data_1EQT
# 
_entry.id   1EQT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EQT         
RCSB  RCSB010830   
WWPDB D_1000010830 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1b3a 
_pdbx_database_related.details        AOP-RANTES 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EQT 
_pdbx_database_status.recvd_initial_deposition_date   2000-04-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hoover, D.M.'      1 
'Shaw, J.'          2 
'Gryczynski, Z.'    3 
'Proudfoot, A.E.I.' 4 
'Wells, T.'         5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The Crystal Structure of MET-RANTES: Comparison with Native RANTES and AOP-RANTES'                                
'PROTEIN PEPT.LETT.' 7   73   82   2000 PPELEN NE 0929-8665 2077 ? -1 ?                               
1       'Total Chemical Synthesis and High-resolution Crystal Structure of the Potent anti-HIV Protein AOP-RANTES'         
Chem.Biol.           6   43   51   1999 CBOLE2 UK 1074-5521 2050 ? ?  '10.1016/S1074-5521(99)80019-2' 
2       'Extension of Recombinant Human RANTES by the Retention of the Initiating Methionine Produces a Potent Antagonist' 
J.Biol.Chem.         271 2599 2603 1996 JBCHA3 US 0021-9258 0071 ? ?  10.1074/jbc.271.5.2599          
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hoover, D.M.'      1  
primary 'Shaw, J.'          2  
primary 'Gryczynski, Z.'    3  
primary 'Proudfoot, A.E.I.' 4  
primary 'Wells, T.'         5  
1       'Wilken, J.'        6  
1       'Hoover, D.'        7  
1       'Thompson, D.A.'    8  
1       'Barlow, P.N.'      9  
1       'McSparron, H.'     10 
1       'Picard, L.'        11 
1       'Wlodawer, A.'      12 
1       'Lubkowski, J.'     13 
1       'Kent, S.B.'        14 
2       'Proudfoot, A.E.'   15 
2       'Power, C.A.'       16 
2       'Hoogewerf, A.J.'   17 
2       'Montjovent, M.O.'  18 
2       'Borlat, F.'        19 
2       'Offord, R.E.'      20 
2       'Wells, T.N.'       21 
# 
_cell.entry_id           1EQT 
_cell.length_a           24.019 
_cell.length_b           56.809 
_cell.length_c           93.863 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EQT 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'T-CELL SPECIFIC RANTES PROTEIN' 7884.104 2   ? ? ? ? 
2 non-polymer syn 'SULFATE ION'                    96.063   2   ? ? ? ? 
3 water       nat water                            18.015   187 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SMALL INDUCIBLE CYTOKINE A5' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MGYSSDTTPCCFAYIARPMPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 
_entity_poly.pdbx_seq_one_letter_code_can   MGYSSDTTPCCFAYIARPMPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  TYR n 
1 4  SER n 
1 5  SER n 
1 6  ASP n 
1 7  THR n 
1 8  THR n 
1 9  PRO n 
1 10 CYS n 
1 11 CYS n 
1 12 PHE n 
1 13 ALA n 
1 14 TYR n 
1 15 ILE n 
1 16 ALA n 
1 17 ARG n 
1 18 PRO n 
1 19 MET n 
1 20 PRO n 
1 21 ARG n 
1 22 ALA n 
1 23 HIS n 
1 24 ILE n 
1 25 LYS n 
1 26 GLU n 
1 27 TYR n 
1 28 PHE n 
1 29 TYR n 
1 30 THR n 
1 31 SER n 
1 32 GLY n 
1 33 LYS n 
1 34 CYS n 
1 35 SER n 
1 36 ASN n 
1 37 PRO n 
1 38 ALA n 
1 39 VAL n 
1 40 VAL n 
1 41 PHE n 
1 42 VAL n 
1 43 THR n 
1 44 ARG n 
1 45 LYS n 
1 46 ASN n 
1 47 ARG n 
1 48 GLN n 
1 49 VAL n 
1 50 CYS n 
1 51 ALA n 
1 52 ASN n 
1 53 PRO n 
1 54 GLU n 
1 55 LYS n 
1 56 LYS n 
1 57 TRP n 
1 58 VAL n 
1 59 ARG n 
1 60 GLU n 
1 61 TYR n 
1 62 ILE n 
1 63 ASN n 
1 64 SER n 
1 65 LEU n 
1 66 GLU n 
1 67 MET n 
1 68 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    BLOOD 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PT7-7 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    CCL5_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P13501 
_struct_ref.pdbx_align_begin           24 
_struct_ref.pdbx_seq_one_letter_code   SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EQT A 2 ? 68 ? P13501 25 ? 91 ? 2 68 
2 1 1EQT B 2 ? 68 ? P13501 25 ? 91 ? 2 68 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1EQT MET A 1  ? UNP P13501 ?   ?  'SEE REMARK 999' 1  1 
1 1EQT GLY A 2  ? UNP P13501 PRO 25 CONFLICT         2  2 
1 1EQT MET A 19 ? UNP P13501 LEU 42 CONFLICT         19 3 
2 1EQT MET B 1  ? UNP P13501 ?   ?  'SEE REMARK 999' 1  4 
2 1EQT GLY B 2  ? UNP P13501 PRO 25 CONFLICT         2  5 
2 1EQT MET B 19 ? UNP P13501 LEU 42 CONFLICT         19 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EQT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.03 
_exptl_crystal.density_percent_sol   39.39 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
;PEG 35000, ammonium sulfate, sodium succinate, MES, sodium acetate, ethanol, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 295.0K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-01-23 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             0.98 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EQT 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            1.6 
_reflns.number_obs                   17136 
_reflns.number_all                   44155 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            0.039 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.3 
_reflns.B_iso_Wilson_estimate        20.0 
_reflns.pdbx_redundancy              2.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.6 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   96.0 
_reflns_shell.Rmerge_I_obs           0.42 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1650 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1EQT 
_refine.ls_number_reflns_obs                     16548 
_refine.ls_number_reflns_all                     17136 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    84.2 
_refine.ls_R_factor_obs                          0.178 
_refine.ls_R_factor_all                          0.178 
_refine.ls_R_factor_R_work                       0.1868 
_refine.ls_R_factor_R_free                       0.2513 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  1655 
_refine.ls_number_parameters                     513 
_refine.ls_number_restraints                     451 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'RANTES (NMR MODEL 1RTN)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1EQT 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          0. 
_refine_analyze.occupancy_sum_non_hydrogen      1281. 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1084 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             187 
_refine_hist.number_atoms_total               1281 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d  0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d 0.024 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1EQT 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.186 
_pdbx_refine.free_R_factor_no_cutoff                     0.251 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     10. 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            165 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.177 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.238 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   10. 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          142 
_pdbx_refine.number_reflns_obs_4sig_cutoff               1428 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1EQT 
_struct.title                     MET-RANTES 
_struct.pdbx_descriptor           'T-CELL SPECIFIC RANTES PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EQT 
_struct_keywords.pdbx_keywords   CYTOKINE 
_struct_keywords.text            'CHEMOATTRACTANT, CYTOKINE, RANTES' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is likely a dimer constructed of both chain A and B.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 20 ? ALA A 22 ? PRO A 20 ALA A 22 5 ? 3  
HELX_P HELX_P2 2 LYS A 55 ? MET A 67 ? LYS A 55 MET A 67 1 ? 13 
HELX_P HELX_P3 3 PRO B 20 ? ALA B 22 ? PRO B 20 ALA B 22 5 ? 3  
HELX_P HELX_P4 4 LYS B 55 ? SER B 68 ? LYS B 55 SER B 68 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 10 A CYS 34 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 11 A CYS 50 1_555 ? ? ? ? ? ? ? 2.062 ? 
disulf3 disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 34 SG ? ? B CYS 10 B CYS 34 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf4 disulf ? ? B CYS 11 SG ? ? ? 1_555 B CYS 50 SG ? ? B CYS 11 B CYS 50 1_555 ? ? ? ? ? ? ? 2.043 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 8  ? CYS A 10 ? THR A 8  CYS A 10 
A 2 THR B 8  ? CYS B 10 ? THR B 8  CYS B 10 
B 1 ILE A 24 ? TYR A 29 ? ILE A 24 TYR A 29 
B 2 VAL A 39 ? THR A 43 ? VAL A 39 THR A 43 
B 3 GLN A 48 ? ALA A 51 ? GLN A 48 ALA A 51 
C 1 ILE B 24 ? TYR B 29 ? ILE B 24 TYR B 29 
C 2 VAL B 39 ? THR B 43 ? VAL B 39 THR B 43 
C 3 GLN B 48 ? ALA B 51 ? GLN B 48 ALA B 51 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 10 ? N CYS A 10 O THR B 8  ? O THR B 8  
B 1 2 O PHE A 28 ? O PHE A 28 N VAL A 40 ? N VAL A 40 
B 2 3 N PHE A 41 ? N PHE A 41 O VAL A 49 ? O VAL A 49 
C 1 2 O PHE B 28 ? O PHE B 28 N VAL B 40 ? N VAL B 40 
C 2 3 N PHE B 41 ? N PHE B 41 O VAL B 49 ? O VAL B 49 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 A 198' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 B 199' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 TYR A 3  ? TYR A 3    . ? 1_555 ? 
2  AC1 10 SER A 31 ? SER A 31   . ? 1_555 ? 
3  AC1 10 GLY A 32 ? GLY A 32   . ? 1_555 ? 
4  AC1 10 LYS A 33 ? LYS A 33   . ? 1_555 ? 
5  AC1 10 HOH E .  ? HOH A 1030 . ? 3_745 ? 
6  AC1 10 HOH E .  ? HOH A 1116 . ? 1_555 ? 
7  AC1 10 HOH E .  ? HOH A 1123 . ? 1_555 ? 
8  AC1 10 HOH E .  ? HOH A 1125 . ? 1_555 ? 
9  AC1 10 SER B 31 ? SER B 31   . ? 1_655 ? 
10 AC1 10 GLY B 32 ? GLY B 32   . ? 1_655 ? 
11 AC2 8  HIS B 23 ? HIS B 23   . ? 1_555 ? 
12 AC2 8  THR B 43 ? THR B 43   . ? 1_555 ? 
13 AC2 8  ARG B 44 ? ARG B 44   . ? 1_555 ? 
14 AC2 8  LYS B 45 ? LYS B 45   . ? 1_555 ? 
15 AC2 8  ARG B 47 ? ARG B 47   . ? 1_555 ? 
16 AC2 8  MET B 67 ? MET B 67   . ? 1_655 ? 
17 AC2 8  SER B 68 ? SER B 68   . ? 1_655 ? 
18 AC2 8  HOH F .  ? HOH B 1095 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EQT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1EQT 
_atom_sites.fract_transf_matrix[1][1]   0.041634 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017603 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010654 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 2  ? 28.698 23.549 41.665 1.00 86.80  ? 2    GLY A N   1 
ATOM   2    C CA  . GLY A 1 2  ? 28.358 24.508 42.694 1.00 68.82  ? 2    GLY A CA  1 
ATOM   3    C C   . GLY A 1 2  ? 28.592 25.946 42.287 1.00 59.82  ? 2    GLY A C   1 
ATOM   4    O O   . GLY A 1 2  ? 29.715 26.459 42.275 1.00 69.99  ? 2    GLY A O   1 
ATOM   5    N N   . TYR A 1 3  ? 27.528 26.663 41.926 1.00 41.11  ? 3    TYR A N   1 
ATOM   6    C CA  . TYR A 1 3  ? 27.763 28.050 41.510 1.00 51.28  ? 3    TYR A CA  1 
ATOM   7    C C   . TYR A 1 3  ? 26.970 29.029 42.365 1.00 37.11  ? 3    TYR A C   1 
ATOM   8    O O   . TYR A 1 3  ? 26.379 28.637 43.377 1.00 32.43  ? 3    TYR A O   1 
ATOM   9    C CB  . TYR A 1 3  ? 27.393 28.215 40.040 1.00 65.66  ? 3    TYR A CB  1 
ATOM   10   C CG  . TYR A 1 3  ? 28.339 29.080 39.246 1.00 71.93  ? 3    TYR A CG  1 
ATOM   11   C CD1 . TYR A 1 3  ? 29.354 28.503 38.494 1.00 85.89  ? 3    TYR A CD1 1 
ATOM   12   C CD2 . TYR A 1 3  ? 28.219 30.462 39.243 1.00 73.07  ? 3    TYR A CD2 1 
ATOM   13   C CE1 . TYR A 1 3  ? 30.232 29.278 37.759 1.00 91.41  ? 3    TYR A CE1 1 
ATOM   14   C CE2 . TYR A 1 3  ? 29.091 31.246 38.511 1.00 84.82  ? 3    TYR A CE2 1 
ATOM   15   C CZ  . TYR A 1 3  ? 30.094 30.651 37.771 1.00 91.52  ? 3    TYR A CZ  1 
ATOM   16   O OH  . TYR A 1 3  ? 30.967 31.426 37.038 1.00 90.14  ? 3    TYR A OH  1 
ATOM   17   N N   . SER A 1 4  ? 26.959 30.297 41.957 1.00 28.35  ? 4    SER A N   1 
ATOM   18   C CA  . SER A 1 4  ? 26.189 31.275 42.707 1.00 29.33  ? 4    SER A CA  1 
ATOM   19   C C   . SER A 1 4  ? 24.708 30.862 42.759 1.00 26.86  ? 4    SER A C   1 
ATOM   20   O O   . SER A 1 4  ? 24.192 30.277 41.793 1.00 23.08  ? 4    SER A O   1 
ATOM   21   C CB  . SER A 1 4  ? 26.240 32.688 42.130 1.00 22.67  ? 4    SER A CB  1 
ATOM   22   O OG  . SER A 1 4  ? 27.533 33.246 42.301 1.00 59.44  ? 4    SER A OG  1 
ATOM   23   N N   . SER A 1 5  ? 24.151 31.226 43.910 1.00 21.71  ? 5    SER A N   1 
ATOM   24   C CA  . SER A 1 5  ? 22.711 31.043 44.110 1.00 23.50  ? 5    SER A CA  1 
ATOM   25   C C   . SER A 1 5  ? 22.038 32.388 43.889 1.00 19.11  ? 5    SER A C   1 
ATOM   26   O O   . SER A 1 5  ? 20.846 32.561 44.152 1.00 19.02  ? 5    SER A O   1 
ATOM   27   C CB  . SER A 1 5  ? 22.326 30.471 45.468 1.00 24.57  ? 5    SER A CB  1 
ATOM   28   O OG  . SER A 1 5  ? 22.921 31.190 46.520 1.00 32.04  ? 5    SER A OG  1 
ATOM   29   N N   . ASP A 1 6  ? 22.838 33.324 43.358 1.00 20.75  ? 6    ASP A N   1 
ATOM   30   C CA  . ASP A 1 6  ? 22.205 34.628 43.078 1.00 21.54  ? 6    ASP A CA  1 
ATOM   31   C C   . ASP A 1 6  ? 21.496 34.576 41.731 1.00 20.41  ? 6    ASP A C   1 
ATOM   32   O O   . ASP A 1 6  ? 21.872 33.758 40.869 1.00 17.80  ? 6    ASP A O   1 
ATOM   33   C CB  . ASP A 1 6  ? 23.265 35.726 43.102 1.00 24.17  ? 6    ASP A CB  1 
ATOM   34   C CG  . ASP A 1 6  ? 23.826 35.831 44.529 1.00 34.16  ? 6    ASP A CG  1 
ATOM   35   O OD1 . ASP A 1 6  ? 25.058 35.820 44.671 1.00 69.51  ? 6    ASP A OD1 1 
ATOM   36   O OD2 . ASP A 1 6  ? 23.019 35.913 45.484 1.00 40.43  ? 6    ASP A OD2 1 
ATOM   37   N N   . THR A 1 7  ? 20.496 35.434 41.543 1.00 17.12  ? 7    THR A N   1 
ATOM   38   C CA  . THR A 1 7  ? 19.883 35.431 40.206 1.00 13.21  ? 7    THR A CA  1 
ATOM   39   C C   . THR A 1 7  ? 20.880 36.009 39.205 1.00 16.96  ? 7    THR A C   1 
ATOM   40   O O   . THR A 1 7  ? 21.815 36.735 39.576 1.00 20.70  ? 7    THR A O   1 
ATOM   41   C CB  . THR A 1 7  ? 18.588 36.254 40.122 1.00 15.23  ? 7    THR A CB  1 
ATOM   42   O OG1 . THR A 1 7  ? 18.907 37.584 40.558 1.00 20.19  ? 7    THR A OG1 1 
ATOM   43   C CG2 . THR A 1 7  ? 17.514 35.693 41.034 1.00 17.33  ? 7    THR A CG2 1 
ATOM   44   N N   . THR A 1 8  ? 20.650 35.734 37.921 1.00 15.16  ? 8    THR A N   1 
ATOM   45   C CA  . THR A 1 8  ? 21.460 36.411 36.884 1.00 15.90  ? 8    THR A CA  1 
ATOM   46   C C   . THR A 1 8  ? 20.539 36.752 35.711 1.00 12.81  ? 8    THR A C   1 
ATOM   47   O O   . THR A 1 8  ? 19.624 35.959 35.415 1.00 13.37  ? 8    THR A O   1 
ATOM   48   C CB  . THR A 1 8  ? 22.670 35.546 36.506 1.00 21.81  ? 8    THR A CB  1 
ATOM   49   O OG1 . THR A 1 8  ? 23.557 36.298 35.655 1.00 19.03  ? 8    THR A OG1 1 
ATOM   50   C CG2 . THR A 1 8  ? 22.237 34.301 35.748 1.00 20.13  ? 8    THR A CG2 1 
ATOM   51   N N   . PRO A 1 9  ? 20.676 37.885 35.040 1.00 12.18  ? 9    PRO A N   1 
ATOM   52   C CA  . PRO A 1 9  ? 19.726 38.242 33.995 1.00 12.98  ? 9    PRO A CA  1 
ATOM   53   C C   . PRO A 1 9  ? 19.928 37.439 32.716 1.00 14.67  ? 9    PRO A C   1 
ATOM   54   O O   . PRO A 1 9  ? 21.061 37.279 32.230 1.00 16.75  ? 9    PRO A O   1 
ATOM   55   C CB  . PRO A 1 9  ? 20.025 39.731 33.752 1.00 16.57  ? 9    PRO A CB  1 
ATOM   56   C CG  . PRO A 1 9  ? 21.477 39.861 34.085 1.00 17.29  ? 9    PRO A CG  1 
ATOM   57   C CD  . PRO A 1 9  ? 21.713 38.920 35.237 1.00 14.97  ? 9    PRO A CD  1 
ATOM   58   N N   . CYS A 1 10 ? 18.807 36.971 32.186 1.00 12.39  ? 10   CYS A N   1 
ATOM   59   C CA  . CYS A 1 10 ? 18.800 36.330 30.878 1.00 11.91  ? 10   CYS A CA  1 
ATOM   60   C C   . CYS A 1 10 ? 17.852 37.048 29.914 1.00 17.32  ? 10   CYS A C   1 
ATOM   61   O O   . CYS A 1 10 ? 16.946 37.768 30.359 1.00 15.17  ? 10   CYS A O   1 
ATOM   62   C CB  . CYS A 1 10 ? 18.388 34.858 31.031 1.00 13.09  ? 10   CYS A CB  1 
ATOM   63   S SG  . CYS A 1 10 ? 19.533 33.830 31.993 1.00 14.91  ? 10   CYS A SG  1 
ATOM   64   N N   . CYS A 1 11 ? 18.043 36.817 28.613 1.00 13.86  ? 11   CYS A N   1 
ATOM   65   C CA  . CYS A 1 11 ? 17.224 37.370 27.549 1.00 11.95  ? 11   CYS A CA  1 
ATOM   66   C C   . CYS A 1 11 ? 16.383 36.315 26.832 1.00 18.08  ? 11   CYS A C   1 
ATOM   67   O O   . CYS A 1 11 ? 16.847 35.195 26.601 1.00 15.52  ? 11   CYS A O   1 
ATOM   68   C CB  . CYS A 1 11 ? 18.140 38.032 26.510 1.00 15.18  ? 11   CYS A CB  1 
ATOM   69   S SG  . CYS A 1 11 ? 18.922 39.545 27.196 1.00 14.72  ? 11   CYS A SG  1 
ATOM   70   N N   . PHE A 1 12 ? 15.150 36.672 26.469 1.00 16.82  ? 12   PHE A N   1 
ATOM   71   C CA  . PHE A 1 12 ? 14.277 35.714 25.770 1.00 18.65  ? 12   PHE A CA  1 
ATOM   72   C C   . PHE A 1 12 ? 13.742 36.281 24.466 1.00 22.39  ? 12   PHE A C   1 
