data_1ES0
# 
_entry.id   1ES0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ES0         
RCSB  RCSB010843   
WWPDB D_1000010843 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ES0 
_pdbx_database_status.recvd_initial_deposition_date   2000-04-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Corper, A.L.' 1 
'Teyton, L.'   2 
'Wilson, I.A.' 3 
# 
_citation.id                        primary 
_citation.title                     'A structural framework for deciphering the link between I-Ag7 and autoimmune diabetes.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            288 
_citation.page_first                505 
_citation.page_last                 511 
_citation.year                      2000 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10775108 
_citation.pdbx_database_id_DOI      10.1126/science.288.5465.505 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Corper, A.L.'       1 
primary 'Stratmann, T.'      2 
primary 'Apostolopoulos, V.' 3 
primary 'Scott, C.A.'        4 
primary 'Garcia, K.C.'       5 
primary 'Kang, A.S.'         6 
primary 'Wilson, I.A.'       7 
primary 'Teyton, L.'         8 
# 
_cell.entry_id           1ES0 
_cell.length_a           95.149 
_cell.length_b           110.123 
_cell.length_c           96.084 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1ES0 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN'                                   21623.129 1  ? ? 'ALPHA CHAIN' ? 
2 polymer man '65 KD GLUTAMIC ACID DECARBOXYLASE+H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN' 25563.430 1  ? ? 
'PEPTIDE (RESIDUES 222-235) + BETA CHAIN' ? 
3 water   nat water                                                                       18.015    76 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EDDIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKR
SNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPS
DDDIYDCKVEHWGLEEPVLKHWSSADLVPR
;
;EDDIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKR
SNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPS
DDDIYDCKVEHWGLEEPVLKHWSSADLVPR
;
A ? 
2 'polypeptide(L)' no no 
;GSHSRGYEIAPVFVLLEYVTGSGSGSGDSERHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELG
RHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNG
QEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWSSADLVPR
;
;GSHSRGYEIAPVFVLLEYVTGSGSGSGDSERHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELG
RHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNG
QEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWSSADLVPR
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASP n 
1 3   ASP n 
1 4   ILE n 
1 5   GLU n 
1 6   ALA n 
1 7   ASP n 
1 8   HIS n 
1 9   VAL n 
1 10  GLY n 
1 11  PHE n 
1 12  TYR n 
1 13  GLY n 
1 14  THR n 
1 15  THR n 
1 16  VAL n 
1 17  TYR n 
1 18  GLN n 
1 19  SER n 
1 20  PRO n 
1 21  GLY n 
1 22  ASP n 
1 23  ILE n 
1 24  GLY n 
1 25  GLN n 
1 26  TYR n 
1 27  THR n 
1 28  HIS n 
1 29  GLU n 
1 30  PHE n 
1 31  ASP n 
1 32  GLY n 
1 33  ASP n 
1 34  GLU n 
1 35  LEU n 
1 36  PHE n 
1 37  TYR n 
1 38  VAL n 
1 39  ASP n 
1 40  LEU n 
1 41  ASP n 
1 42  LYS n 
1 43  LYS n 
1 44  LYS n 
1 45  THR n 
1 46  VAL n 
1 47  TRP n 
1 48  ARG n 
1 49  LEU n 
1 50  PRO n 
1 51  GLU n 
1 52  PHE n 
1 53  GLY n 
1 54  GLN n 
1 55  LEU n 
1 56  ILE n 
1 57  LEU n 
1 58  PHE n 
1 59  GLU n 
1 60  PRO n 
1 61  GLN n 
1 62  GLY n 
1 63  GLY n 
1 64  LEU n 
1 65  GLN n 
1 66  ASN n 
1 67  ILE n 
1 68  ALA n 
1 69  ALA n 
1 70  GLU n 
1 71  LYS n 
1 72  HIS n 
1 73  ASN n 
1 74  LEU n 
1 75  GLY n 
1 76  ILE n 
1 77  LEU n 
1 78  THR n 
1 79  LYS n 
1 80  ARG n 
1 81  SER n 
1 82  ASN n 
1 83  PHE n 
1 84  THR n 
1 85  PRO n 
1 86  ALA n 
1 87  THR n 
1 88  ASN n 
1 89  GLU n 
1 90  ALA n 
1 91  PRO n 
1 92  GLN n 
1 93  ALA n 
1 94  THR n 
1 95  VAL n 
1 96  PHE n 
1 97  PRO n 
1 98  LYS n 
1 99  SER n 
1 100 PRO n 
1 101 VAL n 
1 102 LEU n 
1 103 LEU n 
1 104 GLY n 
1 105 GLN n 
1 106 PRO n 
1 107 ASN n 
1 108 THR n 
1 109 LEU n 
1 110 ILE n 
1 111 CYS n 
1 112 PHE n 
1 113 VAL n 
1 114 ASP n 
1 115 ASN n 
1 116 ILE n 
1 117 PHE n 
1 118 PRO n 
1 119 PRO n 
1 120 VAL n 
1 121 ILE n 
1 122 ASN n 
1 123 ILE n 
1 124 THR n 
1 125 TRP n 
1 126 LEU n 
1 127 ARG n 
1 128 ASN n 
1 129 SER n 
1 130 LYS n 
1 131 SER n 
1 132 VAL n 
1 133 THR n 
1 134 ASP n 
1 135 GLY n 
1 136 VAL n 
1 137 TYR n 
1 138 GLU n 
1 139 THR n 
1 140 SER n 
1 141 PHE n 
1 142 LEU n 
1 143 VAL n 
1 144 ASN n 
1 145 ARG n 
1 146 ASP n 
1 147 HIS n 
1 148 SER n 
1 149 PHE n 
1 150 HIS n 
1 151 LYS n 
1 152 LEU n 
1 153 SER n 
1 154 TYR n 
1 155 LEU n 
1 156 THR n 
1 157 PHE n 
1 158 ILE n 
1 159 PRO n 
1 160 SER n 
1 161 ASP n 
1 162 ASP n 
1 163 ASP n 
1 164 ILE n 
1 165 TYR n 
1 166 ASP n 
1 167 CYS n 
1 168 LYS n 
1 169 VAL n 
1 170 GLU n 
1 171 HIS n 
1 172 TRP n 
1 173 GLY n 
1 174 LEU n 
1 175 GLU n 
1 176 GLU n 
1 177 PRO n 
1 178 VAL n 
1 179 LEU n 
1 180 LYS n 
1 181 HIS n 
1 182 TRP n 
1 183 SER n 
1 184 SER n 
1 185 ALA n 
1 186 ASP n 
1 187 LEU n 
1 188 VAL n 
1 189 PRO n 
1 190 ARG n 
2 1   GLY n 
2 2   SER n 
2 3   HIS n 
2 4   SER n 
2 5   ARG n 
2 6   GLY n 
2 7   TYR n 
2 8   GLU n 
2 9   ILE n 
2 10  ALA n 
2 11  PRO n 
2 12  VAL n 
2 13  PHE n 
2 14  VAL n 
2 15  LEU n 
2 16  LEU n 
2 17  GLU n 
2 18  TYR n 
2 19  VAL n 
2 20  THR n 
2 21  GLY n 
2 22  SER n 
2 23  GLY n 
2 24  SER n 
2 25  GLY n 
2 26  SER n 
2 27  GLY n 
2 28  ASP n 
2 29  SER n 
2 30  GLU n 
2 31  ARG n 
2 32  HIS n 
2 33  PHE n 
2 34  VAL n 
2 35  HIS n 
2 36  GLN n 
2 37  PHE n 
2 38  LYS n 
2 39  GLY n 
2 40  GLU n 
2 41  CYS n 
2 42  TYR n 
2 43  PHE n 
2 44  THR n 
2 45  ASN n 
2 46  GLY n 
2 47  THR n 
2 48  GLN n 
2 49  ARG n 
2 50  ILE n 
2 51  ARG n 
2 52  LEU n 
2 53  VAL n 
2 54  THR n 
2 55  ARG n 
2 56  TYR n 
2 57  ILE n 
2 58  TYR n 
2 59  ASN n 
2 60  ARG n 
2 61  GLU n 
2 62  GLU n 
2 63  TYR n 
2 64  LEU n 
2 65  ARG n 
2 66  PHE n 
2 67  ASP n 
2 68  SER n 
2 69  ASP n 
2 70  VAL n 
2 71  GLY n 
2 72  GLU n 
2 73  TYR n 
2 74  ARG n 
2 75  ALA n 
2 76  VAL n 
2 77  THR n 
2 78  GLU n 
2 79  LEU n 
2 80  GLY n 
2 81  ARG n 
2 82  HIS n 
2 83  SER n 
2 84  ALA n 
2 85  GLU n 
2 86  TYR n 
2 87  TYR n 
2 88  ASN n 
2 89  LYS n 
2 90  GLN n 
2 91  TYR n 
2 92  LEU n 
2 93  GLU n 
2 94  ARG n 
2 95  THR n 
2 96  ARG n 
2 97  ALA n 
2 98  GLU n 
2 99  LEU n 
2 100 ASP n 
2 101 THR n 
2 102 ALA n 
2 103 CYS n 
2 104 ARG n 
2 105 HIS n 
2 106 ASN n 
2 107 TYR n 
2 108 GLU n 
2 109 GLU n 
2 110 THR n 
2 111 GLU n 
2 112 VAL n 
2 113 PRO n 
2 114 THR n 
2 115 SER n 
2 116 LEU n 
2 117 ARG n 
2 118 ARG n 
2 119 LEU n 
2 120 GLU n 
2 121 GLN n 
2 122 PRO n 
2 123 ASN n 
2 124 VAL n 
2 125 ALA n 
2 126 ILE n 
2 127 SER n 
2 128 LEU n 
2 129 SER n 
2 130 ARG n 
2 131 THR n 
2 132 GLU n 
2 133 ALA n 
2 134 LEU n 
2 135 ASN n 
2 136 HIS n 
2 137 HIS n 
2 138 ASN n 
2 139 THR n 
2 140 LEU n 
2 141 VAL n 
2 142 CYS n 
2 143 SER n 
2 144 VAL n 
2 145 THR n 
2 146 ASP n 
2 147 PHE n 
2 148 TYR n 
2 149 PRO n 
2 150 ALA n 
2 151 LYS n 
2 152 ILE n 
2 153 LYS n 
2 154 VAL n 
2 155 ARG n 
2 156 TRP n 
2 157 PHE n 
2 158 ARG n 
2 159 ASN n 
2 160 GLY n 
2 161 GLN n 
2 162 GLU n 
2 163 GLU n 
2 164 THR n 
2 165 VAL n 
2 166 GLY n 
2 167 VAL n 
2 168 SER n 
2 169 SER n 
2 170 THR n 
2 171 GLN n 
2 172 LEU n 
2 173 ILE n 
2 174 ARG n 
2 175 ASN n 
2 176 GLY n 
2 177 ASP n 
2 178 TRP n 
2 179 THR n 
2 180 PHE n 
2 181 GLN n 
2 182 VAL n 
2 183 LEU n 
2 184 VAL n 
2 185 MET n 
2 186 LEU n 
2 187 GLU n 
2 188 MET n 
2 189 THR n 
2 190 PRO n 
2 191 HIS n 
2 192 GLN n 
2 193 GLY n 
2 194 GLU n 
2 195 VAL n 
2 196 TYR n 
2 197 THR n 
2 198 CYS n 
2 199 HIS n 
2 200 VAL n 
2 201 GLU n 
2 202 HIS n 
2 203 PRO n 
2 204 SER n 
2 205 LEU n 
2 206 LYS n 
2 207 SER n 
2 208 PRO n 
2 209 ILE n 
2 210 THR n 
2 211 VAL n 
2 212 GLU n 
2 213 TRP n 
2 214 SER n 
2 215 SER n 
2 216 ALA n 
2 217 ASP n 
2 218 LEU n 
2 219 VAL n 
2 220 PRO n 
2 221 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ?  ?   mouse ? ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? INSECT ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? 7  20  human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? INSECT ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 2 sample ? 27 213 human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? INSECT ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP HA2D_MOUSE 1 ? ? P04228 ? 
2 UNP DCE2_HUMAN 2 ? ? Q05329 ? 
3 GB  AAA39547   2 ? ? 387435 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ES0 A 5  ? 182 ? P04228 24  ? 205 ? 1   178 
2 2 1ES0 B 7  P 20  P Q05329 222 ? 235 ? 207 220 
3 3 1ES0 B 27 ? 213 ? 387435 28  ? 214 ? 1   188 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ES0 SER A 183 ? UNP P04228 ? ? 'SEE REMARK 999' 179 1  
1 1ES0 SER A 184 ? UNP P04228 ? ? 'SEE REMARK 999' 180 2  
1 1ES0 ALA A 185 ? UNP P04228 ? ? 'SEE REMARK 999' 181 3  
1 1ES0 ASP A 186 ? UNP P04228 ? ? 'SEE REMARK 999' 182 4  
1 1ES0 LEU A 187 ? UNP P04228 ? ? 'SEE REMARK 999' 183 5  
1 1ES0 VAL A 188 ? UNP P04228 ? ? 'SEE REMARK 999' 184 6  
1 1ES0 PRO A 189 ? UNP P04228 ? ? 'SEE REMARK 999' 185 7  
1 1ES0 ARG A 190 ? UNP P04228 ? ? 'SEE REMARK 999' 186 8  
2 1ES0 GLY B 1   P UNP Q05329 ? ? 'SEE REMARK 999' 201 9  
2 1ES0 SER B 2   P UNP Q05329 ? ? 'SEE REMARK 999' 202 10 
2 1ES0 HIS B 3   P UNP Q05329 ? ? 'SEE REMARK 999' 203 11 
2 1ES0 SER B 4   P UNP Q05329 ? ? 'SEE REMARK 999' 204 12 
2 1ES0 ARG B 5   P UNP Q05329 ? ? 'SEE REMARK 999' 205 13 
2 1ES0 GLY B 6   P UNP Q05329 ? ? 'SEE REMARK 999' 206 14 
2 1ES0 GLY B 21  ? GB  387435 ? ? 'SEE REMARK 999' -5  15 
2 1ES0 SER B 22  ? GB  387435 ? ? 'SEE REMARK 999' -4  16 
2 1ES0 GLY B 23  ? GB  387435 ? ? 'SEE REMARK 999' -3  17 
2 1ES0 SER B 24  ? GB  387435 ? ? 'SEE REMARK 999' -2  18 
2 1ES0 GLY B 25  ? GB  387435 ? ? 'SEE REMARK 999' -1  19 
2 1ES0 SER B 26  ? GB  387435 ? ? 'SEE REMARK 999' 0   20 
2 1ES0 SER B 214 ? GB  387435 ? ? 'SEE REMARK 999' 189 21 
2 1ES0 SER B 215 ? GB  387435 ? ? 'SEE REMARK 999' 190 22 
2 1ES0 ALA B 216 ? GB  387435 ? ? 'SEE REMARK 999' 191 23 
2 1ES0 ASP B 217 ? GB  387435 ? ? 'SEE REMARK 999' 192 24 
2 1ES0 LEU B 218 ? GB  387435 ? ? 'SEE REMARK 999' 193 25 
2 1ES0 VAL B 219 ? GB  387435 ? ? 'SEE REMARK 999' 194 26 
2 1ES0 PRO B 220 ? GB  387435 ? ? 'SEE REMARK 999' 195 27 
2 1ES0 ARG B 221 ? GB  387435 ? ? 'SEE REMARK 999' 196 28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ES0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.90 
_exptl_crystal.density_percent_sol   57.0 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'16-18% PEG 4000, 0.2 M LICL (PH 6.6), 1% MPD, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           96.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-01-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             1.08 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1ES0 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             39.960 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   15754 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.068 
_reflns.pdbx_netI_over_sigmaI        15.7000 
_reflns.B_iso_Wilson_estimate        51.80 
_reflns.pdbx_redundancy              4.200 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.353 
_reflns_shell.meanI_over_sigI_obs    4.2 
_reflns_shell.pdbx_redundancy        4.20 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1ES0 
_refine.ls_number_reflns_obs                     15754 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.96 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          0.21 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21 
_refine.ls_R_factor_R_free                       0.258 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.800 
_refine.ls_number_reflns_R_free                  1541 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               36.10 
_refine.aniso_B[1][1]                            8.00000 
_refine.aniso_B[2][2]                            -3.51000 
_refine.aniso_B[3][3]                            -4.50000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35 
_refine.solvent_model_param_bsol                 32.63 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'I-A(K) - PDB CODE 1IAK' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             GROUP 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ES0 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.28 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.39 
_refine_analyze.Luzzati_sigma_a_free            0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3012 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             76 
_refine_hist.number_atoms_total               3088 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        39.96 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.30  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      26.00 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.81  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.69 
_refine_ls_shell.number_reflns_R_work             1396 
_refine_ls_shell.R_factor_R_work                  0.276 
_refine_ls_shell.percent_reflns_obs               99.60 
_refine_ls_shell.R_factor_R_free                  0.344 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            9.60 
_refine_ls_shell.number_reflns_R_free             149 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP     'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP       'X-RAY DIFFRACTION' 
3 CIS_PEPTIDE.PARAM CIS_PEPTIDE.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ES0 
_struct.title                     
'CRYSTAL STRUCTURE OF THE MURINE CLASS II ALLELE I-A(G7) COMPLEXED WITH THE GLUTAMIC ACID DECARBOXYLASE (GAD65) PEPTIDE 207-220' 
_struct.pdbx_descriptor           'H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ES0 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'HISTOCOMPATIBILITY ANTIGEN, CLASS II MHC I-A(G7), IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 51  ? LEU A 55  ? GLU A 47 LEU A 51 5 ? 5  
HELX_P HELX_P2 2 GLU A 59  ? SER A 81  ? GLU A 55 SER A 77 1 ? 23 
HELX_P HELX_P3 3 GLY B 80  ? LEU B 92  ? GLY B 54 LEU B 68 1 ? 13 
HELX_P HELX_P4 4 TYR B 91  ? ALA B 102 ? TYR B 66 ALA B 78 1 ? 12 
HELX_P HELX_P5 5 ALA B 102 ? THR B 110 ? ALA B 78 THR B 86 1 ? 9  
HELX_P HELX_P6 6 THR B 114 ? ARG B 118 ? THR B 90 ARG B 94 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 111 SG ? ? ? 1_555 A CYS 167 SG ? ? A CYS 107 A CYS 163 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? B CYS 41  SG ? ? ? 1_555 B CYS 103 SG ? ? B CYS 15  B CYS 79  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf3 disulf ? ? B CYS 142 SG ? ? ? 1_555 B CYS 198 SG ? ? B CYS 117 B CYS 173 1_555 ? ? ? ? ? ? ? 2.025 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 19  A . ? SER 15  A PRO 20  A ? PRO 16  A 1 0.67  
2 PHE 117 A . ? PHE 113 A PRO 118 A ? PRO 114 A 1 -0.74 
3 TYR 148 B . ? TYR 123 B PRO 149 B ? PRO 124 B 1 -0.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 44  ? TRP A 47  ? LYS A 40  TRP A 43  
A 2 ASP A 33  ? ASP A 39  ? ASP A 29  ASP A 35  
A 3 ILE A 23  ? PHE A 30  ? ILE A 19  PHE A 26  
A 4 HIS A 8   ? SER A 19  ? HIS A 4   SER A 15  
A 5 PHE B 33  ? THR B 44  ? PHE B 7   THR B 18  
A 6 ARG B 49  ? TYR B 58  ? ARG B 23  TYR B 32  
A 7 GLU B 61  ? ASP B 67  ? GLU B 35  ASP B 41  
A 8 TYR B 73  ? ALA B 75  ? TYR B 47  ALA B 49  
B 1 GLN A 92  ? PRO A 97  ? GLN A 88  PRO A 93  
B 2 ASN A 107 ? ILE A 116 ? ASN A 103 ILE A 112 
B 3 PHE A 149 ? PHE A 157 ? PHE A 145 PHE A 153 
B 4 VAL A 136 ? GLU A 138 ? VAL A 132 GLU A 134 
C 1 GLN A 92  ? PRO A 97  ? GLN A 88  PRO A 93  
C 2 ASN A 107 ? ILE A 116 ? ASN A 103 ILE A 112 
C 3 PHE A 149 ? PHE A 157 ? PHE A 145 PHE A 153 
C 4 LEU A 142 ? VAL A 143 ? LEU A 138 VAL A 139 
D 1 LYS A 130 ? VAL A 132 ? LYS A 126 VAL A 128 
D 2 ASN A 122 ? ARG A 127 ? ASN A 118 ARG A 123 
D 3 ILE A 164 ? GLU A 170 ? ILE A 160 GLU A 166 
D 4 VAL A 178 ? SER A 183 ? VAL A 174 SER A 179 
E 1 ASN B 123 ? LEU B 128 ? ASN B 98  LEU B 103 
E 2 THR B 139 ? PHE B 147 ? THR B 114 PHE B 122 
E 3 PHE B 180 ? GLU B 187 ? PHE B 155 GLU B 162 
E 4 VAL B 167 ? SER B 169 ? VAL B 142 SER B 144 
F 1 ASN B 123 ? LEU B 128 ? ASN B 98  LEU B 103 
F 2 THR B 139 ? PHE B 147 ? THR B 114 PHE B 122 
F 3 PHE B 180 ? GLU B 187 ? PHE B 155 GLU B 162 
F 4 ILE B 173 ? ARG B 174 ? ILE B 148 ARG B 149 
G 1 GLN B 161 ? GLU B 162 ? GLN B 136 GLU B 137 
G 2 LYS B 153 ? ARG B 158 ? LYS B 128 ARG B 133 
G 3 TYR B 196 ? GLU B 201 ? TYR B 171 GLU B 176 
G 4 ILE B 209 ? TRP B 213 ? ILE B 184 TRP B 188 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 46  ? N VAL A 42  O TYR A 37  ? O TYR A 33  
A 2 3 N VAL A 38  ? N VAL A 34  O TYR A 26  ? O TYR A 22  
A 3 4 O GLU A 29  ? O GLU A 25  N PHE A 11  ? N PHE A 7   
A 4 5 O SER A 19  ? O SER A 15  N PHE B 33  ? N PHE B 7   
A 5 6 N THR B 44  ? N THR B 18  O ARG B 49  ? O ARG B 23  
A 6 7 N TYR B 58  ? N TYR B 32  O GLU B 61  ? O GLU B 35  
A 7 8 O ARG B 65  ? O ARG B 39  N ARG B 74  ? N ARG B 48  
B 1 2 O PHE A 96  ? O PHE A 92  N ILE A 110 ? N ILE A 106 
B 2 3 N ILE A 116 ? N ILE A 112 O PHE A 149 ? O PHE A 145 
B 3 4 N TYR A 154 ? N TYR A 150 O TYR A 137 ? O TYR A 133 
C 1 2 O PHE A 96  ? O PHE A 92  N ILE A 110 ? N ILE A 106 
C 2 3 N ILE A 116 ? N ILE A 112 O PHE A 149 ? O PHE A 145 
C 3 4 O HIS A 150 ? O HIS A 146 N LEU A 142 ? N LEU A 138 
D 1 2 N VAL A 132 ? N VAL A 128 O TRP A 125 ? O TRP A 121 
D 2 3 O LEU A 126 ? O LEU A 122 N ASP A 166 ? N ASP A 162 
D 3 4 N VAL A 169 ? N VAL A 165 O VAL A 178 ? O VAL A 174 
E 1 2 O SER B 127 ? O SER B 102 N VAL B 141 ? N VAL B 116 
E 2 3 O PHE B 147 ? O PHE B 122 N PHE B 180 ? N PHE B 155 
E 3 4 N MET B 185 ? N MET B 160 O SER B 168 ? O SER B 143 
F 1 2 O SER B 127 ? O SER B 102 N VAL B 141 ? N VAL B 116 
F 2 3 O PHE B 147 ? O PHE B 122 N PHE B 180 ? N PHE B 155 
F 3 4 O GLN B 181 ? O GLN B 156 N ILE B 173 ? N ILE B 148 
G 1 2 O GLN B 161 ? O GLN B 136 N ARG B 158 ? N ARG B 133 
G 2 3 O PHE B 157 ? O PHE B 132 N THR B 197 ? N THR B 172 
G 3 4 N VAL B 200 ? N VAL B 175 O ILE B 209 ? O ILE B 184 
# 
_database_PDB_matrix.entry_id          1ES0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ES0 
_atom_sites.fract_transf_matrix[1][1]   0.010510 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009081 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010408 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 3   B 33.108 12.811  16.286 1.00 54.12  ? 1   ASP A N   1 
ATOM   2    C CA  . ASP A 1 3   B 32.505 13.559  17.431 1.00 54.12  ? 1   ASP A CA  1 
ATOM   3    C C   . ASP A 1 3   B 33.245 14.875  17.706 1.00 54.12  ? 1   ASP A C   1 
ATOM   4    O O   . ASP A 1 3   B 34.351 15.092  17.214 1.00 54.12  ? 1   ASP A O   1 
ATOM   5    C CB  . ASP A 1 3   B 32.507 12.682  18.692 1.00 37.16  ? 1   ASP A CB  1 
ATOM   6    N N   . ILE A 1 4   A 32.623 15.750  18.491 1.00 52.49  ? 1   ILE A N   1 
ATOM   7    C CA  . ILE A 1 4   A 33.203 17.052  18.835 1.00 52.49  ? 1   ILE A CA  1 
ATOM   8    C C   . ILE A 1 4   A 34.298 16.917  19.893 1.00 52.49  ? 1   ILE A C   1 
ATOM   9    O O   . ILE A 1 4   A 34.266 15.990  20.697 1.00 52.49  ? 1   ILE A O   1 
ATOM   10   C CB  . ILE A 1 4   A 32.108 18.003  19.382 1.00 43.62  ? 1   ILE A CB  1 
ATOM   11   C CG1 . ILE A 1 4   A 30.992 18.165  18.337 1.00 43.62  ? 1   ILE A CG1 1 
ATOM   12   C CG2 . ILE A 1 4   A 32.725 19.350  19.765 1.00 43.62  ? 1   ILE A CG2 1 
ATOM   13   C CD1 . ILE A 1 4   A 29.778 18.945  18.823 1.00 43.62  ? 1   ILE A CD1 1 
ATOM   14   N N   . GLU A 1 5   ? 35.264 17.835  19.899 1.00 45.78  ? 1   GLU A N   1 
ATOM   15   C CA  . GLU A 1 5   ? 36.342 17.781  20.893 1.00 45.78  ? 1   GLU A CA  1 
ATOM   16   C C   . GLU A 1 5   ? 36.166 18.847  21.974 1.00 45.78  ? 1   GLU A C   1 
ATOM   17   O O   . GLU A 1 5   ? 35.779 19.979  21.692 1.00 45.78  ? 1   GLU A O   1 
ATOM   18   C CB  . GLU A 1 5   ? 37.721 17.937  20.233 1.00 86.14  ? 1   GLU A CB  1 
ATOM   19   C CG  . GLU A 1 5   ? 38.156 19.370  19.970 1.00 86.14  ? 1   GLU A CG  1 
ATOM   20   C CD  . GLU A 1 5   ? 39.648 19.479  19.679 1.00 86.14  ? 1   GLU A CD  1 
ATOM   21   O OE1 . GLU A 1 5   ? 40.454 19.088  20.551 1.00 86.14  ? 1   GLU A OE1 1 
ATOM   22   O OE2 . GLU A 1 5   ? 40.017 19.955  18.582 1.00 86.14  ? 1   GLU A OE2 1 
ATOM   23   N N   . ALA A 1 6   ? 36.447 18.463  23.214 1.00 31.49  ? 2   ALA A N   1 
ATOM   24   C CA  . ALA A 1 6   ? 36.323 19.355  24.361 1.00 31.49  ? 2   ALA A CA  1 
ATOM   25   C C   . ALA A 1 6   ? 37.053 18.717  25.538 1.00 31.49  ? 2   ALA A C   1 
ATOM   26   O O   . ALA A 1 6   ? 37.405 17.542  25.478 1.00 31.49  ? 2   ALA A O   1 
ATOM   27   C CB  . ALA A 1 6   ? 34.849 19.555  24.706 1.00 38.64  ? 2   ALA A CB  1 
ATOM   28   N N   . ASP A 1 7   ? 37.289 19.490  26.596 1.00 32.96  ? 3   ASP A N   1 
ATOM   29   C CA  . ASP A 1 7   ? 37.962 18.960  27.777 1.00 32.96  ? 3   ASP A CA  1 
ATOM   30   C C   . ASP A 1 7   ? 36.936 18.203  28.592 1.00 32.96  ? 3   ASP A C   1 
ATOM   31   O O   . ASP A 1 7   ? 37.268 17.248  29.298 1.00 32.96  ? 3   ASP A O   1 
ATOM   32   C CB  . ASP A 1 7   ? 38.514 20.067  28.676 1.00 37.08  ? 3   ASP A CB  1 
ATOM   33   C CG  . ASP A 1 7   ? 39.529 20.932  27.988 1.00 37.08  ? 3   ASP A CG  1 
ATOM   34   O OD1 . ASP A 1 7   ? 40.189 20.441  27.050 1.00 37.08  ? 3   ASP A OD1 1 
ATOM   35   O OD2 . ASP A 1 7   ? 39.677 22.101  28.404 1.00 37.08  ? 3   ASP A OD2 1 
ATOM   36   N N   . HIS A 1 8   ? 35.691 18.661  28.513 1.00 33.16  ? 4   HIS A N   1 
ATOM   37   C CA  . HIS A 1 8   ? 34.610 18.050  29.259 1.00 33.16  ? 4   HIS A CA  1 
ATOM   38   C C   . HIS A 1 8   ? 33.298 18.089  28.481 1.00 33.16  ? 4   HIS A C   1 
ATOM   39   O O   . HIS A 1 8   ? 33.112 18.914  27.582 1.00 33.16  ? 4   HIS A O   1 
ATOM   40   C CB  . HIS A 1 8   ? 34.465 18.758  30.607 1.00 32.63  ? 4   HIS A CB  1 
ATOM   41   C CG  . HIS A 1 8   ? 35.672 18.630  31.487 1.00 32.63  ? 4   HIS A CG  1 
ATOM   42   N ND1 . HIS A 1 8   ? 36.040 17.439  32.075 1.00 32.63  ? 4   HIS A ND1 1 
ATOM   43   C CD2 . HIS A 1 8   ? 36.618 19.533  31.840 1.00 32.63  ? 4   HIS A CD2 1 
ATOM   44   C CE1 . HIS A 1 8   ? 37.163 17.614  32.750 1.00 32.63  ? 4   HIS A CE1 1 
ATOM   45   N NE2 . HIS A 1 8   ? 37.535 18.875  32.622 1.00 32.63  ? 4   HIS A NE2 1 
ATOM   46   N N   . VAL A 1 9   ? 32.386 17.193  28.836 1.00 24.10  ? 5   VAL A N   1 
ATOM   47   C CA  . VAL A 1 9   ? 31.107 17.111  28.150 1.00 24.10  ? 5   VAL A CA  1 
ATOM   48   C C   . VAL A 1 9   ? 29.987 16.718  29.094 1.00 24.10  ? 5   VAL A C   1 
ATOM   49   O O   . VAL A 1 9   ? 30.024 15.653  29.702 1.00 24.10  ? 5   VAL A O   1 
ATOM   50   C CB  . VAL A 1 9   ? 31.154 16.067  27.020 1.00 37.78  ? 5   VAL A CB  1 
ATOM   51   C CG1 . VAL A 1 9   ? 29.857 16.081  26.256 1.00 37.78  ? 5   VAL A CG1 1 
ATOM   52   C CG2 . VAL A 1 9   ? 32.319 16.350  26.100 1.00 37.78  ? 5   VAL A CG2 1 
ATOM   53   N N   . GLY A 1 10  ? 28.982 17.575  29.208 1.00 25.10  ? 6   GLY A N   1 
ATOM   54   C CA  . GLY A 1 10  ? 27.868 17.263  30.080 1.00 25.10  ? 6   GLY A CA  1 
ATOM   55   C C   . GLY A 1 10  ? 26.630 16.902  29.279 1.00 25.10  ? 6   GLY A C   1 
ATOM   56   O O   . GLY A 1 10  ? 26.341 17.521  28.258 1.00 25.10  ? 6   GLY A O   1 
ATOM   57   N N   . PHE A 1 11  ? 25.908 15.882  29.718 1.00 27.44  ? 7   PHE A N   1 
ATOM   58   C CA  . PHE A 1 11  ? 24.686 15.501  29.032 1.00 27.44  ? 7   PHE A CA  1 
ATOM   59   C C   . PHE A 1 11  ? 23.554 15.937  29.930 1.00 27.44  ? 7   PHE A C   1 
ATOM   60   O O   . PHE A 1 11  ? 23.359 15.352  30.991 1.00 27.44  ? 7   PHE A O   1 
ATOM   61   C CB  . PHE A 1 11  ? 24.616 13.989  28.819 1.00 22.35  ? 7   PHE A CB  1 
ATOM   62   C CG  . PHE A 1 11  ? 25.542 13.481  27.753 1.00 22.35  ? 7   PHE A CG  1 
ATOM   63   C CD1 . PHE A 1 11  ? 26.174 14.359  26.878 1.00 22.35  ? 7   PHE A CD1 1 
ATOM   64   C CD2 . PHE A 1 11  ? 25.771 12.113  27.611 1.00 22.35  ? 7   PHE A CD2 1 
ATOM   65   C CE1 . PHE A 1 11  ? 27.020 13.884  25.880 1.00 22.35  ? 7   PHE A CE1 1 
ATOM   66   C CE2 . PHE A 1 11  ? 26.615 11.628  26.614 1.00 22.35  ? 7   PHE A CE2 1 
ATOM   67   C CZ  . PHE A 1 11  ? 27.241 12.512  25.748 1.00 22.35  ? 7   PHE A CZ  1 
ATOM   68   N N   . TYR A 1 12  ? 22.824 16.973  29.527 1.00 25.66  ? 8   TYR A N   1 
ATOM   69   C CA  . TYR A 1 12  ? 21.716 17.449  30.343 1.00 25.66  ? 8   TYR A CA  1 
ATOM   70   C C   . TYR A 1 12  ? 20.388 17.333  29.603 1.00 25.66  ? 8   TYR A C   1 
ATOM   71   O O   . TYR A 1 12  ? 20.326 17.541  28.392 1.00 25.66  ? 8   TYR A O   1 
ATOM   72   C CB  . TYR A 1 12  ? 21.960 18.894  30.765 1.00 25.37  ? 8   TYR A CB  1 
ATOM   73   C CG  . TYR A 1 12  ? 23.336 19.145  31.351 1.00 25.37  ? 8   TYR A CG  1 
ATOM   74   C CD1 . TYR A 1 12  ? 23.933 18.222  32.209 1.00 25.37  ? 8   TYR A CD1 1 
ATOM   75   C CD2 . TYR A 1 12  ? 24.026 20.322  31.073 1.00 25.37  ? 8   TYR A CD2 1 
ATOM   76   C CE1 . TYR A 1 12  ? 25.177 18.462  32.772 1.00 25.37  ? 8   TYR A CE1 1 
ATOM   77   C CE2 . TYR A 1 12  ? 25.274 20.577  31.637 1.00 25.37  ? 8   TYR A CE2 1 
ATOM   78   C CZ  . TYR A 1 12  ? 25.842 19.643  32.486 1.00 25.37  ? 8   TYR A CZ  1 
ATOM   79   O OH  . TYR A 1 12  ? 27.067 19.903  33.068 1.00 25.37  ? 8   TYR A OH  1 
ATOM   80   N N   . GLY A 1 13  ? 19.334 16.984  30.335 1.00 21.92  ? 9   GLY A N   1 
