data_1ENV
# 
_entry.id   1ENV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.280 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ENV         
WWPDB D_1000173103 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ENV 
_pdbx_database_status.recvd_initial_deposition_date   1997-06-27 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Weissenhorn, W.' 1 
'Dessen, A.'      2 
'Harrison, S.C.'  3 
'Skehel, J.J.'    4 
'Wiley, D.C.'     5 
# 
_citation.id                        primary 
_citation.title                     'Atomic structure of the ectodomain from HIV-1 gp41.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            387 
_citation.page_first                426 
_citation.page_last                 430 
_citation.year                      1997 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9163431 
_citation.pdbx_database_id_DOI      10.1038/387426a0 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Weissenhorn, W.' 1 
primary 'Dessen, A.'      2 
primary 'Harrison, S.C.'  3 
primary 'Skehel, J.J.'    4 
primary 'Wiley, D.C.'     5 
# 
_cell.entry_id           1ENV 
_cell.length_a           52.350 
_cell.length_b           52.350 
_cell.length_c           414.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ENV 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'HIV-1 ENVELOPE PROTEIN CHIMERA CONSISTING OF A FRAGMENT OF GCN4 ZIPPER CLONED N-TERMINAL TO TWO FRAGMENTS OF GP41' 
14709.765 1  ? 'L2I, V61, L9I, N13I, L16I, V20I, L23I, V27I' 'GCN4 IS RESIDUES 1 - 29, GP41 IS RESIDUES 30 - 154' ? 
2 water   nat water                                                                                                               
18.015    12 ? ?                                             ?                                                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Env polyprotein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKQIEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKD
QNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKQIEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKD
QNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLN n 
1 4   ILE n 
1 5   GLU n 
1 6   ASP n 
1 7   LYS n 
1 8   ILE n 
1 9   GLU n 
1 10  GLU n 
1 11  ILE n 
1 12  LEU n 
1 13  SER n 
1 14  LYS n 
1 15  ILE n 
1 16  TYR n 
1 17  HIS n 
1 18  ILE n 
1 19  GLU n 
1 20  ASN n 
1 21  GLU n 
1 22  ILE n 
1 23  ALA n 
1 24  ARG n 
1 25  ILE n 
1 26  LYS n 
1 27  LYS n 
1 28  LEU n 
1 29  ILE n 
1 30  GLY n 
1 31  GLU n 
1 32  ALA n 
1 33  ARG n 
1 34  GLN n 
1 35  LEU n 
1 36  LEU n 
1 37  SER n 
1 38  GLY n 
1 39  ILE n 
1 40  VAL n 
1 41  GLN n 
1 42  GLN n 
1 43  GLN n 
1 44  ASN n 
1 45  ASN n 
1 46  LEU n 
1 47  LEU n 
1 48  ARG n 
1 49  ALA n 
1 50  ILE n 
1 51  GLU n 
1 52  ALA n 
1 53  GLN n 
1 54  GLN n 
1 55  HIS n 
1 56  LEU n 
1 57  LEU n 
1 58  GLN n 
1 59  LEU n 
1 60  THR n 
1 61  VAL n 
1 62  TRP n 
1 63  GLY n 
1 64  ILE n 
1 65  LYS n 
1 66  GLN n 
1 67  LEU n 
1 68  GLN n 
1 69  ALA n 
1 70  ARG n 
1 71  ILE n 
1 72  LEU n 
1 73  ALA n 
1 74  VAL n 
1 75  GLU n 
1 76  ARG n 
1 77  TYR n 
1 78  LEU n 
1 79  LYS n 
1 80  ASP n 
1 81  GLN n 
1 82  ASN n 
1 83  ASN n 
1 84  MET n 
1 85  THR n 
1 86  TRP n 
1 87  MET n 
1 88  GLU n 
1 89  TRP n 
1 90  ASP n 
1 91  ARG n 
1 92  GLU n 
1 93  ILE n 
1 94  ASN n 
1 95  ASN n 
1 96  TYR n 
1 97  THR n 
1 98  SER n 
1 99  LEU n 
1 100 ILE n 
1 101 HIS n 
1 102 SER n 
1 103 LEU n 
1 104 ILE n 
1 105 GLU n 
1 106 GLU n 
1 107 SER n 
1 108 GLN n 
1 109 ASN n 
1 110 GLN n 
1 111 GLN n 
1 112 GLU n 
1 113 LYS n 
1 114 ASN n 
1 115 GLU n 
1 116 GLN n 
1 117 GLU n 
1 118 LEU n 
1 119 LEU n 
1 120 GLU n 
1 121 LEU n 
1 122 ASP n 
1 123 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  31  
;Baker's yeast
;
Saccharomyces 'GCN4, AAS3, ARG9, YEL009C' ? ? ? ? ? '30 - 154' 'Saccharomyces cerevisiae'       4932  ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia GP41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 32 79  HIV-1           Saccharomyces env                         ? ? ? ? ? '30 - 154' 
'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia GP41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? 
1 3 sample 'Biological sequence' 80 123 HIV-1           Saccharomyces env                         ? ? ? ? ? '30 - 154' 
'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia GP41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ENV_HV1BR P03377 ? 1 AVGIGALFLGFLGAAGSTMGARSMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLK 517 
2 UNP ENV_HV1BR P03377 ? 1 WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK                                        633 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ENV A 3  ? 79  ? P03377 517 ? 593 ? 1   77  
2 2 1ENV A 86 ? 123 ? P03377 633 ? 670 ? 117 154 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ENV ILE A 4  ? UNP P03377 VAL 518 'engineered mutation' 2   1  
1 1ENV ILE A 8  ? UNP P03377 ALA 522 'engineered mutation' 6   2  
1 1ENV ILE A 11 ? UNP P03377 LEU 525 'engineered mutation' 9   3  
1 1ENV ILE A 15 ? UNP P03377 GLY 529 'engineered mutation' 13  4  
1 1ENV ILE A 18 ? UNP P03377 GLY 532 'engineered mutation' 16  5  
1 1ENV ILE A 22 ? UNP P03377 GLY 536 'engineered mutation' 20  6  
1 1ENV ILE A 25 ? UNP P03377 SER 539 'engineered mutation' 23  7  
1 1ENV ILE A 29 ? UNP P03377 THR 543 'engineered mutation' 27  8  
1 1ENV ASP A 80 ? UNP P03377 ?   ?   linker                111 9  
1 1ENV GLN A 81 ? UNP P03377 ?   ?   linker                112 10 
1 1ENV ASN A 82 ? UNP P03377 ?   ?   linker                113 11 
1 1ENV ASN A 83 ? UNP P03377 ?   ?   linker                114 12 
1 1ENV MET A 84 ? UNP P03377 ?   ?   linker                115 13 
1 1ENV THR A 85 ? UNP P03377 ?   ?   linker                116 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ENV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.4 
_exptl_crystal.density_percent_sol   72. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'20 MM HEPES PH 8.0 1.1 M AMMONIUM SULFATE 12% ETHYLENE GLYCOL SPACE GROUP R32 IN HEXAGONAL SETTING' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-02 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ELLIOTT GX-13' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1ENV 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25. 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   8130 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.5 
_reflns.pdbx_Rmerge_I_obs            0.0710000 
_reflns.pdbx_Rsym_value              0.0710000 
_reflns.pdbx_netI_over_sigmaI        10.2 
_reflns.B_iso_Wilson_estimate        59.41 
_reflns.pdbx_redundancy              7.45 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.59 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   91.4 
_reflns_shell.Rmerge_I_obs           0.1790000 
_reflns_shell.pdbx_Rsym_value        0.1790000 
_reflns_shell.meanI_over_sigI_obs    4.5 
_reflns_shell.pdbx_redundancy        5. 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1ENV 
_refine.ls_number_reflns_obs                     6432 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25. 
_refine.ls_d_res_high                            2.6 
_refine.ls_percent_reflns_obs                    90.5 
_refine.ls_R_factor_obs                          0.2440000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2440000 
_refine.ls_R_factor_R_free                       0.2770000 
_refine.ls_R_factor_R_free_error                 0.0000 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  674 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               52.9 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        935 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             12 
_refine_hist.number_atoms_total               947 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        25. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.20  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.6 
_refine_ls_shell.d_res_low                        2.72 
_refine_ls_shell.number_reflns_R_work             695 
_refine_ls_shell.R_factor_R_work                  0.2440000 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2770000 
_refine_ls_shell.R_factor_R_free_error            0.004 
_refine_ls_shell.percent_reflns_R_free            10. 
_refine_ls_shell.number_reflns_R_free             88 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.SOL  TOPH19M.SOL  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ENV 
_struct.title                     'ATOMIC STRUCTURE OF THE ECTODOMAIN FROM HIV-1 GP41' 
_struct.pdbx_descriptor           
'HIV-1 ENVELOPE PROTEIN CHIMERA CONSISTING OF A FRAGMENT OF GCN4 ZIPPER CLONED N-TERMINAL TO TWO FRAGMENTS OF GP41' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ENV 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            'VIRAL FUSION, COAT PROTEIN, Viral protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 3  ? LYS A 79  ? GLN A 1   LYS A 77  1 ? 77 
HELX_P HELX_P2 2 TRP A 86 ? LYS A 123 ? TRP A 117 LYS A 154 1 ? 38 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1ENV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ENV 
_atom_sites.fract_transf_matrix[1][1]   0.019102 
_atom_sites.fract_transf_matrix[1][2]   0.011029 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022057 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002412 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLN A 1 3   ? 31.714 8.530  139.598 1.00 109.35 ? 1   GLN A N   1 
ATOM   2   C CA  . GLN A 1 3   ? 32.034 8.751  141.030 1.00 109.33 ? 1   GLN A CA  1 
ATOM   3   C C   . GLN A 1 3   ? 31.228 9.823  141.748 1.00 106.55 ? 1   GLN A C   1 
ATOM   4   O O   . GLN A 1 3   ? 31.172 9.816  142.969 1.00 105.06 ? 1   GLN A O   1 
ATOM   5   C CB  . GLN A 1 3   ? 33.528 8.930  141.231 1.00 111.01 ? 1   GLN A CB  1 
ATOM   6   C CG  . GLN A 1 3   ? 34.224 7.592  141.226 1.00 118.26 ? 1   GLN A CG  1 
ATOM   7   C CD  . GLN A 1 3   ? 35.686 7.703  140.924 1.00 123.88 ? 1   GLN A CD  1 
ATOM   8   O OE1 . GLN A 1 3   ? 36.089 7.642  139.765 1.00 128.68 ? 1   GLN A OE1 1 
ATOM   9   N NE2 . GLN A 1 3   ? 36.495 7.870  141.958 1.00 125.37 ? 1   GLN A NE2 1 
ATOM   10  N N   . ILE A 1 4   ? 30.626 10.755 141.010 1.00 103.33 ? 2   ILE A N   1 
ATOM   11  C CA  . ILE A 1 4   ? 29.765 11.747 141.649 1.00 99.54  ? 2   ILE A CA  1 
ATOM   12  C C   . ILE A 1 4   ? 28.651 10.888 142.231 1.00 99.03  ? 2   ILE A C   1 
ATOM   13  O O   . ILE A 1 4   ? 28.265 11.039 143.381 1.00 102.03 ? 2   ILE A O   1 
ATOM   14  C CB  . ILE A 1 4   ? 29.172 12.743 140.623 1.00 99.38  ? 2   ILE A CB  1 
ATOM   15  C CG1 . ILE A 1 4   ? 29.925 14.069 140.692 1.00 100.52 ? 2   ILE A CG1 1 
ATOM   16  C CG2 . ILE A 1 4   ? 27.677 12.980 140.873 1.00 96.80  ? 2   ILE A CG2 1 
ATOM   17  C CD1 . ILE A 1 4   ? 29.718 14.839 141.977 1.00 101.17 ? 2   ILE A CD1 1 
ATOM   18  N N   . GLU A 1 5   ? 28.197 9.938  141.418 1.00 97.36  ? 3   GLU A N   1 
ATOM   19  C CA  . GLU A 1 5   ? 27.156 8.986  141.789 1.00 95.22  ? 3   GLU A CA  1 
ATOM   20  C C   . GLU A 1 5   ? 27.533 8.285  143.106 1.00 93.50  ? 3   GLU A C   1 
ATOM   21  O O   . GLU A 1 5   ? 26.785 8.348  144.082 1.00 92.16  ? 3   GLU A O   1 
ATOM   22  C CB  . GLU A 1 5   ? 27.012 7.928  140.682 1.00 97.33  ? 3   GLU A CB  1 
ATOM   23  C CG  . GLU A 1 5   ? 26.918 8.460  139.245 1.00 93.47  ? 3   GLU A CG  1 
ATOM   24  C CD  . GLU A 1 5   ? 25.516 8.899  138.863 1.00 92.57  ? 3   GLU A CD  1 
ATOM   25  O OE1 . GLU A 1 5   ? 24.645 8.028  138.649 1.00 86.13  ? 3   GLU A OE1 1 
ATOM   26  O OE2 . GLU A 1 5   ? 25.287 10.122 138.769 1.00 94.16  ? 3   GLU A OE2 1 
ATOM   27  N N   . ASP A 1 6   ? 28.699 7.631  143.114 1.00 92.13  ? 4   ASP A N   1 
ATOM   28  C CA  . ASP A 1 6   ? 29.222 6.898  144.282 1.00 91.67  ? 4   ASP A CA  1 
ATOM   29  C C   . ASP A 1 6   ? 29.414 7.766  145.533 1.00 92.37  ? 4   ASP A C   1 
ATOM   30  O O   . ASP A 1 6   ? 29.118 7.337  146.656 1.00 92.89  ? 4   ASP A O   1 
ATOM   31  C CB  . ASP A 1 6   ? 30.567 6.216  143.942 1.00 88.16  ? 4   ASP A CB  1 
ATOM   32  C CG  . ASP A 1 6   ? 30.405 4.860  143.243 1.00 84.11  ? 4   ASP A CG  1 
ATOM   33  O OD1 . ASP A 1 6   ? 29.261 4.390  143.059 1.00 80.92  ? 4   ASP A OD1 1 
ATOM   34  O OD2 . ASP A 1 6   ? 31.443 4.250  142.890 1.00 76.82  ? 4   ASP A OD2 1 
ATOM   35  N N   . LYS A 1 7   ? 29.929 8.978  145.339 1.00 90.22  ? 5   LYS A N   1 