ATOM   73   O O   . PHE A 1 12 ? 13.057 35.579 23.722 1.00 20.64  ? 12   PHE A O   1 
ATOM   74   C CB  . PHE A 1 12 ? 13.130 35.259 26.707 1.00 16.29  ? 12   PHE A CB  1 
ATOM   75   C CG  . PHE A 1 12 ? 13.715 34.462 27.868 1.00 14.39  ? 12   PHE A CG  1 
ATOM   76   C CD1 . PHE A 1 12 ? 13.914 35.082 29.098 1.00 21.28  ? 12   PHE A CD1 1 
ATOM   77   C CD2 . PHE A 1 12 ? 14.066 33.139 27.690 1.00 19.32  ? 12   PHE A CD2 1 
ATOM   78   C CE1 . PHE A 1 12 ? 14.491 34.355 30.129 1.00 20.15  ? 12   PHE A CE1 1 
ATOM   79   C CE2 . PHE A 1 12 ? 14.643 32.408 28.715 1.00 14.47  ? 12   PHE A CE2 1 
ATOM   80   C CZ  . PHE A 1 12 ? 14.854 33.025 29.929 1.00 21.51  ? 12   PHE A CZ  1 
ATOM   81   N N   . ALA A 1 13 ? 14.095 37.527 24.170 1.00 16.71  ? 13   ALA A N   1 
ATOM   82   C CA  . ALA A 1 13 ? 13.745 38.162 22.900 1.00 16.79  ? 13   ALA A CA  1 
ATOM   83   C C   . ALA A 1 13 ? 14.748 39.283 22.638 1.00 17.86  ? 13   ALA A C   1 
ATOM   84   O O   . ALA A 1 13 ? 15.343 39.799 23.585 1.00 20.71  ? 13   ALA A O   1 
ATOM   85   C CB  . ALA A 1 13 ? 12.323 38.681 22.962 1.00 21.86  ? 13   ALA A CB  1 
ATOM   86   N N   . TYR A 1 14 ? 14.972 39.615 21.377 1.00 20.02  ? 14   TYR A N   1 
ATOM   87   C CA  . TYR A 1 14 ? 15.924 40.629 20.982 1.00 17.54  ? 14   TYR A CA  1 
ATOM   88   C C   . TYR A 1 14 ? 15.185 41.861 20.444 1.00 22.74  ? 14   TYR A C   1 
ATOM   89   O O   . TYR A 1 14 ? 14.190 41.726 19.729 1.00 20.14  ? 14   TYR A O   1 
ATOM   90   C CB  . TYR A 1 14 ? 16.842 40.089 19.897 1.00 16.94  ? 14   TYR A CB  1 
ATOM   91   C CG  . TYR A 1 14 ? 17.639 38.873 20.280 1.00 20.08  ? 14   TYR A CG  1 
ATOM   92   C CD1 . TYR A 1 14 ? 18.359 38.837 21.468 1.00 20.28  ? 14   TYR A CD1 1 
ATOM   93   C CD2 . TYR A 1 14 ? 17.689 37.758 19.458 1.00 23.67  ? 14   TYR A CD2 1 
ATOM   94   C CE1 . TYR A 1 14 ? 19.098 37.734 21.819 1.00 21.15  ? 14   TYR A CE1 1 
ATOM   95   C CE2 . TYR A 1 14 ? 18.429 36.637 19.801 1.00 23.07  ? 14   TYR A CE2 1 
ATOM   96   C CZ  . TYR A 1 14 ? 19.124 36.630 20.987 1.00 21.16  ? 14   TYR A CZ  1 
ATOM   97   O OH  . TYR A 1 14 ? 19.861 35.535 21.347 1.00 19.94  ? 14   TYR A OH  1 
ATOM   98   N N   . ILE A 1 15 ? 15.668 43.050 20.770 1.00 16.87  ? 15   ILE A N   1 
ATOM   99   C CA  . ILE A 1 15 ? 15.025 44.262 20.261 1.00 17.64  ? 15   ILE A CA  1 
ATOM   100  C C   . ILE A 1 15 ? 15.107 44.257 18.733 1.00 22.87  ? 15   ILE A C   1 
ATOM   101  O O   . ILE A 1 15 ? 16.158 43.908 18.182 1.00 22.25  ? 15   ILE A O   1 
ATOM   102  C CB  . ILE A 1 15 ? 15.693 45.501 20.836 1.00 18.92  ? 15   ILE A CB  1 
ATOM   103  C CG1 . ILE A 1 15 ? 15.004 46.813 20.398 1.00 23.78  ? 15   ILE A CG1 1 
ATOM   104  C CG2 . ILE A 1 15 ? 17.164 45.560 20.487 1.00 23.89  ? 15   ILE A CG2 1 
ATOM   105  C CD1 . ILE A 1 15 ? 14.109 47.335 21.507 1.00 39.65  ? 15   ILE A CD1 1 
ATOM   106  N N   . ALA A 1 16 ? 14.032 44.606 18.051 1.00 18.07  ? 16   ALA A N   1 
ATOM   107  C CA  . ALA A 1 16 ? 13.888 44.363 16.621 1.00 24.92  ? 16   ALA A CA  1 
ATOM   108  C C   . ALA A 1 16 ? 14.676 45.322 15.741 1.00 29.30  ? 16   ALA A C   1 
ATOM   109  O O   . ALA A 1 16 ? 15.274 44.917 14.752 1.00 29.12  ? 16   ALA A O   1 
ATOM   110  C CB  . ALA A 1 16 ? 12.424 44.462 16.195 1.00 25.28  ? 16   ALA A CB  1 
ATOM   111  N N   . ARG A 1 17 ? 14.657 46.594 16.111 1.00 27.92  ? 17   ARG A N   1 
ATOM   112  C CA  . ARG A 1 17 ? 15.356 47.651 15.396 1.00 35.46  ? 17   ARG A CA  1 
ATOM   113  C C   . ARG A 1 17 ? 16.417 48.312 16.273 1.00 27.55  ? 17   ARG A C   1 
ATOM   114  O O   . ARG A 1 17 ? 16.310 48.445 17.488 1.00 37.70  ? 17   ARG A O   1 
ATOM   115  C CB  . ARG A 1 17 ? 14.350 48.690 14.895 1.00 38.97  ? 17   ARG A CB  1 
ATOM   116  C CG  . ARG A 1 17 ? 12.988 48.110 14.560 1.00 50.84  ? 17   ARG A CG  1 
ATOM   117  C CD  . ARG A 1 17 ? 12.912 47.549 13.155 1.00 62.59  ? 17   ARG A CD  1 
ATOM   118  N NE  . ARG A 1 17 ? 13.767 46.389 12.928 1.00 75.85  ? 17   ARG A NE  1 
ATOM   119  C CZ  . ARG A 1 17 ? 13.332 45.159 12.676 1.00 78.03  ? 17   ARG A CZ  1 
ATOM   120  N NH1 . ARG A 1 17 ? 14.179 44.158 12.480 1.00 70.04  ? 17   ARG A NH1 1 
ATOM   121  N NH2 . ARG A 1 17 ? 12.030 44.909 12.620 1.00 63.29  ? 17   ARG A NH2 1 
ATOM   122  N N   . PRO A 1 18 ? 17.479 48.754 15.634 1.00 25.45  ? 18   PRO A N   1 
ATOM   123  C CA  . PRO A 1 18 ? 18.586 49.382 16.363 1.00 30.26  ? 18   PRO A CA  1 
ATOM   124  C C   . PRO A 1 18 ? 18.099 50.575 17.179 1.00 29.82  ? 18   PRO A C   1 
ATOM   125  O O   . PRO A 1 18 ? 17.346 51.366 16.603 1.00 28.73  ? 18   PRO A O   1 
ATOM   126  C CB  . PRO A 1 18 ? 19.497 49.879 15.241 1.00 33.49  ? 18   PRO A CB  1 
ATOM   127  C CG  . PRO A 1 18 ? 19.176 49.013 14.070 1.00 27.90  ? 18   PRO A CG  1 
ATOM   128  C CD  . PRO A 1 18 ? 17.711 48.706 14.179 1.00 30.35  ? 18   PRO A CD  1 
ATOM   129  N N   . MET A 1 19 ? 18.540 50.659 18.420 1.00 31.53  ? 19   MET A N   1 
ATOM   130  C CA  . MET A 1 19 ? 18.372 51.762 19.347 1.00 33.90  ? 19   MET A CA  1 
ATOM   131  C C   . MET A 1 19 ? 19.241 52.923 18.859 1.00 22.20  ? 19   MET A C   1 
ATOM   132  O O   . MET A 1 19 ? 20.217 52.626 18.155 1.00 27.72  ? 19   MET A O   1 
ATOM   133  C CB  . MET A 1 19 ? 18.779 51.407 20.782 1.00 29.52  ? 19   MET A CB  1 
ATOM   134  C CG  . MET A 1 19 ? 19.707 50.209 20.930 1.00 16.88  ? 19   MET A CG  1 
ATOM   135  S SD  . MET A 1 19 ? 19.107 49.053 22.193 1.00 40.59  ? 19   MET A SD  1 
ATOM   136  C CE  . MET A 1 19 ? 18.323 50.207 23.323 1.00 56.88  ? 19   MET A CE  1 
ATOM   137  N N   . PRO A 1 20 ? 18.931 54.164 19.169 1.00 28.26  ? 20   PRO A N   1 
ATOM   138  C CA  . PRO A 1 20 ? 19.839 55.244 18.710 1.00 22.89  ? 20   PRO A CA  1 
ATOM   139  C C   . PRO A 1 20 ? 21.168 55.054 19.413 1.00 24.01  ? 20   PRO A C   1 
ATOM   140  O O   . PRO A 1 20 ? 21.171 54.866 20.635 1.00 21.79  ? 20   PRO A O   1 
ATOM   141  C CB  . PRO A 1 20 ? 19.141 56.522 19.155 1.00 27.30  ? 20   PRO A CB  1 
ATOM   142  C CG  . PRO A 1 20 ? 17.702 56.115 19.330 1.00 34.54  ? 20   PRO A CG  1 
ATOM   143  C CD  . PRO A 1 20 ? 17.797 54.722 19.924 1.00 30.93  ? 20   PRO A CD  1 
ATOM   144  N N   . ARG A 1 21 ? 22.256 55.097 18.632 1.00 16.19  ? 21   ARG A N   1 
ATOM   145  C CA  . ARG A 1 21 ? 23.561 54.849 19.215 1.00 15.69  ? 21   ARG A CA  1 
ATOM   146  C C   . ARG A 1 21 ? 23.899 55.782 20.367 1.00 18.51  ? 21   ARG A C   1 
ATOM   147  O O   . ARG A 1 21 ? 24.490 55.366 21.368 1.00 19.12  ? 21   ARG A O   1 
ATOM   148  C CB  . ARG A 1 21 ? 24.617 54.946 18.098 1.00 17.83  ? 21   ARG A CB  1 
ATOM   149  C CG  . ARG A 1 21 ? 26.038 55.011 18.640 1.00 17.88  ? 21   ARG A CG  1 
ATOM   150  C CD  . ARG A 1 21 ? 26.473 53.701 19.312 1.00 15.93  ? 21   ARG A CD  1 
ATOM   151  N NE  . ARG A 1 21 ? 27.883 53.793 19.719 1.00 14.32  ? 21   ARG A NE  1 
ATOM   152  C CZ  . ARG A 1 21 ? 28.228 54.161 20.938 1.00 17.96  ? 21   ARG A CZ  1 
ATOM   153  N NH1 . ARG A 1 21 ? 27.234 54.443 21.797 1.00 18.39  ? 21   ARG A NH1 1 
ATOM   154  N NH2 . ARG A 1 21 ? 29.488 54.262 21.308 1.00 18.04  ? 21   ARG A NH2 1 
ATOM   155  N N   . ALA A 1 22 ? 23.513 57.051 20.301 1.00 18.01  ? 22   ALA A N   1 
ATOM   156  C CA  . ALA A 1 22 ? 23.809 58.058 21.307 1.00 13.57  ? 22   ALA A CA  1 
ATOM   157  C C   . ALA A 1 22 ? 23.114 57.808 22.638 1.00 18.08  ? 22   ALA A C   1 
ATOM   158  O O   . ALA A 1 22 ? 23.441 58.408 23.660 1.00 23.98  ? 22   ALA A O   1 
ATOM   159  C CB  . ALA A 1 22 ? 23.371 59.436 20.795 1.00 12.59  ? 22   ALA A CB  1 
ATOM   160  N N   . HIS A 1 23 ? 22.137 56.908 22.658 1.00 19.71  ? 23   HIS A N   1 
ATOM   161  C CA  . HIS A 1 23 ? 21.434 56.649 23.901 1.00 24.93  ? 23   HIS A CA  1 
ATOM   162  C C   . HIS A 1 23 ? 21.984 55.422 24.637 1.00 23.13  ? 23   HIS A C   1 
ATOM   163  O O   . HIS A 1 23 ? 21.401 55.051 25.661 1.00 20.60  ? 23   HIS A O   1 
ATOM   164  C CB  . HIS A 1 23 ? 19.944 56.390 23.641 1.00 29.82  ? 23   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 23 ? 19.229 57.579 23.084 1.00 49.65  ? 23   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 23 ? 19.762 58.849 23.131 1.00 64.94  ? 23   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 23 ? 18.034 57.694 22.462 1.00 59.36  ? 23   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 23 ? 18.924 59.699 22.566 1.00 65.73  ? 23   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 23 ? 17.866 59.023 22.152 1.00 62.18  ? 23   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 24 ? 23.023 54.843 24.058 1.00 20.95  ? 24   ILE A N   1 
ATOM   171  C CA  . ILE A 1 24 ? 23.629 53.676 24.704 1.00 16.98  ? 24   ILE A CA  1 
ATOM   172  C C   . ILE A 1 24 ? 24.972 54.025 25.306 1.00 17.08  ? 24   ILE A C   1 
ATOM   173  O O   . ILE A 1 24 ? 25.873 54.602 24.671 1.00 18.43  ? 24   ILE A O   1 
ATOM   174  C CB  . ILE A 1 24 ? 23.790 52.518 23.707 1.00 18.30  ? 24   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 24 ? 22.446 52.040 23.146 1.00 21.34  ? 24   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 24 ? 24.585 51.375 24.339 1.00 16.25  ? 24   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 24 ? 22.637 51.442 21.763 1.00 29.43  ? 24   ILE A CD1 1 
ATOM   178  N N   . LYS A 1 25 ? 25.174 53.626 26.571 1.00 15.15  ? 25   LYS A N   1 
ATOM   179  C CA  . LYS A 1 25 ? 26.455 53.989 27.168 1.00 19.43  ? 25   LYS A CA  1 
ATOM   180  C C   . LYS A 1 25 ? 27.329 52.819 27.582 1.00 15.58  ? 25   LYS A C   1 
ATOM   181  O O   . LYS A 1 25 ? 28.531 52.971 27.808 1.00 16.73  ? 25   LYS A O   1 
ATOM   182  C CB  . LYS A 1 25 ? 26.192 54.864 28.390 1.00 17.80  ? 25   LYS A CB  1 
ATOM   183  C CG  . LYS A 1 25 ? 25.289 54.265 29.438 1.00 21.08  ? 25   LYS A CG  1 
ATOM   184  C CD  . LYS A 1 25 ? 25.373 55.104 30.715 1.00 22.48  ? 25   LYS A CD  1 
ATOM   185  C CE  . LYS A 1 25 ? 24.431 54.515 31.763 1.00 21.93  ? 25   LYS A CE  1 
ATOM   186  N NZ  . LYS A 1 25 ? 24.355 55.482 32.926 1.00 23.76  ? 25   LYS A NZ  1 
ATOM   187  N N   . GLU A 1 26 ? 26.743 51.641 27.725 1.00 17.26  ? 26   GLU A N   1 
ATOM   188  C CA  . GLU A 1 26 ? 27.455 50.430 28.140 1.00 16.45  ? 26   GLU A CA  1 
ATOM   189  C C   . GLU A 1 26 ? 26.781 49.204 27.544 1.00 13.90  ? 26   GLU A C   1 
ATOM   190  O O   . GLU A 1 26 ? 25.645 49.198 27.035 1.00 14.32  ? 26   GLU A O   1 
ATOM   191  C CB  . GLU A 1 26 ? 27.421 50.221 29.663 1.00 15.15  ? 26   GLU A CB  1 
ATOM   192  C CG  . GLU A 1 26 ? 28.060 51.371 30.436 1.00 22.86  ? 26   GLU A CG  1 
ATOM   193  C CD  . GLU A 1 26 ? 27.693 51.247 31.904 1.00 31.67  ? 26   GLU A CD  1 
ATOM   194  O OE1 . GLU A 1 26 ? 27.350 52.263 32.529 1.00 27.23  ? 26   GLU A OE1 1 
ATOM   195  O OE2 . GLU A 1 26 ? 27.752 50.089 32.368 1.00 30.97  ? 26   GLU A OE2 1 
ATOM   196  N N   . TYR A 1 27 ? 27.513 48.096 27.613 1.00 16.50  ? 27   TYR A N   1 
ATOM   197  C CA  . TYR A 1 27 ? 26.912 46.821 27.222 1.00 17.68  ? 27   TYR A CA  1 
ATOM   198  C C   . TYR A 1 27 ? 27.515 45.709 28.068 1.00 16.43  ? 27   TYR A C   1 
ATOM   199  O O   . TYR A 1 27 ? 28.624 45.864 28.569 1.00 19.75  ? 27   TYR A O   1 
ATOM   200  C CB  . TYR A 1 27 ? 27.108 46.527 25.728 1.00 14.83  ? 27   TYR A CB  1 
ATOM   201  C CG  . TYR A 1 27 ? 28.406 45.855 25.365 1.00 14.48  ? 27   TYR A CG  1 
ATOM   202  C CD1 . TYR A 1 27 ? 28.418 44.461 25.186 1.00 22.17  ? 27   TYR A CD1 1 
ATOM   203  C CD2 . TYR A 1 27 ? 29.580 46.552 25.179 1.00 17.57  ? 27   TYR A CD2 1 
ATOM   204  C CE1 . TYR A 1 27 ? 29.569 43.807 24.855 1.00 21.22  ? 27   TYR A CE1 1 
ATOM   205  C CE2 . TYR A 1 27 ? 30.760 45.897 24.841 1.00 21.56  ? 27   TYR A CE2 1 
ATOM   206  C CZ  . TYR A 1 27 ? 30.733 44.535 24.683 1.00 20.07  ? 27   TYR A CZ  1 
ATOM   207  O OH  . TYR A 1 27 ? 31.843 43.798 24.347 1.00 30.94  ? 27   TYR A OH  1 
ATOM   208  N N   . PHE A 1 28 ? 26.809 44.569 28.105 1.00 15.23  ? 28   PHE A N   1 
ATOM   209  C CA  . PHE A 1 28 ? 27.473 43.389 28.656 1.00 18.23  ? 28   PHE A CA  1 
ATOM   210  C C   . PHE A 1 28 ? 26.860 42.178 27.956 1.00 22.97  ? 28   PHE A C   1 
ATOM   211  O O   . PHE A 1 28 ? 25.828 42.278 27.281 1.00 19.88  ? 28   PHE A O   1 
ATOM   212  C CB  . PHE A 1 28 ? 27.357 43.344 30.165 1.00 17.07  ? 28   PHE A CB  1 
ATOM   213  C CG  . PHE A 1 28 ? 25.946 43.256 30.711 1.00 23.11  ? 28   PHE A CG  1 
ATOM   214  C CD1 . PHE A 1 28 ? 25.309 42.050 30.913 1.00 25.88  ? 28   PHE A CD1 1 
ATOM   215  C CD2 . PHE A 1 28 ? 25.234 44.402 31.035 1.00 18.44  ? 28   PHE A CD2 1 
ATOM   216  C CE1 . PHE A 1 28 ? 24.028 42.001 31.427 1.00 18.30  ? 28   PHE A CE1 1 
ATOM   217  C CE2 . PHE A 1 28 ? 23.956 44.370 31.538 1.00 17.15  ? 28   PHE A CE2 1 
ATOM   218  C CZ  . PHE A 1 28 ? 23.332 43.150 31.723 1.00 17.86  ? 28   PHE A CZ  1 
ATOM   219  N N   . TYR A 1 29 ? 27.498 41.031 28.114 1.00 21.97  ? 29   TYR A N   1 
ATOM   220  C CA  . TYR A 1 29 ? 26.939 39.788 27.587 1.00 19.26  ? 29   TYR A CA  1 
ATOM   221  C C   . TYR A 1 29 ? 26.288 39.059 28.760 1.00 17.08  ? 29   TYR A C   1 
ATOM   222  O O   . TYR A 1 29 ? 26.781 39.133 29.890 1.00 17.24  ? 29   TYR A O   1 
ATOM   223  C CB  . TYR A 1 29 ? 27.981 38.902 26.938 1.00 16.58  ? 29   TYR A CB  1 
ATOM   224  C CG  . TYR A 1 29 ? 28.382 39.218 25.533 1.00 20.53  ? 29   TYR A CG  1 
ATOM   225  C CD1 . TYR A 1 29 ? 29.480 40.013 25.239 1.00 26.37  ? 29   TYR A CD1 1 
ATOM   226  C CD2 . TYR A 1 29 ? 27.648 38.699 24.462 1.00 22.66  ? 29   TYR A CD2 1 
ATOM   227  C CE1 . TYR A 1 29 ? 29.830 40.284 23.928 1.00 29.36  ? 29   TYR A CE1 1 
ATOM   228  C CE2 . TYR A 1 29 ? 27.994 38.966 23.150 1.00 22.78  ? 29   TYR A CE2 1 
ATOM   229  C CZ  . TYR A 1 29 ? 29.088 39.761 22.888 1.00 25.84  ? 29   TYR A CZ  1 
ATOM   230  O OH  . TYR A 1 29 ? 29.446 40.037 21.585 1.00 24.60  ? 29   TYR A OH  1 
ATOM   231  N N   . THR A 1 30 ? 25.175 38.383 28.487 1.00 11.39  ? 30   THR A N   1 
ATOM   232  C CA  . THR A 1 30 ? 24.525 37.656 29.563 1.00 15.27  ? 30   THR A CA  1 
ATOM   233  C C   . THR A 1 30 ? 25.321 36.378 29.855 1.00 12.75  ? 30   THR A C   1 
ATOM   234  O O   . THR A 1 30 ? 26.089 35.910 29.006 1.00 14.25  ? 30   THR A O   1 
ATOM   235  C CB  . THR A 1 30 ? 23.061 37.303 29.215 1.00 15.79  ? 30   THR A CB  1 
ATOM   236  O OG1 . THR A 1 30 ? 22.959 36.727 27.902 1.00 13.57  ? 30   THR A OG1 1 
ATOM   237  C CG2 . THR A 1 30 ? 22.200 38.557 29.253 1.00 12.54  ? 30   THR A CG2 1 
ATOM   238  N N   . SER A 1 31 ? 25.143 35.817 31.032 1.00 11.41  ? 31   SER A N   1 
ATOM   239  C CA  . SER A 1 31 ? 25.781 34.602 31.485 1.00 12.53  ? 31   SER A CA  1 
ATOM   240  C C   . SER A 1 31 ? 25.667 33.449 30.479 1.00 14.73  ? 31   SER A C   1 
ATOM   241  O O   . SER A 1 31 ? 24.619 33.214 29.855 1.00 14.52  ? 31   SER A O   1 
ATOM   242  C CB  . SER A 1 31 ? 25.148 34.140 32.811 1.00 11.65  ? 31   SER A CB  1 
ATOM   243  O OG  . SER A 1 31 ? 25.733 32.849 33.060 1.00 13.95  ? 31   SER A OG  1 
ATOM   244  N N   . GLY A 1 32 ? 26.710 32.661 30.312 1.00 12.09  ? 32   GLY A N   1 
ATOM   245  C CA  . GLY A 1 32 ? 26.662 31.480 29.476 1.00 9.80   ? 32   GLY A CA  1 
ATOM   246  C C   . GLY A 1 32 ? 25.762 30.382 29.962 1.00 10.85  ? 32   GLY A C   1 
ATOM   247  O O   . GLY A 1 32 ? 25.492 29.428 29.220 1.00 14.14  ? 32   GLY A O   1 
ATOM   248  N N   . LYS A 1 33 ? 25.278 30.526 31.205 1.00 12.95  ? 33   LYS A N   1 
ATOM   249  C CA  . LYS A 1 33 ? 24.247 29.653 31.736 1.00 12.82  ? 33   LYS A CA  1 
ATOM   250  C C   . LYS A 1 33 ? 22.879 29.893 31.115 1.00 11.17  ? 33   LYS A C   1 
ATOM   251  O O   . LYS A 1 33 ? 22.074 28.953 31.180 1.00 13.77  ? 33   LYS A O   1 
ATOM   252  C CB  . LYS A 1 33 ? 24.158 29.840 33.265 1.00 14.76  ? 33   LYS A CB  1 
ATOM   253  C CG  . LYS A 1 33 ? 25.451 29.396 33.924 1.00 16.13  ? 33   LYS A CG  1 
ATOM   254  C CD  . LYS A 1 33 ? 25.348 29.636 35.431 1.00 24.43  ? 33   LYS A CD  1 
ATOM   255  C CE  . LYS A 1 33 ? 26.758 29.962 35.937 1.00 42.78  ? 33   LYS A CE  1 
ATOM   256  N NZ  . LYS A 1 33 ? 27.790 29.353 35.042 1.00 62.63  ? 33   LYS A NZ  1 
ATOM   257  N N   . CYS A 1 34 ? 22.624 31.043 30.535 1.00 14.51  ? 34   CYS A N   1 
ATOM   258  C CA  . CYS A 1 34 ? 21.311 31.353 29.974 1.00 16.07  ? 34   CYS A CA  1 
ATOM   259  C C   . CYS A 1 34 ? 21.077 30.542 28.706 1.00 14.56  ? 34   CYS A C   1 
ATOM   260  O O   . CYS A 1 34 ? 22.061 30.162 28.076 1.00 14.48  ? 34   CYS A O   1 
ATOM   261  C CB  . CYS A 1 34 ? 21.217 32.841 29.627 1.00 13.40  ? 34   CYS A CB  1 
ATOM   262  S SG  . CYS A 1 34 ? 21.324 33.957 31.045 1.00 14.65  ? 34   CYS A SG  1 
ATOM   263  N N   . SER A 1 35 ? 19.810 30.297 28.355 1.00 12.62  ? 35   SER A N   1 