ATOM   81   C CA  . GLY A 1 13  ? 18.024 16.844  29.730 1.00 21.92  ? 9   GLY A CA  1 
ATOM   82   C C   . GLY A 1 13  ? 17.793 15.543  28.975 1.00 21.92  ? 9   GLY A C   1 
ATOM   83   O O   . GLY A 1 13  ? 16.698 15.317  28.459 1.00 21.92  ? 9   GLY A O   1 
ATOM   84   N N   . THR A 1 14  ? 18.814 14.689  28.916 1.00 24.38  ? 10  THR A N   1 
ATOM   85   C CA  . THR A 1 14  ? 18.743 13.406  28.209 1.00 24.38  ? 10  THR A CA  1 
ATOM   86   C C   . THR A 1 14  ? 17.451 12.643  28.508 1.00 24.38  ? 10  THR A C   1 
ATOM   87   O O   . THR A 1 14  ? 17.223 12.169  29.624 1.00 24.38  ? 10  THR A O   1 
ATOM   88   C CB  . THR A 1 14  ? 19.946 12.524  28.567 1.00 13.34  ? 10  THR A CB  1 
ATOM   89   O OG1 . THR A 1 14  ? 21.135 13.325  28.561 1.00 13.34  ? 10  THR A OG1 1 
ATOM   90   C CG2 . THR A 1 14  ? 20.092 11.384  27.556 1.00 13.34  ? 10  THR A CG2 1 
ATOM   91   N N   . THR A 1 15  ? 16.614 12.516  27.486 1.00 25.84  ? 11  THR A N   1 
ATOM   92   C CA  . THR A 1 15  ? 15.323 11.867  27.637 1.00 25.84  ? 11  THR A CA  1 
ATOM   93   C C   . THR A 1 15  ? 15.068 10.827  26.575 1.00 25.84  ? 11  THR A C   1 
ATOM   94   O O   . THR A 1 15  ? 15.485 10.965  25.432 1.00 25.84  ? 11  THR A O   1 
ATOM   95   C CB  . THR A 1 15  ? 14.166 12.885  27.534 1.00 16.54  ? 11  THR A CB  1 
ATOM   96   O OG1 . THR A 1 15  ? 14.370 13.951  28.467 1.00 16.54  ? 11  THR A OG1 1 
ATOM   97   C CG2 . THR A 1 15  ? 12.832 12.198  27.810 1.00 16.54  ? 11  THR A CG2 1 
ATOM   98   N N   . VAL A 1 16  ? 14.347 9.791   26.965 1.00 19.23  ? 12  VAL A N   1 
ATOM   99   C CA  . VAL A 1 16  ? 13.994 8.725   26.051 1.00 19.23  ? 12  VAL A CA  1 
ATOM   100  C C   . VAL A 1 16  ? 12.564 8.330   26.359 1.00 19.23  ? 12  VAL A C   1 
ATOM   101  O O   . VAL A 1 16  ? 12.172 8.271   27.523 1.00 19.23  ? 12  VAL A O   1 
ATOM   102  C CB  . VAL A 1 16  ? 14.881 7.500   26.254 1.00 35.65  ? 12  VAL A CB  1 
ATOM   103  C CG1 . VAL A 1 16  ? 14.541 6.450   25.220 1.00 35.65  ? 12  VAL A CG1 1 
ATOM   104  C CG2 . VAL A 1 16  ? 16.344 7.901   26.172 1.00 35.65  ? 12  VAL A CG2 1 
ATOM   105  N N   . TYR A 1 17  ? 11.788 8.078   25.314 1.00 26.44  ? 13  TYR A N   1 
ATOM   106  C CA  . TYR A 1 17  ? 10.404 7.658   25.485 1.00 26.44  ? 13  TYR A CA  1 
ATOM   107  C C   . TYR A 1 17  ? 9.996  6.730   24.352 1.00 26.44  ? 13  TYR A C   1 
ATOM   108  O O   . TYR A 1 17  ? 10.393 6.912   23.197 1.00 26.44  ? 13  TYR A O   1 
ATOM   109  C CB  . TYR A 1 17  ? 9.464  8.861   25.526 1.00 45.12  ? 13  TYR A CB  1 
ATOM   110  C CG  . TYR A 1 17  ? 8.089  8.488   26.015 1.00 45.12  ? 13  TYR A CG  1 
ATOM   111  C CD1 . TYR A 1 17  ? 7.189  7.825   25.187 1.00 45.12  ? 13  TYR A CD1 1 
ATOM   112  C CD2 . TYR A 1 17  ? 7.724  8.708   27.341 1.00 45.12  ? 13  TYR A CD2 1 
ATOM   113  C CE1 . TYR A 1 17  ? 5.968  7.380   25.666 1.00 45.12  ? 13  TYR A CE1 1 
ATOM   114  C CE2 . TYR A 1 17  ? 6.504  8.269   27.833 1.00 45.12  ? 13  TYR A CE2 1 
ATOM   115  C CZ  . TYR A 1 17  ? 5.633  7.602   26.991 1.00 45.12  ? 13  TYR A CZ  1 
ATOM   116  O OH  . TYR A 1 17  ? 4.435  7.138   27.489 1.00 45.12  ? 13  TYR A OH  1 
ATOM   117  N N   . GLN A 1 18  ? 9.214  5.714   24.678 1.00 35.58  ? 14  GLN A N   1 
ATOM   118  C CA  . GLN A 1 18  ? 8.785  4.801   23.642 1.00 35.58  ? 14  GLN A CA  1 
ATOM   119  C C   . GLN A 1 18  ? 7.436  4.191   23.937 1.00 35.58  ? 14  GLN A C   1 
ATOM   120  O O   . GLN A 1 18  ? 6.943  4.225   25.068 1.00 35.58  ? 14  GLN A O   1 
ATOM   121  C CB  . GLN A 1 18  ? 9.818  3.692   23.434 1.00 48.33  ? 14  GLN A CB  1 
ATOM   122  C CG  . GLN A 1 18  ? 9.809  2.601   24.480 1.00 48.33  ? 14  GLN A CG  1 
ATOM   123  C CD  . GLN A 1 18  ? 10.718 1.444   24.096 1.00 48.33  ? 14  GLN A CD  1 
ATOM   124  O OE1 . GLN A 1 18  ? 11.945 1.527   24.221 1.00 48.33  ? 14  GLN A OE1 1 
ATOM   125  N NE2 . GLN A 1 18  ? 10.118 0.361   23.605 1.00 48.33  ? 14  GLN A NE2 1 
ATOM   126  N N   . SER A 1 19  ? 6.844  3.636   22.891 1.00 36.38  ? 15  SER A N   1 
ATOM   127  C CA  . SER A 1 19  ? 5.551  2.999   22.993 1.00 36.38  ? 15  SER A CA  1 
ATOM   128  C C   . SER A 1 19  ? 5.512  1.900   21.948 1.00 36.38  ? 15  SER A C   1 
ATOM   129  O O   . SER A 1 19  ? 6.248  1.939   20.966 1.00 36.38  ? 15  SER A O   1 
ATOM   130  C CB  . SER A 1 19  ? 4.435  4.015   22.735 1.00 40.08  ? 15  SER A CB  1 
ATOM   131  O OG  . SER A 1 19  ? 4.429  4.426   21.381 1.00 40.08  ? 15  SER A OG  1 
ATOM   132  N N   . PRO A 1 20  ? 4.633  0.912   22.137 1.00 59.05  ? 16  PRO A N   1 
ATOM   133  C CA  . PRO A 1 20  ? 3.707  0.834   23.270 1.00 59.05  ? 16  PRO A CA  1 
ATOM   134  C C   . PRO A 1 20  ? 4.414  0.589   24.597 1.00 59.05  ? 16  PRO A C   1 
ATOM   135  O O   . PRO A 1 20  ? 5.598  0.248   24.623 1.00 59.05  ? 16  PRO A O   1 
ATOM   136  C CB  . PRO A 1 20  ? 2.802  -0.324  22.879 1.00 64.79  ? 16  PRO A CB  1 
ATOM   137  C CG  . PRO A 1 20  ? 3.753  -1.239  22.163 1.00 64.79  ? 16  PRO A CG  1 
ATOM   138  C CD  . PRO A 1 20  ? 4.508  -0.276  21.274 1.00 64.79  ? 16  PRO A CD  1 
ATOM   139  N N   . GLY A 1 21  ? 3.688  0.785   25.694 1.00 41.39  ? 17  GLY A N   1 
ATOM   140  C CA  . GLY A 1 21  ? 4.257  0.541   27.006 1.00 41.39  ? 17  GLY A CA  1 
ATOM   141  C C   . GLY A 1 21  ? 4.549  1.734   27.896 1.00 41.39  ? 17  GLY A C   1 
ATOM   142  O O   . GLY A 1 21  ? 4.815  1.552   29.087 1.00 41.39  ? 17  GLY A O   1 
ATOM   143  N N   . ASP A 1 22  ? 4.512  2.944   27.346 1.00 34.80  ? 18  ASP A N   1 
ATOM   144  C CA  . ASP A 1 22  ? 4.791  4.129   28.152 1.00 34.80  ? 18  ASP A CA  1 
ATOM   145  C C   . ASP A 1 22  ? 6.103  4.009   28.934 1.00 34.80  ? 18  ASP A C   1 
ATOM   146  O O   . ASP A 1 22  ? 6.134  4.207   30.150 1.00 34.80  ? 18  ASP A O   1 
ATOM   147  C CB  . ASP A 1 22  ? 3.650  4.377   29.140 1.00 78.67  ? 18  ASP A CB  1 
ATOM   148  C CG  . ASP A 1 22  ? 2.648  5.374   28.624 1.00 78.67  ? 18  ASP A CG  1 
ATOM   149  O OD1 . ASP A 1 22  ? 2.170  5.193   27.484 1.00 78.67  ? 18  ASP A OD1 1 
ATOM   150  O OD2 . ASP A 1 22  ? 2.340  6.337   29.359 1.00 78.67  ? 18  ASP A OD2 1 
ATOM   151  N N   . ILE A 1 23  ? 7.184  3.686   28.237 1.00 41.77  ? 19  ILE A N   1 
ATOM   152  C CA  . ILE A 1 23  ? 8.481  3.550   28.882 1.00 41.77  ? 19  ILE A CA  1 
ATOM   153  C C   . ILE A 1 23  ? 9.295  4.823   28.666 1.00 41.77  ? 19  ILE A C   1 
ATOM   154  O O   . ILE A 1 23  ? 9.584  5.201   27.528 1.00 41.77  ? 19  ILE A O   1 
ATOM   155  C CB  . ILE A 1 23  ? 9.249  2.354   28.310 1.00 39.95  ? 19  ILE A CB  1 
ATOM   156  C CG1 . ILE A 1 23  ? 8.359  1.111   28.339 1.00 39.95  ? 19  ILE A CG1 1 
ATOM   157  C CG2 . ILE A 1 23  ? 10.488 2.097   29.128 1.00 39.95  ? 19  ILE A CG2 1 
ATOM   158  C CD1 . ILE A 1 23  ? 8.975  -0.091  27.657 1.00 39.95  ? 19  ILE A CD1 1 
ATOM   159  N N   . GLY A 1 24  ? 9.654  5.485   29.761 1.00 30.98  ? 20  GLY A N   1 
ATOM   160  C CA  . GLY A 1 24  ? 10.420 6.712   29.662 1.00 30.98  ? 20  GLY A CA  1 
ATOM   161  C C   . GLY A 1 24  ? 11.620 6.732   30.590 1.00 30.98  ? 20  GLY A C   1 
ATOM   162  O O   . GLY A 1 24  ? 11.658 6.013   31.595 1.00 30.98  ? 20  GLY A O   1 
ATOM   163  N N   . GLN A 1 25  ? 12.608 7.554   30.249 1.00 19.62  ? 21  GLN A N   1 
ATOM   164  C CA  . GLN A 1 25  ? 13.815 7.670   31.054 1.00 19.62  ? 21  GLN A CA  1 
ATOM   165  C C   . GLN A 1 25  ? 14.414 9.075   30.971 1.00 19.62  ? 21  GLN A C   1 
ATOM   166  O O   . GLN A 1 25  ? 14.406 9.715   29.914 1.00 19.62  ? 21  GLN A O   1 
ATOM   167  C CB  . GLN A 1 25  ? 14.854 6.627   30.605 1.00 39.99  ? 21  GLN A CB  1 
ATOM   168  C CG  . GLN A 1 25  ? 16.234 6.801   31.243 1.00 39.99  ? 21  GLN A CG  1 
ATOM   169  C CD  . GLN A 1 25  ? 17.257 5.748   30.803 1.00 39.99  ? 21  GLN A CD  1 
ATOM   170  O OE1 . GLN A 1 25  ? 17.307 4.630   31.348 1.00 39.99  ? 21  GLN A OE1 1 
ATOM   171  N NE2 . GLN A 1 25  ? 18.079 6.103   29.809 1.00 39.99  ? 21  GLN A NE2 1 
ATOM   172  N N   . TYR A 1 26  ? 14.919 9.554   32.100 1.00 20.48  ? 22  TYR A N   1 
ATOM   173  C CA  . TYR A 1 26  ? 15.540 10.870  32.147 1.00 20.48  ? 22  TYR A CA  1 
ATOM   174  C C   . TYR A 1 26  ? 16.833 10.799  32.934 1.00 20.48  ? 22  TYR A C   1 
ATOM   175  O O   . TYR A 1 26  ? 16.835 10.437  34.111 1.00 20.48  ? 22  TYR A O   1 
ATOM   176  C CB  . TYR A 1 26  ? 14.601 11.904  32.784 1.00 25.13  ? 22  TYR A CB  1 
ATOM   177  C CG  . TYR A 1 26  ? 15.205 13.294  32.878 1.00 25.13  ? 22  TYR A CG  1 
ATOM   178  C CD1 . TYR A 1 26  ? 16.118 13.618  33.888 1.00 25.13  ? 22  TYR A CD1 1 
ATOM   179  C CD2 . TYR A 1 26  ? 14.900 14.273  31.936 1.00 25.13  ? 22  TYR A CD2 1 
ATOM   180  C CE1 . TYR A 1 26  ? 16.711 14.873  33.951 1.00 25.13  ? 22  TYR A CE1 1 
ATOM   181  C CE2 . TYR A 1 26  ? 15.489 15.536  31.989 1.00 25.13  ? 22  TYR A CE2 1 
ATOM   182  C CZ  . TYR A 1 26  ? 16.393 15.826  32.995 1.00 25.13  ? 22  TYR A CZ  1 
ATOM   183  O OH  . TYR A 1 26  ? 16.997 17.054  33.029 1.00 25.13  ? 22  TYR A OH  1 
ATOM   184  N N   . THR A 1 27  ? 17.937 11.156  32.291 1.00 20.68  ? 23  THR A N   1 
ATOM   185  C CA  . THR A 1 27  ? 19.216 11.115  32.975 1.00 20.68  ? 23  THR A CA  1 
ATOM   186  C C   . THR A 1 27  ? 20.104 12.285  32.652 1.00 20.68  ? 23  THR A C   1 
ATOM   187  O O   . THR A 1 27  ? 19.824 13.072  31.744 1.00 20.68  ? 23  THR A O   1 
ATOM   188  C CB  . THR A 1 27  ? 20.015 9.849   32.617 1.00 24.12  ? 23  THR A CB  1 
ATOM   189  O OG1 . THR A 1 27  ? 20.252 9.815   31.203 1.00 24.12  ? 23  THR A OG1 1 
ATOM   190  C CG2 . THR A 1 27  ? 19.263 8.605   33.039 1.00 24.12  ? 23  THR A CG2 1 
ATOM   191  N N   . HIS A 1 28  ? 21.177 12.381  33.434 1.00 16.20  ? 24  HIS A N   1 
ATOM   192  C CA  . HIS A 1 28  ? 22.215 13.390  33.265 1.00 16.20  ? 24  HIS A CA  1 
ATOM   193  C C   . HIS A 1 28  ? 23.538 12.655  33.392 1.00 16.20  ? 24  HIS A C   1 
ATOM   194  O O   . HIS A 1 28  ? 23.681 11.728  34.203 1.00 16.20  ? 24  HIS A O   1 
ATOM   195  C CB  . HIS A 1 28  ? 22.156 14.478  34.338 1.00 30.21  ? 24  HIS A CB  1 
ATOM   196  C CG  . HIS A 1 28  ? 21.264 15.628  33.992 1.00 30.21  ? 24  HIS A CG  1 
ATOM   197  N ND1 . HIS A 1 28  ? 21.382 16.863  34.593 1.00 30.21  ? 24  HIS A ND1 1 
ATOM   198  C CD2 . HIS A 1 28  ? 20.217 15.723  33.140 1.00 30.21  ? 24  HIS A CD2 1 
ATOM   199  C CE1 . HIS A 1 28  ? 20.445 17.668  34.128 1.00 30.21  ? 24  HIS A CE1 1 
ATOM   200  N NE2 . HIS A 1 28  ? 19.724 17.001  33.245 1.00 30.21  ? 24  HIS A NE2 1 
ATOM   201  N N   . GLU A 1 29  ? 24.505 13.062  32.584 1.00 27.93  ? 25  GLU A N   1 
ATOM   202  C CA  . GLU A 1 29  ? 25.811 12.443  32.617 1.00 27.93  ? 25  GLU A CA  1 
ATOM   203  C C   . GLU A 1 29  ? 26.866 13.509  32.542 1.00 27.93  ? 25  GLU A C   1 
ATOM   204  O O   . GLU A 1 29  ? 26.592 14.640  32.141 1.00 27.93  ? 25  GLU A O   1 
ATOM   205  C CB  . GLU A 1 29  ? 25.994 11.513  31.428 1.00 26.64  ? 25  GLU A CB  1 
ATOM   206  C CG  . GLU A 1 29  ? 25.119 10.280  31.429 1.00 26.64  ? 25  GLU A CG  1 
ATOM   207  C CD  . GLU A 1 29  ? 25.258 9.504   30.136 1.00 26.64  ? 25  GLU A CD  1 
ATOM   208  O OE1 . GLU A 1 29  ? 26.385 9.079   29.819 1.00 26.64  ? 25  GLU A OE1 1 
ATOM   209  O OE2 . GLU A 1 29  ? 24.246 9.330   29.431 1.00 26.64  ? 25  GLU A OE2 1 
ATOM   210  N N   . PHE A 1 30  ? 28.075 13.143  32.938 1.00 31.10  ? 26  PHE A N   1 
ATOM   211  C CA  . PHE A 1 30  ? 29.202 14.049  32.860 1.00 31.10  ? 26  PHE A CA  1 
ATOM   212  C C   . PHE A 1 30  ? 30.431 13.252  32.435 1.00 31.10  ? 26  PHE A C   1 
ATOM   213  O O   . PHE A 1 30  ? 30.825 12.290  33.104 1.00 31.10  ? 26  PHE A O   1 
ATOM   214  C CB  . PHE A 1 30  ? 29.473 14.736  34.191 1.00 25.57  ? 26  PHE A CB  1 
ATOM   215  C CG  . PHE A 1 30  ? 30.474 15.831  34.068 1.00 25.57  ? 26  PHE A CG  1 
ATOM   216  C CD1 . PHE A 1 30  ? 30.109 17.051  33.519 1.00 25.57  ? 26  PHE A CD1 1 
ATOM   217  C CD2 . PHE A 1 30  ? 31.807 15.607  34.380 1.00 25.57  ? 26  PHE A CD2 1 
ATOM   218  C CE1 . PHE A 1 30  ? 31.055 18.029  33.274 1.00 25.57  ? 26  PHE A CE1 1 
ATOM   219  C CE2 . PHE A 1 30  ? 32.762 16.581  34.139 1.00 25.57  ? 26  PHE A CE2 1 
ATOM   220  C CZ  . PHE A 1 30  ? 32.386 17.794  33.584 1.00 25.57  ? 26  PHE A CZ  1 
ATOM   221  N N   . ASP A 1 31  ? 31.026 13.648  31.315 1.00 21.13  ? 27  ASP A N   1 
ATOM   222  C CA  . ASP A 1 31  ? 32.198 12.959  30.783 1.00 21.13  ? 27  ASP A CA  1 
ATOM   223  C C   . ASP A 1 31  ? 31.948 11.469  30.601 1.00 21.13  ? 27  ASP A C   1 
ATOM   224  O O   . ASP A 1 31  ? 32.851 10.653  30.770 1.00 21.13  ? 27  ASP A O   1 
ATOM   225  C CB  . ASP A 1 31  ? 33.409 13.172  31.696 1.00 32.66  ? 27  ASP A CB  1 
ATOM   226  C CG  . ASP A 1 31  ? 34.025 14.553  31.539 1.00 32.66  ? 27  ASP A CG  1 
ATOM   227  O OD1 . ASP A 1 31  ? 33.348 15.467  31.013 1.00 32.66  ? 27  ASP A OD1 1 
ATOM   228  O OD2 . ASP A 1 31  ? 35.188 14.724  31.954 1.00 32.66  ? 27  ASP A OD2 1 
ATOM   229  N N   . GLY A 1 32  ? 30.711 11.116  30.275 1.00 23.68  ? 28  GLY A N   1 
ATOM   230  C CA  . GLY A 1 32  ? 30.381 9.724   30.049 1.00 23.68  ? 28  GLY A CA  1 
ATOM   231  C C   . GLY A 1 32  ? 29.854 8.887   31.202 1.00 23.68  ? 28  GLY A C   1 
ATOM   232  O O   . GLY A 1 32  ? 29.591 7.698   31.006 1.00 23.68  ? 28  GLY A O   1 
ATOM   233  N N   . ASP A 1 33  ? 29.705 9.467   32.393 1.00 19.58  ? 29  ASP A N   1 
ATOM   234  C CA  . ASP A 1 33  ? 29.186 8.702   33.528 1.00 19.58  ? 29  ASP A CA  1 
ATOM   235  C C   . ASP A 1 33  ? 27.873 9.266   34.083 1.00 19.58  ? 29  ASP A C   1 
ATOM   236  O O   . ASP A 1 33  ? 27.704 10.476  34.234 1.00 19.58  ? 29  ASP A O   1 
ATOM   237  C CB  . ASP A 1 33  ? 30.230 8.618   34.652 1.00 24.09  ? 29  ASP A CB  1 
ATOM   238  C CG  . ASP A 1 33  ? 31.491 7.890   34.224 1.00 24.09  ? 29  ASP A CG  1 
ATOM   239  O OD1 . ASP A 1 33  ? 31.375 6.815   33.607 1.00 24.09  ? 29  ASP A OD1 1 
ATOM   240  O OD2 . ASP A 1 33  ? 32.597 8.383   34.513 1.00 24.09  ? 29  ASP A OD2 1 
ATOM   241  N N   . GLU A 1 34  ? 26.951 8.365   34.393 1.00 25.16  ? 30  GLU A N   1 
ATOM   242  C CA  . GLU A 1 34  ? 25.651 8.728   34.926 1.00 25.16  ? 30  GLU A CA  1 
ATOM   243  C C   . GLU A 1 34  ? 25.756 9.483   36.250 1.00 25.16  ? 30  GLU A C   1 
ATOM   244  O O   . GLU A 1 34  ? 26.491 9.078   37.154 1.00 25.16  ? 30  GLU A O   1 
ATOM   245  C CB  . GLU A 1 34  ? 24.809 7.459   35.108 1.00 26.57  ? 30  GLU A CB  1 
ATOM   246  C CG  . GLU A 1 34  ? 23.426 7.678   35.698 1.00 26.57  ? 30  GLU A CG  1 
ATOM   247  C CD  . GLU A 1 34  ? 22.580 6.413   35.672 1.00 26.57  ? 30  GLU A CD  1 
ATOM   248  O OE1 . GLU A 1 34  ? 23.133 5.319   35.415 1.00 26.57  ? 30  GLU A OE1 1 
ATOM   249  O OE2 . GLU A 1 34  ? 21.358 6.509   35.915 1.00 26.57  ? 30  GLU A OE2 1 
ATOM   250  N N   . LEU A 1 35  ? 25.032 10.593  36.354 1.00 26.56  ? 31  LEU A N   1 
ATOM   251  C CA  . LEU A 1 35  ? 25.030 11.373  37.579 1.00 26.56  ? 31  LEU A CA  1 
ATOM   252  C C   . LEU A 1 35  ? 23.781 11.028  38.364 1.00 26.56  ? 31  LEU A C   1 
ATOM   253  O O   . LEU A 1 35  ? 23.808 10.917  39.588 1.00 26.56  ? 31  LEU A O   1 
ATOM   254  C CB  . LEU A 1 35  ? 25.015 12.862  37.281 1.00 26.84  ? 31  LEU A CB  1 
ATOM   255  C CG  . LEU A 1 35  ? 24.987 13.718  38.552 1.00 26.84  ? 31  LEU A CG  1 
ATOM   256  C CD1 . LEU A 1 35  ? 26.289 13.503  39.319 1.00 26.84  ? 31  LEU A CD1 1 
ATOM   257  C CD2 . LEU A 1 35  ? 24.821 15.188  38.207 1.00 26.84  ? 31  LEU A CD2 1 
ATOM   258  N N   . PHE A 1 36  ? 22.677 10.864  37.645 1.00 34.08  ? 32  PHE A N   1 
ATOM   259  C CA  . PHE A 1 36  ? 21.412 10.542  38.274 1.00 34.08  ? 32  PHE A CA  1 
ATOM   260  C C   . PHE A 1 36  ? 20.364 10.245  37.216 1.00 34.08  ? 32  PHE A C   1 
ATOM   261  O O   . PHE A 1 36  ? 20.562 10.506  36.025 1.00 34.08  ? 32  PHE A O   1 
ATOM   262  C CB  . PHE A 1 36  ? 20.937 11.728  39.136 1.00 23.32  ? 32  PHE A CB  1 
ATOM   263  C CG  . PHE A 1 36  ? 20.406 12.899  38.337 1.00 23.32  ? 32  PHE A CG  1 
ATOM   264  C CD1 . PHE A 1 36  ? 19.112 12.877  37.804 1.00 23.32  ? 32  PHE A CD1 1 
ATOM   265  C CD2 . PHE A 1 36  ? 21.207 14.006  38.084 1.00 23.32  ? 32  PHE A CD2 1 
ATOM   266  C CE1 . PHE A 1 36  ? 18.634 13.937  37.033 1.00 23.32  ? 32  PHE A CE1 1 
ATOM   267  C CE2 . PHE A 1 36  ? 20.734 15.075  37.310 1.00 23.32  ? 32  PHE A CE2 1 
ATOM   268  C CZ  . PHE A 1 36  ? 19.448 15.037  36.785 1.00 23.32  ? 32  PHE A CZ  1 
ATOM   269  N N   . TYR A 1 37  ? 19.250 9.686   37.659 1.00 29.51  ? 33  TYR A N   1 
ATOM   270  C CA  . TYR A 1 37  ? 18.137 9.422   36.774 1.00 29.51  ? 33  TYR A CA  1 
ATOM   271  C C   . TYR A 1 37  ? 16.941 9.750   37.636 1.00 29.51  ? 33  TYR A C   1 
ATOM   272  O O   . TYR A 1 37  ? 17.018 9.665   38.860 1.00 29.51  ? 33  TYR A O   1 
ATOM   273  C CB  . TYR A 1 37  ? 18.107 7.962   36.315 1.00 24.30  ? 33  TYR A CB  1 
ATOM   274  C CG  . TYR A 1 37  ? 17.786 6.939   37.383 1.00 24.30  ? 33  TYR A CG  1 
ATOM   275  C CD1 . TYR A 1 37  ? 16.459 6.644   37.735 1.00 24.30  ? 33  TYR A CD1 1 
ATOM   276  C CD2 . TYR A 1 37  ? 18.805 6.224   38.006 1.00 24.30  ? 33  TYR A CD2 1 
ATOM   277  C CE1 . TYR A 1 37  ? 16.166 5.650   38.677 1.00 24.30  ? 33  TYR A CE1 1 
ATOM   278  C CE2 . TYR A 1 37  ? 18.526 5.241   38.943 1.00 24.30  ? 33  TYR A CE2 1 
ATOM   279  C CZ  . TYR A 1 37  ? 17.212 4.955   39.274 1.00 24.30  ? 33  TYR A CZ  1 
ATOM   280  O OH  . TYR A 1 37  ? 16.967 3.965   40.199 1.00 24.30  ? 33  TYR A OH  1 
ATOM   281  N N   . VAL A 1 38  ? 15.846 10.160  37.020 1.00 26.40  ? 34  VAL A N   1 
ATOM   282  C CA  . VAL A 1 38  ? 14.676 10.476  37.808 1.00 26.40  ? 34  VAL A CA  1 
ATOM   283  C C   . VAL A 1 38  ? 13.718 9.298   37.825 1.00 26.40  ? 34  VAL A C   1 
ATOM   284  O O   . VAL A 1 38  ? 13.224 8.870   36.782 1.00 26.40  ? 34  VAL A O   1 
ATOM   285  C CB  . VAL A 1 38  ? 13.960 11.715  37.268 1.00 18.64  ? 34  VAL A CB  1 
ATOM   286  C CG1 . VAL A 1 38  ? 12.604 11.863  37.937 1.00 18.64  ? 34  VAL A CG1 1 
ATOM   287  C CG2 . VAL A 1 38  ? 14.813 12.942  37.526 1.00 18.64  ? 34  VAL A CG2 1 
ATOM   288  N N   . ASP A 1 39  ? 13.482 8.771   39.024 1.00 40.80  ? 35  ASP A N   1 
ATOM   289  C CA  . ASP A 1 39  ? 12.576 7.647   39.221 1.00 40.80  ? 35  ASP A CA  1 
ATOM   290  C C   . ASP A 1 39  ? 11.158 8.155   38.935 1.00 40.80  ? 35  ASP A C   1 
ATOM   291  O O   . ASP A 1 39  ? 10.543 8.826   39.771 1.00 40.80  ? 35  ASP A O   1 
ATOM   292  C CB  . ASP A 1 39  ? 12.685 7.148   40.667 1.00 48.41  ? 35  ASP A CB  1 
ATOM   293  C CG  . ASP A 1 39  ? 11.868 5.899   40.919 1.00 48.41  ? 35  ASP A CG  1 
ATOM   294  O OD1 . ASP A 1 39  ? 10.682 5.883   40.524 1.00 48.41  ? 35  ASP A OD1 1 
ATOM   295  O OD2 . ASP A 1 39  ? 12.405 4.939   41.521 1.00 48.41  ? 35  ASP A OD2 1 
ATOM   296  N N   . LEU A 1 40  ? 10.656 7.845   37.744 1.00 46.21  ? 36  LEU A N   1 
ATOM   297  C CA  . LEU A 1 40  ? 9.325  8.273   37.322 1.00 46.21  ? 36  LEU A CA  1 
ATOM   298  C C   . LEU A 1 40  ? 8.215  7.837   38.288 1.00 46.21  ? 36  LEU A C   1 
ATOM   299  O O   . LEU A 1 40  ? 7.301  8.604   38.587 1.00 46.21  ? 36  LEU A O   1 
ATOM   300  C CB  . LEU A 1 40  ? 9.031  7.721   35.924 1.00 34.12  ? 36  LEU A CB  1 
ATOM   301  C CG  . LEU A 1 40  ? 10.130 7.928   34.883 1.00 34.12  ? 36  LEU A CG  1 
ATOM   302  C CD1 . LEU A 1 40  ? 9.695  7.291   33.567 1.00 34.12  ? 36  LEU A CD1 1 
ATOM   303  C CD2 . LEU A 1 40  ? 10.421 9.422   34.710 1.00 34.12  ? 36  LEU A CD2 1 
ATOM   304  N N   . ASP A 1 41  ? 8.297  6.600   38.766 1.00 54.70  ? 37  ASP A N   1 
ATOM   305  C CA  . ASP A 1 41  ? 7.298  6.065   39.688 1.00 54.70  ? 37  ASP A CA  1 
ATOM   306  C C   . ASP A 1 41  ? 7.236  6.911   40.954 1.00 54.70  ? 37  ASP A C   1 
ATOM   307  O O   . ASP A 1 41  ? 6.228  7.562   41.229 1.00 54.70  ? 37  ASP A O   1 
ATOM   308  C CB  . ASP A 1 41  ? 7.648  4.624   40.080 1.00 136.60 ? 37  ASP A CB  1 
ATOM   309  C CG  . ASP A 1 41  ? 8.141  3.795   38.907 1.00 136.60 ? 37  ASP A CG  1 
ATOM   310  O OD1 . ASP A 1 41  ? 9.225  4.106   38.362 1.00 136.60 ? 37  ASP A OD1 1 
ATOM   311  O OD2 . ASP A 1 41  ? 7.447  2.827   38.532 1.00 136.60 ? 37  ASP A OD2 1 
ATOM   312  N N   . LYS A 1 42  ? 8.332  6.897   41.713 1.00 41.54  ? 38  LYS A N   1 
ATOM   313  C CA  . LYS A 1 42  ? 8.429  7.624   42.973 1.00 41.54  ? 38  LYS A CA  1 
ATOM   314  C C   . LYS A 1 42  ? 8.557  9.134   42.804 1.00 41.54  ? 38  LYS A C   1 
ATOM   315  O O   . LYS A 1 42  ? 8.440  9.884   43.777 1.00 41.54  ? 38  LYS A O   1 
ATOM   316  C CB  . LYS A 1 42  ? 9.611  7.086   43.790 1.00 69.57  ? 38  LYS A CB  1 
ATOM   317  C CG  . LYS A 1 42  ? 9.558  5.576   44.025 1.00 69.57  ? 38  LYS A CG  1 
ATOM   318  C CD  . LYS A 1 42  ? 10.749 5.072   44.833 1.00 69.57  ? 38  LYS A CD  1 
ATOM   319  C CE  . LYS A 1 42  ? 10.734 5.627   46.252 1.00 69.57  ? 38  LYS A CE  1 
ATOM   320  N NZ  . LYS A 1 42  ? 11.880 5.131   47.067 1.00 69.57  ? 38  LYS A NZ  1 
ATOM   321  N N   . LYS A 1 43  ? 8.797  9.579   41.572 1.00 58.79  ? 39  LYS A N   1 
ATOM   322  C CA  . LYS A 1 43  ? 8.935  11.006  41.289 1.00 58.79  ? 39  LYS A CA  1 
ATOM   323  C C   . LYS A 1 43  ? 10.112 11.568  42.090 1.00 58.79  ? 39  LYS A C   1 
ATOM   324  O O   . LYS A 1 43  ? 9.970  12.550  42.816 1.00 58.79  ? 39  LYS A O   1 
ATOM   325  C CB  . LYS A 1 43  ? 7.630  11.729  41.662 1.00 65.28  ? 39  LYS A CB  1 
ATOM   326  C CG  . LYS A 1 43  ? 6.385  11.086  41.033 1.00 65.28  ? 39  LYS A CG  1 
ATOM   327  C CD  . LYS A 1 43  ? 5.075  11.485  41.722 1.00 65.28  ? 39  LYS A CD  1 
ATOM   328  C CE  . LYS A 1 43  ? 4.715  12.943  41.490 1.00 65.28  ? 39  LYS A CE  1 
ATOM   329  N NZ  . LYS A 1 43  ? 3.406  13.284  42.105 1.00 65.28  ? 39  LYS A NZ  1 
ATOM   330  N N   . LYS A 1 44  ? 11.278 10.941  41.949 1.00 45.34  ? 40  LYS A N   1 
ATOM   331  C CA  . LYS A 1 44  ? 12.463 11.376  42.685 1.00 45.34  ? 40  LYS A CA  1 
ATOM   332  C C   . LYS A 1 44  ? 13.802 11.222  41.949 1.00 45.34  ? 40  LYS A C   1 
ATOM   333  O O   . LYS A 1 44  ? 13.958 10.390  41.055 1.00 45.34  ? 40  LYS A O   1 
ATOM   334  C CB  . LYS A 1 44  ? 12.532 10.632  44.026 1.00 34.32  ? 40  LYS A CB  1 
ATOM   335  N N   . THR A 1 45  ? 14.761 12.044  42.353 1.00 27.75  ? 41  THR A N   1 
ATOM   336  C CA  . THR A 1 45  ? 16.107 12.049  41.794 1.00 27.75  ? 41  THR A CA  1 
ATOM   337  C C   . THR A 1 45  ? 16.946 10.961  42.463 1.00 27.75  ? 41  THR A C   1 
ATOM   338  O O   . THR A 1 45  ? 17.108 10.958  43.681 1.00 27.75  ? 41  THR A O   1 
ATOM   339  C CB  . THR A 1 45  ? 16.773 13.410  42.045 1.00 20.93  ? 41  THR A CB  1 
ATOM   340  O OG1 . THR A 1 45  ? 16.051 14.425  41.343 1.00 20.93  ? 41  THR A OG1 1 
ATOM   341  C CG2 . THR A 1 45  ? 18.214 13.401  41.596 1.00 20.93  ? 41  THR A CG2 1 
ATOM   342  N N   . VAL A 1 46  ? 17.474 10.038  41.670 1.00 25.62  ? 42  VAL A N   1 
ATOM   343  C CA  . VAL A 1 46  ? 18.292 8.954   42.210 1.00 25.62  ? 42  VAL A CA  1 
ATOM   344  C C   . VAL A 1 46  ? 19.722 9.112   41.714 1.00 25.62  ? 42  VAL A C   1 
ATOM   345  O O   . VAL A 1 46  ? 20.001 8.938   40.531 1.00 25.62  ? 42  VAL A O   1 
ATOM   346  C CB  . VAL A 1 46  ? 17.771 7.575   41.769 1.00 31.61  ? 42  VAL A CB  1 
ATOM   347  C CG1 . VAL A 1 46  ? 18.546 6.484   42.469 1.00 31.61  ? 42  VAL A CG1 1 
ATOM   348  C CG2 . VAL A 1 46  ? 16.294 7.453   42.076 1.00 31.61  ? 42  VAL A CG2 1 
ATOM   349  N N   . TRP A 1 47  ? 20.628 9.444   42.623 1.00 31.46  ? 43  TRP A N   1 
ATOM   350  C CA  . TRP A 1 47  ? 22.022 9.641   42.257 1.00 31.46  ? 43  TRP A CA  1 
ATOM   351  C C   . TRP A 1 47  ? 22.786 8.328   42.090 1.00 31.46  ? 43  TRP A C   1 
ATOM   352  O O   . TRP A 1 47  ? 22.530 7.350   42.794 1.00 31.46  ? 43  TRP A O   1 
ATOM   353  C CB  . TRP A 1 47  ? 22.705 10.521  43.303 1.00 20.62  ? 43  TRP A CB  1 
ATOM   354  C CG  . TRP A 1 47  ? 21.920 11.752  43.638 1.00 20.62  ? 43  TRP A CG  1 
ATOM   355  C CD1 . TRP A 1 47  ? 20.968 11.878  44.617 1.00 20.62  ? 43  TRP A CD1 1 
ATOM   356  C CD2 . TRP A 1 47  ? 22.006 13.035  42.995 1.00 20.62  ? 43  TRP A CD2 1 
ATOM   357  N NE1 . TRP A 1 47  ? 20.465 13.157  44.624 1.00 20.62  ? 43  TRP A NE1 1 
ATOM   358  C CE2 . TRP A 1 47  ? 21.078 13.888  43.639 1.00 20.62  ? 43  TRP A CE2 1 
ATOM   359  C CE3 . TRP A 1 47  ? 22.774 13.545  41.942 1.00 20.62  ? 43  TRP A CE3 1 
ATOM   360  C CZ2 . TRP A 1 47  ? 20.896 15.228  43.263 1.00 20.62  ? 43  TRP A CZ2 1 
ATOM   361  C CZ3 . TRP A 1 47  ? 22.595 14.883  41.564 1.00 20.62  ? 43  TRP A CZ3 1 
ATOM   362  C CH2 . TRP A 1 47  ? 21.662 15.707  42.225 1.00 20.62  ? 43  TRP A CH2 1 
ATOM   363  N N   . ARG A 1 48  ? 23.723 8.315   41.147 1.00 25.96  ? 44  ARG A N   1 
ATOM   364  C CA  . ARG A 1 48  ? 24.523 7.132   40.868 1.00 25.96  ? 44  ARG A CA  1 
ATOM   365  C C   . ARG A 1 48  ? 25.368 6.773   42.079 1.00 25.96  ? 44  ARG A C   1 
ATOM   366  O O   . ARG A 1 48  ? 25.564 5.598   42.388 1.00 25.96  ? 44  ARG A O   1 
ATOM   367  C CB  . ARG A 1 48  ? 25.423 7.382   39.662 1.00 29.25  ? 44  ARG A CB  1 
ATOM   368  C CG  . ARG A 1 48  ? 26.241 6.177   39.251 1.00 29.25  ? 44  ARG A CG  1 
ATOM   369  C CD  . ARG A 1 48  ? 25.349 5.059   38.730 1.00 29.25  ? 44  ARG A CD  1 
ATOM   370  N NE  . ARG A 1 48  ? 26.151 3.915   38.313 1.00 29.25  ? 44  ARG A NE  1 
ATOM   371  C CZ  . ARG A 1 48  ? 26.877 3.164   39.142 1.00 29.25  ? 44  ARG A CZ  1 
ATOM   372  N NH1 . ARG A 1 48  ? 26.899 3.431   40.443 1.00 29.25  ? 44  ARG A NH1 1 