ATOM   36  C CA  . LYS A 1 7   ? 30.164 9.889  146.447 1.00 86.25  ? 5   LYS A CA  1 
ATOM   37  C C   . LYS A 1 7   ? 28.867 10.218 147.184 1.00 85.44  ? 5   LYS A C   1 
ATOM   38  O O   . LYS A 1 7   ? 28.852 10.262 148.411 1.00 87.02  ? 5   LYS A O   1 
ATOM   39  C CB  . LYS A 1 7   ? 30.870 11.158 145.968 1.00 86.03  ? 5   LYS A CB  1 
ATOM   40  C CG  . LYS A 1 7   ? 31.921 11.653 146.945 1.00 85.72  ? 5   LYS A CG  1 
ATOM   41  C CD  . LYS A 1 7   ? 33.202 12.083 146.243 1.00 84.40  ? 5   LYS A CD  1 
ATOM   42  C CE  . LYS A 1 7   ? 33.103 13.502 145.714 1.00 85.92  ? 5   LYS A CE  1 
ATOM   43  N NZ  . LYS A 1 7   ? 34.370 13.939 145.071 1.00 89.61  ? 5   LYS A NZ  1 
ATOM   44  N N   . ILE A 1 8   ? 27.768 10.388 146.450 1.00 83.17  ? 6   ILE A N   1 
ATOM   45  C CA  . ILE A 1 8   ? 26.484 10.686 147.083 1.00 81.71  ? 6   ILE A CA  1 
ATOM   46  C C   . ILE A 1 8   ? 25.990 9.482  147.869 1.00 82.21  ? 6   ILE A C   1 
ATOM   47  O O   . ILE A 1 8   ? 25.220 9.630  148.813 1.00 84.88  ? 6   ILE A O   1 
ATOM   48  C CB  . ILE A 1 8   ? 25.413 11.128 146.067 1.00 79.92  ? 6   ILE A CB  1 
ATOM   49  C CG1 . ILE A 1 8   ? 25.907 12.354 145.302 1.00 79.44  ? 6   ILE A CG1 1 
ATOM   50  C CG2 . ILE A 1 8   ? 24.119 11.472 146.776 1.00 77.76  ? 6   ILE A CG2 1 
ATOM   51  C CD1 . ILE A 1 8   ? 26.653 13.335 146.157 1.00 76.18  ? 6   ILE A CD1 1 
ATOM   52  N N   . GLU A 1 9   ? 26.431 8.292  147.481 1.00 82.92  ? 7   GLU A N   1 
ATOM   53  C CA  . GLU A 1 9   ? 26.051 7.083  148.196 1.00 84.12  ? 7   GLU A CA  1 
ATOM   54  C C   . GLU A 1 9   ? 26.802 7.101  149.526 1.00 84.48  ? 7   GLU A C   1 
ATOM   55  O O   . GLU A 1 9   ? 26.194 6.953  150.582 1.00 84.07  ? 7   GLU A O   1 
ATOM   56  C CB  . GLU A 1 9   ? 26.411 5.843  147.392 1.00 84.03  ? 7   GLU A CB  1 
ATOM   57  N N   . GLU A 1 10  ? 28.111 7.346  149.472 1.00 84.33  ? 8   GLU A N   1 
ATOM   58  C CA  . GLU A 1 10  ? 28.934 7.403  150.679 1.00 85.98  ? 8   GLU A CA  1 
ATOM   59  C C   . GLU A 1 10  ? 28.434 8.471  151.639 1.00 83.69  ? 8   GLU A C   1 
ATOM   60  O O   . GLU A 1 10  ? 28.182 8.191  152.810 1.00 85.62  ? 8   GLU A O   1 
ATOM   61  C CB  . GLU A 1 10  ? 30.401 7.680  150.335 1.00 91.09  ? 8   GLU A CB  1 
ATOM   62  C CG  . GLU A 1 10  ? 31.076 6.584  149.522 1.00 103.02 ? 8   GLU A CG  1 
ATOM   63  C CD  . GLU A 1 10  ? 30.987 5.209  150.167 1.00 108.86 ? 8   GLU A CD  1 
ATOM   64  O OE1 . GLU A 1 10  ? 30.796 5.121  151.405 1.00 109.33 ? 8   GLU A OE1 1 
ATOM   65  O OE2 . GLU A 1 10  ? 31.118 4.211  149.421 1.00 112.27 ? 8   GLU A OE2 1 
ATOM   66  N N   . ILE A 1 11  ? 28.320 9.699  151.145 1.00 80.47  ? 9   ILE A N   1 
ATOM   67  C CA  . ILE A 1 11  ? 27.839 10.812 151.951 1.00 77.70  ? 9   ILE A CA  1 
ATOM   68  C C   . ILE A 1 11  ? 26.569 10.416 152.696 1.00 78.24  ? 9   ILE A C   1 
ATOM   69  O O   . ILE A 1 11  ? 26.510 10.534 153.922 1.00 83.89  ? 9   ILE A O   1 
ATOM   70  C CB  . ILE A 1 11  ? 27.598 12.069 151.080 1.00 77.78  ? 9   ILE A CB  1 
ATOM   71  C CG1 . ILE A 1 11  ? 28.944 12.681 150.670 1.00 77.48  ? 9   ILE A CG1 1 
ATOM   72  C CG2 . ILE A 1 11  ? 26.737 13.083 151.821 1.00 72.43  ? 9   ILE A CG2 1 
ATOM   73  C CD1 . ILE A 1 11  ? 28.832 13.887 149.758 1.00 79.90  ? 9   ILE A CD1 1 
ATOM   74  N N   . LEU A 1 12  ? 25.587 9.885  151.972 1.00 76.52  ? 10  LEU A N   1 
ATOM   75  C CA  . LEU A 1 12  ? 24.331 9.460  152.588 1.00 78.03  ? 10  LEU A CA  1 
ATOM   76  C C   . LEU A 1 12  ? 24.507 8.393  153.671 1.00 78.79  ? 10  LEU A C   1 
ATOM   77  O O   . LEU A 1 12  ? 23.772 8.378  154.660 1.00 76.05  ? 10  LEU A O   1 
ATOM   78  C CB  . LEU A 1 12  ? 23.339 8.955  151.534 1.00 78.44  ? 10  LEU A CB  1 
ATOM   79  C CG  . LEU A 1 12  ? 22.354 9.978  150.975 1.00 77.87  ? 10  LEU A CG  1 
ATOM   80  C CD1 . LEU A 1 12  ? 21.340 9.267  150.101 1.00 76.10  ? 10  LEU A CD1 1 
ATOM   81  C CD2 . LEU A 1 12  ? 21.647 10.687 152.121 1.00 81.52  ? 10  LEU A CD2 1 
ATOM   82  N N   . SER A 1 13  ? 25.464 7.492  153.477 1.00 81.16  ? 11  SER A N   1 
ATOM   83  C CA  . SER A 1 13  ? 25.714 6.437  154.451 1.00 83.59  ? 11  SER A CA  1 
ATOM   84  C C   . SER A 1 13  ? 26.291 7.030  155.735 1.00 85.16  ? 11  SER A C   1 
ATOM   85  O O   . SER A 1 13  ? 25.861 6.672  156.839 1.00 86.73  ? 11  SER A O   1 
ATOM   86  C CB  . SER A 1 13  ? 26.665 5.383  153.873 1.00 84.90  ? 11  SER A CB  1 
ATOM   87  O OG  . SER A 1 13  ? 26.728 4.237  154.707 1.00 85.55  ? 11  SER A OG  1 
ATOM   88  N N   . LYS A 1 14  ? 27.269 7.922  155.596 1.00 83.03  ? 12  LYS A N   1 
ATOM   89  C CA  . LYS A 1 14  ? 27.874 8.561  156.756 1.00 81.38  ? 12  LYS A CA  1 
ATOM   90  C C   . LYS A 1 14  ? 26.835 9.386  157.509 1.00 81.83  ? 12  LYS A C   1 
ATOM   91  O O   . LYS A 1 14  ? 26.706 9.267  158.729 1.00 82.41  ? 12  LYS A O   1 
ATOM   92  C CB  . LYS A 1 14  ? 29.039 9.457  156.348 1.00 81.01  ? 12  LYS A CB  1 
ATOM   93  C CG  . LYS A 1 14  ? 30.264 8.703  155.899 1.00 87.75  ? 12  LYS A CG  1 
ATOM   94  C CD  . LYS A 1 14  ? 31.474 9.623  155.802 1.00 91.74  ? 12  LYS A CD  1 
ATOM   95  C CE  . LYS A 1 14  ? 32.694 8.863  155.289 1.00 93.84  ? 12  LYS A CE  1 
ATOM   96  N NZ  . LYS A 1 14  ? 33.925 9.693  155.339 1.00 94.57  ? 12  LYS A NZ  1 
ATOM   97  N N   . ILE A 1 15  ? 26.060 10.181 156.778 1.00 80.20  ? 13  ILE A N   1 
ATOM   98  C CA  . ILE A 1 15  ? 25.046 11.012 157.405 1.00 81.94  ? 13  ILE A CA  1 
ATOM   99  C C   . ILE A 1 15  ? 24.047 10.176 158.210 1.00 82.74  ? 13  ILE A C   1 
ATOM   100 O O   . ILE A 1 15  ? 23.592 10.610 159.258 1.00 86.62  ? 13  ILE A O   1 
ATOM   101 C CB  . ILE A 1 15  ? 24.309 11.913 156.379 1.00 84.09  ? 13  ILE A CB  1 
ATOM   102 C CG1 . ILE A 1 15  ? 23.875 13.219 157.052 1.00 87.62  ? 13  ILE A CG1 1 
ATOM   103 C CG2 . ILE A 1 15  ? 23.073 11.202 155.811 1.00 86.09  ? 13  ILE A CG2 1 
ATOM   104 C CD1 . ILE A 1 15  ? 23.182 14.203 156.114 1.00 87.13  ? 13  ILE A CD1 1 
ATOM   105 N N   . TYR A 1 16  ? 23.739 8.969  157.752 1.00 83.31  ? 14  TYR A N   1 
ATOM   106 C CA  . TYR A 1 16  ? 22.802 8.108  158.472 1.00 86.38  ? 14  TYR A CA  1 
ATOM   107 C C   . TYR A 1 16  ? 23.410 7.559  159.764 1.00 89.95  ? 14  TYR A C   1 
ATOM   108 O O   . TYR A 1 16  ? 22.828 7.701  160.842 1.00 93.46  ? 14  TYR A O   1 
ATOM   109 C CB  . TYR A 1 16  ? 22.333 6.964  157.584 1.00 83.91  ? 14  TYR A CB  1 
ATOM   110 N N   . HIS A 1 17  ? 24.598 6.967  159.662 1.00 90.77  ? 15  HIS A N   1 
ATOM   111 C CA  . HIS A 1 17  ? 25.262 6.388  160.833 1.00 89.07  ? 15  HIS A CA  1 
ATOM   112 C C   . HIS A 1 17  ? 25.560 7.425  161.895 1.00 85.93  ? 15  HIS A C   1 
ATOM   113 O O   . HIS A 1 17  ? 25.446 7.134  163.084 1.00 84.99  ? 15  HIS A O   1 
ATOM   114 C CB  . HIS A 1 17  ? 26.536 5.640  160.441 1.00 94.33  ? 15  HIS A CB  1 
ATOM   115 C CG  . HIS A 1 17  ? 26.296 4.478  159.521 1.00 102.89 ? 15  HIS A CG  1 
ATOM   116 N ND1 . HIS A 1 17  ? 27.316 3.816  158.873 1.00 104.06 ? 15  HIS A ND1 1 
ATOM   117 C CD2 . HIS A 1 17  ? 25.150 3.876  159.133 1.00 104.36 ? 15  HIS A CD2 1 
ATOM   118 C CE1 . HIS A 1 17  ? 26.811 2.857  158.122 1.00 103.08 ? 15  HIS A CE1 1 
ATOM   119 N NE2 . HIS A 1 17  ? 25.494 2.867  158.260 1.00 105.44 ? 15  HIS A NE2 1 
ATOM   120 N N   . ILE A 1 18  ? 25.937 8.632  161.477 1.00 82.06  ? 16  ILE A N   1 
ATOM   121 C CA  . ILE A 1 18  ? 26.206 9.686  162.444 1.00 79.89  ? 16  ILE A CA  1 
ATOM   122 C C   . ILE A 1 18  ? 24.878 10.233 162.966 1.00 79.69  ? 16  ILE A C   1 
ATOM   123 O O   . ILE A 1 18  ? 24.771 10.612 164.133 1.00 82.66  ? 16  ILE A O   1 
ATOM   124 C CB  . ILE A 1 18  ? 27.103 10.837 161.892 1.00 76.14  ? 16  ILE A CB  1 
ATOM   125 C CG1 . ILE A 1 18  ? 26.310 11.797 161.011 1.00 72.98  ? 16  ILE A CG1 1 
ATOM   126 C CG2 . ILE A 1 18  ? 28.296 10.267 161.153 1.00 76.33  ? 16  ILE A CG2 1 
ATOM   127 C CD1 . ILE A 1 18  ? 27.108 12.996 160.588 1.00 71.22  ? 16  ILE A CD1 1 
ATOM   128 N N   . GLU A 1 19  ? 23.858 10.244 162.112 1.00 77.73  ? 17  GLU A N   1 
ATOM   129 C CA  . GLU A 1 19  ? 22.530 10.714 162.511 1.00 77.42  ? 17  GLU A CA  1 
ATOM   130 C C   . GLU A 1 19  ? 22.083 9.817  163.662 1.00 76.14  ? 17  GLU A C   1 
ATOM   131 O O   . GLU A 1 19  ? 21.319 10.240 164.535 1.00 73.36  ? 17  GLU A O   1 
ATOM   132 C CB  . GLU A 1 19  ? 21.553 10.621 161.333 1.00 80.37  ? 17  GLU A CB  1 
ATOM   133 C CG  . GLU A 1 19  ? 20.198 11.273 161.559 1.00 82.42  ? 17  GLU A CG  1 
ATOM   134 C CD  . GLU A 1 19  ? 19.402 11.441 160.273 1.00 84.18  ? 17  GLU A CD  1 
ATOM   135 O OE1 . GLU A 1 19  ? 18.815 10.449 159.791 1.00 82.67  ? 17  GLU A OE1 1 
ATOM   136 O OE2 . GLU A 1 19  ? 19.344 12.577 159.753 1.00 85.84  ? 17  GLU A OE2 1 
ATOM   137 N N   . ASN A 1 20  ? 22.579 8.579  163.657 1.00 74.29  ? 18  ASN A N   1 
ATOM   138 C CA  . ASN A 1 20  ? 22.275 7.617  164.710 1.00 73.77  ? 18  ASN A CA  1 
ATOM   139 C C   . ASN A 1 20  ? 22.958 8.041  166.003 1.00 72.77  ? 18  ASN A C   1 
ATOM   140 O O   . ASN A 1 20  ? 22.320 8.080  167.055 1.00 71.67  ? 18  ASN A O   1 
ATOM   141 C CB  . ASN A 1 20  ? 22.727 6.214  164.316 1.00 74.14  ? 18  ASN A CB  1 
ATOM   142 C CG  . ASN A 1 20  ? 21.583 5.342  163.834 1.00 75.14  ? 18  ASN A CG  1 
ATOM   143 O OD1 . ASN A 1 20  ? 21.801 4.214  163.398 1.00 76.88  ? 18  ASN A OD1 1 
ATOM   144 N ND2 . ASN A 1 20  ? 20.350 5.851  163.929 1.00 72.27  ? 18  ASN A ND2 1 
ATOM   145 N N   . GLU A 1 21  ? 24.245 8.380  165.910 1.00 70.23  ? 19  GLU A N   1 
ATOM   146 C CA  . GLU A 1 21  ? 25.036 8.831  167.056 1.00 66.88  ? 19  GLU A CA  1 
ATOM   147 C C   . GLU A 1 21  ? 24.287 9.879  167.863 1.00 66.20  ? 19  GLU A C   1 
ATOM   148 O O   . GLU A 1 21  ? 24.184 9.770  169.086 1.00 70.47  ? 19  GLU A O   1 
ATOM   149 C CB  . GLU A 1 21  ? 26.364 9.431  166.598 1.00 63.09  ? 19  GLU A CB  1 
ATOM   150 C CG  . GLU A 1 21  ? 27.303 8.439  165.970 1.00 62.24  ? 19  GLU A CG  1 
ATOM   151 C CD  . GLU A 1 21  ? 27.813 7.422  166.956 1.00 64.20  ? 19  GLU A CD  1 
ATOM   152 O OE1 . GLU A 1 21  ? 27.029 6.543  167.384 1.00 59.22  ? 19  GLU A OE1 1 
ATOM   153 O OE2 . GLU A 1 21  ? 29.013 7.501  167.296 1.00 67.95  ? 19  GLU A OE2 1 
ATOM   154 N N   . ILE A 1 22  ? 23.775 10.895 167.178 1.00 62.24  ? 20  ILE A N   1 
ATOM   155 C CA  . ILE A 1 22  ? 23.034 11.957 167.837 1.00 60.14  ? 20  ILE A CA  1 
ATOM   156 C C   . ILE A 1 22  ? 21.866 11.404 168.661 1.00 64.30  ? 20  ILE A C   1 
ATOM   157 O O   . ILE A 1 22  ? 21.794 11.660 169.867 1.00 70.39  ? 20  ILE A O   1 
ATOM   158 C CB  . ILE A 1 22  ? 22.601 13.060 166.829 1.00 53.74  ? 20  ILE A CB  1 
ATOM   159 C CG1 . ILE A 1 22  ? 23.844 13.837 166.373 1.00 48.32  ? 20  ILE A CG1 1 
ATOM   160 C CG2 . ILE A 1 22  ? 21.585 14.023 167.456 1.00 50.37  ? 20  ILE A CG2 1 
ATOM   161 C CD1 . ILE A 1 22  ? 23.543 15.073 165.556 1.00 48.52  ? 20  ILE A CD1 1 
ATOM   162 N N   . ALA A 1 23  ? 21.003 10.587 168.057 1.00 62.79  ? 21  ALA A N   1 
ATOM   163 C CA  . ALA A 1 23  ? 19.870 10.019 168.796 1.00 62.31  ? 21  ALA A CA  1 
ATOM   164 C C   . ALA A 1 23  ? 20.378 9.212  170.006 1.00 63.54  ? 21  ALA A C   1 
ATOM   165 O O   . ALA A 1 23  ? 19.817 9.283  171.094 1.00 63.39  ? 21  ALA A O   1 
ATOM   166 C CB  . ALA A 1 23  ? 18.934 9.273  167.863 1.00 56.32  ? 21  ALA A CB  1 
ATOM   167 N N   . ARG A 1 24  ? 21.452 8.448  169.826 1.00 64.74  ? 22  ARG A N   1 
ATOM   168 C CA  . ARG A 1 24  ? 22.094 7.716  170.937 1.00 64.52  ? 22  ARG A CA  1 
ATOM   169 C C   . ARG A 1 24  ? 22.456 8.646  172.091 1.00 64.80  ? 22  ARG A C   1 
ATOM   170 O O   . ARG A 1 24  ? 22.005 8.473  173.228 1.00 63.49  ? 22  ARG A O   1 
ATOM   171 C CB  . ARG A 1 24  ? 23.363 7.031  170.413 1.00 68.56  ? 22  ARG A CB  1 
ATOM   172 C CG  . ARG A 1 24  ? 23.718 5.727  171.101 1.00 77.01  ? 22  ARG A CG  1 
ATOM   173 C CD  . ARG A 1 24  ? 23.117 4.531  170.374 1.00 84.97  ? 22  ARG A CD  1 
ATOM   174 N NE  . ARG A 1 24  ? 23.122 4.686  168.916 1.00 92.99  ? 22  ARG A NE  1 
ATOM   175 C CZ  . ARG A 1 24  ? 24.220 4.802  168.169 1.00 94.83  ? 22  ARG A CZ  1 
ATOM   176 N NH1 . ARG A 1 24  ? 25.418 4.792  168.736 1.00 95.77  ? 22  ARG A NH1 1 
ATOM   177 N NH2 . ARG A 1 24  ? 24.115 4.932  166.851 1.00 93.62  ? 22  ARG A NH2 1 
ATOM   178 N N   . ILE A 1 25  ? 23.252 9.658  171.759 1.00 60.92  ? 23  ILE A N   1 
ATOM   179 C CA  . ILE A 1 25  ? 23.706 10.659 172.705 1.00 57.66  ? 23  ILE A CA  1 
ATOM   180 C C   . ILE A 1 25  ? 22.539 11.330 173.428 1.00 58.59  ? 23  ILE A C   1 
ATOM   181 O O   . ILE A 1 25  ? 22.607 11.538 174.634 1.00 63.76  ? 23  ILE A O   1 