ATOM   264  C CA  . SER A 1 35 ? 19.523 29.474 27.176 1.00 14.25  ? 35   SER A CA  1 
ATOM   265  C C   . SER A 1 35 ? 19.929 30.152 25.879 1.00 17.94  ? 35   SER A C   1 
ATOM   266  O O   . SER A 1 35 ? 20.324 29.488 24.922 1.00 20.29  ? 35   SER A O   1 
ATOM   267  C CB  . SER A 1 35 ? 18.038 29.077 27.134 1.00 17.74  ? 35   SER A CB  1 
ATOM   268  O OG  . SER A 1 35 ? 17.266 30.270 27.049 1.00 20.47  ? 35   SER A OG  1 
ATOM   269  N N   . ASN A 1 36 ? 19.829 31.472 25.873 1.00 15.33  ? 36   ASN A N   1 
ATOM   270  C CA  . ASN A 1 36 ? 20.201 32.255 24.711 1.00 16.31  ? 36   ASN A CA  1 
ATOM   271  C C   . ASN A 1 36 ? 21.455 33.100 24.957 1.00 17.26  ? 36   ASN A C   1 
ATOM   272  O O   . ASN A 1 36 ? 21.576 33.694 26.036 1.00 20.10  ? 36   ASN A O   1 
ATOM   273  C CB  . ASN A 1 36 ? 19.065 33.246 24.384 1.00 23.00  ? 36   ASN A CB  1 
ATOM   274  C CG  . ASN A 1 36 ? 17.809 32.520 23.958 1.00 26.87  ? 36   ASN A CG  1 
ATOM   275  O OD1 . ASN A 1 36 ? 17.935 31.537 23.207 1.00 25.87  ? 36   ASN A OD1 1 
ATOM   276  N ND2 . ASN A 1 36 ? 16.671 33.004 24.424 1.00 21.77  ? 36   ASN A ND2 1 
ATOM   277  N N   . PRO A 1 37 ? 22.324 33.200 23.963 1.00 16.93  ? 37   PRO A N   1 
ATOM   278  C CA  . PRO A 1 37 ? 23.400 34.189 24.006 1.00 16.94  ? 37   PRO A CA  1 
ATOM   279  C C   . PRO A 1 37 ? 22.766 35.569 23.850 1.00 18.57  ? 37   PRO A C   1 
ATOM   280  O O   . PRO A 1 37 ? 21.790 35.681 23.100 1.00 20.67  ? 37   PRO A O   1 
ATOM   281  C CB  . PRO A 1 37 ? 24.242 33.821 22.789 1.00 25.72  ? 37   PRO A CB  1 
ATOM   282  C CG  . PRO A 1 37 ? 23.240 33.235 21.833 1.00 20.51  ? 37   PRO A CG  1 
ATOM   283  C CD  . PRO A 1 37 ? 22.310 32.432 22.701 1.00 19.93  ? 37   PRO A CD  1 
ATOM   284  N N   . ALA A 1 38 ? 23.252 36.594 24.549 1.00 15.10  ? 38   ALA A N   1 
ATOM   285  C CA  . ALA A 1 38 ? 22.640 37.905 24.350 1.00 13.52  ? 38   ALA A CA  1 
ATOM   286  C C   . ALA A 1 38 ? 23.609 39.020 24.710 1.00 15.67  ? 38   ALA A C   1 
ATOM   287  O O   . ALA A 1 38 ? 24.457 38.947 25.607 1.00 14.23  ? 38   ALA A O   1 
ATOM   288  C CB  . ALA A 1 38 ? 21.364 38.043 25.188 1.00 13.22  ? 38   ALA A CB  1 
ATOM   289  N N   . VAL A 1 39 ? 23.436 40.115 23.982 1.00 14.87  ? 39   VAL A N   1 
ATOM   290  C CA  . VAL A 1 39 ? 24.066 41.356 24.379 1.00 17.12  ? 39   VAL A CA  1 
ATOM   291  C C   . VAL A 1 39 ? 23.027 42.186 25.121 1.00 17.24  ? 39   VAL A C   1 
ATOM   292  O O   . VAL A 1 39 ? 21.890 42.170 24.650 1.00 18.92  ? 39   VAL A O   1 
ATOM   293  C CB  . VAL A 1 39 ? 24.534 42.164 23.153 1.00 16.84  ? 39   VAL A CB  1 
ATOM   294  C CG1 . VAL A 1 39 ? 24.868 43.583 23.546 1.00 19.59  ? 39   VAL A CG1 1 
ATOM   295  C CG2 . VAL A 1 39 ? 25.721 41.437 22.535 1.00 19.08  ? 39   VAL A CG2 1 
ATOM   296  N N   . VAL A 1 40 ? 23.432 42.883 26.173 1.00 14.48  ? 40   VAL A N   1 
ATOM   297  C CA  . VAL A 1 40 ? 22.500 43.762 26.879 1.00 17.02  ? 40   VAL A CA  1 
ATOM   298  C C   . VAL A 1 40 ? 23.072 45.171 26.773 1.00 18.55  ? 40   VAL A C   1 
ATOM   299  O O   . VAL A 1 40 ? 24.175 45.426 27.223 1.00 15.72  ? 40   VAL A O   1 
ATOM   300  C CB  . VAL A 1 40 ? 22.318 43.387 28.347 1.00 11.28  ? 40   VAL A CB  1 
ATOM   301  C CG1 . VAL A 1 40 ? 21.447 44.387 29.071 1.00 14.56  ? 40   VAL A CG1 1 
ATOM   302  C CG2 . VAL A 1 40 ? 21.767 41.968 28.390 1.00 15.98  ? 40   VAL A CG2 1 
ATOM   303  N N   . PHE A 1 41 ? 22.286 46.038 26.135 1.00 15.11  ? 41   PHE A N   1 
ATOM   304  C CA  . PHE A 1 41 ? 22.726 47.423 25.998 1.00 15.10  ? 41   PHE A CA  1 
ATOM   305  C C   . PHE A 1 41 ? 22.142 48.211 27.164 1.00 14.73  ? 41   PHE A C   1 
ATOM   306  O O   . PHE A 1 41 ? 20.948 48.100 27.448 1.00 19.48  ? 41   PHE A O   1 
ATOM   307  C CB  . PHE A 1 41 ? 22.284 47.991 24.647 1.00 13.83  ? 41   PHE A CB  1 
ATOM   308  C CG  . PHE A 1 41 ? 23.158 47.546 23.485 1.00 16.85  ? 41   PHE A CG  1 
ATOM   309  C CD1 . PHE A 1 41 ? 22.565 46.926 22.386 1.00 15.97  ? 41   PHE A CD1 1 
ATOM   310  C CD2 . PHE A 1 41 ? 24.515 47.732 23.507 1.00 13.82  ? 41   PHE A CD2 1 
ATOM   311  C CE1 . PHE A 1 41 ? 23.367 46.508 21.356 1.00 14.64  ? 41   PHE A CE1 1 
ATOM   312  C CE2 . PHE A 1 41 ? 25.333 47.322 22.487 1.00 14.22  ? 41   PHE A CE2 1 
ATOM   313  C CZ  . PHE A 1 41 ? 24.738 46.704 21.394 1.00 17.75  ? 41   PHE A CZ  1 
ATOM   314  N N   . VAL A 1 42 ? 22.964 48.991 27.827 1.00 11.90  ? 42   VAL A N   1 
ATOM   315  C CA  . VAL A 1 42 ? 22.483 49.868 28.903 1.00 16.06  ? 42   VAL A CA  1 
ATOM   316  C C   . VAL A 1 42 ? 22.270 51.278 28.379 1.00 15.05  ? 42   VAL A C   1 
ATOM   317  O O   . VAL A 1 42 ? 23.218 51.858 27.846 1.00 17.53  ? 42   VAL A O   1 
ATOM   318  C CB  . VAL A 1 42 ? 23.486 49.866 30.073 1.00 17.42  ? 42   VAL A CB  1 
ATOM   319  C CG1 . VAL A 1 42 ? 22.999 50.683 31.254 1.00 16.33  ? 42   VAL A CG1 1 
ATOM   320  C CG2 . VAL A 1 42 ? 23.752 48.408 30.464 1.00 19.72  ? 42   VAL A CG2 1 
ATOM   321  N N   . THR A 1 43 ? 21.042 51.794 28.521 1.00 18.04  ? 43   THR A N   1 
ATOM   322  C CA  . THR A 1 43 ? 20.825 53.131 27.955 1.00 14.70  ? 43   THR A CA  1 
ATOM   323  C C   . THR A 1 43 ? 21.204 54.223 28.942 1.00 25.33  ? 43   THR A C   1 
ATOM   324  O O   . THR A 1 43 ? 21.608 54.019 30.083 1.00 20.28  ? 43   THR A O   1 
ATOM   325  C CB  . THR A 1 43 ? 19.372 53.342 27.509 1.00 15.27  ? 43   THR A CB  1 
ATOM   326  O OG1 . THR A 1 43 ? 18.568 53.561 28.680 1.00 22.69  ? 43   THR A OG1 1 
ATOM   327  C CG2 . THR A 1 43 ? 18.789 52.136 26.772 1.00 21.48  ? 43   THR A CG2 1 
ATOM   328  N N   . ARG A 1 44 ? 21.075 55.466 28.463 1.00 21.33  ? 44   ARG A N   1 
ATOM   329  C CA  . ARG A 1 44 ? 21.532 56.564 29.324 1.00 24.71  ? 44   ARG A CA  1 
ATOM   330  C C   . ARG A 1 44 ? 20.467 56.891 30.356 1.00 23.05  ? 44   ARG A C   1 
ATOM   331  O O   . ARG A 1 44 ? 20.718 57.671 31.282 1.00 28.09  ? 44   ARG A O   1 
ATOM   332  C CB  . ARG A 1 44 ? 21.922 57.776 28.468 1.00 20.62  ? 44   ARG A CB  1 
ATOM   333  C CG  . ARG A 1 44 ? 23.351 57.578 27.982 1.00 26.52  ? 44   ARG A CG  1 
ATOM   334  C CD  . ARG A 1 44 ? 23.847 58.752 27.152 1.00 28.76  ? 44   ARG A CD  1 
ATOM   335  N NE  . ARG A 1 44 ? 25.038 58.282 26.407 1.00 31.82  ? 44   ARG A NE  1 
ATOM   336  C CZ  . ARG A 1 44 ? 26.247 58.356 26.966 1.00 33.42  ? 44   ARG A CZ  1 
ATOM   337  N NH1 . ARG A 1 44 ? 26.357 58.860 28.198 1.00 32.72  ? 44   ARG A NH1 1 
ATOM   338  N NH2 . ARG A 1 44 ? 27.302 57.933 26.290 1.00 33.55  ? 44   ARG A NH2 1 
ATOM   339  N N   . LYS A 1 45 ? 19.307 56.268 30.180 1.00 20.88  ? 45   LYS A N   1 
ATOM   340  C CA  . LYS A 1 45 ? 18.278 56.339 31.225 1.00 22.02  ? 45   LYS A CA  1 
ATOM   341  C C   . LYS A 1 45 ? 18.348 55.084 32.099 1.00 21.60  ? 45   LYS A C   1 
ATOM   342  O O   . LYS A 1 45 ? 17.509 54.825 32.959 1.00 23.36  ? 45   LYS A O   1 
ATOM   343  C CB  . LYS A 1 45 ? 16.887 56.488 30.633 1.00 34.65  ? 45   LYS A CB  1 
ATOM   344  C CG  . LYS A 1 45 ? 16.630 57.712 29.774 1.00 38.78  ? 45   LYS A CG  1 
ATOM   345  C CD  . LYS A 1 45 ? 15.192 57.685 29.267 1.00 46.56  ? 45   LYS A CD  1 
ATOM   346  C CE  . LYS A 1 45 ? 14.547 59.059 29.318 1.00 64.84  ? 45   LYS A CE  1 
ATOM   347  N NZ  . LYS A 1 45 ? 14.852 59.871 28.111 1.00 56.23  ? 45   LYS A NZ  1 
ATOM   348  N N   . ASN A 1 46 ? 19.407 54.311 31.883 1.00 20.60  ? 46   ASN A N   1 
ATOM   349  C CA  . ASN A 1 46 ? 19.823 53.151 32.652 1.00 27.92  ? 46   ASN A CA  1 
ATOM   350  C C   . ASN A 1 46 ? 18.902 51.953 32.488 1.00 28.48  ? 46   ASN A C   1 
ATOM   351  O O   . ASN A 1 46 ? 18.841 51.072 33.341 1.00 33.05  ? 46   ASN A O   1 
ATOM   352  C CB  . ASN A 1 46 ? 19.980 53.454 34.152 1.00 20.27  ? 46   ASN A CB  1 
ATOM   353  C CG  . ASN A 1 46 ? 21.149 54.388 34.370 1.00 20.11  ? 46   ASN A CG  1 
ATOM   354  O OD1 . ASN A 1 46 ? 22.305 54.046 34.102 1.00 20.83  ? 46   ASN A OD1 1 
ATOM   355  N ND2 . ASN A 1 46 ? 20.865 55.589 34.873 1.00 21.96  ? 46   ASN A ND2 1 
ATOM   356  N N   . ARG A 1 47 ? 18.204 51.899 31.368 1.00 20.52  ? 47   ARG A N   1 
ATOM   357  C CA  . ARG A 1 47 ? 17.454 50.700 31.070 1.00 25.61  ? 47   ARG A CA  1 
ATOM   358  C C   . ARG A 1 47 ? 18.329 49.665 30.372 1.00 19.17  ? 47   ARG A C   1 
ATOM   359  O O   . ARG A 1 47 ? 19.343 49.969 29.756 1.00 20.28  ? 47   ARG A O   1 
ATOM   360  C CB  . ARG A 1 47 ? 16.240 50.989 30.187 1.00 37.73  ? 47   ARG A CB  1 
ATOM   361  C CG  . ARG A 1 47 ? 14.956 50.417 30.777 1.00 53.45  ? 47   ARG A CG  1 
ATOM   362  C CD  . ARG A 1 47 ? 14.618 51.070 32.105 1.00 63.24  ? 47   ARG A CD  1 
ATOM   363  N NE  . ARG A 1 47 ? 14.993 50.251 33.254 1.00 67.84  ? 47   ARG A NE  1 
ATOM   364  C CZ  . ARG A 1 47 ? 15.186 50.693 34.493 1.00 66.40  ? 47   ARG A CZ  1 
ATOM   365  N NH1 . ARG A 1 47 ? 15.523 49.815 35.427 1.00 43.03  ? 47   ARG A NH1 1 
ATOM   366  N NH2 . ARG A 1 47 ? 15.054 51.968 34.836 1.00 52.77  ? 47   ARG A NH2 1 
ATOM   367  N N   . GLN A 1 48 ? 17.906 48.418 30.505 1.00 20.02  ? 48   GLN A N   1 
ATOM   368  C CA  . GLN A 1 48 ? 18.671 47.319 29.922 1.00 21.96  ? 48   GLN A CA  1 
ATOM   369  C C   . GLN A 1 48 ? 17.901 46.680 28.779 1.00 20.16  ? 48   GLN A C   1 
ATOM   370  O O   . GLN A 1 48 ? 16.747 46.303 28.957 1.00 19.82  ? 48   GLN A O   1 
ATOM   371  C CB  . GLN A 1 48 ? 18.968 46.319 31.059 1.00 18.56  ? 48   GLN A CB  1 
ATOM   372  C CG  . GLN A 1 48 ? 19.808 46.968 32.153 1.00 30.86  ? 48   GLN A CG  1 
ATOM   373  C CD  . GLN A 1 48 ? 20.256 46.017 33.237 1.00 31.06  ? 48   GLN A CD  1 
ATOM   374  O OE1 . GLN A 1 48 ? 21.175 45.210 33.110 1.00 27.63  ? 48   GLN A OE1 1 
ATOM   375  N NE2 . GLN A 1 48 ? 19.570 46.112 34.377 1.00 49.76  ? 48   GLN A NE2 1 
ATOM   376  N N   . VAL A 1 49 ? 18.501 46.526 27.609 1.00 19.07  ? 49   VAL A N   1 
ATOM   377  C CA  . VAL A 1 49 ? 17.801 46.020 26.432 1.00 18.32  ? 49   VAL A CA  1 
ATOM   378  C C   . VAL A 1 49 ? 18.532 44.841 25.800 1.00 11.81  ? 49   VAL A C   1 
ATOM   379  O O   . VAL A 1 49 ? 19.725 44.974 25.542 1.00 15.46  ? 49   VAL A O   1 
ATOM   380  C CB  . VAL A 1 49 ? 17.693 47.141 25.370 1.00 17.73  ? 49   VAL A CB  1 
ATOM   381  C CG1 . VAL A 1 49 ? 16.851 46.676 24.192 1.00 15.41  ? 49   VAL A CG1 1 
ATOM   382  C CG2 . VAL A 1 49 ? 17.110 48.374 26.028 1.00 16.92  ? 49   VAL A CG2 1 
ATOM   383  N N   . CYS A 1 50 ? 17.820 43.741 25.608 1.00 13.14  ? 50   CYS A N   1 
ATOM   384  C CA  . CYS A 1 50 ? 18.416 42.545 25.019 1.00 14.62  ? 50   CYS A CA  1 
ATOM   385  C C   . CYS A 1 50 ? 18.529 42.699 23.504 1.00 18.25  ? 50   CYS A C   1 
ATOM   386  O O   . CYS A 1 50 ? 17.583 43.184 22.856 1.00 15.77  ? 50   CYS A O   1 
ATOM   387  C CB  . CYS A 1 50 ? 17.535 41.331 25.273 1.00 15.21  ? 50   CYS A CB  1 
ATOM   388  S SG  . CYS A 1 50 ? 17.371 40.894 27.028 1.00 17.14  ? 50   CYS A SG  1 
ATOM   389  N N   . ALA A 1 51 ? 19.672 42.281 22.995 1.00 16.01  ? 51   ALA A N   1 
ATOM   390  C CA  . ALA A 1 51 ? 19.953 42.374 21.555 1.00 20.07  ? 51   ALA A CA  1 
ATOM   391  C C   . ALA A 1 51 ? 20.663 41.137 21.041 1.00 20.98  ? 51   ALA A C   1 
ATOM   392  O O   . ALA A 1 51 ? 21.379 40.464 21.782 1.00 17.81  ? 51   ALA A O   1 
ATOM   393  C CB  . ALA A 1 51 ? 20.785 43.629 21.262 1.00 16.06  ? 51   ALA A CB  1 
ATOM   394  N N   . ASN A 1 52 ? 20.447 40.828 19.757 1.00 16.44  ? 52   ASN A N   1 
ATOM   395  C CA  . ASN A 1 52 ? 21.047 39.659 19.112 1.00 17.40  ? 52   ASN A CA  1 
ATOM   396  C C   . ASN A 1 52 ? 22.512 39.852 18.798 1.00 14.27  ? 52   ASN A C   1 
ATOM   397  O O   . ASN A 1 52 ? 22.941 40.657 17.960 1.00 22.85  ? 52   ASN A O   1 
ATOM   398  C CB  . ASN A 1 52 ? 20.246 39.373 17.835 1.00 22.74  ? 52   ASN A CB  1 
ATOM   399  C CG  . ASN A 1 52 ? 20.616 38.031 17.206 1.00 29.05  ? 52   ASN A CG  1 
ATOM   400  O OD1 . ASN A 1 52 ? 21.713 37.515 17.417 1.00 22.38  ? 52   ASN A OD1 1 
ATOM   401  N ND2 . ASN A 1 52 ? 19.665 37.500 16.438 1.00 27.58  ? 52   ASN A ND2 1 
ATOM   402  N N   . PRO A 1 53 ? 23.423 39.124 19.455 1.00 15.98  ? 53   PRO A N   1 
ATOM   403  C CA  . PRO A 1 53 ? 24.839 39.324 19.207 1.00 18.12  ? 53   PRO A CA  1 
ATOM   404  C C   . PRO A 1 53 ? 25.281 39.042 17.781 1.00 19.55  ? 53   PRO A C   1 
ATOM   405  O O   . PRO A 1 53 ? 26.416 39.345 17.375 1.00 29.08  ? 53   PRO A O   1 
ATOM   406  C CB  . PRO A 1 53 ? 25.516 38.261 20.106 1.00 25.64  ? 53   PRO A CB  1 
ATOM   407  C CG  . PRO A 1 53 ? 24.464 37.564 20.865 1.00 21.55  ? 53   PRO A CG  1 
ATOM   408  C CD  . PRO A 1 53 ? 23.134 38.105 20.456 1.00 20.75  ? 53   PRO A CD  1 
ATOM   409  N N   . GLU A 1 54 ? 24.425 38.448 16.965 1.00 25.66  ? 54   GLU A N   1 
ATOM   410  C CA  . GLU A 1 54 ? 24.864 38.101 15.614 1.00 33.19  ? 54   GLU A CA  1 
ATOM   411  C C   . GLU A 1 54 ? 24.492 39.197 14.638 1.00 31.56  ? 54   GLU A C   1 
ATOM   412  O O   . GLU A 1 54 ? 24.970 39.236 13.502 1.00 33.75  ? 54   GLU A O   1 
ATOM   413  C CB  . GLU A 1 54 ? 24.248 36.746 15.237 1.00 37.51  ? 54   GLU A CB  1 
ATOM   414  C CG  . GLU A 1 54 ? 24.944 35.594 15.960 1.00 41.54  ? 54   GLU A CG  1 
ATOM   415  C CD  . GLU A 1 54 ? 24.363 34.246 15.583 1.00 57.35  ? 54   GLU A CD  1 
ATOM   416  O OE1 . GLU A 1 54 ? 23.587 34.222 14.600 1.00 63.79  ? 54   GLU A OE1 1 
ATOM   417  O OE2 . GLU A 1 54 ? 24.687 33.243 16.259 1.00 61.54  ? 54   GLU A OE2 1 
ATOM   418  N N   . LYS A 1 55 ? 23.611 40.091 15.078 1.00 24.79  ? 55   LYS A N   1 
ATOM   419  C CA  . LYS A 1 55 ? 23.207 41.187 14.204 1.00 21.97  ? 55   LYS A CA  1 
ATOM   420  C C   . LYS A 1 55 ? 24.336 42.183 13.988 1.00 19.94  ? 55   LYS A C   1 
ATOM   421  O O   . LYS A 1 55 ? 25.134 42.510 14.845 1.00 20.97  ? 55   LYS A O   1 
ATOM   422  C CB  . LYS A 1 55 ? 21.991 41.948 14.739 1.00 26.23  ? 55   LYS A CB  1 
ATOM   423  C CG  . LYS A 1 55 ? 20.670 41.247 14.464 1.00 34.61  ? 55   LYS A CG  1 
ATOM   424  C CD  . LYS A 1 55 ? 20.221 41.474 13.024 1.00 42.45  ? 55   LYS A CD  1 
ATOM   425  C CE  . LYS A 1 55 ? 18.836 40.909 12.770 1.00 47.96  ? 55   LYS A CE  1 
ATOM   426  N NZ  . LYS A 1 55 ? 17.739 41.838 13.159 1.00 59.46  ? 55   LYS A NZ  1 
ATOM   427  N N   . LYS A 1 56 ? 24.403 42.662 12.745 1.00 28.00  ? 56   LYS A N   1 
ATOM   428  C CA  . LYS A 1 56 ? 25.433 43.569 12.267 1.00 26.34  ? 56   LYS A CA  1 
ATOM   429  C C   . LYS A 1 56 ? 25.492 44.838 13.091 1.00 24.05  ? 56   LYS A C   1 
ATOM   430  O O   . LYS A 1 56 ? 26.562 45.261 13.508 1.00 20.29  ? 56   LYS A O   1 
ATOM   431  C CB  . LYS A 1 56 ? 25.139 43.845 10.785 1.00 26.24  ? 56   LYS A CB  1 
ATOM   432  C CG  . LYS A 1 56 ? 23.884 44.632 10.500 1.00 43.23  ? 56   LYS A CG  1 
ATOM   433  C CD  . LYS A 1 56 ? 22.564 43.935 10.754 1.00 45.11  ? 56   LYS A CD  1 
ATOM   434  C CE  . LYS A 1 56 ? 21.454 44.950 10.965 1.00 49.50  ? 56   LYS A CE  1 
ATOM   435  N NZ  . LYS A 1 56 ? 20.137 44.333 11.291 1.00 59.11  ? 56   LYS A NZ  1 
ATOM   436  N N   . TRP A 1 57 ? 24.341 45.469 13.335 1.00 25.02  ? 57   TRP A N   1 
ATOM   437  C CA  . TRP A 1 57 ? 24.302 46.748 14.031 1.00 24.61  ? 57   TRP A CA  1 
ATOM   438  C C   . TRP A 1 57 ? 24.754 46.527 15.479 1.00 18.03  ? 57   TRP A C   1 
ATOM   439  O O   . TRP A 1 57 ? 25.371 47.414 16.078 1.00 20.63  ? 57   TRP A O   1 
ATOM   440  C CB  . TRP A 1 57 ? 22.924 47.393 13.963 1.00 18.73  ? 57   TRP A CB  1 
ATOM   441  C CG  . TRP A 1 57 ? 21.804 46.729 14.702 1.00 24.23  ? 57   TRP A CG  1 
ATOM   442  C CD1 . TRP A 1 57 ? 20.904 45.818 14.231 1.00 26.96  ? 57   TRP A CD1 1 
ATOM   443  C CD2 . TRP A 1 57 ? 21.448 46.928 16.089 1.00 23.43  ? 57   TRP A CD2 1 
ATOM   444  N NE1 . TRP A 1 57 ? 20.017 45.427 15.210 1.00 20.80  ? 57   TRP A NE1 1 
ATOM   445  C CE2 . TRP A 1 57 ? 20.339 46.106 16.359 1.00 21.92  ? 57   TRP A CE2 1 
ATOM   446  C CE3 . TRP A 1 57 ? 21.971 47.727 17.117 1.00 19.08  ? 57   TRP A CE3 1 
ATOM   447  C CZ2 . TRP A 1 57 ? 19.737 46.063 17.622 1.00 16.64  ? 57   TRP A CZ2 1 
ATOM   448  C CZ3 . TRP A 1 57 ? 21.379 47.682 18.361 1.00 22.48  ? 57   TRP A CZ3 1 
ATOM   449  C CH2 . TRP A 1 57 ? 20.276 46.857 18.604 1.00 20.31  ? 57   TRP A CH2 1 
ATOM   450  N N   . VAL A 1 58 ? 24.439 45.345 16.002 1.00 20.01  ? 58   VAL A N   1 
ATOM   451  C CA  . VAL A 1 58 ? 24.821 45.022 17.383 1.00 16.42  ? 58   VAL A CA  1 
ATOM   452  C C   . VAL A 1 58 ? 26.322 44.910 17.507 1.00 19.58  ? 58   VAL A C   1 
ATOM   453  O O   . VAL A 1 58 ? 26.965 45.440 18.421 1.00 19.35  ? 58   VAL A O   1 
ATOM   454  C CB  . VAL A 1 58 ? 24.115 43.733 17.851 1.00 22.19  ? 58   VAL A CB  1 
ATOM   455  C CG1 . VAL A 1 58 ? 24.563 43.303 19.245 1.00 23.56  ? 58   VAL A CG1 1 
ATOM   456  C CG2 . VAL A 1 58 ? 22.603 43.943 17.846 1.00 18.15  ? 58   VAL A CG2 1 