ATOM   373  N NH2 . ARG A 1 48  ? 27.587 2.148   38.666 1.00 29.25  ? 44  ARG A NH2 1 
ATOM   374  N N   . LEU A 1 49  ? 25.861 7.796   42.765 1.00 35.39  ? 45  LEU A N   1 
ATOM   375  C CA  . LEU A 1 49  ? 26.669 7.602   43.960 1.00 35.39  ? 45  LEU A CA  1 
ATOM   376  C C   . LEU A 1 49  ? 26.092 8.395   45.129 1.00 35.39  ? 45  LEU A C   1 
ATOM   377  O O   . LEU A 1 49  ? 25.749 9.566   44.984 1.00 35.39  ? 45  LEU A O   1 
ATOM   378  C CB  . LEU A 1 49  ? 28.113 8.042   43.703 1.00 24.77  ? 45  LEU A CB  1 
ATOM   379  C CG  . LEU A 1 49  ? 28.890 7.189   42.695 1.00 24.77  ? 45  LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 49  ? 30.309 7.702   42.576 1.00 24.77  ? 45  LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 49  ? 28.885 5.730   43.146 1.00 24.77  ? 45  LEU A CD2 1 
ATOM   382  N N   . PRO A 1 50  ? 25.993 7.768   46.308 1.00 57.89  ? 46  PRO A N   1 
ATOM   383  C CA  . PRO A 1 50  ? 25.457 8.406   47.515 1.00 57.89  ? 46  PRO A CA  1 
ATOM   384  C C   . PRO A 1 50  ? 25.869 9.880   47.653 1.00 57.89  ? 46  PRO A C   1 
ATOM   385  O O   . PRO A 1 50  ? 25.024 10.784  47.680 1.00 57.89  ? 46  PRO A O   1 
ATOM   386  C CB  . PRO A 1 50  ? 26.043 7.550   48.636 1.00 45.76  ? 46  PRO A CB  1 
ATOM   387  C CG  . PRO A 1 50  ? 26.092 6.188   48.026 1.00 45.76  ? 46  PRO A CG  1 
ATOM   388  C CD  . PRO A 1 50  ? 26.617 6.471   46.633 1.00 45.76  ? 46  PRO A CD  1 
ATOM   389  N N   . GLU A 1 51  ? 27.180 10.096  47.735 1.00 35.24  ? 47  GLU A N   1 
ATOM   390  C CA  . GLU A 1 51  ? 27.790 11.416  47.891 1.00 35.24  ? 47  GLU A CA  1 
ATOM   391  C C   . GLU A 1 51  ? 27.121 12.536  47.112 1.00 35.24  ? 47  GLU A C   1 
ATOM   392  O O   . GLU A 1 51  ? 26.890 13.628  47.630 1.00 35.24  ? 47  GLU A O   1 
ATOM   393  C CB  . GLU A 1 51  ? 29.261 11.356  47.450 1.00 33.63  ? 47  GLU A CB  1 
ATOM   394  C CG  . GLU A 1 51  ? 29.958 10.051  47.785 1.00 33.63  ? 47  GLU A CG  1 
ATOM   395  C CD  . GLU A 1 51  ? 30.201 9.170   46.575 1.00 33.63  ? 47  GLU A CD  1 
ATOM   396  O OE1 . GLU A 1 51  ? 31.037 9.554   45.733 1.00 33.63  ? 47  GLU A OE1 1 
ATOM   397  O OE2 . GLU A 1 51  ? 29.566 8.093   46.470 1.00 33.63  ? 47  GLU A OE2 1 
ATOM   398  N N   . PHE A 1 52  ? 26.851 12.241  45.848 1.00 43.70  ? 48  PHE A N   1 
ATOM   399  C CA  . PHE A 1 52  ? 26.279 13.166  44.882 1.00 43.70  ? 48  PHE A CA  1 
ATOM   400  C C   . PHE A 1 52  ? 25.349 14.299  45.328 1.00 43.70  ? 48  PHE A C   1 
ATOM   401  O O   . PHE A 1 52  ? 25.777 15.462  45.448 1.00 43.70  ? 48  PHE A O   1 
ATOM   402  C CB  . PHE A 1 52  ? 25.602 12.351  43.772 1.00 65.71  ? 48  PHE A CB  1 
ATOM   403  C CG  . PHE A 1 52  ? 26.569 11.572  42.911 1.00 65.71  ? 48  PHE A CG  1 
ATOM   404  C CD1 . PHE A 1 52  ? 27.949 11.743  43.049 1.00 65.71  ? 48  PHE A CD1 1 
ATOM   405  C CD2 . PHE A 1 52  ? 26.099 10.689  41.941 1.00 65.71  ? 48  PHE A CD2 1 
ATOM   406  C CE1 . PHE A 1 52  ? 28.842 11.050  42.234 1.00 65.71  ? 48  PHE A CE1 1 
ATOM   407  C CE2 . PHE A 1 52  ? 26.984 9.991   41.119 1.00 65.71  ? 48  PHE A CE2 1 
ATOM   408  C CZ  . PHE A 1 52  ? 28.357 10.172  41.265 1.00 65.71  ? 48  PHE A CZ  1 
ATOM   409  N N   . GLY A 1 53  ? 24.081 13.957  45.547 1.00 32.08  ? 49  GLY A N   1 
ATOM   410  C CA  . GLY A 1 53  ? 23.087 14.944  45.934 1.00 32.08  ? 49  GLY A CA  1 
ATOM   411  C C   . GLY A 1 53  ? 23.248 15.627  47.278 1.00 32.08  ? 49  GLY A C   1 
ATOM   412  O O   . GLY A 1 53  ? 22.268 16.132  47.819 1.00 32.08  ? 49  GLY A O   1 
ATOM   413  N N   . GLN A 1 54  ? 24.468 15.656  47.811 1.00 29.21  ? 50  GLN A N   1 
ATOM   414  C CA  . GLN A 1 54  ? 24.730 16.286  49.102 1.00 29.21  ? 50  GLN A CA  1 
ATOM   415  C C   . GLN A 1 54  ? 25.001 17.783  48.991 1.00 29.21  ? 50  GLN A C   1 
ATOM   416  O O   . GLN A 1 54  ? 24.735 18.544  49.923 1.00 29.21  ? 50  GLN A O   1 
ATOM   417  C CB  . GLN A 1 54  ? 25.910 15.605  49.781 1.00 27.60  ? 50  GLN A CB  1 
ATOM   418  C CG  . GLN A 1 54  ? 25.515 14.559  50.800 1.00 27.60  ? 50  GLN A CG  1 
ATOM   419  C CD  . GLN A 1 54  ? 26.713 13.809  51.321 1.00 27.60  ? 50  GLN A CD  1 
ATOM   420  O OE1 . GLN A 1 54  ? 27.769 14.397  51.554 1.00 27.60  ? 50  GLN A OE1 1 
ATOM   421  N NE2 . GLN A 1 54  ? 26.559 12.500  51.513 1.00 27.60  ? 50  GLN A NE2 1 
ATOM   422  N N   . LEU A 1 55  ? 25.534 18.201  47.851 1.00 64.16  ? 51  LEU A N   1 
ATOM   423  C CA  . LEU A 1 55  ? 25.823 19.608  47.630 1.00 64.16  ? 51  LEU A CA  1 
ATOM   424  C C   . LEU A 1 55  ? 24.813 20.127  46.619 1.00 64.16  ? 51  LEU A C   1 
ATOM   425  O O   . LEU A 1 55  ? 23.911 20.898  46.947 1.00 64.16  ? 51  LEU A O   1 
ATOM   426  C CB  . LEU A 1 55  ? 27.236 19.785  47.068 1.00 60.26  ? 51  LEU A CB  1 
ATOM   427  C CG  . LEU A 1 55  ? 28.286 18.705  47.356 1.00 60.26  ? 51  LEU A CG  1 
ATOM   428  C CD1 . LEU A 1 55  ? 29.636 19.192  46.848 1.00 60.26  ? 51  LEU A CD1 1 
ATOM   429  C CD2 . LEU A 1 55  ? 28.360 18.402  48.845 1.00 60.26  ? 51  LEU A CD2 1 
ATOM   430  N N   . ILE A 1 56  ? 24.976 19.669  45.384 1.00 28.98  ? 52  ILE A N   1 
ATOM   431  C CA  . ILE A 1 56  ? 24.121 20.057  44.284 1.00 28.98  ? 52  ILE A CA  1 
ATOM   432  C C   . ILE A 1 56  ? 22.743 19.419  44.392 1.00 28.98  ? 52  ILE A C   1 
ATOM   433  O O   . ILE A 1 56  ? 22.544 18.462  45.144 1.00 28.98  ? 52  ILE A O   1 
ATOM   434  C CB  . ILE A 1 56  ? 24.794 19.683  42.975 1.00 26.24  ? 52  ILE A CB  1 
ATOM   435  C CG1 . ILE A 1 56  ? 25.036 18.173  42.920 1.00 26.24  ? 52  ILE A CG1 1 
ATOM   436  C CG2 . ILE A 1 56  ? 26.141 20.397  42.890 1.00 26.24  ? 52  ILE A CG2 1 
ATOM   437  C CD1 . ILE A 1 56  ? 25.843 17.725  41.724 1.00 26.24  ? 52  ILE A CD1 1 
ATOM   438  N N   . LEU A 1 57  ? 21.794 19.960  43.638 1.00 30.06  ? 53  LEU A N   1 
ATOM   439  C CA  . LEU A 1 57  ? 20.415 19.493  43.664 1.00 30.06  ? 53  LEU A CA  1 
ATOM   440  C C   . LEU A 1 57  ? 19.735 19.462  42.291 1.00 30.06  ? 53  LEU A C   1 
ATOM   441  O O   . LEU A 1 57  ? 20.076 20.237  41.395 1.00 30.06  ? 53  LEU A O   1 
ATOM   442  C CB  . LEU A 1 57  ? 19.621 20.412  44.593 1.00 33.05  ? 53  LEU A CB  1 
ATOM   443  C CG  . LEU A 1 57  ? 18.118 20.589  44.371 1.00 33.05  ? 53  LEU A CG  1 
ATOM   444  C CD1 . LEU A 1 57  ? 17.350 19.462  45.030 1.00 33.05  ? 53  LEU A CD1 1 
ATOM   445  C CD2 . LEU A 1 57  ? 17.692 21.922  44.951 1.00 33.05  ? 53  LEU A CD2 1 
ATOM   446  N N   . PHE A 1 58  ? 18.779 18.554  42.127 1.00 25.19  ? 54  PHE A N   1 
ATOM   447  C CA  . PHE A 1 58  ? 18.020 18.484  40.885 1.00 25.19  ? 54  PHE A CA  1 
ATOM   448  C C   . PHE A 1 58  ? 16.547 18.256  41.175 1.00 25.19  ? 54  PHE A C   1 
ATOM   449  O O   . PHE A 1 58  ? 16.180 17.263  41.798 1.00 25.19  ? 54  PHE A O   1 
ATOM   450  C CB  . PHE A 1 58  ? 18.499 17.362  39.965 1.00 22.95  ? 54  PHE A CB  1 
ATOM   451  C CG  . PHE A 1 58  ? 17.798 17.356  38.625 1.00 22.95  ? 54  PHE A CG  1 
ATOM   452  C CD1 . PHE A 1 58  ? 18.152 18.270  37.638 1.00 22.95  ? 54  PHE A CD1 1 
ATOM   453  C CD2 . PHE A 1 58  ? 16.747 16.476  38.374 1.00 22.95  ? 54  PHE A CD2 1 
ATOM   454  C CE1 . PHE A 1 58  ? 17.472 18.312  36.417 1.00 22.95  ? 54  PHE A CE1 1 
ATOM   455  C CE2 . PHE A 1 58  ? 16.060 16.509  37.160 1.00 22.95  ? 54  PHE A CE2 1 
ATOM   456  C CZ  . PHE A 1 58  ? 16.428 17.434  36.177 1.00 22.95  ? 54  PHE A CZ  1 
ATOM   457  N N   . GLU A 1 59  ? 15.705 19.175  40.721 1.00 33.09  ? 55  GLU A N   1 
ATOM   458  C CA  . GLU A 1 59  ? 14.266 19.055  40.930 1.00 33.09  ? 55  GLU A CA  1 
ATOM   459  C C   . GLU A 1 59  ? 13.698 18.038  39.951 1.00 33.09  ? 55  GLU A C   1 
ATOM   460  O O   . GLU A 1 59  ? 13.661 18.279  38.746 1.00 33.09  ? 55  GLU A O   1 
ATOM   461  C CB  . GLU A 1 59  ? 13.587 20.408  40.713 1.00 59.87  ? 55  GLU A CB  1 
ATOM   462  C CG  . GLU A 1 59  ? 13.991 21.452  41.725 1.00 59.87  ? 55  GLU A CG  1 
ATOM   463  C CD  . GLU A 1 59  ? 13.379 21.198  43.086 1.00 59.87  ? 55  GLU A CD  1 
ATOM   464  O OE1 . GLU A 1 59  ? 13.177 20.014  43.437 1.00 59.87  ? 55  GLU A OE1 1 
ATOM   465  O OE2 . GLU A 1 59  ? 13.111 22.182  43.809 1.00 59.87  ? 55  GLU A OE2 1 
ATOM   466  N N   . PRO A 1 60  ? 13.253 16.881  40.458 1.00 28.47  ? 56  PRO A N   1 
ATOM   467  C CA  . PRO A 1 60  ? 12.690 15.846  39.585 1.00 28.47  ? 56  PRO A CA  1 
ATOM   468  C C   . PRO A 1 60  ? 11.674 16.400  38.581 1.00 28.47  ? 56  PRO A C   1 
ATOM   469  O O   . PRO A 1 60  ? 11.582 15.934  37.434 1.00 28.47  ? 56  PRO A O   1 
ATOM   470  C CB  . PRO A 1 60  ? 12.077 14.843  40.577 1.00 31.47  ? 56  PRO A CB  1 
ATOM   471  C CG  . PRO A 1 60  ? 11.949 15.622  41.869 1.00 31.47  ? 56  PRO A CG  1 
ATOM   472  C CD  . PRO A 1 60  ? 13.175 16.480  41.870 1.00 31.47  ? 56  PRO A CD  1 
ATOM   473  N N   . GLN A 1 61  ? 10.925 17.404  39.025 1.00 31.97  ? 57  GLN A N   1 
ATOM   474  C CA  . GLN A 1 61  ? 9.917  18.061  38.202 1.00 31.97  ? 57  GLN A CA  1 
ATOM   475  C C   . GLN A 1 61  ? 10.432 18.248  36.773 1.00 31.97  ? 57  GLN A C   1 
ATOM   476  O O   . GLN A 1 61  ? 9.711  18.024  35.804 1.00 31.97  ? 57  GLN A O   1 
ATOM   477  C CB  . GLN A 1 61  ? 9.580  19.426  38.808 1.00 100.48 ? 57  GLN A CB  1 
ATOM   478  C CG  . GLN A 1 61  ? 8.396  20.128  38.173 1.00 100.48 ? 57  GLN A CG  1 
ATOM   479  C CD  . GLN A 1 61  ? 7.071  19.549  38.622 1.00 100.48 ? 57  GLN A CD  1 
ATOM   480  O OE1 . GLN A 1 61  ? 6.712  19.628  39.797 1.00 100.48 ? 57  GLN A OE1 1 
ATOM   481  N NE2 . GLN A 1 61  ? 6.336  18.960  37.687 1.00 100.48 ? 57  GLN A NE2 1 
ATOM   482  N N   . GLY A 1 62  ? 11.684 18.666  36.649 1.00 40.35  ? 58  GLY A N   1 
ATOM   483  C CA  . GLY A 1 62  ? 12.260 18.873  35.335 1.00 40.35  ? 58  GLY A CA  1 
ATOM   484  C C   . GLY A 1 62  ? 12.206 17.611  34.499 1.00 40.35  ? 58  GLY A C   1 
ATOM   485  O O   . GLY A 1 62  ? 11.650 17.609  33.403 1.00 40.35  ? 58  GLY A O   1 
ATOM   486  N N   . GLY A 1 63  ? 12.782 16.531  35.019 1.00 28.86  ? 59  GLY A N   1 
ATOM   487  C CA  . GLY A 1 63  ? 12.782 15.280  34.289 1.00 28.86  ? 59  GLY A CA  1 
ATOM   488  C C   . GLY A 1 63  ? 11.397 14.885  33.821 1.00 28.86  ? 59  GLY A C   1 
ATOM   489  O O   . GLY A 1 63  ? 11.214 14.459  32.674 1.00 28.86  ? 59  GLY A O   1 
ATOM   490  N N   . LEU A 1 64  ? 10.412 15.027  34.705 1.00 27.15  ? 60  LEU A N   1 
ATOM   491  C CA  . LEU A 1 64  ? 9.043  14.661  34.357 1.00 27.15  ? 60  LEU A CA  1 
ATOM   492  C C   . LEU A 1 64  ? 8.532  15.496  33.191 1.00 27.15  ? 60  LEU A C   1 
ATOM   493  O O   . LEU A 1 64  ? 7.809  14.990  32.329 1.00 27.15  ? 60  LEU A O   1 
ATOM   494  C CB  . LEU A 1 64  ? 8.130  14.801  35.572 1.00 45.27  ? 60  LEU A CB  1 
ATOM   495  C CG  . LEU A 1 64  ? 8.557  13.894  36.732 1.00 45.27  ? 60  LEU A CG  1 
ATOM   496  C CD1 . LEU A 1 64  ? 7.488  13.874  37.808 1.00 45.27  ? 60  LEU A CD1 1 
ATOM   497  C CD2 . LEU A 1 64  ? 8.793  12.482  36.212 1.00 45.27  ? 60  LEU A CD2 1 
ATOM   498  N N   . GLN A 1 65  ? 8.932  16.766  33.156 1.00 32.14  ? 61  GLN A N   1 
ATOM   499  C CA  . GLN A 1 65  ? 8.536  17.669  32.078 1.00 32.14  ? 61  GLN A CA  1 
ATOM   500  C C   . GLN A 1 65  ? 9.042  17.133  30.732 1.00 32.14  ? 61  GLN A C   1 
ATOM   501  O O   . GLN A 1 65  ? 8.246  16.876  29.824 1.00 32.14  ? 61  GLN A O   1 
ATOM   502  C CB  . GLN A 1 65  ? 9.094  19.078  32.336 1.00 59.98  ? 61  GLN A CB  1 
ATOM   503  C CG  . GLN A 1 65  ? 8.750  20.117  31.259 1.00 59.98  ? 61  GLN A CG  1 
ATOM   504  C CD  . GLN A 1 65  ? 9.004  21.560  31.708 1.00 59.98  ? 61  GLN A CD  1 
ATOM   505  O OE1 . GLN A 1 65  ? 8.916  22.502  30.910 1.00 59.98  ? 61  GLN A OE1 1 
ATOM   506  N NE2 . GLN A 1 65  ? 9.314  21.735  32.990 1.00 59.98  ? 61  GLN A NE2 1 
ATOM   507  N N   . ASN A 1 66  ? 10.360 16.950  30.618 1.00 28.21  ? 62  ASN A N   1 
ATOM   508  C CA  . ASN A 1 66  ? 10.957 16.450  29.387 1.00 28.21  ? 62  ASN A CA  1 
ATOM   509  C C   . ASN A 1 66  ? 10.343 15.127  28.959 1.00 28.21  ? 62  ASN A C   1 
ATOM   510  O O   . ASN A 1 66  ? 10.098 14.901  27.775 1.00 28.21  ? 62  ASN A O   1 
ATOM   511  C CB  . ASN A 1 66  ? 12.466 16.276  29.548 1.00 36.82  ? 62  ASN A CB  1 
ATOM   512  C CG  . ASN A 1 66  ? 13.220 17.583  29.459 1.00 36.82  ? 62  ASN A CG  1 
ATOM   513  O OD1 . ASN A 1 66  ? 12.749 18.545  28.866 1.00 36.82  ? 62  ASN A OD1 1 
ATOM   514  N ND2 . ASN A 1 66  ? 14.414 17.613  30.028 1.00 36.82  ? 62  ASN A ND2 1 
ATOM   515  N N   . ILE A 1 67  ? 10.103 14.242  29.917 1.00 30.13  ? 63  ILE A N   1 
ATOM   516  C CA  . ILE A 1 67  ? 9.497  12.961  29.590 1.00 30.13  ? 63  ILE A CA  1 
ATOM   517  C C   . ILE A 1 67  ? 8.160  13.226  28.900 1.00 30.13  ? 63  ILE A C   1 
ATOM   518  O O   . ILE A 1 67  ? 7.896  12.709  27.809 1.00 30.13  ? 63  ILE A O   1 
ATOM   519  C CB  . ILE A 1 67  ? 9.258  12.113  30.854 1.00 28.73  ? 63  ILE A CB  1 
ATOM   520  C CG1 . ILE A 1 67  ? 10.598 11.695  31.458 1.00 28.73  ? 63  ILE A CG1 1 
ATOM   521  C CG2 . ILE A 1 67  ? 8.432  10.883  30.511 1.00 28.73  ? 63  ILE A CG2 1 
ATOM   522  C CD1 . ILE A 1 67  ? 11.421 10.837  30.540 1.00 28.73  ? 63  ILE A CD1 1 
ATOM   523  N N   . ALA A 1 68  ? 7.328  14.050  29.533 1.00 40.20  ? 64  ALA A N   1 
ATOM   524  C CA  . ALA A 1 68  ? 6.021  14.386  28.974 1.00 40.20  ? 64  ALA A CA  1 
ATOM   525  C C   . ALA A 1 68  ? 6.171  15.001  27.585 1.00 40.20  ? 64  ALA A C   1 
ATOM   526  O O   . ALA A 1 68  ? 5.465  14.617  26.657 1.00 40.20  ? 64  ALA A O   1 
ATOM   527  C CB  . ALA A 1 68  ? 5.264  15.352  29.911 1.00 18.11  ? 64  ALA A CB  1 
ATOM   528  N N   . ALA A 1 69  ? 7.087  15.953  27.439 1.00 29.83  ? 65  ALA A N   1 
ATOM   529  C CA  . ALA A 1 69  ? 7.307  16.585  26.140 1.00 29.83  ? 65  ALA A CA  1 
ATOM   530  C C   . ALA A 1 69  ? 7.692  15.517  25.125 1.00 29.83  ? 65  ALA A C   1 
ATOM   531  O O   . ALA A 1 69  ? 7.242  15.534  23.979 1.00 29.83  ? 65  ALA A O   1 
ATOM   532  C CB  . ALA A 1 69  ? 8.416  17.636  26.234 1.00 23.38  ? 65  ALA A CB  1 
ATOM   533  N N   . GLU A 1 70  ? 8.532  14.582  25.547 1.00 34.50  ? 66  GLU A N   1 
ATOM   534  C CA  . GLU A 1 70  ? 8.952  13.528  24.643 1.00 34.50  ? 66  GLU A CA  1 
ATOM   535  C C   . GLU A 1 70  ? 7.788  12.615  24.300 1.00 34.50  ? 66  GLU A C   1 
ATOM   536  O O   . GLU A 1 70  ? 7.737  12.063  23.206 1.00 34.50  ? 66  GLU A O   1 
ATOM   537  C CB  . GLU A 1 70  ? 10.116 12.736  25.247 1.00 28.39  ? 66  GLU A CB  1 
ATOM   538  C CG  . GLU A 1 70  ? 11.458 13.416  25.031 1.00 28.39  ? 66  GLU A CG  1 
ATOM   539  C CD  . GLU A 1 70  ? 11.824 13.511  23.557 1.00 28.39  ? 66  GLU A CD  1 
ATOM   540  O OE1 . GLU A 1 70  ? 12.312 12.511  22.987 1.00 28.39  ? 66  GLU A OE1 1 
ATOM   541  O OE2 . GLU A 1 70  ? 11.608 14.582  22.960 1.00 28.39  ? 66  GLU A OE2 1 
ATOM   542  N N   . LYS A 1 71  ? 6.850  12.461  25.227 1.00 29.62  ? 67  LYS A N   1 
ATOM   543  C CA  . LYS A 1 71  ? 5.680  11.625  24.974 1.00 29.62  ? 67  LYS A CA  1 
ATOM   544  C C   . LYS A 1 71  ? 4.904  12.307  23.842 1.00 29.62  ? 67  LYS A C   1 
ATOM   545  O O   . LYS A 1 71  ? 4.367  11.657  22.936 1.00 29.62  ? 67  LYS A O   1 
ATOM   546  C CB  . LYS A 1 71  ? 4.809  11.539  26.231 1.00 47.19  ? 67  LYS A CB  1 
ATOM   547  C CG  . LYS A 1 71  ? 3.668  10.542  26.140 1.00 47.19  ? 67  LYS A CG  1 
ATOM   548  C CD  . LYS A 1 71  ? 2.839  10.554  27.418 1.00 47.19  ? 67  LYS A CD  1 
ATOM   549  C CE  . LYS A 1 71  ? 1.670  9.568   27.358 1.00 47.19  ? 67  LYS A CE  1 
ATOM   550  N NZ  . LYS A 1 71  ? 0.860  9.559   28.619 1.00 47.19  ? 67  LYS A NZ  1 
ATOM   551  N N   . HIS A 1 72  ? 4.882  13.634  23.903 1.00 34.35  ? 68  HIS A N   1 
ATOM   552  C CA  . HIS A 1 72  ? 4.213  14.464  22.917 1.00 34.35  ? 68  HIS A CA  1 
ATOM   553  C C   . HIS A 1 72  ? 4.905  14.298  21.570 1.00 34.35  ? 68  HIS A C   1 
ATOM   554  O O   . HIS A 1 72  ? 4.261  14.010  20.563 1.00 34.35  ? 68  HIS A O   1 
ATOM   555  C CB  . HIS A 1 72  ? 4.280  15.932  23.363 1.00 44.35  ? 68  HIS A CB  1 
ATOM   556  C CG  . HIS A 1 72  ? 3.619  16.897  22.422 1.00 44.35  ? 68  HIS A CG  1 
ATOM   557  N ND1 . HIS A 1 72  ? 2.256  17.107  22.400 1.00 44.35  ? 68  HIS A ND1 1 
ATOM   558  C CD2 . HIS A 1 72  ? 4.140  17.717  21.477 1.00 44.35  ? 68  HIS A CD2 1 
ATOM   559  C CE1 . HIS A 1 72  ? 1.968  18.015  21.485 1.00 44.35  ? 68  HIS A CE1 1 
ATOM   560  N NE2 . HIS A 1 72  ? 3.093  18.401  20.910 1.00 44.35  ? 68  HIS A NE2 1 
ATOM   561  N N   . ASN A 1 73  ? 6.221  14.468  21.554 1.00 45.23  ? 69  ASN A N   1 
ATOM   562  C CA  . ASN A 1 73  ? 6.974  14.360  20.311 1.00 45.23  ? 69  ASN A CA  1 
ATOM   563  C C   . ASN A 1 73  ? 6.894  12.998  19.619 1.00 45.23  ? 69  ASN A C   1 
ATOM   564  O O   . ASN A 1 73  ? 6.829  12.926  18.390 1.00 45.23  ? 69  ASN A O   1 
ATOM   565  C CB  . ASN A 1 73  ? 8.439  14.753  20.548 1.00 45.68  ? 69  ASN A CB  1 
ATOM   566  C CG  . ASN A 1 73  ? 8.592  16.217  20.936 1.00 45.68  ? 69  ASN A CG  1 
ATOM   567  O OD1 . ASN A 1 73  ? 7.843  17.075  20.470 1.00 45.68  ? 69  ASN A OD1 1 
ATOM   568  N ND2 . ASN A 1 73  ? 9.573  16.510  21.778 1.00 45.68  ? 69  ASN A ND2 1 
ATOM   569  N N   . LEU A 1 74  ? 6.883  11.921  20.396 1.00 31.59  ? 70  LEU A N   1 
ATOM   570  C CA  . LEU A 1 74  ? 6.816  10.581  19.817 1.00 31.59  ? 70  LEU A CA  1 
ATOM   571  C C   . LEU A 1 74  ? 5.571  10.341  18.946 1.00 31.59  ? 70  LEU A C   1 
ATOM   572  O O   . LEU A 1 74  ? 5.670  9.758   17.859 1.00 31.59  ? 70  LEU A O   1 
ATOM   573  C CB  . LEU A 1 74  ? 6.875  9.528   20.926 1.00 20.86  ? 70  LEU A CB  1 
ATOM   574  C CG  . LEU A 1 74  ? 6.859  8.066   20.481 1.00 20.86  ? 70  LEU A CG  1 
ATOM   575  C CD1 . LEU A 1 74  ? 8.077  7.752   19.619 1.00 20.86  ? 70  LEU A CD1 1 
ATOM   576  C CD2 . LEU A 1 74  ? 6.843  7.181   21.711 1.00 20.86  ? 70  LEU A CD2 1 
ATOM   577  N N   . GLY A 1 75  ? 4.408  10.787  19.423 1.00 32.38  ? 71  GLY A N   1 
ATOM   578  C CA  . GLY A 1 75  ? 3.176  10.602  18.675 1.00 32.38  ? 71  GLY A CA  1 
ATOM   579  C C   . GLY A 1 75  ? 3.190  11.306  17.329 1.00 32.38  ? 71  GLY A C   1 
ATOM   580  O O   . GLY A 1 75  ? 2.735  10.756  16.318 1.00 32.38  ? 71  GLY A O   1 
ATOM   581  N N   . ILE A 1 76  ? 3.717  12.528  17.321 1.00 35.41  ? 72  ILE A N   1 
ATOM   582  C CA  . ILE A 1 76  ? 3.813  13.336  16.114 1.00 35.41  ? 72  ILE A CA  1 
ATOM   583  C C   . ILE A 1 76  ? 4.777  12.718  15.108 1.00 35.41  ? 72  ILE A C   1 
ATOM   584  O O   . ILE A 1 76  ? 4.407  12.444  13.964 1.00 35.41  ? 72  ILE A O   1 
ATOM   585  C CB  . ILE A 1 76  ? 4.285  14.763  16.461 1.00 35.65  ? 72  ILE A CB  1 
ATOM   586  C CG1 . ILE A 1 76  ? 3.205  15.466  17.286 1.00 35.65  ? 72  ILE A CG1 1 
ATOM   587  C CG2 . ILE A 1 76  ? 4.584  15.548  15.208 1.00 35.65  ? 72  ILE A CG2 1 
ATOM   588  C CD1 . ILE A 1 76  ? 3.653  16.781  17.889 1.00 35.65  ? 72  ILE A CD1 1 
ATOM   589  N N   . LEU A 1 77  ? 6.015  12.501  15.536 1.00 26.44  ? 73  LEU A N   1 
ATOM   590  C CA  . LEU A 1 77  ? 7.021  11.918  14.662 1.00 26.44  ? 73  LEU A CA  1 
ATOM   591  C C   . LEU A 1 77  ? 6.612  10.535  14.195 1.00 26.44  ? 73  LEU A C   1 
ATOM   592  O O   . LEU A 1 77  ? 6.849  10.175  13.045 1.00 26.44  ? 73  LEU A O   1 
ATOM   593  C CB  . LEU A 1 77  ? 8.375  11.848  15.375 1.00 23.30  ? 73  LEU A CB  1 
ATOM   594  C CG  . LEU A 1 77  ? 9.280  13.069  15.178 1.00 23.30  ? 73  LEU A CG  1 
ATOM   595  C CD1 . LEU A 1 77  ? 9.798  13.063  13.751 1.00 23.30  ? 73  LEU A CD1 1 
ATOM   596  C CD2 . LEU A 1 77  ? 8.522  14.373  15.480 1.00 23.30  ? 73  LEU A CD2 1 
ATOM   597  N N   . THR A 1 78  ? 5.999  9.752   15.082 1.00 37.41  ? 74  THR A N   1 
ATOM   598  C CA  . THR A 1 78  ? 5.571  8.413   14.696 1.00 37.41  ? 74  THR A CA  1 
ATOM   599  C C   . THR A 1 78  ? 4.719  8.501   13.438 1.00 37.41  ? 74  THR A C   1 
ATOM   600  O O   . THR A 1 78  ? 4.998  7.821   12.451 1.00 37.41  ? 74  THR A O   1 
ATOM   601  C CB  . THR A 1 78  ? 4.762  7.724   15.813 1.00 45.93  ? 74  THR A CB  1 
ATOM   602  O OG1 . THR A 1 78  ? 5.623  7.468   16.930 1.00 45.93  ? 74  THR A OG1 1 
ATOM   603  C CG2 . THR A 1 78  ? 4.178  6.401   15.319 1.00 45.93  ? 74  THR A CG2 1 
ATOM   604  N N   . LYS A 1 79  ? 3.689  9.345   13.474 1.00 43.87  ? 75  LYS A N   1 
ATOM   605  C CA  . LYS A 1 79  ? 2.814  9.535   12.317 1.00 43.87  ? 75  LYS A CA  1 
ATOM   606  C C   . LYS A 1 79  ? 3.644  10.045  11.134 1.00 43.87  ? 75  LYS A C   1 
ATOM   607  O O   . LYS A 1 79  ? 3.622  9.472   10.045 1.00 43.87  ? 75  LYS A O   1 
ATOM   608  C CB  . LYS A 1 79  ? 1.714  10.557  12.633 1.00 54.33  ? 75  LYS A CB  1 
ATOM   609  C CG  . LYS A 1 79  ? 0.786  10.186  13.787 1.00 54.33  ? 75  LYS A CG  1 
ATOM   610  C CD  . LYS A 1 79  ? -0.173 11.333  14.102 1.00 54.33  ? 75  LYS A CD  1 
ATOM   611  C CE  . LYS A 1 79  ? -0.992 11.063  15.360 1.00 54.33  ? 75  LYS A CE  1 
ATOM   612  N NZ  . LYS A 1 79  ? -1.819 12.248  15.741 1.00 54.33  ? 75  LYS A NZ  1 
ATOM   613  N N   . ARG A 1 80  ? 4.378  11.127  11.373 1.00 24.64  ? 76  ARG A N   1 
ATOM   614  C CA  . ARG A 1 80  ? 5.224  11.757  10.367 1.00 24.64  ? 76  ARG A CA  1 
ATOM   615  C C   . ARG A 1 80  ? 6.010  10.730  9.561  1.00 24.64  ? 76  ARG A C   1 
ATOM   616  O O   . ARG A 1 80  ? 6.237  10.903  8.361  1.00 24.64  ? 76  ARG A O   1 
ATOM   617  C CB  . ARG A 1 80  ? 6.200  12.713  11.060 1.00 48.59  ? 76  ARG A CB  1 
ATOM   618  C CG  . ARG A 1 80  ? 7.059  13.561  10.136 1.00 48.59  ? 76  ARG A CG  1 
ATOM   619  C CD  . ARG A 1 80  ? 6.488  14.954  9.997  1.00 48.59  ? 76  ARG A CD  1 
ATOM   620  N NE  . ARG A 1 80  ? 6.543  15.729  11.238 1.00 48.59  ? 76  ARG A NE  1 
ATOM   621  C CZ  . ARG A 1 80  ? 7.631  16.338  11.705 1.00 48.59  ? 76  ARG A CZ  1 
ATOM   622  N NH1 . ARG A 1 80  ? 8.779  16.270  11.044 1.00 48.59  ? 76  ARG A NH1 1 
ATOM   623  N NH2 . ARG A 1 80  ? 7.565  17.040  12.829 1.00 48.59  ? 76  ARG A NH2 1 
ATOM   624  N N   . SER A 1 81  ? 6.426  9.659   10.224 1.00 44.29  ? 77  SER A N   1 
ATOM   625  C CA  . SER A 1 81  ? 7.211  8.623   9.569  1.00 44.29  ? 77  SER A CA  1 
ATOM   626  C C   . SER A 1 81  ? 6.338  7.570   8.927  1.00 44.29  ? 77  SER A C   1 
ATOM   627  O O   . SER A 1 81  ? 6.848  6.575   8.416  1.00 44.29  ? 77  SER A O   1 
ATOM   628  C CB  . SER A 1 81  ? 8.105  7.926   10.581 1.00 38.70  ? 77  SER A CB  1 
ATOM   629  O OG  . SER A 1 81  ? 7.349  6.977   11.314 1.00 38.70  ? 77  SER A OG  1 
ATOM   630  N N   . ASN A 1 82  ? 5.029  7.781   8.948  1.00 56.77  ? 78  ASN A N   1 
ATOM   631  C CA  . ASN A 1 82  ? 4.113  6.795   8.394  1.00 56.77  ? 78  ASN A CA  1 
ATOM   632  C C   . ASN A 1 82  ? 4.325  5.501   9.185  1.00 56.77  ? 78  ASN A C   1 
ATOM   633  O O   . ASN A 1 82  ? 4.396  4.408   8.618  1.00 56.77  ? 78  ASN A O   1 
ATOM   634  C CB  . ASN A 1 82  ? 4.384  6.568   6.899  1.00 67.49  ? 78  ASN A CB  1 
ATOM   635  C CG  . ASN A 1 82  ? 3.996  7.768   6.042  1.00 67.49  ? 78  ASN A CG  1 
ATOM   636  O OD1 . ASN A 1 82  ? 2.851  8.224   6.079  1.00 67.49  ? 78  ASN A OD1 1 
ATOM   637  N ND2 . ASN A 1 82  ? 4.950  8.282   5.262  1.00 67.49  ? 78  ASN A ND2 1 
ATOM   638  N N   . PHE A 1 83  ? 4.456  5.660   10.502 1.00 41.38  ? 79  PHE A N   1 
ATOM   639  C CA  . PHE A 1 83  ? 4.639  4.563   11.451 1.00 41.38  ? 79  PHE A CA  1 
ATOM   640  C C   . PHE A 1 83  ? 5.763  3.565   11.187 1.00 41.38  ? 79  PHE A C   1 
ATOM   641  O O   . PHE A 1 83  ? 5.532  2.357   11.137 1.00 41.38  ? 79  PHE A O   1 
ATOM   642  C CB  . PHE A 1 83  ? 3.328  3.790   11.613 1.00 36.74  ? 79  PHE A CB  1 
ATOM   643  C CG  . PHE A 1 83  ? 2.176  4.636   12.062 1.00 36.74  ? 79  PHE A CG  1 
ATOM   644  C CD1 . PHE A 1 83  ? 1.631  5.595   11.217 1.00 36.74  ? 79  PHE A CD1 1 
ATOM   645  C CD2 . PHE A 1 83  ? 1.622  4.460   13.325 1.00 36.74  ? 79  PHE A CD2 1 
ATOM   646  C CE1 . PHE A 1 83  ? 0.549  6.367   11.622 1.00 36.74  ? 79  PHE A CE1 1 
ATOM   647  C CE2 . PHE A 1 83  ? 0.540  5.225   13.743 1.00 36.74  ? 79  PHE A CE2 1 
ATOM   648  C CZ  . PHE A 1 83  ? 0.002  6.180   12.890 1.00 36.74  ? 79  PHE A CZ  1 
ATOM   649  N N   . THR A 1 84  ? 6.982  4.062   11.033 1.00 29.18  ? 80  THR A N   1 
ATOM   650  C CA  . THR A 1 84  ? 8.126  3.183   10.817 1.00 29.18  ? 80  THR A CA  1 
ATOM   651  C C   . THR A 1 84  ? 8.613  2.709   12.187 1.00 29.18  ? 80  THR A C   1 
ATOM   652  O O   . THR A 1 84  ? 9.051  3.510   13.014 1.00 29.18  ? 80  THR A O   1 
ATOM   653  C CB  . THR A 1 84  ? 9.263  3.923   10.115 1.00 34.36  ? 80  THR A CB  1 
ATOM   654  O OG1 . THR A 1 84  ? 8.772  4.490   8.891  1.00 34.36  ? 80  THR A OG1 1 
ATOM   655  C CG2 . THR A 1 84  ? 10.413 2.968   9.821  1.00 34.36  ? 80  THR A CG2 1 
ATOM   656  N N   . PRO A 1 85  ? 8.540  1.397   12.446 1.00 37.38  ? 81  PRO A N   1 
ATOM   657  C CA  . PRO A 1 85  ? 8.978  0.865   13.738 1.00 37.38  ? 81  PRO A CA  1 
ATOM   658  C C   . PRO A 1 85  ? 10.480 0.961   13.954 1.00 37.38  ? 81  PRO A C   1 
ATOM   659  O O   . PRO A 1 85  ? 11.250 1.223   13.028 1.00 37.38  ? 81  PRO A O   1 
ATOM   660  C CB  . PRO A 1 85  ? 8.519  -0.594  13.696 1.00 28.96  ? 81  PRO A CB  1 
ATOM   661  C CG  . PRO A 1 85  ? 7.468  -0.623  12.617 1.00 28.96  ? 81  PRO A CG  1 
ATOM   662  C CD  . PRO A 1 85  ? 8.024  0.317   11.593 1.00 28.96  ? 81  PRO A CD  1 
ATOM   663  N N   . ALA A 1 86  ? 10.888 0.739   15.191 1.00 47.02  ? 82  ALA A N   1 
ATOM   664  C CA  . ALA A 1 86  ? 12.292 0.768   15.532 1.00 47.02  ? 82  ALA A CA  1 
