 N  NE2 . HIS B 1 26  ? 20.541  20.387  21.801  1.00 13.71 ? 26  HIS B NE2 1 
ATOM   1875 N  N   . HIS B 1 27  ? 18.133  16.807  25.614  1.00 20.86 ? 27  HIS B N   1 
ATOM   1876 C  CA  . HIS B 1 27  ? 17.724  17.315  26.914  1.00 20.59 ? 27  HIS B CA  1 
ATOM   1877 C  C   . HIS B 1 27  ? 18.401  16.632  28.106  1.00 20.58 ? 27  HIS B C   1 
ATOM   1878 O  O   . HIS B 1 27  ? 19.073  17.287  28.905  1.00 20.68 ? 27  HIS B O   1 
ATOM   1879 C  CB  . HIS B 1 27  ? 16.205  17.198  27.044  1.00 21.32 ? 27  HIS B CB  1 
ATOM   1880 C  CG  . HIS B 1 27  ? 15.672  17.663  28.361  1.00 22.82 ? 27  HIS B CG  1 
ATOM   1881 N  ND1 . HIS B 1 27  ? 15.026  16.822  29.241  1.00 23.61 ? 27  HIS B ND1 1 
ATOM   1882 C  CD2 . HIS B 1 27  ? 15.684  18.884  28.946  1.00 22.96 ? 27  HIS B CD2 1 
ATOM   1883 C  CE1 . HIS B 1 27  ? 14.664  17.506  30.312  1.00 24.28 ? 27  HIS B CE1 1 
ATOM   1884 N  NE2 . HIS B 1 27  ? 15.052  18.759  30.158  1.00 21.23 ? 27  HIS B NE2 1 
ATOM   1885 N  N   . THR B 1 28  ? 18.244  15.315  28.213  1.00 20.57 ? 28  THR B N   1 
ATOM   1886 C  CA  . THR B 1 28  ? 18.793  14.574  29.348  1.00 20.16 ? 28  THR B CA  1 
ATOM   1887 C  C   . THR B 1 28  ? 20.298  14.341  29.375  1.00 22.25 ? 28  THR B C   1 
ATOM   1888 O  O   . THR B 1 28  ? 20.845  14.020  30.429  1.00 20.86 ? 28  THR B O   1 
ATOM   1889 C  CB  . THR B 1 28  ? 18.109  13.199  29.508  1.00 20.70 ? 28  THR B CB  1 
ATOM   1890 O  OG1 . THR B 1 28  ? 18.520  12.327  28.450  1.00 21.95 ? 28  THR B OG1 1 
ATOM   1891 C  CG2 . THR B 1 28  ? 16.595  13.352  29.468  1.00 22.17 ? 28  THR B CG2 1 
ATOM   1892 N  N   . LYS B 1 29  ? 20.969  14.492  28.235  1.00 19.77 ? 29  LYS B N   1 
ATOM   1893 C  CA  . LYS B 1 29  ? 22.416  14.279  28.201  1.00 20.25 ? 29  LYS B CA  1 
ATOM   1894 C  C   . LYS B 1 29  ? 23.182  15.589  28.015  1.00 20.36 ? 29  LYS B C   1 
ATOM   1895 O  O   . LYS B 1 29  ? 23.933  16.013  28.897  1.00 20.53 ? 29  LYS B O   1 
ATOM   1896 C  CB  . LYS B 1 29  ? 22.789  13.315  27.070  1.00 20.90 ? 29  LYS B CB  1 
ATOM   1897 C  CG  . LYS B 1 29  ? 22.130  11.951  27.159  1.00 24.13 ? 29  LYS B CG  1 
ATOM   1898 C  CD  . LYS B 1 29  ? 22.524  11.223  28.432  1.00 29.02 ? 29  LYS B CD  1 
ATOM   1899 C  CE  . LYS B 1 29  ? 21.870  9.851   28.492  1.00 32.94 ? 29  LYS B CE  1 
ATOM   1900 N  NZ  . LYS B 1 29  ? 22.256  9.123   29.729  1.00 37.24 ? 29  LYS B NZ  1 
ATOM   1901 N  N   . HIS B 1 30  ? 22.985  16.232  26.868  1.00 17.72 ? 30  HIS B N   1 
ATOM   1902 C  CA  . HIS B 1 30  ? 23.682  17.483  26.568  1.00 17.86 ? 30  HIS B CA  1 
ATOM   1903 C  C   . HIS B 1 30  ? 23.335  18.637  27.505  1.00 18.61 ? 30  HIS B C   1 
ATOM   1904 O  O   . HIS B 1 30  ? 24.222  19.220  28.131  1.00 16.59 ? 30  HIS B O   1 
ATOM   1905 C  CB  . HIS B 1 30  ? 23.411  17.911  25.121  1.00 16.50 ? 30  HIS B CB  1 
ATOM   1906 C  CG  . HIS B 1 30  ? 24.066  17.031  24.102  1.00 18.06 ? 30  HIS B CG  1 
ATOM   1907 N  ND1 . HIS B 1 30  ? 25.434  16.938  23.971  1.00 17.51 ? 30  HIS B ND1 1 
ATOM   1908 C  CD2 . HIS B 1 30  ? 23.542  16.174  23.194  1.00 18.56 ? 30  HIS B CD2 1 
ATOM   1909 C  CE1 . HIS B 1 30  ? 25.726  16.060  23.026  1.00 18.57 ? 30  HIS B CE1 1 
ATOM   1910 N  NE2 . HIS B 1 30  ? 24.595  15.581  22.539  1.00 16.98 ? 30  HIS B NE2 1 
ATOM   1911 N  N   . HIS B 1 31  ? 22.054  18.984  27.600  1.00 18.46 ? 31  HIS B N   1 
ATOM   1912 C  CA  . HIS B 1 31  ? 21.668  20.098  28.463  1.00 18.11 ? 31  HIS B CA  1 
ATOM   1913 C  C   . HIS B 1 31  ? 22.032  19.816  29.921  1.00 18.69 ? 31  HIS B C   1 
ATOM   1914 O  O   . HIS B 1 31  ? 22.511  20.704  30.630  1.00 19.71 ? 31  HIS B O   1 
ATOM   1915 C  CB  . HIS B 1 31  ? 20.167  20.395  28.339  1.00 19.89 ? 31  HIS B CB  1 
ATOM   1916 C  CG  . HIS B 1 31  ? 19.751  21.690  28.980  1.00 19.69 ? 31  HIS B CG  1 
ATOM   1917 N  ND1 . HIS B 1 31  ? 18.476  22.200  28.867  1.00 19.92 ? 31  HIS B ND1 1 
ATOM   1918 C  CD2 . HIS B 1 31  ? 20.440  22.572  29.747  1.00 19.92 ? 31  HIS B CD2 1 
ATOM   1919 C  CE1 . HIS B 1 31  ? 18.397  23.339  29.533  1.00 21.46 ? 31  HIS B CE1 1 
ATOM   1920 N  NE2 . HIS B 1 31  ? 19.575  23.589  30.076  1.00 21.75 ? 31  HIS B NE2 1 
ATOM   1921 N  N   . GLN B 1 32  ? 21.820  18.580  30.365  1.00 17.45 ? 32  GLN B N   1 
ATOM   1922 C  CA  . GLN B 1 32  ? 22.143  18.195  31.738  1.00 18.24 ? 32  GLN B CA  1 
ATOM   1923 C  C   . GLN B 1 32  ? 23.618  18.467  32.036  1.00 20.02 ? 32  GLN B C   1 
ATOM   1924 O  O   . GLN B 1 32  ? 23.971  18.930  33.125  1.00 19.46 ? 32  GLN B O   1 
ATOM   1925 C  CB  . GLN B 1 32  ? 21.856  16.703  31.954  1.00 19.78 ? 32  GLN B CB  1 
ATOM   1926 C  CG  . GLN B 1 32  ? 22.363  16.135  33.285  1.00 19.48 ? 32  GLN B CG  1 
ATOM   1927 C  CD  . GLN B 1 32  ? 21.498  16.537  34.470  1.00 21.47 ? 32  GLN B CD  1 
ATOM   1928 O  OE1 . GLN B 1 32  ? 20.407  16.005  34.654  1.00 22.34 ? 32  GLN B OE1 1 
ATOM   1929 N  NE2 . GLN B 1 32  ? 21.980  17.484  35.270  1.00 20.75 ? 32  GLN B NE2 1 
ATOM   1930 N  N   . THR B 1 33  ? 24.477  18.171  31.065  1.00 18.34 ? 33  THR B N   1 
ATOM   1931 C  CA  . THR B 1 33  ? 25.915  18.384  31.231  1.00 19.49 ? 33  THR B CA  1 
ATOM   1932 C  C   . THR B 1 33  ? 26.280  19.853  31.431  1.00 17.24 ? 33  THR B C   1 
ATOM   1933 O  O   . THR B 1 33  ? 27.132  20.176  32.258  1.00 19.26 ? 33  THR B O   1 
ATOM   1934 C  CB  . THR B 1 33  ? 26.684  17.808  30.019  1.00 18.69 ? 33  THR B CB  1 
ATOM   1935 O  OG1 . THR B 1 33  ? 26.650  16.379  30.097  1.00 19.16 ? 33  THR B OG1 1 
ATOM   1936 C  CG2 . THR B 1 33  ? 28.143  18.282  30.008  1.00 21.20 ? 33  THR B CG2 1 
ATOM   1937 N  N   . TYR B 1 34  ? 25.642  20.742  30.680  1.00 18.23 ? 34  TYR B N   1 
ATOM   1938 C  CA  . TYR B 1 34  ? 25.921  22.167  30.813  1.00 18.13 ? 34  TYR B CA  1 
ATOM   1939 C  C   . TYR B 1 34  ? 25.505  22.651  32.201  1.00 18.37 ? 34  TYR B C   1 
ATOM   1940 O  O   . TYR B 1 34  ? 26.206  23.441  32.832  1.00 19.75 ? 34  TYR B O   1 
ATOM   1941 C  CB  . TYR B 1 34  ? 25.175  22.953  29.731  1.00 19.99 ? 34  TYR B CB  1 
ATOM   1942 C  CG  . TYR B 1 34  ? 25.456  22.460  28.325  1.00 20.37 ? 34  TYR B CG  1 
ATOM   1943 C  CD1 . TYR B 1 34  ? 26.748  22.095  27.940  1.00 22.41 ? 34  TYR B CD1 1 
ATOM   1944 C  CD2 . TYR B 1 34  ? 24.433  22.345  27.384  1.00 20.84 ? 34  TYR B CD2 1 
ATOM   1945 C  CE1 . TYR B 1 34  ? 27.015  21.621  26.652  1.00 22.82 ? 34  TYR B CE1 1 
ATOM   1946 C  CE2 . TYR B 1 34  ? 24.689  21.875  26.094  1.00 22.00 ? 34  TYR B CE2 1 
ATOM   1947 C  CZ  . TYR B 1 34  ? 25.980  21.512  25.738  1.00 23.39 ? 34  TYR B CZ  1 
ATOM   1948 O  OH  . TYR B 1 34  ? 26.235  21.023  24.475  1.00 26.51 ? 34  TYR B OH  1 
ATOM   1949 N  N   . VAL B 1 35  ? 24.359  22.175  32.674  1.00 19.45 ? 35  VAL B N   1 
ATOM   1950 C  CA  . VAL B 1 35  ? 23.883  22.559  33.995  1.00 19.26 ? 35  VAL B CA  1 
ATOM   1951 C  C   . VAL B 1 35  ? 24.861  22.062  35.059  1.00 19.17 ? 35  VAL B C   1 
ATOM   1952 O  O   . VAL B 1 35  ? 25.235  22.813  35.957  1.00 22.75 ? 35  VAL B O   1 
ATOM   1953 C  CB  . VAL B 1 35  ? 22.483  21.996  34.272  1.00 18.34 ? 35  VAL B CB  1 
ATOM   1954 C  CG1 . VAL B 1 35  ? 22.136  22.176  35.740  1.00 18.66 ? 35  VAL B CG1 1 
ATOM   1955 C  CG2 . VAL B 1 35  ? 21.464  22.733  33.412  1.00 18.67 ? 35  VAL B CG2 1 
ATOM   1956 N  N   . ASN B 1 36  ? 25.286  20.810  34.946  1.00 18.68 ? 36  ASN B N   1 
ATOM   1957 C  CA  . ASN B 1 36  ? 26.225  20.249  35.906  1.00 20.70 ? 36  ASN B CA  1 
ATOM   1958 C  C   . ASN B 1 36  ? 27.532  21.024  35.953  1.00 20.36 ? 36  ASN B C   1 
ATOM   1959 O  O   . ASN B 1 36  ? 28.023  21.365  37.029  1.00 18.78 ? 36  ASN B O   1 
ATOM   1960 C  CB  . ASN B 1 36  ? 26.520  18.796  35.570  1.00 19.91 ? 36  ASN B CB  1 
ATOM   1961 C  CG  . ASN B 1 36  ? 25.368  17.890  35.906  1.00 21.85 ? 36  ASN B CG  1 
ATOM   1962 O  OD1 . ASN B 1 36  ? 24.508  18.246  36.710  1.00 23.71 ? 36  ASN B OD1 1 
ATOM   1963 N  ND2 . ASN B 1 36  ? 25.346  16.707  35.308  1.00 20.11 ? 36  ASN B ND2 1 
ATOM   1964 N  N   . ASN B 1 37  ? 28.102  21.292  34.783  1.00 21.94 ? 37  ASN B N   1 
ATOM   1965 C  CA  . ASN B 1 37  ? 29.364  22.017  34.727  1.00 22.83 ? 37  ASN B CA  1 
ATOM   1966 C  C   . ASN B 1 37  ? 29.248  23.452  35.219  1.00 22.88 ? 37  ASN B C   1 
ATOM   1967 O  O   . ASN B 1 37  ? 30.163  23.957  35.865  1.00 24.65 ? 37  ASN B O   1 
ATOM   1968 C  CB  . ASN B 1 37  ? 29.948  21.994  33.311  1.00 22.43 ? 37  ASN B CB  1 
ATOM   1969 C  CG  . ASN B 1 37  ? 30.452  20.617  32.918  1.00 23.73 ? 37  ASN B CG  1 
ATOM   1970 O  OD1 . ASN B 1 37  ? 30.916  19.852  33.761  1.00 26.31 ? 37  ASN B OD1 1 
ATOM   1971 N  ND2 . ASN B 1 37  ? 30.372  20.299  31.636  1.00 26.41 ? 37  ASN B ND2 1 
ATOM   1972 N  N   . ALA B 1 38  ? 28.133  24.113  34.914  1.00 21.94 ? 38  ALA B N   1 
ATOM   1973 C  CA  . ALA B 1 38  ? 27.935  25.488  35.363  1.00 22.20 ? 38  ALA B CA  1 
ATOM   1974 C  C   . ALA B 1 38  ? 27.840  25.517  36.891  1.00 24.32 ? 38  ALA B C   1 
ATOM   1975 O  O   . ALA B 1 38  ? 28.466  26.355  37.543  1.00 25.37 ? 38  ALA B O   1 
ATOM   1976 C  CB  . ALA B 1 38  ? 26.659  26.075  34.746  1.00 21.21 ? 38  ALA B CB  1 
ATOM   1977 N  N   . ASN B 1 39  ? 27.061  24.597  37.461  1.00 25.50 ? 39  ASN B N   1 
ATOM   1978 C  CA  . ASN B 1 39  ? 26.904  24.540  38.912  1.00 25.22 ? 39  ASN B CA  1 
ATOM   1979 C  C   . ASN B 1 39  ? 28.229  24.268  39.615  1.00 26.10 ? 39  ASN B C   1 
ATOM   1980 O  O   . ASN B 1 39  ? 28.517  24.873  40.642  1.00 26.33 ? 39  ASN B O   1 
ATOM   1981 C  CB  . ASN B 1 39  ? 25.866  23.481  39.316  1.00 24.94 ? 39  ASN B CB  1 
ATOM   1982 C  CG  . ASN B 1 39  ? 24.431  23.931  39.049  1.00 25.04 ? 39  ASN B CG  1 
ATOM   1983 O  OD1 . ASN B 1 39  ? 24.116  25.119  39.134  1.00 26.08 ? 39  ASN B OD1 1 
ATOM   1984 N  ND2 . ASN B 1 39  ? 23.557  22.983  38.745  1.00 24.62 ? 39  ASN B ND2 1 
ATOM   1985 N  N   . ALA B 1 40  ? 29.039  23.370  39.059  1.00 27.19 ? 40  ALA B N   1 
ATOM   1986 C  CA  . ALA B 1 40  ? 30.325  23.048  39.663  1.00 27.91 ? 40  ALA B CA  1 
ATOM   1987 C  C   . ALA B 1 40  ? 31.219  24.284  39.719  1.00 29.11 ? 40  ALA B C   1 
ATOM   1988 O  O   . ALA B 1 40  ? 31.925  24.502  40.702  1.00 29.68 ? 40  ALA B O   1 
ATOM   1989 C  CB  . ALA B 1 40  ? 31.010  21.923  38.887  1.00 28.28 ? 40  ALA B CB  1 
ATOM   1990 N  N   . ALA B 1 41  ? 31.174  25.099  38.671  1.00 29.08 ? 41  ALA B N   1 
ATOM   1991 C  CA  . ALA B 1 41  ? 31.986  26.309  38.612  1.00 30.91 ? 41  ALA B CA  1 
ATOM   1992 C  C   . ALA B 1 41  ? 31.469  27.395  39.554  1.00 32.38 ? 41  ALA B C   1 
ATOM   1993 O  O   . ALA B 1 41  ? 32.254  28.163  40.112  1.00 32.87 ? 41  ALA B O   1 
ATOM   1994 C  CB  . ALA B 1 41  ? 32.022  26.840  37.180  1.00 28.58 ? 41  ALA B CB  1 
ATOM   1995 N  N   . LEU B 1 42  ? 30.151  27.453  39.731  1.00 32.37 ? 42  LEU B N   1 
ATOM   1996 C  CA  . LEU B 1 42  ? 29.543  28.469  40.586  1.00 35.09 ? 42  LEU B CA  1 
ATOM   1997 C  C   . LEU B 1 42  ? 29.615  28.158  42.074  1.00 38.29 ? 42  LEU B C   1 
ATOM   1998 O  O   . LEU B 1 42  ? 29.334  29.019  42.910  1.00 38.35 ? 42  LEU B O   1 
ATOM   1999 C  CB  . LEU B 1 42  ? 28.083  28.686  40.183  1.00 33.93 ? 42  LEU B CB  1 
ATOM   2000 C  CG  . LEU B 1 42  ? 27.848  29.311  38.806  1.00 34.09 ? 42  LEU B CG  1 
ATOM   2001 C  CD1 . LEU B 1 42  ? 26.361  29.326  38.504  1.00 33.97 ? 42  LEU B CD1 1 
ATOM   2002 C  CD2 . LEU B 1 42  ? 28.420  30.720  38.770  1.00 35.29 ? 42  LEU B CD2 1 
ATOM   2003 N  N   . GLU B 1 43  ? 29.996  26.928  42.395  1.00 42.70 ? 43  GLU B N   1 
ATOM   2004 C  CA  . GLU B 1 43  ? 30.097  26.484  43.776  1.00 48.80 ? 43  GLU B CA  1 
ATOM   2005 C  C   . GLU B 1 43  ? 30.831  27.471  44.684  1.00 50.37 ? 43  GLU B C   1 
ATOM   2006 O  O   . GLU B 1 43  ? 30.352  27.799  45.769  1.00 51.29 ? 43  GLU B O   1 
ATOM   2007 C  CB  . GLU B 1 43  ? 30.800  25.131  43.827  1.00 51.74 ? 43  GLU B CB  1 
ATOM   2008 C  CG  . GLU B 1 43  ? 30.819  24.499  45.199  1.00 58.47 ? 43  GLU B CG  1 
ATOM   2009 C  CD  . GLU B 1 43  ? 31.601  23.207  45.215  1.00 62.58 ? 43  GLU B CD  1 
ATOM   2010 O  OE1 . GLU B 1 43  ? 31.257  22.295  44.430  1.00 65.68 ? 43  GLU B OE1 1 
ATOM   2011 O  OE2 . GLU B 1 43  ? 32.561  23.104  46.009  1.00 64.94 ? 43  GLU B OE2 1 
ATOM   2012 N  N   . SER B 1 44  ? 31.989  27.944  44.233  1.00 51.64 ? 44  SER B N   1 
ATOM   2013 C  CA  . SER B 1 44  ? 32.796  28.877  45.014  1.00 53.26 ? 44  SER B CA  1 
ATOM   2014 C  C   . SER B 1 44  ? 32.459  30.348  44.785  1.00 53.69 ? 44  SER B C   1 
ATOM   2015 O  O   . SER B 1 44  ? 33.110  31.231  45.346  1.00 54.06 ? 44  SER B O   1 
ATOM   2016 C  CB  . SER B 1 44  ? 34.277  28.651  44.712  1.00 54.21 ? 44  SER B CB  1 
ATOM   2017 O  OG  . SER B 1 44  ? 34.544  28.836  43.331  1.00 56.17 ? 44  SER B OG  1 
ATOM   2018 N  N   . LEU B 1 45  ? 31.452  30.617  43.960  1.00 53.21 ? 45  LEU B N   1 
ATOM   2019 C  CA  . LEU B 1 45  ? 31.060  31.994  43.679  1.00 52.94 ? 45  LEU B CA  1 
ATOM   2020 C  C   . LEU B 1 45  ? 29.621  32.274  44.099  1.00 52.78 ? 45  LEU B C   1 
ATOM   2021 O  O   . LEU B 1 45  ? 28.755  32.518  43.259  1.00 51.53 ? 45  LEU B O   1 
ATOM   2022 C  CB  . LEU B 1 45  ? 31.230  32.307  42.189  1.00 52.78 ? 45  LEU B CB  1 
ATOM   2023 C  CG  . LEU B 1 45  ? 32.651  32.413  41.628  1.00 53.98 ? 45  LEU B CG  1 
ATOM   2024 C  CD1 . LEU B 1 45  ? 33.381  31.093  41.786  1.00 54.94 ? 45  LEU B CD1 1 
ATOM   2025 C  CD2 . LEU B 1 45  ? 32.583  32.797  40.159  1.00 53.66 ? 45  LEU B CD2 1 
ATOM   2026 N  N   . PRO B 1 46  ? 29.349  32.243  45.414  1.00 53.54 ? 46  PRO B N   1 
ATOM   2027 C  CA  . PRO B 1 46  ? 28.003  32.497  45.938  1.00 53.30 ? 46  PRO B CA  1 
ATOM   2028 C  C   . PRO B 1 46  ? 27.392  33.789  45.397  1.00 53.01 ? 46  PRO B C   1 
ATOM   2029 O  O   . PRO B 1 46  ? 26.191  33.856  45.141  1.00 53.19 ? 46  PRO B O   1 
ATOM   2030 C  CB  . PRO B 1 46  ? 28.231  32.553  47.446  1.00 53.91 ? 46  PRO B CB  1 
ATOM   2031 C  CG  . PRO B 1 46  ? 29.344  31.566  47.641  1.00 53.97 ? 46  PRO B CG  1 
ATOM   2032 C  CD  . PRO B 1 46  ? 30.283  31.922  46.509  1.00 53.55 ? 46  PRO B CD  1 
ATOM   2033 N  N   . GLU B 1 47  ? 28.227  34.809  45.218  1.00 53.31 ? 47  GLU B N   1 
ATOM   2034 C  CA  . GLU B 1 47  ? 27.768  36.099  44.715  1.00 53.66 ? 47  GLU B CA  1 
ATOM   2035 C  C   . GLU B 1 47  ? 27.155  36.008  43.318  1.00 53.18 ? 47  GLU B C   1 
ATOM   2036 O  O   . GLU B 1 47  ? 26.228  36.750  42.990  1.00 53.66 ? 47  GLU B O   1 
ATOM   2037 C  CB  . GLU B 1 47  ? 28.921  37.110  44.696  1.00 54.68 ? 47  GLU B CB  1 
ATOM   2038 C  CG  . GLU B 1 47  ? 30.093  36.731  43.799  1.00 57.63 ? 47  GLU B CG  1 
ATOM   2039 C  CD  . GLU B 1 47  ? 31.143  35.894  44.512  1.00 59.08 ? 47  GLU B CD  1 
ATOM   2040 O  OE1 . GLU B 1 47  ? 30.783  34.850  45.097  1.00 59.29 ? 47  GLU B OE1 1 
ATOM   2041 O  OE2 . GLU B 1 47  ? 32.331  36.282  44.481  1.00 59.83 ? 47  GLU B OE2 1 
ATOM   2042 N  N   . PHE B 1 48  ? 27.674  35.097  42.500  1.00 51.79 ? 48  PHE B N   1 
ATOM   2043 C  CA  . PHE B 1 48  ? 27.181  34.922  41.137  1.00 49.90 ? 48  PHE B CA  1 
ATOM   2044 C  C   . PHE B 1 48  ? 26.156  33.800  41.010  1.00 48.86 ? 48  PHE B C   1 
ATOM   2045 O  O   . PHE B 1 48  ? 25.322  33.816  40.106  1.00 48.38 ? 48  PHE B O   1 
ATOM   2046 C  CB  . PHE B 1 48  ? 28.353  34.647  40.189  1.00 49.76 ? 48  PHE B CB  1 
ATOM   2047 C  CG  . PHE B 1 48  ? 29.259  35.829  39.982  1.00 50.27 ? 48  PHE B CG  1 
ATOM   2048 C  CD1 . PHE B 1 48  ? 28.818  36.945  39.282  1.00 50.82 ? 48  PHE B CD1 1 
ATOM   2049 C  CD2 . PHE B 1 48  ? 30.556  35.825  40.487  1.00 51.67 ? 48  PHE B CD2 1 
ATOM   2050 C  CE1 . PHE B 1 48  ? 29.656  38.046  39.085  1.00 51.91 ? 48  PHE B CE1 1 
ATOM   2051 C  CE2 . PHE B 1 48  ? 31.402  36.920  40.297  1.00 51.98 ? 48  PHE B CE2 1 
ATOM   2052 C  CZ  . PHE B 1 48  ? 30.949  38.033  39.593  1.00 51.88 ? 48  PHE B CZ  1 
ATOM   2053 N  N   . ALA B 1 49  ? 26.212  32.833  41.920  1.00 46.96 ? 49  ALA B N   1 
ATOM   2054 C  CA  . ALA B 1 49  ? 25.296  31.701  41.881  1.00 47.42 ? 49  ALA B CA  1 
ATOM   2055 C  C   . ALA B 1 49  ? 23.831  32.075  42.088  1.00 47.66 ? 49  ALA B C   1 
ATOM   2056 O  O   . ALA B 1 49  ? 22.935  31.322  41.705  1.00 46.12 ? 49  ALA B O   1 
ATOM   2057 C  CB  . ALA B 1 49  ? 25.716  30.666  42.914  1.00 47.19 ? 49  ALA B CB  1 
ATOM   2058 N  N   . ASN B 1 50  ? 23.585  33.240  42.677  1.00 48.39 ? 50  ASN B N   1 
ATOM   2059 C  CA  . ASN B 1 50  ? 22.219  33.684  42.945  1.00 49.57 ? 50  ASN B CA  1 
ATOM   2060 C  C   . ASN B 1 50  ? 21.528  34.349  41.758  1.00 48.00 ? 50  ASN B C   1 
ATOM   2061 O  O   . ASN B 1 50  ? 20.301  34.432  41.715  1.00 48.77 ? 50  ASN B O   1 
ATOM   2062 C  CB  . ASN B 1 50  ? 22.209  34.648  44.133  1.00 53.15 ? 50  ASN B CB  1 
ATOM   2063 C  CG  . ASN B 1 50  ? 22.887  34.067  45.356  1.00 56.02 ? 50  ASN B CG  1 
ATOM   2064 O  OD1 . ASN B 1 50  ? 22.558  32.963  45.797  1.00 57.40 ? 50  ASN B OD1 1 
ATOM   2065 N  ND2 . ASN B 1 50  ? 23.838  34.808  45.915  1.00 57.07 ? 50  ASN B ND2 1 
ATOM   2066 N  N   . LEU B 1 51  ? 22.312  34.822  40.798  1.00 45.95 ? 51  LEU B N   1 
ATOM   2067 C  CA  . LEU B 1 51  ? 21.760  35.489  39.622  1.00 43.29 ? 51  LEU B CA  1 
ATOM   2068 C  C   . LEU B 1 51  ? 21.094  34.528  38.642  1.00 40.67 ? 51  LEU B C   1 
ATOM   2069 O  O   . LEU B 1 51  ? 21.451  33.351  38.569  1.00 39.94 ? 51  LEU B O   1 
ATOM   2070 C  CB  . LEU B 1 51  ? 22.869  36.235  38.877  1.00 44.58 ? 51  LEU B CB  1 
ATOM   2071 C  CG  . LEU B 1 51  ? 23.711  37.253  39.645  1.00 46.72 ? 51  LEU B CG  1 
ATOM   2072 C  CD1 . LEU B 1 51  ? 24.839  37.749  38.752  1.00 46.88 ? 51  LEU B CD1 1 
ATOM   2073 C  CD2 . LEU B 1 51  ? 22.835  38.408  40.097  1.00 48.03 ? 51  LEU B CD2 1 
ATOM   2074 N  N   . PRO B 1 52  ? 20.096  35.015  37.886  1.00 37.82 ? 52  PRO B N   1 
ATOM   2075 C  CA  . PRO B 1 52  ? 19.432  34.143  36.912  1.00 36.46 ? 52  PRO B CA  1 
ATOM   2076 C  C   . PRO B 1 52  ? 20.498  33.921  35.835  1.00 34.19 ? 52  PRO B C   1 
ATOM   2077 O  O   . PRO B 1 52  ? 21.341  34.794  35.626  1.00 31.31 ? 52  PRO B O   1 
ATOM   2078 C  CB  . PRO B 1 52  ? 18.279  35.006  36.400  1.00 37.93 ? 52  PRO B CB  1 
ATOM   2079 C  CG  . PRO B 1 52  ? 18.015  35.954  37.541  1.00 37.58 ? 52  PRO B CG  1 
ATOM   2080 C  CD  . PRO B 1 52  ? 19.405  36.311  37.990  1.00 37.25 ? 52  PRO B CD  1 
ATOM   2081 N  N   . VAL B 1 53  ? 20.478  32.779  35.155  1.00 32.61 ? 53  VAL B N   1 
ATOM   2082 C  CA  . VAL B 1 53  ? 21.498  32.524  34.142  1.00 31.21 ? 53  VAL B CA  1 
ATOM   2083 C  C   . VAL B 1 53  ? 21.561  33.603  33.060  1.00 31.52 ? 53  VAL B C   1 
ATOM   2084 O  O   . VAL B 1 53  ? 22.649  33.974  32.622  1.00 32.85 ? 53  VAL B O   1 
ATOM   2085 C  CB  . VAL B 1 53  ? 21.314  31.125  33.481  1.00 29.38 ? 53  VAL B CB  1 
ATOM   2086 C  CG1 . VAL B 1 53  ? 20.003  31.056  32.724  1.00 27.43 ? 53  VAL B CG1 1 
ATOM   2087 C  CG2 . VAL B 1 53  ? 22.494  30.833  32.559  1.00 29.52 ? 53  VAL B CG2 1 
ATOM   2088 N  N   . GLU B 1 54  ? 20.407  34.115  32.640  1.00 33.05 ? 54  GLU B N   1 
ATOM   2089 C  CA  . GLU B 1 54  ? 20.369  35.150  31.607  1.00 36.61 ? 54  GLU B CA  1 
ATOM   2090 C  C   . GLU B 1 54  ? 21.111  36.400  32.056  1.00 37.83 ? 54  GLU B C   1 
ATOM   2091 O  O   . GLU B 1 54  ? 21.641  37.154  31.237  1.00 38.11 ? 54  GLU B O   1 
ATOM   2092 C  CB  . GLU B 1 54  ? 18.929  35.544  31.266  1.00 40.04 ? 54  GLU B CB  1 
ATOM   2093 C  CG  . GLU B 1 54  ? 18.047  34.431  30.725  1.00 46.13 ? 54  GLU B CG  1 
ATOM   2094 C  CD  . GLU B 1 54  ? 17.612  33.455  31.799  1.00 49.37 ? 54  GLU B CD  1 
ATOM   2095 O  OE1 . GLU B 1 54  ? 17.381  33.901  32.943  1.00 49.47 ? 54  GLU B OE1 1 
ATOM   2096 O  OE2 . GLU B 1 54  ? 17.485  32.249  31.496  1.00 51.94 ? 54  GLU B OE2 1 
ATOM   2097 N  N   . GLU B 1 55  ? 21.143  36.627  33.361  1.00 38.25 ? 55  GLU B N   1 
ATOM   2098 C  CA  . GLU B 1 55  ? 21.822  37.797  33.894  1.00 39.60 ? 55  GLU B CA  1 
ATOM   2099 C  C   . GLU B 1 55  ? 23.319  37.526  34.035  1.00 36.99 ? 55  GLU B C   1 
ATOM   2100 O  O   . GLU B 1 55  ? 24.146  38.372  33.700  1.00 36.62 ? 55  GLU B O   1 
ATOM   2101 C  CB  . GLU B 1 55  ? 21.217  38.172  35.247  1.00 42.93 ? 55  GLU B CB  1 
ATOM   2102 C  CG  . GLU B 1 55  ? 21.644  39.531  35.759  1.00 49.64 ? 55  GLU B CG  1 
ATOM   2103 C  CD  . GLU B 1 55  ? 20.904  39.922  37.020  1.00 52.97 ? 55  GLU B CD  1 
ATOM   2104 O  OE1 . GLU B 1 55  ? 19.654  39.939  36.987  1.00 55.03 ? 55  GLU B OE1 1 
ATOM   2105 O  OE2 . GLU B 1 55  ? 21.570  40.210  38.037  1.00 54.87 ? 55  GLU B OE2 1 
ATOM   2106 N  N   . LEU B 1 56  ? 23.659  36.337  34.522  1.00 35.14 ? 56  LEU B N   1 
ATOM   2107 C  CA  . LEU B 1 56  ? 25.056  35.954  34.699  1.00 33.10 ? 56  LEU B CA  1 
ATOM   2108 C  C   . LEU B 1 56  ? 25.867  36.072  33.410  1.00 32.37 ? 56  LEU B C   1 
ATOM   2109 O  O   . LEU B 1 56  ? 26.996  36.570  33.426  1.00 30.03 ? 56  LEU B O   1 
ATOM   2110 C  CB  . LEU B 1 56  ? 25.154  34.515  35.213  1.00 34.51 ? 56  LEU B CB  1 
ATOM   2111 C  CG  . LEU B 1 56  ? 26.581  33.979  35.379  1.00 36.89 ? 56  LEU B CG  1 
ATOM   2112 C  CD1 . LEU B 1 56  ? 27.277  34.720  36.502  1.00 37.93 ? 56  LEU B CD1 1 
ATOM   2113 C  CD2 . LEU B 1 56  ? 26.549  32.495  35.679  1.00 39.04 ? 56  LEU B CD2 1 
ATOM   2114 N  N   . ILE B 1 57  ? 25.297  35.626  32.292  1.00 30.21 ? 57  ILE B N   1 
ATOM   2115 C  CA  . ILE B 1 57  ? 26.031  35.676  31.031  1.00 29.90 ? 57  ILE B CA  1 
ATOM   2116 C  C   . ILE B 1 57  ? 26.268  37.082  30.472  1.00 31.25 ? 57  ILE B C   1 
ATOM   2117 O  O   . ILE B 1 57  ? 26.976  37.246  29.475  1.00 29.05 ? 57  ILE B O   1 
ATOM   2118 C  CB  . ILE B 1 57  ? 25.382  34.731  29.953  1.00 27.89 ? 57  ILE B CB  1 
ATOM   2119 C  CG1 . ILE B 1 57  ? 23.913  35.069  29.718  1.00 29.07 ? 57  ILE B CG1 1 
ATOM   2120 C  CG2 . ILE B 1 57  ? 25.460  33.280  30.430  1.00 24.54 ? 57  ILE B CG2 1 
ATOM   2121 C  CD1 . ILE B 1 57  ? 23.693  36.331  28.955  1.00 36.43 ? 57  ILE B CD1 1 
ATOM   2122 N  N   . THR B 1 58  ? 25.701  38.101  31.118  1.00 32.74 ? 58  THR B N   1 
ATOM   2123 C  CA  . THR B 1 58  ? 25.920  39.479  30.673  1.00 35.22 ? 58  THR B CA  1 
ATOM   2124 C  C   . THR B 1 58  ? 27.050  40.092  31.505  1.00 36.87 ? 58  THR B C   1 
ATOM   2125 O  O   . THR B 1 58  ? 27.475  41.220  31.261  1.00 37.17 ? 58  THR B O   1 
ATOM   2126 C  CB  . THR B 1 58  ? 24.667  40.371  30.864  1.00 35.77 ? 58  THR B CB  1 
ATOM   2127 O  OG1 . THR B 1 58  ? 24.447  40.593  32.263  1.00 36.10 ? 58  THR B OG1 1 
ATOM   2128 C  CG2 . THR B 1 58  ? 23.440  39.716  30.260  1.00 36.26 ? 58  THR B CG2 1 
ATOM   2129 N  N   . LYS B 1 59  ? 27.543  39.338  32.481  1.00 38.36 ? 59  LYS B N   1 
ATOM   2130 C  CA  . LYS B 1 59  ? 28.598  39.825  33.365  1.00 39.23 ? 59  LYS B CA  1 
ATOM   2131 C  C   . LYS B 1 59  ? 29.819  38.914  33.413  1.00 39.23 ? 59  LYS B C   1 
ATOM   2132 O  O   . LYS B 1 59  ? 30.513  38.851  34.427  1.00 37.82 ? 59  LYS B O   1 
ATOM   2133 C  CB  . LYS B 1 59  ? 28.036  39.986  34.781  1.00 41.72 ? 59  LYS B CB  1 
ATOM   2134 C  CG  . LYS B 1 59  ? 26.835  40.912  34.862  1.00 43.83 ? 59  LYS B CG  1 
ATOM   2135 C  CD  . LYS B 1 59  ? 26.201  40.898  36.242  1.00 47.52 ? 59  LYS B CD  1 
ATOM   2136 C  CE  . LYS B 1 59  ? 25.019  41.860  36.301  1.00 49.46 ? 59  LYS B CE  1 
ATOM   2137 N  NZ  . LYS B 1 59  ? 24.320  41.834  37.621  1.00 50.98 ? 59  LYS B NZ  1 
ATOM   2138 N  N   . LEU B 1 60  ? 30.088  38.218  32.315  1.00 39.53 ? 60  LEU B N   1 
ATOM   2139 C  CA  . LEU B 1 60  ? 31.224  37.305  32.258  1.00 39.89 ? 60  LEU B CA  1 
ATOM   2140 C  C   . LEU B 1 60  ? 32.560  37.979  32.559  1.00 42.03 ? 60  LEU B C   1 
ATOM   2141 O  O   . LEU B 1 60  ? 33.475  37.347  33.090  1.00 40.49 ? 60  LEU B O   1 
ATOM   2142 C  CB  . LEU B 1 60  ? 31.282  36.629  30.884  1.00 38.77 ? 60  LEU B CB  1 
ATOM   2143 C  CG  . LEU B 1 60  ? 30.060  35.776  30.524  1.00 37.81 ? 60  LEU B CG  1 
ATOM   2144 C  CD1 . LEU B 1 60  ? 30.190  35.274  29.094  1.00 37.00 ? 60  LEU B CD1 1 
ATOM   2145 C  CD2 . LEU B 1 60  ? 29.936  34.610  31.502  1.00 35.59 ? 60  LEU B CD2 1 
ATOM   2146 N  N   . ASP B 1 61  ? 32.673  39.260  32.223  1.00 45.52 ? 61  ASP B N   1 
ATOM   2147 C  CA  . ASP B 1 61  ? 33.914  39.996  32.459  1.00 50.01 ? 61  ASP B CA  1 
ATOM   2148 C  C   . ASP B 1 61  ? 34.216  40.250  33.935  1.00 50.13 ? 61  ASP B C   1 
ATOM   2149 O  O   . ASP B 1 61  ? 35.349  40.566  34.292  1.00 50.16 ? 61  ASP B O   1 
ATOM   2150 C  CB  . ASP B 1 61  ? 33.888  41.331  31.709  1.00 53.61 ? 61  ASP B CB  1 
ATOM   2151 C  CG  . ASP B 1 61  ? 33.968  41.155  30.202  1.00 58.88 ? 61  ASP B CG  1 
ATOM   2152 O  OD1 . ASP B 1 61  ? 34.966  40.570  29.721  1.00 59.51 ? 61  ASP B OD1 1 
ATOM   2153 O  OD2 . ASP B 1 61  ? 33.033  41.602  29.499  1.00 62.08 ? 61  ASP B OD2 1 
ATOM   2154 N  N   . GLN B 1 62  ? 33.211  40.105  34.792  1.00 50.41 ? 62  GLN B N   1 
ATOM   2155 C  CA  . GLN B 1 62  ? 33.398  40.335  36.219  1.00 51.90 ? 62  GLN B CA  1 
ATOM   2156 C  C   . GLN B 1 62  ? 33.798  39.073  36.975  1.00 51.92 ? 62  GLN B C   1 
ATOM   2157 O  O   . GLN B 1 62  ? 34.040  39.117  38.180  1.00 51.98 ? 62  GLN B O   1 
ATOM   2158 C  CB  . GLN B 1 62  ? 32.117  40.903  36.827  1.00 53.32 ? 62  GLN B CB  1 
ATOM   2159 C  CG  . GLN B 1 62  ? 31.647  42.183  36.170  1.00 56.34 ? 62  GLN B CG  1 
ATOM   2160 C  CD  . GLN B 1 62  ? 30.326  42.675  36.729  1.00 58.74 ? 62  GLN B CD  1 
ATOM   2161 O  OE1 . GLN B 1 62  ? 29.749  43.639  36.224  1.00 60.77 ? 62  GLN B OE1 1 
ATOM   2162 N  NE2 . GLN B 1 62  ? 29.841  42.017  37.777  1.00 59.49 ? 62  GLN B NE2 1 
ATOM   2163 N  N   . LEU B 1 63  ? 33.860  37.949  36.271  1.00 51.62 ? 63  LEU B N   1 
ATOM   2164 C  CA  . LEU B 1 63  ? 34.230  36.682  36.895  1.00 51.34 ? 63  LEU B CA  1 
ATOM   2165 C  C   . LEU B 1 63  ? 35.744  36.540  36.939  1.00 51.70 ? 63  LEU B C   1 
ATOM   2166 O  O   . LEU B 1 63  ? 36.461  37.192  36.180  1.00 52.42 ? 63  LEU B O   1 
ATOM   2167 C  CB  . LEU B 1 63  ? 33.655  35.506  36.098  1.00 50.59 ? 63  LEU B CB  1 
ATOM   2168 C  CG  . LEU B 1 63  ? 32.142  35.406  35.913  1.00 49.96 ? 63  LEU B CG  1 
ATOM   2169 C  CD1 . LEU B 1 63  ? 31.830  34.334  34.881  1.00 50.49 ? 63  LEU B CD1 1 
ATOM   2170 C  CD2 . LEU B 1 63  ? 31.484  35.085  37.239  1.00 49.86 ? 63  LEU B CD2 1 
ATOM   2171 N  N   . PRO B 1 64  ? 36.255  35.695  37.844  1.00 52.04 ? 64  PRO B N   1 
ATOM   2172 C  CA  . PRO B 1 64  ? 37.706  35.516  37.915  1.00 52.30 ? 64  PRO B CA  1 
ATOM   2173 C  C   . PRO B 1 64  ? 38.197  34.887  36.612  1.00 53.11 ? 64  PRO B C   1 
ATOM   2174 O  O   . PRO B 1 64  ? 37.508  34.061  36.014  1.00 52.90 ? 64  PRO B O   1 
ATOM   2175 C  CB  . PRO B 1 64  ? 37.886  34.601  39.127  1.00 52.22 ? 64  PRO B CB  1 
ATOM   2176 C  CG  . PRO B 1 64  ? 36.593  33.851  39.194  1.00 53.25 ? 64  PRO B CG  1 
ATOM   2177 C  CD  . PRO B 1 64  ? 35.575  34.920  38.894  1.00 51.87 ? 64  PRO B CD  1 
ATOM   2178 N  N   . ALA B 1 65  ? 39.387  35.287  36.179  1.00 53.67 ? 65  ALA B N   1 
ATOM   2179 C  CA  . ALA B 1 65  ? 39.976  34.799  34.936  1.00 53.21 ? 65  ALA B CA  1 
ATOM   2180 C  C   . ALA B 1 65  ? 39.871  33.293  34.678  1.00 52.56 ? 65  ALA B C   1 
ATOM   2181 O  O   . ALA B 1 65  ? 39.695  32.871  33.535  1.00 52.45 ? 65  ALA B O   1 
ATOM   2182 C  CB  . ALA B 1 65  ? 41.438  35.230  34.863  1.00 53.82 ? 65  ALA B CB  1 
ATOM   2183 N  N   . ASP B 1 66  ? 39.975  32.487  35.730  1.00 51.58 ? 66  ASP B N   1 
ATOM   2184 C  CA  . ASP B 1 66  ? 39.921  31.034  35.576  1.00 50.97 ? 66  ASP B CA  1 
ATOM   2185 C  C   . ASP B 1 66  ? 38.520  30.424  35.537  1.00 49.42 ? 66  ASP B C   1 
ATOM   2186 O  O   . ASP B 1 66  ? 38.376  29.212  35.380  1.00 48.76 ? 66  ASP B O   1 
ATOM   2187 C  CB  . ASP B 1 66  ? 40.729  30.365  36.691  1.00 53.53 ? 66  ASP B CB  1 
ATOM   2188 C  CG  . ASP B 1 66  ? 40.196  30.689  38.071  1.00 55.39 ? 66  ASP B CG  1 
ATOM   2189 O  OD1 . ASP B 1 66  ? 40.138  31.886  38.420  1.00 57.67 ? 66  ASP B OD1 1 
ATOM   2190 O  OD2 . ASP B 1 66  ? 39.835  29.748  38.809  1.00 57.35 ? 66  ASP B OD2 1 
ATOM   2191 N  N   . LYS B 1 67  ? 37.494  31.256  35.677  1.00 46.59 ? 67  LYS B N   1 
ATOM   2192 C  CA  . LYS B 1 67  ? 36.114  30.772  35.658  1.00 44.50 ? 67  LYS B CA  1 
ATOM   2193 C  C   . LYS B 1 67  ? 35.359  31.318  34.453  1.00 41.61 ? 67  LYS B C   1 
ATOM   2194 O  O   . LYS B 1 67  ? 34.279  30.839  34.117  1.00 41.26 ? 67  LYS B O   1 
ATOM   2195 C  CB  . LYS B 1 67  ? 35.379  31.214  36.927  1.00 45.39 ? 67  LYS B CB  1 
ATOM   2196 C  CG  . LYS B 1 67  ? 35.931  30.669  38.230  1.00 46.37 ? 67  LYS B CG  1 
ATOM   2197 C  CD  . LYS B 1 67  ? 35.466  29.253  38.492  1.00 47.49 ? 67  LYS B CD  1 
ATOM   2198 C  CE  . LYS B 1 67  ? 35.772  28.851  39.924  1.00 48.14 ? 67  LYS B CE  1 
ATOM   2199 N  NZ  . LYS B 1 67  ? 35.212  27.514  40.260  1.00 50.72 ? 67  LYS B NZ  1 
ATOM   2200 N  N   . LYS B 1 68  ? 35.938  32.318  33.802  1.00 38.58 ? 68  LYS B N   1 
ATOM   2201 C  CA  . LYS B 1 68  ? 35.291  32.954  32.666  1.00 37.62 ? 68  LYS B CA  1 
ATOM   2202 C  C   . LYS B 1 68  ? 34.929  32.031  31.497  1.00 35.47 ? 68  LYS B C   1 
ATOM   2203 O  O   . LYS B 1 68  ? 33.791  32.036  31.028  1.00 33.52 ? 68  LYS B O   1 
ATOM   2204 C  CB  . LYS B 1 68  ? 36.166  34.108  32.172  1.00 39.96 ? 68  LYS B CB  1 
ATOM   2205 C  CG  . LYS B 1 68  ? 35.464  35.057  31.220  1.00 44.16 ? 68  LYS B CG  1 
ATOM   2206 C  CD  . LYS B 1 68  ? 36.319  36.285  30.948  1.00 47.50 ? 68  LYS B CD  1 
ATOM   2207 C  CE  . LYS B 1 68  ? 35.625  37.241  29.989  1.00 50.02 ? 68  LYS B CE  1 
ATOM   2208 N  NZ  . LYS B 1 68  ? 36.489  38.408  29.646  1.00 51.97 ? 68  LYS B NZ  1 
ATOM   2209 N  N   . THR B 1 69  ? 35.886  31.238  31.029  1.00 32.77 ? 69  THR B N   1 
ATOM   2210 C  CA  . THR B 1 69  ? 35.628  30.357  29.899  1.00 30.66 ? 69  THR B CA  1 
ATOM   2211 C  C   . THR B 1 69  ? 34.659  29.222  30.209  1.00 28.99 ? 69  THR B C   1 
ATOM   2212 O  O   . THR B 1 69  ? 33.740  28.962  29.433  1.00 28.07 ? 69  THR B O   1 
ATOM   2213 C  CB  . THR B 1 69  ? 36.945  29.783  29.339  1.00 33.46 ? 69  THR B CB  1 
ATOM   2214 O  OG1 . THR B 1 69  ? 37.744  30.859  28.829  1.00 33.36 ? 69  THR B OG1 1 
ATOM   2215 C  CG2 . THR B 1 69  ? 36.669  28.797  28.205  1.00 32.37 ? 69  THR B CG2 1 
ATOM   2216 N  N   . VAL B 1 70  ? 34.856  28.548  31.337  1.00 27.54 ? 70  VAL B N   1 
ATOM   2217 C  CA  . VAL B 1 70  ? 33.974  27.449  31.703  1.00 27.56 ? 70  VAL B CA  1 
ATOM   2218 C  C   . VAL B 1 70  ? 32.523  27.918  31.858  1.00 26.67 ? 70  VAL B C   1 
ATOM   2219 O  O   . VAL B 1 70  ? 31.596  27.233  31.428  1.00 24.98 ? 70  VAL B O   1 
ATOM   2220 C  CB  . VAL B 1 70  ? 34.436  26.760  33.004  1.00 29.75 ? 70  VAL B CB  1 
ATOM   2221 C  CG1 . VAL B 1 70  ? 34.481  27.761  34.144  1.00 32.38 ? 70  VAL B CG1 1 
ATOM   2222 C  CG2 . VAL B 1 70  ? 33.495  25.614  33.344  1.00 31.53 ? 70  VAL B CG2 1 
ATOM   2223 N  N   . LEU B 1 71  ? 32.322  29.090  32.450  1.00 25.41 ? 71  LEU B N   1 
ATOM   2224 C  CA  . LEU B 1 71  ? 30.969  29.604  32.628  1.00 26.40 ? 71  LEU B CA  1 
ATOM   2225 C  C   . LEU B 1 71  ? 30.408  30.161  31.324  1.00 25.11 ? 71  LEU B C   1 
ATOM   2226 O  O   . LEU B 1 71  ? 29.211  30.046  31.052  1.00 25.08 ? 71  LEU B O   1 
ATOM   2227 C  CB  . LEU B 1 71  ? 30.945  30.660  33.739  1.00 27.42 ? 71  LEU B CB  1 
ATOM   2228 C  CG  . LEU B 1 71  ? 31.030  30.045  35.142  1.00 28.17 ? 71  LEU B CG  1 
ATOM   2229 C  CD1 . LEU B 1 71  ? 31.195  31.138  36.192  1.00 31.04 ? 71  LEU B CD1 1 
ATOM   2230 C  CD2 . LEU B 1 71  ? 29.768  29.233  35.413  1.00 28.46 ? 71  LEU B CD2 1 
ATOM   2231 N  N   . ARG B 1 72  ? 31.267  30.755  30.505  1.00 23.40 ? 72  ARG B N   1 
ATOM   2232 C  CA  . ARG B 1 72  ? 30.815  31.280  29.222  1.00 22.78 ? 72  ARG B CA  1 
ATOM   2233 C  C   . ARG B 1 72  ? 30.213  30.129  28.407  1.00 22.02 ? 72  ARG B C   1 
ATOM   2234 O  O   . ARG B 1 72  ? 29.123  30.246  27.840  1.00 22.63 ? 72  ARG B O   1 
ATOM   2235 C  CB  . ARG B 1 72  ? 31.991  31.876  28.458  1.00 23.76 ? 72  ARG B CB  1 
ATOM   2236 C  CG  . ARG B 1 72  ? 31.705  32.165  27.000  1.00 22.58 ? 72  ARG B CG  1 
ATOM   2237 C  CD  . ARG B 1 72  ? 32.995  32.544  26.287  1.00 25.49 ? 72  ARG B CD  1 
ATOM   2238 N  NE  . ARG B 1 72  ? 32.795  32.832  24.870  1.00 23.91 ? 72  ARG B NE  1 
ATOM   2239 C  CZ  . ARG B 1 72  ? 33.736  33.344  24.083  1.00 27.60 ? 72  ARG B CZ  1 
ATOM   2240 N  NH1 . ARG B 1 72  ? 34.937  33.623  24.579  1.00 26.12 ? 72  ARG B NH1 1 
ATOM   2241 N  NH2 . ARG B 1 72  ? 33.484  33.577  22.802  1.00 27.01 ? 72  ARG B NH2 1 
ATOM   2242 N  N   . ASN B 1 73  ? 30.931  29.013  28.361  1.00 19.39 ? 73  ASN B N   1 
ATOM   2243 C  CA  . ASN B 1 73  ? 30.473  27.856  27.601  1.00 19.61 ? 73  ASN B CA  1 
ATOM   2244 C  C   . ASN B 1 73  ? 29.281  27.135  28.215  1.00 18.88 ? 73  ASN B C   1 
ATOM   2245 O  O   . ASN B 1 73  ? 28.298  26.868  27.533  1.00 19.07 ? 73  ASN B O   1 
ATOM   2246 C  CB  . ASN B 1 73  ? 31.606  26.842  27.411  1.00 19.32 ? 73  ASN B CB  1 
ATOM   2247 C  CG  . ASN B 1 73  ? 32.726  27.370  26.532  1.00 21.87 ? 73  ASN B CG  1 
ATOM   2248 O  OD1 . ASN B 1 73  ? 32.511  28.234  25.681  1.00 22.62 ? 73  ASN B OD1 1 
ATOM   2249 N  ND2 . ASN B 1 73  ? 33.927  26.835  26.721  1.00 22.77 ? 73  ASN B ND2 1 
ATOM   2250 N  N   . ASN B 1 74  ? 29.364  26.830  29.502  1.00 18.48 ? 74  ASN B N   1 
ATOM   2251 C  CA  . ASN B 1 74  ? 28.300  26.088  30.160  1.00 19.54 ? 74  ASN B CA  1 
ATOM   2252 C  C   . ASN B 1 74  ? 27.076  26.883  30.600  1.00 20.79 ? 74  ASN B C   1 
ATOM   2253 O  O   . ASN B 1 74  ? 25.954  26.384  30.499  1.00 21.62 ? 74  ASN B O   1 
ATOM   2254 C  CB  . ASN B 1 74  ? 28.903  25.295  31.310  1.00 18.77 ? 74  ASN B CB  1 
ATOM   2255 C  CG  . ASN B 1 74  ? 29.864  24.237  30.814  1.00 24.21 ? 74  ASN B CG  1 
ATOM   2256 O  OD1 . ASN B 1 74  ? 29.449  23.243  30.221  1.00 20.65 ? 74  ASN B OD1 1 
ATOM   2257 N  ND2 . ASN B 1 74  ? 31.159  24.461  31.021  1.00 23.63 ? 74  ASN B ND2 1 
ATOM   2258 N  N   . ALA B 1 75  ? 27.272  28.106  31.084  1.00 20.65 ? 75  ALA B N   1 
ATOM   2259 C  CA  . ALA B 1 75  ? 26.135  28.932  31.473  1.00 20.59 ? 75  ALA B CA  1 
ATOM   2260 C  C   . ALA B 1 75  ? 25.490  29.338  30.150  1.00 20.47 ? 75  ALA B C   1 
ATOM   2261 O  O   . ALA B 1 75  ? 24.270  29.437  30.038  1.00 20.79 ? 75  ALA B O   1 
ATOM   2262 C  CB  . ALA B 1 75  ? 26.604  30.177  32.249  1.00 20.58 ? 75  ALA B CB  1 
ATOM   2263 N  N   . GLY B 1 76  ? 26.326  29.567  29.141  1.00 18.45 ? 76  GLY B N   1 
ATOM   2264 C  CA  . GLY B 1 76  ? 25.808  29.920  27.835  1.00 18.58 ? 76  GLY B CA  1 
ATOM   2265 C  C   . GLY B 1 76  ? 24.977  28.753  27.324  1.00 18.88 ? 76  GLY B C   1 
ATOM   2266 O  O   . GLY B 1 76  ? 23.883  28.940  26.788  1.00 22.11 ? 76  GLY B O   1 
ATOM   2267 N  N   . GLY B 1 77  ? 25.491  27.539  27.504  1.00 19.49 ? 77  GLY B N   1 
ATOM   2268 C  CA  . GLY B 1 77  ? 24.769  26.358  27.059  1.00 17.73 ? 77  GLY B CA  1 
ATOM   2269 C  C   . GLY B 1 77  ? 23.432  26.214  27.770  1.00 19.34 ? 77  GLY B C   1 
ATOM   2270 O  O   . GLY B 1 77  ? 22.420  25.885  27.148  1.00 19.78 ? 77  GLY B O   1 
ATOM   2271 N  N   . HIS B 1 78  ? 23.422  26.465  29.076  1.00 17.94 ? 78  HIS B N   1 
ATOM   2272 C  CA  . HIS B 1 78  ? 22.189  26.361  29.854  1.00 18.10 ? 78  HIS B CA  1 
ATOM   2273 C  C   . HIS B 1 78  ? 21.167  27.404  29.401  1.00 18.68 ? 78  HIS B C   1 
ATOM   2274 O  O   . HIS B 1 78  ? 19.991  27.087  29.188  1.00 18.21 ? 78  HIS B O   1 
ATOM   2275 C  CB  . HIS B 1 78  ? 22.499  26.518  31.352  1.00 19.27 ? 78  HIS B CB  1 
ATOM   2276 C  CG  . HIS B 1 78  ? 21.284  26.519  32.232  1.00 20.71 ? 78  HIS B CG  1 
ATOM   2277 N  ND1 . HIS B 1 78  ? 20.224  25.654  32.048  1.00 20.25 ? 78  HIS B ND1 1 
ATOM   2278 C  CD2 . HIS B 1 78  ? 20.969  27.272  33.315  1.00 21.79 ? 78  HIS B CD2 1 
ATOM   2279 C  CE1 . HIS B 1 78  ? 19.309  25.876  32.976  1.00 21.22 ? 78  HIS B CE1 1 
ATOM   2280 N  NE2 . HIS B 1 78  ? 19.736  26.852  33.758  1.00 21.67 ? 78  HIS B NE2 1 
ATOM   2281 N  N   . ALA B 1 79  ? 21.611  28.648  29.241  1.00 19.11 ? 79  ALA B N   1 
ATOM   2282 C  CA  . ALA B 1 79  ? 20.717  29.719  28.805  1.00 19.40 ? 79  ALA B CA  1 
ATOM   2283 C  C   . ALA B 1 79  ? 20.120  29.438  27.429  1.00 19.61 ? 79  ALA B C   1 
ATOM   2284 O  O   . ALA B 1 79  ? 18.907  29.547  27.229  1.00 16.63 ? 79  ALA B O   1 
ATOM   2285 C  CB  . ALA B 1 79  ? 21.462  31.044  28.765  1.00 18.19 ? 79  ALA B CB  1 
ATOM   2286 N  N   . ASN B 1 80  ? 20.980  29.084  26.478  1.00 18.01 ? 80  ASN B N   1 
ATOM   2287 C  CA  . ASN B 1 80  ? 20.537  28.818  25.114  1.00 17.80 ? 80  ASN B CA  1 
ATOM   2288 C  C   . ASN B 1 80  ? 19.557  27.654  25.004  1.00 17.37 ? 80  ASN B C   1 
ATOM   2289 O  O   . ASN B 1 80  ? 18.524  27.771  24.348  1.00 17.74 ? 80  ASN B O   1 
ATOM   2290 C  CB  . ASN B 1 80  ? 21.749  28.554  24.214  1.00 19.29 ? 80  ASN B CB  1 
ATOM   2291 C  CG  . ASN B 1 80  ? 22.598  29.800  23.990  1.00 21.16 ? 80  ASN B CG  1 
ATOM   2292 O  OD1 . ASN B 1 80  ? 22.333  30.866  24.558  1.00 19.59 ? 80  ASN B OD1 1 
ATOM   2293 N  ND2 . ASN B 1 80  ? 23.625  29.667  23.160  1.00 21.42 ? 80  ASN B ND2 1 
ATOM   2294 N  N   . HIS B 1 81  ? 19.880  26.529  25.634  1.00 18.04 ? 81  HIS B N   1 
ATOM   2295 C  CA  . HIS B 1 81  ? 18.991  25.380  25.558  1.00 18.95 ? 81  HIS B CA  1 
ATOM   2296 C  C   . HIS B 1 81  ? 17.671  25.599  26.296  1.00 19.49 ? 81  HIS B C   1 
ATOM   2297 O  O   . HIS B 1 81  ? 16.630  25.113  25.860  1.00 20.06 ? 81  HIS B O   1 
ATOM   2298 C  CB  . HIS B 1 81  ? 19.697  24.119  26.061  1.00 18.17 ? 81  HIS B CB  1 
ATOM   2299 C  CG  . HIS B 1 81  ? 20.742  23.609  25.117  1.00 19.70 ? 81  HIS B CG  1 
ATOM   2300 N  ND1 . HIS B 1 81  ? 22.025  24.112  25.081  1.00 18.50 ? 81  HIS B ND1 1 
ATOM   2301 C  CD2 . HIS B 1 81  ? 20.671  22.693  24.121  1.00 17.73 ? 81  HIS B CD2 1 
ATOM   2302 C  CE1 . HIS B 1 81  ? 22.699  23.528  24.107  1.00 18.24 ? 81  HIS B CE1 1 
ATOM   2303 N  NE2 . HIS B 1 81  ? 21.899  22.663  23.508  1.00 17.77 ? 81  HIS B NE2 1 
ATOM   2304 N  N   . SER B 1 82  ? 17.709  26.332  27.404  1.00 20.08 ? 82  SER B N   1 
ATOM   2305 C  CA  . SER B 1 82  ? 16.484  26.604  28.150  1.00 21.51 ? 82  SER B CA  1 
ATOM   2306 C  C   . SER B 1 82  ? 15.530  27.386  27.246  1.00 22.68 ? 82  SER B C   1 
ATOM   2307 O  O   . SER B 1 82  ? 14.334  27.104  27.189  1.00 22.72 ? 82  SER B O   1 
ATOM   2308 C  CB  . SER B 1 82  ? 16.798  27.415  29.413  1.00 20.97 ? 82  SER B CB  1 
ATOM   2309 O  OG  . SER B 1 82  ? 17.536  26.632  30.334  1.00 22.79 ? 82  SER B OG  1 
ATOM   2310 N  N   . LEU B 1 83  ? 16.074  28.364  26.533  1.00 22.19 ? 83  LEU B N   1 
ATOM   2311 C  CA  . LEU B 1 83  ? 15.287  29.182  25.622  1.00 25.09 ? 83  LEU B CA  1 
ATOM   2312 C  C   . LEU B 1 83  ? 14.760  28.332  24.457  1.00 25.01 ? 83  LEU B C   1 
ATOM   2313 O  O   . LEU B 1 83  ? 13.611  28.472  24.038  1.00 24.59 ? 83  LEU B O   1 
ATOM   2314 C  CB  . LEU B 1 83  ? 16.165  30.332  25.107  1.00 28.87 ? 83  LEU B CB  1 
ATOM   2315 C  CG  . LEU B 1 83  ? 15.588  31.430  24.208  1.00 32.96 ? 83  LEU B CG  1 
ATOM   2316 C  CD1 . LEU B 1 83  ? 16.509  32.641  24.239  1.00 34.89 ? 83  LEU B CD1 1 
ATOM   2317 C  CD2 . LEU B 1 83  ? 15.432  30.915  22.787  1.00 34.78 ? 83  LEU B CD2 1 
ATOM   2318 N  N   . PHE B 1 84  ? 15.608  27.439  23.953  1.00 22.48 ? 84  PHE B N   1 
ATOM   2319 C  CA  . PHE B 1 84  ? 15.261  26.563  22.834  1.00 22.07 ? 84  PHE B CA  1 
ATOM   2320 C  C   . PHE B 1 84  ? 14.019  25.697  23.109  1.00 21.31 ? 84  PHE B C   1 
ATOM   2321 O  O   . PHE B 1 84  ? 13.099  25.651  22.288  1.00 22.01 ? 84  PHE B O   1 
ATOM   2322 C  CB  . PHE B 1 84  ? 16.464  25.665  22.496  1.00 20.20 ? 84  PHE B CB  1 
ATOM   2323 C  CG  . PHE B 1 84  ? 16.359  24.959  21.163  1.00 17.63 ? 84  PHE B CG  1 
ATOM   2324 C  CD1 . PHE B 1 84  ? 16.131  25.678  19.996  1.00 18.44 ? 84  PHE B CD1 1 
ATOM   2325 C  CD2 . PHE B 1 84  ? 16.519  23.579  21.075  1.00 18.13 ? 84  PHE B CD2 1 
ATOM   2326 C  CE1 . PHE B 1 84  ? 16.062  25.040  18.762  1.00 17.59 ? 84  PHE B CE1 1 
ATOM   2327 C  CE2 . PHE B 1 84  ? 16.453  22.928  19.840  1.00 19.03 ? 84  PHE B CE2 1 
ATOM   2328 C  CZ  . PHE B 1 84  ? 16.224  23.663  18.681  1.00 17.49 ? 84  PHE B CZ  1 
ATOM   2329 N  N   . TRP B 1 85  ? 13.986  25.019  24.253  1.00 20.73 ? 85  TRP B N   1 
ATOM   2330 C  CA  . TRP B 1 85  ? 12.850  24.152  24.585  1.00 21.59 ? 85  TRP B CA  1 
ATOM   2331 C  C   . TRP B 1 85  ? 11.530  24.918  24.577  1.00 22.48 ? 85  TRP B C   1 
ATOM   2332 O  O   . TRP B 1 85  ? 10.534  24.440  24.033  1.00 22.99 ? 85  TRP B O   1 
ATOM   2333 C  CB  . TRP B 1 85  ? 13.027  23.514  25.969  1.00 20.28 ? 85  TRP B CB  1 
ATOM   2334 C  CG  . TRP B 1 85  ? 14.321  22.802  26.169  1.00 20.47 ? 85  TRP B CG  1 
ATOM   2335 C  CD1 . TRP B 1 85  ? 15.119  22.858  27.276  1.00 19.25 ? 85  TRP B CD1 1 
ATOM   2336 C  CD2 . TRP B 1 85  ? 14.978  21.933  25.243  1.00 20.67 ? 85  TRP B CD2 1 
ATOM   2337 N  NE1 . TRP B 1 85  ? 16.237  22.081  27.096  1.00 20.23 ? 85  TRP B NE1 1 
ATOM   2338 C  CE2 . TRP B 1 85  ? 16.178  21.501  25.857  1.00 20.70 ? 85  TRP B CE2 1 
ATOM   2339 C  CE3 . TRP B 1 85  ? 14.675  21.477  23.952  1.00 22.29 ? 85  TRP B CE3 1 
ATOM   2340 C  CZ2 . TRP B 1 85  ? 17.075  20.635  25.224  1.00 20.36 ? 85  TRP B CZ2 1 
ATOM   2341 C  CZ3 . TRP B 1 85  ? 15.572  20.614  23.319  1.00 22.01 ? 85  TRP B CZ3 1 
ATOM   2342 C  CH2 . TRP B 1 85  ? 16.757  20.203  23.960  1.00 22.31 ? 85  TRP B CH2 1 
ATOM   2343 N  N   . LYS B 1 86  ? 11.528  26.098  25.192  1.00 22.81 ? 86  LYS B N   1 
ATOM   2344 C  CA  . LYS B 1 86  ? 10.322  26.922  25.263  1.00 25.07 ? 86  LYS B CA  1 
ATOM   2345 C  C   . LYS B 1 86  ? 9.942   27.514  23.913  1.00 26.04 ? 86  LYS B C   1 
ATOM   2346 O  O   . LYS B 1 86  ? 8.787   27.900  23.698  1.00 24.67 ? 86  LYS B O   1 
ATOM   2347 C  CB  . LYS B 1 86  ? 10.509  28.070  26.254  1.00 27.18 ? 86  LYS B CB  1 
ATOM   2348 C  CG  . LYS B 1 86  ? 10.532  27.678  27.718  1.00 32.06 ? 86  LYS B CG  1 
ATOM   2349 C  CD  . LYS B 1 86  ? 10.648  28.941  28.569  1.00 37.89 ? 86  LYS B CD  1 
ATOM   2350 C  CE  . LYS B 1 86  ? 10.692  28.637  30.058  1.00 43.11 ? 86  LYS B CE  1 
ATOM   2351 N  NZ  . LYS B 1 86  ? 10.843  29.890  30.862  1.00 46.95 ? 86  LYS B NZ  1 
ATOM   2352 N  N   . GLY B 1 87  ? 10.914  27.585  23.009  1.00 23.07 ? 87  GLY B N   1 
ATOM   2353 C  CA  . GLY B 1 87  ? 10.669  28.164  21.702  1.00 22.90 ? 87  GLY B CA  1 
ATOM   2354 C  C   . GLY B 1 87  ? 10.155  27.204  20.654  1.00 22.53 ? 87  GLY B C   1 
ATOM   2355 O  O   . GLY B 1 87  ? 10.035  27.571  19.483  1.00 23.65 ? 87  GLY B O   1 
ATOM   2356 N  N   . LEU B 1 88  ? 9.851   25.978  21.062  1.00 20.50 ? 88  LEU B N   1 
ATOM   2357 C  CA  . LEU B 1 88  ? 9.346   24.976  20.134  1.00 21.19 ? 88  LEU B CA  1 
ATOM   2358 C  C   . LEU B 1 88  ? 7.924   24.557  20.499  1.00 23.30 ? 88  LEU B C   1 
ATOM   2359 O  O   . LEU B 1 88  ? 7.619   24.332  21.667  1.00 20.28 ? 88  LEU B O   1 
ATOM   2360 C  CB  . LEU B 1 88  ? 10.238  23.736  20.152  1.00 21.29 ? 88  LEU B CB  1 
ATOM   2361 C  CG  . LEU B 1 88  ? 11.732  23.915  19.860  1.00 19.00 ? 88  LEU B CG  1 
ATOM   2362 C  CD1 . LEU B 1 88  ? 12.406  22.567  20.026  1.00 18.05 ? 88  LEU B CD1 1 
ATOM   2363 C  CD2 . LEU B 1 88  ? 11.948  24.450  18.454  1.00 19.77 ? 88  LEU B CD2 1 
ATOM   2364 N  N   . LYS B 1 89  ? 7.070   24.440  19.485  1.00 24.84 ? 89  LYS B N   1 
ATOM   2365 C  CA  . LYS B 1 89  ? 5.681   24.032  19.673  1.00 28.43 ? 89  LYS B CA  1 
ATOM   2366 C  C   . LYS B 1 89  ? 5.001   23.977  18.312  1.00 29.27 ? 89  LYS B C   1 
ATOM   2367 O  O   . LYS B 1 89  ? 5.187   24.866  17.483  1.00 29.99 ? 89  LYS B O   1 
ATOM   2368 C  CB  . LYS B 1 89  ? 4.933   25.025  20.569  1.00 29.65 ? 89  LYS B CB  1 
ATOM   2369 C  CG  . LYS B 1 89  ? 3.528   24.566  20.952  1.00 34.63 ? 89  LYS B CG  1 
ATOM   2370 C  CD  . LYS B 1 89  ? 2.757   25.644  21.695  1.00 38.27 ? 89  LYS B CD  1 
ATOM   2371 C  CE  . LYS B 1 89  ? 1.370   25.149  22.086  1.00 41.73 ? 89  LYS B CE  1 
ATOM   2372 N  NZ  . LYS B 1 89  ? 0.514   26.243  22.633  1.00 44.99 ? 89  LYS B NZ  1 
ATOM   2373 N  N   . LYS B 1 90  ? 4.225   22.927  18.080  1.00 30.25 ? 90  LYS B N   1 
ATOM   2374 C  CA  . LYS B 1 90  ? 3.512   22.779  16.815  1.00 32.63 ? 90  LYS B CA  1 
ATOM   2375 C  C   . LYS B 1 90  ? 2.191   23.546  16.858  1.00 32.51 ? 90  LYS B C   1 
ATOM   2376 O  O   . LYS B 1 90  ? 1.658   23.821  17.932  1.00 32.48 ? 90  LYS B O   1 
ATOM   2377 C  CB  . LYS B 1 90  ? 3.211   21.302  16.542  1.00 33.67 ? 90  LYS B CB  1 
ATOM   2378 C  CG  . LYS B 1 90  ? 4.435   20.429  16.311  1.00 36.02 ? 90  LYS B CG  1 
ATOM   2379 C  CD  . LYS B 1 90  ? 4.058   18.954  16.191  1.00 37.74 ? 90  LYS B CD  1 
ATOM   2380 C  CE  . LYS B 1 90  ? 3.125   18.690  15.014  1.00 39.44 ? 90  LYS B CE  1 
ATOM   2381 N  NZ  . LYS B 1 90  ? 2.748   17.248  14.911  1.00 38.67 ? 90  LYS B NZ  1 
ATOM   2382 N  N   . GLY B 1 91  ? 1.680   23.901  15.683  1.00 34.57 ? 91  GLY B N   1 
ATOM   2383 C  CA  . GLY B 1 91  ? 0.397   24.581  15.597  1.00 35.04 ? 91  GLY B CA  1 
ATOM   2384 C  C   . GLY B 1 91  ? 0.290   26.069  15.865  1.00 36.12 ? 91  GLY B C   1 
ATOM   2385 O  O   . GLY B 1 91  ? -0.826  26.584  15.981  1.00 35.58 ? 91  GLY B O   1 
ATOM   2386 N  N   . THR B 1 92  ? 1.413   26.774  15.962  1.00 33.94 ? 92  THR B N   1 
ATOM   2387 C  CA  . THR B 1 92  ? 1.354   28.211  16.214  1.00 33.99 ? 92  THR B CA  1 
ATOM   2388 C  C   . THR B 1 92  ? 1.368   28.977  14.900  1.00 34.36 ? 92  THR B C   1 
ATOM   2389 O  O   . THR B 1 92  ? 1.756   28.443  13.864  1.00 35.13 ? 92  THR B O   1 
ATOM   2390 C  CB  . THR B 1 92  ? 2.531   28.690  17.086  1.00 33.71 ? 92  THR B CB  1 
ATOM   2391 O  OG1 . THR B 1 92  ? 3.763   28.515  16.373  1.00 32.33 ? 92  THR B OG1 1 
ATOM   2392 C  CG2 . THR B 1 92  ? 2.577   27.899  18.385  1.00 33.89 ? 92  THR B CG2 1 
ATOM   2393 N  N   . THR B 1 93  ? 0.945   30.233  14.950  1.00 36.43 ? 93  THR B N   1 
ATOM   2394 C  CA  . THR B 1 93  ? 0.894   31.066  13.756  1.00 38.34 ? 93  THR B CA  1 
ATOM   2395 C  C   . THR B 1 93  ? 1.505   32.435  14.007  1.00 38.12 ? 93  THR B C   1 
ATOM   2396 O  O   . THR B 1 93  ? 1.225   33.070  15.021  1.00 39.31 ? 93  THR B O   1 
ATOM   2397 C  CB  . THR B 1 93  ? -0.567  31.267  13.291  1.00 39.73 ? 93  THR B CB  1 
ATOM   2398 O  OG1 . THR B 1 93  ? -1.177  29.990  13.062  1.00 41.90 ? 93  THR B OG1 1 
ATOM   2399 C  CG2 . THR B 1 93  ? -0.615  32.082  12.008  1.00 39.92 ? 93  THR B CG2 1 
ATOM   2400 N  N   . LEU B 1 94  ? 2.345   32.883  13.080  1.00 38.93 ? 94  LEU B N   1 
ATOM   2401 C  CA  . LEU B 1 94  ? 2.976   34.192  13.186  1.00 40.13 ? 94  LEU B CA  1 
ATOM   2402 C  C   . LEU B 1 94  ? 1.915   35.249  12.885  1.00 41.53 ? 94  LEU B C   1 
ATOM   2403 O  O   . LEU B 1 94  ? 1.351   35.278  11.790  1.00 40.75 ? 94  LEU B O   1 
ATOM   2404 C  CB  . LEU B 1 94  ? 4.125   34.309  12.184  1.00 39.09 ? 94  LEU B CB  1 
ATOM   2405 C  CG  . LEU B 1 94  ? 4.831   35.663  12.123  1.00 39.20 ? 94  LEU B CG  1 
ATOM   2406 C  CD1 . LEU B 1 94  ? 5.395   36.021  13.492  1.00 38.80 ? 94  LEU B CD1 1 
ATOM   2407 C  CD2 . LEU B 1 94  ? 5.930   35.607  11.078  1.00 38.87 ? 94  LEU B CD2 1 
ATOM   2408 N  N   . GLN B 1 95  ? 1.646   36.112  13.859  1.00 42.47 ? 95  GLN B N   1 
ATOM   2409 C  CA  . GLN B 1 95  ? 0.637   37.151  13.701  1.00 44.41 ? 95  GLN B CA  1 
ATOM   2410 C  C   . GLN B 1 95  ? 0.903   38.316  14.646  1.00 44.00 ? 95  GLN B C   1 
ATOM   2411 O  O   . GLN B 1 95  ? 1.965   38.407  15.259  1.00 44.16 ? 95  GLN B O   1 
ATOM   2412 C  CB  . GLN B 1 95  ? -0.746  36.568  14.002  1.00 46.23 ? 95  GLN B CB  1 
ATOM   2413 C  CG  . GLN B 1 95  ? -0.862  36.019  15.419  1.00 51.64 ? 95  GLN B CG  1 
ATOM   2414 C  CD  . GLN B 1 95  ? -2.200  35.360  15.704  1.00 54.69 ? 95  GLN B CD  1 
ATOM   2415 O  OE1 . GLN B 1 95  ? -2.426  34.845  16.800  1.00 56.31 ? 95  GLN B OE1 1 
ATOM   2416 N  NE2 . GLN B 1 95  ? -3.093  35.372  14.720  1.00 56.36 ? 95  GLN B NE2 1 
ATOM   2417 N  N   . GLY B 1 96  ? -0.073  39.208  14.758  1.00 44.09 ? 96  GLY B N   1 
ATOM   2418 C  CA  . GLY B 1 96  ? 0.062   40.345  15.649  1.00 43.37 ? 96  GLY B CA  1 
ATOM   2419 C  C   . GLY B 1 96  ? 1.220   41.279  15.358  1.00 42.43 ? 96  GLY B C   1 
ATOM   2420 O  O   . GLY B 1 96  ? 1.685   41.381  14.223  1.00 41.97 ? 96  GLY B O   1 
ATOM   2421 N  N   . ASP B 1 97  ? 1.687   41.958  16.403  1.00 43.00 ? 97  ASP B N   1 
ATOM   2422 C  CA  . ASP B 1 97  ? 2.780   42.916  16.286  1.00 44.62 ? 97  ASP B CA  1 
ATOM   2423 C  C   . ASP B 1 97  ? 4.095   42.297  15.832  1.00 43.88 ? 97  ASP B C   1 
ATOM   2424 O  O   . ASP B 1 97  ? 4.873   42.943  15.128  1.00 43.41 ? 97  ASP B O   1 
ATOM   2425 C  CB  . ASP B 1 97  ? 2.994   43.644  17.618  1.00 47.23 ? 97  ASP B CB  1 
ATOM   2426 C  CG  . ASP B 1 97  ? 1.737   44.346  18.109  1.00 50.18 ? 97  ASP B CG  1 
ATOM   2427 O  OD1 . ASP B 1 97  ? 1.106   45.068  17.308  1.00 51.12 ? 97  ASP B OD1 1 
ATOM   2428 O  OD2 . ASP B 1 97  ? 1.383   44.180  19.296  1.00 51.21 ? 97  ASP B OD2 1 
ATOM   2429 N  N   . LEU B 1 98  ? 4.359   41.057  16.233  1.00 42.50 ? 98  LEU B N   1 
ATOM   2430 C  CA  . LEU B 1 98  ? 5.606   40.429  15.821  1.00 41.71 ? 98  LEU B CA  1 
ATOM   2431 C  C   . LEU B 1 98  ? 5.665   40.336  14.303  1.00 41.39 ? 98  LEU B C   1 
ATOM   2432 O  O   . LEU B 1 98  ? 6.665   40.715  13.695  1.00 40.23 ? 98  LEU B O   1 
ATOM   2433 C  CB  . LEU B 1 98  ? 5.768   39.035  16.436  1.00 38.57 ? 98  LEU B CB  1 
ATOM   2434 C  CG  . LEU B 1 98  ? 7.088   38.345  16.066  1.00 37.08 ? 98  LEU B CG  1 
ATOM   2435 C  CD1 . LEU B 1 98  ? 8.263   39.267  16.377  1.00 33.79 ? 98  LEU B CD1 1 
ATOM   2436 C  CD2 . LEU B 1 98  ? 7.217   37.028  16.825  1.00 34.55 ? 98  LEU B CD2 1 
ATOM   2437 N  N   . LYS B 1 99  ? 4.590   39.846  13.693  1.00 42.40 ? 99  LYS B N   1 
ATOM   2438 C  CA  . LYS B 1 99  ? 4.549   39.725  12.241  1.00 43.59 ? 99  LYS B CA  1 
ATOM   2439 C  C   . LYS B 1 99  ? 4.742   41.087  11.586  1.00 43.69 ? 99  LYS B C   1 
ATOM   2440 O  O   . LYS B 1 99  ? 5.463   41.212  10.595  1.00 43.71 ? 99  LYS B O   1 
ATOM   2441 C  CB  . LYS B 1 99  ? 3.223   39.121  11.779  1.00 44.23 ? 99  LYS B CB  1 
ATOM   2442 C  CG  . LYS B 1 99  ? 3.158   38.947  10.273  1.00 45.74 ? 99  LYS B CG  1 
ATOM   2443 C  CD  . LYS B 1 99  ? 1.877   38.290  9.816   1.00 47.26 ? 99  LYS B CD  1 
ATOM   2444 C  CE  . LYS B 1 99  ? 1.889   38.118  8.308   1.00 49.38 ? 99  LYS B CE  1 
ATOM   2445 N  NZ  . LYS B 1 99  ? 0.640   37.495  7.801   1.00 51.31 ? 99  LYS B NZ  1 
ATOM   2446 N  N   . ALA B 1 100 ? 4.098   42.106  12.146  1.00 43.72 ? 100 ALA B N   1 
ATOM   2447 C  CA  . ALA B 1 100 ? 4.204   43.460  11.616  1.00 43.57 ? 100 ALA B CA  1 
ATOM   2448 C  C   . ALA B 1 100 ? 5.647   43.949  11.671  1.00 42.92 ? 100 ALA B C   1 
ATOM   2449 O  O   . ALA B 1 100 ? 6.150   44.532  10.712  1.00 42.91 ? 100 ALA B O   1 
ATOM   2450 C  CB  . ALA B 1 100 ? 3.305   44.400  12.405  1.00 43.84 ? 100 ALA B CB  1 
ATOM   2451 N  N   . ALA B 1 101 ? 6.309   43.711  12.800  1.00 42.77 ? 101 ALA B N   1 
ATOM   2452 C  CA  . ALA B 1 101 ? 7.694   44.132  12.972  1.00 42.23 ? 101 ALA B CA  1 
ATOM   2453 C  C   . ALA B 1 101 ? 8.605   43.410  11.983  1.00 42.37 ? 101 ALA B C   1 
ATOM   2454 O  O   . ALA B 1 101 ? 9.538   44.001  11.442  1.00 41.60 ? 101 ALA B O   1 
ATOM   2455 C  CB  . ALA B 1 101 ? 8.149   43.863  14.399  1.00 41.81 ? 101 ALA B CB  1 
ATOM   2456 N  N   . ILE B 1 102 ? 8.333   42.130  11.751  1.00 42.02 ? 102 ILE B N   1 
ATOM   2457 C  CA  . ILE B 1 102 ? 9.132   41.344  10.819  1.00 43.28 ? 102 ILE B CA  1 
ATOM   2458 C  C   . ILE B 1 102 ? 9.030   41.941  9.421   1.00 45.27 ? 102 ILE B C   1 
ATOM   2459 O  O   . ILE B 1 102 ? 10.042  42.233  8.781   1.00 44.82 ? 102 ILE B O   1 
ATOM   2460 C  CB  . ILE B 1 102 ? 8.653   39.874  10.753  1.00 42.62 ? 102 ILE B CB  1 
ATOM   2461 C  CG1 . ILE B 1 102 ? 8.915   39.168  12.084  1.00 42.75 ? 102 ILE B CG1 1 
ATOM   2462 C  CG2 . ILE B 1 102 ? 9.362   39.145  9.618   1.00 41.71 ? 102 ILE B CG2 1 
ATOM   2463 C  CD1 . ILE B 1 102 ? 10.377  39.055  12.436  1.00 44.53 ? 102 ILE B CD1 1 
ATOM   2464 N  N   . GLU B 1 103 ? 7.801   42.120  8.950   1.00 45.88 ? 103 GLU B N   1 
ATOM   2465 C  CA  . GLU B 1 103 ? 7.575   42.676  7.623   1.00 47.81 ? 103 GLU B CA  1 
ATOM   2466 C  C   . GLU B 1 103 ? 8.182   44.066  7.511   1.00 48.06 ? 103 GLU B C   1 
ATOM   2467 O  O   . GLU B 1 103 ? 8.662   44.460  6.452   1.00 47.68 ? 103 GLU B O   1 
ATOM   2468 C  CB  . GLU B 1 103 ? 6.075   42.725  7.329   1.00 48.19 ? 103 GLU B CB  1 
ATOM   2469 C  CG  . GLU B 1 103 ? 5.413   41.367  7.425   1.00 49.51 ? 103 GLU B CG  1 
ATOM   2470 C  CD  . GLU B 1 103 ? 3.931   41.417  7.146   1.00 52.20 ? 103 GLU B CD  1 
ATOM   2471 O  OE1 . GLU B 1 103 ? 3.241   42.257  7.762   1.00 53.07 ? 103 GLU B OE1 1 
ATOM   2472 O  OE2 . GLU B 1 103 ? 3.457   40.610  6.319   1.00 52.46 ? 103 GLU B OE2 1 
ATOM   2473 N  N   . ARG B 1 104 ? 8.172   44.799  8.618   1.00 49.43 ? 104 ARG B N   1 
ATOM   2474 C  CA  . ARG B 1 104 ? 8.720   46.146  8.649   1.00 50.90 ? 104 ARG B CA  1 
ATOM   2475 C  C   . ARG B 1 104 ? 10.238  46.161  8.489   1.00 50.71 ? 104 ARG B C   1 
ATOM   2476 O  O   . ARG B 1 104 ? 10.772  46.904  7.667   1.00 50.82 ? 104 ARG B O   1 
ATOM   2477 C  CB  . ARG B 1 104 ? 8.347   46.828  9.966   1.00 52.47 ? 104 ARG B CB  1 
ATOM   2478 C  CG  . ARG B 1 104 ? 8.828   48.265  10.088  1.00 54.80 ? 104 ARG B CG  1 
ATOM   2479 C  CD  . ARG B 1 104 ? 8.818   48.701  11.542  1.00 57.06 ? 104 ARG B CD  1 
ATOM   2480 N  NE  . ARG B 1 104 ? 9.778   47.927  12.325  1.00 60.20 ? 104 ARG B NE  1 
ATOM   2481 C  CZ  . ARG B 1 104 ? 9.807   47.889  13.653  1.00 61.57 ? 104 ARG B CZ  1 
ATOM   2482 N  NH1 . ARG B 1 104 ? 8.923   48.583  14.357  1.00 61.89 ? 104 ARG B NH1 1 
ATOM   2483 N  NH2 . ARG B 1 104 ? 10.721  47.155  14.279  1.00 61.44 ? 104 ARG B NH2 1 
ATOM   2484 N  N   . ASP B 1 105 ? 10.930  45.339  9.273   1.00 50.12 ? 105 ASP B N   1 
ATOM   2485 C  CA  . ASP B 1 105 ? 12.387  45.298  9.222   1.00 49.62 ? 105 ASP B CA  1 
ATOM   2486 C  C   . ASP B 1 105 ? 12.986  44.393  8.152   1.00 48.48 ? 105 ASP B C   1 
ATOM   2487 O  O   . ASP B 1 105 ? 14.151  44.552  7.792   1.00 48.57 ? 105 ASP B O   1 
ATOM   2488 C  CB  . ASP B 1 105 ? 12.947  44.897  10.589  1.00 51.21 ? 105 ASP B CB  1 
ATOM   2489 C  CG  . ASP B 1 105 ? 12.575  45.880  11.683  1.00 51.75 ? 105 ASP B CG  1 
ATOM   2490 O  OD1 . ASP B 1 105 ? 12.658  47.103  11.441  1.00 53.73 ? 105 ASP B OD1 1 
ATOM   2491 O  OD2 . ASP B 1 105 ? 12.213  45.428  12.789  1.00 51.22 ? 105 ASP B OD2 1 
ATOM   2492 N  N   . PHE B 1 106 ? 12.200  43.454  7.637   1.00 47.08 ? 106 PHE B N   1 
ATOM   2493 C  CA  . PHE B 1 106 ? 12.697  42.534  6.620   1.00 47.28 ? 106 PHE B CA  1 
ATOM   2494 C  C   . PHE B 1 106 ? 11.958  42.641  5.291   1.00 48.23 ? 106 PHE B C   1 
ATOM   2495 O  O   . PHE B 1 106 ? 12.314  41.970  4.321   1.00 48.12 ? 106 PHE B O   1 
ATOM   2496 C  CB  . PHE B 1 106 ? 12.617  41.094  7.139   1.00 45.89 ? 106 PHE B CB  1 
ATOM   2497 C  CG  . PHE B 1 106 ? 13.572  40.803  8.259   1.00 43.88 ? 106 PHE B CG  1 
ATOM   2498 C  CD1 . PHE B 1 106 ? 14.917  40.556  7.997   1.00 44.63 ? 106 PHE B CD1 1 
ATOM   2499 C  CD2 . PHE B 1 106 ? 13.136  40.801  9.579   1.00 43.82 ? 106 PHE B CD2 1 
ATOM   2500 C  CE1 . PHE B 1 106 ? 15.817  40.312  9.034   1.00 43.15 ? 106 PHE B CE1 1 
ATOM   2501 C  CE2 . PHE B 1 106 ? 14.027  40.559  10.627  1.00 43.73 ? 106 PHE B CE2 1 
ATOM   2502 C  CZ  . PHE B 1 106 ? 15.371  40.315  10.352  1.00 43.09 ? 106 PHE B CZ  1 
ATOM   2503 N  N   . GLY B 1 107 ? 10.933  43.486  5.245   1.00 48.92 ? 107 GLY B N   1 
ATOM   2504 C  CA  . GLY B 1 107 ? 10.173  43.649  4.019   1.00 49.03 ? 107 GLY B CA  1 
ATOM   2505 C  C   . GLY B 1 107 ? 9.010   42.679  3.934   1.00 49.70 ? 107 GLY B C   1 
ATOM   2506 O  O   . GLY B 1 107 ? 7.908   43.050  3.532   1.00 49.81 ? 107 GLY B O   1 
ATOM   2507 N  N   . SER B 1 108 ? 9.256   41.429  4.312   1.00 48.90 ? 108 SER B N   1 
ATOM   2508 C  CA  . SER B 1 108 ? 8.220   40.406  4.284   1.00 47.80 ? 108 SER B CA  1 
ATOM   2509 C  C   . SER B 1 108 ? 8.662   39.209  5.114   1.00 47.96 ? 108 SER B C   1 
ATOM   2510 O  O   . SER B 1 108 ? 9.837   39.081  5.456   1.00 47.42 ? 108 SER B O   1 
ATOM   2511 C  CB  . SER B 1 108 ? 7.964   39.949  2.851   1.00 47.99 ? 108 SER B CB  1 
ATOM   2512 O  OG  . SER B 1 108 ? 9.071   39.219  2.353   1.00 45.09 ? 108 SER B OG  1 
ATOM   2513 N  N   . VAL B 1 109 ? 7.716   38.334  5.431   1.00 46.90 ? 109 VAL B N   1 
ATOM   2514 C  CA  . VAL B 1 109 ? 8.018   37.146  6.211   1.00 46.01 ? 109 VAL B CA  1 
ATOM   2515 C  C   . VAL B 1 109 ? 8.964   36.238  5.432   1.00 46.49 ? 109 VAL B C   1 
ATOM   2516 O  O   . VAL B 1 109 ? 9.868   35.636  6.007   1.00 45.66 ? 109 VAL B O   1 
ATOM   2517 C  CB  . VAL B 1 109 ? 6.733   36.368  6.553   1.00 45.03 ? 109 VAL B CB  1 
ATOM   2518 C  CG1 . VAL B 1 109 ? 7.081   35.032  7.189   1.00 43.39 ? 109 VAL B CG1 1 
ATOM   2519 C  CG2 . VAL B 1 109 ? 5.870   37.194  7.494   1.00 44.49 ? 109 VAL B CG2 1 
ATOM   2520 N  N   . ASP B 1 110 ? 8.756   36.147  4.122   1.00 46.69 ? 110 ASP B N   1 
ATOM   2521 C  CA  . ASP B 1 110 ? 9.600   35.309  3.277   1.00 47.51 ? 110 ASP B CA  1 
ATOM   2522 C  C   . ASP B 1 110 ? 11.042  35.799  3.253   1.00 46.50 ? 110 ASP B C   1 
ATOM   2523 O  O   . ASP B 1 110 ? 11.973  34.994  3.241   1.00 45.57 ? 110 ASP B O   1 
ATOM   2524 C  CB  . ASP B 1 110 ? 9.053   35.260  1.851   1.00 50.81 ? 110 ASP B CB  1 
ATOM   2525 C  CG  . ASP B 1 110 ? 7.763   34.480  1.753   1.00 54.21 ? 110 ASP B CG  1 
ATOM   2526 O  OD1 . ASP B 1 110 ? 7.747   33.306  2.185   1.00 56.36 ? 110 ASP B OD1 1 
ATOM   2527 O  OD2 . ASP B 1 110 ? 6.768   35.036  1.242   1.00 57.42 ? 110 ASP B OD2 1 
ATOM   2528 N  N   . ASN B 1 111 ? 11.228  37.115  3.233   1.00 45.08 ? 111 ASN B N   1 
ATOM   2529 C  CA  . ASN B 1 111 ? 12.573  37.675  3.228   1.00 44.61 ? 111 ASN B CA  1 
ATOM   2530 C  C   . ASN B 1 111 ? 13.247  37.330  4.546   1.00 42.40 ? 111 ASN B C   1 
ATOM   2531 O  O   . ASN B 1 111 ? 14.433  37.003  4.579   1.00 41.06 ? 111 ASN B O   1 
ATOM   2532 C  CB  . ASN B 1 111 ? 12.543  39.196  3.063   1.00 48.43 ? 111 ASN B CB  1 
ATOM   2533 C  CG  . ASN B 1 111 ? 12.203  39.628  1.651   1.00 52.82 ? 111 ASN B CG  1 
ATOM   2534 O  OD1 . ASN B 1 111 ? 12.796  39.150  0.683   1.00 55.43 ? 111 ASN B OD1 1 
ATOM   2535 N  ND2 . ASN B 1 111 ? 11.253  40.549  1.525   1.00 55.87 ? 111 ASN B ND2 1 
ATOM   2536 N  N   . PHE B 1 112 ? 12.486  37.413  5.634   1.00 39.11 ? 112 PHE B N   1 
ATOM   2537 C  CA  . PHE B 1 112 ? 13.015  37.094  6.951   1.00 38.08 ? 112 PHE B CA  1 
ATOM   2538 C  C   . PHE B 1 112 ? 13.485  35.645  6.985   1.00 36.29 ? 112 PHE B C   1 
ATOM   2539 O  O   . PHE B 1 112 ? 14.615  35.366  7.382   1.00 34.63 ? 112 PHE B O   1 
ATOM   2540 C  CB  . PHE B 1 112 ? 11.955  37.307  8.031   1.00 37.42 ? 112 PHE B CB  1 
ATOM   2541 C  CG  . PHE B 1 112 ? 12.242  36.566  9.302   1.00 37.41 ? 112 PHE B CG  1 
ATOM   2542 C  CD1 . PHE B 1 112 ? 13.365  36.877  10.065  1.00 36.37 ? 112 PHE B CD1 1 
ATOM   2543 C  CD2 . PHE B 1 112 ? 11.424  35.519  9.709   1.00 37.23 ? 112 PHE B CD2 1 
ATOM   2544 C  CE1 . PHE B 1 112 ? 13.670  36.151  11.213  1.00 36.63 ? 112 PHE B CE1 1 
ATOM   2545 C  CE2 . PHE B 1 112 ? 11.721  34.788  10.854  1.00 37.29 ? 112 PHE B CE2 1 
ATOM   2546 C  CZ  . PHE B 1 112 ? 12.848  35.106  11.607  1.00 36.63 ? 112 PHE B CZ  1 
ATOM   2547 N  N   . LYS B 1 113 ? 12.614  34.729  6.571   1.00 35.34 ? 113 LYS B N   1 
ATOM   2548 C  CA  . LYS B 1 113 ? 12.953  33.312  6.559   1.00 35.42 ? 113 LYS B CA  1 
ATOM   2549 C  C   . LYS B 1 113 ? 14.219  33.055  5.753   1.00 34.67 ? 113 LYS B C   1 
ATOM   2550 O  O   . LYS B 1 113 ? 15.069  32.262  6.155   1.00 33.94 ? 113 LYS B O   1 
ATOM   2551 C  CB  . LYS B 1 113 ? 11.802  32.483  5.982   1.00 36.90 ? 113 LYS B CB  1 
ATOM   2552 C  CG  . LYS B 1 113 ? 10.602  32.349  6.904   1.00 38.63 ? 113 LYS B CG  1 
ATOM   2553 C  CD  . LYS B 1 113 ? 9.610   31.332  6.353   1.00 41.56 ? 113 LYS B CD  1 
ATOM   2554 C  CE  . LYS B 1 113 ? 8.427   31.140  7.292   1.00 44.67 ? 113 LYS B CE  1 
ATOM   2555 N  NZ  . LYS B 1 113 ? 7.487   30.093  6.794   1.00 45.68 ? 113 LYS B NZ  1 
ATOM   2556 N  N   . ALA B 1 114 ? 14.344  33.733  4.616   1.00 32.74 ? 114 ALA B N   1 
ATOM   2557 C  CA  . ALA B 1 114 ? 15.511  33.566  3.759   1.00 32.09 ? 114 ALA B CA  1 
ATOM   2558 C  C   . ALA B 1 114 ? 16.777  34.015  4.480   1.00 31.84 ? 114 ALA B C   1 
ATOM   2559 O  O   . ALA B 1 114 ? 17.809  33.352  4.411   1.00 31.72 ? 114 ALA B O   1 
ATOM   2560 C  CB  . ALA B 1 114 ? 15.337  34.362  2.475   1.00 33.96 ? 114 ALA B CB  1 
ATOM   2561 N  N   . GLU B 1 115 ? 16.691  35.144  5.171   1.00 29.89 ? 115 GLU B N   1 
ATOM   2562 C  CA  . GLU B 1 115 ? 17.834  35.673  5.895   1.00 30.45 ? 115 GLU B CA  1 
ATOM   2563 C  C   . GLU B 1 115 ? 18.219  34.762  7.056   1.00 28.55 ? 115 GLU B C   1 
ATOM   2564 O  O   . GLU B 1 115 ? 19.401  34.540  7.310   1.00 25.89 ? 115 GLU B O   1 