ATOM   457  N N   . ARG A 1 59 ? 26.940 44.227 16.534 1.00 17.78  ? 59   ARG A N   1 
ATOM   458  C CA  . ARG A 1 59 ? 28.386 44.076 16.531 1.00 22.73  ? 59   ARG A CA  1 
ATOM   459  C C   . ARG A 1 59 ? 29.061 45.419 16.334 1.00 23.69  ? 59   ARG A C   1 
ATOM   460  O O   . ARG A 1 59 ? 30.118 45.682 16.922 1.00 23.74  ? 59   ARG A O   1 
ATOM   461  C CB  . ARG A 1 59 ? 28.797 43.058 15.444 1.00 26.63  ? 59   ARG A CB  1 
ATOM   462  C CG  . ARG A 1 59 ? 28.465 41.636 15.873 1.00 31.22  ? 59   ARG A CG  1 
ATOM   463  C CD  . ARG A 1 59 ? 28.582 40.623 14.757 1.00 34.72  ? 59   ARG A CD  1 
ATOM   464  N NE  . ARG A 1 59 ? 28.084 41.127 13.483 1.00 47.11  ? 59   ARG A NE  1 
ATOM   465  C CZ  . ARG A 1 59 ? 27.509 40.357 12.568 1.00 50.99  ? 59   ARG A CZ  1 
ATOM   466  N NH1 . ARG A 1 59 ? 27.083 40.890 11.433 1.00 58.86  ? 59   ARG A NH1 1 
ATOM   467  N NH2 . ARG A 1 59 ? 27.359 39.058 12.790 1.00 63.15  ? 59   ARG A NH2 1 
ATOM   468  N N   . GLU A 1 60 ? 28.437 46.291 15.531 1.00 27.55  ? 60   GLU A N   1 
ATOM   469  C CA  . GLU A 1 60 ? 29.014 47.634 15.324 1.00 20.58  ? 60   GLU A CA  1 
ATOM   470  C C   . GLU A 1 60 ? 28.939 48.530 16.546 1.00 17.57  ? 60   GLU A C   1 
ATOM   471  O O   . GLU A 1 60 ? 29.857 49.292 16.875 1.00 20.19  ? 60   GLU A O   1 
ATOM   472  C CB  . GLU A 1 60 ? 28.283 48.275 14.128 1.00 21.42  ? 60   GLU A CB  1 
ATOM   473  C CG  . GLU A 1 60 ? 28.562 47.515 12.834 1.00 34.66  ? 60   GLU A CG  1 
ATOM   474  C CD  . GLU A 1 60 ? 28.225 48.325 11.597 1.00 53.50  ? 60   GLU A CD  1 
ATOM   475  O OE1 . GLU A 1 60 ? 29.182 48.719 10.894 1.00 62.81  ? 60   GLU A OE1 1 
ATOM   476  O OE2 . GLU A 1 60 ? 27.021 48.564 11.343 1.00 56.11  ? 60   GLU A OE2 1 
ATOM   477  N N   . TYR A 1 61 ? 27.811 48.439 17.252 1.00 18.55  ? 61   TYR A N   1 
ATOM   478  C CA  . TYR A 1 61 ? 27.633 49.205 18.484 1.00 18.40  ? 61   TYR A CA  1 
ATOM   479  C C   . TYR A 1 61 ? 28.651 48.763 19.535 1.00 18.06  ? 61   TYR A C   1 
ATOM   480  O O   . TYR A 1 61 ? 29.229 49.543 20.287 1.00 16.74  ? 61   TYR A O   1 
ATOM   481  C CB  . TYR A 1 61 ? 26.218 49.035 19.030 1.00 17.91  ? 61   TYR A CB  1 
ATOM   482  C CG  . TYR A 1 61 ? 25.141 49.863 18.364 1.00 23.12  ? 61   TYR A CG  1 
ATOM   483  C CD1 . TYR A 1 61 ? 25.300 50.316 17.061 1.00 21.14  ? 61   TYR A CD1 1 
ATOM   484  C CD2 . TYR A 1 61 ? 23.974 50.191 19.027 1.00 17.22  ? 61   TYR A CD2 1 
ATOM   485  C CE1 . TYR A 1 61 ? 24.287 51.073 16.481 1.00 19.97  ? 61   TYR A CE1 1 
ATOM   486  C CE2 . TYR A 1 61 ? 22.954 50.945 18.462 1.00 17.95  ? 61   TYR A CE2 1 
ATOM   487  C CZ  . TYR A 1 61 ? 23.145 51.385 17.156 1.00 19.17  ? 61   TYR A CZ  1 
ATOM   488  O OH  . TYR A 1 61 ? 22.161 52.138 16.547 1.00 27.88  ? 61   TYR A OH  1 
ATOM   489  N N   . ILE A 1 62 ? 28.871 47.440 19.610 1.00 20.18  ? 62   ILE A N   1 
ATOM   490  C CA  . ILE A 1 62 ? 29.849 46.947 20.602 1.00 13.90  ? 62   ILE A CA  1 
ATOM   491  C C   . ILE A 1 62 ? 31.229 47.459 20.265 1.00 14.80  ? 62   ILE A C   1 
ATOM   492  O O   . ILE A 1 62 ? 32.005 47.931 21.095 1.00 18.18  ? 62   ILE A O   1 
ATOM   493  C CB  . ILE A 1 62 ? 29.851 45.405 20.624 1.00 15.83  ? 62   ILE A CB  1 
ATOM   494  C CG1 . ILE A 1 62 ? 28.563 44.857 21.261 1.00 14.06  ? 62   ILE A CG1 1 
ATOM   495  C CG2 . ILE A 1 62 ? 31.091 44.849 21.297 1.00 18.92  ? 62   ILE A CG2 1 
ATOM   496  C CD1 . ILE A 1 62 ? 28.439 43.359 21.068 1.00 30.75  ? 62   ILE A CD1 1 
ATOM   497  N N   . ASN A 1 63 ? 31.549 47.404 18.962 1.00 18.55  ? 63   ASN A N   1 
ATOM   498  C CA  . ASN A 1 63 ? 32.880 47.874 18.583 1.00 20.49  ? 63   ASN A CA  1 
ATOM   499  C C   . ASN A 1 63 ? 33.010 49.362 18.909 1.00 18.05  ? 63   ASN A C   1 
ATOM   500  O O   . ASN A 1 63 ? 34.051 49.824 19.359 1.00 21.21  ? 63   ASN A O   1 
ATOM   501  C CB  . ASN A 1 63 ? 33.167 47.604 17.107 1.00 26.99  ? 63   ASN A CB  1 
ATOM   502  C CG  . ASN A 1 63 ? 33.205 46.131 16.744 1.00 23.04  ? 63   ASN A CG  1 
ATOM   503  O OD1 . ASN A 1 63 ? 33.034 45.750 15.579 1.00 25.24  ? 63   ASN A OD1 1 
ATOM   504  N ND2 . ASN A 1 63 ? 33.422 45.303 17.768 1.00 18.97  ? 63   ASN A ND2 1 
ATOM   505  N N   . SER A 1 64 ? 31.939 50.115 18.676 1.00 16.32  ? 64   SER A N   1 
ATOM   506  C CA  . SER A 1 64 ? 31.954 51.552 18.916 1.00 20.67  ? 64   SER A CA  1 
ATOM   507  C C   . SER A 1 64 ? 32.044 51.817 20.411 1.00 28.16  ? 64   SER A C   1 
ATOM   508  O O   . SER A 1 64 ? 32.809 52.659 20.866 1.00 27.61  ? 64   SER A O   1 
ATOM   509  C CB  . SER A 1 64 ? 30.711 52.218 18.318 1.00 20.19  ? 64   SER A CB  1 
ATOM   510  O OG  . SER A 1 64 ? 30.587 53.559 18.786 1.00 21.61  ? 64   SER A OG  1 
ATOM   511  N N   . LEU A 1 65 ? 31.281 51.067 21.204 1.00 23.48  ? 65   LEU A N   1 
ATOM   512  C CA  . LEU A 1 65 ? 31.407 51.257 22.654 1.00 24.25  ? 65   LEU A CA  1 
ATOM   513  C C   . LEU A 1 65 ? 32.780 50.858 23.158 1.00 25.10  ? 65   LEU A C   1 
ATOM   514  O O   . LEU A 1 65 ? 33.242 51.352 24.186 1.00 27.91  ? 65   LEU A O   1 
ATOM   515  C CB  . LEU A 1 65 ? 30.359 50.435 23.419 1.00 25.68  ? 65   LEU A CB  1 
ATOM   516  C CG  . LEU A 1 65 ? 28.905 50.909 23.295 1.00 19.34  ? 65   LEU A CG  1 
ATOM   517  C CD1 . LEU A 1 65 ? 27.957 49.744 23.506 1.00 22.23  ? 65   LEU A CD1 1 
ATOM   518  C CD2 . LEU A 1 65 ? 28.638 52.025 24.299 1.00 20.09  ? 65   LEU A CD2 1 
ATOM   519  N N   . GLU A 1 66 ? 33.454 49.939 22.464 1.00 27.80  ? 66   GLU A N   1 
ATOM   520  C CA  . GLU A 1 66 ? 34.767 49.519 22.955 1.00 28.23  ? 66   GLU A CA  1 
ATOM   521  C C   . GLU A 1 66 ? 35.859 50.513 22.552 1.00 36.71  ? 66   GLU A C   1 
ATOM   522  O O   . GLU A 1 66 ? 36.887 50.556 23.234 1.00 30.73  ? 66   GLU A O   1 
ATOM   523  C CB  . GLU A 1 66 ? 35.078 48.089 22.481 1.00 26.95  ? 66   GLU A CB  1 
ATOM   524  C CG  . GLU A 1 66 ? 34.250 47.098 23.277 1.00 27.35  ? 66   GLU A CG  1 
ATOM   525  C CD  . GLU A 1 66 ? 34.645 45.655 23.163 1.00 33.44  ? 66   GLU A CD  1 
ATOM   526  O OE1 . GLU A 1 66 ? 34.242 44.895 24.077 1.00 32.15  ? 66   GLU A OE1 1 
ATOM   527  O OE2 . GLU A 1 66 ? 35.321 45.253 22.192 1.00 29.65  ? 66   GLU A OE2 1 
ATOM   528  N N   . MET A 1 67 ? 35.647 51.312 21.516 1.00 40.26  ? 67   MET A N   1 
ATOM   529  C CA  . MET A 1 67 ? 36.573 52.342 21.062 1.00 65.99  ? 67   MET A CA  1 
ATOM   530  C C   . MET A 1 67 ? 36.349 53.665 21.792 1.00 84.76  ? 67   MET A C   1 
ATOM   531  O O   . MET A 1 67 ? 35.199 54.028 22.059 1.00 96.61  ? 67   MET A O   1 
ATOM   532  C CB  . MET A 1 67 ? 36.452 52.586 19.550 1.00 72.50  ? 67   MET A CB  1 
ATOM   533  C CG  . MET A 1 67 ? 35.167 53.246 19.090 1.00 79.68  ? 67   MET A CG  1 
ATOM   534  S SD  . MET A 1 67 ? 35.084 53.651 17.326 1.00 48.31  ? 67   MET A SD  1 
ATOM   535  C CE  . MET A 1 67 ? 35.934 55.230 17.331 1.00 43.86  ? 67   MET A CE  1 
ATOM   536  N N   . SER A 1 68 ? 37.415 54.394 22.111 1.00 98.27  ? 68   SER A N   1 
ATOM   537  C CA  . SER A 1 68 ? 37.295 55.724 22.703 1.00 108.87 ? 68   SER A CA  1 
ATOM   538  C C   . SER A 1 68 ? 38.656 56.360 22.981 1.00 115.12 ? 68   SER A C   1 
ATOM   539  O O   . SER A 1 68 ? 38.673 57.502 23.493 1.00 118.07 ? 68   SER A O   1 
ATOM   540  C CB  . SER A 1 68 ? 36.490 55.698 24.007 1.00 110.50 ? 68   SER A CB  1 
ATOM   541  O OG  . SER A 1 68 ? 36.486 56.980 24.621 1.00 101.50 ? 68   SER A OG  1 
ATOM   542  O OXT . SER A 1 68 ? 39.686 55.721 22.692 1.00 121.14 ? 68   SER A OXT 1 
ATOM   543  N N   . GLY B 1 2  ? 6.937  35.059 21.445 1.00 89.29  ? 2    GLY B N   1 
ATOM   544  C CA  . GLY B 1 2  ? 7.529  36.368 21.658 1.00 69.93  ? 2    GLY B CA  1 
ATOM   545  C C   . GLY B 1 2  ? 7.484  36.812 23.103 1.00 62.95  ? 2    GLY B C   1 
ATOM   546  O O   . GLY B 1 2  ? 6.569  36.484 23.867 1.00 41.63  ? 2    GLY B O   1 
ATOM   547  N N   . TYR B 1 3  ? 8.509  37.562 23.527 1.00 48.70  ? 3    TYR B N   1 
ATOM   548  C CA  . TYR B 1 3  ? 8.551  38.109 24.879 1.00 43.66  ? 3    TYR B CA  1 
ATOM   549  C C   . TYR B 1 3  ? 9.076  39.535 24.774 1.00 23.85  ? 3    TYR B C   1 
ATOM   550  O O   . TYR B 1 3  ? 9.402  39.966 23.666 1.00 36.94  ? 3    TYR B O   1 
ATOM   551  C CB  . TYR B 1 3  ? 9.399  37.293 25.855 1.00 51.81  ? 3    TYR B CB  1 
ATOM   552  C CG  . TYR B 1 3  ? 9.238  35.796 25.692 1.00 71.94  ? 3    TYR B CG  1 
ATOM   553  C CD1 . TYR B 1 3  ? 10.206 35.061 25.016 1.00 79.78  ? 3    TYR B CD1 1 
ATOM   554  C CD2 . TYR B 1 3  ? 8.128  35.111 26.174 1.00 78.20  ? 3    TYR B CD2 1 
ATOM   555  C CE1 . TYR B 1 3  ? 10.093 33.695 24.837 1.00 80.16  ? 3    TYR B CE1 1 
ATOM   556  C CE2 . TYR B 1 3  ? 8.007  33.739 26.006 1.00 77.56  ? 3    TYR B CE2 1 
ATOM   557  C CZ  . TYR B 1 3  ? 8.989  33.040 25.337 1.00 79.44  ? 3    TYR B CZ  1 
ATOM   558  O OH  . TYR B 1 3  ? 8.897  31.680 25.150 1.00 96.68  ? 3    TYR B OH  1 
ATOM   559  N N   . SER B 1 4  ? 9.144  40.258 25.878 1.00 25.43  ? 4    SER B N   1 
ATOM   560  C CA  . SER B 1 4  ? 9.727  41.597 25.736 1.00 24.02  ? 4    SER B CA  1 
ATOM   561  C C   . SER B 1 4  ? 11.239 41.447 25.582 1.00 28.43  ? 4    SER B C   1 
ATOM   562  O O   . SER B 1 4  ? 11.775 40.358 25.810 1.00 23.28  ? 4    SER B O   1 
ATOM   563  C CB  . SER B 1 4  ? 9.345  42.487 26.901 1.00 26.19  ? 4    SER B CB  1 
ATOM   564  O OG  . SER B 1 4  ? 9.868  42.055 28.124 1.00 38.42  ? 4    SER B OG  1 
ATOM   565  N N   . SER B 1 5  ? 11.911 42.518 25.190 1.00 22.11  ? 5    SER B N   1 
ATOM   566  C CA  . SER B 1 5  ? 13.381 42.439 25.132 1.00 20.71  ? 5    SER B CA  1 
ATOM   567  C C   . SER B 1 5  ? 14.008 42.907 26.432 1.00 20.88  ? 5    SER B C   1 
ATOM   568  O O   . SER B 1 5  ? 15.199 43.239 26.501 1.00 18.57  ? 5    SER B O   1 
ATOM   569  C CB  . SER B 1 5  ? 13.862 43.207 23.897 1.00 23.05  ? 5    SER B CB  1 
ATOM   570  O OG  . SER B 1 5  ? 13.447 44.568 23.996 1.00 40.31  ? 5    SER B OG  1 
ATOM   571  N N   . ASP B 1 6  ? 13.273 42.969 27.543 1.00 18.88  ? 6    ASP B N   1 
ATOM   572  C CA  . ASP B 1 6  ? 13.833 43.226 28.858 1.00 19.26  ? 6    ASP B CA  1 
ATOM   573  C C   . ASP B 1 6  ? 14.590 41.999 29.374 1.00 16.78  ? 6    ASP B C   1 
ATOM   574  O O   . ASP B 1 6  ? 14.288 40.908 28.915 1.00 19.20  ? 6    ASP B O   1 
ATOM   575  C CB  . ASP B 1 6  ? 12.767 43.490 29.927 1.00 26.76  ? 6    ASP B CB  1 
ATOM   576  C CG  . ASP B 1 6  ? 12.069 44.824 29.733 1.00 28.36  ? 6    ASP B CG  1 
ATOM   577  O OD1 . ASP B 1 6  ? 11.153 45.099 30.542 1.00 30.93  ? 6    ASP B OD1 1 
ATOM   578  O OD2 . ASP B 1 6  ? 12.475 45.523 28.788 1.00 28.67  ? 6    ASP B OD2 1 
ATOM   579  N N   . THR B 1 7  ? 15.513 42.170 30.317 1.00 15.62  ? 7    THR B N   1 
ATOM   580  C CA  . THR B 1 7  ? 16.119 40.979 30.911 1.00 14.67  ? 7    THR B CA  1 
ATOM   581  C C   . THR B 1 7  ? 15.186 40.458 32.013 1.00 24.33  ? 7    THR B C   1 
ATOM   582  O O   . THR B 1 7  ? 14.305 41.193 32.469 1.00 18.88  ? 7    THR B O   1 
ATOM   583  C CB  . THR B 1 7  ? 17.517 41.197 31.524 1.00 16.32  ? 7    THR B CB  1 
ATOM   584  O OG1 . THR B 1 7  ? 17.364 42.192 32.552 1.00 21.33  ? 7    THR B OG1 1 
ATOM   585  C CG2 . THR B 1 7  ? 18.504 41.734 30.511 1.00 15.57  ? 7    THR B CG2 1 
ATOM   586  N N   . THR B 1 8  ? 15.435 39.206 32.359 1.00 14.41  ? 8    THR B N   1 
ATOM   587  C CA  . THR B 1 8  ? 14.631 38.464 33.308 1.00 16.52  ? 8    THR B CA  1 
ATOM   588  C C   . THR B 1 8  ? 15.548 37.740 34.277 1.00 15.49  ? 8    THR B C   1 
ATOM   589  O O   . THR B 1 8  ? 16.448 37.057 33.812 1.00 18.98  ? 8    THR B O   1 
ATOM   590  C CB  . THR B 1 8  ? 13.704 37.454 32.605 1.00 23.22  ? 8    THR B CB  1 
ATOM   591  O OG1 . THR B 1 8  ? 12.794 38.158 31.749 1.00 32.78  ? 8    THR B OG1 1 
ATOM   592  C CG2 . THR B 1 8  ? 12.831 36.732 33.619 1.00 32.71  ? 8    THR B CG2 1 
ATOM   593  N N   . PRO B 1 9  ? 15.401 37.826 35.589 1.00 14.93  ? 9    PRO B N   1 
ATOM   594  C CA  . PRO B 1 9  ? 16.300 37.072 36.464 1.00 16.03  ? 9    PRO B CA  1 
ATOM   595  C C   . PRO B 1 9  ? 16.061 35.564 36.419 1.00 16.83  ? 9    PRO B C   1 
ATOM   596  O O   . PRO B 1 9  ? 14.916 35.120 36.588 1.00 17.39  ? 9    PRO B O   1 
ATOM   597  C CB  . PRO B 1 9  ? 16.007 37.662 37.846 1.00 14.90  ? 9    PRO B CB  1 
ATOM   598  C CG  . PRO B 1 9  ? 14.598 38.176 37.762 1.00 17.60  ? 9    PRO B CG  1 
ATOM   599  C CD  . PRO B 1 9  ? 14.430 38.656 36.344 1.00 18.70  ? 9    PRO B CD  1 
ATOM   600  N N   . CYS B 1 10 ? 17.087 34.742 36.188 1.00 13.10  ? 10   CYS B N   1 
ATOM   601  C CA  . CYS B 1 10 ? 16.933 33.294 36.224 1.00 14.25  ? 10   CYS B CA  1 
ATOM   602  C C   . CYS B 1 10 ? 17.894 32.712 37.278 1.00 12.18  ? 10   CYS B C   1 
ATOM   603  O O   . CYS B 1 10 ? 18.880 33.370 37.631 1.00 17.45  ? 10   CYS B O   1 
ATOM   604  C CB  . CYS B 1 10 ? 17.173 32.592 34.885 1.00 14.30  ? 10   CYS B CB  1 
ATOM   605  S SG  . CYS B 1 10 ? 15.927 33.023 33.617 1.00 15.78  ? 10   CYS B SG  1 
ATOM   606  N N   . CYS B 1 11 ? 17.602 31.533 37.754 1.00 11.02  ? 11   CYS B N   1 
ATOM   607  C CA  . CYS B 1 11 ? 18.400 30.853 38.781 1.00 13.50  ? 11   CYS B CA  1 
ATOM   608  C C   . CYS B 1 11 ? 19.126 29.630 38.262 1.00 14.36  ? 11   CYS B C   1 
ATOM   609  O O   . CYS B 1 11 ? 18.510 28.868 37.508 1.00 15.97  ? 11   CYS B O   1 
ATOM   610  C CB  . CYS B 1 11 ? 17.486 30.386 39.945 1.00 14.88  ? 11   CYS B CB  1 
ATOM   611  S SG  . CYS B 1 11 ? 16.899 31.802 40.921 1.00 15.04  ? 11   CYS B SG  1 
ATOM   612  N N   . PHE B 1 12 ? 20.373 29.406 38.687 1.00 13.08  ? 12   PHE B N   1 
ATOM   613  C CA  . PHE B 1 12 ? 21.104 28.231 38.204 1.00 14.85  ? 12   PHE B CA  1 
ATOM   614  C C   . PHE B 1 12 ? 21.623 27.371 39.330 1.00 21.86  ? 12   PHE B C   1 
ATOM   615  O O   . PHE B 1 12 ? 22.188 26.307 39.089 1.00 18.91  ? 12   PHE B O   1 
ATOM   616  C CB  . PHE B 1 12 ? 22.251 28.704 37.280 1.00 16.14  ? 12   PHE B CB  1 
ATOM   617  C CG  . PHE B 1 12 ? 21.605 29.329 36.025 1.00 16.54  ? 12   PHE B CG  1 
ATOM   618  C CD1 . PHE B 1 12 ? 21.514 30.683 35.873 1.00 14.63  ? 12   PHE B CD1 1 
ATOM   619  C CD2 . PHE B 1 12 ? 21.062 28.507 35.048 1.00 14.13  ? 12   PHE B CD2 1 
ATOM   620  C CE1 . PHE B 1 12 ? 20.887 31.248 34.774 1.00 17.83  ? 12   PHE B CE1 1 
ATOM   621  C CE2 . PHE B 1 12 ? 20.455 29.056 33.928 1.00 14.76  ? 12   PHE B CE2 1 
ATOM   622  C CZ  . PHE B 1 12 ? 20.367 30.424 33.784 1.00 15.24  ? 12   PHE B CZ  1 
ATOM   623  N N   . ALA B 1 13 ? 21.431 27.801 40.583 1.00 18.25  ? 13   ALA B N   1 
ATOM   624  C CA  . ALA B 1 13 ? 21.735 26.954 41.731 1.00 19.39  ? 13   ALA B CA  1 
ATOM   625  C C   . ALA B 1 13 ? 20.844 27.404 42.893 1.00 18.06  ? 13   ALA B C   1 
ATOM   626  O O   . ALA B 1 13 ? 20.435 28.567 42.906 1.00 21.93  ? 13   ALA B O   1 
ATOM   627  C CB  . ALA B 1 13 ? 23.185 27.031 42.158 1.00 22.79  ? 13   ALA B CB  1 
ATOM   628  N N   . TYR B 1 14 ? 20.559 26.514 43.816 1.00 21.76  ? 14   TYR B N   1 
ATOM   629  C CA  . TYR B 1 14 ? 19.726 26.851 44.968 1.00 23.19  ? 14   TYR B CA  1 
ATOM   630  C C   . TYR B 1 14 ? 20.575 26.959 46.228 1.00 33.79  ? 14   TYR B C   1 
ATOM   631  O O   . TYR B 1 14 ? 21.509 26.179 46.445 1.00 20.35  ? 14   TYR B O   1 
ATOM   632  C CB  . TYR B 1 14 ? 18.669 25.777 45.130 1.00 22.32  ? 14   TYR B CB  1 
ATOM   633  C CG  . TYR B 1 14 ? 17.786 25.510 43.932 1.00 28.40  ? 14   TYR B CG  1 
ATOM   634  C CD1 . TYR B 1 14 ? 17.060 26.500 43.295 1.00 26.29  ? 14   TYR B CD1 1 
ATOM   635  C CD2 . TYR B 1 14 ? 17.670 24.217 43.418 1.00 29.34  ? 14   TYR B CD2 1 
ATOM   636  C CE1 . TYR B 1 14 ? 16.257 26.244 42.203 1.00 23.59  ? 14   TYR B CE1 1 
ATOM   637  C CE2 . TYR B 1 14 ? 16.860 23.951 42.328 1.00 31.13  ? 14   TYR B CE2 1 
ATOM   638  C CZ  . TYR B 1 14 ? 16.152 24.958 41.712 1.00 31.60  ? 14   TYR B CZ  1 
ATOM   639  O OH  . TYR B 1 14 ? 15.347 24.676 40.624 1.00 27.08  ? 14   TYR B OH  1 
ATOM   640  N N   . ILE B 1 15 ? 20.246 27.939 47.071 1.00 26.33  ? 15   ILE B N   1 
ATOM   641  C CA  . ILE B 1 15 ? 20.896 27.975 48.393 1.00 26.61  ? 15   ILE B CA  1 
ATOM   642  C C   . ILE B 1 15 ? 20.538 26.681 49.116 1.00 20.70  ? 15   ILE B C   1 
ATOM   643  O O   . ILE B 1 15 ? 19.388 26.246 49.182 1.00 24.11  ? 15   ILE B O   1 
ATOM   644  C CB  . ILE B 1 15 ? 20.496 29.231 49.188 1.00 27.12  ? 15   ILE B CB  1 
ATOM   645  C CG1 . ILE B 1 15 ? 21.442 29.552 50.345 1.00 37.17  ? 15   ILE B CG1 1 
ATOM   646  C CG2 . ILE B 1 15 ? 19.041 29.150 49.635 1.00 18.02  ? 15   ILE B CG2 1 
ATOM   647  C CD1 . ILE B 1 15 ? 21.245 30.887 51.019 1.00 40.98  ? 15   ILE B CD1 1 
ATOM   648  N N   . ALA B 1 16 ? 21.577 26.035 49.631 1.00 43.23  ? 16   ALA B N   1 
ATOM   649  C CA  . ALA B 1 16 ? 21.467 24.761 50.328 1.00 48.18  ? 16   ALA B CA  1 