ATOM   665  C C   . ALA A 1 86  ? 12.858 -0.585  15.137 1.00 47.02  ? 82  ALA A C   1 
ATOM   666  O O   . ALA A 1 86  ? 12.177 -1.605  15.247 1.00 47.02  ? 82  ALA A O   1 
ATOM   667  C CB  . ALA A 1 86  ? 12.451 0.982   17.014 1.00 22.75  ? 82  ALA A CB  1 
ATOM   668  N N   . THR A 1 87  ? 14.093 -0.593  14.661 1.00 30.00  ? 83  THR A N   1 
ATOM   669  C CA  . THR A 1 87  ? 14.742 -1.832  14.279 1.00 30.00  ? 83  THR A CA  1 
ATOM   670  C C   . THR A 1 87  ? 15.440 -2.432  15.504 1.00 30.00  ? 83  THR A C   1 
ATOM   671  O O   . THR A 1 87  ? 16.256 -1.766  16.156 1.00 30.00  ? 83  THR A O   1 
ATOM   672  C CB  . THR A 1 87  ? 15.776 -1.578  13.179 1.00 25.38  ? 83  THR A CB  1 
ATOM   673  O OG1 . THR A 1 87  ? 15.128 -0.955  12.066 1.00 25.38  ? 83  THR A OG1 1 
ATOM   674  C CG2 . THR A 1 87  ? 16.399 -2.879  12.713 1.00 25.38  ? 83  THR A CG2 1 
ATOM   675  N N   . ASN A 1 88  ? 15.112 -3.681  15.828 1.00 40.34  ? 84  ASN A N   1 
ATOM   676  C CA  . ASN A 1 88  ? 15.728 -4.345  16.967 1.00 40.34  ? 84  ASN A CA  1 
ATOM   677  C C   . ASN A 1 88  ? 17.185 -4.677  16.697 1.00 40.34  ? 84  ASN A C   1 
ATOM   678  O O   . ASN A 1 88  ? 17.495 -5.404  15.757 1.00 40.34  ? 84  ASN A O   1 
ATOM   679  C CB  . ASN A 1 88  ? 15.005 -5.642  17.300 1.00 41.25  ? 84  ASN A CB  1 
ATOM   680  C CG  . ASN A 1 88  ? 13.600 -5.413  17.771 1.00 41.25  ? 84  ASN A CG  1 
ATOM   681  O OD1 . ASN A 1 88  ? 13.358 -4.621  18.687 1.00 41.25  ? 84  ASN A OD1 1 
ATOM   682  N ND2 . ASN A 1 88  ? 12.653 -6.112  17.155 1.00 41.25  ? 84  ASN A ND2 1 
ATOM   683  N N   . GLU A 1 89  ? 18.083 -4.145  17.517 1.00 31.82  ? 85  GLU A N   1 
ATOM   684  C CA  . GLU A 1 89  ? 19.490 -4.446  17.340 1.00 31.82  ? 85  GLU A CA  1 
ATOM   685  C C   . GLU A 1 89  ? 19.803 -5.680  18.167 1.00 31.82  ? 85  GLU A C   1 
ATOM   686  O O   . GLU A 1 89  ? 18.970 -6.150  18.943 1.00 31.82  ? 85  GLU A O   1 
ATOM   687  C CB  . GLU A 1 89  ? 20.361 -3.282  17.812 1.00 47.07  ? 85  GLU A CB  1 
ATOM   688  C CG  . GLU A 1 89  ? 20.294 -2.063  16.928 1.00 47.07  ? 85  GLU A CG  1 
ATOM   689  C CD  . GLU A 1 89  ? 20.668 -2.375  15.494 1.00 47.07  ? 85  GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 89  ? 21.751 -2.960  15.279 1.00 47.07  ? 85  GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 89  ? 19.884 -2.035  14.584 1.00 47.07  ? 85  GLU A OE2 1 
ATOM   692  N N   . ALA A 1 90  ? 21.008 -6.205  17.991 1.00 34.27  ? 86  ALA A N   1 
ATOM   693  C CA  . ALA A 1 90  ? 21.445 -7.369  18.745 1.00 34.27  ? 86  ALA A CA  1 
ATOM   694  C C   . ALA A 1 90  ? 22.469 -6.878  19.773 1.00 34.27  ? 86  ALA A C   1 
ATOM   695  O O   . ALA A 1 90  ? 23.495 -6.310  19.411 1.00 34.27  ? 86  ALA A O   1 
ATOM   696  C CB  . ALA A 1 90  ? 22.074 -8.397  17.804 1.00 18.63  ? 86  ALA A CB  1 
ATOM   697  N N   . PRO A 1 91  ? 22.204 -7.092  21.069 1.00 25.54  ? 87  PRO A N   1 
ATOM   698  C CA  . PRO A 1 91  ? 23.140 -6.642  22.102 1.00 25.54  ? 87  PRO A CA  1 
ATOM   699  C C   . PRO A 1 91  ? 24.452 -7.430  22.128 1.00 25.54  ? 87  PRO A C   1 
ATOM   700  O O   . PRO A 1 91  ? 24.475 -8.621  21.827 1.00 25.54  ? 87  PRO A O   1 
ATOM   701  C CB  . PRO A 1 91  ? 22.350 -6.839  23.400 1.00 28.91  ? 87  PRO A CB  1 
ATOM   702  C CG  . PRO A 1 91  ? 20.912 -6.996  22.961 1.00 28.91  ? 87  PRO A CG  1 
ATOM   703  C CD  . PRO A 1 91  ? 21.036 -7.745  21.681 1.00 28.91  ? 87  PRO A CD  1 
ATOM   704  N N   . GLN A 1 92  ? 25.538 -6.754  22.490 1.00 35.46  ? 88  GLN A N   1 
ATOM   705  C CA  . GLN A 1 92  ? 26.856 -7.375  22.609 1.00 35.46  ? 88  GLN A CA  1 
ATOM   706  C C   . GLN A 1 92  ? 27.216 -7.296  24.098 1.00 35.46  ? 88  GLN A C   1 
ATOM   707  O O   . GLN A 1 92  ? 27.224 -6.205  24.681 1.00 35.46  ? 88  GLN A O   1 
ATOM   708  C CB  . GLN A 1 92  ? 27.884 -6.597  21.788 1.00 65.68  ? 88  GLN A CB  1 
ATOM   709  C CG  . GLN A 1 92  ? 27.582 -6.539  20.301 1.00 65.68  ? 88  GLN A CG  1 
ATOM   710  C CD  . GLN A 1 92  ? 27.958 -7.819  19.565 1.00 65.68  ? 88  GLN A CD  1 
ATOM   711  O OE1 . GLN A 1 92  ? 29.142 -8.137  19.411 1.00 65.68  ? 88  GLN A OE1 1 
ATOM   712  N NE2 . GLN A 1 92  ? 26.948 -8.560  19.106 1.00 65.68  ? 88  GLN A NE2 1 
ATOM   713  N N   . ALA A 1 93  ? 27.509 -8.433  24.720 1.00 23.60  ? 89  ALA A N   1 
ATOM   714  C CA  . ALA A 1 93  ? 27.843 -8.434  26.145 1.00 23.60  ? 89  ALA A CA  1 
ATOM   715  C C   . ALA A 1 93  ? 29.272 -8.865  26.423 1.00 23.60  ? 89  ALA A C   1 
ATOM   716  O O   . ALA A 1 93  ? 29.817 -9.707  25.720 1.00 23.60  ? 89  ALA A O   1 
ATOM   717  C CB  . ALA A 1 93  ? 26.874 -9.333  26.911 1.00 9.64   ? 89  ALA A CB  1 
ATOM   718  N N   . THR A 1 94  ? 29.866 -8.283  27.460 1.00 33.69  ? 90  THR A N   1 
ATOM   719  C CA  . THR A 1 94  ? 31.237 -8.592  27.862 1.00 33.69  ? 90  THR A CA  1 
ATOM   720  C C   . THR A 1 94  ? 31.325 -8.573  29.378 1.00 33.69  ? 90  THR A C   1 
ATOM   721  O O   . THR A 1 94  ? 30.792 -7.673  30.028 1.00 33.69  ? 90  THR A O   1 
ATOM   722  C CB  . THR A 1 94  ? 32.226 -7.550  27.335 1.00 36.18  ? 90  THR A CB  1 
ATOM   723  O OG1 . THR A 1 94  ? 32.095 -7.449  25.917 1.00 36.18  ? 90  THR A OG1 1 
ATOM   724  C CG2 . THR A 1 94  ? 33.644 -7.944  27.675 1.00 36.18  ? 90  THR A CG2 1 
ATOM   725  N N   . VAL A 1 95  ? 32.001 -9.563  29.944 1.00 20.62  ? 91  VAL A N   1 
ATOM   726  C CA  . VAL A 1 95  ? 32.136 -9.621  31.387 1.00 20.62  ? 91  VAL A CA  1 
ATOM   727  C C   . VAL A 1 95  ? 33.594 -9.448  31.764 1.00 20.62  ? 91  VAL A C   1 
ATOM   728  O O   . VAL A 1 95  ? 34.479 -10.003 31.119 1.00 20.62  ? 91  VAL A O   1 
ATOM   729  C CB  . VAL A 1 95  ? 31.640 -10.966 31.945 1.00 17.49  ? 91  VAL A CB  1 
ATOM   730  C CG1 . VAL A 1 95  ? 31.519 -10.892 33.457 1.00 17.49  ? 91  VAL A CG1 1 
ATOM   731  C CG2 . VAL A 1 95  ? 30.322 -11.314 31.325 1.00 17.49  ? 91  VAL A CG2 1 
ATOM   732  N N   . PHE A 1 96  ? 33.836 -8.665  32.808 1.00 20.43  ? 92  PHE A N   1 
ATOM   733  C CA  . PHE A 1 96  ? 35.189 -8.437  33.287 1.00 20.43  ? 92  PHE A CA  1 
ATOM   734  C C   . PHE A 1 96  ? 35.149 -8.001  34.744 1.00 20.43  ? 92  PHE A C   1 
ATOM   735  O O   . PHE A 1 96  ? 34.182 -7.387  35.189 1.00 20.43  ? 92  PHE A O   1 
ATOM   736  C CB  . PHE A 1 96  ? 35.906 -7.390  32.415 1.00 17.80  ? 92  PHE A CB  1 
ATOM   737  C CG  . PHE A 1 96  ? 35.244 -6.025  32.401 1.00 17.80  ? 92  PHE A CG  1 
ATOM   738  C CD1 . PHE A 1 96  ? 35.549 -5.075  33.373 1.00 17.80  ? 92  PHE A CD1 1 
ATOM   739  C CD2 . PHE A 1 96  ? 34.339 -5.683  31.389 1.00 17.80  ? 92  PHE A CD2 1 
ATOM   740  C CE1 . PHE A 1 96  ? 34.964 -3.800  33.335 1.00 17.80  ? 92  PHE A CE1 1 
ATOM   741  C CE2 . PHE A 1 96  ? 33.748 -4.415  31.335 1.00 17.80  ? 92  PHE A CE2 1 
ATOM   742  C CZ  . PHE A 1 96  ? 34.058 -3.471  32.304 1.00 17.80  ? 92  PHE A CZ  1 
ATOM   743  N N   . PRO A 1 97  ? 36.188 -8.353  35.516 1.00 31.36  ? 93  PRO A N   1 
ATOM   744  C CA  . PRO A 1 97  ? 36.277 -7.994  36.935 1.00 31.36  ? 93  PRO A CA  1 
ATOM   745  C C   . PRO A 1 97  ? 36.708 -6.547  37.127 1.00 31.36  ? 93  PRO A C   1 
ATOM   746  O O   . PRO A 1 97  ? 37.444 -5.998  36.309 1.00 31.36  ? 93  PRO A O   1 
ATOM   747  C CB  . PRO A 1 97  ? 37.315 -8.971  37.466 1.00 28.95  ? 93  PRO A CB  1 
ATOM   748  C CG  . PRO A 1 97  ? 38.232 -9.143  36.294 1.00 28.95  ? 93  PRO A CG  1 
ATOM   749  C CD  . PRO A 1 97  ? 37.252 -9.308  35.151 1.00 28.95  ? 93  PRO A CD  1 
ATOM   750  N N   . LYS A 1 98  ? 36.243 -5.939  38.213 1.00 29.13  ? 94  LYS A N   1 
ATOM   751  C CA  . LYS A 1 98  ? 36.577 -4.555  38.532 1.00 29.13  ? 94  LYS A CA  1 
ATOM   752  C C   . LYS A 1 98  ? 38.050 -4.462  38.920 1.00 29.13  ? 94  LYS A C   1 
ATOM   753  O O   . LYS A 1 98  ? 38.772 -3.571  38.470 1.00 29.13  ? 94  LYS A O   1 
ATOM   754  C CB  . LYS A 1 98  ? 35.693 -4.060  39.689 1.00 19.44  ? 94  LYS A CB  1 
ATOM   755  C CG  . LYS A 1 98  ? 35.916 -2.612  40.132 1.00 19.44  ? 94  LYS A CG  1 
ATOM   756  C CD  . LYS A 1 98  ? 34.908 -2.240  41.217 1.00 19.44  ? 94  LYS A CD  1 
ATOM   757  C CE  . LYS A 1 98  ? 35.278 -0.989  41.993 1.00 19.44  ? 94  LYS A CE  1 
ATOM   758  N NZ  . LYS A 1 98  ? 35.074 0.275   41.239 1.00 19.44  ? 94  LYS A NZ  1 
ATOM   759  N N   . SER A 1 99  ? 38.496 -5.402  39.742 1.00 18.89  ? 95  SER A N   1 
ATOM   760  C CA  . SER A 1 99  ? 39.876 -5.409  40.185 1.00 18.89  ? 95  SER A CA  1 
ATOM   761  C C   . SER A 1 99  ? 40.502 -6.789  40.033 1.00 18.89  ? 95  SER A C   1 
ATOM   762  O O   . SER A 1 99  ? 39.821 -7.749  39.698 1.00 18.89  ? 95  SER A O   1 
ATOM   763  C CB  . SER A 1 99  ? 39.941 -4.958  41.642 1.00 31.41  ? 95  SER A CB  1 
ATOM   764  O OG  . SER A 1 99  ? 39.071 -5.736  42.433 1.00 31.41  ? 95  SER A OG  1 
ATOM   765  N N   . PRO A 1 100 ? 41.820 -6.899  40.259 1.00 27.98  ? 96  PRO A N   1 
ATOM   766  C CA  . PRO A 1 100 ? 42.477 -8.199  40.132 1.00 27.98  ? 96  PRO A CA  1 
ATOM   767  C C   . PRO A 1 100 ? 41.774 -9.202  41.044 1.00 27.98  ? 96  PRO A C   1 
ATOM   768  O O   . PRO A 1 100 ? 41.346 -8.858  42.147 1.00 27.98  ? 96  PRO A O   1 
ATOM   769  C CB  . PRO A 1 100 ? 43.903 -7.903  40.579 1.00 17.66  ? 96  PRO A CB  1 
ATOM   770  C CG  . PRO A 1 100 ? 44.102 -6.515  40.125 1.00 17.66  ? 96  PRO A CG  1 
ATOM   771  C CD  . PRO A 1 100 ? 42.807 -5.850  40.564 1.00 17.66  ? 96  PRO A CD  1 
ATOM   772  N N   . VAL A 1 101 ? 41.664 -10.441 40.579 1.00 32.17  ? 97  VAL A N   1 
ATOM   773  C CA  . VAL A 1 101 ? 40.983 -11.475 41.333 1.00 32.17  ? 97  VAL A CA  1 
ATOM   774  C C   . VAL A 1 101 ? 41.860 -12.192 42.329 1.00 32.17  ? 97  VAL A C   1 
ATOM   775  O O   . VAL A 1 101 ? 42.910 -12.714 41.979 1.00 32.17  ? 97  VAL A O   1 
ATOM   776  C CB  . VAL A 1 101 ? 40.372 -12.518 40.396 1.00 26.62  ? 97  VAL A CB  1 
ATOM   777  C CG1 . VAL A 1 101 ? 39.849 -13.694 41.202 1.00 26.62  ? 97  VAL A CG1 1 
ATOM   778  C CG2 . VAL A 1 101 ? 39.252 -11.885 39.589 1.00 26.62  ? 97  VAL A CG2 1 
ATOM   779  N N   . LEU A 1 102 ? 41.403 -12.227 43.574 1.00 32.14  ? 98  LEU A N   1 
ATOM   780  C CA  . LEU A 1 102 ? 42.127 -12.885 44.658 1.00 32.14  ? 98  LEU A CA  1 
ATOM   781  C C   . LEU A 1 102 ? 41.133 -13.747 45.437 1.00 32.14  ? 98  LEU A C   1 
ATOM   782  O O   . LEU A 1 102 ? 40.058 -13.278 45.818 1.00 32.14  ? 98  LEU A O   1 
ATOM   783  C CB  . LEU A 1 102 ? 42.767 -11.823 45.554 1.00 29.87  ? 98  LEU A CB  1 
ATOM   784  C CG  . LEU A 1 102 ? 43.718 -10.911 44.761 1.00 29.87  ? 98  LEU A CG  1 
ATOM   785  C CD1 . LEU A 1 102 ? 44.172 -9.730  45.594 1.00 29.87  ? 98  LEU A CD1 1 
ATOM   786  C CD2 . LEU A 1 102 ? 44.915 -11.741 44.296 1.00 29.87  ? 98  LEU A CD2 1 
ATOM   787  N N   . LEU A 1 103 ? 41.486 -15.012 45.651 1.00 36.77  ? 99  LEU A N   1 
ATOM   788  C CA  . LEU A 1 103 ? 40.605 -15.938 46.353 1.00 36.77  ? 99  LEU A CA  1 
ATOM   789  C C   . LEU A 1 103 ? 40.181 -15.482 47.744 1.00 36.77  ? 99  LEU A C   1 
ATOM   790  O O   . LEU A 1 103 ? 41.017 -15.154 48.595 1.00 36.77  ? 99  LEU A O   1 
ATOM   791  C CB  . LEU A 1 103 ? 41.252 -17.325 46.428 1.00 64.70  ? 99  LEU A CB  1 
ATOM   792  C CG  . LEU A 1 103 ? 40.586 -18.411 45.567 1.00 64.70  ? 99  LEU A CG  1 
ATOM   793  C CD1 . LEU A 1 103 ? 40.643 -18.039 44.086 1.00 64.70  ? 99  LEU A CD1 1 
ATOM   794  C CD2 . LEU A 1 103 ? 41.282 -19.742 45.810 1.00 64.70  ? 99  LEU A CD2 1 
ATOM   795  N N   . GLY A 1 104 ? 38.867 -15.459 47.958 1.00 23.99  ? 100 GLY A N   1 
ATOM   796  C CA  . GLY A 1 104 ? 38.318 -15.053 49.239 1.00 23.99  ? 100 GLY A CA  1 
ATOM   797  C C   . GLY A 1 104 ? 38.256 -13.551 49.443 1.00 23.99  ? 100 GLY A C   1 
ATOM   798  O O   . GLY A 1 104 ? 37.879 -13.084 50.518 1.00 23.99  ? 100 GLY A O   1 
ATOM   799  N N   . GLN A 1 105 ? 38.617 -12.785 48.420 1.00 27.93  ? 101 GLN A N   1 
ATOM   800  C CA  . GLN A 1 105 ? 38.597 -11.336 48.533 1.00 27.93  ? 101 GLN A CA  1 
ATOM   801  C C   . GLN A 1 105 ? 37.492 -10.706 47.690 1.00 27.93  ? 101 GLN A C   1 
ATOM   802  O O   . GLN A 1 105 ? 37.460 -10.864 46.470 1.00 27.93  ? 101 GLN A O   1 
ATOM   803  C CB  . GLN A 1 105 ? 39.943 -10.755 48.113 1.00 43.35  ? 101 GLN A CB  1 
ATOM   804  C CG  . GLN A 1 105 ? 41.127 -11.405 48.779 1.00 43.35  ? 101 GLN A CG  1 
ATOM   805  C CD  . GLN A 1 105 ? 42.346 -10.507 48.792 1.00 43.35  ? 101 GLN A CD  1 
ATOM   806  O OE1 . GLN A 1 105 ? 43.461 -10.969 49.032 1.00 43.35  ? 101 GLN A OE1 1 
ATOM   807  N NE2 . GLN A 1 105 ? 42.140 -9.210  48.548 1.00 43.35  ? 101 GLN A NE2 1 
ATOM   808  N N   . PRO A 1 106 ? 36.575 -9.972  48.342 1.00 29.49  ? 102 PRO A N   1 
ATOM   809  C CA  . PRO A 1 106 ? 35.439 -9.287  47.721 1.00 29.49  ? 102 PRO A CA  1 
ATOM   810  C C   . PRO A 1 106 ? 35.803 -8.559  46.429 1.00 29.49  ? 102 PRO A C   1 
ATOM   811  O O   . PRO A 1 106 ? 36.630 -7.649  46.436 1.00 29.49  ? 102 PRO A O   1 
ATOM   812  C CB  . PRO A 1 106 ? 34.988 -8.327  48.812 1.00 50.08  ? 102 PRO A CB  1 
ATOM   813  C CG  . PRO A 1 106 ? 35.245 -9.117  50.048 1.00 50.08  ? 102 PRO A CG  1 
ATOM   814  C CD  . PRO A 1 106 ? 36.621 -9.688  49.788 1.00 50.08  ? 102 PRO A CD  1 
ATOM   815  N N   . ASN A 1 107 ? 35.176 -8.963  45.326 1.00 19.98  ? 103 ASN A N   1 
ATOM   816  C CA  . ASN A 1 107 ? 35.436 -8.349  44.032 1.00 19.98  ? 103 ASN A CA  1 
ATOM   817  C C   . ASN A 1 107 ? 34.097 -8.070  43.355 1.00 19.98  ? 103 ASN A C   1 
ATOM   818  O O   . ASN A 1 107 ? 33.047 -8.252  43.964 1.00 19.98  ? 103 ASN A O   1 
ATOM   819  C CB  . ASN A 1 107 ? 36.272 -9.286  43.164 1.00 27.90  ? 103 ASN A CB  1 
ATOM   820  C CG  . ASN A 1 107 ? 37.077 -8.543  42.114 1.00 27.90  ? 103 ASN A CG  1 
ATOM   821  O OD1 . ASN A 1 107 ? 36.572 -7.641  41.439 1.00 27.90  ? 103 ASN A OD1 1 
ATOM   822  N ND2 . ASN A 1 107 ? 38.334 -8.928  41.961 1.00 27.90  ? 103 ASN A ND2 1 
ATOM   823  N N   . THR A 1 108 ? 34.124 -7.632  42.101 1.00 23.80  ? 104 THR A N   1 
ATOM   824  C CA  . THR A 1 108 ? 32.879 -7.345  41.403 1.00 23.80  ? 104 THR A CA  1 
ATOM   825  C C   . THR A 1 108 ? 32.959 -7.651  39.924 1.00 23.80  ? 104 THR A C   1 
ATOM   826  O O   . THR A 1 108 ? 33.873 -7.185  39.244 1.00 23.80  ? 104 THR A O   1 
ATOM   827  C CB  . THR A 1 108 ? 32.476 -5.858  41.523 1.00 22.00  ? 104 THR A CB  1 
ATOM   828  O OG1 . THR A 1 108 ? 32.481 -5.457  42.899 1.00 22.00  ? 104 THR A OG1 1 
ATOM   829  C CG2 . THR A 1 108 ? 31.076 -5.646  40.942 1.00 22.00  ? 104 THR A CG2 1 
ATOM   830  N N   . LEU A 1 109 ? 32.013 -8.438  39.421 1.00 16.74  ? 105 LEU A N   1 
ATOM   831  C CA  . LEU A 1 109 ? 32.003 -8.733  37.994 1.00 16.74  ? 105 LEU A CA  1 
ATOM   832  C C   . LEU A 1 109 ? 31.137 -7.680  37.318 1.00 16.74  ? 105 LEU A C   1 
ATOM   833  O O   . LEU A 1 109 ? 30.048 -7.342  37.792 1.00 16.74  ? 105 LEU A O   1 
ATOM   834  C CB  . LEU A 1 109 ? 31.457 -10.133 37.710 1.00 24.30  ? 105 LEU A CB  1 
ATOM   835  C CG  . LEU A 1 109 ? 32.384 -11.263 38.167 1.00 24.30  ? 105 LEU A CG  1 
ATOM   836  C CD1 . LEU A 1 109 ? 31.705 -12.606 37.935 1.00 24.30  ? 105 LEU A CD1 1 
ATOM   837  C CD2 . LEU A 1 109 ? 33.706 -11.191 37.416 1.00 24.30  ? 105 LEU A CD2 1 
ATOM   838  N N   . ILE A 1 110 ? 31.633 -7.137  36.219 1.00 28.86  ? 106 ILE A N   1 
ATOM   839  C CA  . ILE A 1 110 ? 30.883 -6.124  35.510 1.00 28.86  ? 106 ILE A CA  1 
ATOM   840  C C   . ILE A 1 110 ? 30.426 -6.703  34.183 1.00 28.86  ? 106 ILE A C   1 
ATOM   841  O O   . ILE A 1 110 ? 31.200 -7.345  33.476 1.00 28.86  ? 106 ILE A O   1 
ATOM   842  C CB  . ILE A 1 110 ? 31.755 -4.877  35.256 1.00 20.51  ? 106 ILE A CB  1 
ATOM   843  C CG1 . ILE A 1 110 ? 32.381 -4.409  36.569 1.00 20.51  ? 106 ILE A CG1 1 
ATOM   844  C CG2 . ILE A 1 110 ? 30.917 -3.762  34.660 1.00 20.51  ? 106 ILE A CG2 1 
ATOM   845  C CD1 . ILE A 1 110 ? 33.418 -3.327  36.396 1.00 20.51  ? 106 ILE A CD1 1 
ATOM   846  N N   . CYS A 1 111 ? 29.157 -6.510  33.860 1.00 23.96  ? 107 CYS A N   1 
ATOM   847  C CA  . CYS A 1 111 ? 28.645 -6.989  32.589 1.00 23.96  ? 107 CYS A CA  1 
ATOM   848  C C   . CYS A 1 111 ? 28.295 -5.750  31.781 1.00 23.96  ? 107 CYS A C   1 
ATOM   849  O O   . CYS A 1 111 ? 27.393 -4.985  32.137 1.00 23.96  ? 107 CYS A O   1 
ATOM   850  C CB  . CYS A 1 111 ? 27.401 -7.860  32.767 1.00 26.41  ? 107 CYS A CB  1 
ATOM   851  S SG  . CYS A 1 111 ? 26.892 -8.685  31.219 1.00 26.41  ? 107 CYS A SG  1 
ATOM   852  N N   . PHE A 1 112 ? 29.040 -5.548  30.707 1.00 14.28  ? 108 PHE A N   1 
ATOM   853  C CA  . PHE A 1 112 ? 28.844 -4.408  29.840 1.00 14.28  ? 108 PHE A CA  1 
ATOM   854  C C   . PHE A 1 112 ? 28.046 -4.875  28.623 1.00 14.28  ? 108 PHE A C   1 
ATOM   855  O O   . PHE A 1 112 ? 28.448 -5.816  27.933 1.00 14.28  ? 108 PHE A O   1 
ATOM   856  C CB  . PHE A 1 112 ? 30.211 -3.854  29.421 1.00 19.30  ? 108 PHE A CB  1 
ATOM   857  C CG  . PHE A 1 112 ? 30.132 -2.757  28.402 1.00 19.30  ? 108 PHE A CG  1 
ATOM   858  C CD1 . PHE A 1 112 ? 29.736 -1.472  28.770 1.00 19.30  ? 108 PHE A CD1 1 
ATOM   859  C CD2 . PHE A 1 112 ? 30.420 -3.015  27.062 1.00 19.30  ? 108 PHE A CD2 1 
ATOM   860  C CE1 . PHE A 1 112 ? 29.626 -0.458  27.823 1.00 19.30  ? 108 PHE A CE1 1 
ATOM   861  C CE2 . PHE A 1 112 ? 30.310 -2.005  26.104 1.00 19.30  ? 108 PHE A CE2 1 
ATOM   862  C CZ  . PHE A 1 112 ? 29.911 -0.723  26.487 1.00 19.30  ? 108 PHE A CZ  1 
ATOM   863  N N   . VAL A 1 113 ? 26.910 -4.236  28.370 1.00 14.20  ? 109 VAL A N   1 
ATOM   864  C CA  . VAL A 1 113 ? 26.068 -4.607  27.234 1.00 14.20  ? 109 VAL A CA  1 
ATOM   865  C C   . VAL A 1 113 ? 25.936 -3.387  26.336 1.00 14.20  ? 109 VAL A C   1 
ATOM   866  O O   . VAL A 1 113 ? 25.569 -2.310  26.801 1.00 14.20  ? 109 VAL A O   1 
ATOM   867  C CB  . VAL A 1 113 ? 24.659 -5.055  27.700 1.00 15.00  ? 109 VAL A CB  1 
ATOM   868  C CG1 . VAL A 1 113 ? 23.908 -5.696  26.548 1.00 15.00  ? 109 VAL A CG1 1 
ATOM   869  C CG2 . VAL A 1 113 ? 24.780 -6.021  28.872 1.00 15.00  ? 109 VAL A CG2 1 
ATOM   870  N N   . ASP A 1 114 ? 26.222 -3.564  25.052 1.00 21.29  ? 110 ASP A N   1 
ATOM   871  C CA  . ASP A 1 114 ? 26.175 -2.465  24.100 1.00 21.29  ? 110 ASP A CA  1 
ATOM   872  C C   . ASP A 1 114 ? 25.294 -2.786  22.885 1.00 21.29  ? 110 ASP A C   1 
ATOM   873  O O   . ASP A 1 114 ? 24.899 -3.929  22.672 1.00 21.29  ? 110 ASP A O   1 
ATOM   874  C CB  . ASP A 1 114 ? 27.607 -2.145  23.658 1.00 33.57  ? 110 ASP A CB  1 
ATOM   875  C CG  . ASP A 1 114 ? 27.771 -0.718  23.194 1.00 33.57  ? 110 ASP A CG  1 
ATOM   876  O OD1 . ASP A 1 114 ? 26.810 0.067   23.339 1.00 33.57  ? 110 ASP A OD1 1 
ATOM   877  O OD2 . ASP A 1 114 ? 28.865 -0.378  22.693 1.00 33.57  ? 110 ASP A OD2 1 
ATOM   878  N N   . ASN A 1 115 ? 25.002 -1.770  22.082 1.00 19.93  ? 111 ASN A N   1 
ATOM   879  C CA  . ASN A 1 115 ? 24.166 -1.932  20.903 1.00 19.93  ? 111 ASN A CA  1 
ATOM   880  C C   . ASN A 1 115 ? 22.767 -2.383  21.324 1.00 19.93  ? 111 ASN A C   1 
ATOM   881  O O   . ASN A 1 115 ? 22.200 -3.342  20.786 1.00 19.93  ? 111 ASN A O   1 
ATOM   882  C CB  . ASN A 1 115 ? 24.776 -2.938  19.927 1.00 32.11  ? 111 ASN A CB  1 
ATOM   883  C CG  . ASN A 1 115 ? 24.100 -2.900  18.564 1.00 32.11  ? 111 ASN A CG  1 
ATOM   884  O OD1 . ASN A 1 115 ? 23.847 -1.820  18.018 1.00 32.11  ? 111 ASN A OD1 1 
ATOM   885  N ND2 . ASN A 1 115 ? 23.809 -4.071  18.006 1.00 32.11  ? 111 ASN A ND2 1 
ATOM   886  N N   . ILE A 1 116 ? 22.220 -1.668  22.298 1.00 23.35  ? 112 ILE A N   1 
ATOM   887  C CA  . ILE A 1 116 ? 20.897 -1.962  22.816 1.00 23.35  ? 112 ILE A CA  1 
ATOM   888  C C   . ILE A 1 116 ? 19.850 -1.063  22.169 1.00 23.35  ? 112 ILE A C   1 
ATOM   889  O O   . ILE A 1 116 ? 19.909 0.162   22.298 1.00 23.35  ? 112 ILE A O   1 
ATOM   890  C CB  . ILE A 1 116 ? 20.845 -1.739  24.323 1.00 18.94  ? 112 ILE A CB  1 
ATOM   891  C CG1 . ILE A 1 116 ? 21.988 -2.506  24.995 1.00 18.94  ? 112 ILE A CG1 1 
ATOM   892  C CG2 . ILE A 1 116 ? 19.485 -2.157  24.847 1.00 18.94  ? 112 ILE A CG2 1 
ATOM   893  C CD1 . ILE A 1 116 ? 22.100 -2.268  26.481 1.00 18.94  ? 112 ILE A CD1 1 
ATOM   894  N N   . PHE A 1 117 ? 18.894 -1.671  21.474 1.00 21.07  ? 113 PHE A N   1 
ATOM   895  C CA  . PHE A 1 117 ? 17.843 -0.901  20.833 1.00 21.07  ? 113 PHE A CA  1 
ATOM   896  C C   . PHE A 1 117 ? 16.719 -1.780  20.316 1.00 21.07  ? 113 PHE A C   1 
ATOM   897  O O   . PHE A 1 117 ? 16.954 -2.742  19.588 1.00 21.07  ? 113 PHE A O   1 
ATOM   898  C CB  . PHE A 1 117 ? 18.403 -0.089  19.669 1.00 24.38  ? 113 PHE A CB  1 
ATOM   899  C CG  . PHE A 1 117 ? 17.483 0.990   19.207 1.00 24.38  ? 113 PHE A CG  1 
ATOM   900  C CD1 . PHE A 1 117 ? 17.437 2.212   19.870 1.00 24.38  ? 113 PHE A CD1 1 
ATOM   901  C CD2 . PHE A 1 117 ? 16.632 0.783   18.129 1.00 24.38  ? 113 PHE A CD2 1 
ATOM   902  C CE1 . PHE A 1 117 ? 16.551 3.215   19.463 1.00 24.38  ? 113 PHE A CE1 1 
ATOM   903  C CE2 . PHE A 1 117 ? 15.744 1.785   17.723 1.00 24.38  ? 113 PHE A CE2 1 
ATOM   904  C CZ  . PHE A 1 117 ? 15.707 2.998   18.391 1.00 24.38  ? 113 PHE A CZ  1 
ATOM   905  N N   . PRO A 1 118 ? 15.477 -1.453  20.682 1.00 30.63  ? 114 PRO A N   1 
ATOM   906  C CA  . PRO A 1 118 ? 15.193 -0.315  21.553 1.00 30.63  ? 114 PRO A CA  1 
ATOM   907  C C   . PRO A 1 118 ? 15.687 -0.548  22.977 1.00 30.63  ? 114 PRO A C   1 
ATOM   908  O O   . PRO A 1 118 ? 16.130 -1.638  23.316 1.00 30.63  ? 114 PRO A O   1 
ATOM   909  C CB  . PRO A 1 118 ? 13.664 -0.171  21.452 1.00 20.90  ? 114 PRO A CB  1 
ATOM   910  C CG  . PRO A 1 118 ? 13.208 -1.518  21.079 1.00 20.90  ? 114 PRO A CG  1 
ATOM   911  C CD  . PRO A 1 118 ? 14.235 -1.953  20.075 1.00 20.90  ? 114 PRO A CD  1 
ATOM   912  N N   . PRO A 1 119 ? 15.640 0.489   23.818 1.00 21.53  ? 115 PRO A N   1 
ATOM   913  C CA  . PRO A 1 119 ? 16.081 0.405   25.212 1.00 21.53  ? 115 PRO A CA  1 
ATOM   914  C C   . PRO A 1 119 ? 15.148 -0.335  26.188 1.00 21.53  ? 115 PRO A C   1 
ATOM   915  O O   . PRO A 1 119 ? 14.572 0.266   27.084 1.00 21.53  ? 115 PRO A O   1 
ATOM   916  C CB  . PRO A 1 119 ? 16.280 1.870   25.596 1.00 18.17  ? 115 PRO A CB  1 
ATOM   917  C CG  . PRO A 1 119 ? 15.214 2.545   24.812 1.00 18.17  ? 115 PRO A CG  1 
ATOM   918  C CD  . PRO A 1 119 ? 15.327 1.881   23.453 1.00 18.17  ? 115 PRO A CD  1 
ATOM   919  N N   . VAL A 1 120 ? 15.020 -1.642  25.988 1.00 30.99  ? 116 VAL A N   1 
ATOM   920  C CA  . VAL A 1 120 ? 14.232 -2.533  26.840 1.00 30.99  ? 116 VAL A CA  1 
ATOM   921  C C   . VAL A 1 120 ? 15.122 -3.771  26.911 1.00 30.99  ? 116 VAL A C   1 
ATOM   922  O O   . VAL A 1 120 ? 15.512 -4.305  25.870 1.00 30.99  ? 116 VAL A O   1 
ATOM   923  C CB  . VAL A 1 120 ? 12.871 -2.920  26.199 1.00 37.50  ? 116 VAL A CB  1 
ATOM   924  C CG1 . VAL A 1 120 ? 12.117 -3.881  27.114 1.00 37.50  ? 116 VAL A CG1 1 
ATOM   925  C CG2 . VAL A 1 120 ? 12.036 -1.675  25.960 1.00 37.50  ? 116 VAL A CG2 1 
ATOM   926  N N   . ILE A 1 121 ? 15.448 -4.237  28.115 1.00 30.44  ? 117 ILE A N   1 
ATOM   927  C CA  . ILE A 1 121 ? 16.357 -5.380  28.210 1.00 30.44  ? 117 ILE A CA  1 
ATOM   928  C C   . ILE A 1 121 ? 16.377 -6.090  29.564 1.00 30.44  ? 117 ILE A C   1 
ATOM   929  O O   . ILE A 1 121 ? 16.124 -5.482  30.599 1.00 30.44  ? 117 ILE A O   1 
ATOM   930  C CB  . ILE A 1 121 ? 17.801 -4.919  27.873 1.00 9.38   ? 117 ILE A CB  1 
ATOM   931  C CG1 . ILE A 1 121 ? 18.641 -6.093  27.378 1.00 9.38   ? 117 ILE A CG1 1 
ATOM   932  C CG2 . ILE A 1 121 ? 18.439 -4.298  29.103 1.00 9.38   ? 117 ILE A CG2 1 
ATOM   933  C CD1 . ILE A 1 121 ? 19.987 -5.657  26.810 1.00 9.38   ? 117 ILE A CD1 1 
ATOM   934  N N   . ASN A 1 122 ? 16.695 -7.383  29.533 1.00 26.06  ? 118 ASN A N   1 
ATOM   935  C CA  . ASN A 1 122 ? 16.776 -8.222  30.728 1.00 26.06  ? 118 ASN A CA  1 
ATOM   936  C C   . ASN A 1 122 ? 18.207 -8.705  30.970 1.00 26.06  ? 118 ASN A C   1 
ATOM   937  O O   . ASN A 1 122 ? 18.700 -9.582  30.254 1.00 26.06  ? 118 ASN A O   1 
ATOM   938  C CB  . ASN A 1 122 ? 15.872 -9.449  30.584 1.00 57.97  ? 118 ASN A CB  1 
ATOM   939  C CG  . ASN A 1 122 ? 14.574 -9.306  31.332 1.00 57.97  ? 118 ASN A CG  1 
ATOM   940  O OD1 . ASN A 1 122 ? 14.565 -8.905  32.494 1.00 57.97  ? 118 ASN A OD1 1 
ATOM   941  N ND2 . ASN A 1 122 ? 13.465 -9.648  30.679 1.00 57.97  ? 118 ASN A ND2 1 
ATOM   942  N N   . ILE A 1 123 ? 18.874 -8.138  31.968 1.00 17.24  ? 119 ILE A N   1 
ATOM   943  C CA  . ILE A 1 123 ? 20.237 -8.558  32.282 1.00 17.24  ? 119 ILE A CA  1 
ATOM   944  C C   . ILE A 1 123 ? 20.228 -9.258  33.629 1.00 17.24  ? 119 ILE A C   1 
ATOM   945  O O   . ILE A 1 123 ? 19.860 -8.665  34.650 1.00 17.24  ? 119 ILE A O   1 
ATOM   946  C CB  . ILE A 1 123 ? 21.207 -7.358  32.328 1.00 14.29  ? 119 ILE A CB  1 
ATOM   947  C CG1 . ILE A 1 123 ? 21.254 -6.687  30.950 1.00 14.29  ? 119 ILE A CG1 1 
ATOM   948  C CG2 . ILE A 1 123 ? 22.591 -7.825  32.721 1.00 14.29  ? 119 ILE A CG2 1 
ATOM   949  C CD1 . ILE A 1 123 ? 22.111 -5.454  30.880 1.00 14.29  ? 119 ILE A CD1 1 
ATOM   950  N N   . THR A 1 124 ? 20.621 -10.524 33.641 1.00 32.04  ? 120 THR A N   1 
ATOM   951  C CA  . THR A 1 124 ? 20.616 -11.276 34.887 1.00 32.04  ? 120 THR A CA  1 
ATOM   952  C C   . THR A 1 124 ? 21.897 -12.054 35.118 1.00 32.04  ? 120 THR A C   1 
ATOM   953  O O   . THR A 1 124 ? 22.680 -12.265 34.200 1.00 32.04  ? 120 THR A O   1 
ATOM   954  C CB  . THR A 1 124 ? 19.423 -12.247 34.922 1.00 25.10  ? 120 THR A CB  1 
ATOM   955  O OG1 . THR A 1 124 ? 19.448 -13.062 33.746 1.00 25.10  ? 120 THR A OG1 1 