ATOM   182 C CB  . ILE A 1 25  ? 24.566 11.717 171.990 1.00 53.28  ? 23  ILE A CB  1 
ATOM   183 C CG1 . ILE A 1 25  ? 25.845 11.059 171.462 1.00 51.00  ? 23  ILE A CG1 1 
ATOM   184 C CG2 . ILE A 1 25  ? 24.881 12.885 172.927 1.00 53.38  ? 23  ILE A CG2 1 
ATOM   185 C CD1 . ILE A 1 25  ? 26.755 12.005 170.683 1.00 44.41  ? 23  ILE A CD1 1 
ATOM   186 N N   . LYS A 1 26  ? 21.464 11.645 172.707 1.00 57.91  ? 24  LYS A N   1 
ATOM   187 C CA  . LYS A 1 26  ? 20.296 12.285 173.322 1.00 58.10  ? 24  LYS A CA  1 
ATOM   188 C C   . LYS A 1 26  ? 19.526 11.370 174.282 1.00 57.01  ? 24  LYS A C   1 
ATOM   189 O O   . LYS A 1 26  ? 18.816 11.846 175.177 1.00 56.40  ? 24  LYS A O   1 
ATOM   190 C CB  . LYS A 1 26  ? 19.332 12.833 172.261 1.00 59.03  ? 24  LYS A CB  1 
ATOM   191 C CG  . LYS A 1 26  ? 19.895 13.940 171.383 1.00 63.63  ? 24  LYS A CG  1 
ATOM   192 C CD  . LYS A 1 26  ? 18.770 14.808 170.819 1.00 62.24  ? 24  LYS A CD  1 
ATOM   193 C CE  . LYS A 1 26  ? 17.669 13.962 170.183 1.00 62.02  ? 24  LYS A CE  1 
ATOM   194 N NZ  . LYS A 1 26  ? 16.500 14.784 169.765 1.00 59.48  ? 24  LYS A NZ  1 
ATOM   195 N N   . LYS A 1 27  ? 19.636 10.060 174.079 1.00 53.33  ? 25  LYS A N   1 
ATOM   196 C CA  . LYS A 1 27  ? 18.956 9.109  174.941 1.00 51.29  ? 25  LYS A CA  1 
ATOM   197 C C   . LYS A 1 27  ? 19.727 9.106  176.253 1.00 50.14  ? 25  LYS A C   1 
ATOM   198 O O   . LYS A 1 27  ? 19.167 9.363  177.316 1.00 47.88  ? 25  LYS A O   1 
ATOM   199 C CB  . LYS A 1 27  ? 18.973 7.716  174.323 1.00 51.49  ? 25  LYS A CB  1 
ATOM   200 C CG  . LYS A 1 27  ? 18.082 6.734  175.041 1.00 63.37  ? 25  LYS A CG  1 
ATOM   201 C CD  . LYS A 1 27  ? 18.242 5.347  174.460 1.00 71.56  ? 25  LYS A CD  1 
ATOM   202 C CE  . LYS A 1 27  ? 17.248 4.373  175.075 1.00 79.75  ? 25  LYS A CE  1 
ATOM   203 N NZ  . LYS A 1 27  ? 17.393 3.023  174.464 1.00 84.85  ? 25  LYS A NZ  1 
ATOM   204 N N   . LEU A 1 28  ? 21.024 8.835  176.162 1.00 45.79  ? 26  LEU A N   1 
ATOM   205 C CA  . LEU A 1 28  ? 21.895 8.819  177.323 1.00 41.25  ? 26  LEU A CA  1 
ATOM   206 C C   . LEU A 1 28  ? 21.746 10.132 178.097 1.00 45.39  ? 26  LEU A C   1 
ATOM   207 O O   . LEU A 1 28  ? 21.623 10.124 179.322 1.00 53.27  ? 26  LEU A O   1 
ATOM   208 C CB  . LEU A 1 28  ? 23.339 8.601  176.880 1.00 35.16  ? 26  LEU A CB  1 
ATOM   209 C CG  . LEU A 1 28  ? 24.478 8.842  177.867 1.00 43.08  ? 26  LEU A CG  1 
ATOM   210 C CD1 . LEU A 1 28  ? 25.607 7.867  177.585 1.00 39.26  ? 26  LEU A CD1 1 
ATOM   211 C CD2 . LEU A 1 28  ? 24.965 10.293 177.787 1.00 43.47  ? 26  LEU A CD2 1 
ATOM   212 N N   . ILE A 1 29  ? 21.738 11.254 177.388 1.00 40.61  ? 27  ILE A N   1 
ATOM   213 C CA  . ILE A 1 29  ? 21.582 12.551 178.035 1.00 38.67  ? 27  ILE A CA  1 
ATOM   214 C C   . ILE A 1 29  ? 20.241 12.623 178.785 1.00 42.26  ? 27  ILE A C   1 
ATOM   215 O O   . ILE A 1 29  ? 20.134 13.286 179.820 1.00 42.64  ? 27  ILE A O   1 
ATOM   216 C CB  . ILE A 1 29  ? 21.732 13.712 177.002 1.00 37.33  ? 27  ILE A CB  1 
ATOM   217 C CG1 . ILE A 1 29  ? 23.193 14.147 176.915 1.00 34.10  ? 27  ILE A CG1 1 
ATOM   218 C CG2 . ILE A 1 29  ? 20.834 14.900 177.342 1.00 38.96  ? 27  ILE A CG2 1 
ATOM   219 C CD1 . ILE A 1 29  ? 23.423 15.262 175.939 1.00 38.17  ? 27  ILE A CD1 1 
ATOM   220 N N   . GLY A 1 30  ? 19.227 11.932 178.269 1.00 45.36  ? 28  GLY A N   1 
ATOM   221 C CA  . GLY A 1 30  ? 17.923 11.929 178.912 1.00 48.77  ? 28  GLY A CA  1 
ATOM   222 C C   . GLY A 1 30  ? 18.091 11.253 180.284 1.00 53.23  ? 28  GLY A C   1 
ATOM   223 O O   . GLY A 1 30  ? 17.766 11.832 181.318 1.00 54.75  ? 28  GLY A O   1 
ATOM   224 N N   . GLU A 1 31  ? 18.635 10.024 180.266 1.00 54.46  ? 29  GLU A N   1 
ATOM   225 C CA  . GLU A 1 31  ? 18.899 9.243  181.487 1.00 52.05  ? 29  GLU A CA  1 
ATOM   226 C C   . GLU A 1 31  ? 19.663 10.035 182.548 1.00 46.85  ? 29  GLU A C   1 
ATOM   227 O O   . GLU A 1 31  ? 19.212 10.193 183.683 1.00 48.39  ? 29  GLU A O   1 
ATOM   228 C CB  . GLU A 1 31  ? 19.689 7.968  181.172 1.00 55.17  ? 29  GLU A CB  1 
ATOM   229 C CG  . GLU A 1 31  ? 19.457 7.411  179.778 1.00 64.80  ? 29  GLU A CG  1 
ATOM   230 C CD  . GLU A 1 31  ? 18.516 6.222  179.774 1.00 69.75  ? 29  GLU A CD  1 
ATOM   231 O OE1 . GLU A 1 31  ? 17.287 6.441  179.788 1.00 71.99  ? 29  GLU A OE1 1 
ATOM   232 O OE2 . GLU A 1 31  ? 19.007 5.073  179.757 1.00 72.58  ? 29  GLU A OE2 1 
ATOM   233 N N   . ALA A 1 32  ? 20.831 10.528 182.159 1.00 40.90  ? 30  ALA A N   1 
ATOM   234 C CA  . ALA A 1 32  ? 21.675 11.319 183.038 1.00 44.88  ? 30  ALA A CA  1 
ATOM   235 C C   . ALA A 1 32  ? 20.967 12.519 183.675 1.00 46.78  ? 30  ALA A C   1 
ATOM   236 O O   . ALA A 1 32  ? 21.420 13.025 184.707 1.00 50.20  ? 30  ALA A O   1 
ATOM   237 C CB  . ALA A 1 32  ? 22.920 11.774 182.297 1.00 44.02  ? 30  ALA A CB  1 
ATOM   238 N N   . ARG A 1 33  ? 19.898 13.015 183.057 1.00 46.42  ? 31  ARG A N   1 
ATOM   239 C CA  . ARG A 1 33  ? 19.169 14.133 183.649 1.00 46.32  ? 31  ARG A CA  1 
ATOM   240 C C   . ARG A 1 33  ? 18.500 13.608 184.924 1.00 47.11  ? 31  ARG A C   1 
ATOM   241 O O   . ARG A 1 33  ? 18.541 14.279 185.961 1.00 47.94  ? 31  ARG A O   1 
ATOM   242 C CB  . ARG A 1 33  ? 18.128 14.709 182.675 1.00 44.62  ? 31  ARG A CB  1 
ATOM   243 N N   . GLN A 1 34  ? 17.979 12.376 184.867 1.00 43.08  ? 32  GLN A N   1 
ATOM   244 C CA  . GLN A 1 34  ? 17.316 11.765 186.026 1.00 44.27  ? 32  GLN A CA  1 
ATOM   245 C C   . GLN A 1 34  ? 18.258 11.567 187.189 1.00 43.14  ? 32  GLN A C   1 
ATOM   246 O O   . GLN A 1 34  ? 17.999 12.054 188.288 1.00 42.70  ? 32  GLN A O   1 
ATOM   247 C CB  . GLN A 1 34  ? 16.643 10.436 185.677 1.00 48.18  ? 32  GLN A CB  1 
ATOM   248 C CG  . GLN A 1 34  ? 15.652 10.530 184.541 1.00 66.69  ? 32  GLN A CG  1 
ATOM   249 C CD  . GLN A 1 34  ? 14.636 11.649 184.714 1.00 75.44  ? 32  GLN A CD  1 
ATOM   250 O OE1 . GLN A 1 34  ? 14.871 12.634 185.416 1.00 79.82  ? 32  GLN A OE1 1 
ATOM   251 N NE2 . GLN A 1 34  ? 13.502 11.513 184.051 1.00 79.99  ? 32  GLN A NE2 1 
ATOM   252 N N   . LEU A 1 35  ? 19.372 10.891 186.941 1.00 38.57  ? 33  LEU A N   1 
ATOM   253 C CA  . LEU A 1 35  ? 20.365 10.647 187.979 1.00 35.37  ? 33  LEU A CA  1 
ATOM   254 C C   . LEU A 1 35  ? 20.867 11.961 188.600 1.00 35.25  ? 33  LEU A C   1 
ATOM   255 O O   . LEU A 1 35  ? 21.239 12.009 189.774 1.00 40.32  ? 33  LEU A O   1 
ATOM   256 C CB  . LEU A 1 35  ? 21.528 9.844  187.394 1.00 29.37  ? 33  LEU A CB  1 
ATOM   257 C CG  . LEU A 1 35  ? 22.733 9.678  188.306 1.00 32.46  ? 33  LEU A CG  1 
ATOM   258 C CD1 . LEU A 1 35  ? 22.318 8.973  189.588 1.00 35.24  ? 33  LEU A CD1 1 
ATOM   259 C CD2 . LEU A 1 35  ? 23.814 8.907  187.588 1.00 35.91  ? 33  LEU A CD2 1 
ATOM   260 N N   . LEU A 1 36  ? 20.840 13.031 187.820 1.00 38.61  ? 34  LEU A N   1 
ATOM   261 C CA  . LEU A 1 36  ? 21.303 14.336 188.286 1.00 38.01  ? 34  LEU A CA  1 
ATOM   262 C C   . LEU A 1 36  ? 20.298 14.957 189.246 1.00 35.44  ? 34  LEU A C   1 
ATOM   263 O O   . LEU A 1 36  ? 20.684 15.629 190.198 1.00 37.72  ? 34  LEU A O   1 
ATOM   264 C CB  . LEU A 1 36  ? 21.551 15.270 187.100 1.00 38.80  ? 34  LEU A CB  1 
ATOM   265 C CG  . LEU A 1 36  ? 22.847 16.062 187.231 1.00 41.69  ? 34  LEU A CG  1 
ATOM   266 C CD1 . LEU A 1 36  ? 24.037 15.159 186.948 1.00 41.23  ? 34  LEU A CD1 1 
ATOM   267 C CD2 . LEU A 1 36  ? 22.830 17.225 186.283 1.00 42.02  ? 34  LEU A CD2 1 
ATOM   268 N N   . SER A 1 37  ? 19.010 14.783 188.978 1.00 28.51  ? 35  SER A N   1 
ATOM   269 C CA  . SER A 1 37  ? 18.007 15.330 189.879 1.00 34.68  ? 35  SER A CA  1 
ATOM   270 C C   . SER A 1 37  ? 18.051 14.490 191.157 1.00 36.11  ? 35  SER A C   1 
ATOM   271 O O   . SER A 1 37  ? 17.877 15.013 192.248 1.00 39.77  ? 35  SER A O   1 
ATOM   272 C CB  . SER A 1 37  ? 16.614 15.298 189.258 1.00 29.94  ? 35  SER A CB  1 
ATOM   273 O OG  . SER A 1 37  ? 16.213 13.968 188.997 1.00 41.98  ? 35  SER A OG  1 
ATOM   274 N N   . GLY A 1 38  ? 18.317 13.193 191.012 1.00 36.50  ? 36  GLY A N   1 
ATOM   275 C CA  . GLY A 1 38  ? 18.413 12.301 192.156 1.00 34.84  ? 36  GLY A CA  1 
ATOM   276 C C   . GLY A 1 38  ? 19.568 12.700 193.063 1.00 36.78  ? 36  GLY A C   1 
ATOM   277 O O   . GLY A 1 38  ? 19.467 12.581 194.285 1.00 33.45  ? 36  GLY A O   1 
ATOM   278 N N   . ILE A 1 39  ? 20.671 13.161 192.475 1.00 32.41  ? 37  ILE A N   1 
ATOM   279 C CA  . ILE A 1 39  ? 21.818 13.595 193.258 1.00 30.07  ? 37  ILE A CA  1 
ATOM   280 C C   . ILE A 1 39  ? 21.509 14.914 193.964 1.00 32.92  ? 37  ILE A C   1 
ATOM   281 O O   . ILE A 1 39  ? 21.930 15.132 195.104 1.00 39.37  ? 37  ILE A O   1 
ATOM   282 C CB  . ILE A 1 39  ? 23.057 13.745 192.388 1.00 28.66  ? 37  ILE A CB  1 
ATOM   283 C CG1 . ILE A 1 39  ? 23.588 12.357 192.037 1.00 30.47  ? 37  ILE A CG1 1 
ATOM   284 C CG2 . ILE A 1 39  ? 24.131 14.565 193.098 1.00 22.97  ? 37  ILE A CG2 1 
ATOM   285 C CD1 . ILE A 1 39  ? 24.762 12.391 191.092 1.00 31.82  ? 37  ILE A CD1 1 
ATOM   286 N N   . VAL A 1 40  ? 20.758 15.784 193.300 1.00 29.96  ? 38  VAL A N   1 
ATOM   287 C CA  . VAL A 1 40  ? 20.401 17.063 193.896 1.00 27.61  ? 38  VAL A CA  1 
ATOM   288 C C   . VAL A 1 40  ? 19.402 16.896 195.051 1.00 29.57  ? 38  VAL A C   1 
ATOM   289 O O   . VAL A 1 40  ? 19.531 17.554 196.086 1.00 32.02  ? 38  VAL A O   1 
ATOM   290 C CB  . VAL A 1 40  ? 19.918 18.083 192.813 1.00 23.80  ? 38  VAL A CB  1 
ATOM   291 C CG1 . VAL A 1 40  ? 19.229 19.298 193.448 1.00 18.14  ? 38  VAL A CG1 1 
ATOM   292 C CG2 . VAL A 1 40  ? 21.116 18.553 192.004 1.00 19.59  ? 38  VAL A CG2 1 
ATOM   293 N N   . GLN A 1 41  ? 18.435 15.995 194.894 1.00 31.46  ? 39  GLN A N   1 
ATOM   294 C CA  . GLN A 1 41  ? 17.451 15.752 195.938 1.00 32.35  ? 39  GLN A CA  1 
ATOM   295 C C   . GLN A 1 41  ? 18.170 15.129 197.128 1.00 35.58  ? 39  GLN A C   1 
ATOM   296 O O   . GLN A 1 41  ? 17.978 15.554 198.264 1.00 36.13  ? 39  GLN A O   1 
ATOM   297 C CB  . GLN A 1 41  ? 16.356 14.825 195.444 1.00 34.08  ? 39  GLN A CB  1 
ATOM   298 C CG  . GLN A 1 41  ? 15.143 14.798 196.349 1.00 56.24  ? 39  GLN A CG  1 
ATOM   299 C CD  . GLN A 1 41  ? 14.067 13.873 195.820 1.00 70.12  ? 39  GLN A CD  1 
ATOM   300 O OE1 . GLN A 1 41  ? 14.039 13.547 194.626 1.00 75.98  ? 39  GLN A OE1 1 
ATOM   301 N NE2 . GLN A 1 41  ? 13.171 13.441 196.700 1.00 76.71  ? 39  GLN A NE2 1 
ATOM   302 N N   . GLN A 1 42  ? 19.024 14.147 196.854 1.00 33.82  ? 40  GLN A N   1 
ATOM   303 C CA  . GLN A 1 42  ? 19.807 13.468 197.882 1.00 27.91  ? 40  GLN A CA  1 
ATOM   304 C C   . GLN A 1 42  ? 20.554 14.470 198.742 1.00 29.63  ? 40  GLN A C   1 
ATOM   305 O O   . GLN A 1 42  ? 20.699 14.279 199.944 1.00 36.78  ? 40  GLN A O   1 
ATOM   306 C CB  . GLN A 1 42  ? 20.830 12.547 197.232 1.00 29.95  ? 40  GLN A CB  1 
ATOM   307 C CG  . GLN A 1 42  ? 21.707 11.810 198.215 1.00 24.70  ? 40  GLN A CG  1 
ATOM   308 C CD  . GLN A 1 42  ? 20.949 10.729 198.924 1.00 26.82  ? 40  GLN A CD  1 
ATOM   309 O OE1 . GLN A 1 42  ? 19.836 10.950 199.411 1.00 33.78  ? 40  GLN A OE1 1 
ATOM   310 N NE2 . GLN A 1 42  ? 21.506 9.529  198.928 1.00 25.88  ? 40  GLN A NE2 1 
ATOM   311 N N   . GLN A 1 43  ? 21.043 15.534 198.127 1.00 24.40  ? 41  GLN A N   1 
ATOM   312 C CA  . GLN A 1 43  ? 21.784 16.533 198.876 1.00 29.32  ? 41  GLN A CA  1 
ATOM   313 C C   . GLN A 1 43  ? 20.901 17.399 199.747 1.00 32.01  ? 41  GLN A C   1 
ATOM   314 O O   . GLN A 1 43  ? 21.356 17.917 200.765 1.00 27.54  ? 41  GLN A O   1 
ATOM   315 C CB  . GLN A 1 43  ? 22.610 17.396 197.947 1.00 29.61  ? 41  GLN A CB  1 
ATOM   316 C CG  . GLN A 1 43  ? 23.569 16.577 197.166 1.00 32.24  ? 41  GLN A CG  1 
ATOM   317 C CD  . GLN A 1 43  ? 24.742 17.371 196.736 1.00 36.32  ? 41  GLN A CD  1 
ATOM   318 O OE1 . GLN A 1 43  ? 24.603 18.347 196.009 1.00 39.71  ? 41  GLN A OE1 1 
ATOM   319 N NE2 . GLN A 1 43  ? 25.914 16.990 197.211 1.00 38.87  ? 41  GLN A NE2 1 
ATOM   320 N N   . ASN A 1 44  ? 19.656 17.603 199.326 1.00 32.80  ? 42  ASN A N   1 
ATOM   321 C CA  . ASN A 1 44  ? 18.739 18.390 200.133 1.00 32.65  ? 42  ASN A CA  1 
ATOM   322 C C   . ASN A 1 44  ? 18.420 17.558 201.386 1.00 33.20  ? 42  ASN A C   1 
ATOM   323 O O   . ASN A 1 44  ? 18.278 18.089 202.490 1.00 31.10  ? 42  ASN A O   1 
ATOM   324 C CB  . ASN A 1 44  ? 17.450 18.691 199.367 1.00 32.57  ? 42  ASN A CB  1 
ATOM   325 C CG  . ASN A 1 44  ? 16.426 19.420 200.229 1.00 40.28  ? 42  ASN A CG  1 
ATOM   326 O OD1 . ASN A 1 44  ? 15.325 18.931 200.463 1.00 45.50  ? 42  ASN A OD1 1 