ATOM   650  C C   . ALA B 1 16 ? 20.708 24.892 51.643 1.00 45.57  ? 16   ALA B C   1 
ATOM   651  O O   . ALA B 1 16 ? 19.664 24.274 51.863 1.00 45.99  ? 16   ALA B O   1 
ATOM   652  C CB  . ALA B 1 16 ? 22.862 24.205 50.588 1.00 62.45  ? 16   ALA B CB  1 
ATOM   653  N N   . ARG B 1 17 ? 21.245 25.726 52.535 1.00 37.92  ? 17   ARG B N   1 
ATOM   654  C CA  . ARG B 1 17 ? 20.612 25.862 53.846 1.00 41.48  ? 17   ARG B CA  1 
ATOM   655  C C   . ARG B 1 17 ? 19.757 27.121 53.960 1.00 46.57  ? 17   ARG B C   1 
ATOM   656  O O   . ARG B 1 17 ? 20.001 28.170 53.366 1.00 35.40  ? 17   ARG B O   1 
ATOM   657  C CB  . ARG B 1 17 ? 21.683 25.823 54.946 1.00 49.83  ? 17   ARG B CB  1 
ATOM   658  C CG  . ARG B 1 17 ? 22.477 24.525 54.951 1.00 60.63  ? 17   ARG B CG  1 
ATOM   659  C CD  . ARG B 1 17 ? 21.828 23.435 55.779 1.00 64.49  ? 17   ARG B CD  1 
ATOM   660  N NE  . ARG B 1 17 ? 20.393 23.311 55.569 1.00 66.05  ? 17   ARG B NE  1 
ATOM   661  C CZ  . ARG B 1 17 ? 19.784 22.465 54.752 1.00 65.99  ? 17   ARG B CZ  1 
ATOM   662  N NH1 . ARG B 1 17 ? 18.458 22.455 54.653 1.00 63.76  ? 17   ARG B NH1 1 
ATOM   663  N NH2 . ARG B 1 17 ? 20.484 21.612 54.019 1.00 83.84  ? 17   ARG B NH2 1 
ATOM   664  N N   . PRO B 1 18 ? 18.704 26.983 54.767 1.00 43.77  ? 18   PRO B N   1 
ATOM   665  C CA  . PRO B 1 18 ? 17.740 28.078 54.966 1.00 25.49  ? 18   PRO B CA  1 
ATOM   666  C C   . PRO B 1 18 ? 18.498 29.318 55.427 1.00 33.42  ? 18   PRO B C   1 
ATOM   667  O O   . PRO B 1 18 ? 19.471 29.266 56.185 1.00 28.63  ? 18   PRO B O   1 
ATOM   668  C CB  . PRO B 1 18 ? 16.812 27.526 56.031 1.00 42.92  ? 18   PRO B CB  1 
ATOM   669  C CG  . PRO B 1 18 ? 16.940 26.041 55.921 1.00 40.67  ? 18   PRO B CG  1 
ATOM   670  C CD  . PRO B 1 18 ? 18.376 25.779 55.551 1.00 36.15  ? 18   PRO B CD  1 
ATOM   671  N N   . MET B 1 19 ? 18.068 30.478 54.931 1.00 26.26  ? 19   MET B N   1 
ATOM   672  C CA  . MET B 1 19 ? 18.653 31.731 55.402 1.00 30.46  ? 19   MET B CA  1 
ATOM   673  C C   . MET B 1 19 ? 17.859 32.212 56.612 1.00 24.23  ? 19   MET B C   1 
ATOM   674  O O   . MET B 1 19 ? 16.801 31.619 56.845 1.00 23.52  ? 19   MET B O   1 
ATOM   675  C CB  . MET B 1 19 ? 18.627 32.735 54.261 1.00 40.60  ? 19   MET B CB  1 
ATOM   676  C CG  . MET B 1 19 ? 17.300 32.654 53.501 1.00 36.53  ? 19   MET B CG  1 
ATOM   677  S SD  . MET B 1 19 ? 17.533 33.103 51.770 1.00 47.22  ? 19   MET B SD  1 
ATOM   678  C CE  . MET B 1 19 ? 16.946 34.797 51.798 1.00 46.06  ? 19   MET B CE  1 
ATOM   679  N N   . PRO B 1 20 ? 18.310 33.193 57.370 1.00 33.04  ? 20   PRO B N   1 
ATOM   680  C CA  . PRO B 1 20 ? 17.495 33.663 58.501 1.00 38.46  ? 20   PRO B CA  1 
ATOM   681  C C   . PRO B 1 20 ? 16.186 34.278 58.027 1.00 26.38  ? 20   PRO B C   1 
ATOM   682  O O   . PRO B 1 20 ? 16.099 35.129 57.147 1.00 22.30  ? 20   PRO B O   1 
ATOM   683  C CB  . PRO B 1 20 ? 18.376 34.721 59.181 1.00 32.34  ? 20   PRO B CB  1 
ATOM   684  C CG  . PRO B 1 20 ? 19.757 34.452 58.678 1.00 36.67  ? 20   PRO B CG  1 
ATOM   685  C CD  . PRO B 1 20 ? 19.577 33.937 57.273 1.00 37.96  ? 20   PRO B CD  1 
ATOM   686  N N   . ARG B 1 21 ? 15.079 33.850 58.639 1.00 20.99  ? 21   ARG B N   1 
ATOM   687  C CA  . ARG B 1 21 ? 13.785 34.365 58.168 1.00 23.24  ? 21   ARG B CA  1 
ATOM   688  C C   . ARG B 1 21 ? 13.687 35.869 58.352 1.00 15.87  ? 21   ARG B C   1 
ATOM   689  O O   . ARG B 1 21 ? 13.001 36.579 57.632 1.00 22.39  ? 21   ARG B O   1 
ATOM   690  C CB  . ARG B 1 21 ? 12.644 33.622 58.898 1.00 19.14  ? 21   ARG B CB  1 
ATOM   691  C CG  . ARG B 1 21 ? 11.308 34.314 58.729 1.00 19.03  ? 21   ARG B CG  1 
ATOM   692  C CD  . ARG B 1 21 ? 10.817 34.203 57.283 1.00 23.67  ? 21   ARG B CD  1 
ATOM   693  N NE  . ARG B 1 21 ? 9.475  34.777 57.121 1.00 25.56  ? 21   ARG B NE  1 
ATOM   694  C CZ  . ARG B 1 21 ? 9.208  36.059 56.876 1.00 24.19  ? 21   ARG B CZ  1 
ATOM   695  N NH1 . ARG B 1 21 ? 10.141 36.994 56.740 1.00 27.45  ? 21   ARG B NH1 1 
ATOM   696  N NH2 . ARG B 1 21 ? 7.955  36.448 56.749 1.00 24.63  ? 21   ARG B NH2 1 
ATOM   697  N N   . ALA B 1 22 ? 14.411 36.403 59.346 1.00 17.31  ? 22   ALA B N   1 
ATOM   698  C CA  . ALA B 1 22 ? 14.248 37.835 59.616 1.00 24.76  ? 22   ALA B CA  1 
ATOM   699  C C   . ALA B 1 22 ? 14.871 38.728 58.539 1.00 34.19  ? 22   ALA B C   1 
ATOM   700  O O   . ALA B 1 22 ? 14.474 39.883 58.376 1.00 33.28  ? 22   ALA B O   1 
ATOM   701  C CB  . ALA B 1 22 ? 14.828 38.165 60.987 1.00 26.38  ? 22   ALA B CB  1 
ATOM   702  N N   . HIS B 1 23 ? 15.839 38.223 57.792 1.00 25.40  ? 23   HIS B N   1 
ATOM   703  C CA  . HIS B 1 23 ? 16.484 38.967 56.712 1.00 24.86  ? 23   HIS B CA  1 
ATOM   704  C C   . HIS B 1 23 ? 15.669 39.029 55.432 1.00 29.21  ? 23   HIS B C   1 
ATOM   705  O O   . HIS B 1 23 ? 16.072 39.702 54.464 1.00 29.74  ? 23   HIS B O   1 
ATOM   706  C CB  . HIS B 1 23 ? 17.823 38.284 56.391 1.00 28.79  ? 23   HIS B CB  1 
ATOM   707  C CG  . HIS B 1 23 ? 18.794 38.383 57.523 1.00 28.37  ? 23   HIS B CG  1 
ATOM   708  N ND1 . HIS B 1 23 ? 20.108 38.013 57.399 1.00 30.31  ? 23   HIS B ND1 1 
ATOM   709  C CD2 . HIS B 1 23 ? 18.611 38.817 58.798 1.00 23.73  ? 23   HIS B CD2 1 
ATOM   710  C CE1 . HIS B 1 23 ? 20.718 38.205 58.556 1.00 26.59  ? 23   HIS B CE1 1 
ATOM   711  N NE2 . HIS B 1 23 ? 19.830 38.689 59.409 1.00 31.92  ? 23   HIS B NE2 1 
ATOM   712  N N   . ILE B 1 24 ? 14.542 38.317 55.382 1.00 23.42  ? 24   ILE B N   1 
ATOM   713  C CA  . ILE B 1 24 ? 13.811 38.266 54.106 1.00 22.79  ? 24   ILE B CA  1 
ATOM   714  C C   . ILE B 1 24 ? 12.680 39.271 54.039 1.00 21.29  ? 24   ILE B C   1 
ATOM   715  O O   . ILE B 1 24 ? 11.841 39.303 54.923 1.00 20.20  ? 24   ILE B O   1 
ATOM   716  C CB  . ILE B 1 24 ? 13.283 36.845 53.837 1.00 20.55  ? 24   ILE B CB  1 
ATOM   717  C CG1 . ILE B 1 24 ? 14.425 35.844 53.649 1.00 24.87  ? 24   ILE B CG1 1 
ATOM   718  C CG2 . ILE B 1 24 ? 12.341 36.795 52.649 1.00 26.29  ? 24   ILE B CG2 1 
ATOM   719  C CD1 . ILE B 1 24 ? 13.979 34.392 53.587 1.00 32.52  ? 24   ILE B CD1 1 
ATOM   720  N N   . LYS B 1 25 ? 12.661 40.078 52.980 1.00 21.17  ? 25   LYS B N   1 
ATOM   721  C CA  . LYS B 1 25 ? 11.696 41.132 52.726 1.00 19.36  ? 25   LYS B CA  1 
ATOM   722  C C   . LYS B 1 25 ? 10.471 40.661 51.966 1.00 27.26  ? 25   LYS B C   1 
ATOM   723  O O   . LYS B 1 25 ? 9.299  40.932 52.265 1.00 22.33  ? 25   LYS B O   1 
ATOM   724  C CB  . LYS B 1 25 ? 12.379 42.223 51.863 1.00 22.50  ? 25   LYS B CB  1 
ATOM   725  C CG  . LYS B 1 25 ? 12.936 43.390 52.646 1.00 39.97  ? 25   LYS B CG  1 
ATOM   726  C CD  . LYS B 1 25 ? 12.935 44.654 51.784 1.00 41.99  ? 25   LYS B CD  1 
ATOM   727  C CE  . LYS B 1 25 ? 13.851 44.481 50.576 1.00 34.67  ? 25   LYS B CE  1 
ATOM   728  N NZ  . LYS B 1 25 ? 13.964 45.746 49.794 1.00 29.51  ? 25   LYS B NZ  1 
ATOM   729  N N   . GLU B 1 26 ? 10.791 39.912 50.898 1.00 21.20  ? 26   GLU B N   1 
ATOM   730  C CA  . GLU B 1 26 ? 9.722  39.361 50.065 1.00 22.63  ? 26   GLU B CA  1 
ATOM   731  C C   . GLU B 1 26 ? 10.259 38.213 49.212 1.00 15.73  ? 26   GLU B C   1 
ATOM   732  O O   . GLU B 1 26 ? 11.445 37.900 49.274 1.00 14.68  ? 26   GLU B O   1 
ATOM   733  C CB  . GLU B 1 26 ? 9.089  40.446 49.174 1.00 28.58  ? 26   GLU B CB  1 
ATOM   734  C CG  . GLU B 1 26 ? 10.085 40.932 48.124 1.00 34.10  ? 26   GLU B CG  1 
ATOM   735  C CD  . GLU B 1 26 ? 10.452 42.391 48.319 1.00 42.40  ? 26   GLU B CD  1 
ATOM   736  O OE1 . GLU B 1 26 ? 9.940  42.958 49.303 1.00 34.44  ? 26   GLU B OE1 1 
ATOM   737  O OE2 . GLU B 1 26 ? 11.227 42.945 47.513 1.00 26.99  ? 26   GLU B OE2 1 
ATOM   738  N N   . TYR B 1 27 ? 9.362  37.601 48.444 1.00 17.40  ? 27   TYR B N   1 
ATOM   739  C CA  . TYR B 1 27 ? 9.753  36.536 47.533 1.00 17.08  ? 27   TYR B CA  1 
ATOM   740  C C   . TYR B 1 27 ? 9.014  36.681 46.213 1.00 17.53  ? 27   TYR B C   1 
ATOM   741  O O   . TYR B 1 27 ? 7.958  37.300 46.148 1.00 17.44  ? 27   TYR B O   1 
ATOM   742  C CB  . TYR B 1 27 ? 9.464  35.175 48.191 1.00 22.35  ? 27   TYR B CB  1 
ATOM   743  C CG  . TYR B 1 27 ? 8.003  34.789 48.033 1.00 23.21  ? 27   TYR B CG  1 
ATOM   744  C CD1 . TYR B 1 27 ? 7.600  33.847 47.098 1.00 24.80  ? 27   TYR B CD1 1 
ATOM   745  C CD2 . TYR B 1 27 ? 7.049  35.412 48.823 1.00 23.38  ? 27   TYR B CD2 1 
ATOM   746  C CE1 . TYR B 1 27 ? 6.269  33.510 46.952 1.00 34.90  ? 27   TYR B CE1 1 
ATOM   747  C CE2 . TYR B 1 27 ? 5.707  35.070 48.682 1.00 32.71  ? 27   TYR B CE2 1 
ATOM   748  C CZ  . TYR B 1 27 ? 5.335  34.130 47.754 1.00 38.48  ? 27   TYR B CZ  1 
ATOM   749  O OH  . TYR B 1 27 ? 4.014  33.777 47.597 1.00 67.94  ? 27   TYR B OH  1 
ATOM   750  N N   . PHE B 1 28 ? 9.560  36.070 45.161 1.00 17.52  ? 28   PHE B N   1 
ATOM   751  C CA  . PHE B 1 28 ? 8.830  35.939 43.893 1.00 19.28  ? 28   PHE B CA  1 
ATOM   752  C C   . PHE B 1 28 ? 9.330  34.669 43.201 1.00 21.68  ? 28   PHE B C   1 
ATOM   753  O O   . PHE B 1 28 ? 10.414 34.169 43.493 1.00 15.81  ? 28   PHE B O   1 
ATOM   754  C CB  . PHE B 1 28 ? 8.974  37.165 43.004 1.00 20.95  ? 28   PHE B CB  1 
ATOM   755  C CG  . PHE B 1 28 ? 10.386 37.418 42.516 1.00 19.52  ? 28   PHE B CG  1 
ATOM   756  C CD1 . PHE B 1 28 ? 10.802 36.907 41.283 1.00 21.55  ? 28   PHE B CD1 1 
ATOM   757  C CD2 . PHE B 1 28 ? 11.289 38.157 43.247 1.00 15.95  ? 28   PHE B CD2 1 
ATOM   758  C CE1 . PHE B 1 28 ? 12.091 37.145 40.849 1.00 17.22  ? 28   PHE B CE1 1 
ATOM   759  C CE2 . PHE B 1 28 ? 12.583 38.386 42.816 1.00 18.03  ? 28   PHE B CE2 1 
ATOM   760  C CZ  . PHE B 1 28 ? 12.997 37.885 41.596 1.00 15.85  ? 28   PHE B CZ  1 
ATOM   761  N N   . TYR B 1 29 ? 8.539  34.140 42.281 1.00 21.04  ? 29   TYR B N   1 
ATOM   762  C CA  . TYR B 1 29 ? 8.967  32.943 41.546 1.00 18.67  ? 29   TYR B CA  1 
ATOM   763  C C   . TYR B 1 29 ? 9.583  33.375 40.232 1.00 19.69  ? 29   TYR B C   1 
ATOM   764  O O   . TYR B 1 29 ? 9.101  34.348 39.644 1.00 19.42  ? 29   TYR B O   1 
ATOM   765  C CB  . TYR B 1 29 ? 7.752  32.077 41.277 1.00 21.92  ? 29   TYR B CB  1 
ATOM   766  C CG  . TYR B 1 29 ? 7.140  31.306 42.415 1.00 21.34  ? 29   TYR B CG  1 
ATOM   767  C CD1 . TYR B 1 29 ? 6.049  31.787 43.124 1.00 22.18  ? 29   TYR B CD1 1 
ATOM   768  C CD2 . TYR B 1 29 ? 7.675  30.075 42.782 1.00 30.04  ? 29   TYR B CD2 1 
ATOM   769  C CE1 . TYR B 1 29 ? 5.507  31.060 44.168 1.00 30.48  ? 29   TYR B CE1 1 
ATOM   770  C CE2 . TYR B 1 29 ? 7.137  29.337 43.819 1.00 33.88  ? 29   TYR B CE2 1 
ATOM   771  C CZ  . TYR B 1 29 ? 6.054  29.842 44.505 1.00 39.43  ? 29   TYR B CZ  1 
ATOM   772  O OH  . TYR B 1 29 ? 5.527  29.093 45.534 1.00 34.47  ? 29   TYR B OH  1 
ATOM   773  N N   . THR B 1 30 ? 10.637 32.695 39.768 1.00 13.41  ? 30   THR B N   1 
ATOM   774  C CA  . THR B 1 30 ? 11.207 33.184 38.519 1.00 15.57  ? 30   THR B CA  1 
ATOM   775  C C   . THR B 1 30 ? 10.302 32.760 37.356 1.00 14.19  ? 30   THR B C   1 
ATOM   776  O O   . THR B 1 30 ? 9.456  31.876 37.503 1.00 19.96  ? 30   THR B O   1 
ATOM   777  C CB  . THR B 1 30 ? 12.611 32.651 38.259 1.00 15.92  ? 30   THR B CB  1 
ATOM   778  O OG1 . THR B 1 30 ? 12.630 31.225 38.498 1.00 15.13  ? 30   THR B OG1 1 
ATOM   779  C CG2 . THR B 1 30 ? 13.657 33.225 39.213 1.00 16.22  ? 30   THR B CG2 1 
ATOM   780  N N   . SER B 1 31 ? 10.529 33.426 36.244 1.00 13.17  ? 31   SER B N   1 
ATOM   781  C CA  . SER B 1 31 ? 9.741  33.241 35.046 1.00 18.55  ? 31   SER B CA  1 
ATOM   782  C C   . SER B 1 31 ? 9.733  31.795 34.604 1.00 29.32  ? 31   SER B C   1 
ATOM   783  O O   . SER B 1 31 ? 10.742 31.090 34.596 1.00 20.13  ? 31   SER B O   1 
ATOM   784  C CB  . SER B 1 31 ? 10.292 34.107 33.910 1.00 21.59  ? 31   SER B CB  1 
ATOM   785  O OG  . SER B 1 31 ? 9.627  33.874 32.677 1.00 22.98  ? 31   SER B OG  1 
ATOM   786  N N   . GLY B 1 32 ? 8.564  31.333 34.121 1.00 18.69  ? 32   GLY B N   1 
ATOM   787  C CA  . GLY B 1 32 ? 8.605  30.017 33.480 1.00 15.22  ? 32   GLY B CA  1 
ATOM   788  C C   . GLY B 1 32 ? 9.478  30.004 32.227 1.00 22.12  ? 32   GLY B C   1 
ATOM   789  O O   . GLY B 1 32 ? 9.741  28.904 31.708 1.00 22.82  ? 32   GLY B O   1 
ATOM   790  N N   . LYS B 1 33 ? 9.948  31.133 31.713 1.00 19.52  ? 33   LYS B N   1 
ATOM   791  C CA  . LYS B 1 33 ? 10.909 31.121 30.598 1.00 19.80  ? 33   LYS B CA  1 
ATOM   792  C C   . LYS B 1 33 ? 12.267 30.593 31.018 1.00 23.15  ? 33   LYS B C   1 
ATOM   793  O O   . LYS B 1 33 ? 13.022 30.059 30.190 1.00 14.84  ? 33   LYS B O   1 
ATOM   794  C CB  . LYS B 1 33 ? 11.040 32.527 30.034 1.00 23.38  ? 33   LYS B CB  1 
ATOM   795  C CG  . LYS B 1 33 ? 9.726  32.976 29.371 1.00 25.49  ? 33   LYS B CG  1 
ATOM   796  C CD  . LYS B 1 33 ? 9.859  34.405 28.891 1.00 33.85  ? 33   LYS B CD  1 
ATOM   797  C CE  . LYS B 1 33 ? 9.978  35.390 30.041 1.00 42.53  ? 33   LYS B CE  1 
ATOM   798  N NZ  . LYS B 1 33 ? 8.723  36.153 30.292 1.00 40.91  ? 33   LYS B NZ  1 
ATOM   799  N N   . CYS B 1 34 ? 12.550 30.725 32.317 1.00 16.51  ? 34   CYS B N   1 
ATOM   800  C CA  . CYS B 1 34 ? 13.815 30.205 32.806 1.00 13.74  ? 34   CYS B CA  1 
ATOM   801  C C   . CYS B 1 34 ? 13.861 28.673 32.796 1.00 16.72  ? 34   CYS B C   1 
ATOM   802  O O   . CYS B 1 34 ? 12.856 27.991 32.971 1.00 16.69  ? 34   CYS B O   1 
ATOM   803  C CB  . CYS B 1 34 ? 14.063 30.668 34.246 1.00 15.92  ? 34   CYS B CB  1 
ATOM   804  S SG  . CYS B 1 34 ? 14.171 32.442 34.477 1.00 16.95  ? 34   CYS B SG  1 
ATOM   805  N N   . SER B 1 35 ? 15.028 28.061 32.585 1.00 15.71  ? 35   SER B N   1 
ATOM   806  C CA  . SER B 1 35 ? 15.045 26.584 32.504 1.00 19.62  ? 35   SER B CA  1 
ATOM   807  C C   . SER B 1 35 ? 14.868 25.862 33.828 1.00 25.05  ? 35   SER B C   1 
ATOM   808  O O   . SER B 1 35 ? 14.434 24.700 33.882 1.00 26.42  ? 35   SER B O   1 
ATOM   809  C CB  . SER B 1 35 ? 16.363 26.131 31.855 1.00 22.93  ? 35   SER B CB  1 
ATOM   810  O OG  . SER B 1 35 ? 16.359 26.473 30.474 1.00 31.91  ? 35   SER B OG  1 
ATOM   811  N N   . ASN B 1 36 ? 15.193 26.481 34.955 1.00 17.54  ? 36   ASN B N   1 
ATOM   812  C CA  . ASN B 1 36 ? 15.015 25.914 36.277 1.00 15.56  ? 36   ASN B CA  1 
ATOM   813  C C   . ASN B 1 36 ? 13.914 26.648 37.029 1.00 25.90  ? 36   ASN B C   1 
ATOM   814  O O   . ASN B 1 36 ? 13.875 27.887 37.102 1.00 22.65  ? 36   ASN B O   1 
ATOM   815  C CB  . ASN B 1 36 ? 16.294 26.056 37.120 1.00 19.78  ? 36   ASN B CB  1 
ATOM   816  C CG  . ASN B 1 36 ? 17.447 25.416 36.369 1.00 29.34  ? 36   ASN B CG  1 
ATOM   817  O OD1 . ASN B 1 36 ? 17.305 24.290 35.918 1.00 30.83  ? 36   ASN B OD1 1 
ATOM   818  N ND2 . ASN B 1 36 ? 18.548 26.131 36.207 1.00 23.20  ? 36   ASN B ND2 1 
ATOM   819  N N   . PRO B 1 37 ? 12.985 25.911 37.616 1.00 23.60  ? 37   PRO B N   1 
ATOM   820  C CA  . PRO B 1 37 ? 11.989 26.614 38.430 1.00 20.16  ? 37   PRO B CA  1 
ATOM   821  C C   . PRO B 1 37 ? 12.686 27.116 39.681 1.00 14.36  ? 37   PRO B C   1 
ATOM   822  O O   . PRO B 1 37 ? 13.659 26.541 40.162 1.00 19.17  ? 37   PRO B O   1 
ATOM   823  C CB  . PRO B 1 37 ? 10.969 25.535 38.807 1.00 28.65  ? 37   PRO B CB  1 
ATOM   824  C CG  . PRO B 1 37 ? 11.667 24.232 38.596 1.00 34.71  ? 37   PRO B CG  1 
ATOM   825  C CD  . PRO B 1 37 ? 12.771 24.455 37.594 1.00 30.46  ? 37   PRO B CD  1 
ATOM   826  N N   . ALA B 1 38 ? 12.206 28.232 40.223 1.00 20.11  ? 38   ALA B N   1 
ATOM   827  C CA  . ALA B 1 38 ? 12.855 28.724 41.423 1.00 20.58  ? 38   ALA B CA  1 
ATOM   828  C C   . ALA B 1 38 ? 12.005 29.762 42.148 1.00 17.33  ? 38   ALA B C   1 
ATOM   829  O O   . ALA B 1 38 ? 11.233 30.451 41.519 1.00 17.74  ? 38   ALA B O   1 
ATOM   830  C CB  . ALA B 1 38 ? 14.193 29.399 41.065 1.00 13.55  ? 38   ALA B CB  1 
ATOM   831  N N   . VAL B 1 39 ? 12.217 29.851 43.450 1.00 17.09  ? 39   VAL B N   1 
ATOM   832  C CA  . VAL B 1 39 ? 11.765 30.959 44.257 1.00 18.49  ? 39   VAL B CA  1 
ATOM   833  C C   . VAL B 1 39 ? 12.954 31.881 44.493 1.00 17.92  ? 39   VAL B C   1 
ATOM   834  O O   . VAL B 1 39 ? 14.070 31.373 44.664 1.00 17.18  ? 39   VAL B O   1 
ATOM   835  C CB  . VAL B 1 39 ? 11.233 30.503 45.631 1.00 34.37  ? 39   VAL B CB  1 
ATOM   836  C CG1 . VAL B 1 39 ? 10.565 31.672 46.337 1.00 30.23  ? 39   VAL B CG1 1 
ATOM   837  C CG2 . VAL B 1 39 ? 10.277 29.329 45.461 1.00 40.17  ? 39   VAL B CG2 1 
ATOM   838  N N   . VAL B 1 40 ? 12.712 33.181 44.498 1.00 16.48  ? 40   VAL B N   1 
ATOM   839  C CA  . VAL B 1 40 ? 13.798 34.122 44.789 1.00 14.60  ? 40   VAL B CA  1 
ATOM   840  C C   . VAL B 1 40 ? 13.414 34.831 46.083 1.00 17.35  ? 40   VAL B C   1 
ATOM   841  O O   . VAL B 1 40 ? 12.329 35.401 46.132 1.00 20.87  ? 40   VAL B O   1 
ATOM   842  C CB  . VAL B 1 40 ? 14.050 35.168 43.703 1.00 17.59  ? 40   VAL B CB  1 