ATOM   2565 C  CB  . GLU B 1 115 ? 17.519  37.076  6.414   1.00 34.44 ? 115 GLU B CB  1 
ATOM   2566 C  CG  . GLU B 1 115 ? 18.751  37.935  6.589   1.00 42.31 ? 115 GLU B CG  1 
ATOM   2567 C  CD  . GLU B 1 115 ? 19.481  38.165  5.275   1.00 45.52 ? 115 GLU B CD  1 
ATOM   2568 O  OE1 . GLU B 1 115 ? 20.635  38.641  5.316   1.00 48.80 ? 115 GLU B OE1 1 
ATOM   2569 O  OE2 . GLU B 1 115 ? 18.902  37.876  4.202   1.00 46.66 ? 115 GLU B OE2 1 
ATOM   2570 N  N   . PHE B 1 116 ? 17.217  34.237  7.758   1.00 25.95 ? 116 PHE B N   1 
ATOM   2571 C  CA  . PHE B 1 116 ? 17.464  33.351  8.889   1.00 25.61 ? 116 PHE B CA  1 
ATOM   2572 C  C   . PHE B 1 116 ? 18.115  32.055  8.407   1.00 25.64 ? 116 PHE B C   1 
ATOM   2573 O  O   . PHE B 1 116 ? 19.093  31.590  8.987   1.00 24.69 ? 116 PHE B O   1 
ATOM   2574 C  CB  . PHE B 1 116 ? 16.156  33.023  9.618   1.00 26.12 ? 116 PHE B CB  1 
ATOM   2575 C  CG  . PHE B 1 116 ? 16.359  32.341  10.947  1.00 25.10 ? 116 PHE B CG  1 
ATOM   2576 C  CD1 . PHE B 1 116 ? 16.640  33.084  12.091  1.00 27.07 ? 116 PHE B CD1 1 
ATOM   2577 C  CD2 . PHE B 1 116 ? 16.299  30.957  11.047  1.00 25.80 ? 116 PHE B CD2 1 
ATOM   2578 C  CE1 . PHE B 1 116 ? 16.858  32.455  13.320  1.00 27.12 ? 116 PHE B CE1 1 
ATOM   2579 C  CE2 . PHE B 1 116 ? 16.515  30.317  12.270  1.00 25.70 ? 116 PHE B CE2 1 
ATOM   2580 C  CZ  . PHE B 1 116 ? 16.796  31.066  13.406  1.00 26.02 ? 116 PHE B CZ  1 
ATOM   2581 N  N   . GLU B 1 117 ? 17.569  31.475  7.346   1.00 24.57 ? 117 GLU B N   1 
ATOM   2582 C  CA  . GLU B 1 117 ? 18.111  30.237  6.800   1.00 26.42 ? 117 GLU B CA  1 
ATOM   2583 C  C   . GLU B 1 117 ? 19.557  30.404  6.349   1.00 26.69 ? 117 GLU B C   1 
ATOM   2584 O  O   . GLU B 1 117 ? 20.381  29.509  6.536   1.00 25.22 ? 117 GLU B O   1 
ATOM   2585 C  CB  . GLU B 1 117 ? 17.251  29.766  5.632   1.00 26.06 ? 117 GLU B CB  1 
ATOM   2586 C  CG  . GLU B 1 117 ? 15.958  29.133  6.092   1.00 30.87 ? 117 GLU B CG  1 
ATOM   2587 C  CD  . GLU B 1 117 ? 15.095  28.660  4.949   1.00 34.70 ? 117 GLU B CD  1 
ATOM   2588 O  OE1 . GLU B 1 117 ? 15.646  28.103  3.972   1.00 36.39 ? 117 GLU B OE1 1 
ATOM   2589 O  OE2 . GLU B 1 117 ? 13.862  28.834  5.040   1.00 35.85 ? 117 GLU B OE2 1 
ATOM   2590 N  N   . LYS B 1 118 ? 19.859  31.553  5.755   1.00 26.97 ? 118 LYS B N   1 
ATOM   2591 C  CA  . LYS B 1 118 ? 21.213  31.839  5.289   1.00 27.84 ? 118 LYS B CA  1 
ATOM   2592 C  C   . LYS B 1 118 ? 22.175  31.896  6.469   1.00 26.55 ? 118 LYS B C   1 
ATOM   2593 O  O   . LYS B 1 118 ? 23.279  31.347  6.411   1.00 26.55 ? 118 LYS B O   1 
ATOM   2594 C  CB  . LYS B 1 118 ? 21.248  33.173  4.529   1.00 30.77 ? 118 LYS B CB  1 
ATOM   2595 C  CG  . LYS B 1 118 ? 20.602  33.109  3.152   1.00 36.28 ? 118 LYS B CG  1 
ATOM   2596 C  CD  . LYS B 1 118 ? 20.299  34.492  2.576   1.00 43.09 ? 118 LYS B CD  1 
ATOM   2597 C  CE  . LYS B 1 118 ? 21.536  35.372  2.489   1.00 46.35 ? 118 LYS B CE  1 
ATOM   2598 N  NZ  . LYS B 1 118 ? 21.218  36.700  1.873   1.00 49.39 ? 118 LYS B NZ  1 
ATOM   2599 N  N   . ALA B 1 119 ? 21.756  32.556  7.544   1.00 24.83 ? 119 ALA B N   1 
ATOM   2600 C  CA  . ALA B 1 119 ? 22.600  32.666  8.729   1.00 24.65 ? 119 ALA B CA  1 
ATOM   2601 C  C   . ALA B 1 119 ? 22.790  31.303  9.388   1.00 23.78 ? 119 ALA B C   1 
ATOM   2602 O  O   . ALA B 1 119 ? 23.890  30.959  9.812   1.00 24.19 ? 119 ALA B O   1 
ATOM   2603 C  CB  . ALA B 1 119 ? 21.992  33.649  9.728   1.00 23.78 ? 119 ALA B CB  1 
ATOM   2604 N  N   . ALA B 1 120 ? 21.717  30.526  9.472   1.00 22.49 ? 120 ALA B N   1 
ATOM   2605 C  CA  . ALA B 1 120 ? 21.793  29.205  10.093  1.00 23.16 ? 120 ALA B CA  1 
ATOM   2606 C  C   . ALA B 1 120 ? 22.641  28.234  9.278   1.00 22.86 ? 120 ALA B C   1 
ATOM   2607 O  O   . ALA B 1 120 ? 23.396  27.441  9.834   1.00 22.79 ? 120 ALA B O   1 
ATOM   2608 C  CB  . ALA B 1 120 ? 20.389  28.633  10.289  1.00 21.71 ? 120 ALA B CB  1 
ATOM   2609 N  N   . ALA B 1 121 ? 22.528  28.308  7.958   1.00 23.51 ? 121 ALA B N   1 
ATOM   2610 C  CA  . ALA B 1 121 ? 23.284  27.409  7.099   1.00 25.82 ? 121 ALA B CA  1 
ATOM   2611 C  C   . ALA B 1 121 ? 24.750  27.791  6.929   1.00 25.83 ? 121 ALA B C   1 
ATOM   2612 O  O   . ALA B 1 121 ? 25.600  26.922  6.737   1.00 28.06 ? 121 ALA B O   1 
ATOM   2613 C  CB  . ALA B 1 121 ? 22.605  27.312  5.732   1.00 26.93 ? 121 ALA B CB  1 
ATOM   2614 N  N   . SER B 1 122 ? 25.058  29.079  7.010   1.00 25.72 ? 122 SER B N   1 
ATOM   2615 C  CA  . SER B 1 122 ? 26.437  29.514  6.822   1.00 25.44 ? 122 SER B CA  1 
ATOM   2616 C  C   . SER B 1 122 ? 27.310  29.439  8.070   1.00 25.03 ? 122 SER B C   1 
ATOM   2617 O  O   . SER B 1 122 ? 28.518  29.636  7.984   1.00 23.61 ? 122 SER B O   1 
ATOM   2618 C  CB  . SER B 1 122 ? 26.472  30.938  6.258   1.00 25.00 ? 122 SER B CB  1 
ATOM   2619 O  OG  . SER B 1 122 ? 25.949  31.863  7.192   1.00 33.42 ? 122 SER B OG  1 
ATOM   2620 N  N   . ARG B 1 123 ? 26.714  29.167  9.230   1.00 22.43 ? 123 ARG B N   1 
ATOM   2621 C  CA  . ARG B 1 123 ? 27.508  29.068  10.448  1.00 22.07 ? 123 ARG B CA  1 
ATOM   2622 C  C   . ARG B 1 123 ? 28.376  27.816  10.341  1.00 22.30 ? 123 ARG B C   1 
ATOM   2623 O  O   . ARG B 1 123 ? 27.868  26.694  10.339  1.00 21.91 ? 123 ARG B O   1 
ATOM   2624 C  CB  . ARG B 1 123 ? 26.593  29.012  11.680  1.00 23.51 ? 123 ARG B CB  1 
ATOM   2625 C  CG  . ARG B 1 123 ? 27.264  28.537  12.979  1.00 25.88 ? 123 ARG B CG  1 
ATOM   2626 C  CD  . ARG B 1 123 ? 28.537  29.304  13.332  1.00 25.27 ? 123 ARG B CD  1 
ATOM   2627 N  NE  . ARG B 1 123 ? 28.300  30.733  13.495  1.00 27.30 ? 123 ARG B NE  1 
ATOM   2628 C  CZ  . ARG B 1 123 ? 29.232  31.605  13.866  1.00 27.66 ? 123 ARG B CZ  1 
ATOM   2629 N  NH1 . ARG B 1 123 ? 30.466  31.191  14.118  1.00 27.93 ? 123 ARG B NH1 1 
ATOM   2630 N  NH2 . ARG B 1 123 ? 28.932  32.893  13.970  1.00 29.36 ? 123 ARG B NH2 1 
ATOM   2631 N  N   . PHE B 1 124 ? 29.688  28.016  10.232  1.00 21.41 ? 124 PHE B N   1 
ATOM   2632 C  CA  . PHE B 1 124 ? 30.636  26.907  10.097  1.00 21.82 ? 124 PHE B CA  1 
ATOM   2633 C  C   . PHE B 1 124 ? 31.010  26.352  11.470  1.00 22.10 ? 124 PHE B C   1 
ATOM   2634 O  O   . PHE B 1 124 ? 31.372  27.103  12.377  1.00 23.49 ? 124 PHE B O   1 
ATOM   2635 C  CB  . PHE B 1 124 ? 31.900  27.385  9.366   1.00 23.19 ? 124 PHE B CB  1 
ATOM   2636 C  CG  . PHE B 1 124 ? 32.743  26.270  8.814   1.00 23.09 ? 124 PHE B CG  1 
ATOM   2637 C  CD1 . PHE B 1 124 ? 32.385  25.633  7.628   1.00 25.73 ? 124 PHE B CD1 1 
ATOM   2638 C  CD2 . PHE B 1 124 ? 33.876  25.836  9.492   1.00 25.05 ? 124 PHE B CD2 1 
ATOM   2639 C  CE1 . PHE B 1 124 ? 33.145  24.573  7.126   1.00 27.00 ? 124 PHE B CE1 1 
ATOM   2640 C  CE2 . PHE B 1 124 ? 34.642  24.777  9.001   1.00 24.06 ? 124 PHE B CE2 1 
ATOM   2641 C  CZ  . PHE B 1 124 ? 34.275  24.145  7.817   1.00 25.71 ? 124 PHE B CZ  1 
ATOM   2642 N  N   . GLY B 1 125 ? 30.942  25.035  11.621  1.00 20.66 ? 125 GLY B N   1 
ATOM   2643 C  CA  . GLY B 1 125 ? 31.257  24.447  12.909  1.00 18.47 ? 125 GLY B CA  1 
ATOM   2644 C  C   . GLY B 1 125 ? 30.017  24.529  13.783  1.00 17.69 ? 125 GLY B C   1 
ATOM   2645 O  O   . GLY B 1 125 ? 28.909  24.636  13.267  1.00 20.20 ? 125 GLY B O   1 
ATOM   2646 N  N   . SER B 1 126 ? 30.197  24.496  15.098  1.00 16.99 ? 126 SER B N   1 
ATOM   2647 C  CA  . SER B 1 126 ? 29.074  24.544  16.034  1.00 16.47 ? 126 SER B CA  1 
ATOM   2648 C  C   . SER B 1 126 ? 28.612  25.978  16.291  1.00 15.71 ? 126 SER B C   1 
ATOM   2649 O  O   . SER B 1 126 ? 29.425  26.901  16.340  1.00 13.66 ? 126 SER B O   1 
ATOM   2650 C  CB  . SER B 1 126 ? 29.485  23.896  17.356  1.00 12.99 ? 126 SER B CB  1 
ATOM   2651 O  OG  . SER B 1 126 ? 30.094  22.637  17.117  1.00 18.31 ? 126 SER B OG  1 
ATOM   2652 N  N   . GLY B 1 127 ? 27.308  26.167  16.470  1.00 15.18 ? 127 GLY B N   1 
ATOM   2653 C  CA  . GLY B 1 127 ? 26.814  27.511  16.717  1.00 14.67 ? 127 GLY B CA  1 
ATOM   2654 C  C   . GLY B 1 127 ? 25.305  27.601  16.807  1.00 16.90 ? 127 GLY B C   1 
ATOM   2655 O  O   . GLY B 1 127 ? 24.609  26.579  16.819  1.00 15.11 ? 127 GLY B O   1 
ATOM   2656 N  N   A TRP B 1 128 ? 24.804  28.830  16.855  0.50 14.35 ? 128 TRP B N   1 
ATOM   2657 N  N   B TRP B 1 128 ? 24.799  28.831  16.850  0.50 16.27 ? 128 TRP B N   1 
ATOM   2658 C  CA  A TRP B 1 128 ? 23.374  29.092  16.942  0.50 15.50 ? 128 TRP B CA  1 
ATOM   2659 C  CA  B TRP B 1 128 ? 23.368  29.094  16.978  0.50 18.76 ? 128 TRP B CA  1 
ATOM   2660 C  C   A TRP B 1 128 ? 23.012  30.246  16.007  0.50 17.43 ? 128 TRP B C   1 
ATOM   2661 C  C   B TRP B 1 128 ? 22.992  30.269  16.062  0.50 19.40 ? 128 TRP B C   1 
ATOM   2662 O  O   A TRP B 1 128 ? 23.846  31.114  15.734  0.50 17.30 ? 128 TRP B O   1 
ATOM   2663 O  O   B TRP B 1 128 ? 23.803  31.175  15.851  0.50 19.10 ? 128 TRP B O   1 
ATOM   2664 C  CB  A TRP B 1 128 ? 22.993  29.487  18.375  0.50 13.09 ? 128 TRP B CB  1 
ATOM   2665 C  CB  B TRP B 1 128 ? 23.081  29.458  18.441  0.50 20.30 ? 128 TRP B CB  1 
ATOM   2666 C  CG  A TRP B 1 128 ? 22.991  28.365  19.370  0.50 11.27 ? 128 TRP B CG  1 
ATOM   2667 C  CG  B TRP B 1 128 ? 21.857  28.841  19.054  0.50 24.32 ? 128 TRP B CG  1 
ATOM   2668 C  CD1 A TRP B 1 128 ? 24.065  27.656  19.819  0.50 11.16 ? 128 TRP B CD1 1 
ATOM   2669 C  CD1 B TRP B 1 128 ? 20.563  29.240  18.890  0.50 24.79 ? 128 TRP B CD1 1 
ATOM   2670 C  CD2 A TRP B 1 128 ? 21.843  27.822  20.037  0.50 12.47 ? 128 TRP B CD2 1 
ATOM   2671 C  CD2 B TRP B 1 128 ? 21.823  27.733  19.963  0.50 25.06 ? 128 TRP B CD2 1 
ATOM   2672 N  NE1 A TRP B 1 128 ? 23.659  26.698  20.725  0.50 12.44 ? 128 TRP B NE1 1 
ATOM   2673 N  NE1 B TRP B 1 128 ? 19.724  28.453  19.646  0.50 26.06 ? 128 TRP B NE1 1 
ATOM   2674 C  CE2 A TRP B 1 128 ? 22.298  26.781  20.875  0.50 11.78 ? 128 TRP B CE2 1 
ATOM   2675 C  CE2 B TRP B 1 128 ? 20.472  27.520  20.313  0.50 25.52 ? 128 TRP B CE2 1 
ATOM   2676 C  CE3 A TRP B 1 128 ? 20.472  28.116  20.006  0.50 12.03 ? 128 TRP B CE3 1 
ATOM   2677 C  CE3 B TRP B 1 128 ? 22.805  26.901  20.517  0.50 26.33 ? 128 TRP B CE3 1 
ATOM   2678 C  CZ2 A TRP B 1 128 ? 21.431  26.031  21.675  0.50 12.54 ? 128 TRP B CZ2 1 
ATOM   2679 C  CZ2 B TRP B 1 128 ? 20.077  26.508  21.192  0.50 25.84 ? 128 TRP B CZ2 1 
ATOM   2680 C  CZ3 A TRP B 1 128 ? 19.607  27.371  20.803  0.50 10.78 ? 128 TRP B CZ3 1 
ATOM   2681 C  CZ3 B TRP B 1 128 ? 22.413  25.895  21.391  0.50 25.81 ? 128 TRP B CZ3 1 
ATOM   2682 C  CH2 A TRP B 1 128 ? 20.092  26.340  21.626  0.50 12.47 ? 128 TRP B CH2 1 
ATOM   2683 C  CH2 B TRP B 1 128 ? 21.059  25.708  21.719  0.50 26.19 ? 128 TRP B CH2 1 
ATOM   2684 N  N   . ALA B 1 129 ? 21.776  30.251  15.514  1.00 17.83 ? 129 ALA B N   1 
ATOM   2685 C  CA  . ALA B 1 129 ? 21.299  31.337  14.642  1.00 19.87 ? 129 ALA B CA  1 
ATOM   2686 C  C   . ALA B 1 129 ? 20.189  32.017  15.446  1.00 21.29 ? 129 ALA B C   1 
ATOM   2687 O  O   . ALA B 1 129 ? 19.385  31.331  16.083  1.00 20.55 ? 129 ALA B O   1 
ATOM   2688 C  CB  . ALA B 1 129 ? 20.744  30.787  13.334  1.00 18.01 ? 129 ALA B CB  1 
ATOM   2689 N  N   . TRP B 1 130 ? 20.133  33.347  15.410  1.00 20.52 ? 130 TRP B N   1 
ATOM   2690 C  CA  . TRP B 1 130 ? 19.144  34.075  16.200  1.00 23.14 ? 130 TRP B CA  1 
ATOM   2691 C  C   . TRP B 1 130 ? 18.377  35.194  15.517  1.00 24.92 ? 130 TRP B C   1 
ATOM   2692 O  O   . TRP B 1 130 ? 18.835  35.792  14.547  1.00 26.59 ? 130 TRP B O   1 
ATOM   2693 C  CB  . TRP B 1 130 ? 19.798  34.745  17.413  1.00 22.88 ? 130 TRP B CB  1 
ATOM   2694 C  CG  . TRP B 1 130 ? 20.752  33.928  18.200  1.00 22.39 ? 130 TRP B CG  1 
ATOM   2695 C  CD1 . TRP B 1 130 ? 22.090  33.780  17.973  1.00 21.67 ? 130 TRP B CD1 1 
ATOM   2696 C  CD2 . TRP B 1 130 ? 20.455  33.180  19.379  1.00 22.74 ? 130 TRP B CD2 1 
ATOM   2697 N  NE1 . TRP B 1 130 ? 22.648  32.989  18.947  1.00 21.70 ? 130 TRP B NE1 1 
ATOM   2698 C  CE2 . TRP B 1 130 ? 21.667  32.604  19.822  1.00 21.62 ? 130 TRP B CE2 1 
ATOM   2699 C  CE3 . TRP B 1 130 ? 19.280  32.940  20.110  1.00 22.18 ? 130 TRP B CE3 1 
ATOM   2700 C  CZ2 . TRP B 1 130 ? 21.740  31.801  20.964  1.00 21.35 ? 130 TRP B CZ2 1 
ATOM   2701 C  CZ3 . TRP B 1 130 ? 19.353  32.142  21.246  1.00 25.09 ? 130 TRP B CZ3 1 
ATOM   2702 C  CH2 . TRP B 1 130 ? 20.579  31.580  21.662  1.00 22.40 ? 130 TRP B CH2 1 
ATOM   2703 N  N   . LEU B 1 131 ? 17.199  35.468  16.069  1.00 25.55 ? 131 LEU B N   1 
ATOM   2704 C  CA  . LEU B 1 131 ? 16.372  36.592  15.652  1.00 26.18 ? 131 LEU B CA  1 
ATOM   2705 C  C   . LEU B 1 131 ? 16.461  37.405  16.936  1.00 28.05 ? 131 LEU B C   1 
ATOM   2706 O  O   . LEU B 1 131 ? 15.968  36.970  17.977  1.00 27.57 ? 131 LEU B O   1 
ATOM   2707 C  CB  . LEU B 1 131 ? 14.914  36.200  15.415  1.00 28.27 ? 131 LEU B CB  1 
ATOM   2708 C  CG  . LEU B 1 131 ? 14.008  37.436  15.272  1.00 29.18 ? 131 LEU B CG  1 
ATOM   2709 C  CD1 . LEU B 1 131 ? 14.457  38.272  14.077  1.00 29.57 ? 131 LEU B CD1 1 
ATOM   2710 C  CD2 . LEU B 1 131 ? 12.561  37.007  15.117  1.00 30.87 ? 131 LEU B CD2 1 
ATOM   2711 N  N   . VAL B 1 132 ? 17.117  38.557  16.882  1.00 27.33 ? 132 VAL B N   1 
ATOM   2712 C  CA  . VAL B 1 132 ? 17.273  39.379  18.072  1.00 29.42 ? 132 VAL B CA  1 
ATOM   2713 C  C   . VAL B 1 132 ? 16.622  40.749  17.915  1.00 31.53 ? 132 VAL B C   1 
ATOM   2714 O  O   . VAL B 1 132 ? 16.325  41.190  16.804  1.00 30.20 ? 132 VAL B O   1 
ATOM   2715 C  CB  . VAL B 1 132 ? 18.774  39.605  18.405  1.00 28.75 ? 132 VAL B CB  1 
ATOM   2716 C  CG1 . VAL B 1 132 ? 19.469  38.275  18.659  1.00 27.22 ? 132 VAL B CG1 1 
ATOM   2717 C  CG2 . VAL B 1 132 ? 19.452  40.339  17.264  1.00 28.75 ? 132 VAL B CG2 1 
ATOM   2718 N  N   . LEU B 1 133 ? 16.403  41.410  19.045  1.00 33.26 ? 133 LEU B N   1 
ATOM   2719 C  CA  . LEU B 1 133 ? 15.824  42.744  19.051  1.00 36.31 ? 133 LEU B CA  1 
ATOM   2720 C  C   . LEU B 1 133 ? 16.909  43.676  19.570  1.00 37.64 ? 133 LEU B C   1 
ATOM   2721 O  O   . LEU B 1 133 ? 17.305  43.593  20.731  1.00 37.04 ? 133 LEU B O   1 
ATOM   2722 C  CB  . LEU B 1 133 ? 14.586  42.798  19.959  1.00 36.26 ? 133 LEU B CB  1 
ATOM   2723 C  CG  . LEU B 1 133 ? 13.875  44.144  20.154  1.00 38.06 ? 133 LEU B CG  1 
ATOM   2724 C  CD1 . LEU B 1 133 ? 13.526  44.767  18.814  1.00 38.23 ? 133 LEU B CD1 1 
ATOM   2725 C  CD2 . LEU B 1 133 ? 12.615  43.933  20.979  1.00 37.11 ? 133 LEU B CD2 1 
ATOM   2726 N  N   . LYS B 1 134 ? 17.418  44.528  18.685  1.00 41.01 ? 134 LYS B N   1 
ATOM   2727 C  CA  . LYS B 1 134 ? 18.454  45.497  19.039  1.00 44.57 ? 134 LYS B CA  1 
ATOM   2728 C  C   . LYS B 1 134 ? 17.779  46.854  19.039  1.00 46.24 ? 134 LYS B C   1 
ATOM   2729 O  O   . LYS B 1 134 ? 17.457  47.393  17.975  1.00 46.27 ? 134 LYS B O   1 
ATOM   2730 C  CB  . LYS B 1 134 ? 19.566  45.531  17.990  1.00 46.22 ? 134 LYS B CB  1 
ATOM   2731 C  CG  . LYS B 1 134 ? 20.370  44.265  17.816  1.00 48.97 ? 134 LYS B CG  1 
ATOM   2732 C  CD  . LYS B 1 134 ? 21.445  44.515  16.766  1.00 52.17 ? 134 LYS B CD  1 
ATOM   2733 C  CE  . LYS B 1 134 ? 22.335  43.313  16.546  1.00 53.73 ? 134 LYS B CE  1 
ATOM   2734 N  NZ  . LYS B 1 134 ? 23.352  43.612  15.500  1.00 55.60 ? 134 LYS B NZ  1 
ATOM   2735 N  N   . GLY B 1 135 ? 17.557  47.389  20.233  1.00 47.98 ? 135 GLY B N   1 
ATOM   2736 C  CA  . GLY B 1 135 ? 16.893  48.668  20.344  1.00 49.42 ? 135 GLY B CA  1 
ATOM   2737 C  C   . GLY B 1 135 ? 15.436  48.475  19.984  1.00 50.31 ? 135 GLY B C   1 
ATOM   2738 O  O   . GLY B 1 135 ? 14.655  47.947  20.778  1.00 51.08 ? 135 GLY B O   1 
ATOM   2739 N  N   . ASP B 1 136 ? 15.077  48.876  18.770  1.00 51.04 ? 136 ASP B N   1 
ATOM   2740 C  CA  . ASP B 1 136 ? 13.705  48.763  18.292  1.00 51.87 ? 136 ASP B CA  1 
ATOM   2741 C  C   . ASP B 1 136 ? 13.619  48.026  16.959  1.00 50.26 ? 136 ASP B C   1 
ATOM   2742 O  O   . ASP B 1 136 ? 12.532  47.863  16.405  1.00 50.05 ? 136 ASP B O   1 
ATOM   2743 C  CB  . ASP B 1 136 ? 13.108  50.163  18.133  1.00 55.69 ? 136 ASP B CB  1 
ATOM   2744 C  CG  . ASP B 1 136 ? 13.939  51.046  17.213  1.00 58.98 ? 136 ASP B CG  1 
ATOM   2745 O  OD1 . ASP B 1 136 ? 15.133  51.273  17.518  1.00 60.81 ? 136 ASP B OD1 1 
ATOM   2746 O  OD2 . ASP B 1 136 ? 13.402  51.510  16.185  1.00 60.89 ? 136 ASP B OD2 1 
ATOM   2747 N  N   . LYS B 1 137 ? 14.761  47.585  16.442  1.00 48.43 ? 137 LYS B N   1 
ATOM   2748 C  CA  . LYS B 1 137 ? 14.784  46.882  15.161  1.00 47.02 ? 137 LYS B CA  1 
ATOM   2749 C  C   . LYS B 1 137 ? 15.146  45.412  15.319  1.00 44.23 ? 137 LYS B C   1 
ATOM   2750 O  O   . LYS B 1 137 ? 15.970  45.053  16.158  1.00 42.00 ? 137 LYS B O   1 
ATOM   2751 C  CB  . LYS B 1 137 ? 15.789  47.539  14.204  1.00 49.87 ? 137 LYS B CB  1 
ATOM   2752 C  CG  . LYS B 1 137 ? 15.419  48.951  13.769  1.00 55.40 ? 137 LYS B CG  1 
ATOM   2753 C  CD  . LYS B 1 137 ? 16.474  49.543  12.841  1.00 58.17 ? 137 LYS B CD  1 
ATOM   2754 C  CE  . LYS B 1 137 ? 16.113  50.966  12.425  1.00 60.31 ? 137 LYS B CE  1 
ATOM   2755 N  NZ  . LYS B 1 137 ? 17.165  51.594  11.569  1.00 61.00 ? 137 LYS B NZ  1 
ATOM   2756 N  N   . LEU B 1 138 ? 14.523  44.566  14.505  1.00 41.10 ? 138 LEU B N   1 
ATOM   2757 C  CA  . LEU B 1 138 ? 14.797  43.138  14.539  1.00 39.31 ? 138 LEU B CA  1 
ATOM   2758 C  C   . LEU B 1 138 ? 15.963  42.844  13.604  1.00 37.29 ? 138 LEU B C   1 
ATOM   2759 O  O   . LEU B 1 138 ? 16.137  43.517  12.589  1.00 37.22 ? 138 LEU B O   1 
ATOM   2760 C  CB  . LEU B 1 138 ? 13.561  42.349  14.101  1.00 38.85 ? 138 LEU B CB  1 
ATOM   2761 C  CG  . LEU B 1 138 ? 12.374  42.392  15.064  1.00 39.16 ? 138 LEU B CG  1 
ATOM   2762 C  CD1 . LEU B 1 138 ? 11.173  41.715  14.430  1.00 38.96 ? 138 LEU B CD1 1 
ATOM   2763 C  CD2 . LEU B 1 138 ? 12.752  41.706  16.367  1.00 39.17 ? 138 LEU B CD2 1 
ATOM   2764 N  N   . ALA B 1 139 ? 16.768  41.846  13.952  1.00 34.98 ? 139 ALA B N   1 
ATOM   2765 C  CA  . ALA B 1 139 ? 17.910  41.476  13.126  1.00 32.48 ? 139 ALA B CA  1 
ATOM   2766 C  C   . ALA B 1 139 ? 18.246  40.000  13.293  1.00 30.96 ? 139 ALA B C   1 
ATOM   2767 O  O   . ALA B 1 139 ? 17.896  39.380  14.296  1.00 29.86 ? 139 ALA B O   1 
ATOM   2768 C  CB  . ALA B 1 139 ? 19.119  42.330  13.488  1.00 31.75 ? 139 ALA B CB  1 
ATOM   2769 N  N   . VAL B 1 140 ? 18.922  39.445  12.295  1.00 30.34 ? 140 VAL B N   1 
ATOM   2770 C  CA  . VAL B 1 140 ? 19.330  38.048  12.325  1.00 29.56 ? 140 VAL B CA  1 
ATOM   2771 C  C   . VAL B 1 140 ? 20.839  38.001  12.517  1.00 29.68 ? 140 VAL B C   1 
ATOM   2772 O  O   . VAL B 1 140 ? 21.582  38.672  11.797  1.00 28.76 ? 140 VAL B O   1 
ATOM   2773 C  CB  . VAL B 1 140 ? 18.961  37.327  11.006  1.00 29.81 ? 140 VAL B CB  1 
ATOM   2774 C  CG1 . VAL B 1 140 ? 19.644  35.960  10.942  1.00 28.65 ? 140 VAL B CG1 1 
ATOM   2775 C  CG2 . VAL B 1 140 ? 17.445  37.161  10.913  1.00 27.37 ? 140 VAL B CG2 1 
ATOM   2776 N  N   . VAL B 1 141 ? 21.284  37.227  13.501  1.00 27.64 ? 141 VAL B N   1 
ATOM   2777 C  CA  . VAL B 1 141 ? 22.709  37.077  13.785  1.00 26.36 ? 141 VAL B CA  1 
ATOM   2778 C  C   . VAL B 1 141 ? 22.977  35.621  14.156  1.00 26.65 ? 141 VAL B C   1 
ATOM   2779 O  O   . VAL B 1 141 ? 22.043  34.843  14.365  1.00 23.37 ? 141 VAL B O   1 
ATOM   2780 C  CB  . VAL B 1 141 ? 23.160  37.963  14.980  1.00 28.17 ? 141 VAL B CB  1 
ATOM   2781 C  CG1 . VAL B 1 141 ? 22.944  39.435  14.661  1.00 31.07 ? 141 VAL B CG1 1 
ATOM   2782 C  CG2 . VAL B 1 141 ? 22.390  37.582  16.238  1.00 28.63 ? 141 VAL B CG2 1 
ATOM   2783 N  N   . SER B 1 142 ? 24.249  35.248  14.225  1.00 25.01 ? 142 SER B N   1 
ATOM   2784 C  CA  . SER B 1 142 ? 24.606  33.892  14.617  1.00 24.69 ? 142 SER B CA  1 
ATOM   2785 C  C   . SER B 1 142 ? 25.819  33.987  15.528  1.00 24.02 ? 142 SER B C   1 
ATOM   2786 O  O   . SER B 1 142 ? 26.582  34.949  15.460  1.00 24.05 ? 142 SER B O   1 
ATOM   2787 C  CB  . SER B 1 142 ? 24.907  33.010  13.394  1.00 25.54 ? 142 SER B CB  1 
ATOM   2788 O  OG  . SER B 1 142 ? 26.178  33.278  12.835  1.00 30.67 ? 142 SER B OG  1 
ATOM   2789 N  N   . THR B 1 143 ? 25.978  32.997  16.394  1.00 20.97 ? 143 THR B N   1 
ATOM   2790 C  CA  . THR B 1 143 ? 27.086  32.962  17.331  1.00 21.10 ? 143 THR B CA  1 
ATOM   2791 C  C   . THR B 1 143 ? 27.770  31.604  17.269  1.00 22.16 ? 143 THR B C   1 
ATOM   2792 O  O   . THR B 1 143 ? 27.177  30.620  16.819  1.00 20.51 ? 143 THR B O   1 
ATOM   2793 C  CB  . THR B 1 143 ? 26.601  33.192  18.774  1.00 20.52 ? 143 THR B CB  1 
ATOM   2794 O  OG1 . THR B 1 143 ? 25.518  32.299  19.061  1.00 19.13 ? 143 THR B OG1 1 
ATOM   2795 C  CG2 . THR B 1 143 ? 26.138  34.633  18.957  1.00 20.13 ? 143 THR B CG2 1 
ATOM   2796 N  N   . ALA B 1 144 ? 29.015  31.562  17.728  1.00 20.60 ? 144 ALA B N   1 
ATOM   2797 C  CA  . ALA B 1 144 ? 29.794  30.333  17.733  1.00 21.45 ? 144 ALA B CA  1 
ATOM   2798 C  C   . ALA B 1 144 ? 29.557  29.536  19.007  1.00 19.68 ? 144 ALA B C   1 
ATOM   2799 O  O   . ALA B 1 144 ? 29.239  30.096  20.054  1.00 19.69 ? 144 ALA B O   1 
ATOM   2800 C  CB  . ALA B 1 144 ? 31.286  30.653  17.603  1.00 20.89 ? 144 ALA B CB  1 
ATOM   2801 N  N   . ASN B 1 145 ? 29.704  28.221  18.893  1.00 19.00 ? 145 ASN B N   1 
ATOM   2802 C  CA  . ASN B 1 145 ? 29.562  27.312  20.018  1.00 17.70 ? 145 ASN B CA  1 
ATOM   2803 C  C   . ASN B 1 145 ? 28.346  27.579  20.904  1.00 15.91 ? 145 ASN B C   1 
ATOM   2804 O  O   . ASN B 1 145 ? 27.214  27.499  20.435  1.00 15.08 ? 145 ASN B O   1 
ATOM   2805 C  CB  . ASN B 1 145 ? 30.867  27.339  20.814  1.00 18.27 ? 145 ASN B CB  1 
ATOM   2806 C  CG  . ASN B 1 145 ? 32.064  26.972  19.943  1.00 23.45 ? 145 ASN B CG  1 
ATOM   2807 O  OD1 . ASN B 1 145 ? 31.971  26.075  19.101  1.00 21.22 ? 145 ASN B OD1 1 
ATOM   2808 N  ND2 . ASN B 1 145 ? 33.181  27.659  20.132  1.00 23.08 ? 145 ASN B ND2 1 
ATOM   2809 N  N   . LEU B 1 146 ? 28.561  27.885  22.178  1.00 16.30 ? 146 LEU B N   1 
ATOM   2810 C  CA  . LEU B 1 146 ? 27.418  28.146  23.047  1.00 17.60 ? 146 LEU B CA  1 
ATOM   2811 C  C   . LEU B 1 146 ? 27.333  29.599  23.493  1.00 17.90 ? 146 LEU B C   1 
ATOM   2812 O  O   . LEU B 1 146 ? 26.792  29.900  24.556  1.00 17.62 ? 146 LEU B O   1 
ATOM   2813 C  CB  . LEU B 1 146 ? 27.442  27.213  24.265  1.00 17.96 ? 146 LEU B CB  1 
ATOM   2814 C  CG  . LEU B 1 146 ? 27.220  25.730  23.940  1.00 20.57 ? 146 LEU B CG  1 
ATOM   2815 C  CD1 . LEU B 1 146 ? 27.273  24.895  25.209  1.00 21.37 ? 146 LEU B CD1 1 
ATOM   2816 C  CD2 . LEU B 1 146 ? 25.881  25.560  23.251  1.00 17.98 ? 146 LEU B CD2 1 
ATOM   2817 N  N   . ASP B 1 147 ? 27.871  30.505  22.683  1.00 18.18 ? 147 ASP B N   1 
ATOM   2818 C  CA  . ASP B 1 147 ? 27.796  31.916  23.031  1.00 20.75 ? 147 ASP B CA  1 
ATOM   2819 C  C   . ASP B 1 147 ? 26.366  32.384  22.798  1.00 21.92 ? 147 ASP B C   1 
ATOM   2820 O  O   . ASP B 1 147 ? 25.585  31.727  22.104  1.00 21.45 ? 147 ASP B O   1 
ATOM   2821 C  CB  . ASP B 1 147 ? 28.737  32.761  22.164  1.00 21.45 ? 147 ASP B CB  1 
ATOM   2822 C  CG  . ASP B 1 147 ? 30.199  32.514  22.467  1.00 20.00 ? 147 ASP B CG  1 
ATOM   2823 O  OD1 . ASP B 1 147 ? 30.513  31.946  23.533  1.00 22.75 ? 147 ASP B OD1 1 
ATOM   2824 O  OD2 . ASP B 1 147 ? 31.037  32.906  21.633  1.00 22.95 ? 147 ASP B OD2 1 
ATOM   2825 N  N   . SER B 1 148 ? 26.032  33.530  23.379  1.00 21.97 ? 148 SER B N   1 
ATOM   2826 C  CA  . SER B 1 148 ? 24.706  34.113  23.238  1.00 23.11 ? 148 SER B CA  1 
ATOM   2827 C  C   . SER B 1 148 ? 24.867  35.603  22.953  1.00 23.97 ? 148 SER B C   1 
ATOM   2828 O  O   . SER B 1 148 ? 25.850  36.218  23.380  1.00 23.38 ? 148 SER B O   1 
ATOM   2829 C  CB  . SER B 1 148 ? 23.906  33.921  24.532  1.00 25.14 ? 148 SER B CB  1 
ATOM   2830 O  OG  . SER B 1 148 ? 22.786  34.798  24.577  1.00 23.26 ? 148 SER B OG  1 
ATOM   2831 N  N   . PRO B 1 149 ? 23.919  36.196  22.208  1.00 24.71 ? 149 PRO B N   1 
ATOM   2832 C  CA  . PRO B 1 149 ? 23.964  37.625  21.877  1.00 26.14 ? 149 PRO B CA  1 
ATOM   2833 C  C   . PRO B 1 149 ? 23.907  38.456  23.160  1.00 26.86 ? 149 PRO B C   1 
ATOM   2834 O  O   . PRO B 1 149 ? 24.322  39.617  23.183  1.00 26.04 ? 149 PRO B O   1 
ATOM   2835 C  CB  . PRO B 1 149 ? 22.711  37.823  21.028  1.00 26.55 ? 149 PRO B CB  1 
ATOM   2836 C  CG  . PRO B 1 149 ? 22.513  36.479  20.397  1.00 27.57 ? 149 PRO B CG  1 
ATOM   2837 C  CD  . PRO B 1 149 ? 22.788  35.539  21.531  1.00 24.26 ? 149 PRO B CD  1 
ATOM   2838 N  N   . LEU B 1 150 ? 23.383  37.853  24.224  1.00 26.73 ? 150 LEU B N   1 
ATOM   2839 C  CA  . LEU B 1 150 ? 23.269  38.538  25.503  1.00 26.79 ? 150 LEU B CA  1 
ATOM   2840 C  C   . LEU B 1 150 ? 24.636  38.794  26.120  1.00 28.40 ? 150 LEU B C   1 
ATOM   2841 O  O   . LEU B 1 150 ? 24.769  39.634  27.011  1.00 28.33 ? 150 LEU B O   1 
ATOM   2842 C  CB  . LEU B 1 150 ? 22.407  37.726  26.471  1.00 27.73 ? 150 LEU B CB  1 
ATOM   2843 C  CG  . LEU B 1 150 ? 20.905  37.646  26.173  1.00 29.82 ? 150 LEU B CG  1 
ATOM   2844 C  CD1 . LEU B 1 150 ? 20.209  36.807  27.237  1.00 31.07 ? 150 LEU B CD1 1 
ATOM   2845 C  CD2 . LEU B 1 150 ? 20.312  39.049  26.148  1.00 32.52 ? 150 LEU B CD2 1 
ATOM   2846 N  N   . MET B 1 151 ? 25.654  38.082  25.642  1.00 25.67 ? 151 MET B N   1 
ATOM   2847 C  CA  . MET B 1 151 ? 27.012  38.250  26.163  1.00 26.40 ? 151 MET B CA  1 
ATOM   2848 C  C   . MET B 1 151 ? 27.708  39.513  25.653  1.00 27.81 ? 151 MET B C   1 
ATOM   2849 O  O   . MET B 1 151 ? 28.755  39.907  26.171  1.00 26.62 ? 151 MET B O   1 
ATOM   2850 C  CB  . MET B 1 151 ? 27.872  37.043  25.799  1.00 23.64 ? 151 MET B CB  1 
ATOM   2851 C  CG  . MET B 1 151 ? 27.420  35.758  26.444  1.00 23.75 ? 151 MET B CG  1 
ATOM   2852 S  SD  . MET B 1 151 ? 28.357  34.366  25.818  1.00 23.58 ? 151 MET B SD  1 
ATOM   2853 C  CE  . MET B 1 151 ? 27.681  33.059  26.856  1.00 20.87 ? 151 MET B CE  1 
ATOM   2854 N  N   . GLY B 1 152 ? 27.135  40.139  24.633  1.00 29.27 ? 152 GLY B N   1 
ATOM   2855 C  CA  . GLY B 1 152 ? 27.743  41.339  24.095  1.00 31.24 ? 152 GLY B CA  1 
ATOM   2856 C  C   . GLY B 1 152 ? 28.599  41.049  22.879  1.00 33.36 ? 152 GLY B C   1 
ATOM   2857 O  O   . GLY B 1 152 ? 29.046  39.919  22.661  1.00 33.53 ? 152 GLY B O   1 
ATOM   2858 N  N   . GLU B 1 153 ? 28.840  42.085  22.089  1.00 33.18 ? 153 GLU B N   1 
ATOM   2859 C  CA  . GLU B 1 153 ? 29.621  41.968  20.871  1.00 34.19 ? 153 GLU B CA  1 
ATOM   2860 C  C   . GLU B 1 153 ? 31.099  41.630  21.106  1.00 32.72 ? 153 GLU B C   1 
ATOM   2861 O  O   . GLU B 1 153 ? 31.702  40.888  20.330  1.00 29.57 ? 153 GLU B O   1 
ATOM   2862 C  CB  . GLU B 1 153 ? 29.487  43.265  20.080  1.00 37.87 ? 153 GLU B CB  1 
ATOM   2863 C  CG  . GLU B 1 153 ? 29.982  43.187  18.658  1.00 47.49 ? 153 GLU B CG  1 
ATOM   2864 C  CD  . GLU B 1 153 ? 29.727  44.473  17.904  1.00 52.88 ? 153 GLU B CD  1 
ATOM   2865 O  OE1 . GLU B 1 153 ? 28.545  44.872  17.799  1.00 55.03 ? 153 GLU B OE1 1 
ATOM   2866 O  OE2 . GLU B 1 153 ? 30.707  45.086  17.424  1.00 56.45 ? 153 GLU B OE2 1 
ATOM   2867 N  N   . ALA B 1 154 ? 31.678  42.166  22.175  1.00 31.55 ? 154 ALA B N   1 
ATOM   2868 C  CA  . ALA B 1 154 ? 33.083  41.915  22.485  1.00 32.12 ? 154 ALA B CA  1 
ATOM   2869 C  C   . ALA B 1 154 ? 33.360  40.428  22.667  1.00 32.45 ? 154 ALA B C   1 
ATOM   2870 O  O   . ALA B 1 154 ? 34.379  39.913  22.207  1.00 31.36 ? 154 ALA B O   1 
ATOM   2871 C  CB  . ALA B 1 154 ? 33.484  42.666  23.748  1.00 32.71 ? 154 ALA B CB  1 
ATOM   2872 N  N   . ILE B 1 155 ? 32.449  39.744  23.347  1.00 31.60 ? 155 ILE B N   1 
ATOM   2873 C  CA  . ILE B 1 155 ? 32.606  38.320  23.600  1.00 30.76 ? 155 ILE B CA  1 
ATOM   2874 C  C   . ILE B 1 155 ? 32.112  37.441  22.451  1.00 29.20 ? 155 ILE B C   1 
ATOM   2875 O  O   . ILE B 1 155 ? 32.877  36.662  21.883  1.00 28.68 ? 155 ILE B O   1 
ATOM   2876 C  CB  . ILE B 1 155 ? 31.831  37.883  24.875  1.00 31.96 ? 155 ILE B CB  1 
ATOM   2877 C  CG1 . ILE B 1 155 ? 32.306  38.673  26.103  1.00 33.37 ? 155 ILE B CG1 1 
ATOM   2878 C  CG2 . ILE B 1 155 ? 32.011  36.389  25.101  1.00 29.98 ? 155 ILE B CG2 1 
ATOM   2879 C  CD1 . ILE B 1 155 ? 33.721  38.384  26.534  1.00 36.51 ? 155 ILE B CD1 1 
ATOM   2880 N  N   . SER B 1 156 ? 30.834  37.582  22.108  1.00 29.29 ? 156 SER B N   1 
ATOM   2881 C  CA  . SER B 1 156 ? 30.195  36.752  21.085  1.00 27.00 ? 156 SER B CA  1 
ATOM   2882 C  C   . SER B 1 156 ? 30.216  37.216  19.639  1.00 27.72 ? 156 SER B C   1 
ATOM   2883 O  O   . SER B 1 156 ? 29.934  36.425  18.734  1.00 25.43 ? 156 SER B O   1 
ATOM   2884 C  CB  . SER B 1 156 ? 28.736  36.505  21.475  1.00 26.61 ? 156 SER B CB  1 
ATOM   2885 O  OG  . SER B 1 156 ? 27.966  37.682  21.298  1.00 26.82 ? 156 SER B OG  1 
ATOM   2886 N  N   . GLY B 1 157 ? 30.528  38.485  19.408  1.00 28.14 ? 157 GLY B N   1 
ATOM   2887 C  CA  . GLY B 1 157 ? 30.538  38.982  18.044  1.00 28.57 ? 157 GLY B CA  1 
ATOM   2888 C  C   . GLY B 1 157 ? 29.154  39.444  17.620  1.00 29.58 ? 157 GLY B C   1 
ATOM   2889 O  O   . GLY B 1 157 ? 28.952  39.877  16.483  1.00 30.52 ? 157 GLY B O   1 
ATOM   2890 N  N   . ALA B 1 158 ? 28.192  39.348  18.534  1.00 29.90 ? 158 ALA B N   1 
ATOM   2891 C  CA  . ALA B 1 158 ? 26.823  39.777  18.255  1.00 30.54 ? 158 ALA B CA  1 
ATOM   2892 C  C   . ALA B 1 158 ? 26.199  40.354  19.520  1.00 31.06 ? 158 ALA B C   1 
ATOM   2893 O  O   . ALA B 1 158 ? 26.727  40.173  20.613  1.00 31.07 ? 158 ALA B O   1 
ATOM   2894 C  CB  . ALA B 1 158 ? 25.990  38.600  17.762  1.00 31.49 ? 158 ALA B CB  1 
ATOM   2895 N  N   . SER B 1 159 ? 25.074  41.045  19.367  1.00 30.95 ? 159 SER B N   1 
ATOM   2896 C  CA  . SER B 1 159 ? 24.380  41.631  20.510  1.00 32.90 ? 159 SER B CA  1 
ATOM   2897 C  C   . SER B 1 159 ? 22.879  41.690  20.243  1.00 32.66 ? 159 SER B C   1 
ATOM   2898 O  O   . SER B 1 159 ? 22.434  41.489  19.113  1.00 33.12 ? 159 SER B O   1 
ATOM   2899 C  CB  . SER B 1 159 ? 24.912  43.042  20.790  1.00 34.54 ? 159 SER B CB  1 
ATOM   2900 O  OG  . SER B 1 159 ? 24.709  43.895  19.674  1.00 34.09 ? 159 SER B OG  1 
ATOM   2901 N  N   . GLY B 1 160 ? 22.102  41.960  21.288  1.00 32.70 ? 160 GLY B N   1 
ATOM   2902 C  CA  . GLY B 1 160 ? 20.663  42.044  21.126  1.00 32.03 ? 160 GLY B CA  1 
ATOM   2903 C  C   . GLY B 1 160 ? 19.909  41.077  22.014  1.00 32.34 ? 160 GLY B C   1 
ATOM   2904 O  O   . GLY B 1 160 ? 20.482  40.116  22.526  1.00 32.31 ? 160 GLY B O   1 
ATOM   2905 N  N   . PHE B 1 161 ? 18.620  41.341  22.203  1.00 31.96 ? 161 PHE B N   1 
ATOM   2906 C  CA  . PHE B 1 161 ? 17.759  40.494  23.023  1.00 31.88 ? 161 PHE B CA  1 
ATOM   2907 C  C   . PHE B 1 161 ? 17.206  39.374  22.147  1.00 31.26 ? 161 PHE B C   1 
ATOM   2908 O  O   . PHE B 1 161 ? 16.532  39.632  21.152  1.00 30.43 ? 161 PHE B O   1 
ATOM   2909 C  CB  . PHE B 1 161 ? 16.604  41.321  23.598  1.00 34.11 ? 161 PHE B CB  1 
ATOM   2910 C  CG  . PHE B 1 161 ? 15.640  40.523  24.425  1.00 35.46 ? 161 PHE B CG  1 
ATOM   2911 C  CD1 . PHE B 1 161 ? 16.031  39.981  25.645  1.00 36.28 ? 161 PHE B CD1 1 
ATOM   2912 C  CD2 . PHE B 1 161 ? 14.341  40.304  23.979  1.00 35.52 ? 161 PHE B CD2 1 
ATOM   2913 C  CE1 . PHE B 1 161 ? 15.141  39.229  26.411  1.00 37.06 ? 161 PHE B CE1 1 
ATOM   2914 C  CE2 . PHE B 1 161 ? 13.444  39.555  24.734  1.00 37.68 ? 161 PHE B CE2 1 
ATOM   2915 C  CZ  . PHE B 1 161 ? 13.846  39.016  25.954  1.00 36.83 ? 161 PHE B CZ  1 
ATOM   2916 N  N   . PRO B 1 162 ? 17.484  38.110  22.507  1.00 31.10 ? 162 PRO B N   1 
ATOM   2917 C  CA  . PRO B 1 162 ? 17.003  36.962  21.729  1.00 30.25 ? 162 PRO B CA  1 
ATOM   2918 C  C   . PRO B 1 162 ? 15.486  36.784  21.741  1.00 29.55 ? 162 PRO B C   1 
ATOM   2919 O  O   . PRO B 1 162 ? 14.882  36.662  22.802  1.00 31.22 ? 162 PRO B O   1 
ATOM   2920 C  CB  . PRO B 1 162 ? 17.705  35.771  22.392  1.00 29.51 ? 162 PRO B CB  1 
ATOM   2921 C  CG  . PRO B 1 162 ? 18.917  36.367  23.016  1.00 32.33 ? 162 PRO B CG  1 
ATOM   2922 C  CD  . PRO B 1 162 ? 18.385  37.662  23.582  1.00 31.22 ? 162 PRO B CD  1 
ATOM   2923 N  N   . ILE B 1 163 ? 14.878  36.768  20.561  1.00 29.54 ? 163 ILE B N   1 
ATOM   2924 C  CA  . ILE B 1 163 ? 13.440  36.563  20.442  1.00 29.15 ? 163 ILE B CA  1 
ATOM   2925 C  C   . ILE B 1 163 ? 13.231  35.063  20.238  1.00 29.03 ? 163 ILE B C   1 
ATOM   2926 O  O   . ILE B 1 163 ? 12.342  34.449  20.833  1.00 28.41 ? 163 ILE B O   1 
ATOM   2927 C  CB  . ILE B 1 163 ? 12.862  37.322  19.225  1.00 29.81 ? 163 ILE B CB  1 
ATOM   2928 C  CG1 . ILE B 1 163 ? 13.016  38.830  19.425  1.00 31.82 ? 163 ILE B CG1 1 
ATOM   2929 C  CG2 . ILE B 1 163 ? 11.410  36.946  19.017  1.00 28.68 ? 163 ILE B CG2 1 
ATOM   2930 C  CD1 . ILE B 1 163 ? 12.329  39.362  20.667  1.00 33.93 ? 163 ILE B CD1 1 
ATOM   2931 N  N   . MET B 1 164 ? 14.074  34.478  19.392  1.00 28.29 ? 164 MET B N   1 
ATOM   2932 C  CA  . MET B 1 164 ? 14.012  33.052  19.094  1.00 27.61 ? 164 MET B CA  1 
ATOM   2933 C  C   . MET B 1 164 ? 15.359  32.619  18.511  1.00 26.05 ? 164 MET B C   1 
ATOM   2934 O  O   . MET B 1 164 ? 16.118  33.450  18.022  1.00 22.27 ? 164 MET B O   1 
ATOM   2935 C  CB  . MET B 1 164 ? 12.857  32.796  18.116  1.00 30.75 ? 164 MET B CB  1 
ATOM   2936 C  CG  . MET B 1 164 ? 13.046  31.655  17.145  1.00 37.38 ? 164 MET B CG  1 
ATOM   2937 S  SD  . MET B 1 164 ? 13.828  32.209  15.624  1.00 41.54 ? 164 MET B SD  1 
ATOM   2938 C  CE  . MET B 1 164 ? 12.402  32.596  14.637  1.00 40.99 ? 164 MET B CE  1 
ATOM   2939 N  N   . GLY B 1 165 ? 15.666  31.330  18.583  1.00 24.73 ? 165 GLY B N   1 
ATOM   2940 C  CA  . GLY B 1 165 ? 16.935  30.868  18.051  1.00 23.58 ? 165 GLY B CA  1 
ATOM   2941 C  C   . GLY B 1 165 ? 16.895  29.419  17.625  1.00 23.00 ? 165 GLY B C   1 
ATOM   2942 O  O   . GLY B 1 165 ? 15.988  28.680  18.010  1.00 21.34 ? 165 GLY B O   1 
ATOM   2943 N  N   . LEU B 1 166 ? 17.878  29.019  16.823  1.00 21.43 ? 166 LEU B N   1 
ATOM   2944 C  CA  . LEU B 1 166 ? 17.971  27.650  16.336  1.00 20.00 ? 166 LEU B CA  1 
ATOM   2945 C  C   . LEU B 1 166 ? 19.363  27.089  16.612  1.00 18.49 ? 166 LEU B C   1 
ATOM   2946 O  O   . LEU B 1 166 ? 20.369  27.687  16.244  1.00 18.94 ? 166 LEU B O   1 
ATOM   2947 C  CB  . LEU B 1 166 ? 17.695  27.597  14.831  1.00 19.33 ? 166 LEU B CB  1 
ATOM   2948 C  CG  . LEU B 1 166 ? 17.842  26.233  14.142  1.00 19.68 ? 166 LEU B CG  1 
ATOM   2949 C  CD1 . LEU B 1 166 ? 16.824  25.238  14.706  1.00 19.85 ? 166 LEU B CD1 1 
ATOM   2950 C  CD2 . LEU B 1 166 ? 17.630  26.401  12.646  1.00 20.65 ? 166 LEU B CD2 1 
ATOM   2951 N  N   . ASP B 1 167 ? 19.400  25.933  17.260  1.00 17.84 ? 167 ASP B N   1 
ATOM   2952 C  CA  . ASP B 1 167 ? 20.642  25.252  17.595  1.00 16.73 ? 167 ASP B CA  1 
ATOM   2953 C  C   . ASP B 1 167 ? 21.157  24.581  16.319  1.00 17.64 ? 167 ASP B C   1 
ATOM   2954 O  O   . ASP B 1 167 ? 20.448  23.764  15.729  1.00 18.21 ? 167 ASP B O   1 
ATOM   2955 C  CB  . ASP B 1 167 ? 20.344  24.198  18.673  1.00 15.34 ? 167 ASP B CB  1 
ATOM   2956 C  CG  . ASP B 1 167 ? 21.581  23.480  19.183  1.00 18.61 ? 167 ASP B CG  1 
ATOM   2957 O  OD1 . ASP B 1 167 ? 22.704  23.749  18.697  1.00 17.11 ? 167 ASP B OD1 1 
ATOM   2958 O  OD2 . ASP B 1 167 ? 21.424  22.626  20.091  1.00 18.41 ? 167 ASP B OD2 1 
ATOM   2959 N  N   . VAL B 1 168 ? 22.359  24.936  15.862  1.00 16.54 ? 168 VAL B N   1 
ATOM   2960 C  CA  . VAL B 1 168 ? 22.878  24.267  14.679  1.00 15.80 ? 168 VAL B CA  1 
ATOM   2961 C  C   . VAL B 1 168 ? 24.108  23.421  14.957  1.00 17.29 ? 168 VAL B C   1 
ATOM   2962 O  O   . VAL B 1 168 ? 24.925  23.187  14.071  1.00 19.22 ? 168 VAL B O   1 
ATOM   2963 C  CB  . VAL B 1 168 ? 23.161  25.226  13.490  1.00 17.94 ? 168 VAL B CB  1 
ATOM   2964 C  CG1 . VAL B 1 168 ? 21.835  25.734  12.918  1.00 17.16 ? 168 VAL B CG1 1 
ATOM   2965 C  CG2 . VAL B 1 168 ? 24.065  26.364  13.919  1.00 17.40 ? 168 VAL B CG2 1 
ATOM   2966 N  N   . TRP B 1 169 ? 24.248  22.979  16.203  1.00 17.11 ? 169 TRP B N   1 
ATOM   2967 C  CA  . TRP B 1 169 ? 25.323  22.060  16.558  1.00 16.05 ? 169 TRP B CA  1 
ATOM   2968 C  C   . TRP B 1 169 ? 24.846  20.781  15.882  1.00 16.23 ? 169 TRP B C   1 
ATOM   2969 O  O   . TRP B 1 169 ? 23.638  20.543  15.820  1.00 16.98 ? 169 TRP B O   1 
ATOM   2970 C  CB  . TRP B 1 169 ? 25.364  21.801  18.060  1.00 12.28 ? 169 TRP B CB  1 
ATOM   2971 C  CG  . TRP B 1 169 ? 26.131  22.799  18.846  1.00 14.41 ? 169 TRP B CG  1 
ATOM   2972 C  CD1 . TRP B 1 169 ? 25.910  24.146  18.916  1.00 12.93 ? 169 TRP B CD1 1 
ATOM   2973 C  CD2 . TRP B 1 169 ? 27.233  22.523  19.711  1.00 14.21 ? 169 TRP B CD2 1 
ATOM   2974 N  NE1 . TRP B 1 169 ? 26.813  24.727  19.777  1.00 14.87 ? 169 TRP B NE1 1 
ATOM   2975 C  CE2 . TRP B 1 169 ? 27.637  23.751  20.279  1.00 15.27 ? 169 TRP B CE2 1 
ATOM   2976 C  CE3 . TRP B 1 169 ? 27.919  21.352  20.066  1.00 13.47 ? 169 TRP B CE3 1 
ATOM   2977 C  CZ2 . TRP B 1 169 ? 28.697  23.843  21.183  1.00 15.00 ? 169 TRP B CZ2 1 
ATOM   2978 C  CZ3 . TRP B 1 169 ? 28.977  21.443  20.966  1.00 14.54 ? 169 TRP B CZ3 1 
ATOM   2979 C  CH2 . TRP B 1 169 ? 29.354  22.682  21.513  1.00 16.70 ? 169 TRP B CH2 1 
ATOM   2980 N  N   . GLU B 1 170 ? 25.767  19.952  15.400  1.00 15.39 ? 170 GLU B N   1 
ATOM   2981 C  CA  . GLU B 1 170 ? 25.365  18.721  14.724  1.00 15.74 ? 170 GLU B CA  1 
ATOM   2982 C  C   . GLU B 1 170 ? 24.547  17.758  15.597  1.00 15.76 ? 170 GLU B C   1 
ATOM   2983 O  O   . GLU B 1 170 ? 23.724  17.013  15.068  1.00 17.14 ? 170 GLU B O   1 
ATOM   2984 C  CB  . GLU B 1 170 ? 26.593  18.020  14.125  1.00 14.53 ? 170 GLU B CB  1 
ATOM   2985 C  CG  . GLU B 1 170 ? 27.236  18.852  13.018  1.00 15.24 ? 170 GLU B CG  1 
ATOM   2986 C  CD  . GLU B 1 170 ? 28.529  18.264  12.489  1.00 14.90 ? 170 GLU B CD  1 
ATOM   2987 O  OE1 . GLU B 1 170 ? 29.338  17.791  13.304  1.00 15.36 ? 170 GLU B OE1 1 
ATOM   2988 O  OE2 . GLU B 1 170 ? 28.739  18.291  11.258  1.00 16.06 ? 170 GLU B OE2 1 
ATOM   2989 N  N   . HIS B 1 171 ? 24.733  17.778  16.917  1.00 15.32 ? 171 HIS B N   1 
ATOM   2990 C  CA  . HIS B 1 171 ? 23.947  16.879  17.765  1.00 14.82 ? 171 HIS B CA  1 
ATOM   2991 C  C   . HIS B 1 171 ? 22.454  17.189  17.728  1.00 15.86 ? 171 HIS B C   1 
ATOM   2992 O  O   . HIS B 1 171 ? 21.634  16.328  18.046  1.00 16.45 ? 171 HIS B O   1 
ATOM   2993 C  CB  . HIS B 1 171 ? 24.448  16.865  19.227  1.00 14.87 ? 171 HIS B CB  1 
ATOM   2994 C  CG  . HIS B 1 171 ? 24.312  18.172  19.954  1.00 15.95 ? 171 HIS B CG  1 
ATOM   2995 N  ND1 . HIS B 1 171 ? 25.386  18.806  20.542  1.00 14.83 ? 171 HIS B ND1 1 
ATOM   2996 C  CD2 . HIS B 1 171 ? 23.224  18.926  20.252  1.00 15.12 ? 171 HIS B CD2 1 
ATOM   2997 C  CE1 . HIS B 1 171 ? 24.968  19.890  21.173  1.00 15.34 ? 171 HIS B CE1 1 
ATOM   2998 N  NE2 . HIS B 1 171 ? 23.659  19.986  21.013  1.00 16.65 ? 171 HIS B NE2 1 
ATOM   2999 N  N   . ALA B 1 172 ? 22.102  18.408  17.322  1.00 15.78 ? 172 ALA B N   1 
ATOM   3000 C  CA  . ALA B 1 172 ? 20.700  18.812  17.233  1.00 16.96 ? 172 ALA B CA  1 
ATOM   3001 C  C   . ALA B 1 172 ? 19.968  18.204  16.029  1.00 17.58 ? 172 ALA B C   1 
ATOM   3002 O  O   . ALA B 1 172 ? 18.729  18.156  16.007  1.00 17.57 ? 172 ALA B O   1 
ATOM   3003 C  CB  . ALA B 1 172 ? 20.607  20.331  17.158  1.00 14.94 ? 172 ALA B CB  1 
ATOM   3004 N  N   . TYR B 1 173 ? 20.718  17.723  15.039  1.00 16.24 ? 173 TYR B N   1 
ATOM   3005 C  CA  . TYR B 1 173 ? 20.081  17.189  13.835  1.00 14.51 ? 173 TYR B CA  1 
ATOM   3006 C  C   . TYR B 1 173 ? 20.710  15.982  13.145  1.00 15.24 ? 173 TYR B C   1 
ATOM   3007 O  O   . TYR B 1 173 ? 20.154  15.487  12.167  1.00 17.00 ? 173 TYR B O   1 
ATOM   3008 C  CB  . TYR B 1 173 ? 19.968  18.324  12.806  1.00 15.75 ? 173 TYR B CB  1 
ATOM   3009 C  CG  . TYR B 1 173 ? 21.311  18.872  12.302  1.00 17.59 ? 173 TYR B CG  1 
ATOM   3010 C  CD1 . TYR B 1 173 ? 22.049  18.203  11.313  1.00 16.56 ? 173 TYR B CD1 1 
ATOM   3011 C  CD2 . TYR B 1 173 ? 21.830  20.069  12.805  1.00 17.01 ? 173 TYR B CD2 1 
ATOM   3012 C  CE1 . TYR B 1 173 ? 23.269  18.721  10.838  1.00 18.85 ? 173 TYR B CE1 1 
ATOM   3013 C  CE2 . TYR B 1 173 ? 23.041  20.594  12.339  1.00 18.02 ? 173 TYR B CE2 1 
ATOM   3014 C  CZ  . TYR B 1 173 ? 23.754  19.920  11.357  1.00 18.35 ? 173 TYR B CZ  1 
ATOM   3015 O  OH  . TYR B 1 173 ? 24.941  20.460  10.894  1.00 17.72 ? 173 TYR B OH  1 
ATOM   3016 N  N   . TYR B 1 174 ? 21.844  15.490  13.634  1.00 15.26 ? 174 TYR B N   1 
ATOM   3017 C  CA  . TYR B 1 174 ? 22.505  14.389  12.948  1.00 15.61 ? 174 TYR B CA  1 
ATOM   3018 C  C   . TYR B 1 174 ? 21.786  13.045  12.897  1.00 19.04 ? 174 TYR B C   1 
ATOM   3019 O  O   . TYR B 1 174 ? 21.837  12.363  11.874  1.00 17.31 ? 174 TYR B O   1 
ATOM   3020 C  CB  . TYR B 1 174 ? 23.920  14.171  13.496  1.00 17.48 ? 174 TYR B CB  1 
ATOM   3021 C  CG  . TYR B 1 174 ? 24.904  13.887  12.387  1.00 15.76 ? 174 TYR B CG  1 
ATOM   3022 C  CD1 . TYR B 1 174 ? 25.332  14.910  11.539  1.00 17.75 ? 174 TYR B CD1 1 
ATOM   3023 C  CD2 . TYR B 1 174 ? 25.316  12.581  12.105  1.00 16.62 ? 174 TYR B CD2 1 
ATOM   3024 C  CE1 . TYR B 1 174 ? 26.134  14.643  10.430  1.00 16.62 ? 174 TYR B CE1 1 
ATOM   3025 C  CE2 . TYR B 1 174 ? 26.118  12.305  10.994  1.00 17.37 ? 174 TYR B CE2 1 
ATOM   3026 C  CZ  . TYR B 1 174 ? 26.518  13.342  10.162  1.00 17.61 ? 174 TYR B CZ  1 
ATOM   3027 O  OH  . TYR B 1 174 ? 27.281  13.076  9.052   1.00 20.22 ? 174 TYR B OH  1 
ATOM   3028 N  N   . LEU B 1 175 ? 21.122  12.654  13.980  1.00 17.04 ? 175 LEU B N   1 
ATOM   3029 C  CA  . LEU B 1 175 ? 20.443  11.363  13.978  1.00 19.05 ? 175 LEU B CA  1 
ATOM   3030 C  C   . LEU B 1 175 ? 19.405  11.256  12.866  1.00 18.31 ? 175 LEU B C   1 
ATOM   3031 O  O   . LEU B 1 175 ? 19.312  10.230  12.198  1.00 19.66 ? 175 LEU B O   1 
ATOM   3032 C  CB  . LEU B 1 175 ? 19.784  11.090  15.335  1.00 18.18 ? 175 LEU B CB  1 
ATOM   3033 C  CG  . LEU B 1 175 ? 20.733  10.878  16.515  1.00 20.28 ? 175 LEU B CG  1 
ATOM   3034 C  CD1 . LEU B 1 175 ? 19.924  10.528  17.752  1.00 23.28 ? 175 LEU B CD1 1 
ATOM   3035 C  CD2 . LEU B 1 175 ? 21.728  9.766   16.197  1.00 21.86 ? 175 LEU B CD2 1 
ATOM   3036 N  N   . LYS B 1 176 ? 18.639  12.314  12.648  1.00 19.46 ? 176 LYS B N   1 
ATOM   3037 C  CA  . LYS B 1 176 ? 17.615  12.266  11.615  1.00 20.91 ? 176 LYS B CA  1 
ATOM   3038 C  C   . LYS B 1 176 ? 18.015  12.826  10.251  1.00 21.50 ? 176 LYS B C   1 
ATOM   3039 O  O   . LYS B 1 176 ? 17.635  12.279  9.212   1.00 21.73 ? 176 LYS B O   1 
ATOM   3040 C  CB  . LYS B 1 176 ? 16.356  12.987  12.096  1.00 20.69 ? 176 LYS B CB  1 
ATOM   3041 C  CG  . LYS B 1 176 ? 15.236  13.021  11.054  1.00 24.24 ? 176 LYS B CG  1 
ATOM   3042 C  CD  . LYS B 1 176 ? 13.999  13.725  11.579  1.00 25.50 ? 176 LYS B CD  1 
ATOM   3043 C  CE  . LYS B 1 176 ? 12.908  13.741  10.521  1.00 27.82 ? 176 LYS B CE  1 
ATOM   3044 N  NZ  . LYS B 1 176 ? 11.709  14.483  10.969  1.00 29.63 ? 176 LYS B NZ  1 
ATOM   3045 N  N   . PHE B 1 177 ? 18.793  13.900  10.246  1.00 19.47 ? 177 PHE B N   1 
ATOM   3046 C  CA  . PHE B 1 177 ? 19.172  14.550  8.994   1.00 19.13 ? 177 PHE B CA  1 
ATOM   3047 C  C   . PHE B 1 177 ? 20.622  14.356  8.545   1.00 19.94 ? 177 PHE B C   1 
ATOM   3048 O  O   . PHE B 1 177 ? 20.981  14.750  7.435   1.00 20.98 ? 177 PHE B O   1 
ATOM   3049 C  CB  . PHE B 1 177 ? 18.902  16.054  9.118   1.00 19.60 ? 177 PHE B CB  1 
ATOM   3050 C  CG  . PHE B 1 177 ? 17.485  16.398  9.513   1.00 22.07 ? 177 PHE B CG  1 
ATOM   3051 C  CD1 . PHE B 1 177 ? 16.497  16.560  8.548   1.00 22.97 ? 177 PHE B CD1 1 
ATOM   3052 C  CD2 . PHE B 1 177 ? 17.147  16.581  10.853  1.00 21.92 ? 177 PHE B CD2 1 
ATOM   3053 C  CE1 . PHE B 1 177 ? 15.187  16.905  8.910   1.00 24.15 ? 177 PHE B CE1 1 
ATOM   3054 C  CE2 . PHE B 1 177 ? 15.842  16.924  11.228  1.00 24.31 ? 177 PHE B CE2 1 
ATOM   3055 C  CZ  . PHE B 1 177 ? 14.861  17.088  10.254  1.00 23.43 ? 177 PHE B CZ  1 
ATOM   3056 N  N   . GLN B 1 178 ? 21.446  13.743  9.388   1.00 19.52 ? 178 GLN B N   1 
ATOM   3057 C  CA  . GLN B 1 178 ? 22.863  13.580  9.077   1.00 20.60 ? 178 GLN B CA  1 
ATOM   3058 C  C   . GLN B 1 178 ? 23.415  14.931  8.587   1.00 20.55 ? 178 GLN B C   1 
ATOM   3059 O  O   . GLN B 1 178 ? 23.201  15.960  9.229   1.00 18.42 ? 178 GLN B O   1 
ATOM   3060 C  CB  . GLN B 1 178 ? 23.084  12.485  8.022   1.00 21.82 ? 178 GLN B CB  1 
ATOM   3061 C  CG  . GLN B 1 178 ? 22.745  11.075  8.507   1.00 26.94 ? 178 GLN B CG  1 
ATOM   3062 C  CD  . GLN B 1 178 ? 21.253  10.791  8.487   1.00 29.29 ? 178 GLN B CD  1 
ATOM   3063 O  OE1 . GLN B 1 178 ? 20.611  10.873  7.441   1.00 31.09 ? 178 GLN B OE1 1 
ATOM   3064 N  NE2 . GLN B 1 178 ? 20.696  10.453  9.645   1.00 30.83 ? 178 GLN B NE2 1 
ATOM   3065 N  N   . ASN B 1 179 ? 24.091  14.933  7.442   1.00 19.64 ? 179 ASN B N   1 
ATOM   3066 C  CA  . ASN B 1 179 ? 24.693  16.150  6.891   1.00 20.84 ? 179 ASN B CA  1 
ATOM   3067 C  C   . ASN B 1 179 ? 23.731  17.191  6.321   1.00 20.85 ? 179 ASN B C   1 
ATOM   3068 O  O   . ASN B 1 179 ? 24.122  18.332  6.074   1.00 21.13 ? 179 ASN B O   1 
ATOM   3069 C  CB  . ASN B 1 179 ? 25.663  15.773  5.774   1.00 22.94 ? 179 ASN B CB  1 
ATOM   3070 C  CG  . ASN B 1 179 ? 24.965  15.067  4.625   1.00 24.89 ? 179 ASN B CG  1 
ATOM   3071 O  OD1 . ASN B 1 179 ? 24.494  13.942  4.773   1.00 23.78 ? 179 ASN B OD1 1 
ATOM   3072 N  ND2 . ASN B 1 179 ? 24.879  15.734  3.481   1.00 26.14 ? 179 ASN B ND2 1 
ATOM   3073 N  N   A ARG B 1 180 ? 22.477  16.806  6.116   0.50 20.73 ? 180 ARG B N   1 
ATOM   3074 N  N   B ARG B 1 180 ? 22.476  16.802  6.135   0.50 20.95 ? 180 ARG B N   1 
ATOM   3075 C  CA  A ARG B 1 180 ? 21.492  17.709  5.527   0.50 21.13 ? 180 ARG B CA  1 
ATOM   3076 C  CA  B ARG B 1 180 ? 21.471  17.685  5.555   0.50 21.56 ? 180 ARG B CA  1 
ATOM   3077 C  C   A ARG B 1 180 ? 20.935  18.801  6.442   0.50 21.56 ? 180 ARG B C   1 
ATOM   3078 C  C   B ARG B 1 180 ? 20.932  18.787  6.473   0.50 21.86 ? 180 ARG B C   1 
ATOM   3079 O  O   A ARG B 1 180 ? 19.734  18.846  6.707   0.50 20.89 ? 180 ARG B O   1 
ATOM   3080 O  O   B ARG B 1 180 ? 19.739  18.823  6.770   0.50 21.35 ? 180 ARG B O   1 
ATOM   3081 C  CB  A ARG B 1 180 ? 20.334  16.890  4.940   0.50 22.94 ? 180 ARG B CB  1 
ATOM   3082 C  CB  B ARG B 1 180 ? 20.309  16.836  5.025   0.50 23.75 ? 180 ARG B CB  1 
ATOM   3083 C  CG  A ARG B 1 180 ? 20.764  15.856  3.899   0.50 23.35 ? 180 ARG B CG  1 
ATOM   3084 C  CG  B ARG B 1 180 ? 20.740  15.770  4.017   0.50 24.56 ? 180 ARG B CG  1 
ATOM   3085 C  CD  A ARG B 1 180 ? 19.555  15.154  3.282   0.50 25.08 ? 180 ARG B CD  1 
ATOM   3086 C  CD  B ARG B 1 180 ? 19.573  14.882  3.583   0.50 27.18 ? 180 ARG B CD  1 
ATOM   3087 N  NE  A ARG B 1 180 ? 18.786  14.402  4.273   0.50 27.27 ? 180 ARG B NE  1 
ATOM   3088 N  NE  B ARG B 1 180 ? 19.100  14.013  4.659   0.50 27.88 ? 180 ARG B NE  1 
ATOM   3089 C  CZ  A ARG B 1 180 ? 19.215  13.296  4.875   0.50 26.62 ? 180 ARG B CZ  1 
ATOM   3090 C  CZ  B ARG B 1 180 ? 17.881  14.068  5.190   0.50 27.79 ? 180 ARG B CZ  1 
ATOM   3091 N  NH1 A ARG B 1 180 ? 20.411  12.802  4.589   0.50 28.81 ? 180 ARG B NH1 1 
ATOM   3092 N  NH1 B ARG B 1 180 ? 16.998  14.954  4.751   0.50 28.03 ? 180 ARG B NH1 1 
ATOM   3093 N  NH2 A ARG B 1 180 ? 18.448  12.683  5.766   0.50 26.68 ? 180 ARG B NH2 1 
ATOM   3094 N  NH2 B ARG B 1 180 ? 17.542  13.231  6.161   0.50 28.83 ? 180 ARG B NH2 1 
ATOM   3095 N  N   . ARG B 1 181 ? 21.804  19.698  6.901   1.00 21.73 ? 181 ARG B N   1 
ATOM   3096 C  CA  . ARG B 1 181 ? 21.379  20.788  7.775   1.00 20.81 ? 181 ARG B CA  1 
ATOM   3097 C  C   . ARG B 1 181 ? 20.247  21.626  7.157   1.00 21.11 ? 181 ARG B C   1 
ATOM   3098 O  O   . ARG B 1 181 ? 19.348  22.082  7.868   1.00 21.06 ? 181 ARG B O   1 
ATOM   3099 C  CB  . ARG B 1 181 ? 22.558  21.708  8.132   1.00 20.07 ? 181 ARG B CB  1 
ATOM   3100 C  CG  . ARG B 1 181 ? 22.194  22.719  9.215   1.00 20.06 ? 181 ARG B CG  1 
ATOM   3101 C  CD  . ARG B 1 181 ? 23.226  23.830  9.386   1.00 18.33 ? 181 ARG B CD  1 
ATOM   3102 N  NE  . ARG B 1 181 ? 24.468  23.363  9.988   1.00 20.42 ? 181 ARG B NE  1 
ATOM   3103 C  CZ  . ARG B 1 181 ? 25.480  24.166  10.310  1.00 22.49 ? 181 ARG B CZ  1 
ATOM   3104 N  NH1 . ARG B 1 181 ? 25.388  25.472  10.086  1.00 19.58 ? 181 ARG B NH1 1 
ATOM   3105 N  NH2 . ARG B 1 181 ? 26.583  23.665  10.852  1.00 21.71 ? 181 ARG B NH2 1 
ATOM   3106 N  N   . PRO B 1 182 ? 20.280  21.857  5.833   1.00 21.51 ? 182 PRO B N   1 
ATOM   3107 C  CA  . PRO B 1 182 ? 19.206  22.650  5.221   1.00 23.46 ? 182 PRO B CA  1 
ATOM   3108 C  C   . PRO B 1 182 ? 17.816  22.038  5.420   1.00 24.14 ? 182 PRO B C   1 
ATOM   3109 O  O   . PRO B 1 182 ? 16.837  22.766  5.573   1.00 25.64 ? 182 PRO B O   1 
ATOM   3110 C  CB  . PRO B 1 182 ? 19.618  22.713  3.754   1.00 24.92 ? 182 PRO B CB  1 
ATOM   3111 C  CG  . PRO B 1 182 ? 21.133  22.727  3.850   1.00 23.98 ? 182 PRO B CG  1 
ATOM   3112 C  CD  . PRO B 1 182 ? 21.377  21.635  4.870   1.00 22.65 ? 182 PRO B CD  1 
ATOM   3113 N  N   . ASP B 1 183 ? 17.725  20.711  5.414   1.00 24.32 ? 183 ASP B N   1 
ATOM   3114 C  CA  . ASP B 1 183 ? 16.435  20.052  5.613   1.00 24.83 ? 183 ASP B CA  1 
ATOM   3115 C  C   . ASP B 1 183 ? 15.958  20.275  7.045   1.00 24.29 ? 183 ASP B C   1 
ATOM   3116 O  O   . ASP B 1 183 ? 14.768  20.466  7.293   1.00 24.45 ? 183 ASP B O   1 
ATOM   3117 C  CB  . ASP B 1 183 ? 16.545  18.553  5.322   1.00 26.33 ? 183 ASP B CB  1 
ATOM   3118 C  CG  . ASP B 1 183 ? 16.801  18.263  3.850   1.00 29.22 ? 183 ASP B CG  1 
ATOM   3119 O  OD1 . ASP B 1 183 ? 16.507  19.140  3.015   1.00 30.67 ? 183 ASP B OD1 1 
ATOM   3120 O  OD2 . ASP B 1 183 ? 17.279  17.158  3.528   1.00 31.44 ? 183 ASP B OD2 1 
ATOM   3121 N  N   . TYR B 1 184 ? 16.902  20.248  7.981   1.00 22.56 ? 184 TYR B N   1 
ATOM   3122 C  CA  . TYR B 1 184 ? 16.619  20.473  9.393   1.00 20.85 ? 184 TYR B CA  1 
ATOM   3123 C  C   . TYR B 1 184 ? 16.078  21.894  9.575   1.00 22.67 ? 184 TYR B C   1 
ATOM   3124 O  O   . TYR B 1 184 ? 15.087  22.112  10.281  1.00 20.98 ? 184 TYR B O   1 
ATOM   3125 C  CB  . TYR B 1 184 ? 17.917  20.281  10.186  1.00 20.11 ? 184 TYR B CB  1 
ATOM   3126 C  CG  . TYR B 1 184 ? 17.913  20.830  11.594  1.00 19.71 ? 184 TYR B CG  1 
ATOM   3127 C  CD1 . TYR B 1 184 ? 17.097  20.277  12.585  1.00 18.38 ? 184 TYR B CD1 1 
ATOM   3128 C  CD2 . TYR B 1 184 ? 18.776  21.868  11.950  1.00 18.40 ? 184 TYR B CD2 1 
ATOM   3129 C  CE1 . TYR B 1 184 ? 17.151  20.743  13.900  1.00 21.19 ? 184 TYR B CE1 1 
ATOM   3130 C  CE2 . TYR B 1 184 ? 18.840  22.338  13.252  1.00 18.30 ? 184 TYR B CE2 1 
ATOM   3131 C  CZ  . TYR B 1 184 ? 18.029  21.773  14.225  1.00 18.56 ? 184 TYR B CZ  1 
ATOM   3132 O  OH  . TYR B 1 184 ? 18.115  22.227  15.520  1.00 19.85 ? 184 TYR B OH  1 
ATOM   3133 N  N   . ILE B 1 185 ? 16.735  22.851  8.923   1.00 23.06 ? 185 ILE B N   1 
ATOM   3134 C  CA  . ILE B 1 185 ? 16.336  24.256  8.993   1.00 25.69 ? 185 ILE B CA  1 
ATOM   3135 C  C   . ILE B 1 185 ? 14.893  24.430  8.514   1.00 27.23 ? 185 ILE B C   1 
ATOM   3136 O  O   . ILE B 1 185 ? 14.122  25.180  9.106   1.00 27.37 ? 185 ILE B O   1 
ATOM   3137 C  CB  . ILE B 1 185 ? 17.224  25.155  8.088   1.00 27.87 ? 185 ILE B CB  1 
ATOM   3138 C  CG1 . ILE B 1 185 ? 18.711  24.956  8.397   1.00 29.12 ? 185 ILE B CG1 1 
ATOM   3139 C  CG2 . ILE B 1 185 ? 16.843  26.608  8.280   1.00 27.71 ? 185 ILE B CG2 1 
ATOM   3140 C  CD1 . ILE B 1 185 ? 19.115  25.358  9.768   1.00 34.89 ? 185 ILE B CD1 1 
ATOM   3141 N  N   . LYS B 1 186 ? 14.536  23.743  7.432   1.00 28.31 ? 186 LYS B N   1 
ATOM   3142 C  CA  . LYS B 1 186 ? 13.182  23.841  6.886   1.00 30.47 ? 186 LYS B CA  1 
ATOM   3143 C  C   . LYS B 1 186 ? 12.144  23.268  7.838   1.00 28.89 ? 186 LYS B C   1 
ATOM   3144 O  O   . LYS B 1 186 ? 11.067  23.837  7.994   1.00 29.61 ? 186 LYS B O   1 
ATOM   3145 C  CB  . LYS B 1 186 ? 13.087  23.105  5.545   1.00 33.12 ? 186 LYS B CB  1 
ATOM   3146 C  CG  . LYS B 1 186 ? 13.700  23.848  4.374   1.00 38.47 ? 186 LYS B CG  1 
ATOM   3147 C  CD  . LYS B 1 186 ? 12.961  25.154  4.119   1.00 43.09 ? 186 LYS B CD  1 
ATOM   3148 C  CE  . LYS B 1 186 ? 13.542  25.909  2.931   1.00 45.75 ? 186 LYS B CE  1 
ATOM   3149 N  NZ  . LYS B 1 186 ? 12.836  27.204  2.703   1.00 46.38 ? 186 LYS B NZ  1 
ATOM   3150 N  N   . GLU B 1 187 ? 12.461  22.138  8.465   1.00 28.14 ? 187 GLU B N   1 
ATOM   3151 C  CA  . GLU B 1 187 ? 11.534  21.513  9.407   1.00 28.36 ? 187 GLU B CA  1 
ATOM   3152 C  C   . GLU B 1 187 ? 11.291  22.414  10.615  1.00 27.55 ? 187 GLU B C   1 
ATOM   3153 O  O   . GLU B 1 187 ? 10.211  22.394  11.213  1.00 26.92 ? 187 GLU B O   1 
ATOM   3154 C  CB  . GLU B 1 187 ? 12.078  20.167  9.891   1.00 27.39 ? 187 GLU B CB  1 
ATOM   3155 C  CG  . GLU B 1 187 ? 11.939  19.029  8.904   1.00 30.34 ? 187 GLU B CG  1 
ATOM   3156 C  CD  . GLU B 1 187 ? 10.500  18.798  8.468   1.00 35.08 ? 187 GLU B CD  1 
ATOM   3157 O  OE1 . GLU B 1 187 ? 9.574   19.030  9.277   1.00 33.52 ? 187 GLU B OE1 1 
ATOM   3158 O  OE2 . GLU B 1 187 ? 10.298  18.371  7.314   1.00 37.97 ? 187 GLU B OE2 1 
ATOM   3159 N  N   . PHE B 1 188 ? 12.301  23.203  10.968  1.00 25.48 ? 188 PHE B N   1 
ATOM   3160 C  CA  . PHE B 1 188 ? 12.214  24.115  12.106  1.00 24.36 ? 188 PHE B CA  1 
ATOM   3161 C  C   . PHE B 1 188 ? 11.018  25.061  12.006  1.00 25.42 ? 188 PHE B C   1 
ATOM   3162 O  O   . PHE B 1 188 ? 10.357  25.350  13.008  1.00 25.48 ? 188 PHE B O   1 
ATOM   3163 C  CB  . PHE B 1 188 ? 13.515  24.924  12.221  1.00 22.15 ? 188 PHE B CB  1 
ATOM   3164 C  CG  . PHE B 1 188 ? 13.490  25.984  13.292  1.00 23.57 ? 188 PHE B CG  1 
ATOM   3165 C  CD1 . PHE B 1 188 ? 13.342  25.641  14.632  1.00 22.67 ? 188 PHE B CD1 1 
ATOM   3166 C  CD2 . PHE B 1 188 ? 13.649  27.327  12.960  1.00 21.80 ? 188 PHE B CD2 1 
ATOM   3167 C  CE1 . PHE B 1 188 ? 13.358  26.627  15.626  1.00 23.68 ? 188 PHE B CE1 1 
ATOM   3168 C  CE2 . PHE B 1 188 ? 13.666  28.313  13.939  1.00 22.75 ? 188 PHE B CE2 1 
ATOM   3169 C  CZ  . PHE B 1 188 ? 13.521  27.960  15.279  1.00 23.39 ? 188 PHE B CZ  1 
ATOM   3170 N  N   . TRP B 1 189 ? 10.754  25.559  10.802  1.00 24.92 ? 189 TRP B N   1 
ATOM   3171 C  CA  . TRP B 1 189 ? 9.645   26.485  10.599  1.00 26.57 ? 189 TRP B CA  1 
ATOM   3172 C  C   . TRP B 1 189 ? 8.315   25.889  11.053  1.00 26.50 ? 189 TRP B C   1 
ATOM   3173 O  O   . TRP B 1 189 ? 7.405   26.616  11.439  1.00 28.22 ? 189 TRP B O   1 
ATOM   3174 C  CB  . TRP B 1 189 ? 9.559   26.894  9.125   1.00 27.38 ? 189 TRP B CB  1 
ATOM   3175 C  CG  . TRP B 1 189 ? 10.732  27.714  8.680   1.00 27.91 ? 189 TRP B CG  1 
ATOM   3176 C  CD1 . TRP B 1 189 ? 11.549  27.465  7.615   1.00 27.29 ? 189 TRP B CD1 1 
ATOM   3177 C  CD2 . TRP B 1 189 ? 11.242  28.897  9.309   1.00 28.35 ? 189 TRP B CD2 1 
ATOM   3178 N  NE1 . TRP B 1 189 ? 12.539  28.416  7.546   1.00 26.77 ? 189 TRP B NE1 1 
ATOM   3179 C  CE2 . TRP B 1 189 ? 12.375  29.307  8.572   1.00 27.65 ? 189 TRP B CE2 1 
ATOM   3180 C  CE3 . TRP B 1 189 ? 10.854  29.651  10.426  1.00 28.57 ? 189 TRP B CE3 1 
ATOM   3181 C  CZ2 . TRP B 1 189 ? 13.126  30.440  8.914   1.00 29.02 ? 189 TRP B CZ2 1 
ATOM   3182 C  CZ3 . TRP B 1 189 ? 11.602  30.779  10.766  1.00 28.35 ? 189 TRP B CZ3 1 
ATOM   3183 C  CH2 . TRP B 1 189 ? 12.724  31.160  10.011  1.00 27.67 ? 189 TRP B CH2 1 
ATOM   3184 N  N   . ASN B 1 190 ? 8.213   24.565  11.010  1.00 26.10 ? 190 ASN B N   1 
ATOM   3185 C  CA  . ASN B 1 190 ? 6.996   23.881  11.425  1.00 27.91 ? 190 ASN B CA  1 
ATOM   3186 C  C   . ASN B 1 190 ? 6.857   23.783  12.941  1.00 28.10 ? 190 ASN B C   1 
ATOM   3187 O  O   . ASN B 1 190 ? 5.754   23.572  13.449  1.00 27.10 ? 190 ASN B O   1 
ATOM   3188 C  CB  . ASN B 1 190 ? 6.948   22.476  10.821  1.00 28.33 ? 190 ASN B CB  1 
ATOM   3189 C  CG  . ASN B 1 190 ? 6.824   22.500  9.314   1.00 30.23 ? 190 ASN B CG  1 
ATOM   3190 O  OD1 . ASN B 1 190 ? 5.919   23.130  8.770   1.00 32.51 ? 190 ASN B OD1 1 
ATOM   3191 N  ND2 . ASN B 1 190 ? 7.729   21.814  8.632   1.00 29.39 ? 190 ASN B ND2 1 
ATOM   3192 N  N   . VAL B 1 191 ? 7.963   23.937  13.666  1.00 25.07 ? 191 VAL B N   1 
ATOM   3193 C  CA  . VAL B 1 191 ? 7.908   23.836  15.120  1.00 24.21 ? 191 VAL B CA  1 
ATOM   3194 C  C   . VAL B 1 191 ? 8.332   25.073  15.901  1.00 24.82 ? 191 VAL B C   1 
ATOM   3195 O  O   . VAL B 1 191 ? 8.380   25.033  17.131  1.00 25.25 ? 191 VAL B O   1 
ATOM   3196 C  CB  . VAL B 1 191 ? 8.736   22.633  15.635  1.00 23.55 ? 191 VAL B CB  1 
ATOM   3197 C  CG1 . VAL B 1 191 ? 8.103   21.334  15.164  1.00 23.30 ? 191 VAL B CG1 1 
ATOM   3198 C  CG2 . VAL B 1 191 ? 10.185  22.732  15.139  1.00 22.75 ? 191 VAL B CG2 1 
ATOM   3199 N  N   . VAL B 1 192 ? 8.645   26.172  15.220  1.00 24.62 ? 192 VAL B N   1 
ATOM   3200 C  CA  . VAL B 1 192 ? 9.024   27.368  15.963  1.00 25.43 ? 192 VAL B CA  1 
ATOM   3201 C  C   . VAL B 1 192 ? 7.775   27.869  16.691  1.00 27.02 ? 192 VAL B C   1 
ATOM   3202 O  O   . VAL B 1 192 ? 6.708   28.033  16.088  1.00 26.36 ? 192 VAL B O   1 
ATOM   3203 C  CB  . VAL B 1 192 ? 9.600   28.484  15.040  1.00 27.54 ? 192 VAL B CB  1 
ATOM   3204 C  CG1 . VAL B 1 192 ? 8.604   28.855  13.967  1.00 29.71 ? 192 VAL B CG1 1 
ATOM   3205 C  CG2 . VAL B 1 192 ? 9.961   29.706  15.875  1.00 27.12 ? 192 VAL B CG2 1 
ATOM   3206 N  N   . ASN B 1 193 ? 7.903   28.086  17.995  1.00 26.73 ? 193 ASN B N   1 
ATOM   3207 C  CA  . ASN B 1 193 ? 6.779   28.543  18.800  1.00 28.05 ? 193 ASN B CA  1 
ATOM   3208 C  C   . ASN B 1 193 ? 6.605   30.050  18.670  1.00 26.62 ? 193 ASN B C   1 
ATOM   3209 O  O   . ASN B 1 193 ? 7.242   30.819  19.386  1.00 25.57 ? 193 ASN B O   1 
ATOM   3210 C  CB  . ASN B 1 193 ? 6.998   28.160  20.265  1.00 28.42 ? 193 ASN B CB  1 
ATOM   3211 C  CG  . ASN B 1 193 ? 5.814   28.509  21.141  1.00 29.98 ? 193 ASN B CG  1 
ATOM   3212 O  OD1 . ASN B 1 193 ? 4.903   29.218  20.716  1.00 29.87 ? 193 ASN B OD1 1 
ATOM   3213 N  ND2 . ASN B 1 193 ? 5.827   28.024  22.378  1.00 29.83 ? 193 ASN B ND2 1 
ATOM   3214 N  N   . TRP B 1 194 ? 5.738   30.467  17.752  1.00 28.45 ? 194 TRP B N   1 
ATOM   3215 C  CA  . TRP B 1 194 ? 5.501   31.892  17.532  1.00 30.28 ? 194 TRP B CA  1 
ATOM   3216 C  C   . TRP B 1 194 ? 4.831   32.592  18.708  1.00 30.41 ? 194 TRP B C   1 
ATOM   3217 O  O   . TRP B 1 194 ? 4.984   33.800  18.881  1.00 31.28 ? 194 TRP B O   1 
ATOM   3218 C  CB  . TRP B 1 194 ? 4.669   32.111  16.263  1.00 30.44 ? 194 TRP B CB  1 
ATOM   3219 C  CG  . TRP B 1 194 ? 5.433   31.824  15.011  1.00 31.54 ? 194 TRP B CG  1 
ATOM   3220 C  CD1 . TRP B 1 194 ? 5.151   30.868  14.082  1.00 30.64 ? 194 TRP B CD1 1 
ATOM   3221 C  CD2 . TRP B 1 194 ? 6.636   32.468  14.575  1.00 30.86 ? 194 TRP B CD2 1 
ATOM   3222 N  NE1 . TRP B 1 194 ? 6.106   30.873  13.092  1.00 30.34 ? 194 TRP B NE1 1 
ATOM   3223 C  CE2 . TRP B 1 194 ? 7.030   31.845  13.370  1.00 31.14 ? 194 TRP B CE2 1 
ATOM   3224 C  CE3 . TRP B 1 194 ? 7.421   33.512  15.086  1.00 30.09 ? 194 TRP B CE3 1 
ATOM   3225 C  CZ2 . TRP B 1 194 ? 8.178   32.228  12.665  1.00 30.92 ? 194 TRP B CZ2 1 
ATOM   3226 C  CZ3 . TRP B 1 194 ? 8.565   33.894  14.384  1.00 31.57 ? 194 TRP B CZ3 1 
ATOM   3227 C  CH2 . TRP B 1 194 ? 8.930   33.251  13.186  1.00 32.36 ? 194 TRP B CH2 1 
ATOM   3228 N  N   . ASP B 1 195 ? 4.087   31.847  19.517  1.00 31.06 ? 195 ASP B N   1 
ATOM   3229 C  CA  . ASP B 1 195 ? 3.430   32.454  20.669  1.00 33.38 ? 195 ASP B CA  1 
ATOM   3230 C  C   . ASP B 1 195 ? 4.480   32.905  21.676  1.00 33.32 ? 195 ASP B C   1 
ATOM   3231 O  O   . ASP B 1 195 ? 4.403   34.010  22.211  1.00 33.91 ? 195 ASP B O   1 
ATOM   3232 C  CB  . ASP B 1 195 ? 2.465   31.471  21.334  1.00 35.25 ? 195 ASP B CB  1 
ATOM   3233 C  CG  . ASP B 1 195 ? 1.341   31.048  20.413  1.00 37.69 ? 195 ASP B CG  1 
ATOM   3234 O  OD1 . ASP B 1 195 ? 0.930   31.866  19.564  1.00 36.13 ? 195 ASP B OD1 1 
ATOM   3235 O  OD2 . ASP B 1 195 ? 0.864   29.901  20.546  1.00 41.97 ? 195 ASP B OD2 1 
ATOM   3236 N  N   . GLU B 1 196 ? 5.465   32.048  21.927  1.00 32.58 ? 196 GLU B N   1 
ATOM   3237 C  CA  . GLU B 1 196 ? 6.526   32.385  22.870  1.00 32.68 ? 196 GLU B CA  1 
ATOM   3238 C  C   . GLU B 1 196 ? 7.377   33.517  22.310  1.00 31.17 ? 196 GLU B C   1 
ATOM   3239 O  O   . GLU B 1 196 ? 7.799   34.408  23.046  1.00 32.12 ? 196 GLU B O   1 
ATOM   3240 C  CB  . GLU B 1 196 ? 7.406   31.165  23.148  1.00 32.87 ? 196 GLU B CB  1 
ATOM   3241 C  CG  . GLU B 1 196 ? 8.489   31.393  24.200  1.00 35.52 ? 196 GLU B CG  1 
ATOM   3242 C  CD  . GLU B 1 196 ? 7.927   31.839  25.543  1.00 37.33 ? 196 GLU B CD  1 
ATOM   3243 O  OE1 . GLU B 1 196 ? 6.818   31.394  25.907  1.00 37.56 ? 196 GLU B OE1 1 
ATOM   3244 O  OE2 . GLU B 1 196 ? 8.600   32.625  26.243  1.00 39.64 ? 196 GLU B OE2 1 
ATOM   3245 N  N   . ALA B 1 197 ? 7.625   33.481  21.005  1.00 31.06 ? 197 ALA B N   1 
ATOM   3246 C  CA  . ALA B 1 197 ? 8.419   34.517  20.360  1.00 30.14 ? 197 ALA B CA  1 
ATOM   3247 C  C   . ALA B 1 197 ? 7.704   35.859  20.514  1.00 31.09 ? 197 ALA B C   1 
ATOM   3248 O  O   . ALA B 1 197 ? 8.329   36.877  20.801  1.00 29.71 ? 197 ALA B O   1 
ATOM   3249 C  CB  . ALA B 1 197 ? 8.612   34.185  18.884  1.00 29.85 ? 197 ALA B CB  1 
ATOM   3250 N  N   . ALA B 1 198 ? 6.386   35.850  20.323  1.00 32.95 ? 198 ALA B N   1 
ATOM   3251 C  CA  . ALA B 1 198 ? 5.584   37.066  20.450  1.00 33.89 ? 198 ALA B CA  1 
ATOM   3252 C  C   . ALA B 1 198 ? 5.666   37.592  21.878  1.00 35.00 ? 198 ALA B C   1 
ATOM   3253 O  O   . ALA B 1 198 ? 5.850   38.790  22.102  1.00 36.03 ? 198 ALA B O   1 
ATOM   3254 C  CB  . ALA B 1 198 ? 4.133   36.775  20.082  1.00 33.46 ? 198 ALA B CB  1 
ATOM   3255 N  N   . ALA B 1 199 ? 5.534   36.685  22.842  1.00 36.11 ? 199 ALA B N   1 
ATOM   3256 C  CA  . ALA B 1 199 ? 5.595   37.049  24.253  1.00 36.25 ? 199 ALA B CA  1 