ATOM   327 N ND2 . ASN A 1 44  ? 16.811 20.583 200.742 1.00 44.39  ? 42  ASN A ND2 1 
ATOM   328 N N   . ASN A 1 45  ? 18.351 16.244 201.192 1.00 28.40  ? 43  ASN A N   1 
ATOM   329 C CA  . ASN A 1 45  ? 18.069 15.304 202.256 1.00 25.37  ? 43  ASN A CA  1 
ATOM   330 C C   . ASN A 1 45  ? 19.223 15.242 203.234 1.00 29.95  ? 43  ASN A C   1 
ATOM   331 O O   . ASN A 1 45  ? 19.034 15.353 204.449 1.00 32.34  ? 43  ASN A O   1 
ATOM   332 C CB  . ASN A 1 45  ? 17.814 13.926 201.682 1.00 21.58  ? 43  ASN A CB  1 
ATOM   333 C CG  . ASN A 1 45  ? 16.388 13.746 201.249 1.00 24.03  ? 43  ASN A CG  1 
ATOM   334 O OD1 . ASN A 1 45  ? 15.507 14.533 201.606 1.00 33.17  ? 43  ASN A OD1 1 
ATOM   335 N ND2 . ASN A 1 45  ? 16.140 12.706 200.476 1.00 36.65  ? 43  ASN A ND2 1 
ATOM   336 N N   . LEU A 1 46  ? 20.428 15.087 202.700 1.00 29.05  ? 44  LEU A N   1 
ATOM   337 C CA  . LEU A 1 46  ? 21.627 15.020 203.524 1.00 27.20  ? 44  LEU A CA  1 
ATOM   338 C C   . LEU A 1 46  ? 21.784 16.294 204.365 1.00 28.70  ? 44  LEU A C   1 
ATOM   339 O O   . LEU A 1 46  ? 22.236 16.240 205.507 1.00 32.41  ? 44  LEU A O   1 
ATOM   340 C CB  . LEU A 1 46  ? 22.844 14.810 202.623 1.00 26.97  ? 44  LEU A CB  1 
ATOM   341 C CG  . LEU A 1 46  ? 23.539 13.443 202.617 1.00 30.90  ? 44  LEU A CG  1 
ATOM   342 C CD1 . LEU A 1 46  ? 22.548 12.298 202.681 1.00 29.54  ? 44  LEU A CD1 1 
ATOM   343 C CD2 . LEU A 1 46  ? 24.438 13.340 201.399 1.00 26.78  ? 44  LEU A CD2 1 
ATOM   344 N N   . LEU A 1 47  ? 21.387 17.432 203.805 1.00 25.88  ? 45  LEU A N   1 
ATOM   345 C CA  . LEU A 1 47  ? 21.477 18.714 204.506 1.00 23.76  ? 45  LEU A CA  1 
ATOM   346 C C   . LEU A 1 47  ? 20.454 18.830 205.634 1.00 26.74  ? 45  LEU A C   1 
ATOM   347 O O   . LEU A 1 47  ? 20.745 19.402 206.683 1.00 26.72  ? 45  LEU A O   1 
ATOM   348 C CB  . LEU A 1 47  ? 21.275 19.884 203.530 1.00 19.83  ? 45  LEU A CB  1 
ATOM   349 C CG  . LEU A 1 47  ? 21.285 21.286 204.150 1.00 19.81  ? 45  LEU A CG  1 
ATOM   350 C CD1 . LEU A 1 47  ? 22.608 21.546 204.831 1.00 17.59  ? 45  LEU A CD1 1 
ATOM   351 C CD2 . LEU A 1 47  ? 21.031 22.340 203.101 1.00 22.09  ? 45  LEU A CD2 1 
ATOM   352 N N   . ARG A 1 48  ? 19.245 18.335 205.395 1.00 27.71  ? 46  ARG A N   1 
ATOM   353 C CA  . ARG A 1 48  ? 18.190 18.404 206.387 1.00 27.43  ? 46  ARG A CA  1 
ATOM   354 C C   . ARG A 1 48  ? 18.515 17.537 207.572 1.00 28.88  ? 46  ARG A C   1 
ATOM   355 O O   . ARG A 1 48  ? 18.185 17.896 208.690 1.00 31.72  ? 46  ARG A O   1 
ATOM   356 C CB  . ARG A 1 48  ? 16.850 18.038 205.768 1.00 31.90  ? 46  ARG A CB  1 
ATOM   357 C CG  . ARG A 1 48  ? 16.258 19.188 204.962 1.00 40.33  ? 46  ARG A CG  1 
ATOM   358 C CD  . ARG A 1 48  ? 15.165 18.733 204.002 1.00 49.83  ? 46  ARG A CD  1 
ATOM   359 N NE  . ARG A 1 48  ? 14.039 18.078 204.667 1.00 58.36  ? 46  ARG A NE  1 
ATOM   360 C CZ  . ARG A 1 48  ? 13.270 17.148 204.101 1.00 63.95  ? 46  ARG A CZ  1 
ATOM   361 N NH1 . ARG A 1 48  ? 13.502 16.747 202.850 1.00 62.03  ? 46  ARG A NH1 1 
ATOM   362 N NH2 . ARG A 1 48  ? 12.262 16.619 204.783 1.00 66.30  ? 46  ARG A NH2 1 
ATOM   363 N N   . ALA A 1 49  ? 19.193 16.419 207.330 1.00 25.92  ? 47  ALA A N   1 
ATOM   364 C CA  . ALA A 1 49  ? 19.596 15.517 208.406 1.00 26.58  ? 47  ALA A CA  1 
ATOM   365 C C   . ALA A 1 49  ? 20.629 16.244 209.245 1.00 26.11  ? 47  ALA A C   1 
ATOM   366 O O   . ALA A 1 49  ? 20.539 16.270 210.467 1.00 31.65  ? 47  ALA A O   1 
ATOM   367 C CB  . ALA A 1 49  ? 20.198 14.247 207.844 1.00 22.14  ? 47  ALA A CB  1 
ATOM   368 N N   . ILE A 1 50  ? 21.595 16.852 208.568 1.00 26.91  ? 48  ILE A N   1 
ATOM   369 C CA  . ILE A 1 50  ? 22.660 17.619 209.211 1.00 25.92  ? 48  ILE A CA  1 
ATOM   370 C C   . ILE A 1 50  ? 22.084 18.768 210.063 1.00 26.99  ? 48  ILE A C   1 
ATOM   371 O O   . ILE A 1 50  ? 22.564 19.038 211.170 1.00 32.03  ? 48  ILE A O   1 
ATOM   372 C CB  . ILE A 1 50  ? 23.671 18.138 208.146 1.00 23.21  ? 48  ILE A CB  1 
ATOM   373 C CG1 . ILE A 1 50  ? 24.524 16.973 207.631 1.00 22.71  ? 48  ILE A CG1 1 
ATOM   374 C CG2 . ILE A 1 50  ? 24.534 19.256 208.717 1.00 23.39  ? 48  ILE A CG2 1 
ATOM   375 C CD1 . ILE A 1 50  ? 25.486 17.346 206.551 1.00 21.04  ? 48  ILE A CD1 1 
ATOM   376 N N   . GLU A 1 51  ? 21.037 19.419 209.570 1.00 26.11  ? 49  GLU A N   1 
ATOM   377 C CA  . GLU A 1 51  ? 20.402 20.498 210.314 1.00 28.36  ? 49  GLU A CA  1 
ATOM   378 C C   . GLU A 1 51  ? 19.837 19.917 211.608 1.00 29.81  ? 49  GLU A C   1 
ATOM   379 O O   . GLU A 1 51  ? 20.157 20.386 212.697 1.00 35.61  ? 49  GLU A O   1 
ATOM   380 C CB  . GLU A 1 51  ? 19.247 21.097 209.527 1.00 29.37  ? 49  GLU A CB  1 
ATOM   381 C CG  . GLU A 1 51  ? 19.580 22.292 208.715 1.00 43.03  ? 49  GLU A CG  1 
ATOM   382 C CD  . GLU A 1 51  ? 18.333 22.897 208.119 1.00 55.52  ? 49  GLU A CD  1 
ATOM   383 O OE1 . GLU A 1 51  ? 17.593 23.575 208.867 1.00 61.09  ? 49  GLU A OE1 1 
ATOM   384 O OE2 . GLU A 1 51  ? 18.084 22.693 206.910 1.00 53.39  ? 49  GLU A OE2 1 
ATOM   385 N N   . ALA A 1 52  ? 18.984 18.903 211.472 1.00 27.78  ? 50  ALA A N   1 
ATOM   386 C CA  . ALA A 1 52  ? 18.344 18.231 212.598 1.00 27.73  ? 50  ALA A CA  1 
ATOM   387 C C   . ALA A 1 52  ? 19.373 17.738 213.613 1.00 32.50  ? 50  ALA A C   1 
ATOM   388 O O   . ALA A 1 52  ? 19.191 17.905 214.835 1.00 35.77  ? 50  ALA A O   1 
ATOM   389 C CB  . ALA A 1 52  ? 17.505 17.074 212.096 1.00 23.63  ? 50  ALA A CB  1 
ATOM   390 N N   . GLN A 1 53  ? 20.474 17.177 213.123 1.00 29.18  ? 51  GLN A N   1 
ATOM   391 C CA  . GLN A 1 53  ? 21.503 16.694 214.031 1.00 29.18  ? 51  GLN A CA  1 
ATOM   392 C C   . GLN A 1 53  ? 22.113 17.821 214.820 1.00 29.83  ? 51  GLN A C   1 
ATOM   393 O O   . GLN A 1 53  ? 22.515 17.632 215.974 1.00 32.51  ? 51  GLN A O   1 
ATOM   394 C CB  . GLN A 1 53  ? 22.559 15.882 213.299 1.00 30.95  ? 51  GLN A CB  1 
ATOM   395 C CG  . GLN A 1 53  ? 22.047 14.488 212.941 1.00 34.71  ? 51  GLN A CG  1 
ATOM   396 C CD  . GLN A 1 53  ? 23.151 13.541 212.550 1.00 35.50  ? 51  GLN A CD  1 
ATOM   397 O OE1 . GLN A 1 53  ? 24.248 13.963 212.192 1.00 35.40  ? 51  GLN A OE1 1 
ATOM   398 N NE2 . GLN A 1 53  ? 22.872 12.246 212.617 1.00 40.81  ? 51  GLN A NE2 1 
ATOM   399 N N   . GLN A 1 54  ? 22.132 19.008 214.228 1.00 30.62  ? 52  GLN A N   1 
ATOM   400 C CA  . GLN A 1 54  ? 22.656 20.160 214.937 1.00 32.65  ? 52  GLN A CA  1 
ATOM   401 C C   . GLN A 1 54  ? 21.693 20.565 216.066 1.00 31.24  ? 52  GLN A C   1 
ATOM   402 O O   . GLN A 1 54  ? 22.146 20.962 217.125 1.00 31.16  ? 52  GLN A O   1 
ATOM   403 C CB  . GLN A 1 54  ? 22.911 21.329 213.985 1.00 30.08  ? 52  GLN A CB  1 
ATOM   404 C CG  . GLN A 1 54  ? 23.562 22.528 214.663 1.00 34.29  ? 52  GLN A CG  1 
ATOM   405 C CD  . GLN A 1 54  ? 24.915 22.201 215.261 1.00 36.48  ? 52  GLN A CD  1 
ATOM   406 O OE1 . GLN A 1 54  ? 25.496 21.154 214.980 1.00 43.61  ? 52  GLN A OE1 1 
ATOM   407 N NE2 . GLN A 1 54  ? 25.424 23.096 216.092 1.00 28.70  ? 52  GLN A NE2 1 
ATOM   408 N N   . HIS A 1 55  ? 20.375 20.472 215.849 1.00 32.59  ? 53  HIS A N   1 
ATOM   409 C CA  . HIS A 1 55  ? 19.426 20.831 216.905 1.00 38.84  ? 53  HIS A CA  1 
ATOM   410 C C   . HIS A 1 55  ? 19.621 19.845 218.016 1.00 39.46  ? 53  HIS A C   1 
ATOM   411 O O   . HIS A 1 55  ? 19.619 20.217 219.189 1.00 38.04  ? 53  HIS A O   1 
ATOM   412 C CB  . HIS A 1 55  ? 17.970 20.787 216.443 1.00 43.75  ? 53  HIS A CB  1 
ATOM   413 C CG  . HIS A 1 55  ? 17.613 21.866 215.470 1.00 63.98  ? 53  HIS A CG  1 
ATOM   414 N ND1 . HIS A 1 55  ? 17.735 23.211 215.771 1.00 69.16  ? 53  HIS A ND1 1 
ATOM   415 C CD2 . HIS A 1 55  ? 17.203 21.803 214.190 1.00 71.09  ? 53  HIS A CD2 1 
ATOM   416 C CE1 . HIS A 1 55  ? 17.416 23.924 214.708 1.00 70.53  ? 53  HIS A CE1 1 
ATOM   417 N NE2 . HIS A 1 55  ? 17.088 23.094 213.731 1.00 73.11  ? 53  HIS A NE2 1 
ATOM   418 N N   . LEU A 1 56  ? 19.803 18.586 217.637 1.00 37.55  ? 54  LEU A N   1 
ATOM   419 C CA  . LEU A 1 56  ? 20.030 17.533 218.603 1.00 34.61  ? 54  LEU A CA  1 
ATOM   420 C C   . LEU A 1 56  ? 21.284 17.879 219.429 1.00 36.51  ? 54  LEU A C   1 
ATOM   421 O O   . LEU A 1 56  ? 21.218 17.884 220.664 1.00 44.80  ? 54  LEU A O   1 
ATOM   422 C CB  . LEU A 1 56  ? 20.176 16.186 217.899 1.00 29.80  ? 54  LEU A CB  1 
ATOM   423 C CG  . LEU A 1 56  ? 19.634 14.993 218.685 1.00 35.65  ? 54  LEU A CG  1 
ATOM   424 C CD1 . LEU A 1 56  ? 18.145 15.185 218.960 1.00 35.38  ? 54  LEU A CD1 1 
ATOM   425 C CD2 . LEU A 1 56  ? 19.863 13.714 217.898 1.00 40.01  ? 54  LEU A CD2 1 
ATOM   426 N N   . LEU A 1 57  ? 22.387 18.242 218.765 1.00 32.35  ? 55  LEU A N   1 
ATOM   427 C CA  . LEU A 1 57  ? 23.639 18.607 219.455 1.00 29.13  ? 55  LEU A CA  1 
ATOM   428 C C   . LEU A 1 57  ? 23.460 19.814 220.380 1.00 31.32  ? 55  LEU A C   1 
ATOM   429 O O   . LEU A 1 57  ? 24.082 19.890 221.447 1.00 35.94  ? 55  LEU A O   1 
ATOM   430 C CB  . LEU A 1 57  ? 24.755 18.884 218.443 1.00 30.94  ? 55  LEU A CB  1 
ATOM   431 C CG  . LEU A 1 57  ? 25.562 17.665 217.985 1.00 34.59  ? 55  LEU A CG  1 
ATOM   432 C CD1 . LEU A 1 57  ? 26.381 17.994 216.742 1.00 30.34  ? 55  LEU A CD1 1 
ATOM   433 C CD2 . LEU A 1 57  ? 26.464 17.211 219.113 1.00 28.22  ? 55  LEU A CD2 1 
ATOM   434 N N   . GLN A 1 58  ? 22.629 20.769 219.969 1.00 30.41  ? 56  GLN A N   1 
ATOM   435 C CA  . GLN A 1 58  ? 22.369 21.939 220.805 1.00 31.35  ? 56  GLN A CA  1 
ATOM   436 C C   . GLN A 1 58  ? 21.607 21.514 222.074 1.00 29.63  ? 56  GLN A C   1 
ATOM   437 O O   . GLN A 1 58  ? 21.874 22.007 223.169 1.00 29.27  ? 56  GLN A O   1 
ATOM   438 C CB  . GLN A 1 58  ? 21.594 23.036 220.048 1.00 37.19  ? 56  GLN A CB  1 
ATOM   439 C CG  . GLN A 1 58  ? 22.388 23.759 218.959 1.00 49.64  ? 56  GLN A CG  1 
ATOM   440 C CD  . GLN A 1 58  ? 23.796 24.162 219.403 1.00 60.81  ? 56  GLN A CD  1 
ATOM   441 O OE1 . GLN A 1 58  ? 24.129 24.136 220.587 1.00 68.76  ? 56  GLN A OE1 1 
ATOM   442 N NE2 . GLN A 1 58  ? 24.627 24.548 218.443 1.00 68.74  ? 56  GLN A NE2 1 
ATOM   443 N N   . LEU A 1 59  ? 20.697 20.557 221.923 1.00 25.51  ? 57  LEU A N   1 
ATOM   444 C CA  . LEU A 1 59  ? 19.914 20.058 223.037 1.00 23.68  ? 57  LEU A CA  1 
ATOM   445 C C   . LEU A 1 59  ? 20.821 19.349 224.035 1.00 30.22  ? 57  LEU A C   1 
ATOM   446 O O   . LEU A 1 59  ? 20.656 19.487 225.250 1.00 32.51  ? 57  LEU A O   1 
ATOM   447 C CB  . LEU A 1 59  ? 18.813 19.103 222.548 1.00 20.06  ? 57  LEU A CB  1 
ATOM   448 C CG  . LEU A 1 59  ? 17.615 19.787 221.874 1.00 28.07  ? 57  LEU A CG  1 
ATOM   449 C CD1 . LEU A 1 59  ? 16.584 18.768 221.465 1.00 28.32  ? 57  LEU A CD1 1 
ATOM   450 C CD2 . LEU A 1 59  ? 17.004 20.799 222.833 1.00 29.19  ? 57  LEU A CD2 1 
ATOM   451 N N   . THR A 1 60  ? 21.802 18.609 223.542 1.00 26.72  ? 58  THR A N   1 
ATOM   452 C CA  . THR A 1 60  ? 22.677 17.904 224.459 1.00 28.07  ? 58  THR A CA  1 
ATOM   453 C C   . THR A 1 60  ? 23.689 18.802 225.194 1.00 28.37  ? 58  THR A C   1 
ATOM   454 O O   . THR A 1 60  ? 24.089 18.500 226.327 1.00 28.39  ? 58  THR A O   1 
ATOM   455 C CB  . THR A 1 60  ? 23.363 16.723 223.774 1.00 22.10  ? 58  THR A CB  1 
ATOM   456 O OG1 . THR A 1 60  ? 24.179 17.197 222.703 1.00 17.92  ? 58  THR A OG1 1 
ATOM   457 C CG2 . THR A 1 60  ? 22.312 15.733 223.221 1.00 16.15  ? 58  THR A CG2 1 
ATOM   458 N N   . VAL A 1 61  ? 24.102 19.897 224.555 1.00 29.42  ? 59  VAL A N   1 
ATOM   459 C CA  . VAL A 1 61  ? 25.043 20.835 225.178 1.00 27.11  ? 59  VAL A CA  1 
ATOM   460 C C   . VAL A 1 61  ? 24.308 21.540 226.304 1.00 27.67  ? 59  VAL A C   1 
ATOM   461 O O   . VAL A 1 61  ? 24.888 21.864 227.328 1.00 30.59  ? 59  VAL A O   1 
ATOM   462 C CB  . VAL A 1 61  ? 25.564 21.894 224.177 1.00 26.57  ? 59  VAL A CB  1 
ATOM   463 C CG1 . VAL A 1 61  ? 26.103 23.133 224.927 1.00 18.48  ? 59  VAL A CG1 1 
ATOM   464 C CG2 . VAL A 1 61  ? 26.654 21.292 223.338 1.00 23.05  ? 59  VAL A CG2 1 
ATOM   465 N N   . TRP A 1 62  ? 23.033 21.820 226.079 1.00 29.14  ? 60  TRP A N   1 
ATOM   466 C CA  . TRP A 1 62  ? 22.218 22.463 227.086 1.00 33.81  ? 60  TRP A CA  1 
ATOM   467 C C   . TRP A 1 62  ? 22.030 21.450 228.220 1.00 33.26  ? 60  TRP A C   1 
ATOM   468 O O   . TRP A 1 62  ? 22.177 21.805 229.386 1.00 37.07  ? 60  TRP A O   1 
ATOM   469 C CB  . TRP A 1 62  ? 20.880 22.913 226.488 1.00 31.08  ? 60  TRP A CB  1 
ATOM   470 C CG  . TRP A 1 62  ? 19.989 23.666 227.435 1.00 38.92  ? 60  TRP A CG  1 
ATOM   471 C CD1 . TRP A 1 62  ? 19.921 25.026 227.602 1.00 37.96  ? 60  TRP A CD1 1 