ATOM   956  C CG2 . THR A 1 124 ? 18.116 -11.479 34.959 1.00 25.10  ? 120 THR A CG2 1 
ATOM   957  N N   . TRP A 1 125 ? 22.110 -12.482 36.353 1.00 22.78  ? 121 TRP A N   1 
ATOM   958  C CA  . TRP A 1 125 ? 23.309 -13.230 36.678 1.00 22.78  ? 121 TRP A CA  1 
ATOM   959  C C   . TRP A 1 125 ? 23.016 -14.643 37.156 1.00 22.78  ? 121 TRP A C   1 
ATOM   960  O O   . TRP A 1 125 ? 21.993 -14.911 37.790 1.00 22.78  ? 121 TRP A O   1 
ATOM   961  C CB  . TRP A 1 125 ? 24.109 -12.516 37.767 1.00 23.47  ? 121 TRP A CB  1 
ATOM   962  C CG  . TRP A 1 125 ? 24.728 -11.224 37.364 1.00 23.47  ? 121 TRP A CG  1 
ATOM   963  C CD1 . TRP A 1 125 ? 24.212 -9.971  37.545 1.00 23.47  ? 121 TRP A CD1 1 
ATOM   964  C CD2 . TRP A 1 125 ? 26.020 -11.047 36.771 1.00 23.47  ? 121 TRP A CD2 1 
ATOM   965  N NE1 . TRP A 1 125 ? 25.108 -9.022  37.111 1.00 23.47  ? 121 TRP A NE1 1 
ATOM   966  C CE2 . TRP A 1 125 ? 26.227 -9.652  36.631 1.00 23.47  ? 121 TRP A CE2 1 
ATOM   967  C CE3 . TRP A 1 125 ? 27.028 -11.931 36.348 1.00 23.47  ? 121 TRP A CE3 1 
ATOM   968  C CZ2 . TRP A 1 125 ? 27.406 -9.116  36.086 1.00 23.47  ? 121 TRP A CZ2 1 
ATOM   969  C CZ3 . TRP A 1 125 ? 28.202 -11.397 35.804 1.00 23.47  ? 121 TRP A CZ3 1 
ATOM   970  C CH2 . TRP A 1 125 ? 28.378 -10.000 35.681 1.00 23.47  ? 121 TRP A CH2 1 
ATOM   971  N N   . LEU A 1 126 ? 23.931 -15.549 36.852 1.00 27.55  ? 122 LEU A N   1 
ATOM   972  C CA  . LEU A 1 126 ? 23.793 -16.924 37.290 1.00 27.55  ? 122 LEU A CA  1 
ATOM   973  C C   . LEU A 1 126 ? 25.098 -17.340 37.920 1.00 27.55  ? 122 LEU A C   1 
ATOM   974  O O   . LEU A 1 126 ? 26.177 -16.991 37.430 1.00 27.55  ? 122 LEU A O   1 
ATOM   975  C CB  . LEU A 1 126 ? 23.486 -17.857 36.118 1.00 33.85  ? 122 LEU A CB  1 
ATOM   976  C CG  . LEU A 1 126 ? 22.010 -18.108 35.813 1.00 33.85  ? 122 LEU A CG  1 
ATOM   977  C CD1 . LEU A 1 126 ? 21.333 -16.803 35.447 1.00 33.85  ? 122 LEU A CD1 1 
ATOM   978  C CD2 . LEU A 1 126 ? 21.885 -19.103 34.676 1.00 33.85  ? 122 LEU A CD2 1 
ATOM   979  N N   . ARG A 1 127 ? 24.998 -18.060 39.029 1.00 28.59  ? 123 ARG A N   1 
ATOM   980  C CA  . ARG A 1 127 ? 26.177 -18.563 39.711 1.00 28.59  ? 123 ARG A CA  1 
ATOM   981  C C   . ARG A 1 127 ? 26.031 -20.079 39.651 1.00 28.59  ? 123 ARG A C   1 
ATOM   982  O O   . ARG A 1 127 ? 25.117 -20.646 40.241 1.00 28.59  ? 123 ARG A O   1 
ATOM   983  C CB  . ARG A 1 127 ? 26.216 -18.074 41.159 1.00 38.71  ? 123 ARG A CB  1 
ATOM   984  C CG  . ARG A 1 127 ? 27.389 -18.630 41.922 1.00 38.71  ? 123 ARG A CG  1 
ATOM   985  C CD  . ARG A 1 127 ? 27.546 -18.001 43.281 1.00 38.71  ? 123 ARG A CD  1 
ATOM   986  N NE  . ARG A 1 127 ? 28.577 -18.694 44.045 1.00 38.71  ? 123 ARG A NE  1 
ATOM   987  C CZ  . ARG A 1 127 ? 28.468 -19.952 44.467 1.00 38.71  ? 123 ARG A CZ  1 
ATOM   988  N NH1 . ARG A 1 127 ? 27.373 -20.655 44.201 1.00 38.71  ? 123 ARG A NH1 1 
ATOM   989  N NH2 . ARG A 1 127 ? 29.450 -20.510 45.162 1.00 38.71  ? 123 ARG A NH2 1 
ATOM   990  N N   . ASN A 1 128 ? 26.925 -20.731 38.923 1.00 34.31  ? 124 ASN A N   1 
ATOM   991  C CA  . ASN A 1 128 ? 26.846 -22.171 38.761 1.00 34.31  ? 124 ASN A CA  1 
ATOM   992  C C   . ASN A 1 128 ? 25.452 -22.501 38.228 1.00 34.31  ? 124 ASN A C   1 
ATOM   993  O O   . ASN A 1 128 ? 24.739 -23.361 38.747 1.00 34.31  ? 124 ASN A O   1 
ATOM   994  C CB  . ASN A 1 128 ? 27.107 -22.881 40.085 1.00 30.39  ? 124 ASN A CB  1 
ATOM   995  C CG  . ASN A 1 128 ? 28.449 -22.517 40.679 1.00 30.39  ? 124 ASN A CG  1 
ATOM   996  O OD1 . ASN A 1 128 ? 29.419 -22.278 39.961 1.00 30.39  ? 124 ASN A OD1 1 
ATOM   997  N ND2 . ASN A 1 128 ? 28.516 -22.485 42.003 1.00 30.39  ? 124 ASN A ND2 1 
ATOM   998  N N   . SER A 1 129 ? 25.077 -21.772 37.187 1.00 39.23  ? 125 SER A N   1 
ATOM   999  C CA  . SER A 1 129 ? 23.802 -21.944 36.523 1.00 39.23  ? 125 SER A CA  1 
ATOM   1000 C C   . SER A 1 129 ? 22.604 -21.832 37.447 1.00 39.23  ? 125 SER A C   1 
ATOM   1001 O O   . SER A 1 129 ? 21.550 -22.401 37.185 1.00 39.23  ? 125 SER A O   1 
ATOM   1002 C CB  . SER A 1 129 ? 23.788 -23.278 35.789 1.00 61.76  ? 125 SER A CB  1 
ATOM   1003 O OG  . SER A 1 129 ? 24.782 -23.295 34.773 1.00 61.76  ? 125 SER A OG  1 
ATOM   1004 N N   . LYS A 1 130 ? 22.775 -21.092 38.535 1.00 37.60  ? 126 LYS A N   1 
ATOM   1005 C CA  . LYS A 1 130 ? 21.694 -20.863 39.479 1.00 37.60  ? 126 LYS A CA  1 
ATOM   1006 C C   . LYS A 1 130 ? 21.459 -19.361 39.582 1.00 37.60  ? 126 LYS A C   1 
ATOM   1007 O O   . LYS A 1 130 ? 22.388 -18.584 39.802 1.00 37.60  ? 126 LYS A O   1 
ATOM   1008 C CB  . LYS A 1 130 ? 22.034 -21.454 40.853 1.00 64.83  ? 126 LYS A CB  1 
ATOM   1009 C CG  . LYS A 1 130 ? 21.735 -22.943 40.951 1.00 64.83  ? 126 LYS A CG  1 
ATOM   1010 C CD  . LYS A 1 130 ? 22.049 -23.518 42.324 1.00 64.83  ? 126 LYS A CD  1 
ATOM   1011 C CE  . LYS A 1 130 ? 23.544 -23.731 42.519 1.00 64.83  ? 126 LYS A CE  1 
ATOM   1012 N NZ  . LYS A 1 130 ? 24.103 -24.688 41.519 1.00 64.83  ? 126 LYS A NZ  1 
ATOM   1013 N N   . SER A 1 131 ? 20.209 -18.963 39.402 1.00 34.15  ? 127 SER A N   1 
ATOM   1014 C CA  . SER A 1 131 ? 19.810 -17.565 39.457 1.00 34.15  ? 127 SER A CA  1 
ATOM   1015 C C   . SER A 1 131 ? 20.268 -16.802 40.701 1.00 34.15  ? 127 SER A C   1 
ATOM   1016 O O   . SER A 1 131 ? 20.195 -17.311 41.823 1.00 34.15  ? 127 SER A O   1 
ATOM   1017 C CB  . SER A 1 131 ? 18.293 -17.480 39.343 1.00 48.14  ? 127 SER A CB  1 
ATOM   1018 O OG  . SER A 1 131 ? 17.852 -16.167 39.594 1.00 48.14  ? 127 SER A OG  1 
ATOM   1019 N N   . VAL A 1 132 ? 20.726 -15.570 40.487 1.00 39.20  ? 128 VAL A N   1 
ATOM   1020 C CA  . VAL A 1 132 ? 21.201 -14.694 41.560 1.00 39.20  ? 128 VAL A CA  1 
ATOM   1021 C C   . VAL A 1 132 ? 20.528 -13.326 41.453 1.00 39.20  ? 128 VAL A C   1 
ATOM   1022 O O   . VAL A 1 132 ? 20.757 -12.596 40.492 1.00 39.20  ? 128 VAL A O   1 
ATOM   1023 C CB  . VAL A 1 132 ? 22.729 -14.511 41.473 1.00 45.59  ? 128 VAL A CB  1 
ATOM   1024 C CG1 . VAL A 1 132 ? 23.180 -13.374 42.374 1.00 45.59  ? 128 VAL A CG1 1 
ATOM   1025 C CG2 . VAL A 1 132 ? 23.415 -15.802 41.870 1.00 45.59  ? 128 VAL A CG2 1 
ATOM   1026 N N   . THR A 1 133 ? 19.707 -12.982 42.441 1.00 64.56  ? 129 THR A N   1 
ATOM   1027 C CA  . THR A 1 133 ? 18.980 -11.710 42.436 1.00 64.56  ? 129 THR A CA  1 
ATOM   1028 C C   . THR A 1 133 ? 19.458 -10.722 43.490 1.00 64.56  ? 129 THR A C   1 
ATOM   1029 O O   . THR A 1 133 ? 19.280 -9.510  43.346 1.00 64.56  ? 129 THR A O   1 
ATOM   1030 C CB  . THR A 1 133 ? 17.481 -11.929 42.675 1.00 68.49  ? 129 THR A CB  1 
ATOM   1031 O OG1 . THR A 1 133 ? 17.295 -12.630 43.913 1.00 68.49  ? 129 THR A OG1 1 
ATOM   1032 C CG2 . THR A 1 133 ? 16.871 -12.728 41.537 1.00 68.49  ? 129 THR A CG2 1 
ATOM   1033 N N   . ASP A 1 134 ? 20.051 -11.243 44.555 1.00 34.08  ? 130 ASP A N   1 
ATOM   1034 C CA  . ASP A 1 134 ? 20.540 -10.401 45.635 1.00 34.08  ? 130 ASP A CA  1 
ATOM   1035 C C   . ASP A 1 134 ? 21.931 -9.853  45.373 1.00 34.08  ? 130 ASP A C   1 
ATOM   1036 O O   . ASP A 1 134 ? 22.796 -10.548 44.827 1.00 34.08  ? 130 ASP A O   1 
ATOM   1037 C CB  . ASP A 1 134 ? 20.547 -11.173 46.957 1.00 68.77  ? 130 ASP A CB  1 
ATOM   1038 C CG  . ASP A 1 134 ? 19.599 -10.582 47.975 1.00 68.77  ? 130 ASP A CG  1 
ATOM   1039 O OD1 . ASP A 1 134 ? 18.371 -10.726 47.797 1.00 68.77  ? 130 ASP A OD1 1 
ATOM   1040 O OD2 . ASP A 1 134 ? 20.084 -9.960  48.945 1.00 68.77  ? 130 ASP A OD2 1 
ATOM   1041 N N   . GLY A 1 135 ? 22.127 -8.599  45.779 1.00 50.41  ? 131 GLY A N   1 
ATOM   1042 C CA  . GLY A 1 135 ? 23.409 -7.938  45.619 1.00 50.41  ? 131 GLY A CA  1 
ATOM   1043 C C   . GLY A 1 135 ? 23.771 -7.654  44.180 1.00 50.41  ? 131 GLY A C   1 
ATOM   1044 O O   . GLY A 1 135 ? 24.937 -7.775  43.782 1.00 50.41  ? 131 GLY A O   1 
ATOM   1045 N N   . VAL A 1 136 ? 22.762 -7.281  43.400 1.00 21.32  ? 132 VAL A N   1 
ATOM   1046 C CA  . VAL A 1 136 ? 22.943 -6.970  41.991 1.00 21.32  ? 132 VAL A CA  1 
ATOM   1047 C C   . VAL A 1 136 ? 22.530 -5.526  41.733 1.00 21.32  ? 132 VAL A C   1 
ATOM   1048 O O   . VAL A 1 136 ? 21.469 -5.098  42.170 1.00 21.32  ? 132 VAL A O   1 
ATOM   1049 C CB  . VAL A 1 136 ? 22.085 -7.897  41.103 1.00 18.60  ? 132 VAL A CB  1 
ATOM   1050 C CG1 . VAL A 1 136 ? 22.119 -7.417  39.657 1.00 18.60  ? 132 VAL A CG1 1 
ATOM   1051 C CG2 . VAL A 1 136 ? 22.593 -9.322  41.195 1.00 18.60  ? 132 VAL A CG2 1 
ATOM   1052 N N   . TYR A 1 137 ? 23.375 -4.781  41.029 1.00 16.12  ? 133 TYR A N   1 
ATOM   1053 C CA  . TYR A 1 137 ? 23.081 -3.391  40.707 1.00 16.12  ? 133 TYR A CA  1 
ATOM   1054 C C   . TYR A 1 137 ? 23.068 -3.183  39.191 1.00 16.12  ? 133 TYR A C   1 
ATOM   1055 O O   . TYR A 1 137 ? 23.835 -3.810  38.460 1.00 16.12  ? 133 TYR A O   1 
ATOM   1056 C CB  . TYR A 1 137 ? 24.113 -2.458  41.349 1.00 28.32  ? 133 TYR A CB  1 
ATOM   1057 C CG  . TYR A 1 137 ? 23.807 -1.006  41.095 1.00 28.32  ? 133 TYR A CG  1 
ATOM   1058 C CD1 . TYR A 1 137 ? 22.774 -0.355  41.783 1.00 28.32  ? 133 TYR A CD1 1 
ATOM   1059 C CD2 . TYR A 1 137 ? 24.486 -0.298  40.101 1.00 28.32  ? 133 TYR A CD2 1 
ATOM   1060 C CE1 . TYR A 1 137 ? 22.425 0.966   41.477 1.00 28.32  ? 133 TYR A CE1 1 
ATOM   1061 C CE2 . TYR A 1 137 ? 24.144 1.018   39.784 1.00 28.32  ? 133 TYR A CE2 1 
ATOM   1062 C CZ  . TYR A 1 137 ? 23.113 1.641   40.474 1.00 28.32  ? 133 TYR A CZ  1 
ATOM   1063 O OH  . TYR A 1 137 ? 22.771 2.930   40.139 1.00 28.32  ? 133 TYR A OH  1 
ATOM   1064 N N   . GLU A 1 138 ? 22.205 -2.287  38.724 1.00 32.97  ? 134 GLU A N   1 
ATOM   1065 C CA  . GLU A 1 138 ? 22.102 -2.025  37.290 1.00 32.97  ? 134 GLU A CA  1 
ATOM   1066 C C   . GLU A 1 138 ? 22.021 -0.528  36.989 1.00 32.97  ? 134 GLU A C   1 
ATOM   1067 O O   . GLU A 1 138 ? 21.207 0.187   37.574 1.00 32.97  ? 134 GLU A O   1 
ATOM   1068 C CB  . GLU A 1 138 ? 20.858 -2.732  36.734 1.00 44.18  ? 134 GLU A CB  1 
ATOM   1069 C CG  . GLU A 1 138 ? 20.818 -2.891  35.221 1.00 44.18  ? 134 GLU A CG  1 
ATOM   1070 C CD  . GLU A 1 138 ? 19.572 -3.639  34.738 1.00 44.18  ? 134 GLU A CD  1 
ATOM   1071 O OE1 . GLU A 1 138 ? 18.476 -3.036  34.720 1.00 44.18  ? 134 GLU A OE1 1 
ATOM   1072 O OE2 . GLU A 1 138 ? 19.685 -4.834  34.380 1.00 44.18  ? 134 GLU A OE2 1 
ATOM   1073 N N   . THR A 1 139 ? 22.871 -0.055  36.081 1.00 20.36  ? 135 THR A N   1 
ATOM   1074 C CA  . THR A 1 139 ? 22.859 1.354   35.690 1.00 20.36  ? 135 THR A CA  1 
ATOM   1075 C C   . THR A 1 139 ? 21.625 1.626   34.827 1.00 20.36  ? 135 THR A C   1 
ATOM   1076 O O   . THR A 1 139 ? 20.869 0.713   34.502 1.00 20.36  ? 135 THR A O   1 
ATOM   1077 C CB  . THR A 1 139 ? 24.097 1.734   34.845 1.00 23.74  ? 135 THR A CB  1 
ATOM   1078 O OG1 . THR A 1 139 ? 24.011 1.107   33.559 1.00 23.74  ? 135 THR A OG1 1 
ATOM   1079 C CG2 . THR A 1 139 ? 25.362 1.282   35.523 1.00 23.74  ? 135 THR A CG2 1 
ATOM   1080 N N   . SER A 1 140 ? 21.423 2.887   34.465 1.00 29.21  ? 136 SER A N   1 
ATOM   1081 C CA  . SER A 1 140 ? 20.306 3.259   33.613 1.00 29.21  ? 136 SER A CA  1 
ATOM   1082 C C   . SER A 1 140 ? 20.752 2.956   32.189 1.00 29.21  ? 136 SER A C   1 
ATOM   1083 O O   . SER A 1 140 ? 21.868 2.478   31.976 1.00 29.21  ? 136 SER A O   1 
ATOM   1084 C CB  . SER A 1 140 ? 20.009 4.757   33.740 1.00 15.92  ? 136 SER A CB  1 
ATOM   1085 O OG  . SER A 1 140 ? 19.476 5.072   35.014 1.00 15.92  ? 136 SER A OG  1 
ATOM   1086 N N   . PHE A 1 141 ? 19.881 3.208   31.217 1.00 22.30  ? 137 PHE A N   1 
ATOM   1087 C CA  . PHE A 1 141 ? 20.259 2.993   29.830 1.00 22.30  ? 137 PHE A CA  1 
ATOM   1088 C C   . PHE A 1 141 ? 21.105 4.223   29.473 1.00 22.30  ? 137 PHE A C   1 
ATOM   1089 O O   . PHE A 1 141 ? 20.635 5.355   29.553 1.00 22.30  ? 137 PHE A O   1 
ATOM   1090 C CB  . PHE A 1 141 ? 19.017 2.928   28.931 1.00 16.71  ? 137 PHE A CB  1 
ATOM   1091 C CG  . PHE A 1 141 ? 18.268 1.619   28.990 1.00 16.71  ? 137 PHE A CG  1 
ATOM   1092 C CD1 . PHE A 1 141 ? 18.640 0.550   28.178 1.00 16.71  ? 137 PHE A CD1 1 
ATOM   1093 C CD2 . PHE A 1 141 ? 17.154 1.471   29.823 1.00 16.71  ? 137 PHE A CD2 1 
ATOM   1094 C CE1 . PHE A 1 141 ? 17.916 -0.642  28.186 1.00 16.71  ? 137 PHE A CE1 1 
ATOM   1095 C CE2 . PHE A 1 141 ? 16.422 0.287   29.844 1.00 16.71  ? 137 PHE A CE2 1 
ATOM   1096 C CZ  . PHE A 1 141 ? 16.805 -0.772  29.022 1.00 16.71  ? 137 PHE A CZ  1 
ATOM   1097 N N   . LEU A 1 142 ? 22.354 4.009   29.093 1.00 24.69  ? 138 LEU A N   1 
ATOM   1098 C CA  . LEU A 1 142 ? 23.229 5.124   28.745 1.00 24.69  ? 138 LEU A CA  1 
ATOM   1099 C C   . LEU A 1 142 ? 23.352 5.309   27.230 1.00 24.69  ? 138 LEU A C   1 
ATOM   1100 O O   . LEU A 1 142 ? 23.652 4.372   26.473 1.00 24.69  ? 138 LEU A O   1 
ATOM   1101 C CB  . LEU A 1 142 ? 24.596 4.925   29.401 1.00 22.10  ? 138 LEU A CB  1 
ATOM   1102 C CG  . LEU A 1 142 ? 24.463 4.734   30.924 1.00 22.10  ? 138 LEU A CG  1 
ATOM   1103 C CD1 . LEU A 1 142 ? 25.813 4.479   31.556 1.00 22.10  ? 138 LEU A CD1 1 
ATOM   1104 C CD2 . LEU A 1 142 ? 23.812 5.965   31.532 1.00 22.10  ? 138 LEU A CD2 1 
ATOM   1105 N N   . VAL A 1 143 ? 23.109 6.542   26.806 1.00 23.35  ? 139 VAL A N   1 
ATOM   1106 C CA  . VAL A 1 143 ? 23.119 6.916   25.401 1.00 23.35  ? 139 VAL A CA  1 
ATOM   1107 C C   . VAL A 1 143 ? 24.426 6.773   24.645 1.00 23.35  ? 139 VAL A C   1 
ATOM   1108 O O   . VAL A 1 143 ? 25.498 7.064   25.166 1.00 23.35  ? 139 VAL A O   1 
ATOM   1109 C CB  . VAL A 1 143 ? 22.624 8.364   25.243 1.00 16.88  ? 139 VAL A CB  1 
ATOM   1110 C CG1 . VAL A 1 143 ? 21.173 8.451   25.705 1.00 16.88  ? 139 VAL A CG1 1 
ATOM   1111 C CG2 . VAL A 1 143 ? 23.508 9.314   26.057 1.00 16.88  ? 139 VAL A CG2 1 
ATOM   1112 N N   . ASN A 1 144 ? 24.319 6.312   23.402 1.00 29.04  ? 140 ASN A N   1 
ATOM   1113 C CA  . ASN A 1 144 ? 25.481 6.156   22.540 1.00 29.04  ? 140 ASN A CA  1 
ATOM   1114 C C   . ASN A 1 144 ? 25.360 7.192   21.421 1.00 29.04  ? 140 ASN A C   1 
ATOM   1115 O O   . ASN A 1 144 ? 24.253 7.641   21.093 1.00 29.04  ? 140 ASN A O   1 
ATOM   1116 C CB  . ASN A 1 144 ? 25.545 4.740   21.958 1.00 33.37  ? 140 ASN A CB  1 
ATOM   1117 C CG  . ASN A 1 144 ? 25.947 3.697   22.992 1.00 33.37  ? 140 ASN A CG  1 
ATOM   1118 O OD1 . ASN A 1 144 ? 26.840 3.925   23.795 1.00 33.37  ? 140 ASN A OD1 1 
ATOM   1119 N ND2 . ASN A 1 144 ? 25.300 2.542   22.958 1.00 33.37  ? 140 ASN A ND2 1 
ATOM   1120 N N   . ARG A 1 145 ? 26.496 7.579   20.847 1.00 25.37  ? 141 ARG A N   1 
ATOM   1121 C CA  . ARG A 1 145 ? 26.506 8.576   19.781 1.00 25.37  ? 141 ARG A CA  1 
ATOM   1122 C C   . ARG A 1 145 ? 25.647 8.157   18.588 1.00 25.37  ? 141 ARG A C   1 
ATOM   1123 O O   . ARG A 1 145 ? 25.116 9.007   17.876 1.00 25.37  ? 141 ARG A O   1 
ATOM   1124 C CB  . ARG A 1 145 ? 27.942 8.850   19.317 1.00 95.01  ? 141 ARG A CB  1 
ATOM   1125 C CG  . ARG A 1 145 ? 28.528 7.788   18.405 1.00 95.01  ? 141 ARG A CG  1 
ATOM   1126 C CD  . ARG A 1 145 ? 29.983 8.079   18.071 1.00 95.01  ? 141 ARG A CD  1 
ATOM   1127 N NE  . ARG A 1 145 ? 30.862 7.862   19.218 1.00 95.01  ? 141 ARG A NE  1 
ATOM   1128 C CZ  . ARG A 1 145 ? 32.184 7.991   19.181 1.00 95.01  ? 141 ARG A CZ  1 
ATOM   1129 N NH1 . ARG A 1 145 ? 32.788 8.341   18.052 1.00 95.01  ? 141 ARG A NH1 1 
ATOM   1130 N NH2 . ARG A 1 145 ? 32.903 7.759   20.270 1.00 95.01  ? 141 ARG A NH2 1 
ATOM   1131 N N   . ASP A 1 146 ? 25.508 6.851   18.374 1.00 19.75  ? 142 ASP A N   1 
ATOM   1132 C CA  . ASP A 1 146 ? 24.712 6.357   17.260 1.00 19.75  ? 142 ASP A CA  1 
ATOM   1133 C C   . ASP A 1 146 ? 23.241 6.196   17.658 1.00 19.75  ? 142 ASP A C   1 
ATOM   1134 O O   . ASP A 1 146 ? 22.425 5.661   16.901 1.00 19.75  ? 142 ASP A O   1 
ATOM   1135 C CB  . ASP A 1 146 ? 25.288 5.033   16.721 1.00 25.25  ? 142 ASP A CB  1 
ATOM   1136 C CG  . ASP A 1 146 ? 25.131 3.873   17.690 1.00 25.25  ? 142 ASP A CG  1 
ATOM   1137 O OD1 . ASP A 1 146 ? 24.548 4.063   18.787 1.00 25.25  ? 142 ASP A OD1 1 
ATOM   1138 O OD2 . ASP A 1 146 ? 25.593 2.762   17.343 1.00 25.25  ? 142 ASP A OD2 1 
ATOM   1139 N N   . HIS A 1 147 ? 22.927 6.666   18.860 1.00 26.53  ? 143 HIS A N   1 
ATOM   1140 C CA  . HIS A 1 147 ? 21.580 6.649   19.411 1.00 26.53  ? 143 HIS A CA  1 
ATOM   1141 C C   . HIS A 1 147 ? 21.045 5.321   19.910 1.00 26.53  ? 143 HIS A C   1 
ATOM   1142 O O   . HIS A 1 147 ? 19.847 5.174   20.148 1.00 26.53  ? 143 HIS A O   1 
ATOM   1143 C CB  . HIS A 1 147 ? 20.628 7.301   18.418 1.00 22.92  ? 143 HIS A CB  1 
ATOM   1144 C CG  . HIS A 1 147 ? 21.111 8.637   17.955 1.00 22.92  ? 143 HIS A CG  1 
ATOM   1145 N ND1 . HIS A 1 147 ? 21.420 8.903   16.639 1.00 22.92  ? 143 HIS A ND1 1 
ATOM   1146 C CD2 . HIS A 1 147 ? 21.444 9.748   18.653 1.00 22.92  ? 143 HIS A CD2 1 
ATOM   1147 C CE1 . HIS A 1 147 ? 21.926 10.120  16.547 1.00 22.92  ? 143 HIS A CE1 1 
ATOM   1148 N NE2 . HIS A 1 147 ? 21.952 10.654  17.755 1.00 22.92  ? 143 HIS A NE2 1 
ATOM   1149 N N   . SER A 1 148 ? 21.937 4.349   20.065 1.00 19.57  ? 144 SER A N   1 
ATOM   1150 C CA  . SER A 1 148 ? 21.555 3.071   20.644 1.00 19.57  ? 144 SER A CA  1 
ATOM   1151 C C   . SER A 1 148 ? 22.001 3.277   22.097 1.00 19.57  ? 144 SER A C   1 
ATOM   1152 O O   . SER A 1 148 ? 22.392 4.383   22.475 1.00 19.57  ? 144 SER A O   1 
ATOM   1153 C CB  . SER A 1 148 ? 22.323 1.911   20.005 1.00 18.45  ? 144 SER A CB  1 
ATOM   1154 O OG  . SER A 1 148 ? 23.709 1.990   20.275 1.00 18.45  ? 144 SER A OG  1 
ATOM   1155 N N   . PHE A 1 149 ? 21.971 2.234   22.909 1.00 23.28  ? 145 PHE A N   1 
ATOM   1156 C CA  . PHE A 1 149 ? 22.369 2.390   24.296 1.00 23.28  ? 145 PHE A CA  1 
ATOM   1157 C C   . PHE A 1 149 ? 23.295 1.284   24.788 1.00 23.28  ? 145 PHE A C   1 
ATOM   1158 O O   . PHE A 1 149 ? 23.469 0.254   24.136 1.00 23.28  ? 145 PHE A O   1 
ATOM   1159 C CB  . PHE A 1 149 ? 21.128 2.396   25.207 1.00 18.68  ? 145 PHE A CB  1 
ATOM   1160 C CG  . PHE A 1 149 ? 20.114 3.447   24.868 1.00 18.68  ? 145 PHE A CG  1 
ATOM   1161 C CD1 . PHE A 1 149 ? 19.193 3.243   23.839 1.00 18.68  ? 145 PHE A CD1 1 
ATOM   1162 C CD2 . PHE A 1 149 ? 20.068 4.642   25.584 1.00 18.68  ? 145 PHE A CD2 1 
ATOM   1163 C CE1 . PHE A 1 149 ? 18.242 4.213   23.529 1.00 18.68  ? 145 PHE A CE1 1 
ATOM   1164 C CE2 . PHE A 1 149 ? 19.113 5.623   25.276 1.00 18.68  ? 145 PHE A CE2 1 
ATOM   1165 C CZ  . PHE A 1 149 ? 18.201 5.407   24.249 1.00 18.68  ? 145 PHE A CZ  1 
ATOM   1166 N N   . HIS A 1 150 ? 23.901 1.521   25.945 1.00 25.17  ? 146 HIS A N   1 
ATOM   1167 C CA  . HIS A 1 150 ? 24.723 0.509   26.584 1.00 25.17  ? 146 HIS A CA  1 
ATOM   1168 C C   . HIS A 1 150 ? 24.253 0.523   28.029 1.00 25.17  ? 146 HIS A C   1 
ATOM   1169 O O   . HIS A 1 150 ? 23.697 1.522   28.499 1.00 25.17  ? 146 HIS A O   1 
ATOM   1170 C CB  . HIS A 1 150 ? 26.226 0.794   26.480 1.00 24.99  ? 146 HIS A CB  1 
ATOM   1171 C CG  . HIS A 1 150 ? 26.654 2.079   27.104 1.00 24.99  ? 146 HIS A CG  1 
ATOM   1172 N ND1 . HIS A 1 150 ? 26.514 3.295   26.473 1.00 24.99  ? 146 HIS A ND1 1 
ATOM   1173 C CD2 . HIS A 1 150 ? 27.237 2.337   28.297 1.00 24.99  ? 146 HIS A CD2 1 
ATOM   1174 C CE1 . HIS A 1 150 ? 26.995 4.248   27.249 1.00 24.99  ? 146 HIS A CE1 1 
ATOM   1175 N NE2 . HIS A 1 150 ? 27.438 3.693   28.362 1.00 24.99  ? 146 HIS A NE2 1 
ATOM   1176 N N   . LYS A 1 151 ? 24.447 -0.594  28.718 1.00 26.72  ? 147 LYS A N   1 
ATOM   1177 C CA  . LYS A 1 151 ? 23.999 -0.722  30.093 1.00 26.72  ? 147 LYS A CA  1 
ATOM   1178 C C   . LYS A 1 151 ? 24.987 -1.591  30.853 1.00 26.72  ? 147 LYS A C   1 
ATOM   1179 O O   . LYS A 1 151 ? 25.670 -2.416  30.256 1.00 26.72  ? 147 LYS A O   1 
ATOM   1180 C CB  . LYS A 1 151 ? 22.613 -1.369  30.091 1.00 22.60  ? 147 LYS A CB  1 
ATOM   1181 C CG  . LYS A 1 151 ? 21.798 -1.195  31.350 1.00 22.60  ? 147 LYS A CG  1 
ATOM   1182 C CD  . LYS A 1 151 ? 20.379 -1.653  31.068 1.00 22.60  ? 147 LYS A CD  1 
ATOM   1183 C CE  . LYS A 1 151 ? 19.339 -0.710  31.661 1.00 22.60  ? 147 LYS A CE  1 
ATOM   1184 N NZ  . LYS A 1 151 ? 19.216 -0.910  33.128 1.00 22.60  ? 147 LYS A NZ  1 
ATOM   1185 N N   . LEU A 1 152 ? 25.073 -1.402  32.166 1.00 19.43  ? 148 LEU A N   1 
ATOM   1186 C CA  . LEU A 1 152 ? 25.985 -2.205  32.967 1.00 19.43  ? 148 LEU A CA  1 
ATOM   1187 C C   . LEU A 1 152 ? 25.313 -2.768  34.209 1.00 19.43  ? 148 LEU A C   1 
ATOM   1188 O O   . LEU A 1 152 ? 24.524 -2.091  34.872 1.00 19.43  ? 148 LEU A O   1 
ATOM   1189 C CB  . LEU A 1 152 ? 27.217 -1.398  33.395 1.00 16.50  ? 148 LEU A CB  1 
ATOM   1190 C CG  . LEU A 1 152 ? 28.107 -0.762  32.327 1.00 16.50  ? 148 LEU A CG  1 
ATOM   1191 C CD1 . LEU A 1 152 ? 27.671 0.670   32.113 1.00 16.50  ? 148 LEU A CD1 1 
ATOM   1192 C CD2 . LEU A 1 152 ? 29.567 -0.793  32.770 1.00 16.50  ? 148 LEU A CD2 1 
ATOM   1193 N N   . SER A 1 153 ? 25.631 -4.028  34.496 1.00 19.47  ? 149 SER A N   1 
ATOM   1194 C CA  . SER A 1 153 ? 25.126 -4.721  35.666 1.00 19.47  ? 149 SER A CA  1 
ATOM   1195 C C   . SER A 1 153 ? 26.343 -5.147  36.475 1.00 19.47  ? 149 SER A C   1 
ATOM   1196 O O   . SER A 1 153 ? 27.393 -5.444  35.918 1.00 19.47  ? 149 SER A O   1 
ATOM   1197 C CB  . SER A 1 153 ? 24.311 -5.949  35.270 1.00 16.88  ? 149 SER A CB  1 
ATOM   1198 O OG  . SER A 1 153 ? 23.778 -6.582  36.425 1.00 16.88  ? 149 SER A OG  1 
ATOM   1199 N N   . TYR A 1 154 ? 26.183 -5.180  37.791 1.00 28.25  ? 150 TYR A N   1 
ATOM   1200 C CA  . TYR A 1 154 ? 27.263 -5.535  38.688 1.00 28.25  ? 150 TYR A CA  1 
ATOM   1201 C C   . TYR A 1 154 ? 26.923 -6.693  39.612 1.00 28.25  ? 150 TYR A C   1 
ATOM   1202 O O   . TYR A 1 154 ? 25.784 -6.836  40.065 1.00 28.25  ? 150 TYR A O   1 
ATOM   1203 C CB  . TYR A 1 154 ? 27.644 -4.314  39.523 1.00 16.85  ? 150 TYR A CB  1 
ATOM   1204 C CG  . TYR A 1 154 ? 27.994 -3.102  38.691 1.00 16.85  ? 150 TYR A CG  1 
ATOM   1205 C CD1 . TYR A 1 154 ? 26.998 -2.375  38.026 1.00 16.85  ? 150 TYR A CD1 1 
ATOM   1206 C CD2 . TYR A 1 154 ? 29.319 -2.684  38.550 1.00 16.85  ? 150 TYR A CD2 1 
ATOM   1207 C CE1 . TYR A 1 154 ? 27.308 -1.273  37.251 1.00 16.85  ? 150 TYR A CE1 1 
ATOM   1208 C CE2 . TYR A 1 154 ? 29.637 -1.574  37.771 1.00 16.85  ? 150 TYR A CE2 1 
ATOM   1209 C CZ  . TYR A 1 154 ? 28.627 -0.876  37.126 1.00 16.85  ? 150 TYR A CZ  1 
ATOM   1210 O OH  . TYR A 1 154 ? 28.927 0.217   36.348 1.00 16.85  ? 150 TYR A OH  1 
ATOM   1211 N N   . LEU A 1 155 ? 27.918 -7.525  39.889 1.00 18.03  ? 151 LEU A N   1 
ATOM   1212 C CA  . LEU A 1 155 ? 27.722 -8.652  40.785 1.00 18.03  ? 151 LEU A CA  1 
ATOM   1213 C C   . LEU A 1 155 ? 28.876 -8.704  41.758 1.00 18.03  ? 151 LEU A C   1 
ATOM   1214 O O   . LEU A 1 155 ? 30.011 -8.967  41.362 1.00 18.03  ? 151 LEU A O   1 
ATOM   1215 C CB  . LEU A 1 155 ? 27.666 -9.978  40.025 1.00 12.71  ? 151 LEU A CB  1 
ATOM   1216 C CG  . LEU A 1 155 ? 27.388 -11.182 40.945 1.00 12.71  ? 151 LEU A CG  1 
ATOM   1217 C CD1 . LEU A 1 155 ? 25.981 -11.089 41.489 1.00 12.71  ? 151 LEU A CD1 1 
ATOM   1218 C CD2 . LEU A 1 155 ? 27.552 -12.484 40.183 1.00 12.71  ? 151 LEU A CD2 1 
ATOM   1219 N N   . THR A 1 156 ? 28.591 -8.446  43.028 1.00 25.98  ? 152 THR A N   1 
ATOM   1220 C CA  . THR A 1 156 ? 29.624 -8.485  44.054 1.00 25.98  ? 152 THR A CA  1 
ATOM   1221 C C   . THR A 1 156 ? 29.794 -9.951  44.451 1.00 25.98  ? 152 THR A C   1 
ATOM   1222 O O   . THR A 1 156 ? 28.818 -10.610 44.816 1.00 25.98  ? 152 THR A O   1 
ATOM   1223 C CB  . THR A 1 156 ? 29.202 -7.662  45.285 1.00 32.18  ? 152 THR A CB  1 
ATOM   1224 O OG1 . THR A 1 156 ? 28.838 -6.341  44.871 1.00 32.18  ? 152 THR A OG1 1 
ATOM   1225 C CG2 . THR A 1 156 ? 30.340 -7.565  46.269 1.00 32.18  ? 152 THR A CG2 1 
ATOM   1226 N N   . PHE A 1 157 ? 31.020 -10.461 44.391 1.00 27.38  ? 153 PHE A N   1 
ATOM   1227 C CA  . PHE A 1 157 ? 31.250 -11.867 44.705 1.00 27.38  ? 153 PHE A CA  1 
ATOM   1228 C C   . PHE A 1 157 ? 32.562 -12.156 45.434 1.00 27.38  ? 153 PHE A C   1 
ATOM   1229 O O   . PHE A 1 157 ? 33.434 -11.287 45.549 1.00 27.38  ? 153 PHE A O   1 
ATOM   1230 C CB  . PHE A 1 157 ? 31.224 -12.684 43.403 1.00 17.84  ? 153 PHE A CB  1 
ATOM   1231 C CG  . PHE A 1 157 ? 32.458 -12.502 42.545 1.00 17.84  ? 153 PHE A CG  1 
ATOM   1232 C CD1 . PHE A 1 157 ? 32.761 -11.255 41.977 1.00 17.84  ? 153 PHE A CD1 1 
ATOM   1233 C CD2 . PHE A 1 157 ? 33.333 -13.567 42.326 1.00 17.84  ? 153 PHE A CD2 1 
ATOM   1234 C CE1 . PHE A 1 157 ? 33.917 -11.071 41.208 1.00 17.84  ? 153 PHE A CE1 1 
ATOM   1235 C CE2 . PHE A 1 157 ? 34.493 -13.394 41.555 1.00 17.84  ? 153 PHE A CE2 1 
ATOM   1236 C CZ  . PHE A 1 157 ? 34.785 -12.142 40.997 1.00 17.84  ? 153 PHE A CZ  1 
ATOM   1237 N N   . ILE A 1 158 ? 32.690 -13.394 45.913 1.00 21.33  ? 154 ILE A N   1 
ATOM   1238 C CA  . ILE A 1 158 ? 33.893 -13.857 46.603 1.00 21.33  ? 154 ILE A CA  1 
ATOM   1239 C C   . ILE A 1 158 ? 34.549 -14.878 45.678 1.00 21.33  ? 154 ILE A C   1 
ATOM   1240 O O   . ILE A 1 158 ? 34.009 -15.956 45.471 1.00 21.33  ? 154 ILE A O   1 
ATOM   1241 C CB  . ILE A 1 158 ? 33.564 -14.573 47.928 1.00 42.03  ? 154 ILE A CB  1 
ATOM   1242 C CG1 . ILE A 1 158 ? 32.725 -13.665 48.829 1.00 42.03  ? 154 ILE A CG1 1 
ATOM   1243 C CG2 . ILE A 1 158 ? 34.853 -14.987 48.623 1.00 42.03  ? 154 ILE A CG2 1 
ATOM   1244 C CD1 . ILE A 1 158 ? 33.394 -12.352 49.175 1.00 42.03  ? 154 ILE A CD1 1 
ATOM   1245 N N   . PRO A 1 159 ? 35.716 -14.548 45.107 1.00 21.14  ? 155 PRO A N   1 
ATOM   1246 C CA  . PRO A 1 159 ? 36.397 -15.478 44.206 1.00 21.14  ? 155 PRO A CA  1 
ATOM   1247 C C   . PRO A 1 159 ? 36.706 -16.807 44.874 1.00 21.14  ? 155 PRO A C   1 