ATOM   3257 C  C   . ALA B 1 199 ? 6.916   37.738  24.587  1.00 37.49 ? 199 ALA B C   1 
ATOM   3258 O  O   . ALA B 1 199 ? 6.935   38.769  25.258  1.00 37.79 ? 199 ALA B O   1 
ATOM   3259 C  CB  . ALA B 1 199 ? 5.425   35.807  25.117  1.00 36.05 ? 199 ALA B CB  1 
ATOM   3260 N  N   . ARG B 1 200 ? 8.021   37.168  24.115  1.00 37.40 ? 200 ARG B N   1 
ATOM   3261 C  CA  . ARG B 1 200 ? 9.337   37.742  24.374  1.00 38.06 ? 200 ARG B CA  1 
ATOM   3262 C  C   . ARG B 1 200 ? 9.485   39.099  23.691  1.00 39.44 ? 200 ARG B C   1 
ATOM   3263 O  O   . ARG B 1 200 ? 10.112  40.009  24.234  1.00 39.92 ? 200 ARG B O   1 
ATOM   3264 C  CB  . ARG B 1 200 ? 10.444  36.797  23.891  1.00 36.31 ? 200 ARG B CB  1 
ATOM   3265 C  CG  . ARG B 1 200 ? 10.519  35.473  24.644  1.00 34.93 ? 200 ARG B CG  1 
ATOM   3266 C  CD  . ARG B 1 200 ? 11.667  34.610  24.127  1.00 34.68 ? 200 ARG B CD  1 
ATOM   3267 N  NE  . ARG B 1 200 ? 12.960  35.261  24.313  1.00 32.83 ? 200 ARG B NE  1 
ATOM   3268 C  CZ  . ARG B 1 200 ? 13.617  35.301  25.466  1.00 34.87 ? 200 ARG B CZ  1 
ATOM   3269 N  NH1 . ARG B 1 200 ? 13.105  34.718  26.543  1.00 34.68 ? 200 ARG B NH1 1 
ATOM   3270 N  NH2 . ARG B 1 200 ? 14.782  35.934  25.547  1.00 32.33 ? 200 ARG B NH2 1 
ATOM   3271 N  N   . PHE B 1 201 ? 8.907   39.232  22.501  1.00 40.85 ? 201 PHE B N   1 
ATOM   3272 C  CA  . PHE B 1 201 ? 8.978   40.485  21.760  1.00 43.00 ? 201 PHE B CA  1 
ATOM   3273 C  C   . PHE B 1 201 ? 8.228   41.587  22.504  1.00 45.10 ? 201 PHE B C   1 
ATOM   3274 O  O   . PHE B 1 201 ? 8.658   42.740  22.526  1.00 44.25 ? 201 PHE B O   1 
ATOM   3275 C  CB  . PHE B 1 201 ? 8.378   40.312  20.367  1.00 43.47 ? 201 PHE B CB  1 
ATOM   3276 C  CG  . PHE B 1 201 ? 8.356   41.573  19.559  1.00 44.45 ? 201 PHE B CG  1 
ATOM   3277 C  CD1 . PHE B 1 201 ? 9.542   42.204  19.199  1.00 45.76 ? 201 PHE B CD1 1 
ATOM   3278 C  CD2 . PHE B 1 201 ? 7.150   42.135  19.159  1.00 45.40 ? 201 PHE B CD2 1 
ATOM   3279 C  CE1 . PHE B 1 201 ? 9.528   43.378  18.449  1.00 46.15 ? 201 PHE B CE1 1 
ATOM   3280 C  CE2 . PHE B 1 201 ? 7.123   43.308  18.410  1.00 46.54 ? 201 PHE B CE2 1 
ATOM   3281 C  CZ  . PHE B 1 201 ? 8.316   43.932  18.054  1.00 46.73 ? 201 PHE B CZ  1 
ATOM   3282 N  N   . ALA B 1 202 ? 7.104   41.222  23.113  1.00 46.74 ? 202 ALA B N   1 
ATOM   3283 C  CA  . ALA B 1 202 ? 6.295   42.173  23.862  1.00 49.71 ? 202 ALA B CA  1 
ATOM   3284 C  C   . ALA B 1 202 ? 7.045   42.647  25.103  1.00 52.03 ? 202 ALA B C   1 
ATOM   3285 O  O   . ALA B 1 202 ? 7.119   43.845  25.375  1.00 52.83 ? 202 ALA B O   1 
ATOM   3286 C  CB  . ALA B 1 202 ? 4.973   41.533  24.260  1.00 48.82 ? 202 ALA B CB  1 
ATOM   3287 N  N   . ALA B 1 203 ? 7.603   41.701  25.851  1.00 54.62 ? 203 ALA B N   1 
ATOM   3288 C  CA  . ALA B 1 203 ? 8.351   42.029  27.058  1.00 56.86 ? 203 ALA B CA  1 
ATOM   3289 C  C   . ALA B 1 203 ? 9.546   42.912  26.714  1.00 58.48 ? 203 ALA B C   1 
ATOM   3290 O  O   . ALA B 1 203 ? 9.924   43.790  27.489  1.00 59.27 ? 203 ALA B O   1 
ATOM   3291 C  CB  . ALA B 1 203 ? 8.822   40.754  27.742  1.00 57.99 ? 203 ALA B CB  1 
ATOM   3292 N  N   . LYS B 1 204 ? 10.136  42.667  25.546  1.00 60.11 ? 204 LYS B N   1 
ATOM   3293 C  CA  . LYS B 1 204 ? 11.287  43.426  25.065  1.00 60.65 ? 204 LYS B CA  1 
ATOM   3294 C  C   . LYS B 1 204 ? 12.520  43.338  25.955  1.00 61.29 ? 204 LYS B C   1 
ATOM   3295 O  O   . LYS B 1 204 ? 13.524  44.000  25.694  1.00 61.19 ? 204 LYS B O   1 
ATOM   3296 C  CB  . LYS B 1 204 ? 10.908  44.896  24.864  1.00 60.97 ? 204 LYS B CB  1 
ATOM   3297 C  CG  . LYS B 1 204 ? 10.117  45.147  23.597  1.00 62.04 ? 204 LYS B CG  1 
ATOM   3298 C  CD  . LYS B 1 204 ? 9.782   46.615  23.415  1.00 62.99 ? 204 LYS B CD  1 
ATOM   3299 C  CE  . LYS B 1 204 ? 9.186   46.855  22.037  1.00 64.02 ? 204 LYS B CE  1 
ATOM   3300 N  NZ  . LYS B 1 204 ? 8.039   45.941  21.758  1.00 63.45 ? 204 LYS B NZ  1 
ATOM   3301 N  N   . LYS B 1 205 ? 12.449  42.521  26.999  1.00 62.55 ? 205 LYS B N   1 
ATOM   3302 C  CA  . LYS B 1 205 ? 13.576  42.365  27.909  1.00 63.95 ? 205 LYS B CA  1 
ATOM   3303 C  C   . LYS B 1 205 ? 13.350  41.195  28.865  1.00 64.64 ? 205 LYS B C   1 
ATOM   3304 O  O   . LYS B 1 205 ? 12.279  40.554  28.772  1.00 64.20 ? 205 LYS B O   1 
ATOM   3305 C  CB  . LYS B 1 205 ? 13.786  43.655  28.707  1.00 65.67 ? 205 LYS B CB  1 
ATOM   3306 C  CG  . LYS B 1 205 ? 15.248  44.040  28.894  1.00 68.08 ? 205 LYS B CG  1 
ATOM   3307 C  CD  . LYS B 1 205 ? 15.918  44.298  27.551  1.00 69.61 ? 205 LYS B CD  1 
ATOM   3308 C  CE  . LYS B 1 205 ? 17.376  44.693  27.716  1.00 70.79 ? 205 LYS B CE  1 
ATOM   3309 N  NZ  . LYS B 1 205 ? 18.030  44.895  26.393  1.00 71.48 ? 205 LYS B NZ  1 
ATOM   3310 O  OXT . LYS B 1 205 ? 14.248  40.934  29.694  1.00 64.66 ? 205 LYS B OXT 1 
ATOM   3311 N  N   . SER C 1 1   ? 79.421  10.388  54.618  1.00 39.00 ? 1   SER C N   1 
ATOM   3312 C  CA  . SER C 1 1   ? 79.719  11.672  53.920  1.00 37.86 ? 1   SER C CA  1 
ATOM   3313 C  C   . SER C 1 1   ? 80.948  11.535  53.032  1.00 35.03 ? 1   SER C C   1 
ATOM   3314 O  O   . SER C 1 1   ? 81.911  10.859  53.394  1.00 35.48 ? 1   SER C O   1 
ATOM   3315 C  CB  . SER C 1 1   ? 79.959  12.789  54.940  1.00 39.74 ? 1   SER C CB  1 
ATOM   3316 O  OG  . SER C 1 1   ? 78.737  13.232  55.508  1.00 46.25 ? 1   SER C OG  1 
ATOM   3317 N  N   . TYR C 1 2   ? 80.908  12.178  51.869  1.00 31.20 ? 2   TYR C N   1 
ATOM   3318 C  CA  . TYR C 1 2   ? 82.034  12.135  50.940  1.00 28.88 ? 2   TYR C CA  1 
ATOM   3319 C  C   . TYR C 1 2   ? 83.110  13.133  51.350  1.00 26.69 ? 2   TYR C C   1 
ATOM   3320 O  O   . TYR C 1 2   ? 82.829  14.132  52.009  1.00 22.43 ? 2   TYR C O   1 
ATOM   3321 C  CB  . TYR C 1 2   ? 81.589  12.492  49.515  1.00 29.00 ? 2   TYR C CB  1 
ATOM   3322 C  CG  . TYR C 1 2   ? 80.498  11.631  48.932  1.00 31.50 ? 2   TYR C CG  1 
ATOM   3323 C  CD1 . TYR C 1 2   ? 80.454  10.258  49.172  1.00 32.07 ? 2   TYR C CD1 1 
ATOM   3324 C  CD2 . TYR C 1 2   ? 79.530  12.187  48.096  1.00 31.05 ? 2   TYR C CD2 1 
ATOM   3325 C  CE1 . TYR C 1 2   ? 79.465  9.458   48.590  1.00 33.79 ? 2   TYR C CE1 1 
ATOM   3326 C  CE2 . TYR C 1 2   ? 78.547  11.402  47.511  1.00 33.55 ? 2   TYR C CE2 1 
ATOM   3327 C  CZ  . TYR C 1 2   ? 78.520  10.040  47.760  1.00 33.32 ? 2   TYR C CZ  1 
ATOM   3328 O  OH  . TYR C 1 2   ? 77.555  9.267   47.161  1.00 36.07 ? 2   TYR C OH  1 
ATOM   3329 N  N   . THR C 1 3   ? 84.344  12.853  50.951  1.00 26.83 ? 3   THR C N   1 
ATOM   3330 C  CA  . THR C 1 3   ? 85.459  13.747  51.228  1.00 27.08 ? 3   THR C CA  1 
ATOM   3331 C  C   . THR C 1 3   ? 86.251  13.872  49.936  1.00 25.36 ? 3   THR C C   1 
ATOM   3332 O  O   . THR C 1 3   ? 86.227  12.968  49.100  1.00 26.68 ? 3   THR C O   1 
ATOM   3333 C  CB  . THR C 1 3   ? 86.399  13.193  52.321  1.00 29.14 ? 3   THR C CB  1 
ATOM   3334 O  OG1 . THR C 1 3   ? 86.930  11.932  51.897  1.00 31.02 ? 3   THR C OG1 1 
ATOM   3335 C  CG2 . THR C 1 3   ? 85.651  13.011  53.634  1.00 30.96 ? 3   THR C CG2 1 
ATOM   3336 N  N   . LEU C 1 4   ? 86.933  14.993  49.760  1.00 23.74 ? 4   LEU C N   1 
ATOM   3337 C  CA  . LEU C 1 4   ? 87.743  15.191  48.568  1.00 23.46 ? 4   LEU C CA  1 
ATOM   3338 C  C   . LEU C 1 4   ? 88.910  14.213  48.667  1.00 24.24 ? 4   LEU C C   1 
ATOM   3339 O  O   . LEU C 1 4   ? 89.652  14.225  49.645  1.00 24.81 ? 4   LEU C O   1 
ATOM   3340 C  CB  . LEU C 1 4   ? 88.279  16.619  48.530  1.00 23.58 ? 4   LEU C CB  1 
ATOM   3341 C  CG  . LEU C 1 4   ? 89.098  16.967  47.286  1.00 24.53 ? 4   LEU C CG  1 
ATOM   3342 C  CD1 . LEU C 1 4   ? 88.180  16.968  46.065  1.00 23.42 ? 4   LEU C CD1 1 
ATOM   3343 C  CD2 . LEU C 1 4   ? 89.759  18.325  47.466  1.00 22.75 ? 4   LEU C CD2 1 
ATOM   3344 N  N   . PRO C 1 5   ? 89.092  13.352  47.662  1.00 25.48 ? 5   PRO C N   1 
ATOM   3345 C  CA  . PRO C 1 5   ? 90.218  12.423  47.784  1.00 27.87 ? 5   PRO C CA  1 
ATOM   3346 C  C   . PRO C 1 5   ? 91.552  13.127  47.570  1.00 29.41 ? 5   PRO C C   1 
ATOM   3347 O  O   . PRO C 1 5   ? 91.637  14.091  46.811  1.00 27.38 ? 5   PRO C O   1 
ATOM   3348 C  CB  . PRO C 1 5   ? 89.925  11.390  46.702  1.00 28.26 ? 5   PRO C CB  1 
ATOM   3349 C  CG  . PRO C 1 5   ? 89.280  12.220  45.624  1.00 28.24 ? 5   PRO C CG  1 
ATOM   3350 C  CD  . PRO C 1 5   ? 88.346  13.130  46.409  1.00 26.37 ? 5   PRO C CD  1 
ATOM   3351 N  N   A SER C 1 6   ? 92.587  12.655  48.253  0.50 29.92 ? 6   SER C N   1 
ATOM   3352 N  N   B SER C 1 6   ? 92.588  12.662  48.260  0.50 30.02 ? 6   SER C N   1 
ATOM   3353 C  CA  A SER C 1 6   ? 93.911  13.242  48.104  0.50 31.68 ? 6   SER C CA  1 
ATOM   3354 C  CA  B SER C 1 6   ? 93.913  13.250  48.103  0.50 31.88 ? 6   SER C CA  1 
ATOM   3355 C  C   A SER C 1 6   ? 94.516  12.694  46.817  0.50 32.55 ? 6   SER C C   1 
ATOM   3356 C  C   B SER C 1 6   ? 94.513  12.698  46.816  0.50 32.66 ? 6   SER C C   1 
ATOM   3357 O  O   A SER C 1 6   ? 94.232  11.562  46.424  0.50 32.71 ? 6   SER C O   1 
ATOM   3358 O  O   B SER C 1 6   ? 94.222  11.568  46.424  0.50 32.79 ? 6   SER C O   1 
ATOM   3359 C  CB  A SER C 1 6   ? 94.799  12.866  49.292  0.50 31.62 ? 6   SER C CB  1 
ATOM   3360 C  CB  B SER C 1 6   ? 94.821  12.887  49.286  0.50 31.97 ? 6   SER C CB  1 
ATOM   3361 O  OG  A SER C 1 6   ? 94.948  11.460  49.384  0.50 29.93 ? 6   SER C OG  1 
ATOM   3362 O  OG  B SER C 1 6   ? 94.413  13.536  50.479  0.50 31.08 ? 6   SER C OG  1 
ATOM   3363 N  N   . LEU C 1 7   ? 95.341  13.499  46.157  1.00 33.67 ? 7   LEU C N   1 
ATOM   3364 C  CA  . LEU C 1 7   ? 95.983  13.077  44.921  1.00 35.16 ? 7   LEU C CA  1 
ATOM   3365 C  C   . LEU C 1 7   ? 97.135  12.139  45.252  1.00 35.39 ? 7   LEU C C   1 
ATOM   3366 O  O   . LEU C 1 7   ? 97.837  12.329  46.245  1.00 35.11 ? 7   LEU C O   1 
ATOM   3367 C  CB  . LEU C 1 7   ? 96.510  14.292  44.160  1.00 38.00 ? 7   LEU C CB  1 
ATOM   3368 C  CG  . LEU C 1 7   ? 95.733  14.749  42.924  1.00 40.22 ? 7   LEU C CG  1 
ATOM   3369 C  CD1 . LEU C 1 7   ? 94.249  14.778  43.205  1.00 40.94 ? 7   LEU C CD1 1 
ATOM   3370 C  CD2 . LEU C 1 7   ? 96.236  16.121  42.512  1.00 41.08 ? 7   LEU C CD2 1 
ATOM   3371 N  N   . PRO C 1 8   ? 97.337  11.101  44.430  1.00 35.30 ? 8   PRO C N   1 
ATOM   3372 C  CA  . PRO C 1 8   ? 98.421  10.143  44.661  1.00 36.16 ? 8   PRO C CA  1 
ATOM   3373 C  C   . PRO C 1 8   ? 99.767  10.709  44.206  1.00 35.01 ? 8   PRO C C   1 
ATOM   3374 O  O   . PRO C 1 8   ? 100.750 9.976   44.100  1.00 38.10 ? 8   PRO C O   1 
ATOM   3375 C  CB  . PRO C 1 8   ? 98.010  8.934   43.812  1.00 36.56 ? 8   PRO C CB  1 
ATOM   3376 C  CG  . PRO C 1 8   ? 96.542  9.145   43.541  1.00 38.53 ? 8   PRO C CG  1 
ATOM   3377 C  CD  . PRO C 1 8   ? 96.449  10.627  43.360  1.00 36.17 ? 8   PRO C CD  1 
ATOM   3378 N  N   . TYR C 1 9   ? 99.806  12.010  43.938  1.00 32.57 ? 9   TYR C N   1 
ATOM   3379 C  CA  . TYR C 1 9   ? 101.025 12.660  43.465  1.00 30.28 ? 9   TYR C CA  1 
ATOM   3380 C  C   . TYR C 1 9   ? 100.958 14.168  43.650  1.00 29.71 ? 9   TYR C C   1 
ATOM   3381 O  O   . TYR C 1 9   ? 99.921  14.708  44.038  1.00 28.55 ? 9   TYR C O   1 
ATOM   3382 C  CB  . TYR C 1 9   ? 101.238 12.321  41.984  1.00 31.03 ? 9   TYR C CB  1 
ATOM   3383 C  CG  . TYR C 1 9   ? 99.971  12.412  41.152  1.00 29.36 ? 9   TYR C CG  1 
ATOM   3384 C  CD1 . TYR C 1 9   ? 99.355  13.640  40.910  1.00 30.45 ? 9   TYR C CD1 1 
ATOM   3385 C  CD2 . TYR C 1 9   ? 99.358  11.262  40.657  1.00 31.22 ? 9   TYR C CD2 1 
ATOM   3386 C  CE1 . TYR C 1 9   ? 98.152  13.721  40.200  1.00 30.89 ? 9   TYR C CE1 1 
ATOM   3387 C  CE2 . TYR C 1 9   ? 98.154  11.329  39.947  1.00 30.66 ? 9   TYR C CE2 1 
ATOM   3388 C  CZ  . TYR C 1 9   ? 97.557  12.561  39.727  1.00 31.50 ? 9   TYR C CZ  1 
ATOM   3389 O  OH  . TYR C 1 9   ? 96.351  12.627  39.064  1.00 31.79 ? 9   TYR C OH  1 
ATOM   3390 N  N   . ALA C 1 10  ? 102.070 14.846  43.378  1.00 26.46 ? 10  ALA C N   1 
ATOM   3391 C  CA  . ALA C 1 10  ? 102.135 16.297  43.494  1.00 26.33 ? 10  ALA C CA  1 
ATOM   3392 C  C   . ALA C 1 10  ? 101.341 16.917  42.345  1.00 25.49 ? 10  ALA C C   1 
ATOM   3393 O  O   . ALA C 1 10  ? 101.086 16.256  41.339  1.00 26.09 ? 10  ALA C O   1 
ATOM   3394 C  CB  . ALA C 1 10  ? 103.597 16.767  43.437  1.00 27.02 ? 10  ALA C CB  1 
ATOM   3395 N  N   . TYR C 1 11  ? 100.963 18.181  42.492  1.00 26.22 ? 11  TYR C N   1 
ATOM   3396 C  CA  . TYR C 1 11  ? 100.194 18.868  41.458  1.00 29.17 ? 11  TYR C CA  1 
ATOM   3397 C  C   . TYR C 1 11  ? 100.984 19.063  40.168  1.00 30.86 ? 11  TYR C C   1 
ATOM   3398 O  O   . TYR C 1 11  ? 100.399 19.257  39.103  1.00 28.86 ? 11  TYR C O   1 
ATOM   3399 C  CB  . TYR C 1 11  ? 99.695  20.223  41.969  1.00 27.99 ? 11  TYR C CB  1 
ATOM   3400 C  CG  . TYR C 1 11  ? 98.558  20.118  42.969  1.00 31.63 ? 11  TYR C CG  1 
ATOM   3401 C  CD1 . TYR C 1 11  ? 97.373  19.456  42.639  1.00 31.72 ? 11  TYR C CD1 1 
ATOM   3402 C  CD2 . TYR C 1 11  ? 98.668  20.675  44.244  1.00 32.71 ? 11  TYR C CD2 1 
ATOM   3403 C  CE1 . TYR C 1 11  ? 96.321  19.348  43.559  1.00 33.17 ? 11  TYR C CE1 1 
ATOM   3404 C  CE2 . TYR C 1 11  ? 97.625  20.574  45.169  1.00 33.38 ? 11  TYR C CE2 1 
ATOM   3405 C  CZ  . TYR C 1 11  ? 96.456  19.907  44.821  1.00 34.10 ? 11  TYR C CZ  1 
ATOM   3406 O  OH  . TYR C 1 11  ? 95.430  19.788  45.738  1.00 32.67 ? 11  TYR C OH  1 
ATOM   3407 N  N   . ASP C 1 12  ? 102.310 19.018  40.262  1.00 31.91 ? 12  ASP C N   1 
ATOM   3408 C  CA  . ASP C 1 12  ? 103.148 19.177  39.077  1.00 34.16 ? 12  ASP C CA  1 
ATOM   3409 C  C   . ASP C 1 12  ? 103.672 17.840  38.579  1.00 34.15 ? 12  ASP C C   1 
ATOM   3410 O  O   . ASP C 1 12  ? 104.559 17.795  37.730  1.00 36.13 ? 12  ASP C O   1 
ATOM   3411 C  CB  . ASP C 1 12  ? 104.333 20.108  39.359  1.00 37.21 ? 12  ASP C CB  1 
ATOM   3412 C  CG  . ASP C 1 12  ? 105.176 19.653  40.543  1.00 39.70 ? 12  ASP C CG  1 
ATOM   3413 O  OD1 . ASP C 1 12  ? 105.330 18.428  40.745  1.00 40.50 ? 12  ASP C OD1 1 
ATOM   3414 O  OD2 . ASP C 1 12  ? 105.695 20.530  41.265  1.00 43.44 ? 12  ASP C OD2 1 
ATOM   3415 N  N   . ALA C 1 13  ? 103.116 16.749  39.093  1.00 32.56 ? 13  ALA C N   1 
ATOM   3416 C  CA  . ALA C 1 13  ? 103.564 15.420  38.696  1.00 33.32 ? 13  ALA C CA  1 
ATOM   3417 C  C   . ALA C 1 13  ? 103.222 15.061  37.255  1.00 33.68 ? 13  ALA C C   1 
ATOM   3418 O  O   . ALA C 1 13  ? 103.731 14.073  36.728  1.00 33.68 ? 13  ALA C O   1 
ATOM   3419 C  CB  . ALA C 1 13  ? 102.991 14.371  39.638  1.00 33.74 ? 13  ALA C CB  1 
ATOM   3420 N  N   . LEU C 1 14  ? 102.365 15.853  36.614  1.00 32.44 ? 14  LEU C N   1 
ATOM   3421 C  CA  . LEU C 1 14  ? 101.989 15.568  35.232  1.00 31.83 ? 14  LEU C CA  1 
ATOM   3422 C  C   . LEU C 1 14  ? 102.635 16.525  34.223  1.00 30.84 ? 14  LEU C C   1 
ATOM   3423 O  O   . LEU C 1 14  ? 102.397 16.426  33.019  1.00 29.19 ? 14  LEU C O   1 
ATOM   3424 C  CB  . LEU C 1 14  ? 100.463 15.583  35.086  1.00 30.55 ? 14  LEU C CB  1 
ATOM   3425 C  CG  . LEU C 1 14  ? 99.754  14.563  35.990  1.00 30.84 ? 14  LEU C CG  1 
ATOM   3426 C  CD1 . LEU C 1 14  ? 98.245  14.690  35.838  1.00 27.60 ? 14  LEU C CD1 1 
ATOM   3427 C  CD2 . LEU C 1 14  ? 100.214 13.153  35.638  1.00 28.50 ? 14  LEU C CD2 1 
ATOM   3428 N  N   . GLU C 1 15  ? 103.441 17.456  34.721  1.00 29.92 ? 15  GLU C N   1 
ATOM   3429 C  CA  . GLU C 1 15  ? 104.152 18.383  33.848  1.00 31.04 ? 15  GLU C CA  1 
ATOM   3430 C  C   . GLU C 1 15  ? 105.072 17.518  32.985  1.00 30.35 ? 15  GLU C C   1 
ATOM   3431 O  O   . GLU C 1 15  ? 105.458 16.422  33.392  1.00 30.77 ? 15  GLU C O   1 
ATOM   3432 C  CB  . GLU C 1 15  ? 104.984 19.362  34.678  1.00 28.95 ? 15  GLU C CB  1 
ATOM   3433 C  CG  . GLU C 1 15  ? 104.163 20.374  35.455  1.00 31.23 ? 15  GLU C CG  1 
ATOM   3434 C  CD  . GLU C 1 15  ? 103.709 21.528  34.591  1.00 31.87 ? 15  GLU C CD  1 
ATOM   3435 O  OE1 . GLU C 1 15  ? 103.844 21.429  33.355  1.00 32.45 ? 15  GLU C OE1 1 
ATOM   3436 O  OE2 . GLU C 1 15  ? 103.214 22.532  35.143  1.00 30.68 ? 15  GLU C OE2 1 
ATOM   3437 N  N   . PRO C 1 16  ? 105.415 17.980  31.773  1.00 30.79 ? 16  PRO C N   1 
ATOM   3438 C  CA  . PRO C 1 16  ? 105.011 19.242  31.150  1.00 31.12 ? 16  PRO C CA  1 
ATOM   3439 C  C   . PRO C 1 16  ? 103.738 19.077  30.309  1.00 29.98 ? 16  PRO C C   1 
ATOM   3440 O  O   . PRO C 1 16  ? 103.469 19.890  29.426  1.00 28.61 ? 16  PRO C O   1 
ATOM   3441 C  CB  . PRO C 1 16  ? 106.211 19.566  30.276  1.00 31.58 ? 16  PRO C CB  1 
ATOM   3442 C  CG  . PRO C 1 16  ? 106.529 18.217  29.720  1.00 29.30 ? 16  PRO C CG  1 
ATOM   3443 C  CD  . PRO C 1 16  ? 106.422 17.298  30.937  1.00 29.77 ? 16  PRO C CD  1 
ATOM   3444 N  N   . HIS C 1 17  ? 102.963 18.030  30.584  1.00 28.34 ? 17  HIS C N   1 
ATOM   3445 C  CA  . HIS C 1 17  ? 101.745 17.759  29.821  1.00 27.53 ? 17  HIS C CA  1 
ATOM   3446 C  C   . HIS C 1 17  ? 100.510 18.496  30.344  1.00 27.60 ? 17  HIS C C   1 
ATOM   3447 O  O   . HIS C 1 17  ? 99.868  19.229  29.590  1.00 24.72 ? 17  HIS C O   1 
ATOM   3448 C  CB  . HIS C 1 17  ? 101.513 16.256  29.774  1.00 29.50 ? 17  HIS C CB  1 
ATOM   3449 C  CG  . HIS C 1 17  ? 102.712 15.493  29.305  1.00 33.77 ? 17  HIS C CG  1 
ATOM   3450 N  ND1 . HIS C 1 17  ? 103.293 15.708  28.073  1.00 34.70 ? 17  HIS C ND1 1 
ATOM   3451 C  CD2 . HIS C 1 17  ? 103.461 14.542  29.913  1.00 35.51 ? 17  HIS C CD2 1 
ATOM   3452 C  CE1 . HIS C 1 17  ? 104.348 14.923  27.943  1.00 36.14 ? 17  HIS C CE1 1 
ATOM   3453 N  NE2 . HIS C 1 17  ? 104.473 14.205  29.045  1.00 35.59 ? 17  HIS C NE2 1 
ATOM   3454 N  N   . PHE C 1 18  ? 100.166 18.286  31.615  1.00 25.05 ? 18  PHE C N   1 
ATOM   3455 C  CA  . PHE C 1 18  ? 99.041  18.991  32.239  1.00 25.68 ? 18  PHE C CA  1 
ATOM   3456 C  C   . PHE C 1 18  ? 99.670  19.986  33.208  1.00 23.75 ? 18  PHE C C   1 
ATOM   3457 O  O   . PHE C 1 18  ? 100.488 19.607  34.048  1.00 25.83 ? 18  PHE C O   1 
ATOM   3458 C  CB  . PHE C 1 18  ? 98.122  18.019  33.001  1.00 24.42 ? 18  PHE C CB  1 
ATOM   3459 C  CG  . PHE C 1 18  ? 97.206  17.213  32.113  1.00 25.07 ? 18  PHE C CG  1 
ATOM   3460 C  CD1 . PHE C 1 18  ? 97.259  17.332  30.725  1.00 26.56 ? 18  PHE C CD1 1 
ATOM   3461 C  CD2 . PHE C 1 18  ? 96.282  16.336  32.671  1.00 25.04 ? 18  PHE C CD2 1 
ATOM   3462 C  CE1 . PHE C 1 18  ? 96.405  16.590  29.907  1.00 24.52 ? 18  PHE C CE1 1 
ATOM   3463 C  CE2 . PHE C 1 18  ? 95.422  15.588  31.863  1.00 24.33 ? 18  PHE C CE2 1 
ATOM   3464 C  CZ  . PHE C 1 18  ? 95.483  15.715  30.479  1.00 25.45 ? 18  PHE C CZ  1 
ATOM   3465 N  N   . ASP C 1 19  ? 99.302  21.257  33.095  1.00 23.93 ? 19  ASP C N   1 
ATOM   3466 C  CA  . ASP C 1 19  ? 99.886  22.281  33.953  1.00 23.87 ? 19  ASP C CA  1 
ATOM   3467 C  C   . ASP C 1 19  ? 99.505  22.168  35.419  1.00 26.41 ? 19  ASP C C   1 
ATOM   3468 O  O   . ASP C 1 19  ? 98.362  21.848  35.757  1.00 23.34 ? 19  ASP C O   1 
ATOM   3469 C  CB  . ASP C 1 19  ? 99.523  23.671  33.437  1.00 22.78 ? 19  ASP C CB  1 
ATOM   3470 C  CG  . ASP C 1 19  ? 98.029  23.874  33.321  1.00 23.50 ? 19  ASP C CG  1 
ATOM   3471 O  OD1 . ASP C 1 19  ? 97.386  23.068  32.617  1.00 22.30 ? 19  ASP C OD1 1 
ATOM   3472 O  OD2 . ASP C 1 19  ? 97.513  24.839  33.926  1.00 19.47 ? 19  ASP C OD2 1 
ATOM   3473 N  N   . LYS C 1 20  ? 100.472 22.458  36.286  1.00 25.63 ? 20  LYS C N   1 
ATOM   3474 C  CA  . LYS C 1 20  ? 100.264 22.384  37.726  1.00 27.92 ? 20  LYS C CA  1 
ATOM   3475 C  C   . LYS C 1 20  ? 99.183  23.334  38.236  1.00 26.26 ? 20  LYS C C   1 
ATOM   3476 O  O   . LYS C 1 20  ? 98.438  22.983  39.147  1.00 26.22 ? 20  LYS C O   1 
ATOM   3477 C  CB  . LYS C 1 20  ? 101.572 22.648  38.489  1.00 30.89 ? 20  LYS C CB  1 
ATOM   3478 C  CG  . LYS C 1 20  ? 101.936 24.117  38.610  1.00 36.30 ? 20  LYS C CG  1 
ATOM   3479 C  CD  . LYS C 1 20  ? 102.770 24.383  39.858  1.00 41.07 ? 20  LYS C CD  1 
ATOM   3480 C  CE  . LYS C 1 20  ? 102.052 23.892  41.117  1.00 44.13 ? 20  LYS C CE  1 
ATOM   3481 N  NZ  . LYS C 1 20  ? 100.634 24.367  41.206  1.00 45.83 ? 20  LYS C NZ  1 
ATOM   3482 N  N   . GLN C 1 21  ? 99.089  24.527  37.657  1.00 23.09 ? 21  GLN C N   1 
ATOM   3483 C  CA  . GLN C 1 21  ? 98.089  25.491  38.096  1.00 26.48 ? 21  GLN C CA  1 
ATOM   3484 C  C   . GLN C 1 21  ? 96.667  24.942  37.921  1.00 24.83 ? 21  GLN C C   1 
ATOM   3485 O  O   . GLN C 1 21  ? 95.821  25.095  38.801  1.00 23.58 ? 21  GLN C O   1 
ATOM   3486 C  CB  . GLN C 1 21  ? 98.239  26.799  37.319  1.00 29.90 ? 21  GLN C CB  1 
ATOM   3487 C  CG  . GLN C 1 21  ? 97.376  27.930  37.856  1.00 37.00 ? 21  GLN C CG  1 
ATOM   3488 C  CD  . GLN C 1 21  ? 97.508  29.215  37.048  1.00 41.20 ? 21  GLN C CD  1 
ATOM   3489 O  OE1 . GLN C 1 21  ? 96.973  30.259  37.431  1.00 45.07 ? 21  GLN C OE1 1 
ATOM   3490 N  NE2 . GLN C 1 21  ? 98.213  29.142  35.922  1.00 42.99 ? 21  GLN C NE2 1 
ATOM   3491 N  N   . THR C 1 22  ? 96.416  24.302  36.784  1.00 23.89 ? 22  THR C N   1 
ATOM   3492 C  CA  . THR C 1 22  ? 95.106  23.728  36.507  1.00 22.44 ? 22  THR C CA  1 
ATOM   3493 C  C   . THR C 1 22  ? 94.826  22.553  37.439  1.00 23.48 ? 22  THR C C   1 
ATOM   3494 O  O   . THR C 1 22  ? 93.733  22.441  37.989  1.00 22.75 ? 22  THR C O   1 
ATOM   3495 C  CB  . THR C 1 22  ? 95.009  23.241  35.039  1.00 22.91 ? 22  THR C CB  1 
ATOM   3496 O  OG1 . THR C 1 22  ? 95.004  24.376  34.160  1.00 19.39 ? 22  THR C OG1 1 
ATOM   3497 C  CG2 . THR C 1 22  ? 93.733  22.433  34.823  1.00 19.49 ? 22  THR C CG2 1 
ATOM   3498 N  N   . MET C 1 23  ? 95.809  21.676  37.617  1.00 23.22 ? 23  MET C N   1 
ATOM   3499 C  CA  . MET C 1 23  ? 95.628  20.523  38.496  1.00 22.90 ? 23  MET C CA  1 
ATOM   3500 C  C   . MET C 1 23  ? 95.171  20.963  39.884  1.00 23.50 ? 23  MET C C   1 
ATOM   3501 O  O   . MET C 1 23  ? 94.273  20.364  40.474  1.00 23.20 ? 23  MET C O   1 
ATOM   3502 C  CB  . MET C 1 23  ? 96.934  19.727  38.629  1.00 25.06 ? 23  MET C CB  1 
ATOM   3503 C  CG  . MET C 1 23  ? 97.358  18.959  37.385  1.00 25.18 ? 23  MET C CG  1 
ATOM   3504 S  SD  . MET C 1 23  ? 96.176  17.703  36.832  1.00 27.58 ? 23  MET C SD  1 
ATOM   3505 C  CE  . MET C 1 23  ? 96.281  16.494  38.178  1.00 26.68 ? 23  MET C CE  1 
ATOM   3506 N  N   . GLU C 1 24  ? 95.783  22.019  40.403  1.00 22.21 ? 24  GLU C N   1 
ATOM   3507 C  CA  . GLU C 1 24  ? 95.440  22.513  41.727  1.00 24.16 ? 24  GLU C CA  1 
ATOM   3508 C  C   . GLU C 1 24  ? 94.044  23.138  41.801  1.00 22.80 ? 24  GLU C C   1 
ATOM   3509 O  O   . GLU C 1 24  ? 93.296  22.875  42.741  1.00 23.31 ? 24  GLU C O   1 
ATOM   3510 C  CB  . GLU C 1 24  ? 96.511  23.505  42.194  1.00 29.92 ? 24  GLU C CB  1 
ATOM   3511 C  CG  . GLU C 1 24  ? 96.221  24.174  43.524  1.00 36.34 ? 24  GLU C CG  1 
ATOM   3512 C  CD  . GLU C 1 24  ? 97.476  24.752  44.169  1.00 41.72 ? 24  GLU C CD  1 
ATOM   3513 O  OE1 . GLU C 1 24  ? 98.351  25.259  43.430  1.00 41.41 ? 24  GLU C OE1 1 
ATOM   3514 O  OE2 . GLU C 1 24  ? 97.578  24.706  45.416  1.00 41.93 ? 24  GLU C OE2 1 
ATOM   3515 N  N   . ILE C 1 25  ? 93.692  23.961  40.819  1.00 20.55 ? 25  ILE C N   1 
ATOM   3516 C  CA  . ILE C 1 25  ? 92.370  24.593  40.784  1.00 21.15 ? 25  ILE C CA  1 
ATOM   3517 C  C   . ILE C 1 25  ? 91.287  23.533  40.558  1.00 18.53 ? 25  ILE C C   1 
ATOM   3518 O  O   . ILE C 1 25  ? 90.253  23.515  41.230  1.00 19.15 ? 25  ILE C O   1 
ATOM   3519 C  CB  . ILE C 1 25  ? 92.262  25.607  39.620  1.00 22.39 ? 25  ILE C CB  1 
ATOM   3520 C  CG1 . ILE C 1 25  ? 93.308  26.711  39.771  1.00 28.20 ? 25  ILE C CG1 1 
ATOM   3521 C  CG2 . ILE C 1 25  ? 90.864  26.206  39.582  1.00 24.74 ? 25  ILE C CG2 1 
ATOM   3522 C  CD1 . ILE C 1 25  ? 93.086  27.609  40.969  1.00 31.05 ? 25  ILE C CD1 1 
ATOM   3523 N  N   . HIS C 1 26  ? 91.541  22.663  39.591  1.00 17.20 ? 26  HIS C N   1 
ATOM   3524 C  CA  . HIS C 1 26  ? 90.615  21.602  39.220  1.00 18.31 ? 26  HIS C CA  1 
ATOM   3525 C  C   . HIS C 1 26  ? 90.255  20.737  40.431  1.00 19.83 ? 26  HIS C C   1 
ATOM   3526 O  O   . HIS C 1 26  ? 89.094  20.412  40.665  1.00 20.16 ? 26  HIS C O   1 
ATOM   3527 C  CB  . HIS C 1 26  ? 91.262  20.740  38.136  1.00 16.57 ? 26  HIS C CB  1 
ATOM   3528 C  CG  . HIS C 1 26  ? 90.287  19.988  37.283  1.00 17.45 ? 26  HIS C CG  1 
ATOM   3529 N  ND1 . HIS C 1 26  ? 90.686  19.193  36.233  1.00 19.06 ? 26  HIS C ND1 1 
ATOM   3530 C  CD2 . HIS C 1 26  ? 88.932  19.914  37.318  1.00 18.58 ? 26  HIS C CD2 1 
ATOM   3531 C  CE1 . HIS C 1 26  ? 89.621  18.658  35.657  1.00 19.58 ? 26  HIS C CE1 1 
ATOM   3532 N  NE2 . HIS C 1 26  ? 88.545  19.078  36.298  1.00 17.26 ? 26  HIS C NE2 1 
ATOM   3533 N  N   . HIS C 1 27  ? 91.268  20.377  41.207  1.00 20.89 ? 27  HIS C N   1 
ATOM   3534 C  CA  . HIS C 1 27  ? 91.081  19.533  42.380  1.00 21.40 ? 27  HIS C CA  1 
ATOM   3535 C  C   . HIS C 1 27  ? 90.502  20.263  43.596  1.00 21.89 ? 27  HIS C C   1 
ATOM   3536 O  O   . HIS C 1 27  ? 89.426  19.905  44.095  1.00 22.91 ? 27  HIS C O   1 
ATOM   3537 C  CB  . HIS C 1 27  ? 92.432  18.897  42.744  1.00 22.50 ? 27  HIS C CB  1 
ATOM   3538 C  CG  . HIS C 1 27  ? 92.385  17.986  43.930  1.00 23.30 ? 27  HIS C CG  1 
ATOM   3539 N  ND1 . HIS C 1 27  ? 93.139  18.205  45.064  1.00 25.21 ? 27  HIS C ND1 1 
ATOM   3540 C  CD2 . HIS C 1 27  ? 91.724  16.822  44.138  1.00 23.82 ? 27  HIS C CD2 1 
ATOM   3541 C  CE1 . HIS C 1 27  ? 92.949  17.213  45.917  1.00 24.62 ? 27  HIS C CE1 1 
ATOM   3542 N  NE2 . HIS C 1 27  ? 92.095  16.359  45.379  1.00 23.77 ? 27  HIS C NE2 1 
ATOM   3543 N  N   . THR C 1 28  ? 91.196  21.297  44.059  1.00 21.70 ? 28  THR C N   1 
ATOM   3544 C  CA  . THR C 1 28  ? 90.772  22.026  45.252  1.00 21.68 ? 28  THR C CA  1 
ATOM   3545 C  C   . THR C 1 28  ? 89.577  22.962  45.132  1.00 21.75 ? 28  THR C C   1 
ATOM   3546 O  O   . THR C 1 28  ? 88.989  23.325  46.144  1.00 20.47 ? 28  THR C O   1 
ATOM   3547 C  CB  . THR C 1 28  ? 91.944  22.834  45.863  1.00 23.24 ? 28  THR C CB  1 
ATOM   3548 O  OG1 . THR C 1 28  ? 92.293  23.917  44.993  1.00 24.02 ? 28  THR C OG1 1 
ATOM   3549 C  CG2 . THR C 1 28  ? 93.156  21.937  46.068  1.00 22.72 ? 28  THR C CG2 1 
ATOM   3550 N  N   . LYS C 1 29  ? 89.209  23.361  43.918  1.00 23.17 ? 29  LYS C N   1 
ATOM   3551 C  CA  . LYS C 1 29  ? 88.066  24.257  43.751  1.00 22.65 ? 29  LYS C CA  1 
ATOM   3552 C  C   . LYS C 1 29  ? 86.858  23.552  43.138  1.00 22.83 ? 29  LYS C C   1 
ATOM   3553 O  O   . LYS C 1 29  ? 85.790  23.500  43.739  1.00 22.80 ? 29  LYS C O   1 
ATOM   3554 C  CB  . LYS C 1 29  ? 88.440  25.451  42.870  1.00 25.83 ? 29  LYS C CB  1 
ATOM   3555 C  CG  . LYS C 1 29  ? 89.644  26.236  43.357  1.00 30.57 ? 29  LYS C CG  1 
ATOM   3556 C  CD  . LYS C 1 29  ? 89.382  26.894  44.694  1.00 33.63 ? 29  LYS C CD  1 
ATOM   3557 C  CE  . LYS C 1 29  ? 90.593  27.714  45.127  1.00 38.80 ? 29  LYS C CE  1 
ATOM   3558 N  NZ  . LYS C 1 29  ? 90.379  28.329  46.465  1.00 43.69 ? 29  LYS C NZ  1 
ATOM   3559 N  N   . HIS C 1 30  ? 87.035  23.012  41.940  1.00 20.17 ? 30  HIS C N   1 
ATOM   3560 C  CA  . HIS C 1 30  ? 85.957  22.328  41.230  1.00 19.79 ? 30  HIS C CA  1 
ATOM   3561 C  C   . HIS C 1 30  ? 85.506  21.024  41.892  1.00 17.78 ? 30  HIS C C   1 
ATOM   3562 O  O   . HIS C 1 30  ? 84.328  20.874  42.217  1.00 18.56 ? 30  HIS C O   1 
ATOM   3563 C  CB  . HIS C 1 30  ? 86.374  22.057  39.767  1.00 18.55 ? 30  HIS C CB  1 
ATOM   3564 C  CG  . HIS C 1 30  ? 86.495  23.294  38.920  1.00 20.25 ? 30  HIS C CG  1 
ATOM   3565 N  ND1 . HIS C 1 30  ? 85.415  24.087  38.597  1.00 20.32 ? 30  HIS C ND1 1 
ATOM   3566 C  CD2 . HIS C 1 30  ? 87.572  23.872  38.333  1.00 20.81 ? 30  HIS C CD2 1 
ATOM   3567 C  CE1 . HIS C 1 30  ? 85.820  25.101  37.851  1.00 22.16 ? 30  HIS C CE1 1 
ATOM   3568 N  NE2 . HIS C 1 30  ? 87.125  24.995  37.677  1.00 21.11 ? 30  HIS C NE2 1 
ATOM   3569 N  N   . HIS C 1 31  ? 86.429  20.086  42.094  1.00 16.45 ? 31  HIS C N   1 
ATOM   3570 C  CA  . HIS C 1 31  ? 86.061  18.814  42.700  1.00 17.85 ? 31  HIS C CA  1 
ATOM   3571 C  C   . HIS C 1 31  ? 85.507  19.006  44.113  1.00 18.97 ? 31  HIS C C   1 
ATOM   3572 O  O   . HIS C 1 31  ? 84.527  18.360  44.495  1.00 19.12 ? 31  HIS C O   1 
ATOM   3573 C  CB  . HIS C 1 31  ? 87.259  17.851  42.706  1.00 17.59 ? 31  HIS C CB  1 
ATOM   3574 C  CG  . HIS C 1 31  ? 86.889  16.430  43.008  1.00 18.88 ? 31  HIS C CG  1 
ATOM   3575 N  ND1 . HIS C 1 31  ? 87.782  15.385  42.892  1.00 19.17 ? 31  HIS C ND1 1 
ATOM   3576 C  CD2 . HIS C 1 31  ? 85.725  15.883  43.436  1.00 18.61 ? 31  HIS C CD2 1 
ATOM   3577 C  CE1 . HIS C 1 31  ? 87.185  14.257  43.236  1.00 20.12 ? 31  HIS C CE1 1 
ATOM   3578 N  NE2 . HIS C 1 31  ? 85.936  14.532  43.571  1.00 20.47 ? 31  HIS C NE2 1 
ATOM   3579 N  N   . GLN C 1 32  ? 86.118  19.903  44.881  1.00 17.21 ? 32  GLN C N   1 
ATOM   3580 C  CA  . GLN C 1 32  ? 85.659  20.173  46.237  1.00 18.42 ? 32  GLN C CA  1 
ATOM   3581 C  C   . GLN C 1 32  ? 84.195  20.614  46.232  1.00 19.60 ? 32  GLN C C   1 
ATOM   3582 O  O   . GLN C 1 32  ? 83.419  20.227  47.105  1.00 19.46 ? 32  GLN C O   1 
ATOM   3583 C  CB  . GLN C 1 32  ? 86.492  21.280  46.881  1.00 20.09 ? 32  GLN C CB  1 
ATOM   3584 C  CG  . GLN C 1 32  ? 86.060  21.579  48.308  1.00 22.87 ? 32  GLN C CG  1 
ATOM   3585 C  CD  . GLN C 1 32  ? 86.388  20.430  49.232  1.00 25.70 ? 32  GLN C CD  1 
ATOM   3586 O  OE1 . GLN C 1 32  ? 87.554  20.174  49.517  1.00 23.92 ? 32  GLN C OE1 1 
ATOM   3587 N  NE2 . GLN C 1 32  ? 85.363  19.715  49.689  1.00 24.02 ? 32  GLN C NE2 1 
ATOM   3588 N  N   . THR C 1 33  ? 83.826  21.437  45.254  1.00 18.64 ? 33  THR C N   1 
ATOM   3589 C  CA  . THR C 1 33  ? 82.453  21.927  45.164  1.00 20.14 ? 33  THR C CA  1 
ATOM   3590 C  C   . THR C 1 33  ? 81.443  20.806  44.932  1.00 18.78 ? 33  THR C C   1 
ATOM   3591 O  O   . THR C 1 33  ? 80.362  20.817  45.519  1.00 18.76 ? 33  THR C O   1 
ATOM   3592 C  CB  . THR C 1 33  ? 82.301  22.972  44.050  1.00 22.60 ? 33  THR C CB  1 
ATOM   3593 O  OG1 . THR C 1 33  ? 83.136  24.099  44.342  1.00 22.04 ? 33  THR C OG1 1 
ATOM   3594 C  CG2 . THR C 1 33  ? 80.850  23.446  43.958  1.00 24.38 ? 33  THR C CG2 1 
ATOM   3595 N  N   . TYR C 1 34  ? 81.788  19.837  44.088  1.00 18.09 ? 34  TYR C N   1 
ATOM   3596 C  CA  . TYR C 1 34  ? 80.881  18.724  43.821  1.00 18.84 ? 34  TYR C CA  1 
ATOM   3597 C  C   . TYR C 1 34  ? 80.685  17.909  45.096  1.00 20.20 ? 34  TYR C C   1 
ATOM   3598 O  O   . TYR C 1 34  ? 79.572  17.482  45.409  1.00 19.85 ? 34  TYR C O   1 
ATOM   3599 C  CB  . TYR C 1 34  ? 81.428  17.827  42.702  1.00 18.93 ? 34  TYR C CB  1 
ATOM   3600 C  CG  . TYR C 1 34  ? 81.741  18.589  41.434  1.00 19.75 ? 34  TYR C CG  1 
ATOM   3601 C  CD1 . TYR C 1 34  ? 80.883  19.587  40.973  1.00 22.52 ? 34  TYR C CD1 1 
ATOM   3602 C  CD2 . TYR C 1 34  ? 82.914  18.351  40.724  1.00 20.50 ? 34  TYR C CD2 1 
ATOM   3603 C  CE1 . TYR C 1 34  ? 81.190  20.344  39.839  1.00 23.95 ? 34  TYR C CE1 1 
ATOM   3604 C  CE2 . TYR C 1 34  ? 83.231  19.101  39.587  1.00 23.14 ? 34  TYR C CE2 1 
ATOM   3605 C  CZ  . TYR C 1 34  ? 82.367  20.097  39.158  1.00 24.51 ? 34  TYR C CZ  1 
ATOM   3606 O  OH  . TYR C 1 34  ? 82.699  20.880  38.079  1.00 29.44 ? 34  TYR C OH  1 
ATOM   3607 N  N   . VAL C 1 35  ? 81.770  17.699  45.833  1.00 19.10 ? 35  VAL C N   1 
ATOM   3608 C  CA  . VAL C 1 35  ? 81.707  16.953  47.085  1.00 19.54 ? 35  VAL C CA  1 
ATOM   3609 C  C   . VAL C 1 35  ? 80.797  17.690  48.070  1.00 19.01 ? 35  VAL C C   1 
ATOM   3610 O  O   . VAL C 1 35  ? 79.910  17.093  48.678  1.00 20.24 ? 35  VAL C O   1 
ATOM   3611 C  CB  . VAL C 1 35  ? 83.123  16.802  47.714  1.00 20.95 ? 35  VAL C CB  1 
ATOM   3612 C  CG1 . VAL C 1 35  ? 83.018  16.300  49.150  1.00 20.44 ? 35  VAL C CG1 1 
ATOM   3613 C  CG2 . VAL C 1 35  ? 83.952  15.832  46.889  1.00 19.82 ? 35  VAL C CG2 1 
ATOM   3614 N  N   . ASN C 1 36  ? 81.014  18.994  48.218  1.00 17.74 ? 36  ASN C N   1 
ATOM   3615 C  CA  . ASN C 1 36  ? 80.209  19.792  49.134  1.00 19.28 ? 36  ASN C CA  1 
ATOM   3616 C  C   . ASN C 1 36  ? 78.721  19.741  48.781  1.00 21.46 ? 36  ASN C C   1 
ATOM   3617 O  O   . ASN C 1 36  ? 77.872  19.526  49.651  1.00 20.34 ? 36  ASN C O   1 
ATOM   3618 C  CB  . ASN C 1 36  ? 80.652  21.261  49.119  1.00 19.97 ? 36  ASN C CB  1 
ATOM   3619 C  CG  . ASN C 1 36  ? 82.046  21.465  49.687  1.00 18.66 ? 36  ASN C CG  1 
ATOM   3620 O  OD1 . ASN C 1 36  ? 82.645  20.551  50.246  1.00 21.07 ? 36  ASN C OD1 1 
ATOM   3621 N  ND2 . ASN C 1 36  ? 82.560  22.678  49.552  1.00 20.51 ? 36  ASN C ND2 1 
ATOM   3622 N  N   . ASN C 1 37  ? 78.406  19.955  47.508  1.00 20.60 ? 37  ASN C N   1 
ATOM   3623 C  CA  . ASN C 1 37  ? 77.015  19.949  47.078  1.00 22.52 ? 37  ASN C CA  1 
ATOM   3624 C  C   . ASN C 1 37  ? 76.354  18.588  47.215  1.00 21.93 ? 37  ASN C C   1 
ATOM   3625 O  O   . ASN C 1 37  ? 75.179  18.506  47.576  1.00 23.26 ? 37  ASN C O   1 
ATOM   3626 C  CB  . ASN C 1 37  ? 76.896  20.441  45.636  1.00 23.04 ? 37  ASN C CB  1 
ATOM   3627 C  CG  . ASN C 1 37  ? 77.214  21.916  45.498  1.00 27.75 ? 37  ASN C CG  1 
ATOM   3628 O  OD1 . ASN C 1 37  ? 77.081  22.688  46.449  1.00 28.34 ? 37  ASN C OD1 1 
ATOM   3629 N  ND2 . ASN C 1 37  ? 77.621  22.319  44.304  1.00 29.96 ? 37  ASN C ND2 1 
ATOM   3630 N  N   . ALA C 1 38  ? 77.096  17.522  46.925  1.00 20.75 ? 38  ALA C N   1 
ATOM   3631 C  CA  . ALA C 1 38  ? 76.552  16.172  47.047  1.00 21.89 ? 38  ALA C CA  1 
ATOM   3632 C  C   . ALA C 1 38  ? 76.229  15.880  48.513  1.00 23.41 ? 38  ALA C C   1 
ATOM   3633 O  O   . ALA C 1 38  ? 75.151  15.363  48.828  1.00 22.87 ? 38  ALA C O   1 
ATOM   3634 C  CB  . ALA C 1 38  ? 77.555  15.144  46.514  1.00 23.13 ? 38  ALA C CB  1 
ATOM   3635 N  N   . ASN C 1 39  ? 77.164  16.205  49.405  1.00 22.85 ? 39  ASN C N   1 
ATOM   3636 C  CA  . ASN C 1 39  ? 76.966  15.979  50.836  1.00 21.83 ? 39  ASN C CA  1 
ATOM   3637 C  C   . ASN C 1 39  ? 75.756  16.738  51.361  1.00 21.49 ? 39  ASN C C   1 
ATOM   3638 O  O   . ASN C 1 39  ? 74.986  16.208  52.159  1.00 22.11 ? 39  ASN C O   1 
ATOM   3639 C  CB  . ASN C 1 39  ? 78.188  16.422  51.654  1.00 21.19 ? 39  ASN C CB  1 
ATOM   3640 C  CG  . ASN C 1 39  ? 79.324  15.417  51.611  1.00 22.53 ? 39  ASN C CG  1 
ATOM   3641 O  OD1 . ASN C 1 39  ? 79.140  14.269  51.213  1.00 22.78 ? 39  ASN C OD1 1 
ATOM   3642 N  ND2 . ASN C 1 39  ? 80.510  15.846  52.043  1.00 20.27 ? 39  ASN C ND2 1 
ATOM   3643 N  N   . ALA C 1 40  ? 75.602  17.986  50.931  1.00 21.76 ? 40  ALA C N   1 
ATOM   3644 C  CA  . ALA C 1 40  ? 74.483  18.807  51.373  1.00 23.67 ? 40  ALA C CA  1 
ATOM   3645 C  C   . ALA C 1 40  ? 73.155  18.155  51.006  1.00 26.45 ? 40  ALA C C   1 
ATOM   3646 O  O   . ALA C 1 40  ? 72.207  18.165  51.788  1.00 26.73 ? 40  ALA C O   1 
ATOM   3647 C  CB  . ALA C 1 40  ? 74.572  20.188  50.739  1.00 23.28 ? 40  ALA C CB  1 
ATOM   3648 N  N   . ALA C 1 41  ? 73.093  17.582  49.811  1.00 27.08 ? 41  ALA C N   1 
ATOM   3649 C  CA  . ALA C 1 41  ? 71.877  16.940  49.341  1.00 28.56 ? 41  ALA C CA  1 
ATOM   3650 C  C   . ALA C 1 41  ? 71.614  15.618  50.049  1.00 29.35 ? 41  ALA C C   1 
ATOM   3651 O  O   . ALA C 1 41  ? 70.462  15.254  50.285  1.00 31.09 ? 41  ALA C O   1 
ATOM   3652 C  CB  . ALA C 1 41  ? 71.954  16.720  47.838  1.00 29.01 ? 41  ALA C CB  1 
ATOM   3653 N  N   . LEU C 1 42  ? 72.678  14.906  50.401  1.00 28.04 ? 42  LEU C N   1 
ATOM   3654 C  CA  . LEU C 1 42  ? 72.533  13.613  51.060  1.00 29.13 ? 42  LEU C CA  1 
ATOM   3655 C  C   . LEU C 1 42  ? 72.242  13.680  52.557  1.00 31.30 ? 42  LEU C C   1 
ATOM   3656 O  O   . LEU C 1 42  ? 71.896  12.670  53.167  1.00 30.30 ? 42  LEU C O   1 
ATOM   3657 C  CB  . LEU C 1 42  ? 73.777  12.756  50.812  1.00 28.92 ? 42  LEU C CB  1 
ATOM   3658 C  CG  . LEU C 1 42  ? 73.898  12.207  49.386  1.00 28.61 ? 42  LEU C CG  1 
ATOM   3659 C  CD1 . LEU C 1 42  ? 75.296  11.688  49.141  1.00 31.29 ? 42  LEU C CD1 1 
ATOM   3660 C  CD2 . LEU C 1 42  ? 72.866  11.099  49.181  1.00 29.97 ? 42  LEU C CD2 1 
ATOM   3661 N  N   . GLU C 1 43  ? 72.374  14.858  53.152  1.00 31.71 ? 43  GLU C N   1 
ATOM   3662 C  CA  . GLU C 1 43  ? 72.121  15.004  54.582  1.00 34.89 ? 43  GLU C CA  1 
ATOM   3663 C  C   . GLU C 1 43  ? 70.722  14.508  54.942  1.00 36.50 ? 43  GLU C C   1 
ATOM   3664 O  O   . GLU C 1 43  ? 70.534  13.869  55.974  1.00 35.25 ? 43  GLU C O   1 
ATOM   3665 C  CB  . GLU C 1 43  ? 72.278  16.472  54.998  1.00 33.85 ? 43  GLU C CB  1 
ATOM   3666 C  CG  . GLU C 1 43  ? 72.079  16.762  56.490  1.00 33.90 ? 43  GLU C CG  1 
ATOM   3667 C  CD  . GLU C 1 43  ? 73.077  16.043  57.387  1.00 34.93 ? 43  GLU C CD  1 
ATOM   3668 O  OE1 . GLU C 1 43  ? 74.261  15.932  57.010  1.00 33.13 ? 43  GLU C OE1 1 
ATOM   3669 O  OE2 . GLU C 1 43  ? 72.681  15.602  58.487  1.00 35.35 ? 43  GLU C OE2 1 
ATOM   3670 N  N   . SER C 1 44  ? 69.752  14.785  54.077  1.00 39.52 ? 44  SER C N   1 
ATOM   3671 C  CA  . SER C 1 44  ? 68.370  14.384  54.328  1.00 42.97 ? 44  SER C CA  1 
ATOM   3672 C  C   . SER C 1 44  ? 67.969  13.051  53.692  1.00 44.64 ? 44  SER C C   1 
ATOM   3673 O  O   . SER C 1 44  ? 66.781  12.736  53.601  1.00 45.26 ? 44  SER C O   1 
ATOM   3674 C  CB  . SER C 1 44  ? 67.419  15.489  53.857  1.00 43.62 ? 44  SER C CB  1 
ATOM   3675 O  OG  . SER C 1 44  ? 67.590  15.756  52.475  1.00 47.70 ? 44  SER C OG  1 
ATOM   3676 N  N   . LEU C 1 45  ? 68.955  12.273  53.254  1.00 44.54 ? 45  LEU C N   1 
ATOM   3677 C  CA  . LEU C 1 45  ? 68.694  10.973  52.638  1.00 45.28 ? 45  LEU C CA  1 
ATOM   3678 C  C   . LEU C 1 45  ? 69.585  9.892   53.244  1.00 45.95 ? 45  LEU C C   1 
ATOM   3679 O  O   . LEU C 1 45  ? 70.443  9.330   52.569  1.00 46.19 ? 45  LEU C O   1 
ATOM   3680 C  CB  . LEU C 1 45  ? 68.927  11.037  51.125  1.00 46.31 ? 45  LEU C CB  1 
ATOM   3681 C  CG  . LEU C 1 45  ? 67.874  11.702  50.233  1.00 47.94 ? 45  LEU C CG  1 
ATOM   3682 C  CD1 . LEU C 1 45  ? 67.713  13.170  50.586  1.00 49.01 ? 45  LEU C CD1 1 
ATOM   3683 C  CD2 . LEU C 1 45  ? 68.306  11.560  48.785  1.00 48.51 ? 45  LEU C CD2 1 
ATOM   3684 N  N   . PRO C 1 46  ? 69.379  9.580   54.532  1.00 47.38 ? 46  PRO C N   1 
ATOM   3685 C  CA  . PRO C 1 46  ? 70.158  8.566   55.250  1.00 48.75 ? 46  PRO C CA  1 
ATOM   3686 C  C   . PRO C 1 46  ? 70.293  7.222   54.534  1.00 49.75 ? 46  PRO C C   1 
ATOM   3687 O  O   . PRO C 1 46  ? 71.328  6.567   54.630  1.00 50.40 ? 46  PRO C O   1 
ATOM   3688 C  CB  . PRO C 1 46  ? 69.411  8.439   56.574  1.00 49.05 ? 46  PRO C CB  1 
ATOM   3689 C  CG  . PRO C 1 46  ? 68.891  9.826   56.789  1.00 48.95 ? 46  PRO C CG  1 
ATOM   3690 C  CD  . PRO C 1 46  ? 68.364  10.179  55.417  1.00 48.04 ? 46  PRO C CD  1 
ATOM   3691 N  N   . GLU C 1 47  ? 69.250  6.815   53.820  1.00 50.99 ? 47  GLU C N   1 
ATOM   3692 C  CA  . GLU C 1 47  ? 69.269  5.538   53.110  1.00 53.07 ? 47  GLU C CA  1 
ATOM   3693 C  C   . GLU C 1 47  ? 70.360  5.488   52.043  1.00 52.35 ? 47  GLU C C   1 
ATOM   3694 O  O   . GLU C 1 47  ? 70.971  4.442   51.819  1.00 52.93 ? 47  GLU C O   1 
ATOM   3695 C  CB  . GLU C 1 47  ? 67.917  5.277   52.436  1.00 56.36 ? 47  GLU C CB  1 
ATOM   3696 C  CG  . GLU C 1 47  ? 66.701  5.528   53.309  1.00 62.00 ? 47  GLU C CG  1 
ATOM   3697 C  CD  . GLU C 1 47  ? 66.489  7.005   53.604  1.00 65.66 ? 47  GLU C CD  1 
ATOM   3698 O  OE1 . GLU C 1 47  ? 66.375  7.797   52.644  1.00 66.95 ? 47  GLU C OE1 1 
ATOM   3699 O  OE2 . GLU C 1 47  ? 66.434  7.373   54.798  1.00 68.25 ? 47  GLU C OE2 1 
ATOM   3700 N  N   . PHE C 1 48  ? 70.597  6.623   51.391  1.00 51.35 ? 48  PHE C N   1 
ATOM   3701 C  CA  . PHE C 1 48  ? 71.588  6.721   50.319  1.00 50.42 ? 48  PHE C CA  1 
ATOM   3702 C  C   . PHE C 1 48  ? 72.953  7.263   50.738  1.00 49.62 ? 48  PHE C C   1 
ATOM   3703 O  O   . PHE C 1 48  ? 73.974  6.890   50.167  1.00 49.10 ? 48  PHE C O   1 
ATOM   3704 C  CB  . PHE C 1 48  ? 71.038  7.606   49.197  1.00 50.16 ? 48  PHE C CB  1 
ATOM   3705 C  CG  . PHE C 1 48  ? 69.768  7.094   48.587  1.00 50.74 ? 48  PHE C CG  1 
ATOM   3706 C  CD1 . PHE C 1 48  ? 69.790  6.026   47.698  1.00 51.63 ? 48  PHE C CD1 1 
ATOM   3707 C  CD2 . PHE C 1 48  ? 68.546  7.676   48.909  1.00 50.96 ? 48  PHE C CD2 1 
ATOM   3708 C  CE1 . PHE C 1 48  ? 68.609  5.543   47.135  1.00 52.91 ? 48  PHE C CE1 1 
ATOM   3709 C  CE2 . PHE C 1 48  ? 67.360  7.202   48.353  1.00 51.35 ? 48  PHE C CE2 1 
ATOM   3710 C  CZ  . PHE C 1 48  ? 67.391  6.134   47.464  1.00 51.75 ? 48  PHE C CZ  1 
ATOM   3711 N  N   . ALA C 1 49  ? 72.961  8.145   51.729  1.00 49.36 ? 49  ALA C N   1 
ATOM   3712 C  CA  . ALA C 1 49  ? 74.188  8.777   52.205  1.00 49.98 ? 49  ALA C CA  1 
ATOM   3713 C  C   . ALA C 1 49  ? 75.368  7.854   52.502  1.00 50.96 ? 49  ALA C C   1 
ATOM   3714 O  O   . ALA C 1 49  ? 76.515  8.301   52.510  1.00 51.84 ? 49  ALA C O   1 
ATOM   3715 C  CB  . ALA C 1 49  ? 73.878  9.622   53.435  1.00 50.00 ? 49  ALA C CB  1 
ATOM   3716 N  N   . ASN C 1 50  ? 75.103  6.573   52.735  1.00 51.29 ? 50  ASN C N   1 
ATOM   3717 C  CA  . ASN C 1 50  ? 76.178  5.637   53.059  1.00 51.49 ? 50  ASN C CA  1 
ATOM   3718 C  C   . ASN C 1 50  ? 76.715  4.822   51.881  1.00 49.44 ? 50  ASN C C   1 
ATOM   3719 O  O   . ASN C 1 50  ? 77.681  4.073   52.031  1.00 49.43 ? 50  ASN C O   1 
ATOM   3720 C  CB  . ASN C 1 50  ? 75.714  4.685   54.164  1.00 55.42 ? 50  ASN C CB  1 
ATOM   3721 C  CG  . ASN C 1 50  ? 74.490  3.879   53.758  1.00 59.83 ? 50  ASN C CG  1 
ATOM   3722 O  OD1 . ASN C 1 50  ? 73.447  4.442   53.411  1.00 61.51 ? 50  ASN C OD1 1 
ATOM   3723 N  ND2 . ASN C 1 50  ? 74.612  2.553   53.798  1.00 61.69 ? 50  ASN C ND2 1 
ATOM   3724 N  N   . LEU C 1 51  ? 76.100  4.967   50.712  1.00 45.85 ? 51  LEU C N   1 
ATOM   3725 C  CA  . LEU C 1 51  ? 76.534  4.225   49.532  1.00 41.97 ? 51  LEU C CA  1 
ATOM   3726 C  C   . LEU C 1 51  ? 77.783  4.820   48.889  1.00 39.42 ? 51  LEU C C   1 
ATOM   3727 O  O   . LEU C 1 51  ? 78.059  6.010   49.031  1.00 37.68 ? 51  LEU C O   1 
ATOM   3728 C  CB  . LEU C 1 51  ? 75.428  4.209   48.479  1.00 42.14 ? 51  LEU C CB  1 
ATOM   3729 C  CG  . LEU C 1 51  ? 74.062  3.650   48.864  1.00 42.88 ? 51  LEU C CG  1 
ATOM   3730 C  CD1 . LEU C 1 51  ? 73.084  3.876   47.720  1.00 41.47 ? 51  LEU C CD1 1 
ATOM   3731 C  CD2 . LEU C 1 51  ? 74.190  2.171   49.186  1.00 43.74 ? 51  LEU C CD2 1 
ATOM   3732 N  N   . PRO C 1 52  ? 78.570  3.987   48.192  1.00 37.55 ? 52  PRO C N   1 
ATOM   3733 C  CA  . PRO C 1 52  ? 79.773  4.503   47.534  1.00 35.02 ? 52  PRO C CA  1 
ATOM   3734 C  C   . PRO C 1 52  ? 79.220  5.361   46.395  1.00 32.87 ? 52  PRO C C   1 
ATOM   3735 O  O   . PRO C 1 52  ? 78.171  5.036   45.832  1.00 30.33 ? 52  PRO C O   1 
ATOM   3736 C  CB  . PRO C 1 52  ? 80.455  3.242   47.014  1.00 36.47 ? 52  PRO C CB  1 
ATOM   3737 C  CG  . PRO C 1 52  ? 79.983  2.172   47.963  1.00 38.12 ? 52  PRO C CG  1 
ATOM   3738 C  CD  . PRO C 1 52  ? 78.524  2.517   48.131  1.00 37.89 ? 52  PRO C CD  1 
ATOM   3739 N  N   . VAL C 1 53  ? 79.903  6.446   46.051  1.00 30.21 ? 53  VAL C N   1 
ATOM   3740 C  CA  . VAL C 1 53  ? 79.400  7.312   44.996  1.00 29.01 ? 53  VAL C CA  1 
ATOM   3741 C  C   . VAL C 1 53  ? 79.122  6.568   43.689  1.00 29.08 ? 53  VAL C C   1 
ATOM   3742 O  O   . VAL C 1 53  ? 78.134  6.857   43.021  1.00 29.78 ? 53  VAL C O   1 
ATOM   3743 C  CB  . VAL C 1 53  ? 80.362  8.503   44.738  1.00 28.26 ? 53  VAL C CB  1 
ATOM   3744 C  CG1 . VAL C 1 53  ? 81.644  8.019   44.100  1.00 25.12 ? 53  VAL C CG1 1 
ATOM   3745 C  CG2 . VAL C 1 53  ? 79.671  9.548   43.872  1.00 28.03 ? 53  VAL C CG2 1 
ATOM   3746 N  N   . GLU C 1 54  ? 79.973  5.607   43.334  1.00 30.92 ? 54  GLU C N   1 
ATOM   3747 C  CA  . GLU C 1 54  ? 79.790  4.840   42.097  1.00 34.70 ? 54  GLU C CA  1 
ATOM   3748 C  C   . GLU C 1 54  ? 78.475  4.067   42.101  1.00 35.47 ? 54  GLU C C   1 
ATOM   3749 O  O   . GLU C 1 54  ? 77.883  3.816   41.048  1.00 34.82 ? 54  GLU C O   1 
ATOM   3750 C  CB  . GLU C 1 54  ? 80.923  3.830   41.892  1.00 37.80 ? 54  GLU C CB  1 
ATOM   3751 C  CG  . GLU C 1 54  ? 82.307  4.416   41.714  1.00 42.51 ? 54  GLU C CG  1 
ATOM   3752 C  CD  . GLU C 1 54  ? 82.836  5.059   42.979  1.00 45.45 ? 54  GLU C CD  1 
ATOM   3753 O  OE1 . GLU C 1 54  ? 82.560  4.530   44.080  1.00 43.77 ? 54  GLU C OE1 1 
ATOM   3754 O  OE2 . GLU C 1 54  ? 83.540  6.087   42.869  1.00 47.99 ? 54  GLU C OE2 1 
ATOM   3755 N  N   . GLU C 1 55  ? 78.025  3.683   43.289  1.00 35.01 ? 55  GLU C N   1 
ATOM   3756 C  CA  . GLU C 1 55  ? 76.789  2.930   43.411  1.00 35.61 ? 55  GLU C CA  1 
ATOM   3757 C  C   . GLU C 1 55  ? 75.585  3.862   43.405  1.00 33.13 ? 55  GLU C C   1 
ATOM   3758 O  O   . GLU C 1 55  ? 74.553  3.559   42.804  1.00 32.58 ? 55  GLU C O   1 
ATOM   3759 C  CB  . GLU C 1 55  ? 76.807  2.107   44.697  1.00 38.29 ? 55  GLU C CB  1 
ATOM   3760 C  CG  . GLU C 1 55  ? 75.800  0.977   44.710  1.00 45.26 ? 55  GLU C CG  1 
ATOM   3761 C  CD  . GLU C 1 55  ? 75.822  0.195   46.008  1.00 48.49 ? 55  GLU C CD  1 
ATOM   3762 O  OE1 . GLU C 1 55  ? 76.923  -0.225  46.432  1.00 50.81 ? 55  GLU C OE1 1 
ATOM   3763 O  OE2 . GLU C 1 55  ? 74.738  -0.002  46.598  1.00 50.60 ? 55  GLU C OE2 1 
ATOM   3764 N  N   . LEU C 1 56  ? 75.719  5.000   44.074  1.00 31.21 ? 56  LEU C N   1 
ATOM   3765 C  CA  . LEU C 1 56  ? 74.633  5.967   44.134  1.00 29.83 ? 56  LEU C CA  1 
ATOM   3766 C  C   . LEU C 1 56  ? 74.176  6.417   42.748  1.00 29.59 ? 56  LEU C C   1 
ATOM   3767 O  O   . LEU C 1 56  ? 72.975  6.517   42.491  1.00 28.98 ? 56  LEU C O   1 
ATOM   3768 C  CB  . LEU C 1 56  ? 75.054  7.199   44.943  1.00 30.44 ? 56  LEU C CB  1 
ATOM   3769 C  CG  . LEU C 1 56  ? 74.076  8.378   44.902  1.00 30.78 ? 56  LEU C CG  1 
ATOM   3770 C  CD1 . LEU C 1 56  ? 72.820  8.033   45.687  1.00 33.45 ? 56  LEU C CD1 1 
ATOM   3771 C  CD2 . LEU C 1 56  ? 74.732  9.612   45.491  1.00 34.06 ? 56  LEU C CD2 1 
ATOM   3772 N  N   . ILE C 1 57  ? 75.122  6.675   41.847  1.00 28.02 ? 57  ILE C N   1 
ATOM   3773 C  CA  . ILE C 1 57  ? 74.748  7.155   40.520  1.00 28.83 ? 57  ILE C CA  1 
ATOM   3774 C  C   . ILE C 1 57  ? 74.098  6.131   39.599  1.00 30.05 ? 57  ILE C C   1 
ATOM   3775 O  O   . ILE C 1 57  ? 73.725  6.457   38.471  1.00 30.61 ? 57  ILE C O   1 
ATOM   3776 C  CB  . ILE C 1 57  ? 75.947  7.824   39.790  1.00 27.48 ? 57  ILE C CB  1 
ATOM   3777 C  CG1 . ILE C 1 57  ? 77.101  6.840   39.619  1.00 26.83 ? 57  ILE C CG1 1 
ATOM   3778 C  CG2 . ILE C 1 57  ? 76.406  9.045   40.581  1.00 27.09 ? 57  ILE C CG2 1 
ATOM   3779 C  CD1 . ILE C 1 57  ? 78.274  7.414   38.820  1.00 27.11 ? 57  ILE C CD1 1 
ATOM   3780 N  N   . THR C 1 58  ? 73.955  4.898   40.073  1.00 32.54 ? 58  THR C N   1 
ATOM   3781 C  CA  . THR C 1 58  ? 73.299  3.864   39.277  1.00 33.65 ? 58  THR C CA  1 
ATOM   3782 C  C   . THR C 1 58  ? 71.864  3.753   39.780  1.00 35.63 ? 58  THR C C   1 
ATOM   3783 O  O   . THR C 1 58  ? 71.045  3.034   39.204  1.00 36.59 ? 58  THR C O   1 
ATOM   3784 C  CB  . THR C 1 58  ? 73.965  2.474   39.437  1.00 32.92 ? 58  THR C CB  1 
ATOM   3785 O  OG1 . THR C 1 58  ? 73.784  2.007   40.781  1.00 31.35 ? 58  THR C OG1 1 
ATOM   3786 C  CG2 . THR C 1 58  ? 75.450  2.544   39.121  1.00 31.10 ? 58  THR C CG2 1 
ATOM   3787 N  N   . LYS C 1 59  ? 71.565  4.482   40.853  1.00 36.83 ? 59  LYS C N   1 
ATOM   3788 C  CA  . LYS C 1 59  ? 70.238  4.457   41.462  1.00 38.82 ? 59  LYS C CA  1 
ATOM   3789 C  C   . LYS C 1 59  ? 69.556  5.819   41.498  1.00 38.78 ? 59  LYS C C   1 
ATOM   3790 O  O   . LYS C 1 59  ? 68.739  6.081   42.380  1.00 38.34 ? 59  LYS C O   1 
ATOM   3791 C  CB  . LYS C 1 59  ? 70.340  3.916   42.890  1.00 40.72 ? 59  LYS C CB  1 
ATOM   3792 C  CG  . LYS C 1 59  ? 71.009  2.561   42.983  1.00 44.96 ? 59  LYS C CG  1 
ATOM   3793 C  CD  . LYS C 1 59  ? 71.098  2.076   44.420  1.00 47.65 ? 59  LYS C CD  1 
ATOM   3794 C  CE  . LYS C 1 59  ? 71.813  0.737   44.493  1.00 49.84 ? 59  LYS C CE  1 
ATOM   3795 N  NZ  . LYS C 1 59  ? 71.997  0.281   45.899  1.00 52.61 ? 59  LYS C NZ  1 
ATOM   3796 N  N   . LEU C 1 60  ? 69.877  6.680   40.538  1.00 38.75 ? 60  LEU C N   1 
ATOM   3797 C  CA  . LEU C 1 60  ? 69.293  8.014   40.490  1.00 39.41 ? 60  LEU C CA  1 
ATOM   3798 C  C   . LEU C 1 60  ? 67.769  8.008   40.381  1.00 42.00 ? 60  LEU C C   1 
ATOM   3799 O  O   . LEU C 1 60  ? 67.107  8.914   40.885  1.00 41.08 ? 60  LEU C O   1 
ATOM   3800 C  CB  . LEU C 1 60  ? 69.889  8.808   39.324  1.00 38.52 ? 60  LEU C CB  1 
ATOM   3801 C  CG  . LEU C 1 60  ? 71.396  9.079   39.390  1.00 36.10 ? 60  LEU C CG  1 
ATOM   3802 C  CD1 . LEU C 1 60  ? 71.833  9.806   38.128  1.00 36.91 ? 60  LEU C CD1 1 
ATOM   3803 C  CD2 . LEU C 1 60  ? 71.722  9.903   40.629  1.00 34.99 ? 60  LEU C CD2 1 
ATOM   3804 N  N   . ASP C 1 61  ? 67.213  6.992   39.727  1.00 44.53 ? 61  ASP C N   1 
ATOM   3805 C  CA  . ASP C 1 61  ? 65.763  6.904   39.571  1.00 48.19 ? 61  ASP C CA  1 
ATOM   3806 C  C   . ASP C 1 61  ? 65.038  6.605   40.879  1.00 48.78 ? 61  ASP C C   1 
ATOM   3807 O  O   . ASP C 1 61  ? 63.843  6.867   41.004  1.00 49.96 ? 61  ASP C O   1 
ATOM   3808 C  CB  . ASP C 1 61  ? 65.398  5.838   38.537  1.00 50.81 ? 61  ASP C CB  1 
ATOM   3809 C  CG  . ASP C 1 61  ? 65.742  6.258   37.123  1.00 54.28 ? 61  ASP C CG  1 
ATOM   3810 O  OD1 . ASP C 1 61  ? 65.372  7.388   36.734  1.00 55.40 ? 61  ASP C OD1 1 
ATOM   3811 O  OD2 . ASP C 1 61  ? 66.376  5.461   36.398  1.00 57.03 ? 61  ASP C OD2 1 
ATOM   3812 N  N   . GLN C 1 62  ? 65.760  6.059   41.851  1.00 49.78 ? 62  GLN C N   1 
ATOM   3813 C  CA  . GLN C 1 62  ? 65.174  5.728   43.144  1.00 50.02 ? 62  GLN C CA  1 
ATOM   3814 C  C   . GLN C 1 62  ? 65.118  6.935   44.075  1.00 50.24 ? 62  GLN C C   1 
ATOM   3815 O  O   . GLN C 1 62  ? 64.495  6.879   45.133  1.00 50.30 ? 62  GLN C O   1 
ATOM   3816 C  CB  . GLN C 1 62  ? 65.976  4.615   43.812  1.00 51.05 ? 62  GLN C CB  1 
ATOM   3817 C  CG  . GLN C 1 62  ? 66.133  3.369   42.961  1.00 52.68 ? 62  GLN C CG  1 
ATOM   3818 C  CD  . GLN C 1 62  ? 66.907  2.280   43.675  1.00 53.78 ? 62  GLN C CD  1 
ATOM   3819 O  OE1 . GLN C 1 62  ? 67.272  1.267   43.076  1.00 55.06 ? 62  GLN C OE1 1 
ATOM   3820 N  NE2 . GLN C 1 62  ? 67.158  2.481   44.964  1.00 54.02 ? 62  GLN C NE2 1 
ATOM   3821 N  N   . LEU C 1 63  ? 65.771  8.024   43.682  1.00 49.73 ? 63  LEU C N   1 
ATOM   3822 C  CA  . LEU C 1 63  ? 65.791  9.238   44.493  1.00 49.34 ? 63  LEU C CA  1 
ATOM   3823 C  C   . LEU C 1 63  ? 64.538  10.075  44.282  1.00 49.37 ? 63  LEU C C   1 
ATOM   3824 O  O   . LEU C 1 63  ? 63.890  9.990   43.240  1.00 49.79 ? 63  LEU C O   1 
ATOM   3825 C  CB  . LEU C 1 63  ? 67.003  10.106  44.137  1.00 48.46 ? 63  LEU C CB  1 
ATOM   3826 C  CG  . LEU C 1 63  ? 68.418  9.567   44.330  1.00 48.86 ? 63  LEU C CG  1 
ATOM   3827 C  CD1 . LEU C 1 63  ? 69.412  10.575  43.764  1.00 48.16 ? 63  LEU C CD1 1 
ATOM   3828 C  CD2 . LEU C 1 63  ? 68.683  9.316   45.802  1.00 48.23 ? 63  LEU C CD2 1 
ATOM   3829 N  N   . PRO C 1 64  ? 64.181  10.901  45.277  1.00 49.72 ? 64  PRO C N   1 
ATOM   3830 C  CA  . PRO C 1 64  ? 62.997  11.752  45.156  1.00 49.95 ? 64  PRO C CA  1 
ATOM   3831 C  C   . PRO C 1 64  ? 63.215  12.773  44.043  1.00 50.44 ? 64  PRO C C   1 
ATOM   3832 O  O   . PRO C 1 64  ? 64.340  13.209  43.799  1.00 49.71 ? 64  PRO C O   1 
ATOM   3833 C  CB  . PRO C 1 64  ? 62.888  12.393  46.540  1.00 50.98 ? 64  PRO C CB  1 
ATOM   3834 C  CG  . PRO C 1 64  ? 64.308  12.396  47.033  1.00 50.86 ? 64  PRO C CG  1 
ATOM   3835 C  CD  . PRO C 1 64  ? 64.787  11.035  46.613  1.00 49.90 ? 64  PRO C CD  1 
ATOM   3836 N  N   . ALA C 1 65  ? 62.135  13.149  43.372  1.00 50.05 ? 65  ALA C N   1 
ATOM   3837 C  CA  . ALA C 1 65  ? 62.202  14.097  42.269  1.00 50.52 ? 65  ALA C CA  1 
ATOM   3838 C  C   . ALA C 1 65  ? 63.069  15.329  42.519  1.00 50.35 ? 65  ALA C C   1 
ATOM   3839 O  O   . ALA C 1 65  ? 63.909  15.676  41.688  1.00 50.98 ? 65  ALA C O   1 
ATOM   3840 C  CB  . ALA C 1 65  ? 60.793  14.531  41.880  1.00 51.56 ? 65  ALA C CB  1 
ATOM   3841 N  N   . ASP C 1 66  ? 62.871  15.982  43.661  1.00 48.44 ? 66  ASP C N   1 
ATOM   3842 C  CA  . ASP C 1 66  ? 63.613  17.199  43.987  1.00 47.57 ? 66  ASP C CA  1 
ATOM   3843 C  C   . ASP C 1 66  ? 65.094  17.020  44.326  1.00 45.70 ? 66  ASP C C   1 
ATOM   3844 O  O   . ASP C 1 66  ? 65.808  18.007  44.513  1.00 45.95 ? 66  ASP C O   1 
ATOM   3845 C  CB  . ASP C 1 66  ? 62.915  17.941  45.136  1.00 49.05 ? 66  ASP C CB  1 
ATOM   3846 C  CG  . ASP C 1 66  ? 62.998  17.193  46.455  1.00 52.06 ? 66  ASP C CG  1 
ATOM   3847 O  OD1 . ASP C 1 66  ? 62.636  15.999  46.493  1.00 54.19 ? 66  ASP C OD1 1 
ATOM   3848 O  OD2 . ASP C 1 66  ? 63.422  17.804  47.460  1.00 54.31 ? 66  ASP C OD2 1 
ATOM   3849 N  N   . LYS C 1 67  ? 65.559  15.777  44.397  1.00 42.35 ? 67  LYS C N   1 
ATOM   3850 C  CA  . LYS C 1 67  ? 66.960  15.504  44.726  1.00 40.36 ? 67  LYS C CA  1 
ATOM   3851 C  C   . LYS C 1 67  ? 67.733  14.893  43.557  1.00 38.95 ? 67  LYS C C   1 
ATOM   3852 O  O   . LYS C 1 67  ? 68.966  14.838  43.572  1.00 38.00 ? 67  LYS C O   1 
ATOM   3853 C  CB  . LYS C 1 67  ? 67.039  14.536  45.912  1.00 40.86 ? 67  LYS C CB  1 
ATOM   3854 C  CG  . LYS C 1 67  ? 66.623  15.106  47.258  1.00 41.65 ? 67  LYS C CG  1 
ATOM   3855 C  CD  . LYS C 1 67  ? 67.620  16.138  47.750  1.00 44.83 ? 67  LYS C CD  1 
ATOM   3856 C  CE  . LYS C 1 67  ? 67.401  16.461  49.221  1.00 46.06 ? 67  LYS C CE  1 
ATOM   3857 N  NZ  . LYS C 1 67  ? 66.035  16.990  49.468  1.00 47.94 ? 67  LYS C NZ  1 
ATOM   3858 N  N   . LYS C 1 68  ? 67.002  14.450  42.543  1.00 35.94 ? 68  LYS C N   1 
ATOM   3859 C  CA  . LYS C 1 68  ? 67.594  13.782  41.393  1.00 35.66 ? 68  LYS C CA  1 
ATOM   3860 C  C   . LYS C 1 68  ? 68.603  14.583  40.570  1.00 33.35 ? 68  LYS C C   1 
ATOM   3861 O  O   . LYS C 1 68  ? 69.692  14.096  40.285  1.00 32.22 ? 68  LYS C O   1 
ATOM   3862 C  CB  . LYS C 1 68  ? 66.486  13.253  40.480  1.00 38.20 ? 68  LYS C CB  1 
ATOM   3863 C  CG  . LYS C 1 68  ? 66.957  12.225  39.472  1.00 42.03 ? 68  LYS C CG  1 
ATOM   3864 C  CD  . LYS C 1 68  ? 65.783  11.612  38.720  1.00 45.49 ? 68  LYS C CD  1 
ATOM   3865 C  CE  . LYS C 1 68  ? 66.255  10.612  37.671  1.00 46.96 ? 68  LYS C CE  1 
ATOM   3866 N  NZ  . LYS C 1 68  ? 65.113  9.960   36.959  1.00 49.12 ? 68  LYS C NZ  1 
ATOM   3867 N  N   . THR C 1 69  ? 68.247  15.803  40.189  1.00 31.54 ? 69  THR C N   1 
ATOM   3868 C  CA  . THR C 1 69  ? 69.138  16.630  39.384  1.00 31.52 ? 69  THR C CA  1 
ATOM   3869 C  C   . THR C 1 69  ? 70.407  17.057  40.114  1.00 29.49 ? 69  THR C C   1 
ATOM   3870 O  O   . THR C 1 69  ? 71.507  16.946  39.571  1.00 28.18 ? 69  THR C O   1 
ATOM   3871 C  CB  . THR C 1 69  ? 68.416  17.898  38.896  1.00 33.01 ? 69  THR C CB  1 
ATOM   3872 O  OG1 . THR C 1 69  ? 67.363  17.526  38.001  1.00 35.58 ? 69  THR C OG1 1 
ATOM   3873 C  CG2 . THR C 1 69  ? 69.385  18.823  38.174  1.00 34.07 ? 69  THR C CG2 1 
ATOM   3874 N  N   . VAL C 1 70  ? 70.254  17.551  41.338  1.00 27.43 ? 70  VAL C N   1 
ATOM   3875 C  CA  . VAL C 1 70  ? 71.401  18.004  42.116  1.00 26.35 ? 70  VAL C CA  1 
ATOM   3876 C  C   . VAL C 1 70  ? 72.401  16.870  42.345  1.00 25.51 ? 70  VAL C C   1 
ATOM   3877 O  O   . VAL C 1 70  ? 73.613  17.075  42.256  1.00 25.00 ? 70  VAL C O   1 
ATOM   3878 C  CB  . VAL C 1 70  ? 70.952  18.596  43.486  1.00 26.81 ? 70  VAL C CB  1 
ATOM   3879 C  CG1 . VAL C 1 70  ? 70.274  17.527  44.325  1.00 28.42 ? 70  VAL C CG1 1 
ATOM   3880 C  CG2 . VAL C 1 70  ? 72.147  19.177  44.229  1.00 28.90 ? 70  VAL C CG2 1 
ATOM   3881 N  N   . LEU C 1 71  ? 71.903  15.670  42.627  1.00 23.61 ? 71  LEU C N   1 
ATOM   3882 C  CA  . LEU C 1 71  ? 72.794  14.536  42.855  1.00 23.28 ? 71  LEU C CA  1 
ATOM   3883 C  C   . LEU C 1 71  ? 73.359  13.992  41.544  1.00 22.74 ? 71  LEU C C   1 
ATOM   3884 O  O   . LEU C 1 71  ? 74.504  13.550  41.491  1.00 22.01 ? 71  LEU C O   1 
ATOM   3885 C  CB  . LEU C 1 71  ? 72.069  13.439  43.640  1.00 25.25 ? 71  LEU C CB  1 
ATOM   3886 C  CG  . LEU C 1 71  ? 71.980  13.758  45.142  1.00 25.95 ? 71  LEU C CG  1 
ATOM   3887 C  CD1 . LEU C 1 71  ? 71.134  12.725  45.859  1.00 24.90 ? 71  LEU C CD1 1 
ATOM   3888 C  CD2 . LEU C 1 71  ? 73.388  13.792  45.733  1.00 25.97 ? 71  LEU C CD2 1 
ATOM   3889 N  N   . ARG C 1 72  ? 72.561  14.030  40.481  1.00 21.18 ? 72  ARG C N   1 
ATOM   3890 C  CA  . ARG C 1 72  ? 73.044  13.574  39.185  1.00 21.06 ? 72  ARG C CA  1 
ATOM   3891 C  C   . ARG C 1 72  ? 74.277  14.393  38.805  1.00 20.76 ? 72  ARG C C   1 
ATOM   3892 O  O   . ARG C 1 72  ? 75.303  13.848  38.391  1.00 21.51 ? 72  ARG C O   1 
ATOM   3893 C  CB  . ARG C 1 72  ? 71.978  13.780  38.113  1.00 21.35 ? 72  ARG C CB  1 
ATOM   3894 C  CG  . ARG C 1 72  ? 72.497  13.670  36.684  1.00 23.59 ? 72  ARG C CG  1 
ATOM   3895 C  CD  . ARG C 1 72  ? 71.376  13.979  35.692  1.00 28.62 ? 72  ARG C CD  1 
ATOM   3896 N  NE  . ARG C 1 72  ? 71.808  13.902  34.301  1.00 28.45 ? 72  ARG C NE  1 
ATOM   3897 C  CZ  . ARG C 1 72  ? 70.988  14.034  33.263  1.00 30.42 ? 72  ARG C CZ  1 
ATOM   3898 N  NH1 . ARG C 1 72  ? 69.691  14.249  33.463  1.00 28.10 ? 72  ARG C NH1 1 
ATOM   3899 N  NH2 . ARG C 1 72  ? 71.460  13.954  32.027  1.00 26.26 ? 72  ARG C NH2 1 
ATOM   3900 N  N   . ASN C 1 73  ? 74.166  15.710  38.947  1.00 19.56 ? 73  ASN C N   1 
ATOM   3901 C  CA  . ASN C 1 73  ? 75.265  16.596  38.590  1.00 19.75 ? 73  ASN C CA  1 
ATOM   3902 C  C   . ASN C 1 73  ? 76.454  16.533  39.533  1.00 19.64 ? 73  ASN C C   1 
ATOM   3903 O  O   . ASN C 1 73  ? 77.595  16.383  39.093  1.00 20.01 ? 73  ASN C O   1 
ATOM   3904 C  CB  . ASN C 1 73  ? 74.782  18.047  38.498  1.00 20.07 ? 73  ASN C CB  1 
ATOM   3905 C  CG  . ASN C 1 73  ? 73.808  18.265  37.360  1.00 23.89 ? 73  ASN C CG  1 
ATOM   3906 O  OD1 . ASN C 1 73  ? 73.866  17.579  36.338  1.00 22.10 ? 73  ASN C OD1 1 
ATOM   3907 N  ND2 . ASN C 1 73  ? 72.919  19.239  37.521  1.00 23.52 ? 73  ASN C ND2 1 
ATOM   3908 N  N   . ASN C 1 74  ? 76.188  16.633  40.831  1.00 19.20 ? 74  ASN C N   1 
ATOM   3909 C  CA  . ASN C 1 74  ? 77.260  16.639  41.818  1.00 20.14 ? 74  ASN C CA  1 
ATOM   3910 C  C   . ASN C 1 74  ? 77.855  15.285  42.196  1.00 19.57 ? 74  ASN C C   1 
ATOM   3911 O  O   . ASN C 1 74  ? 79.067  15.179  42.388  1.00 18.46 ? 74  ASN C O   1 
ATOM   3912 C  CB  . ASN C 1 74  ? 76.782  17.404  43.048  1.00 18.72 ? 74  ASN C CB  1 
ATOM   3913 C  CG  . ASN C 1 74  ? 76.545  18.869  42.743  1.00 20.69 ? 74  ASN C CG  1 
ATOM   3914 O  OD1 . ASN C 1 74  ? 77.489  19.626  42.538  1.00 19.76 ? 74  ASN C OD1 1 
ATOM   3915 N  ND2 . ASN C 1 74  ? 75.280  19.271  42.680  1.00 22.85 ? 74  ASN C ND2 1 
ATOM   3916 N  N   . ALA C 1 75  ? 77.022  14.253  42.311  1.00 19.73 ? 75  ALA C N   1 
ATOM   3917 C  CA  . ALA C 1 75  ? 77.546  12.926  42.624  1.00 18.64 ? 75  ALA C CA  1 
ATOM   3918 C  C   . ALA C 1 75  ? 78.254  12.482  41.350  1.00 19.54 ? 75  ALA C C   1 
ATOM   3919 O  O   . ALA C 1 75  ? 79.289  11.811  41.393  1.00 18.93 ? 75  ALA C O   1 
ATOM   3920 C  CB  . ALA C 1 75  ? 76.418  11.949  42.964  1.00 22.13 ? 75  ALA C CB  1 
ATOM   3921 N  N   . GLY C 1 76  ? 77.681  12.856  40.210  1.00 17.77 ? 76  GLY C N   1 
ATOM   3922 C  CA  . GLY C 1 76  ? 78.296  12.509  38.943  1.00 19.05 ? 76  GLY C CA  1 
ATOM   3923 C  C   . GLY C 1 76  ? 79.663  13.177  38.882  1.00 18.46 ? 76  GLY C C   1 
ATOM   3924 O  O   . GLY C 1 76  ? 80.651  12.560  38.485  1.00 19.49 ? 76  GLY C O   1 
ATOM   3925 N  N   . GLY C 1 77  ? 79.716  14.442  39.291  1.00 19.04 ? 77  GLY C N   1 
ATOM   3926 C  CA  . GLY C 1 77  ? 80.974  15.170  39.286  1.00 17.90 ? 77  GLY C CA  1 
ATOM   3927 C  C   . GLY C 1 77  ? 82.007  14.525  40.194  1.00 18.73 ? 77  GLY C C   1 
ATOM   3928 O  O   . GLY C 1 77  ? 83.182  14.417  39.836  1.00 18.08 ? 77  GLY C O   1 
ATOM   3929 N  N   . HIS C 1 78  ? 81.574  14.093  41.375  1.00 17.03 ? 78  HIS C N   1 
ATOM   3930 C  CA  . HIS C 1 78  ? 82.479  13.458  42.325  1.00 17.52 ? 78  HIS C CA  1 
ATOM   3931 C  C   . HIS C 1 78  ? 83.010  12.137  41.771  1.00 17.95 ? 78  HIS C C   1 
ATOM   3932 O  O   . HIS C 1 78  ? 84.212  11.874  41.826  1.00 19.81 ? 78  HIS C O   1 
ATOM   3933 C  CB  . HIS C 1 78  ? 81.756  13.239  43.664  1.00 17.92 ? 78  HIS C CB  1 
ATOM   3934 C  CG  . HIS C 1 78  ? 82.597  12.575  44.707  1.00 19.77 ? 78  HIS C CG  1 
ATOM   3935 N  ND1 . HIS C 1 78  ? 83.935  12.860  44.878  1.00 20.39 ? 78  HIS C ND1 1 
ATOM   3936 C  CD2 . HIS C 1 78  ? 82.281  11.665  45.661  1.00 21.22 ? 78  HIS C CD2 1 
ATOM   3937 C  CE1 . HIS C 1 78  ? 84.406  12.157  45.893  1.00 22.17 ? 78  HIS C CE1 1 
ATOM   3938 N  NE2 . HIS C 1 78  ? 83.422  11.424  46.386  1.00 22.93 ? 78  HIS C NE2 1 
ATOM   3939 N  N   . ALA C 1 79  ? 82.119  11.315  41.221  1.00 18.21 ? 79  ALA C N   1 
ATOM   3940 C  CA  . ALA C 1 79  ? 82.516  10.022  40.663  1.00 18.49 ? 79  ALA C CA  1 
ATOM   3941 C  C   . ALA C 1 79  ? 83.501  10.190  39.503  1.00 18.53 ? 79  ALA C C   1 
ATOM   3942 O  O   . ALA C 1 79  ? 84.539  9.535   39.461  1.00 19.83 ? 79  ALA C O   1 
ATOM   3943 C  CB  . ALA C 1 79  ? 81.282  9.264   40.175  1.00 16.26 ? 79  ALA C CB  1 
ATOM   3944 N  N   . ASN C 1 80  ? 83.162  11.064  38.561  1.00 17.70 ? 80  ASN C N   1 
ATOM   3945 C  CA  . ASN C 1 80  ? 84.011  11.291  37.390  1.00 18.28 ? 80  ASN C CA  1 
ATOM   3946 C  C   . ASN C 1 80  ? 85.394  11.829  37.731  1.00 18.25 ? 80  ASN C C   1 
ATOM   3947 O  O   . ASN C 1 80  ? 86.399  11.331  37.219  1.00 19.36 ? 80  ASN C O   1 