ATOM   472 C CD2 . TRP A 1 62  ? 19.006 23.104 228.315 1.00 36.94  ? 60  TRP A CD2 1 
ATOM   473 N NE1 . TRP A 1 62  ? 18.948 25.340 228.526 1.00 39.40  ? 60  TRP A NE1 1 
ATOM   474 C CE2 . TRP A 1 62  ? 18.372 24.182 228.982 1.00 38.48  ? 60  TRP A CE2 1 
ATOM   475 C CE3 . TRP A 1 62  ? 18.597 21.799 228.608 1.00 40.53  ? 60  TRP A CE3 1 
ATOM   476 C CZ2 . TRP A 1 62  ? 17.352 23.988 229.928 1.00 44.19  ? 60  TRP A CZ2 1 
ATOM   477 C CZ3 . TRP A 1 62  ? 17.583 21.602 229.553 1.00 46.94  ? 60  TRP A CZ3 1 
ATOM   478 C CH2 . TRP A 1 62  ? 16.971 22.696 230.200 1.00 45.56  ? 60  TRP A CH2 1 
ATOM   479 N N   . GLY A 1 63  ? 21.762 20.190 227.871 1.00 30.10  ? 61  GLY A N   1 
ATOM   480 C CA  . GLY A 1 63  ? 21.586 19.144 228.869 1.00 29.19  ? 61  GLY A CA  1 
ATOM   481 C C   . GLY A 1 63  ? 22.810 19.052 229.765 1.00 33.64  ? 61  GLY A C   1 
ATOM   482 O O   . GLY A 1 63  ? 22.701 19.003 230.992 1.00 35.07  ? 61  GLY A O   1 
ATOM   483 N N   . ILE A 1 64  ? 23.983 19.062 229.146 1.00 30.58  ? 62  ILE A N   1 
ATOM   484 C CA  . ILE A 1 64  ? 25.238 19.011 229.862 1.00 27.50  ? 62  ILE A CA  1 
ATOM   485 C C   . ILE A 1 64  ? 25.416 20.235 230.764 1.00 32.23  ? 62  ILE A C   1 
ATOM   486 O O   . ILE A 1 64  ? 25.773 20.078 231.927 1.00 38.20  ? 62  ILE A O   1 
ATOM   487 C CB  . ILE A 1 64  ? 26.409 18.888 228.885 1.00 25.84  ? 62  ILE A CB  1 
ATOM   488 C CG1 . ILE A 1 64  ? 26.394 17.509 228.233 1.00 25.12  ? 62  ILE A CG1 1 
ATOM   489 C CG2 . ILE A 1 64  ? 27.735 19.113 229.581 1.00 16.84  ? 62  ILE A CG2 1 
ATOM   490 C CD1 . ILE A 1 64  ? 27.624 17.260 227.358 1.00 29.40  ? 62  ILE A CD1 1 
ATOM   491 N N   . LYS A 1 65  ? 25.147 21.439 230.258 1.00 33.84  ? 63  LYS A N   1 
ATOM   492 C CA  . LYS A 1 65  ? 25.282 22.656 231.070 1.00 35.04  ? 63  LYS A CA  1 
ATOM   493 C C   . LYS A 1 65  ? 24.430 22.619 232.338 1.00 39.83  ? 63  LYS A C   1 
ATOM   494 O O   . LYS A 1 65  ? 24.870 23.067 233.407 1.00 41.37  ? 63  LYS A O   1 
ATOM   495 C CB  . LYS A 1 65  ? 24.951 23.906 230.260 1.00 33.72  ? 63  LYS A CB  1 
ATOM   496 C CG  . LYS A 1 65  ? 26.151 24.485 229.551 1.00 45.00  ? 63  LYS A CG  1 
ATOM   497 C CD  . LYS A 1 65  ? 25.775 25.749 228.787 1.00 54.33  ? 63  LYS A CD  1 
ATOM   498 C CE  . LYS A 1 65  ? 26.988 26.402 228.122 1.00 59.27  ? 63  LYS A CE  1 
ATOM   499 N NZ  . LYS A 1 65  ? 27.531 25.650 226.946 1.00 68.98  ? 63  LYS A NZ  1 
ATOM   500 N N   . GLN A 1 66  ? 23.225 22.062 232.229 1.00 38.16  ? 64  GLN A N   1 
ATOM   501 C CA  . GLN A 1 66  ? 22.337 21.959 233.382 1.00 39.41  ? 64  GLN A CA  1 
ATOM   502 C C   . GLN A 1 66  ? 22.952 21.025 234.413 1.00 40.03  ? 64  GLN A C   1 
ATOM   503 O O   . GLN A 1 66  ? 23.016 21.365 235.595 1.00 43.33  ? 64  GLN A O   1 
ATOM   504 C CB  . GLN A 1 66  ? 20.948 21.462 232.983 1.00 41.37  ? 64  GLN A CB  1 
ATOM   505 C CG  . GLN A 1 66  ? 20.210 22.369 232.009 1.00 46.06  ? 64  GLN A CG  1 
ATOM   506 C CD  . GLN A 1 66  ? 20.191 23.832 232.433 1.00 52.86  ? 64  GLN A CD  1 
ATOM   507 O OE1 . GLN A 1 66  ? 19.670 24.187 233.496 1.00 55.98  ? 64  GLN A OE1 1 
ATOM   508 N NE2 . GLN A 1 66  ? 20.764 24.691 231.593 1.00 54.15  ? 64  GLN A NE2 1 
ATOM   509 N N   . LEU A 1 67  ? 23.443 19.871 233.972 1.00 35.68  ? 65  LEU A N   1 
ATOM   510 C CA  . LEU A 1 67  ? 24.072 18.947 234.904 1.00 33.63  ? 65  LEU A CA  1 
ATOM   511 C C   . LEU A 1 67  ? 25.297 19.573 235.552 1.00 34.98  ? 65  LEU A C   1 
ATOM   512 O O   . LEU A 1 67  ? 25.658 19.199 236.657 1.00 39.11  ? 65  LEU A O   1 
ATOM   513 C CB  . LEU A 1 67  ? 24.438 17.625 234.242 1.00 27.23  ? 65  LEU A CB  1 
ATOM   514 C CG  . LEU A 1 67  ? 23.259 16.812 233.705 1.00 30.54  ? 65  LEU A CG  1 
ATOM   515 C CD1 . LEU A 1 67  ? 23.665 15.368 233.613 1.00 31.56  ? 65  LEU A CD1 1 
ATOM   516 C CD2 . LEU A 1 67  ? 22.053 16.951 234.610 1.00 27.86  ? 65  LEU A CD2 1 
ATOM   517 N N   . GLN A 1 68  ? 25.932 20.532 234.891 1.00 33.56  ? 66  GLN A N   1 
ATOM   518 C CA  . GLN A 1 68  ? 27.085 21.181 235.495 1.00 37.89  ? 66  GLN A CA  1 
ATOM   519 C C   . GLN A 1 68  ? 26.631 22.017 236.675 1.00 38.51  ? 66  GLN A C   1 
ATOM   520 O O   . GLN A 1 68  ? 27.273 22.015 237.716 1.00 42.19  ? 66  GLN A O   1 
ATOM   521 C CB  . GLN A 1 68  ? 27.787 22.082 234.507 1.00 37.45  ? 66  GLN A CB  1 
ATOM   522 C CG  . GLN A 1 68  ? 28.655 21.350 233.550 1.00 53.09  ? 66  GLN A CG  1 
ATOM   523 C CD  . GLN A 1 68  ? 28.860 22.145 232.300 1.00 60.42  ? 66  GLN A CD  1 
ATOM   524 O OE1 . GLN A 1 68  ? 29.007 23.362 232.343 1.00 66.78  ? 66  GLN A OE1 1 
ATOM   525 N NE2 . GLN A 1 68  ? 28.840 21.473 231.167 1.00 66.75  ? 66  GLN A NE2 1 
ATOM   526 N N   . ALA A 1 69  ? 25.529 22.740 236.497 1.00 39.34  ? 67  ALA A N   1 
ATOM   527 C CA  . ALA A 1 69  ? 24.977 23.586 237.551 1.00 36.54  ? 67  ALA A CA  1 
ATOM   528 C C   . ALA A 1 69  ? 24.545 22.723 238.736 1.00 40.26  ? 67  ALA A C   1 
ATOM   529 O O   . ALA A 1 69  ? 25.010 22.927 239.858 1.00 44.31  ? 67  ALA A O   1 
ATOM   530 C CB  . ALA A 1 69  ? 23.785 24.415 237.020 1.00 26.60  ? 67  ALA A CB  1 
ATOM   531 N N   . ARG A 1 70  ? 23.706 21.724 238.482 1.00 40.70  ? 68  ARG A N   1 
ATOM   532 C CA  . ARG A 1 70  ? 23.230 20.858 239.557 1.00 41.56  ? 68  ARG A CA  1 
ATOM   533 C C   . ARG A 1 70  ? 24.354 20.166 240.343 1.00 45.93  ? 68  ARG A C   1 
ATOM   534 O O   . ARG A 1 70  ? 24.289 20.078 241.570 1.00 56.02  ? 68  ARG A O   1 
ATOM   535 C CB  . ARG A 1 70  ? 22.208 19.831 239.039 1.00 38.79  ? 68  ARG A CB  1 
ATOM   536 C CG  . ARG A 1 70  ? 20.987 20.443 238.350 1.00 37.35  ? 68  ARG A CG  1 
ATOM   537 C CD  . ARG A 1 70  ? 19.715 19.634 238.618 1.00 46.91  ? 68  ARG A CD  1 
ATOM   538 N NE  . ARG A 1 70  ? 19.796 18.235 238.179 1.00 51.47  ? 68  ARG A NE  1 
ATOM   539 C CZ  . ARG A 1 70  ? 18.834 17.327 238.356 1.00 54.55  ? 68  ARG A CZ  1 
ATOM   540 N NH1 . ARG A 1 70  ? 17.712 17.659 238.973 1.00 56.50  ? 68  ARG A NH1 1 
ATOM   541 N NH2 . ARG A 1 70  ? 18.980 16.090 237.895 1.00 55.64  ? 68  ARG A NH2 1 
ATOM   542 N N   . ILE A 1 71  ? 25.396 19.701 239.664 1.00 46.79  ? 69  ILE A N   1 
ATOM   543 C CA  . ILE A 1 71  ? 26.486 19.041 240.372 1.00 45.05  ? 69  ILE A CA  1 
ATOM   544 C C   . ILE A 1 71  ? 27.367 20.061 241.078 1.00 45.95  ? 69  ILE A C   1 
ATOM   545 O O   . ILE A 1 71  ? 27.941 19.747 242.110 1.00 51.35  ? 69  ILE A O   1 
ATOM   546 C CB  . ILE A 1 71  ? 27.327 18.115 239.443 1.00 49.21  ? 69  ILE A CB  1 
ATOM   547 C CG1 . ILE A 1 71  ? 27.884 16.933 240.234 1.00 54.87  ? 69  ILE A CG1 1 
ATOM   548 C CG2 . ILE A 1 71  ? 28.479 18.869 238.812 1.00 48.98  ? 69  ILE A CG2 1 
ATOM   549 C CD1 . ILE A 1 71  ? 29.105 17.252 241.072 1.00 60.04  ? 69  ILE A CD1 1 
ATOM   550 N N   . LEU A 1 72  ? 27.492 21.266 240.531 1.00 45.60  ? 70  LEU A N   1 
ATOM   551 C CA  . LEU A 1 72  ? 28.303 22.299 241.173 1.00 48.77  ? 70  LEU A CA  1 
ATOM   552 C C   . LEU A 1 72  ? 27.670 22.647 242.519 1.00 54.58  ? 70  LEU A C   1 
ATOM   553 O O   . LEU A 1 72  ? 28.354 22.686 243.539 1.00 57.39  ? 70  LEU A O   1 
ATOM   554 C CB  . LEU A 1 72  ? 28.375 23.557 240.316 1.00 47.71  ? 70  LEU A CB  1 
ATOM   555 C CG  . LEU A 1 72  ? 28.985 24.768 241.027 1.00 50.83  ? 70  LEU A CG  1 
ATOM   556 C CD1 . LEU A 1 72  ? 30.497 24.638 241.046 1.00 47.58  ? 70  LEU A CD1 1 
ATOM   557 C CD2 . LEU A 1 72  ? 28.560 26.056 240.340 1.00 53.31  ? 70  LEU A CD2 1 
ATOM   558 N N   . ALA A 1 73  ? 26.364 22.909 242.511 1.00 57.23  ? 71  ALA A N   1 
ATOM   559 C CA  . ALA A 1 73  ? 25.623 23.242 243.726 1.00 56.98  ? 71  ALA A CA  1 
ATOM   560 C C   . ALA A 1 73  ? 25.741 22.119 244.757 1.00 58.48  ? 71  ALA A C   1 
ATOM   561 O O   . ALA A 1 73  ? 26.104 22.378 245.904 1.00 63.83  ? 71  ALA A O   1 
ATOM   562 C CB  . ALA A 1 73  ? 24.152 23.535 243.411 1.00 53.21  ? 71  ALA A CB  1 
ATOM   563 N N   . VAL A 1 74  ? 25.450 20.881 244.362 1.00 58.33  ? 72  VAL A N   1 
ATOM   564 C CA  . VAL A 1 74  ? 25.572 19.764 245.294 1.00 60.42  ? 72  VAL A CA  1 
ATOM   565 C C   . VAL A 1 74  ? 26.971 19.746 245.927 1.00 66.09  ? 72  VAL A C   1 
ATOM   566 O O   . VAL A 1 74  ? 27.081 19.546 247.135 1.00 71.90  ? 72  VAL A O   1 
ATOM   567 C CB  . VAL A 1 74  ? 25.216 18.389 244.639 1.00 58.26  ? 72  VAL A CB  1 
ATOM   568 C CG1 . VAL A 1 74  ? 25.836 17.222 245.419 1.00 49.08  ? 72  VAL A CG1 1 
ATOM   569 C CG2 . VAL A 1 74  ? 23.711 18.215 244.604 1.00 53.22  ? 72  VAL A CG2 1 
ATOM   570 N N   . GLU A 1 75  ? 28.032 20.007 245.159 1.00 67.83  ? 73  GLU A N   1 
ATOM   571 C CA  . GLU A 1 75  ? 29.365 20.015 245.771 1.00 72.39  ? 73  GLU A CA  1 
ATOM   572 C C   . GLU A 1 75  ? 29.560 21.189 246.750 1.00 75.88  ? 73  GLU A C   1 
ATOM   573 O O   . GLU A 1 75  ? 30.251 21.069 247.764 1.00 78.04  ? 73  GLU A O   1 
ATOM   574 C CB  . GLU A 1 75  ? 30.504 19.730 244.768 1.00 71.50  ? 73  GLU A CB  1 
ATOM   575 C CG  . GLU A 1 75  ? 30.561 20.635 243.544 1.00 74.28  ? 73  GLU A CG  1 
ATOM   576 C CD  . GLU A 1 75  ? 31.581 20.122 242.516 1.00 75.72  ? 73  GLU A CD  1 
ATOM   577 O OE1 . GLU A 1 75  ? 31.701 18.852 242.309 1.00 69.37  ? 73  GLU A OE1 1 
ATOM   578 O OE2 . GLU A 1 75  ? 32.319 20.950 241.861 1.00 77.44  ? 73  GLU A OE2 1 
ATOM   579 N N   . ARG A 1 76  ? 28.945 22.316 246.518 1.00 78.45  ? 74  ARG A N   1 
ATOM   580 C CA  . ARG A 1 76  ? 29.024 23.431 247.500 1.00 78.89  ? 74  ARG A CA  1 
ATOM   581 C C   . ARG A 1 76  ? 28.341 23.071 248.818 1.00 78.90  ? 74  ARG A C   1 
ATOM   582 O O   . ARG A 1 76  ? 28.908 23.257 249.904 1.00 79.46  ? 74  ARG A O   1 
ATOM   583 C CB  . ARG A 1 76  ? 28.352 24.667 246.939 1.00 82.91  ? 74  ARG A CB  1 
ATOM   584 C CG  . ARG A 1 76  ? 29.244 25.462 245.991 1.00 92.13  ? 74  ARG A CG  1 
ATOM   585 C CD  . ARG A 1 76  ? 28.564 26.730 245.483 1.00 100.30 ? 74  ARG A CD  1 
ATOM   586 N NE  . ARG A 1 76  ? 29.376 27.470 244.513 1.00 108.55 ? 74  ARG A NE  1 
ATOM   587 C CZ  . ARG A 1 76  ? 29.014 28.645 243.989 1.00 113.03 ? 74  ARG A CZ  1 
ATOM   588 N NH1 . ARG A 1 76  ? 27.856 29.224 244.334 1.00 115.47 ? 74  ARG A NH1 1 
ATOM   589 N NH2 . ARG A 1 76  ? 29.750 29.328 243.104 1.00 114.76 ? 74  ARG A NH2 1 
ATOM   590 N N   . TYR A 1 77  ? 27.128 22.573 248.703 1.00 75.59  ? 75  TYR A N   1 
ATOM   591 C CA  . TYR A 1 77  ? 26.347 22.173 249.878 1.00 72.98  ? 75  TYR A CA  1 
ATOM   592 C C   . TYR A 1 77  ? 27.222 21.284 250.773 1.00 72.58  ? 75  TYR A C   1 
ATOM   593 O O   . TYR A 1 77  ? 27.264 21.443 251.997 1.00 74.91  ? 75  TYR A O   1 
ATOM   594 C CB  . TYR A 1 77  ? 25.088 21.417 249.440 1.00 69.89  ? 75  TYR A CB  1 
ATOM   595 N N   . LEU A 1 78  ? 27.923 20.381 250.117 1.00 70.37  ? 76  LEU A N   1 
ATOM   596 C CA  . LEU A 1 78  ? 28.816 19.407 250.774 1.00 70.96  ? 76  LEU A CA  1 
ATOM   597 C C   . LEU A 1 78  ? 30.145 20.021 251.353 1.00 77.93  ? 76  LEU A C   1 
ATOM   598 O O   . LEU A 1 78  ? 30.765 19.447 252.261 1.00 85.29  ? 76  LEU A O   1 
ATOM   599 C CB  . LEU A 1 78  ? 29.309 18.368 249.756 1.00 64.97  ? 76  LEU A CB  1 
ATOM   600 C CG  . LEU A 1 78  ? 28.330 17.221 249.512 1.00 65.11  ? 76  LEU A CG  1 
ATOM   601 C CD1 . LEU A 1 78  ? 29.032 15.883 249.258 1.00 62.04  ? 76  LEU A CD1 1 
ATOM   602 C CD2 . LEU A 1 78  ? 27.386 16.979 250.688 1.00 61.69  ? 76  LEU A CD2 1 
ATOM   603 N N   . LYS A 1 79  ? 30.552 21.205 250.863 1.00 82.59  ? 77  LYS A N   1 
ATOM   604 C CA  . LYS A 1 79  ? 31.959 21.738 251.053 1.00 89.74  ? 77  LYS A CA  1 
ATOM   605 C C   . LYS A 1 79  ? 32.390 22.628 252.240 1.00 95.24  ? 77  LYS A C   1 
ATOM   606 O O   . LYS A 1 79  ? 32.196 22.209 253.405 1.00 99.15  ? 77  LYS A O   1 
ATOM   607 C CB  . LYS A 1 79  ? 32.352 22.615 249.862 1.00 87.28  ? 77  LYS A CB  1 
ATOM   608 N N   . TRP A 1 86  ? 36.842 25.229 233.196 1.00 100.64 ? 117 TRP A N   1 
ATOM   609 C CA  . TRP A 1 86  ? 35.658 24.880 232.430 1.00 99.86  ? 117 TRP A CA  1 
ATOM   610 C C   . TRP A 1 86  ? 35.505 25.827 231.205 1.00 97.04  ? 117 TRP A C   1 
ATOM   611 O O   . TRP A 1 86  ? 35.187 25.393 230.092 1.00 99.71  ? 117 TRP A O   1 
ATOM   612 C CB  . TRP A 1 86  ? 34.427 24.858 233.335 1.00 104.01 ? 117 TRP A CB  1 
ATOM   613 C CG  . TRP A 1 86  ? 33.176 24.292 232.660 1.00 112.83 ? 117 TRP A CG  1 
ATOM   614 C CD1 . TRP A 1 86  ? 32.008 24.920 232.470 1.00 115.40 ? 117 TRP A CD1 1 
ATOM   615 C CD2 . TRP A 1 86  ? 33.060 22.985 232.123 1.00 116.54 ? 117 TRP A CD2 1 
ATOM   616 N NE1 . TRP A 1 86  ? 31.137 23.998 231.807 1.00 119.90 ? 117 TRP A NE1 1 