ATOM   1248 O O   . PRO A 1 159 ? 36.998 -16.860 46.069 1.00 21.14  ? 155 PRO A O   1 
ATOM   1249 C CB  . PRO A 1 159 ? 37.665 -14.723 43.828 1.00 28.37  ? 155 PRO A CB  1 
ATOM   1250 C CG  . PRO A 1 159 ? 37.234 -13.309 43.886 1.00 28.37  ? 155 PRO A CG  1 
ATOM   1251 C CD  . PRO A 1 159 ? 36.452 -13.277 45.179 1.00 28.37  ? 155 PRO A CD  1 
ATOM   1252 N N   . SER A 1 160 ? 36.631 -17.871 44.087 1.00 49.75  ? 156 SER A N   1 
ATOM   1253 C CA  . SER A 1 160 ? 36.913 -19.227 44.541 1.00 49.75  ? 156 SER A CA  1 
ATOM   1254 C C   . SER A 1 160 ? 37.067 -20.027 43.264 1.00 49.75  ? 156 SER A C   1 
ATOM   1255 O O   . SER A 1 160 ? 36.334 -19.803 42.300 1.00 49.75  ? 156 SER A O   1 
ATOM   1256 C CB  . SER A 1 160 ? 35.755 -19.791 45.365 1.00 50.07  ? 156 SER A CB  1 
ATOM   1257 O OG  . SER A 1 160 ? 34.633 -20.063 44.545 1.00 50.07  ? 156 SER A OG  1 
ATOM   1258 N N   . ASP A 1 161 ? 38.012 -20.955 43.243 1.00 54.84  ? 157 ASP A N   1 
ATOM   1259 C CA  . ASP A 1 161 ? 38.229 -21.738 42.039 1.00 54.84  ? 157 ASP A CA  1 
ATOM   1260 C C   . ASP A 1 161 ? 37.032 -22.579 41.625 1.00 54.84  ? 157 ASP A C   1 
ATOM   1261 O O   . ASP A 1 161 ? 36.231 -23.013 42.458 1.00 54.84  ? 157 ASP A O   1 
ATOM   1262 C CB  . ASP A 1 161 ? 39.459 -22.631 42.199 1.00 78.75  ? 157 ASP A CB  1 
ATOM   1263 C CG  . ASP A 1 161 ? 40.741 -21.833 42.326 1.00 78.75  ? 157 ASP A CG  1 
ATOM   1264 O OD1 . ASP A 1 161 ? 40.989 -20.953 41.468 1.00 78.75  ? 157 ASP A OD1 1 
ATOM   1265 O OD2 . ASP A 1 161 ? 41.500 -22.089 43.283 1.00 78.75  ? 157 ASP A OD2 1 
ATOM   1266 N N   . ASP A 1 162 ? 36.915 -22.776 40.316 1.00 79.93  ? 158 ASP A N   1 
ATOM   1267 C CA  . ASP A 1 162 ? 35.859 -23.582 39.725 1.00 79.93  ? 158 ASP A CA  1 
ATOM   1268 C C   . ASP A 1 162 ? 34.496 -22.905 39.608 1.00 79.93  ? 158 ASP A C   1 
ATOM   1269 O O   . ASP A 1 162 ? 33.759 -23.168 38.656 1.00 79.93  ? 158 ASP A O   1 
ATOM   1270 C CB  . ASP A 1 162 ? 35.745 -24.906 40.489 1.00 60.14  ? 158 ASP A CB  1 
ATOM   1271 C CG  . ASP A 1 162 ? 37.058 -25.671 40.507 1.00 60.14  ? 158 ASP A CG  1 
ATOM   1272 O OD1 . ASP A 1 162 ? 37.551 -26.031 39.416 1.00 60.14  ? 158 ASP A OD1 1 
ATOM   1273 O OD2 . ASP A 1 162 ? 37.609 -25.901 41.604 1.00 60.14  ? 158 ASP A OD2 1 
ATOM   1274 N N   . ASP A 1 163 ? 34.157 -22.035 40.555 1.00 37.18  ? 159 ASP A N   1 
ATOM   1275 C CA  . ASP A 1 163 ? 32.871 -21.345 40.498 1.00 37.18  ? 159 ASP A CA  1 
ATOM   1276 C C   . ASP A 1 163 ? 32.642 -20.685 39.135 1.00 37.18  ? 159 ASP A C   1 
ATOM   1277 O O   . ASP A 1 163 ? 33.509 -19.978 38.623 1.00 37.18  ? 159 ASP A O   1 
ATOM   1278 C CB  . ASP A 1 163 ? 32.787 -20.312 41.621 1.00 52.86  ? 159 ASP A CB  1 
ATOM   1279 C CG  . ASP A 1 163 ? 32.126 -20.869 42.875 1.00 52.86  ? 159 ASP A CG  1 
ATOM   1280 O OD1 . ASP A 1 163 ? 32.339 -22.060 43.198 1.00 52.86  ? 159 ASP A OD1 1 
ATOM   1281 O OD2 . ASP A 1 163 ? 31.396 -20.111 43.544 1.00 52.86  ? 159 ASP A OD2 1 
ATOM   1282 N N   . ILE A 1 164 ? 31.474 -20.933 38.547 1.00 31.44  ? 160 ILE A N   1 
ATOM   1283 C CA  . ILE A 1 164 ? 31.146 -20.384 37.237 1.00 31.44  ? 160 ILE A CA  1 
ATOM   1284 C C   . ILE A 1 164 ? 30.093 -19.280 37.271 1.00 31.44  ? 160 ILE A C   1 
ATOM   1285 O O   . ILE A 1 164 ? 29.009 -19.449 37.832 1.00 31.44  ? 160 ILE A O   1 
ATOM   1286 C CB  . ILE A 1 164 ? 30.644 -21.485 36.282 1.00 48.00  ? 160 ILE A CB  1 
ATOM   1287 C CG1 . ILE A 1 164 ? 31.656 -22.637 36.212 1.00 48.00  ? 160 ILE A CG1 1 
ATOM   1288 C CG2 . ILE A 1 164 ? 30.425 -20.894 34.892 1.00 48.00  ? 160 ILE A CG2 1 
ATOM   1289 C CD1 . ILE A 1 164 ? 33.016 -22.252 35.626 1.00 48.00  ? 160 ILE A CD1 1 
ATOM   1290 N N   . TYR A 1 165 ? 30.408 -18.156 36.639 1.00 18.01  ? 161 TYR A N   1 
ATOM   1291 C CA  . TYR A 1 165 ? 29.488 -17.031 36.610 1.00 18.01  ? 161 TYR A CA  1 
ATOM   1292 C C   . TYR A 1 165 ? 28.978 -16.716 35.215 1.00 18.01  ? 161 TYR A C   1 
ATOM   1293 O O   . TYR A 1 165 ? 29.703 -16.840 34.237 1.00 18.01  ? 161 TYR A O   1 
ATOM   1294 C CB  . TYR A 1 165 ? 30.167 -15.800 37.211 1.00 22.63  ? 161 TYR A CB  1 
ATOM   1295 C CG  . TYR A 1 165 ? 30.304 -15.891 38.712 1.00 22.63  ? 161 TYR A CG  1 
ATOM   1296 C CD1 . TYR A 1 165 ? 29.198 -15.701 39.535 1.00 22.63  ? 161 TYR A CD1 1 
ATOM   1297 C CD2 . TYR A 1 165 ? 31.525 -16.210 39.310 1.00 22.63  ? 161 TYR A CD2 1 
ATOM   1298 C CE1 . TYR A 1 165 ? 29.291 -15.826 40.913 1.00 22.63  ? 161 TYR A CE1 1 
ATOM   1299 C CE2 . TYR A 1 165 ? 31.629 -16.340 40.701 1.00 22.63  ? 161 TYR A CE2 1 
ATOM   1300 C CZ  . TYR A 1 165 ? 30.500 -16.145 41.495 1.00 22.63  ? 161 TYR A CZ  1 
ATOM   1301 O OH  . TYR A 1 165 ? 30.566 -16.279 42.870 1.00 22.63  ? 161 TYR A OH  1 
ATOM   1302 N N   . ASP A 1 166 ? 27.723 -16.308 35.122 1.00 25.08  ? 162 ASP A N   1 
ATOM   1303 C CA  . ASP A 1 166 ? 27.151 -15.978 33.827 1.00 25.08  ? 162 ASP A CA  1 
ATOM   1304 C C   . ASP A 1 166 ? 26.358 -14.692 33.852 1.00 25.08  ? 162 ASP A C   1 
ATOM   1305 O O   . ASP A 1 166 ? 25.693 -14.374 34.839 1.00 25.08  ? 162 ASP A O   1 
ATOM   1306 C CB  . ASP A 1 166 ? 26.220 -17.090 33.342 1.00 36.31  ? 162 ASP A CB  1 
ATOM   1307 C CG  . ASP A 1 166 ? 26.962 -18.320 32.902 1.00 36.31  ? 162 ASP A CG  1 
ATOM   1308 O OD1 . ASP A 1 166 ? 27.822 -18.204 32.005 1.00 36.31  ? 162 ASP A OD1 1 
ATOM   1309 O OD2 . ASP A 1 166 ? 26.676 -19.408 33.446 1.00 36.31  ? 162 ASP A OD2 1 
ATOM   1310 N N   . CYS A 1 167 ? 26.445 -13.955 32.754 1.00 29.21  ? 163 CYS A N   1 
ATOM   1311 C CA  . CYS A 1 167 ? 25.685 -12.735 32.596 1.00 29.21  ? 163 CYS A CA  1 
ATOM   1312 C C   . CYS A 1 167 ? 24.686 -13.074 31.487 1.00 29.21  ? 163 CYS A C   1 
ATOM   1313 O O   . CYS A 1 167 ? 25.064 -13.259 30.320 1.00 29.21  ? 163 CYS A O   1 
ATOM   1314 C CB  . CYS A 1 167 ? 26.573 -11.573 32.163 1.00 30.91  ? 163 CYS A CB  1 
ATOM   1315 S SG  . CYS A 1 167 ? 25.568 -10.095 31.837 1.00 30.91  ? 163 CYS A SG  1 
ATOM   1316 N N   . LYS A 1 168 ? 23.416 -13.175 31.857 1.00 28.07  ? 164 LYS A N   1 
ATOM   1317 C CA  . LYS A 1 168 ? 22.381 -13.522 30.900 1.00 28.07  ? 164 LYS A CA  1 
ATOM   1318 C C   . LYS A 1 168 ? 21.673 -12.296 30.341 1.00 28.07  ? 164 LYS A C   1 
ATOM   1319 O O   . LYS A 1 168 ? 21.124 -11.486 31.090 1.00 28.07  ? 164 LYS A O   1 
ATOM   1320 C CB  . LYS A 1 168 ? 21.372 -14.460 31.564 1.00 34.95  ? 164 LYS A CB  1 
ATOM   1321 C CG  . LYS A 1 168 ? 20.247 -14.915 30.656 1.00 34.95  ? 164 LYS A CG  1 
ATOM   1322 C CD  . LYS A 1 168 ? 19.419 -15.988 31.334 1.00 34.95  ? 164 LYS A CD  1 
ATOM   1323 C CE  . LYS A 1 168 ? 18.260 -16.428 30.467 1.00 34.95  ? 164 LYS A CE  1 
ATOM   1324 N NZ  . LYS A 1 168 ? 17.490 -17.505 31.136 1.00 34.95  ? 164 LYS A NZ  1 
ATOM   1325 N N   . VAL A 1 169 ? 21.682 -12.172 29.019 1.00 21.44  ? 165 VAL A N   1 
ATOM   1326 C CA  . VAL A 1 169 ? 21.045 -11.045 28.353 1.00 21.44  ? 165 VAL A CA  1 
ATOM   1327 C C   . VAL A 1 169 ? 19.879 -11.492 27.467 1.00 21.44  ? 165 VAL A C   1 
ATOM   1328 O O   . VAL A 1 169 ? 20.019 -12.398 26.649 1.00 21.44  ? 165 VAL A O   1 
ATOM   1329 C CB  . VAL A 1 169 ? 22.070 -10.268 27.487 1.00 20.65  ? 165 VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 169 ? 21.390 -9.097  26.795 1.00 20.65  ? 165 VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 169 ? 23.219 -9.772  28.352 1.00 20.65  ? 165 VAL A CG2 1 
ATOM   1332 N N   . GLU A 1 170 ? 18.730 -10.847 27.642 1.00 34.61  ? 166 GLU A N   1 
ATOM   1333 C CA  . GLU A 1 170 ? 17.524 -11.150 26.866 1.00 34.61  ? 166 GLU A CA  1 
ATOM   1334 C C   . GLU A 1 170 ? 17.007 -9.869  26.217 1.00 34.61  ? 166 GLU A C   1 
ATOM   1335 O O   . GLU A 1 170 ? 16.844 -8.855  26.888 1.00 34.61  ? 166 GLU A O   1 
ATOM   1336 C CB  . GLU A 1 170 ? 16.449 -11.738 27.773 1.00 46.04  ? 166 GLU A CB  1 
ATOM   1337 C CG  . GLU A 1 170 ? 16.861 -13.027 28.437 1.00 46.04  ? 166 GLU A CG  1 
ATOM   1338 C CD  . GLU A 1 170 ? 15.752 -13.625 29.266 1.00 46.04  ? 166 GLU A CD  1 
ATOM   1339 O OE1 . GLU A 1 170 ? 15.290 -12.958 30.214 1.00 46.04  ? 166 GLU A OE1 1 
ATOM   1340 O OE2 . GLU A 1 170 ? 15.341 -14.765 28.965 1.00 46.04  ? 166 GLU A OE2 1 
ATOM   1341 N N   . HIS A 1 171 ? 16.733 -9.931  24.917 1.00 33.61  ? 167 HIS A N   1 
ATOM   1342 C CA  . HIS A 1 171 ? 16.278 -8.768  24.165 1.00 33.61  ? 167 HIS A CA  1 
ATOM   1343 C C   . HIS A 1 171 ? 15.578 -9.178  22.854 1.00 33.61  ? 167 HIS A C   1 
ATOM   1344 O O   . HIS A 1 171 ? 16.025 -10.097 22.163 1.00 33.61  ? 167 HIS A O   1 
ATOM   1345 C CB  . HIS A 1 171 ? 17.499 -7.887  23.875 1.00 29.60  ? 167 HIS A CB  1 
ATOM   1346 C CG  . HIS A 1 171 ? 17.183 -6.611  23.162 1.00 29.60  ? 167 HIS A CG  1 
ATOM   1347 N ND1 . HIS A 1 171 ? 16.701 -6.578  21.871 1.00 29.60  ? 167 HIS A ND1 1 
ATOM   1348 C CD2 . HIS A 1 171 ? 17.292 -5.321  23.559 1.00 29.60  ? 167 HIS A CD2 1 
ATOM   1349 C CE1 . HIS A 1 171 ? 16.525 -5.320  21.503 1.00 29.60  ? 167 HIS A CE1 1 
ATOM   1350 N NE2 . HIS A 1 171 ? 16.877 -4.537  22.510 1.00 29.60  ? 167 HIS A NE2 1 
ATOM   1351 N N   . TRP A 1 172 ? 14.490 -8.486  22.514 1.00 33.35  ? 168 TRP A N   1 
ATOM   1352 C CA  . TRP A 1 172 ? 13.725 -8.779  21.301 1.00 33.35  ? 168 TRP A CA  1 
ATOM   1353 C C   . TRP A 1 172 ? 14.586 -9.029  20.072 1.00 33.35  ? 168 TRP A C   1 
ATOM   1354 O O   . TRP A 1 172 ? 14.189 -9.759  19.165 1.00 33.35  ? 168 TRP A O   1 
ATOM   1355 C CB  . TRP A 1 172 ? 12.749 -7.639  20.982 1.00 29.16  ? 168 TRP A CB  1 
ATOM   1356 C CG  . TRP A 1 172 ? 11.812 -7.328  22.096 1.00 29.16  ? 168 TRP A CG  1 
ATOM   1357 C CD1 . TRP A 1 172 ? 11.270 -8.218  22.981 1.00 29.16  ? 168 TRP A CD1 1 
ATOM   1358 C CD2 . TRP A 1 172 ? 11.307 -6.035  22.465 1.00 29.16  ? 168 TRP A CD2 1 
ATOM   1359 N NE1 . TRP A 1 172 ? 10.465 -7.560  23.880 1.00 29.16  ? 168 TRP A NE1 1 
ATOM   1360 C CE2 . TRP A 1 172 ? 10.467 -6.220  23.586 1.00 29.16  ? 168 TRP A CE2 1 
ATOM   1361 C CE3 . TRP A 1 172 ? 11.483 -4.741  21.957 1.00 29.16  ? 168 TRP A CE3 1 
ATOM   1362 C CZ2 . TRP A 1 172 ? 9.803  -5.158  24.212 1.00 29.16  ? 168 TRP A CZ2 1 
ATOM   1363 C CZ3 . TRP A 1 172 ? 10.821 -3.679  22.580 1.00 29.16  ? 168 TRP A CZ3 1 
ATOM   1364 C CH2 . TRP A 1 172 ? 9.991  -3.899  23.698 1.00 29.16  ? 168 TRP A CH2 1 
ATOM   1365 N N   . GLY A 1 173 ? 15.758 -8.414  20.034 1.00 28.08  ? 169 GLY A N   1 
ATOM   1366 C CA  . GLY A 1 173 ? 16.628 -8.589  18.889 1.00 28.08  ? 169 GLY A CA  1 
ATOM   1367 C C   . GLY A 1 173 ? 17.491 -9.816  19.048 1.00 28.08  ? 169 GLY A C   1 
ATOM   1368 O O   . GLY A 1 173 ? 18.496 -9.960  18.359 1.00 28.08  ? 169 GLY A O   1 
ATOM   1369 N N   . LEU A 1 174 ? 17.094 -10.699 19.961 1.00 33.43  ? 170 LEU A N   1 
ATOM   1370 C CA  . LEU A 1 174 ? 17.831 -11.929 20.229 1.00 33.43  ? 170 LEU A CA  1 
ATOM   1371 C C   . LEU A 1 174 ? 16.971 -13.175 20.073 1.00 33.43  ? 170 LEU A C   1 
ATOM   1372 O O   . LEU A 1 174 ? 16.041 -13.409 20.852 1.00 33.43  ? 170 LEU A O   1 
ATOM   1373 C CB  . LEU A 1 174 ? 18.404 -11.917 21.652 1.00 39.17  ? 170 LEU A CB  1 
ATOM   1374 C CG  . LEU A 1 174 ? 19.632 -11.070 21.991 1.00 39.17  ? 170 LEU A CG  1 
ATOM   1375 C CD1 . LEU A 1 174 ? 19.927 -11.199 23.478 1.00 39.17  ? 170 LEU A CD1 1 
ATOM   1376 C CD2 . LEU A 1 174 ? 20.830 -11.535 21.173 1.00 39.17  ? 170 LEU A CD2 1 
ATOM   1377 N N   . GLU A 1 175 ? 17.293 -13.977 19.064 1.00 59.56  ? 171 GLU A N   1 
ATOM   1378 C CA  . GLU A 1 175 ? 16.584 -15.228 18.823 1.00 59.56  ? 171 GLU A CA  1 
ATOM   1379 C C   . GLU A 1 175 ? 16.596 -15.997 20.143 1.00 59.56  ? 171 GLU A C   1 
ATOM   1380 O O   . GLU A 1 175 ? 15.551 -16.357 20.687 1.00 59.56  ? 171 GLU A O   1 
ATOM   1381 C CB  . GLU A 1 175 ? 17.311 -16.024 17.737 1.00 138.66 ? 171 GLU A CB  1 
ATOM   1382 C CG  . GLU A 1 175 ? 18.822 -16.093 17.946 1.00 138.66 ? 171 GLU A CG  1 
ATOM   1383 C CD  . GLU A 1 175 ? 19.549 -16.795 16.815 1.00 138.66 ? 171 GLU A CD  1 
ATOM   1384 O OE1 . GLU A 1 175 ? 19.432 -16.339 15.657 1.00 138.66 ? 171 GLU A OE1 1 
ATOM   1385 O OE2 . GLU A 1 175 ? 20.241 -17.801 17.085 1.00 138.66 ? 171 GLU A OE2 1 
ATOM   1386 N N   . GLU A 1 176 ? 17.795 -16.227 20.663 1.00 46.43  ? 172 GLU A N   1 
ATOM   1387 C CA  . GLU A 1 176 ? 17.948 -16.932 21.921 1.00 46.43  ? 172 GLU A CA  1 
ATOM   1388 C C   . GLU A 1 176 ? 18.761 -16.068 22.883 1.00 46.43  ? 172 GLU A C   1 
ATOM   1389 O O   . GLU A 1 176 ? 19.649 -15.317 22.468 1.00 46.43  ? 172 GLU A O   1 
ATOM   1390 C CB  . GLU A 1 176 ? 18.653 -18.268 21.691 1.00 72.63  ? 172 GLU A CB  1 
ATOM   1391 C CG  . GLU A 1 176 ? 20.093 -18.123 21.256 1.00 72.63  ? 172 GLU A CG  1 
ATOM   1392 C CD  . GLU A 1 176 ? 20.684 -19.425 20.766 1.00 72.63  ? 172 GLU A CD  1 
ATOM   1393 O OE1 . GLU A 1 176 ? 20.235 -19.918 19.709 1.00 72.63  ? 172 GLU A OE1 1 
ATOM   1394 O OE2 . GLU A 1 176 ? 21.594 -19.958 21.437 1.00 72.63  ? 172 GLU A OE2 1 
ATOM   1395 N N   . PRO A 1 177 ? 18.461 -16.159 24.184 1.00 39.43  ? 173 PRO A N   1 
ATOM   1396 C CA  . PRO A 1 177 ? 19.179 -15.376 25.191 1.00 39.43  ? 173 PRO A CA  1 
ATOM   1397 C C   . PRO A 1 177 ? 20.676 -15.635 25.086 1.00 39.43  ? 173 PRO A C   1 
ATOM   1398 O O   . PRO A 1 177 ? 21.098 -16.716 24.671 1.00 39.43  ? 173 PRO A O   1 
ATOM   1399 C CB  . PRO A 1 177 ? 18.604 -15.896 26.510 1.00 33.13  ? 173 PRO A CB  1 
ATOM   1400 C CG  . PRO A 1 177 ? 17.215 -16.320 26.129 1.00 33.13  ? 173 PRO A CG  1 
ATOM   1401 C CD  . PRO A 1 177 ? 17.450 -17.024 24.815 1.00 33.13  ? 173 PRO A CD  1 
ATOM   1402 N N   . VAL A 1 178 ? 21.473 -14.647 25.463 1.00 26.94  ? 174 VAL A N   1 
ATOM   1403 C CA  . VAL A 1 178 ? 22.914 -14.795 25.412 1.00 26.94  ? 174 VAL A CA  1 
ATOM   1404 C C   . VAL A 1 178 ? 23.502 -14.980 26.807 1.00 26.94  ? 174 VAL A C   1 
ATOM   1405 O O   . VAL A 1 178 ? 23.075 -14.331 27.758 1.00 26.94  ? 174 VAL A O   1 
ATOM   1406 C CB  . VAL A 1 178 ? 23.558 -13.568 24.767 1.00 43.71  ? 174 VAL A CB  1 
ATOM   1407 C CG1 . VAL A 1 178 ? 25.074 -13.672 24.851 1.00 43.71  ? 174 VAL A CG1 1 
ATOM   1408 C CG2 . VAL A 1 178 ? 23.107 -13.458 23.321 1.00 43.71  ? 174 VAL A CG2 1 
ATOM   1409 N N   . LEU A 1 179 ? 24.475 -15.877 26.927 1.00 22.26  ? 175 LEU A N   1 
ATOM   1410 C CA  . LEU A 1 179 ? 25.127 -16.120 28.208 1.00 22.26  ? 175 LEU A CA  1 
ATOM   1411 C C   . LEU A 1 179 ? 26.609 -15.819 28.138 1.00 22.26  ? 175 LEU A C   1 
ATOM   1412 O O   . LEU A 1 179 ? 27.336 -16.451 27.378 1.00 22.26  ? 175 LEU A O   1 
ATOM   1413 C CB  . LEU A 1 179 ? 24.961 -17.571 28.656 1.00 29.83  ? 175 LEU A CB  1 
ATOM   1414 C CG  . LEU A 1 179 ? 23.700 -17.982 29.406 1.00 29.83  ? 175 LEU A CG  1 
ATOM   1415 C CD1 . LEU A 1 179 ? 23.959 -19.320 30.064 1.00 29.83  ? 175 LEU A CD1 1 
ATOM   1416 C CD2 . LEU A 1 179 ? 23.350 -16.964 30.467 1.00 29.83  ? 175 LEU A CD2 1 
ATOM   1417 N N   . LYS A 1 180 ? 27.054 -14.848 28.927 1.00 37.49  ? 176 LYS A N   1 
ATOM   1418 C CA  . LYS A 1 180 ? 28.469 -14.503 28.975 1.00 37.49  ? 176 LYS A CA  1 
ATOM   1419 C C   . LYS A 1 180 ? 29.040 -15.068 30.260 1.00 37.49  ? 176 LYS A C   1 
ATOM   1420 O O   . LYS A 1 180 ? 28.667 -14.659 31.361 1.00 37.49  ? 176 LYS A O   1 
ATOM   1421 C CB  . LYS A 1 180 ? 28.670 -12.991 28.914 1.00 52.31  ? 176 LYS A CB  1 
ATOM   1422 C CG  . LYS A 1 180 ? 28.668 -12.450 27.497 1.00 52.31  ? 176 LYS A CG  1 
ATOM   1423 C CD  . LYS A 1 180 ? 29.804 -13.056 26.677 1.00 52.31  ? 176 LYS A CD  1 
ATOM   1424 C CE  . LYS A 1 180 ? 29.797 -12.556 25.241 1.00 52.31  ? 176 LYS A CE  1 
ATOM   1425 N NZ  . LYS A 1 180 ? 31.026 -12.999 24.511 1.00 52.31  ? 176 LYS A NZ  1 
ATOM   1426 N N   . HIS A 1 181 ? 29.949 -16.021 30.095 1.00 35.21  ? 177 HIS A N   1 
ATOM   1427 C CA  . HIS A 1 181 ? 30.579 -16.721 31.199 1.00 35.21  ? 177 HIS A CA  1 
ATOM   1428 C C   . HIS A 1 181 ? 31.912 -16.131 31.664 1.00 35.21  ? 177 HIS A C   1 
ATOM   1429 O O   . HIS A 1 181 ? 32.648 -15.516 30.882 1.00 35.21  ? 177 HIS A O   1 
ATOM   1430 C CB  . HIS A 1 181 ? 30.753 -18.194 30.790 1.00 46.58  ? 177 HIS A CB  1 
ATOM   1431 C CG  . HIS A 1 181 ? 32.158 -18.699 30.901 1.00 46.58  ? 177 HIS A CG  1 
ATOM   1432 N ND1 . HIS A 1 181 ? 32.700 -19.143 32.090 1.00 46.58  ? 177 HIS A ND1 1 
ATOM   1433 C CD2 . HIS A 1 181 ? 33.145 -18.797 29.979 1.00 46.58  ? 177 HIS A CD2 1 
ATOM   1434 C CE1 . HIS A 1 181 ? 33.960 -19.489 31.896 1.00 46.58  ? 177 HIS A CE1 1 
ATOM   1435 N NE2 . HIS A 1 181 ? 34.255 -19.289 30.623 1.00 46.58  ? 177 HIS A NE2 1 
ATOM   1436 N N   . TRP A 1 182 ? 32.207 -16.333 32.948 1.00 31.77  ? 178 TRP A N   1 
ATOM   1437 C CA  . TRP A 1 182 ? 33.448 -15.875 33.562 1.00 31.77  ? 178 TRP A CA  1 
ATOM   1438 C C   . TRP A 1 182 ? 33.833 -16.853 34.683 1.00 31.77  ? 178 TRP A C   1 
ATOM   1439 O O   . TRP A 1 182 ? 32.968 -17.321 35.442 1.00 31.77  ? 178 TRP A O   1 
ATOM   1440 C CB  . TRP A 1 182 ? 33.288 -14.473 34.156 1.00 21.47  ? 178 TRP A CB  1 
ATOM   1441 C CG  . TRP A 1 182 ? 34.573 -13.961 34.749 1.00 21.47  ? 178 TRP A CG  1 
ATOM   1442 C CD1 . TRP A 1 182 ? 35.554 -13.261 34.099 1.00 21.47  ? 178 TRP A CD1 1 
ATOM   1443 C CD2 . TRP A 1 182 ? 35.061 -14.194 36.076 1.00 21.47  ? 178 TRP A CD2 1 
ATOM   1444 N NE1 . TRP A 1 182 ? 36.622 -13.048 34.940 1.00 21.47  ? 178 TRP A NE1 1 
ATOM   1445 C CE2 . TRP A 1 182 ? 36.346 -13.608 36.159 1.00 21.47  ? 178 TRP A CE2 1 
ATOM   1446 C CE3 . TRP A 1 182 ? 34.540 -14.840 37.202 1.00 21.47  ? 178 TRP A CE3 1 
ATOM   1447 C CZ2 . TRP A 1 182 ? 37.115 -13.649 37.327 1.00 21.47  ? 178 TRP A CZ2 1 
ATOM   1448 C CZ3 . TRP A 1 182 ? 35.305 -14.883 38.366 1.00 21.47  ? 178 TRP A CZ3 1 
ATOM   1449 C CH2 . TRP A 1 182 ? 36.579 -14.290 38.419 1.00 21.47  ? 178 TRP A CH2 1 
ATOM   1450 N N   . SER A 1 183 ? 35.132 -17.137 34.799 1.00 48.89  ? 179 SER A N   1 
ATOM   1451 C CA  . SER A 1 183 ? 35.630 -18.074 35.807 1.00 48.89  ? 179 SER A CA  1 
ATOM   1452 C C   . SER A 1 183 ? 36.841 -17.619 36.626 1.00 48.89  ? 179 SER A C   1 
ATOM   1453 O O   . SER A 1 183 ? 37.697 -16.874 36.148 1.00 48.89  ? 179 SER A O   1 
ATOM   1454 C CB  . SER A 1 183 ? 35.968 -19.405 35.135 1.00 47.28  ? 179 SER A CB  1 
ATOM   1455 O OG  . SER A 1 183 ? 36.572 -20.294 36.057 1.00 47.28  ? 179 SER A OG  1 
ATOM   1456 N N   . SER A 1 184 ? 36.911 -18.106 37.862 1.00 59.32  ? 180 SER A N   1 
ATOM   1457 C CA  . SER A 1 184 ? 38.000 -17.781 38.780 1.00 59.32  ? 180 SER A CA  1 
ATOM   1458 C C   . SER A 1 184 ? 39.288 -18.521 38.409 1.00 59.32  ? 180 SER A C   1 
ATOM   1459 O O   . SER A 1 184 ? 39.640 -18.523 37.207 1.00 59.32  ? 180 SER A O   1 
ATOM   1460 C CB  . SER A 1 184 ? 37.598 -18.153 40.210 1.00 89.83  ? 180 SER A CB  1 
ATOM   1461 O OG  . SER A 1 184 ? 36.307 -17.656 40.529 1.00 89.83  ? 180 SER A OG  1 
ATOM   1462 N N   . TYR B 2 7   P 23.566 26.230  43.434 1.00 35.56  ? 207 TYR B N   1 
ATOM   1463 C CA  . TYR B 2 7   P 23.787 24.779  43.717 1.00 35.56  ? 207 TYR B CA  1 
ATOM   1464 C C   . TYR B 2 7   P 22.784 23.868  42.997 1.00 35.56  ? 207 TYR B C   1 
ATOM   1465 O O   . TYR B 2 7   P 22.882 22.645  43.078 1.00 35.56  ? 207 TYR B O   1 
ATOM   1466 C CB  . TYR B 2 7   P 23.714 24.521  45.225 1.00 31.41  ? 207 TYR B CB  1 
ATOM   1467 N N   . GLU B 2 8   P 21.824 24.460  42.291 1.00 25.47  ? 208 GLU B N   1 
ATOM   1468 C CA  . GLU B 2 8   P 20.817 23.672  41.576 1.00 25.47  ? 208 GLU B CA  1 
ATOM   1469 C C   . GLU B 2 8   P 21.163 23.406  40.111 1.00 25.47  ? 208 GLU B C   1 
ATOM   1470 O O   . GLU B 2 8   P 21.583 24.306  39.382 1.00 25.47  ? 208 GLU B O   1 
ATOM   1471 C CB  . GLU B 2 8   P 19.446 24.347  41.645 1.00 52.86  ? 208 GLU B CB  1 
ATOM   1472 C CG  . GLU B 2 8   P 18.342 23.493  41.043 1.00 52.86  ? 208 GLU B CG  1 
ATOM   1473 C CD  . GLU B 2 8   P 16.977 24.151  41.107 1.00 52.86  ? 208 GLU B CD  1 
ATOM   1474 O OE1 . GLU B 2 8   P 16.683 24.821  42.121 1.00 52.86  ? 208 GLU B OE1 1 
ATOM   1475 O OE2 . GLU B 2 8   P 16.193 23.982  40.148 1.00 52.86  ? 208 GLU B OE2 1 
ATOM   1476 N N   . ILE B 2 9   P 20.978 22.155  39.697 1.00 30.10  ? 209 ILE B N   1 
ATOM   1477 C CA  . ILE B 2 9   P 21.258 21.737  38.329 1.00 30.10  ? 209 ILE B CA  1 
ATOM   1478 C C   . ILE B 2 9   P 20.075 22.053  37.417 1.00 30.10  ? 209 ILE B C   1 
ATOM   1479 O O   . ILE B 2 9   P 18.929 21.699  37.706 1.00 30.10  ? 209 ILE B O   1 
ATOM   1480 C CB  . ILE B 2 9   P 21.550 20.220  38.267 1.00 26.56  ? 209 ILE B CB  1 
ATOM   1481 C CG1 . ILE B 2 9   P 22.885 19.922  38.956 1.00 26.56  ? 209 ILE B CG1 1 
ATOM   1482 C CG2 . ILE B 2 9   P 21.564 19.740  36.822 1.00 26.56  ? 209 ILE B CG2 1 
ATOM   1483 C CD1 . ILE B 2 9   P 23.093 18.464  39.292 1.00 26.56  ? 209 ILE B CD1 1 
ATOM   1484 N N   . ALA B 2 10  P 20.366 22.732  36.315 1.00 17.35  ? 210 ALA B N   1 
ATOM   1485 C CA  . ALA B 2 10  P 19.341 23.089  35.357 1.00 17.35  ? 210 ALA B CA  1 
ATOM   1486 C C   . ALA B 2 10  P 19.240 22.008  34.304 1.00 17.35  ? 210 ALA B C   1 
ATOM   1487 O O   . ALA B 2 10  P 20.231 21.396  33.921 1.00 17.35  ? 210 ALA B O   1 
ATOM   1488 C CB  . ALA B 2 10  P 19.678 24.427  34.685 1.00 7.52   ? 210 ALA B CB  1 
ATOM   1489 N N   . PRO B 2 11  P 18.026 21.729  33.848 1.00 30.83  ? 211 PRO B N   1 
ATOM   1490 C CA  . PRO B 2 11  P 17.960 20.696  32.822 1.00 30.83  ? 211 PRO B CA  1 
ATOM   1491 C C   . PRO B 2 11  P 17.991 21.392  31.475 1.00 30.83  ? 211 PRO B C   1 
ATOM   1492 O O   . PRO B 2 11  P 17.832 22.605  31.413 1.00 30.83  ? 211 PRO B O   1 
ATOM   1493 C CB  . PRO B 2 11  P 16.615 20.040  33.093 1.00 19.78  ? 211 PRO B CB  1 
ATOM   1494 C CG  . PRO B 2 11  P 15.796 21.173  33.568 1.00 19.78  ? 211 PRO B CG  1 
ATOM   1495 C CD  . PRO B 2 11  P 16.726 21.887  34.518 1.00 19.78  ? 211 PRO B CD  1 
ATOM   1496 N N   . VAL B 2 12  P 18.248 20.647  30.408 1.00 26.49  ? 212 VAL B N   1 
ATOM   1497 C CA  . VAL B 2 12  P 18.188 21.229  29.078 1.00 26.49  ? 212 VAL B CA  1 
ATOM   1498 C C   . VAL B 2 12  P 16.795 20.757  28.637 1.00 26.49  ? 212 VAL B C   1 
ATOM   1499 O O   . VAL B 2 12  P 16.541 19.548  28.542 1.00 26.49  ? 212 VAL B O   1 
ATOM   1500 C CB  . VAL B 2 12  P 19.278 20.676  28.157 1.00 35.81  ? 212 VAL B CB  1 
ATOM   1501 C CG1 . VAL B 2 12  P 18.991 21.080  26.722 1.00 35.81  ? 212 VAL B CG1 1 
ATOM   1502 C CG2 . VAL B 2 12  P 20.628 21.235  28.576 1.00 35.81  ? 212 VAL B CG2 1 
ATOM   1503 N N   . PHE B 2 13  P 15.894 21.704  28.393 1.00 25.60  ? 213 PHE B N   1 
ATOM   1504 C CA  . PHE B 2 13  P 14.505 21.374  28.057 1.00 25.60  ? 213 PHE B CA  1 
ATOM   1505 C C   . PHE B 2 13  P 14.129 20.879  26.667 1.00 25.60  ? 213 PHE B C   1 
ATOM   1506 O O   . PHE B 2 13  P 14.626 21.367  25.657 1.00 25.60  ? 213 PHE B O   1 
ATOM   1507 C CB  . PHE B 2 13  P 13.594 22.570  28.395 1.00 29.89  ? 213 PHE B CB  1 
ATOM   1508 C CG  . PHE B 2 13  P 13.537 22.897  29.864 1.00 29.89  ? 213 PHE B CG  1 
ATOM   1509 C CD1 . PHE B 2 13  P 12.810 22.102  30.739 1.00 29.89  ? 213 PHE B CD1 1 
ATOM   1510 C CD2 . PHE B 2 13  P 14.251 23.979  30.378 1.00 29.89  ? 213 PHE B CD2 1 
ATOM   1511 C CE1 . PHE B 2 13  P 12.797 22.374  32.112 1.00 29.89  ? 213 PHE B CE1 1 
ATOM   1512 C CE2 . PHE B 2 13  P 14.245 24.257  31.744 1.00 29.89  ? 213 PHE B CE2 1 
ATOM   1513 C CZ  . PHE B 2 13  P 13.517 23.452  32.613 1.00 29.89  ? 213 PHE B CZ  1 
ATOM   1514 N N   . VAL B 2 14  P 13.220 19.908  26.647 1.00 31.49  ? 214 VAL B N   1 
ATOM   1515 C CA  . VAL B 2 14  P 12.684 19.355  25.410 1.00 31.49  ? 214 VAL B CA  1 
ATOM   1516 C C   . VAL B 2 14  P 11.568 20.311  24.996 1.00 31.49  ? 214 VAL B C   1 
ATOM   1517 O O   . VAL B 2 14  P 10.677 20.600  25.801 1.00 31.49  ? 214 VAL B O   1 
ATOM   1518 C CB  . VAL B 2 14  P 12.017 17.988  25.625 1.00 32.63  ? 214 VAL B CB  1 
ATOM   1519 C CG1 . VAL B 2 14  P 11.437 17.488  24.303 1.00 32.63  ? 214 VAL B CG1 1 
ATOM   1520 C CG2 . VAL B 2 14  P 13.009 16.997  26.206 1.00 32.63  ? 214 VAL B CG2 1 
ATOM   1521 N N   . LEU B 2 15  P 11.606 20.794  23.757 1.00 43.56  ? 215 LEU B N   1 
ATOM   1522 C CA  . LEU B 2 15  P 10.578 21.713  23.282 1.00 43.56  ? 215 LEU B CA  1 
ATOM   1523 C C   . LEU B 2 15  P 9.562  21.006  22.390 1.00 43.56  ? 215 LEU B C   1 
ATOM   1524 O O   . LEU B 2 15  P 9.922  20.166  21.557 1.00 43.56  ? 215 LEU B O   1 
ATOM   1525 C CB  . LEU B 2 15  P 11.230 22.878  22.544 1.00 41.69  ? 215 LEU B CB  1 
ATOM   1526 C CG  . LEU B 2 15  P 12.258 23.582  23.433 1.00 41.69  ? 215 LEU B CG  1 
ATOM   1527 C CD1 . LEU B 2 15  P 13.009 24.626  22.635 1.00 41.69  ? 215 LEU B CD1 1 
ATOM   1528 C CD2 . LEU B 2 15  P 11.552 24.198  24.632 1.00 41.69  ? 215 LEU B CD2 1 
ATOM   1529 N N   . LEU B 2 16  P 8.292  21.361  22.580 1.00 34.69  ? 216 LEU B N   1 
ATOM   1530 C CA  . LEU B 2 16  P 7.177  20.767  21.848 1.00 34.69  ? 216 LEU B CA  1 
ATOM   1531 C C   . LEU B 2 16  P 7.137  20.987  20.338 1.00 34.69  ? 216 LEU B C   1 
ATOM   1532 O O   . LEU B 2 16  P 7.368  22.090  19.844 1.00 34.69  ? 216 LEU B O   1 
ATOM   1533 C CB  . LEU B 2 16  P 5.859  21.247  22.450 1.00 27.72  ? 216 LEU B CB  1 
ATOM   1534 C CG  . LEU B 2 16  P 5.649  20.901  23.928 1.00 27.72  ? 216 LEU B CG  1 
ATOM   1535 C CD1 . LEU B 2 16  P 4.292  21.412  24.386 1.00 27.72  ? 216 LEU B CD1 1 
ATOM   1536 C CD2 . LEU B 2 16  P 5.745  19.394  24.131 1.00 27.72  ? 216 LEU B CD2 1 
ATOM   1537 N N   . GLU B 2 17  P 6.826  19.915  19.616 1.00 42.69  ? 217 GLU B N   1 
ATOM   1538 C CA  . GLU B 2 17  P 6.721  19.942  18.160 1.00 42.69  ? 217 GLU B CA  1 
ATOM   1539 C C   . GLU B 2 17  P 5.293  20.348  17.787 1.00 42.69  ? 217 GLU B C   1 