ATOM   3948 C  CB  . ASN C 1 80  ? 83.342  12.260  36.408  1.00 18.52 ? 80  ASN C CB  1 
ATOM   3949 C  CG  . ASN C 1 80  ? 82.105  11.673  35.755  1.00 21.57 ? 80  ASN C CG  1 
ATOM   3950 O  OD1 . ASN C 1 80  ? 81.718  10.540  36.035  1.00 20.32 ? 80  ASN C OD1 1 
ATOM   3951 N  ND2 . ASN C 1 80  ? 81.480  12.447  34.875  1.00 18.98 ? 80  ASN C ND2 1 
ATOM   3952 N  N   . HIS C 1 81  ? 85.456  12.853  38.576  1.00 16.69 ? 81  HIS C N   1 
ATOM   3953 C  CA  . HIS C 1 81  ? 86.752  13.410  38.928  1.00 18.69 ? 81  HIS C CA  1 
ATOM   3954 C  C   . HIS C 1 81  ? 87.599  12.463  39.777  1.00 19.84 ? 81  HIS C C   1 
ATOM   3955 O  O   . HIS C 1 81  ? 88.824  12.437  39.638  1.00 19.68 ? 81  HIS C O   1 
ATOM   3956 C  CB  . HIS C 1 81  ? 86.583  14.769  39.602  1.00 15.91 ? 81  HIS C CB  1 
ATOM   3957 C  CG  . HIS C 1 81  ? 86.134  15.845  38.662  1.00 19.33 ? 81  HIS C CG  1 
ATOM   3958 N  ND1 . HIS C 1 81  ? 84.813  16.024  38.306  1.00 17.57 ? 81  HIS C ND1 1 
ATOM   3959 C  CD2 . HIS C 1 81  ? 86.843  16.752  37.947  1.00 17.09 ? 81  HIS C CD2 1 
ATOM   3960 C  CE1 . HIS C 1 81  ? 84.729  16.993  37.409  1.00 19.63 ? 81  HIS C CE1 1 
ATOM   3961 N  NE2 . HIS C 1 81  ? 85.947  17.450  37.174  1.00 18.92 ? 81  HIS C NE2 1 
ATOM   3962 N  N   . SER C 1 82  ? 86.962  11.677  40.642  1.00 20.44 ? 82  SER C N   1 
ATOM   3963 C  CA  . SER C 1 82  ? 87.714  10.727  41.459  1.00 20.79 ? 82  SER C CA  1 
ATOM   3964 C  C   . SER C 1 82  ? 88.407  9.729   40.533  1.00 22.45 ? 82  SER C C   1 
ATOM   3965 O  O   . SER C 1 82  ? 89.570  9.381   40.729  1.00 23.64 ? 82  SER C O   1 
ATOM   3966 C  CB  . SER C 1 82  ? 86.780  9.982   42.418  1.00 20.50 ? 82  SER C CB  1 
ATOM   3967 O  OG  . SER C 1 82  ? 86.260  10.869  43.390  1.00 19.02 ? 82  SER C OG  1 
ATOM   3968 N  N   . LEU C 1 83  ? 87.682  9.274   39.519  1.00 22.31 ? 83  LEU C N   1 
ATOM   3969 C  CA  . LEU C 1 83  ? 88.224  8.326   38.560  1.00 23.98 ? 83  LEU C CA  1 
ATOM   3970 C  C   . LEU C 1 83  ? 89.345  8.975   37.739  1.00 23.94 ? 83  LEU C C   1 
ATOM   3971 O  O   . LEU C 1 83  ? 90.370  8.344   37.457  1.00 23.08 ? 83  LEU C O   1 
ATOM   3972 C  CB  . LEU C 1 83  ? 87.091  7.836   37.651  1.00 26.46 ? 83  LEU C CB  1 
ATOM   3973 C  CG  . LEU C 1 83  ? 87.331  6.756   36.595  1.00 29.93 ? 83  LEU C CG  1 
ATOM   3974 C  CD1 . LEU C 1 83  ? 85.985  6.215   36.115  1.00 31.35 ? 83  LEU C CD1 1 
ATOM   3975 C  CD2 . LEU C 1 83  ? 88.110  7.324   35.431  1.00 30.99 ? 83  LEU C CD2 1 
ATOM   3976 N  N   . PHE C 1 84  ? 89.146  10.240  37.374  1.00 21.52 ? 84  PHE C N   1 
ATOM   3977 C  CA  . PHE C 1 84  ? 90.117  10.995  36.581  1.00 21.57 ? 84  PHE C CA  1 
ATOM   3978 C  C   . PHE C 1 84  ? 91.499  11.086  37.249  1.00 21.90 ? 84  PHE C C   1 
ATOM   3979 O  O   . PHE C 1 84  ? 92.515  10.805  36.616  1.00 21.64 ? 84  PHE C O   1 
ATOM   3980 C  CB  . PHE C 1 84  ? 89.572  12.404  36.324  1.00 20.42 ? 84  PHE C CB  1 
ATOM   3981 C  CG  . PHE C 1 84  ? 90.334  13.186  35.286  1.00 21.38 ? 84  PHE C CG  1 
ATOM   3982 C  CD1 . PHE C 1 84  ? 90.519  12.678  34.005  1.00 23.00 ? 84  PHE C CD1 1 
ATOM   3983 C  CD2 . PHE C 1 84  ? 90.794  14.466  35.568  1.00 22.50 ? 84  PHE C CD2 1 
ATOM   3984 C  CE1 . PHE C 1 84  ? 91.147  13.438  33.018  1.00 23.83 ? 84  PHE C CE1 1 
ATOM   3985 C  CE2 . PHE C 1 84  ? 91.424  15.237  34.586  1.00 24.44 ? 84  PHE C CE2 1 
ATOM   3986 C  CZ  . PHE C 1 84  ? 91.598  14.719  33.310  1.00 23.44 ? 84  PHE C CZ  1 
ATOM   3987 N  N   . TRP C 1 85  ? 91.539  11.468  38.523  1.00 21.99 ? 85  TRP C N   1 
ATOM   3988 C  CA  . TRP C 1 85  ? 92.819  11.603  39.229  1.00 23.80 ? 85  TRP C CA  1 
ATOM   3989 C  C   . TRP C 1 85  ? 93.614  10.300  39.217  1.00 25.66 ? 85  TRP C C   1 
ATOM   3990 O  O   . TRP C 1 85  ? 94.822  10.303  38.970  1.00 26.16 ? 85  TRP C O   1 
ATOM   3991 C  CB  . TRP C 1 85  ? 92.599  12.036  40.684  1.00 23.11 ? 85  TRP C CB  1 
ATOM   3992 C  CG  . TRP C 1 85  ? 91.759  13.271  40.850  1.00 21.60 ? 85  TRP C CG  1 
ATOM   3993 C  CD1 . TRP C 1 85  ? 90.758  13.462  41.763  1.00 20.41 ? 85  TRP C CD1 1 
ATOM   3994 C  CD2 . TRP C 1 85  ? 91.835  14.480  40.083  1.00 20.83 ? 85  TRP C CD2 1 
ATOM   3995 N  NE1 . TRP C 1 85  ? 90.204  14.711  41.609  1.00 18.74 ? 85  TRP C NE1 1 
ATOM   3996 C  CE2 . TRP C 1 85  ? 90.845  15.357  40.585  1.00 20.20 ? 85  TRP C CE2 1 
ATOM   3997 C  CE3 . TRP C 1 85  ? 92.640  14.909  39.018  1.00 23.82 ? 85  TRP C CE3 1 
ATOM   3998 C  CZ2 . TRP C 1 85  ? 90.640  16.634  40.059  1.00 21.17 ? 85  TRP C CZ2 1 
ATOM   3999 C  CZ3 . TRP C 1 85  ? 92.435  16.182  38.496  1.00 23.51 ? 85  TRP C CZ3 1 
ATOM   4000 C  CH2 . TRP C 1 85  ? 91.442  17.027  39.018  1.00 23.40 ? 85  TRP C CH2 1 
ATOM   4001 N  N   . LYS C 1 86  ? 92.935  9.191   39.492  1.00 25.82 ? 86  LYS C N   1 
ATOM   4002 C  CA  . LYS C 1 86  ? 93.580  7.883   39.519  1.00 28.12 ? 86  LYS C CA  1 
ATOM   4003 C  C   . LYS C 1 86  ? 93.984  7.400   38.135  1.00 28.33 ? 86  LYS C C   1 
ATOM   4004 O  O   . LYS C 1 86  ? 94.856  6.536   38.001  1.00 28.40 ? 86  LYS C O   1 
ATOM   4005 C  CB  . LYS C 1 86  ? 92.646  6.840   40.139  1.00 30.12 ? 86  LYS C CB  1 
ATOM   4006 C  CG  . LYS C 1 86  ? 92.409  6.986   41.633  1.00 34.44 ? 86  LYS C CG  1 
ATOM   4007 C  CD  . LYS C 1 86  ? 91.570  5.816   42.125  1.00 40.31 ? 86  LYS C CD  1 
ATOM   4008 C  CE  . LYS C 1 86  ? 91.312  5.874   43.617  1.00 44.35 ? 86  LYS C CE  1 
ATOM   4009 N  NZ  . LYS C 1 86  ? 90.524  4.683   44.059  1.00 48.10 ? 86  LYS C NZ  1 
ATOM   4010 N  N   . GLY C 1 87  ? 93.336  7.944   37.109  1.00 26.20 ? 87  GLY C N   1 
ATOM   4011 C  CA  . GLY C 1 87  ? 93.639  7.531   35.753  1.00 24.93 ? 87  GLY C CA  1 
ATOM   4012 C  C   . GLY C 1 87  ? 94.765  8.298   35.085  1.00 24.41 ? 87  GLY C C   1 
ATOM   4013 O  O   . GLY C 1 87  ? 94.987  8.137   33.888  1.00 26.71 ? 87  GLY C O   1 
ATOM   4014 N  N   . LEU C 1 88  ? 95.474  9.128   35.841  1.00 24.55 ? 88  LEU C N   1 
ATOM   4015 C  CA  . LEU C 1 88  ? 96.573  9.915   35.281  1.00 25.98 ? 88  LEU C CA  1 
ATOM   4016 C  C   . LEU C 1 88  ? 97.904  9.539   35.918  1.00 28.76 ? 88  LEU C C   1 
ATOM   4017 O  O   . LEU C 1 88  ? 98.006  9.431   37.141  1.00 27.89 ? 88  LEU C O   1 
ATOM   4018 C  CB  . LEU C 1 88  ? 96.323  11.409  35.498  1.00 25.95 ? 88  LEU C CB  1 
ATOM   4019 C  CG  . LEU C 1 88  ? 95.015  11.978  34.936  1.00 25.94 ? 88  LEU C CG  1 
ATOM   4020 C  CD1 . LEU C 1 88  ? 94.839  13.400  35.436  1.00 25.80 ? 88  LEU C CD1 1 
ATOM   4021 C  CD2 . LEU C 1 88  ? 95.024  11.928  33.415  1.00 24.24 ? 88  LEU C CD2 1 
ATOM   4022 N  N   . LYS C 1 89  ? 98.924  9.357   35.083  1.00 30.80 ? 89  LYS C N   1 
ATOM   4023 C  CA  . LYS C 1 89  ? 100.258 8.991   35.554  1.00 34.04 ? 89  LYS C CA  1 
ATOM   4024 C  C   . LYS C 1 89  ? 101.224 8.881   34.379  1.00 34.32 ? 89  LYS C C   1 
ATOM   4025 O  O   . LYS C 1 89  ? 100.875 8.348   33.327  1.00 34.87 ? 89  LYS C O   1 
ATOM   4026 C  CB  . LYS C 1 89  ? 100.197 7.650   36.288  1.00 34.52 ? 89  LYS C CB  1 
ATOM   4027 C  CG  . LYS C 1 89  ? 101.512 7.172   36.879  1.00 39.29 ? 89  LYS C CG  1 
ATOM   4028 C  CD  . LYS C 1 89  ? 101.324 5.780   37.466  1.00 41.93 ? 89  LYS C CD  1 
ATOM   4029 C  CE  . LYS C 1 89  ? 102.603 5.222   38.060  1.00 46.13 ? 89  LYS C CE  1 
ATOM   4030 N  NZ  . LYS C 1 89  ? 102.390 3.826   38.548  1.00 47.38 ? 89  LYS C NZ  1 
ATOM   4031 N  N   . LYS C 1 90  ? 102.435 9.394   34.562  1.00 36.41 ? 90  LYS C N   1 
ATOM   4032 C  CA  . LYS C 1 90  ? 103.460 9.336   33.521  1.00 38.84 ? 90  LYS C CA  1 
ATOM   4033 C  C   . LYS C 1 90  ? 104.253 8.038   33.644  1.00 40.92 ? 90  LYS C C   1 
ATOM   4034 O  O   . LYS C 1 90  ? 104.330 7.446   34.723  1.00 40.92 ? 90  LYS C O   1 
ATOM   4035 C  CB  . LYS C 1 90  ? 104.431 10.514  33.659  1.00 38.03 ? 90  LYS C CB  1 
ATOM   4036 C  CG  . LYS C 1 90  ? 103.829 11.877  33.385  1.00 38.48 ? 90  LYS C CG  1 
ATOM   4037 C  CD  . LYS C 1 90  ? 104.771 12.994  33.821  1.00 38.86 ? 90  LYS C CD  1 
ATOM   4038 C  CE  . LYS C 1 90  ? 106.121 12.919  33.121  1.00 38.68 ? 90  LYS C CE  1 
ATOM   4039 N  NZ  . LYS C 1 90  ? 106.959 14.113  33.439  1.00 37.76 ? 90  LYS C NZ  1 
ATOM   4040 N  N   . GLY C 1 91  ? 104.831 7.595   32.533  1.00 42.81 ? 91  GLY C N   1 
ATOM   4041 C  CA  . GLY C 1 91  ? 105.647 6.395   32.556  1.00 44.56 ? 91  GLY C CA  1 
ATOM   4042 C  C   . GLY C 1 91  ? 104.986 5.035   32.438  1.00 44.75 ? 91  GLY C C   1 
ATOM   4043 O  O   . GLY C 1 91  ? 105.658 4.023   32.634  1.00 45.99 ? 91  GLY C O   1 
ATOM   4044 N  N   . THR C 1 92  ? 103.693 4.977   32.132  1.00 44.22 ? 92  THR C N   1 
ATOM   4045 C  CA  . THR C 1 92  ? 103.040 3.677   31.992  1.00 43.88 ? 92  THR C CA  1 
ATOM   4046 C  C   . THR C 1 92  ? 103.000 3.294   30.520  1.00 44.77 ? 92  THR C C   1 
ATOM   4047 O  O   . THR C 1 92  ? 103.198 4.137   29.649  1.00 44.81 ? 92  THR C O   1 
ATOM   4048 C  CB  . THR C 1 92  ? 101.593 3.678   32.540  1.00 42.85 ? 92  THR C CB  1 
ATOM   4049 O  OG1 . THR C 1 92  ? 100.754 4.474   31.696  1.00 40.19 ? 92  THR C OG1 1 
ATOM   4050 C  CG2 . THR C 1 92  ? 101.562 4.227   33.955  1.00 42.09 ? 92  THR C CG2 1 
ATOM   4051 N  N   . THR C 1 93  ? 102.749 2.019   30.244  1.00 46.24 ? 93  THR C N   1 
ATOM   4052 C  CA  . THR C 1 93  ? 102.688 1.546   28.867  1.00 47.67 ? 93  THR C CA  1 
ATOM   4053 C  C   . THR C 1 93  ? 101.531 0.571   28.688  1.00 47.33 ? 93  THR C C   1 
ATOM   4054 O  O   . THR C 1 93  ? 101.274 -0.267  29.553  1.00 47.36 ? 93  THR C O   1 
ATOM   4055 C  CB  . THR C 1 93  ? 104.010 0.846   28.458  1.00 49.75 ? 93  THR C CB  1 
ATOM   4056 O  OG1 . THR C 1 93  ? 104.194 -0.337  29.245  1.00 52.61 ? 93  THR C OG1 1 
ATOM   4057 C  CG2 . THR C 1 93  ? 105.199 1.773   28.687  1.00 49.89 ? 93  THR C CG2 1 
ATOM   4058 N  N   . LEU C 1 94  ? 100.828 0.695   27.568  1.00 47.39 ? 94  LEU C N   1 
ATOM   4059 C  CA  . LEU C 1 94  ? 99.698  -0.178  27.273  1.00 48.41 ? 94  LEU C CA  1 
ATOM   4060 C  C   . LEU C 1 94  ? 100.215 -1.579  26.962  1.00 49.85 ? 94  LEU C C   1 
ATOM   4061 O  O   . LEU C 1 94  ? 101.120 -1.745  26.145  1.00 49.36 ? 94  LEU C O   1 
ATOM   4062 C  CB  . LEU C 1 94  ? 98.911  0.370   26.080  1.00 47.23 ? 94  LEU C CB  1 
ATOM   4063 C  CG  . LEU C 1 94  ? 97.733  -0.459  25.566  1.00 46.12 ? 94  LEU C CG  1 
ATOM   4064 C  CD1 . LEU C 1 94  ? 96.713  -0.668  26.670  1.00 45.67 ? 94  LEU C CD1 1 
ATOM   4065 C  CD2 . LEU C 1 94  ? 97.099  0.256   24.383  1.00 46.39 ? 94  LEU C CD2 1 
ATOM   4066 N  N   . GLN C 1 95  ? 99.638  -2.584  27.612  1.00 51.63 ? 95  GLN C N   1 
ATOM   4067 C  CA  . GLN C 1 95  ? 100.071 -3.964  27.410  1.00 53.21 ? 95  GLN C CA  1 
ATOM   4068 C  C   . GLN C 1 95  ? 99.067  -4.968  27.968  1.00 52.59 ? 95  GLN C C   1 
ATOM   4069 O  O   . GLN C 1 95  ? 97.947  -4.613  28.336  1.00 52.97 ? 95  GLN C O   1 
ATOM   4070 C  CB  . GLN C 1 95  ? 101.420 -4.176  28.097  1.00 54.99 ? 95  GLN C CB  1 
ATOM   4071 C  CG  . GLN C 1 95  ? 101.380 -3.875  29.592  1.00 58.45 ? 95  GLN C CG  1 
ATOM   4072 C  CD  . GLN C 1 95  ? 102.735 -3.994  30.264  1.00 60.81 ? 95  GLN C CD  1 
ATOM   4073 O  OE1 . GLN C 1 95  ? 103.347 -5.064  30.276  1.00 62.60 ? 95  GLN C OE1 1 
ATOM   4074 N  NE2 . GLN C 1 95  ? 103.212 -2.891  30.831  1.00 61.24 ? 95  GLN C NE2 1 
ATOM   4075 N  N   . GLY C 1 96  ? 99.481  -6.228  28.022  1.00 52.36 ? 96  GLY C N   1 
ATOM   4076 C  CA  . GLY C 1 96  ? 98.628  -7.273  28.558  1.00 50.72 ? 96  GLY C CA  1 
ATOM   4077 C  C   . GLY C 1 96  ? 97.298  -7.483  27.862  1.00 50.67 ? 96  GLY C C   1 
ATOM   4078 O  O   . GLY C 1 96  ? 97.148  -7.213  26.669  1.00 50.15 ? 96  GLY C O   1 
ATOM   4079 N  N   . ASP C 1 97  ? 96.328  -7.969  28.630  1.00 49.76 ? 97  ASP C N   1 
ATOM   4080 C  CA  . ASP C 1 97  ? 94.991  -8.253  28.129  1.00 49.68 ? 97  ASP C CA  1 
ATOM   4081 C  C   . ASP C 1 97  ? 94.245  -7.021  27.633  1.00 48.55 ? 97  ASP C C   1 
ATOM   4082 O  O   . ASP C 1 97  ? 93.419  -7.116  26.725  1.00 47.97 ? 97  ASP C O   1 
ATOM   4083 C  CB  . ASP C 1 97  ? 94.174  -8.943  29.221  1.00 51.82 ? 97  ASP C CB  1 
ATOM   4084 C  CG  . ASP C 1 97  ? 94.861  -10.182 29.759  1.00 54.71 ? 97  ASP C CG  1 
ATOM   4085 O  OD1 . ASP C 1 97  ? 95.115  -11.111 28.963  1.00 55.06 ? 97  ASP C OD1 1 
ATOM   4086 O  OD2 . ASP C 1 97  ? 95.153  -10.226 30.973  1.00 55.71 ? 97  ASP C OD2 1 
ATOM   4087 N  N   . LEU C 1 98  ? 94.523  -5.868  28.233  1.00 47.44 ? 98  LEU C N   1 
ATOM   4088 C  CA  . LEU C 1 98  ? 93.862  -4.639  27.817  1.00 46.53 ? 98  LEU C CA  1 
ATOM   4089 C  C   . LEU C 1 98  ? 94.231  -4.309  26.375  1.00 46.38 ? 98  LEU C C   1 
ATOM   4090 O  O   . LEU C 1 98  ? 93.357  -4.048  25.546  1.00 45.41 ? 98  LEU C O   1 
ATOM   4091 C  CB  . LEU C 1 98  ? 94.263  -3.479  28.733  1.00 45.11 ? 98  LEU C CB  1 
ATOM   4092 C  CG  . LEU C 1 98  ? 93.603  -2.133  28.411  1.00 44.94 ? 98  LEU C CG  1 
ATOM   4093 C  CD1 . LEU C 1 98  ? 92.084  -2.277  28.442  1.00 43.39 ? 98  LEU C CD1 1 
ATOM   4094 C  CD2 . LEU C 1 98  ? 94.072  -1.087  29.409  1.00 43.19 ? 98  LEU C CD2 1 
ATOM   4095 N  N   . LYS C 1 99  ? 95.528  -4.324  26.079  1.00 46.50 ? 99  LYS C N   1 
ATOM   4096 C  CA  . LYS C 1 99  ? 95.990  -4.022  24.731  1.00 46.94 ? 99  LYS C CA  1 
ATOM   4097 C  C   . LYS C 1 99  ? 95.388  -4.996  23.728  1.00 46.82 ? 99  LYS C C   1 
ATOM   4098 O  O   . LYS C 1 99  ? 94.973  -4.600  22.639  1.00 46.65 ? 99  LYS C O   1 
ATOM   4099 C  CB  . LYS C 1 99  ? 97.513  -4.082  24.653  1.00 48.12 ? 99  LYS C CB  1 
ATOM   4100 C  CG  . LYS C 1 99  ? 98.048  -3.752  23.271  1.00 51.39 ? 99  LYS C CG  1 
ATOM   4101 C  CD  . LYS C 1 99  ? 99.565  -3.727  23.243  1.00 53.90 ? 99  LYS C CD  1 
ATOM   4102 C  CE  . LYS C 1 99  ? 100.080 -3.445  21.838  1.00 55.75 ? 99  LYS C CE  1 
ATOM   4103 N  NZ  . LYS C 1 99  ? 101.569 -3.409  21.785  1.00 57.58 ? 99  LYS C NZ  1 
ATOM   4104 N  N   . ALA C 1 100 ? 95.336  -6.270  24.103  1.00 46.47 ? 100 ALA C N   1 
ATOM   4105 C  CA  . ALA C 1 100 ? 94.778  -7.299  23.235  1.00 46.26 ? 100 ALA C CA  1 
ATOM   4106 C  C   . ALA C 1 100 ? 93.308  -7.017  22.940  1.00 45.82 ? 100 ALA C C   1 
ATOM   4107 O  O   . ALA C 1 100 ? 92.864  -7.127  21.798  1.00 45.24 ? 100 ALA C O   1 
ATOM   4108 C  CB  . ALA C 1 100 ? 94.927  -8.667  23.889  1.00 47.21 ? 100 ALA C CB  1 
ATOM   4109 N  N   . ALA C 1 101 ? 92.556  -6.654  23.976  1.00 45.06 ? 101 ALA C N   1 
ATOM   4110 C  CA  . ALA C 1 101 ? 91.136  -6.358  23.817  1.00 44.46 ? 101 ALA C CA  1 
ATOM   4111 C  C   . ALA C 1 101 ? 90.935  -5.140  22.918  1.00 44.36 ? 101 ALA C C   1 
ATOM   4112 O  O   . ALA C 1 101 ? 90.009  -5.104  22.106  1.00 43.68 ? 101 ALA C O   1 
ATOM   4113 C  CB  . ALA C 1 101 ? 90.497  -6.118  25.178  1.00 44.28 ? 101 ALA C CB  1 
ATOM   4114 N  N   . ILE C 1 102 ? 91.803  -4.143  23.068  1.00 44.60 ? 102 ILE C N   1 
ATOM   4115 C  CA  . ILE C 1 102 ? 91.719  -2.932  22.259  1.00 45.27 ? 102 ILE C CA  1 
ATOM   4116 C  C   . ILE C 1 102 ? 91.896  -3.285  20.784  1.00 46.79 ? 102 ILE C C   1 
ATOM   4117 O  O   . ILE C 1 102 ? 91.063  -2.940  19.942  1.00 46.00 ? 102 ILE C O   1 
ATOM   4118 C  CB  . ILE C 1 102 ? 92.821  -1.914  22.646  1.00 44.82 ? 102 ILE C CB  1 
ATOM   4119 C  CG1 . ILE C 1 102 ? 92.591  -1.386  24.064  1.00 43.89 ? 102 ILE C CG1 1 
ATOM   4120 C  CG2 . ILE C 1 102 ? 92.836  -0.761  21.652  1.00 43.87 ? 102 ILE C CG2 1 
ATOM   4121 C  CD1 . ILE C 1 102 ? 91.330  -0.578  24.217  1.00 44.79 ? 102 ILE C CD1 1 
ATOM   4122 N  N   . GLU C 1 103 ? 92.991  -3.974  20.478  1.00 47.82 ? 103 GLU C N   1 
ATOM   4123 C  CA  . GLU C 1 103 ? 93.280  -4.366  19.105  1.00 49.67 ? 103 GLU C CA  1 
ATOM   4124 C  C   . GLU C 1 103 ? 92.162  -5.238  18.550  1.00 49.47 ? 103 GLU C C   1 
ATOM   4125 O  O   . GLU C 1 103 ? 91.844  -5.178  17.366  1.00 50.09 ? 103 GLU C O   1 
ATOM   4126 C  CB  . GLU C 1 103 ? 94.614  -5.113  19.042  1.00 50.70 ? 103 GLU C CB  1 
ATOM   4127 C  CG  . GLU C 1 103 ? 95.775  -4.323  19.621  1.00 53.09 ? 103 GLU C CG  1 
ATOM   4128 C  CD  . GLU C 1 103 ? 97.087  -5.077  19.568  1.00 55.00 ? 103 GLU C CD  1 
ATOM   4129 O  OE1 . GLU C 1 103 ? 97.127  -6.240  20.024  1.00 55.71 ? 103 GLU C OE1 1 
ATOM   4130 O  OE2 . GLU C 1 103 ? 98.083  -4.502  19.078  1.00 56.37 ? 103 GLU C OE2 1 
ATOM   4131 N  N   . ARG C 1 104 ? 91.556  -6.037  19.419  1.00 50.45 ? 104 ARG C N   1 
ATOM   4132 C  CA  . ARG C 1 104 ? 90.472  -6.921  19.017  1.00 51.52 ? 104 ARG C CA  1 
ATOM   4133 C  C   . ARG C 1 104 ? 89.207  -6.160  18.625  1.00 51.54 ? 104 ARG C C   1 
ATOM   4134 O  O   . ARG C 1 104 ? 88.626  -6.409  17.570  1.00 51.63 ? 104 ARG C O   1 
ATOM   4135 C  CB  . ARG C 1 104 ? 90.138  -7.889  20.152  1.00 52.89 ? 104 ARG C CB  1 
ATOM   4136 C  CG  . ARG C 1 104 ? 88.993  -8.841  19.845  1.00 55.15 ? 104 ARG C CG  1 
ATOM   4137 C  CD  . ARG C 1 104 ? 88.507  -9.520  21.114  1.00 57.43 ? 104 ARG C CD  1 
ATOM   4138 N  NE  . ARG C 1 104 ? 87.912  -8.554  22.031  1.00 59.76 ? 104 ARG C NE  1 
ATOM   4139 C  CZ  . ARG C 1 104 ? 87.616  -8.806  23.301  1.00 60.50 ? 104 ARG C CZ  1 
ATOM   4140 N  NH1 . ARG C 1 104 ? 87.862  -10.002 23.819  1.00 60.35 ? 104 ARG C NH1 1 
ATOM   4141 N  NH2 . ARG C 1 104 ? 87.074  -7.857  24.054  1.00 60.67 ? 104 ARG C NH2 1 
ATOM   4142 N  N   . ASP C 1 105 ? 88.782  -5.232  19.477  1.00 51.24 ? 105 ASP C N   1 
ATOM   4143 C  CA  . ASP C 1 105 ? 87.567  -4.465  19.217  1.00 50.86 ? 105 ASP C CA  1 
ATOM   4144 C  C   . ASP C 1 105 ? 87.741  -3.234  18.332  1.00 49.88 ? 105 ASP C C   1 
ATOM   4145 O  O   . ASP C 1 105 ? 86.769  -2.737  17.767  1.00 50.17 ? 105 ASP C O   1 
ATOM   4146 C  CB  . ASP C 1 105 ? 86.916  -4.044  20.538  1.00 51.85 ? 105 ASP C CB  1 
ATOM   4147 C  CG  . ASP C 1 105 ? 86.481  -5.229  21.378  1.00 52.95 ? 105 ASP C CG  1 
ATOM   4148 O  OD1 . ASP C 1 105 ? 85.773  -6.108  20.843  1.00 54.15 ? 105 ASP C OD1 1 
ATOM   4149 O  OD2 . ASP C 1 105 ? 86.841  -5.279  22.573  1.00 52.95 ? 105 ASP C OD2 1 
ATOM   4150 N  N   . PHE C 1 106 ? 88.969  -2.741  18.208  1.00 48.76 ? 106 PHE C N   1 
ATOM   4151 C  CA  . PHE C 1 106 ? 89.225  -1.555  17.395  1.00 48.80 ? 106 PHE C CA  1 
ATOM   4152 C  C   . PHE C 1 106 ? 90.150  -1.816  16.211  1.00 49.18 ? 106 PHE C C   1 
ATOM   4153 O  O   . PHE C 1 106 ? 90.394  -0.923  15.402  1.00 49.05 ? 106 PHE C O   1 
ATOM   4154 C  CB  . PHE C 1 106 ? 89.818  -0.444  18.269  1.00 47.41 ? 106 PHE C CB  1 
ATOM   4155 C  CG  . PHE C 1 106 ? 88.863  0.090   19.300  1.00 46.64 ? 106 PHE C CG  1 
ATOM   4156 C  CD1 . PHE C 1 106 ? 87.789  0.890   18.924  1.00 45.76 ? 106 PHE C CD1 1 
ATOM   4157 C  CD2 . PHE C 1 106 ? 89.023  -0.226  20.645  1.00 45.65 ? 106 PHE C CD2 1 
ATOM   4158 C  CE1 . PHE C 1 106 ? 86.888  1.367   19.871  1.00 44.91 ? 106 PHE C CE1 1 
ATOM   4159 C  CE2 . PHE C 1 106 ? 88.126  0.246   21.601  1.00 45.57 ? 106 PHE C CE2 1 
ATOM   4160 C  CZ  . PHE C 1 106 ? 87.057  1.044   21.211  1.00 44.80 ? 106 PHE C CZ  1 
ATOM   4161 N  N   . GLY C 1 107 ? 90.661  -3.039  16.110  1.00 49.57 ? 107 GLY C N   1 
ATOM   4162 C  CA  . GLY C 1 107 ? 91.554  -3.373  15.014  1.00 49.68 ? 107 GLY C CA  1 
ATOM   4163 C  C   . GLY C 1 107 ? 93.005  -3.106  15.362  1.00 49.69 ? 107 GLY C C   1 
ATOM   4164 O  O   . GLY C 1 107 ? 93.884  -3.910  15.054  1.00 50.82 ? 107 GLY C O   1 
ATOM   4165 N  N   . SER C 1 108 ? 93.260  -1.972  16.004  1.00 48.95 ? 108 SER C N   1 
ATOM   4166 C  CA  . SER C 1 108 ? 94.612  -1.604  16.402  1.00 48.66 ? 108 SER C CA  1 
ATOM   4167 C  C   . SER C 1 108 ? 94.556  -0.486  17.431  1.00 48.40 ? 108 SER C C   1 
ATOM   4168 O  O   . SER C 1 108 ? 93.518  0.151   17.608  1.00 48.31 ? 108 SER C O   1 
ATOM   4169 C  CB  . SER C 1 108 ? 95.418  -1.141  15.187  1.00 48.63 ? 108 SER C CB  1 
ATOM   4170 O  OG  . SER C 1 108 ? 94.810  -0.019  14.569  1.00 49.35 ? 108 SER C OG  1 
ATOM   4171 N  N   . VAL C 1 109 ? 95.675  -0.251  18.106  1.00 47.92 ? 109 VAL C N   1 
ATOM   4172 C  CA  . VAL C 1 109 ? 95.744  0.799   19.108  1.00 48.43 ? 109 VAL C CA  1 
ATOM   4173 C  C   . VAL C 1 109 ? 95.546  2.164   18.451  1.00 48.73 ? 109 VAL C C   1 
ATOM   4174 O  O   . VAL C 1 109 ? 94.894  3.044   19.014  1.00 48.93 ? 109 VAL C O   1 
ATOM   4175 C  CB  . VAL C 1 109 ? 97.099  0.776   19.842  1.00 48.62 ? 109 VAL C CB  1 
ATOM   4176 C  CG1 . VAL C 1 109 ? 97.157  1.895   20.868  1.00 48.02 ? 109 VAL C CG1 1 
ATOM   4177 C  CG2 . VAL C 1 109 ? 97.294  -0.568  20.520  1.00 47.62 ? 109 VAL C CG2 1 
ATOM   4178 N  N   . ASP C 1 110 ? 96.102  2.333   17.256  1.00 48.54 ? 110 ASP C N   1 
ATOM   4179 C  CA  . ASP C 1 110 ? 95.979  3.595   16.536  1.00 48.95 ? 110 ASP C CA  1 
ATOM   4180 C  C   . ASP C 1 110 ? 94.534  3.894   16.164  1.00 47.21 ? 110 ASP C C   1 
ATOM   4181 O  O   . ASP C 1 110 ? 94.102  5.045   16.217  1.00 46.55 ? 110 ASP C O   1 
ATOM   4182 C  CB  . ASP C 1 110 ? 96.847  3.567   15.280  1.00 52.19 ? 110 ASP C CB  1 
ATOM   4183 C  CG  . ASP C 1 110 ? 98.325  3.488   15.601  1.00 55.77 ? 110 ASP C CG  1 
ATOM   4184 O  OD1 . ASP C 1 110 ? 98.864  4.460   16.174  1.00 57.48 ? 110 ASP C OD1 1 
ATOM   4185 O  OD2 . ASP C 1 110 ? 98.946  2.449   15.288  1.00 58.63 ? 110 ASP C OD2 1 
ATOM   4186 N  N   . ASN C 1 111 ? 93.789  2.863   15.779  1.00 46.00 ? 111 ASN C N   1 
ATOM   4187 C  CA  . ASN C 1 111 ? 92.388  3.043   15.423  1.00 45.59 ? 111 ASN C CA  1 
ATOM   4188 C  C   . ASN C 1 111 ? 91.621  3.478   16.665  1.00 44.23 ? 111 ASN C C   1 
ATOM   4189 O  O   . ASN C 1 111 ? 90.743  4.338   16.596  1.00 42.43 ? 111 ASN C O   1 
ATOM   4190 C  CB  . ASN C 1 111 ? 91.796  1.739   14.889  1.00 48.27 ? 111 ASN C CB  1 
ATOM   4191 C  CG  . ASN C 1 111 ? 92.262  1.420   13.484  1.00 52.82 ? 111 ASN C CG  1 
ATOM   4192 O  OD1 . ASN C 1 111 ? 91.964  0.351   12.947  1.00 55.29 ? 111 ASN C OD1 1 
ATOM   4193 N  ND2 . ASN C 1 111 ? 92.991  2.350   12.874  1.00 53.21 ? 111 ASN C ND2 1 
ATOM   4194 N  N   . PHE C 1 112 ? 91.957  2.871   17.801  1.00 42.53 ? 112 PHE C N   1 
ATOM   4195 C  CA  . PHE C 1 112 ? 91.305  3.211   19.058  1.00 40.56 ? 112 PHE C CA  1 
ATOM   4196 C  C   . PHE C 1 112 ? 91.541  4.679   19.381  1.00 38.58 ? 112 PHE C C   1 
ATOM   4197 O  O   . PHE C 1 112 ? 90.598  5.418   19.647  1.00 37.41 ? 112 PHE C O   1 
ATOM   4198 C  CB  . PHE C 1 112 ? 91.842  2.360   20.212  1.00 39.94 ? 112 PHE C CB  1 
ATOM   4199 C  CG  . PHE C 1 112 ? 91.584  2.961   21.567  1.00 38.49 ? 112 PHE C CG  1 
ATOM   4200 C  CD1 . PHE C 1 112 ? 90.283  3.155   22.019  1.00 36.82 ? 112 PHE C CD1 1 
ATOM   4201 C  CD2 . PHE C 1 112 ? 92.641  3.389   22.365  1.00 38.17 ? 112 PHE C CD2 1 
ATOM   4202 C  CE1 . PHE C 1 112 ? 90.037  3.771   23.245  1.00 36.14 ? 112 PHE C CE1 1 
ATOM   4203 C  CE2 . PHE C 1 112 ? 92.406  4.006   23.593  1.00 37.32 ? 112 PHE C CE2 1 
ATOM   4204 C  CZ  . PHE C 1 112 ? 91.101  4.198   24.033  1.00 35.92 ? 112 PHE C CZ  1 
ATOM   4205 N  N   . LYS C 1 113 ? 92.806  5.091   19.363  1.00 37.88 ? 113 LYS C N   1 
ATOM   4206 C  CA  . LYS C 1 113 ? 93.152  6.476   19.660  1.00 37.95 ? 113 LYS C CA  1 
ATOM   4207 C  C   . LYS C 1 113 ? 92.396  7.442   18.759  1.00 37.35 ? 113 LYS C C   1 
ATOM   4208 O  O   . LYS C 1 113 ? 91.926  8.483   19.213  1.00 36.65 ? 113 LYS C O   1 
ATOM   4209 C  CB  . LYS C 1 113 ? 94.657  6.705   19.504  1.00 38.51 ? 113 LYS C CB  1 
ATOM   4210 C  CG  . LYS C 1 113 ? 95.497  6.086   20.603  1.00 39.37 ? 113 LYS C CG  1 
ATOM   4211 C  CD  . LYS C 1 113 ? 96.953  6.497   20.470  1.00 41.26 ? 113 LYS C CD  1 
ATOM   4212 C  CE  . LYS C 1 113 ? 97.791  5.919   21.596  1.00 43.50 ? 113 LYS C CE  1 
ATOM   4213 N  NZ  . LYS C 1 113 ? 99.233  6.282   21.458  1.00 45.40 ? 113 LYS C NZ  1 
ATOM   4214 N  N   . ALA C 1 114 ? 92.278  7.091   17.482  1.00 36.04 ? 114 ALA C N   1 
ATOM   4215 C  CA  . ALA C 1 114 ? 91.577  7.934   16.521  1.00 35.24 ? 114 ALA C CA  1 
ATOM   4216 C  C   . ALA C 1 114 ? 90.106  8.069   16.897  1.00 34.61 ? 114 ALA C C   1 
ATOM   4217 O  O   . ALA C 1 114 ? 89.538  9.159   16.838  1.00 34.70 ? 114 ALA C O   1 
ATOM   4218 C  CB  . ALA C 1 114 ? 91.708  7.349   15.121  1.00 36.42 ? 114 ALA C CB  1 
ATOM   4219 N  N   . GLU C 1 115 ? 89.491  6.956   17.280  1.00 33.26 ? 115 GLU C N   1 
ATOM   4220 C  CA  . GLU C 1 115 ? 88.088  6.958   17.674  1.00 33.46 ? 115 GLU C CA  1 
ATOM   4221 C  C   . GLU C 1 115 ? 87.873  7.762   18.947  1.00 30.56 ? 115 GLU C C   1 
ATOM   4222 O  O   . GLU C 1 115 ? 86.901  8.507   19.062  1.00 29.66 ? 115 GLU C O   1 
ATOM   4223 C  CB  . GLU C 1 115 ? 87.596  5.527   17.899  1.00 38.58 ? 115 GLU C CB  1 
ATOM   4224 C  CG  . GLU C 1 115 ? 87.374  4.750   16.625  1.00 45.45 ? 115 GLU C CG  1 
ATOM   4225 C  CD  . GLU C 1 115 ? 86.355  5.423   15.735  1.00 49.63 ? 115 GLU C CD  1 
ATOM   4226 O  OE1 . GLU C 1 115 ? 85.222  5.655   16.215  1.00 51.65 ? 115 GLU C OE1 1 
ATOM   4227 O  OE2 . GLU C 1 115 ? 86.686  5.721   14.566  1.00 51.51 ? 115 GLU C OE2 1 
ATOM   4228 N  N   . PHE C 1 116 ? 88.780  7.600   19.906  1.00 27.71 ? 116 PHE C N   1 
ATOM   4229 C  CA  . PHE C 1 116 ? 88.675  8.319   21.170  1.00 27.78 ? 116 PHE C CA  1 
ATOM   4230 C  C   . PHE C 1 116 ? 88.822  9.822   20.945  1.00 27.21 ? 116 PHE C C   1 
ATOM   4231 O  O   . PHE C 1 116 ? 88.046  10.617  21.469  1.00 27.54 ? 116 PHE C O   1 
ATOM   4232 C  CB  . PHE C 1 116 ? 89.757  7.860   22.146  1.00 27.45 ? 116 PHE C CB  1 
ATOM   4233 C  CG  . PHE C 1 116 ? 89.566  8.379   23.545  1.00 26.75 ? 116 PHE C CG  1 
ATOM   4234 C  CD1 . PHE C 1 116 ? 88.696  7.740   24.425  1.00 26.65 ? 116 PHE C CD1 1 
ATOM   4235 C  CD2 . PHE C 1 116 ? 90.236  9.519   23.976  1.00 25.98 ? 116 PHE C CD2 1 
ATOM   4236 C  CE1 . PHE C 1 116 ? 88.498  8.229   25.716  1.00 26.05 ? 116 PHE C CE1 1 
ATOM   4237 C  CE2 . PHE C 1 116 ? 90.044  10.016  25.263  1.00 25.33 ? 116 PHE C CE2 1 
ATOM   4238 C  CZ  . PHE C 1 116 ? 89.175  9.368   26.133  1.00 25.22 ? 116 PHE C CZ  1 
ATOM   4239 N  N   . GLU C 1 117 ? 89.828  10.207  20.171  1.00 26.37 ? 117 GLU C N   1 
ATOM   4240 C  CA  . GLU C 1 117 ? 90.064  11.616  19.887  1.00 28.38 ? 117 GLU C CA  1 
ATOM   4241 C  C   . GLU C 1 117 ? 88.872  12.259  19.187  1.00 28.66 ? 117 GLU C C   1 
ATOM   4242 O  O   . GLU C 1 117 ? 88.526  13.410  19.460  1.00 27.15 ? 117 GLU C O   1 
ATOM   4243 C  CB  . GLU C 1 117 ? 91.322  11.767  19.030  1.00 30.20 ? 117 GLU C CB  1 
ATOM   4244 C  CG  . GLU C 1 117 ? 92.599  11.445  19.781  1.00 34.29 ? 117 GLU C CG  1 
ATOM   4245 C  CD  . GLU C 1 117 ? 93.842  11.734  18.967  1.00 38.47 ? 117 GLU C CD  1 
ATOM   4246 O  OE1 . GLU C 1 117 ? 93.905  12.813  18.342  1.00 41.83 ? 117 GLU C OE1 1 
ATOM   4247 O  OE2 . GLU C 1 117 ? 94.759  10.891  18.964  1.00 38.65 ? 117 GLU C OE2 1 
ATOM   4248 N  N   . LYS C 1 118 ? 88.247  11.511  18.286  1.00 28.51 ? 118 LYS C N   1 
ATOM   4249 C  CA  . LYS C 1 118 ? 87.096  12.014  17.555  1.00 31.04 ? 118 LYS C CA  1 
ATOM   4250 C  C   . LYS C 1 118 ? 85.932  12.259  18.510  1.00 29.08 ? 118 LYS C C   1 
ATOM   4251 O  O   . LYS C 1 118 ? 85.248  13.281  18.418  1.00 28.78 ? 118 LYS C O   1 
ATOM   4252 C  CB  . LYS C 1 118 ? 86.700  11.018  16.459  1.00 34.53 ? 118 LYS C CB  1 
ATOM   4253 C  CG  . LYS C 1 118 ? 85.579  11.495  15.553  1.00 40.64 ? 118 LYS C CG  1 
ATOM   4254 C  CD  . LYS C 1 118 ? 85.576  10.736  14.230  1.00 45.99 ? 118 LYS C CD  1 
ATOM   4255 C  CE  . LYS C 1 118 ? 85.432  9.235   14.441  1.00 49.23 ? 118 LYS C CE  1 
ATOM   4256 N  NZ  . LYS C 1 118 ? 85.458  8.487   13.151  1.00 52.83 ? 118 LYS C NZ  1 
ATOM   4257 N  N   . ALA C 1 119 ? 85.715  11.326  19.432  1.00 28.10 ? 119 ALA C N   1 
ATOM   4258 C  CA  . ALA C 1 119 ? 84.632  11.464  20.399  1.00 27.15 ? 119 ALA C CA  1 
ATOM   4259 C  C   . ALA C 1 119 ? 84.902  12.630  21.346  1.00 25.06 ? 119 ALA C C   1 
ATOM   4260 O  O   . ALA C 1 119 ? 84.002  13.402  21.661  1.00 25.67 ? 119 ALA C O   1 
ATOM   4261 C  CB  . ALA C 1 119 ? 84.473  10.176  21.189  1.00 26.85 ? 119 ALA C CB  1 
ATOM   4262 N  N   . ALA C 1 120 ? 86.148  12.758  21.794  1.00 24.78 ? 120 ALA C N   1 
ATOM   4263 C  CA  . ALA C 1 120 ? 86.521  13.831  22.711  1.00 23.98 ? 120 ALA C CA  1 
ATOM   4264 C  C   . ALA C 1 120 ? 86.433  15.204  22.057  1.00 24.19 ? 120 ALA C C   1 
ATOM   4265 O  O   . ALA C 1 120 ? 86.000  16.171  22.679  1.00 24.30 ? 120 ALA C O   1 
ATOM   4266 C  CB  . ALA C 1 120 ? 87.933  13.601  23.243  1.00 23.84 ? 120 ALA C CB  1 
ATOM   4267 N  N   . ALA C 1 121 ? 86.833  15.286  20.794  1.00 23.82 ? 121 ALA C N   1 
ATOM   4268 C  CA  . ALA C 1 121 ? 86.806  16.551  20.082  1.00 25.67 ? 121 ALA C CA  1 
ATOM   4269 C  C   . ALA C 1 121 ? 85.415  16.969  19.600  1.00 26.92 ? 121 ALA C C   1 
ATOM   4270 O  O   . ALA C 1 121 ? 85.131  18.163  19.499  1.00 26.21 ? 121 ALA C O   1 
ATOM   4271 C  CB  . ALA C 1 121 ? 87.763  16.492  18.897  1.00 26.42 ? 121 ALA C CB  1 
ATOM   4272 N  N   A SER C 1 122 ? 84.552  15.996  19.317  0.50 26.25 ? 122 SER C N   1 
ATOM   4273 N  N   B SER C 1 122 ? 84.556  15.990  19.318  0.50 26.57 ? 122 SER C N   1 
ATOM   4274 C  CA  A SER C 1 122 ? 83.204  16.283  18.822  0.50 26.56 ? 122 SER C CA  1 
ATOM   4275 C  CA  B SER C 1 122 ? 83.203  16.253  18.822  0.50 27.15 ? 122 SER C CA  1 
ATOM   4276 C  C   A SER C 1 122 ? 82.169  16.600  19.901  0.50 26.86 ? 122 SER C C   1 
ATOM   4277 C  C   B SER C 1 122 ? 82.166  16.582  19.898  0.50 27.18 ? 122 SER C C   1 
ATOM   4278 O  O   A SER C 1 122 ? 81.086  17.100  19.593  0.50 26.65 ? 122 SER C O   1 
ATOM   4279 O  O   B SER C 1 122 ? 81.082  17.075  19.584  0.50 26.92 ? 122 SER C O   1 
ATOM   4280 C  CB  A SER C 1 122 ? 82.696  15.115  17.970  0.50 27.22 ? 122 SER C CB  1 
ATOM   4281 C  CB  B SER C 1 122 ? 82.698  15.057  18.003  0.50 28.31 ? 122 SER C CB  1 
ATOM   4282 O  OG  A SER C 1 122 ? 82.570  13.936  18.747  0.50 28.16 ? 122 SER C OG  1 
ATOM   4283 O  OG  B SER C 1 122 ? 83.567  14.757  16.925  0.50 30.69 ? 122 SER C OG  1 
ATOM   4284 N  N   . ARG C 1 123 ? 82.485  16.301  21.157  1.00 25.76 ? 123 ARG C N   1 
ATOM   4285 C  CA  . ARG C 1 123 ? 81.558  16.586  22.252  1.00 25.78 ? 123 ARG C CA  1 
ATOM   4286 C  C   . ARG C 1 123 ? 81.395  18.106  22.352  1.00 25.99 ? 123 ARG C C   1 
ATOM   4287 O  O   . ARG C 1 123 ? 82.306  18.816  22.785  1.00 26.05 ? 123 ARG C O   1 
ATOM   4288 C  CB  . ARG C 1 123 ? 82.089  15.996  23.570  1.00 26.31 ? 123 ARG C CB  1 
ATOM   4289 C  CG  . ARG C 1 123 ? 81.442  16.530  24.851  1.00 27.69 ? 123 ARG C CG  1 
ATOM   4290 C  CD  . ARG C 1 123 ? 79.909  16.471  24.846  1.00 26.99 ? 123 ARG C CD  1 
ATOM   4291 N  NE  . ARG C 1 123 ? 79.384  15.129  24.628  1.00 26.71 ? 123 ARG C NE  1 
ATOM   4292 C  CZ  . ARG C 1 123 ? 78.090  14.818  24.648  1.00 27.33 ? 123 ARG C CZ  1 
ATOM   4293 N  NH1 . ARG C 1 123 ? 77.177  15.754  24.881  1.00 27.22 ? 123 ARG C NH1 1 
ATOM   4294 N  NH2 . ARG C 1 123 ? 77.705  13.569  24.418  1.00 27.50 ? 123 ARG C NH2 1 
ATOM   4295 N  N   . PHE C 1 124 ? 80.235  18.599  21.928  1.00 24.49 ? 124 PHE C N   1 
ATOM   4296 C  CA  . PHE C 1 124 ? 79.949  20.030  21.948  1.00 23.50 ? 124 PHE C CA  1 
ATOM   4297 C  C   . PHE C 1 124 ? 79.505  20.458  23.345  1.00 22.85 ? 124 PHE C C   1 
ATOM   4298 O  O   . PHE C 1 124 ? 78.654  19.815  23.961  1.00 22.34 ? 124 PHE C O   1 
ATOM   4299 C  CB  . PHE C 1 124 ? 78.851  20.358  20.936  1.00 25.30 ? 124 PHE C CB  1 
ATOM   4300 C  CG  . PHE C 1 124 ? 78.697  21.825  20.667  1.00 26.03 ? 124 PHE C CG  1 
ATOM   4301 C  CD1 . PHE C 1 124 ? 79.647  22.507  19.913  1.00 29.03 ? 124 PHE C CD1 1 
ATOM   4302 C  CD2 . PHE C 1 124 ? 77.613  22.526  21.172  1.00 28.72 ? 124 PHE C CD2 1 
ATOM   4303 C  CE1 . PHE C 1 124 ? 79.518  23.872  19.666  1.00 31.47 ? 124 PHE C CE1 1 
ATOM   4304 C  CE2 . PHE C 1 124 ? 77.473  23.893  20.931  1.00 31.07 ? 124 PHE C CE2 1 
ATOM   4305 C  CZ  . PHE C 1 124 ? 78.429  24.565  20.176  1.00 31.73 ? 124 PHE C CZ  1 
ATOM   4306 N  N   . GLY C 1 125 ? 80.068  21.553  23.838  1.00 19.73 ? 125 GLY C N   1 
ATOM   4307 C  CA  . GLY C 1 125 ? 79.715  22.004  25.171  1.00 18.81 ? 125 GLY C CA  1 
ATOM   4308 C  C   . GLY C 1 125 ? 80.571  21.280  26.196  1.00 19.33 ? 125 GLY C C   1 
ATOM   4309 O  O   . GLY C 1 125 ? 81.660  20.799  25.871  1.00 20.68 ? 125 GLY C O   1 
ATOM   4310 N  N   . SER C 1 126 ? 80.085  21.185  27.429  1.00 16.07 ? 126 SER C N   1 
ATOM   4311 C  CA  . SER C 1 126 ? 80.835  20.520  28.483  1.00 16.21 ? 126 SER C CA  1 
ATOM   4312 C  C   . SER C 1 126 ? 80.546  19.023  28.453  1.00 17.23 ? 126 SER C C   1 
ATOM   4313 O  O   . SER C 1 126 ? 79.426  18.608  28.147  1.00 17.34 ? 126 SER C O   1 
ATOM   4314 C  CB  . SER C 1 126 ? 80.442  21.105  29.841  1.00 15.07 ? 126 SER C CB  1 
ATOM   4315 O  OG  . SER C 1 126 ? 80.519  22.526  29.819  1.00 18.37 ? 126 SER C OG  1 
ATOM   4316 N  N   . GLY C 1 127 ? 81.546  18.210  28.772  1.00 16.85 ? 127 GLY C N   1 
ATOM   4317 C  CA  . GLY C 1 127 ? 81.330  16.774  28.754  1.00 18.01 ? 127 GLY C CA  1 
ATOM   4318 C  C   . GLY C 1 127 ? 82.561  15.941  29.046  1.00 17.72 ? 127 GLY C C   1 
ATOM   4319 O  O   . GLY C 1 127 ? 83.613  16.470  29.417  1.00 17.58 ? 127 GLY C O   1 
ATOM   4320 N  N   A TRP C 1 128 ? 82.429  14.631  28.861  0.70 16.68 ? 128 TRP C N   1 
ATOM   4321 N  N   B TRP C 1 128 ? 82.427  14.630  28.856  0.30 18.13 ? 128 TRP C N   1 
ATOM   4322 C  CA  A TRP C 1 128 ? 83.519  13.693  29.097  0.70 17.28 ? 128 TRP C CA  1 
ATOM   4323 C  CA  B TRP C 1 128 ? 83.501  13.677  29.129  0.30 19.06 ? 128 TRP C CA  1 
ATOM   4324 C  C   A TRP C 1 128 ? 83.549  12.657  27.980  0.70 18.97 ? 128 TRP C C   1 
ATOM   4325 C  C   B TRP C 1 128 ? 83.541  12.607  28.032  0.30 19.79 ? 128 TRP C C   1 
ATOM   4326 O  O   A TRP C 1 128 ? 82.508  12.324  27.408  0.70 18.80 ? 128 TRP C O   1 
ATOM   4327 O  O   B TRP C 1 128 ? 82.496  12.201  27.522  0.30 19.67 ? 128 TRP C O   1 
ATOM   4328 C  CB  A TRP C 1 128 ? 83.326  12.963  30.435  0.70 17.22 ? 128 TRP C CB  1 
ATOM   4329 C  CB  B TRP C 1 128 ? 83.229  13.020  30.487  0.30 19.92 ? 128 TRP C CB  1 
ATOM   4330 C  CG  A TRP C 1 128 ? 83.546  13.806  31.660  0.70 17.06 ? 128 TRP C CG  1 
ATOM   4331 C  CG  B TRP C 1 128 ? 84.439  12.619  31.270  0.30 20.78 ? 128 TRP C CG  1 
ATOM   4332 C  CD1 A TRP C 1 128 ? 82.792  14.865  32.080  0.70 17.45 ? 128 TRP C CD1 1 
ATOM   4333 C  CD1 B TRP C 1 128 ? 85.312  11.609  30.982  0.30 21.63 ? 128 TRP C CD1 1 
ATOM   4334 C  CD2 A TRP C 1 128 ? 84.606  13.663  32.617  0.70 18.05 ? 128 TRP C CD2 1 
ATOM   4335 C  CD2 B TRP C 1 128 ? 84.896  13.208  32.494  0.30 21.68 ? 128 TRP C CD2 1 
ATOM   4336 N  NE1 A TRP C 1 128 ? 83.318  15.391  33.237  0.70 17.95 ? 128 TRP C NE1 1 
ATOM   4337 N  NE1 B TRP C 1 128 ? 86.282  11.531  31.954  0.30 22.07 ? 128 TRP C NE1 1 
ATOM   4338 C  CE2 A TRP C 1 128 ? 84.431  14.674  33.588  0.70 16.95 ? 128 TRP C CE2 1 
ATOM   4339 C  CE2 B TRP C 1 128 ? 86.051  12.501  32.893  0.30 21.07 ? 128 TRP C CE2 1 
ATOM   4340 C  CE3 A TRP C 1 128 ? 85.688  12.778  32.748  0.70 16.90 ? 128 TRP C CE3 1 
ATOM   4341 C  CE3 B TRP C 1 128 ? 84.439  14.266  33.293  0.30 21.11 ? 128 TRP C CE3 1 
ATOM   4342 C  CZ2 A TRP C 1 128 ? 85.300  14.828  34.676  0.70 18.49 ? 128 TRP C CZ2 1 
ATOM   4343 C  CZ2 B TRP C 1 128 ? 86.759  12.817  34.059  0.30 22.10 ? 128 TRP C CZ2 1 
ATOM   4344 C  CZ3 A TRP C 1 128 ? 86.551  12.931  33.829  0.70 18.19 ? 128 TRP C CZ3 1 
ATOM   4345 C  CZ3 B TRP C 1 128 ? 85.143  14.581  34.453  0.30 22.08 ? 128 TRP C CZ3 1 
ATOM   4346 C  CH2 A TRP C 1 128 ? 86.351  13.951  34.780  0.70 15.75 ? 128 TRP C CH2 1 
ATOM   4347 C  CH2 B TRP C 1 128 ? 86.291  13.857  34.823  0.30 21.14 ? 128 TRP C CH2 1 
ATOM   4348 N  N   . ALA C 1 129 ? 84.741  12.154  27.672  1.00 19.59 ? 129 ALA C N   1 
ATOM   4349 C  CA  . ALA C 1 129 ? 84.897  11.118  26.642  1.00 21.28 ? 129 ALA C CA  1 
ATOM   4350 C  C   . ALA C 1 129 ? 85.316  9.859   27.396  1.00 21.95 ? 129 ALA C C   1 
ATOM   4351 O  O   . ALA C 1 129 ? 86.153  9.930   28.301  1.00 21.12 ? 129 ALA C O   1 
ATOM   4352 C  CB  . ALA C 1 129 ? 85.978  11.502  25.636  1.00 22.61 ? 129 ALA C CB  1 
ATOM   4353 N  N   . TRP C 1 130 ? 84.763  8.711   27.016  1.00 20.66 ? 130 TRP C N   1 
ATOM   4354 C  CA  . TRP C 1 130 ? 85.068  7.468   27.722  1.00 22.22 ? 130 TRP C CA  1 
ATOM   4355 C  C   . TRP C 1 130 ? 85.398  6.245   26.884  1.00 24.23 ? 130 TRP C C   1 
ATOM   4356 O  O   . TRP C 1 130 ? 84.993  6.125   25.727  1.00 25.90 ? 130 TRP C O   1 
ATOM   4357 C  CB  . TRP C 1 130 ? 83.882  7.033   28.588  1.00 20.87 ? 130 TRP C CB  1 
ATOM   4358 C  CG  . TRP C 1 130 ? 83.245  8.075   29.409  1.00 19.98 ? 130 TRP C CG  1 
ATOM   4359 C  CD1 . TRP C 1 130 ? 82.247  8.925   29.032  1.00 20.50 ? 130 TRP C CD1 1 
ATOM   4360 C  CD2 . TRP C 1 130 ? 83.527  8.360   30.778  1.00 19.90 ? 130 TRP C CD2 1 
ATOM   4361 N  NE1 . TRP C 1 130 ? 81.884  9.725   30.091  1.00 20.84 ? 130 TRP C NE1 1 
ATOM   4362 C  CE2 . TRP C 1 130 ? 82.658  9.399   31.175  1.00 19.78 ? 130 TRP C CE2 1 
ATOM   4363 C  CE3 . TRP C 1 130 ? 84.433  7.836   31.712  1.00 21.41 ? 130 TRP C CE3 1 
ATOM   4364 C  CZ2 . TRP C 1 130 ? 82.665  9.928   32.470  1.00 21.28 ? 130 TRP C CZ2 1 
ATOM   4365 C  CZ3 . TRP C 1 130 ? 84.441  8.363   33.001  1.00 21.18 ? 130 TRP C CZ3 1 
ATOM   4366 C  CH2 . TRP C 1 130 ? 83.560  9.399   33.366  1.00 19.88 ? 130 TRP C CH2 1 
ATOM   4367 N  N   . LEU C 1 131 ? 86.130  5.333   27.514  1.00 26.02 ? 131 LEU C N   1 
ATOM   4368 C  CA  . LEU C 1 131 ? 86.445  4.030   26.945  1.00 26.07 ? 131 LEU C CA  1 
ATOM   4369 C  C   . LEU C 1 131 ? 85.659  3.175   27.940  1.00 26.70 ? 131 LEU C C   1 
ATOM   4370 O  O   . LEU C 1 131 ? 86.002  3.132   29.121  1.00 26.40 ? 131 LEU C O   1 
ATOM   4371 C  CB  . LEU C 1 131 ? 87.936  3.695   27.054  1.00 25.03 ? 131 LEU C CB  1 
ATOM   4372 C  CG  . LEU C 1 131 ? 88.267  2.217   26.789  1.00 25.49 ? 131 LEU C CG  1 
ATOM   4373 C  CD1 . LEU C 1 131 ? 87.810  1.830   25.391  1.00 26.55 ? 131 LEU C CD1 1 
ATOM   4374 C  CD2 . LEU C 1 131 ? 89.756  1.974   26.939  1.00 26.24 ? 131 LEU C CD2 1 
ATOM   4375 N  N   . VAL C 1 132 ? 84.588  2.538   27.485  1.00 27.41 ? 132 VAL C N   1 
ATOM   4376 C  CA  . VAL C 1 132 ? 83.778  1.722   28.376  1.00 29.51 ? 132 VAL C CA  1 
ATOM   4377 C  C   . VAL C 1 132 ? 83.748  0.258   27.959  1.00 32.05 ? 132 VAL C C   1 
ATOM   4378 O  O   . VAL C 1 132 ? 84.090  -0.089  26.829  1.00 31.87 ? 132 VAL C O   1 
ATOM   4379 C  CB  . VAL C 1 132 ? 82.318  2.230   28.434  1.00 29.97 ? 132 VAL C CB  1 
ATOM   4380 C  CG1 . VAL C 1 132 ? 82.276  3.641   29.005  1.00 28.73 ? 132 VAL C CG1 1 
ATOM   4381 C  CG2 . VAL C 1 132 ? 81.699  2.200   27.040  1.00 30.07 ? 132 VAL C CG2 1 
ATOM   4382 N  N   . LEU C 1 133 ? 83.336  -0.591  28.891  1.00 34.04 ? 133 LEU C N   1 
ATOM   4383 C  CA  . LEU C 1 133 ? 83.223  -2.017  28.643  1.00 36.72 ? 133 LEU C CA  1 
ATOM   4384 C  C   . LEU C 1 133 ? 81.740  -2.345  28.714  1.00 38.12 ? 133 LEU C C   1 
ATOM   4385 O  O   . LEU C 1 133 ? 81.134  -2.262  29.781  1.00 38.89 ? 133 LEU C O   1 
ATOM   4386 C  CB  . LEU C 1 133 ? 83.992  -2.802  29.712  1.00 36.29 ? 133 LEU C CB  1 
ATOM   4387 C  CG  . LEU C 1 133 ? 83.949  -4.335  29.679  1.00 37.57 ? 133 LEU C CG  1 
ATOM   4388 C  CD1 . LEU C 1 133 ? 84.536  -4.864  28.375  1.00 35.89 ? 133 LEU C CD1 1 
ATOM   4389 C  CD2 . LEU C 1 133 ? 84.731  -4.878  30.863  1.00 36.63 ? 133 LEU C CD2 1 
ATOM   4390 N  N   . LYS C 1 134 ? 81.151  -2.674  27.567  1.00 40.08 ? 134 LYS C N   1 
ATOM   4391 C  CA  . LYS C 1 134 ? 79.739  -3.033  27.492  1.00 42.97 ? 134 LYS C CA  1 
ATOM   4392 C  C   . LYS C 1 134 ? 79.697  -4.524  27.231  1.00 44.64 ? 134 LYS C C   1 
ATOM   4393 O  O   . LYS C 1 134 ? 80.006  -4.971  26.123  1.00 44.58 ? 134 LYS C O   1 
ATOM   4394 C  CB  . LYS C 1 134 ? 79.050  -2.342  26.318  1.00 45.17 ? 134 LYS C CB  1 
ATOM   4395 C  CG  . LYS C 1 134 ? 79.018  -0.836  26.344  1.00 48.95 ? 134 LYS C CG  1 
ATOM   4396 C  CD  . LYS C 1 134 ? 78.299  -0.353  25.095  1.00 51.27 ? 134 LYS C CD  1 
ATOM   4397 C  CE  . LYS C 1 134 ? 78.194  1.154   25.035  1.00 53.24 ? 134 LYS C CE  1 
ATOM   4398 N  NZ  . LYS C 1 134 ? 77.513  1.569   23.776  1.00 54.97 ? 134 LYS C NZ  1 
ATOM   4399 N  N   . GLY C 1 135 ? 79.332  -5.281  28.259  1.00 45.38 ? 135 GLY C N   1 
ATOM   4400 C  CA  . GLY C 1 135 ? 79.281  -6.721  28.126  1.00 45.58 ? 135 GLY C CA  1 
ATOM   4401 C  C   . GLY C 1 135 ? 80.689  -7.269  28.026  1.00 45.58 ? 135 GLY C C   1 
ATOM   4402 O  O   . GLY C 1 135 ? 81.426  -7.310  29.013  1.00 45.41 ? 135 GLY C O   1 
ATOM   4403 N  N   . ASP C 1 136 ? 81.072  -7.675  26.821  1.00 45.44 ? 136 ASP C N   1 
ATOM   4404 C  CA  . ASP C 1 136 ? 82.395  -8.235  26.590  1.00 46.19 ? 136 ASP C CA  1 
ATOM   4405 C  C   . ASP C 1 136 ? 83.160  -7.456  25.526  1.00 45.55 ? 136 ASP C C   1 
ATOM   4406 O  O   . ASP C 1 136 ? 84.259  -7.841  25.133  1.00 45.98 ? 136 ASP C O   1 
ATOM   4407 C  CB  . ASP C 1 136 ? 82.258  -9.707  26.174  1.00 47.40 ? 136 ASP C CB  1 
ATOM   4408 C  CG  . ASP C 1 136 ? 81.332  -9.898  24.976  1.00 48.44 ? 136 ASP C CG  1 
ATOM   4409 O  OD1 . ASP C 1 136 ? 80.404  -9.081  24.792  1.00 49.93 ? 136 ASP C OD1 1 
ATOM   4410 O  OD2 . ASP C 1 136 ? 81.519  -10.878 24.225  1.00 48.82 ? 136 ASP C OD2 1 
ATOM   4411 N  N   . LYS C 1 137 ? 82.586  -6.345  25.078  1.00 44.76 ? 137 LYS C N   1 
ATOM   4412 C  CA  . LYS C 1 137 ? 83.218  -5.540  24.042  1.00 44.82 ? 137 LYS C CA  1 
ATOM   4413 C  C   . LYS C 1 137 ? 83.541  -4.125  24.518  1.00 42.69 ? 137 LYS C C   1 
ATOM   4414 O  O   . LYS C 1 137 ? 82.781  -3.531  25.284  1.00 42.22 ? 137 LYS C O   1 
ATOM   4415 C  CB  . LYS C 1 137 ? 82.294  -5.475  22.821  1.00 46.80 ? 137 LYS C CB  1 
ATOM   4416 C  CG  . LYS C 1 137 ? 82.887  -4.762  21.612  1.00 51.35 ? 137 LYS C CG  1 
ATOM   4417 C  CD  . LYS C 1 137 ? 81.894  -4.692  20.451  1.00 54.49 ? 137 LYS C CD  1 
ATOM   4418 C  CE  . LYS C 1 137 ? 81.551  -6.073  19.901  1.00 55.55 ? 137 LYS C CE  1 
ATOM   4419 N  NZ  . LYS C 1 137 ? 82.735  -6.741  19.281  1.00 56.97 ? 137 LYS C NZ  1 
ATOM   4420 N  N   . LEU C 1 138 ? 84.675  -3.593  24.068  1.00 40.22 ? 138 LEU C N   1 
ATOM   4421 C  CA  . LEU C 1 138 ? 85.083  -2.238  24.428  1.00 38.49 ? 138 LEU C CA  1 
ATOM   4422 C  C   . LEU C 1 138 ? 84.458  -1.263  23.440  1.00 37.34 ? 138 LEU C C   1 
ATOM   4423 O  O   . LEU C 1 138 ? 84.264  -1.593  22.271  1.00 37.41 ? 138 LEU C O   1 
ATOM   4424 C  CB  . LEU C 1 138 ? 86.608  -2.098  24.384  1.00 37.89 ? 138 LEU C CB  1 
ATOM   4425 C  CG  . LEU C 1 138 ? 87.412  -2.811  25.471  1.00 37.97 ? 138 LEU C CG  1 
ATOM   4426 C  CD1 . LEU C 1 138 ? 88.894  -2.636  25.214  1.00 38.51 ? 138 LEU C CD1 1 
ATOM   4427 C  CD2 . LEU C 1 138 ? 87.044  -2.248  26.833  1.00 39.63 ? 138 LEU C CD2 1 
ATOM   4428 N  N   . ALA C 1 139 ? 84.138  -0.063  23.912  1.00 35.52 ? 139 ALA C N   1 
ATOM   4429 C  CA  . ALA C 1 139 ? 83.538  0.951   23.055  1.00 33.04 ? 139 ALA C CA  1 
ATOM   4430 C  C   . ALA C 1 139 ? 83.881  2.353   23.545  1.00 32.44 ? 139 ALA C C   1 
ATOM   4431 O  O   . ALA C 1 139 ? 84.202  2.555   24.719  1.00 31.49 ? 139 ALA C O   1 
ATOM   4432 C  CB  . ALA C 1 139 ? 82.026  0.775   23.020  1.00 32.72 ? 139 ALA C CB  1 
ATOM   4433 N  N   . VAL C 1 140 ? 83.818  3.316   22.635  1.00 31.42 ? 140 VAL C N   1 
ATOM   4434 C  CA  . VAL C 1 140 ? 84.097  4.707   22.970  1.00 30.89 ? 140 VAL C CA  1 
ATOM   4435 C  C   . VAL C 1 140 ? 82.780  5.473   22.936  1.00 29.86 ? 140 VAL C C   1 
ATOM   4436 O  O   . VAL C 1 140 ? 82.026  5.387   21.964  1.00 29.45 ? 140 VAL C O   1 
ATOM   4437 C  CB  . VAL C 1 140 ? 85.085  5.353   21.961  1.00 33.31 ? 140 VAL C CB  1 
ATOM   4438 C  CG1 . VAL C 1 140 ? 85.152  6.864   22.183  1.00 33.12 ? 140 VAL C CG1 1 
ATOM   4439 C  CG2 . VAL C 1 140 ? 86.476  4.742   22.124  1.00 33.89 ? 140 VAL C CG2 1 
ATOM   4440 N  N   . VAL C 1 141 ? 82.498  6.203   24.010  1.00 28.17 ? 141 VAL C N   1 
ATOM   4441 C  CA  . VAL C 1 141 ? 81.276  6.993   24.106  1.00 27.32 ? 141 VAL C CA  1 
ATOM   4442 C  C   . VAL C 1 141 ? 81.606  8.306   24.808  1.00 25.47 ? 141 VAL C C   1 
ATOM   4443 O  O   . VAL C 1 141 ? 82.694  8.464   25.362  1.00 25.67 ? 141 VAL C O   1 
ATOM   4444 C  CB  . VAL C 1 141 ? 80.178  6.255   24.936  1.00 27.89 ? 141 VAL C CB  1 
ATOM   4445 C  CG1 . VAL C 1 141 ? 79.818  4.934   24.282  1.00 30.48 ? 141 VAL C CG1 1 
ATOM   4446 C  CG2 . VAL C 1 141 ? 80.667  6.011   26.361  1.00 25.51 ? 141 VAL C CG2 1 
ATOM   4447 N  N   . SER C 1 142 ? 80.680  9.255   24.767  1.00 25.47 ? 142 SER C N   1 
ATOM   4448 C  CA  . SER C 1 142 ? 80.888  10.526  25.450  1.00 24.42 ? 142 SER C CA  1 
ATOM   4449 C  C   . SER C 1 142 ? 79.575  10.907  26.111  1.00 24.36 ? 142 SER C C   1 
ATOM   4450 O  O   . SER C 1 142 ? 78.499  10.475  25.678  1.00 24.61 ? 142 SER C O   1 
ATOM   4451 C  CB  . SER C 1 142 ? 81.329  11.618  24.471  1.00 24.87 ? 142 SER C CB  1 
ATOM   4452 O  OG  . SER C 1 142 ? 80.248  12.083  23.694  1.00 26.49 ? 142 SER C OG  1 
ATOM   4453 N  N   . THR C 1 143 ? 79.666  11.702  27.169  1.00 21.76 ? 143 THR C N   1 
ATOM   4454 C  CA  . THR C 1 143 ? 78.491  12.135  27.907  1.00 20.53 ? 143 THR C CA  1 
ATOM   4455 C  C   . THR C 1 143 ? 78.532  13.645  28.099  1.00 20.46 ? 143 THR C C   1 
ATOM   4456 O  O   . THR C 1 143 ? 79.588  14.259  28.015  1.00 18.98 ? 143 THR C O   1 
ATOM   4457 C  CB  . THR C 1 143 ? 78.444  11.462  29.282  1.00 20.65 ? 143 THR C CB  1 
ATOM   4458 O  OG1 . THR C 1 143 ? 79.707  11.637  29.935  1.00 20.28 ? 143 THR C OG1 1 
ATOM   4459 C  CG2 . THR C 1 143 ? 78.165  9.962   29.135  1.00 20.54 ? 143 THR C CG2 1 
ATOM   4460 N  N   . ALA C 1 144 ? 77.371  14.228  28.360  1.00 19.75 ? 144 ALA C N   1 
ATOM   4461 C  CA  . ALA C 1 144 ? 77.247  15.661  28.571  1.00 20.05 ? 144 ALA C CA  1 
ATOM   4462 C  C   . ALA C 1 144 ? 77.489  16.029  30.025  1.00 18.63 ? 144 ALA C C   1 
ATOM   4463 O  O   . ALA C 1 144 ? 77.252  15.233  30.929  1.00 19.45 ? 144 ALA C O   1 
ATOM   4464 C  CB  . ALA C 1 144 ? 75.853  16.121  28.165  1.00 20.57 ? 144 ALA C CB  1 
ATOM   4465 N  N   . ASN C 1 145 ? 77.958  17.252  30.228  1.00 18.95 ? 145 ASN C N   1 
ATOM   4466 C  CA  . ASN C 1 145 ? 78.193  17.790  31.553  1.00 17.89 ? 145 ASN C CA  1 
ATOM   4467 C  C   . ASN C 1 145 ? 78.868  16.823  32.509  1.00 17.70 ? 145 ASN C C   1 
ATOM   4468 O  O   . ASN C 1 145 ? 79.985  16.385  32.245  1.00 16.89 ? 145 ASN C O   1 
ATOM   4469 C  CB  . ASN C 1 145 ? 76.863  18.294  32.100  1.00 19.13 ? 145 ASN C CB  1 
ATOM   4470 C  CG  . ASN C 1 145 ? 76.195  19.265  31.138  1.00 23.78 ? 145 ASN C CG  1 
ATOM   4471 O  OD1 . ASN C 1 145 ? 76.860  20.125  30.564  1.00 21.01 ? 145 ASN C OD1 1 
ATOM   4472 N  ND2 . ASN C 1 145 ? 74.885  19.134  30.958  1.00 26.51 ? 145 ASN C ND2 1 
ATOM   4473 N  N   . LEU C 1 146 ? 78.215  16.485  33.619  1.00 16.92 ? 146 LEU C N   1 
ATOM   4474 C  CA  . LEU C 1 146 ? 78.846  15.570  34.569  1.00 17.74 ? 146 LEU C CA  1 
ATOM   4475 C  C   . LEU C 1 146 ? 78.187  14.203  34.657  1.00 19.73 ? 146 LEU C C   1 
ATOM   4476 O  O   . LEU C 1 146 ? 78.265  13.522  35.685  1.00 18.55 ? 146 LEU C O   1 
ATOM   4477 C  CB  . LEU C 1 146 ? 78.929  16.215  35.950  1.00 20.02 ? 146 LEU C CB  1 
ATOM   4478 C  CG  . LEU C 1 146 ? 79.879  17.420  36.003  1.00 22.55 ? 146 LEU C CG  1 
ATOM   4479 C  CD1 . LEU C 1 146 ? 79.843  18.041  37.384  1.00 24.35 ? 146 LEU C CD1 1 
ATOM   4480 C  CD2 . LEU C 1 146 ? 81.302  16.974  35.646  1.00 20.74 ? 146 LEU C CD2 1 
ATOM   4481 N  N   . ASP C 1 147 ? 77.545  13.800  33.567  1.00 19.49 ? 147 ASP C N   1 
ATOM   4482 C  CA  . ASP C 1 147 ? 76.904  12.495  33.509  1.00 21.58 ? 147 ASP C CA  1 
ATOM   4483 C  C   . ASP C 1 147 ? 77.978  11.423  33.360  1.00 21.48 ? 147 ASP C C   1 
ATOM   4484 O  O   . ASP C 1 147 ? 79.116  11.708  32.969  1.00 20.39 ? 147 ASP C O   1 
ATOM   4485 C  CB  . ASP C 1 147 ? 75.944  12.411  32.321  1.00 20.71 ? 147 ASP C CB  1 
ATOM   4486 C  CG  . ASP C 1 147 ? 74.729  13.300  32.482  1.00 24.12 ? 147 ASP C CG  1 
ATOM   4487 O  OD1 . ASP C 1 147 ? 74.461  13.767  33.613  1.00 24.10 ? 147 ASP C OD1 1 
ATOM   4488 O  OD2 . ASP C 1 147 ? 74.028  13.519  31.471  1.00 25.19 ? 147 ASP C OD2 1 
ATOM   4489 N  N   . SER C 1 148 ? 77.610  10.189  33.683  1.00 22.09 ? 148 SER C N   1 
ATOM   4490 C  CA  . SER C 1 148 ? 78.521  9.057   33.582  1.00 22.34 ? 148 SER C CA  1 
ATOM   4491 C  C   . SER C 1 148 ? 77.800  7.871   32.949  1.00 24.25 ? 148 SER C C   1 
ATOM   4492 O  O   . SER C 1 148 ? 76.586  7.713   33.120  1.00 23.53 ? 148 SER C O   1 
ATOM   4493 C  CB  . SER C 1 148 ? 79.010  8.642   34.965  1.00 23.09 ? 148 SER C CB  1 
ATOM   4494 O  OG  . SER C 1 148 ? 79.611  7.360   34.901  1.00 25.43 ? 148 SER C OG  1 
ATOM   4495 N  N   . PRO C 1 149 ? 78.536  7.022   32.213  1.00 24.27 ? 149 PRO C N   1 
ATOM   4496 C  CA  . PRO C 1 149 ? 77.910  5.855   31.580  1.00 26.50 ? 149 PRO C CA  1 
ATOM   4497 C  C   . PRO C 1 149 ? 77.245  4.966   32.634  1.00 26.66 ? 149 PRO C C   1 
ATOM   4498 O  O   . PRO C 1 149 ? 76.289  4.247   32.341  1.00 27.74 ? 149 PRO C O   1 
ATOM   4499 C  CB  . PRO C 1 149 ? 79.086  5.154   30.897  1.00 26.02 ? 149 PRO C CB  1 
ATOM   4500 C  CG  . PRO C 1 149 ? 80.029  6.276   30.595  1.00 27.82 ? 149 PRO C CG  1 
ATOM   4501 C  CD  . PRO C 1 149 ? 79.961  7.122   31.845  1.00 25.63 ? 149 PRO C CD  1 
ATOM   4502 N  N   . LEU C 1 150 ? 77.759  5.019   33.859  1.00 27.16 ? 150 LEU C N   1 
ATOM   4503 C  CA  . LEU C 1 150 ? 77.210  4.219   34.952  1.00 28.60 ? 150 LEU C CA  1 
ATOM   4504 C  C   . LEU C 1 150 ? 75.755  4.577   35.248  1.00 29.86 ? 150 LEU C C   1 
ATOM   4505 O  O   . LEU C 1 150 ? 75.015  3.769   35.816  1.00 29.75 ? 150 LEU C O   1 
ATOM   4506 C  CB  . LEU C 1 150 ? 78.043  4.404   36.224  1.00 29.21 ? 150 LEU C CB  1 
ATOM   4507 C  CG  . LEU C 1 150 ? 79.451  3.807   36.240  1.00 29.84 ? 150 LEU C CG  1 
ATOM   4508 C  CD1 . LEU C 1 150 ? 80.101  4.084   37.589  1.00 29.92 ? 150 LEU C CD1 1 
ATOM   4509 C  CD2 . LEU C 1 150 ? 79.379  2.303   35.986  1.00 32.96 ? 150 LEU C CD2 1 
ATOM   4510 N  N   . MET C 1 151 ? 75.346  5.782   34.855  1.00 28.27 ? 151 MET C N   1 
ATOM   4511 C  CA  . MET C 1 151 ? 73.982  6.241   35.092  1.00 29.03 ? 151 MET C CA  1 
ATOM   4512 C  C   . MET C 1 151 ? 72.933  5.570   34.212  1.00 31.61 ? 151 MET C C   1 
ATOM   4513 O  O   . MET C 1 151 ? 71.739  5.630   34.505  1.00 31.17 ? 151 MET C O   1 
ATOM   4514 C  CB  . MET C 1 151 ? 73.896  7.752   34.902  1.00 25.98 ? 151 MET C CB  1 
ATOM   4515 C  CG  . MET C 1 151 ? 74.818  8.519   35.821  1.00 22.15 ? 151 MET C CG  1 
ATOM   4516 S  SD  . MET C 1 151 ? 74.653  10.274  35.547  1.00 20.34 ? 151 MET C SD  1 
ATOM   4517 C  CE  . MET C 1 151 ? 75.525  10.899  36.987  1.00 18.59 ? 151 MET C CE  1 
ATOM   4518 N  N   . GLY C 1 152 ? 73.370  4.942   33.129  1.00 34.12 ? 152 GLY C N   1 
ATOM   4519 C  CA  . GLY C 1 152 ? 72.419  4.284   32.258  1.00 36.47 ? 152 GLY C CA  1 
ATOM   4520 C  C   . GLY C 1 152 ? 72.124  5.094   31.017  1.00 38.53 ? 152 GLY C C   1 
ATOM   4521 O  O   . GLY C 1 152 ? 72.273  6.317   30.999  1.00 37.07 ? 152 GLY C O   1 
ATOM   4522 N  N   . GLU C 1 153 ? 71.681  4.399   29.977  1.00 39.84 ? 153 GLU C N   1 
ATOM   4523 C  CA  . GLU C 1 153 ? 71.377  5.017   28.698  1.00 41.58 ? 153 GLU C CA  1 
ATOM   4524 C  C   . GLU C 1 153 ? 70.211  6.002   28.746  1.00 40.26 ? 153 GLU C C   1 
ATOM   4525 O  O   . GLU C 1 153 ? 70.215  7.017   28.047  1.00 39.53 ? 153 GLU C O   1 
ATOM   4526 C  CB  . GLU C 1 153 ? 71.105  3.916   27.680  1.00 46.12 ? 153 GLU C CB  1 
ATOM   4527 C  CG  . GLU C 1 153 ? 71.344  4.312   26.248  1.00 53.84 ? 153 GLU C CG  1 
ATOM   4528 C  CD  . GLU C 1 153 ? 71.629  3.107   25.381  1.00 57.48 ? 153 GLU C CD  1 
ATOM   4529 O  OE1 . GLU C 1 153 ? 72.677  2.459   25.596  1.00 59.80 ? 153 GLU C OE1 1 
ATOM   4530 O  OE2 . GLU C 1 153 ? 70.803  2.803   24.494  1.00 60.68 ? 153 GLU C OE2 1 
ATOM   4531 N  N   . ALA C 1 154 ? 69.214  5.711   29.573  1.00 38.18 ? 154 ALA C N   1 
ATOM   4532 C  CA  . ALA C 1 154 ? 68.055  6.588   29.687  1.00 37.28 ? 154 ALA C CA  1 
ATOM   4533 C  C   . ALA C 1 154 ? 68.439  7.950   30.260  1.00 36.44 ? 154 ALA C C   1 
ATOM   4534 O  O   . ALA C 1 154 ? 67.882  8.975   29.875  1.00 37.07 ? 154 ALA C O   1 
ATOM   4535 C  CB  . ALA C 1 154 ? 66.990  5.937   30.570  1.00 38.25 ? 154 ALA C CB  1 
ATOM   4536 N  N   . ILE C 1 155 ? 69.395  7.953   31.182  1.00 35.70 ? 155 ILE C N   1 
ATOM   4537 C  CA  . ILE C 1 155 ? 69.835  9.191   31.817  1.00 34.34 ? 155 ILE C CA  1 
ATOM   4538 C  C   . ILE C 1 155 ? 70.955  9.896   31.051  1.00 32.73 ? 155 ILE C C   1 
ATOM   4539 O  O   . ILE C 1 155 ? 70.821  11.059  30.662  1.00 31.42 ? 155 ILE C O   1 
ATOM   4540 C  CB  . ILE C 1 155 ? 70.348  8.935   33.266  1.00 35.75 ? 155 ILE C CB  1 
ATOM   4541 C  CG1 . ILE C 1 155 ? 69.232  8.352   34.141  1.00 37.20 ? 155 ILE C CG1 1 
ATOM   4542 C  CG2 . ILE C 1 155 ? 70.871  10.238  33.874  1.00 33.16 ? 155 ILE C CG2 1 
ATOM   4543 C  CD1 . ILE C 1 155 ? 68.069  9.291   34.373  1.00 40.02 ? 155 ILE C CD1 1 
ATOM   4544 N  N   . SER C 1 156 ? 72.056  9.186   30.833  1.00 31.12 ? 156 SER C N   1 
ATOM   4545 C  CA  . SER C 1 156 ? 73.222  9.763   30.169  1.00 31.00 ? 156 SER C CA  1 
ATOM   4546 C  C   . SER C 1 156 ? 73.326  9.589   28.660  1.00 31.54 ? 156 SER C C   1 
ATOM   4547 O  O   . SER C 1 156 ? 74.155  10.236  28.028  1.00 31.14 ? 156 SER C O   1 
ATOM   4548 C  CB  . SER C 1 156 ? 74.491  9.197   30.798  1.00 30.00 ? 156 SER C CB  1 
ATOM   4549 O  OG  . SER C 1 156 ? 74.666  7.848   30.406  1.00 31.39 ? 156 SER C OG  1 
ATOM   4550 N  N   . GLY C 1 157 ? 72.511  8.714   28.081  1.00 31.45 ? 157 GLY C N   1 
ATOM   4551 C  CA  . GLY C 1 157 ? 72.590  8.496   26.646  1.00 31.71 ? 157 GLY C CA  1 
ATOM   4552 C  C   . GLY C 1 157 ? 73.692  7.502   26.316  1.00 32.56 ? 157 GLY C C   1 
ATOM   4553 O  O   . GLY C 1 157 ? 73.950  7.190   25.152  1.00 32.71 ? 157 GLY C O   1 
ATOM   4554 N  N   . ALA C 1 158 ? 74.351  7.002   27.353  1.00 32.19 ? 158 ALA C N   1 
ATOM   4555 C  CA  . ALA C 1 158 ? 75.421  6.035   27.178  1.00 33.41 ? 158 ALA C CA  1 
ATOM   4556 C  C   . ALA C 1 158 ? 75.361  5.018   28.307  1.00 34.58 ? 158 ALA C C   1 
ATOM   4557 O  O   . ALA C 1 158 ? 74.654  5.218   29.295  1.00 35.02 ? 158 ALA C O   1 
ATOM   4558 C  CB  . ALA C 1 158 ? 76.769  6.740   27.182  1.00 35.06 ? 158 ALA C CB  1 
ATOM   4559 N  N   . SER C 1 159 ? 76.102  3.928   28.157  1.00 34.48 ? 159 SER C N   1 
ATOM   4560 C  CA  . SER C 1 159 ? 76.132  2.889   29.172  1.00 34.81 ? 159 SER C CA  1 
ATOM   4561 C  C   . SER C 1 159 ? 77.449  2.133   29.092  1.00 35.09 ? 159 SER C C   1 
ATOM   4562 O  O   . SER C 1 159 ? 78.162  2.208   28.089  1.00 35.24 ? 159 SER C O   1 
ATOM   4563 C  CB  . SER C 1 159 ? 74.965  1.919   28.976  1.00 36.75 ? 159 SER C CB  1 
ATOM   4564 O  OG  . SER C 1 159 ? 75.063  1.251   27.729  1.00 39.00 ? 159 SER C OG  1 
ATOM   4565 N  N   . GLY C 1 160 ? 77.773  1.412   30.156  1.00 33.36 ? 160 GLY C N   1 
ATOM   4566 C  CA  . GLY C 1 160 ? 79.006  0.657   30.170  1.00 32.65 ? 160 GLY C CA  1 
ATOM   4567 C  C   . GLY C 1 160 ? 79.853  0.976   31.379  1.00 33.13 ? 160 GLY C C   1 
ATOM   4568 O  O   . GLY C 1 160 ? 79.679  2.013   32.020  1.00 33.93 ? 160 GLY C O   1 
ATOM   4569 N  N   . PHE C 1 161 ? 80.768  0.069   31.695  1.00 32.55 ? 161 PHE C N   1 
ATOM   4570 C  CA  . PHE C 1 161 ? 81.666  0.243   32.824  1.00 32.53 ? 161 PHE C CA  1 
ATOM   4571 C  C   . PHE C 1 161 ? 82.867  1.062   32.359  1.00 31.98 ? 161 PHE C C   1 
ATOM   4572 O  O   . PHE C 1 161 ? 83.587  0.652   31.452  1.00 31.29 ? 161 PHE C O   1 
ATOM   4573 C  CB  . PHE C 1 161 ? 82.124  -1.123  33.325  1.00 32.72 ? 161 PHE C CB  1 
ATOM   4574 C  CG  . PHE C 1 161 ? 83.103  -1.054  34.450  1.00 33.42 ? 161 PHE C CG  1 
ATOM   4575 C  CD1 . PHE C 1 161 ? 82.719  -0.566  35.693  1.00 33.44 ? 161 PHE C CD1 1 
ATOM   4576 C  CD2 . PHE C 1 161 ? 84.418  -1.460  34.263  1.00 32.34 ? 161 PHE C CD2 1 
ATOM   4577 C  CE1 . PHE C 1 161 ? 83.636  -0.485  36.738  1.00 33.96 ? 161 PHE C CE1 1 
ATOM   4578 C  CE2 . PHE C 1 161 ? 85.341  -1.382  35.298  1.00 33.57 ? 161 PHE C CE2 1 
ATOM   4579 C  CZ  . PHE C 1 161 ? 84.950  -0.893  36.539  1.00 33.69 ? 161 PHE C CZ  1 
ATOM   4580 N  N   . PRO C 1 162 ? 83.100  2.234   32.977  1.00 32.19 ? 162 PRO C N   1 
ATOM   4581 C  CA  . PRO C 1 162 ? 84.225  3.092   32.592  1.00 30.83 ? 162 PRO C CA  1 
ATOM   4582 C  C   . PRO C 1 162 ? 85.600  2.505   32.901  1.00 30.68 ? 162 PRO C C   1 
ATOM   4583 O  O   . PRO C 1 162 ? 85.891  2.160   34.045  1.00 32.42 ? 162 PRO C O   1 
ATOM   4584 C  CB  . PRO C 1 162 ? 83.974  4.380   33.383  1.00 31.66 ? 162 PRO C CB  1 
ATOM   4585 C  CG  . PRO C 1 162 ? 82.501  4.354   33.656  1.00 33.42 ? 162 PRO C CG  1 
ATOM   4586 C  CD  . PRO C 1 162 ? 82.267  2.903   33.988  1.00 32.03 ? 162 PRO C CD  1 
ATOM   4587 N  N   . ILE C 1 163 ? 86.438  2.392   31.875  1.00 30.44 ? 163 ILE C N   1 
ATOM   4588 C  CA  . ILE C 1 163 ? 87.796  1.885   32.046  1.00 29.56 ? 163 ILE C CA  1 
ATOM   4589 C  C   . ILE C 1 163 ? 88.690  3.106   32.268  1.00 28.60 ? 163 ILE C C   1 
ATOM   4590 O  O   . ILE C 1 163 ? 89.560  3.109   33.138  1.00 29.69 ? 163 ILE C O   1 
ATOM   4591 C  CB  . ILE C 1 163 ? 88.299  1.105   30.795  1.00 31.00 ? 163 ILE C CB  1 
ATOM   4592 C  CG1 . ILE C 1 163 ? 87.574  -0.239  30.671  1.00 33.50 ? 163 ILE C CG1 1 
ATOM   4593 C  CG2 . ILE C 1 163 ? 89.797  0.841   30.912  1.00 28.08 ? 163 ILE C CG2 1 
ATOM   4594 C  CD1 . ILE C 1 163 ? 86.115  -0.125  30.323  1.00 39.52 ? 163 ILE C CD1 1 
ATOM   4595 N  N   . MET C 1 164 ? 88.461  4.142   31.468  1.00 28.34 ? 164 MET C N   1 
ATOM   4596 C  CA  . MET C 1 164 ? 89.206  5.393   31.580  1.00 28.04 ? 164 MET C CA  1 
ATOM   4597 C  C   . MET C 1 164 ? 88.396  6.504   30.914  1.00 26.14 ? 164 MET C C   1 
ATOM   4598 O  O   . MET C 1 164 ? 87.502  6.237   30.112  1.00 24.95 ? 164 MET C O   1 
ATOM   4599 C  CB  . MET C 1 164 ? 90.585  5.263   30.929  1.00 31.08 ? 164 MET C CB  1 
ATOM   4600 C  CG  . MET C 1 164 ? 90.553  4.937   29.453  1.00 37.41 ? 164 MET C CG  1 
ATOM   4601 S  SD  . MET C 1 164 ? 90.635  6.411   28.436  1.00 42.23 ? 164 MET C SD  1 
ATOM   4602 C  CE  . MET C 1 164 ? 92.174  6.117   27.575  1.00 42.45 ? 164 MET C CE  1 
ATOM   4603 N  N   . GLY C 1 165 ? 88.694  7.750   31.258  1.00 25.13 ? 165 GLY C N   1 
ATOM   4604 C  CA  . GLY C 1 165 ? 87.954  8.848   30.664  1.00 24.02 ? 165 GLY C CA  1 
ATOM   4605 C  C   . GLY C 1 165 ? 88.742  10.138  30.633  1.00 23.11 ? 165 GLY C C   1 
ATOM   4606 O  O   . GLY C 1 165 ? 89.749  10.278  31.328  1.00 22.32 ? 165 GLY C O   1 
ATOM   4607 N  N   . LEU C 1 166 ? 88.279  11.080  29.819  1.00 21.79 ? 166 LEU C N   1 
ATOM   4608 C  CA  . LEU C 1 166 ? 88.932  12.373  29.685  1.00 20.33 ? 166 LEU C CA  1 
ATOM   4609 C  C   . LEU C 1 166 ? 87.918  13.494  29.871  1.00 18.57 ? 166 LEU C C   1 
ATOM   4610 O  O   . LEU C 1 166 ? 86.884  13.528  29.205  1.00 19.04 ? 166 LEU C O   1 
ATOM   4611 C  CB  . LEU C 1 166 ? 89.572  12.513  28.302  1.00 19.14 ? 166 LEU C CB  1 
ATOM   4612 C  CG  . LEU C 1 166 ? 90.208  13.876  28.024  1.00 20.54 ? 166 LEU C CG  1 
ATOM   4613 C  CD1 . LEU C 1 166 ? 91.413  14.069  28.940  1.00 20.22 ? 166 LEU C CD1 1 
ATOM   4614 C  CD2 . LEU C 1 166 ? 90.641  13.954  26.567  1.00 22.03 ? 166 LEU C CD2 1 
ATOM   4615 N  N   . ASP C 1 167 ? 88.234  14.409  30.777  1.00 17.23 ? 167 ASP C N   1 
ATOM   4616 C  CA  . ASP C 1 167 ? 87.389  15.562  31.071  1.00 17.34 ? 167 ASP C CA  1 
ATOM   4617 C  C   . ASP C 1 167 ? 87.574  16.572  29.937  1.00 17.96 ? 167 ASP C C   1 
ATOM   4618 O  O   . ASP C 1 167 ? 88.703  17.006  29.685  1.00 18.78 ? 167 ASP C O   1 
ATOM   4619 C  CB  . ASP C 1 167 ? 87.854  16.182  32.398  1.00 18.33 ? 167 ASP C CB  1 
ATOM   4620 C  CG  . ASP C 1 167 ? 86.948  17.300  32.901  1.00 18.23 ? 167 ASP C CG  1 
ATOM   4621 O  OD1 . ASP C 1 167 ? 85.964  17.674  32.227  1.00 16.15 ? 167 ASP C OD1 1 
ATOM   4622 O  OD2 . ASP C 1 167 ? 87.235  17.812  34.002  1.00 18.25 ? 167 ASP C OD2 1 
ATOM   4623 N  N   . VAL C 1 168 ? 86.500  16.925  29.229  1.00 17.18 ? 168 VAL C N   1 
ATOM   4624 C  CA  . VAL C 1 168 ? 86.628  17.919  28.174  1.00 18.00 ? 168 VAL C CA  1 
ATOM   4625 C  C   . VAL C 1 168 ? 85.885  19.217  28.474  1.00 17.98 ? 168 VAL C C   1 
ATOM   4626 O  O   . VAL C 1 168 ? 85.524  19.971  27.565  1.00 18.38 ? 168 VAL C O   1 
ATOM   4627 C  CB  . VAL C 1 168 ? 86.235  17.382  26.762  1.00 19.88 ? 168 VAL C CB  1 
ATOM   4628 C  CG1 . VAL C 1 168 ? 87.232  16.309  26.335  1.00 22.09 ? 168 VAL C CG1 1 
ATOM   4629 C  CG2 . VAL C 1 168 ? 84.813  16.848  26.751  1.00 23.31 ? 168 VAL C CG2 1 
ATOM   4630 N  N   . TRP C 1 169 ? 85.640  19.470  29.758  1.00 14.24 ? 169 TRP C N   1 
ATOM   4631 C  CA  . TRP C 1 169 ? 85.055  20.741  30.164  1.00 14.96 ? 169 TRP C CA  1 
ATOM   4632 C  C   . TRP C 1 169 ? 86.206  21.711  29.891  1.00 15.55 ? 169 TRP C C   1 
ATOM   4633 O  O   . TRP C 1 169 ? 87.378  21.335  30.026  1.00 14.66 ? 169 TRP C O   1 
ATOM   4634 C  CB  . TRP C 1 169 ? 84.748  20.763  31.667  1.00 15.22 ? 169 TRP C CB  1 
ATOM   4635 C  CG  . TRP C 1 169 ? 83.441  20.157  32.049  1.00 15.55 ? 169 TRP C CG  1 
ATOM   4636 C  CD1 . TRP C 1 169 ? 83.010  18.883  31.795  1.00 16.17 ? 169 TRP C CD1 1 
ATOM   4637 C  CD2 . TRP C 1 169 ? 82.391  20.802  32.780  1.00 15.36 ? 169 TRP C CD2 1 
ATOM   4638 N  NE1 . TRP C 1 169 ? 81.753  18.697  32.327  1.00 16.67 ? 169 TRP C NE1 1 