ATOM   617 C CE2 . TRP A 1 86  ? 31.773 22.869 231.614 1.00 119.17 ? 117 TRP A CE2 1 
ATOM   618 C CE3 . TRP A 1 86  ? 33.932 21.895 232.027 1.00 116.35 ? 117 TRP A CE3 1 
ATOM   619 C CZ2 . TRP A 1 86  ? 31.293 21.705 231.004 1.00 118.39 ? 117 TRP A CZ2 1 
ATOM   620 C CZ3 . TRP A 1 86  ? 33.441 20.727 231.409 1.00 117.46 ? 117 TRP A CZ3 1 
ATOM   621 C CH2 . TRP A 1 86  ? 32.183 20.638 230.923 1.00 116.69 ? 117 TRP A CH2 1 
ATOM   622 N N   . MET A 1 87  ? 35.769 27.106 231.418 1.00 90.64  ? 118 MET A N   1 
ATOM   623 C CA  . MET A 1 87  ? 35.629 28.168 230.376 1.00 82.72  ? 118 MET A CA  1 
ATOM   624 C C   . MET A 1 87  ? 36.175 27.780 228.946 1.00 70.87  ? 118 MET A C   1 
ATOM   625 O O   . MET A 1 87  ? 35.593 28.151 227.919 1.00 66.79  ? 118 MET A O   1 
ATOM   626 C CB  . MET A 1 87  ? 36.324 29.462 230.827 1.00 93.86  ? 118 MET A CB  1 
ATOM   627 C CG  . MET A 1 87  ? 37.845 29.359 230.947 1.00 107.34 ? 118 MET A CG  1 
ATOM   628 S SD  . MET A 1 87  ? 38.582 30.900 231.461 1.00 119.79 ? 118 MET A SD  1 
ATOM   629 C CE  . MET A 1 87  ? 37.353 32.193 231.452 1.00 111.50 ? 118 MET A CE  1 
ATOM   630 N N   . GLU A 1 88  ? 37.301 27.046 228.820 1.00 60.08  ? 119 GLU A N   1 
ATOM   631 C CA  . GLU A 1 88  ? 37.857 26.663 227.453 1.00 53.23  ? 119 GLU A CA  1 
ATOM   632 C C   . GLU A 1 88  ? 36.807 25.865 226.680 1.00 48.02  ? 119 GLU A C   1 
ATOM   633 O O   . GLU A 1 88  ? 36.511 26.159 225.521 1.00 48.76  ? 119 GLU A O   1 
ATOM   634 C CB  . GLU A 1 88  ? 39.131 25.828 227.596 1.00 50.70  ? 119 GLU A CB  1 
ATOM   635 C CG  . GLU A 1 88  ? 39.818 25.550 226.252 1.00 59.88  ? 119 GLU A CG  1 
ATOM   636 C CD  . GLU A 1 88  ? 40.161 26.823 225.466 1.00 62.89  ? 119 GLU A CD  1 
ATOM   637 O OE1 . GLU A 1 88  ? 40.180 27.967 226.062 1.00 64.32  ? 119 GLU A OE1 1 
ATOM   638 O OE2 . GLU A 1 88  ? 40.433 26.752 224.205 1.00 61.03  ? 119 GLU A OE2 1 
ATOM   639 N N   . TRP A 1 89  ? 36.241 24.864 227.346 1.00 39.13  ? 120 TRP A N   1 
ATOM   640 C CA  . TRP A 1 89  ? 35.207 24.018 226.774 1.00 32.81  ? 120 TRP A CA  1 
ATOM   641 C C   . TRP A 1 89  ? 34.066 24.881 226.267 1.00 35.13  ? 120 TRP A C   1 
ATOM   642 O O   . TRP A 1 89  ? 33.490 24.611 225.210 1.00 38.77  ? 120 TRP A O   1 
ATOM   643 C CB  . TRP A 1 89  ? 34.696 23.063 227.839 1.00 24.80  ? 120 TRP A CB  1 
ATOM   644 C CG  . TRP A 1 89  ? 33.661 22.085 227.378 1.00 21.16  ? 120 TRP A CG  1 
ATOM   645 C CD1 . TRP A 1 89  ? 33.885 20.837 226.863 1.00 16.07  ? 120 TRP A CD1 1 
ATOM   646 C CD2 . TRP A 1 89  ? 32.234 22.214 227.514 1.00 20.34  ? 120 TRP A CD2 1 
ATOM   647 N NE1 . TRP A 1 89  ? 32.683 20.178 226.688 1.00 22.81  ? 120 TRP A NE1 1 
ATOM   648 C CE2 . TRP A 1 89  ? 31.657 20.998 227.079 1.00 20.79  ? 120 TRP A CE2 1 
ATOM   649 C CE3 . TRP A 1 89  ? 31.390 23.242 227.972 1.00 21.54  ? 120 TRP A CE3 1 
ATOM   650 C CZ2 . TRP A 1 89  ? 30.266 20.775 227.093 1.00 17.16  ? 120 TRP A CZ2 1 
ATOM   651 C CZ3 . TRP A 1 89  ? 30.010 23.024 227.986 1.00 20.28  ? 120 TRP A CZ3 1 
ATOM   652 C CH2 . TRP A 1 89  ? 29.463 21.797 227.547 1.00 21.56  ? 120 TRP A CH2 1 
ATOM   653 N N   . ASP A 1 90  ? 33.745 25.931 227.013 1.00 37.49  ? 121 ASP A N   1 
ATOM   654 C CA  . ASP A 1 90  ? 32.668 26.822 226.603 1.00 40.34  ? 121 ASP A CA  1 
ATOM   655 C C   . ASP A 1 90  ? 33.031 27.601 225.359 1.00 41.88  ? 121 ASP A C   1 
ATOM   656 O O   . ASP A 1 90  ? 32.171 27.882 224.528 1.00 41.46  ? 121 ASP A O   1 
ATOM   657 C CB  . ASP A 1 90  ? 32.269 27.752 227.741 1.00 35.75  ? 121 ASP A CB  1 
ATOM   658 C CG  . ASP A 1 90  ? 31.508 27.022 228.817 1.00 46.40  ? 121 ASP A CG  1 
ATOM   659 O OD1 . ASP A 1 90  ? 30.443 26.438 228.518 1.00 46.64  ? 121 ASP A OD1 1 
ATOM   660 O OD2 . ASP A 1 90  ? 31.981 27.003 229.967 1.00 54.92  ? 121 ASP A OD2 1 
ATOM   661 N N   . ARG A 1 91  ? 34.312 27.928 225.228 1.00 45.74  ? 122 ARG A N   1 
ATOM   662 C CA  . ARG A 1 91  ? 34.814 28.655 224.070 1.00 50.31  ? 122 ARG A CA  1 
ATOM   663 C C   . ARG A 1 91  ? 34.759 27.760 222.836 1.00 46.10  ? 122 ARG A C   1 
ATOM   664 O O   . ARG A 1 91  ? 34.096 28.098 221.854 1.00 44.83  ? 122 ARG A O   1 
ATOM   665 C CB  . ARG A 1 91  ? 36.254 29.104 224.299 1.00 59.34  ? 122 ARG A CB  1 
ATOM   666 C CG  . ARG A 1 91  ? 36.404 30.069 225.439 1.00 74.95  ? 122 ARG A CG  1 
ATOM   667 C CD  . ARG A 1 91  ? 37.847 30.209 225.836 1.00 85.16  ? 122 ARG A CD  1 
ATOM   668 N NE  . ARG A 1 91  ? 37.977 31.250 226.843 1.00 93.68  ? 122 ARG A NE  1 
ATOM   669 C CZ  . ARG A 1 91  ? 38.999 32.090 226.924 1.00 100.26 ? 122 ARG A CZ  1 
ATOM   670 N NH1 . ARG A 1 91  ? 40.009 32.012 226.065 1.00 103.63 ? 122 ARG A NH1 1 
ATOM   671 N NH2 . ARG A 1 91  ? 38.965 33.071 227.806 1.00 103.84 ? 122 ARG A NH2 1 
ATOM   672 N N   . GLU A 1 92  ? 35.458 26.629 222.885 1.00 37.87  ? 123 GLU A N   1 
ATOM   673 C CA  . GLU A 1 92  ? 35.475 25.713 221.762 1.00 38.43  ? 123 GLU A CA  1 
ATOM   674 C C   . GLU A 1 92  ? 34.078 25.328 221.313 1.00 39.14  ? 123 GLU A C   1 
ATOM   675 O O   . GLU A 1 92  ? 33.801 25.231 220.108 1.00 44.92  ? 123 GLU A O   1 
ATOM   676 C CB  . GLU A 1 92  ? 36.319 24.492 222.070 1.00 37.29  ? 123 GLU A CB  1 
ATOM   677 C CG  . GLU A 1 92  ? 37.788 24.713 221.751 1.00 51.26  ? 123 GLU A CG  1 
ATOM   678 C CD  . GLU A 1 92  ? 38.661 23.530 222.141 1.00 62.60  ? 123 GLU A CD  1 
ATOM   679 O OE1 . GLU A 1 92  ? 38.194 22.374 222.053 1.00 68.66  ? 123 GLU A OE1 1 
ATOM   680 O OE2 . GLU A 1 92  ? 39.822 23.752 222.548 1.00 62.96  ? 123 GLU A OE2 1 
ATOM   681 N N   . ILE A 1 93  ? 33.167 25.191 222.266 1.00 36.31  ? 124 ILE A N   1 
ATOM   682 C CA  . ILE A 1 93  ? 31.799 24.852 221.919 1.00 35.70  ? 124 ILE A CA  1 
ATOM   683 C C   . ILE A 1 93  ? 31.101 25.996 221.179 1.00 37.71  ? 124 ILE A C   1 
ATOM   684 O O   . ILE A 1 93  ? 30.377 25.765 220.202 1.00 40.42  ? 124 ILE A O   1 
ATOM   685 C CB  . ILE A 1 93  ? 30.995 24.373 223.148 1.00 32.66  ? 124 ILE A CB  1 
ATOM   686 C CG1 . ILE A 1 93  ? 31.209 22.866 223.300 1.00 32.20  ? 124 ILE A CG1 1 
ATOM   687 C CG2 . ILE A 1 93  ? 29.518 24.743 223.007 1.00 26.52  ? 124 ILE A CG2 1 
ATOM   688 C CD1 . ILE A 1 93  ? 30.167 22.193 224.056 1.00 43.04  ? 124 ILE A CD1 1 
ATOM   689 N N   . ASN A 1 94  ? 31.366 27.225 221.614 1.00 38.08  ? 125 ASN A N   1 
ATOM   690 C CA  . ASN A 1 94  ? 30.789 28.414 220.989 1.00 40.61  ? 125 ASN A CA  1 
ATOM   691 C C   . ASN A 1 94  ? 31.341 28.594 219.565 1.00 38.91  ? 125 ASN A C   1 
ATOM   692 O O   . ASN A 1 94  ? 30.582 28.877 218.635 1.00 37.38  ? 125 ASN A O   1 
ATOM   693 C CB  . ASN A 1 94  ? 31.083 29.671 221.832 1.00 44.24  ? 125 ASN A CB  1 
ATOM   694 C CG  . ASN A 1 94  ? 30.066 29.893 222.953 1.00 53.42  ? 125 ASN A CG  1 
ATOM   695 O OD1 . ASN A 1 94  ? 29.187 29.062 223.194 1.00 60.22  ? 125 ASN A OD1 1 
ATOM   696 N ND2 . ASN A 1 94  ? 30.179 31.027 223.635 1.00 53.72  ? 125 ASN A ND2 1 
ATOM   697 N N   . ASN A 1 95  ? 32.650 28.380 219.399 1.00 35.47  ? 126 ASN A N   1 
ATOM   698 C CA  . ASN A 1 95  ? 33.319 28.529 218.105 1.00 37.27  ? 126 ASN A CA  1 
ATOM   699 C C   . ASN A 1 95  ? 32.780 27.544 217.092 1.00 40.40  ? 126 ASN A C   1 
ATOM   700 O O   . ASN A 1 95  ? 32.207 27.949 216.076 1.00 39.12  ? 126 ASN A O   1 
ATOM   701 C CB  . ASN A 1 95  ? 34.828 28.359 218.239 1.00 36.65  ? 126 ASN A CB  1 
ATOM   702 C CG  . ASN A 1 95  ? 35.491 29.558 218.885 1.00 42.63  ? 126 ASN A CG  1 
ATOM   703 O OD1 . ASN A 1 95  ? 34.852 30.581 219.154 1.00 46.52  ? 126 ASN A OD1 1 
ATOM   704 N ND2 . ASN A 1 95  ? 36.780 29.440 219.144 1.00 43.11  ? 126 ASN A ND2 1 
ATOM   705 N N   . TYR A 1 96  ? 32.940 26.254 217.381 1.00 38.32  ? 127 TYR A N   1 
ATOM   706 C CA  . TYR A 1 96  ? 32.444 25.214 216.498 1.00 36.27  ? 127 TYR A CA  1 
ATOM   707 C C   . TYR A 1 96  ? 30.960 25.386 216.205 1.00 36.90  ? 127 TYR A C   1 
ATOM   708 O O   . TYR A 1 96  ? 30.489 25.054 215.118 1.00 38.04  ? 127 TYR A O   1 
ATOM   709 C CB  . TYR A 1 96  ? 32.735 23.841 217.072 1.00 35.81  ? 127 TYR A CB  1 
ATOM   710 C CG  . TYR A 1 96  ? 34.175 23.445 216.883 1.00 43.47  ? 127 TYR A CG  1 
ATOM   711 C CD1 . TYR A 1 96  ? 34.729 23.404 215.613 1.00 45.68  ? 127 TYR A CD1 1 
ATOM   712 C CD2 . TYR A 1 96  ? 34.980 23.129 217.968 1.00 48.30  ? 127 TYR A CD2 1 
ATOM   713 C CE1 . TYR A 1 96  ? 36.047 23.043 215.423 1.00 46.54  ? 127 TYR A CE1 1 
ATOM   714 C CE2 . TYR A 1 96  ? 36.303 22.770 217.789 1.00 50.95  ? 127 TYR A CE2 1 
ATOM   715 C CZ  . TYR A 1 96  ? 36.829 22.726 216.514 1.00 45.79  ? 127 TYR A CZ  1 
ATOM   716 O OH  . TYR A 1 96  ? 38.140 22.358 216.323 1.00 51.04  ? 127 TYR A OH  1 
ATOM   717 N N   . THR A 1 97  ? 30.211 25.906 217.170 1.00 39.31  ? 128 THR A N   1 
ATOM   718 C CA  . THR A 1 97  ? 28.788 26.126 216.953 1.00 36.74  ? 128 THR A CA  1 
ATOM   719 C C   . THR A 1 97  ? 28.597 27.204 215.882 1.00 36.85  ? 128 THR A C   1 
ATOM   720 O O   . THR A 1 97  ? 27.763 27.065 214.989 1.00 39.44  ? 128 THR A O   1 
ATOM   721 C CB  . THR A 1 97  ? 28.075 26.471 218.267 1.00 32.83  ? 128 THR A CB  1 
ATOM   722 O OG1 . THR A 1 97  ? 27.911 25.277 219.050 1.00 31.75  ? 128 THR A OG1 1 
ATOM   723 C CG2 . THR A 1 97  ? 26.713 27.088 217.996 1.00 30.31  ? 128 THR A CG2 1 
ATOM   724 N N   . SER A 1 98  ? 29.392 28.275 215.965 1.00 37.69  ? 129 SER A N   1 
ATOM   725 C CA  . SER A 1 98  ? 29.341 29.364 214.982 1.00 43.71  ? 129 SER A CA  1 
ATOM   726 C C   . SER A 1 98  ? 29.613 28.862 213.560 1.00 44.31  ? 129 SER A C   1 
ATOM   727 O O   . SER A 1 98  ? 28.828 29.117 212.646 1.00 39.94  ? 129 SER A O   1 
ATOM   728 C CB  . SER A 1 98  ? 30.339 30.466 215.345 1.00 44.39  ? 129 SER A CB  1 
ATOM   729 O OG  . SER A 1 98  ? 29.845 31.275 216.397 1.00 49.82  ? 129 SER A OG  1 
ATOM   730 N N   . LEU A 1 99  ? 30.703 28.108 213.411 1.00 44.43  ? 130 LEU A N   1 
ATOM   731 C CA  . LEU A 1 99  ? 31.144 27.525 212.144 1.00 43.25  ? 130 LEU A CA  1 
ATOM   732 C C   . LEU A 1 99  ? 30.032 26.689 211.486 1.00 44.33  ? 130 LEU A C   1 
ATOM   733 O O   . LEU A 1 99  ? 29.625 26.966 210.346 1.00 47.83  ? 130 LEU A O   1 
ATOM   734 C CB  . LEU A 1 99  ? 32.378 26.658 212.402 1.00 40.51  ? 130 LEU A CB  1 
ATOM   735 C CG  . LEU A 1 99  ? 33.202 26.121 211.235 1.00 40.49  ? 130 LEU A CG  1 
ATOM   736 C CD1 . LEU A 1 99  ? 33.923 27.260 210.543 1.00 39.07  ? 130 LEU A CD1 1 
ATOM   737 C CD2 . LEU A 1 99  ? 34.207 25.106 211.754 1.00 38.83  ? 130 LEU A CD2 1 
ATOM   738 N N   . ILE A 1 100 ? 29.526 25.693 212.216 1.00 38.66  ? 131 ILE A N   1 
ATOM   739 C CA  . ILE A 1 100 ? 28.464 24.817 211.720 1.00 34.60  ? 131 ILE A CA  1 
ATOM   740 C C   . ILE A 1 100 ? 27.261 25.619 211.255 1.00 36.65  ? 131 ILE A C   1 
ATOM   741 O O   . ILE A 1 100 ? 26.496 25.162 210.418 1.00 40.09  ? 131 ILE A O   1 
ATOM   742 C CB  . ILE A 1 100 ? 27.982 23.823 212.801 1.00 32.94  ? 131 ILE A CB  1 
ATOM   743 C CG1 . ILE A 1 100 ? 29.148 22.980 213.276 1.00 30.62  ? 131 ILE A CG1 1 
ATOM   744 C CG2 . ILE A 1 100 ? 26.924 22.867 212.239 1.00 31.39  ? 131 ILE A CG2 1 
ATOM   745 C CD1 . ILE A 1 100 ? 28.810 22.129 214.431 1.00 43.61  ? 131 ILE A CD1 1 
ATOM   746 N N   . HIS A 1 101 ? 27.057 26.791 211.833 1.00 38.38  ? 132 HIS A N   1 
ATOM   747 C CA  . HIS A 1 101 ? 25.933 27.601 211.414 1.00 40.86  ? 132 HIS A CA  1 
ATOM   748 C C   . HIS A 1 101 ? 26.228 28.306 210.109 1.00 37.98  ? 132 HIS A C   1 
ATOM   749 O O   . HIS A 1 101 ? 25.316 28.559 209.323 1.00 37.45  ? 132 HIS A O   1 
ATOM   750 C CB  . HIS A 1 101 ? 25.527 28.575 212.501 1.00 41.40  ? 132 HIS A CB  1 
ATOM   751 C CG  . HIS A 1 101 ? 24.755 27.921 213.594 1.00 50.50  ? 132 HIS A CG  1 
ATOM   752 N ND1 . HIS A 1 101 ? 24.851 28.306 214.910 1.00 61.93  ? 132 HIS A ND1 1 
ATOM   753 C CD2 . HIS A 1 101 ? 23.891 26.882 213.566 1.00 55.82  ? 132 HIS A CD2 1 
ATOM   754 C CE1 . HIS A 1 101 ? 24.077 27.532 215.650 1.00 62.37  ? 132 HIS A CE1 1 
ATOM   755 N NE2 . HIS A 1 101 ? 23.481 26.661 214.857 1.00 62.20  ? 132 HIS A NE2 1 
ATOM   756 N N   . SER A 1 102 ? 27.499 28.620 209.882 1.00 35.17  ? 133 SER A N   1 
ATOM   757 C CA  . SER A 1 102 ? 27.900 29.258 208.647 1.00 37.68  ? 133 SER A CA  1 
ATOM   758 C C   . SER A 1 102 ? 27.756 28.200 207.568 1.00 41.24  ? 133 SER A C   1 
ATOM   759 O O   . SER A 1 102 ? 26.926 28.344 206.670 1.00 43.21  ? 133 SER A O   1 
ATOM   760 C CB  . SER A 1 102 ? 29.347 29.727 208.718 1.00 39.48  ? 133 SER A CB  1 
ATOM   761 O OG  . SER A 1 102 ? 29.452 30.870 209.548 1.00 47.63  ? 133 SER A OG  1 
ATOM   762 N N   . LEU A 1 103 ? 28.509 27.106 207.706 1.00 37.06  ? 134 LEU A N   1 