ATOM   1540 O O   . GLU B 2 17  P 4.363  20.142  18.567 1.00 42.69  ? 217 GLU B O   1 
ATOM   1541 C CB  . GLU B 2 17  P 7.030  18.550  17.593 1.00 49.68  ? 217 GLU B CB  1 
ATOM   1542 C CG  . GLU B 2 17  P 6.848  18.427  16.090 1.00 49.68  ? 217 GLU B CG  1 
ATOM   1543 C CD  . GLU B 2 17  P 7.890  19.191  15.307 1.00 49.68  ? 217 GLU B CD  1 
ATOM   1544 O OE1 . GLU B 2 17  P 9.056  18.749  15.299 1.00 49.68  ? 217 GLU B OE1 1 
ATOM   1545 O OE2 . GLU B 2 17  P 7.543  20.233  14.708 1.00 49.68  ? 217 GLU B OE2 1 
ATOM   1546 N N   . TYR B 2 18  P 5.118  20.922  16.600 1.00 50.11  ? 218 TYR B N   1 
ATOM   1547 C CA  . TYR B 2 18  P 3.790  21.342  16.154 1.00 50.11  ? 218 TYR B CA  1 
ATOM   1548 C C   . TYR B 2 18  P 2.926  20.141  15.775 1.00 50.11  ? 218 TYR B C   1 
ATOM   1549 O O   . TYR B 2 18  P 3.381  19.225  15.087 1.00 50.11  ? 218 TYR B O   1 
ATOM   1550 C CB  . TYR B 2 18  P 3.902  22.285  14.955 1.00 42.00  ? 218 TYR B CB  1 
ATOM   1551 N N   . VAL B 2 19  P 1.677  20.153  16.230 1.00 51.45  ? 219 VAL B N   1 
ATOM   1552 C CA  . VAL B 2 19  P 0.739  19.072  15.944 1.00 51.45  ? 219 VAL B CA  1 
ATOM   1553 C C   . VAL B 2 19  P 0.237  19.129  14.502 1.00 51.45  ? 219 VAL B C   1 
ATOM   1554 O O   . VAL B 2 19  P -0.391 20.104  14.090 1.00 51.45  ? 219 VAL B O   1 
ATOM   1555 C CB  . VAL B 2 19  P -0.483 19.132  16.895 1.00 39.27  ? 219 VAL B CB  1 
ATOM   1556 C CG1 . VAL B 2 19  P -1.530 18.101  16.475 1.00 39.27  ? 219 VAL B CG1 1 
ATOM   1557 C CG2 . VAL B 2 19  P -0.033 18.876  18.333 1.00 39.27  ? 219 VAL B CG2 1 
ATOM   1558 N N   . THR B 2 20  P 0.513  18.075  13.740 1.00 50.64  ? 220 THR B N   1 
ATOM   1559 C CA  . THR B 2 20  P 0.083  18.011  12.351 1.00 50.64  ? 220 THR B CA  1 
ATOM   1560 C C   . THR B 2 20  P -0.823 16.801  12.117 1.00 50.64  ? 220 THR B C   1 
ATOM   1561 O O   . THR B 2 20  P -2.049 16.968  12.294 1.00 50.64  ? 220 THR B O   1 
ATOM   1562 C CB  . THR B 2 20  P 1.295  17.926  11.397 1.00 26.22  ? 220 THR B CB  1 
ATOM   1563 N N   . ARG B 2 31  ? 5.581  -4.192  17.055 1.00 40.05  ? 5   ARG B N   1 
ATOM   1564 C CA  . ARG B 2 31  ? 5.874  -2.799  16.604 1.00 40.05  ? 5   ARG B CA  1 
ATOM   1565 C C   . ARG B 2 31  ? 6.149  -1.871  17.784 1.00 40.05  ? 5   ARG B C   1 
ATOM   1566 O O   . ARG B 2 31  ? 5.304  -1.699  18.670 1.00 40.05  ? 5   ARG B O   1 
ATOM   1567 C CB  . ARG B 2 31  ? 4.706  -2.250  15.778 1.00 95.64  ? 5   ARG B CB  1 
ATOM   1568 C CG  . ARG B 2 31  ? 4.677  -2.747  14.338 1.00 95.64  ? 5   ARG B CG  1 
ATOM   1569 C CD  . ARG B 2 31  ? 3.324  -2.501  13.662 1.00 95.64  ? 5   ARG B CD  1 
ATOM   1570 N NE  . ARG B 2 31  ? 2.967  -1.085  13.570 1.00 95.64  ? 5   ARG B NE  1 
ATOM   1571 C CZ  . ARG B 2 31  ? 1.831  -0.636  13.042 1.00 95.64  ? 5   ARG B CZ  1 
ATOM   1572 N NH1 . ARG B 2 31  ? 0.939  -1.492  12.556 1.00 95.64  ? 5   ARG B NH1 1 
ATOM   1573 N NH2 . ARG B 2 31  ? 1.581  0.668   12.999 1.00 95.64  ? 5   ARG B NH2 1 
ATOM   1574 N N   . HIS B 2 32  ? 7.343  -1.283  17.793 1.00 34.44  ? 6   HIS B N   1 
ATOM   1575 C CA  . HIS B 2 32  ? 7.727  -0.359  18.853 1.00 34.44  ? 6   HIS B CA  1 
ATOM   1576 C C   . HIS B 2 32  ? 8.257  0.938   18.252 1.00 34.44  ? 6   HIS B C   1 
ATOM   1577 O O   . HIS B 2 32  ? 8.896  0.925   17.202 1.00 34.44  ? 6   HIS B O   1 
ATOM   1578 C CB  . HIS B 2 32  ? 8.788  -0.992  19.748 1.00 36.87  ? 6   HIS B CB  1 
ATOM   1579 C CG  . HIS B 2 32  ? 8.375  -2.305  20.330 1.00 36.87  ? 6   HIS B CG  1 
ATOM   1580 N ND1 . HIS B 2 32  ? 8.654  -3.510  19.721 1.00 36.87  ? 6   HIS B ND1 1 
ATOM   1581 C CD2 . HIS B 2 32  ? 7.669  -2.602  21.448 1.00 36.87  ? 6   HIS B CD2 1 
ATOM   1582 C CE1 . HIS B 2 32  ? 8.140  -4.495  20.439 1.00 36.87  ? 6   HIS B CE1 1 
ATOM   1583 N NE2 . HIS B 2 32  ? 7.537  -3.970  21.492 1.00 36.87  ? 6   HIS B NE2 1 
ATOM   1584 N N   . PHE B 2 33  ? 7.992  2.054   18.920 1.00 25.86  ? 7   PHE B N   1 
ATOM   1585 C CA  . PHE B 2 33  ? 8.434  3.359   18.435 1.00 25.86  ? 7   PHE B CA  1 
ATOM   1586 C C   . PHE B 2 33  ? 9.216  4.117   19.511 1.00 25.86  ? 7   PHE B C   1 
ATOM   1587 O O   . PHE B 2 33  ? 8.807  4.171   20.671 1.00 25.86  ? 7   PHE B O   1 
ATOM   1588 C CB  . PHE B 2 33  ? 7.208  4.146   17.978 1.00 38.58  ? 7   PHE B CB  1 
ATOM   1589 C CG  . PHE B 2 33  ? 6.393  3.419   16.949 1.00 38.58  ? 7   PHE B CG  1 
ATOM   1590 C CD1 . PHE B 2 33  ? 6.761  3.445   15.606 1.00 38.58  ? 7   PHE B CD1 1 
ATOM   1591 C CD2 . PHE B 2 33  ? 5.300  2.651   17.329 1.00 38.58  ? 7   PHE B CD2 1 
ATOM   1592 C CE1 . PHE B 2 33  ? 6.051  2.713   14.654 1.00 38.58  ? 7   PHE B CE1 1 
ATOM   1593 C CE2 . PHE B 2 33  ? 4.583  1.915   16.388 1.00 38.58  ? 7   PHE B CE2 1 
ATOM   1594 C CZ  . PHE B 2 33  ? 4.961  1.947   15.045 1.00 38.58  ? 7   PHE B CZ  1 
ATOM   1595 N N   . VAL B 2 34  ? 10.343 4.705   19.123 1.00 30.56  ? 8   VAL B N   1 
ATOM   1596 C CA  . VAL B 2 34  ? 11.189 5.420   20.075 1.00 30.56  ? 8   VAL B CA  1 
ATOM   1597 C C   . VAL B 2 34  ? 11.517 6.855   19.686 1.00 30.56  ? 8   VAL B C   1 
ATOM   1598 O O   . VAL B 2 34  ? 11.704 7.160   18.510 1.00 30.56  ? 8   VAL B O   1 
ATOM   1599 C CB  . VAL B 2 34  ? 12.543 4.688   20.261 1.00 22.90  ? 8   VAL B CB  1 
ATOM   1600 C CG1 . VAL B 2 34  ? 13.392 5.415   21.283 1.00 22.90  ? 8   VAL B CG1 1 
ATOM   1601 C CG2 . VAL B 2 34  ? 12.314 3.248   20.677 1.00 22.90  ? 8   VAL B CG2 1 
ATOM   1602 N N   . HIS B 2 35  ? 11.588 7.733   20.686 1.00 26.23  ? 9   HIS B N   1 
ATOM   1603 C CA  . HIS B 2 35  ? 11.961 9.125   20.454 1.00 26.23  ? 9   HIS B CA  1 
ATOM   1604 C C   . HIS B 2 35  ? 12.954 9.515   21.551 1.00 26.23  ? 9   HIS B C   1 
ATOM   1605 O O   . HIS B 2 35  ? 12.806 9.098   22.705 1.00 26.23  ? 9   HIS B O   1 
ATOM   1606 C CB  . HIS B 2 35  ? 10.743 10.052  20.480 1.00 31.68  ? 9   HIS B CB  1 
ATOM   1607 C CG  . HIS B 2 35  ? 11.030 11.422  19.950 1.00 31.68  ? 9   HIS B CG  1 
ATOM   1608 N ND1 . HIS B 2 35  ? 11.798 12.338  20.636 1.00 31.68  ? 9   HIS B ND1 1 
ATOM   1609 C CD2 . HIS B 2 35  ? 10.714 12.006  18.769 1.00 31.68  ? 9   HIS B CD2 1 
ATOM   1610 C CE1 . HIS B 2 35  ? 11.946 13.426  19.900 1.00 31.68  ? 9   HIS B CE1 1 
ATOM   1611 N NE2 . HIS B 2 35  ? 11.298 13.250  18.762 1.00 31.68  ? 9   HIS B NE2 1 
ATOM   1612 N N   . GLN B 2 36  ? 13.963 10.307  21.191 1.00 26.01  ? 10  GLN B N   1 
ATOM   1613 C CA  . GLN B 2 36  ? 14.990 10.712  22.151 1.00 26.01  ? 10  GLN B CA  1 
ATOM   1614 C C   . GLN B 2 36  ? 15.348 12.183  22.051 1.00 26.01  ? 10  GLN B C   1 
ATOM   1615 O O   . GLN B 2 36  ? 15.324 12.760  20.964 1.00 26.01  ? 10  GLN B O   1 
ATOM   1616 C CB  . GLN B 2 36  ? 16.292 9.927   21.923 1.00 16.41  ? 10  GLN B CB  1 
ATOM   1617 C CG  . GLN B 2 36  ? 16.172 8.421   21.823 1.00 16.41  ? 10  GLN B CG  1 
ATOM   1618 C CD  . GLN B 2 36  ? 17.533 7.736   21.642 1.00 16.41  ? 10  GLN B CD  1 
ATOM   1619 O OE1 . GLN B 2 36  ? 18.426 7.893   22.469 1.00 16.41  ? 10  GLN B OE1 1 
ATOM   1620 N NE2 . GLN B 2 36  ? 17.685 6.969   20.563 1.00 16.41  ? 10  GLN B NE2 1 
ATOM   1621 N N   . PHE B 2 37  ? 15.693 12.779  23.190 1.00 24.46  ? 11  PHE B N   1 
ATOM   1622 C CA  . PHE B 2 37  ? 16.138 14.172  23.234 1.00 24.46  ? 11  PHE B CA  1 
ATOM   1623 C C   . PHE B 2 37  ? 17.505 14.206  23.921 1.00 24.46  ? 11  PHE B C   1 
ATOM   1624 O O   . PHE B 2 37  ? 17.660 13.707  25.038 1.00 24.46  ? 11  PHE B O   1 
ATOM   1625 C CB  . PHE B 2 37  ? 15.181 15.056  24.021 1.00 34.76  ? 11  PHE B CB  1 
ATOM   1626 C CG  . PHE B 2 37  ? 15.725 16.433  24.279 1.00 34.76  ? 11  PHE B CG  1 
ATOM   1627 C CD1 . PHE B 2 37  ? 15.638 17.422  23.310 1.00 34.76  ? 11  PHE B CD1 1 
ATOM   1628 C CD2 . PHE B 2 37  ? 16.355 16.732  25.482 1.00 34.76  ? 11  PHE B CD2 1 
ATOM   1629 C CE1 . PHE B 2 37  ? 16.172 18.692  23.534 1.00 34.76  ? 11  PHE B CE1 1 
ATOM   1630 C CE2 . PHE B 2 37  ? 16.891 17.997  25.714 1.00 34.76  ? 11  PHE B CE2 1 
ATOM   1631 C CZ  . PHE B 2 37  ? 16.799 18.978  24.737 1.00 34.76  ? 11  PHE B CZ  1 
ATOM   1632 N N   . LYS B 2 38  ? 18.493 14.790  23.257 1.00 29.98  ? 12  LYS B N   1 
ATOM   1633 C CA  . LYS B 2 38  ? 19.822 14.857  23.835 1.00 29.98  ? 12  LYS B CA  1 
ATOM   1634 C C   . LYS B 2 38  ? 20.320 16.274  24.016 1.00 29.98  ? 12  LYS B C   1 
ATOM   1635 O O   . LYS B 2 38  ? 20.430 17.026  23.055 1.00 29.98  ? 12  LYS B O   1 
ATOM   1636 C CB  . LYS B 2 38  ? 20.818 14.070  22.980 1.00 23.37  ? 12  LYS B CB  1 
ATOM   1637 C CG  . LYS B 2 38  ? 20.583 12.578  23.027 1.00 23.37  ? 12  LYS B CG  1 
ATOM   1638 C CD  . LYS B 2 38  ? 21.581 11.800  22.196 1.00 23.37  ? 12  LYS B CD  1 
ATOM   1639 C CE  . LYS B 2 38  ? 21.361 10.306  22.399 1.00 23.37  ? 12  LYS B CE  1 
ATOM   1640 N NZ  . LYS B 2 38  ? 22.406 9.480   21.744 1.00 23.37  ? 12  LYS B NZ  1 
ATOM   1641 N N   . GLY B 2 39  ? 20.595 16.632  25.265 1.00 23.64  ? 13  GLY B N   1 
ATOM   1642 C CA  . GLY B 2 39  ? 21.125 17.945  25.575 1.00 23.64  ? 13  GLY B CA  1 
ATOM   1643 C C   . GLY B 2 39  ? 22.609 17.754  25.847 1.00 23.64  ? 13  GLY B C   1 
ATOM   1644 O O   . GLY B 2 39  ? 23.002 17.001  26.749 1.00 23.64  ? 13  GLY B O   1 
ATOM   1645 N N   . GLU B 2 40  ? 23.442 18.431  25.074 1.00 30.89  ? 14  GLU B N   1 
ATOM   1646 C CA  . GLU B 2 40  ? 24.882 18.290  25.226 1.00 30.89  ? 14  GLU B CA  1 
ATOM   1647 C C   . GLU B 2 40  ? 25.616 19.622  25.421 1.00 30.89  ? 14  GLU B C   1 
ATOM   1648 O O   . GLU B 2 40  ? 25.402 20.577  24.664 1.00 30.89  ? 14  GLU B O   1 
ATOM   1649 C CB  . GLU B 2 40  ? 25.427 17.537  24.002 1.00 29.45  ? 14  GLU B CB  1 
ATOM   1650 C CG  . GLU B 2 40  ? 24.972 16.074  23.939 1.00 29.45  ? 14  GLU B CG  1 
ATOM   1651 C CD  . GLU B 2 40  ? 25.099 15.451  22.560 1.00 29.45  ? 14  GLU B CD  1 
ATOM   1652 O OE1 . GLU B 2 40  ? 26.026 15.819  21.807 1.00 29.45  ? 14  GLU B OE1 1 
ATOM   1653 O OE2 . GLU B 2 40  ? 24.267 14.579  22.235 1.00 29.45  ? 14  GLU B OE2 1 
ATOM   1654 N N   . CYS B 2 41  ? 26.467 19.684  26.448 1.00 27.44  ? 15  CYS B N   1 
ATOM   1655 C CA  . CYS B 2 41  ? 27.247 20.893  26.750 1.00 27.44  ? 15  CYS B CA  1 
ATOM   1656 C C   . CYS B 2 41  ? 28.742 20.589  26.697 1.00 27.44  ? 15  CYS B C   1 
ATOM   1657 O O   . CYS B 2 41  ? 29.253 19.854  27.534 1.00 27.44  ? 15  CYS B O   1 
ATOM   1658 C CB  . CYS B 2 41  ? 26.914 21.425  28.147 1.00 39.11  ? 15  CYS B CB  1 
ATOM   1659 S SG  . CYS B 2 41  ? 25.275 22.182  28.406 1.00 39.11  ? 15  CYS B SG  1 
ATOM   1660 N N   . TYR B 2 42  ? 29.443 21.159  25.724 1.00 28.49  ? 16  TYR B N   1 
ATOM   1661 C CA  . TYR B 2 42  ? 30.878 20.931  25.586 1.00 28.49  ? 16  TYR B CA  1 
ATOM   1662 C C   . TYR B 2 42  ? 31.671 22.053  26.239 1.00 28.49  ? 16  TYR B C   1 
ATOM   1663 O O   . TYR B 2 42  ? 31.324 23.225  26.090 1.00 28.49  ? 16  TYR B O   1 
ATOM   1664 C CB  . TYR B 2 42  ? 31.244 20.819  24.109 1.00 28.31  ? 16  TYR B CB  1 
ATOM   1665 C CG  . TYR B 2 42  ? 30.583 19.639  23.449 1.00 28.31  ? 16  TYR B CG  1 
ATOM   1666 C CD1 . TYR B 2 42  ? 31.145 18.369  23.524 1.00 28.31  ? 16  TYR B CD1 1 
ATOM   1667 C CD2 . TYR B 2 42  ? 29.355 19.777  22.818 1.00 28.31  ? 16  TYR B CD2 1 
ATOM   1668 C CE1 . TYR B 2 42  ? 30.493 17.266  22.987 1.00 28.31  ? 16  TYR B CE1 1 
ATOM   1669 C CE2 . TYR B 2 42  ? 28.697 18.686  22.284 1.00 28.31  ? 16  TYR B CE2 1 
ATOM   1670 C CZ  . TYR B 2 42  ? 29.267 17.435  22.371 1.00 28.31  ? 16  TYR B CZ  1 
ATOM   1671 O OH  . TYR B 2 42  ? 28.594 16.357  21.853 1.00 28.31  ? 16  TYR B OH  1 
ATOM   1672 N N   . PHE B 2 43  ? 32.729 21.683  26.963 1.00 31.48  ? 17  PHE B N   1 
ATOM   1673 C CA  . PHE B 2 43  ? 33.573 22.649  27.661 1.00 31.48  ? 17  PHE B CA  1 
ATOM   1674 C C   . PHE B 2 43  ? 35.048 22.471  27.325 1.00 31.48  ? 17  PHE B C   1 
ATOM   1675 O O   . PHE B 2 43  ? 35.546 21.349  27.217 1.00 31.48  ? 17  PHE B O   1 
ATOM   1676 C CB  . PHE B 2 43  ? 33.395 22.511  29.174 1.00 25.19  ? 17  PHE B CB  1 
ATOM   1677 C CG  . PHE B 2 43  ? 31.969 22.632  29.634 1.00 25.19  ? 17  PHE B CG  1 
ATOM   1678 C CD1 . PHE B 2 43  ? 31.399 23.880  29.870 1.00 25.19  ? 17  PHE B CD1 1 
ATOM   1679 C CD2 . PHE B 2 43  ? 31.189 21.494  29.835 1.00 25.19  ? 17  PHE B CD2 1 
ATOM   1680 C CE1 . PHE B 2 43  ? 30.067 23.999  30.306 1.00 25.19  ? 17  PHE B CE1 1 
ATOM   1681 C CE2 . PHE B 2 43  ? 29.860 21.600  30.269 1.00 25.19  ? 17  PHE B CE2 1 
ATOM   1682 C CZ  . PHE B 2 43  ? 29.299 22.861  30.506 1.00 25.19  ? 17  PHE B CZ  1 
ATOM   1683 N N   . THR B 2 44  ? 35.741 23.592  27.163 1.00 44.40  ? 18  THR B N   1 
ATOM   1684 C CA  . THR B 2 44  ? 37.167 23.587  26.858 1.00 44.40  ? 18  THR B CA  1 
ATOM   1685 C C   . THR B 2 44  ? 37.808 24.740  27.621 1.00 44.40  ? 18  THR B C   1 
ATOM   1686 O O   . THR B 2 44  ? 37.411 25.897  27.463 1.00 44.40  ? 18  THR B O   1 
ATOM   1687 C CB  . THR B 2 44  ? 37.430 23.773  25.352 1.00 32.38  ? 18  THR B CB  1 
ATOM   1688 O OG1 . THR B 2 44  ? 36.719 22.771  24.615 1.00 32.38  ? 18  THR B OG1 1 
ATOM   1689 C CG2 . THR B 2 44  ? 38.920 23.644  25.058 1.00 32.38  ? 18  THR B CG2 1 
ATOM   1690 N N   . ASN B 2 45  ? 38.798 24.415  28.445 1.00 55.75  ? 19  ASN B N   1 
ATOM   1691 C CA  . ASN B 2 45  ? 39.482 25.407  29.263 1.00 55.75  ? 19  ASN B CA  1 
ATOM   1692 C C   . ASN B 2 45  ? 38.429 26.093  30.125 1.00 55.75  ? 19  ASN B C   1 
ATOM   1693 O O   . ASN B 2 45  ? 38.111 27.266  29.921 1.00 55.75  ? 19  ASN B O   1 
ATOM   1694 C CB  . ASN B 2 45  ? 40.202 26.439  28.386 1.00 50.78  ? 19  ASN B CB  1 
ATOM   1695 C CG  . ASN B 2 45  ? 41.162 27.309  29.182 1.00 50.78  ? 19  ASN B CG  1 
ATOM   1696 O OD1 . ASN B 2 45  ? 42.026 26.798  29.901 1.00 50.78  ? 19  ASN B OD1 1 
ATOM   1697 N ND2 . ASN B 2 45  ? 41.022 28.626  29.053 1.00 50.78  ? 19  ASN B ND2 1 
ATOM   1698 N N   . GLY B 2 46  ? 37.889 25.349  31.089 1.00 46.98  ? 20  GLY B N   1 
ATOM   1699 C CA  . GLY B 2 46  ? 36.861 25.898  31.957 1.00 46.98  ? 20  GLY B CA  1 
ATOM   1700 C C   . GLY B 2 46  ? 35.626 26.247  31.141 1.00 46.98  ? 20  GLY B C   1 
ATOM   1701 O O   . GLY B 2 46  ? 35.160 25.435  30.341 1.00 46.98  ? 20  GLY B O   1 
ATOM   1702 N N   . THR B 2 47  ? 35.099 27.452  31.343 1.00 39.54  ? 21  THR B N   1 
ATOM   1703 C CA  . THR B 2 47  ? 33.930 27.922  30.611 1.00 39.54  ? 21  THR B CA  1 
ATOM   1704 C C   . THR B 2 47  ? 34.351 28.980  29.592 1.00 39.54  ? 21  THR B C   1 
ATOM   1705 O O   . THR B 2 47  ? 33.544 29.797  29.149 1.00 39.54  ? 21  THR B O   1 
ATOM   1706 C CB  . THR B 2 47  ? 32.876 28.522  31.564 1.00 52.62  ? 21  THR B CB  1 
ATOM   1707 O OG1 . THR B 2 47  ? 33.494 29.477  32.436 1.00 52.62  ? 21  THR B OG1 1 
ATOM   1708 C CG2 . THR B 2 47  ? 32.246 27.432  32.395 1.00 52.62  ? 21  THR B CG2 1 
ATOM   1709 N N   . GLN B 2 48  ? 35.630 28.952  29.231 1.00 44.32  ? 22  GLN B N   1 
ATOM   1710 C CA  . GLN B 2 48  ? 36.190 29.889  28.263 1.00 44.32  ? 22  GLN B CA  1 
ATOM   1711 C C   . GLN B 2 48  ? 35.485 29.715  26.926 1.00 44.32  ? 22  GLN B C   1 
ATOM   1712 O O   . GLN B 2 48  ? 35.161 30.689  26.242 1.00 44.32  ? 22  GLN B O   1 
ATOM   1713 C CB  . GLN B 2 48  ? 37.685 29.621  28.080 1.00 109.91 ? 22  GLN B CB  1 
ATOM   1714 C CG  . GLN B 2 48  ? 38.369 30.573  27.119 1.00 109.91 ? 22  GLN B CG  1 
ATOM   1715 C CD  . GLN B 2 48  ? 38.469 31.981  27.676 1.00 109.91 ? 22  GLN B CD  1 
ATOM   1716 O OE1 . GLN B 2 48  ? 38.847 32.919  26.970 1.00 109.91 ? 22  GLN B OE1 1 
ATOM   1717 N NE2 . GLN B 2 48  ? 38.137 32.135  28.957 1.00 109.91 ? 22  GLN B NE2 1 
ATOM   1718 N N   . ARG B 2 49  ? 35.262 28.457  26.564 1.00 61.86  ? 23  ARG B N   1 
ATOM   1719 C CA  . ARG B 2 49  ? 34.597 28.115  25.315 1.00 61.86  ? 23  ARG B CA  1 
ATOM   1720 C C   . ARG B 2 49  ? 33.523 27.083  25.607 1.00 61.86  ? 23  ARG B C   1 
ATOM   1721 O O   . ARG B 2 49  ? 33.811 25.971  26.043 1.00 61.86  ? 23  ARG B O   1 
ATOM   1722 C CB  . ARG B 2 49  ? 35.614 27.558  24.318 1.00 83.87  ? 23  ARG B CB  1 
ATOM   1723 C CG  . ARG B 2 49  ? 36.796 28.488  24.092 1.00 83.87  ? 23  ARG B CG  1 
ATOM   1724 C CD  . ARG B 2 49  ? 37.926 27.830  23.305 1.00 83.87  ? 23  ARG B CD  1 
ATOM   1725 N NE  . ARG B 2 49  ? 37.567 27.552  21.917 1.00 83.87  ? 23  ARG B NE  1 
ATOM   1726 C CZ  . ARG B 2 49  ? 36.892 26.481  21.504 1.00 83.87  ? 23  ARG B CZ  1 
ATOM   1727 N NH1 . ARG B 2 49  ? 36.490 25.558  22.371 1.00 83.87  ? 23  ARG B NH1 1 
ATOM   1728 N NH2 . ARG B 2 49  ? 36.617 26.334  20.213 1.00 83.87  ? 23  ARG B NH2 1 
ATOM   1729 N N   . ILE B 2 50  ? 32.276 27.465  25.385 1.00 38.46  ? 24  ILE B N   1 
ATOM   1730 C CA  . ILE B 2 50  ? 31.158 26.572  25.627 1.00 38.46  ? 24  ILE B CA  1 
ATOM   1731 C C   . ILE B 2 50  ? 30.409 26.358  24.332 1.00 38.46  ? 24  ILE B C   1 
ATOM   1732 O O   . ILE B 2 50  ? 30.375 27.238  23.468 1.00 38.46  ? 24  ILE B O   1 
ATOM   1733 C CB  . ILE B 2 50  ? 30.159 27.170  26.626 1.00 34.50  ? 24  ILE B CB  1 
ATOM   1734 C CG1 . ILE B 2 50  ? 30.880 27.599  27.899 1.00 34.50  ? 24  ILE B CG1 1 
ATOM   1735 C CG2 . ILE B 2 50  ? 29.073 26.153  26.944 1.00 34.50  ? 24  ILE B CG2 1 
ATOM   1736 C CD1 . ILE B 2 50  ? 29.977 28.340  28.878 1.00 34.50  ? 24  ILE B CD1 1 
ATOM   1737 N N   . ARG B 2 51  ? 29.798 25.187  24.207 1.00 34.28  ? 25  ARG B N   1 
ATOM   1738 C CA  . ARG B 2 51  ? 29.023 24.867  23.026 1.00 34.28  ? 25  ARG B CA  1 
ATOM   1739 C C   . ARG B 2 51  ? 27.865 23.957  23.417 1.00 34.28  ? 25  ARG B C   1 
ATOM   1740 O O   . ARG B 2 51  ? 28.039 22.963  24.118 1.00 34.28  ? 25  ARG B O   1 
ATOM   1741 C CB  . ARG B 2 51  ? 29.906 24.199  21.970 1.00 30.55  ? 25  ARG B CB  1 
ATOM   1742 C CG  . ARG B 2 51  ? 29.200 23.957  20.650 1.00 30.55  ? 25  ARG B CG  1 
ATOM   1743 C CD  . ARG B 2 51  ? 30.166 23.388  19.645 1.00 30.55  ? 25  ARG B CD  1 
ATOM   1744 N NE  . ARG B 2 51  ? 29.514 23.052  18.389 1.00 30.55  ? 25  ARG B NE  1 
ATOM   1745 C CZ  . ARG B 2 51  ? 30.119 22.430  17.382 1.00 30.55  ? 25  ARG B CZ  1 
ATOM   1746 N NH1 . ARG B 2 51  ? 31.399 22.073  17.480 1.00 30.55  ? 25  ARG B NH1 1 
ATOM   1747 N NH2 . ARG B 2 51  ? 29.442 22.168  16.273 1.00 30.55  ? 25  ARG B NH2 1 
ATOM   1748 N N   . LEU B 2 52  ? 26.678 24.328  22.964 1.00 30.82  ? 26  LEU B N   1 
ATOM   1749 C CA  . LEU B 2 52  ? 25.465 23.585  23.250 1.00 30.82  ? 26  LEU B CA  1 
ATOM   1750 C C   . LEU B 2 52  ? 24.947 22.908  22.005 1.00 30.82  ? 26  LEU B C   1 
ATOM   1751 O O   . LEU B 2 52  ? 25.038 23.453  20.907 1.00 30.82  ? 26  LEU B O   1 
ATOM   1752 C CB  . LEU B 2 52  ? 24.374 24.524  23.776 1.00 23.17  ? 26  LEU B CB  1 
ATOM   1753 C CG  . LEU B 2 52  ? 22.953 23.936  23.848 1.00 23.17  ? 26  LEU B CG  1 
ATOM   1754 C CD1 . LEU B 2 52  ? 22.921 22.739  24.794 1.00 23.17  ? 26  LEU B CD1 1 
ATOM   1755 C CD2 . LEU B 2 52  ? 21.985 24.998  24.330 1.00 23.17  ? 26  LEU B CD2 1 
ATOM   1756 N N   . VAL B 2 53  ? 24.415 21.708  22.176 1.00 26.98  ? 27  VAL B N   1 
ATOM   1757 C CA  . VAL B 2 53  ? 23.835 20.986  21.068 1.00 26.98  ? 27  VAL B CA  1 
ATOM   1758 C C   . VAL B 2 53  ? 22.582 20.324  21.605 1.00 26.98  ? 27  VAL B C   1 
ATOM   1759 O O   . VAL B 2 53  ? 22.546 19.845  22.738 1.00 26.98  ? 27  VAL B O   1 
ATOM   1760 C CB  . VAL B 2 53  ? 24.793 19.924  20.480 1.00 18.98  ? 27  VAL B CB  1 
ATOM   1761 C CG1 . VAL B 2 53  ? 24.059 19.084  19.449 1.00 18.98  ? 27  VAL B CG1 1 
ATOM   1762 C CG2 . VAL B 2 53  ? 25.981 20.606  19.802 1.00 18.98  ? 27  VAL B CG2 1 
ATOM   1763 N N   . THR B 2 54  ? 21.543 20.335  20.784 1.00 36.30  ? 28  THR B N   1 
ATOM   1764 C CA  . THR B 2 54  ? 20.269 19.750  21.141 1.00 36.30  ? 28  THR B CA  1 
ATOM   1765 C C   . THR B 2 54  ? 19.905 18.839  19.981 1.00 36.30  ? 28  THR B C   1 
ATOM   1766 O O   . THR B 2 54  ? 19.898 19.280  18.839 1.00 36.30  ? 28  THR B O   1 
ATOM   1767 C CB  . THR B 2 54  ? 19.225 20.853  21.301 1.00 43.77  ? 28  THR B CB  1 
ATOM   1768 O OG1 . THR B 2 54  ? 19.596 21.694  22.397 1.00 43.77  ? 28  THR B OG1 1 
ATOM   1769 C CG2 . THR B 2 54  ? 17.872 20.270  21.559 1.00 43.77  ? 28  THR B CG2 1 
ATOM   1770 N N   . ARG B 2 55  ? 19.623 17.569  20.264 1.00 20.05  ? 29  ARG B N   1 
ATOM   1771 C CA  . ARG B 2 55  ? 19.282 16.622  19.205 1.00 20.05  ? 29  ARG B CA  1 
ATOM   1772 C C   . ARG B 2 55  ? 17.898 16.040  19.406 1.00 20.05  ? 29  ARG B C   1 
ATOM   1773 O O   . ARG B 2 55  ? 17.541 15.631  20.510 1.00 20.05  ? 29  ARG B O   1 
ATOM   1774 C CB  . ARG B 2 55  ? 20.291 15.467  19.166 1.00 23.29  ? 29  ARG B CB  1 
ATOM   1775 C CG  . ARG B 2 55  ? 21.752 15.879  19.064 1.00 23.29  ? 29  ARG B CG  1 
ATOM   1776 C CD  . ARG B 2 55  ? 22.646 14.672  19.211 1.00 23.29  ? 29  ARG B CD  1 
ATOM   1777 N NE  . ARG B 2 55  ? 24.049 15.020  19.408 1.00 23.29  ? 29  ARG B NE  1 
ATOM   1778 C CZ  . ARG B 2 55  ? 24.882 15.406  18.442 1.00 23.29  ? 29  ARG B CZ  1 
ATOM   1779 N NH1 . ARG B 2 55  ? 24.457 15.499  17.186 1.00 23.29  ? 29  ARG B NH1 1 
ATOM   1780 N NH2 . ARG B 2 55  ? 26.149 15.702  18.736 1.00 23.29  ? 29  ARG B NH2 1 
ATOM   1781 N N   . TYR B 2 56  ? 17.104 16.023  18.343 1.00 31.36  ? 30  TYR B N   1 
ATOM   1782 C CA  . TYR B 2 56  ? 15.771 15.442  18.411 1.00 31.36  ? 30  TYR B CA  1 
ATOM   1783 C C   . TYR B 2 56  ? 15.840 14.193  17.536 1.00 31.36  ? 30  TYR B C   1 
ATOM   1784 O O   . TYR B 2 56  ? 16.144 14.260  16.338 1.00 31.36  ? 30  TYR B O   1 
ATOM   1785 C CB  . TYR B 2 56  ? 14.718 16.431  17.917 1.00 21.18  ? 30  TYR B CB  1 
ATOM   1786 C CG  . TYR B 2 56  ? 14.418 17.537  18.915 1.00 21.18  ? 30  TYR B CG  1 
ATOM   1787 C CD1 . TYR B 2 56  ? 15.284 18.627  19.079 1.00 21.18  ? 30  TYR B CD1 1 
ATOM   1788 C CD2 . TYR B 2 56  ? 13.257 17.504  19.691 1.00 21.18  ? 30  TYR B CD2 1 
ATOM   1789 C CE1 . TYR B 2 56  ? 14.988 19.655  19.989 1.00 21.18  ? 30  TYR B CE1 1 
ATOM   1790 C CE2 . TYR B 2 56  ? 12.961 18.518  20.594 1.00 21.18  ? 30  TYR B CE2 1 
ATOM   1791 C CZ  . TYR B 2 56  ? 13.821 19.590  20.743 1.00 21.18  ? 30  TYR B CZ  1 
ATOM   1792 O OH  . TYR B 2 56  ? 13.507 20.595  21.650 1.00 21.18  ? 30  TYR B OH  1 
ATOM   1793 N N   . ILE B 2 57  ? 15.558 13.051  18.147 1.00 30.10  ? 31  ILE B N   1 
ATOM   1794 C CA  . ILE B 2 57  ? 15.681 11.789  17.451 1.00 30.10  ? 31  ILE B CA  1 
ATOM   1795 C C   . ILE B 2 57  ? 14.458 10.885  17.420 1.00 30.10  ? 31  ILE B C   1 
ATOM   1796 O O   . ILE B 2 57  ? 13.817 10.651  18.448 1.00 30.10  ? 31  ILE B O   1 
ATOM   1797 C CB  . ILE B 2 57  ? 16.875 11.021  18.058 1.00 14.84  ? 31  ILE B CB  1 
ATOM   1798 C CG1 . ILE B 2 57  ? 18.163 11.810  17.781 1.00 14.84  ? 31  ILE B CG1 1 
ATOM   1799 C CG2 . ILE B 2 57  ? 16.954 9.600   17.491 1.00 14.84  ? 31  ILE B CG2 1 
ATOM   1800 C CD1 . ILE B 2 57  ? 19.111 11.891  18.946 1.00 14.84  ? 31  ILE B CD1 1 
ATOM   1801 N N   . TYR B 2 58  ? 14.145 10.387  16.224 1.00 20.59  ? 32  TYR B N   1 
ATOM   1802 C CA  . TYR B 2 58  ? 13.032 9.466   16.035 1.00 20.59  ? 32  TYR B CA  1 
ATOM   1803 C C   . TYR B 2 58  ? 13.672 8.110   15.782 1.00 20.59  ? 32  TYR B C   1 
ATOM   1804 O O   . TYR B 2 58  ? 14.316 7.909   14.747 1.00 20.59  ? 32  TYR B O   1 
ATOM   1805 C CB  . TYR B 2 58  ? 12.181 9.839   14.828 1.00 31.46  ? 32  TYR B CB  1 
ATOM   1806 C CG  . TYR B 2 58  ? 11.087 8.827   14.595 1.00 31.46  ? 32  TYR B CG  1 
ATOM   1807 C CD1 . TYR B 2 58  ? 10.065 8.665   15.527 1.00 31.46  ? 32  TYR B CD1 1 
ATOM   1808 C CD2 . TYR B 2 58  ? 11.101 7.991   13.480 1.00 31.46  ? 32  TYR B CD2 1 
ATOM   1809 C CE1 . TYR B 2 58  ? 9.087  7.698   15.363 1.00 31.46  ? 32  TYR B CE1 1 
ATOM   1810 C CE2 . TYR B 2 58  ? 10.122 7.011   13.304 1.00 31.46  ? 32  TYR B CE2 1 
ATOM   1811 C CZ  . TYR B 2 58  ? 9.119  6.873   14.256 1.00 31.46  ? 32  TYR B CZ  1 
ATOM   1812 O OH  . TYR B 2 58  ? 8.159  5.897   14.129 1.00 31.46  ? 32  TYR B OH  1 
ATOM   1813 N N   . ASN B 2 59  ? 13.477 7.191   16.729 1.00 36.83  ? 33  ASN B N   1 
ATOM   1814 C CA  . ASN B 2 59  ? 14.070 5.858   16.692 1.00 36.83  ? 33  ASN B CA  1 
ATOM   1815 C C   . ASN B 2 59  ? 15.573 6.054   16.828 1.00 36.83  ? 33  ASN B C   1 
ATOM   1816 O O   . ASN B 2 59  ? 16.073 6.226   17.937 1.00 36.83  ? 33  ASN B O   1 
ATOM   1817 C CB  . ASN B 2 59  ? 13.738 5.123   15.394 1.00 33.47  ? 33  ASN B CB  1 
ATOM   1818 C CG  . ASN B 2 59  ? 12.384 4.445   15.445 1.00 33.47  ? 33  ASN B CG  1 
ATOM   1819 O OD1 . ASN B 2 59  ? 11.839 4.205   16.527 1.00 33.47  ? 33  ASN B OD1 1 
ATOM   1820 N ND2 . ASN B 2 59  ? 11.838 4.112   14.277 1.00 33.47  ? 33  ASN B ND2 1 
ATOM   1821 N N   . ARG B 2 60  ? 16.287 6.045   15.708 1.00 26.90  ? 34  ARG B N   1 
ATOM   1822 C CA  . ARG B 2 60  ? 17.725 6.258   15.738 1.00 26.90  ? 34  ARG B CA  1 
ATOM   1823 C C   . ARG B 2 60  ? 18.130 7.357   14.756 1.00 26.90  ? 34  ARG B C   1 
ATOM   1824 O O   . ARG B 2 60  ? 19.313 7.540   14.469 1.00 26.90  ? 34  ARG B O   1 
ATOM   1825 C CB  . ARG B 2 60  ? 18.467 4.961   15.409 1.00 40.66  ? 34  ARG B CB  1 
ATOM   1826 C CG  . ARG B 2 60  ? 18.238 3.851   16.425 1.00 40.66  ? 34  ARG B CG  1 
ATOM   1827 C CD  . ARG B 2 60  ? 19.155 2.671   16.166 1.00 40.66  ? 34  ARG B CD  1 
ATOM   1828 N NE  . ARG B 2 60  ? 20.549 3.032   16.384 1.00 40.66  ? 34  ARG B NE  1 
ATOM   1829 C CZ  . ARG B 2 60  ? 21.578 2.254   16.071 1.00 40.66  ? 34  ARG B CZ  1 
ATOM   1830 N NH1 . ARG B 2 60  ? 21.367 1.060   15.522 1.00 40.66  ? 34  ARG B NH1 1 