ATOM   4639 C  CE2 . TRP C 1 169 ? 81.351  19.859  32.937  1.00 16.13 ? 169 TRP C CE2 1 
ATOM   4640 C  CE3 . TRP C 1 169 ? 82.229  22.086  33.316  1.00 16.00 ? 169 TRP C CE3 1 
ATOM   4641 C  CZ2 . TRP C 1 169 ? 80.160  20.161  33.612  1.00 18.08 ? 169 TRP C CZ2 1 
ATOM   4642 C  CZ3 . TRP C 1 169 ? 81.039  22.390  33.988  1.00 17.74 ? 169 TRP C CZ3 1 
ATOM   4643 C  CH2 . TRP C 1 169 ? 80.023  21.426  34.128  1.00 18.23 ? 169 TRP C CH2 1 
ATOM   4644 N  N   . GLU C 1 170 ? 85.897  22.945  29.516  1.00 16.11 ? 170 GLU C N   1 
ATOM   4645 C  CA  . GLU C 1 170 ? 86.959  23.904  29.219  1.00 17.33 ? 170 GLU C CA  1 
ATOM   4646 C  C   . GLU C 1 170 ? 87.874  24.205  30.409  1.00 19.49 ? 170 GLU C C   1 
ATOM   4647 O  O   . GLU C 1 170 ? 89.052  24.510  30.211  1.00 18.61 ? 170 GLU C O   1 
ATOM   4648 C  CB  . GLU C 1 170 ? 86.362  25.197  28.651  1.00 17.96 ? 170 GLU C CB  1 
ATOM   4649 C  CG  . GLU C 1 170 ? 85.667  24.977  27.298  1.00 17.69 ? 170 GLU C CG  1 
ATOM   4650 C  CD  . GLU C 1 170 ? 85.039  26.236  26.717  1.00 19.07 ? 170 GLU C CD  1 
ATOM   4651 O  OE1 . GLU C 1 170 ? 84.349  26.960  27.457  1.00 15.98 ? 170 GLU C OE1 1 
ATOM   4652 O  OE2 . GLU C 1 170 ? 85.216  26.489  25.506  1.00 20.04 ? 170 GLU C OE2 1 
ATOM   4653 N  N   . HIS C 1 171 ? 87.362  24.102  31.639  1.00 16.96 ? 171 HIS C N   1 
ATOM   4654 C  CA  . HIS C 1 171 ? 88.206  24.377  32.804  1.00 17.08 ? 171 HIS C CA  1 
ATOM   4655 C  C   . HIS C 1 171 ? 89.361  23.393  32.932  1.00 16.94 ? 171 HIS C C   1 
ATOM   4656 O  O   . HIS C 1 171 ? 90.347  23.655  33.630  1.00 17.09 ? 171 HIS C O   1 
ATOM   4657 C  CB  . HIS C 1 171 ? 87.383  24.394  34.114  1.00 17.75 ? 171 HIS C CB  1 
ATOM   4658 C  CG  . HIS C 1 171 ? 86.813  23.062  34.518  1.00 17.03 ? 171 HIS C CG  1 
ATOM   4659 N  ND1 . HIS C 1 171 ? 85.477  22.891  34.814  1.00 18.28 ? 171 HIS C ND1 1 
ATOM   4660 C  CD2 . HIS C 1 171 ? 87.401  21.861  34.739  1.00 18.34 ? 171 HIS C CD2 1 
ATOM   4661 C  CE1 . HIS C 1 171 ? 85.266  21.643  35.201  1.00 17.93 ? 171 HIS C CE1 1 
ATOM   4662 N  NE2 . HIS C 1 171 ? 86.418  20.997  35.166  1.00 16.50 ? 171 HIS C NE2 1 
ATOM   4663 N  N   . ALA C 1 172 ? 89.252  22.263  32.248  1.00 17.70 ? 172 ALA C N   1 
ATOM   4664 C  CA  . ALA C 1 172 ? 90.295  21.259  32.330  1.00 17.34 ? 172 ALA C CA  1 
ATOM   4665 C  C   . ALA C 1 172 ? 91.480  21.565  31.426  1.00 18.32 ? 172 ALA C C   1 
ATOM   4666 O  O   . ALA C 1 172 ? 92.553  20.996  31.605  1.00 18.56 ? 172 ALA C O   1 
ATOM   4667 C  CB  . ALA C 1 172 ? 89.728  19.893  31.977  1.00 15.58 ? 172 ALA C CB  1 
ATOM   4668 N  N   . TYR C 1 173 ? 91.301  22.470  30.471  1.00 16.98 ? 173 TYR C N   1 
ATOM   4669 C  CA  . TYR C 1 173 ? 92.386  22.746  29.536  1.00 17.51 ? 173 TYR C CA  1 
ATOM   4670 C  C   . TYR C 1 173 ? 92.550  24.184  29.069  1.00 17.47 ? 173 TYR C C   1 
ATOM   4671 O  O   . TYR C 1 173 ? 93.454  24.474  28.278  1.00 20.12 ? 173 TYR C O   1 
ATOM   4672 C  CB  . TYR C 1 173 ? 92.206  21.850  28.301  1.00 17.13 ? 173 TYR C CB  1 
ATOM   4673 C  CG  . TYR C 1 173 ? 90.943  22.134  27.481  1.00 18.90 ? 173 TYR C CG  1 
ATOM   4674 C  CD1 . TYR C 1 173 ? 90.874  23.223  26.605  1.00 18.64 ? 173 TYR C CD1 1 
ATOM   4675 C  CD2 . TYR C 1 173 ? 89.822  21.303  27.578  1.00 18.13 ? 173 TYR C CD2 1 
ATOM   4676 C  CE1 . TYR C 1 173 ? 89.710  23.476  25.836  1.00 18.76 ? 173 TYR C CE1 1 
ATOM   4677 C  CE2 . TYR C 1 173 ? 88.658  21.546  26.815  1.00 18.30 ? 173 TYR C CE2 1 
ATOM   4678 C  CZ  . TYR C 1 173 ? 88.607  22.629  25.949  1.00 19.35 ? 173 TYR C CZ  1 
ATOM   4679 O  OH  . TYR C 1 173 ? 87.458  22.855  25.195  1.00 18.06 ? 173 TYR C OH  1 
ATOM   4680 N  N   . TYR C 1 174 ? 91.718  25.098  29.548  1.00 16.92 ? 174 TYR C N   1 
ATOM   4681 C  CA  . TYR C 1 174 ? 91.812  26.461  29.045  1.00 18.55 ? 174 TYR C CA  1 
ATOM   4682 C  C   . TYR C 1 174 ? 93.059  27.273  29.407  1.00 21.78 ? 174 TYR C C   1 
ATOM   4683 O  O   . TYR C 1 174 ? 93.591  28.004  28.560  1.00 20.50 ? 174 TYR C O   1 
ATOM   4684 C  CB  . TYR C 1 174 ? 90.558  27.261  29.417  1.00 18.37 ? 174 TYR C CB  1 
ATOM   4685 C  CG  . TYR C 1 174 ? 90.113  28.152  28.278  1.00 19.90 ? 174 TYR C CG  1 
ATOM   4686 C  CD1 . TYR C 1 174 ? 89.530  27.601  27.136  1.00 19.18 ? 174 TYR C CD1 1 
ATOM   4687 C  CD2 . TYR C 1 174 ? 90.374  29.523  28.289  1.00 19.86 ? 174 TYR C CD2 1 
ATOM   4688 C  CE1 . TYR C 1 174 ? 89.230  28.382  26.033  1.00 19.65 ? 174 TYR C CE1 1 
ATOM   4689 C  CE2 . TYR C 1 174 ? 90.074  30.319  27.180  1.00 22.02 ? 174 TYR C CE2 1 
ATOM   4690 C  CZ  . TYR C 1 174 ? 89.506  29.737  26.056  1.00 19.49 ? 174 TYR C CZ  1 
ATOM   4691 O  OH  . TYR C 1 174 ? 89.239  30.489  24.939  1.00 21.80 ? 174 TYR C OH  1 
ATOM   4692 N  N   . LEU C 1 175 ? 93.535  27.158  30.643  1.00 20.76 ? 175 LEU C N   1 
ATOM   4693 C  CA  . LEU C 1 175 ? 94.702  27.938  31.048  1.00 23.15 ? 175 LEU C CA  1 
ATOM   4694 C  C   . LEU C 1 175 ? 95.924  27.673  30.175  1.00 22.59 ? 175 LEU C C   1 
ATOM   4695 O  O   . LEU C 1 175 ? 96.645  28.599  29.811  1.00 24.72 ? 175 LEU C O   1 
ATOM   4696 C  CB  . LEU C 1 175 ? 95.046  27.680  32.522  1.00 20.87 ? 175 LEU C CB  1 
ATOM   4697 C  CG  . LEU C 1 175 ? 94.025  28.198  33.540  1.00 22.70 ? 175 LEU C CG  1 
ATOM   4698 C  CD1 . LEU C 1 175 ? 94.592  28.021  34.939  1.00 27.84 ? 175 LEU C CD1 1 
ATOM   4699 C  CD2 . LEU C 1 175 ? 93.709  29.666  33.289  1.00 24.86 ? 175 LEU C CD2 1 
ATOM   4700 N  N   . LYS C 1 176 ? 96.151  26.414  29.827  1.00 24.90 ? 176 LYS C N   1 
ATOM   4701 C  CA  . LYS C 1 176 ? 97.301  26.072  29.007  1.00 25.70 ? 176 LYS C CA  1 
ATOM   4702 C  C   . LYS C 1 176 ? 97.026  25.954  27.512  1.00 26.07 ? 176 LYS C C   1 
ATOM   4703 O  O   . LYS C 1 176 ? 97.872  26.330  26.699  1.00 26.47 ? 176 LYS C O   1 
ATOM   4704 C  CB  . LYS C 1 176 ? 97.930  24.768  29.490  1.00 26.47 ? 176 LYS C CB  1 
ATOM   4705 C  CG  . LYS C 1 176 ? 99.175  24.387  28.705  1.00 27.51 ? 176 LYS C CG  1 
ATOM   4706 C  CD  . LYS C 1 176 ? 99.764  23.085  29.179  1.00 27.26 ? 176 LYS C CD  1 
ATOM   4707 C  CE  . LYS C 1 176 ? 100.962 22.710  28.324  1.00 31.09 ? 176 LYS C CE  1 
ATOM   4708 N  NZ  . LYS C 1 176 ? 101.547 21.406  28.717  1.00 30.70 ? 176 LYS C NZ  1 
ATOM   4709 N  N   . PHE C 1 177 ? 95.858  25.440  27.136  1.00 23.18 ? 177 PHE C N   1 
ATOM   4710 C  CA  . PHE C 1 177 ? 95.564  25.262  25.713  1.00 23.24 ? 177 PHE C CA  1 
ATOM   4711 C  C   . PHE C 1 177 ? 94.518  26.188  25.102  1.00 23.39 ? 177 PHE C C   1 
ATOM   4712 O  O   . PHE C 1 177 ? 94.346  26.204  23.878  1.00 24.21 ? 177 PHE C O   1 
ATOM   4713 C  CB  . PHE C 1 177 ? 95.141  23.814  25.445  1.00 22.19 ? 177 PHE C CB  1 
ATOM   4714 C  CG  . PHE C 1 177 ? 96.071  22.784  26.023  1.00 25.06 ? 177 PHE C CG  1 
ATOM   4715 C  CD1 . PHE C 1 177 ? 96.002  22.438  27.372  1.00 24.77 ? 177 PHE C CD1 1 
ATOM   4716 C  CD2 . PHE C 1 177 ? 96.996  22.132  25.213  1.00 25.20 ? 177 PHE C CD2 1 
ATOM   4717 C  CE1 . PHE C 1 177 ? 96.836  21.458  27.901  1.00 25.58 ? 177 PHE C CE1 1 
ATOM   4718 C  CE2 . PHE C 1 177 ? 97.834  21.150  25.734  1.00 24.61 ? 177 PHE C CE2 1 
ATOM   4719 C  CZ  . PHE C 1 177 ? 97.753  20.812  27.081  1.00 23.54 ? 177 PHE C CZ  1 
ATOM   4720 N  N   . GLN C 1 178 ? 93.836  26.964  25.937  1.00 22.41 ? 178 GLN C N   1 
ATOM   4721 C  CA  . GLN C 1 178 ? 92.774  27.855  25.475  1.00 25.15 ? 178 GLN C CA  1 
ATOM   4722 C  C   . GLN C 1 178 ? 91.801  27.072  24.599  1.00 24.78 ? 178 GLN C C   1 
ATOM   4723 O  O   . GLN C 1 178 ? 91.325  26.019  24.998  1.00 24.29 ? 178 GLN C O   1 
ATOM   4724 C  CB  . GLN C 1 178 ? 93.326  29.057  24.695  1.00 25.42 ? 178 GLN C CB  1 
ATOM   4725 C  CG  . GLN C 1 178 ? 94.058  30.073  25.549  1.00 27.69 ? 178 GLN C CG  1 
ATOM   4726 C  CD  . GLN C 1 178 ? 95.481  29.652  25.859  1.00 30.62 ? 178 GLN C CD  1 
ATOM   4727 O  OE1 . GLN C 1 178 ? 96.285  29.442  24.955  1.00 31.81 ? 178 GLN C OE1 1 
ATOM   4728 N  NE2 . GLN C 1 178 ? 95.798  29.525  27.142  1.00 31.15 ? 178 GLN C NE2 1 
ATOM   4729 N  N   . ASN C 1 179 ? 91.529  27.566  23.398  1.00 24.66 ? 179 ASN C N   1 
ATOM   4730 C  CA  . ASN C 1 179 ? 90.584  26.913  22.492  1.00 25.10 ? 179 ASN C CA  1 
ATOM   4731 C  C   . ASN C 1 179 ? 91.089  25.648  21.796  1.00 24.92 ? 179 ASN C C   1 
ATOM   4732 O  O   . ASN C 1 179 ? 90.314  24.939  21.160  1.00 23.55 ? 179 ASN C O   1 
ATOM   4733 C  CB  . ASN C 1 179 ? 90.176  27.893  21.405  1.00 26.93 ? 179 ASN C CB  1 
ATOM   4734 C  CG  . ASN C 1 179 ? 91.331  28.220  20.480  1.00 28.11 ? 179 ASN C CG  1 
ATOM   4735 O  OD1 . ASN C 1 179 ? 92.342  28.772  20.911  1.00 27.34 ? 179 ASN C OD1 1 
ATOM   4736 N  ND2 . ASN C 1 179 ? 91.196  27.864  19.210  1.00 28.04 ? 179 ASN C ND2 1 
ATOM   4737 N  N   A ARG C 1 180 ? 92.381  25.366  21.917  0.50 23.90 ? 180 ARG C N   1 
ATOM   4738 N  N   B ARG C 1 180 ? 92.380  25.366  21.924  0.50 23.92 ? 180 ARG C N   1 
ATOM   4739 C  CA  A ARG C 1 180 ? 92.965  24.201  21.257  0.50 24.94 ? 180 ARG C CA  1 
ATOM   4740 C  CA  B ARG C 1 180 ? 92.972  24.204  21.268  0.50 24.97 ? 180 ARG C CA  1 
ATOM   4741 C  C   A ARG C 1 180 ? 92.715  22.873  21.968  0.50 24.37 ? 180 ARG C C   1 
ATOM   4742 C  C   B ARG C 1 180 ? 92.716  22.875  21.978  0.50 24.40 ? 180 ARG C C   1 
ATOM   4743 O  O   A ARG C 1 180 ? 93.653  22.219  22.427  0.50 23.12 ? 180 ARG C O   1 
ATOM   4744 O  O   B ARG C 1 180 ? 93.651  22.223  22.445  0.50 23.14 ? 180 ARG C O   1 
ATOM   4745 C  CB  A ARG C 1 180 ? 94.473  24.415  21.072  0.50 25.93 ? 180 ARG C CB  1 
ATOM   4746 C  CB  B ARG C 1 180 ? 94.480  24.435  21.097  0.50 26.07 ? 180 ARG C CB  1 
ATOM   4747 C  CG  A ARG C 1 180 ? 94.824  25.681  20.286  0.50 28.03 ? 180 ARG C CG  1 
ATOM   4748 C  CG  B ARG C 1 180 ? 94.803  25.715  20.318  0.50 28.06 ? 180 ARG C CG  1 
ATOM   4749 C  CD  A ARG C 1 180 ? 96.332  25.827  20.098  0.50 30.08 ? 180 ARG C CD  1 
ATOM   4750 C  CD  B ARG C 1 180 ? 96.303  25.985  20.208  0.50 30.59 ? 180 ARG C CD  1 
ATOM   4751 N  NE  A ARG C 1 180 ? 97.037  26.051  21.360  0.50 31.79 ? 180 ARG C NE  1 
ATOM   4752 N  NE  B ARG C 1 180 ? 96.911  26.376  21.480  0.50 31.95 ? 180 ARG C NE  1 
ATOM   4753 C  CZ  A ARG C 1 180 ? 96.914  27.146  22.105  0.50 31.21 ? 180 ARG C CZ  1 
ATOM   4754 C  CZ  B ARG C 1 180 ? 97.708  25.594  22.204  0.50 32.51 ? 180 ARG C CZ  1 
ATOM   4755 N  NH1 A ARG C 1 180 ? 96.111  28.126  21.720  0.50 33.41 ? 180 ARG C NH1 1 
ATOM   4756 N  NH1 B ARG C 1 180 ? 98.002  24.369  21.791  0.50 33.07 ? 180 ARG C NH1 1 
ATOM   4757 N  NH2 A ARG C 1 180 ? 97.595  27.263  23.235  0.50 31.04 ? 180 ARG C NH2 1 
ATOM   4758 N  NH2 B ARG C 1 180 ? 98.220  26.042  23.342  0.50 32.87 ? 180 ARG C NH2 1 
ATOM   4759 N  N   . ARG C 1 181 ? 91.451  22.468  22.047  1.00 23.86 ? 181 ARG C N   1 
ATOM   4760 C  CA  . ARG C 1 181 ? 91.104  21.208  22.699  1.00 22.31 ? 181 ARG C CA  1 
ATOM   4761 C  C   . ARG C 1 181 ? 91.834  20.018  22.060  1.00 22.19 ? 181 ARG C C   1 
ATOM   4762 O  O   . ARG C 1 181 ? 92.234  19.090  22.754  1.00 22.37 ? 181 ARG C O   1 
ATOM   4763 C  CB  . ARG C 1 181 ? 89.589  20.961  22.664  1.00 20.84 ? 181 ARG C CB  1 
ATOM   4764 C  CG  . ARG C 1 181 ? 89.180  19.739  23.484  1.00 20.49 ? 181 ARG C CG  1 
ATOM   4765 C  CD  . ARG C 1 181 ? 87.746  19.308  23.219  1.00 21.66 ? 181 ARG C CD  1 
ATOM   4766 N  NE  . ARG C 1 181 ? 86.744  20.272  23.667  1.00 17.17 ? 181 ARG C NE  1 
ATOM   4767 C  CZ  . ARG C 1 181 ? 85.434  20.040  23.607  1.00 21.32 ? 181 ARG C CZ  1 
ATOM   4768 N  NH1 . ARG C 1 181 ? 84.991  18.885  23.122  1.00 19.81 ? 181 ARG C NH1 1 
ATOM   4769 N  NH2 . ARG C 1 181 ? 84.569  20.949  24.034  1.00 20.83 ? 181 ARG C NH2 1 
ATOM   4770 N  N   . PRO C 1 182 ? 92.010  20.024  20.724  1.00 24.21 ? 182 PRO C N   1 
ATOM   4771 C  CA  . PRO C 1 182 ? 92.709  18.903  20.086  1.00 24.17 ? 182 PRO C CA  1 
ATOM   4772 C  C   . PRO C 1 182 ? 94.136  18.709  20.610  1.00 24.28 ? 182 PRO C C   1 
ATOM   4773 O  O   . PRO C 1 182 ? 94.610  17.581  20.723  1.00 24.57 ? 182 PRO C O   1 
ATOM   4774 C  CB  . PRO C 1 182 ? 92.675  19.279  18.608  1.00 27.17 ? 182 PRO C CB  1 
ATOM   4775 C  CG  . PRO C 1 182 ? 91.354  19.985  18.494  1.00 27.46 ? 182 PRO C CG  1 
ATOM   4776 C  CD  . PRO C 1 182 ? 91.402  20.896  19.703  1.00 25.99 ? 182 PRO C CD  1 
ATOM   4777 N  N   . ASP C 1 183 ? 94.823  19.805  20.920  1.00 23.09 ? 183 ASP C N   1 
ATOM   4778 C  CA  . ASP C 1 183 ? 96.183  19.705  21.447  1.00 25.86 ? 183 ASP C CA  1 
ATOM   4779 C  C   . ASP C 1 183 ? 96.157  19.077  22.843  1.00 25.76 ? 183 ASP C C   1 
ATOM   4780 O  O   . ASP C 1 183 ? 97.035  18.293  23.206  1.00 25.59 ? 183 ASP C O   1 
ATOM   4781 C  CB  . ASP C 1 183 ? 96.848  21.088  21.495  1.00 26.31 ? 183 ASP C CB  1 
ATOM   4782 C  CG  . ASP C 1 183 ? 97.147  21.640  20.101  1.00 30.54 ? 183 ASP C CG  1 
ATOM   4783 O  OD1 . ASP C 1 183 ? 97.227  20.839  19.149  1.00 31.68 ? 183 ASP C OD1 1 
ATOM   4784 O  OD2 . ASP C 1 183 ? 97.314  22.866  19.952  1.00 33.00 ? 183 ASP C OD2 1 
ATOM   4785 N  N   . TYR C 1 184 ? 95.137  19.429  23.620  1.00 25.13 ? 184 TYR C N   1 
ATOM   4786 C  CA  . TYR C 1 184 ? 94.961  18.898  24.974  1.00 22.63 ? 184 TYR C CA  1 
ATOM   4787 C  C   . TYR C 1 184 ? 94.735  17.390  24.889  1.00 23.52 ? 184 TYR C C   1 
ATOM   4788 O  O   . TYR C 1 184 ? 95.325  16.611  25.646  1.00 23.94 ? 184 TYR C O   1 
ATOM   4789 C  CB  . TYR C 1 184 ? 93.757  19.592  25.628  1.00 22.10 ? 184 TYR C CB  1 
ATOM   4790 C  CG  . TYR C 1 184 ? 93.164  18.912  26.851  1.00 22.89 ? 184 TYR C CG  1 
ATOM   4791 C  CD1 . TYR C 1 184 ? 93.879  18.817  28.052  1.00 19.61 ? 184 TYR C CD1 1 
ATOM   4792 C  CD2 . TYR C 1 184 ? 91.849  18.429  26.824  1.00 21.69 ? 184 TYR C CD2 1 
ATOM   4793 C  CE1 . TYR C 1 184 ? 93.294  18.263  29.199  1.00 20.37 ? 184 TYR C CE1 1 
ATOM   4794 C  CE2 . TYR C 1 184 ? 91.258  17.877  27.957  1.00 20.17 ? 184 TYR C CE2 1 
ATOM   4795 C  CZ  . TYR C 1 184 ? 91.980  17.798  29.140  1.00 20.70 ? 184 TYR C CZ  1 
ATOM   4796 O  OH  . TYR C 1 184 ? 91.375  17.278  30.258  1.00 20.76 ? 184 TYR C OH  1 
ATOM   4797 N  N   . ILE C 1 185 ? 93.883  16.986  23.954  1.00 23.03 ? 185 ILE C N   1 
ATOM   4798 C  CA  . ILE C 1 185 ? 93.568  15.580  23.755  1.00 25.03 ? 185 ILE C CA  1 
ATOM   4799 C  C   . ILE C 1 185 ? 94.829  14.777  23.421  1.00 28.33 ? 185 ILE C C   1 
ATOM   4800 O  O   . ILE C 1 185 ? 95.011  13.665  23.919  1.00 28.02 ? 185 ILE C O   1 
ATOM   4801 C  CB  . ILE C 1 185 ? 92.508  15.423  22.638  1.00 24.09 ? 185 ILE C CB  1 
ATOM   4802 C  CG1 . ILE C 1 185 ? 91.189  16.064  23.100  1.00 22.24 ? 185 ILE C CG1 1 
ATOM   4803 C  CG2 . ILE C 1 185 ? 92.292  13.959  22.307  1.00 24.09 ? 185 ILE C CG2 1 
ATOM   4804 C  CD1 . ILE C 1 185 ? 90.174  16.260  22.004  1.00 18.52 ? 185 ILE C CD1 1 
ATOM   4805 N  N   . LYS C 1 186 ? 95.704  15.340  22.591  1.00 29.24 ? 186 LYS C N   1 
ATOM   4806 C  CA  . LYS C 1 186 ? 96.931  14.639  22.232  1.00 32.25 ? 186 LYS C CA  1 
ATOM   4807 C  C   . LYS C 1 186 ? 97.885  14.507  23.413  1.00 30.91 ? 186 LYS C C   1 
ATOM   4808 O  O   . LYS C 1 186 ? 98.523  13.471  23.577  1.00 31.80 ? 186 LYS C O   1 
ATOM   4809 C  CB  . LYS C 1 186 ? 97.636  15.325  21.053  1.00 34.55 ? 186 LYS C CB  1 
ATOM   4810 C  CG  . LYS C 1 186 ? 97.233  14.758  19.691  1.00 40.64 ? 186 LYS C CG  1 
ATOM   4811 C  CD  . LYS C 1 186 ? 96.518  15.786  18.821  1.00 45.75 ? 186 LYS C CD  1 
ATOM   4812 C  CE  . LYS C 1 186 ? 97.445  16.941  18.441  1.00 48.51 ? 186 LYS C CE  1 
ATOM   4813 N  NZ  . LYS C 1 186 ? 96.753  18.000  17.638  1.00 50.09 ? 186 LYS C NZ  1 
ATOM   4814 N  N   . GLU C 1 187 ? 97.980  15.543  24.241  1.00 31.55 ? 187 GLU C N   1 
ATOM   4815 C  CA  . GLU C 1 187 ? 98.861  15.487  25.404  1.00 31.25 ? 187 GLU C CA  1 
ATOM   4816 C  C   . GLU C 1 187 ? 98.373  14.438  26.405  1.00 30.64 ? 187 GLU C C   1 
ATOM   4817 O  O   . GLU C 1 187 ? 99.170  13.846  27.135  1.00 30.46 ? 187 GLU C O   1 
ATOM   4818 C  CB  . GLU C 1 187 ? 98.948  16.863  26.065  1.00 33.12 ? 187 GLU C CB  1 
ATOM   4819 C  CG  . GLU C 1 187 ? 99.813  17.851  25.295  1.00 39.09 ? 187 GLU C CG  1 
ATOM   4820 C  CD  . GLU C 1 187 ? 101.305 17.686  25.578  1.00 41.36 ? 187 GLU C CD  1 
ATOM   4821 O  OE1 . GLU C 1 187 ? 101.786 16.537  25.661  1.00 41.43 ? 187 GLU C OE1 1 
ATOM   4822 O  OE2 . GLU C 1 187 ? 101.998 18.716  25.711  1.00 43.71 ? 187 GLU C OE2 1 
ATOM   4823 N  N   . PHE C 1 188 ? 97.063  14.203  26.421  1.00 29.86 ? 188 PHE C N   1 
ATOM   4824 C  CA  . PHE C 1 188 ? 96.455  13.221  27.321  1.00 28.23 ? 188 PHE C CA  1 
ATOM   4825 C  C   . PHE C 1 188 ? 97.101  11.849  27.170  1.00 28.87 ? 188 PHE C C   1 
ATOM   4826 O  O   . PHE C 1 188 ? 97.286  11.130  28.151  1.00 28.73 ? 188 PHE C O   1 
ATOM   4827 C  CB  . PHE C 1 188 ? 94.948  13.112  27.037  1.00 26.53 ? 188 PHE C CB  1 
ATOM   4828 C  CG  . PHE C 1 188 ? 94.243  12.031  27.828  1.00 25.71 ? 188 PHE C CG  1 
ATOM   4829 C  CD1 . PHE C 1 188 ? 94.254  12.042  29.220  1.00 26.04 ? 188 PHE C CD1 1 
ATOM   4830 C  CD2 . PHE C 1 188 ? 93.543  11.021  27.174  1.00 25.32 ? 188 PHE C CD2 1 
ATOM   4831 C  CE1 . PHE C 1 188 ? 93.571  11.058  29.954  1.00 26.64 ? 188 PHE C CE1 1 
ATOM   4832 C  CE2 . PHE C 1 188 ? 92.857  10.031  27.894  1.00 28.31 ? 188 PHE C CE2 1 
ATOM   4833 C  CZ  . PHE C 1 188 ? 92.871  10.052  29.289  1.00 28.64 ? 188 PHE C CZ  1 
ATOM   4834 N  N   . TRP C 1 189 ? 97.451  11.489  25.940  1.00 29.30 ? 189 TRP C N   1 
ATOM   4835 C  CA  . TRP C 1 189 ? 98.073  10.196  25.686  1.00 28.86 ? 189 TRP C CA  1 
ATOM   4836 C  C   . TRP C 1 189 ? 99.363  9.997   26.477  1.00 29.09 ? 189 TRP C C   1 
ATOM   4837 O  O   . TRP C 1 189 ? 99.767  8.863   26.738  1.00 29.36 ? 189 TRP C O   1 
ATOM   4838 C  CB  . TRP C 1 189 ? 98.346  10.037  24.193  1.00 30.41 ? 189 TRP C CB  1 
ATOM   4839 C  CG  . TRP C 1 189 ? 97.094  9.946   23.387  1.00 31.21 ? 189 TRP C CG  1 
ATOM   4840 C  CD1 . TRP C 1 189 ? 96.786  10.663  22.269  1.00 31.32 ? 189 TRP C CD1 1 
ATOM   4841 C  CD2 . TRP C 1 189 ? 95.973  9.090   23.638  1.00 31.39 ? 189 TRP C CD2 1 
ATOM   4842 N  NE1 . TRP C 1 189 ? 95.543  10.310  21.808  1.00 30.66 ? 189 TRP C NE1 1 
ATOM   4843 C  CE2 . TRP C 1 189 ? 95.020  9.345   22.629  1.00 31.60 ? 189 TRP C CE2 1 
ATOM   4844 C  CE3 . TRP C 1 189 ? 95.681  8.131   24.618  1.00 31.29 ? 189 TRP C CE3 1 
ATOM   4845 C  CZ2 . TRP C 1 189 ? 93.793  8.677   22.569  1.00 32.89 ? 189 TRP C CZ2 1 
ATOM   4846 C  CZ3 . TRP C 1 189 ? 94.461  7.464   24.559  1.00 32.33 ? 189 TRP C CZ3 1 
ATOM   4847 C  CH2 . TRP C 1 189 ? 93.532  7.741   23.540  1.00 34.80 ? 189 TRP C CH2 1 
ATOM   4848 N  N   . ASN C 1 190 ? 99.998  11.099  26.863  1.00 29.41 ? 190 ASN C N   1 
ATOM   4849 C  CA  . ASN C 1 190 ? 101.245 11.041  27.622  1.00 31.63 ? 190 ASN C CA  1 
ATOM   4850 C  C   . ASN C 1 190 ? 101.039 10.811  29.119  1.00 32.94 ? 190 ASN C C   1 
ATOM   4851 O  O   . ASN C 1 190 ? 101.958 10.376  29.816  1.00 32.28 ? 190 ASN C O   1 
ATOM   4852 C  CB  . ASN C 1 190 ? 102.042 12.331  27.424  1.00 32.95 ? 190 ASN C CB  1 
ATOM   4853 C  CG  . ASN C 1 190 ? 102.523 12.504  25.993  1.00 35.57 ? 190 ASN C CG  1 
ATOM   4854 O  OD1 . ASN C 1 190 ? 103.154 11.610  25.429  1.00 35.99 ? 190 ASN C OD1 1 
ATOM   4855 N  ND2 . ASN C 1 190 ? 102.227 13.655  25.401  1.00 33.30 ? 190 ASN C ND2 1 
ATOM   4856 N  N   . VAL C 1 191 ? 99.838  11.097  29.615  1.00 31.52 ? 191 VAL C N   1 
ATOM   4857 C  CA  . VAL C 1 191 ? 99.565  10.932  31.037  1.00 29.86 ? 191 VAL C CA  1 
ATOM   4858 C  C   . VAL C 1 191 ? 98.479  9.912   31.384  1.00 30.70 ? 191 VAL C C   1 
ATOM   4859 O  O   . VAL C 1 191 ? 98.110  9.784   32.549  1.00 30.48 ? 191 VAL C O   1 
ATOM   4860 C  CB  . VAL C 1 191 ? 99.200  12.286  31.690  1.00 29.26 ? 191 VAL C CB  1 
ATOM   4861 C  CG1 . VAL C 1 191 ? 100.406 13.212  31.676  1.00 28.48 ? 191 VAL C CG1 1 
ATOM   4862 C  CG2 . VAL C 1 191 ? 98.038  12.929  30.943  1.00 25.81 ? 191 VAL C CG2 1 
ATOM   4863 N  N   . VAL C 1 192 ? 97.963  9.193   30.390  1.00 29.86 ? 192 VAL C N   1 
ATOM   4864 C  CA  . VAL C 1 192 ? 96.946  8.183   30.658  1.00 32.39 ? 192 VAL C CA  1 
ATOM   4865 C  C   . VAL C 1 192 ? 97.614  7.060   31.444  1.00 33.13 ? 192 VAL C C   1 
ATOM   4866 O  O   . VAL C 1 192 ? 98.619  6.505   30.999  1.00 31.54 ? 192 VAL C O   1 
ATOM   4867 C  CB  . VAL C 1 192 ? 96.371  7.578   29.364  1.00 33.34 ? 192 VAL C CB  1 
ATOM   4868 C  CG1 . VAL C 1 192 ? 95.240  6.626   29.698  1.00 37.58 ? 192 VAL C CG1 1 
ATOM   4869 C  CG2 . VAL C 1 192 ? 95.877  8.667   28.457  1.00 38.00 ? 192 VAL C CG2 1 
ATOM   4870 N  N   . ASN C 1 193 ? 97.060  6.736   32.612  1.00 32.49 ? 193 ASN C N   1 
ATOM   4871 C  CA  . ASN C 1 193 ? 97.600  5.678   33.463  1.00 31.72 ? 193 ASN C CA  1 
ATOM   4872 C  C   . ASN C 1 193 ? 97.097  4.320   32.983  1.00 31.84 ? 193 ASN C C   1 
ATOM   4873 O  O   . ASN C 1 193 ? 96.032  3.861   33.397  1.00 32.14 ? 193 ASN C O   1 
ATOM   4874 C  CB  . ASN C 1 193 ? 97.166  5.898   34.917  1.00 32.35 ? 193 ASN C CB  1 
ATOM   4875 C  CG  . ASN C 1 193 ? 97.808  4.909   35.877  1.00 33.67 ? 193 ASN C CG  1 
ATOM   4876 O  OD1 . ASN C 1 193 ? 98.221  3.818   35.481  1.00 34.66 ? 193 ASN C OD1 1 
ATOM   4877 N  ND2 . ASN C 1 193 ? 97.878  5.281   37.149  1.00 34.04 ? 193 ASN C ND2 1 
ATOM   4878 N  N   . TRP C 1 194 ? 97.864  3.673   32.112  1.00 31.77 ? 194 TRP C N   1 
ATOM   4879 C  CA  . TRP C 1 194 ? 97.460  2.376   31.587  1.00 32.31 ? 194 TRP C CA  1 
ATOM   4880 C  C   . TRP C 1 194 ? 97.424  1.268   32.634  1.00 32.03 ? 194 TRP C C   1 
ATOM   4881 O  O   . TRP C 1 194 ? 96.697  0.288   32.475  1.00 32.98 ? 194 TRP C O   1 
ATOM   4882 C  CB  . TRP C 1 194 ? 98.360  1.975   30.415  1.00 34.24 ? 194 TRP C CB  1 
ATOM   4883 C  CG  . TRP C 1 194 ? 98.152  2.850   29.207  1.00 33.77 ? 194 TRP C CG  1 
ATOM   4884 C  CD1 . TRP C 1 194 ? 99.046  3.727   28.661  1.00 33.82 ? 194 TRP C CD1 1 
ATOM   4885 C  CD2 . TRP C 1 194 ? 96.959  2.950   28.420  1.00 33.20 ? 194 TRP C CD2 1 
ATOM   4886 N  NE1 . TRP C 1 194 ? 98.482  4.368   27.582  1.00 33.42 ? 194 TRP C NE1 1 
ATOM   4887 C  CE2 . TRP C 1 194 ? 97.201  3.909   27.413  1.00 33.29 ? 194 TRP C CE2 1 
ATOM   4888 C  CE3 . TRP C 1 194 ? 95.707  2.323   28.468  1.00 34.36 ? 194 TRP C CE3 1 
ATOM   4889 C  CZ2 . TRP C 1 194 ? 96.237  4.257   26.460  1.00 33.95 ? 194 TRP C CZ2 1 
ATOM   4890 C  CZ3 . TRP C 1 194 ? 94.746  2.670   27.520  1.00 35.47 ? 194 TRP C CZ3 1 
ATOM   4891 C  CH2 . TRP C 1 194 ? 95.019  3.629   26.531  1.00 34.90 ? 194 TRP C CH2 1 
ATOM   4892 N  N   . ASP C 1 195 ? 98.194  1.417   33.706  1.00 32.33 ? 195 ASP C N   1 
ATOM   4893 C  CA  . ASP C 1 195 ? 98.188  0.408   34.761  1.00 34.25 ? 195 ASP C CA  1 
ATOM   4894 C  C   . ASP C 1 195 ? 96.829  0.395   35.450  1.00 34.29 ? 195 ASP C C   1 
ATOM   4895 O  O   . ASP C 1 195 ? 96.259  -0.666  35.697  1.00 33.11 ? 195 ASP C O   1 
ATOM   4896 C  CB  . ASP C 1 195 ? 99.278  0.692   35.794  1.00 36.94 ? 195 ASP C CB  1 
ATOM   4897 C  CG  . ASP C 1 195 ? 100.669 0.521   35.231  1.00 37.61 ? 195 ASP C CG  1 
ATOM   4898 O  OD1 . ASP C 1 195 ? 100.818 -0.191  34.214  1.00 38.24 ? 195 ASP C OD1 1 
ATOM   4899 O  OD2 . ASP C 1 195 ? 101.611 1.087   35.814  1.00 40.89 ? 195 ASP C OD2 1 
ATOM   4900 N  N   . GLU C 1 196 ? 96.310  1.583   35.755  1.00 33.43 ? 196 GLU C N   1 
ATOM   4901 C  CA  . GLU C 1 196 ? 95.011  1.693   36.407  1.00 33.21 ? 196 GLU C CA  1 
ATOM   4902 C  C   . GLU C 1 196 ? 93.913  1.222   35.461  1.00 31.36 ? 196 GLU C C   1 
ATOM   4903 O  O   . GLU C 1 196 ? 92.966  0.560   35.875  1.00 33.41 ? 196 GLU C O   1 
ATOM   4904 C  CB  . GLU C 1 196 ? 94.751  3.142   36.823  1.00 35.05 ? 196 GLU C CB  1 
ATOM   4905 C  CG  . GLU C 1 196 ? 93.473  3.344   37.624  1.00 38.73 ? 196 GLU C CG  1 
ATOM   4906 C  CD  . GLU C 1 196 ? 93.462  2.547   38.913  1.00 41.32 ? 196 GLU C CD  1 
ATOM   4907 O  OE1 . GLU C 1 196 ? 94.502  2.524   39.603  1.00 42.97 ? 196 GLU C OE1 1 
ATOM   4908 O  OE2 . GLU C 1 196 ? 92.413  1.954   39.241  1.00 42.71 ? 196 GLU C OE2 1 
ATOM   4909 N  N   . ALA C 1 197 ? 94.043  1.567   34.184  1.00 31.61 ? 197 ALA C N   1 
ATOM   4910 C  CA  . ALA C 1 197 ? 93.062  1.160   33.188  1.00 31.16 ? 197 ALA C CA  1 
ATOM   4911 C  C   . ALA C 1 197 ? 93.029  -0.367  33.110  1.00 33.02 ? 197 ALA C C   1 
ATOM   4912 O  O   . ALA C 1 197 ? 91.961  -0.972  33.036  1.00 32.03 ? 197 ALA C O   1 
ATOM   4913 C  CB  . ALA C 1 197 ? 93.416  1.753   31.826  1.00 30.29 ? 197 ALA C CB  1 
ATOM   4914 N  N   . ALA C 1 198 ? 94.206  -0.986  33.130  1.00 34.54 ? 198 ALA C N   1 
ATOM   4915 C  CA  . ALA C 1 198 ? 94.305  -2.442  33.070  1.00 35.65 ? 198 ALA C CA  1 
ATOM   4916 C  C   . ALA C 1 198 ? 93.637  -3.056  34.293  1.00 36.11 ? 198 ALA C C   1 
ATOM   4917 O  O   . ALA C 1 198 ? 92.885  -4.023  34.181  1.00 36.50 ? 198 ALA C O   1 
ATOM   4918 C  CB  . ALA C 1 198 ? 95.767  -2.867  33.011  1.00 36.67 ? 198 ALA C CB  1 
ATOM   4919 N  N   . ALA C 1 199 ? 93.916  -2.486  35.461  1.00 36.61 ? 199 ALA C N   1 
ATOM   4920 C  CA  . ALA C 1 199 ? 93.341  -2.976  36.708  1.00 36.96 ? 199 ALA C CA  1 
ATOM   4921 C  C   . ALA C 1 199 ? 91.817  -2.952  36.655  1.00 37.67 ? 199 ALA C C   1 
ATOM   4922 O  O   . ALA C 1 199 ? 91.161  -3.919  37.044  1.00 38.06 ? 199 ALA C O   1 
ATOM   4923 C  CB  . ALA C 1 199 ? 93.836  -2.138  37.874  1.00 36.51 ? 199 ALA C CB  1 
ATOM   4924 N  N   . ARG C 1 200 ? 91.253  -1.847  36.175  1.00 37.44 ? 200 ARG C N   1 
ATOM   4925 C  CA  . ARG C 1 200 ? 89.804  -1.720  36.079  1.00 37.90 ? 200 ARG C CA  1 
ATOM   4926 C  C   . ARG C 1 200 ? 89.238  -2.708  35.069  1.00 38.88 ? 200 ARG C C   1 
ATOM   4927 O  O   . ARG C 1 200 ? 88.153  -3.252  35.267  1.00 38.70 ? 200 ARG C O   1 
ATOM   4928 C  CB  . ARG C 1 200 ? 89.411  -0.295  35.677  1.00 36.13 ? 200 ARG C CB  1 
ATOM   4929 C  CG  . ARG C 1 200 ? 89.776  0.775   36.698  1.00 34.75 ? 200 ARG C CG  1 
ATOM   4930 C  CD  . ARG C 1 200 ? 89.282  2.146   36.246  1.00 34.46 ? 200 ARG C CD  1 
ATOM   4931 N  NE  . ARG C 1 200 ? 87.826  2.190   36.133  1.00 33.58 ? 200 ARG C NE  1 
ATOM   4932 C  CZ  . ARG C 1 200 ? 87.001  2.362   37.161  1.00 35.41 ? 200 ARG C CZ  1 
ATOM   4933 N  NH1 . ARG C 1 200 ? 87.489  2.515   38.386  1.00 34.44 ? 200 ARG C NH1 1 
ATOM   4934 N  NH2 . ARG C 1 200 ? 85.688  2.374   36.966  1.00 33.92 ? 200 ARG C NH2 1 
ATOM   4935 N  N   . PHE C 1 201 ? 89.974  -2.938  33.985  1.00 40.42 ? 201 PHE C N   1 
ATOM   4936 C  CA  . PHE C 1 201 ? 89.532  -3.869  32.952  1.00 42.94 ? 201 PHE C CA  1 
ATOM   4937 C  C   . PHE C 1 201 ? 89.485  -5.293  33.502  1.00 44.52 ? 201 PHE C C   1 
ATOM   4938 O  O   . PHE C 1 201 ? 88.593  -6.072  33.167  1.00 44.16 ? 201 PHE C O   1 
ATOM   4939 C  CB  . PHE C 1 201 ? 90.474  -3.819  31.745  1.00 43.75 ? 201 PHE C CB  1 
ATOM   4940 C  CG  . PHE C 1 201 ? 90.142  -4.825  30.677  1.00 44.99 ? 201 PHE C CG  1 
ATOM   4941 C  CD1 . PHE C 1 201 ? 88.908  -4.795  30.035  1.00 45.80 ? 201 PHE C CD1 1 
ATOM   4942 C  CD2 . PHE C 1 201 ? 91.052  -5.817  30.329  1.00 46.54 ? 201 PHE C CD2 1 
ATOM   4943 C  CE1 . PHE C 1 201 ? 88.585  -5.738  29.065  1.00 46.85 ? 201 PHE C CE1 1 
ATOM   4944 C  CE2 . PHE C 1 201 ? 90.738  -6.765  29.360  1.00 46.44 ? 201 PHE C CE2 1 
ATOM   4945 C  CZ  . PHE C 1 201 ? 89.503  -6.726  28.728  1.00 46.83 ? 201 PHE C CZ  1 
ATOM   4946 N  N   . ALA C 1 202 ? 90.452  -5.624  34.351  1.00 45.94 ? 202 ALA C N   1 
ATOM   4947 C  CA  . ALA C 1 202 ? 90.519  -6.950  34.950  1.00 48.97 ? 202 ALA C CA  1 
ATOM   4948 C  C   . ALA C 1 202 ? 89.354  -7.167  35.914  1.00 51.09 ? 202 ALA C C   1 
ATOM   4949 O  O   . ALA C 1 202 ? 88.671  -8.190  35.856  1.00 51.76 ? 202 ALA C O   1 
ATOM   4950 C  CB  . ALA C 1 202 ? 91.844  -7.123  35.677  1.00 47.88 ? 202 ALA C CB  1 
ATOM   4951 N  N   . ALA C 1 203 ? 89.129  -6.203  36.800  1.00 52.61 ? 203 ALA C N   1 
ATOM   4952 C  CA  . ALA C 1 203 ? 88.049  -6.297  37.773  1.00 54.22 ? 203 ALA C CA  1 
ATOM   4953 C  C   . ALA C 1 203 ? 86.682  -6.317  37.091  1.00 56.02 ? 203 ALA C C   1 
ATOM   4954 O  O   . ALA C 1 203 ? 85.781  -7.048  37.505  1.00 55.68 ? 203 ALA C O   1 
ATOM   4955 C  CB  . ALA C 1 203 ? 88.129  -5.133  38.750  1.00 53.96 ? 203 ALA C CB  1 
ATOM   4956 N  N   . LYS C 1 204 ? 86.538  -5.507  36.046  1.00 58.14 ? 204 LYS C N   1 
ATOM   4957 C  CA  . LYS C 1 204 ? 85.290  -5.413  35.291  1.00 60.15 ? 204 LYS C CA  1 
ATOM   4958 C  C   . LYS C 1 204 ? 84.111  -4.942  36.135  1.00 61.08 ? 204 LYS C C   1 
ATOM   4959 O  O   . LYS C 1 204 ? 82.969  -4.934  35.671  1.00 60.98 ? 204 LYS C O   1 
ATOM   4960 C  CB  . LYS C 1 204 ? 84.952  -6.761  34.649  1.00 61.19 ? 204 LYS C CB  1 
ATOM   4961 C  CG  . LYS C 1 204 ? 85.900  -7.168  33.536  1.00 63.39 ? 204 LYS C CG  1 
ATOM   4962 C  CD  . LYS C 1 204 ? 85.448  -8.450  32.856  1.00 64.86 ? 204 LYS C CD  1 
ATOM   4963 C  CE  . LYS C 1 204 ? 86.365  -8.812  31.697  1.00 66.28 ? 204 LYS C CE  1 
ATOM   4964 N  NZ  . LYS C 1 204 ? 87.775  -9.006  32.140  1.00 66.52 ? 204 LYS C NZ  1 
ATOM   4965 N  N   . LYS C 1 205 ? 84.387  -4.541  37.372  1.00 62.58 ? 205 LYS C N   1 
ATOM   4966 C  CA  . LYS C 1 205 ? 83.333  -4.073  38.264  1.00 64.24 ? 205 LYS C CA  1 
ATOM   4967 C  C   . LYS C 1 205 ? 83.870  -2.988  39.202  1.00 64.55 ? 205 LYS C C   1 
ATOM   4968 O  O   . LYS C 1 205 ? 85.111  -2.843  39.290  1.00 63.99 ? 205 LYS C O   1 
ATOM   4969 C  CB  . LYS C 1 205 ? 82.789  -5.250  39.081  1.00 65.66 ? 205 LYS C CB  1 
ATOM   4970 C  CG  . LYS C 1 205 ? 81.345  -5.094  39.540  1.00 68.32 ? 205 LYS C CG  1 
ATOM   4971 C  CD  . LYS C 1 205 ? 80.380  -5.133  38.358  1.00 70.57 ? 205 LYS C CD  1 
ATOM   4972 C  CE  . LYS C 1 205 ? 78.929  -5.064  38.822  1.00 71.69 ? 205 LYS C CE  1 
ATOM   4973 N  NZ  . LYS C 1 205 ? 77.974  -5.111  37.678  1.00 72.76 ? 205 LYS C NZ  1 
ATOM   4974 O  OXT . LYS C 1 205 ? 83.046  -2.297  39.844  1.00 64.34 ? 205 LYS C OXT 1 
ATOM   4975 N  N   . SER D 1 1   ? 76.670  33.306  2.707   1.00 32.54 ? 1   SER D N   1 
ATOM   4976 C  CA  . SER D 1 1   ? 77.642  32.885  3.752   1.00 31.20 ? 1   SER D CA  1 
ATOM   4977 C  C   . SER D 1 1   ? 77.733  33.957  4.824   1.00 30.63 ? 1   SER D C   1 
ATOM   4978 O  O   . SER D 1 1   ? 77.483  35.138  4.561   1.00 31.28 ? 1   SER D O   1 
ATOM   4979 C  CB  . SER D 1 1   ? 79.027  32.661  3.139   1.00 33.17 ? 1   SER D CB  1 
ATOM   4980 O  OG  . SER D 1 1   ? 79.627  33.885  2.748   1.00 28.91 ? 1   SER D OG  1 
ATOM   4981 N  N   . TYR D 1 2   ? 78.095  33.544  6.032   1.00 27.00 ? 2   TYR D N   1 
ATOM   4982 C  CA  . TYR D 1 2   ? 78.217  34.470  7.144   1.00 24.56 ? 2   TYR D CA  1 
ATOM   4983 C  C   . TYR D 1 2   ? 79.613  35.058  7.203   1.00 23.87 ? 2   TYR D C   1 
ATOM   4984 O  O   . TYR D 1 2   ? 80.594  34.380  6.907   1.00 21.41 ? 2   TYR D O   1 
ATOM   4985 C  CB  . TYR D 1 2   ? 77.929  33.767  8.468   1.00 25.43 ? 2   TYR D CB  1 
ATOM   4986 C  CG  . TYR D 1 2   ? 76.573  33.115  8.554   1.00 26.36 ? 2   TYR D CG  1 
ATOM   4987 C  CD1 . TYR D 1 2   ? 75.435  33.745  8.048   1.00 27.82 ? 2   TYR D CD1 1 
ATOM   4988 C  CD2 . TYR D 1 2   ? 76.419  31.885  9.184   1.00 27.22 ? 2   TYR D CD2 1 
ATOM   4989 C  CE1 . TYR D 1 2   ? 74.171  33.155  8.170   1.00 30.69 ? 2   TYR D CE1 1 
ATOM   4990 C  CE2 . TYR D 1 2   ? 75.166  31.293  9.316   1.00 30.10 ? 2   TYR D CE2 1 
ATOM   4991 C  CZ  . TYR D 1 2   ? 74.049  31.931  8.807   1.00 29.83 ? 2   TYR D CZ  1 
ATOM   4992 O  OH  . TYR D 1 2   ? 72.817  31.338  8.948   1.00 32.09 ? 2   TYR D OH  1 
ATOM   4993 N  N   . THR D 1 3   ? 79.689  36.327  7.587   1.00 23.64 ? 3   THR D N   1 
ATOM   4994 C  CA  . THR D 1 3   ? 80.962  37.016  7.707   1.00 23.67 ? 3   THR D CA  1 
ATOM   4995 C  C   . THR D 1 3   ? 81.219  37.271  9.183   1.00 23.45 ? 3   THR D C   1 
ATOM   4996 O  O   . THR D 1 3   ? 80.313  37.664  9.914   1.00 24.92 ? 3   THR D O   1 
ATOM   4997 C  CB  . THR D 1 3   ? 80.935  38.369  6.956   1.00 24.86 ? 3   THR D CB  1 
ATOM   4998 O  OG1 . THR D 1 3   ? 80.806  38.132  5.549   1.00 22.64 ? 3   THR D OG1 1 
ATOM   4999 C  CG2 . THR D 1 3   ? 82.212  39.161  7.217   1.00 24.04 ? 3   THR D CG2 1 
ATOM   5000 N  N   . LEU D 1 4   ? 82.441  37.014  9.633   1.00 22.34 ? 4   LEU D N   1 
ATOM   5001 C  CA  . LEU D 1 4   ? 82.782  37.271  11.025  1.00 22.65 ? 4   LEU D CA  1 
ATOM   5002 C  C   . LEU D 1 4   ? 82.768  38.789  11.206  1.00 24.71 ? 4   LEU D C   1 
ATOM   5003 O  O   . LEU D 1 4   ? 83.577  39.491  10.604  1.00 21.90 ? 4   LEU D O   1 
ATOM   5004 C  CB  . LEU D 1 4   ? 84.178  36.750  11.332  1.00 22.43 ? 4   LEU D CB  1 
ATOM   5005 C  CG  . LEU D 1 4   ? 84.641  36.985  12.772  1.00 24.30 ? 4   LEU D CG  1 
ATOM   5006 C  CD1 . LEU D 1 4   ? 83.823  36.133  13.721  1.00 23.81 ? 4   LEU D CD1 1 
ATOM   5007 C  CD2 . LEU D 1 4   ? 86.106  36.643  12.893  1.00 22.68 ? 4   LEU D CD2 1 
ATOM   5008 N  N   . PRO D 1 5   ? 81.851  39.317  12.033  1.00 26.51 ? 5   PRO D N   1 
ATOM   5009 C  CA  . PRO D 1 5   ? 81.818  40.770  12.219  1.00 27.57 ? 5   PRO D CA  1 
ATOM   5010 C  C   . PRO D 1 5   ? 83.019  41.268  13.009  1.00 29.32 ? 5   PRO D C   1 
ATOM   5011 O  O   . PRO D 1 5   ? 83.536  40.570  13.878  1.00 29.55 ? 5   PRO D O   1 
ATOM   5012 C  CB  . PRO D 1 5   ? 80.516  40.982  12.975  1.00 28.03 ? 5   PRO D CB  1 
ATOM   5013 C  CG  . PRO D 1 5   ? 80.477  39.783  13.866  1.00 28.17 ? 5   PRO D CG  1 
ATOM   5014 C  CD  . PRO D 1 5   ? 80.872  38.656  12.915  1.00 27.32 ? 5   PRO D CD  1 
ATOM   5015 N  N   . SER D 1 6   ? 83.482  42.470  12.695  1.00 29.94 ? 6   SER D N   1 
ATOM   5016 C  CA  . SER D 1 6   ? 84.601  43.027  13.434  1.00 31.95 ? 6   SER D CA  1 
ATOM   5017 C  C   . SER D 1 6   ? 83.975  43.605  14.705  1.00 29.50 ? 6   SER D C   1 
ATOM   5018 O  O   . SER D 1 6   ? 82.777  43.888  14.733  1.00 29.66 ? 6   SER D O   1 
ATOM   5019 C  CB  . SER D 1 6   ? 85.296  44.116  12.610  1.00 34.82 ? 6   SER D CB  1 
ATOM   5020 O  OG  . SER D 1 6   ? 84.359  45.065  12.138  1.00 40.03 ? 6   SER D OG  1 
ATOM   5021 N  N   . LEU D 1 7   ? 84.767  43.741  15.760  1.00 29.84 ? 7   LEU D N   1 
ATOM   5022 C  CA  . LEU D 1 7   ? 84.265  44.272  17.025  1.00 31.97 ? 7   LEU D CA  1 
ATOM   5023 C  C   . LEU D 1 7   ? 83.991  45.773  16.929  1.00 33.14 ? 7   LEU D C   1 
ATOM   5024 O  O   . LEU D 1 7   ? 84.644  46.482  16.162  1.00 32.53 ? 7   LEU D O   1 
ATOM   5025 C  CB  . LEU D 1 7   ? 85.278  43.995  18.140  1.00 32.85 ? 7   LEU D CB  1 
ATOM   5026 C  CG  . LEU D 1 7   ? 84.958  42.891  19.153  1.00 35.70 ? 7   LEU D CG  1 
ATOM   5027 C  CD1 . LEU D 1 7   ? 84.442  41.640  18.460  1.00 33.11 ? 7   LEU D CD1 1 
ATOM   5028 C  CD2 . LEU D 1 7   ? 86.209  42.591  19.959  1.00 35.90 ? 7   LEU D CD2 1 
ATOM   5029 N  N   . PRO D 1 8   ? 83.009  46.275  17.698  1.00 33.94 ? 8   PRO D N   1 
ATOM   5030 C  CA  . PRO D 1 8   ? 82.692  47.708  17.659  1.00 33.86 ? 8   PRO D CA  1 
ATOM   5031 C  C   . PRO D 1 8   ? 83.634  48.552  18.522  1.00 33.74 ? 8   PRO D C   1 
ATOM   5032 O  O   . PRO D 1 8   ? 83.349  49.711  18.829  1.00 35.30 ? 8   PRO D O   1 
ATOM   5033 C  CB  . PRO D 1 8   ? 81.245  47.750  18.142  1.00 35.29 ? 8   PRO D CB  1 
ATOM   5034 C  CG  . PRO D 1 8   ? 81.186  46.617  19.111  1.00 36.15 ? 8   PRO D CG  1 
ATOM   5035 C  CD  . PRO D 1 8   ? 81.981  45.523  18.444  1.00 34.07 ? 8   PRO D CD  1 
ATOM   5036 N  N   . TYR D 1 9   ? 84.766  47.963  18.890  1.00 31.66 ? 9   TYR D N   1 
ATOM   5037 C  CA  . TYR D 1 9   ? 85.763  48.626  19.719  1.00 30.62 ? 9   TYR D CA  1 
ATOM   5038 C  C   . TYR D 1 9   ? 87.036  47.809  19.669  1.00 31.34 ? 9   TYR D C   1 
ATOM   5039 O  O   . TYR D 1 9   ? 87.043  46.705  19.123  1.00 31.23 ? 9   TYR D O   1 
ATOM   5040 C  CB  . TYR D 1 9   ? 85.262  48.719  21.161  1.00 33.70 ? 9   TYR D CB  1 
ATOM   5041 C  CG  . TYR D 1 9   ? 84.509  47.482  21.614  1.00 32.87 ? 9   TYR D CG  1 
ATOM   5042 C  CD1 . TYR D 1 9   ? 85.167  46.269  21.805  1.00 33.33 ? 9   TYR D CD1 1 
ATOM   5043 C  CD2 . TYR D 1 9   ? 83.126  47.515  21.791  1.00 34.51 ? 9   TYR D CD2 1 
ATOM   5044 C  CE1 . TYR D 1 9   ? 84.461  45.114  22.156  1.00 33.62 ? 9   TYR D CE1 1 
ATOM   5045 C  CE2 . TYR D 1 9   ? 82.412  46.368  22.140  1.00 34.46 ? 9   TYR D CE2 1 
ATOM   5046 C  CZ  . TYR D 1 9   ? 83.086  45.173  22.317  1.00 33.62 ? 9   TYR D CZ  1 
ATOM   5047 O  OH  . TYR D 1 9   ? 82.378  44.037  22.622  1.00 35.85 ? 9   TYR D OH  1 
ATOM   5048 N  N   . ALA D 1 10  ? 88.114  48.349  20.229  1.00 30.49 ? 10  ALA D N   1 
ATOM   5049 C  CA  . ALA D 1 10  ? 89.389  47.643  20.252  1.00 31.10 ? 10  ALA D CA  1 
ATOM   5050 C  C   . ALA D 1 10  ? 89.300  46.530  21.290  1.00 31.89 ? 10  ALA D C   1 
ATOM   5051 O  O   . ALA D 1 10  ? 88.435  46.565  22.164  1.00 30.70 ? 10  ALA D O   1 
ATOM   5052 C  CB  . ALA D 1 10  ? 90.518  48.602  20.606  1.00 31.79 ? 10  ALA D CB  1 
ATOM   5053 N  N   . TYR D 1 11  ? 90.199  45.555  21.194  1.00 33.07 ? 11  TYR D N   1 
ATOM   5054 C  CA  . TYR D 1 11  ? 90.214  44.416  22.107  1.00 34.88 ? 11  TYR D CA  1 
ATOM   5055 C  C   . TYR D 1 11  ? 90.413  44.762  23.578  1.00 35.37 ? 11  TYR D C   1 
ATOM   5056 O  O   . TYR D 1 11  ? 90.006  44.002  24.454  1.00 33.10 ? 11  TYR D O   1 
ATOM   5057 C  CB  . TYR D 1 11  ? 91.282  43.403  21.672  1.00 36.59 ? 11  TYR D CB  1 
ATOM   5058 C  CG  . TYR D 1 11  ? 90.916  42.655  20.409  1.00 38.51 ? 11  TYR D CG  1 
ATOM   5059 C  CD1 . TYR D 1 11  ? 89.728  41.929  20.330  1.00 40.76 ? 11  TYR D CD1 1 
ATOM   5060 C  CD2 . TYR D 1 11  ? 91.739  42.695  19.285  1.00 41.24 ? 11  TYR D CD2 1 
ATOM   5061 C  CE1 . TYR D 1 11  ? 89.361  41.263  19.159  1.00 41.26 ? 11  TYR D CE1 1 
ATOM   5062 C  CE2 . TYR D 1 11  ? 91.382  42.033  18.105  1.00 41.80 ? 11  TYR D CE2 1 
ATOM   5063 C  CZ  . TYR D 1 11  ? 90.191  41.322  18.051  1.00 42.47 ? 11  TYR D CZ  1 
ATOM   5064 O  OH  . TYR D 1 11  ? 89.819  40.688  16.885  1.00 42.35 ? 11  TYR D OH  1 
ATOM   5065 N  N   . ASP D 1 12  ? 91.030  45.904  23.859  1.00 35.12 ? 12  ASP D N   1 
ATOM   5066 C  CA  . ASP D 1 12  ? 91.262  46.288  25.246  1.00 35.43 ? 12  ASP D CA  1 
ATOM   5067 C  C   . ASP D 1 12  ? 90.306  47.373  25.727  1.00 35.42 ? 12  ASP D C   1 
ATOM   5068 O  O   . ASP D 1 12  ? 90.485  47.925  26.808  1.00 37.57 ? 12  ASP D O   1 
ATOM   5069 C  CB  . ASP D 1 12  ? 92.712  46.752  25.423  1.00 37.60 ? 12  ASP D CB  1 
ATOM   5070 C  CG  . ASP D 1 12  ? 93.038  48.009  24.621  1.00 38.88 ? 12  ASP D CG  1 
ATOM   5071 O  OD1 . ASP D 1 12  ? 92.184  48.477  23.834  1.00 37.07 ? 12  ASP D OD1 1 
ATOM   5072 O  OD2 . ASP D 1 12  ? 94.163  48.529  24.779  1.00 41.03 ? 12  ASP D OD2 1 
ATOM   5073 N  N   . ALA D 1 13  ? 89.280  47.657  24.932  1.00 34.98 ? 13  ALA D N   1 
ATOM   5074 C  CA  . ALA D 1 13  ? 88.303  48.697  25.253  1.00 34.97 ? 13  ALA D CA  1 
ATOM   5075 C  C   . ALA D 1 13  ? 87.396  48.420  26.449  1.00 36.29 ? 13  ALA D C   1 
ATOM   5076 O  O   . ALA D 1 13  ? 86.704  49.325  26.927  1.00 35.15 ? 13  ALA D O   1 
ATOM   5077 C  CB  . ALA D 1 13  ? 87.448  48.990  24.026  1.00 35.25 ? 13  ALA D CB  1 
ATOM   5078 N  N   . LEU D 1 14  ? 87.383  47.181  26.931  1.00 35.18 ? 14  LEU D N   1 
ATOM   5079 C  CA  . LEU D 1 14  ? 86.540  46.838  28.065  1.00 34.61 ? 14  LEU D CA  1 
ATOM   5080 C  C   . LEU D 1 14  ? 87.342  46.647  29.350  1.00 34.45 ? 14  LEU D C   1 
ATOM   5081 O  O   . LEU D 1 14  ? 86.786  46.274  30.384  1.00 34.54 ? 14  LEU D O   1 
ATOM   5082 C  CB  . LEU D 1 14  ? 85.723  45.579  27.752  1.00 35.40 ? 14  LEU D CB  1 
ATOM   5083 C  CG  . LEU D 1 14  ? 84.773  45.704  26.553  1.00 35.84 ? 14  LEU D CG  1 
ATOM   5084 C  CD1 . LEU D 1 14  ? 84.011  44.402  26.363  1.00 36.24 ? 14  LEU D CD1 1 
ATOM   5085 C  CD2 . LEU D 1 14  ? 83.799  46.858  26.778  1.00 35.59 ? 14  LEU D CD2 1 
ATOM   5086 N  N   . GLU D 1 15  ? 88.649  46.893  29.281  1.00 34.00 ? 15  GLU D N   1 
ATOM   5087 C  CA  . GLU D 1 15  ? 89.515  46.782  30.456  1.00 35.51 ? 15  GLU D CA  1 
ATOM   5088 C  C   . GLU D 1 15  ? 89.096  47.870  31.445  1.00 36.77 ? 15  GLU D C   1 
ATOM   5089 O  O   . GLU D 1 15  ? 88.611  48.927  31.041  1.00 36.71 ? 15  GLU D O   1 
ATOM   5090 C  CB  . GLU D 1 15  ? 90.979  46.993  30.060  1.00 34.95 ? 15  GLU D CB  1 
ATOM   5091 C  CG  . GLU D 1 15  ? 91.592  45.841  29.286  1.00 34.15 ? 15  GLU D CG  1 
ATOM   5092 C  CD  . GLU D 1 15  ? 92.073  44.736  30.191  1.00 35.24 ? 15  GLU D CD  1 
ATOM   5093 O  OE1 . GLU D 1 15  ? 91.745  44.775  31.393  1.00 36.95 ? 15  GLU D OE1 1 
ATOM   5094 O  OE2 . GLU D 1 15  ? 92.777  43.827  29.704  1.00 34.81 ? 15  GLU D OE2 1 
ATOM   5095 N  N   . PRO D 1 16  ? 89.294  47.639  32.753  1.00 37.92 ? 16  PRO D N   1 
ATOM   5096 C  CA  . PRO D 1 16  ? 89.879  46.453  33.386  1.00 38.35 ? 16  PRO D CA  1 
ATOM   5097 C  C   . PRO D 1 16  ? 88.828  45.431  33.825  1.00 37.20 ? 16  PRO D C   1 
ATOM   5098 O  O   . PRO D 1 16  ? 89.070  44.650  34.742  1.00 38.01 ? 16  PRO D O   1 
ATOM   5099 C  CB  . PRO D 1 16  ? 90.601  47.049  34.579  1.00 38.74 ? 16  PRO D CB  1 
ATOM   5100 C  CG  . PRO D 1 16  ? 89.580  48.052  35.053  1.00 38.04 ? 16  PRO D CG  1 
ATOM   5101 C  CD  . PRO D 1 16  ? 89.075  48.698  33.757  1.00 38.01 ? 16  PRO D CD  1 
ATOM   5102 N  N   . HIS D 1 17  ? 87.670  45.444  33.176  1.00 36.52 ? 17  HIS D N   1 
ATOM   5103 C  CA  . HIS D 1 17  ? 86.589  44.521  33.520  1.00 35.85 ? 17  HIS D CA  1 
ATOM   5104 C  C   . HIS D 1 17  ? 86.739  43.170  32.819  1.00 35.05 ? 17  HIS D C   1 
ATOM   5105 O  O   . HIS D 1 17  ? 86.808  42.131  33.481  1.00 35.00 ? 17  HIS D O   1 
ATOM   5106 C  CB  . HIS D 1 17  ? 85.251  45.168  33.180  1.00 37.10 ? 17  HIS D CB  1 
ATOM   5107 C  CG  . HIS D 1 17  ? 85.082  46.526  33.784  1.00 39.93 ? 17  HIS D CG  1 
ATOM   5108 N  ND1 . HIS D 1 17  ? 85.103  46.741  35.145  1.00 40.47 ? 17  HIS D ND1 1 
ATOM   5109 C  CD2 . HIS D 1 17  ? 84.937  47.745  33.213  1.00 41.33 ? 17  HIS D CD2 1 
ATOM   5110 C  CE1 . HIS D 1 17  ? 84.981  48.034  35.387  1.00 41.90 ? 17  HIS D CE1 1 
ATOM   5111 N  NE2 . HIS D 1 17  ? 84.879  48.666  34.232  1.00 42.23 ? 17  HIS D NE2 1 
ATOM   5112 N  N   . PHE D 1 18  ? 86.772  43.184  31.489  1.00 32.77 ? 18  PHE D N   1 
ATOM   5113 C  CA  . PHE D 1 18  ? 86.963  41.962  30.702  1.00 31.26 ? 18  PHE D CA  1 
ATOM   5114 C  C   . PHE D 1 18  ? 88.364  42.076  30.104  1.00 30.58 ? 18  PHE D C   1 
ATOM   5115 O  O   . PHE D 1 18  ? 88.678  43.076  29.456  1.00 32.27 ? 18  PHE D O   1 
ATOM   5116 C  CB  . PHE D 1 18  ? 85.929  41.866  29.573  1.00 30.21 ? 18  PHE D CB  1 
ATOM   5117 C  CG  . PHE D 1 18  ? 84.555  41.428  30.022  1.00 29.54 ? 18  PHE D CG  1 
ATOM   5118 C  CD1 . PHE D 1 18  ? 84.216  41.383  31.372  1.00 30.25 ? 18  PHE D CD1 1 
ATOM   5119 C  CD2 . PHE D 1 18  ? 83.591  41.078  29.081  1.00 27.91 ? 18  PHE D CD2 1 
ATOM   5120 C  CE1 . PHE D 1 18  ? 82.934  41.000  31.778  1.00 28.45 ? 18  PHE D CE1 1 
ATOM   5121 C  CE2 . PHE D 1 18  ? 82.310  40.695  29.476  1.00 29.03 ? 18  PHE D CE2 1 
ATOM   5122 C  CZ  . PHE D 1 18  ? 81.983  40.657  30.829  1.00 28.61 ? 18  PHE D CZ  1 
ATOM   5123 N  N   . ASP D 1 19  ? 89.199  41.064  30.318  1.00 29.05 ? 19  ASP D N   1 
ATOM   5124 C  CA  . ASP D 1 19  ? 90.567  41.085  29.814  1.00 28.31 ? 19  ASP D CA  1 
ATOM   5125 C  C   . ASP D 1 19  ? 90.705  41.065  28.294  1.00 30.10 ? 19  ASP D C   1 
ATOM   5126 O  O   . ASP D 1 19  ? 89.924  40.428  27.577  1.00 26.18 ? 19  ASP D O   1 
ATOM   5127 C  CB  . ASP D 1 19  ? 91.384  39.931  30.418  1.00 28.63 ? 19  ASP D CB  1 
ATOM   5128 C  CG  . ASP D 1 19  ? 90.762  38.570  30.164  1.00 27.44 ? 19  ASP D CG  1 
ATOM   5129 O  OD1 . ASP D 1 19  ? 89.588  38.384  30.527  1.00 25.17 ? 19  ASP D OD1 1 
ATOM   5130 O  OD2 . ASP D 1 19  ? 91.453  37.686  29.611  1.00 27.22 ? 19  ASP D OD2 1 
ATOM   5131 N  N   . LYS D 1 20  ? 91.719  41.782  27.820  1.00 28.44 ? 20  LYS D N   1 
ATOM   5132 C  CA  . LYS D 1 20  ? 92.025  41.889  26.404  1.00 29.33 ? 20  LYS D CA  1 
ATOM   5133 C  C   . LYS D 1 20  ? 92.381  40.546  25.770  1.00 28.12 ? 20  LYS D C   1 
ATOM   5134 O  O   . LYS D 1 20  ? 91.994  40.274  24.633  1.00 28.01 ? 20  LYS D O   1 
ATOM   5135 C  CB  . LYS D 1 20  ? 93.185  42.874  26.218  1.00 34.38 ? 20  LYS D CB  1 
ATOM   5136 C  CG  . LYS D 1 20  ? 93.807  42.876  24.836  1.00 39.26 ? 20  LYS D CG  1 
ATOM   5137 C  CD  . LYS D 1 20  ? 95.041  43.774  24.808  1.00 43.85 ? 20  LYS D CD  1 
ATOM   5138 C  CE  . LYS D 1 20  ? 95.673  43.777  23.426  1.00 47.02 ? 20  LYS D CE  1 
ATOM   5139 N  NZ  . LYS D 1 20  ? 94.706  44.243  22.386  1.00 48.25 ? 20  LYS D NZ  1 
ATOM   5140 N  N   . GLN D 1 21  ? 93.125  39.710  26.491  1.00 26.30 ? 21  GLN D N   1 
ATOM   5141 C  CA  . GLN D 1 21  ? 93.524  38.417  25.943  1.00 27.24 ? 21  GLN D CA  1 
ATOM   5142 C  C   . GLN D 1 21  ? 92.313  37.549  25.599  1.00 25.46 ? 21  GLN D C   1 
ATOM   5143 O  O   . GLN D 1 21  ? 92.279  36.907  24.548  1.00 24.68 ? 21  GLN D O   1 
ATOM   5144 C  CB  . GLN D 1 21  ? 94.436  37.668  26.913  1.00 30.15 ? 21  GLN D CB  1 
ATOM   5145 C  CG  . GLN D 1 21  ? 95.061  36.434  26.295  1.00 36.67 ? 21  GLN D CG  1 
ATOM   5146 C  CD  . GLN D 1 21  ? 95.826  35.590  27.294  1.00 41.07 ? 21  GLN D CD  1 
ATOM   5147 O  OE1 . GLN D 1 21  ? 96.503  34.629  26.919  1.00 45.08 ? 21  GLN D OE1 1 
ATOM   5148 N  NE2 . GLN D 1 21  ? 95.720  35.938  28.574  1.00 42.46 ? 21  GLN D NE2 1 
ATOM   5149 N  N   . THR D 1 22  ? 91.323  37.533  26.483  1.00 23.95 ? 22  THR D N   1 
ATOM   5150 C  CA  . THR D 1 22  ? 90.115  36.752  26.253  1.00 23.21 ? 22  THR D CA  1 
ATOM   5151 C  C   . THR D 1 22  ? 89.302  37.327  25.102  1.00 24.00 ? 22  THR D C   1 
ATOM   5152 O  O   . THR D 1 22  ? 88.817  36.585  24.248  1.00 24.55 ? 22  THR D O   1 
ATOM   5153 C  CB  . THR D 1 22  ? 89.241  36.707  27.517  1.00 22.32 ? 22  THR D CB  1 
ATOM   5154 O  OG1 . THR D 1 22  ? 89.901  35.914  28.507  1.00 23.07 ? 22  THR D OG1 1 
ATOM   5155 C  CG2 . THR D 1 22  ? 87.881  36.102  27.216  1.00 20.06 ? 22  THR D CG2 1 
ATOM   5156 N  N   . MET D 1 23  ? 89.151  38.646  25.070  1.00 23.92 ? 23  MET D N   1 
ATOM   5157 C  CA  . MET D 1 23  ? 88.389  39.272  23.996  1.00 25.47 ? 23  MET D CA  1 
ATOM   5158 C  C   . MET D 1 23  ? 88.940  38.861  22.631  1.00 24.85 ? 23  MET D C   1 
ATOM   5159 O  O   . MET D 1 23  ? 88.184  38.560  21.709  1.00 25.57 ? 23  MET D O   1 
ATOM   5160 C  CB  . MET D 1 23  ? 88.426  40.800  24.128  1.00 27.97 ? 23  MET D CB  1 
ATOM   5161 C  CG  . MET D 1 23  ? 87.694  41.353  25.338  1.00 28.82 ? 23  MET D CG  1 
ATOM   5162 S  SD  . MET D 1 23  ? 85.941  40.932  25.353  1.00 29.77 ? 23  MET D SD  1 
ATOM   5163 C  CE  . MET D 1 23  ? 85.350  41.861  23.936  1.00 31.42 ? 23  MET D CE  1 
ATOM   5164 N  N   . GLU D 1 24  ? 90.260  38.831  22.514  1.00 23.41 ? 24  GLU D N   1 
ATOM   5165 C  CA  . GLU D 1 24  ? 90.909  38.467  21.261  1.00 26.85 ? 24  GLU D CA  1 
ATOM   5166 C  C   . GLU D 1 24  ? 90.709  36.993  20.884  1.00 24.65 ? 24  GLU D C   1 
ATOM   5167 O  O   . GLU D 1 24  ? 90.405  36.675  19.733  1.00 25.25 ? 24  GLU D O   1 
ATOM   5168 C  CB  . GLU D 1 24  ? 92.404  38.763  21.362  1.00 28.97 ? 24  GLU D CB  1 
ATOM   5169 C  CG  . GLU D 1 24  ? 93.099  38.859  20.027  1.00 38.72 ? 24  GLU D CG  1 
ATOM   5170 C  CD  . GLU D 1 24  ? 94.555  39.234  20.170  1.00 41.96 ? 24  GLU D CD  1 
ATOM   5171 O  OE1 . GLU D 1 24  ? 94.861  40.109  21.011  1.00 44.24 ? 24  GLU D OE1 1 
ATOM   5172 O  OE2 . GLU D 1 24  ? 95.387  38.662  19.436  1.00 45.74 ? 24  GLU D OE2 1 
ATOM   5173 N  N   . ILE D 1 25  ? 90.900  36.095  21.847  1.00 23.26 ? 25  ILE D N   1 
ATOM   5174 C  CA  . ILE D 1 25  ? 90.733  34.661  21.589  1.00 21.36 ? 25  ILE D CA  1 
ATOM   5175 C  C   . ILE D 1 25  ? 89.263  34.350  21.312  1.00 19.78 ? 25  ILE D C   1 
ATOM   5176 O  O   . ILE D 1 25  ? 88.931  33.624  20.380  1.00 22.04 ? 25  ILE D O   1 
ATOM   5177 C  CB  . ILE D 1 25  ? 91.164  33.795  22.802  1.00 22.47 ? 25  ILE D CB  1 
ATOM   5178 C  CG1 . ILE D 1 25  ? 92.596  34.126  23.228  1.00 25.85 ? 25  ILE D CG1 1 
ATOM   5179 C  CG2 . ILE D 1 25  ? 91.050  32.315  22.446  1.00 21.34 ? 25  ILE D CG2 1 
ATOM   5180 C  CD1 . ILE D 1 25  ? 93.642  33.764  22.212  1.00 30.68 ? 25  ILE D CD1 1 
ATOM   5181 N  N   . HIS D 1 26  ? 88.392  34.905  22.145  1.00 20.51 ? 26  HIS D N   1 
ATOM   5182 C  CA  . HIS D 1 26  ? 86.952  34.699  22.042  1.00 21.42 ? 26  HIS D CA  1 
ATOM   5183 C  C   . HIS D 1 26  ? 86.443  35.073  20.649  1.00 23.03 ? 26  HIS D C   1 
ATOM   5184 O  O   . HIS D 1 26  ? 85.659  34.345  20.035  1.00 21.83 ? 26  HIS D O   1 
ATOM   5185 C  CB  . HIS D 1 26  ? 86.255  35.557  23.101  1.00 21.17 ? 26  HIS D CB  1 
ATOM   5186 C  CG  . HIS D 1 26  ? 84.918  35.040  23.532  1.00 21.18 ? 26  HIS D CG  1 
ATOM   5187 N  ND1 . HIS D 1 26  ? 84.168  35.661  24.508  1.00 20.74 ? 26  HIS D ND1 1 
ATOM   5188 C  CD2 . HIS D 1 26  ? 84.187  33.977  23.116  1.00 19.31 ? 26  HIS D CD2 1 
ATOM   5189 C  CE1 . HIS D 1 26  ? 83.032  35.006  24.673  1.00 18.04 ? 26  HIS D CE1 1 
ATOM   5190 N  NE2 . HIS D 1 26  ? 83.019  33.981  23.840  1.00 18.07 ? 26  HIS D NE2 1 
ATOM   5191 N  N   . HIS D 1 27  ? 86.910  36.209  20.149  1.00 21.65 ? 27  HIS D N   1 
ATOM   5192 C  CA  . HIS D 1 27  ? 86.490  36.694  18.845  1.00 22.27 ? 27  HIS D CA  1 
ATOM   5193 C  C   . HIS D 1 27  ? 87.157  35.993  17.660  1.00 21.41 ? 27  HIS D C   1 
ATOM   5194 O  O   . HIS D 1 27  ? 86.479  35.390  16.826  1.00 22.41 ? 27  HIS D O   1 
ATOM   5195 C  CB  . HIS D 1 27  ? 86.750  38.203  18.759  1.00 24.09 ? 27  HIS D CB  1 
ATOM   5196 C  CG  . HIS D 1 27  ? 86.319  38.817  17.464  1.00 26.82 ? 27  HIS D CG  1 
ATOM   5197 N  ND1 . HIS D 1 27  ? 87.182  39.519  16.652  1.00 27.02 ? 27  HIS D ND1 1 
ATOM   5198 C  CD2 . HIS D 1 27  ? 85.121  38.821  16.832  1.00 27.20 ? 27  HIS D CD2 1 
ATOM   5199 C  CE1 . HIS D 1 27  ? 86.536  39.928  15.574  1.00 28.45 ? 27  HIS D CE1 1 
ATOM   5200 N  NE2 . HIS D 1 27  ? 85.283  39.517  15.659  1.00 30.15 ? 27  HIS D NE2 1 
ATOM   5201 N  N   . THR D 1 28  ? 88.484  36.050  17.600  1.00 20.83 ? 28  THR D N   1 
ATOM   5202 C  CA  . THR D 1 28  ? 89.220  35.477  16.478  1.00 19.84 ? 28  THR D CA  1 
ATOM   5203 C  C   . THR D 1 28  ? 89.351  33.963  16.418  1.00 20.68 ? 28  THR D C   1 
ATOM   5204 O  O   . THR D 1 28  ? 89.670  33.419  15.357  1.00 18.23 ? 28  THR D O   1 
ATOM   5205 C  CB  . THR D 1 28  ? 90.646  36.079  16.379  1.00 22.48 ? 28  THR D CB  1 
ATOM   5206 O  OG1 . THR D 1 28  ? 91.458  35.591  17.454  1.00 20.49 ? 28  THR D OG1 1 
ATOM   5207 C  CG2 . THR D 1 28  ? 90.577  37.601  16.454  1.00 20.85 ? 28  THR D CG2 1 
ATOM   5208 N  N   . LYS D 1 29  ? 89.110  33.282  17.534  1.00 19.05 ? 29  LYS D N   1 
ATOM   5209 C  CA  . LYS D 1 29  ? 89.225  31.826  17.551  1.00 20.61 ? 29  LYS D CA  1 
ATOM   5210 C  C   . LYS D 1 29  ? 87.865  31.150  17.682  1.00 20.30 ? 29  LYS D C   1 
ATOM   5211 O  O   . LYS D 1 29  ? 87.427  30.446  16.774  1.00 20.04 ? 29  LYS D O   1 
ATOM   5212 C  CB  . LYS D 1 29  ? 90.128  31.379  18.702  1.00 24.01 ? 29  LYS D CB  1 
ATOM   5213 C  CG  . LYS D 1 29  ? 91.515  31.997  18.672  1.00 28.73 ? 29  LYS D CG  1 
ATOM   5214 C  CD  . LYS D 1 29  ? 92.279  31.584  17.429  1.00 34.02 ? 29  LYS D CD  1 
ATOM   5215 C  CE  . LYS D 1 29  ? 93.704  32.128  17.465  1.00 37.96 ? 29  LYS D CE  1 
ATOM   5216 N  NZ  . LYS D 1 29  ? 94.522  31.598  16.338  1.00 41.10 ? 29  LYS D NZ  1 
ATOM   5217 N  N   . HIS D 1 30  ? 87.203  31.371  18.814  1.00 19.42 ? 30  HIS D N   1 
ATOM   5218 C  CA  . HIS D 1 30  ? 85.899  30.762  19.054  1.00 18.62 ? 30  HIS D CA  1 
ATOM   5219 C  C   . HIS D 1 30  ? 84.818  31.206  18.076  1.00 18.87 ? 30  HIS D C   1 
ATOM   5220 O  O   . HIS D 1 30  ? 84.213  30.376  17.405  1.00 17.45 ? 30  HIS D O   1 
ATOM   5221 C  CB  . HIS D 1 30  ? 85.447  31.043  20.489  1.00 19.06 ? 30  HIS D CB  1 
ATOM   5222 C  CG  . HIS D 1 30  ? 86.218  30.276  21.518  1.00 19.61 ? 30  HIS D CG  1 
ATOM   5223 N  ND1 . HIS D 1 30  ? 86.154  28.903  21.622  1.00 20.21 ? 30  HIS D ND1 1 
ATOM   5224 C  CD2 . HIS D 1 30  ? 87.094  30.685  22.467  1.00 20.80 ? 30  HIS D CD2 1 
ATOM   5225 C  CE1 . HIS D 1 30  ? 86.958  28.499  22.591  1.00 21.75 ? 30  HIS D CE1 1 
ATOM   5226 N  NE2 . HIS D 1 30  ? 87.540  29.561  23.119  1.00 20.26 ? 30  HIS D NE2 1 
ATOM   5227 N  N   . HIS D 1 31  ? 84.566  32.510  17.986  1.00 17.76 ? 31  HIS D N   1 
ATOM   5228 C  CA  . HIS D 1 31  ? 83.531  32.991  17.074  1.00 18.14 ? 31  HIS D CA  1 
ATOM   5229 C  C   . HIS D 1 31  ? 83.865  32.633  15.625  1.00 18.20 ? 31  HIS D C   1 
ATOM   5230 O  O   . HIS D 1 31  ? 82.986  32.240  14.856  1.00 18.08 ? 31  HIS D O   1 
ATOM   5231 C  CB  . HIS D 1 31  ? 83.347  34.509  17.216  1.00 18.99 ? 31  HIS D CB  1 
ATOM   5232 C  CG  . HIS D 1 31  ? 82.104  35.036  16.561  1.00 19.69 ? 31  HIS D CG  1 
ATOM   5233 N  ND1 . HIS D 1 31  ? 81.668  36.332  16.733  1.00 20.52 ? 31  HIS D ND1 1 
ATOM   5234 C  CD2 . HIS D 1 31  ? 81.210  34.447  15.731  1.00 20.32 ? 31  HIS D CD2 1 
ATOM   5235 C  CE1 . HIS D 1 31  ? 80.559  36.520  16.039  1.00 20.66 ? 31  HIS D CE1 1 
ATOM   5236 N  NE2 . HIS D 1 31  ? 80.260  35.391  15.421  1.00 22.68 ? 31  HIS D NE2 1 
ATOM   5237 N  N   . GLN D 1 32  ? 85.134  32.762  15.252  1.00 15.94 ? 32  GLN D N   1 
ATOM   5238 C  CA  . GLN D 1 32  ? 85.560  32.437  13.894  1.00 17.21 ? 32  GLN D CA  1 
ATOM   5239 C  C   . GLN D 1 32  ? 85.210  30.985  13.556  1.00 18.16 ? 32  GLN D C   1 
ATOM   5240 O  O   . GLN D 1 32  ? 84.784  30.678  12.445  1.00 17.41 ? 32  GLN D O   1 
ATOM   5241 C  CB  . GLN D 1 32  ? 87.074  32.638  13.745  1.00 18.71 ? 32  GLN D CB  1 
ATOM   5242 C  CG  . GLN D 1 32  ? 87.638  32.174  12.396  1.00 21.95 ? 32  GLN D CG  1 
ATOM   5243 C  CD  . GLN D 1 32  ? 87.272  33.108  11.254  1.00 24.04 ? 32  GLN D CD  1 
ATOM   5244 O  OE1 . GLN D 1 32  ? 87.823  34.211  11.133  1.00 24.22 ? 32  GLN D OE1 1 
ATOM   5245 N  NE2 . GLN D 1 32  ? 86.331  32.682  10.419  1.00 22.85 ? 32  GLN D NE2 1 
ATOM   5246 N  N   . THR D 1 33  ? 85.396  30.090  14.522  1.00 18.03 ? 33  THR D N   1 
ATOM   5247 C  CA  . THR D 1 33  ? 85.097  28.678  14.312  1.00 18.55 ? 33  THR D CA  1 
ATOM   5248 C  C   . THR D 1 33  ? 83.617  28.425  14.028  1.00 18.32 ? 33  THR D C   1 
ATOM   5249 O  O   . THR D 1 33  ? 83.282  27.610  13.169  1.00 20.06 ? 33  THR D O   1 
ATOM   5250 C  CB  . THR D 1 33  ? 85.551  27.831  15.530  1.00 18.19 ? 33  THR D CB  1 
ATOM   5251 O  OG1 . THR D 1 33  ? 86.979  27.697  15.499  1.00 18.89 ? 33  THR D OG1 1 
ATOM   5252 C  CG2 . THR D 1 33  ? 84.917  26.438  15.499  1.00 22.43 ? 33  THR D CG2 1 
ATOM   5253 N  N   . TYR D 1 34  ? 82.735  29.119  14.740  1.00 17.79 ? 34  TYR D N   1 
ATOM   5254 C  CA  . TYR D 1 34  ? 81.303  28.939  14.525  1.00 19.38 ? 34  TYR D CA  1 
ATOM   5255 C  C   . TYR D 1 34  ? 80.929  29.407  13.124  1.00 21.28 ? 34  TYR D C   1 
ATOM   5256 O  O   . TYR D 1 34  ? 80.131  28.764  12.440  1.00 20.37 ? 34  TYR D O   1 
ATOM   5257 C  CB  . TYR D 1 34  ? 80.492  29.711  15.571  1.00 19.10 ? 34  TYR D CB  1 
ATOM   5258 C  CG  . TYR D 1 34  ? 80.874  29.373  16.996  1.00 20.37 ? 34  TYR D CG  1 
ATOM   5259 C  CD1 . TYR D 1 34  ? 81.087  28.052  17.384  1.00 22.42 ? 34  TYR D CD1 1 
ATOM   5260 C  CD2 . TYR D 1 34  ? 81.045  30.374  17.950  1.00 22.53 ? 34  TYR D CD2 1 
ATOM   5261 C  CE1 . TYR D 1 34  ? 81.469  27.734  18.688  1.00 22.98 ? 34  TYR D CE1 1 
ATOM   5262 C  CE2 . TYR D 1 34  ? 81.426  30.065  19.254  1.00 24.13 ? 34  TYR D CE2 1 
ATOM   5263 C  CZ  . TYR D 1 34  ? 81.636  28.741  19.612  1.00 22.23 ? 34  TYR D CZ  1 
ATOM   5264 O  OH  . TYR D 1 34  ? 82.017  28.429  20.896  1.00 28.48 ? 34  TYR D OH  1 
ATOM   5265 N  N   . VAL D 1 35  ? 81.507  30.530  12.700  1.00 20.42 ? 35  VAL D N   1 
ATOM   5266 C  CA  . VAL D 1 35  ? 81.234  31.051  11.366  1.00 18.52 ? 35  VAL D CA  1 
ATOM   5267 C  C   . VAL D 1 35  ? 81.717  30.057  10.316  1.00 18.23 ? 35  VAL D C   1 
ATOM   5268 O  O   . VAL D 1 35  ? 80.990  29.744  9.376   1.00 17.82 ? 35  VAL D O   1 
ATOM   5269 C  CB  . VAL D 1 35  ? 81.914  32.421  11.137  1.00 19.76 ? 35  VAL D CB  1 
ATOM   5270 C  CG1 . VAL D 1 35  ? 81.883  32.784  9.660   1.00 20.77 ? 35  VAL D CG1 1 
ATOM   5271 C  CG2 . VAL D 1 35  ? 81.186  33.481  11.930  1.00 16.80 ? 35  VAL D CG2 1 
ATOM   5272 N  N   . ASN D 1 36  ? 82.935  29.549  10.482  1.00 16.99 ? 36  ASN D N   1 
ATOM   5273 C  CA  . ASN D 1 36  ? 83.487  28.582  9.536   1.00 17.36 ? 36  ASN D CA  1 
ATOM   5274 C  C   . ASN D 1 36  ? 82.622  27.326  9.424   1.00 20.17 ? 36  ASN D C   1 
ATOM   5275 O  O   . ASN D 1 36  ? 82.305  26.872  8.319   1.00 18.98 ? 36  ASN D O   1 
ATOM   5276 C  CB  . ASN D 1 36  ? 84.904  28.166  9.949   1.00 16.59 ? 36  ASN D CB  1 
ATOM   5277 C  CG  . ASN D 1 36  ? 85.943  29.234  9.649   1.00 20.59 ? 36  ASN D CG  1 
ATOM   5278 O  OD1 . ASN D 1 36  ? 85.683  30.170  8.891   1.00 19.49 ? 36  ASN D OD1 1 
ATOM   5279 N  ND2 . ASN D 1 36  ? 87.133  29.089  10.233  1.00 18.58 ? 36  ASN D ND2 1 
ATOM   5280 N  N   . ASN D 1 37  ? 82.243  26.763  10.566  1.00 19.40 ? 37  ASN D N   1 
ATOM   5281 C  CA  . ASN D 1 37  ? 81.428  25.554  10.562  1.00 21.22 ? 37  ASN D CA  1 
ATOM   5282 C  C   . ASN D 1 37  ? 80.032  25.780  9.995   1.00 21.22 ? 37  ASN D C   1 
ATOM   5283 O  O   . ASN D 1 37  ? 79.503  24.914  9.297   1.00 22.68 ? 37  ASN D O   1 
ATOM   5284 C  CB  . ASN D 1 37  ? 81.329  24.952  11.968  1.00 22.91 ? 37  ASN D CB  1 
ATOM   5285 C  CG  . ASN D 1 37  ? 82.630  24.303  12.421  1.00 25.34 ? 37  ASN D CG  1 
ATOM   5286 O  OD1 . ASN D 1 37  ? 83.448  23.886  11.604  1.00 28.40 ? 37  ASN D OD1 1 
ATOM   5287 N  ND2 . ASN D 1 37  ? 82.813  24.200  13.729  1.00 28.43 ? 37  ASN D ND2 1 
ATOM   5288 N  N   . ALA D 1 38  ? 79.431  26.927  10.296  1.00 19.96 ? 38  ALA D N   1 
ATOM   5289 C  CA  . ALA D 1 38  ? 78.102  27.228  9.773   1.00 20.33 ? 38  ALA D CA  1 
ATOM   5290 C  C   . ALA D 1 38  ? 78.167  27.359  8.250   1.00 21.08 ? 38  ALA D C   1 
ATOM   5291 O  O   . ALA D 1 38  ? 77.324  26.806  7.538   1.00 21.46 ? 38  ALA D O   1 
ATOM   5292 C  CB  . ALA D 1 38  ? 77.567  28.510  10.392  1.00 20.53 ? 38  ALA D CB  1 
ATOM   5293 N  N   . ASN D 1 39  ? 79.172  28.078  7.751   1.00 19.73 ? 39  ASN D N   1 
ATOM   5294 C  CA  . ASN D 1 39  ? 79.327  28.256  6.307   1.00 22.29 ? 39  ASN D CA  1 
ATOM   5295 C  C   . ASN D 1 39  ? 79.532  26.930  5.588   1.00 21.46 ? 39  ASN D C   1 
ATOM   5296 O  O   . ASN D 1 39  ? 78.968  26.709  4.516   1.00 22.61 ? 39  ASN D O   1 
ATOM   5297 C  CB  . ASN D 1 39  ? 80.498  29.200  5.995   1.00 21.26 ? 39  ASN D CB  1 
ATOM   5298 C  CG  . ASN D 1 39  ? 80.145  30.655  6.232   1.00 23.36 ? 39  ASN D CG  1 
ATOM   5299 O  OD1 . ASN D 1 39  ? 78.990  31.048  6.072   1.00 22.35 ? 39  ASN D OD1 1 
ATOM   5300 N  ND2 . ASN D 1 39  ? 81.136  31.464  6.603   1.00 18.91 ? 39  ASN D ND2 1 
ATOM   5301 N  N   . ALA D 1 40  ? 80.337  26.049  6.175   1.00 21.70 ? 40  ALA D N   1 
ATOM   5302 C  CA  . ALA D 1 40  ? 80.597  24.748  5.567   1.00 24.61 ? 40  ALA D CA  1 
ATOM   5303 C  C   . ALA D 1 40  ? 79.304  23.954  5.419   1.00 25.34 ? 40  ALA D C   1 
ATOM   5304 O  O   . ALA D 1 40  ? 79.093  23.281  4.410   1.00 27.21 ? 40  ALA D O   1 
ATOM   5305 C  CB  . ALA D 1 40  ? 81.605  23.959  6.409   1.00 25.07 ? 40  ALA D CB  1 
ATOM   5306 N  N   . ALA D 1 41  ? 78.439  24.036  6.423   1.00 26.76 ? 41  ALA D N   1 
ATOM   5307 C  CA  . ALA D 1 41  ? 77.177  23.309  6.392   1.00 27.92 ? 41  ALA D CA  1 
ATOM   5308 C  C   . ALA D 1 41  ? 76.181  23.924  5.411   1.00 29.22 ? 41  ALA D C   1 
ATOM   5309 O  O   . ALA D 1 41  ? 75.390  23.213  4.792   1.00 31.31 ? 41  ALA D O   1 
ATOM   5310 C  CB  . ALA D 1 41  ? 76.570  23.252  7.795   1.00 27.34 ? 41  ALA D CB  1 
ATOM   5311 N  N   . LEU D 1 42  ? 76.231  25.243  5.260   1.00 30.56 ? 42  LEU D N   1 
ATOM   5312 C  CA  . LEU D 1 42  ? 75.319  25.950  4.372   1.00 32.11 ? 42  LEU D CA  1 
ATOM   5313 C  C   . LEU D 1 42  ? 75.684  25.868  2.894   1.00 34.25 ? 42  LEU D C   1 
ATOM   5314 O  O   . LEU D 1 42  ? 74.880  26.222  2.034   1.00 34.07 ? 42  LEU D O   1 
ATOM   5315 C  CB  . LEU D 1 42  ? 75.245  27.421  4.784   1.00 32.60 ? 42  LEU D CB  1 
ATOM   5316 C  CG  . LEU D 1 42  ? 74.529  27.731  6.098   1.00 35.55 ? 42  LEU D CG  1 
ATOM   5317 C  CD1 . LEU D 1 42  ? 74.709  29.202  6.448   1.00 35.46 ? 42  LEU D CD1 1 
ATOM   5318 C  CD2 . LEU D 1 42  ? 73.054  27.379  5.964   1.00 34.69 ? 42  LEU D CD2 1 
ATOM   5319 N  N   . GLU D 1 43  ? 76.894  25.415  2.600   1.00 36.13 ? 43  GLU D N   1 
ATOM   5320 C  CA  . GLU D 1 43  ? 77.338  25.316  1.220   1.00 41.32 ? 43  GLU D CA  1 
ATOM   5321 C  C   . GLU D 1 43  ? 76.303  24.613  0.343   1.00 41.76 ? 43  GLU D C   1 
ATOM   5322 O  O   . GLU D 1 43  ? 76.084  25.002  -0.801  1.00 41.68 ? 43  GLU D O   1 
ATOM   5323 C  CB  . GLU D 1 43  ? 78.670  24.570  1.149   1.00 44.94 ? 43  GLU D CB  1 
ATOM   5324 C  CG  . GLU D 1 43  ? 79.250  24.490  -0.245  1.00 52.49 ? 43  GLU D CG  1 
ATOM   5325 C  CD  . GLU D 1 43  ? 80.576  23.757  -0.280  1.00 58.06 ? 43  GLU D CD  1 
ATOM   5326 O  OE1 . GLU D 1 43  ? 80.607  22.563  0.101   1.00 60.95 ? 43  GLU D OE1 1 
ATOM   5327 O  OE2 . GLU D 1 43  ? 81.586  24.374  -0.685  1.00 61.33 ? 43  GLU D OE2 1 
ATOM   5328 N  N   . SER D 1 44  ? 75.657  23.590  0.891   1.00 41.73 ? 44  SER D N   1 
ATOM   5329 C  CA  . SER D 1 44  ? 74.660  22.832  0.147   1.00 43.42 ? 44  SER D CA  1 
ATOM   5330 C  C   . SER D 1 44  ? 73.220  23.265  0.419   1.00 43.92 ? 44  SER D C   1 