ATOM   843  C CG1 . VAL B 1 40 ? 15.079 36.218 44.131 1.00 18.07  ? 40   VAL B CG1 1 
ATOM   844  C CG2 . VAL B 1 40 ? 14.540 34.454 42.442 1.00 18.52  ? 40   VAL B CG2 1 
ATOM   845  N N   . PHE B 1 41 ? 14.292 34.746 47.076 1.00 13.06  ? 41   PHE B N   1 
ATOM   846  C CA  . PHE B 1 41 ? 14.037 35.454 48.321 1.00 12.69  ? 41   PHE B CA  1 
ATOM   847  C C   . PHE B 1 41 ? 14.813 36.762 48.295 1.00 15.90  ? 41   PHE B C   1 
ATOM   848  O O   . PHE B 1 41 ? 15.992 36.755 47.954 1.00 19.27  ? 41   PHE B O   1 
ATOM   849  C CB  . PHE B 1 41 ? 14.489 34.647 49.538 1.00 17.17  ? 41   PHE B CB  1 
ATOM   850  C CG  . PHE B 1 41 ? 13.538 33.495 49.857 1.00 21.53  ? 41   PHE B CG  1 
ATOM   851  C CD1 . PHE B 1 41 ? 14.025 32.195 49.863 1.00 17.80  ? 41   PHE B CD1 1 
ATOM   852  C CD2 . PHE B 1 41 ? 12.198 33.731 50.147 1.00 21.52  ? 41   PHE B CD2 1 
ATOM   853  C CE1 . PHE B 1 41 ? 13.170 31.153 50.156 1.00 18.95  ? 41   PHE B CE1 1 
ATOM   854  C CE2 . PHE B 1 41 ? 11.360 32.673 50.450 1.00 17.06  ? 41   PHE B CE2 1 
ATOM   855  C CZ  . PHE B 1 41 ? 11.838 31.381 50.459 1.00 16.07  ? 41   PHE B CZ  1 
ATOM   856  N N   . VAL B 1 42 ? 14.152 37.856 48.619 1.00 18.15  ? 42   VAL B N   1 
ATOM   857  C CA  . VAL B 1 42 ? 14.803 39.173 48.495 1.00 18.40  ? 42   VAL B CA  1 
ATOM   858  C C   . VAL B 1 42 ? 15.106 39.665 49.899 1.00 17.10  ? 42   VAL B C   1 
ATOM   859  O O   . VAL B 1 42 ? 14.174 39.758 50.700 1.00 19.48  ? 42   VAL B O   1 
ATOM   860  C CB  . VAL B 1 42 ? 13.885 40.157 47.754 1.00 20.27  ? 42   VAL B CB  1 
ATOM   861  C CG1 . VAL B 1 42 ? 14.564 41.515 47.648 1.00 16.93  ? 42   VAL B CG1 1 
ATOM   862  C CG2 . VAL B 1 42 ? 13.504 39.595 46.388 1.00 20.30  ? 42   VAL B CG2 1 
ATOM   863  N N   . THR B 1 43 ? 16.369 39.910 50.199 1.00 19.39  ? 43   THR B N   1 
ATOM   864  C CA  . THR B 1 43 ? 16.742 40.284 51.558 1.00 25.66  ? 43   THR B CA  1 
ATOM   865  C C   . THR B 1 43 ? 16.541 41.788 51.768 1.00 23.31  ? 43   THR B C   1 
ATOM   866  O O   . THR B 1 43 ? 16.187 42.537 50.862 1.00 18.87  ? 43   THR B O   1 
ATOM   867  C CB  . THR B 1 43 ? 18.189 39.936 51.923 1.00 23.04  ? 43   THR B CB  1 
ATOM   868  O OG1 . THR B 1 43 ? 19.088 40.784 51.182 1.00 26.82  ? 43   THR B OG1 1 
ATOM   869  C CG2 . THR B 1 43 ? 18.545 38.504 51.567 1.00 22.82  ? 43   THR B CG2 1 
ATOM   870  N N   . ARG B 1 44 ? 16.771 42.191 53.017 1.00 25.82  ? 44   ARG B N   1 
ATOM   871  C CA  . ARG B 1 44 ? 16.621 43.589 53.373 1.00 31.09  ? 44   ARG B CA  1 
ATOM   872  C C   . ARG B 1 44 ? 17.705 44.425 52.694 1.00 23.55  ? 44   ARG B C   1 
ATOM   873  O O   . ARG B 1 44 ? 17.480 45.609 52.465 1.00 32.12  ? 44   ARG B O   1 
ATOM   874  C CB  . ARG B 1 44 ? 16.656 43.763 54.889 1.00 37.12  ? 44   ARG B CB  1 
ATOM   875  C CG  . ARG B 1 44 ? 17.719 42.913 55.575 1.00 34.16  ? 44   ARG B CG  1 
ATOM   876  C CD  . ARG B 1 44 ? 17.586 43.085 57.087 1.00 50.00  ? 44   ARG B CD  1 
ATOM   877  N NE  . ARG B 1 44 ? 18.437 42.192 57.858 1.00 60.43  ? 44   ARG B NE  1 
ATOM   878  C CZ  . ARG B 1 44 ? 19.749 42.052 57.743 1.00 67.39  ? 44   ARG B CZ  1 
ATOM   879  N NH1 . ARG B 1 44 ? 20.429 42.766 56.850 1.00 88.87  ? 44   ARG B NH1 1 
ATOM   880  N NH2 . ARG B 1 44 ? 20.409 41.196 58.514 1.00 57.61  ? 44   ARG B NH2 1 
ATOM   881  N N   . LYS B 1 45 ? 18.843 43.823 52.347 1.00 23.40  ? 45   LYS B N   1 
ATOM   882  C CA  . LYS B 1 45 ? 19.836 44.569 51.567 1.00 26.84  ? 45   LYS B CA  1 
ATOM   883  C C   . LYS B 1 45 ? 19.645 44.325 50.077 1.00 22.21  ? 45   LYS B C   1 
ATOM   884  O O   . LYS B 1 45 ? 20.567 44.578 49.297 1.00 20.48  ? 45   LYS B O   1 
ATOM   885  C CB  . LYS B 1 45 ? 21.256 44.176 51.987 1.00 27.15  ? 45   LYS B CB  1 
ATOM   886  C CG  . LYS B 1 45 ? 21.558 44.568 53.433 1.00 31.95  ? 45   LYS B CG  1 
ATOM   887  C CD  . LYS B 1 45 ? 23.039 44.426 53.732 1.00 34.72  ? 45   LYS B CD  1 
ATOM   888  C CE  . LYS B 1 45 ? 23.434 45.050 55.056 1.00 30.37  ? 45   LYS B CE  1 
ATOM   889  N NZ  . LYS B 1 45 ? 22.988 44.225 56.211 1.00 37.25  ? 45   LYS B NZ  1 
ATOM   890  N N   . ASN B 1 46 ? 18.462 43.811 49.700 1.00 15.42  ? 46   ASN B N   1 
ATOM   891  C CA  . ASN B 1 46 ? 18.103 43.617 48.304 1.00 20.46  ? 46   ASN B CA  1 
ATOM   892  C C   . ASN B 1 46 ? 18.870 42.535 47.562 1.00 23.77  ? 46   ASN B C   1 
ATOM   893  O O   . ASN B 1 46 ? 18.948 42.539 46.325 1.00 17.52  ? 46   ASN B O   1 
ATOM   894  C CB  . ASN B 1 46 ? 18.271 44.973 47.565 1.00 14.84  ? 46   ASN B CB  1 
ATOM   895  C CG  . ASN B 1 46 ? 17.143 45.871 48.063 1.00 21.89  ? 46   ASN B CG  1 
ATOM   896  O OD1 . ASN B 1 46 ? 15.988 45.411 48.144 1.00 25.23  ? 46   ASN B OD1 1 
ATOM   897  N ND2 . ASN B 1 46 ? 17.472 47.114 48.390 1.00 24.11  ? 46   ASN B ND2 1 
ATOM   898  N N   . ARG B 1 47 ? 19.440 41.576 48.289 1.00 16.96  ? 47   ARG B N   1 
ATOM   899  C CA  . ARG B 1 47 ? 20.085 40.440 47.628 1.00 14.19  ? 47   ARG B CA  1 
ATOM   900  C C   . ARG B 1 47 ? 19.017 39.491 47.112 1.00 20.40  ? 47   ARG B C   1 
ATOM   901  O O   . ARG B 1 47 ? 18.051 39.278 47.868 1.00 23.21  ? 47   ARG B O   1 
ATOM   902  C CB  . ARG B 1 47 ? 20.997 39.768 48.651 1.00 23.93  ? 47   ARG B CB  1 
ATOM   903  C CG  . ARG B 1 47 ? 21.944 38.687 48.197 1.00 38.38  ? 47   ARG B CG  1 
ATOM   904  C CD  . ARG B 1 47 ? 22.930 38.322 49.310 1.00 44.45  ? 47   ARG B CD  1 
ATOM   905  N NE  . ARG B 1 47 ? 22.594 37.038 49.927 1.00 58.81  ? 47   ARG B NE  1 
ATOM   906  C CZ  . ARG B 1 47 ? 22.065 36.886 51.136 1.00 67.85  ? 47   ARG B CZ  1 
ATOM   907  N NH1 . ARG B 1 47 ? 21.794 35.671 51.609 1.00 62.44  ? 47   ARG B NH1 1 
ATOM   908  N NH2 . ARG B 1 47 ? 21.797 37.947 51.891 1.00 59.50  ? 47   ARG B NH2 1 
ATOM   909  N N   . GLN B 1 48 ? 19.142 38.950 45.916 1.00 18.79  ? 48   GLN B N   1 
ATOM   910  C CA  . GLN B 1 48 ? 18.158 38.005 45.356 1.00 16.70  ? 48   GLN B CA  1 
ATOM   911  C C   . GLN B 1 48 ? 18.720 36.582 45.388 1.00 28.81  ? 48   GLN B C   1 
ATOM   912  O O   . GLN B 1 48 ? 19.607 36.261 44.595 1.00 26.32  ? 48   GLN B O   1 
ATOM   913  C CB  . GLN B 1 48 ? 17.782 38.326 43.908 1.00 20.08  ? 48   GLN B CB  1 
ATOM   914  C CG  . GLN B 1 48 ? 17.180 39.726 43.734 1.00 22.97  ? 48   GLN B CG  1 
ATOM   915  C CD  . GLN B 1 48 ? 16.488 39.858 42.389 1.00 34.82  ? 48   GLN B CD  1 
ATOM   916  O OE1 . GLN B 1 48 ? 16.809 39.168 41.413 1.00 27.04  ? 48   GLN B OE1 1 
ATOM   917  N NE2 . GLN B 1 48 ? 15.516 40.763 42.368 1.00 35.29  ? 48   GLN B NE2 1 
ATOM   918  N N   . VAL B 1 49 ? 18.204 35.779 46.307 1.00 14.40  ? 49   VAL B N   1 
ATOM   919  C CA  . VAL B 1 49 ? 18.737 34.453 46.574 1.00 17.87  ? 49   VAL B CA  1 
ATOM   920  C C   . VAL B 1 49 ? 17.762 33.402 46.040 1.00 16.28  ? 49   VAL B C   1 
ATOM   921  O O   . VAL B 1 49 ? 16.587 33.328 46.403 1.00 14.72  ? 49   VAL B O   1 
ATOM   922  C CB  . VAL B 1 49 ? 18.950 34.268 48.095 1.00 19.89  ? 49   VAL B CB  1 
ATOM   923  C CG1 . VAL B 1 49 ? 19.558 32.899 48.390 1.00 19.82  ? 49   VAL B CG1 1 
ATOM   924  C CG2 . VAL B 1 49 ? 19.804 35.394 48.662 1.00 17.78  ? 49   VAL B CG2 1 
ATOM   925  N N   . CYS B 1 50 ? 18.306 32.588 45.134 1.00 17.37  ? 50   CYS B N   1 
ATOM   926  C CA  . CYS B 1 50 ? 17.548 31.488 44.578 1.00 11.36  ? 50   CYS B CA  1 
ATOM   927  C C   . CYS B 1 50 ? 17.326 30.321 45.530 1.00 15.68  ? 50   CYS B C   1 
ATOM   928  O O   . CYS B 1 50 ? 18.263 29.914 46.228 1.00 18.80  ? 50   CYS B O   1 
ATOM   929  C CB  . CYS B 1 50 ? 18.344 30.962 43.375 1.00 14.21  ? 50   CYS B CB  1 
ATOM   930  S SG  . CYS B 1 50 ? 18.541 32.183 42.076 1.00 16.56  ? 50   CYS B SG  1 
ATOM   931  N N   . ALA B 1 51 ? 16.123 29.757 45.510 1.00 19.32  ? 51   ALA B N   1 
ATOM   932  C CA  . ALA B 1 51 ? 15.799 28.644 46.401 1.00 19.08  ? 51   ALA B CA  1 
ATOM   933  C C   . ALA B 1 51 ? 14.935 27.613 45.698 1.00 20.14  ? 51   ALA B C   1 
ATOM   934  O O   . ALA B 1 51 ? 14.200 27.891 44.732 1.00 19.46  ? 51   ALA B O   1 
ATOM   935  C CB  . ALA B 1 51 ? 15.112 29.160 47.651 1.00 23.97  ? 51   ALA B CB  1 
ATOM   936  N N   . ASN B 1 52 ? 15.039 26.383 46.191 1.00 20.85  ? 52   ASN B N   1 
ATOM   937  C CA  . ASN B 1 52 ? 14.290 25.288 45.588 1.00 24.39  ? 52   ASN B CA  1 
ATOM   938  C C   . ASN B 1 52 ? 12.864 25.255 46.122 1.00 23.63  ? 52   ASN B C   1 
ATOM   939  O O   . ASN B 1 52 ? 12.772 24.916 47.290 1.00 20.62  ? 52   ASN B O   1 
ATOM   940  C CB  . ASN B 1 52 ? 14.947 23.943 45.909 1.00 37.63  ? 52   ASN B CB  1 
ATOM   941  C CG  . ASN B 1 52 ? 14.425 22.784 45.085 1.00 37.29  ? 52   ASN B CG  1 
ATOM   942  O OD1 . ASN B 1 52 ? 14.950 21.674 45.192 1.00 42.32  ? 52   ASN B OD1 1 
ATOM   943  N ND2 . ASN B 1 52 ? 13.428 23.003 44.245 1.00 28.43  ? 52   ASN B ND2 1 
ATOM   944  N N   . PRO B 1 53 ? 11.864 25.541 45.307 1.00 24.01  ? 53   PRO B N   1 
ATOM   945  C CA  . PRO B 1 53 ? 10.478 25.550 45.779 1.00 25.43  ? 53   PRO B CA  1 
ATOM   946  C C   . PRO B 1 53 ? 10.046 24.189 46.317 1.00 26.49  ? 53   PRO B C   1 
ATOM   947  O O   . PRO B 1 53 ? 9.059  24.017 47.034 1.00 38.79  ? 53   PRO B O   1 
ATOM   948  C CB  . PRO B 1 53 ? 9.692  25.883 44.514 1.00 28.11  ? 53   PRO B CB  1 
ATOM   949  C CG  . PRO B 1 53 ? 10.645 26.361 43.480 1.00 26.29  ? 53   PRO B CG  1 
ATOM   950  C CD  . PRO B 1 53 ? 11.994 25.849 43.873 1.00 30.45  ? 53   PRO B CD  1 
ATOM   951  N N   . GLU B 1 54 ? 10.766 23.112 45.986 1.00 26.69  ? 54   GLU B N   1 
ATOM   952  C CA  . GLU B 1 54 ? 10.257 21.815 46.443 1.00 27.43  ? 54   GLU B CA  1 
ATOM   953  C C   . GLU B 1 54 ? 10.620 21.544 47.888 1.00 28.07  ? 54   GLU B C   1 
ATOM   954  O O   . GLU B 1 54 ? 9.998  20.702 48.538 1.00 38.53  ? 54   GLU B O   1 
ATOM   955  C CB  . GLU B 1 54 ? 10.824 20.712 45.540 1.00 44.91  ? 54   GLU B CB  1 
ATOM   956  C CG  . GLU B 1 54 ? 10.368 20.841 44.095 1.00 45.69  ? 54   GLU B CG  1 
ATOM   957  C CD  . GLU B 1 54 ? 11.053 19.862 43.164 1.00 59.90  ? 54   GLU B CD  1 
ATOM   958  O OE1 . GLU B 1 54 ? 12.292 19.961 43.018 1.00 72.22  ? 54   GLU B OE1 1 
ATOM   959  O OE2 . GLU B 1 54 ? 10.351 19.004 42.576 1.00 62.31  ? 54   GLU B OE2 1 
ATOM   960  N N   . LYS B 1 55 ? 11.631 22.266 48.355 1.00 30.60  ? 55   LYS B N   1 
ATOM   961  C CA  . LYS B 1 55 ? 12.213 22.122 49.682 1.00 39.91  ? 55   LYS B CA  1 
ATOM   962  C C   . LYS B 1 55 ? 11.297 22.655 50.779 1.00 35.92  ? 55   LYS B C   1 
ATOM   963  O O   . LYS B 1 55 ? 10.646 23.699 50.669 1.00 28.41  ? 55   LYS B O   1 
ATOM   964  C CB  . LYS B 1 55 ? 13.580 22.810 49.730 1.00 48.91  ? 55   LYS B CB  1 
ATOM   965  C CG  . LYS B 1 55 ? 14.669 22.163 48.880 1.00 62.00  ? 55   LYS B CG  1 
ATOM   966  C CD  . LYS B 1 55 ? 16.045 22.689 49.263 1.00 66.03  ? 55   LYS B CD  1 
ATOM   967  C CE  . LYS B 1 55 ? 17.186 22.068 48.478 1.00 66.49  ? 55   LYS B CE  1 
ATOM   968  N NZ  . LYS B 1 55 ? 18.159 23.089 47.976 1.00 39.67  ? 55   LYS B NZ  1 
ATOM   969  N N   . LYS B 1 56 ? 11.233 21.889 51.875 1.00 34.01  ? 56   LYS B N   1 
ATOM   970  C CA  . LYS B 1 56 ? 10.269 22.174 52.930 1.00 37.33  ? 56   LYS B CA  1 
ATOM   971  C C   . LYS B 1 56 ? 10.411 23.582 53.494 1.00 32.84  ? 56   LYS B C   1 
ATOM   972  O O   . LYS B 1 56 ? 9.436  24.332 53.574 1.00 28.61  ? 56   LYS B O   1 
ATOM   973  C CB  . LYS B 1 56 ? 10.431 21.147 54.063 1.00 54.43  ? 56   LYS B CB  1 
ATOM   974  C CG  . LYS B 1 56 ? 9.157  20.780 54.799 1.00 62.36  ? 56   LYS B CG  1 
ATOM   975  C CD  . LYS B 1 56 ? 9.161  21.234 56.246 1.00 62.58  ? 56   LYS B CD  1 
ATOM   976  C CE  . LYS B 1 56 ? 9.295  20.064 57.205 1.00 67.00  ? 56   LYS B CE  1 
ATOM   977  N NZ  . LYS B 1 56 ? 9.351  20.480 58.635 1.00 60.72  ? 56   LYS B NZ  1 
ATOM   978  N N   . TRP B 1 57 ? 11.643 23.912 53.901 1.00 32.19  ? 57   TRP B N   1 
ATOM   979  C CA  . TRP B 1 57 ? 11.870 25.230 54.505 1.00 31.24  ? 57   TRP B CA  1 
ATOM   980  C C   . TRP B 1 57 ? 11.460 26.349 53.559 1.00 23.00  ? 57   TRP B C   1 
ATOM   981  O O   . TRP B 1 57 ? 10.987 27.395 54.026 1.00 23.85  ? 57   TRP B O   1 
ATOM   982  C CB  . TRP B 1 57 ? 13.316 25.361 54.948 1.00 32.31  ? 57   TRP B CB  1 
ATOM   983  C CG  . TRP B 1 57 ? 14.366 25.591 53.912 1.00 27.46  ? 57   TRP B CG  1 
ATOM   984  C CD1 . TRP B 1 57 ? 15.190 24.673 53.335 1.00 31.75  ? 57   TRP B CD1 1 
ATOM   985  C CD2 . TRP B 1 57 ? 14.706 26.851 53.331 1.00 29.63  ? 57   TRP B CD2 1 
ATOM   986  N NE1 . TRP B 1 57 ? 16.023 25.281 52.421 1.00 32.17  ? 57   TRP B NE1 1 
ATOM   987  C CE2 . TRP B 1 57 ? 15.743 26.622 52.407 1.00 34.44  ? 57   TRP B CE2 1 
ATOM   988  C CE3 . TRP B 1 57 ? 14.224 28.148 53.508 1.00 24.94  ? 57   TRP B CE3 1 
ATOM   989  C CZ2 . TRP B 1 57 ? 16.300 27.665 51.669 1.00 26.04  ? 57   TRP B CZ2 1 
ATOM   990  C CZ3 . TRP B 1 57 ? 14.781 29.176 52.776 1.00 23.89  ? 57   TRP B CZ3 1 
ATOM   991  C CH2 . TRP B 1 57 ? 15.811 28.930 51.865 1.00 19.02  ? 57   TRP B CH2 1 
ATOM   992  N N   . VAL B 1 58 ? 11.642 26.136 52.257 1.00 24.38  ? 58   VAL B N   1 
ATOM   993  C CA  . VAL B 1 58 ? 11.283 27.168 51.258 1.00 25.10  ? 58   VAL B CA  1 
ATOM   994  C C   . VAL B 1 58 ? 9.780  27.406 51.222 1.00 23.32  ? 58   VAL B C   1 
ATOM   995  O O   . VAL B 1 58 ? 9.285  28.548 51.207 1.00 27.03  ? 58   VAL B O   1 
ATOM   996  C CB  . VAL B 1 58 ? 11.811 26.781 49.857 1.00 22.90  ? 58   VAL B CB  1 
ATOM   997  C CG1 . VAL B 1 58 ? 11.330 27.709 48.756 1.00 18.02  ? 58   VAL B CG1 1 
ATOM   998  C CG2 . VAL B 1 58 ? 13.332 26.741 49.873 1.00 19.32  ? 58   VAL B CG2 1 
ATOM   999  N N   . ARG B 1 59 ? 8.980  26.332 51.215 1.00 30.99  ? 59   ARG B N   1 
ATOM   1000 C CA  . ARG B 1 59 ? 7.520  26.483 51.220 1.00 28.79  ? 59   ARG B CA  1 
ATOM   1001 C C   . ARG B 1 59 ? 7.010  27.012 52.553 1.00 31.60  ? 59   ARG B C   1 
ATOM   1002 O O   . ARG B 1 59 ? 6.012  27.726 52.657 1.00 31.08  ? 59   ARG B O   1 
ATOM   1003 C CB  . ARG B 1 59 ? 6.858  25.144 50.897 1.00 41.54  ? 59   ARG B CB  1 
ATOM   1004 C CG  . ARG B 1 59 ? 7.386  24.465 49.642 1.00 43.53  ? 59   ARG B CG  1 
ATOM   1005 C CD  . ARG B 1 59 ? 6.826  23.052 49.522 1.00 51.73  ? 59   ARG B CD  1 
ATOM   1006 N NE  . ARG B 1 59 ? 7.585  22.092 50.312 1.00 58.34  ? 59   ARG B NE  1 
ATOM   1007 C CZ  . ARG B 1 59 ? 7.493  20.773 50.298 1.00 58.51  ? 59   ARG B CZ  1 
ATOM   1008 N NH1 . ARG B 1 59 ? 8.276  20.043 51.089 1.00 46.19  ? 59   ARG B NH1 1 
ATOM   1009 N NH2 . ARG B 1 59 ? 6.625  20.173 49.497 1.00 55.45  ? 59   ARG B NH2 1 
ATOM   1010 N N   . GLU B 1 60 ? 7.695  26.677 53.652 1.00 27.53  ? 60   GLU B N   1 
ATOM   1011 C CA  . GLU B 1 60 ? 7.283  27.315 54.913 1.00 28.27  ? 60   GLU B CA  1 
ATOM   1012 C C   . GLU B 1 60 ? 7.460  28.819 54.824 1.00 26.35  ? 60   GLU B C   1 
ATOM   1013 O O   . GLU B 1 60 ? 6.581  29.618 55.151 1.00 35.27  ? 60   GLU B O   1 
ATOM   1014 C CB  . GLU B 1 60 ? 8.091  26.690 56.046 1.00 38.34  ? 60   GLU B CB  1 
ATOM   1015 C CG  . GLU B 1 60 ? 7.978  25.162 56.018 1.00 47.48  ? 60   GLU B CG  1 
ATOM   1016 C CD  . GLU B 1 60 ? 8.514  24.509 57.277 1.00 45.70  ? 60   GLU B CD  1 
ATOM   1017 O OE1 . GLU B 1 60 ? 7.834  23.597 57.801 1.00 41.49  ? 60   GLU B OE1 1 
ATOM   1018 O OE2 . GLU B 1 60 ? 9.607  24.906 57.736 1.00 46.44  ? 60   GLU B OE2 1 
ATOM   1019 N N   . TYR B 1 61 ? 8.606  29.277 54.335 1.00 23.97  ? 61   TYR B N   1 
ATOM   1020 C CA  . TYR B 1 61 ? 8.885  30.700 54.225 1.00 25.14  ? 61   TYR B CA  1 
ATOM   1021 C C   . TYR B 1 61 ? 7.902  31.438 53.327 1.00 30.56  ? 61   TYR B C   1 
ATOM   1022 O O   . TYR B 1 61 ? 7.467  32.552 53.638 1.00 25.22  ? 61   TYR B O   1 
ATOM   1023 C CB  . TYR B 1 61 ? 10.329 30.874 53.723 1.00 23.43  ? 61   TYR B CB  1 
ATOM   1024 C CG  . TYR B 1 61 ? 11.386 30.814 54.794 1.00 19.60  ? 61   TYR B CG  1 
ATOM   1025 C CD1 . TYR B 1 61 ? 11.198 30.114 55.990 1.00 21.33  ? 61   TYR B CD1 1 
ATOM   1026 C CD2 . TYR B 1 61 ? 12.600 31.457 54.616 1.00 22.14  ? 61   TYR B CD2 1 
ATOM   1027 C CE1 . TYR B 1 61 ? 12.185 30.074 56.963 1.00 21.15  ? 61   TYR B CE1 1 
ATOM   1028 C CE2 . TYR B 1 61 ? 13.598 31.418 55.583 1.00 28.74  ? 61   TYR B CE2 1 
ATOM   1029 C CZ  . TYR B 1 61 ? 13.377 30.721 56.758 1.00 21.33  ? 61   TYR B CZ  1 
ATOM   1030 O OH  . TYR B 1 61 ? 14.380 30.689 57.696 1.00 20.82  ? 61   TYR B OH  1 
ATOM   1031 N N   . ILE B 1 62 ? 7.511  30.885 52.186 1.00 27.04  ? 62   ILE B N   1 
ATOM   1032 C CA  . ILE B 1 62 ? 6.540  31.532 51.308 1.00 25.97  ? 62   ILE B CA  1 
ATOM   1033 C C   . ILE B 1 62 ? 5.194  31.655 52.020 1.00 25.83  ? 62   ILE B C   1 
ATOM   1034 O O   . ILE B 1 62 ? 4.568  32.711 52.000 1.00 28.78  ? 62   ILE B O   1 
ATOM   1035 C CB  . ILE B 1 62 ? 6.382  30.750 49.991 1.00 35.95  ? 62   ILE B CB  1 