ATOM   763 C CA  . LEU A 1 103 ? 28.472 26.014 206.743 1.00 33.84  ? 134 LEU A CA  1 
ATOM   764 C C   . LEU A 1 103 ? 27.044 25.619 206.372 1.00 36.81  ? 134 LEU A C   1 
ATOM   765 O O   . LEU A 1 103 ? 26.780 25.342 205.200 1.00 42.07  ? 134 LEU A O   1 
ATOM   766 C CB  . LEU A 1 103 ? 29.279 24.816 207.253 1.00 28.69  ? 134 LEU A CB  1 
ATOM   767 C CG  . LEU A 1 103 ? 30.789 24.755 206.966 1.00 27.04  ? 134 LEU A CG  1 
ATOM   768 C CD1 . LEU A 1 103 ? 31.345 26.070 206.451 1.00 21.54  ? 134 LEU A CD1 1 
ATOM   769 C CD2 . LEU A 1 103 ? 31.514 24.314 208.218 1.00 23.06  ? 134 LEU A CD2 1 
ATOM   770 N N   . ILE A 1 104 ? 26.115 25.668 207.333 1.00 35.81  ? 135 ILE A N   1 
ATOM   771 C CA  . ILE A 1 104 ? 24.704 25.328 207.065 1.00 36.00  ? 135 ILE A CA  1 
ATOM   772 C C   . ILE A 1 104 ? 24.019 26.429 206.252 1.00 38.86  ? 135 ILE A C   1 
ATOM   773 O O   . ILE A 1 104 ? 23.249 26.136 205.334 1.00 39.27  ? 135 ILE A O   1 
ATOM   774 C CB  . ILE A 1 104 ? 23.876 25.036 208.365 1.00 34.81  ? 135 ILE A CB  1 
ATOM   775 C CG1 . ILE A 1 104 ? 24.349 23.729 209.013 1.00 33.59  ? 135 ILE A CG1 1 
ATOM   776 C CG2 . ILE A 1 104 ? 22.364 24.897 208.042 1.00 23.24  ? 135 ILE A CG2 1 
ATOM   777 C CD1 . ILE A 1 104 ? 23.644 23.408 210.298 1.00 32.51  ? 135 ILE A CD1 1 
ATOM   778 N N   . GLU A 1 105 ? 24.289 27.685 206.590 1.00 37.74  ? 136 GLU A N   1 
ATOM   779 C CA  . GLU A 1 105 ? 23.714 28.812 205.864 1.00 41.03  ? 136 GLU A CA  1 
ATOM   780 C C   . GLU A 1 105 ? 24.197 28.702 204.397 1.00 41.14  ? 136 GLU A C   1 
ATOM   781 O O   . GLU A 1 105 ? 23.387 28.694 203.466 1.00 37.47  ? 136 GLU A O   1 
ATOM   782 C CB  . GLU A 1 105 ? 24.191 30.131 206.493 1.00 49.15  ? 136 GLU A CB  1 
ATOM   783 C CG  . GLU A 1 105 ? 23.317 31.355 206.190 1.00 63.93  ? 136 GLU A CG  1 
ATOM   784 C CD  . GLU A 1 105 ? 23.936 32.684 206.659 1.00 71.93  ? 136 GLU A CD  1 
ATOM   785 O OE1 . GLU A 1 105 ? 24.655 32.694 207.687 1.00 75.06  ? 136 GLU A OE1 1 
ATOM   786 O OE2 . GLU A 1 105 ? 23.693 33.725 206.002 1.00 74.80  ? 136 GLU A OE2 1 
ATOM   787 N N   . GLU A 1 106 ? 25.509 28.560 204.198 1.00 39.07  ? 137 GLU A N   1 
ATOM   788 C CA  . GLU A 1 106 ? 26.089 28.430 202.853 1.00 42.50  ? 137 GLU A CA  1 
ATOM   789 C C   . GLU A 1 106 ? 25.524 27.214 202.113 1.00 39.08  ? 137 GLU A C   1 
ATOM   790 O O   . GLU A 1 106 ? 25.201 27.303 200.930 1.00 38.00  ? 137 GLU A O   1 
ATOM   791 C CB  . GLU A 1 106 ? 27.610 28.326 202.923 1.00 48.74  ? 137 GLU A CB  1 
ATOM   792 C CG  . GLU A 1 106 ? 28.287 29.584 203.437 1.00 66.03  ? 137 GLU A CG  1 
ATOM   793 C CD  . GLU A 1 106 ? 29.732 29.346 203.832 1.00 76.69  ? 137 GLU A CD  1 
ATOM   794 O OE1 . GLU A 1 106 ? 30.330 28.369 203.329 1.00 83.14  ? 137 GLU A OE1 1 
ATOM   795 O OE2 . GLU A 1 106 ? 30.277 30.126 204.651 1.00 78.16  ? 137 GLU A OE2 1 
ATOM   796 N N   . SER A 1 107 ? 25.419 26.082 202.802 1.00 34.03  ? 138 SER A N   1 
ATOM   797 C CA  . SER A 1 107 ? 24.860 24.881 202.203 1.00 30.19  ? 138 SER A CA  1 
ATOM   798 C C   . SER A 1 107 ? 23.397 25.092 201.799 1.00 34.80  ? 138 SER A C   1 
ATOM   799 O O   . SER A 1 107 ? 22.906 24.437 200.880 1.00 39.88  ? 138 SER A O   1 
ATOM   800 C CB  . SER A 1 107 ? 24.964 23.704 203.170 1.00 26.36  ? 138 SER A CB  1 
ATOM   801 O OG  . SER A 1 107 ? 26.318 23.394 203.413 1.00 24.31  ? 138 SER A OG  1 
ATOM   802 N N   . GLN A 1 108 ? 22.689 25.979 202.493 1.00 40.61  ? 139 GLN A N   1 
ATOM   803 C CA  . GLN A 1 108 ? 21.287 26.252 202.165 1.00 42.71  ? 139 GLN A CA  1 
ATOM   804 C C   . GLN A 1 108 ? 21.263 27.083 200.881 1.00 39.90  ? 139 GLN A C   1 
ATOM   805 O O   . GLN A 1 108 ? 20.460 26.825 199.976 1.00 38.22  ? 139 GLN A O   1 
ATOM   806 C CB  . GLN A 1 108 ? 20.575 26.985 203.328 1.00 51.87  ? 139 GLN A CB  1 
ATOM   807 C CG  . GLN A 1 108 ? 20.405 26.151 204.619 1.00 59.89  ? 139 GLN A CG  1 
ATOM   808 C CD  . GLN A 1 108 ? 19.690 26.891 205.761 1.00 58.72  ? 139 GLN A CD  1 
ATOM   809 O OE1 . GLN A 1 108 ? 20.016 28.038 206.103 1.00 54.92  ? 139 GLN A OE1 1 
ATOM   810 N NE2 . GLN A 1 108 ? 18.726 26.216 206.374 1.00 59.63  ? 139 GLN A NE2 1 
ATOM   811 N N   . ASN A 1 109 ? 22.181 28.046 200.785 1.00 38.22  ? 140 ASN A N   1 
ATOM   812 C CA  . ASN A 1 109 ? 22.275 28.889 199.587 1.00 40.03  ? 140 ASN A CA  1 
ATOM   813 C C   . ASN A 1 109 ? 22.614 27.998 198.393 1.00 35.95  ? 140 ASN A C   1 
ATOM   814 O O   . ASN A 1 109 ? 21.840 27.913 197.439 1.00 33.85  ? 140 ASN A O   1 
ATOM   815 C CB  . ASN A 1 109 ? 23.328 29.996 199.751 1.00 44.58  ? 140 ASN A CB  1 
ATOM   816 C CG  . ASN A 1 109 ? 22.829 31.143 200.608 1.00 52.99  ? 140 ASN A CG  1 
ATOM   817 O OD1 . ASN A 1 109 ? 21.625 31.253 200.864 1.00 57.39  ? 140 ASN A OD1 1 
ATOM   818 N ND2 . ASN A 1 109 ? 23.736 31.997 201.059 1.00 51.98  ? 140 ASN A ND2 1 
ATOM   819 N N   . GLN A 1 110 ? 23.732 27.281 198.489 1.00 29.96  ? 141 GLN A N   1 
ATOM   820 C CA  . GLN A 1 110 ? 24.173 26.372 197.443 1.00 28.20  ? 141 GLN A CA  1 
ATOM   821 C C   . GLN A 1 110 ? 23.052 25.439 197.001 1.00 31.20  ? 141 GLN A C   1 
ATOM   822 O O   . GLN A 1 110 ? 22.943 25.125 195.811 1.00 38.27  ? 141 GLN A O   1 
ATOM   823 C CB  . GLN A 1 110 ? 25.378 25.551 197.901 1.00 29.63  ? 141 GLN A CB  1 
ATOM   824 C CG  . GLN A 1 110 ? 26.717 26.030 197.334 1.00 42.73  ? 141 GLN A CG  1 
ATOM   825 C CD  . GLN A 1 110 ? 26.884 25.737 195.839 1.00 47.24  ? 141 GLN A CD  1 
ATOM   826 O OE1 . GLN A 1 110 ? 26.316 26.414 194.989 1.00 40.35  ? 141 GLN A OE1 1 
ATOM   827 N NE2 . GLN A 1 110 ? 27.689 24.729 195.524 1.00 49.58  ? 141 GLN A NE2 1 
ATOM   828 N N   . GLN A 1 111 ? 22.182 25.042 197.930 1.00 27.63  ? 142 GLN A N   1 
ATOM   829 C CA  . GLN A 1 111 ? 21.089 24.141 197.574 1.00 29.32  ? 142 GLN A CA  1 
ATOM   830 C C   . GLN A 1 111 ? 19.996 24.807 196.751 1.00 34.72  ? 142 GLN A C   1 
ATOM   831 O O   . GLN A 1 111 ? 19.329 24.148 195.940 1.00 33.57  ? 142 GLN A O   1 
ATOM   832 C CB  . GLN A 1 111 ? 20.480 23.488 198.802 1.00 25.26  ? 142 GLN A CB  1 
ATOM   833 C CG  . GLN A 1 111 ? 19.436 22.418 198.460 1.00 24.35  ? 142 GLN A CG  1 
ATOM   834 C CD  . GLN A 1 111 ? 20.035 21.158 197.841 1.00 30.90  ? 142 GLN A CD  1 
ATOM   835 O OE1 . GLN A 1 111 ? 21.240 20.902 197.932 1.00 31.00  ? 142 GLN A OE1 1 
ATOM   836 N NE2 . GLN A 1 111 ? 19.184 20.352 197.234 1.00 28.98  ? 142 GLN A NE2 1 
ATOM   837 N N   . GLU A 1 112 ? 19.769 26.094 196.992 1.00 38.21  ? 143 GLU A N   1 
ATOM   838 C CA  . GLU A 1 112 ? 18.770 26.826 196.225 1.00 42.19  ? 143 GLU A CA  1 
ATOM   839 C C   . GLU A 1 112 ? 19.253 27.010 194.784 1.00 41.91  ? 143 GLU A C   1 
ATOM   840 O O   . GLU A 1 112 ? 18.496 26.777 193.854 1.00 45.86  ? 143 GLU A O   1 
ATOM   841 C CB  . GLU A 1 112 ? 18.492 28.184 196.856 1.00 46.99  ? 143 GLU A CB  1 
ATOM   842 C CG  . GLU A 1 112 ? 17.538 28.126 198.019 1.00 57.28  ? 143 GLU A CG  1 
ATOM   843 C CD  . GLU A 1 112 ? 17.320 29.479 198.645 1.00 66.73  ? 143 GLU A CD  1 
ATOM   844 O OE1 . GLU A 1 112 ? 17.480 30.500 197.927 1.00 62.19  ? 143 GLU A OE1 1 
ATOM   845 O OE2 . GLU A 1 112 ? 16.991 29.512 199.858 1.00 69.31  ? 143 GLU A OE2 1 
ATOM   846 N N   . LYS A 1 113 ? 20.508 27.426 194.600 1.00 39.98  ? 144 LYS A N   1 
ATOM   847 C CA  . LYS A 1 113 ? 21.066 27.623 193.261 1.00 40.08  ? 144 LYS A CA  1 
ATOM   848 C C   . LYS A 1 113 ? 20.963 26.334 192.478 1.00 34.79  ? 144 LYS A C   1 
ATOM   849 O O   . LYS A 1 113 ? 20.311 26.294 191.445 1.00 36.05  ? 144 LYS A O   1 
ATOM   850 C CB  . LYS A 1 113 ? 22.536 28.033 193.325 1.00 50.38  ? 144 LYS A CB  1 
ATOM   851 C CG  . LYS A 1 113 ? 22.795 29.371 193.988 1.00 61.58  ? 144 LYS A CG  1 
ATOM   852 C CD  . LYS A 1 113 ? 24.278 29.719 193.914 1.00 69.81  ? 144 LYS A CD  1 
ATOM   853 C CE  . LYS A 1 113 ? 24.606 30.889 194.826 1.00 72.96  ? 144 LYS A CE  1 
ATOM   854 N NZ  . LYS A 1 113 ? 26.052 31.248 194.784 1.00 74.84  ? 144 LYS A NZ  1 
ATOM   855 N N   . ASN A 1 114 ? 21.613 25.283 192.968 1.00 27.88  ? 145 ASN A N   1 
ATOM   856 C CA  . ASN A 1 114 ? 21.587 23.988 192.301 1.00 27.68  ? 145 ASN A CA  1 
ATOM   857 C C   . ASN A 1 114 ? 20.189 23.558 191.922 1.00 30.65  ? 145 ASN A C   1 
ATOM   858 O O   . ASN A 1 114 ? 20.001 22.942 190.874 1.00 37.32  ? 145 ASN A O   1 
ATOM   859 C CB  . ASN A 1 114 ? 22.203 22.896 193.172 1.00 27.49  ? 145 ASN A CB  1 
ATOM   860 C CG  . ASN A 1 114 ? 23.671 23.108 193.394 1.00 30.70  ? 145 ASN A CG  1 
ATOM   861 O OD1 . ASN A 1 114 ? 24.248 24.085 192.926 1.00 39.81  ? 145 ASN A OD1 1 
ATOM   862 N ND2 . ASN A 1 114 ? 24.294 22.193 194.117 1.00 30.74  ? 145 ASN A ND2 1 
ATOM   863 N N   . GLU A 1 115 ? 19.204 23.859 192.764 1.00 32.25  ? 146 GLU A N   1 
ATOM   864 C CA  . GLU A 1 115 ? 17.833 23.467 192.452 1.00 33.97  ? 146 GLU A CA  1 
ATOM   865 C C   . GLU A 1 115 ? 17.281 24.372 191.340 1.00 34.38  ? 146 GLU A C   1 
ATOM   866 O O   . GLU A 1 115 ? 16.545 23.921 190.455 1.00 34.54  ? 146 GLU A O   1 
ATOM   867 C CB  . GLU A 1 115 ? 16.975 23.403 193.722 1.00 39.78  ? 146 GLU A CB  1 
ATOM   868 C CG  . GLU A 1 115 ? 17.400 22.280 194.666 1.00 44.96  ? 146 GLU A CG  1 
ATOM   869 C CD  . GLU A 1 115 ? 16.443 22.096 195.840 1.00 46.17  ? 146 GLU A CD  1 
ATOM   870 O OE1 . GLU A 1 115 ? 15.627 23.041 196.158 1.00 49.34  ? 146 GLU A OE1 1 
ATOM   871 O OE2 . GLU A 1 115 ? 16.454 20.997 196.510 1.00 43.20  ? 146 GLU A OE2 1 
ATOM   872 N N   . GLN A 1 116 ? 17.664 25.633 191.368 1.00 35.46  ? 147 GLN A N   1 
ATOM   873 C CA  . GLN A 1 116 ? 17.239 26.600 190.332 1.00 42.10  ? 147 GLN A CA  1 
ATOM   874 C C   . GLN A 1 116 ? 17.808 26.241 188.943 1.00 41.62  ? 147 GLN A C   1 
ATOM   875 O O   . GLN A 1 116 ? 17.083 26.184 187.934 1.00 36.40  ? 147 GLN A O   1 
ATOM   876 C CB  . GLN A 1 116 ? 17.683 28.015 190.714 1.00 49.82  ? 147 GLN A CB  1 
ATOM   877 C CG  . GLN A 1 116 ? 16.900 29.117 189.983 1.00 70.68  ? 147 GLN A CG  1 
ATOM   878 C CD  . GLN A 1 116 ? 15.387 29.094 190.257 1.00 85.24  ? 147 GLN A CD  1 
ATOM   879 O OE1 . GLN A 1 116 ? 14.929 28.397 191.161 1.00 90.67  ? 147 GLN A OE1 1 
ATOM   880 N NE2 . GLN A 1 116 ? 14.574 29.826 189.514 1.00 90.66  ? 147 GLN A NE2 1 
ATOM   881 N N   . GLU A 1 117 ? 19.115 26.005 188.908 1.00 39.29  ? 148 GLU A N   1 
ATOM   882 C CA  . GLU A 1 117 ? 19.801 25.633 187.688 1.00 37.63  ? 148 GLU A CA  1 
ATOM   883 C C   . GLU A 1 117 ? 19.254 24.331 187.135 1.00 36.64  ? 148 GLU A C   1 
ATOM   884 O O   . GLU A 1 117 ? 19.063 24.206 185.922 1.00 43.58  ? 148 GLU A O   1 
ATOM   885 C CB  . GLU A 1 117 ? 21.308 25.557 187.929 1.00 37.67  ? 148 GLU A CB  1 
ATOM   886 C CG  . GLU A 1 117 ? 21.937 26.943 187.979 1.00 50.07  ? 148 GLU A CG  1 
ATOM   887 C CD  . GLU A 1 117 ? 23.427 26.929 188.247 1.00 56.99  ? 148 GLU A CD  1 
ATOM   888 O OE1 . GLU A 1 117 ? 24.114 25.941 187.898 1.00 63.36  ? 148 GLU A OE1 1 
ATOM   889 O OE2 . GLU A 1 117 ? 23.927 27.931 188.801 1.00 63.16  ? 148 GLU A OE2 1 
ATOM   890 N N   . LEU A 1 118 ? 18.955 23.381 188.018 1.00 35.35  ? 149 LEU A N   1 
ATOM   891 C CA  . LEU A 1 118 ? 18.390 22.094 187.600 1.00 32.55  ? 149 LEU A CA  1 
ATOM   892 C C   . LEU A 1 118 ? 16.994 22.329 187.042 1.00 33.08  ? 149 LEU A C   1 
ATOM   893 O O   . LEU A 1 118 ? 16.534 21.596 186.179 1.00 37.33  ? 149 LEU A O   1 
ATOM   894 C CB  . LEU A 1 118 ? 18.324 21.105 188.765 1.00 25.27  ? 149 LEU A CB  1 
ATOM   895 C CG  . LEU A 1 118 ? 17.635 19.789 188.403 1.00 26.41  ? 149 LEU A CG  1 
ATOM   896 C CD1 . LEU A 1 118 ? 18.380 19.072 187.275 1.00 18.54  ? 149 LEU A CD1 1 
ATOM   897 C CD2 . LEU A 1 118 ? 17.565 18.914 189.620 1.00 25.94  ? 149 LEU A CD2 1 
ATOM   898 N N   . LEU A 1 119 ? 16.313 23.337 187.564 1.00 35.12  ? 150 LEU A N   1 
ATOM   899 C CA  . LEU A 1 119 ? 14.984 23.671 187.093 1.00 35.84  ? 150 LEU A CA  1 
ATOM   900 C C   . LEU A 1 119 ? 15.114 24.332 185.698 1.00 41.35  ? 150 LEU A C   1 
ATOM   901 O O   . LEU A 1 119 ? 14.357 24.013 184.783 1.00 43.14  ? 150 LEU A O   1 
ATOM   902 C CB  . LEU A 1 119 ? 14.305 24.605 188.096 1.00 27.93  ? 150 LEU A CB  1 
ATOM   903 C CG  . LEU A 1 119 ? 12.813 24.821 187.901 1.00 25.22  ? 150 LEU A CG  1 
ATOM   904 C CD1 . LEU A 1 119 ? 12.062 23.566 188.313 1.00 20.02  ? 150 LEU A CD1 1 
ATOM   905 C CD2 . LEU A 1 119 ? 12.379 26.007 188.723 1.00 24.00  ? 150 LEU A CD2 1 
ATOM   906 N N   . GLU A 1 120 ? 16.098 25.218 185.529 1.00 43.36  ? 151 GLU A N   1 
ATOM   907 C CA  . GLU A 1 120 ? 16.329 25.898 184.244 1.00 41.45  ? 151 GLU A CA  1 