ATOM   5331 O  O   . SER D 1 44  ? 72.280  22.548  0.079   1.00 44.30 ? 44  SER D O   1 
ATOM   5332 C  CB  . SER D 1 44  ? 74.808  21.345  0.462   1.00 44.46 ? 44  SER D CB  1 
ATOM   5333 O  OG  . SER D 1 44  ? 74.619  21.105  1.844   1.00 46.31 ? 44  SER D OG  1 
ATOM   5334 N  N   . LEU D 1 45  ? 73.043  24.432  1.030   1.00 43.15 ? 45  LEU D N   1 
ATOM   5335 C  CA  . LEU D 1 45  ? 71.706  24.939  1.331   1.00 42.75 ? 45  LEU D CA  1 
ATOM   5336 C  C   . LEU D 1 45  ? 71.545  26.362  0.804   1.00 42.09 ? 45  LEU D C   1 
ATOM   5337 O  O   . LEU D 1 45  ? 71.425  27.312  1.575   1.00 41.59 ? 45  LEU D O   1 
ATOM   5338 C  CB  . LEU D 1 45  ? 71.454  24.909  2.843   1.00 44.39 ? 45  LEU D CB  1 
ATOM   5339 C  CG  . LEU D 1 45  ? 71.088  23.571  3.498   1.00 46.35 ? 45  LEU D CG  1 
ATOM   5340 C  CD1 . LEU D 1 45  ? 72.154  22.530  3.226   1.00 48.95 ? 45  LEU D CD1 1 
ATOM   5341 C  CD2 . LEU D 1 45  ? 70.927  23.773  4.995   1.00 47.90 ? 45  LEU D CD2 1 
ATOM   5342 N  N   . PRO D 1 46  ? 71.526  26.521  -0.529  1.00 42.24 ? 46  PRO D N   1 
ATOM   5343 C  CA  . PRO D 1 46  ? 71.386  27.820  -1.198  1.00 42.76 ? 46  PRO D CA  1 
ATOM   5344 C  C   . PRO D 1 46  ? 70.225  28.660  -0.673  1.00 43.14 ? 46  PRO D C   1 
ATOM   5345 O  O   . PRO D 1 46  ? 70.346  29.872  -0.512  1.00 41.97 ? 46  PRO D O   1 
ATOM   5346 C  CB  . PRO D 1 46  ? 71.196  27.435  -2.661  1.00 42.90 ? 46  PRO D CB  1 
ATOM   5347 C  CG  . PRO D 1 46  ? 71.949  26.152  -2.771  1.00 42.64 ? 46  PRO D CG  1 
ATOM   5348 C  CD  . PRO D 1 46  ? 71.533  25.432  -1.519  1.00 41.77 ? 46  PRO D CD  1 
ATOM   5349 N  N   . GLU D 1 47  ? 69.101  28.007  -0.412  1.00 44.88 ? 47  GLU D N   1 
ATOM   5350 C  CA  . GLU D 1 47  ? 67.923  28.695  0.092   1.00 48.79 ? 47  GLU D CA  1 
ATOM   5351 C  C   . GLU D 1 47  ? 68.140  29.353  1.455   1.00 49.47 ? 47  GLU D C   1 
ATOM   5352 O  O   . GLU D 1 47  ? 67.837  30.533  1.635   1.00 49.93 ? 47  GLU D O   1 
ATOM   5353 C  CB  . GLU D 1 47  ? 66.751  27.715  0.174   1.00 50.85 ? 47  GLU D CB  1 
ATOM   5354 C  CG  . GLU D 1 47  ? 65.509  28.282  0.838   1.00 55.61 ? 47  GLU D CG  1 
ATOM   5355 C  CD  . GLU D 1 47  ? 64.264  27.466  0.540   1.00 57.77 ? 47  GLU D CD  1 
ATOM   5356 O  OE1 . GLU D 1 47  ? 64.317  26.224  0.673   1.00 59.64 ? 47  GLU D OE1 1 
ATOM   5357 O  OE2 . GLU D 1 47  ? 63.232  28.070  0.177   1.00 60.14 ? 47  GLU D OE2 1 
ATOM   5358 N  N   . PHE D 1 48  ? 68.672  28.588  2.405   1.00 50.58 ? 48  PHE D N   1 
ATOM   5359 C  CA  . PHE D 1 48  ? 68.902  29.078  3.766   1.00 51.99 ? 48  PHE D CA  1 
ATOM   5360 C  C   . PHE D 1 48  ? 70.177  29.888  3.975   1.00 51.82 ? 48  PHE D C   1 
ATOM   5361 O  O   . PHE D 1 48  ? 70.275  30.657  4.928   1.00 51.65 ? 48  PHE D O   1 
ATOM   5362 C  CB  . PHE D 1 48  ? 68.910  27.901  4.744   1.00 53.06 ? 48  PHE D CB  1 
ATOM   5363 C  CG  . PHE D 1 48  ? 67.642  27.100  4.745   1.00 54.76 ? 48  PHE D CG  1 
ATOM   5364 C  CD1 . PHE D 1 48  ? 66.444  27.669  5.164   1.00 55.04 ? 48  PHE D CD1 1 
ATOM   5365 C  CD2 . PHE D 1 48  ? 67.643  25.774  4.322   1.00 55.66 ? 48  PHE D CD2 1 
ATOM   5366 C  CE1 . PHE D 1 48  ? 65.264  26.930  5.162   1.00 56.53 ? 48  PHE D CE1 1 
ATOM   5367 C  CE2 . PHE D 1 48  ? 66.468  25.023  4.316   1.00 56.76 ? 48  PHE D CE2 1 
ATOM   5368 C  CZ  . PHE D 1 48  ? 65.276  25.603  4.737   1.00 56.76 ? 48  PHE D CZ  1 
ATOM   5369 N  N   . ALA D 1 49  ? 71.151  29.719  3.089   1.00 52.34 ? 49  ALA D N   1 
ATOM   5370 C  CA  . ALA D 1 49  ? 72.424  30.418  3.217   1.00 52.77 ? 49  ALA D CA  1 
ATOM   5371 C  C   . ALA D 1 49  ? 72.369  31.934  3.030   1.00 53.04 ? 49  ALA D C   1 
ATOM   5372 O  O   . ALA D 1 49  ? 73.339  32.628  3.332   1.00 53.26 ? 49  ALA D O   1 
ATOM   5373 C  CB  . ALA D 1 49  ? 73.438  29.817  2.249   1.00 52.02 ? 49  ALA D CB  1 
ATOM   5374 N  N   . ASN D 1 50  ? 71.244  32.455  2.551   1.00 54.08 ? 50  ASN D N   1 
ATOM   5375 C  CA  . ASN D 1 50  ? 71.130  33.898  2.328   1.00 54.61 ? 50  ASN D CA  1 
ATOM   5376 C  C   . ASN D 1 50  ? 70.390  34.655  3.427   1.00 52.82 ? 50  ASN D C   1 
ATOM   5377 O  O   . ASN D 1 50  ? 70.524  35.875  3.546   1.00 52.50 ? 50  ASN D O   1 
ATOM   5378 C  CB  . ASN D 1 50  ? 70.440  34.165  0.993   1.00 58.99 ? 50  ASN D CB  1 
ATOM   5379 C  CG  . ASN D 1 50  ? 71.135  33.484  -0.161  1.00 62.31 ? 50  ASN D CG  1 
ATOM   5380 O  OD1 . ASN D 1 50  ? 72.315  33.733  -0.429  1.00 64.60 ? 50  ASN D OD1 1 
ATOM   5381 N  ND2 . ASN D 1 50  ? 70.408  32.613  -0.854  1.00 63.24 ? 50  ASN D ND2 1 
ATOM   5382 N  N   . LEU D 1 51  ? 69.607  33.932  4.219   1.00 49.66 ? 51  LEU D N   1 
ATOM   5383 C  CA  . LEU D 1 51  ? 68.839  34.534  5.306   1.00 46.01 ? 51  LEU D CA  1 
ATOM   5384 C  C   . LEU D 1 51  ? 69.745  35.032  6.426   1.00 42.85 ? 51  LEU D C   1 
ATOM   5385 O  O   . LEU D 1 51  ? 70.813  34.472  6.664   1.00 42.19 ? 51  LEU D O   1 
ATOM   5386 C  CB  . LEU D 1 51  ? 67.877  33.502  5.897   1.00 47.08 ? 51  LEU D CB  1 
ATOM   5387 C  CG  . LEU D 1 51  ? 66.999  32.710  4.931   1.00 48.85 ? 51  LEU D CG  1 
ATOM   5388 C  CD1 . LEU D 1 51  ? 66.260  31.620  5.693   1.00 49.08 ? 51  LEU D CD1 1 
ATOM   5389 C  CD2 . LEU D 1 51  ? 66.030  33.652  4.235   1.00 49.43 ? 51  LEU D CD2 1 
ATOM   5390 N  N   . PRO D 1 52  ? 69.335  36.104  7.124   1.00 40.25 ? 52  PRO D N   1 
ATOM   5391 C  CA  . PRO D 1 52  ? 70.158  36.615  8.224   1.00 36.41 ? 52  PRO D CA  1 
ATOM   5392 C  C   . PRO D 1 52  ? 70.226  35.467  9.236   1.00 33.90 ? 52  PRO D C   1 
ATOM   5393 O  O   . PRO D 1 52  ? 69.277  34.687  9.340   1.00 31.92 ? 52  PRO D O   1 
ATOM   5394 C  CB  . PRO D 1 52  ? 69.338  37.790  8.749   1.00 37.36 ? 52  PRO D CB  1 
ATOM   5395 C  CG  . PRO D 1 52  ? 68.622  38.271  7.521   1.00 39.59 ? 52  PRO D CG  1 
ATOM   5396 C  CD  . PRO D 1 52  ? 68.176  36.981  6.883   1.00 39.83 ? 52  PRO D CD  1 
ATOM   5397 N  N   . VAL D 1 53  ? 71.323  35.350  9.975   1.00 32.01 ? 53  VAL D N   1 
ATOM   5398 C  CA  . VAL D 1 53  ? 71.433  34.254  10.934  1.00 30.30 ? 53  VAL D CA  1 
ATOM   5399 C  C   . VAL D 1 53  ? 70.283  34.252  11.949  1.00 30.48 ? 53  VAL D C   1 
ATOM   5400 O  O   . VAL D 1 53  ? 69.810  33.191  12.344  1.00 30.06 ? 53  VAL D O   1 
ATOM   5401 C  CB  . VAL D 1 53  ? 72.792  34.290  11.683  1.00 28.56 ? 53  VAL D CB  1 
ATOM   5402 C  CG1 . VAL D 1 53  ? 72.870  35.513  12.577  1.00 27.50 ? 53  VAL D CG1 1 
ATOM   5403 C  CG2 . VAL D 1 53  ? 72.974  33.010  12.492  1.00 26.12 ? 53  VAL D CG2 1 
ATOM   5404 N  N   . GLU D 1 54  ? 69.829  35.438  12.358  1.00 31.46 ? 54  GLU D N   1 
ATOM   5405 C  CA  . GLU D 1 54  ? 68.736  35.551  13.325  1.00 33.83 ? 54  GLU D CA  1 
ATOM   5406 C  C   . GLU D 1 54  ? 67.450  34.937  12.784  1.00 34.53 ? 54  GLU D C   1 
ATOM   5407 O  O   . GLU D 1 54  ? 66.569  34.538  13.546  1.00 34.84 ? 54  GLU D O   1 
ATOM   5408 C  CB  . GLU D 1 54  ? 68.463  37.017  13.687  1.00 36.33 ? 54  GLU D CB  1 
ATOM   5409 C  CG  . GLU D 1 54  ? 69.617  37.767  14.334  1.00 41.76 ? 54  GLU D CG  1 
ATOM   5410 C  CD  . GLU D 1 54  ? 70.713  38.124  13.345  1.00 44.30 ? 54  GLU D CD  1 
ATOM   5411 O  OE1 . GLU D 1 54  ? 70.399  38.289  12.146  1.00 44.45 ? 54  GLU D OE1 1 
ATOM   5412 O  OE2 . GLU D 1 54  ? 71.884  38.256  13.767  1.00 47.39 ? 54  GLU D OE2 1 
ATOM   5413 N  N   . GLU D 1 55  ? 67.338  34.869  11.464  1.00 34.27 ? 55  GLU D N   1 
ATOM   5414 C  CA  . GLU D 1 55  ? 66.153  34.296  10.850  1.00 34.52 ? 55  GLU D CA  1 
ATOM   5415 C  C   . GLU D 1 55  ? 66.318  32.790  10.680  1.00 31.93 ? 55  GLU D C   1 
ATOM   5416 O  O   . GLU D 1 55  ? 65.376  32.026  10.893  1.00 31.48 ? 55  GLU D O   1 
ATOM   5417 C  CB  . GLU D 1 55  ? 65.894  34.958  9.498   1.00 38.75 ? 55  GLU D CB  1 
ATOM   5418 C  CG  . GLU D 1 55  ? 64.580  34.560  8.861   1.00 46.22 ? 55  GLU D CG  1 
ATOM   5419 C  CD  . GLU D 1 55  ? 64.335  35.281  7.550   1.00 50.38 ? 55  GLU D CD  1 
ATOM   5420 O  OE1 . GLU D 1 55  ? 64.360  36.534  7.544   1.00 52.63 ? 55  GLU D OE1 1 
ATOM   5421 O  OE2 . GLU D 1 55  ? 64.118  34.595  6.527   1.00 53.10 ? 55  GLU D OE2 1 
ATOM   5422 N  N   . LEU D 1 56  ? 67.519  32.359  10.309  1.00 28.74 ? 56  LEU D N   1 
ATOM   5423 C  CA  . LEU D 1 56  ? 67.773  30.935  10.130  1.00 28.34 ? 56  LEU D CA  1 
ATOM   5424 C  C   . LEU D 1 56  ? 67.502  30.121  11.399  1.00 27.65 ? 56  LEU D C   1 
ATOM   5425 O  O   . LEU D 1 56  ? 66.959  29.015  11.322  1.00 27.17 ? 56  LEU D O   1 
ATOM   5426 C  CB  . LEU D 1 56  ? 69.222  30.692  9.685   1.00 29.04 ? 56  LEU D CB  1 
ATOM   5427 C  CG  . LEU D 1 56  ? 69.561  29.205  9.539   1.00 32.18 ? 56  LEU D CG  1 
ATOM   5428 C  CD1 . LEU D 1 56  ? 68.832  28.650  8.332   1.00 34.01 ? 56  LEU D CD1 1 
ATOM   5429 C  CD2 . LEU D 1 56  ? 71.056  29.005  9.383   1.00 33.34 ? 56  LEU D CD2 1 
ATOM   5430 N  N   . ILE D 1 57  ? 67.870  30.658  12.564  1.00 26.78 ? 57  ILE D N   1 
ATOM   5431 C  CA  . ILE D 1 57  ? 67.667  29.919  13.810  1.00 27.49 ? 57  ILE D CA  1 
ATOM   5432 C  C   . ILE D 1 57  ? 66.220  29.839  14.284  1.00 29.50 ? 57  ILE D C   1 
ATOM   5433 O  O   . ILE D 1 57  ? 65.929  29.180  15.281  1.00 27.37 ? 57  ILE D O   1 
ATOM   5434 C  CB  . ILE D 1 57  ? 68.543  30.469  14.969  1.00 27.76 ? 57  ILE D CB  1 
ATOM   5435 C  CG1 . ILE D 1 57  ? 68.243  31.945  15.220  1.00 28.48 ? 57  ILE D CG1 1 
ATOM   5436 C  CG2 . ILE D 1 57  ? 70.019  30.264  14.647  1.00 27.37 ? 57  ILE D CG2 1 
ATOM   5437 C  CD1 . ILE D 1 57  ? 69.013  32.515  16.408  1.00 28.56 ? 57  ILE D CD1 1 
ATOM   5438 N  N   . THR D 1 58  ? 65.312  30.510  13.582  1.00 31.50 ? 58  THR D N   1 
ATOM   5439 C  CA  . THR D 1 58  ? 63.907  30.450  13.952  1.00 33.47 ? 58  THR D CA  1 
ATOM   5440 C  C   . THR D 1 58  ? 63.230  29.422  13.048  1.00 34.63 ? 58  THR D C   1 
ATOM   5441 O  O   . THR D 1 58  ? 62.053  29.111  13.212  1.00 35.38 ? 58  THR D O   1 
ATOM   5442 C  CB  . THR D 1 58  ? 63.205  31.827  13.791  1.00 34.34 ? 58  THR D CB  1 
ATOM   5443 O  OG1 . THR D 1 58  ? 63.136  32.179  12.405  1.00 34.13 ? 58  THR D OG1 1 
ATOM   5444 C  CG2 . THR D 1 58  ? 63.970  32.908  14.543  1.00 34.08 ? 58  THR D CG2 1 
ATOM   5445 N  N   . LYS D 1 59  ? 63.997  28.872  12.109  1.00 36.60 ? 59  LYS D N   1 
ATOM   5446 C  CA  . LYS D 1 59  ? 63.471  27.886  11.166  1.00 36.78 ? 59  LYS D CA  1 
ATOM   5447 C  C   . LYS D 1 59  ? 64.239  26.563  11.172  1.00 36.07 ? 59  LYS D C   1 
ATOM   5448 O  O   . LYS D 1 59  ? 64.266  25.846  10.169  1.00 34.65 ? 59  LYS D O   1 
ATOM   5449 C  CB  . LYS D 1 59  ? 63.488  28.478  9.756   1.00 39.40 ? 59  LYS D CB  1 
ATOM   5450 C  CG  . LYS D 1 59  ? 62.747  29.800  9.650   1.00 44.05 ? 59  LYS D CG  1 
ATOM   5451 C  CD  . LYS D 1 59  ? 62.855  30.391  8.254   1.00 47.52 ? 59  LYS D CD  1 
ATOM   5452 C  CE  . LYS D 1 59  ? 62.042  31.675  8.139   1.00 49.38 ? 59  LYS D CE  1 
ATOM   5453 N  NZ  . LYS D 1 59  ? 62.062  32.219  6.752   1.00 51.52 ? 59  LYS D NZ  1 
ATOM   5454 N  N   . LEU D 1 60  ? 64.849  26.230  12.303  1.00 35.01 ? 60  LEU D N   1 
ATOM   5455 C  CA  . LEU D 1 60  ? 65.619  24.996  12.398  1.00 34.17 ? 60  LEU D CA  1 
ATOM   5456 C  C   . LEU D 1 60  ? 64.829  23.751  11.998  1.00 35.43 ? 60  LEU D C   1 
ATOM   5457 O  O   . LEU D 1 60  ? 65.390  22.808  11.437  1.00 33.31 ? 60  LEU D O   1 
ATOM   5458 C  CB  . LEU D 1 60  ? 66.178  24.834  13.814  1.00 32.80 ? 60  LEU D CB  1 
ATOM   5459 C  CG  . LEU D 1 60  ? 67.258  25.843  14.223  1.00 30.94 ? 60  LEU D CG  1 
ATOM   5460 C  CD1 . LEU D 1 60  ? 67.608  25.672  15.699  1.00 29.78 ? 60  LEU D CD1 1 
ATOM   5461 C  CD2 . LEU D 1 60  ? 68.492  25.639  13.355  1.00 30.16 ? 60  LEU D CD2 1 
ATOM   5462 N  N   . ASP D 1 61  ? 63.528  23.743  12.273  1.00 36.83 ? 61  ASP D N   1 
ATOM   5463 C  CA  . ASP D 1 61  ? 62.705  22.587  11.928  1.00 39.29 ? 61  ASP D CA  1 
ATOM   5464 C  C   . ASP D 1 61  ? 62.585  22.317  10.432  1.00 39.65 ? 61  ASP D C   1 
ATOM   5465 O  O   . ASP D 1 61  ? 62.208  21.220  10.031  1.00 40.13 ? 61  ASP D O   1 
ATOM   5466 C  CB  . ASP D 1 61  ? 61.302  22.725  12.526  1.00 41.16 ? 61  ASP D CB  1 
ATOM   5467 C  CG  . ASP D 1 61  ? 61.249  22.302  13.975  1.00 41.37 ? 61  ASP D CG  1 
ATOM   5468 O  OD1 . ASP D 1 61  ? 62.126  21.513  14.389  1.00 43.11 ? 61  ASP D OD1 1 
ATOM   5469 O  OD2 . ASP D 1 61  ? 60.330  22.742  14.694  1.00 42.47 ? 61  ASP D OD2 1 
ATOM   5470 N  N   . GLN D 1 62  ? 62.908  23.308  9.608   1.00 41.49 ? 62  GLN D N   1 
ATOM   5471 C  CA  . GLN D 1 62  ? 62.816  23.148  8.160   1.00 43.56 ? 62  GLN D CA  1 
ATOM   5472 C  C   . GLN D 1 62  ? 64.084  22.568  7.550   1.00 44.03 ? 62  GLN D C   1 
ATOM   5473 O  O   . GLN D 1 62  ? 64.099  22.189  6.378   1.00 44.90 ? 62  GLN D O   1 
ATOM   5474 C  CB  . GLN D 1 62  ? 62.524  24.491  7.496   1.00 46.04 ? 62  GLN D CB  1 
ATOM   5475 C  CG  . GLN D 1 62  ? 61.342  25.236  8.081   1.00 50.36 ? 62  GLN D CG  1 
ATOM   5476 C  CD  . GLN D 1 62  ? 61.058  26.532  7.342   1.00 53.09 ? 62  GLN D CD  1 
ATOM   5477 O  OE1 . GLN D 1 62  ? 60.332  27.395  7.836   1.00 55.79 ? 62  GLN D OE1 1 
ATOM   5478 N  NE2 . GLN D 1 62  ? 61.625  26.670  6.146   1.00 53.63 ? 62  GLN D NE2 1 
ATOM   5479 N  N   . LEU D 1 63  ? 65.148  22.503  8.344   1.00 42.72 ? 63  LEU D N   1 
ATOM   5480 C  CA  . LEU D 1 63  ? 66.423  21.981  7.870   1.00 41.95 ? 63  LEU D CA  1 
ATOM   5481 C  C   . LEU D 1 63  ? 66.460  20.464  7.785   1.00 42.13 ? 63  LEU D C   1 
ATOM   5482 O  O   . LEU D 1 63  ? 65.747  19.773  8.512   1.00 42.21 ? 63  LEU D O   1 
ATOM   5483 C  CB  . LEU D 1 63  ? 67.558  22.432  8.793   1.00 40.81 ? 63  LEU D CB  1 
ATOM   5484 C  CG  . LEU D 1 63  ? 67.852  23.924  8.910   1.00 41.04 ? 63  LEU D CG  1 
ATOM   5485 C  CD1 . LEU D 1 63  ? 68.960  24.138  9.933   1.00 40.80 ? 63  LEU D CD1 1 
ATOM   5486 C  CD2 . LEU D 1 63  ? 68.254  24.474  7.554   1.00 40.98 ? 63  LEU D CD2 1 
ATOM   5487 N  N   . PRO D 1 64  ? 67.292  19.927  6.879   1.00 42.20 ? 64  PRO D N   1 
ATOM   5488 C  CA  . PRO D 1 64  ? 67.429  18.478  6.713   1.00 43.35 ? 64  PRO D CA  1 
ATOM   5489 C  C   . PRO D 1 64  ? 67.978  17.930  8.026   1.00 44.23 ? 64  PRO D C   1 
ATOM   5490 O  O   . PRO D 1 64  ? 68.763  18.600  8.697   1.00 43.99 ? 64  PRO D O   1 
ATOM   5491 C  CB  . PRO D 1 64  ? 68.439  18.356  5.578   1.00 43.11 ? 64  PRO D CB  1 
ATOM   5492 C  CG  . PRO D 1 64  ? 68.149  19.564  4.754   1.00 43.48 ? 64  PRO D CG  1 
ATOM   5493 C  CD  . PRO D 1 64  ? 67.993  20.642  5.801   1.00 43.28 ? 64  PRO D CD  1 
ATOM   5494 N  N   . ALA D 1 65  ? 67.569  16.722  8.390   1.00 44.45 ? 65  ALA D N   1 
ATOM   5495 C  CA  . ALA D 1 65  ? 68.017  16.112  9.637   1.00 45.15 ? 65  ALA D CA  1 
ATOM   5496 C  C   . ALA D 1 65  ? 69.528  16.162  9.857   1.00 45.56 ? 65  ALA D C   1 
ATOM   5497 O  O   . ALA D 1 65  ? 69.986  16.512  10.944  1.00 46.38 ? 65  ALA D O   1 
ATOM   5498 C  CB  . ALA D 1 65  ? 67.534  14.667  9.709   1.00 46.48 ? 65  ALA D CB  1 
ATOM   5499 N  N   . ASP D 1 66  ? 70.300  15.817  8.830   1.00 44.87 ? 66  ASP D N   1 
ATOM   5500 C  CA  . ASP D 1 66  ? 71.758  15.800  8.935   1.00 44.58 ? 66  ASP D CA  1 
ATOM   5501 C  C   . ASP D 1 66  ? 72.421  17.172  9.099   1.00 42.75 ? 66  ASP D C   1 
ATOM   5502 O  O   . ASP D 1 66  ? 73.617  17.253  9.371   1.00 43.53 ? 66  ASP D O   1 
ATOM   5503 C  CB  . ASP D 1 66  ? 72.355  15.095  7.713   1.00 46.50 ? 66  ASP D CB  1 
ATOM   5504 C  CG  . ASP D 1 66  ? 72.121  15.860  6.427   1.00 47.82 ? 66  ASP D CG  1 
ATOM   5505 O  OD1 . ASP D 1 66  ? 70.965  16.251  6.168   1.00 50.90 ? 66  ASP D OD1 1 
ATOM   5506 O  OD2 . ASP D 1 66  ? 73.090  16.068  5.669   1.00 50.07 ? 66  ASP D OD2 1 
ATOM   5507 N  N   . LYS D 1 67  ? 71.649  18.244  8.946   1.00 41.12 ? 67  LYS D N   1 
ATOM   5508 C  CA  . LYS D 1 67  ? 72.187  19.602  9.064   1.00 38.51 ? 67  LYS D CA  1 
ATOM   5509 C  C   . LYS D 1 67  ? 71.633  20.373  10.259  1.00 36.70 ? 67  LYS D C   1 
ATOM   5510 O  O   . LYS D 1 67  ? 72.184  21.405  10.650  1.00 32.26 ? 67  LYS D O   1 
ATOM   5511 C  CB  . LYS D 1 67  ? 71.880  20.397  7.790   1.00 39.65 ? 67  LYS D CB  1 
ATOM   5512 C  CG  . LYS D 1 67  ? 72.637  19.947  6.546   1.00 41.89 ? 67  LYS D CG  1 
ATOM   5513 C  CD  . LYS D 1 67  ? 74.117  20.254  6.672   1.00 44.89 ? 67  LYS D CD  1 
ATOM   5514 C  CE  . LYS D 1 67  ? 74.850  20.035  5.356   1.00 47.48 ? 67  LYS D CE  1 
ATOM   5515 N  NZ  . LYS D 1 67  ? 74.833  18.606  4.944   1.00 50.18 ? 67  LYS D NZ  1 
ATOM   5516 N  N   . LYS D 1 68  ? 70.546  19.871  10.835  1.00 33.70 ? 68  LYS D N   1 
ATOM   5517 C  CA  . LYS D 1 68  ? 69.897  20.537  11.955  1.00 34.16 ? 68  LYS D CA  1 
ATOM   5518 C  C   . LYS D 1 68  ? 70.786  20.801  13.176  1.00 30.97 ? 68  LYS D C   1 
ATOM   5519 O  O   . LYS D 1 68  ? 70.842  21.922  13.677  1.00 30.35 ? 68  LYS D O   1 
ATOM   5520 C  CB  . LYS D 1 68  ? 68.668  19.726  12.366  1.00 35.39 ? 68  LYS D CB  1 
ATOM   5521 C  CG  . LYS D 1 68  ? 67.650  20.501  13.170  1.00 39.47 ? 68  LYS D CG  1 
ATOM   5522 C  CD  . LYS D 1 68  ? 66.398  19.672  13.369  1.00 42.04 ? 68  LYS D CD  1 
ATOM   5523 C  CE  . LYS D 1 68  ? 65.328  20.451  14.108  1.00 43.99 ? 68  LYS D CE  1 
ATOM   5524 N  NZ  . LYS D 1 68  ? 64.109  19.616  14.281  1.00 46.13 ? 68  LYS D NZ  1 
ATOM   5525 N  N   . THR D 1 69  ? 71.477  19.776  13.654  1.00 29.45 ? 69  THR D N   1 
ATOM   5526 C  CA  . THR D 1 69  ? 72.325  19.937  14.826  1.00 29.69 ? 69  THR D CA  1 
ATOM   5527 C  C   . THR D 1 69  ? 73.538  20.834  14.595  1.00 27.85 ? 69  THR D C   1 
ATOM   5528 O  O   . THR D 1 69  ? 73.825  21.709  15.412  1.00 26.57 ? 69  THR D O   1 
ATOM   5529 C  CB  . THR D 1 69  ? 72.802  18.573  15.354  1.00 30.41 ? 69  THR D CB  1 
ATOM   5530 O  OG1 . THR D 1 69  ? 71.664  17.800  15.761  1.00 33.71 ? 69  THR D OG1 1 
ATOM   5531 C  CG2 . THR D 1 69  ? 73.733  18.762  16.551  1.00 30.95 ? 69  THR D CG2 1 
ATOM   5532 N  N   . VAL D 1 70  ? 74.246  20.617  13.491  1.00 26.71 ? 70  VAL D N   1 
ATOM   5533 C  CA  . VAL D 1 70  ? 75.427  21.421  13.195  1.00 25.55 ? 70  VAL D CA  1 
ATOM   5534 C  C   . VAL D 1 70  ? 75.074  22.903  13.076  1.00 25.17 ? 70  VAL D C   1 
ATOM   5535 O  O   . VAL D 1 70  ? 75.806  23.758  13.569  1.00 23.46 ? 70  VAL D O   1 
ATOM   5536 C  CB  . VAL D 1 70  ? 76.130  20.949  11.895  1.00 27.41 ? 70  VAL D CB  1 
ATOM   5537 C  CG1 . VAL D 1 70  ? 75.190  21.062  10.718  1.00 29.95 ? 70  VAL D CG1 1 
ATOM   5538 C  CG2 . VAL D 1 70  ? 77.389  21.783  11.648  1.00 30.21 ? 70  VAL D CG2 1 
ATOM   5539 N  N   . LEU D 1 71  ? 73.951  23.213  12.435  1.00 23.04 ? 71  LEU D N   1 
ATOM   5540 C  CA  . LEU D 1 71  ? 73.556  24.607  12.289  1.00 23.61 ? 71  LEU D CA  1 
ATOM   5541 C  C   . LEU D 1 71  ? 72.970  25.166  13.581  1.00 21.97 ? 71  LEU D C   1 
ATOM   5542 O  O   . LEU D 1 71  ? 73.149  26.337  13.892  1.00 21.79 ? 71  LEU D O   1 
ATOM   5543 C  CB  . LEU D 1 71  ? 72.582  24.768  11.117  1.00 25.28 ? 71  LEU D CB  1 
ATOM   5544 C  CG  . LEU D 1 71  ? 73.329  24.790  9.777   1.00 24.93 ? 71  LEU D CG  1 
ATOM   5545 C  CD1 . LEU D 1 71  ? 72.347  24.704  8.616   1.00 27.02 ? 71  LEU D CD1 1 
ATOM   5546 C  CD2 . LEU D 1 71  ? 74.164  26.066  9.693   1.00 24.27 ? 71  LEU D CD2 1 
ATOM   5547 N  N   . ARG D 1 72  ? 72.282  24.329  14.348  1.00 22.27 ? 72  ARG D N   1 
ATOM   5548 C  CA  . ARG D 1 72  ? 71.729  24.782  15.622  1.00 22.05 ? 72  ARG D CA  1 
ATOM   5549 C  C   . ARG D 1 72  ? 72.880  25.276  16.497  1.00 21.06 ? 72  ARG D C   1 
ATOM   5550 O  O   . ARG D 1 72  ? 72.820  26.356  17.092  1.00 22.09 ? 72  ARG D O   1 
ATOM   5551 C  CB  . ARG D 1 72  ? 71.023  23.627  16.337  1.00 22.01 ? 72  ARG D CB  1 
ATOM   5552 C  CG  . ARG D 1 72  ? 70.638  23.915  17.780  1.00 23.25 ? 72  ARG D CG  1 
ATOM   5553 C  CD  . ARG D 1 72  ? 70.040  22.665  18.426  1.00 24.77 ? 72  ARG D CD  1 
ATOM   5554 N  NE  . ARG D 1 72  ? 69.767  22.835  19.849  1.00 25.73 ? 72  ARG D NE  1 
ATOM   5555 C  CZ  . ARG D 1 72  ? 69.099  21.954  20.591  1.00 27.82 ? 72  ARG D CZ  1 
ATOM   5556 N  NH1 . ARG D 1 72  ? 68.633  20.838  20.039  1.00 26.06 ? 72  ARG D NH1 1 
ATOM   5557 N  NH2 . ARG D 1 72  ? 68.898  22.185  21.884  1.00 24.48 ? 72  ARG D NH2 1 
ATOM   5558 N  N   . ASN D 1 73  ? 73.934  24.474  16.567  1.00 19.84 ? 73  ASN D N   1 
ATOM   5559 C  CA  . ASN D 1 73  ? 75.092  24.812  17.382  1.00 20.17 ? 73  ASN D CA  1 
ATOM   5560 C  C   . ASN D 1 73  ? 75.928  25.968  16.842  1.00 19.53 ? 73  ASN D C   1 
ATOM   5561 O  O   . ASN D 1 73  ? 76.233  26.913  17.567  1.00 20.60 ? 73  ASN D O   1 
ATOM   5562 C  CB  . ASN D 1 73  ? 75.992  23.582  17.547  1.00 19.54 ? 73  ASN D CB  1 
ATOM   5563 C  CG  . ASN D 1 73  ? 75.355  22.500  18.406  1.00 21.53 ? 73  ASN D CG  1 
ATOM   5564 O  OD1 . ASN D 1 73  ? 74.438  22.766  19.183  1.00 20.99 ? 73  ASN D OD1 1 
ATOM   5565 N  ND2 . ASN D 1 73  ? 75.858  21.279  18.286  1.00 20.17 ? 73  ASN D ND2 1 
ATOM   5566 N  N   . ASN D 1 74  ? 76.292  25.899  15.567  1.00 19.75 ? 74  ASN D N   1 
ATOM   5567 C  CA  . ASN D 1 74  ? 77.137  26.934  14.985  1.00 19.63 ? 74  ASN D CA  1 
ATOM   5568 C  C   . ASN D 1 74  ? 76.444  28.222  14.545  1.00 20.15 ? 74  ASN D C   1 
ATOM   5569 O  O   . ASN D 1 74  ? 77.010  29.309  14.705  1.00 18.76 ? 74  ASN D O   1 
ATOM   5570 C  CB  . ASN D 1 74  ? 77.971  26.325  13.864  1.00 18.71 ? 74  ASN D CB  1 
ATOM   5571 C  CG  . ASN D 1 74  ? 78.919  25.259  14.382  1.00 22.16 ? 74  ASN D CG  1 
ATOM   5572 O  OD1 . ASN D 1 74  ? 79.895  25.563  15.072  1.00 20.78 ? 74  ASN D OD1 1 
ATOM   5573 N  ND2 . ASN D 1 74  ? 78.619  23.999  14.080  1.00 20.96 ? 74  ASN D ND2 1 
ATOM   5574 N  N   . ALA D 1 75  ? 75.234  28.126  14.000  1.00 18.12 ? 75  ALA D N   1 
ATOM   5575 C  CA  . ALA D 1 75  ? 74.514  29.338  13.618  1.00 20.79 ? 75  ALA D CA  1 
ATOM   5576 C  C   . ALA D 1 75  ? 74.100  29.976  14.942  1.00 20.67 ? 75  ALA D C   1 
ATOM   5577 O  O   . ALA D 1 75  ? 74.075  31.199  15.089  1.00 20.68 ? 75  ALA D O   1 
ATOM   5578 C  CB  . ALA D 1 75  ? 73.271  28.993  12.785  1.00 21.29 ? 75  ALA D CB  1 
ATOM   5579 N  N   . GLY D 1 76  ? 73.767  29.130  15.911  1.00 20.84 ? 76  GLY D N   1 
ATOM   5580 C  CA  . GLY D 1 76  ? 73.390  29.638  17.215  1.00 20.23 ? 76  GLY D CA  1 
ATOM   5581 C  C   . GLY D 1 76  ? 74.585  30.364  17.800  1.00 19.13 ? 76  GLY D C   1 
ATOM   5582 O  O   . GLY D 1 76  ? 74.451  31.454  18.360  1.00 20.15 ? 76  GLY D O   1 
ATOM   5583 N  N   . GLY D 1 77  ? 75.765  29.761  17.662  1.00 18.44 ? 77  GLY D N   1 
ATOM   5584 C  CA  . GLY D 1 77  ? 76.973  30.380  18.176  1.00 16.98 ? 77  GLY D CA  1 
ATOM   5585 C  C   . GLY D 1 77  ? 77.243  31.727  17.516  1.00 19.60 ? 77  GLY D C   1 
ATOM   5586 O  O   . GLY D 1 77  ? 77.614  32.697  18.178  1.00 18.58 ? 77  GLY D O   1 
ATOM   5587 N  N   . HIS D 1 78  ? 77.053  31.791  16.203  1.00 20.72 ? 78  HIS D N   1 
ATOM   5588 C  CA  . HIS D 1 78  ? 77.279  33.030  15.461  1.00 19.95 ? 78  HIS D CA  1 
ATOM   5589 C  C   . HIS D 1 78  ? 76.298  34.118  15.904  1.00 19.49 ? 78  HIS D C   1 
ATOM   5590 O  O   . HIS D 1 78  ? 76.697  35.252  16.164  1.00 20.31 ? 78  HIS D O   1 
ATOM   5591 C  CB  . HIS D 1 78  ? 77.142  32.756  13.961  1.00 21.62 ? 78  HIS D CB  1 
ATOM   5592 C  CG  . HIS D 1 78  ? 77.261  33.978  13.101  1.00 22.41 ? 78  HIS D CG  1 
ATOM   5593 N  ND1 . HIS D 1 78  ? 78.223  34.944  13.305  1.00 22.95 ? 78  HIS D ND1 1 
ATOM   5594 C  CD2 . HIS D 1 78  ? 76.555  34.374  12.015  1.00 23.02 ? 78  HIS D CD2 1 
ATOM   5595 C  CE1 . HIS D 1 78  ? 78.105  35.882  12.381  1.00 25.17 ? 78  HIS D CE1 1 
ATOM   5596 N  NE2 . HIS D 1 78  ? 77.100  35.560  11.586  1.00 24.62 ? 78  HIS D NE2 1 
ATOM   5597 N  N   . ALA D 1 79  ? 75.018  33.768  15.995  1.00 20.04 ? 79  ALA D N   1 
ATOM   5598 C  CA  . ALA D 1 79  ? 73.996  34.729  16.410  1.00 20.36 ? 79  ALA D CA  1 
ATOM   5599 C  C   . ALA D 1 79  ? 74.254  35.259  17.817  1.00 19.90 ? 79  ALA D C   1 
ATOM   5600 O  O   . ALA D 1 79  ? 74.225  36.465  18.048  1.00 21.54 ? 79  ALA D O   1 
ATOM   5601 C  CB  . ALA D 1 79  ? 72.612  34.088  16.349  1.00 21.57 ? 79  ALA D CB  1 
ATOM   5602 N  N   . ASN D 1 80  ? 74.507  34.354  18.756  1.00 18.35 ? 80  ASN D N   1 
ATOM   5603 C  CA  . ASN D 1 80  ? 74.747  34.741  20.144  1.00 19.30 ? 80  ASN D CA  1 
ATOM   5604 C  C   . ASN D 1 80  ? 75.968  35.629  20.335  1.00 19.30 ? 80  ASN D C   1 
ATOM   5605 O  O   . ASN D 1 80  ? 75.894  36.654  21.015  1.00 19.41 ? 80  ASN D O   1 
ATOM   5606 C  CB  . ASN D 1 80  ? 74.896  33.497  21.023  1.00 21.06 ? 80  ASN D CB  1 
ATOM   5607 C  CG  . ASN D 1 80  ? 73.584  32.768  21.218  1.00 23.46 ? 80  ASN D CG  1 
ATOM   5608 O  OD1 . ASN D 1 80  ? 72.564  33.147  20.644  1.00 23.70 ? 80  ASN D OD1 1 
ATOM   5609 N  ND2 . ASN D 1 80  ? 73.601  31.717  22.035  1.00 22.62 ? 80  ASN D ND2 1 
ATOM   5610 N  N   . HIS D 1 81  ? 77.095  35.240  19.750  1.00 18.08 ? 81  HIS D N   1 
ATOM   5611 C  CA  . HIS D 1 81  ? 78.299  36.036  19.911  1.00 19.41 ? 81  HIS D CA  1 
ATOM   5612 C  C   . HIS D 1 81  ? 78.206  37.385  19.200  1.00 21.21 ? 81  HIS D C   1 
ATOM   5613 O  O   . HIS D 1 81  ? 78.745  38.375  19.686  1.00 22.79 ? 81  HIS D O   1 
ATOM   5614 C  CB  . HIS D 1 81  ? 79.535  35.255  19.439  1.00 19.33 ? 81  HIS D CB  1 
ATOM   5615 C  CG  . HIS D 1 81  ? 79.906  34.118  20.346  1.00 19.21 ? 81  HIS D CG  1 
ATOM   5616 N  ND1 . HIS D 1 81  ? 79.238  32.914  20.343  1.00 18.01 ? 81  HIS D ND1 1 
ATOM   5617 C  CD2 . HIS D 1 81  ? 80.830  34.032  21.333  1.00 20.49 ? 81  HIS D CD2 1 
ATOM   5618 C  CE1 . HIS D 1 81  ? 79.730  32.134  21.290  1.00 20.17 ? 81  HIS D CE1 1 
ATOM   5619 N  NE2 . HIS D 1 81  ? 80.698  32.789  21.907  1.00 20.92 ? 81  HIS D NE2 1 
ATOM   5620 N  N   . SER D 1 82  ? 77.527  37.432  18.059  1.00 22.18 ? 82  SER D N   1 
ATOM   5621 C  CA  . SER D 1 82  ? 77.385  38.698  17.342  1.00 24.43 ? 82  SER D CA  1 
ATOM   5622 C  C   . SER D 1 82  ? 76.626  39.676  18.233  1.00 24.41 ? 82  SER D C   1 
ATOM   5623 O  O   . SER D 1 82  ? 76.981  40.851  18.332  1.00 25.89 ? 82  SER D O   1 
ATOM   5624 C  CB  . SER D 1 82  ? 76.633  38.493  16.022  1.00 22.40 ? 82  SER D CB  1 
ATOM   5625 O  OG  . SER D 1 82  ? 77.426  37.754  15.112  1.00 24.14 ? 82  SER D OG  1 
ATOM   5626 N  N   . LEU D 1 83  ? 75.581  39.182  18.889  1.00 24.92 ? 83  LEU D N   1 
ATOM   5627 C  CA  . LEU D 1 83  ? 74.783  40.016  19.780  1.00 26.81 ? 83  LEU D CA  1 
ATOM   5628 C  C   . LEU D 1 83  ? 75.611  40.437  20.999  1.00 26.32 ? 83  LEU D C   1 
ATOM   5629 O  O   . LEU D 1 83  ? 75.533  41.579  21.451  1.00 27.65 ? 83  LEU D O   1 
ATOM   5630 C  CB  . LEU D 1 83  ? 73.525  39.252  20.222  1.00 29.49 ? 83  LEU D CB  1 
ATOM   5631 C  CG  . LEU D 1 83  ? 72.528  39.960  21.144  1.00 33.01 ? 83  LEU D CG  1 
ATOM   5632 C  CD1 . LEU D 1 83  ? 71.185  39.260  21.070  1.00 34.35 ? 83  LEU D CD1 1 
ATOM   5633 C  CD2 . LEU D 1 83  ? 73.053  39.969  22.573  1.00 36.30 ? 83  LEU D CD2 1 
ATOM   5634 N  N   . PHE D 1 84  ? 76.416  39.511  21.511  1.00 24.55 ? 84  PHE D N   1 
ATOM   5635 C  CA  . PHE D 1 84  ? 77.267  39.757  22.679  1.00 24.50 ? 84  PHE D CA  1 
ATOM   5636 C  C   . PHE D 1 84  ? 78.228  40.943  22.485  1.00 24.99 ? 84  PHE D C   1 
ATOM   5637 O  O   . PHE D 1 84  ? 78.307  41.833  23.336  1.00 24.40 ? 84  PHE D O   1 
ATOM   5638 C  CB  . PHE D 1 84  ? 78.065  38.478  23.000  1.00 22.41 ? 84  PHE D CB  1 
ATOM   5639 C  CG  . PHE D 1 84  ? 78.745  38.483  24.354  1.00 21.77 ? 84  PHE D CG  1 
ATOM   5640 C  CD1 . PHE D 1 84  ? 78.012  38.686  25.520  1.00 21.08 ? 84  PHE D CD1 1 
ATOM   5641 C  CD2 . PHE D 1 84  ? 80.111  38.228  24.463  1.00 20.76 ? 84  PHE D CD2 1 
ATOM   5642 C  CE1 . PHE D 1 84  ? 78.629  38.631  26.774  1.00 21.77 ? 84  PHE D CE1 1 
ATOM   5643 C  CE2 . PHE D 1 84  ? 80.737  38.169  25.716  1.00 22.43 ? 84  PHE D CE2 1 
ATOM   5644 C  CZ  . PHE D 1 84  ? 79.994  38.371  26.871  1.00 18.93 ? 84  PHE D CZ  1 
ATOM   5645 N  N   . TRP D 1 85  ? 78.955  40.959  21.370  1.00 24.65 ? 85  TRP D N   1 
ATOM   5646 C  CA  . TRP D 1 85  ? 79.916  42.033  21.108  1.00 25.24 ? 85  TRP D CA  1 
ATOM   5647 C  C   . TRP D 1 85  ? 79.253  43.407  21.125  1.00 25.94 ? 85  TRP D C   1 
ATOM   5648 O  O   . TRP D 1 85  ? 79.775  44.348  21.718  1.00 28.30 ? 85  TRP D O   1 
ATOM   5649 C  CB  . TRP D 1 85  ? 80.592  41.836  19.746  1.00 24.73 ? 85  TRP D CB  1 
ATOM   5650 C  CG  . TRP D 1 85  ? 81.199  40.471  19.517  1.00 23.24 ? 85  TRP D CG  1 
ATOM   5651 C  CD1 . TRP D 1 85  ? 81.115  39.725  18.374  1.00 23.18 ? 85  TRP D CD1 1 
ATOM   5652 C  CD2 . TRP D 1 85  ? 81.981  39.701  20.441  1.00 24.74 ? 85  TRP D CD2 1 
ATOM   5653 N  NE1 . TRP D 1 85  ? 81.793  38.539  18.530  1.00 23.25 ? 85  TRP D NE1 1 
ATOM   5654 C  CE2 . TRP D 1 85  ? 82.335  38.497  19.787  1.00 24.56 ? 85  TRP D CE2 1 
ATOM   5655 C  CE3 . TRP D 1 85  ? 82.419  39.910  21.758  1.00 24.35 ? 85  TRP D CE3 1 
ATOM   5656 C  CZ2 . TRP D 1 85  ? 83.106  37.502  20.404  1.00 25.15 ? 85  TRP D CZ2 1 
ATOM   5657 C  CZ3 . TRP D 1 85  ? 83.191  38.917  22.374  1.00 24.08 ? 85  TRP D CZ3 1 
ATOM   5658 C  CH2 . TRP D 1 85  ? 83.524  37.731  21.693  1.00 25.26 ? 85  TRP D CH2 1 
ATOM   5659 N  N   . LYS D 1 86  ? 78.107  43.514  20.463  1.00 26.98 ? 86  LYS D N   1 
ATOM   5660 C  CA  . LYS D 1 86  ? 77.379  44.777  20.391  1.00 30.32 ? 86  LYS D CA  1 
ATOM   5661 C  C   . LYS D 1 86  ? 76.739  45.160  21.722  1.00 30.99 ? 86  LYS D C   1 
ATOM   5662 O  O   . LYS D 1 86  ? 76.426  46.332  21.954  1.00 31.00 ? 86  LYS D O   1 
ATOM   5663 C  CB  . LYS D 1 86  ? 76.305  44.697  19.300  1.00 32.09 ? 86  LYS D CB  1 
ATOM   5664 C  CG  . LYS D 1 86  ? 76.873  44.466  17.903  1.00 36.88 ? 86  LYS D CG  1 
ATOM   5665 C  CD  . LYS D 1 86  ? 75.777  44.267  16.862  1.00 41.68 ? 86  LYS D CD  1 
ATOM   5666 C  CE  . LYS D 1 86  ? 74.941  45.525  16.672  1.00 45.92 ? 86  LYS D CE  1 
ATOM   5667 N  NZ  . LYS D 1 86  ? 73.851  45.328  15.667  1.00 48.51 ? 86  LYS D NZ  1 
ATOM   5668 N  N   . GLY D 1 87  ? 76.554  44.172  22.593  1.00 29.68 ? 87  GLY D N   1 
ATOM   5669 C  CA  . GLY D 1 87  ? 75.940  44.426  23.883  1.00 30.00 ? 87  GLY D CA  1 
ATOM   5670 C  C   . GLY D 1 87  ? 76.898  44.837  24.985  1.00 29.00 ? 87  GLY D C   1 
ATOM   5671 O  O   . GLY D 1 87  ? 76.494  44.961  26.139  1.00 30.42 ? 87  GLY D O   1 
ATOM   5672 N  N   . LEU D 1 88  ? 78.163  45.049  24.640  1.00 28.58 ? 88  LEU D N   1 
ATOM   5673 C  CA  . LEU D 1 88  ? 79.163  45.448  25.624  1.00 28.65 ? 88  LEU D CA  1 
ATOM   5674 C  C   . LEU D 1 88  ? 79.689  46.840  25.306  1.00 31.93 ? 88  LEU D C   1 
ATOM   5675 O  O   . LEU D 1 88  ? 79.821  47.207  24.139  1.00 29.95 ? 88  LEU D O   1 
ATOM   5676 C  CB  . LEU D 1 88  ? 80.336  44.471  25.626  1.00 28.78 ? 88  LEU D CB  1 
ATOM   5677 C  CG  . LEU D 1 88  ? 80.032  42.988  25.854  1.00 28.27 ? 88  LEU D CG  1 
ATOM   5678 C  CD1 . LEU D 1 88  ? 81.321  42.193  25.710  1.00 28.46 ? 88  LEU D CD1 1 
ATOM   5679 C  CD2 . LEU D 1 88  ? 79.420  42.779  27.232  1.00 28.75 ? 88  LEU D CD2 1 
ATOM   5680 N  N   . LYS D 1 89  ? 79.994  47.601  26.353  1.00 33.42 ? 89  LYS D N   1 
ATOM   5681 C  CA  . LYS D 1 89  ? 80.514  48.954  26.206  1.00 38.15 ? 89  LYS D CA  1 
ATOM   5682 C  C   . LYS D 1 89  ? 80.585  49.623  27.570  1.00 38.60 ? 89  LYS D C   1 
ATOM   5683 O  O   . LYS D 1 89  ? 79.653  49.512  28.368  1.00 38.01 ? 89  LYS D O   1 
ATOM   5684 C  CB  . LYS D 1 89  ? 79.608  49.780  25.291  1.00 40.12 ? 89  LYS D CB  1 
ATOM   5685 C  CG  . LYS D 1 89  ? 80.149  51.165  24.968  1.00 44.62 ? 89  LYS D CG  1 
ATOM   5686 C  CD  . LYS D 1 89  ? 79.166  51.944  24.111  1.00 47.88 ? 89  LYS D CD  1 
ATOM   5687 C  CE  . LYS D 1 89  ? 79.696  53.327  23.776  1.00 50.68 ? 89  LYS D CE  1 
ATOM   5688 N  NZ  . LYS D 1 89  ? 78.709  54.097  22.969  1.00 53.43 ? 89  LYS D NZ  1 
ATOM   5689 N  N   . LYS D 1 90  ? 81.693  50.309  27.833  1.00 39.99 ? 90  LYS D N   1 
ATOM   5690 C  CA  . LYS D 1 90  ? 81.881  51.016  29.099  1.00 42.74 ? 90  LYS D CA  1 
ATOM   5691 C  C   . LYS D 1 90  ? 81.256  52.401  29.014  1.00 43.65 ? 90  LYS D C   1 
ATOM   5692 O  O   . LYS D 1 90  ? 81.001  52.904  27.924  1.00 43.78 ? 90  LYS D O   1 
ATOM   5693 C  CB  . LYS D 1 90  ? 83.369  51.185  29.405  1.00 42.25 ? 90  LYS D CB  1 
ATOM   5694 C  CG  . LYS D 1 90  ? 84.138  49.899  29.583  1.00 42.75 ? 90  LYS D CG  1 
ATOM   5695 C  CD  . LYS D 1 90  ? 85.619  50.184  29.790  1.00 43.17 ? 90  LYS D CD  1 
ATOM   5696 C  CE  . LYS D 1 90  ? 85.858  51.065  31.011  1.00 43.61 ? 90  LYS D CE  1 
ATOM   5697 N  NZ  . LYS D 1 90  ? 87.307  51.361  31.204  1.00 43.68 ? 90  LYS D NZ  1 
ATOM   5698 N  N   . GLY D 1 91  ? 81.014  53.014  30.168  1.00 46.24 ? 91  GLY D N   1 
ATOM   5699 C  CA  . GLY D 1 91  ? 80.449  54.353  30.200  1.00 47.56 ? 91  GLY D CA  1 
ATOM   5700 C  C   . GLY D 1 91  ? 79.015  54.494  29.731  1.00 48.68 ? 91  GLY D C   1 
ATOM   5701 O  O   . GLY D 1 91  ? 78.674  55.439  29.020  1.00 50.10 ? 91  GLY D O   1 
ATOM   5702 N  N   . THR D 1 92  ? 78.167  53.560  30.137  1.00 49.11 ? 92  THR D N   1 
ATOM   5703 C  CA  . THR D 1 92  ? 76.763  53.594  29.759  1.00 49.45 ? 92  THR D CA  1 
ATOM   5704 C  C   . THR D 1 92  ? 75.915  53.563  31.030  1.00 50.19 ? 92  THR D C   1 
ATOM   5705 O  O   . THR D 1 92  ? 76.354  53.045  32.058  1.00 50.98 ? 92  THR D O   1 
ATOM   5706 C  CB  . THR D 1 92  ? 76.417  52.385  28.868  1.00 50.21 ? 92  THR D CB  1 
ATOM   5707 O  OG1 . THR D 1 92  ? 75.020  52.398  28.555  1.00 51.95 ? 92  THR D OG1 1 
ATOM   5708 C  CG2 . THR D 1 92  ? 76.766  51.089  29.580  1.00 48.56 ? 92  THR D CG2 1 
ATOM   5709 N  N   . THR D 1 93  ? 74.710  54.123  30.970  1.00 50.81 ? 93  THR D N   1 
ATOM   5710 C  CA  . THR D 1 93  ? 73.830  54.134  32.137  1.00 52.31 ? 93  THR D CA  1 
ATOM   5711 C  C   . THR D 1 93  ? 72.399  53.756  31.765  1.00 53.04 ? 93  THR D C   1 
ATOM   5712 O  O   . THR D 1 93  ? 71.875  54.206  30.746  1.00 53.29 ? 93  THR D O   1 
ATOM   5713 C  CB  . THR D 1 93  ? 73.811  55.525  32.828  1.00 52.22 ? 93  THR D CB  1 
ATOM   5714 O  OG1 . THR D 1 93  ? 73.195  56.487  31.962  1.00 52.35 ? 93  THR D OG1 1 
ATOM   5715 C  CG2 . THR D 1 93  ? 75.229  55.983  33.152  1.00 51.84 ? 93  THR D CG2 1 
ATOM   5716 N  N   . LEU D 1 94  ? 71.776  52.921  32.590  1.00 54.01 ? 94  LEU D N   1 
ATOM   5717 C  CA  . LEU D 1 94  ? 70.401  52.497  32.344  1.00 56.24 ? 94  LEU D CA  1 
ATOM   5718 C  C   . LEU D 1 94  ? 69.469  53.683  32.562  1.00 57.88 ? 94  LEU D C   1 
ATOM   5719 O  O   . LEU D 1 94  ? 69.705  54.504  33.448  1.00 58.12 ? 94  LEU D O   1 
ATOM   5720 C  CB  . LEU D 1 94  ? 70.017  51.357  33.292  1.00 55.56 ? 94  LEU D CB  1 
ATOM   5721 C  CG  . LEU D 1 94  ? 68.565  50.873  33.213  1.00 56.39 ? 94  LEU D CG  1 
ATOM   5722 C  CD1 . LEU D 1 94  ? 68.252  50.371  31.811  1.00 55.75 ? 94  LEU D CD1 1 
ATOM   5723 C  CD2 . LEU D 1 94  ? 68.343  49.773  34.234  1.00 56.48 ? 94  LEU D CD2 1 
ATOM   5724 N  N   . GLN D 1 95  ? 68.410  53.772  31.761  1.00 59.70 ? 95  GLN D N   1 
ATOM   5725 C  CA  . GLN D 1 95  ? 67.469  54.881  31.887  1.00 60.71 ? 95  GLN D CA  1 
ATOM   5726 C  C   . GLN D 1 95  ? 66.300  54.770  30.915  1.00 59.68 ? 95  GLN D C   1 
ATOM   5727 O  O   . GLN D 1 95  ? 66.105  53.739  30.270  1.00 59.97 ? 95  GLN D O   1 
ATOM   5728 C  CB  . GLN D 1 95  ? 68.204  56.199  31.641  1.00 62.65 ? 95  GLN D CB  1 
ATOM   5729 C  CG  . GLN D 1 95  ? 68.750  56.338  30.228  1.00 65.70 ? 95  GLN D CG  1 
ATOM   5730 C  CD  . GLN D 1 95  ? 69.861  57.364  30.129  1.00 68.15 ? 95  GLN D CD  1 
ATOM   5731 O  OE1 . GLN D 1 95  ? 70.283  57.736  29.033  1.00 69.86 ? 95  GLN D OE1 1 
ATOM   5732 N  NE2 . GLN D 1 95  ? 70.351  57.820  31.277  1.00 69.28 ? 95  GLN D NE2 1 
ATOM   5733 N  N   . GLY D 1 96  ? 65.522  55.845  30.829  1.00 58.13 ? 96  GLY D N   1 
ATOM   5734 C  CA  . GLY D 1 96  ? 64.386  55.891  29.926  1.00 56.63 ? 96  GLY D CA  1 
ATOM   5735 C  C   . GLY D 1 96  ? 63.404  54.739  29.997  1.00 55.96 ? 96  GLY D C   1 
ATOM   5736 O  O   . GLY D 1 96  ? 63.216  54.126  31.047  1.00 55.50 ? 96  GLY D O   1 
ATOM   5737 N  N   . ASP D 1 97  ? 62.777  54.454  28.857  1.00 55.59 ? 97  ASP D N   1 
ATOM   5738 C  CA  . ASP D 1 97  ? 61.786  53.388  28.732  1.00 54.99 ? 97  ASP D CA  1 
ATOM   5739 C  C   . ASP D 1 97  ? 62.239  52.028  29.256  1.00 53.80 ? 97  ASP D C   1 
ATOM   5740 O  O   . ASP D 1 97  ? 61.476  51.332  29.929  1.00 53.84 ? 97  ASP D O   1 
ATOM   5741 C  CB  . ASP D 1 97  ? 61.365  53.228  27.266  1.00 56.70 ? 97  ASP D CB  1 
ATOM   5742 C  CG  . ASP D 1 97  ? 60.602  54.430  26.736  1.00 58.76 ? 97  ASP D CG  1 
ATOM   5743 O  OD1 . ASP D 1 97  ? 59.536  54.759  27.302  1.00 59.30 ? 97  ASP D OD1 1 
ATOM   5744 O  OD2 . ASP D 1 97  ? 61.066  55.042  25.749  1.00 58.12 ? 97  ASP D OD2 1 
ATOM   5745 N  N   . LEU D 1 98  ? 63.473  51.646  28.938  1.00 51.41 ? 98  LEU D N   1 
ATOM   5746 C  CA  . LEU D 1 98  ? 63.998  50.353  29.367  1.00 49.71 ? 98  LEU D CA  1 
ATOM   5747 C  C   . LEU D 1 98  ? 64.003  50.242  30.882  1.00 48.50 ? 98  LEU D C   1 
ATOM   5748 O  O   . LEU D 1 98  ? 63.516  49.258  31.441  1.00 47.19 ? 98  LEU D O   1 
ATOM   5749 C  CB  . LEU D 1 98  ? 65.421  50.139  28.835  1.00 49.98 ? 98  LEU D CB  1 
ATOM   5750 C  CG  . LEU D 1 98  ? 66.090  48.822  29.255  1.00 50.03 ? 98  LEU D CG  1 
ATOM   5751 C  CD1 . LEU D 1 98  ? 65.252  47.648  28.777  1.00 49.41 ? 98  LEU D CD1 1 
ATOM   5752 C  CD2 . LEU D 1 98  ? 67.495  48.740  28.681  1.00 48.82 ? 98  LEU D CD2 1 
ATOM   5753 N  N   . LYS D 1 99  ? 64.554  51.254  31.545  1.00 48.14 ? 99  LYS D N   1 
ATOM   5754 C  CA  . LYS D 1 99  ? 64.613  51.256  33.000  1.00 49.67 ? 99  LYS D CA  1 
ATOM   5755 C  C   . LYS D 1 99  ? 63.211  51.154  33.593  1.00 49.26 ? 99  LYS D C   1 
ATOM   5756 O  O   . LYS D 1 99  ? 62.985  50.425  34.560  1.00 49.54 ? 99  LYS D O   1 
ATOM   5757 C  CB  . LYS D 1 99  ? 65.293  52.531  33.507  1.00 51.01 ? 99  LYS D CB  1 
ATOM   5758 C  CG  . LYS D 1 99  ? 65.389  52.595  35.019  1.00 53.35 ? 99  LYS D CG  1 
ATOM   5759 C  CD  . LYS D 1 99  ? 66.101  53.845  35.492  1.00 54.85 ? 99  LYS D CD  1 
ATOM   5760 C  CE  . LYS D 1 99  ? 66.162  53.888  37.013  1.00 56.17 ? 99  LYS D CE  1 
ATOM   5761 N  NZ  . LYS D 1 99  ? 66.871  55.100  37.511  1.00 57.81 ? 99  LYS D NZ  1 
ATOM   5762 N  N   . ALA D 1 100 ? 62.272  51.887  33.006  1.00 49.01 ? 100 ALA D N   1 
ATOM   5763 C  CA  . ALA D 1 100 ? 60.892  51.881  33.472  1.00 48.63 ? 100 ALA D CA  1 
ATOM   5764 C  C   . ALA D 1 100 ? 60.292  50.484  33.359  1.00 48.51 ? 100 ALA D C   1 
ATOM   5765 O  O   . ALA D 1 100 ? 59.630  50.008  34.279  1.00 48.65 ? 100 ALA D O   1 
ATOM   5766 C  CB  . ALA D 1 100 ? 60.062  52.869  32.657  1.00 49.13 ? 100 ALA D CB  1 
ATOM   5767 N  N   . ALA D 1 101 ? 60.524  49.834  32.222  1.00 48.29 ? 101 ALA D N   1 
ATOM   5768 C  CA  . ALA D 1 101 ? 60.003  48.493  31.994  1.00 47.79 ? 101 ALA D CA  1 
ATOM   5769 C  C   . ALA D 1 101 ? 60.607  47.501  32.984  1.00 47.85 ? 101 ALA D C   1 
ATOM   5770 O  O   . ALA D 1 101 ? 59.918  46.604  33.476  1.00 47.31 ? 101 ALA D O   1 
ATOM   5771 C  CB  . ALA D 1 101 ? 60.297  48.056  30.563  1.00 48.71 ? 101 ALA D CB  1 
ATOM   5772 N  N   . ILE D 1 102 ? 61.894  47.663  33.277  1.00 47.82 ? 102 ILE D N   1 
ATOM   5773 C  CA  . ILE D 1 102 ? 62.560  46.770  34.214  1.00 48.67 ? 102 ILE D CA  1 
ATOM   5774 C  C   . ILE D 1 102 ? 61.927  46.894  35.595  1.00 50.04 ? 102 ILE D C   1 
ATOM   5775 O  O   . ILE D 1 102 ? 61.526  45.894  36.195  1.00 49.51 ? 102 ILE D O   1 
ATOM   5776 C  CB  . ILE D 1 102 ? 64.074  47.065  34.306  1.00 48.74 ? 102 ILE D CB  1 
ATOM   5777 C  CG1 . ILE D 1 102 ? 64.756  46.666  32.993  1.00 48.48 ? 102 ILE D CG1 1 
ATOM   5778 C  CG2 . ILE D 1 102 ? 64.690  46.294  35.469  1.00 48.75 ? 102 ILE D CG2 1 
ATOM   5779 C  CD1 . ILE D 1 102 ? 66.251  46.924  32.966  1.00 47.20 ? 102 ILE D CD1 1 
ATOM   5780 N  N   . GLU D 1 103 ? 61.825  48.122  36.091  1.00 51.07 ? 103 GLU D N   1 
ATOM   5781 C  CA  . GLU D 1 103 ? 61.237  48.360  37.403  1.00 51.94 ? 103 GLU D CA  1 
ATOM   5782 C  C   . GLU D 1 103 ? 59.795  47.868  37.436  1.00 52.15 ? 103 GLU D C   1 
ATOM   5783 O  O   . GLU D 1 103 ? 59.315  47.390  38.462  1.00 51.74 ? 103 GLU D O   1 
ATOM   5784 C  CB  . GLU D 1 103 ? 61.316  49.851  37.740  1.00 53.07 ? 103 GLU D CB  1 
ATOM   5785 C  CG  . GLU D 1 103 ? 62.743  50.380  37.709  1.00 55.60 ? 103 GLU D CG  1 
ATOM   5786 C  CD  . GLU D 1 103 ? 62.837  51.881  37.916  1.00 58.29 ? 103 GLU D CD  1 
ATOM   5787 O  OE1 . GLU D 1 103 ? 62.133  52.632  37.206  1.00 59.82 ? 103 GLU D OE1 1 
ATOM   5788 O  OE2 . GLU D 1 103 ? 63.630  52.312  38.781  1.00 59.10 ? 103 GLU D OE2 1 
ATOM   5789 N  N   . ARG D 1 104 ? 59.114  47.964  36.300  1.00 53.01 ? 104 ARG D N   1 
ATOM   5790 C  CA  . ARG D 1 104 ? 57.729  47.525  36.202  1.00 53.97 ? 104 ARG D CA  1 
ATOM   5791 C  C   . ARG D 1 104 ? 57.585  46.007  36.317  1.00 54.47 ? 104 ARG D C   1 
ATOM   5792 O  O   . ARG D 1 104 ? 56.765  45.513  37.092  1.00 54.21 ? 104 ARG D O   1 
ATOM   5793 C  CB  . ARG D 1 104 ? 57.127  47.985  34.875  1.00 56.04 ? 104 ARG D CB  1 
ATOM   5794 C  CG  . ARG D 1 104 ? 55.679  47.566  34.674  1.00 59.90 ? 104 ARG D CG  1 
ATOM   5795 C  CD  . ARG D 1 104 ? 55.248  47.776  33.233  1.00 63.22 ? 104 ARG D CD  1 
ATOM   5796 N  NE  . ARG D 1 104 ? 56.067  46.987  32.315  1.00 67.76 ? 104 ARG D NE  1 
ATOM   5797 C  CZ  . ARG D 1 104 ? 55.911  46.968  30.995  1.00 69.40 ? 104 ARG D CZ  1 
ATOM   5798 N  NH1 . ARG D 1 104 ? 54.960  47.697  30.426  1.00 71.51 ? 104 ARG D NH1 1 
ATOM   5799 N  NH2 . ARG D 1 104 ? 56.708  46.221  30.241  1.00 70.09 ? 104 ARG D NH2 1 
ATOM   5800 N  N   . ASP D 1 105 ? 58.384  45.271  35.549  1.00 53.99 ? 105 ASP D N   1 
ATOM   5801 C  CA  . ASP D 1 105 ? 58.308  43.813  35.559  1.00 54.09 ? 105 ASP D CA  1 
ATOM   5802 C  C   . ASP D 1 105 ? 59.116  43.119  36.649  1.00 52.92 ? 105 ASP D C   1 
ATOM   5803 O  O   . ASP D 1 105 ? 58.851  41.961  36.969  1.00 53.26 ? 105 ASP D O   1 
ATOM   5804 C  CB  . ASP D 1 105 ? 58.724  43.260  34.196  1.00 56.49 ? 105 ASP D CB  1 
ATOM   5805 C  CG  . ASP D 1 105 ? 57.795  43.699  33.086  1.00 59.02 ? 105 ASP D CG  1 
ATOM   5806 O  OD1 . ASP D 1 105 ? 56.569  43.496  33.220  1.00 61.43 ? 105 ASP D OD1 1 
ATOM   5807 O  OD2 . ASP D 1 105 ? 58.290  44.244  32.078  1.00 61.38 ? 105 ASP D OD2 1 
ATOM   5808 N  N   . PHE D 1 106 ? 60.091  43.815  37.222  1.00 51.81 ? 106 PHE D N   1 
ATOM   5809 C  CA  . PHE D 1 106 ? 60.921  43.219  38.264  1.00 51.62 ? 106 PHE D CA  1 
ATOM   5810 C  C   . PHE D 1 106 ? 60.820  43.934  39.608  1.00 51.57 ? 106 PHE D C   1 
ATOM   5811 O  O   . PHE D 1 106 ? 61.419  43.503  40.593  1.00 50.98 ? 106 PHE D O   1 
ATOM   5812 C  CB  . PHE D 1 106 ? 62.380  43.173  37.795  1.00 51.24 ? 106 PHE D CB  1 
ATOM   5813 C  CG  . PHE D 1 106 ? 62.602  42.264  36.618  1.00 51.25 ? 106 PHE D CG  1 
ATOM   5814 C  CD1 . PHE D 1 106 ? 62.574  40.880  36.777  1.00 51.21 ? 106 PHE D CD1 1 
ATOM   5815 C  CD2 . PHE D 1 106 ? 62.791  42.787  35.343  1.00 51.37 ? 106 PHE D CD2 1 
ATOM   5816 C  CE1 . PHE D 1 106 ? 62.729  40.028  35.681  1.00 50.39 ? 106 PHE D CE1 1 
ATOM   5817 C  CE2 . PHE D 1 106 ? 62.947  41.944  34.238  1.00 50.86 ? 106 PHE D CE2 1 
ATOM   5818 C  CZ  . PHE D 1 106 ? 62.914  40.563  34.410  1.00 49.88 ? 106 PHE D CZ  1 
ATOM   5819 N  N   . GLY D 1 107 ? 60.054  45.019  39.649  1.00 52.30 ? 107 GLY D N   1 
ATOM   5820 C  CA  . GLY D 1 107 ? 59.900  45.760  40.889  1.00 52.19 ? 107 GLY D CA  1 
ATOM   5821 C  C   . GLY D 1 107 ? 60.952  46.840  41.042  1.00 52.84 ? 107 GLY D C   1 
ATOM   5822 O  O   . GLY D 1 107 ? 60.649  47.960  41.457  1.00 53.66 ? 107 GLY D O   1 
ATOM   5823 N  N   . SER D 1 108 ? 62.195  46.504  40.714  1.00 52.22 ? 108 SER D N   1 
ATOM   5824 C  CA  . SER D 1 108 ? 63.293  47.459  40.801  1.00 51.82 ? 108 SER D CA  1 
ATOM   5825 C  C   . SER D 1 108 ? 64.485  46.936  40.016  1.00 51.80 ? 108 SER D C   1 
ATOM   5826 O  O   . SER D 1 108 ? 64.532  45.762  39.647  1.00 50.92 ? 108 SER D O   1 
ATOM   5827 C  CB  . SER D 1 108 ? 63.712  47.681  42.256  1.00 52.50 ? 108 SER D CB  1 
ATOM   5828 O  OG  . SER D 1 108 ? 64.441  46.574  42.754  1.00 52.79 ? 108 SER D OG  1 
ATOM   5829 N  N   . VAL D 1 109 ? 65.447  47.815  39.763  1.00 51.68 ? 109 VAL D N   1 
ATOM   5830 C  CA  . VAL D 1 109 ? 66.643  47.439  39.029  1.00 51.70 ? 109 VAL D CA  1 
ATOM   5831 C  C   . VAL D 1 109 ? 67.439  46.405  39.817  1.00 51.62 ? 109 VAL D C   1 
ATOM   5832 O  O   . VAL D 1 109 ? 67.993  45.467  39.243  1.00 51.84 ? 109 VAL D O   1 
ATOM   5833 C  CB  . VAL D 1 109 ? 67.526  48.675  38.757  1.00 52.28 ? 109 VAL D CB  1 
ATOM   5834 C  CG1 . VAL D 1 109 ? 68.878  48.250  38.213  1.00 52.90 ? 109 VAL D CG1 1 
ATOM   5835 C  CG2 . VAL D 1 109 ? 66.825  49.594  37.767  1.00 52.07 ? 109 VAL D CG2 1 
ATOM   5836 N  N   . ASP D 1 110 ? 67.487  46.572  41.134  1.00 51.91 ? 110 ASP D N   1 
ATOM   5837 C  CA  . ASP D 1 110 ? 68.222  45.643  41.986  1.00 51.94 ? 110 ASP D CA  1 
ATOM   5838 C  C   . ASP D 1 110 ? 67.616  44.246  41.952  1.00 50.71 ? 110 ASP D C   1 
ATOM   5839 O  O   . ASP D 1 110 ? 68.341  43.252  41.969  1.00 49.86 ? 110 ASP D O   1 
ATOM   5840 C  CB  . ASP D 1 110 ? 68.267  46.156  43.427  1.00 54.61 ? 110 ASP D CB  1 
ATOM   5841 C  CG  . ASP D 1 110 ? 69.132  47.395  43.579  1.00 57.14 ? 110 ASP D CG  1 
ATOM   5842 O  OD1 . ASP D 1 110 ? 70.336  47.325  43.253  1.00 57.68 ? 110 ASP D OD1 1 
ATOM   5843 O  OD2 . ASP D 1 110 ? 68.610  48.437  44.028  1.00 59.89 ? 110 ASP D OD2 1 
ATOM   5844 N  N   . ASN D 1 111 ? 66.289  44.167  41.910  1.00 50.20 ? 111 ASN D N   1 
ATOM   5845 C  CA  . ASN D 1 111 ? 65.623  42.872  41.859  1.00 49.86 ? 111 ASN D CA  1 
ATOM   5846 C  C   . ASN D 1 111 ? 65.964  42.201  40.535  1.00 47.45 ? 111 ASN D C   1 
ATOM   5847 O  O   . ASN D 1 111 ? 66.193  40.993  40.484  1.00 46.72 ? 111 ASN D O   1 
ATOM   5848 C  CB  . ASN D 1 111 ? 64.106  43.034  41.990  1.00 53.50 ? 111 ASN D CB  1 
ATOM   5849 C  CG  . ASN D 1 111 ? 63.701  43.668  43.308  1.00 57.62 ? 111 ASN D CG  1 
ATOM   5850 O  OD1 . ASN D 1 111 ? 64.183  43.275  44.372  1.00 59.39 ? 111 ASN D OD1 1 
ATOM   5851 N  ND2 . ASN D 1 111 ? 62.805  44.650  43.245  1.00 58.65 ? 111 ASN D ND2 1 
ATOM   5852 N  N   . PHE D 1 112 ? 65.996  42.993  39.466  1.00 45.47 ? 112 PHE D N   1 
ATOM   5853 C  CA  . PHE D 1 112 ? 66.328  42.473  38.146  1.00 43.55 ? 112 PHE D CA  1 
ATOM   5854 C  C   . PHE D 1 112 ? 67.735  41.885  38.163  1.00 41.93 ? 112 PHE D C   1 
ATOM   5855 O  O   . PHE D 1 112 ? 67.941  40.742  37.753  1.00 41.59 ? 112 PHE D O   1 
ATOM   5856 C  CB  . PHE D 1 112 ? 66.257  43.577  37.086  1.00 44.57 ? 112 PHE D CB  1 
ATOM   5857 C  CG  . PHE D 1 112 ? 67.012  43.249  35.828  1.00 45.41 ? 112 PHE D CG  1 
ATOM   5858 C  CD1 . PHE D 1 112 ? 66.570  42.240  34.978  1.00 44.80 ? 112 PHE D CD1 1 
ATOM   5859 C  CD2 . PHE D 1 112 ? 68.205  43.903  35.530  1.00 45.24 ? 112 PHE D CD2 1 
ATOM   5860 C  CE1 . PHE D 1 112 ? 67.310  41.883  33.850  1.00 46.44 ? 112 PHE D CE1 1 
ATOM   5861 C  CE2 . PHE D 1 112 ? 68.952  43.553  34.406  1.00 45.25 ? 112 PHE D CE2 1 
ATOM   5862 C  CZ  . PHE D 1 112 ? 68.505  42.541  33.565  1.00 45.01 ? 112 PHE D CZ  1 
ATOM   5863 N  N   . LYS D 1 113 ? 68.700  42.673  38.633  1.00 40.51 ? 113 LYS D N   1 
ATOM   5864 C  CA  . LYS D 1 113 ? 70.084  42.219  38.700  1.00 40.10 ? 113 LYS D CA  1 
ATOM   5865 C  C   . LYS D 1 113 ? 70.203  40.917  39.480  1.00 39.63 ? 113 LYS D C   1 
ATOM   5866 O  O   . LYS D 1 113 ? 70.946  40.016  39.091  1.00 40.05 ? 113 LYS D O   1 
ATOM   5867 C  CB  . LYS D 1 113 ? 70.972  43.273  39.360  1.00 41.00 ? 113 LYS D CB  1 
ATOM   5868 C  CG  . LYS D 1 113 ? 71.246  44.500  38.518  1.00 42.86 ? 113 LYS D CG  1 
ATOM   5869 C  CD  . LYS D 1 113 ? 72.409  45.280  39.111  1.00 44.69 ? 113 LYS D CD  1 
ATOM   5870 C  CE  . LYS D 1 113 ? 72.751  46.502  38.283  1.00 46.97 ? 113 LYS D CE  1 
ATOM   5871 N  NZ  . LYS D 1 113 ? 73.964  47.191  38.813  1.00 48.32 ? 113 LYS D NZ  1 
ATOM   5872 N  N   . ALA D 1 114 ? 69.469  40.823  40.585  1.00 38.95 ? 114 ALA D N   1 
ATOM   5873 C  CA  . ALA D 1 114 ? 69.500  39.626  41.418  1.00 37.72 ? 114 ALA D CA  1 
ATOM   5874 C  C   . ALA D 1 114 ? 68.985  38.415  40.644  1.00 35.64 ? 114 ALA D C   1 
ATOM   5875 O  O   . ALA D 1 114 ? 69.565  37.333  40.711  1.00 35.75 ? 114 ALA D O   1 
ATOM   5876 C  CB  . ALA D 1 114 ? 68.662  39.847  42.677  1.00 39.58 ? 114 ALA D CB  1 
ATOM   5877 N  N   . GLU D 1 115 ? 67.896  38.605  39.910  1.00 35.07 ? 115 GLU D N   1 
ATOM   5878 C  CA  . GLU D 1 115 ? 67.310  37.527  39.122  1.00 35.30 ? 115 GLU D CA  1 
ATOM   5879 C  C   . GLU D 1 115 ? 68.243  37.100  37.994  1.00 33.35 ? 115 GLU D C   1 
ATOM   5880 O  O   . GLU D 1 115 ? 68.390  35.909  37.716  1.00 30.95 ? 115 GLU D O   1 
ATOM   5881 C  CB  . GLU D 1 115 ? 65.966  37.968  38.535  1.00 39.46 ? 115 GLU D CB  1 
ATOM   5882 C  CG  . GLU D 1 115 ? 64.833  37.952  39.539  1.00 46.52 ? 115 GLU D CG  1 
ATOM   5883 C  CD  . GLU D 1 115 ? 64.548  36.552  40.036  1.00 49.60 ? 115 GLU D CD  1 
ATOM   5884 O  OE1 . GLU D 1 115 ? 64.150  35.709  39.205  1.00 52.53 ? 115 GLU D OE1 1 
ATOM   5885 O  OE2 . GLU D 1 115 ? 64.728  36.290  41.246  1.00 52.28 ? 115 GLU D OE2 1 
ATOM   5886 N  N   . PHE D 1 116 ? 68.868  38.077  37.345  1.00 32.02 ? 116 PHE D N   1 
ATOM   5887 C  CA  . PHE D 1 116 ? 69.786  37.788  36.249  1.00 31.92 ? 116 PHE D CA  1 
ATOM   5888 C  C   . PHE D 1 116 ? 71.002  37.024  36.760  1.00 30.61 ? 116 PHE D C   1 
ATOM   5889 O  O   . PHE D 1 116 ? 71.409  36.027  36.169  1.00 30.71 ? 116 PHE D O   1 
ATOM   5890 C  CB  . PHE D 1 116 ? 70.253  39.077  35.577  1.00 31.77 ? 116 PHE D CB  1 
ATOM   5891 C  CG  . PHE D 1 116 ? 70.984  38.848  34.286  1.00 32.96 ? 116 PHE D CG  1 
ATOM   5892 C  CD1 . PHE D 1 116 ? 70.281  38.617  33.107  1.00 33.43 ? 116 PHE D CD1 1 
ATOM   5893 C  CD2 . PHE D 1 116 ? 72.372  38.833  34.252  1.00 32.26 ? 116 PHE D CD2 1 
ATOM   5894 C  CE1 . PHE D 1 116 ? 70.955  38.373  31.910  1.00 35.08 ? 116 PHE D CE1 1 
ATOM   5895 C  CE2 . PHE D 1 116 ? 73.056  38.591  33.062  1.00 34.57 ? 116 PHE D CE2 1 
ATOM   5896 C  CZ  . PHE D 1 116 ? 72.345  38.360  31.889  1.00 33.71 ? 116 PHE D CZ  1 
ATOM   5897 N  N   . GLU D 1 117 ? 71.585  37.493  37.858  1.00 31.92 ? 117 GLU D N   1 
ATOM   5898 C  CA  . GLU D 1 117 ? 72.756  36.832  38.424  1.00 31.52 ? 117 GLU D CA  1 
ATOM   5899 C  C   . GLU D 1 117 ? 72.446  35.400  38.842  1.00 31.20 ? 117 GLU D C   1 
ATOM   5900 O  O   . GLU D 1 117 ? 73.276  34.507  38.676  1.00 29.93 ? 117 GLU D O   1 
ATOM   5901 C  CB  . GLU D 1 117 ? 73.301  37.637  39.605  1.00 34.98 ? 117 GLU D CB  1 
ATOM   5902 C  CG  . GLU D 1 117 ? 73.908  38.962  39.172  1.00 41.44 ? 117 GLU D CG  1 
ATOM   5903 C  CD  . GLU D 1 117 ? 74.597  39.708  40.298  1.00 45.43 ? 117 GLU D CD  1 
ATOM   5904 O  OE1 . GLU D 1 117 ? 75.372  39.077  41.053  1.00 47.78 ? 117 GLU D OE1 1 
ATOM   5905 O  OE2 . GLU D 1 117 ? 74.375  40.931  40.416  1.00 47.08 ? 117 GLU D OE2 1 
ATOM   5906 N  N   . LYS D 1 118 ? 71.248  35.181  39.372  1.00 30.78 ? 118 LYS D N   1 
ATOM   5907 C  CA  . LYS D 1 118 ? 70.830  33.847  39.793  1.00 32.42 ? 118 LYS D CA  1 
ATOM   5908 C  C   . LYS D 1 118 ? 70.760  32.916  38.590  1.00 31.43 ? 118 LYS D C   1 
ATOM   5909 O  O   . LYS D 1 118 ? 71.213  31.770  38.644  1.00 31.54 ? 118 LYS D O   1 
ATOM   5910 C  CB  . LYS D 1 118 ? 69.448  33.905  40.460  1.00 35.65 ? 118 LYS D CB  1 
ATOM   5911 C  CG  . LYS D 1 118 ? 69.471  34.254  41.942  1.00 42.52 ? 118 LYS D CG  1 
ATOM   5912 C  CD  . LYS D 1 118 ? 68.080  34.639  42.469  1.00 47.05 ? 118 LYS D CD  1 
ATOM   5913 C  CE  . LYS D 1 118 ? 66.999  33.657  42.022  1.00 48.89 ? 118 LYS D CE  1 
ATOM   5914 N  NZ  . LYS D 1 118 ? 67.338  32.245  42.354  1.00 51.91 ? 118 LYS D NZ  1 
ATOM   5915 N  N   . ALA D 1 119 ? 70.179  33.410  37.501  1.00 30.06 ? 119 ALA D N   1 
ATOM   5916 C  CA  . ALA D 1 119 ? 70.050  32.611  36.289  1.00 28.95 ? 119 ALA D CA  1 
ATOM   5917 C  C   . ALA D 1 119 ? 71.424  32.325  35.682  1.00 27.90 ? 119 ALA D C   1 
ATOM   5918 O  O   . ALA D 1 119 ? 71.699  31.209  35.247  1.00 28.61 ? 119 ALA D O   1 
ATOM   5919 C  CB  . ALA D 1 119 ? 69.166  33.336  35.275  1.00 29.63 ? 119 ALA D CB  1 
ATOM   5920 N  N   . ALA D 1 120 ? 72.290  33.331  35.665  1.00 26.59 ? 120 ALA D N   1 
ATOM   5921 C  CA  . ALA D 1 120 ? 73.629  33.171  35.106  1.00 25.55 ? 120 ALA D CA  1 
ATOM   5922 C  C   . ALA D 1 120 ? 74.490  32.221  35.928  1.00 27.35 ? 120 ALA D C   1 
ATOM   5923 O  O   . ALA D 1 120 ? 75.251  31.424  35.383  1.00 26.90 ? 120 ALA D O   1 
ATOM   5924 C  CB  . ALA D 1 120 ? 74.316  34.523  35.012  1.00 25.39 ? 120 ALA D CB  1 
ATOM   5925 N  N   . ALA D 1 121 ? 74.370  32.303  37.247  1.00 28.16 ? 121 ALA D N   1 
ATOM   5926 C  CA  . ALA D 1 121 ? 75.173  31.456  38.120  1.00 29.37 ? 121 ALA D CA  1 
ATOM   5927 C  C   . ALA D 1 121 ? 74.656  30.029  38.233  1.00 29.95 ? 121 ALA D C   1 
ATOM   5928 O  O   . ALA D 1 121 ? 75.430  29.099  38.448  1.00 29.98 ? 121 ALA D O   1 
ATOM   5929 C  CB  . ALA D 1 121 ? 75.265  32.085  39.511  1.00 29.96 ? 121 ALA D CB  1 
ATOM   5930 N  N   A SER D 1 122 ? 73.348  29.860  38.079  0.50 30.04 ? 122 SER D N   1 
ATOM   5931 N  N   B SER D 1 122 ? 73.348  29.861  38.077  0.50 29.80 ? 122 SER D N   1 
ATOM   5932 C  CA  A SER D 1 122 ? 72.731  28.545  38.191  0.50 31.00 ? 122 SER D CA  1 
ATOM   5933 C  CA  B SER D 1 122 ? 72.726  28.547  38.185  0.50 30.54 ? 122 SER D CA  1 
ATOM   5934 C  C   A SER D 1 122 ? 72.848  27.688  36.935  0.50 31.24 ? 122 SER D C   1 
ATOM   5935 C  C   B SER D 1 122 ? 72.839  27.690  36.932  0.50 30.98 ? 122 SER D C   1 
ATOM   5936 O  O   A SER D 1 122 ? 72.552  26.495  36.972  0.50 32.02 ? 122 SER D O   1 
ATOM   5937 O  O   B SER D 1 122 ? 72.532  26.500  36.966  0.50 31.78 ? 122 SER D O   1 
ATOM   5938 C  CB  A SER D 1 122 ? 71.256  28.692  38.569  0.50 31.70 ? 122 SER D CB  1 
ATOM   5939 C  CB  B SER D 1 122 ? 71.252  28.698  38.563  0.50 30.87 ? 122 SER D CB  1 
ATOM   5940 O  OG  A SER D 1 122 ? 70.551  29.415  37.577  0.50 31.97 ? 122 SER D OG  1 
ATOM   5941 O  OG  B SER D 1 122 ? 71.122  29.295  39.839  0.50 29.68 ? 122 SER D OG  1 
ATOM   5942 N  N   . ARG D 1 123 ? 73.270  28.286  35.825  1.00 30.38 ? 123 ARG D N   1 
ATOM   5943 C  CA  . ARG D 1 123 ? 73.415  27.534  34.584  1.00 28.86 ? 123 ARG D CA  1 
ATOM   5944 C  C   . ARG D 1 123 ? 74.553  26.529  34.756  1.00 28.71 ? 123 ARG D C   1 
ATOM   5945 O  O   . ARG D 1 123 ? 75.724  26.902  34.911  1.00 27.87 ? 123 ARG D O   1 
ATOM   5946 C  CB  . ARG D 1 123 ? 73.685  28.486  33.409  1.00 29.99 ? 123 ARG D CB  1 
ATOM   5947 C  CG  . ARG D 1 123 ? 74.116  27.811  32.110  1.00 30.07 ? 123 ARG D CG  1 
ATOM   5948 C  CD  . ARG D 1 123 ? 73.241  26.617  31.720  1.00 31.54 ? 123 ARG D CD  1 
ATOM   5949 N  NE  . ARG D 1 123 ? 71.837  26.970  31.537  1.00 32.28 ? 123 ARG D NE  1 
ATOM   5950 C  CZ  . ARG D 1 123 ? 70.913  26.122  31.095  1.00 33.01 ? 123 ARG D CZ  1 
ATOM   5951 N  NH1 . ARG D 1 123 ? 71.250  24.877  30.789  1.00 32.49 ? 123 ARG D NH1 1 
ATOM   5952 N  NH2 . ARG D 1 123 ? 69.653  26.514  30.965  1.00 32.60 ? 123 ARG D NH2 1 
ATOM   5953 N  N   . PHE D 1 124 ? 74.196  25.249  34.751  1.00 25.03 ? 124 PHE D N   1 
ATOM   5954 C  CA  . PHE D 1 124 ? 75.170  24.180  34.924  1.00 25.76 ? 124 PHE D CA  1 
ATOM   5955 C  C   . PHE D 1 124 ? 75.754  23.792  33.572  1.00 24.94 ? 124 PHE D C   1 
ATOM   5956 O  O   . PHE D 1 124 ? 75.017  23.528  32.624  1.00 25.21 ? 124 PHE D O   1 
ATOM   5957 C  CB  . PHE D 1 124 ? 74.497  22.967  35.566  1.00 28.32 ? 124 PHE D CB  1 
ATOM   5958 C  CG  . PHE D 1 124 ? 75.448  21.865  35.909  1.00 29.13 ? 124 PHE D CG  1 
ATOM   5959 C  CD1 . PHE D 1 124 ? 76.401  22.040  36.902  1.00 31.27 ? 124 PHE D CD1 1 
ATOM   5960 C  CD2 . PHE D 1 124 ? 75.401  20.656  35.227  1.00 33.53 ? 124 PHE D CD2 1 
ATOM   5961 C  CE1 . PHE D 1 124 ? 77.298  21.027  37.215  1.00 32.22 ? 124 PHE D CE1 1 
ATOM   5962 C  CE2 . PHE D 1 124 ? 76.296  19.632  35.533  1.00 33.48 ? 124 PHE D CE2 1 
ATOM   5963 C  CZ  . PHE D 1 124 ? 77.244  19.821  36.527  1.00 31.18 ? 124 PHE D CZ  1 
ATOM   5964 N  N   . GLY D 1 125 ? 77.077  23.740  33.485  1.00 22.82 ? 125 GLY D N   1 
ATOM   5965 C  CA  . GLY D 1 125 ? 77.699  23.411  32.214  1.00 19.94 ? 125 GLY D CA  1 
ATOM   5966 C  C   . GLY D 1 125 ? 77.777  24.670  31.358  1.00 19.02 ? 125 GLY D C   1 
ATOM   5967 O  O   . GLY D 1 125 ? 77.764  25.781  31.886  1.00 20.05 ? 125 GLY D O   1 
ATOM   5968 N  N   . SER D 1 126 ? 77.841  24.509  30.042  1.00 17.73 ? 126 SER D N   1 
ATOM   5969 C  CA  . SER D 1 126 ? 77.931  25.658  29.145  1.00 16.78 ? 126 SER D CA  1 
ATOM   5970 C  C   . SER D 1 126 ? 76.549  26.243  28.846  1.00 17.43 ? 126 SER D C   1 
ATOM   5971 O  O   . SER D 1 126 ? 75.577  25.508  28.704  1.00 15.91 ? 126 SER D O   1 
ATOM   5972 C  CB  . SER D 1 126 ? 78.611  25.233  27.846  1.00 17.14 ? 126 SER D CB  1 
ATOM   5973 O  OG  . SER D 1 126 ? 79.835  24.561  28.116  1.00 17.52 ? 126 SER D OG  1 
ATOM   5974 N  N   . GLY D 1 127 ? 76.463  27.565  28.749  1.00 16.36 ? 127 GLY D N   1 
ATOM   5975 C  CA  . GLY D 1 127 ? 75.182  28.178  28.470  1.00 15.97 ? 127 GLY D CA  1 
ATOM   5976 C  C   . GLY D 1 127 ? 75.211  29.691  28.417  1.00 19.77 ? 127 GLY D C   1 
ATOM   5977 O  O   . GLY D 1 127 ? 76.283  30.306  28.477  1.00 19.81 ? 127 GLY D O   1 
ATOM   5978 N  N   A TRP D 1 128 ? 74.028  30.289  28.301  0.70 18.17 ? 128 TRP D N   1 
ATOM   5979 N  N   B TRP D 1 128 ? 74.025  30.287  28.318  0.30 19.75 ? 128 TRP D N   1 
ATOM   5980 C  CA  A TRP D 1 128 ? 73.876  31.740  28.243  0.70 19.35 ? 128 TRP D CA  1 
ATOM   5981 C  CA  B TRP D 1 128 ? 73.873  31.737  28.222  0.30 21.29 ? 128 TRP D CA  1 
ATOM   5982 C  C   A TRP D 1 128 ? 72.718  32.174  29.137  0.70 20.80 ? 128 TRP D C   1 
ATOM   5983 C  C   B TRP D 1 128 ? 72.692  32.200  29.082  0.30 21.88 ? 128 TRP D C   1 
ATOM   5984 O  O   A TRP D 1 128 ? 71.768  31.417  29.339  0.70 20.07 ? 128 TRP D O   1 
ATOM   5985 O  O   B TRP D 1 128 ? 71.696  31.486  29.208  0.30 21.73 ? 128 TRP D O   1 
ATOM   5986 C  CB  A TRP D 1 128 ? 73.574  32.201  26.807  0.70 19.50 ? 128 TRP D CB  1 
ATOM   5987 C  CB  B TRP D 1 128 ? 73.625  32.103  26.754  0.30 22.52 ? 128 TRP D CB  1 
ATOM   5988 C  CG  A TRP D 1 128 ? 74.727  32.098  25.857  0.70 19.30 ? 128 TRP D CG  1 
ATOM   5989 C  CG  B TRP D 1 128 ? 74.187  33.416  26.316  0.30 23.88 ? 128 TRP D CG  1 
ATOM   5990 C  CD1 A TRP D 1 128 ? 75.341  30.959  25.431  0.70 20.11 ? 128 TRP D CD1 1 
ATOM   5991 C  CD1 B TRP D 1 128 ? 73.715  34.660  26.623  0.30 24.53 ? 128 TRP D CD1 1 
ATOM   5992 C  CD2 A TRP D 1 128 ? 75.432  33.187  25.247  0.70 21.26 ? 128 TRP D CD2 1 
ATOM   5993 C  CD2 B TRP D 1 128 ? 75.326  33.616  25.471  0.30 24.71 ? 128 TRP D CD2 1 
ATOM   5994 N  NE1 A TRP D 1 128 ? 76.391  31.268  24.595  0.70 19.86 ? 128 TRP D NE1 1 
ATOM   5995 N  NE1 B TRP D 1 128 ? 74.489  35.623  26.019  0.30 24.34 ? 128 TRP D NE1 1 
ATOM   5996 C  CE2 A TRP D 1 128 ? 76.469  32.628  24.466  0.70 20.35 ? 128 TRP D CE2 1 
ATOM   5997 C  CE2 B TRP D 1 128 ? 75.485  35.010  25.306  0.30 24.82 ? 128 TRP D CE2 1 
ATOM   5998 C  CE3 A TRP D 1 128 ? 75.289  34.581  25.285  0.70 21.31 ? 128 TRP D CE3 1 
ATOM   5999 C  CE3 B TRP D 1 128 ? 76.229  32.751  24.835  0.30 24.78 ? 128 TRP D CE3 1 
ATOM   6000 C  CZ2 A TRP D 1 128 ? 77.363  33.416  23.730  0.70 22.80 ? 128 TRP D CZ2 1 
ATOM   6001 C  CZ2 B TRP D 1 128 ? 76.512  35.562  24.531  0.30 25.19 ? 128 TRP D CZ2 1 
ATOM   6002 C  CZ3 A TRP D 1 128 ? 76.179  35.366  24.551  0.70 21.85 ? 128 TRP D CZ3 1 
ATOM   6003 C  CZ3 B TRP D 1 128 ? 77.251  33.300  24.064  0.30 25.60 ? 128 TRP D CZ3 1 
ATOM   6004 C  CH2 A TRP D 1 128 ? 77.203  34.779  23.785  0.70 21.78 ? 128 TRP D CH2 1 
ATOM   6005 C  CH2 B TRP D 1 128 ? 77.382  34.694  23.920  0.30 25.08 ? 128 TRP D CH2 1 
ATOM   6006 N  N   . ALA D 1 129 ? 72.805  33.391  29.669  1.00 21.88 ? 129 ALA D N   1 
ATOM   6007 C  CA  . ALA D 1 129 ? 71.738  33.953  30.507  1.00 22.89 ? 129 ALA D CA  1 
ATOM   6008 C  C   . ALA D 1 129 ? 71.185  35.123  29.697  1.00 24.38 ? 129 ALA D C   1 
ATOM   6009 O  O   . ALA D 1 129 ? 71.954  35.875  29.097  1.00 22.99 ? 129 ALA D O   1 
ATOM   6010 C  CB  . ALA D 1 129 ? 72.288  34.443  31.831  1.00 23.41 ? 129 ALA D CB  1 
ATOM   6011 N  N   . TRP D 1 130 ? 69.862  35.284  29.688  1.00 24.43 ? 130 TRP D N   1 
ATOM   6012 C  CA  . TRP D 1 130 ? 69.240  36.333  28.886  1.00 26.32 ? 130 TRP D CA  1 
ATOM   6013 C  C   . TRP D 1 130 ? 68.177  37.197  29.548  1.00 27.48 ? 130 TRP D C   1 
ATOM   6014 O  O   . TRP D 1 130 ? 67.520  36.791  30.505  1.00 28.10 ? 130 TRP D O   1 
ATOM   6015 C  CB  . TRP D 1 130 ? 68.548  35.719  27.667  1.00 26.80 ? 130 TRP D CB  1 
ATOM   6016 C  CG  . TRP D 1 130 ? 69.358  34.775  26.850  1.00 26.75 ? 130 TRP D CG  1 
ATOM   6017 C  CD1 . TRP D 1 130 ? 69.444  33.418  26.994  1.00 25.14 ? 130 TRP D CD1 1 
ATOM   6018 C  CD2 . TRP D 1 130 ? 70.160  35.113  25.721  1.00 25.31 ? 130 TRP D CD2 1 
ATOM   6019 N  NE1 . TRP D 1 130 ? 70.249  32.890  26.014  1.00 25.31 ? 130 TRP D NE1 1 
ATOM   6020 C  CE2 . TRP D 1 130 ? 70.702  33.911  25.218  1.00 27.29 ? 130 TRP D CE2 1 
ATOM   6021 C  CE3 . TRP D 1 130 ? 70.474  36.321  25.080  1.00 26.11 ? 130 TRP D CE3 1 