ATOM   1036 C CG1 . ILE B 1 62 ? 7.602  30.796 49.069 1.00 36.76  ? 62   ILE B CG1 1 
ATOM   1037 C CG2 . ILE B 1 62 ? 5.123  31.202 49.255 1.00 29.56  ? 62   ILE B CG2 1 
ATOM   1038 C CD1 . ILE B 1 62 ? 7.765  29.635 48.112 1.00 31.77  ? 62   ILE B CD1 1 
ATOM   1039 N N   . ASN B 1 63 ? 4.774  30.562 52.674 1.00 32.94  ? 63   ASN B N   1 
ATOM   1040 C CA  . ASN B 1 63 ? 3.531  30.609 53.439 1.00 38.06  ? 63   ASN B CA  1 
ATOM   1041 C C   . ASN B 1 63 ? 3.544  31.724 54.479 1.00 34.39  ? 63   ASN B C   1 
ATOM   1042 O O   . ASN B 1 63 ? 2.547  32.395 54.713 1.00 49.85  ? 63   ASN B O   1 
ATOM   1043 C CB  . ASN B 1 63 ? 3.278  29.272 54.143 1.00 44.23  ? 63   ASN B CB  1 
ATOM   1044 C CG  . ASN B 1 63 ? 3.196  28.125 53.156 1.00 57.15  ? 63   ASN B CG  1 
ATOM   1045 O OD1 . ASN B 1 63 ? 3.259  28.344 51.945 1.00 79.38  ? 63   ASN B OD1 1 
ATOM   1046 N ND2 . ASN B 1 63 ? 3.053  26.910 53.670 1.00 67.70  ? 63   ASN B ND2 1 
ATOM   1047 N N   . SER B 1 64 ? 4.686  31.906 55.129 1.00 29.65  ? 64   SER B N   1 
ATOM   1048 C CA  . SER B 1 64 ? 4.873  32.936 56.132 1.00 26.35  ? 64   SER B CA  1 
ATOM   1049 C C   . SER B 1 64 ? 4.819  34.312 55.482 1.00 35.42  ? 64   SER B C   1 
ATOM   1050 O O   . SER B 1 64 ? 4.276  35.244 56.067 1.00 39.22  ? 64   SER B O   1 
ATOM   1051 C CB  . SER B 1 64 ? 6.211  32.748 56.848 1.00 27.03  ? 64   SER B CB  1 
ATOM   1052 O OG  . SER B 1 64 ? 6.703  33.991 57.303 1.00 50.81  ? 64   SER B OG  1 
ATOM   1053 N N   . LEU B 1 65 ? 5.381  34.459 54.277 1.00 28.04  ? 65   LEU B N   1 
ATOM   1054 C CA  . LEU B 1 65 ? 5.343  35.753 53.604 1.00 31.07  ? 65   LEU B CA  1 
ATOM   1055 C C   . LEU B 1 65 ? 3.978  35.935 52.944 1.00 44.00  ? 65   LEU B C   1 
ATOM   1056 O O   . LEU B 1 65 ? 3.638  37.038 52.526 1.00 39.59  ? 65   LEU B O   1 
ATOM   1057 C CB  . LEU B 1 65 ? 6.460  35.908 52.555 1.00 33.20  ? 65   LEU B CB  1 
ATOM   1058 C CG  . LEU B 1 65 ? 7.886  35.927 53.125 1.00 33.80  ? 65   LEU B CG  1 
ATOM   1059 C CD1 . LEU B 1 65 ? 8.864  35.232 52.180 1.00 31.86  ? 65   LEU B CD1 1 
ATOM   1060 C CD2 . LEU B 1 65 ? 8.351  37.339 53.439 1.00 31.02  ? 65   LEU B CD2 1 
ATOM   1061 N N   . GLU B 1 66 ? 3.180  34.868 52.841 1.00 52.55  ? 66   GLU B N   1 
ATOM   1062 C CA  . GLU B 1 66 ? 1.858  35.046 52.226 1.00 64.13  ? 66   GLU B CA  1 
ATOM   1063 C C   . GLU B 1 66 ? 0.752  35.275 53.248 1.00 72.25  ? 66   GLU B C   1 
ATOM   1064 O O   . GLU B 1 66 ? -0.008 36.245 53.139 1.00 78.72  ? 66   GLU B O   1 
ATOM   1065 C CB  . GLU B 1 66 ? 1.524  33.847 51.334 1.00 71.26  ? 66   GLU B CB  1 
ATOM   1066 C CG  . GLU B 1 66 ? 1.600  34.130 49.844 1.00 74.74  ? 66   GLU B CG  1 
ATOM   1067 C CD  . GLU B 1 66 ? 0.330  34.706 49.250 1.00 77.44  ? 66   GLU B CD  1 
ATOM   1068 O OE1 . GLU B 1 66 ? 0.422  35.671 48.456 1.00 77.88  ? 66   GLU B OE1 1 
ATOM   1069 O OE2 . GLU B 1 66 ? -0.774 34.206 49.563 1.00 39.33  ? 66   GLU B OE2 1 
ATOM   1070 N N   . MET B 1 67 ? 0.596  34.430 54.266 1.00 79.29  ? 67   MET B N   1 
ATOM   1071 C CA  . MET B 1 67 ? -0.525 34.574 55.197 1.00 79.33  ? 67   MET B CA  1 
ATOM   1072 C C   . MET B 1 67 ? -0.405 35.802 56.094 1.00 83.07  ? 67   MET B C   1 
ATOM   1073 O O   . MET B 1 67 ? -1.407 36.501 56.283 1.00 92.36  ? 67   MET B O   1 
ATOM   1074 C CB  . MET B 1 67 ? -0.693 33.314 56.050 1.00 74.54  ? 67   MET B CB  1 
ATOM   1075 C CG  . MET B 1 67 ? 0.358  33.064 57.113 1.00 73.15  ? 67   MET B CG  1 
ATOM   1076 S SD  . MET B 1 67 ? -0.063 31.674 58.187 1.00 111.92 ? 67   MET B SD  1 
ATOM   1077 C CE  . MET B 1 67 ? -1.142 32.468 59.376 1.00 49.51  ? 67   MET B CE  1 
ATOM   1078 N N   . SER B 1 68 ? 0.771  36.069 56.636 1.00 79.18  ? 68   SER B N   1 
ATOM   1079 C CA  . SER B 1 68 ? 1.024  37.209 57.508 1.00 84.21  ? 68   SER B CA  1 
ATOM   1080 C C   . SER B 1 68 ? 0.457  37.012 58.912 1.00 87.27  ? 68   SER B C   1 
ATOM   1081 O O   . SER B 1 68 ? 0.586  37.957 59.725 1.00 79.89  ? 68   SER B O   1 
ATOM   1082 C CB  . SER B 1 68 ? 0.453  38.496 56.899 1.00 81.63  ? 68   SER B CB  1 
ATOM   1083 O OG  . SER B 1 68 ? 0.618  38.497 55.491 1.00 85.36  ? 68   SER B OG  1 
ATOM   1084 O OXT . SER B 1 68 ? -0.104 35.932 59.193 1.00 75.68  ? 68   SER B OXT 1 
HETATM 1085 S S   . SO4 C 2 .  ? 29.289 32.615 33.475 1.00 47.46  ? 198  SO4 A S   1 
HETATM 1086 O O1  . SO4 C 2 .  ? 30.458 33.040 34.307 1.00 52.37  ? 198  SO4 A O1  1 
HETATM 1087 O O2  . SO4 C 2 .  ? 29.204 31.109 33.478 1.00 43.05  ? 198  SO4 A O2  1 
HETATM 1088 O O3  . SO4 C 2 .  ? 29.436 33.118 32.069 1.00 40.09  ? 198  SO4 A O3  1 
HETATM 1089 O O4  . SO4 C 2 .  ? 28.045 33.192 34.089 1.00 55.83  ? 198  SO4 A O4  1 
HETATM 1090 S S   . SO4 D 2 .  ? 20.882 40.445 54.165 1.00 75.37  ? 199  SO4 B S   1 
HETATM 1091 O O1  . SO4 D 2 .  ? 21.178 40.640 52.703 1.00 61.13  ? 199  SO4 B O1  1 
HETATM 1092 O O2  . SO4 D 2 .  ? 20.776 38.976 54.459 1.00 91.10  ? 199  SO4 B O2  1 
HETATM 1093 O O3  . SO4 D 2 .  ? 19.578 41.119 54.500 1.00 53.75  ? 199  SO4 B O3  1 
HETATM 1094 O O4  . SO4 D 2 .  ? 22.002 41.034 54.971 1.00 72.69  ? 199  SO4 B O4  1 
HETATM 1095 O O   . HOH E 3 .  ? 21.739 40.945 38.721 1.00 48.74  ? 1001 HOH A O   1 
HETATM 1096 O O   . HOH E 3 .  ? 29.798 46.210 31.098 1.00 38.96  ? 1002 HOH A O   1 
HETATM 1097 O O   . HOH E 3 .  ? 16.339 55.226 26.258 1.00 37.33  ? 1004 HOH A O   1 
HETATM 1098 O O   . HOH E 3 .  ? 16.018 46.215 11.491 1.00 54.13  ? 1007 HOH A O   1 
HETATM 1099 O O   . HOH E 3 .  ? 14.150 32.057 23.998 1.00 38.41  ? 1009 HOH A O   1 
HETATM 1100 O O   . HOH E 3 .  ? 36.464 46.838 25.526 1.00 86.24  ? 1010 HOH A O   1 
HETATM 1101 O O   . HOH E 3 .  ? 23.300 57.850 32.071 1.00 31.02  ? 1013 HOH A O   1 
HETATM 1102 O O   . HOH E 3 .  ? 17.700 43.706 15.176 1.00 31.67  ? 1015 HOH A O   1 
HETATM 1103 O O   . HOH E 3 .  ? 34.461 50.586 26.922 1.00 48.27  ? 1016 HOH A O   1 
HETATM 1104 O O   . HOH E 3 .  ? 13.855 37.910 19.472 1.00 39.01  ? 1017 HOH A O   1 
HETATM 1105 O O   . HOH E 3 .  ? 15.642 47.773 32.473 1.00 29.38  ? 1018 HOH A O   1 
HETATM 1106 O O   . HOH E 3 .  ? 21.667 34.303 18.658 1.00 59.87  ? 1019 HOH A O   1 
HETATM 1107 O O   . HOH E 3 .  ? 28.663 39.996 18.728 1.00 52.28  ? 1020 HOH A O   1 
HETATM 1108 O O   . HOH E 3 .  ? 20.912 35.579 14.114 1.00 73.48  ? 1022 HOH A O   1 
HETATM 1109 O O   . HOH E 3 .  ? 14.959 40.836 17.224 1.00 36.05  ? 1023 HOH A O   1 
HETATM 1110 O O   . HOH E 3 .  ? 24.642 33.883 18.733 1.00 35.16  ? 1024 HOH A O   1 
HETATM 1111 O O   . HOH E 3 .  ? 32.055 49.187 26.581 1.00 57.20  ? 1025 HOH A O   1 
HETATM 1112 O O   . HOH E 3 .  ? 38.673 50.150 18.830 1.00 40.72  ? 1026 HOH A O   1 
HETATM 1113 O O   . HOH E 3 .  ? 25.343 38.957 33.463 1.00 33.47  ? 1027 HOH A O   1 
HETATM 1114 O O   . HOH E 3 .  ? 33.439 43.043 14.255 1.00 37.27  ? 1029 HOH A O   1 
HETATM 1115 O O   . HOH E 3 .  ? 19.017 58.147 15.636 1.00 36.38  ? 1030 HOH A O   1 
HETATM 1116 O O   . HOH E 3 .  ? 30.201 49.070 31.686 1.00 34.07  ? 1031 HOH A O   1 
HETATM 1117 O O   . HOH E 3 .  ? 22.843 33.938 46.630 1.00 33.50  ? 1032 HOH A O   1 
HETATM 1118 O O   . HOH E 3 .  ? 19.960 42.476 36.371 1.00 31.86  ? 1033 HOH A O   1 
HETATM 1119 O O   . HOH E 3 .  ? 32.213 48.037 13.657 1.00 35.17  ? 1034 HOH A O   1 
HETATM 1120 O O   . HOH E 3 .  ? 19.881 24.984 30.819 1.00 28.38  ? 1035 HOH A O   1 
HETATM 1121 O O   . HOH E 3 .  ? 30.154 41.183 29.126 1.00 30.84  ? 1036 HOH A O   1 
HETATM 1122 O O   . HOH E 3 .  ? 29.274 54.438 32.020 1.00 44.89  ? 1039 HOH A O   1 
HETATM 1123 O O   . HOH E 3 .  ? 22.925 57.919 35.212 1.00 28.35  ? 1043 HOH A O   1 
HETATM 1124 O O   . HOH E 3 .  ? 21.349 39.352 41.260 1.00 57.14  ? 1045 HOH A O   1 
HETATM 1125 O O   . HOH E 3 .  ? 17.091 38.375 15.775 1.00 39.57  ? 1050 HOH A O   1 
HETATM 1126 O O   . HOH E 3 .  ? 20.162 55.997 14.743 1.00 47.91  ? 1051 HOH A O   1 
HETATM 1127 O O   . HOH E 3 .  ? 15.113 35.167 20.651 1.00 43.40  ? 1052 HOH A O   1 
HETATM 1128 O O   . HOH E 3 .  ? 30.016 54.907 26.587 1.00 34.34  ? 1053 HOH A O   1 
HETATM 1129 O O   . HOH E 3 .  ? 19.675 38.921 38.256 1.00 24.86  ? 1054 HOH A O   1 
HETATM 1130 O O   . HOH E 3 .  ? 29.407 55.769 23.905 1.00 27.28  ? 1055 HOH A O   1 
HETATM 1131 O O   . HOH E 3 .  ? 12.424 48.120 18.394 1.00 29.47  ? 1056 HOH A O   1 
HETATM 1132 O O   . HOH E 3 .  ? 17.781 48.835 34.521 1.00 36.19  ? 1058 HOH A O   1 
HETATM 1133 O O   . HOH E 3 .  ? 18.592 56.628 27.122 1.00 34.60  ? 1059 HOH A O   1 
HETATM 1134 O O   . HOH E 3 .  ? 26.178 57.306 24.083 1.00 29.38  ? 1060 HOH A O   1 
HETATM 1135 O O   . HOH E 3 .  ? 30.367 48.641 28.412 1.00 26.42  ? 1065 HOH A O   1 
HETATM 1136 O O   . HOH E 3 .  ? 25.810 35.853 25.740 1.00 20.41  ? 1067 HOH A O   1 
HETATM 1137 O O   . HOH E 3 .  ? 11.560 45.439 19.454 1.00 22.88  ? 1068 HOH A O   1 
HETATM 1138 O O   . HOH E 3 .  ? 23.849 34.152 27.361 1.00 16.81  ? 1072 HOH A O   1 
HETATM 1139 O O   . HOH E 3 .  ? 18.892 42.591 18.196 1.00 22.36  ? 1073 HOH A O   1 
HETATM 1140 O O   . HOH E 3 .  ? 22.617 26.544 32.290 1.00 18.77  ? 1074 HOH A O   1 
HETATM 1141 O O   . HOH E 3 .  ? 19.342 27.993 30.853 1.00 17.50  ? 1076 HOH A O   1 
HETATM 1142 O O   . HOH E 3 .  ? 17.578 31.003 30.180 1.00 18.90  ? 1077 HOH A O   1 
HETATM 1143 O O   . HOH E 3 .  ? 18.076 32.947 27.865 1.00 14.71  ? 1078 HOH A O   1 
HETATM 1144 O O   . HOH E 3 .  ? 20.428 35.637 27.623 1.00 13.76  ? 1079 HOH A O   1 
HETATM 1145 O O   . HOH E 3 .  ? 23.477 37.114 32.978 1.00 14.50  ? 1080 HOH A O   1 
HETATM 1146 O O   . HOH E 3 .  ? 25.835 32.153 45.874 1.00 48.20  ? 1082 HOH A O   1 
HETATM 1147 O O   . HOH E 3 .  ? 11.455 41.336 19.588 1.00 43.16  ? 1084 HOH A O   1 
HETATM 1148 O O   . HOH E 3 .  ? 17.322 40.966 15.921 1.00 39.72  ? 1086 HOH A O   1 
HETATM 1149 O O   . HOH E 3 .  ? 22.014 54.837 15.655 1.00 31.94  ? 1087 HOH A O   1 
HETATM 1150 O O   . HOH E 3 .  ? 31.442 45.211 28.552 1.00 39.53  ? 1088 HOH A O   1 
HETATM 1151 O O   . HOH E 3 .  ? 15.813 28.509 23.115 1.00 53.72  ? 1089 HOH A O   1 
HETATM 1152 O O   . HOH E 3 .  ? 26.899 33.369 20.473 1.00 35.32  ? 1090 HOH A O   1 
HETATM 1153 O O   . HOH E 3 .  ? 23.733 38.549 45.173 1.00 46.23  ? 1092 HOH A O   1 
HETATM 1154 O O   . HOH E 3 .  ? 14.991 29.759 25.906 1.00 43.77  ? 1093 HOH A O   1 
HETATM 1155 O O   . HOH E 3 .  ? 23.045 40.608 10.368 1.00 44.26  ? 1100 HOH A O   1 
HETATM 1156 O O   . HOH E 3 .  ? 11.334 61.192 28.017 1.00 80.20  ? 1102 HOH A O   1 
HETATM 1157 O O   . HOH E 3 .  ? 31.742 39.044 28.234 1.00 28.85  ? 1103 HOH A O   1 
HETATM 1158 O O   . HOH E 3 .  ? 11.561 25.402 20.253 1.00 44.83  ? 1105 HOH A O   1 
HETATM 1159 O O   . HOH E 3 .  ? 28.596 35.582 28.342 1.00 42.44  ? 1106 HOH A O   1 
HETATM 1160 O O   . HOH E 3 .  ? 19.452 43.332 33.610 1.00 58.53  ? 1108 HOH A O   1 
HETATM 1161 O O   . HOH E 3 .  ? 17.436 60.030 18.475 1.00 43.04  ? 1112 HOH A O   1 
HETATM 1162 O O   . HOH E 3 .  ? 24.838 41.460 34.997 1.00 44.74  ? 1113 HOH A O   1 
HETATM 1163 O O   . HOH E 3 .  ? 18.460 53.416 14.986 1.00 56.67  ? 1114 HOH A O   1 
HETATM 1164 O O   . HOH E 3 .  ? 32.406 53.446 25.618 1.00 42.61  ? 1115 HOH A O   1 
HETATM 1165 O O   . HOH E 3 .  ? 31.003 31.623 30.717 1.00 50.32  ? 1116 HOH A O   1 
HETATM 1166 O O   . HOH E 3 .  ? 27.811 36.841 33.841 1.00 46.87  ? 1119 HOH A O   1 
HETATM 1167 O O   . HOH E 3 .  ? 32.159 54.832 21.527 1.00 64.05  ? 1120 HOH A O   1 
HETATM 1168 O O   . HOH E 3 .  ? 30.031 44.049 33.619 1.00 53.79  ? 1121 HOH A O   1 
HETATM 1169 O O   . HOH E 3 .  ? 30.654 35.348 35.564 1.00 44.37  ? 1123 HOH A O   1 
HETATM 1170 O O   . HOH E 3 .  ? 30.584 34.015 29.947 1.00 36.38  ? 1125 HOH A O   1 
HETATM 1171 O O   . HOH E 3 .  ? 19.424 34.590 17.035 1.00 57.08  ? 1127 HOH A O   1 
HETATM 1172 O O   . HOH E 3 .  ? 14.948 38.450 16.599 1.00 74.39  ? 1129 HOH A O   1 
HETATM 1173 O O   . HOH E 3 .  ? 17.807 56.559 35.567 1.00 46.08  ? 1130 HOH A O   1 
HETATM 1174 O O   . HOH E 3 .  ? 14.430 51.341 27.487 1.00 53.66  ? 1131 HOH A O   1 
HETATM 1175 O O   . HOH E 3 .  ? 25.075 59.135 30.698 1.00 55.27  ? 1132 HOH A O   1 
HETATM 1176 O O   . HOH E 3 .  ? 29.700 40.145 8.230  1.00 123.73 ? 1134 HOH A O   1 
HETATM 1177 O O   . HOH E 3 .  ? 28.835 36.297 20.996 1.00 42.32  ? 1136 HOH A O   1 
HETATM 1178 O O   . HOH E 3 .  ? 19.717 59.480 33.709 1.00 54.97  ? 1137 HOH A O   1 
HETATM 1179 O O   . HOH E 3 .  ? 28.387 35.257 24.816 1.00 60.68  ? 1138 HOH A O   1 
HETATM 1180 O O   . HOH E 3 .  ? 26.528 25.612 35.030 1.00 78.52  ? 1139 HOH A O   1 
HETATM 1181 O O   . HOH E 3 .  ? 16.489 60.830 25.323 1.00 46.36  ? 1144 HOH A O   1 
HETATM 1182 O O   . HOH E 3 .  ? 28.720 58.943 29.799 1.00 72.00  ? 1147 HOH A O   1 
HETATM 1183 O O   . HOH E 3 .  ? 31.709 36.623 32.782 1.00 69.69  ? 1149 HOH A O   1 
HETATM 1184 O O   . HOH E 3 .  ? 22.763 42.612 36.869 1.00 44.40  ? 1151 HOH A O   1 
HETATM 1185 O O   . HOH E 3 .  ? 19.726 61.032 20.242 1.00 48.53  ? 1152 HOH A O   1 
HETATM 1186 O O   . HOH E 3 .  ? 29.551 40.175 31.483 1.00 66.04  ? 1153 HOH A O   1 
HETATM 1187 O O   . HOH E 3 .  ? 29.261 32.297 18.212 1.00 54.51  ? 1159 HOH A O   1 
HETATM 1188 O O   . HOH E 3 .  ? 38.355 57.369 19.928 1.00 61.26  ? 1163 HOH A O   1 
HETATM 1189 O O   . HOH E 3 .  ? 40.959 55.468 12.938 1.00 67.51  ? 1165 HOH A O   1 
HETATM 1190 O O   . HOH E 3 .  ? 16.483 51.609 14.478 1.00 61.53  ? 1166 HOH A O   1 
HETATM 1191 O O   . HOH E 3 .  ? 14.419 47.298 28.853 1.00 47.75  ? 1167 HOH A O   1 
HETATM 1192 O O   . HOH E 3 .  ? 33.457 49.539 31.442 1.00 69.73  ? 1169 HOH A O   1 
HETATM 1193 O O   . HOH E 3 .  ? 33.685 38.200 33.146 1.00 45.25  ? 1171 HOH A O   1 
HETATM 1194 O O   . HOH E 3 .  ? 30.981 24.837 40.490 1.00 88.99  ? 1175 HOH A O   1 
HETATM 1195 O O   . HOH E 3 .  ? 11.955 28.397 18.681 1.00 58.75  ? 1176 HOH A O   1 
HETATM 1196 O O   . HOH E 3 .  ? 15.131 62.806 27.429 1.00 101.37 ? 1177 HOH A O   1 
HETATM 1197 O O   . HOH E 3 .  ? 26.386 58.906 32.570 1.00 61.62  ? 1178 HOH A O   1 
HETATM 1198 O O   . HOH E 3 .  ? 27.428 43.245 34.668 1.00 70.75  ? 1179 HOH A O   1 
HETATM 1199 O O   . HOH E 3 .  ? 32.530 40.211 33.441 1.00 55.93  ? 1182 HOH A O   1 
HETATM 1200 O O   . HOH E 3 .  ? 14.890 40.793 13.022 1.00 53.57  ? 1183 HOH A O   1 
HETATM 1201 O O   . HOH E 3 .  ? 30.356 33.666 15.362 1.00 61.49  ? 1184 HOH A O   1 
HETATM 1202 O O   . HOH E 3 .  ? 14.738 28.172 19.869 1.00 69.41  ? 1187 HOH A O   1 
HETATM 1203 O O   . HOH F 3 .  ? 18.219 22.493 51.928 1.00 95.10  ? 1003 HOH B O   1 
HETATM 1204 O O   . HOH F 3 .  ? 20.779 45.928 57.610 1.00 71.39  ? 1005 HOH B O   1 
HETATM 1205 O O   . HOH F 3 .  ? 15.008 45.643 43.083 1.00 75.20  ? 1006 HOH B O   1 
HETATM 1206 O O   . HOH F 3 .  ? 17.967 23.568 33.356 1.00 43.05  ? 1008 HOH B O   1 
HETATM 1207 O O   . HOH F 3 .  ? 11.521 23.516 33.714 1.00 79.93  ? 1011 HOH B O   1 
HETATM 1208 O O   . HOH F 3 .  ? 9.685  36.869 38.289 1.00 50.87  ? 1012 HOH B O   1 
HETATM 1209 O O   . HOH F 3 .  ? 16.112 44.429 35.233 1.00 59.65  ? 1014 HOH B O   1 
HETATM 1210 O O   . HOH F 3 .  ? 9.211  28.079 36.036 1.00 43.96  ? 1021 HOH B O   1 
HETATM 1211 O O   . HOH F 3 .  ? 9.636  26.342 32.270 1.00 42.39  ? 1028 HOH B O   1 
HETATM 1212 O O   . HOH F 3 .  ? 14.855 28.871 59.530 1.00 38.31  ? 1037 HOH B O   1 
HETATM 1213 O O   . HOH F 3 .  ? 11.274 26.590 34.821 1.00 34.22  ? 1038 HOH B O   1 
HETATM 1214 O O   . HOH F 3 .  ? 15.591 44.937 31.482 1.00 25.95  ? 1040 HOH B O   1 
HETATM 1215 O O   . HOH F 3 .  ? 18.239 40.459 36.796 1.00 27.03  ? 1041 HOH B O   1 
HETATM 1216 O O   . HOH F 3 .  ? 16.877 25.949 48.265 1.00 31.22  ? 1042 HOH B O   1 
HETATM 1217 O O   . HOH F 3 .  ? 14.489 23.112 31.537 1.00 30.77  ? 1044 HOH B O   1 
HETATM 1218 O O   . HOH F 3 .  ? 10.532 42.494 21.925 1.00 55.75  ? 1046 HOH B O   1 
HETATM 1219 O O   . HOH F 3 .  ? 16.448 41.117 35.007 1.00 25.61  ? 1047 HOH B O   1 
HETATM 1220 O O   . HOH F 3 .  ? 16.695 21.963 32.099 1.00 30.12  ? 1048 HOH B O   1 
HETATM 1221 O O   . HOH F 3 .  ? 5.781  35.402 41.990 1.00 32.62  ? 1049 HOH B O   1 
HETATM 1222 O O   . HOH F 3 .  ? 17.169 43.117 44.266 1.00 30.63  ? 1057 HOH B O   1 
HETATM 1223 O O   . HOH F 3 .  ? 14.090 39.210 26.732 1.00 23.30  ? 1061 HOH B O   1 
HETATM 1224 O O   . HOH F 3 .  ? 9.844  29.319 38.970 1.00 23.45  ? 1062 HOH B O   1 
HETATM 1225 O O   . HOH F 3 .  ? 17.487 29.458 32.349 1.00 18.33  ? 1063 HOH B O   1 
HETATM 1226 O O   . HOH F 3 .  ? 12.058 35.740 36.400 1.00 21.25  ? 1064 HOH B O   1 
HETATM 1227 O O   . HOH F 3 .  ? 6.601  38.236 49.402 1.00 25.38  ? 1066 HOH B O   1 
HETATM 1228 O O   . HOH F 3 .  ? 15.573 29.114 29.562 1.00 20.13  ? 1069 HOH B O   1 