ATOM   908 C C   . GLU A 1 120 ? 16.606 24.902 183.110 1.00 39.95  ? 151 GLU A C   1 
ATOM   909 O O   . GLU A 1 120 ? 16.219 25.125 181.953 1.00 40.70  ? 151 GLU A O   1 
ATOM   910 C CB  . GLU A 1 120 ? 17.521 26.856 184.333 1.00 42.82  ? 151 GLU A CB  1 
ATOM   911 C CG  . GLU A 1 120 ? 17.424 27.825 185.513 1.00 52.87  ? 151 GLU A CG  1 
ATOM   912 C CD  . GLU A 1 120 ? 16.279 28.830 185.369 1.00 59.95  ? 151 GLU A CD  1 
ATOM   913 O OE1 . GLU A 1 120 ? 15.785 29.082 184.205 1.00 63.33  ? 151 GLU A OE1 1 
ATOM   914 O OE2 . GLU A 1 120 ? 15.809 29.424 186.413 1.00 66.89  ? 151 GLU A OE2 1 
ATOM   915 N N   . LEU A 1 121 ? 17.263 23.822 183.471 1.00 40.13  ? 152 LEU A N   1 
ATOM   916 C CA  . LEU A 1 121 ? 17.680 22.786 182.512 1.00 39.91  ? 152 LEU A CA  1 
ATOM   917 C C   . LEU A 1 121 ? 16.485 22.124 181.783 1.00 47.47  ? 152 LEU A C   1 
ATOM   918 O O   . LEU A 1 121 ? 16.600 21.690 180.628 1.00 49.12  ? 152 LEU A O   1 
ATOM   919 C CB  . LEU A 1 121 ? 18.473 21.683 183.226 1.00 34.31  ? 152 LEU A CB  1 
ATOM   920 C CG  . LEU A 1 121 ? 19.992 21.917 183.212 1.00 34.41  ? 152 LEU A CG  1 
ATOM   921 C CD1 . LEU A 1 121 ? 20.803 20.626 183.361 1.00 36.10  ? 152 LEU A CD1 1 
ATOM   922 C CD2 . LEU A 1 121 ? 20.492 22.567 181.919 1.00 36.34  ? 152 LEU A CD2 1 
ATOM   923 N N   . ASP A 1 122 ? 15.310 22.035 182.421 1.00 50.66  ? 153 ASP A N   1 
ATOM   924 C CA  . ASP A 1 122 ? 14.174 21.321 181.770 1.00 54.23  ? 153 ASP A CA  1 
ATOM   925 C C   . ASP A 1 122 ? 13.687 22.079 180.479 1.00 58.29  ? 153 ASP A C   1 
ATOM   926 O O   . ASP A 1 122 ? 13.067 21.492 179.586 1.00 60.96  ? 153 ASP A O   1 
ATOM   927 C CB  . ASP A 1 122 ? 13.089 20.893 182.784 1.00 50.83  ? 153 ASP A CB  1 
ATOM   928 C CG  . ASP A 1 122 ? 12.225 21.993 183.380 1.00 51.16  ? 153 ASP A CG  1 
ATOM   929 O OD1 . ASP A 1 122 ? 12.358 23.203 182.987 1.00 54.39  ? 153 ASP A OD1 1 
ATOM   930 O OD2 . ASP A 1 122 ? 11.353 21.688 184.288 1.00 47.37  ? 153 ASP A OD2 1 
ATOM   931 N N   . LYS A 1 123 ? 13.890 23.417 180.318 1.00 64.09  ? 154 LYS A N   1 
ATOM   932 C CA  . LYS A 1 123 ? 13.770 23.985 178.914 1.00 70.61  ? 154 LYS A CA  1 
ATOM   933 C C   . LYS A 1 123 ? 14.911 23.135 178.338 1.00 73.06  ? 154 LYS A C   1 
ATOM   934 O O   . LYS A 1 123 ? 14.606 22.208 177.535 1.00 66.74  ? 154 LYS A O   1 
ATOM   935 C CB  . LYS A 1 123 ? 14.003 25.497 178.932 1.00 73.46  ? 154 LYS A CB  1 
HETATM 936 O O   . HOH B 2 .   ? 17.048 14.187 175.869 1.00 48.87  ? 161 HOH A O   1 
HETATM 937 O O   . HOH B 2 .   ? 17.006 22.005 204.004 1.00 49.89  ? 162 HOH A O   1 
HETATM 938 O O   . HOH B 2 .   ? 22.703 20.563 195.675 1.00 36.05  ? 165 HOH A O   1 
HETATM 939 O O   . HOH B 2 .   ? 25.419 25.836 191.128 1.00 52.25  ? 166 HOH A O   1 
HETATM 940 O O   . HOH B 2 .   ? 15.862 19.723 208.958 1.00 37.13  ? 169 HOH A O   1 
HETATM 941 O O   . HOH B 2 .   ? 13.521 18.888 207.752 1.00 37.91  ? 170 HOH A O   1 
HETATM 942 O O   . HOH B 2 .   ? 24.814 14.620 222.669 1.00 29.56  ? 171 HOH A O   1 
HETATM 943 O O   . HOH B 2 .   ? 24.141 7.654  143.060 1.00 67.95  ? 179 HOH A O   1 
HETATM 944 O O   . HOH B 2 .   ? 15.568 21.124 211.563 1.00 55.62  ? 183 HOH A O   1 
HETATM 945 O O   . HOH B 2 .   ? 15.263 18.524 195.528 1.00 51.25  ? 184 HOH A O   1 
HETATM 946 O O   . HOH B 2 .   ? 19.475 28.328 208.834 1.00 39.97  ? 186 HOH A O   1 
HETATM 947 O O   . HOH B 2 .   ? 39.201 28.501 222.243 1.00 62.89  ? 187 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -1  ?   ?   ?   A . n 
A 1 2   LYS 2   0   ?   ?   ?   A . n 
A 1 3   GLN 3   1   1   GLN GLN A . n 
A 1 4   ILE 4   2   2   ILE ILE A . n 
A 1 5   GLU 5   3   3   GLU GLU A . n 
A 1 6   ASP 6   4   4   ASP ASP A . n 
A 1 7   LYS 7   5   5   LYS LYS A . n 
A 1 8   ILE 8   6   6   ILE ILE A . n 
A 1 9   GLU 9   7   7   GLU GLU A . n 
A 1 10  GLU 10  8   8   GLU GLU A . n 
A 1 11  ILE 11  9   9   ILE ILE A . n 
A 1 12  LEU 12  10  10  LEU LEU A . n 
A 1 13  SER 13  11  11  SER SER A . n 
A 1 14  LYS 14  12  12  LYS LYS A . n 
A 1 15  ILE 15  13  13  ILE ILE A . n 
A 1 16  TYR 16  14  14  TYR TYR A . n 
A 1 17  HIS 17  15  15  HIS HIS A . n 
A 1 18  ILE 18  16  16  ILE ILE A . n 
A 1 19  GLU 19  17  17  GLU GLU A . n 
A 1 20  ASN 20  18  18  ASN ASN A . n 
A 1 21  GLU 21  19  19  GLU GLU A . n 
A 1 22  ILE 22  20  20  ILE ILE A . n 
A 1 23  ALA 23  21  21  ALA ALA A . n 
A 1 24  ARG 24  22  22  ARG ARG A . n 
A 1 25  ILE 25  23  23  ILE ILE A . n 
A 1 26  LYS 26  24  24  LYS LYS A . n 
A 1 27  LYS 27  25  25  LYS LYS A . n 
A 1 28  LEU 28  26  26  LEU LEU A . n 
A 1 29  ILE 29  27  27  ILE ILE A . n 
A 1 30  GLY 30  28  28  GLY GLY A . n 
A 1 31  GLU 31  29  29  GLU GLU A . n 
A 1 32  ALA 32  30  30  ALA ALA A . n 
A 1 33  ARG 33  31  31  ARG ARG A . n 
A 1 34  GLN 34  32  32  GLN GLN A . n 
A 1 35  LEU 35  33  33  LEU LEU A . n 
A 1 36  LEU 36  34  34  LEU LEU A . n 
A 1 37  SER 37  35  35  SER SER A . n 
A 1 38  GLY 38  36  36  GLY GLY A . n 
A 1 39  ILE 39  37  37  ILE ILE A . n 
A 1 40  VAL 40  38  38  VAL VAL A . n 
A 1 41  GLN 41  39  39  GLN GLN A . n 
A 1 42  GLN 42  40  40  GLN GLN A . n 
A 1 43  GLN 43  41  41  GLN GLN A . n 
A 1 44  ASN 44  42  42  ASN ASN A . n 
A 1 45  ASN 45  43  43  ASN ASN A . n 
A 1 46  LEU 46  44  44  LEU LEU A . n 
A 1 47  LEU 47  45  45  LEU LEU A . n 
A 1 48  ARG 48  46  46  ARG ARG A . n 
A 1 49  ALA 49  47  47  ALA ALA A . n 
A 1 50  ILE 50  48  48  ILE ILE A . n 
A 1 51  GLU 51  49  49  GLU GLU A . n 
A 1 52  ALA 52  50  50  ALA ALA A . n 
A 1 53  GLN 53  51  51  GLN GLN A . n 
A 1 54  GLN 54  52  52  GLN GLN A . n 
A 1 55  HIS 55  53  53  HIS HIS A . n 
A 1 56  LEU 56  54  54  LEU LEU A . n 
A 1 57  LEU 57  55  55  LEU LEU A . n 
A 1 58  GLN 58  56  56  GLN GLN A . n 
A 1 59  LEU 59  57  57  LEU LEU A . n 
A 1 60  THR 60  58  58  THR THR A . n 
A 1 61  VAL 61  59  59  VAL VAL A . n 
A 1 62  TRP 62  60  60  TRP TRP A . n 
A 1 63  GLY 63  61  61  GLY GLY A . n 
A 1 64  ILE 64  62  62  ILE ILE A . n 
A 1 65  LYS 65  63  63  LYS LYS A . n 
A 1 66  GLN 66  64  64  GLN GLN A . n 
A 1 67  LEU 67  65  65  LEU LEU A . n 
A 1 68  GLN 68  66  66  GLN GLN A . n 
A 1 69  ALA 69  67  67  ALA ALA A . n 
A 1 70  ARG 70  68  68  ARG ARG A . n 
A 1 71  ILE 71  69  69  ILE ILE A . n 
A 1 72  LEU 72  70  70  LEU LEU A . n 
A 1 73  ALA 73  71  71  ALA ALA A . n 
A 1 74  VAL 74  72  72  VAL VAL A . n 
A 1 75  GLU 75  73  73  GLU GLU A . n 
A 1 76  ARG 76  74  74  ARG ARG A . n 
A 1 77  TYR 77  75  75  TYR TYR A . n 
A 1 78  LEU 78  76  76  LEU LEU A . n 
A 1 79  LYS 79  77  77  LYS LYS A . n 
A 1 80  ASP 80  111 ?   ?   ?   A . n 
A 1 81  GLN 81  112 ?   ?   ?   A . n 
A 1 82  ASN 82  113 ?   ?   ?   A . n 
A 1 83  ASN 83  114 ?   ?   ?   A . n 
A 1 84  MET 84  115 ?   ?   ?   A . n 
A 1 85  THR 85  116 ?   ?   ?   A . n 
A 1 86  TRP 86  117 117 TRP TRP A . n 
A 1 87  MET 87  118 118 MET MET A . n 
A 1 88  GLU 88  119 119 GLU GLU A . n 
A 1 89  TRP 89  120 120 TRP TRP A . n 
A 1 90  ASP 90  121 121 ASP ASP A . n 
A 1 91  ARG 91  122 122 ARG ARG A . n 
A 1 92  GLU 92  123 123 GLU GLU A . n 
A 1 93  ILE 93  124 124 ILE ILE A . n 
A 1 94  ASN 94  125 125 ASN ASN A . n 
A 1 95  ASN 95  126 126 ASN ASN A . n 
A 1 96  TYR 96  127 127 TYR TYR A . n 
A 1 97  THR 97  128 128 THR THR A . n 
A 1 98  SER 98  129 129 SER SER A . n 
A 1 99  LEU 99  130 130 LEU LEU A . n 
A 1 100 ILE 100 131 131 ILE ILE A . n 
A 1 101 HIS 101 132 132 HIS HIS A . n 
A 1 102 SER 102 133 133 SER SER A . n 
A 1 103 LEU 103 134 134 LEU LEU A . n 
A 1 104 ILE 104 135 135 ILE ILE A . n 
A 1 105 GLU 105 136 136 GLU GLU A . n 
A 1 106 GLU 106 137 137 GLU GLU A . n 
A 1 107 SER 107 138 138 SER SER A . n 
A 1 108 GLN 108 139 139 GLN GLN A . n 
A 1 109 ASN 109 140 140 ASN ASN A . n 
A 1 110 GLN 110 141 141 GLN GLN A . n 
A 1 111 GLN 111 142 142 GLN GLN A . n 
A 1 112 GLU 112 143 143 GLU GLU A . n 
A 1 113 LYS 113 144 144 LYS LYS A . n 
A 1 114 ASN 114 145 145 ASN ASN A . n 
A 1 115 GLU 115 146 146 GLU GLU A . n 
A 1 116 GLN 116 147 147 GLN GLN A . n 
A 1 117 GLU 117 148 148 GLU GLU A . n 
A 1 118 LEU 118 149 149 LEU LEU A . n 
A 1 119 LEU 119 150 150 LEU LEU A . n 
A 1 120 GLU 120 151 151 GLU GLU A . n 
A 1 121 LEU 121 152 152 LEU LEU A . n 
A 1 122 ASP 122 153 153 ASP ASP A . n 
A 1 123 LYS 123 154 154 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  161 161 HOH HOH A . 
B 2 HOH 2  162 162 HOH HOH A . 
B 2 HOH 3  165 165 HOH HOH A . 
B 2 HOH 4  166 166 HOH HOH A . 
B 2 HOH 5  169 169 HOH HOH A . 
B 2 HOH 6  170 170 HOH HOH A . 
B 2 HOH 7  171 171 HOH HOH A . 
B 2 HOH 8  179 179 HOH HOH A . 
B 2 HOH 9  183 183 HOH HOH A . 
B 2 HOH 10 184 184 HOH HOH A . 
B 2 HOH 11 186 186 HOH HOH A . 
B 2 HOH 12 187 187 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12370 ? 
1 MORE         -124  ? 
1 'SSA (A^2)'  18890 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -y+1,x-y,z    -0.5000000000 -0.8660254038 0.0000000000 52.3500000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038  0.0000000000 26.1750000000 -0.8660254038 
-0.5000000000 0.0000000000 45.3364298881 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-11-19 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-06-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' Other                       
6 4 'Structure model' 'Source and taxonomy'       
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_name_com      
2 4 'Structure model' entity_src_gen       
3 4 'Structure model' pdbx_database_status 
4 4 'Structure model' struct_ref           
5 4 'Structure model' struct_ref_seq       
6 4 'Structure model' struct_ref_seq_dif   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_database_status.process_site'   
2 4 'Structure model' '_struct_ref.db_code'                  
3 4 'Structure model' '_struct_ref.pdbx_align_begin'         
4 4 'Structure model' '_struct_ref.pdbx_db_accession'        
5 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' 3.1 ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
X-PLOR    phasing          3.1 ? 5 
# 
_pdbx_entry_details.entry_id             1ENV 
_pdbx_entry_details.compound_details     
;THIS STRUCTURE IS A CHIMERA.  IT STARTS AT THE N-TERMINUS
WITH 31 RESIDUES FROM YEAST GCN4 FOLLOWED BY 50 RESIDUES
FROM GP41 AND 42 ADDITIONAL RESIDUES FROM GP41, FOR A
A TOTAL OF 123 RESIDUES AS SHOWN ON SEQRES.  115 OF THESE
RESIDUES WERE LOCATED AND ARE PRESENTED IN THIS ENTRY.
DBREF RECORDS BELOW CAN BE USED TO ASSOCIATE THE RESIDUES
PRESENT IN THIS ENTRY WITH THE CORRESPONDING SWISSPROT
ENTRY.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 74  ? ? CZ A ARG 74  ? ? NH2 A ARG 74  ? ? 123.98 120.30 3.68   0.50 N 
2 1 CG A MET 118 ? ? SD A MET 118 ? ? CE  A MET 118 ? ? 109.88 100.20 9.68   1.60 N 
3 1 N  A LYS 154 ? ? CA A LYS 154 ? ? C   A LYS 154 ? ? 94.65  111.00 -16.35 2.70 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 7   ? CG  ? A GLU 9   CG  
2  1 Y 1 A GLU 7   ? CD  ? A GLU 9   CD  
3  1 Y 1 A GLU 7   ? OE1 ? A GLU 9   OE1 
4  1 Y 1 A GLU 7   ? OE2 ? A GLU 9   OE2 
5  1 Y 1 A TYR 14  ? CG  ? A TYR 16  CG  
6  1 Y 1 A TYR 14  ? CD1 ? A TYR 16  CD1 
7  1 Y 1 A TYR 14  ? CD2 ? A TYR 16  CD2 
8  1 Y 1 A TYR 14  ? CE1 ? A TYR 16  CE1 
9  1 Y 1 A TYR 14  ? CE2 ? A TYR 16  CE2 
10 1 Y 1 A TYR 14  ? CZ  ? A TYR 16  CZ  
11 1 Y 1 A TYR 14  ? OH  ? A TYR 16  OH  
12 1 Y 1 A ARG 31  ? CG  ? A ARG 33  CG  
13 1 Y 1 A ARG 31  ? CD  ? A ARG 33  CD  
14 1 Y 1 A ARG 31  ? NE  ? A ARG 33  NE  
15 1 Y 1 A ARG 31  ? CZ  ? A ARG 33  CZ  
16 1 Y 1 A ARG 31  ? NH1 ? A ARG 33  NH1 
17 1 Y 1 A ARG 31  ? NH2 ? A ARG 33  NH2 
18 1 Y 1 A TYR 75  ? CG  ? A TYR 77  CG  
19 1 Y 1 A TYR 75  ? CD1 ? A TYR 77  CD1 
20 1 Y 1 A TYR 75  ? CD2 ? A TYR 77  CD2 
21 1 Y 1 A TYR 75  ? CE1 ? A TYR 77  CE1 
22 1 Y 1 A TYR 75  ? CE2 ? A TYR 77  CE2 
23 1 Y 1 A TYR 75  ? CZ  ? A TYR 77  CZ  
24 1 Y 1 A TYR 75  ? OH  ? A TYR 77  OH  
25 1 Y 1 A LYS 77  ? CG  ? A LYS 79  CG  
26 1 Y 1 A LYS 77  ? CD  ? A LYS 79  CD  
27 1 Y 1 A LYS 77  ? CE  ? A LYS 79  CE  
28 1 Y 1 A LYS 77  ? NZ  ? A LYS 79  NZ  
29 1 Y 1 A LYS 154 ? CG  ? A LYS 123 CG  
30 1 Y 1 A LYS 154 ? CD  ? A LYS 123 CD  
31 1 Y 1 A LYS 154 ? CE  ? A LYS 123 CE  
32 1 Y 1 A LYS 154 ? NZ  ? A LYS 123 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET -1  ? A MET 1  
2 1 Y 1 A LYS 0   ? A LYS 2  
3 1 Y 1 A ASP 111 ? A ASP 80 
4 1 Y 1 A GLN 112 ? A GLN 81 
5 1 Y 1 A ASN 113 ? A ASN 82 
6 1 Y 1 A ASN 114 ? A ASN 83 
7 1 Y 1 A MET 115 ? A MET 84 
8 1 Y 1 A THR 116 ? A THR 85 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#