ATOM   6022 C  CZ2 . TRP D 1 130 ? 71.540  33.879  24.104  1.00 25.28 ? 130 TRP D CZ2 1 
ATOM   6023 C  CZ3 . TRP D 1 130 ? 71.308  36.290  23.973  1.00 27.41 ? 130 TRP D CZ3 1 
ATOM   6024 C  CH2 . TRP D 1 130 ? 71.832  35.075  23.495  1.00 28.06 ? 130 TRP D CH2 1 
ATOM   6025 N  N   . LEU D 1 131 ? 68.020  38.394  28.994  1.00 28.55 ? 131 LEU D N   1 
ATOM   6026 C  CA  . LEU D 1 131 ? 66.970  39.318  29.383  1.00 28.67 ? 131 LEU D CA  1 
ATOM   6027 C  C   . LEU D 1 131 ? 66.184  39.308  28.079  1.00 29.51 ? 131 LEU D C   1 
ATOM   6028 O  O   . LEU D 1 131 ? 66.685  39.763  27.048  1.00 30.49 ? 131 LEU D O   1 
ATOM   6029 C  CB  . LEU D 1 131 ? 67.502  40.727  29.634  1.00 30.54 ? 131 LEU D CB  1 
ATOM   6030 C  CG  . LEU D 1 131 ? 66.392  41.789  29.660  1.00 30.90 ? 131 LEU D CG  1 
ATOM   6031 C  CD1 . LEU D 1 131 ? 65.338  41.419  30.694  1.00 31.94 ? 131 LEU D CD1 1 
ATOM   6032 C  CD2 . LEU D 1 131 ? 66.992  43.155  29.961  1.00 31.10 ? 131 LEU D CD2 1 
ATOM   6033 N  N   . VAL D 1 132 ? 64.980  38.752  28.098  1.00 30.90 ? 132 VAL D N   1 
ATOM   6034 C  CA  . VAL D 1 132 ? 64.184  38.691  26.881  1.00 32.84 ? 132 VAL D CA  1 
ATOM   6035 C  C   . VAL D 1 132 ? 62.873  39.451  27.008  1.00 35.63 ? 132 VAL D C   1 
ATOM   6036 O  O   . VAL D 1 132 ? 62.434  39.790  28.107  1.00 35.05 ? 132 VAL D O   1 
ATOM   6037 C  CB  . VAL D 1 132 ? 63.860  37.232  26.480  1.00 32.65 ? 132 VAL D CB  1 
ATOM   6038 C  CG1 . VAL D 1 132 ? 65.151  36.456  26.236  1.00 32.41 ? 132 VAL D CG1 1 
ATOM   6039 C  CG2 . VAL D 1 132 ? 63.021  36.561  27.562  1.00 33.47 ? 132 VAL D CG2 1 
ATOM   6040 N  N   . LEU D 1 133 ? 62.260  39.721  25.862  1.00 38.34 ? 133 LEU D N   1 
ATOM   6041 C  CA  . LEU D 1 133 ? 60.985  40.412  25.817  1.00 41.05 ? 133 LEU D CA  1 
ATOM   6042 C  C   . LEU D 1 133 ? 59.973  39.414  25.275  1.00 42.47 ? 133 LEU D C   1 
ATOM   6043 O  O   . LEU D 1 133 ? 60.047  39.017  24.113  1.00 42.65 ? 133 LEU D O   1 
ATOM   6044 C  CB  . LEU D 1 133 ? 61.071  41.627  24.891  1.00 43.70 ? 133 LEU D CB  1 
ATOM   6045 C  CG  . LEU D 1 133 ? 59.792  42.450  24.709  1.00 46.79 ? 133 LEU D CG  1 
ATOM   6046 C  CD1 . LEU D 1 133 ? 59.372  43.058  26.040  1.00 46.25 ? 133 LEU D CD1 1 
ATOM   6047 C  CD2 . LEU D 1 133 ? 60.035  43.541  23.677  1.00 47.73 ? 133 LEU D CD2 1 
ATOM   6048 N  N   . LYS D 1 134 ? 59.057  38.980  26.133  1.00 44.70 ? 134 LYS D N   1 
ATOM   6049 C  CA  . LYS D 1 134 ? 58.012  38.037  25.741  1.00 48.46 ? 134 LYS D CA  1 
ATOM   6050 C  C   . LYS D 1 134 ? 56.714  38.825  25.716  1.00 50.84 ? 134 LYS D C   1 
ATOM   6051 O  O   . LYS D 1 134 ? 56.189  39.199  26.769  1.00 50.32 ? 134 LYS D O   1 
ATOM   6052 C  CB  . LYS D 1 134 ? 57.862  36.915  26.769  1.00 49.91 ? 134 LYS D CB  1 
ATOM   6053 C  CG  . LYS D 1 134 ? 59.085  36.066  27.012  1.00 51.21 ? 134 LYS D CG  1 
ATOM   6054 C  CD  . LYS D 1 134 ? 58.742  34.981  28.017  1.00 53.01 ? 134 LYS D CD  1 
ATOM   6055 C  CE  . LYS D 1 134 ? 59.895  34.022  28.235  1.00 54.47 ? 134 LYS D CE  1 
ATOM   6056 N  NZ  . LYS D 1 134 ? 59.516  32.935  29.180  1.00 56.07 ? 134 LYS D NZ  1 
ATOM   6057 N  N   . GLY D 1 135 ? 56.208  39.076  24.513  1.00 53.85 ? 135 GLY D N   1 
ATOM   6058 C  CA  . GLY D 1 135 ? 54.990  39.847  24.374  1.00 55.72 ? 135 GLY D CA  1 
ATOM   6059 C  C   . GLY D 1 135 ? 55.318  41.293  24.682  1.00 56.81 ? 135 GLY D C   1 
ATOM   6060 O  O   . GLY D 1 135 ? 55.896  42.000  23.855  1.00 57.18 ? 135 GLY D O   1 
ATOM   6061 N  N   . ASP D 1 136 ? 54.966  41.728  25.886  1.00 57.86 ? 136 ASP D N   1 
ATOM   6062 C  CA  . ASP D 1 136 ? 55.230  43.096  26.311  1.00 58.24 ? 136 ASP D CA  1 
ATOM   6063 C  C   . ASP D 1 136 ? 55.874  43.113  27.694  1.00 56.83 ? 136 ASP D C   1 
ATOM   6064 O  O   . ASP D 1 136 ? 56.055  44.180  28.287  1.00 57.09 ? 136 ASP D O   1 
ATOM   6065 C  CB  . ASP D 1 136 ? 53.927  43.895  26.339  1.00 62.02 ? 136 ASP D CB  1 
ATOM   6066 C  CG  . ASP D 1 136 ? 52.898  43.291  27.275  1.00 64.75 ? 136 ASP D CG  1 
ATOM   6067 O  OD1 . ASP D 1 136 ? 52.516  42.119  27.065  1.00 67.00 ? 136 ASP D OD1 1 
ATOM   6068 O  OD2 . ASP D 1 136 ? 52.473  43.987  28.223  1.00 67.29 ? 136 ASP D OD2 1 
ATOM   6069 N  N   . LYS D 1 137 ? 56.213  41.931  28.208  1.00 53.56 ? 137 LYS D N   1 
ATOM   6070 C  CA  . LYS D 1 137 ? 56.839  41.832  29.523  1.00 50.86 ? 137 LYS D CA  1 
ATOM   6071 C  C   . LYS D 1 137 ? 58.279  41.331  29.429  1.00 48.00 ? 137 LYS D C   1 
ATOM   6072 O  O   . LYS D 1 137 ? 58.606  40.498  28.582  1.00 46.99 ? 137 LYS D O   1 
ATOM   6073 C  CB  . LYS D 1 137 ? 56.036  40.902  30.438  1.00 52.97 ? 137 LYS D CB  1 
ATOM   6074 C  CG  . LYS D 1 137 ? 56.118  39.438  30.062  1.00 56.01 ? 137 LYS D CG  1 
ATOM   6075 C  CD  . LYS D 1 137 ? 55.448  38.560  31.107  1.00 59.36 ? 137 LYS D CD  1 
ATOM   6076 C  CE  . LYS D 1 137 ? 55.581  37.082  30.753  1.00 61.80 ? 137 LYS D CE  1 
ATOM   6077 N  NZ  . LYS D 1 137 ? 54.923  36.198  31.760  1.00 63.19 ? 137 LYS D NZ  1 
ATOM   6078 N  N   . LEU D 1 138 ? 59.136  41.854  30.301  1.00 44.81 ? 138 LEU D N   1 
ATOM   6079 C  CA  . LEU D 1 138 ? 60.536  41.454  30.333  1.00 42.84 ? 138 LEU D CA  1 
ATOM   6080 C  C   . LEU D 1 138 ? 60.678  40.234  31.233  1.00 41.03 ? 138 LEU D C   1 
ATOM   6081 O  O   . LEU D 1 138 ? 59.941  40.086  32.208  1.00 41.13 ? 138 LEU D O   1 
ATOM   6082 C  CB  . LEU D 1 138 ? 61.404  42.590  30.879  1.00 43.38 ? 138 LEU D CB  1 
ATOM   6083 C  CG  . LEU D 1 138 ? 61.433  43.883  30.068  1.00 44.13 ? 138 LEU D CG  1 
ATOM   6084 C  CD1 . LEU D 1 138 ? 62.359  44.893  30.724  1.00 45.29 ? 138 LEU D CD1 1 
ATOM   6085 C  CD2 . LEU D 1 138 ? 61.900  43.574  28.664  1.00 45.44 ? 138 LEU D CD2 1 
ATOM   6086 N  N   . ALA D 1 139 ? 61.622  39.358  30.905  1.00 38.71 ? 139 ALA D N   1 
ATOM   6087 C  CA  . ALA D 1 139 ? 61.848  38.161  31.700  1.00 35.45 ? 139 ALA D CA  1 
ATOM   6088 C  C   . ALA D 1 139 ? 63.296  37.707  31.593  1.00 34.88 ? 139 ALA D C   1 
ATOM   6089 O  O   . ALA D 1 139 ? 63.995  38.039  30.635  1.00 35.05 ? 139 ALA D O   1 
ATOM   6090 C  CB  . ALA D 1 139 ? 60.917  37.045  31.242  1.00 34.25 ? 139 ALA D CB  1 
ATOM   6091 N  N   . VAL D 1 140 ? 63.741  36.952  32.592  1.00 33.44 ? 140 VAL D N   1 
ATOM   6092 C  CA  . VAL D 1 140 ? 65.098  36.428  32.617  1.00 31.95 ? 140 VAL D CA  1 
ATOM   6093 C  C   . VAL D 1 140 ? 65.034  34.926  32.375  1.00 32.07 ? 140 VAL D C   1 
ATOM   6094 O  O   . VAL D 1 140 ? 64.269  34.217  33.030  1.00 31.03 ? 140 VAL D O   1 
ATOM   6095 C  CB  . VAL D 1 140 ? 65.770  36.706  33.977  1.00 31.93 ? 140 VAL D CB  1 
ATOM   6096 C  CG1 . VAL D 1 140 ? 67.066  35.919  34.097  1.00 31.23 ? 140 VAL D CG1 1 
ATOM   6097 C  CG2 . VAL D 1 140 ? 66.040  38.195  34.115  1.00 30.86 ? 140 VAL D CG2 1 
ATOM   6098 N  N   . VAL D 1 141 ? 65.823  34.448  31.419  1.00 30.72 ? 141 VAL D N   1 
ATOM   6099 C  CA  . VAL D 1 141 ? 65.860  33.026  31.093  1.00 30.69 ? 141 VAL D CA  1 
ATOM   6100 C  C   . VAL D 1 141 ? 67.299  32.644  30.766  1.00 29.90 ? 141 VAL D C   1 
ATOM   6101 O  O   . VAL D 1 141 ? 68.155  33.512  30.612  1.00 28.24 ? 141 VAL D O   1 
ATOM   6102 C  CB  . VAL D 1 141 ? 64.982  32.707  29.865  1.00 32.18 ? 141 VAL D CB  1 
ATOM   6103 C  CG1 . VAL D 1 141 ? 63.542  33.139  30.119  1.00 35.20 ? 141 VAL D CG1 1 
ATOM   6104 C  CG2 . VAL D 1 141 ? 65.534  33.415  28.639  1.00 32.85 ? 141 VAL D CG2 1 
ATOM   6105 N  N   . SER D 1 142 ? 67.569  31.348  30.682  1.00 28.39 ? 142 SER D N   1 
ATOM   6106 C  CA  . SER D 1 142 ? 68.909  30.888  30.335  1.00 28.43 ? 142 SER D CA  1 
ATOM   6107 C  C   . SER D 1 142 ? 68.759  29.720  29.376  1.00 27.33 ? 142 SER D C   1 
ATOM   6108 O  O   . SER D 1 142 ? 67.733  29.037  29.367  1.00 28.62 ? 142 SER D O   1 
ATOM   6109 C  CB  . SER D 1 142 ? 69.694  30.451  31.579  1.00 29.48 ? 142 SER D CB  1 
ATOM   6110 O  OG  . SER D 1 142 ? 69.292  29.167  32.014  1.00 33.57 ? 142 SER D OG  1 
ATOM   6111 N  N   . THR D 1 143 ? 69.778  29.506  28.557  1.00 24.26 ? 143 THR D N   1 
ATOM   6112 C  CA  . THR D 1 143 ? 69.761  28.427  27.586  1.00 22.17 ? 143 THR D CA  1 
ATOM   6113 C  C   . THR D 1 143 ? 71.054  27.633  27.682  1.00 22.07 ? 143 THR D C   1 
ATOM   6114 O  O   . THR D 1 143 ? 72.062  28.130  28.197  1.00 20.61 ? 143 THR D O   1 
ATOM   6115 C  CB  . THR D 1 143 ? 69.614  28.971  26.157  1.00 23.51 ? 143 THR D CB  1 
ATOM   6116 O  OG1 . THR D 1 143 ? 70.607  29.981  25.930  1.00 23.68 ? 143 THR D OG1 1 
ATOM   6117 C  CG2 . THR D 1 143 ? 68.221  29.574  25.957  1.00 23.63 ? 143 THR D CG2 1 
ATOM   6118 N  N   . ALA D 1 144 ? 71.014  26.400  27.188  1.00 20.26 ? 144 ALA D N   1 
ATOM   6119 C  CA  . ALA D 1 144 ? 72.176  25.521  27.208  1.00 20.34 ? 144 ALA D CA  1 
ATOM   6120 C  C   . ALA D 1 144 ? 73.046  25.716  25.979  1.00 20.08 ? 144 ALA D C   1 
ATOM   6121 O  O   . ALA D 1 144 ? 72.567  26.129  24.924  1.00 19.05 ? 144 ALA D O   1 
ATOM   6122 C  CB  . ALA D 1 144 ? 71.734  24.061  27.283  1.00 20.40 ? 144 ALA D CB  1 
ATOM   6123 N  N   . ASN D 1 145 ? 74.329  25.404  26.134  1.00 20.21 ? 145 ASN D N   1 
ATOM   6124 C  CA  . ASN D 1 145 ? 75.291  25.490  25.053  1.00 19.22 ? 145 ASN D CA  1 
ATOM   6125 C  C   . ASN D 1 145 ? 75.137  26.746  24.200  1.00 18.36 ? 145 ASN D C   1 
ATOM   6126 O  O   . ASN D 1 145 ? 75.259  27.852  24.715  1.00 20.46 ? 145 ASN D O   1 
ATOM   6127 C  CB  . ASN D 1 145 ? 75.197  24.213  24.216  1.00 18.94 ? 145 ASN D CB  1 
ATOM   6128 C  CG  . ASN D 1 145 ? 75.363  22.959  25.072  1.00 23.39 ? 145 ASN D CG  1 
ATOM   6129 O  OD1 . ASN D 1 145 ? 76.177  22.937  26.002  1.00 20.81 ? 145 ASN D OD1 1 
ATOM   6130 N  ND2 . ASN D 1 145 ? 74.597  21.916  24.765  1.00 22.68 ? 145 ASN D ND2 1 
ATOM   6131 N  N   . LEU D 1 146 ? 74.881  26.602  22.905  1.00 18.92 ? 146 LEU D N   1 
ATOM   6132 C  CA  . LEU D 1 146 ? 74.740  27.796  22.085  1.00 19.50 ? 146 LEU D CA  1 
ATOM   6133 C  C   . LEU D 1 146 ? 73.328  28.005  21.559  1.00 20.04 ? 146 LEU D C   1 
ATOM   6134 O  O   . LEU D 1 146 ? 73.135  28.562  20.477  1.00 19.86 ? 146 LEU D O   1 
ATOM   6135 C  CB  . LEU D 1 146 ? 75.756  27.777  20.936  1.00 19.28 ? 146 LEU D CB  1 
ATOM   6136 C  CG  . LEU D 1 146 ? 77.215  27.962  21.396  1.00 22.55 ? 146 LEU D CG  1 
ATOM   6137 C  CD1 . LEU D 1 146 ? 78.155  27.852  20.207  1.00 24.73 ? 146 LEU D CD1 1 
ATOM   6138 C  CD2 . LEU D 1 146 ? 77.381  29.302  22.073  1.00 22.06 ? 146 LEU D CD2 1 
ATOM   6139 N  N   . ASP D 1 147 ? 72.339  27.562  22.329  1.00 18.82 ? 147 ASP D N   1 
ATOM   6140 C  CA  . ASP D 1 147 ? 70.958  27.749  21.915  1.00 21.94 ? 147 ASP D CA  1 
ATOM   6141 C  C   . ASP D 1 147 ? 70.583  29.207  22.153  1.00 22.45 ? 147 ASP D C   1 
ATOM   6142 O  O   . ASP D 1 147 ? 71.277  29.938  22.868  1.00 20.78 ? 147 ASP D O   1 
ATOM   6143 C  CB  . ASP D 1 147 ? 70.000  26.847  22.706  1.00 23.11 ? 147 ASP D CB  1 
ATOM   6144 C  CG  . ASP D 1 147 ? 70.186  25.375  22.398  1.00 23.26 ? 147 ASP D CG  1 
ATOM   6145 O  OD1 . ASP D 1 147 ? 70.837  25.040  21.385  1.00 23.58 ? 147 ASP D OD1 1 
ATOM   6146 O  OD2 . ASP D 1 147 ? 69.665  24.544  23.170  1.00 25.86 ? 147 ASP D OD2 1 
ATOM   6147 N  N   . SER D 1 148 ? 69.482  29.622  21.544  1.00 21.21 ? 148 SER D N   1 
ATOM   6148 C  CA  . SER D 1 148 ? 68.991  30.984  21.681  1.00 24.31 ? 148 SER D CA  1 
ATOM   6149 C  C   . SER D 1 148 ? 67.478  30.950  21.865  1.00 24.54 ? 148 SER D C   1 
ATOM   6150 O  O   . SER D 1 148 ? 66.809  30.054  21.354  1.00 23.50 ? 148 SER D O   1 
ATOM   6151 C  CB  . SER D 1 148 ? 69.321  31.794  20.425  1.00 26.33 ? 148 SER D CB  1 
ATOM   6152 O  OG  . SER D 1 148 ? 68.653  33.045  20.442  1.00 26.30 ? 148 SER D OG  1 
ATOM   6153 N  N   . PRO D 1 149 ? 66.928  31.916  22.617  1.00 27.11 ? 149 PRO D N   1 
ATOM   6154 C  CA  . PRO D 1 149 ? 65.484  32.001  22.864  1.00 28.56 ? 149 PRO D CA  1 
ATOM   6155 C  C   . PRO D 1 149 ? 64.739  32.147  21.536  1.00 29.41 ? 149 PRO D C   1 
ATOM   6156 O  O   . PRO D 1 149 ? 63.563  31.794  21.421  1.00 29.51 ? 149 PRO D O   1 
ATOM   6157 C  CB  . PRO D 1 149 ? 65.359  33.252  23.731  1.00 28.70 ? 149 PRO D CB  1 
ATOM   6158 C  CG  . PRO D 1 149 ? 66.638  33.242  24.498  1.00 30.36 ? 149 PRO D CG  1 
ATOM   6159 C  CD  . PRO D 1 149 ? 67.655  32.903  23.433  1.00 27.40 ? 149 PRO D CD  1 
ATOM   6160 N  N   . LEU D 1 150 ? 65.437  32.673  20.535  1.00 29.67 ? 150 LEU D N   1 
ATOM   6161 C  CA  . LEU D 1 150 ? 64.851  32.852  19.211  1.00 30.34 ? 150 LEU D CA  1 
ATOM   6162 C  C   . LEU D 1 150 ? 64.526  31.508  18.573  1.00 31.10 ? 150 LEU D C   1 
ATOM   6163 O  O   . LEU D 1 150 ? 63.733  31.441  17.633  1.00 31.80 ? 150 LEU D O   1 
ATOM   6164 C  CB  . LEU D 1 150 ? 65.811  33.624  18.301  1.00 30.05 ? 150 LEU D CB  1 
ATOM   6165 C  CG  . LEU D 1 150 ? 66.074  35.090  18.644  1.00 31.02 ? 150 LEU D CG  1 
ATOM   6166 C  CD1 . LEU D 1 150 ? 67.198  35.636  17.785  1.00 30.86 ? 150 LEU D CD1 1 
ATOM   6167 C  CD2 . LEU D 1 150 ? 64.799  35.891  18.438  1.00 33.15 ? 150 LEU D CD2 1 
ATOM   6168 N  N   . MET D 1 151 ? 65.135  30.438  19.080  1.00 28.82 ? 151 MET D N   1 
ATOM   6169 C  CA  . MET D 1 151 ? 64.902  29.106  18.531  1.00 29.03 ? 151 MET D CA  1 
ATOM   6170 C  C   . MET D 1 151 ? 63.575  28.518  18.983  1.00 30.72 ? 151 MET D C   1 
ATOM   6171 O  O   . MET D 1 151 ? 63.146  27.476  18.489  1.00 30.13 ? 151 MET D O   1 
ATOM   6172 C  CB  . MET D 1 151 ? 66.026  28.156  18.938  1.00 26.53 ? 151 MET D CB  1 
ATOM   6173 C  CG  . MET D 1 151 ? 67.395  28.567  18.442  1.00 25.75 ? 151 MET D CG  1 
ATOM   6174 S  SD  . MET D 1 151 ? 68.630  27.401  19.015  1.00 24.12 ? 151 MET D SD  1 
ATOM   6175 C  CE  . MET D 1 151 ? 70.045  27.916  18.025  1.00 19.58 ? 151 MET D CE  1 
ATOM   6176 N  N   . GLY D 1 152 ? 62.929  29.177  19.933  1.00 33.35 ? 152 GLY D N   1 
ATOM   6177 C  CA  . GLY D 1 152 ? 61.659  28.669  20.407  1.00 35.28 ? 152 GLY D CA  1 
ATOM   6178 C  C   . GLY D 1 152 ? 61.814  27.798  21.634  1.00 36.24 ? 152 GLY D C   1 
ATOM   6179 O  O   . GLY D 1 152 ? 62.894  27.282  21.924  1.00 36.73 ? 152 GLY D O   1 
ATOM   6180 N  N   . GLU D 1 153 ? 60.712  27.620  22.346  1.00 36.49 ? 153 GLU D N   1 
ATOM   6181 C  CA  . GLU D 1 153 ? 60.699  26.837  23.567  1.00 37.21 ? 153 GLU D CA  1 
ATOM   6182 C  C   . GLU D 1 153 ? 60.918  25.338  23.353  1.00 34.11 ? 153 GLU D C   1 
ATOM   6183 O  O   . GLU D 1 153 ? 61.568  24.674  24.162  1.00 31.90 ? 153 GLU D O   1 
ATOM   6184 C  CB  . GLU D 1 153 ? 59.377  27.095  24.288  1.00 41.60 ? 153 GLU D CB  1 
ATOM   6185 C  CG  . GLU D 1 153 ? 59.348  26.661  25.724  1.00 50.04 ? 153 GLU D CG  1 
ATOM   6186 C  CD  . GLU D 1 153 ? 58.346  27.462  26.518  1.00 55.05 ? 153 GLU D CD  1 
ATOM   6187 O  OE1 . GLU D 1 153 ? 58.608  28.664  26.748  1.00 57.32 ? 153 GLU D OE1 1 
ATOM   6188 O  OE2 . GLU D 1 153 ? 57.296  26.897  26.898  1.00 58.97 ? 153 GLU D OE2 1 
ATOM   6189 N  N   . ALA D 1 154 ? 60.382  24.802  22.265  1.00 33.05 ? 154 ALA D N   1 
ATOM   6190 C  CA  . ALA D 1 154 ? 60.537  23.379  21.982  1.00 32.74 ? 154 ALA D CA  1 
ATOM   6191 C  C   . ALA D 1 154 ? 62.006  22.989  21.824  1.00 33.05 ? 154 ALA D C   1 
ATOM   6192 O  O   . ALA D 1 154 ? 62.436  21.938  22.301  1.00 34.02 ? 154 ALA D O   1 
ATOM   6193 C  CB  . ALA D 1 154 ? 59.768  23.015  20.715  1.00 34.80 ? 154 ALA D CB  1 
ATOM   6194 N  N   . ILE D 1 155 ? 62.772  23.840  21.150  1.00 32.45 ? 155 ILE D N   1 
ATOM   6195 C  CA  . ILE D 1 155 ? 64.188  23.577  20.909  1.00 31.33 ? 155 ILE D CA  1 
ATOM   6196 C  C   . ILE D 1 155 ? 65.094  23.945  22.080  1.00 29.88 ? 155 ILE D C   1 
ATOM   6197 O  O   . ILE D 1 155 ? 65.802  23.093  22.620  1.00 29.57 ? 155 ILE D O   1 
ATOM   6198 C  CB  . ILE D 1 155 ? 64.712  24.358  19.665  1.00 31.79 ? 155 ILE D CB  1 
ATOM   6199 C  CG1 . ILE D 1 155 ? 64.020  23.873  18.385  1.00 33.66 ? 155 ILE D CG1 1 
ATOM   6200 C  CG2 . ILE D 1 155 ? 66.224  24.177  19.534  1.00 31.24 ? 155 ILE D CG2 1 
ATOM   6201 C  CD1 . ILE D 1 155 ? 64.360  22.451  17.999  1.00 35.36 ? 155 ILE D CD1 1 
ATOM   6202 N  N   . SER D 1 156 ? 65.063  25.217  22.464  1.00 29.93 ? 156 SER D N   1 
ATOM   6203 C  CA  . SER D 1 156 ? 65.924  25.738  23.521  1.00 28.68 ? 156 SER D CA  1 
ATOM   6204 C  C   . SER D 1 156 ? 65.392  25.700  24.944  1.00 30.02 ? 156 SER D C   1 
ATOM   6205 O  O   . SER D 1 156 ? 66.155  25.897  25.888  1.00 26.14 ? 156 SER D O   1 
ATOM   6206 C  CB  . SER D 1 156 ? 66.303  27.179  23.201  1.00 30.27 ? 156 SER D CB  1 
ATOM   6207 O  OG  . SER D 1 156 ? 65.215  28.042  23.483  1.00 29.01 ? 156 SER D OG  1 
ATOM   6208 N  N   . GLY D 1 157 ? 64.093  25.469  25.107  1.00 31.00 ? 157 GLY D N   1 
ATOM   6209 C  CA  . GLY D 1 157 ? 63.533  25.434  26.445  1.00 31.94 ? 157 GLY D CA  1 
ATOM   6210 C  C   . GLY D 1 157 ? 63.194  26.833  26.918  1.00 32.14 ? 157 GLY D C   1 
ATOM   6211 O  O   . GLY D 1 157 ? 62.754  27.030  28.048  1.00 34.17 ? 157 GLY D O   1 
ATOM   6212 N  N   . ALA D 1 158 ? 63.406  27.811  26.047  1.00 32.71 ? 158 ALA D N   1 
ATOM   6213 C  CA  . ALA D 1 158 ? 63.110  29.204  26.365  1.00 32.87 ? 158 ALA D CA  1 
ATOM   6214 C  C   . ALA D 1 158 ? 62.547  29.877  25.120  1.00 33.22 ? 158 ALA D C   1 
ATOM   6215 O  O   . ALA D 1 158 ? 62.611  29.316  24.028  1.00 31.76 ? 158 ALA D O   1 
ATOM   6216 C  CB  . ALA D 1 158 ? 64.381  29.927  26.828  1.00 32.83 ? 158 ALA D CB  1 
ATOM   6217 N  N   . SER D 1 159 ? 62.000  31.078  25.289  1.00 35.61 ? 159 SER D N   1 
ATOM   6218 C  CA  . SER D 1 159 ? 61.428  31.830  24.176  1.00 36.95 ? 159 SER D CA  1 
ATOM   6219 C  C   . SER D 1 159 ? 61.517  33.331  24.442  1.00 37.13 ? 159 SER D C   1 
ATOM   6220 O  O   . SER D 1 159 ? 61.785  33.754  25.565  1.00 37.43 ? 159 SER D O   1 
ATOM   6221 C  CB  . SER D 1 159 ? 59.965  31.425  23.967  1.00 39.83 ? 159 SER D CB  1 
ATOM   6222 O  OG  . SER D 1 159 ? 59.206  31.623  25.151  1.00 41.61 ? 159 SER D OG  1 
ATOM   6223 N  N   . GLY D 1 160 ? 61.307  34.133  23.403  1.00 36.76 ? 160 GLY D N   1 
ATOM   6224 C  CA  . GLY D 1 160 ? 61.365  35.574  23.564  1.00 36.62 ? 160 GLY D CA  1 
ATOM   6225 C  C   . GLY D 1 160 ? 62.437  36.266  22.746  1.00 36.80 ? 160 GLY D C   1 
ATOM   6226 O  O   . GLY D 1 160 ? 63.360  35.624  22.240  1.00 36.94 ? 160 GLY D O   1 
ATOM   6227 N  N   . PHE D 1 161 ? 62.311  37.585  22.619  1.00 36.27 ? 161 PHE D N   1 
ATOM   6228 C  CA  . PHE D 1 161 ? 63.261  38.397  21.866  1.00 35.97 ? 161 PHE D CA  1 
ATOM   6229 C  C   . PHE D 1 161 ? 64.380  38.839  22.799  1.00 35.24 ? 161 PHE D C   1 
ATOM   6230 O  O   . PHE D 1 161 ? 64.132  39.514  23.797  1.00 35.31 ? 161 PHE D O   1 
ATOM   6231 C  CB  . PHE D 1 161 ? 62.564  39.631  21.296  1.00 38.58 ? 161 PHE D CB  1 
ATOM   6232 C  CG  . PHE D 1 161 ? 63.472  40.524  20.509  1.00 38.86 ? 161 PHE D CG  1 
ATOM   6233 C  CD1 . PHE D 1 161 ? 63.936  40.134  19.258  1.00 40.87 ? 161 PHE D CD1 1 
ATOM   6234 C  CD2 . PHE D 1 161 ? 63.884  41.744  21.028  1.00 39.78 ? 161 PHE D CD2 1 
ATOM   6235 C  CE1 . PHE D 1 161 ? 64.800  40.949  18.532  1.00 40.93 ? 161 PHE D CE1 1 
ATOM   6236 C  CE2 . PHE D 1 161 ? 64.749  42.568  20.312  1.00 40.68 ? 161 PHE D CE2 1 
ATOM   6237 C  CZ  . PHE D 1 161 ? 65.208  42.169  19.062  1.00 41.88 ? 161 PHE D CZ  1 
ATOM   6238 N  N   . PRO D 1 162 ? 65.632  38.476  22.481  1.00 34.12 ? 162 PRO D N   1 
ATOM   6239 C  CA  . PRO D 1 162 ? 66.780  38.843  23.316  1.00 33.17 ? 162 PRO D CA  1 
ATOM   6240 C  C   . PRO D 1 162 ? 67.080  40.340  23.346  1.00 33.08 ? 162 PRO D C   1 
ATOM   6241 O  O   . PRO D 1 162 ? 67.293  40.955  22.304  1.00 33.19 ? 162 PRO D O   1 
ATOM   6242 C  CB  . PRO D 1 162 ? 67.937  38.060  22.684  1.00 33.67 ? 162 PRO D CB  1 
ATOM   6243 C  CG  . PRO D 1 162 ? 67.260  36.932  21.959  1.00 34.12 ? 162 PRO D CG  1 
ATOM   6244 C  CD  . PRO D 1 162 ? 66.056  37.611  21.369  1.00 34.90 ? 162 PRO D CD  1 
ATOM   6245 N  N   . ILE D 1 163 ? 67.101  40.917  24.542  1.00 32.52 ? 163 ILE D N   1 
ATOM   6246 C  CA  . ILE D 1 163 ? 67.421  42.328  24.701  1.00 33.27 ? 163 ILE D CA  1 
ATOM   6247 C  C   . ILE D 1 163 ? 68.917  42.415  24.976  1.00 32.26 ? 163 ILE D C   1 
ATOM   6248 O  O   . ILE D 1 163 ? 69.617  43.270  24.434  1.00 32.50 ? 163 ILE D O   1 
ATOM   6249 C  CB  . ILE D 1 163 ? 66.642  42.942  25.865  1.00 35.04 ? 163 ILE D CB  1 
ATOM   6250 C  CG1 . ILE D 1 163 ? 65.151  42.918  25.528  1.00 37.17 ? 163 ILE D CG1 1 
ATOM   6251 C  CG2 . ILE D 1 163 ? 67.135  44.362  26.140  1.00 34.34 ? 163 ILE D CG2 1 
ATOM   6252 C  CD1 . ILE D 1 163 ? 64.275  43.421  26.636  1.00 42.25 ? 163 ILE D CD1 1 
ATOM   6253 N  N   . MET D 1 164 ? 69.399  41.513  25.823  1.00 32.12 ? 164 MET D N   1 
ATOM   6254 C  CA  . MET D 1 164 ? 70.816  41.443  26.160  1.00 31.78 ? 164 MET D CA  1 
ATOM   6255 C  C   . MET D 1 164 ? 71.107  40.059  26.739  1.00 29.31 ? 164 MET D C   1 
ATOM   6256 O  O   . MET D 1 164 ? 70.195  39.360  27.178  1.00 28.61 ? 164 MET D O   1 
ATOM   6257 C  CB  . MET D 1 164 ? 71.185  42.550  27.153  1.00 36.68 ? 164 MET D CB  1 
ATOM   6258 C  CG  . MET D 1 164 ? 70.463  42.481  28.483  1.00 42.13 ? 164 MET D CG  1 
ATOM   6259 S  SD  . MET D 1 164 ? 71.387  41.532  29.704  1.00 50.10 ? 164 MET D SD  1 
ATOM   6260 C  CE  . MET D 1 164 ? 72.138  42.850  30.636  1.00 49.56 ? 164 MET D CE  1 
ATOM   6261 N  N   . GLY D 1 165 ? 72.369  39.652  26.721  1.00 27.03 ? 165 GLY D N   1 
ATOM   6262 C  CA  . GLY D 1 165 ? 72.705  38.342  27.246  1.00 26.43 ? 165 GLY D CA  1 
ATOM   6263 C  C   . GLY D 1 165 ? 74.136  38.255  27.728  1.00 25.24 ? 165 GLY D C   1 
ATOM   6264 O  O   . GLY D 1 165 ? 74.966  39.100  27.397  1.00 25.33 ? 165 GLY D O   1 
ATOM   6265 N  N   . LEU D 1 166 ? 74.419  37.224  28.515  1.00 24.22 ? 166 LEU D N   1 
ATOM   6266 C  CA  . LEU D 1 166 ? 75.747  37.004  29.064  1.00 22.30 ? 166 LEU D CA  1 
ATOM   6267 C  C   . LEU D 1 166 ? 76.210  35.581  28.776  1.00 21.07 ? 166 LEU D C   1 
ATOM   6268 O  O   . LEU D 1 166 ? 75.520  34.616  29.093  1.00 20.42 ? 166 LEU D O   1 
ATOM   6269 C  CB  . LEU D 1 166 ? 75.729  37.228  30.577  1.00 23.78 ? 166 LEU D CB  1 
ATOM   6270 C  CG  . LEU D 1 166 ? 77.020  36.901  31.331  1.00 25.27 ? 166 LEU D CG  1 
ATOM   6271 C  CD1 . LEU D 1 166 ? 78.146  37.820  30.863  1.00 23.80 ? 166 LEU D CD1 1 
ATOM   6272 C  CD2 . LEU D 1 166 ? 76.778  37.062  32.829  1.00 25.78 ? 166 LEU D CD2 1 
ATOM   6273 N  N   . ASP D 1 167 ? 77.388  35.471  28.178  1.00 18.90 ? 167 ASP D N   1 
ATOM   6274 C  CA  . ASP D 1 167 ? 77.990  34.190  27.845  1.00 18.89 ? 167 ASP D CA  1 
ATOM   6275 C  C   . ASP D 1 167 ? 78.553  33.583  29.134  1.00 19.37 ? 167 ASP D C   1 
ATOM   6276 O  O   . ASP D 1 167 ? 79.396  34.208  29.780  1.00 20.89 ? 167 ASP D O   1 
ATOM   6277 C  CB  . ASP D 1 167 ? 79.135  34.436  26.852  1.00 17.88 ? 167 ASP D CB  1 
ATOM   6278 C  CG  . ASP D 1 167 ? 79.707  33.160  26.265  1.00 20.65 ? 167 ASP D CG  1 
ATOM   6279 O  OD1 . ASP D 1 167 ? 79.258  32.055  26.646  1.00 18.69 ? 167 ASP D OD1 1 
ATOM   6280 O  OD2 . ASP D 1 167 ? 80.617  33.272  25.408  1.00 17.94 ? 167 ASP D OD2 1 
ATOM   6281 N  N   . VAL D 1 168 ? 78.083  32.399  29.537  1.00 17.89 ? 168 VAL D N   1 
ATOM   6282 C  CA  . VAL D 1 168 ? 78.658  31.781  30.731  1.00 19.20 ? 168 VAL D CA  1 
ATOM   6283 C  C   . VAL D 1 168 ? 79.443  30.501  30.445  1.00 19.89 ? 168 VAL D C   1 
ATOM   6284 O  O   . VAL D 1 168 ? 79.636  29.666  31.337  1.00 21.49 ? 168 VAL D O   1 
ATOM   6285 C  CB  . VAL D 1 168 ? 77.617  31.518  31.867  1.00 20.16 ? 168 VAL D CB  1 
ATOM   6286 C  CG1 . VAL D 1 168 ? 77.140  32.849  32.437  1.00 23.35 ? 168 VAL D CG1 1 
ATOM   6287 C  CG2 . VAL D 1 168 ? 76.457  30.701  31.361  1.00 21.95 ? 168 VAL D CG2 1 
ATOM   6288 N  N   . TRP D 1 169 ? 79.881  30.338  29.197  1.00 16.46 ? 169 TRP D N   1 
ATOM   6289 C  CA  . TRP D 1 169 ? 80.730  29.202  28.852  1.00 15.48 ? 169 TRP D CA  1 
ATOM   6290 C  C   . TRP D 1 169 ? 82.013  29.554  29.601  1.00 15.46 ? 169 TRP D C   1 
ATOM   6291 O  O   . TRP D 1 169 ? 82.297  30.736  29.791  1.00 15.88 ? 169 TRP D O   1 
ATOM   6292 C  CB  . TRP D 1 169 ? 81.048  29.171  27.359  1.00 13.50 ? 169 TRP D CB  1 
ATOM   6293 C  CG  . TRP D 1 169 ? 80.026  28.486  26.515  1.00 14.57 ? 169 TRP D CG  1 
ATOM   6294 C  CD1 . TRP D 1 169 ? 78.695  28.781  26.427  1.00 14.71 ? 169 TRP D CD1 1 
ATOM   6295 C  CD2 . TRP D 1 169 ? 80.265  27.413  25.604  1.00 14.73 ? 169 TRP D CD2 1 
ATOM   6296 N  NE1 . TRP D 1 169 ? 78.087  27.952  25.507  1.00 17.16 ? 169 TRP D NE1 1 
ATOM   6297 C  CE2 . TRP D 1 169 ? 79.029  27.104  24.987  1.00 13.95 ? 169 TRP D CE2 1 
ATOM   6298 C  CE3 . TRP D 1 169 ? 81.406  26.679  25.242  1.00 14.29 ? 169 TRP D CE3 1 
ATOM   6299 C  CZ2 . TRP D 1 169 ? 78.904  26.093  24.027  1.00 15.07 ? 169 TRP D CZ2 1 
ATOM   6300 C  CZ3 . TRP D 1 169 ? 81.279  25.669  24.285  1.00 12.28 ? 169 TRP D CZ3 1 
ATOM   6301 C  CH2 . TRP D 1 169 ? 80.036  25.389  23.691  1.00 15.12 ? 169 TRP D CH2 1 
ATOM   6302 N  N   . GLU D 1 170 ? 82.791  28.554  30.000  1.00 16.42 ? 170 GLU D N   1 
ATOM   6303 C  CA  . GLU D 1 170 ? 84.016  28.826  30.745  1.00 17.15 ? 170 GLU D CA  1 
ATOM   6304 C  C   . GLU D 1 170 ? 85.079  29.589  29.947  1.00 19.34 ? 170 GLU D C   1 
ATOM   6305 O  O   . GLU D 1 170 ? 85.864  30.330  30.532  1.00 20.12 ? 170 GLU D O   1 
ATOM   6306 C  CB  . GLU D 1 170 ? 84.580  27.521  31.318  1.00 18.21 ? 170 GLU D CB  1 
ATOM   6307 C  CG  . GLU D 1 170 ? 83.627  26.896  32.353  1.00 17.36 ? 170 GLU D CG  1 
ATOM   6308 C  CD  . GLU D 1 170 ? 84.132  25.589  32.943  1.00 17.34 ? 170 GLU D CD  1 
ATOM   6309 O  OE1 . GLU D 1 170 ? 84.620  24.734  32.178  1.00 16.05 ? 170 GLU D OE1 1 
ATOM   6310 O  OE2 . GLU D 1 170 ? 84.017  25.410  34.178  1.00 18.12 ? 170 GLU D OE2 1 
ATOM   6311 N  N   . HIS D 1 171 ? 85.099  29.434  28.624  1.00 19.29 ? 171 HIS D N   1 
ATOM   6312 C  CA  . HIS D 1 171 ? 86.085  30.152  27.820  1.00 19.51 ? 171 HIS D CA  1 
ATOM   6313 C  C   . HIS D 1 171 ? 85.898  31.669  27.894  1.00 20.02 ? 171 HIS D C   1 
ATOM   6314 O  O   . HIS D 1 171 ? 86.816  32.427  27.593  1.00 19.77 ? 171 HIS D O   1 
ATOM   6315 C  CB  . HIS D 1 171 ? 86.061  29.681  26.353  1.00 18.60 ? 171 HIS D CB  1 
ATOM   6316 C  CG  . HIS D 1 171 ? 84.803  30.014  25.608  1.00 19.41 ? 171 HIS D CG  1 
ATOM   6317 N  ND1 . HIS D 1 171 ? 84.049  29.054  24.965  1.00 16.56 ? 171 HIS D ND1 1 
ATOM   6318 C  CD2 . HIS D 1 171 ? 84.199  31.201  25.347  1.00 17.62 ? 171 HIS D CD2 1 
ATOM   6319 C  CE1 . HIS D 1 171 ? 83.039  29.633  24.339  1.00 19.25 ? 171 HIS D CE1 1 
ATOM   6320 N  NE2 . HIS D 1 171 ? 83.107  30.936  24.555  1.00 19.73 ? 171 HIS D NE2 1 
ATOM   6321 N  N   . ALA D 1 172 ? 84.719  32.112  28.320  1.00 19.12 ? 172 ALA D N   1 
ATOM   6322 C  CA  . ALA D 1 172 ? 84.437  33.535  28.415  1.00 20.50 ? 172 ALA D CA  1 
ATOM   6323 C  C   . ALA D 1 172 ? 85.011  34.194  29.670  1.00 22.14 ? 172 ALA D C   1 
ATOM   6324 O  O   . ALA D 1 172 ? 85.085  35.424  29.751  1.00 21.36 ? 172 ALA D O   1 
ATOM   6325 C  CB  . ALA D 1 172 ? 82.933  33.767  28.361  1.00 21.73 ? 172 ALA D CB  1 
ATOM   6326 N  N   . TYR D 1 173 ? 85.431  33.390  30.642  1.00 21.66 ? 173 TYR D N   1 
ATOM   6327 C  CA  . TYR D 1 173 ? 85.944  33.958  31.883  1.00 21.51 ? 173 TYR D CA  1 
ATOM   6328 C  C   . TYR D 1 173 ? 87.068  33.217  32.584  1.00 20.93 ? 173 TYR D C   1 
ATOM   6329 O  O   . TYR D 1 173 ? 87.583  33.708  33.585  1.00 23.37 ? 173 TYR D O   1 
ATOM   6330 C  CB  . TYR D 1 173 ? 84.788  34.116  32.871  1.00 21.19 ? 173 TYR D CB  1 
ATOM   6331 C  CG  . TYR D 1 173 ? 84.144  32.805  33.312  1.00 21.13 ? 173 TYR D CG  1 
ATOM   6332 C  CD1 . TYR D 1 173 ? 84.736  31.997  34.292  1.00 20.66 ? 173 TYR D CD1 1 
ATOM   6333 C  CD2 . TYR D 1 173 ? 82.922  32.393  32.774  1.00 19.75 ? 173 TYR D CD2 1 
ATOM   6334 C  CE1 . TYR D 1 173 ? 84.118  30.811  34.732  1.00 22.88 ? 173 TYR D CE1 1 
ATOM   6335 C  CE2 . TYR D 1 173 ? 82.298  31.214  33.205  1.00 21.06 ? 173 TYR D CE2 1 
ATOM   6336 C  CZ  . TYR D 1 173 ? 82.897  30.431  34.183  1.00 22.47 ? 173 TYR D CZ  1 
ATOM   6337 O  OH  . TYR D 1 173 ? 82.260  29.286  34.618  1.00 21.95 ? 173 TYR D OH  1 
ATOM   6338 N  N   . TYR D 1 174 ? 87.472  32.060  32.075  1.00 19.29 ? 174 TYR D N   1 
ATOM   6339 C  CA  . TYR D 1 174 ? 88.496  31.292  32.771  1.00 19.59 ? 174 TYR D CA  1 
ATOM   6340 C  C   . TYR D 1 174 ? 89.902  31.878  32.886  1.00 22.99 ? 174 TYR D C   1 
ATOM   6341 O  O   . TYR D 1 174 ? 90.554  31.727  33.924  1.00 21.89 ? 174 TYR D O   1 
ATOM   6342 C  CB  . TYR D 1 174 ? 88.615  29.887  32.192  1.00 19.66 ? 174 TYR D CB  1 
ATOM   6343 C  CG  . TYR D 1 174 ? 88.792  28.862  33.291  1.00 18.96 ? 174 TYR D CG  1 
ATOM   6344 C  CD1 . TYR D 1 174 ? 87.712  28.492  34.092  1.00 18.50 ? 174 TYR D CD1 1 
ATOM   6345 C  CD2 . TYR D 1 174 ? 90.048  28.326  33.588  1.00 19.98 ? 174 TYR D CD2 1 
ATOM   6346 C  CE1 . TYR D 1 174 ? 87.871  27.621  35.166  1.00 17.76 ? 174 TYR D CE1 1 
ATOM   6347 C  CE2 . TYR D 1 174 ? 90.224  27.446  34.668  1.00 18.78 ? 174 TYR D CE2 1 
ATOM   6348 C  CZ  . TYR D 1 174 ? 89.126  27.103  35.452  1.00 20.03 ? 174 TYR D CZ  1 
ATOM   6349 O  OH  . TYR D 1 174 ? 89.271  26.260  36.533  1.00 21.70 ? 174 TYR D OH  1 
ATOM   6350 N  N   . LEU D 1 175 ? 90.386  32.522  31.831  1.00 21.43 ? 175 LEU D N   1 
ATOM   6351 C  CA  . LEU D 1 175 ? 91.726  33.087  31.877  1.00 24.88 ? 175 LEU D CA  1 
ATOM   6352 C  C   . LEU D 1 175 ? 91.910  34.099  33.011  1.00 24.39 ? 175 LEU D C   1 
ATOM   6353 O  O   . LEU D 1 175 ? 92.932  34.087  33.687  1.00 25.66 ? 175 LEU D O   1 
ATOM   6354 C  CB  . LEU D 1 175 ? 92.077  33.724  30.527  1.00 24.72 ? 175 LEU D CB  1 
ATOM   6355 C  CG  . LEU D 1 175 ? 92.244  32.723  29.379  1.00 24.83 ? 175 LEU D CG  1 
ATOM   6356 C  CD1 . LEU D 1 175 ? 92.584  33.466  28.092  1.00 26.94 ? 175 LEU D CD1 1 
ATOM   6357 C  CD2 . LEU D 1 175 ? 93.340  31.722  29.726  1.00 25.44 ? 175 LEU D CD2 1 
ATOM   6358 N  N   . LYS D 1 176 ? 90.918  34.951  33.237  1.00 25.95 ? 176 LYS D N   1 
ATOM   6359 C  CA  . LYS D 1 176 ? 91.019  35.957  34.287  1.00 27.06 ? 176 LYS D CA  1 
ATOM   6360 C  C   . LYS D 1 176 ? 90.365  35.587  35.619  1.00 27.59 ? 176 LYS D C   1 
ATOM   6361 O  O   . LYS D 1 176 ? 90.885  35.917  36.687  1.00 26.39 ? 176 LYS D O   1 
ATOM   6362 C  CB  . LYS D 1 176 ? 90.423  37.281  33.804  1.00 29.12 ? 176 LYS D CB  1 
ATOM   6363 C  CG  . LYS D 1 176 ? 90.472  38.387  34.849  1.00 31.44 ? 176 LYS D CG  1 
ATOM   6364 C  CD  . LYS D 1 176 ? 89.796  39.662  34.373  1.00 31.74 ? 176 LYS D CD  1 
ATOM   6365 C  CE  . LYS D 1 176 ? 89.868  40.746  35.443  1.00 34.36 ? 176 LYS D CE  1 
ATOM   6366 N  NZ  . LYS D 1 176 ? 89.203  42.006  35.014  1.00 33.54 ? 176 LYS D NZ  1 
ATOM   6367 N  N   . PHE D 1 177 ? 89.232  34.899  35.560  1.00 26.58 ? 177 PHE D N   1 
ATOM   6368 C  CA  . PHE D 1 177 ? 88.499  34.546  36.771  1.00 25.51 ? 177 PHE D CA  1 
ATOM   6369 C  C   . PHE D 1 177 ? 88.580  33.085  37.196  1.00 24.97 ? 177 PHE D C   1 
ATOM   6370 O  O   . PHE D 1 177 ? 88.205  32.750  38.313  1.00 25.07 ? 177 PHE D O   1 
ATOM   6371 C  CB  . PHE D 1 177 ? 87.028  34.915  36.585  1.00 25.46 ? 177 PHE D CB  1 
ATOM   6372 C  CG  . PHE D 1 177 ? 86.801  36.361  36.246  1.00 27.98 ? 177 PHE D CG  1 
ATOM   6373 C  CD1 . PHE D 1 177 ? 86.712  37.319  37.249  1.00 28.28 ? 177 PHE D CD1 1 
ATOM   6374 C  CD2 . PHE D 1 177 ? 86.675  36.764  34.920  1.00 27.31 ? 177 PHE D CD2 1 
ATOM   6375 C  CE1 . PHE D 1 177 ? 86.498  38.660  36.940  1.00 29.53 ? 177 PHE D CE1 1 
ATOM   6376 C  CE2 . PHE D 1 177 ? 86.461  38.105  34.597  1.00 30.65 ? 177 PHE D CE2 1 
ATOM   6377 C  CZ  . PHE D 1 177 ? 86.371  39.056  35.611  1.00 30.30 ? 177 PHE D CZ  1 
ATOM   6378 N  N   . GLN D 1 178 ? 89.075  32.220  36.317  1.00 25.30 ? 178 GLN D N   1 
ATOM   6379 C  CA  . GLN D 1 178 ? 89.130  30.792  36.608  1.00 25.77 ? 178 GLN D CA  1 
ATOM   6380 C  C   . GLN D 1 178 ? 87.743  30.320  37.064  1.00 25.81 ? 178 GLN D C   1 
ATOM   6381 O  O   . GLN D 1 178 ? 86.741  30.612  36.413  1.00 25.04 ? 178 GLN D O   1 
ATOM   6382 C  CB  . GLN D 1 178 ? 90.171  30.478  37.683  1.00 27.66 ? 178 GLN D CB  1 
ATOM   6383 C  CG  . GLN D 1 178 ? 91.613  30.719  37.260  1.00 32.60 ? 178 GLN D CG  1 
ATOM   6384 C  CD  . GLN D 1 178 ? 92.000  32.181  37.343  1.00 36.50 ? 178 GLN D CD  1 
ATOM   6385 O  OE1 . GLN D 1 178 ? 91.831  32.818  38.385  1.00 36.77 ? 178 GLN D OE1 1 
ATOM   6386 N  NE2 . GLN D 1 178 ? 92.528  32.722  36.246  1.00 36.30 ? 178 GLN D NE2 1 
ATOM   6387 N  N   . ASN D 1 179 ? 87.684  29.619  38.191  1.00 25.71 ? 179 ASN D N   1 
ATOM   6388 C  CA  . ASN D 1 179 ? 86.422  29.089  38.718  1.00 25.06 ? 179 ASN D CA  1 
ATOM   6389 C  C   . ASN D 1 179 ? 85.458  30.120  39.308  1.00 25.93 ? 179 ASN D C   1 
ATOM   6390 O  O   . ASN D 1 179 ? 84.306  29.798  39.599  1.00 26.21 ? 179 ASN D O   1 
ATOM   6391 C  CB  . ASN D 1 179 ? 86.718  28.067  39.813  1.00 25.06 ? 179 ASN D CB  1 
ATOM   6392 C  CG  . ASN D 1 179 ? 87.440  28.691  40.998  1.00 25.07 ? 179 ASN D CG  1 
ATOM   6393 O  OD1 . ASN D 1 179 ? 88.605  29.060  40.900  1.00 26.09 ? 179 ASN D OD1 1 
ATOM   6394 N  ND2 . ASN D 1 179 ? 86.740  28.831  42.112  1.00 26.39 ? 179 ASN D ND2 1 
ATOM   6395 N  N   A ARG D 1 180 ? 85.924  31.353  39.472  0.50 25.00 ? 180 ARG D N   1 
ATOM   6396 N  N   B ARG D 1 180 ? 85.922  31.352  39.476  0.50 24.99 ? 180 ARG D N   1 
ATOM   6397 C  CA  A ARG D 1 180 ? 85.104  32.406  40.063  0.50 25.87 ? 180 ARG D CA  1 
ATOM   6398 C  CA  B ARG D 1 180 ? 85.098  32.398  40.070  0.50 25.83 ? 180 ARG D CA  1 
ATOM   6399 C  C   A ARG D 1 180 ? 84.095  33.057  39.120  0.50 26.19 ? 180 ARG D C   1 
ATOM   6400 C  C   B ARG D 1 180 ? 84.092  33.057  39.128  0.50 26.16 ? 180 ARG D C   1 
ATOM   6401 O  O   A ARG D 1 180 ? 84.180  34.252  38.837  0.50 26.90 ? 180 ARG D O   1 
ATOM   6402 O  O   B ARG D 1 180 ? 84.177  34.254  38.854  0.50 26.86 ? 180 ARG D O   1 
ATOM   6403 C  CB  A ARG D 1 180 ? 86.014  33.484  40.664  0.50 27.00 ? 180 ARG D CB  1 
ATOM   6404 C  CB  B ARG D 1 180 ? 86.010  33.458  40.698  0.50 26.97 ? 180 ARG D CB  1 
ATOM   6405 C  CG  A ARG D 1 180 ? 87.000  32.954  41.697  0.50 29.62 ? 180 ARG D CG  1 
ATOM   6406 C  CG  B ARG D 1 180 ? 86.923  32.890  41.779  0.50 29.59 ? 180 ARG D CG  1 
ATOM   6407 C  CD  A ARG D 1 180 ? 87.872  34.072  42.262  0.50 31.22 ? 180 ARG D CD  1 
ATOM   6408 C  CD  B ARG D 1 180 ? 87.952  33.903  42.274  0.50 31.39 ? 180 ARG D CD  1 
ATOM   6409 N  NE  A ARG D 1 180 ? 88.758  34.649  41.255  0.50 31.82 ? 180 ARG D NE  1 
ATOM   6410 N  NE  B ARG D 1 180 ? 88.922  34.258  41.242  0.50 32.42 ? 180 ARG D NE  1 
ATOM   6411 C  CZ  A ARG D 1 180 ? 89.807  34.022  40.733  0.50 32.29 ? 180 ARG D CZ  1 
ATOM   6412 C  CZ  B ARG D 1 180 ? 88.989  35.447  40.652  0.50 32.93 ? 180 ARG D CZ  1 
ATOM   6413 N  NH1 A ARG D 1 180 ? 90.110  32.791  41.121  0.50 32.59 ? 180 ARG D NH1 1 
ATOM   6414 N  NH1 B ARG D 1 180 ? 88.141  36.409  40.987  0.50 34.17 ? 180 ARG D NH1 1 
ATOM   6415 N  NH2 A ARG D 1 180 ? 90.557  34.625  39.820  0.50 32.66 ? 180 ARG D NH2 1 
ATOM   6416 N  NH2 B ARG D 1 180 ? 89.907  35.676  39.723  0.50 33.55 ? 180 ARG D NH2 1 
ATOM   6417 N  N   . ARG D 1 181 ? 83.129  32.276  38.647  1.00 26.07 ? 181 ARG D N   1 
ATOM   6418 C  CA  . ARG D 1 181 ? 82.104  32.795  37.742  1.00 25.22 ? 181 ARG D CA  1 
ATOM   6419 C  C   . ARG D 1 181 ? 81.325  33.969  38.359  1.00 25.90 ? 181 ARG D C   1 
ATOM   6420 O  O   . ARG D 1 181 ? 80.966  34.918  37.661  1.00 26.02 ? 181 ARG D O   1 
ATOM   6421 C  CB  . ARG D 1 181 ? 81.112  31.690  37.345  1.00 25.32 ? 181 ARG D CB  1 
ATOM   6422 C  CG  . ARG D 1 181 ? 80.151  32.122  36.240  1.00 24.28 ? 181 ARG D CG  1 
ATOM   6423 C  CD  . ARG D 1 181 ? 78.983  31.157  36.036  1.00 25.26 ? 181 ARG D CD  1 
ATOM   6424 N  NE  . ARG D 1 181 ? 79.380  29.862  35.486  1.00 25.02 ? 181 ARG D NE  1 
ATOM   6425 C  CZ  . ARG D 1 181 ? 78.514  28.928  35.097  1.00 26.48 ? 181 ARG D CZ  1 
ATOM   6426 N  NH1 . ARG D 1 181 ? 77.214  29.156  35.200  1.00 22.74 ? 181 ARG D NH1 1 
ATOM   6427 N  NH2 . ARG D 1 181 ? 78.942  27.768  34.607  1.00 24.19 ? 181 ARG D NH2 1 
ATOM   6428 N  N   . PRO D 1 182 ? 81.036  33.910  39.672  1.00 26.75 ? 182 PRO D N   1 
ATOM   6429 C  CA  . PRO D 1 182 ? 80.296  35.008  40.307  1.00 27.23 ? 182 PRO D CA  1 
ATOM   6430 C  C   . PRO D 1 182 ? 80.999  36.365  40.169  1.00 28.23 ? 182 PRO D C   1 
ATOM   6431 O  O   . PRO D 1 182 ? 80.340  37.394  40.016  1.00 28.64 ? 182 PRO D O   1 
ATOM   6432 C  CB  . PRO D 1 182 ? 80.196  34.554  41.763  1.00 30.26 ? 182 PRO D CB  1 
ATOM   6433 C  CG  . PRO D 1 182 ? 80.149  33.055  41.640  1.00 29.89 ? 182 PRO D CG  1 
ATOM   6434 C  CD  . PRO D 1 182 ? 81.214  32.786  40.611  1.00 27.85 ? 182 PRO D CD  1 
ATOM   6435 N  N   . ASP D 1 183 ? 82.329  36.368  40.235  1.00 26.89 ? 183 ASP D N   1 
ATOM   6436 C  CA  . ASP D 1 183 ? 83.082  37.617  40.093  1.00 28.82 ? 183 ASP D CA  1 
ATOM   6437 C  C   . ASP D 1 183 ? 82.939  38.150  38.665  1.00 28.27 ? 183 ASP D C   1 
ATOM   6438 O  O   . ASP D 1 183 ? 82.833  39.359  38.444  1.00 27.82 ? 183 ASP D O   1 
ATOM   6439 C  CB  . ASP D 1 183 ? 84.568  37.403  40.410  1.00 29.58 ? 183 ASP D CB  1 
ATOM   6440 C  CG  . ASP D 1 183 ? 84.823  37.132  41.886  1.00 33.12 ? 183 ASP D CG  1 
ATOM   6441 O  OD1 . ASP D 1 183 ? 83.896  37.314  42.700  1.00 34.90 ? 183 ASP D OD1 1 
ATOM   6442 O  OD2 . ASP D 1 183 ? 85.958  36.744  42.234  1.00 35.37 ? 183 ASP D OD2 1 
ATOM   6443 N  N   . TYR D 1 184 ? 82.946  37.235  37.700  1.00 25.43 ? 184 TYR D N   1 
ATOM   6444 C  CA  . TYR D 1 184 ? 82.800  37.581  36.291  1.00 24.51 ? 184 TYR D CA  1 
ATOM   6445 C  C   . TYR D 1 184 ? 81.428  38.217  36.069  1.00 25.29 ? 184 TYR D C   1 
ATOM   6446 O  O   . TYR D 1 184 ? 81.299  39.242  35.389  1.00 24.53 ? 184 TYR D O   1 
ATOM   6447 C  CB  . TYR D 1 184 ? 82.949  36.306  35.455  1.00 24.84 ? 184 TYR D CB  1 
ATOM   6448 C  CG  . TYR D 1 184 ? 82.444  36.370  34.029  1.00 25.67 ? 184 TYR D CG  1 
ATOM   6449 C  CD1 . TYR D 1 184 ? 83.082  37.155  33.065  1.00 23.76 ? 184 TYR D CD1 1 
ATOM   6450 C  CD2 . TYR D 1 184 ? 81.358  35.587  33.629  1.00 24.42 ? 184 TYR D CD2 1 
ATOM   6451 C  CE1 . TYR D 1 184 ? 82.651  37.149  31.735  1.00 24.35 ? 184 TYR D CE1 1 
ATOM   6452 C  CE2 . TYR D 1 184 ? 80.920  35.576  32.312  1.00 23.07 ? 184 TYR D CE2 1 
ATOM   6453 C  CZ  . TYR D 1 184 ? 81.568  36.354  31.368  1.00 23.46 ? 184 TYR D CZ  1 
ATOM   6454 O  OH  . TYR D 1 184 ? 81.125  36.328  30.063  1.00 23.43 ? 184 TYR D OH  1 
ATOM   6455 N  N   . ILE D 1 185 ? 80.406  37.608  36.658  1.00 26.05 ? 185 ILE D N   1 
ATOM   6456 C  CA  . ILE D 1 185 ? 79.046  38.105  36.527  1.00 27.51 ? 185 ILE D CA  1 
ATOM   6457 C  C   . ILE D 1 185 ? 78.923  39.529  37.073  1.00 29.76 ? 185 ILE D C   1 
ATOM   6458 O  O   . ILE D 1 185 ? 78.242  40.367  36.484  1.00 29.20 ? 185 ILE D O   1 
ATOM   6459 C  CB  . ILE D 1 185 ? 78.055  37.160  37.238  1.00 27.52 ? 185 ILE D CB  1 
ATOM   6460 C  CG1 . ILE D 1 185 ? 78.116  35.777  36.581  1.00 28.71 ? 185 ILE D CG1 1 
ATOM   6461 C  CG2 . ILE D 1 185 ? 76.646  37.710  37.146  1.00 29.60 ? 185 ILE D CG2 1 
ATOM   6462 C  CD1 . ILE D 1 185 ? 77.196  34.740  37.206  1.00 28.03 ? 185 ILE D CD1 1 
ATOM   6463 N  N   . LYS D 1 186 ? 79.594  39.811  38.185  1.00 31.93 ? 186 LYS D N   1 
ATOM   6464 C  CA  . LYS D 1 186 ? 79.537  41.150  38.764  1.00 34.37 ? 186 LYS D CA  1 
ATOM   6465 C  C   . LYS D 1 186 ? 80.238  42.181  37.884  1.00 33.34 ? 186 LYS D C   1 
ATOM   6466 O  O   . LYS D 1 186 ? 79.751  43.299  37.739  1.00 34.24 ? 186 LYS D O   1 
ATOM   6467 C  CB  . LYS D 1 186 ? 80.128  41.150  40.176  1.00 37.66 ? 186 LYS D CB  1 
ATOM   6468 C  CG  . LYS D 1 186 ? 79.180  40.555  41.212  1.00 43.71 ? 186 LYS D CG  1 
ATOM   6469 C  CD  . LYS D 1 186 ? 79.735  40.670  42.622  1.00 49.62 ? 186 LYS D CD  1 
ATOM   6470 C  CE  . LYS D 1 186 ? 78.774  40.073  43.648  1.00 52.78 ? 186 LYS D CE  1 
ATOM   6471 N  NZ  . LYS D 1 186 ? 78.522  38.619  43.407  1.00 55.90 ? 186 LYS D NZ  1 
ATOM   6472 N  N   . GLU D 1 187 ? 81.368  41.808  37.290  1.00 32.16 ? 187 GLU D N   1 
ATOM   6473 C  CA  . GLU D 1 187 ? 82.097  42.722  36.414  1.00 32.77 ? 187 GLU D CA  1 
ATOM   6474 C  C   . GLU D 1 187 ? 81.269  43.058  35.174  1.00 32.49 ? 187 GLU D C   1 
ATOM   6475 O  O   . GLU D 1 187 ? 81.388  44.148  34.611  1.00 34.19 ? 187 GLU D O   1 
ATOM   6476 C  CB  . GLU D 1 187 ? 83.435  42.105  36.001  1.00 32.17 ? 187 GLU D CB  1 
ATOM   6477 C  CG  . GLU D 1 187 ? 84.481  42.113  37.106  1.00 36.91 ? 187 GLU D CG  1 
ATOM   6478 C  CD  . GLU D 1 187 ? 85.165  43.464  37.256  1.00 40.28 ? 187 GLU D CD  1 
ATOM   6479 O  OE1 . GLU D 1 187 ? 84.489  44.500  37.085  1.00 39.57 ? 187 GLU D OE1 1 
ATOM   6480 O  OE2 . GLU D 1 187 ? 86.380  43.489  37.550  1.00 43.65 ? 187 GLU D OE2 1 
ATOM   6481 N  N   . PHE D 1 188 ? 80.427  42.117  34.758  1.00 31.28 ? 188 PHE D N   1 
ATOM   6482 C  CA  . PHE D 1 188 ? 79.570  42.301  33.590  1.00 31.01 ? 188 PHE D CA  1 
ATOM   6483 C  C   . PHE D 1 188 ? 78.720  43.566  33.684  1.00 31.42 ? 188 PHE D C   1 
ATOM   6484 O  O   . PHE D 1 188 ? 78.501  44.252  32.686  1.00 31.37 ? 188 PHE D O   1 
ATOM   6485 C  CB  . PHE D 1 188 ? 78.654  41.091  33.429  1.00 30.86 ? 188 PHE D CB  1 
ATOM   6486 C  CG  . PHE D 1 188 ? 77.626  41.240  32.346  1.00 28.77 ? 188 PHE D CG  1 
ATOM   6487 C  CD1 . PHE D 1 188 ? 78.009  41.464  31.028  1.00 29.73 ? 188 PHE D CD1 1 
ATOM   6488 C  CD2 . PHE D 1 188 ? 76.275  41.095  32.635  1.00 29.20 ? 188 PHE D CD2 1 
ATOM   6489 C  CE1 . PHE D 1 188 ? 77.061  41.533  30.011  1.00 28.86 ? 188 PHE D CE1 1 
ATOM   6490 C  CE2 . PHE D 1 188 ? 75.315  41.162  31.630  1.00 30.24 ? 188 PHE D CE2 1 
ATOM   6491 C  CZ  . PHE D 1 188 ? 75.709  41.380  30.311  1.00 31.27 ? 188 PHE D CZ  1 
ATOM   6492 N  N   . TRP D 1 189 ? 78.233  43.873  34.878  1.00 32.40 ? 189 TRP D N   1 
ATOM   6493 C  CA  . TRP D 1 189 ? 77.406  45.057  35.060  1.00 33.41 ? 189 TRP D CA  1 
ATOM   6494 C  C   . TRP D 1 189 ? 78.145  46.327  34.643  1.00 34.49 ? 189 TRP D C   1 
ATOM   6495 O  O   . TRP D 1 189 ? 77.525  47.307  34.233  1.00 35.66 ? 189 TRP D O   1 
ATOM   6496 C  CB  . TRP D 1 189 ? 76.952  45.154  36.517  1.00 34.80 ? 189 TRP D CB  1 
ATOM   6497 C  CG  . TRP D 1 189 ? 76.058  44.019  36.909  1.00 34.32 ? 189 TRP D CG  1 
ATOM   6498 C  CD1 . TRP D 1 189 ? 76.235  43.152  37.951  1.00 34.25 ? 189 TRP D CD1 1 
ATOM   6499 C  CD2 . TRP D 1 189 ? 74.853  43.616  36.252  1.00 32.70 ? 189 TRP D CD2 1 
ATOM   6500 N  NE1 . TRP D 1 189 ? 75.214  42.235  37.982  1.00 34.13 ? 189 TRP D NE1 1 
ATOM   6501 C  CE2 . TRP D 1 189 ? 74.351  42.497  36.950  1.00 33.37 ? 189 TRP D CE2 1 
ATOM   6502 C  CE3 . TRP D 1 189 ? 74.147  44.093  35.140  1.00 32.05 ? 189 TRP D CE3 1 
ATOM   6503 C  CZ2 . TRP D 1 189 ? 73.171  41.843  36.573  1.00 33.33 ? 189 TRP D CZ2 1 
ATOM   6504 C  CZ3 . TRP D 1 189 ? 72.972  43.443  34.763  1.00 33.71 ? 189 TRP D CZ3 1 
ATOM   6505 C  CH2 . TRP D 1 189 ? 72.498  42.329  35.481  1.00 33.14 ? 189 TRP D CH2 1 
ATOM   6506 N  N   . ASN D 1 190 ? 79.469  46.302  34.738  1.00 34.30 ? 190 ASN D N   1 
ATOM   6507 C  CA  . ASN D 1 190 ? 80.267  47.459  34.359  1.00 36.69 ? 190 ASN D CA  1 
ATOM   6508 C  C   . ASN D 1 190 ? 80.375  47.631  32.844  1.00 37.05 ? 190 ASN D C   1 
ATOM   6509 O  O   . ASN D 1 190 ? 80.608  48.740  32.361  1.00 36.81 ? 190 ASN D O   1 
ATOM   6510 C  CB  . ASN D 1 190 ? 81.675  47.354  34.952  1.00 36.63 ? 190 ASN D CB  1 
ATOM   6511 C  CG  . ASN D 1 190 ? 81.674  47.384  36.470  1.00 40.69 ? 190 ASN D CG  1 
ATOM   6512 O  OD1 . ASN D 1 190 ? 81.062  48.259  37.082  1.00 42.61 ? 190 ASN D OD1 1 
ATOM   6513 N  ND2 . ASN D 1 190 ? 82.364  46.431  37.085  1.00 39.20 ? 190 ASN D ND2 1 
ATOM   6514 N  N   . VAL D 1 191 ? 80.197  46.546  32.093  1.00 34.61 ? 191 VAL D N   1 
ATOM   6515 C  CA  . VAL D 1 191 ? 80.317  46.627  30.641  1.00 32.65 ? 191 VAL D CA  1 
ATOM   6516 C  C   . VAL D 1 191 ? 79.055  46.372  29.826  1.00 32.60 ? 191 VAL D C   1 
ATOM   6517 O  O   . VAL D 1 191 ? 79.111  46.329  28.602  1.00 32.55 ? 191 VAL D O   1 
ATOM   6518 C  CB  . VAL D 1 191 ? 81.432  45.688  30.133  1.00 32.30 ? 191 VAL D CB  1 
ATOM   6519 C  CG1 . VAL D 1 191 ? 82.760  46.096  30.747  1.00 30.13 ? 191 VAL D CG1 1 
ATOM   6520 C  CG2 . VAL D 1 191 ? 81.106  44.243  30.486  1.00 31.75 ? 191 VAL D CG2 1 
ATOM   6521 N  N   . VAL D 1 192 ? 77.914  46.210  30.483  1.00 34.42 ? 192 VAL D N   1 
ATOM   6522 C  CA  . VAL D 1 192 ? 76.675  45.994  29.743  1.00 36.37 ? 192 VAL D CA  1 
ATOM   6523 C  C   . VAL D 1 192 ? 76.331  47.281  28.994  1.00 37.88 ? 192 VAL D C   1 
ATOM   6524 O  O   . VAL D 1 192 ? 76.210  48.342  29.607  1.00 37.02 ? 192 VAL D O   1 
ATOM   6525 C  CB  . VAL D 1 192 ? 75.497  45.664  30.675  1.00 38.10 ? 192 VAL D CB  1 
ATOM   6526 C  CG1 . VAL D 1 192 ? 74.256  45.373  29.848  1.00 38.89 ? 192 VAL D CG1 1 
ATOM   6527 C  CG2 . VAL D 1 192 ? 75.841  44.483  31.551  1.00 41.19 ? 192 VAL D CG2 1 
ATOM   6528 N  N   . ASN D 1 193 ? 76.176  47.184  27.676  1.00 37.80 ? 193 ASN D N   1 
ATOM   6529 C  CA  . ASN D 1 193 ? 75.843  48.344  26.849  1.00 36.97 ? 193 ASN D CA  1 
ATOM   6530 C  C   . ASN D 1 193 ? 74.350  48.647  26.934  1.00 36.75 ? 193 ASN D C   1 
ATOM   6531 O  O   . ASN D 1 193 ? 73.555  48.104  26.161  1.00 35.49 ? 193 ASN D O   1 
ATOM   6532 C  CB  . ASN D 1 193 ? 76.211  48.074  25.392  1.00 37.62 ? 193 ASN D CB  1 
ATOM   6533 C  CG  . ASN D 1 193 ? 76.080  49.307  24.518  1.00 39.05 ? 193 ASN D CG  1 
ATOM   6534 O  OD1 . ASN D 1 193 ? 75.105  50.057  24.618  1.00 38.75 ? 193 ASN D OD1 1 
ATOM   6535 N  ND2 . ASN D 1 193 ? 77.059  49.516  23.645  1.00 37.66 ? 193 ASN D ND2 1 
ATOM   6536 N  N   . TRP D 1 194 ? 73.967  49.520  27.861  1.00 36.00 ? 194 TRP D N   1 
ATOM   6537 C  CA  . TRP D 1 194 ? 72.559  49.860  28.027  1.00 36.98 ? 194 TRP D CA  1 
ATOM   6538 C  C   . TRP D 1 194 ? 71.961  50.606  26.840  1.00 36.59 ? 194 TRP D C   1 
ATOM   6539 O  O   . TRP D 1 194 ? 70.751  50.550  26.617  1.00 38.32 ? 194 TRP D O   1 
ATOM   6540 C  CB  . TRP D 1 194 ? 72.359  50.654  29.318  1.00 38.03 ? 194 TRP D CB  1 
ATOM   6541 C  CG  . TRP D 1 194 ? 72.606  49.820  30.547  1.00 39.12 ? 194 TRP D CG  1 
ATOM   6542 C  CD1 . TRP D 1 194 ? 73.584  50.002  31.483  1.00 39.49 ? 194 TRP D CD1 1 
ATOM   6543 C  CD2 . TRP D 1 194 ? 71.868  48.661  30.957  1.00 37.75 ? 194 TRP D CD2 1 
ATOM   6544 N  NE1 . TRP D 1 194 ? 73.501  49.028  32.452  1.00 39.82 ? 194 TRP D NE1 1 
ATOM   6545 C  CE2 . TRP D 1 194 ? 72.456  48.193  32.152  1.00 39.17 ? 194 TRP D CE2 1 
ATOM   6546 C  CE3 . TRP D 1 194 ? 70.768  47.973  30.429  1.00 38.67 ? 194 TRP D CE3 1 
ATOM   6547 C  CZ2 . TRP D 1 194 ? 71.980  47.066  32.830  1.00 38.79 ? 194 TRP D CZ2 1 
ATOM   6548 C  CZ3 . TRP D 1 194 ? 70.294  46.852  31.102  1.00 39.48 ? 194 TRP D CZ3 1 
ATOM   6549 C  CH2 . TRP D 1 194 ? 70.902  46.411  32.292  1.00 39.17 ? 194 TRP D CH2 1 
ATOM   6550 N  N   . ASP D 1 195 ? 72.799  51.296  26.070  1.00 38.05 ? 195 ASP D N   1 
ATOM   6551 C  CA  . ASP D 1 195 ? 72.301  52.017  24.901  1.00 37.48 ? 195 ASP D CA  1 
ATOM   6552 C  C   . ASP D 1 195 ? 71.798  51.019  23.862  1.00 37.38 ? 195 ASP D C   1 
ATOM   6553 O  O   . ASP D 1 195 ? 70.720  51.193  23.287  1.00 36.98 ? 195 ASP D O   1 
ATOM   6554 C  CB  . ASP D 1 195 ? 73.401  52.888  24.285  1.00 40.38 ? 195 ASP D CB  1 
ATOM   6555 C  CG  . ASP D 1 195 ? 73.844  54.013  25.206  1.00 41.71 ? 195 ASP D CG  1 
ATOM   6556 O  OD1 . ASP D 1 195 ? 73.005  54.506  25.992  1.00 45.14 ? 195 ASP D OD1 1 
ATOM   6557 O  OD2 . ASP D 1 195 ? 75.024  54.417  25.136  1.00 41.56 ? 195 ASP D OD2 1 
ATOM   6558 N  N   . GLU D 1 196 ? 72.578  49.967  23.629  1.00 37.16 ? 196 GLU D N   1 
ATOM   6559 C  CA  . GLU D 1 196 ? 72.193  48.948  22.659  1.00 36.00 ? 196 GLU D CA  1 
ATOM   6560 C  C   . GLU D 1 196 ? 70.969  48.189  23.165  1.00 35.55 ? 196 GLU D C   1 
ATOM   6561 O  O   . GLU D 1 196 ? 70.071  47.854  22.393  1.00 35.70 ? 196 GLU D O   1 
ATOM   6562 C  CB  . GLU D 1 196 ? 73.358  47.983  22.416  1.00 37.96 ? 196 GLU D CB  1 
ATOM   6563 C  CG  . GLU D 1 196 ? 73.131  46.976  21.290  1.00 37.99 ? 196 GLU D CG  1 
ATOM   6564 C  CD  . GLU D 1 196 ? 72.851  47.636  19.951  1.00 40.23 ? 196 GLU D CD  1 
ATOM   6565 O  OE1 . GLU D 1 196 ? 73.448  48.697  19.677  1.00 40.62 ? 196 GLU D OE1 1 
ATOM   6566 O  OE2 . GLU D 1 196 ? 72.046  47.086  19.166  1.00 40.19 ? 196 GLU D OE2 1 
ATOM   6567 N  N   . ALA D 1 197 ? 70.933  47.925  24.468  1.00 34.94 ? 197 ALA D N   1 
ATOM   6568 C  CA  . ALA D 1 197 ? 69.806  47.219  25.064  1.00 34.90 ? 197 ALA D CA  1 
ATOM   6569 C  C   . ALA D 1 197 ? 68.537  48.044  24.867  1.00 35.95 ? 197 ALA D C   1 
ATOM   6570 O  O   . ALA D 1 197 ? 67.478  47.507  24.532  1.00 35.88 ? 197 ALA D O   1 
ATOM   6571 C  CB  . ALA D 1 197 ? 70.058  46.991  26.550  1.00 33.82 ? 197 ALA D CB  1 
ATOM   6572 N  N   . ALA D 1 198 ? 68.649  49.353  25.075  1.00 37.61 ? 198 ALA D N   1 
ATOM   6573 C  CA  . ALA D 1 198 ? 67.505  50.248  24.913  1.00 38.38 ? 198 ALA D CA  1 
ATOM   6574 C  C   . ALA D 1 198 ? 67.036  50.232  23.463  1.00 39.48 ? 198 ALA D C   1 
ATOM   6575 O  O   . ALA D 1 198 ? 65.837  50.153  23.189  1.00 40.05 ? 198 ALA D O   1 
ATOM   6576 C  CB  . ALA D 1 198 ? 67.884  51.661  25.324  1.00 39.85 ? 198 ALA D CB  1 
ATOM   6577 N  N   . ALA D 1 199 ? 67.989  50.300  22.538  1.00 39.58 ? 199 ALA D N   1 
ATOM   6578 C  CA  . ALA D 1 199 ? 67.678  50.289  21.115  1.00 39.82 ? 199 ALA D CA  1 
ATOM   6579 C  C   . ALA D 1 199 ? 66.896  49.034  20.733  1.00 40.48 ? 199 ALA D C   1 
ATOM   6580 O  O   . ALA D 1 199 ? 65.898  49.108  20.013  1.00 39.83 ? 199 ALA D O   1 
ATOM   6581 C  CB  . ALA D 1 199 ? 68.965  50.370  20.304  1.00 41.46 ? 199 ALA D CB  1 
ATOM   6582 N  N   . ARG D 1 200 ? 67.350  47.880  21.216  1.00 40.12 ? 200 ARG D N   1 
ATOM   6583 C  CA  . ARG D 1 200 ? 66.680  46.621  20.917  1.00 40.84 ? 200 ARG D CA  1 
ATOM   6584 C  C   . ARG D 1 200 ? 65.289  46.582  21.539  1.00 42.41 ? 200 ARG D C   1 
ATOM   6585 O  O   . ARG D 1 200 ? 64.351  46.042  20.950  1.00 43.18 ? 200 ARG D O   1 
ATOM   6586 C  CB  . ARG D 1 200 ? 67.510  45.440  21.427  1.00 40.85 ? 200 ARG D CB  1 
ATOM   6587 C  CG  . ARG D 1 200 ? 68.849  45.264  20.715  1.00 42.03 ? 200 ARG D CG  1 
ATOM   6588 C  CD  . ARG D 1 200 ? 69.601  44.041  21.222  1.00 40.28 ? 200 ARG D CD  1 
ATOM   6589 N  NE  . ARG D 1 200 ? 68.879  42.800  20.953  1.00 39.42 ? 200 ARG D NE  1 
ATOM   6590 C  CZ  . ARG D 1 200 ? 68.804  42.213  19.763  1.00 40.41 ? 200 ARG D CZ  1 
ATOM   6591 N  NH1 . ARG D 1 200 ? 69.414  42.746  18.712  1.00 40.95 ? 200 ARG D NH1 1 
ATOM   6592 N  NH2 . ARG D 1 200 ? 68.112  41.090  19.621  1.00 40.51 ? 200 ARG D NH2 1 
ATOM   6593 N  N   . PHE D 1 201 ? 65.160  47.153  22.731  1.00 43.75 ? 201 PHE D N   1 
ATOM   6594 C  CA  . PHE D 1 201 ? 63.880  47.188  23.432  1.00 46.55 ? 201 PHE D CA  1 
ATOM   6595 C  C   . PHE D 1 201 ? 62.871  48.032  22.650  1.00 48.18 ? 201 PHE D C   1 
ATOM   6596 O  O   . PHE D 1 201 ? 61.687  47.699  22.572  1.00 47.51 ? 201 PHE D O   1 
ATOM   6597 C  CB  . PHE D 1 201 ? 64.077  47.773  24.837  1.00 47.60 ? 201 PHE D CB  1 
ATOM   6598 C  CG  . PHE D 1 201 ? 62.806  47.895  25.632  1.00 50.04 ? 201 PHE D CG  1 
ATOM   6599 C  CD1 . PHE D 1 201 ? 62.009  46.780  25.875  1.00 50.65 ? 201 PHE D CD1 1 
ATOM   6600 C  CD2 . PHE D 1 201 ? 62.406  49.126  26.141  1.00 50.78 ? 201 PHE D CD2 1 
ATOM   6601 C  CE1 . PHE D 1 201 ? 60.831  46.888  26.613  1.00 51.29 ? 201 PHE D CE1 1 
ATOM   6602 C  CE2 . PHE D 1 201 ? 61.228  49.246  26.881  1.00 51.50 ? 201 PHE D CE2 1 
ATOM   6603 C  CZ  . PHE D 1 201 ? 60.440  48.123  27.116  1.00 51.81 ? 201 PHE D CZ  1 
ATOM   6604 N  N   . ALA D 1 202 ? 63.354  49.125  22.071  1.00 50.25 ? 202 ALA D N   1 
ATOM   6605 C  CA  . ALA D 1 202 ? 62.504  50.018  21.295  1.00 53.52 ? 202 ALA D CA  1 
ATOM   6606 C  C   . ALA D 1 202 ? 62.021  49.330  20.021  1.00 55.50 ? 202 ALA D C   1 
ATOM   6607 O  O   . ALA D 1 202 ? 60.831  49.355  19.703  1.00 56.10 ? 202 ALA D O   1 
ATOM   6608 C  CB  . ALA D 1 202 ? 63.268  51.291  20.946  1.00 53.35 ? 202 ALA D CB  1 
ATOM   6609 N  N   . ALA D 1 203 ? 62.955  48.716  19.299  1.00 57.80 ? 203 ALA D N   1 
ATOM   6610 C  CA  . ALA D 1 203 ? 62.641  48.020  18.055  1.00 60.20 ? 203 ALA D CA  1 
ATOM   6611 C  C   . ALA D 1 203 ? 61.695  46.845  18.284  1.00 61.99 ? 203 ALA D C   1 
ATOM   6612 O  O   . ALA D 1 203 ? 60.802  46.589  17.474  1.00 62.16 ? 203 ALA D O   1 
ATOM   6613 C  CB  . ALA D 1 203 ? 63.927  47.533  17.397  1.00 59.83 ? 203 ALA D CB  1 
ATOM   6614 N  N   . LYS D 1 204 ? 61.905  46.129  19.386  1.00 63.98 ? 204 LYS D N   1 
ATOM   6615 C  CA  . LYS D 1 204 ? 61.083  44.974  19.743  1.00 65.42 ? 204 LYS D CA  1 
ATOM   6616 C  C   . LYS D 1 204 ? 61.166  43.820  18.746  1.00 65.72 ? 204 LYS D C   1 
ATOM   6617 O  O   . LYS D 1 204 ? 60.559  42.768  18.954  1.00 65.48 ? 204 LYS D O   1 
ATOM   6618 C  CB  . LYS D 1 204 ? 59.623  45.403  19.930  1.00 66.61 ? 204 LYS D CB  1 
ATOM   6619 C  CG  . LYS D 1 204 ? 59.390  46.189  21.208  1.00 68.26 ? 204 LYS D CG  1 
ATOM   6620 C  CD  . LYS D 1 204 ? 57.947  46.630  21.350  1.00 68.95 ? 204 LYS D CD  1 
ATOM   6621 C  CE  . LYS D 1 204 ? 57.688  47.175  22.747  1.00 70.04 ? 204 LYS D CE  1 
ATOM   6622 N  NZ  . LYS D 1 204 ? 58.640  48.259  23.117  1.00 70.04 ? 204 LYS D NZ  1 
ATOM   6623 N  N   . LYS D 1 205 ? 61.923  44.021  17.670  1.00 66.45 ? 205 LYS D N   1 
ATOM   6624 C  CA  . LYS D 1 205 ? 62.106  42.994  16.645  1.00 67.07 ? 205 LYS D CA  1 
ATOM   6625 C  C   . LYS D 1 205 ? 63.478  43.110  15.981  1.00 67.15 ? 205 LYS D C   1 
ATOM   6626 O  O   . LYS D 1 205 ? 64.228  44.045  16.338  1.00 66.64 ? 205 LYS D O   1 
ATOM   6627 C  CB  . LYS D 1 205 ? 61.004  43.094  15.582  1.00 67.94 ? 205 LYS D CB  1 
ATOM   6628 C  CG  . LYS D 1 205 ? 59.622  42.676  16.077  1.00 69.90 ? 205 LYS D CG  1 
ATOM   6629 C  CD  . LYS D 1 205 ? 59.614  41.217  16.531  1.00 71.19 ? 205 LYS D CD  1 
ATOM   6630 C  CE  . LYS D 1 205 ? 58.304  40.847  17.216  1.00 72.04 ? 205 LYS D CE  1 
ATOM   6631 N  NZ  . LYS D 1 205 ? 57.125  41.032  16.325  1.00 72.23 ? 205 LYS D NZ  1 
ATOM   6632 O  OXT . LYS D 1 205 ? 63.788  42.264  15.114  1.00 66.22 ? 205 LYS D OXT 1 
HETATM 6633 MN MN  . MN  E 2 .   ? 34.928  15.285  9.780   1.00 14.82 ? 501 MN  A MN  1 
HETATM 6634 MN MN  . MN  F 2 .   ? 22.340  21.716  21.555  1.00 17.25 ? 502 MN  B MN  1 
HETATM 6635 MN MN  . MN  G 2 .   ? 86.467  18.857  35.513  1.00 16.15 ? 503 MN  C MN  1 
HETATM 6636 MN MN  . MN  H 2 .   ? 81.532  32.282  23.900  1.00 20.04 ? 504 MN  D MN  1 
HETATM 6637 O  O   . HOH I 3 .   ? 34.195  0.694   8.932   1.00 24.05 ? 502 HOH A O   1 
HETATM 6638 O  O   . HOH I 3 .   ? 28.439  9.561   12.850  1.00 16.60 ? 503 HOH A O   1 
HETATM 6639 O  O   . HOH I 3 .   ? 29.317  7.072   14.500  1.00 19.44 ? 504 HOH A O   1 
HETATM 6640 O  O   . HOH I 3 .   ? 30.599  19.303  15.178  1.00 12.58 ? 505 HOH A O   1 
HETATM 6641 O  O   . HOH I 3 .   ? 35.982  24.423  18.849  1.00 23.61 ? 506 HOH A O   1 
HETATM 6642 O  O   . HOH I 3 .   ? 38.516  26.065  10.397  1.00 19.26 ? 507 HOH A O   1 
HETATM 6643 O  O   . HOH I 3 .   ? 38.440  28.139  13.385  1.00 30.63 ? 508 HOH A O   1 
HETATM 6644 O  O   . HOH I 3 .   ? 46.512  19.283  8.286   1.00 27.52 ? 509 HOH A O   1 
HETATM 6645 O  O   . HOH I 3 .   ? 43.884  14.484  -0.984  1.00 30.22 ? 510 HOH A O   1 
HETATM 6646 O  O   . HOH I 3 .   ? 47.820  7.214   11.792  1.00 31.11 ? 511 HOH A O   1 
HETATM 6647 O  O   . HOH I 3 .   ? 48.661  9.412   10.489  1.00 26.96 ? 512 HOH A O   1 
HETATM 6648 O  O   . HOH I 3 .   ? 49.586  10.416  5.665   1.00 36.98 ? 513 HOH A O   1 
HETATM 6649 O  O   . HOH I 3 .   ? 47.774  9.983   7.806   1.00 30.84 ? 514 HOH A O   1 
HETATM 6650 O  O   . HOH I 3 .   ? 41.847  20.224  23.761  1.00 30.87 ? 515 HOH A O   1 
HETATM 6651 O  O   . HOH I 3 .   ? 31.679  20.001  22.831  1.00 20.37 ? 516 HOH A O   1 
HETATM 6652 O  O   . HOH I 3 .   ? 32.237  18.415  18.435  1.00 25.75 ? 517 HOH A O   1 
HETATM 6653 O  O   . HOH I 3 .   ? 42.164  26.444  15.778  1.00 21.14 ? 518 HOH A O   1 
HETATM 6654 O  O   . HOH I 3 .   ? 43.120  17.113  -4.162  1.00 32.71 ? 519 HOH A O   1 
HETATM 6655 O  O   . HOH I 3 .   ? 42.956  14.131  -3.682  1.00 41.01 ? 520 HOH A O   1 
HETATM 6656 O  O   . HOH I 3 .   ? 35.673  16.806  -8.316  1.00 26.65 ? 521 HOH A O   1 
HETATM 6657 O  O   . HOH I 3 .   ? 34.154  12.775  -6.361  1.00 32.88 ? 522 HOH A O   1 
HETATM 6658 O  O   . HOH I 3 .   ? 45.142  11.934  0.021   1.00 25.78 ? 523 HOH A O   1 
HETATM 6659 O  O   . HOH I 3 .   ? 43.312  10.584  1.742   1.00 21.58 ? 524 HOH A O   1 
HETATM 6660 O  O   . HOH I 3 .   ? 43.252  8.048   0.691   1.00 31.67 ? 525 HOH A O   1 
HETATM 6661 O  O   . HOH I 3 .   ? 36.742  5.459   -1.837  1.00 33.66 ? 526 HOH A O   1 
HETATM 6662 O  O   . HOH I 3 .   ? 27.496  -0.703  11.352  1.00 37.81 ? 527 HOH A O   1 
HETATM 6663 O  O   . HOH I 3 .   ? 26.750  1.408   10.000  1.00 24.51 ? 528 HOH A O   1 
HETATM 6664 O  O   . HOH I 3 .   ? 25.838  3.675   12.122  1.00 31.93 ? 529 HOH A O   1 
HETATM 6665 O  O   . HOH I 3 .   ? 34.556  8.483   9.895   1.00 24.68 ? 530 HOH A O   1 
HETATM 6666 O  O   . HOH I 3 .   ? 34.607  8.436   12.530  1.00 29.75 ? 531 HOH A O   1 
HETATM 6667 O  O   . HOH I 3 .   ? 30.971  12.134  -3.387  1.00 28.57 ? 532 HOH A O   1 
HETATM 6668 O  O   . HOH I 3 .   ? 48.518  29.749  7.056   1.00 38.16 ? 533 HOH A O   1 
HETATM 6669 O  O   . HOH I 3 .   ? 36.333  34.213  3.128   1.00 36.86 ? 534 HOH A O   1 
HETATM 6670 O  O   . HOH I 3 .   ? 33.211  18.940  25.082  1.00 47.59 ? 535 HOH A O   1 
HETATM 6671 O  O   . HOH I 3 .   ? 30.719  18.263  20.871  1.00 24.66 ? 536 HOH A O   1 
HETATM 6672 O  O   . HOH I 3 .   ? 49.527  31.390  11.558  1.00 39.15 ? 537 HOH A O   1 
HETATM 6673 O  O   . HOH I 3 .   ? 53.570  29.083  13.948  1.00 35.81 ? 538 HOH A O   1 
HETATM 6674 O  O   . HOH I 3 .   ? 28.957  15.361  21.447  1.00 19.47 ? 539 HOH A O   1 
HETATM 6675 O  O   . HOH I 3 .   ? 46.153  18.889  -2.847  1.00 36.27 ? 540 HOH A O   1 
HETATM 6676 O  O   . HOH I 3 .   ? 33.127  28.249  -1.844  1.00 30.09 ? 541 HOH A O   1 
HETATM 6677 O  O   . HOH I 3 .   ? 38.127  23.980  23.664  1.00 31.63 ? 542 HOH A O   1 
HETATM 6678 O  O   . HOH I 3 .   ? 30.890  21.196  7.638   1.00 36.46 ? 543 HOH A O   1 
HETATM 6679 O  O   . HOH I 3 .   ? 47.751  17.952  6.306   1.00 43.39 ? 544 HOH A O   1 
HETATM 6680 O  O   . HOH I 3 .   ? 29.014  15.159  24.089  1.00 35.08 ? 545 HOH A O   1 
HETATM 6681 O  O   . HOH I 3 .   ? 45.680  24.987  -3.840  1.00 39.10 ? 546 HOH A O   1 
HETATM 6682 O  O   . HOH I 3 .   ? 46.593  1.803   19.547  1.00 43.31 ? 547 HOH A O   1 
HETATM 6683 O  O   . HOH I 3 .   ? 35.917  15.087  -6.190  1.00 21.79 ? 548 HOH A O   1 
HETATM 6684 O  O   . HOH I 3 .   ? 45.645  -0.744  13.913  1.00 25.29 ? 549 HOH A O   1 
HETATM 6685 O  O   . HOH I 3 .   ? 43.280  -3.066  15.549  1.00 31.04 ? 550 HOH A O   1 
HETATM 6686 O  O   . HOH I 3 .   ? 38.849  2.870   -2.845  1.00 20.87 ? 551 HOH A O   1 
HETATM 6687 O  O   . HOH I 3 .   ? 30.223  -0.363  14.527  1.00 33.07 ? 552 HOH A O   1 
HETATM 6688 O  O   . HOH I 3 .   ? 46.675  16.332  4.086   1.00 25.96 ? 553 HOH A O   1 
HETATM 6689 O  O   . HOH I 3 .   ? 52.214  -2.508  12.642  1.00 39.15 ? 554 HOH A O   1 
HETATM 6690 O  O   . HOH I 3 .   ? 53.679  0.386   13.037  1.00 42.80 ? 555 HOH A O   1 
HETATM 6691 O  O   . HOH I 3 .   ? 40.722  21.487  13.443  1.00 30.86 ? 556 HOH A O   1 
HETATM 6692 O  O   . HOH I 3 .   ? 44.566  25.594  19.063  1.00 33.87 ? 557 HOH A O   1 
HETATM 6693 O  O   . HOH I 3 .   ? 51.650  24.143  19.143  1.00 50.50 ? 558 HOH A O   1 
HETATM 6694 O  O   . HOH I 3 .   ? 45.678  0.752   16.175  1.00 29.65 ? 559 HOH A O   1 
HETATM 6695 O  O   . HOH I 3 .   ? 32.335  6.408   13.926  1.00 36.24 ? 560 HOH A O   1 
HETATM 6696 O  O   . HOH I 3 .   ? 41.429  -1.866  8.354   1.00 36.45 ? 561 HOH A O   1 
HETATM 6697 O  O   . HOH I 3 .   ? 52.691  21.788  4.263   1.00 38.72 ? 562 HOH A O   1 
HETATM 6698 O  O   . HOH I 3 .   ? 50.684  17.144  5.768   1.00 43.42 ? 563 HOH A O   1 
HETATM 6699 O  O   . HOH I 3 .   ? 45.142  3.076   5.565   1.00 46.54 ? 564 HOH A O   1 
HETATM 6700 O  O   . HOH I 3 .   ? 32.177  27.127  3.614   1.00 41.97 ? 565 HOH A O   1 
HETATM 6701 O  O   . HOH I 3 .   ? 40.709  1.056   23.554  1.00 36.52 ? 566 HOH A O   1 
HETATM 6702 O  O   . HOH I 3 .   ? 37.497  36.181  4.428   1.00 46.49 ? 567 HOH A O   1 
HETATM 6703 O  O   . HOH I 3 .   ? 45.739  10.848  11.304  1.00 38.60 ? 568 HOH A O   1 
HETATM 6704 O  O   . HOH I 3 .   ? 54.786  2.117   14.832  1.00 43.20 ? 569 HOH A O   1 
HETATM 6705 O  O   . HOH I 3 .   ? 52.584  2.005   28.755  1.00 49.96 ? 570 HOH A O   1 
HETATM 6706 O  O   . HOH I 3 .   ? 54.971  2.306   27.334  1.00 48.28 ? 571 HOH A O   1 
HETATM 6707 O  O   . HOH I 3 .   ? 51.970  17.449  24.883  1.00 29.07 ? 572 HOH A O   1 
HETATM 6708 O  O   . HOH I 3 .   ? 31.887  23.920  3.576   1.00 43.85 ? 573 HOH A O   1 
HETATM 6709 O  O   . HOH I 3 .   ? 58.479  3.666   14.293  1.00 38.91 ? 574 HOH A O   1 
HETATM 6710 O  O   . HOH I 3 .   ? 39.092  25.304  -8.841  1.00 31.55 ? 575 HOH A O   1 
HETATM 6711 O  O   . HOH I 3 .   ? 43.827  9.147   11.721  1.00 37.12 ? 576 HOH A O   1 
HETATM 6712 O  O   . HOH I 3 .   ? 46.093  22.790  22.126  1.00 37.43 ? 577 HOH A O   1 
HETATM 6713 O  O   . HOH I 3 .   ? 57.999  20.463  12.943  1.00 49.64 ? 578 HOH A O   1 