HETATM 1229 O O   . HOH F 3 .  ? 11.514 29.517 36.669 1.00 19.11  ? 1070 HOH B O   1 
HETATM 1230 O O   . HOH F 3 .  ? 21.864 31.113 40.190 1.00 19.20  ? 1071 HOH B O   1 
HETATM 1231 O O   . HOH F 3 .  ? 15.063 30.330 37.439 1.00 13.89  ? 1075 HOH B O   1 
HETATM 1232 O O   . HOH F 3 .  ? 17.075 28.947 35.064 1.00 17.73  ? 1081 HOH B O   1 
HETATM 1233 O O   . HOH F 3 .  ? 24.642 28.175 47.111 1.00 49.96  ? 1083 HOH B O   1 
HETATM 1234 O O   . HOH F 3 .  ? 10.128 45.576 26.761 1.00 34.26  ? 1085 HOH B O   1 
HETATM 1235 O O   . HOH F 3 .  ? 12.434 29.792 27.477 1.00 28.22  ? 1091 HOH B O   1 
HETATM 1236 O O   . HOH F 3 .  ? 11.916 31.288 25.426 1.00 42.79  ? 1094 HOH B O   1 
HETATM 1237 O O   . HOH F 3 .  ? 20.773 36.279 54.566 1.00 71.38  ? 1095 HOH B O   1 
HETATM 1238 O O   . HOH F 3 .  ? 11.095 41.649 44.899 1.00 32.65  ? 1096 HOH B O   1 
HETATM 1239 O O   . HOH F 3 .  ? 13.232 42.805 43.716 1.00 77.27  ? 1097 HOH B O   1 
HETATM 1240 O O   . HOH F 3 .  ? -0.741 40.751 60.128 1.00 37.43  ? 1098 HOH B O   1 
HETATM 1241 O O   . HOH F 3 .  ? 9.002  39.600 56.392 1.00 47.31  ? 1099 HOH B O   1 
HETATM 1242 O O   . HOH F 3 .  ? 15.959 22.094 36.365 1.00 36.97  ? 1101 HOH B O   1 
HETATM 1243 O O   . HOH F 3 .  ? 14.072 21.746 54.189 1.00 49.35  ? 1104 HOH B O   1 
HETATM 1244 O O   . HOH F 3 .  ? 17.549 19.497 53.206 1.00 48.08  ? 1107 HOH B O   1 
HETATM 1245 O O   . HOH F 3 .  ? 4.093  35.263 43.858 1.00 45.10  ? 1109 HOH B O   1 
HETATM 1246 O O   . HOH F 3 .  ? 9.595  45.616 49.490 1.00 35.77  ? 1110 HOH B O   1 
HETATM 1247 O O   . HOH F 3 .  ? 20.949 23.182 47.376 1.00 41.11  ? 1111 HOH B O   1 
HETATM 1248 O O   . HOH F 3 .  ? 25.630 24.414 48.027 1.00 52.88  ? 1117 HOH B O   1 
HETATM 1249 O O   . HOH F 3 .  ? 13.771 17.218 42.670 1.00 56.25  ? 1118 HOH B O   1 
HETATM 1250 O O   . HOH F 3 .  ? 8.529  41.638 54.594 1.00 38.89  ? 1122 HOH B O   1 
HETATM 1251 O O   . HOH F 3 .  ? 14.843 27.029 28.112 1.00 44.57  ? 1124 HOH B O   1 
HETATM 1252 O O   . HOH F 3 .  ? 12.914 21.975 41.937 1.00 59.24  ? 1126 HOH B O   1 
HETATM 1253 O O   . HOH F 3 .  ? 16.807 23.385 58.309 1.00 57.16  ? 1128 HOH B O   1 
HETATM 1254 O O   . HOH F 3 .  ? 22.127 24.901 36.605 1.00 46.57  ? 1133 HOH B O   1 
HETATM 1255 O O   . HOH F 3 .  ? 24.085 26.831 49.159 1.00 43.91  ? 1135 HOH B O   1 
HETATM 1256 O O   . HOH F 3 .  ? 7.881  41.048 21.058 1.00 43.97  ? 1140 HOH B O   1 
HETATM 1257 O O   . HOH F 3 .  ? 14.632 44.480 45.022 1.00 53.11  ? 1141 HOH B O   1 
HETATM 1258 O O   . HOH F 3 .  ? 6.484  39.948 51.260 1.00 57.56  ? 1142 HOH B O   1 
HETATM 1259 O O   . HOH F 3 .  ? 6.760  39.107 56.486 1.00 56.49  ? 1143 HOH B O   1 
HETATM 1260 O O   . HOH F 3 .  ? 17.007 40.903 38.908 1.00 49.62  ? 1145 HOH B O   1 
HETATM 1261 O O   . HOH F 3 .  ? 11.163 16.860 43.977 1.00 51.42  ? 1146 HOH B O   1 
HETATM 1262 O O   . HOH F 3 .  ? 5.375  40.131 53.672 1.00 45.00  ? 1148 HOH B O   1 
HETATM 1263 O O   . HOH F 3 .  ? 24.561 31.971 38.446 1.00 54.14  ? 1150 HOH B O   1 
HETATM 1264 O O   . HOH F 3 .  ? 24.437 22.917 34.334 1.00 56.05  ? 1154 HOH B O   1 
HETATM 1265 O O   . HOH F 3 .  ? 10.506 38.345 28.244 1.00 83.51  ? 1155 HOH B O   1 
HETATM 1266 O O   . HOH F 3 .  ? 24.081 28.053 51.988 1.00 50.90  ? 1156 HOH B O   1 
HETATM 1267 O O   . HOH F 3 .  ? 19.872 20.522 49.319 1.00 97.34  ? 1157 HOH B O   1 
HETATM 1268 O O   . HOH F 3 .  ? 13.176 27.412 58.323 1.00 66.17  ? 1158 HOH B O   1 
HETATM 1269 O O   . HOH F 3 .  ? 9.334  23.401 41.394 1.00 48.81  ? 1160 HOH B O   1 
HETATM 1270 O O   . HOH F 3 .  ? 13.856 42.897 40.234 1.00 70.89  ? 1161 HOH B O   1 
HETATM 1271 O O   . HOH F 3 .  ? 14.849 47.551 51.722 1.00 66.13  ? 1162 HOH B O   1 
HETATM 1272 O O   . HOH F 3 .  ? 18.472 16.395 51.429 1.00 54.08  ? 1164 HOH B O   1 
HETATM 1273 O O   . HOH F 3 .  ? 4.063  27.192 56.744 1.00 55.34  ? 1168 HOH B O   1 
HETATM 1274 O O   . HOH F 3 .  ? 12.288 19.035 52.243 1.00 45.68  ? 1170 HOH B O   1 
HETATM 1275 O O   . HOH F 3 .  ? 17.039 18.270 47.512 1.00 109.17 ? 1172 HOH B O   1 
HETATM 1276 O O   . HOH F 3 .  ? 7.659  42.540 18.536 1.00 56.56  ? 1173 HOH B O   1 
HETATM 1277 O O   . HOH F 3 .  ? 5.638  23.082 57.385 1.00 53.90  ? 1174 HOH B O   1 
HETATM 1278 O O   . HOH F 3 .  ? 9.180  38.624 21.049 1.00 61.63  ? 1180 HOH B O   1 
HETATM 1279 O O   . HOH F 3 .  ? 9.885  41.963 16.228 1.00 70.59  ? 1181 HOH B O   1 
HETATM 1280 O O   . HOH F 3 .  ? 8.642  26.415 37.516 1.00 70.37  ? 1185 HOH B O   1 
HETATM 1281 O O   . HOH F 3 .  ? 17.157 47.201 55.016 1.00 68.75  ? 1186 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  ?  ?   ?   A . n 
A 1 2  GLY 2  2  2  GLY GLY A . n 
A 1 3  TYR 3  3  3  TYR TYR A . n 
A 1 4  SER 4  4  4  SER SER A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  ASP 6  6  6  ASP ASP A . n 
A 1 7  THR 7  7  7  THR THR A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  PRO 9  9  9  PRO PRO A . n 
A 1 10 CYS 10 10 10 CYS CYS A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 PHE 12 12 12 PHE PHE A . n 
A 1 13 ALA 13 13 13 ALA ALA A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 ILE 15 15 15 ILE ILE A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 ARG 17 17 17 ARG ARG A . n 
A 1 18 PRO 18 18 18 PRO PRO A . n 
A 1 19 MET 19 19 19 MET MET A . n 
A 1 20 PRO 20 20 20 PRO PRO A . n 
A 1 21 ARG 21 21 21 ARG ARG A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 HIS 23 23 23 HIS HIS A . n 
A 1 24 ILE 24 24 24 ILE ILE A . n 
A 1 25 LYS 25 25 25 LYS LYS A . n 
A 1 26 GLU 26 26 26 GLU GLU A . n 
A 1 27 TYR 27 27 27 TYR TYR A . n 
A 1 28 PHE 28 28 28 PHE PHE A . n 
A 1 29 TYR 29 29 29 TYR TYR A . n 
A 1 30 THR 30 30 30 THR THR A . n 
A 1 31 SER 31 31 31 SER SER A . n 
A 1 32 GLY 32 32 32 GLY GLY A . n 
A 1 33 LYS 33 33 33 LYS LYS A . n 
A 1 34 CYS 34 34 34 CYS CYS A . n 
A 1 35 SER 35 35 35 SER SER A . n 
A 1 36 ASN 36 36 36 ASN ASN A . n 
A 1 37 PRO 37 37 37 PRO PRO A . n 
A 1 38 ALA 38 38 38 ALA ALA A . n 
A 1 39 VAL 39 39 39 VAL VAL A . n 
A 1 40 VAL 40 40 40 VAL VAL A . n 
A 1 41 PHE 41 41 41 PHE PHE A . n 
A 1 42 VAL 42 42 42 VAL VAL A . n 
A 1 43 THR 43 43 43 THR THR A . n 
A 1 44 ARG 44 44 44 ARG ARG A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 ASN 46 46 46 ASN ASN A . n 
A 1 47 ARG 47 47 47 ARG ARG A . n 
A 1 48 GLN 48 48 48 GLN GLN A . n 
A 1 49 VAL 49 49 49 VAL VAL A . n 
A 1 50 CYS 50 50 50 CYS CYS A . n 
A 1 51 ALA 51 51 51 ALA ALA A . n 
A 1 52 ASN 52 52 52 ASN ASN A . n 
A 1 53 PRO 53 53 53 PRO PRO A . n 
A 1 54 GLU 54 54 54 GLU GLU A . n 
A 1 55 LYS 55 55 55 LYS LYS A . n 
A 1 56 LYS 56 56 56 LYS LYS A . n 
A 1 57 TRP 57 57 57 TRP TRP A . n 
A 1 58 VAL 58 58 58 VAL VAL A . n 
A 1 59 ARG 59 59 59 ARG ARG A . n 
A 1 60 GLU 60 60 60 GLU GLU A . n 
A 1 61 TYR 61 61 61 TYR TYR A . n 
A 1 62 ILE 62 62 62 ILE ILE A . n 
A 1 63 ASN 63 63 63 ASN ASN A . n 
A 1 64 SER 64 64 64 SER SER A . n 
A 1 65 LEU 65 65 65 LEU LEU A . n 
A 1 66 GLU 66 66 66 GLU GLU A . n 
A 1 67 MET 67 67 67 MET MET A . n 
A 1 68 SER 68 68 68 SER SER A . n 
B 1 1  MET 1  1  ?  ?   ?   B . n 
B 1 2  GLY 2  2  2  GLY GLY B . n 
B 1 3  TYR 3  3  3  TYR TYR B . n 
B 1 4  SER 4  4  4  SER SER B . n 
B 1 5  SER 5  5  5  SER SER B . n 
B 1 6  ASP 6  6  6  ASP ASP B . n 
B 1 7  THR 7  7  7  THR THR B . n 
B 1 8  THR 8  8  8  THR THR B . n 
B 1 9  PRO 9  9  9  PRO PRO B . n 
B 1 10 CYS 10 10 10 CYS CYS B . n 
B 1 11 CYS 11 11 11 CYS CYS B . n 
B 1 12 PHE 12 12 12 PHE PHE B . n 
B 1 13 ALA 13 13 13 ALA ALA B . n 
B 1 14 TYR 14 14 14 TYR TYR B . n 
B 1 15 ILE 15 15 15 ILE ILE B . n 
B 1 16 ALA 16 16 16 ALA ALA B . n 
B 1 17 ARG 17 17 17 ARG ARG B . n 
B 1 18 PRO 18 18 18 PRO PRO B . n 
B 1 19 MET 19 19 19 MET MET B . n 
B 1 20 PRO 20 20 20 PRO PRO B . n 
B 1 21 ARG 21 21 21 ARG ARG B . n 
B 1 22 ALA 22 22 22 ALA ALA B . n 
B 1 23 HIS 23 23 23 HIS HIS B . n 
B 1 24 ILE 24 24 24 ILE ILE B . n 
B 1 25 LYS 25 25 25 LYS LYS B . n 
B 1 26 GLU 26 26 26 GLU GLU B . n 
B 1 27 TYR 27 27 27 TYR TYR B . n 
B 1 28 PHE 28 28 28 PHE PHE B . n 
B 1 29 TYR 29 29 29 TYR TYR B . n 
B 1 30 THR 30 30 30 THR THR B . n 
B 1 31 SER 31 31 31 SER SER B . n 
B 1 32 GLY 32 32 32 GLY GLY B . n 
B 1 33 LYS 33 33 33 LYS LYS B . n 
B 1 34 CYS 34 34 34 CYS CYS B . n 
B 1 35 SER 35 35 35 SER SER B . n 
B 1 36 ASN 36 36 36 ASN ASN B . n 
B 1 37 PRO 37 37 37 PRO PRO B . n 
B 1 38 ALA 38 38 38 ALA ALA B . n 
B 1 39 VAL 39 39 39 VAL VAL B . n 
B 1 40 VAL 40 40 40 VAL VAL B . n 
B 1 41 PHE 41 41 41 PHE PHE B . n 
B 1 42 VAL 42 42 42 VAL VAL B . n 
B 1 43 THR 43 43 43 THR THR B . n 
B 1 44 ARG 44 44 44 ARG ARG B . n 
B 1 45 LYS 45 45 45 LYS LYS B . n 
B 1 46 ASN 46 46 46 ASN ASN B . n 
B 1 47 ARG 47 47 47 ARG ARG B . n 
B 1 48 GLN 48 48 48 GLN GLN B . n 
B 1 49 VAL 49 49 49 VAL VAL B . n 
B 1 50 CYS 50 50 50 CYS CYS B . n 
B 1 51 ALA 51 51 51 ALA ALA B . n 
B 1 52 ASN 52 52 52 ASN ASN B . n 
B 1 53 PRO 53 53 53 PRO PRO B . n 
B 1 54 GLU 54 54 54 GLU GLU B . n 
B 1 55 LYS 55 55 55 LYS LYS B . n 
B 1 56 LYS 56 56 56 LYS LYS B . n 
B 1 57 TRP 57 57 57 TRP TRP B . n 
B 1 58 VAL 58 58 58 VAL VAL B . n 
B 1 59 ARG 59 59 59 ARG ARG B . n 
B 1 60 GLU 60 60 60 GLU GLU B . n 
B 1 61 TYR 61 61 61 TYR TYR B . n 
B 1 62 ILE 62 62 62 ILE ILE B . n 
B 1 63 ASN 63 63 63 ASN ASN B . n 
B 1 64 SER 64 64 64 SER SER B . n 
B 1 65 LEU 65 65 65 LEU LEU B . n 
B 1 66 GLU 66 66 66 GLU GLU B . n 
B 1 67 MET 67 67 67 MET MET B . n 
B 1 68 SER 68 68 68 SER SER B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-04-19 
2 'Structure model' 1 1 2007-10-21 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
SHELXL-97 refinement       . ? 4 
# 
_pdbx_entry_details.entry_id             1EQT 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'INITIATING MET RETAINED.' 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 117.12 120.30 -3.18 0.50 N 
2 1 NE B ARG 21 ? ? CZ B ARG 21 ? ? NH1 B ARG 21 ? ? 123.75 120.30 3.45  0.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 B MET 1 ? B MET 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1   198  198  SO4 SO4 A . 
D 2 SO4 1   199  199  SO4 SO4 B . 
E 3 HOH 1   1001 1001 HOH HOH A . 
E 3 HOH 2   1002 1002 HOH HOH A . 
E 3 HOH 3   1004 1004 HOH HOH A . 
E 3 HOH 4   1007 1007 HOH HOH A . 
E 3 HOH 5   1009 1009 HOH HOH A . 
E 3 HOH 6   1010 1010 HOH HOH A . 
E 3 HOH 7   1013 1013 HOH HOH A . 
E 3 HOH 8   1015 1015 HOH HOH A . 
E 3 HOH 9   1016 1016 HOH HOH A . 
E 3 HOH 10  1017 1017 HOH HOH A . 
E 3 HOH 11  1018 1018 HOH HOH A . 
E 3 HOH 12  1019 1019 HOH HOH A . 
E 3 HOH 13  1020 1020 HOH HOH A . 
E 3 HOH 14  1022 1022 HOH HOH A . 
E 3 HOH 15  1023 1023 HOH HOH A . 
E 3 HOH 16  1024 1024 HOH HOH A . 
E 3 HOH 17  1025 1025 HOH HOH A . 
E 3 HOH 18  1026 1026 HOH HOH A . 
E 3 HOH 19  1027 1027 HOH HOH A . 
E 3 HOH 20  1029 1029 HOH HOH A . 
E 3 HOH 21  1030 1030 HOH HOH A . 
E 3 HOH 22  1031 1031 HOH HOH A . 
E 3 HOH 23  1032 1032 HOH HOH A . 
E 3 HOH 24  1033 1033 HOH HOH A . 
E 3 HOH 25  1034 1034 HOH HOH A . 
E 3 HOH 26  1035 1035 HOH HOH A . 
E 3 HOH 27  1036 1036 HOH HOH A . 
E 3 HOH 28  1039 1039 HOH HOH A . 
E 3 HOH 29  1043 1043 HOH HOH A . 
E 3 HOH 30  1045 1045 HOH HOH A . 
E 3 HOH 31  1050 1050 HOH HOH A . 
E 3 HOH 32  1051 1051 HOH HOH A . 
E 3 HOH 33  1052 1052 HOH HOH A . 
E 3 HOH 34  1053 1053 HOH HOH A . 
E 3 HOH 35  1054 1054 HOH HOH A . 
E 3 HOH 36  1055 1055 HOH HOH A . 
E 3 HOH 37  1056 1056 HOH HOH A . 
E 3 HOH 38  1058 1058 HOH HOH A . 
E 3 HOH 39  1059 1059 HOH HOH A . 
E 3 HOH 40  1060 1060 HOH HOH A . 
E 3 HOH 41  1065 1065 HOH HOH A . 
E 3 HOH 42  1067 1067 HOH HOH A . 
E 3 HOH 43  1068 1068 HOH HOH A . 
E 3 HOH 44  1072 1072 HOH HOH A . 
E 3 HOH 45  1073 1073 HOH HOH A . 
E 3 HOH 46  1074 1074 HOH HOH A . 
E 3 HOH 47  1076 1076 HOH HOH A . 
E 3 HOH 48  1077 1077 HOH HOH A . 
E 3 HOH 49  1078 1078 HOH HOH A . 
E 3 HOH 50  1079 1079 HOH HOH A . 
E 3 HOH 51  1080 1080 HOH HOH A . 
E 3 HOH 52  1082 1082 HOH HOH A . 
E 3 HOH 53  1084 1084 HOH HOH A . 
E 3 HOH 54  1086 1086 HOH HOH A . 
E 3 HOH 55  1087 1087 HOH HOH A . 
E 3 HOH 56  1088 1088 HOH HOH A . 
E 3 HOH 57  1089 1089 HOH HOH A . 
E 3 HOH 58  1090 1090 HOH HOH A . 
E 3 HOH 59  1092 1092 HOH HOH A . 
E 3 HOH 60  1093 1093 HOH HOH A . 
E 3 HOH 61  1100 1100 HOH HOH A . 
E 3 HOH 62  1102 1102 HOH HOH A . 
E 3 HOH 63  1103 1103 HOH HOH A . 
E 3 HOH 64  1105 1105 HOH HOH A . 
E 3 HOH 65  1106 1106 HOH HOH A . 
E 3 HOH 66  1108 1108 HOH HOH A . 
E 3 HOH 67  1112 1112 HOH HOH A . 
E 3 HOH 68  1113 1113 HOH HOH A . 
E 3 HOH 69  1114 1114 HOH HOH A . 
E 3 HOH 70  1115 1115 HOH HOH A . 
E 3 HOH 71  1116 1116 HOH HOH A . 
E 3 HOH 72  1119 1119 HOH HOH A . 
E 3 HOH 73  1120 1120 HOH HOH A . 
E 3 HOH 74  1121 1121 HOH HOH A . 
E 3 HOH 75  1123 1123 HOH HOH A . 
E 3 HOH 76  1125 1125 HOH HOH A . 
E 3 HOH 77  1127 1127 HOH HOH A . 
E 3 HOH 78  1129 1129 HOH HOH A . 
E 3 HOH 79  1130 1130 HOH HOH A . 
E 3 HOH 80  1131 1131 HOH HOH A . 
E 3 HOH 81  1132 1132 HOH HOH A . 
E 3 HOH 82  1134 1134 HOH HOH A . 
E 3 HOH 83  1136 1136 HOH HOH A . 
E 3 HOH 84  1137 1137 HOH HOH A . 
E 3 HOH 85  1138 1138 HOH HOH A . 
E 3 HOH 86  1139 1139 HOH HOH A . 
E 3 HOH 87  1144 1144 HOH HOH A . 
E 3 HOH 88  1147 1147 HOH HOH A . 
E 3 HOH 89  1149 1149 HOH HOH A . 
E 3 HOH 90  1151 1151 HOH HOH A . 
E 3 HOH 91  1152 1152 HOH HOH A . 
E 3 HOH 92  1153 1153 HOH HOH A . 
E 3 HOH 93  1159 1159 HOH HOH A . 
E 3 HOH 94  1163 1163 HOH HOH A . 
E 3 HOH 95  1165 1165 HOH HOH A . 
E 3 HOH 96  1166 1166 HOH HOH A . 
E 3 HOH 97  1167 1167 HOH HOH A . 
E 3 HOH 98  1169 1169 HOH HOH A . 
E 3 HOH 99  1171 1171 HOH HOH A . 
E 3 HOH 100 1175 1175 HOH HOH A . 
E 3 HOH 101 1176 1176 HOH HOH A . 
E 3 HOH 102 1177 1177 HOH HOH A . 
E 3 HOH 103 1178 1178 HOH HOH A . 
E 3 HOH 104 1179 1179 HOH HOH A . 
E 3 HOH 105 1182 1182 HOH HOH A . 
E 3 HOH 106 1183 1183 HOH HOH A . 
E 3 HOH 107 1184 1184 HOH HOH A . 
E 3 HOH 108 1187 1187 HOH HOH A . 
F 3 HOH 1   1003 1003 HOH HOH B . 
F 3 HOH 2   1005 1005 HOH HOH B . 
F 3 HOH 3   1006 1006 HOH HOH B . 
F 3 HOH 4   1008 1008 HOH HOH B . 
F 3 HOH 5   1011 1011 HOH HOH B . 
F 3 HOH 6   1012 1012 HOH HOH B . 
F 3 HOH 7   1014 1014 HOH HOH B . 
F 3 HOH 8   1021 1021 HOH HOH B . 
F 3 HOH 9   1028 1028 HOH HOH B . 
F 3 HOH 10  1037 1037 HOH HOH B . 
F 3 HOH 11  1038 1038 HOH HOH B . 
F 3 HOH 12  1040 1040 HOH HOH B . 
F 3 HOH 13  1041 1041 HOH HOH B . 
F 3 HOH 14  1042 1042 HOH HOH B . 
F 3 HOH 15  1044 1044 HOH HOH B . 
F 3 HOH 16  1046 1046 HOH HOH B . 
F 3 HOH 17  1047 1047 HOH HOH B . 
F 3 HOH 18  1048 1048 HOH HOH B . 
F 3 HOH 19  1049 1049 HOH HOH B . 
F 3 HOH 20  1057 1057 HOH HOH B . 
F 3 HOH 21  1061 1061 HOH HOH B . 
F 3 HOH 22  1062 1062 HOH HOH B . 
F 3 HOH 23  1063 1063 HOH HOH B . 
F 3 HOH 24  1064 1064 HOH HOH B . 
F 3 HOH 25  1066 1066 HOH HOH B . 
F 3 HOH 26  1069 1069 HOH HOH B . 
F 3 HOH 27  1070 1070 HOH HOH B . 
F 3 HOH 28  1071 1071 HOH HOH B . 
F 3 HOH 29  1075 1075 HOH HOH B . 
F 3 HOH 30  1081 1081 HOH HOH B . 
F 3 HOH 31  1083 1083 HOH HOH B . 
F 3 HOH 32  1085 1085 HOH HOH B . 
F 3 HOH 33  1091 1091 HOH HOH B . 
F 3 HOH 34  1094 1094 HOH HOH B . 
F 3 HOH 35  1095 1095 HOH HOH B . 
F 3 HOH 36  1096 1096 HOH HOH B . 
F 3 HOH 37  1097 1097 HOH HOH B . 
F 3 HOH 38  1098 1098 HOH HOH B . 
F 3 HOH 39  1099 1099 HOH HOH B . 
F 3 HOH 40  1101 1101 HOH HOH B . 
F 3 HOH 41  1104 1104 HOH HOH B . 
F 3 HOH 42  1107 1107 HOH HOH B . 
F 3 HOH 43  1109 1109 HOH HOH B . 
F 3 HOH 44  1110 1110 HOH HOH B . 
F 3 HOH 45  1111 1111 HOH HOH B . 
F 3 HOH 46  1117 1117 HOH HOH B . 
F 3 HOH 47  1118 1118 HOH HOH B . 
F 3 HOH 48  1122 1122 HOH HOH B . 
F 3 HOH 49  1124 1124 HOH HOH B . 
F 3 HOH 50  1126 1126 HOH HOH B . 
F 3 HOH 51  1128 1128 HOH HOH B . 
F 3 HOH 52  1133 1133 HOH HOH B . 
F 3 HOH 53  1135 1135 HOH HOH B . 
F 3 HOH 54  1140 1140 HOH HOH B . 
F 3 HOH 55  1141 1141 HOH HOH B . 
F 3 HOH 56  1142 1142 HOH HOH B . 
F 3 HOH 57  1143 1143 HOH HOH B . 
F 3 HOH 58  1145 1145 HOH HOH B . 
F 3 HOH 59  1146 1146 HOH HOH B . 
F 3 HOH 60  1148 1148 HOH HOH B . 
F 3 HOH 61  1150 1150 HOH HOH B . 
F 3 HOH 62  1154 1154 HOH HOH B . 
F 3 HOH 63  1155 1155 HOH HOH B . 
F 3 HOH 64  1156 1156 HOH HOH B . 
F 3 HOH 65  1157 1157 HOH HOH B . 
F 3 HOH 66  1158 1158 HOH HOH B . 
F 3 HOH 67  1160 1160 HOH HOH B . 
F 3 HOH 68  1161 1161 HOH HOH B . 
F 3 HOH 69  1162 1162 HOH HOH B . 
F 3 HOH 70  1164 1164 HOH HOH B . 
F 3 HOH 71  1168 1168 HOH HOH B . 
F 3 HOH 72  1170 1170 HOH HOH B . 
F 3 HOH 73  1172 1172 HOH HOH B . 
F 3 HOH 74  1173 1173 HOH HOH B . 
F 3 HOH 75  1174 1174 HOH HOH B . 
F 3 HOH 76  1180 1180 HOH HOH B . 
F 3 HOH 77  1181 1181 HOH HOH B . 
F 3 HOH 78  1185 1185 HOH HOH B . 
F 3 HOH 79  1186 1186 HOH HOH B . 
#