HETATM 6714 O  O   . HOH I 3 .   ? 49.627  -0.762  19.457  1.00 42.38 ? 579 HOH A O   1 
HETATM 6715 O  O   . HOH I 3 .   ? 30.063  22.006  5.391   1.00 43.38 ? 580 HOH A O   1 
HETATM 6716 O  O   . HOH I 3 .   ? 47.135  -1.145  17.843  1.00 46.57 ? 581 HOH A O   1 
HETATM 6717 O  O   . HOH I 3 .   ? 49.767  32.362  5.710   1.00 55.09 ? 582 HOH A O   1 
HETATM 6718 O  O   . HOH I 3 .   ? 39.416  33.547  8.809   1.00 55.13 ? 583 HOH A O   1 
HETATM 6719 O  O   . HOH I 3 .   ? 41.468  24.271  -7.013  1.00 49.90 ? 584 HOH A O   1 
HETATM 6720 O  O   . HOH I 3 .   ? 33.008  0.000   0.000   0.50 16.01 ? 585 HOH A O   1 
HETATM 6721 O  O   . HOH I 3 .   ? 33.323  28.943  5.376   1.00 40.39 ? 586 HOH A O   1 
HETATM 6722 O  O   . HOH I 3 .   ? 46.234  5.333   29.341  1.00 49.91 ? 587 HOH A O   1 
HETATM 6723 O  O   . HOH I 3 .   ? 46.034  16.863  27.081  1.00 50.46 ? 588 HOH A O   1 
HETATM 6724 O  O   . HOH I 3 .   ? 61.082  18.449  14.540  1.00 35.79 ? 589 HOH A O   1 
HETATM 6725 O  O   . HOH I 3 .   ? 52.585  26.506  18.539  1.00 49.50 ? 590 HOH A O   1 
HETATM 6726 O  O   . HOH I 3 .   ? 34.459  -5.212  2.676   1.00 44.33 ? 591 HOH A O   1 
HETATM 6727 O  O   . HOH I 3 .   ? 31.615  -1.230  2.004   1.00 41.38 ? 592 HOH A O   1 
HETATM 6728 O  O   . HOH I 3 .   ? 35.117  31.669  -14.084 1.00 44.98 ? 593 HOH A O   1 
HETATM 6729 O  O   . HOH I 3 .   ? 27.583  0.124   14.093  1.00 47.62 ? 594 HOH A O   1 
HETATM 6730 O  O   . HOH I 3 .   ? 49.556  1.902   6.069   1.00 49.45 ? 595 HOH A O   1 
HETATM 6731 O  O   . HOH I 3 .   ? 25.645  2.389   14.728  1.00 43.86 ? 596 HOH A O   1 
HETATM 6732 O  O   . HOH I 3 .   ? 28.429  20.385  16.529  1.00 17.67 ? 597 HOH A O   1 
HETATM 6733 O  O   . HOH I 3 .   ? 33.918  28.602  16.073  1.00 30.84 ? 598 HOH A O   1 
HETATM 6734 O  O   . HOH I 3 .   ? 21.073  15.415  20.691  1.00 26.79 ? 599 HOH A O   1 
HETATM 6735 O  O   . HOH I 3 .   ? 35.522  17.270  10.700  1.00 12.43 ? 600 HOH A O   1 
HETATM 6736 O  O   . HOH J 3 .   ? 35.512  26.994  18.209  1.00 28.55 ? 503 HOH B O   1 
HETATM 6737 O  O   . HOH J 3 .   ? 29.653  11.536  9.024   1.00 28.03 ? 504 HOH B O   1 
HETATM 6738 O  O   . HOH J 3 .   ? 22.802  12.427  3.480   1.00 47.97 ? 505 HOH B O   1 
HETATM 6739 O  O   . HOH J 3 .   ? 32.768  24.823  16.666  1.00 17.01 ? 506 HOH B O   1 
HETATM 6740 O  O   . HOH J 3 .   ? 9.427   15.183  19.077  1.00 25.39 ? 507 HOH B O   1 
HETATM 6741 O  O   . HOH J 3 .   ? 20.439  14.318  16.463  1.00 19.89 ? 508 HOH B O   1 
HETATM 6742 O  O   . HOH J 3 .   ? 18.017  14.502  14.463  1.00 20.14 ? 509 HOH B O   1 
HETATM 6743 O  O   . HOH J 3 .   ? 31.426  28.138  14.851  1.00 29.65 ? 510 HOH B O   1 
HETATM 6744 O  O   . HOH J 3 .   ? 30.631  29.108  23.921  1.00 21.24 ? 511 HOH B O   1 
HETATM 6745 O  O   . HOH J 3 .   ? 32.820  30.322  21.446  1.00 28.21 ? 512 HOH B O   1 
HETATM 6746 O  O   . HOH J 3 .   ? 20.647  33.284  25.171  1.00 28.04 ? 513 HOH B O   1 
HETATM 6747 O  O   . HOH J 3 .   ? 16.127  27.297  32.760  1.00 39.65 ? 514 HOH B O   1 
HETATM 6748 O  O   . HOH J 3 .   ? 9.993   30.623  19.611  1.00 24.33 ? 515 HOH B O   1 
HETATM 6749 O  O   . HOH J 3 .   ? 11.578  31.810  21.647  1.00 29.04 ? 516 HOH B O   1 
HETATM 6750 O  O   . HOH J 3 .   ? 11.281  32.021  26.580  1.00 34.21 ? 517 HOH B O   1 
HETATM 6751 O  O   . HOH J 3 .   ? 11.832  30.667  24.103  1.00 27.62 ? 518 HOH B O   1 
HETATM 6752 O  O   . HOH J 3 .   ? 26.059  32.615  10.121  1.00 32.62 ? 519 HOH B O   1 
HETATM 6753 O  O   . HOH J 3 .   ? 29.865  23.347  9.603   1.00 16.97 ? 520 HOH B O   1 
HETATM 6754 O  O   . HOH J 3 .   ? 27.452  22.191  13.518  1.00 24.60 ? 521 HOH B O   1 
HETATM 6755 O  O   . HOH J 3 .   ? 30.218  33.791  19.006  1.00 24.00 ? 522 HOH B O   1 
HETATM 6756 O  O   . HOH J 3 .   ? 18.273  28.085  35.659  1.00 36.02 ? 523 HOH B O   1 
HETATM 6757 O  O   . HOH J 3 .   ? 15.587  26.050  35.459  1.00 44.52 ? 524 HOH B O   1 
HETATM 6758 O  O   . HOH J 3 .   ? 21.253  18.673  37.763  1.00 24.84 ? 525 HOH B O   1 
HETATM 6759 O  O   . HOH J 3 .   ? 18.375  15.687  36.484  1.00 33.79 ? 526 HOH B O   1 
HETATM 6760 O  O   . HOH J 3 .   ? 13.487  27.300  31.400  1.00 36.45 ? 527 HOH B O   1 
HETATM 6761 O  O   . HOH J 3 .   ? 13.420  25.647  29.360  1.00 22.53 ? 528 HOH B O   1 
HETATM 6762 O  O   . HOH J 3 .   ? 10.985  24.257  29.616  1.00 29.19 ? 529 HOH B O   1 
HETATM 6763 O  O   . HOH J 3 .   ? 11.047  16.872  30.573  1.00 33.80 ? 530 HOH B O   1 
HETATM 6764 O  O   . HOH J 3 .   ? 11.345  9.525   15.276  1.00 42.22 ? 531 HOH B O   1 
HETATM 6765 O  O   . HOH J 3 .   ? 13.391  8.936   17.130  1.00 27.18 ? 532 HOH B O   1 
HETATM 6766 O  O   . HOH J 3 .   ? 16.145  9.474   15.680  1.00 34.58 ? 533 HOH B O   1 
HETATM 6767 O  O   . HOH J 3 .   ? 16.349  18.851  19.979  1.00 22.28 ? 534 HOH B O   1 
HETATM 6768 O  O   . HOH J 3 .   ? 16.798  19.714  17.245  1.00 31.20 ? 535 HOH B O   1 
HETATM 6769 O  O   . HOH J 3 .   ? 19.431  14.002  33.011  1.00 26.39 ? 536 HOH B O   1 
HETATM 6770 O  O   . HOH J 3 .   ? 29.168  38.878  29.206  1.00 38.22 ? 537 HOH B O   1 
HETATM 6771 O  O   . HOH J 3 .   ? 37.560  28.953  32.588  1.00 38.43 ? 538 HOH B O   1 
HETATM 6772 O  O   . HOH J 3 .   ? 28.530  24.879  7.437   1.00 43.54 ? 539 HOH B O   1 
HETATM 6773 O  O   . HOH J 3 .   ? 28.315  21.298  10.780  1.00 30.61 ? 540 HOH B O   1 
HETATM 6774 O  O   . HOH J 3 .   ? 30.803  41.312  25.457  1.00 34.23 ? 541 HOH B O   1 
HETATM 6775 O  O   . HOH J 3 .   ? 27.595  44.653  22.995  1.00 37.24 ? 542 HOH B O   1 
HETATM 6776 O  O   . HOH J 3 .   ? 26.538  18.722  9.404   1.00 22.02 ? 543 HOH B O   1 
HETATM 6777 O  O   . HOH J 3 .   ? 18.464  30.874  36.126  1.00 42.83 ? 544 HOH B O   1 
HETATM 6778 O  O   . HOH J 3 .   ? 32.703  23.013  35.722  1.00 30.62 ? 545 HOH B O   1 
HETATM 6779 O  O   . HOH J 3 .   ? 30.865  30.562  10.490  1.00 25.00 ? 546 HOH B O   1 
HETATM 6780 O  O   . HOH J 3 .   ? 28.928  19.808  24.287  1.00 41.96 ? 547 HOH B O   1 
HETATM 6781 O  O   . HOH J 3 .   ? 18.588  33.481  26.798  1.00 38.29 ? 548 HOH B O   1 
HETATM 6782 O  O   . HOH J 3 .   ? 26.711  19.389  6.797   1.00 31.73 ? 549 HOH B O   1 
HETATM 6783 O  O   . HOH J 3 .   ? 23.756  32.454  38.235  1.00 52.43 ? 550 HOH B O   1 
HETATM 6784 O  O   . HOH J 3 .   ? 6.697   29.205  10.608  1.00 37.66 ? 551 HOH B O   1 
HETATM 6785 O  O   . HOH J 3 .   ? 18.642  19.784  38.019  1.00 24.60 ? 552 HOH B O   1 
HETATM 6786 O  O   . HOH J 3 .   ? 4.065   26.149  15.518  1.00 27.49 ? 553 HOH B O   1 
HETATM 6787 O  O   . HOH J 3 .   ? 3.168   23.544  13.195  1.00 29.60 ? 554 HOH B O   1 
HETATM 6788 O  O   . HOH J 3 .   ? 8.124   17.280  31.197  1.00 40.50 ? 555 HOH B O   1 
HETATM 6789 O  O   . HOH J 3 .   ? 10.875  12.666  12.965  1.00 38.54 ? 556 HOH B O   1 
HETATM 6790 O  O   . HOH J 3 .   ? -0.384  30.804  17.282  1.00 45.06 ? 557 HOH B O   1 
HETATM 6791 O  O   . HOH J 3 .   ? 1.586   33.612  17.555  1.00 42.70 ? 558 HOH B O   1 
HETATM 6792 O  O   . HOH J 3 .   ? 5.767   27.086  13.585  1.00 32.10 ? 559 HOH B O   1 
HETATM 6793 O  O   . HOH J 3 .   ? 15.777  16.748  15.171  1.00 34.07 ? 560 HOH B O   1 
HETATM 6794 O  O   . HOH J 3 .   ? 3.796   20.676  19.984  1.00 38.12 ? 561 HOH B O   1 
HETATM 6795 O  O   . HOH J 3 .   ? 19.604  39.043  30.308  1.00 44.60 ? 562 HOH B O   1 
HETATM 6796 O  O   . HOH J 3 .   ? 34.149  29.358  23.529  1.00 46.54 ? 563 HOH B O   1 
HETATM 6797 O  O   . HOH J 3 .   ? 6.301   25.400  24.316  1.00 51.37 ? 564 HOH B O   1 
HETATM 6798 O  O   . HOH J 3 .   ? 9.283   24.782  6.173   1.00 44.66 ? 565 HOH B O   1 
HETATM 6799 O  O   . HOH J 3 .   ? 3.024   35.656  16.574  1.00 35.97 ? 566 HOH B O   1 
HETATM 6800 O  O   . HOH J 3 .   ? 6.041   36.935  2.946   1.00 53.84 ? 567 HOH B O   1 
HETATM 6801 O  O   . HOH J 3 .   ? 4.833   38.871  4.367   1.00 51.45 ? 568 HOH B O   1 
HETATM 6802 O  O   . HOH J 3 .   ? 2.836   39.665  18.182  1.00 36.17 ? 569 HOH B O   1 
HETATM 6803 O  O   . HOH J 3 .   ? 23.542  20.035  38.500  1.00 21.88 ? 570 HOH B O   1 
HETATM 6804 O  O   . HOH J 3 .   ? 25.980  37.391  13.264  1.00 44.76 ? 571 HOH B O   1 
HETATM 6805 O  O   . HOH J 3 .   ? 2.812   31.101  10.556  1.00 37.99 ? 572 HOH B O   1 
HETATM 6806 O  O   . HOH J 3 .   ? 3.718   28.603  11.985  1.00 45.69 ? 573 HOH B O   1 
HETATM 6807 O  O   . HOH J 3 .   ? 3.043   16.737  24.975  1.00 33.56 ? 574 HOH B O   1 
HETATM 6808 O  O   . HOH J 3 .   ? 24.872  24.099  6.133   1.00 47.78 ? 575 HOH B O   1 
HETATM 6809 O  O   . HOH J 3 .   ? 14.830  18.362  35.513  1.00 43.54 ? 576 HOH B O   1 
HETATM 6810 O  O   . HOH J 3 .   ? 23.336  42.217  24.114  1.00 37.77 ? 577 HOH B O   1 
HETATM 6811 O  O   . HOH J 3 .   ? 2.006   35.222  22.867  1.00 42.43 ? 578 HOH B O   1 
HETATM 6812 O  O   . HOH J 3 .   ? 33.365  26.636  42.117  1.00 66.32 ? 579 HOH B O   1 
HETATM 6813 O  O   . HOH J 3 .   ? 36.330  27.071  24.784  1.00 40.89 ? 580 HOH B O   1 
HETATM 6814 O  O   . HOH J 3 .   ? 31.105  42.338  15.706  1.00 85.48 ? 581 HOH B O   1 
HETATM 6815 O  O   . HOH J 3 .   ? 23.112  14.411  1.294   1.00 61.16 ? 582 HOH B O   1 
HETATM 6816 O  O   . HOH J 3 .   ? 17.077  27.450  37.917  1.00 48.12 ? 583 HOH B O   1 
HETATM 6817 O  O   . HOH J 3 .   ? 30.014  28.387  5.927   1.00 40.81 ? 584 HOH B O   1 
HETATM 6818 O  O   . HOH J 3 .   ? 26.542  22.246  7.375   1.00 38.72 ? 585 HOH B O   1 
HETATM 6819 O  O   . HOH J 3 .   ? 16.779  32.054  34.614  1.00 47.70 ? 586 HOH B O   1 
HETATM 6820 O  O   . HOH J 3 .   ? 3.250   15.046  17.584  1.00 56.42 ? 587 HOH B O   1 
HETATM 6821 O  O   . HOH J 3 .   ? 19.916  7.521   12.858  1.00 49.56 ? 588 HOH B O   1 
HETATM 6822 O  O   . HOH J 3 .   ? -0.113  41.265  18.858  1.00 58.22 ? 589 HOH B O   1 
HETATM 6823 O  O   . HOH J 3 .   ? 28.995  32.898  10.063  1.00 38.10 ? 590 HOH B O   1 
HETATM 6824 O  O   . HOH J 3 .   ? 24.018  23.253  21.164  1.00 14.59 ? 591 HOH B O   1 
HETATM 6825 O  O   . HOH K 3 .   ? 101.004 18.648  36.550  1.00 27.12 ? 504 HOH C O   1 
HETATM 6826 O  O   . HOH K 3 .   ? 92.749  25.009  32.723  1.00 21.01 ? 505 HOH C O   1 
HETATM 6827 O  O   . HOH K 3 .   ? 95.132  23.990  31.074  1.00 20.60 ? 506 HOH C O   1 
HETATM 6828 O  O   . HOH K 3 .   ? 77.478  18.892  26.224  1.00 28.52 ? 507 HOH C O   1 
HETATM 6829 O  O   . HOH K 3 .   ? 75.493  16.154  34.617  1.00 19.49 ? 508 HOH C O   1 
HETATM 6830 O  O   . HOH K 3 .   ? 73.604  16.496  31.607  1.00 37.27 ? 509 HOH C O   1 
HETATM 6831 O  O   . HOH K 3 .   ? 81.690  7.708   36.479  1.00 31.45 ? 510 HOH C O   1 
HETATM 6832 O  O   . HOH K 3 .   ? 86.757  9.485   45.883  1.00 37.67 ? 511 HOH C O   1 
HETATM 6833 O  O   . HOH K 3 .   ? 93.607  5.280   33.197  1.00 27.26 ? 512 HOH C O   1 
HETATM 6834 O  O   . HOH K 3 .   ? 91.253  4.898   34.490  1.00 31.91 ? 513 HOH C O   1 
HETATM 6835 O  O   . HOH K 3 .   ? 90.154  3.817   39.198  1.00 43.61 ? 514 HOH C O   1 
HETATM 6836 O  O   . HOH K 3 .   ? 90.803  5.671   37.340  1.00 29.36 ? 515 HOH C O   1 
HETATM 6837 O  O   . HOH K 3 .   ? 81.315  12.916  21.277  1.00 32.68 ? 516 HOH C O   1 
HETATM 6838 O  O   . HOH K 3 .   ? 82.355  22.871  22.494  1.00 23.48 ? 517 HOH C O   1 
HETATM 6839 O  O   . HOH K 3 .   ? 83.839  22.141  26.862  1.00 27.20 ? 518 HOH C O   1 
HETATM 6840 O  O   . HOH K 3 .   ? 74.984  12.813  28.973  1.00 26.26 ? 519 HOH C O   1 
HETATM 6841 O  O   . HOH K 3 .   ? 83.954  9.854   48.725  1.00 35.36 ? 520 HOH C O   1 
HETATM 6842 O  O   . HOH K 3 .   ? 86.881  10.347  48.632  1.00 48.34 ? 521 HOH C O   1 
HETATM 6843 O  O   . HOH K 3 .   ? 84.671  17.793  53.262  1.00 41.31 ? 522 HOH C O   1 
HETATM 6844 O  O   . HOH K 3 .   ? 88.590  18.966  51.647  1.00 29.12 ? 523 HOH C O   1 
HETATM 6845 O  O   . HOH K 3 .   ? 89.091  8.195   44.949  1.00 36.09 ? 524 HOH C O   1 
HETATM 6846 O  O   . HOH K 3 .   ? 90.462  9.868   43.302  1.00 22.41 ? 525 HOH C O   1 
HETATM 6847 O  O   . HOH K 3 .   ? 93.135  9.688   44.331  1.00 44.10 ? 526 HOH C O   1 
HETATM 6848 O  O   . HOH K 3 .   ? 96.117  15.750  47.375  1.00 42.13 ? 527 HOH C O   1 
HETATM 6849 O  O   . HOH K 3 .   ? 102.708 24.886  34.403  1.00 49.37 ? 528 HOH C O   1 
HETATM 6850 O  O   . HOH K 3 .   ? 100.972 25.986  36.045  1.00 30.67 ? 529 HOH C O   1 
HETATM 6851 O  O   . HOH K 3 .   ? 98.985  27.122  33.798  1.00 37.90 ? 530 HOH C O   1 
HETATM 6852 O  O   . HOH K 3 .   ? 93.365  18.564  35.587  1.00 25.68 ? 531 HOH C O   1 
HETATM 6853 O  O   . HOH K 3 .   ? 93.394  18.738  32.890  1.00 31.48 ? 532 HOH C O   1 
HETATM 6854 O  O   . HOH K 3 .   ? 89.381  22.119  48.806  1.00 37.25 ? 533 HOH C O   1 
HETATM 6855 O  O   . HOH K 3 .   ? 71.075  6.059   37.703  1.00 36.25 ? 534 HOH C O   1 
HETATM 6856 O  O   . HOH K 3 .   ? 67.472  18.448  42.234  1.00 49.75 ? 535 HOH C O   1 
HETATM 6857 O  O   . HOH K 3 .   ? 83.575  21.548  20.369  1.00 45.55 ? 536 HOH C O   1 
HETATM 6858 O  O   . HOH K 3 .   ? 84.159  23.708  24.493  1.00 30.17 ? 537 HOH C O   1 
HETATM 6859 O  O   . HOH K 3 .   ? 69.523  5.548   32.813  1.00 41.12 ? 538 HOH C O   1 
HETATM 6860 O  O   . HOH K 3 .   ? 71.275  1.597   30.101  1.00 48.08 ? 539 HOH C O   1 
HETATM 6861 O  O   . HOH K 3 .   ? 87.248  25.074  24.010  1.00 21.61 ? 540 HOH C O   1 
HETATM 6862 O  O   . HOH K 3 .   ? 82.222  7.035   47.468  1.00 41.86 ? 541 HOH C O   1 
HETATM 6863 O  O   . HOH K 3 .   ? 73.442  21.081  47.266  1.00 33.68 ? 542 HOH C O   1 
HETATM 6864 O  O   . HOH K 3 .   ? 78.062  16.824  21.357  1.00 35.51 ? 543 HOH C O   1 
HETATM 6865 O  O   . HOH K 3 .   ? 80.583  23.195  37.859  1.00 46.24 ? 544 HOH C O   1 
HETATM 6866 O  O   . HOH K 3 .   ? 83.078  6.161   38.202  1.00 45.46 ? 545 HOH C O   1 
HETATM 6867 O  O   . HOH K 3 .   ? 87.433  25.105  21.337  1.00 33.91 ? 546 HOH C O   1 
HETATM 6868 O  O   . HOH K 3 .   ? 76.240  7.824   48.686  1.00 39.87 ? 547 HOH C O   1 
HETATM 6869 O  O   . HOH K 3 .   ? 99.262  6.483   25.604  1.00 42.88 ? 548 HOH C O   1 
HETATM 6870 O  O   . HOH K 3 .   ? 101.674 6.853   31.199  1.00 36.55 ? 549 HOH C O   1 
HETATM 6871 O  O   . HOH K 3 .   ? 104.370 9.092   30.025  1.00 41.28 ? 550 HOH C O   1 
HETATM 6872 O  O   . HOH K 3 .   ? 84.723  7.089   40.515  1.00 42.98 ? 551 HOH C O   1 
HETATM 6873 O  O   . HOH K 3 .   ? 103.195 0.306   32.485  1.00 47.21 ? 552 HOH C O   1 
HETATM 6874 O  O   . HOH K 3 .   ? 98.228  -1.864  30.295  1.00 45.43 ? 553 HOH C O   1 
HETATM 6875 O  O   . HOH K 3 .   ? 79.981  13.614  31.483  1.00 39.89 ? 554 HOH C O   1 
HETATM 6876 O  O   . HOH K 3 .   ? 75.748  10.586  25.784  1.00 43.00 ? 555 HOH C O   1 
HETATM 6877 O  O   . HOH K 3 .   ? 76.221  3.615   24.893  1.00 42.45 ? 556 HOH C O   1 
HETATM 6878 O  O   . HOH K 3 .   ? 100.225 7.107   28.834  1.00 39.01 ? 557 HOH C O   1 
HETATM 6879 O  O   . HOH K 3 .   ? 95.830  20.770  31.631  1.00 42.82 ? 558 HOH C O   1 
HETATM 6880 O  O   . HOH K 3 .   ? 103.210 10.805  36.841  1.00 48.25 ? 559 HOH C O   1 
HETATM 6881 O  O   . HOH K 3 .   ? 83.747  3.324   39.228  1.00 47.12 ? 560 HOH C O   1 
HETATM 6882 O  O   . HOH K 3 .   ? 72.476  17.532  33.894  1.00 47.52 ? 561 HOH C O   1 
HETATM 6883 O  O   . HOH K 3 .   ? 65.554  17.266  40.504  1.00 39.86 ? 562 HOH C O   1 
HETATM 6884 O  O   . HOH K 3 .   ? 90.306  7.729   33.612  1.00 40.93 ? 563 HOH C O   1 
HETATM 6885 O  O   . HOH K 3 .   ? 82.927  2.292   19.929  1.00 48.96 ? 564 HOH C O   1 
HETATM 6886 O  O   . HOH K 3 .   ? 91.904  10.046  49.605  1.00 41.61 ? 565 HOH C O   1 
HETATM 6887 O  O   . HOH K 3 .   ? 75.954  13.780  53.669  1.00 41.86 ? 566 HOH C O   1 
HETATM 6888 O  O   . HOH K 3 .   ? 92.274  9.011   32.825  1.00 60.89 ? 567 HOH C O   1 
HETATM 6889 O  O   . HOH K 3 .   ? 79.499  -4.102  31.104  1.00 48.25 ? 568 HOH C O   1 
HETATM 6890 O  O   . HOH K 3 .   ? 87.080  20.141  19.724  1.00 47.33 ? 569 HOH C O   1 
HETATM 6891 O  O   . HOH K 3 .   ? 75.763  1.456   32.429  1.00 35.20 ? 570 HOH C O   1 
HETATM 6892 O  O   . HOH K 3 .   ? 86.672  17.137  51.365  1.00 30.46 ? 571 HOH C O   1 
HETATM 6893 O  O   . HOH K 3 .   ? 90.895  7.727   47.108  1.00 57.64 ? 572 HOH C O   1 
HETATM 6894 O  O   . HOH K 3 .   ? 88.510  4.376   41.320  1.00 52.86 ? 573 HOH C O   1 
HETATM 6895 O  O   . HOH K 3 .   ? 75.996  18.728  22.661  1.00 53.54 ? 574 HOH C O   1 
HETATM 6896 O  O   . HOH K 3 .   ? 99.661  18.722  22.197  1.00 39.22 ? 575 HOH C O   1 
HETATM 6897 O  O   . HOH K 3 .   ? 103.676 20.681  26.500  1.00 37.97 ? 576 HOH C O   1 
HETATM 6898 O  O   . HOH K 3 .   ? 82.482  19.890  35.820  1.00 41.88 ? 577 HOH C O   1 
HETATM 6899 O  O   . HOH K 3 .   ? 83.659  -0.504  19.854  1.00 51.13 ? 578 HOH C O   1 
HETATM 6900 O  O   . HOH K 3 .   ? 68.820  2.871   31.018  1.00 57.54 ? 579 HOH C O   1 
HETATM 6901 O  O   . HOH K 3 .   ? 98.894  23.473  17.769  1.00 43.45 ? 580 HOH C O   1 
HETATM 6902 O  O   . HOH K 3 .   ? 82.199  25.945  28.754  1.00 16.75 ? 581 HOH C O   1 
HETATM 6903 O  O   . HOH K 3 .   ? 73.832  20.998  28.699  1.00 42.11 ? 582 HOH C O   1 
HETATM 6904 O  O   . HOH K 3 .   ? 87.855  33.087  24.913  1.00 31.41 ? 583 HOH C O   1 
HETATM 6905 O  O   . HOH K 3 .   ? 94.752  29.896  20.488  1.00 39.14 ? 584 HOH C O   1 
HETATM 6906 O  O   . HOH K 3 .   ? 77.308  21.970  28.448  1.00 15.80 ? 585 HOH C O   1 
HETATM 6907 O  O   . HOH K 3 .   ? 84.419  18.458  34.539  1.00 12.86 ? 586 HOH C O   1 
HETATM 6908 O  O   . HOH L 3 .   ? 90.309  38.144  38.920  1.00 48.62 ? 505 HOH D O   1 
HETATM 6909 O  O   . HOH L 3 .   ? 83.111  23.674  30.052  1.00 17.83 ? 506 HOH D O   1 
HETATM 6910 O  O   . HOH L 3 .   ? 74.841  19.459  26.743  1.00 34.30 ? 507 HOH D O   1 
HETATM 6911 O  O   . HOH L 3 .   ? 90.611  23.716  36.512  1.00 25.26 ? 508 HOH D O   1 
HETATM 6912 O  O   . HOH L 3 .   ? 90.317  30.428  42.319  1.00 38.09 ? 509 HOH D O   1 
HETATM 6913 O  O   . HOH L 3 .   ? 88.797  44.691  27.016  1.00 32.15 ? 510 HOH D O   1 
HETATM 6914 O  O   . HOH L 3 .   ? 88.743  33.578  29.328  1.00 23.18 ? 511 HOH D O   1 
HETATM 6915 O  O   . HOH L 3 .   ? 88.846  35.832  31.274  1.00 30.37 ? 512 HOH D O   1 
HETATM 6916 O  O   . HOH L 3 .   ? 74.159  23.616  30.096  1.00 25.27 ? 513 HOH D O   1 
HETATM 6917 O  O   . HOH L 3 .   ? 73.648  24.728  21.059  1.00 19.89 ? 514 HOH D O   1 
HETATM 6918 O  O   . HOH L 3 .   ? 72.124  22.421  23.506  1.00 30.42 ? 515 HOH D O   1 
HETATM 6919 O  O   . HOH L 3 .   ? 70.285  34.759  19.945  1.00 29.97 ? 516 HOH D O   1 
HETATM 6920 O  O   . HOH L 3 .   ? 76.925  39.255  12.630  1.00 43.52 ? 517 HOH D O   1 
HETATM 6921 O  O   . HOH L 3 .   ? 73.288  45.238  25.831  1.00 32.70 ? 518 HOH D O   1 
HETATM 6922 O  O   . HOH L 3 .   ? 72.260  43.904  23.778  1.00 33.55 ? 519 HOH D O   1 
HETATM 6923 O  O   . HOH L 3 .   ? 72.219  44.157  19.050  1.00 36.49 ? 520 HOH D O   1 
HETATM 6924 O  O   . HOH L 3 .   ? 73.446  43.458  21.342  1.00 34.62 ? 521 HOH D O   1 
HETATM 6925 O  O   . HOH L 3 .   ? 69.869  29.205  34.837  1.00 40.56 ? 522 HOH D O   1 
HETATM 6926 O  O   . HOH L 3 .   ? 78.820  24.516  35.641  1.00 21.77 ? 523 HOH D O   1 
HETATM 6927 O  O   . HOH L 3 .   ? 80.317  27.039  31.819  1.00 27.99 ? 524 HOH D O   1 
HETATM 6928 O  O   . HOH L 3 .   ? 68.766  25.376  25.763  1.00 26.02 ? 525 HOH D O   1 
HETATM 6929 O  O   . HOH L 3 .   ? 76.795  37.068  9.029   1.00 46.80 ? 526 HOH D O   1 
HETATM 6930 O  O   . HOH L 3 .   ? 78.851  39.761  9.957   1.00 40.70 ? 527 HOH D O   1 
HETATM 6931 O  O   . HOH L 3 .   ? 85.463  33.642  7.845   1.00 20.43 ? 528 HOH D O   1 
HETATM 6932 O  O   . HOH L 3 .   ? 88.382  36.229  9.458   1.00 33.70 ? 529 HOH D O   1 
HETATM 6933 O  O   . HOH L 3 .   ? 76.856  41.792  14.007  1.00 39.71 ? 530 HOH D O   1 
HETATM 6934 O  O   . HOH L 3 .   ? 78.623  41.650  16.115  1.00 25.17 ? 531 HOH D O   1 
HETATM 6935 O  O   . HOH L 3 .   ? 80.308  43.947  16.234  1.00 32.61 ? 532 HOH D O   1 
HETATM 6936 O  O   . HOH L 3 .   ? 87.380  43.512  15.439  1.00 42.57 ? 533 HOH D O   1 
HETATM 6937 O  O   . HOH L 3 .   ? 94.482  42.151  30.625  1.00 44.40 ? 534 HOH D O   1 
HETATM 6938 O  O   . HOH L 3 .   ? 94.748  40.123  28.838  1.00 43.86 ? 535 HOH D O   1 
HETATM 6939 O  O   . HOH L 3 .   ? 93.961  37.426  30.386  1.00 41.01 ? 536 HOH D O   1 
HETATM 6940 O  O   . HOH L 3 .   ? 84.761  37.944  25.813  1.00 22.97 ? 537 HOH D O   1 
HETATM 6941 O  O   . HOH L 3 .   ? 84.137  37.377  28.343  1.00 35.44 ? 538 HOH D O   1 
HETATM 6942 O  O   . HOH L 3 .   ? 89.836  34.977  12.919  1.00 28.41 ? 539 HOH D O   1 
HETATM 6943 O  O   . HOH L 3 .   ? 64.088  27.121  15.372  1.00 34.46 ? 540 HOH D O   1 
HETATM 6944 O  O   . HOH L 3 .   ? 73.528  17.984  12.012  1.00 38.12 ? 541 HOH D O   1 
HETATM 6945 O  O   . HOH L 3 .   ? 77.381  25.877  37.821  1.00 46.65 ? 542 HOH D O   1 
HETATM 6946 O  O   . HOH L 3 .   ? 81.037  26.084  34.458  1.00 24.46 ? 543 HOH D O   1 
HETATM 6947 O  O   . HOH L 3 .   ? 61.378  25.591  19.095  1.00 36.35 ? 544 HOH D O   1 
HETATM 6948 O  O   . HOH L 3 .   ? 58.446  28.893  21.343  1.00 42.61 ? 545 HOH D O   1 
HETATM 6949 O  O   . HOH L 3 .   ? 83.735  27.510  36.012  1.00 20.80 ? 546 HOH D O   1 
HETATM 6950 O  O   . HOH L 3 .   ? 73.516  37.077  9.358   1.00 40.88 ? 547 HOH D O   1 
HETATM 6951 O  O   . HOH L 3 .   ? 80.259  22.199  9.512   1.00 28.52 ? 548 HOH D O   1 
HETATM 6952 O  O   . HOH L 3 .   ? 71.493  24.349  34.585  1.00 38.43 ? 549 HOH D O   1 
HETATM 6953 O  O   . HOH L 3 .   ? 82.849  25.431  20.856  1.00 43.29 ? 550 HOH D O   1 
HETATM 6954 O  O   . HOH L 3 .   ? 70.448  37.090  17.988  1.00 42.38 ? 551 HOH D O   1 
HETATM 6955 O  O   . HOH L 3 .   ? 82.849  27.435  38.531  1.00 36.43 ? 552 HOH D O   1 
HETATM 6956 O  O   . HOH L 3 .   ? 71.372  31.947  7.053   1.00 35.17 ? 553 HOH D O   1 
HETATM 6957 O  O   . HOH L 3 .   ? 75.157  48.125  34.695  1.00 45.45 ? 554 HOH D O   1 
HETATM 6958 O  O   . HOH L 3 .   ? 84.440  36.231  7.647   1.00 18.94 ? 555 HOH D O   1 
HETATM 6959 O  O   . HOH L 3 .   ? 87.341  46.733  14.855  1.00 61.55 ? 556 HOH D O   1 
HETATM 6960 O  O   . HOH L 3 .   ? 91.227  42.472  33.053  1.00 42.11 ? 557 HOH D O   1 
HETATM 6961 O  O   . HOH L 3 .   ? 72.599  38.283  16.679  1.00 46.07 ? 558 HOH D O   1 
HETATM 6962 O  O   . HOH L 3 .   ? 72.845  29.346  24.880  1.00 40.32 ? 559 HOH D O   1 
HETATM 6963 O  O   . HOH L 3 .   ? 66.118  26.954  28.359  1.00 47.89 ? 560 HOH D O   1 
HETATM 6964 O  O   . HOH L 3 .   ? 60.927  30.824  28.399  1.00 43.66 ? 561 HOH D O   1 
HETATM 6965 O  O   . HOH L 3 .   ? 64.742  36.481  14.430  1.00 46.30 ? 562 HOH D O   1 
HETATM 6966 O  O   . HOH L 3 .   ? 68.278  39.064  17.280  1.00 49.57 ? 563 HOH D O   1 
HETATM 6967 O  O   . HOH L 3 .   ? 73.095  21.301  21.193  1.00 48.72 ? 564 HOH D O   1 
HETATM 6968 O  O   . HOH L 3 .   ? 80.287  21.623  15.322  1.00 40.05 ? 565 HOH D O   1 
HETATM 6969 O  O   . HOH L 3 .   ? 81.851  24.132  16.550  1.00 50.87 ? 566 HOH D O   1 
HETATM 6970 O  O   . HOH L 3 .   ? 81.888  43.877  10.960  1.00 51.81 ? 567 HOH D O   1 
HETATM 6971 O  O   . HOH L 3 .   ? 83.953  31.273  7.003   1.00 18.02 ? 568 HOH D O   1 
HETATM 6972 O  O   . HOH L 3 .   ? 83.790  24.747  18.547  1.00 37.03 ? 569 HOH D O   1 
HETATM 6973 O  O   . HOH L 3 .   ? 87.827  51.183  20.950  1.00 32.64 ? 570 HOH D O   1 
HETATM 6974 O  O   . HOH L 3 .   ? 86.093  40.131  10.162  1.00 41.82 ? 571 HOH D O   1 
HETATM 6975 O  O   . HOH L 3 .   ? 69.369  53.825  22.747  1.00 46.09 ? 572 HOH D O   1 
HETATM 6976 O  O   . HOH L 3 .   ? 77.395  21.401  3.025   1.00 47.47 ? 573 HOH D O   1 
HETATM 6977 O  O   . HOH L 3 .   ? 75.288  18.746  19.970  1.00 37.29 ? 574 HOH D O   1 
HETATM 6978 O  O   . HOH L 3 .   ? 84.128  41.805  9.060   1.00 40.80 ? 575 HOH D O   1 
HETATM 6979 O  O   . HOH L 3 .   ? 60.296  24.731  16.512  1.00 45.72 ? 576 HOH D O   1 
HETATM 6980 O  O   . HOH L 3 .   ? 79.847  30.740  24.243  1.00 16.94 ? 577 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  HIS 78  78  78  HIS HIS A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  HIS 81  81  81  HIS HIS A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  TRP 85  85  85  TRP TRP A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 TRP 128 128 128 TRP TRP A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 TRP 130 130 130 TRP TRP A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 MET 151 151 151 MET MET A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 TYR 174 174 174 TYR TYR A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 TRP 189 189 189 TRP TRP A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 ARG 200 200 200 ARG ARG A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
B 1 1   SER 1   1   1   SER SER B . n 
B 1 2   TYR 2   2   2   TYR TYR B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   SER 6   6   6   SER SER B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   TYR 9   9   9   TYR TYR B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  TYR 11  11  11  TYR TYR B . n 
B 1 12  ASP 12  12  12  ASP ASP B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  PRO 16  16  16  PRO PRO B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  PHE 18  18  18  PHE PHE B . n 
B 1 19  ASP 19  19  19  ASP ASP B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  THR 22  22  22  THR THR B . n 
B 1 23  MET 23  23  23  MET MET B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  THR 28  28  28  THR THR B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  HIS 30  30  30  HIS HIS B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  GLN 32  32  32  GLN GLN B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  TYR 34  34  34  TYR TYR B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  ASN 36  36  36  ASN ASN B . n 
B 1 37  ASN 37  37  37  ASN ASN B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  PRO 46  46  46  PRO PRO B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  PHE 48  48  48  PHE PHE B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  ILE 57  57  57  ILE ILE B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  GLN 62  62  62  GLN GLN B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  ALA 65  65  65  ALA ALA B . n 
B 1 66  ASP 66  66  66  ASP ASP B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  GLY 76  76  76  GLY GLY B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  HIS 78  78  78  HIS HIS B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  HIS 81  81  81  HIS HIS B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  TRP 85  85  85  TRP TRP B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  THR 92  92  92  THR THR B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  LEU 94  94  94  LEU LEU B . n 
B 1 95  GLN 95  95  95  GLN GLN B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 ILE 102 102 102 ILE ILE B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 ARG 104 104 104 ARG ARG B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 GLY 107 107 107 GLY GLY B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 ASN 111 111 111 ASN ASN B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 LYS 113 113 113 LYS LYS B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 GLU 117 117 117 GLU GLU B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 ALA 119 119 119 ALA ALA B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 PHE 124 124 124 PHE PHE B . n 
B 1 125 GLY 125 125 125 GLY GLY B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 TRP 128 128 128 TRP TRP B . n 
B 1 129 ALA 129 129 129 ALA ALA B . n 
B 1 130 TRP 130 130 130 TRP TRP B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 LYS 134 134 134 LYS LYS B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 LYS 137 137 137 LYS LYS B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 SER 142 142 142 SER SER B . n 
B 1 143 THR 143 143 143 THR THR B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 MET 151 151 151 MET MET B . n 
B 1 152 GLY 152 152 152 GLY GLY B . n 
B 1 153 GLU 153 153 153 GLU GLU B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 ILE 155 155 155 ILE ILE B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 SER 159 159 159 SER SER B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 PHE 161 161 161 PHE PHE B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 ILE 163 163 163 ILE ILE B . n 
B 1 164 MET 164 164 164 MET MET B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 TRP 169 169 169 TRP TRP B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 HIS 171 171 171 HIS HIS B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 TYR 174 174 174 TYR TYR B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 PHE 177 177 177 PHE PHE B . n 
B 1 178 GLN 178 178 178 GLN GLN B . n 
B 1 179 ASN 179 179 179 ASN ASN B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 PRO 182 182 182 PRO PRO B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 TYR 184 184 184 TYR TYR B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 GLU 187 187 187 GLU GLU B . n 
B 1 188 PHE 188 188 188 PHE PHE B . n 
B 1 189 TRP 189 189 189 TRP TRP B . n 
B 1 190 ASN 190 190 190 ASN ASN B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 VAL 192 192 192 VAL VAL B . n 
B 1 193 ASN 193 193 193 ASN ASN B . n 
B 1 194 TRP 194 194 194 TRP TRP B . n 
B 1 195 ASP 195 195 195 ASP ASP B . n 
B 1 196 GLU 196 196 196 GLU GLU B . n 
B 1 197 ALA 197 197 197 ALA ALA B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 ARG 200 200 200 ARG ARG B . n 
B 1 201 PHE 201 201 201 PHE PHE B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 LYS 205 205 205 LYS LYS B . n 
C 1 1   SER 1   1   1   SER SER C . n 
C 1 2   TYR 2   2   2   TYR TYR C . n 
C 1 3   THR 3   3   3   THR THR C . n 
C 1 4   LEU 4   4   4   LEU LEU C . n 
C 1 5   PRO 5   5   5   PRO PRO C . n 
C 1 6   SER 6   6   6   SER SER C . n 
C 1 7   LEU 7   7   7   LEU LEU C . n 
C 1 8   PRO 8   8   8   PRO PRO C . n 
C 1 9   TYR 9   9   9   TYR TYR C . n 
C 1 10  ALA 10  10  10  ALA ALA C . n 
C 1 11  TYR 11  11  11  TYR TYR C . n 
C 1 12  ASP 12  12  12  ASP ASP C . n 
C 1 13  ALA 13  13  13  ALA ALA C . n 
C 1 14  LEU 14  14  14  LEU LEU C . n 
C 1 15  GLU 15  15  15  GLU GLU C . n 
C 1 16  PRO 16  16  16  PRO PRO C . n 
C 1 17  HIS 17  17  17  HIS HIS C . n 
C 1 18  PHE 18  18  18  PHE PHE C . n 
C 1 19  ASP 19  19  19  ASP ASP C . n 
C 1 20  LYS 20  20  20  LYS LYS C . n 
C 1 21  GLN 21  21  21  GLN GLN C . n 
C 1 22  THR 22  22  22  THR THR C . n 
C 1 23  MET 23  23  23  MET MET C . n 
C 1 24  GLU 24  24  24  GLU GLU C . n 
C 1 25  ILE 25  25  25  ILE ILE C . n 
C 1 26  HIS 26  26  26  HIS HIS C . n 
C 1 27  HIS 27  27  27  HIS HIS C . n 
C 1 28  THR 28  28  28  THR THR C . n 
C 1 29  LYS 29  29  29  LYS LYS C . n 
C 1 30  HIS 30  30  30  HIS HIS C . n 
C 1 31  HIS 31  31  31  HIS HIS C . n 
C 1 32  GLN 32  32  32  GLN GLN C . n 
C 1 33  THR 33  33  33  THR THR C . n 
C 1 34  TYR 34  34  34  TYR TYR C . n 
C 1 35  VAL 35  35  35  VAL VAL C . n 
C 1 36  ASN 36  36  36  ASN ASN C . n 
C 1 37  ASN 37  37  37  ASN ASN C . n 
C 1 38  ALA 38  38  38  ALA ALA C . n 
C 1 39  ASN 39  39  39  ASN ASN C . n 
C 1 40  ALA 40  40  40  ALA ALA C . n 
C 1 41  ALA 41  41  41  ALA ALA C . n 
C 1 42  LEU 42  42  42  LEU LEU C . n 
C 1 43  GLU 43  43  43  GLU GLU C . n 
C 1 44  SER 44  44  44  SER SER C . n 
C 1 45  LEU 45  45  45  LEU LEU C . n 
C 1 46  PRO 46  46  46  PRO PRO C . n 
C 1 47  GLU 47  47  47  GLU GLU C . n 
C 1 48  PHE 48  48  48  PHE PHE C . n 
C 1 49  ALA 49  49  49  ALA ALA C . n 
C 1 50  ASN 50  50  50  ASN ASN C . n 
C 1 51  LEU 51  51  51  LEU LEU C . n 
C 1 52  PRO 52  52  52  PRO PRO C . n 
C 1 53  VAL 53  53  53  VAL VAL C . n 
C 1 54  GLU 54  54  54  GLU GLU C . n 
C 1 55  GLU 55  55  55  GLU GLU C . n 
C 1 56  LEU 56  56  56  LEU LEU C . n 
C 1 57  ILE 57  57  57  ILE ILE C . n 
C 1 58  THR 58  58  58  THR THR C . n 
C 1 59  LYS 59  59  59  LYS LYS C . n 
C 1 60  LEU 60  60  60  LEU LEU C . n 
C 1 61  ASP 61  61  61  ASP ASP C . n 
C 1 62  GLN 62  62  62  GLN GLN C . n 
C 1 63  LEU 63  63  63  LEU LEU C . n 
C 1 64  PRO 64  64  64  PRO PRO C . n 
C 1 65  ALA 65  65  65  ALA ALA C . n 
C 1 66  ASP 66  66  66  ASP ASP C . n 
C 1 67  LYS 67  67  67  LYS LYS C . n 
C 1 68  LYS 68  68  68  LYS LYS C . n 
C 1 69  THR 69  69  69  THR THR C . n 
C 1 70  VAL 70  70  70  VAL VAL C . n 
C 1 71  LEU 71  71  71  LEU LEU C . n 
C 1 72  ARG 72  72  72  ARG ARG C . n 
C 1 73  ASN 73  73  73  ASN ASN C . n 
C 1 74  ASN 74  74  74  ASN ASN C . n 
C 1 75  ALA 75  75  75  ALA ALA C . n 
C 1 76  GLY 76  76  76  GLY GLY C . n 
C 1 77  GLY 77  77  77  GLY GLY C . n 
C 1 78  HIS 78  78  78  HIS HIS C . n 
C 1 79  ALA 79  79  79  ALA ALA C . n 
C 1 80  ASN 80  80  80  ASN ASN C . n 
C 1 81  HIS 81  81  81  HIS HIS C . n 
C 1 82  SER 82  82  82  SER SER C . n 
C 1 83  LEU 83  83  83  LEU LEU C . n 
C 1 84  PHE 84  84  84  PHE PHE C . n 
C 1 85  TRP 85  85  85  TRP TRP C . n 
C 1 86  LYS 86  86  86  LYS LYS C . n 
C 1 87  GLY 87  87  87  GLY GLY C . n 
C 1 88  LEU 88  88  88  LEU LEU C . n 
C 1 89  LYS 89  89  89  LYS LYS C . n 
C 1 90  LYS 90  90  90  LYS LYS C . n 
C 1 91  GLY 91  91  91  GLY GLY C . n 
C 1 92  THR 92  92  92  THR THR C . n 
C 1 93  THR 93  93  93  THR THR C . n 
C 1 94  LEU 94  94  94  LEU LEU C . n 
C 1 95  GLN 95  95  95  GLN GLN C . n 
C 1 96  GLY 96  96  96  GLY GLY C . n 
C 1 97  ASP 97  97  97  ASP ASP C . n 
C 1 98  LEU 98  98  98  LEU LEU C . n 
C 1 99  LYS 99  99  99  LYS LYS C . n 
C 1 100 ALA 100 100 100 ALA ALA C . n 
C 1 101 ALA 101 101 101 ALA ALA C . n 
C 1 102 ILE 102 102 102 ILE ILE C . n 
C 1 103 GLU 103 103 103 GLU GLU C . n 
C 1 104 ARG 104 104 104 ARG ARG C . n 
C 1 105 ASP 105 105 105 ASP ASP C . n 
C 1 106 PHE 106 106 106 PHE PHE C . n 
C 1 107 GLY 107 107 107 GLY GLY C . n 
C 1 108 SER 108 108 108 SER SER C . n 
C 1 109 VAL 109 109 109 VAL VAL C . n 
C 1 110 ASP 110 110 110 ASP ASP C . n 
C 1 111 ASN 111 111 111 ASN ASN C . n 
C 1 112 PHE 112 112 112 PHE PHE C . n 
C 1 113 LYS 113 113 113 LYS LYS C . n 
C 1 114 ALA 114 114 114 ALA ALA C . n 
C 1 115 GLU 115 115 115 GLU GLU C . n 
C 1 116 PHE 116 116 116 PHE PHE C . n 
C 1 117 GLU 117 117 117 GLU GLU C . n 
C 1 118 LYS 118 118 118 LYS LYS C . n 
C 1 119 ALA 119 119 119 ALA ALA C . n 
C 1 120 ALA 120 120 120 ALA ALA C . n 
C 1 121 ALA 121 121 121 ALA ALA C . n 
C 1 122 SER 122 122 122 SER SER C . n 
C 1 123 ARG 123 123 123 ARG ARG C . n 
C 1 124 PHE 124 124 124 PHE PHE C . n 
C 1 125 GLY 125 125 125 GLY GLY C . n 
C 1 126 SER 126 126 126 SER SER C . n 
C 1 127 GLY 127 127 127 GLY GLY C . n 
C 1 128 TRP 128 128 128 TRP TRP C . n 
C 1 129 ALA 129 129 129 ALA ALA C . n 
C 1 130 TRP 130 130 130 TRP TRP C . n 
C 1 131 LEU 131 131 131 LEU LEU C . n 
C 1 132 VAL 132 132 132 VAL VAL C . n 
C 1 133 LEU 133 133 133 LEU LEU C . n 
C 1 134 LYS 134 134 134 LYS LYS C . n 
C 1 135 GLY 135 135 135 GLY GLY C . n 
C 1 136 ASP 136 136 136 ASP ASP C . n 
C 1 137 LYS 137 137 137 LYS LYS C . n 
C 1 138 LEU 138 138 138 LEU LEU C . n 
C 1 139 ALA 139 139 139 ALA ALA C . n 
C 1 140 VAL 140 140 140 VAL VAL C . n 
C 1 141 VAL 141 141 141 VAL VAL C . n 
C 1 142 SER 142 142 142 SER SER C . n 
C 1 143 THR 143 143 143 THR THR C . n 
C 1 144 ALA 144 144 144 ALA ALA C . n 
C 1 145 ASN 145 145 145 ASN ASN C . n 
C 1 146 LEU 146 146 146 LEU LEU C . n 
C 1 147 ASP 147 147 147 ASP ASP C . n 
C 1 148 SER 148 148 148 SER SER C . n 
C 1 149 PRO 149 149 149 PRO PRO C . n 
C 1 150 LEU 150 150 150 LEU LEU C . n 
C 1 151 MET 151 151 151 MET MET C . n 
C 1 152 GLY 152 152 152 GLY GLY C . n 
C 1 153 GLU 153 153 153 GLU GLU C . n 
C 1 154 ALA 154 154 154 ALA ALA C . n 
C 1 155 ILE 155 155 155 ILE ILE C . n 
C 1 156 SER 156 156 156 SER SER C . n 
C 1 157 GLY 157 157 157 GLY GLY C . n 
C 1 158 ALA 158 158 158 ALA ALA C . n 
C 1 159 SER 159 159 159 SER SER C . n 
C 1 160 GLY 160 160 160 GLY GLY C . n 
C 1 161 PHE 161 161 161 PHE PHE C . n 
C 1 162 PRO 162 162 162 PRO PRO C . n 
C 1 163 ILE 163 163 163 ILE ILE C . n 
C 1 164 MET 164 164 164 MET MET C . n 
C 1 165 GLY 165 165 165 GLY GLY C . n 
C 1 166 LEU 166 166 166 LEU LEU C . n 
C 1 167 ASP 167 167 167 ASP ASP C . n 
C 1 168 VAL 168 168 168 VAL VAL C . n 
C 1 169 TRP 169 169 169 TRP TRP C . n 
C 1 170 GLU 170 170 170 GLU GLU C . n 
C 1 171 HIS 171 171 171 HIS HIS C . n 
C 1 172 ALA 172 172 172 ALA ALA C . n 
C 1 173 TYR 173 173 173 TYR TYR C . n 
C 1 174 TYR 174 174 174 TYR TYR C . n 
C 1 175 LEU 175 175 175 LEU LEU C . n 
C 1 176 LYS 176 176 176 LYS LYS C . n 
C 1 177 PHE 177 177 177 PHE PHE C . n 
C 1 178 GLN 178 178 178 GLN GLN C . n 
C 1 179 ASN 179 179 179 ASN ASN C . n 
C 1 180 ARG 180 180 180 ARG ARG C . n 
C 1 181 ARG 181 181 181 ARG ARG C . n 
C 1 182 PRO 182 182 182 PRO PRO C . n 
C 1 183 ASP 183 183 183 ASP ASP C . n 
C 1 184 TYR 184 184 184 TYR TYR C . n 
C 1 185 ILE 185 185 185 ILE ILE C . n 
C 1 186 LYS 186 186 186 LYS LYS C . n 
C 1 187 GLU 187 187 187 GLU GLU C . n 
C 1 188 PHE 188 188 188 PHE PHE C . n 
C 1 189 TRP 189 189 189 TRP TRP C . n 
C 1 190 ASN 190 190 190 ASN ASN C . n 
C 1 191 VAL 191 191 191 VAL VAL C . n 
C 1 192 VAL 192 192 192 VAL VAL C . n 
C 1 193 ASN 193 193 193 ASN ASN C . n 
C 1 194 TRP 194 194 194 TRP TRP C . n 
C 1 195 ASP 195 195 195 ASP ASP C . n 
C 1 196 GLU 196 196 196 GLU GLU C . n 
C 1 197 ALA 197 197 197 ALA ALA C . n 
C 1 198 ALA 198 198 198 ALA ALA C . n 
C 1 199 ALA 199 199 199 ALA ALA C . n 
C 1 200 ARG 200 200 200 ARG ARG C . n 
C 1 201 PHE 201 201 201 PHE PHE C . n 
C 1 202 ALA 202 202 202 ALA ALA C . n 
C 1 203 ALA 203 203 203 ALA ALA C . n 
C 1 204 LYS 204 204 204 LYS LYS C . n 
C 1 205 LYS 205 205 205 LYS LYS C . n 
D 1 1   SER 1   1   1   SER SER D . n 
D 1 2   TYR 2   2   2   TYR TYR D . n 
D 1 3   THR 3   3   3   THR THR D . n 
D 1 4   LEU 4   4   4   LEU LEU D . n 
D 1 5   PRO 5   5   5   PRO PRO D . n 
D 1 6   SER 6   6   6   SER SER D . n 
D 1 7   LEU 7   7   7   LEU LEU D . n 
D 1 8   PRO 8   8   8   PRO PRO D . n 
D 1 9   TYR 9   9   9   TYR TYR D . n 
D 1 10  ALA 10  10  10  ALA ALA D . n 
D 1 11  TYR 11  11  11  TYR TYR D . n 
D 1 12  ASP 12  12  12  ASP ASP D . n 
D 1 13  ALA 13  13  13  ALA ALA D . n 
D 1 14  LEU 14  14  14  LEU LEU D . n 
D 1 15  GLU 15  15  15  GLU GLU D . n 
D 1 16  PRO 16  16  16  PRO PRO D . n 
D 1 17  HIS 17  17  17  HIS HIS D . n 
D 1 18  PHE 18  18  18  PHE PHE D . n 
D 1 19  ASP 19  19  19  ASP ASP D . n 
D 1 20  LYS 20  20  20  LYS LYS D . n 
D 1 21  GLN 21  21  21  GLN GLN D . n 
D 1 22  THR 22  22  22  THR THR D . n 
D 1 23  MET 23  23  23  MET MET D . n 
D 1 24  GLU 24  24  24  GLU GLU D . n 
D 1 25  ILE 25  25  25  ILE ILE D . n 
D 1 26  HIS 26  26  26  HIS HIS D . n 
D 1 27  HIS 27  27  27  HIS HIS D . n 
D 1 28  THR 28  28  28  THR THR D . n 
D 1 29  LYS 29  29  29  LYS LYS D . n 
D 1 30  HIS 30  30  30  HIS HIS D . n 
D 1 31  HIS 31  31  31  HIS HIS D . n 
D 1 32  GLN 32  32  32  GLN GLN D . n 
D 1 33  THR 33  33  33  THR THR D . n 
D 1 34  TYR 34  34  34  TYR TYR D . n 
D 1 35  VAL 35  35  35  VAL VAL D . n 
D 1 36  ASN 36  36  36  ASN ASN D . n 
D 1 37  ASN 37  37  37  ASN ASN D . n 
D 1 38  ALA 38  38  38  ALA ALA D . n 
D 1 39  ASN 39  39  39  ASN ASN D . n 
D 1 40  ALA 40  40  40  ALA ALA D . n 
D 1 41  ALA 41  41  41  ALA ALA D . n 
D 1 42  LEU 42  42  42  LEU LEU D . n 
D 1 43  GLU 43  43  43  GLU GLU D . n 
D 1 44  SER 44  44  44  SER SER D . n 
D 1 45  LEU 45  45  45  LEU LEU D . n 
D 1 46  PRO 46  46  46  PRO PRO D . n 
D 1 47  GLU 47  47  47  GLU GLU D . n 
D 1 48  PHE 48  48  48  PHE PHE D . n 
D 1 49  ALA 49  49  49  ALA ALA D . n 
D 1 50  ASN 50  50  50  ASN ASN D . n 
D 1 51  LEU 51  51  51  LEU LEU D . n 
D 1 52  PRO 52  52  52  PRO PRO D . n 
D 1 53  VAL 53  53  53  VAL VAL D . n 
D 1 54  GLU 54  54  54  GLU GLU D . n 
D 1 55  GLU 55  55  55  GLU GLU D . n 
D 1 56  LEU 56  56  56  LEU LEU D . n 
D 1 57  ILE 57  57  57  ILE ILE D . n 
D 1 58  THR 58  58  58  THR THR D . n 
D 1 59  LYS 59  59  59  LYS LYS D . n 
D 1 60  LEU 60  60  60  LEU LEU D . n 
D 1 61  ASP 61  61  61  ASP ASP D . n 
D 1 62  GLN 62  62  62  GLN GLN D . n 
D 1 63  LEU 63  63  63  LEU LEU D . n 
D 1 64  PRO 64  64  64  PRO PRO D . n 
D 1 65  ALA 65  65  65  ALA ALA D . n 
D 1 66  ASP 66  66  66  ASP ASP D . n 
D 1 67  LYS 67  67  67  LYS LYS D . n 
D 1 68  LYS 68  68  68  LYS LYS D . n 
D 1 69  THR 69  69  69  THR THR D . n 
D 1 70  VAL 70  70  70  VAL VAL D . n 
D 1 71  LEU 71  71  71  LEU LEU D . n 
D 1 72  ARG 72  72  72  ARG ARG D . n 
D 1 73  ASN 73  73  73  ASN ASN D . n 
D 1 74  ASN 74  74  74  ASN ASN D . n 
D 1 75  ALA 75  75  75  ALA ALA D . n 
D 1 76  GLY 76  76  76  GLY GLY D . n 
D 1 77  GLY 77  77  77  GLY GLY D . n 
D 1 78  HIS 78  78  78  HIS HIS D . n 
D 1 79  ALA 79  79  79  ALA ALA D . n 
D 1 80  ASN 80  80  80  ASN ASN D . n 
D 1 81  HIS 81  81  81  HIS HIS D . n 
D 1 82  SER 82  82  82  SER SER D . n 
D 1 83  LEU 83  83  83  LEU LEU D . n 
D 1 84  PHE 84  84  84  PHE PHE D . n 
D 1 85  TRP 85  85  85  TRP TRP D . n 
D 1 86  LYS 86  86  86  LYS LYS D . n 
D 1 87  GLY 87  87  87  GLY GLY D . n 
D 1 88  LEU 88  88  88  LEU LEU D . n 
D 1 89  LYS 89  89  89  LYS LYS D . n 
D 1 90  LYS 90  90  90  LYS LYS D . n 
D 1 91  GLY 91  91  91  GLY GLY D . n 
D 1 92  THR 92  92  92  THR THR D . n 
D 1 93  THR 93  93  93  THR THR D . n 
D 1 94  LEU 94  94  94  LEU LEU D . n 
D 1 95  GLN 95  95  95  GLN GLN D . n 
D 1 96  GLY 96  96  96  GLY GLY D . n 
D 1 97  ASP 97  97  97  ASP ASP D . n 
D 1 98  LEU 98  98  98  LEU LEU D . n 
D 1 99  LYS 99  99  99  LYS LYS D . n 
D 1 100 ALA 100 100 100 ALA ALA D . n 
D 1 101 ALA 101 101 101 ALA ALA D . n 
D 1 102 ILE 102 102 102 ILE ILE D . n 
D 1 103 GLU 103 103 103 GLU GLU D . n 
D 1 104 ARG 104 104 104 ARG ARG D . n 
D 1 105 ASP 105 105 105 ASP ASP D . n 
D 1 106 PHE 106 106 106 PHE PHE D . n 
D 1 107 GLY 107 107 107 GLY GLY D . n 
D 1 108 SER 108 108 108 SER SER D . n 
D 1 109 VAL 109 109 109 VAL VAL D . n 
D 1 110 ASP 110 110 110 ASP ASP D . n 
D 1 111 ASN 111 111 111 ASN ASN D . n 
D 1 112 PHE 112 112 112 PHE PHE D . n 
D 1 113 LYS 113 113 113 LYS LYS D . n 
D 1 114 ALA 114 114 114 ALA ALA D . n 
D 1 115 GLU 115 115 115 GLU GLU D . n 
D 1 116 PHE 116 116 116 PHE PHE D . n 
D 1 117 GLU 117 117 117 GLU GLU D . n 
D 1 118 LYS 118 118 118 LYS LYS D . n 
D 1 119 ALA 119 119 119 ALA ALA D . n 
D 1 120 ALA 120 120 120 ALA ALA D . n 
D 1 121 ALA 121 121 121 ALA ALA D . n 
D 1 122 SER 122 122 122 SER SER D . n 
D 1 123 ARG 123 123 123 ARG ARG D . n 
D 1 124 PHE 124 124 124 PHE PHE D . n 
D 1 125 GLY 125 125 125 GLY GLY D . n 
D 1 126 SER 126 126 126 SER SER D . n 
D 1 127 GLY 127 127 127 GLY GLY D . n 
D 1 128 TRP 128 128 128 TRP TRP D . n 
D 1 129 ALA 129 129 129 ALA ALA D . n 
D 1 130 TRP 130 130 130 TRP TRP D . n 
D 1 131 LEU 131 131 131 LEU LEU D . n 
D 1 132 VAL 132 132 132 VAL VAL D . n 
D 1 133 LEU 133 133 133 LEU LEU D . n 
D 1 134 LYS 134 134 134 LYS LYS D . n 
D 1 135 GLY 135 135 135 GLY GLY D . n 
D 1 136 ASP 136 136 136 ASP ASP D . n 
D 1 137 LYS 137 137 137 LYS LYS D . n 
D 1 138 LEU 138 138 138 LEU LEU D . n 
D 1 139 ALA 139 139 139 ALA ALA D . n 
D 1 140 VAL 140 140 140 VAL VAL D . n 
D 1 141 VAL 141 141 141 VAL VAL D . n 
D 1 142 SER 142 142 142 SER SER D . n 
D 1 143 THR 143 143 143 THR THR D . n 
D 1 144 ALA 144 144 144 ALA ALA D . n 
D 1 145 ASN 145 145 145 ASN ASN D . n 
D 1 146 LEU 146 146 146 LEU LEU D . n 
D 1 147 ASP 147 147 147 ASP ASP D . n 
D 1 148 SER 148 148 148 SER SER D . n 
D 1 149 PRO 149 149 149 PRO PRO D . n 
D 1 150 LEU 150 150 150 LEU LEU D . n 
D 1 151 MET 151 151 151 MET MET D . n 
D 1 152 GLY 152 152 152 GLY GLY D . n 
D 1 153 GLU 153 153 153 GLU GLU D . n 
D 1 154 ALA 154 154 154 ALA ALA D . n 
D 1 155 ILE 155 155 155 ILE ILE D . n 
D 1 156 SER 156 156 156 SER SER D . n 
D 1 157 GLY 157 157 157 GLY GLY D . n 
D 1 158 ALA 158 158 158 ALA ALA D . n 
D 1 159 SER 159 159 159 SER SER D . n 
D 1 160 GLY 160 160 160 GLY GLY D . n 
D 1 161 PHE 161 161 161 PHE PHE D . n 
D 1 162 PRO 162 162 162 PRO PRO D . n 
D 1 163 ILE 163 163 163 ILE ILE D . n 
D 1 164 MET 164 164 164 MET MET D . n 
D 1 165 GLY 165 165 165 GLY GLY D . n 
D 1 166 LEU 166 166 166 LEU LEU D . n 
D 1 167 ASP 167 167 167 ASP ASP D . n 
D 1 168 VAL 168 168 168 VAL VAL D . n 
D 1 169 TRP 169 169 169 TRP TRP D . n 
D 1 170 GLU 170 170 170 GLU GLU D . n 
D 1 171 HIS 171 171 171 HIS HIS D . n 
D 1 172 ALA 172 172 172 ALA ALA D . n 
D 1 173 TYR 173 173 173 TYR TYR D . n 
D 1 174 TYR 174 174 174 TYR TYR D . n 
D 1 175 LEU 175 175 175 LEU LEU D . n 
D 1 176 LYS 176 176 176 LYS LYS D . n 
D 1 177 PHE 177 177 177 PHE PHE D . n 
D 1 178 GLN 178 178 178 GLN GLN D . n 
D 1 179 ASN 179 179 179 ASN ASN D . n 
D 1 180 ARG 180 180 180 ARG ARG D . n 
D 1 181 ARG 181 181 181 ARG ARG D . n 
D 1 182 PRO 182 182 182 PRO PRO D . n 
D 1 183 ASP 183 183 183 ASP ASP D . n 
D 1 184 TYR 184 184 184 TYR TYR D . n 
D 1 185 ILE 185 185 185 ILE ILE D . n 
D 1 186 LYS 186 186 186 LYS LYS D . n 
D 1 187 GLU 187 187 187 GLU GLU D . n 
D 1 188 PHE 188 188 188 PHE PHE D . n 
D 1 189 TRP 189 189 189 TRP TRP D . n 
D 1 190 ASN 190 190 190 ASN ASN D . n 
D 1 191 VAL 191 191 191 VAL VAL D . n 
D 1 192 VAL 192 192 192 VAL VAL D . n 
D 1 193 ASN 193 193 193 ASN ASN D . n 
D 1 194 TRP 194 194 194 TRP TRP D . n 
D 1 195 ASP 195 195 195 ASP ASP D . n 
D 1 196 GLU 196 196 196 GLU GLU D . n 
D 1 197 ALA 197 197 197 ALA ALA D . n 
D 1 198 ALA 198 198 198 ALA ALA D . n 
D 1 199 ALA 199 199 199 ALA ALA D . n 
D 1 200 ARG 200 200 200 ARG ARG D . n 
D 1 201 PHE 201 201 201 PHE PHE D . n 
D 1 202 ALA 202 202 202 ALA ALA D . n 
D 1 203 ALA 203 203 203 ALA ALA D . n 
D 1 204 LYS 204 204 204 LYS LYS D . n 
D 1 205 LYS 205 205 205 LYS LYS D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 MN  1  501 206 MN  MN3 A . 
F 2 MN  1  502 206 MN  MN3 B . 
G 2 MN  1  503 206 MN  MN3 C . 
H 2 MN  1  504 206 MN  MN3 D . 
I 3 HOH 1  502 1   HOH HOH A . 
I 3 HOH 2  503 2   HOH HOH A . 
I 3 HOH 3  504 3   HOH HOH A . 
I 3 HOH 4  505 4   HOH HOH A . 
I 3 HOH 5  506 5   HOH HOH A . 
I 3 HOH 6  507 6   HOH HOH A . 
I 3 HOH 7  508 7   HOH HOH A . 
I 3 HOH 8  509 8   HOH HOH A . 
I 3 HOH 9  510 9   HOH HOH A . 
I 3 HOH 10 511 10  HOH HOH A . 
I 3 HOH 11 512 11  HOH HOH A . 
I 3 HOH 12 513 12  HOH HOH A . 
I 3 HOH 13 514 13  HOH HOH A . 
I 3 HOH 14 515 14  HOH HOH A . 
I 3 HOH 15 516 15  HOH HOH A . 
I 3 HOH 16 517 16  HOH HOH A . 
I 3 HOH 17 518 17  HOH HOH A . 
I 3 HOH 18 519 18  HOH HOH A . 
I 3 HOH 19 520 19  HOH HOH A . 
I 3 HOH 20 521 20  HOH HOH A . 
I 3 HOH 21 522 21  HOH HOH A . 
I 3 HOH 22 523 22  HOH HOH A . 
I 3 HOH 23 524 23  HOH HOH A . 
I 3 HOH 24 525 24  HOH HOH A . 
I 3 HOH 25 526 25  HOH HOH A . 
I 3 HOH 26 527 26  HOH HOH A . 
I 3 HOH 27 528 27  HOH HOH A . 
I 3 HOH 28 529 28  HOH HOH A . 
I 3 HOH 29 530 29  HOH HOH A . 
I 3 HOH 30 531 30  HOH HOH A . 
I 3 HOH 31 532 31  HOH HOH A . 
I 3 HOH 32 533 32  HOH HOH A . 
I 3 HOH 33 534 33  HOH HOH A . 
I 3 HOH 34 535 34  HOH HOH A . 
I 3 HOH 35 536 35  HOH HOH A . 
I 3 HOH 36 537 36  HOH HOH A . 
I 3 HOH 37 538 37  HOH HOH A . 
I 3 HOH 38 539 38  HOH HOH A . 
I 3 HOH 39 540 39  HOH HOH A . 
I 3 HOH 40 541 40  HOH HOH A . 
I 3 HOH 41 542 41  HOH HOH A . 
I 3 HOH 42 543 43  HOH HOH A . 
I 3 HOH 43 544 44  HOH HOH A . 
I 3 HOH 44 545 46  HOH HOH A . 
I 3 HOH 45 546 47  HOH HOH A . 
I 3 HOH 46 547 48  HOH HOH A . 
I 3 HOH 47 548 49  HOH HOH A . 
I 3 HOH 48 549 50  HOH HOH A . 
I 3 HOH 49 550 51  HOH HOH A . 
I 3 HOH 50 551 52  HOH HOH A . 
I 3 HOH 51 552 53  HOH HOH A . 
I 3 HOH 52 553 54  HOH HOH A . 
I 3 HOH 53 554 55  HOH HOH A . 
I 3 HOH 54 555 56  HOH HOH A . 
I 3 HOH 55 556 57  HOH HOH A . 
I 3 HOH 56 557 58  HOH HOH A . 
I 3 HOH 57 558 59  HOH HOH A . 
I 3 HOH 58 559 60  HOH HOH A . 
I 3 HOH 59 560 61  HOH HOH A . 
I 3 HOH 60 561 62  HOH HOH A . 
I 3 HOH 61 562 64  HOH HOH A . 
I 3 HOH 62 563 65  HOH HOH A . 
I 3 HOH 63 564 68  HOH HOH A . 
I 3 HOH 64 565 69  HOH HOH A . 
I 3 HOH 65 566 70  HOH HOH A . 
I 3 HOH 66 567 71  HOH HOH A . 
I 3 HOH 67 568 72  HOH HOH A . 
I 3 HOH 68 569 73  HOH HOH A . 
I 3 HOH 69 570 74  HOH HOH A . 
I 3 HOH 70 571 75  HOH HOH A . 
I 3 HOH 71 572 76  HOH HOH A . 
I 3 HOH 72 573 77  HOH HOH A . 
I 3 HOH 73 574 78  HOH HOH A . 
I 3 HOH 74 575 81  HOH HOH A . 
I 3 HOH 75 576 82  HOH HOH A . 
I 3 HOH 76 577 83  HOH HOH A . 
I 3 HOH 77 578 84  HOH HOH A . 
I 3 HOH 78 579 85  HOH HOH A . 
I 3 HOH 79 580 86  HOH HOH A . 
I 3 HOH 80 581 87  HOH HOH A . 
I 3 HOH 81 582 95  HOH HOH A . 
I 3 HOH 82 583 96  HOH HOH A . 
I 3 HOH 83 584 97  HOH HOH A . 
I 3 HOH 84 585 98  HOH HOH A . 
I 3 HOH 85 586 99  HOH HOH A . 
I 3 HOH 86 587 100 HOH HOH A . 
I 3 HOH 87 588 101 HOH HOH A . 
I 3 HOH 88 589 102 HOH HOH A . 
I 3 HOH 89 590 103 HOH HOH A . 
I 3 HOH 90 591 105 HOH HOH A . 
I 3 HOH 91 592 106 HOH HOH A . 
I 3 HOH 92 593 107 HOH HOH A . 
I 3 HOH 93 594 108 HOH HOH A . 
I 3 HOH 94 595 109 HOH HOH A . 
I 3 HOH 95 596 110 HOH HOH A . 
I 3 HOH 96 597 4   HOH HOH A . 
I 3 HOH 97 598 42  HOH HOH A . 
I 3 HOH 98 599 45  HOH HOH A . 
I 3 HOH 99 600 207 HOH OH  A . 
J 3 HOH 1  503 42  HOH HOH B . 
J 3 HOH 2  504 45  HOH HOH B . 
J 3 HOH 3  505 63  HOH HOH B . 
J 3 HOH 4  506 66  HOH HOH B . 
J 3 HOH 5  507 1   HOH HOH B . 
J 3 HOH 6  508 2   HOH HOH B . 
J 3 HOH 7  509 3   HOH HOH B . 
J 3 HOH 8  510 5   HOH HOH B . 
J 3 HOH 9  511 6   HOH HOH B . 
J 3 HOH 10 512 7   HOH HOH B . 
J 3 HOH 11 513 8   HOH HOH B . 
J 3 HOH 12 514 9   HOH HOH B . 
J 3 HOH 13 515 10  HOH HOH B . 
J 3 HOH 14 516 11  HOH HOH B . 
J 3 HOH 15 517 12  HOH HOH B . 
J 3 HOH 16 518 13  HOH HOH B . 
J 3 HOH 17 519 14  HOH HOH B . 
J 3 HOH 18 520 15  HOH HOH B . 
J 3 HOH 19 521 16  HOH HOH B . 
J 3 HOH 20 522 17  HOH HOH B . 
J 3 HOH 21 523 18  HOH HOH B . 
J 3 HOH 22 524 19  HOH HOH B . 
J 3 HOH 23 525 20  HOH HOH B . 
J 3 HOH 24 526 21  HOH HOH B . 
J 3 HOH 25 527 22  HOH HOH B . 
J 3 HOH 26 528 23  HOH HOH B . 
J 3 HOH 27 529 24  HOH HOH B . 
J 3 HOH 28 530 25  HOH HOH B . 
J 3 HOH 29 531 26  HOH HOH B . 
J 3 HOH 30 532 27  HOH HOH B . 
J 3 HOH 31 533 28  HOH HOH B . 
J 3 HOH 32 534 29  HOH HOH B . 
J 3 HOH 33 535 30  HOH HOH B . 
J 3 HOH 34 536 31  HOH HOH B . 
J 3 HOH 35 537 32  HOH HOH B . 
J 3 HOH 36 538 33  HOH HOH B . 
J 3 HOH 37 539 34  HOH HOH B . 
J 3 HOH 38 540 35  HOH HOH B . 
J 3 HOH 39 541 36  HOH HOH B . 
J 3 HOH 40 542 37  HOH HOH B . 
J 3 HOH 41 543 38  HOH HOH B . 
J 3 HOH 42 544 39  HOH HOH B . 
J 3 HOH 43 545 40  HOH HOH B . 
J 3 HOH 44 546 41  HOH HOH B . 
J 3 HOH 45 547 43  HOH HOH B . 
J 3 HOH 46 548 44  HOH HOH B . 
J 3 HOH 47 549 46  HOH HOH B . 
J 3 HOH 48 550 47  HOH HOH B . 
J 3 HOH 49 551 48  HOH HOH B . 
J 3 HOH 50 552 49  HOH HOH B . 
J 3 HOH 51 553 50  HOH HOH B . 
J 3 HOH 52 554 51  HOH HOH B . 
J 3 HOH 53 555 52  HOH HOH B . 
J 3 HOH 54 556 53  HOH HOH B . 
J 3 HOH 55 557 55  HOH HOH B . 
J 3 HOH 56 558 56  HOH HOH B . 
J 3 HOH 57 559 60  HOH HOH B . 
J 3 HOH 58 560 61  HOH HOH B . 
J 3 HOH 59 561 62  HOH HOH B . 
J 3 HOH 60 562 64  HOH HOH B . 
J 3 HOH 61 563 67  HOH HOH B . 
J 3 HOH 62 564 68  HOH HOH B . 
J 3 HOH 63 565 70  HOH HOH B . 
J 3 HOH 64 566 73  HOH HOH B . 
J 3 HOH 65 567 74  HOH HOH B . 
J 3 HOH 66 568 75  HOH HOH B . 
J 3 HOH 67 569 78  HOH HOH B . 
J 3 HOH 68 570 80  HOH HOH B . 
J 3 HOH 69 571 83  HOH HOH B . 
J 3 HOH 70 572 85  HOH HOH B . 
J 3 HOH 71 573 87  HOH HOH B . 
J 3 HOH 72 574 88  HOH HOH B . 
J 3 HOH 73 575 89  HOH HOH B . 
J 3 HOH 74 576 90  HOH HOH B . 
J 3 HOH 75 577 91  HOH HOH B . 
J 3 HOH 76 578 92  HOH HOH B . 
J 3 HOH 77 579 93  HOH HOH B . 
J 3 HOH 78 580 94  HOH HOH B . 
J 3 HOH 79 581 111 HOH HOH B . 
J 3 HOH 80 582 112 HOH HOH B . 
J 3 HOH 81 583 113 HOH HOH B . 
J 3 HOH 82 584 114 HOH HOH B . 
J 3 HOH 83 585 115 HOH HOH B . 
J 3 HOH 84 586 116 HOH HOH B . 
J 3 HOH 85 587 117 HOH HOH B . 
J 3 HOH 86 588 118 HOH HOH B . 
J 3 HOH 87 589 119 HOH HOH B . 
J 3 HOH 88 590 120 HOH HOH B . 
J 3 HOH 89 591 207 HOH OH  B . 
K 3 HOH 1  504 1   HOH HOH C . 
K 3 HOH 2  505 2   HOH HOH C . 
K 3 HOH 3  506 3   HOH HOH C . 
K 3 HOH 4  507 5   HOH HOH C . 
K 3 HOH 5  508 6   HOH HOH C . 
K 3 HOH 6  509 7   HOH HOH C . 
K 3 HOH 7  510 8   HOH HOH C . 
K 3 HOH 8  511 9   HOH HOH C . 
K 3 HOH 9  512 10  HOH HOH C . 
K 3 HOH 10 513 11  HOH HOH C . 
K 3 HOH 11 514 12  HOH HOH C . 
K 3 HOH 12 515 13  HOH HOH C . 
K 3 HOH 13 516 14  HOH HOH C . 
K 3 HOH 14 517 15  HOH HOH C . 
K 3 HOH 15 518 16  HOH HOH C . 
K 3 HOH 16 519 17  HOH HOH C . 
K 3 HOH 17 520 18  HOH HOH C . 
K 3 HOH 18 521 19  HOH HOH C . 
K 3 HOH 19 522 20  HOH HOH C . 
K 3 HOH 20 523 21  HOH HOH C . 
K 3 HOH 21 524 22  HOH HOH C . 
K 3 HOH 22 525 23  HOH HOH C . 
K 3 HOH 23 526 24  HOH HOH C . 
K 3 HOH 24 527 25  HOH HOH C . 
K 3 HOH 25 528 26  HOH HOH C . 
K 3 HOH 26 529 27  HOH HOH C . 
K 3 HOH 27 530 28  HOH HOH C . 
K 3 HOH 28 531 29  HOH HOH C . 
K 3 HOH 29 532 30  HOH HOH C . 
K 3 HOH 30 533 31  HOH HOH C . 
K 3 HOH 31 534 32  HOH HOH C . 
K 3 HOH 32 535 33  HOH HOH C . 
K 3 HOH 33 536 34  HOH HOH C . 
K 3 HOH 34 537 35  HOH HOH C . 
K 3 HOH 35 538 36  HOH HOH C . 
K 3 HOH 36 539 37  HOH HOH C . 
K 3 HOH 37 540 38  HOH HOH C . 
K 3 HOH 38 541 39  HOH HOH C . 
K 3 HOH 39 542 40  HOH HOH C . 
K 3 HOH 40 543 41  HOH HOH C . 
K 3 HOH 41 544 43  HOH HOH C . 
K 3 HOH 42 545 44  HOH HOH C . 
K 3 HOH 43 546 46  HOH HOH C . 
K 3 HOH 44 547 47  HOH HOH C . 
K 3 HOH 45 548 48  HOH HOH C . 
K 3 HOH 46 549 50  HOH HOH C . 
K 3 HOH 47 550 51  HOH HOH C . 
K 3 HOH 48 551 54  HOH HOH C . 
K 3 HOH 49 552 55  HOH HOH C . 
K 3 HOH 50 553 56  HOH HOH C . 
K 3 HOH 51 554 57  HOH HOH C . 
K 3 HOH 52 555 58  HOH HOH C . 
K 3 HOH 53 556 59  HOH HOH C . 
K 3 HOH 54 557 60  HOH HOH C . 
K 3 HOH 55 558 61  HOH HOH C . 
K 3 HOH 56 559 62  HOH HOH C . 
K 3 HOH 57 560 65  HOH HOH C . 
K 3 HOH 58 561 67  HOH HOH C . 
K 3 HOH 59 562 71  HOH HOH C . 
K 3 HOH 60 563 72  HOH HOH C . 
K 3 HOH 61 564 76  HOH HOH C . 
K 3 HOH 62 565 79  HOH HOH C . 
K 3 HOH 63 566 81  HOH HOH C . 
K 3 HOH 64 567 82  HOH HOH C . 
K 3 HOH 65 568 84  HOH HOH C . 
K 3 HOH 66 569 89  HOH HOH C . 
K 3 HOH 67 570 91  HOH HOH C . 
K 3 HOH 68 571 121 HOH HOH C . 
K 3 HOH 69 572 122 HOH HOH C . 
K 3 HOH 70 573 123 HOH HOH C . 
K 3 HOH 71 574 124 HOH HOH C . 
K 3 HOH 72 575 125 HOH HOH C . 
K 3 HOH 73 576 126 HOH HOH C . 
K 3 HOH 74 577 127 HOH HOH C . 
K 3 HOH 75 578 128 HOH HOH C . 
K 3 HOH 76 579 129 HOH HOH C . 
K 3 HOH 77 580 130 HOH HOH C . 
K 3 HOH 78 581 4   HOH HOH C . 
K 3 HOH 79 582 42  HOH HOH C . 
K 3 HOH 80 583 45  HOH HOH C . 
K 3 HOH 81 584 63  HOH HOH C . 
K 3 HOH 82 585 66  HOH HOH C . 
K 3 HOH 83 586 207 HOH OH  C . 
L 3 HOH 1  505 104 HOH HOH D . 
L 3 HOH 2  506 4   HOH HOH D . 
L 3 HOH 3  507 42  HOH HOH D . 
L 3 HOH 4  508 45  HOH HOH D . 
L 3 HOH 5  509 63  HOH HOH D . 
L 3 HOH 6  510 1   HOH HOH D . 
L 3 HOH 7  511 2   HOH HOH D . 
L 3 HOH 8  512 3   HOH HOH D . 
L 3 HOH 9  513 5   HOH HOH D . 
L 3 HOH 10 514 6   HOH HOH D . 
L 3 HOH 11 515 7   HOH HOH D . 
L 3 HOH 12 516 8   HOH HOH D . 
L 3 HOH 13 517 9   HOH HOH D . 
L 3 HOH 14 518 10  HOH HOH D . 
L 3 HOH 15 519 11  HOH HOH D . 
L 3 HOH 16 520 12  HOH HOH D . 
L 3 HOH 17 521 13  HOH HOH D . 
L 3 HOH 18 522 14  HOH HOH D . 
L 3 HOH 19 523 15  HOH HOH D . 
L 3 HOH 20 524 16  HOH HOH D . 
L 3 HOH 21 525 17  HOH HOH D . 
L 3 HOH 22 526 18  HOH HOH D . 
L 3 HOH 23 527 19  HOH HOH D . 
L 3 HOH 24 528 20  HOH HOH D . 
L 3 HOH 25 529 21  HOH HOH D . 
L 3 HOH 26 530 22  HOH HOH D . 
L 3 HOH 27 531 23  HOH HOH D . 
L 3 HOH 28 532 24  HOH HOH D . 
L 3 HOH 29 533 25  HOH HOH D . 
L 3 HOH 30 534 26  HOH HOH D . 
L 3 HOH 31 535 27  HOH HOH D . 
L 3 HOH 32 536 28  HOH HOH D . 
L 3 HOH 33 537 29  HOH HOH D . 
L 3 HOH 34 538 30  HOH HOH D . 
L 3 HOH 35 539 31  HOH HOH D . 
L 3 HOH 36 540 32  HOH HOH D . 
L 3 HOH 37 541 33  HOH HOH D . 
L 3 HOH 38 542 34  HOH HOH D . 
L 3 HOH 39 543 35  HOH HOH D . 
L 3 HOH 40 544 36  HOH HOH D . 
L 3 HOH 41 545 37  HOH HOH D . 
L 3 HOH 42 546 38  HOH HOH D . 
L 3 HOH 43 547 39  HOH HOH D . 
L 3 HOH 44 548 40  HOH HOH D . 
L 3 HOH 45 549 41  HOH HOH D . 
L 3 HOH 46 550 43  HOH HOH D . 
L 3 HOH 47 551 44  HOH HOH D . 
L 3 HOH 48 552 46  HOH HOH D . 
L 3 HOH 49 553 47  HOH HOH D . 
L 3 HOH 50 554 48  HOH HOH D . 
L 3 HOH 51 555 49  HOH HOH D . 
L 3 HOH 52 556 52  HOH HOH D . 
L 3 HOH 53 557 53  HOH HOH D . 
L 3 HOH 54 558 54  HOH HOH D . 
L 3 HOH 55 559 57  HOH HOH D . 
L 3 HOH 56 560 58  HOH HOH D . 
L 3 HOH 57 561 59  HOH HOH D . 
L 3 HOH 58 562 64  HOH HOH D . 
L 3 HOH 59 563 65  HOH HOH D . 
L 3 HOH 60 564 67  HOH HOH D . 
L 3 HOH 61 565 69  HOH HOH D . 
L 3 HOH 62 566 77  HOH HOH D . 
L 3 HOH 63 567 79  HOH HOH D . 
L 3 HOH 64 568 80  HOH HOH D . 
L 3 HOH 65 569 86  HOH HOH D . 
L 3 HOH 66 570 88  HOH HOH D . 
L 3 HOH 67 571 90  HOH HOH D . 
L 3 HOH 68 572 92  HOH HOH D . 
L 3 HOH 69 573 93  HOH HOH D . 
L 3 HOH 70 574 94  HOH HOH D . 
L 3 HOH 71 575 131 HOH HOH D . 
L 3 HOH 72 576 132 HOH HOH D . 
L 3 HOH 73 577 207 HOH OH  D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J 
2 1 C,D,G,H,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1970  ? 
1 MORE         -24   ? 
1 'SSA (A^2)'  17710 ? 
2 'ABSA (A^2)' 1960  ? 
2 MORE         -25   ? 
2 'SSA (A^2)'  17550 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     585 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   I 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? I HOH .   ? A HOH 600 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 26  ? A HIS 26  ? 1_555 172.0 ? 
2  O   ? I HOH .   ? A HOH 600 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 90.6  ? 
3  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 93.0  ? 
4  O   ? I HOH .   ? A HOH 600 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 88.1  ? 
5  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 94.6  ? 
6  NE2 ? A HIS 171 ? A HIS 171 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 133.2 ? 
7  O   ? I HOH .   ? A HOH 600 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 83.3  ? 
8  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 88.7  ? 
9  NE2 ? A HIS 171 ? A HIS 171 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 115.2 ? 
10 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 111.1 ? 
11 O   ? J HOH .   ? B HOH 591 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 173.1 ? 
12 O   ? J HOH .   ? B HOH 591 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 92.6  ? 
13 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 92.4  ? 
14 O   ? J HOH .   ? B HOH 591 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 90.5  ? 
15 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 89.8  ? 
16 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 131.3 ? 
17 O   ? J HOH .   ? B HOH 591 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 84.5  ? 
18 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 89.0  ? 
19 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 117.0 ? 
20 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 MN ? F MN . ? B MN 502 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 111.6 ? 
21 O   ? K HOH .   ? C HOH 586 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 86.1  ? 
22 O   ? K HOH .   ? C HOH 586 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 94.8  ? 
23 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 113.9 ? 
24 O   ? K HOH .   ? C HOH 586 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 89.9  ? 
25 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 108.8 ? 
26 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 137.2 ? 
27 O   ? K HOH .   ? C HOH 586 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 173.6 ? 
28 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 87.7  ? 
29 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 88.8  ? 
30 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 MN ? G MN . ? C MN 503 ? 1_555 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 91.0  ? 
31 O   ? L HOH .   ? D HOH 577 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 94.0  ? 
32 O   ? L HOH .   ? D HOH 577 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 83.5  ? 
33 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 114.0 ? 
34 O   ? L HOH .   ? D HOH 577 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 170.6 ? 
35 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 89.8  ? 
36 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 87.1  ? 
37 O   ? L HOH .   ? D HOH 577 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 90.7  ? 
38 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 133.2 ? 
39 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 112.8 ? 
40 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 MN ? H MN . ? D MN 504 ? 1_555 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 93.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-06-27 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       1.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 89  ? ? -176.29 136.06  
2  1 ASP A 136 ? ? 71.25   -3.05   
3  1 ASN A 145 ? ? 42.30   -121.52 
4  1 TYR A 173 ? ? -142.21 -5.01   
5  1 GLN A 178 ? ? 48.89   -128.09 
6  1 LYS A 204 ? ? 73.20   -12.28  
7  1 LYS B 29  ? ? -109.39 -64.07  
8  1 LEU B 45  ? ? -119.27 66.69   
9  1 LYS B 89  ? ? -178.96 136.28  
10 1 ASN B 145 ? ? 45.31   -118.85 
11 1 TYR B 173 ? ? -143.90 -2.53   
12 1 GLN B 178 ? ? 47.37   -129.07 
13 1 LYS C 89  ? ? -178.80 138.15  
14 1 GLN C 95  ? ? -165.61 -169.44 
15 1 ASN C 145 ? ? 43.55   -119.43 
16 1 GLN C 178 ? ? 50.40   -127.47 
17 1 LYS D 29  ? ? -109.90 -64.33  
18 1 LYS D 89  ? ? 172.44  136.07  
19 1 GLN D 95  ? ? -177.81 -169.85 
20 1 ASN D 145 ? ? 42.33   -119.99 
21 1 TYR D 173 ? ? -145.86 -3.68   
22 1 GLN D 178 ? ? 51.52   -129.53 
23 1 LYS D 204 ? ? 63.40   -2.33   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 water                HOH 
#