ATOM   1831 N NH2 . ARG B 2 60  ? 22.815 2.670   16.302 1.00 40.66  ? 34  ARG B NH2 1 
ATOM   1832 N N   . GLU B 2 61  ? 17.148 8.096   14.252 1.00 33.66  ? 35  GLU B N   1 
ATOM   1833 C CA  . GLU B 2 61  ? 17.425 9.169   13.300 1.00 33.66  ? 35  GLU B CA  1 
ATOM   1834 C C   . GLU B 2 61  ? 17.338 10.572  13.915 1.00 33.66  ? 35  GLU B C   1 
ATOM   1835 O O   . GLU B 2 61  ? 16.290 10.971  14.444 1.00 33.66  ? 35  GLU B O   1 
ATOM   1836 C CB  . GLU B 2 61  ? 16.452 9.086   12.115 1.00 42.63  ? 35  GLU B CB  1 
ATOM   1837 C CG  . GLU B 2 61  ? 16.723 10.093  11.004 1.00 42.63  ? 35  GLU B CG  1 
ATOM   1838 C CD  . GLU B 2 61  ? 15.620 10.136  9.954  1.00 42.63  ? 35  GLU B CD  1 
ATOM   1839 O OE1 . GLU B 2 61  ? 15.032 9.078   9.650  1.00 42.63  ? 35  GLU B OE1 1 
ATOM   1840 O OE2 . GLU B 2 61  ? 15.348 11.228  9.416  1.00 42.63  ? 35  GLU B OE2 1 
ATOM   1841 N N   . GLU B 2 62  ? 18.445 11.308  13.861 1.00 26.96  ? 36  GLU B N   1 
ATOM   1842 C CA  . GLU B 2 62  ? 18.453 12.677  14.362 1.00 26.96  ? 36  GLU B CA  1 
ATOM   1843 C C   . GLU B 2 62  ? 17.931 13.468  13.172 1.00 26.96  ? 36  GLU B C   1 
ATOM   1844 O O   . GLU B 2 62  ? 18.546 13.458  12.109 1.00 26.96  ? 36  GLU B O   1 
ATOM   1845 C CB  . GLU B 2 62  ? 19.874 13.151  14.710 1.00 26.05  ? 36  GLU B CB  1 
ATOM   1846 C CG  . GLU B 2 62  ? 19.917 14.574  15.287 1.00 26.05  ? 36  GLU B CG  1 
ATOM   1847 C CD  . GLU B 2 62  ? 21.335 15.132  15.428 1.00 26.05  ? 36  GLU B CD  1 
ATOM   1848 O OE1 . GLU B 2 62  ? 22.287 14.403  15.091 1.00 26.05  ? 36  GLU B OE1 1 
ATOM   1849 O OE2 . GLU B 2 62  ? 21.499 16.295  15.874 1.00 26.05  ? 36  GLU B OE2 1 
ATOM   1850 N N   . TYR B 2 63  ? 16.790 14.128  13.340 1.00 30.12  ? 37  TYR B N   1 
ATOM   1851 C CA  . TYR B 2 63  ? 16.198 14.906  12.258 1.00 30.12  ? 37  TYR B CA  1 
ATOM   1852 C C   . TYR B 2 63  ? 16.249 16.397  12.530 1.00 30.12  ? 37  TYR B C   1 
ATOM   1853 O O   . TYR B 2 63  ? 16.229 17.207  11.606 1.00 30.12  ? 37  TYR B O   1 
ATOM   1854 C CB  . TYR B 2 63  ? 14.741 14.490  12.040 1.00 24.71  ? 37  TYR B CB  1 
ATOM   1855 C CG  . TYR B 2 63  ? 13.851 14.655  13.258 1.00 24.71  ? 37  TYR B CG  1 
ATOM   1856 C CD1 . TYR B 2 63  ? 13.754 13.647  14.223 1.00 24.71  ? 37  TYR B CD1 1 
ATOM   1857 C CD2 . TYR B 2 63  ? 13.124 15.828  13.458 1.00 24.71  ? 37  TYR B CD2 1 
ATOM   1858 C CE1 . TYR B 2 63  ? 12.947 13.809  15.359 1.00 24.71  ? 37  TYR B CE1 1 
ATOM   1859 C CE2 . TYR B 2 63  ? 12.323 16.001  14.587 1.00 24.71  ? 37  TYR B CE2 1 
ATOM   1860 C CZ  . TYR B 2 63  ? 12.239 14.993  15.532 1.00 24.71  ? 37  TYR B CZ  1 
ATOM   1861 O OH  . TYR B 2 63  ? 11.462 15.179  16.658 1.00 24.71  ? 37  TYR B OH  1 
ATOM   1862 N N   . LEU B 2 64  ? 16.315 16.754  13.806 1.00 33.67  ? 38  LEU B N   1 
ATOM   1863 C CA  . LEU B 2 64  ? 16.350 18.151  14.206 1.00 33.67  ? 38  LEU B CA  1 
ATOM   1864 C C   . LEU B 2 64  ? 17.486 18.414  15.186 1.00 33.67  ? 38  LEU B C   1 
ATOM   1865 O O   . LEU B 2 64  ? 17.712 17.637  16.118 1.00 33.67  ? 38  LEU B O   1 
ATOM   1866 C CB  . LEU B 2 64  ? 15.012 18.528  14.835 1.00 22.96  ? 38  LEU B CB  1 
ATOM   1867 C CG  . LEU B 2 64  ? 14.837 19.960  15.337 1.00 22.96  ? 38  LEU B CG  1 
ATOM   1868 C CD1 . LEU B 2 64  ? 15.037 20.948  14.182 1.00 22.96  ? 38  LEU B CD1 1 
ATOM   1869 C CD2 . LEU B 2 64  ? 13.445 20.104  15.958 1.00 22.96  ? 38  LEU B CD2 1 
ATOM   1870 N N   . ARG B 2 65  ? 18.196 19.518  14.977 1.00 30.94  ? 39  ARG B N   1 
ATOM   1871 C CA  . ARG B 2 65  ? 19.319 19.870  15.837 1.00 30.94  ? 39  ARG B CA  1 
ATOM   1872 C C   . ARG B 2 65  ? 19.524 21.373  16.013 1.00 30.94  ? 39  ARG B C   1 
ATOM   1873 O O   . ARG B 2 65  ? 19.229 22.170  15.117 1.00 30.94  ? 39  ARG B O   1 
ATOM   1874 C CB  . ARG B 2 65  ? 20.606 19.267  15.271 1.00 24.39  ? 39  ARG B CB  1 
ATOM   1875 C CG  . ARG B 2 65  ? 21.876 19.692  16.006 1.00 24.39  ? 39  ARG B CG  1 
ATOM   1876 C CD  . ARG B 2 65  ? 23.139 19.306  15.241 1.00 24.39  ? 39  ARG B CD  1 
ATOM   1877 N NE  . ARG B 2 65  ? 23.158 17.894  14.874 1.00 24.39  ? 39  ARG B NE  1 
ATOM   1878 C CZ  . ARG B 2 65  ? 24.104 17.323  14.131 1.00 24.39  ? 39  ARG B CZ  1 
ATOM   1879 N NH1 . ARG B 2 65  ? 25.117 18.045  13.671 1.00 24.39  ? 39  ARG B NH1 1 
ATOM   1880 N NH2 . ARG B 2 65  ? 24.037 16.025  13.846 1.00 24.39  ? 39  ARG B NH2 1 
ATOM   1881 N N   . PHE B 2 66  ? 20.019 21.748  17.188 1.00 29.95  ? 40  PHE B N   1 
ATOM   1882 C CA  . PHE B 2 66  ? 20.345 23.136  17.494 1.00 29.95  ? 40  PHE B CA  1 
ATOM   1883 C C   . PHE B 2 66  ? 21.801 23.071  17.911 1.00 29.95  ? 40  PHE B C   1 
ATOM   1884 O O   . PHE B 2 66  ? 22.181 22.209  18.706 1.00 29.95  ? 40  PHE B O   1 
ATOM   1885 C CB  . PHE B 2 66  ? 19.522 23.699  18.653 1.00 41.42  ? 40  PHE B CB  1 
ATOM   1886 C CG  . PHE B 2 66  ? 19.984 25.063  19.100 1.00 41.42  ? 40  PHE B CG  1 
ATOM   1887 C CD1 . PHE B 2 66  ? 19.718 26.189  18.330 1.00 41.42  ? 40  PHE B CD1 1 
ATOM   1888 C CD2 . PHE B 2 66  ? 20.767 25.209  20.243 1.00 41.42  ? 40  PHE B CD2 1 
ATOM   1889 C CE1 . PHE B 2 66  ? 20.231 27.440  18.686 1.00 41.42  ? 40  PHE B CE1 1 
ATOM   1890 C CE2 . PHE B 2 66  ? 21.285 26.457  20.607 1.00 41.42  ? 40  PHE B CE2 1 
ATOM   1891 C CZ  . PHE B 2 66  ? 21.016 27.572  19.825 1.00 41.42  ? 40  PHE B CZ  1 
ATOM   1892 N N   . ASP B 2 67  ? 22.611 23.978  17.380 1.00 37.05  ? 41  ASP B N   1 
ATOM   1893 C CA  . ASP B 2 67  ? 24.036 24.001  17.676 1.00 37.05  ? 41  ASP B CA  1 
ATOM   1894 C C   . ASP B 2 67  ? 24.529 25.437  17.923 1.00 37.05  ? 41  ASP B C   1 
ATOM   1895 O O   . ASP B 2 67  ? 24.366 26.316  17.068 1.00 37.05  ? 41  ASP B O   1 
ATOM   1896 C CB  . ASP B 2 67  ? 24.785 23.371  16.496 1.00 27.68  ? 41  ASP B CB  1 
ATOM   1897 C CG  . ASP B 2 67  ? 26.282 23.251  16.732 1.00 27.68  ? 41  ASP B CG  1 
ATOM   1898 O OD1 . ASP B 2 67  ? 26.829 23.930  17.629 1.00 27.68  ? 41  ASP B OD1 1 
ATOM   1899 O OD2 . ASP B 2 67  ? 26.922 22.477  15.993 1.00 27.68  ? 41  ASP B OD2 1 
ATOM   1900 N N   . SER B 2 68  ? 25.129 25.669  19.089 1.00 33.14  ? 42  SER B N   1 
ATOM   1901 C CA  . SER B 2 68  ? 25.649 26.989  19.436 1.00 33.14  ? 42  SER B CA  1 
ATOM   1902 C C   . SER B 2 68  ? 26.515 27.553  18.325 1.00 33.14  ? 42  SER B C   1 
ATOM   1903 O O   . SER B 2 68  ? 26.432 28.735  18.006 1.00 33.14  ? 42  SER B O   1 
ATOM   1904 C CB  . SER B 2 68  ? 26.479 26.923  20.716 1.00 44.44  ? 42  SER B CB  1 
ATOM   1905 O OG  . SER B 2 68  ? 25.641 26.925  21.850 1.00 44.44  ? 42  SER B OG  1 
ATOM   1906 N N   . ASP B 2 69  ? 27.357 26.706  17.749 1.00 37.71  ? 43  ASP B N   1 
ATOM   1907 C CA  . ASP B 2 69  ? 28.232 27.131  16.667 1.00 37.71  ? 43  ASP B CA  1 
ATOM   1908 C C   . ASP B 2 69  ? 27.450 27.749  15.510 1.00 37.71  ? 43  ASP B C   1 
ATOM   1909 O O   . ASP B 2 69  ? 27.970 28.593  14.790 1.00 37.71  ? 43  ASP B O   1 
ATOM   1910 C CB  . ASP B 2 69  ? 29.058 25.942  16.168 1.00 61.87  ? 43  ASP B CB  1 
ATOM   1911 C CG  . ASP B 2 69  ? 30.399 25.825  16.875 1.00 61.87  ? 43  ASP B CG  1 
ATOM   1912 O OD1 . ASP B 2 69  ? 30.482 26.163  18.078 1.00 61.87  ? 43  ASP B OD1 1 
ATOM   1913 O OD2 . ASP B 2 69  ? 31.369 25.386  16.220 1.00 61.87  ? 43  ASP B OD2 1 
ATOM   1914 N N   . VAL B 2 70  ? 26.204 27.327  15.329 1.00 39.74  ? 44  VAL B N   1 
ATOM   1915 C CA  . VAL B 2 70  ? 25.369 27.871  14.265 1.00 39.74  ? 44  VAL B CA  1 
ATOM   1916 C C   . VAL B 2 70  ? 24.493 28.995  14.804 1.00 39.74  ? 44  VAL B C   1 
ATOM   1917 O O   . VAL B 2 70  ? 24.458 30.077  14.237 1.00 39.74  ? 44  VAL B O   1 
ATOM   1918 C CB  . VAL B 2 70  ? 24.460 26.788  13.638 1.00 38.22  ? 44  VAL B CB  1 
ATOM   1919 C CG1 . VAL B 2 70  ? 23.362 27.437  12.815 1.00 38.22  ? 44  VAL B CG1 1 
ATOM   1920 C CG2 . VAL B 2 70  ? 25.287 25.860  12.765 1.00 38.22  ? 44  VAL B CG2 1 
ATOM   1921 N N   . GLY B 2 71  ? 23.787 28.736  15.899 1.00 35.28  ? 45  GLY B N   1 
ATOM   1922 C CA  . GLY B 2 71  ? 22.928 29.753  16.480 1.00 35.28  ? 45  GLY B CA  1 
ATOM   1923 C C   . GLY B 2 71  ? 21.453 29.551  16.192 1.00 35.28  ? 45  GLY B C   1 
ATOM   1924 O O   . GLY B 2 71  ? 20.624 30.343  16.637 1.00 35.28  ? 45  GLY B O   1 
ATOM   1925 N N   . GLU B 2 72  ? 21.116 28.493  15.455 1.00 45.84  ? 46  GLU B N   1 
ATOM   1926 C CA  . GLU B 2 72  ? 19.722 28.218  15.116 1.00 45.84  ? 46  GLU B CA  1 
ATOM   1927 C C   . GLU B 2 72  ? 19.440 26.747  14.803 1.00 45.84  ? 46  GLU B C   1 
ATOM   1928 O O   . GLU B 2 72  ? 20.356 25.947  14.617 1.00 45.84  ? 46  GLU B O   1 
ATOM   1929 C CB  . GLU B 2 72  ? 19.313 29.062  13.916 1.00 57.83  ? 46  GLU B CB  1 
ATOM   1930 C CG  . GLU B 2 72  ? 20.253 28.917  12.740 1.00 57.83  ? 46  GLU B CG  1 
ATOM   1931 C CD  . GLU B 2 72  ? 19.766 29.660  11.517 1.00 57.83  ? 46  GLU B CD  1 
ATOM   1932 O OE1 . GLU B 2 72  ? 18.756 29.230  10.922 1.00 57.83  ? 46  GLU B OE1 1 
ATOM   1933 O OE2 . GLU B 2 72  ? 20.389 30.681  11.156 1.00 57.83  ? 46  GLU B OE2 1 
ATOM   1934 N N   . TYR B 2 73  ? 18.162 26.396  14.741 1.00 34.97  ? 47  TYR B N   1 
ATOM   1935 C CA  . TYR B 2 73  ? 17.766 25.031  14.437 1.00 34.97  ? 47  TYR B CA  1 
ATOM   1936 C C   . TYR B 2 73  ? 17.953 24.724  12.953 1.00 34.97  ? 47  TYR B C   1 
ATOM   1937 O O   . TYR B 2 73  ? 17.603 25.527  12.089 1.00 34.97  ? 47  TYR B O   1 
ATOM   1938 C CB  . TYR B 2 73  ? 16.303 24.814  14.834 1.00 38.94  ? 47  TYR B CB  1 
ATOM   1939 C CG  . TYR B 2 73  ? 16.079 24.716  16.334 1.00 38.94  ? 47  TYR B CG  1 
ATOM   1940 C CD1 . TYR B 2 73  ? 16.262 23.507  17.013 1.00 38.94  ? 47  TYR B CD1 1 
ATOM   1941 C CD2 . TYR B 2 73  ? 15.681 25.829  17.073 1.00 38.94  ? 47  TYR B CD2 1 
ATOM   1942 C CE1 . TYR B 2 73  ? 16.047 23.412  18.391 1.00 38.94  ? 47  TYR B CE1 1 
ATOM   1943 C CE2 . TYR B 2 73  ? 15.469 25.744  18.447 1.00 38.94  ? 47  TYR B CE2 1 
ATOM   1944 C CZ  . TYR B 2 73  ? 15.650 24.536  19.101 1.00 38.94  ? 47  TYR B CZ  1 
ATOM   1945 O OH  . TYR B 2 73  ? 15.422 24.458  20.460 1.00 38.94  ? 47  TYR B OH  1 
ATOM   1946 N N   . ARG B 2 74  ? 18.519 23.562  12.661 1.00 27.46  ? 48  ARG B N   1 
ATOM   1947 C CA  . ARG B 2 74  ? 18.739 23.133  11.284 1.00 27.46  ? 48  ARG B CA  1 
ATOM   1948 C C   . ARG B 2 74  ? 18.201 21.716  11.155 1.00 27.46  ? 48  ARG B C   1 
ATOM   1949 O O   . ARG B 2 74  ? 18.290 20.923  12.101 1.00 27.46  ? 48  ARG B O   1 
ATOM   1950 C CB  . ARG B 2 74  ? 20.235 23.135  10.939 1.00 58.74  ? 48  ARG B CB  1 
ATOM   1951 C CG  . ARG B 2 74  ? 20.858 24.515  10.800 1.00 58.74  ? 48  ARG B CG  1 
ATOM   1952 C CD  . ARG B 2 74  ? 20.436 25.185  9.498  1.00 58.74  ? 48  ARG B CD  1 
ATOM   1953 N NE  . ARG B 2 74  ? 20.963 26.542  9.354  1.00 58.74  ? 48  ARG B NE  1 
ATOM   1954 C CZ  . ARG B 2 74  ? 22.257 26.846  9.290  1.00 58.74  ? 48  ARG B CZ  1 
ATOM   1955 N NH1 . ARG B 2 74  ? 23.175 25.891  9.355  1.00 58.74  ? 48  ARG B NH1 1 
ATOM   1956 N NH2 . ARG B 2 74  ? 22.634 28.112  9.160  1.00 58.74  ? 48  ARG B NH2 1 
ATOM   1957 N N   . ALA B 2 75  ? 17.631 21.407  9.995  1.00 39.60  ? 49  ALA B N   1 
ATOM   1958 C CA  . ALA B 2 75  ? 17.097 20.079  9.738  1.00 39.60  ? 49  ALA B CA  1 
ATOM   1959 C C   . ALA B 2 75  ? 18.272 19.186  9.383  1.00 39.60  ? 49  ALA B C   1 
ATOM   1960 O O   . ALA B 2 75  ? 19.078 19.519  8.518  1.00 39.60  ? 49  ALA B O   1 
ATOM   1961 C CB  . ALA B 2 75  ? 16.100 20.118  8.590  1.00 45.85  ? 49  ALA B CB  1 
ATOM   1962 N N   . VAL B 2 76  ? 18.375 18.054  10.062 1.00 31.42  ? 50  VAL B N   1 
ATOM   1963 C CA  . VAL B 2 76  ? 19.464 17.135  9.808  1.00 31.42  ? 50  VAL B CA  1 
ATOM   1964 C C   . VAL B 2 76  ? 19.048 16.195  8.688  1.00 31.42  ? 50  VAL B C   1 
ATOM   1965 O O   . VAL B 2 76  ? 19.892 15.682  7.943  1.00 31.42  ? 50  VAL B O   1 
ATOM   1966 C CB  . VAL B 2 76  ? 19.789 16.332  11.066 1.00 25.13  ? 50  VAL B CB  1 
ATOM   1967 C CG1 . VAL B 2 76  ? 21.096 15.574  10.877 1.00 25.13  ? 50  VAL B CG1 1 
ATOM   1968 C CG2 . VAL B 2 76  ? 19.860 17.275  12.267 1.00 25.13  ? 50  VAL B CG2 1 
ATOM   1969 N N   . THR B 2 77  ? 17.740 15.973  8.577  1.00 31.64  ? 51  THR B N   1 
ATOM   1970 C CA  . THR B 2 77  ? 17.190 15.114  7.533  1.00 31.64  ? 51  THR B CA  1 
ATOM   1971 C C   . THR B 2 77  ? 15.838 15.636  7.090  1.00 31.64  ? 51  THR B C   1 
ATOM   1972 O O   . THR B 2 77  ? 15.241 16.491  7.749  1.00 31.64  ? 51  THR B O   1 
ATOM   1973 C CB  . THR B 2 77  ? 16.990 13.654  8.003  1.00 31.83  ? 51  THR B CB  1 
ATOM   1974 O OG1 . THR B 2 77  ? 16.140 13.635  9.156  1.00 31.83  ? 51  THR B OG1 1 
ATOM   1975 C CG2 . THR B 2 77  ? 18.327 13.000  8.329  1.00 31.83  ? 51  THR B CG2 1 
ATOM   1976 N N   . GLU B 2 78  ? 15.361 15.103  5.971  1.00 40.95  ? 52  GLU B N   1 
ATOM   1977 C CA  . GLU B 2 78  ? 14.081 15.490  5.400  1.00 40.95  ? 52  GLU B CA  1 
ATOM   1978 C C   . GLU B 2 78  ? 12.947 15.381  6.413  1.00 40.95  ? 52  GLU B C   1 
ATOM   1979 O O   . GLU B 2 78  ? 11.936 16.072  6.309  1.00 40.95  ? 52  GLU B O   1 
ATOM   1980 C CB  . GLU B 2 78  ? 13.772 14.603  4.191  1.00 53.21  ? 52  GLU B CB  1 
ATOM   1981 C CG  . GLU B 2 78  ? 12.442 14.893  3.521  1.00 53.21  ? 52  GLU B CG  1 
ATOM   1982 C CD  . GLU B 2 78  ? 12.358 16.311  2.999  1.00 53.21  ? 52  GLU B CD  1 
ATOM   1983 O OE1 . GLU B 2 78  ? 13.230 16.693  2.188  1.00 53.21  ? 52  GLU B OE1 1 
ATOM   1984 O OE2 . GLU B 2 78  ? 11.420 17.038  3.400  1.00 53.21  ? 52  GLU B OE2 1 
ATOM   1985 N N   . LEU B 2 79  ? 13.123 14.512  7.396  1.00 32.29  ? 53  LEU B N   1 
ATOM   1986 C CA  . LEU B 2 79  ? 12.102 14.306  8.408  1.00 32.29  ? 53  LEU B CA  1 
ATOM   1987 C C   . LEU B 2 79  ? 11.936 15.526  9.319  1.00 32.29  ? 53  LEU B C   1 
ATOM   1988 O O   . LEU B 2 79  ? 10.846 15.763  9.844  1.00 32.29  ? 53  LEU B O   1 
ATOM   1989 C CB  . LEU B 2 79  ? 12.445 13.061  9.231  1.00 31.89  ? 53  LEU B CB  1 
ATOM   1990 C CG  . LEU B 2 79  ? 11.380 12.419  10.128 1.00 31.89  ? 53  LEU B CG  1 
ATOM   1991 C CD1 . LEU B 2 79  ? 10.237 11.899  9.278  1.00 31.89  ? 53  LEU B CD1 1 
ATOM   1992 C CD2 . LEU B 2 79  ? 12.007 11.270  10.919 1.00 31.89  ? 53  LEU B CD2 1 
ATOM   1993 N N   . GLY B 2 80  ? 13.004 16.304  9.490  1.00 34.06  ? 54  GLY B N   1 
ATOM   1994 C CA  . GLY B 2 80  ? 12.937 17.479  10.348 1.00 34.06  ? 54  GLY B CA  1 
ATOM   1995 C C   . GLY B 2 80  ? 12.792 18.807  9.615  1.00 34.06  ? 54  GLY B C   1 
ATOM   1996 O O   . GLY B 2 80  ? 12.714 19.877  10.233 1.00 34.06  ? 54  GLY B O   1 
ATOM   1997 N N   . ARG B 2 81  ? 12.747 18.734  8.290  1.00 55.50  ? 55  ARG B N   1 
ATOM   1998 C CA  . ARG B 2 81  ? 12.624 19.914  7.445  1.00 55.50  ? 55  ARG B CA  1 
ATOM   1999 C C   . ARG B 2 81  ? 11.778 21.025  8.066  1.00 55.50  ? 55  ARG B C   1 
ATOM   2000 O O   . ARG B 2 81  ? 12.286 22.104  8.375  1.00 55.50  ? 55  ARG B O   1 
ATOM   2001 C CB  . ARG B 2 81  ? 12.029 19.512  6.094  1.00 63.06  ? 55  ARG B CB  1 
ATOM   2002 C CG  . ARG B 2 81  ? 12.418 20.428  4.942  1.00 63.06  ? 55  ARG B CG  1 
ATOM   2003 C CD  . ARG B 2 81  ? 11.856 19.930  3.615  1.00 63.06  ? 55  ARG B CD  1 
ATOM   2004 N NE  . ARG B 2 81  ? 12.612 20.441  2.472  1.00 63.06  ? 55  ARG B NE  1 
ATOM   2005 C CZ  . ARG B 2 81  ? 13.908 20.210  2.263  1.00 63.06  ? 55  ARG B CZ  1 
ATOM   2006 N NH1 . ARG B 2 81  ? 14.609 19.475  3.123  1.00 63.06  ? 55  ARG B NH1 1 
ATOM   2007 N NH2 . ARG B 2 81  ? 14.507 20.707  1.189  1.00 63.06  ? 55  ARG B NH2 1 
ATOM   2008 N N   . HIS B 2 82  ? 10.490 20.757  8.259  1.00 40.78  ? 56  HIS B N   1 
ATOM   2009 C CA  . HIS B 2 82  ? 9.589  21.755  8.824  1.00 40.78  ? 56  HIS B CA  1 
ATOM   2010 C C   . HIS B 2 82  ? 9.737  21.934  10.324 1.00 40.78  ? 56  HIS B C   1 
ATOM   2011 O O   . HIS B 2 82  ? 9.365  22.973  10.868 1.00 40.78  ? 56  HIS B O   1 
ATOM   2012 C CB  . HIS B 2 82  ? 8.137  21.409  8.478  1.00 47.59  ? 56  HIS B CB  1 
ATOM   2013 C CG  . HIS B 2 82  ? 7.874  21.352  7.005  1.00 47.59  ? 56  HIS B CG  1 
ATOM   2014 N ND1 . HIS B 2 82  ? 8.204  22.383  6.151  1.00 47.59  ? 56  HIS B ND1 1 
ATOM   2015 C CD2 . HIS B 2 82  ? 7.350  20.374  6.229  1.00 47.59  ? 56  HIS B CD2 1 
ATOM   2016 C CE1 . HIS B 2 82  ? 7.898  22.041  4.912  1.00 47.59  ? 56  HIS B CE1 1 
ATOM   2017 N NE2 . HIS B 2 82  ? 7.378  20.827  4.931  1.00 47.59  ? 56  HIS B NE2 1 
ATOM   2018 N N   . SER B 2 83  ? 10.271 20.928  11.005 1.00 34.57  ? 57  SER B N   1 
ATOM   2019 C CA  . SER B 2 83  ? 10.451 21.054  12.439 1.00 34.57  ? 57  SER B CA  1 
ATOM   2020 C C   . SER B 2 83  ? 11.391 22.224  12.693 1.00 34.57  ? 57  SER B C   1 
ATOM   2021 O O   . SER B 2 83  ? 11.169 23.037  13.593 1.00 34.57  ? 57  SER B O   1 
ATOM   2022 C CB  . SER B 2 83  ? 11.044 19.772  13.020 1.00 30.83  ? 57  SER B CB  1 
ATOM   2023 O OG  . SER B 2 83  ? 10.128 18.697  12.931 1.00 30.83  ? 57  SER B OG  1 
ATOM   2024 N N   . ALA B 2 84  ? 12.436 22.316  11.882 1.00 31.03  ? 58  ALA B N   1 
ATOM   2025 C CA  . ALA B 2 84  ? 13.408 23.389  12.040 1.00 31.03  ? 58  ALA B CA  1 
ATOM   2026 C C   . ALA B 2 84  ? 12.756 24.770  11.991 1.00 31.03  ? 58  ALA B C   1 
ATOM   2027 O O   . ALA B 2 84  ? 13.029 25.630  12.827 1.00 31.03  ? 58  ALA B O   1 
ATOM   2028 C CB  . ALA B 2 84  ? 14.485 23.276  10.966 1.00 15.96  ? 58  ALA B CB  1 
ATOM   2029 N N   . GLU B 2 85  ? 11.886 24.970  11.010 1.00 43.60  ? 59  GLU B N   1 
ATOM   2030 C CA  . GLU B 2 85  ? 11.206 26.243  10.832 1.00 43.60  ? 59  GLU B CA  1 
ATOM   2031 C C   . GLU B 2 85  ? 10.360 26.596  12.054 1.00 43.60  ? 59  GLU B C   1 
ATOM   2032 O O   . GLU B 2 85  ? 10.365 27.738  12.527 1.00 43.60  ? 59  GLU B O   1 
ATOM   2033 C CB  . GLU B 2 85  ? 10.325 26.171  9.585  1.00 59.37  ? 59  GLU B CB  1 
ATOM   2034 C CG  . GLU B 2 85  ? 11.014 25.515  8.396  1.00 59.37  ? 59  GLU B CG  1 
ATOM   2035 C CD  . GLU B 2 85  ? 10.080 25.307  7.211  1.00 59.37  ? 59  GLU B CD  1 
ATOM   2036 O OE1 . GLU B 2 85  ? 8.943  24.820  7.421  1.00 59.37  ? 59  GLU B OE1 1 
ATOM   2037 O OE2 . GLU B 2 85  ? 10.493 25.618  6.068  1.00 59.37  ? 59  GLU B OE2 1 
ATOM   2038 N N   . TYR B 2 86  ? 9.638  25.604  12.563 1.00 46.62  ? 60  TYR B N   1 
ATOM   2039 C CA  . TYR B 2 86  ? 8.775  25.800  13.719 1.00 46.62  ? 60  TYR B CA  1 
ATOM   2040 C C   . TYR B 2 86  ? 9.573  26.155  14.978 1.00 46.62  ? 60  TYR B C   1 
ATOM   2041 O O   . TYR B 2 86  ? 9.285  27.150  15.639 1.00 46.62  ? 60  TYR B O   1 
ATOM   2042 C CB  . TYR B 2 86  ? 7.941  24.536  13.959 1.00 35.45  ? 60  TYR B CB  1 
ATOM   2043 C CG  . TYR B 2 86  ? 6.850  24.703  14.991 1.00 35.45  ? 60  TYR B CG  1 
ATOM   2044 C CD1 . TYR B 2 86  ? 5.764  25.548  14.757 1.00 35.45  ? 60  TYR B CD1 1 
ATOM   2045 C CD2 . TYR B 2 86  ? 6.915  24.033  16.214 1.00 35.45  ? 60  TYR B CD2 1 
ATOM   2046 C CE1 . TYR B 2 86  ? 4.770  25.726  15.717 1.00 35.45  ? 60  TYR B CE1 1 
ATOM   2047 C CE2 . TYR B 2 86  ? 5.930  24.202  17.183 1.00 35.45  ? 60  TYR B CE2 1 
ATOM   2048 C CZ  . TYR B 2 86  ? 4.861  25.051  16.932 1.00 35.45  ? 60  TYR B CZ  1 
ATOM   2049 O OH  . TYR B 2 86  ? 3.900  25.240  17.902 1.00 35.45  ? 60  TYR B OH  1 
ATOM   2050 N N   . TYR B 2 87  ? 10.576 25.347  15.310 1.00 38.29  ? 61  TYR B N   1 
ATOM   2051 C CA  . TYR B 2 87  ? 11.381 25.617  16.500 1.00 38.29  ? 61  TYR B CA  1 
ATOM   2052 C C   . TYR B 2 87  ? 12.099 26.961  16.407 1.00 38.29  ? 61  TYR B C   1 
ATOM   2053 O O   . TYR B 2 87  ? 12.290 27.633  17.423 1.00 38.29  ? 61  TYR B O   1 
ATOM   2054 C CB  . TYR B 2 87  ? 12.407 24.495  16.739 1.00 27.75  ? 61  TYR B CB  1 
ATOM   2055 C CG  . TYR B 2 87  ? 11.812 23.228  17.308 1.00 27.75  ? 61  TYR B CG  1 
ATOM   2056 C CD1 . TYR B 2 87  ? 10.860 22.502  16.595 1.00 27.75  ? 61  TYR B CD1 1 
ATOM   2057 C CD2 . TYR B 2 87  ? 12.187 22.763  18.571 1.00 27.75  ? 61  TYR B CD2 1 
ATOM   2058 C CE1 . TYR B 2 87  ? 10.289 21.347  17.122 1.00 27.75  ? 61  TYR B CE1 1 
ATOM   2059 C CE2 . TYR B 2 87  ? 11.621 21.606  19.111 1.00 27.75  ? 61  TYR B CE2 1 
ATOM   2060 C CZ  . TYR B 2 87  ? 10.671 20.907  18.380 1.00 27.75  ? 61  TYR B CZ  1 
ATOM   2061 O OH  . TYR B 2 87  ? 10.069 19.791  18.913 1.00 27.75  ? 61  TYR B OH  1 
ATOM   2062 N N   . ASN B 2 88  ? 12.501 27.349  15.199 1.00 51.48  ? 62  ASN B N   1 
ATOM   2063 C CA  . ASN B 2 88  ? 13.185 28.627  15.020 1.00 51.48  ? 62  ASN B CA  1 
ATOM   2064 C C   . ASN B 2 88  ? 12.246 29.808  15.238 1.00 51.48  ? 62  ASN B C   1 
ATOM   2065 O O   . ASN B 2 88  ? 12.644 30.829  15.801 1.00 51.48  ? 62  ASN B O   1 
ATOM   2066 C CB  . ASN B 2 88  ? 13.814 28.729  13.628 1.00 28.31  ? 62  ASN B CB  1 
ATOM   2067 C CG  . ASN B 2 88  ? 15.251 28.234  13.599 1.00 28.31  ? 62  ASN B CG  1 
ATOM   2068 O OD1 . ASN B 2 88  ? 16.014 28.464  14.538 1.00 28.31  ? 62  ASN B OD1 1 
ATOM   2069 N ND2 . ASN B 2 88  ? 15.633 27.573  12.514 1.00 28.31  ? 62  ASN B ND2 1 
ATOM   2070 N N   . LYS B 2 89  ? 11.000 29.674  14.799 1.00 45.80  ? 63  LYS B N   1 
ATOM   2071 C CA  . LYS B 2 89  ? 10.032 30.753  14.963 1.00 45.80  ? 63  LYS B CA  1 
ATOM   2072 C C   . LYS B 2 89  ? 9.443  30.772  16.372 1.00 45.80  ? 63  LYS B C   1 
ATOM   2073 O O   . LYS B 2 89  ? 9.010  31.816  16.860 1.00 45.80  ? 63  LYS B O   1 
ATOM   2074 C CB  . LYS B 2 89  ? 8.897  30.619  13.933 1.00 26.57  ? 63  LYS B CB  1 
ATOM   2075 N N   . GLN B 2 90  ? 9.450  29.622  17.033 1.00 35.35  ? 64  GLN B N   1 
ATOM   2076 C CA  . GLN B 2 90  ? 8.876  29.518  18.365 1.00 35.35  ? 64  GLN B CA  1 
ATOM   2077 C C   . GLN B 2 90  ? 9.834  29.500  19.549 1.00 35.35  ? 64  GLN B C   1 
ATOM   2078 O O   . GLN B 2 90  ? 9.475  29.960  20.631 1.00 35.35  ? 64  GLN B O   1 
ATOM   2079 C CB  . GLN B 2 90  ? 8.005  28.263  18.446 1.00 65.41  ? 64  GLN B CB  1 
ATOM   2080 C CG  . GLN B 2 90  ? 6.788  28.277  17.551 1.00 65.41  ? 64  GLN B CG  1 
ATOM   2081 C CD  . GLN B 2 90  ? 5.734  29.249  18.034 1.00 65.41  ? 64  GLN B CD  1 
ATOM   2082 O OE1 . GLN B 2 90  ? 5.222  29.125  19.148 1.00 65.41  ? 64  GLN B OE1 1 
ATOM   2083 N NE2 . GLN B 2 90  ? 5.405  30.224  17.201 1.00 65.41  ? 64  GLN B NE2 1 
ATOM   2084 N N   . TYR B 2 91  ? 11.045 28.988  19.365 1.00 39.16  ? 66  TYR B N   1 
ATOM   2085 C CA  . TYR B 2 91  ? 11.946 28.867  20.506 1.00 39.16  ? 66  TYR B CA  1 
ATOM   2086 C C   . TYR B 2 91  ? 13.372 29.405  20.415 1.00 39.16  ? 66  TYR B C   1 
ATOM   2087 O O   . TYR B 2 91  ? 14.123 29.283  21.387 1.00 39.16  ? 66  TYR B O   1 
ATOM   2088 C CB  . TYR B 2 91  ? 12.046 27.395  20.901 1.00 29.27  ? 66  TYR B CB  1 
ATOM   2089 C CG  . TYR B 2 91  ? 10.741 26.621  20.892 1.00 29.27  ? 66  TYR B CG  1 
ATOM   2090 C CD1 . TYR B 2 91  ? 9.732  26.894  21.815 1.00 29.27  ? 66  TYR B CD1 1 
ATOM   2091 C CD2 . TYR B 2 91  ? 10.547 25.564  20.004 1.00 29.27  ? 66  TYR B CD2 1 
ATOM   2092 C CE1 . TYR B 2 91  ? 8.565  26.120  21.859 1.00 29.27  ? 66  TYR B CE1 1 
ATOM   2093 C CE2 . TYR B 2 91  ? 9.390  24.790  20.039 1.00 29.27  ? 66  TYR B CE2 1 
ATOM   2094 C CZ  . TYR B 2 91  ? 8.410  25.069  20.971 1.00 29.27  ? 66  TYR B CZ  1 
ATOM   2095 O OH  . TYR B 2 91  ? 7.297  24.269  21.044 1.00 29.27  ? 66  TYR B OH  1 
ATOM   2096 N N   . LEU B 2 92  ? 13.759 29.984  19.280 1.00 33.07  ? 68  LEU B N   1 
ATOM   2097 C CA  . LEU B 2 92  ? 15.126 30.480  19.129 1.00 33.07  ? 68  LEU B CA  1 
ATOM   2098 C C   . LEU B 2 92  ? 15.648 31.113  20.418 1.00 33.07  ? 68  LEU B C   1 
ATOM   2099 O O   . LEU B 2 92  ? 16.724 30.762  20.908 1.00 33.07  ? 68  LEU B O   1 
ATOM   2100 C CB  . LEU B 2 92  ? 15.211 31.495  17.989 1.00 41.10  ? 68  LEU B CB  1 
ATOM   2101 C CG  . LEU B 2 92  ? 16.639 31.803  17.528 1.00 41.10  ? 68  LEU B CG  1 
ATOM   2102 C CD1 . LEU B 2 92  ? 17.260 30.546  16.916 1.00 41.10  ? 68  LEU B CD1 1 
ATOM   2103 C CD2 . LEU B 2 92  ? 16.624 32.925  16.515 1.00 41.10  ? 68  LEU B CD2 1 
ATOM   2104 N N   . GLU B 2 93  ? 14.862 32.031  20.968 1.00 35.89  ? 69  GLU B N   1 
ATOM   2105 C CA  . GLU B 2 93  ? 15.213 32.733  22.192 1.00 35.89  ? 69  GLU B CA  1 
ATOM   2106 C C   . GLU B 2 93  ? 15.487 31.786  23.357 1.00 35.89  ? 69  GLU B C   1 
ATOM   2107 O O   . GLU B 2 93  ? 16.621 31.678  23.829 1.00 35.89  ? 69  GLU B O   1 
ATOM   2108 C CB  . GLU B 2 93  ? 14.086 33.699  22.565 1.00 90.89  ? 69  GLU B CB  1 
ATOM   2109 C CG  . GLU B 2 93  ? 14.492 34.772  23.553 1.00 90.89  ? 69  GLU B CG  1 
ATOM   2110 C CD  . GLU B 2 93  ? 15.782 35.458  23.147 1.00 90.89  ? 69  GLU B CD  1 
ATOM   2111 O OE1 . GLU B 2 93  ? 15.942 35.763  21.943 1.00 90.89  ? 69  GLU B OE1 1 
ATOM   2112 O OE2 . GLU B 2 93  ? 16.634 35.694  24.031 1.00 90.89  ? 69  GLU B OE2 1 
ATOM   2113 N N   . ARG B 2 94  ? 14.443 31.105  23.817 1.00 43.18  ? 70  ARG B N   1 
ATOM   2114 C CA  . ARG B 2 94  ? 14.555 30.174  24.937 1.00 43.18  ? 70  ARG B CA  1 
ATOM   2115 C C   . ARG B 2 94  ? 15.713 29.185  24.786 1.00 43.18  ? 70  ARG B C   1 
ATOM   2116 O O   . ARG B 2 94  ? 16.352 28.815  25.772 1.00 43.18  ? 70  ARG B O   1 
ATOM   2117 C CB  . ARG B 2 94  ? 13.245 29.398  25.106 1.00 69.48  ? 70  ARG B CB  1 
ATOM   2118 C CG  . ARG B 2 94  ? 13.192 28.574  26.381 1.00 69.48  ? 70  ARG B CG  1 
ATOM   2119 C CD  . ARG B 2 94  ? 11.907 27.768  26.495 1.00 69.48  ? 70  ARG B CD  1 
ATOM   2120 N NE  . ARG B 2 94  ? 11.808 27.101  27.792 1.00 69.48  ? 70  ARG B NE  1 
ATOM   2121 C CZ  . ARG B 2 94  ? 10.831 26.267  28.134 1.00 69.48  ? 70  ARG B CZ  1 
ATOM   2122 N NH1 . ARG B 2 94  ? 9.861  25.988  27.272 1.00 69.48  ? 70  ARG B NH1 1 
ATOM   2123 N NH2 . ARG B 2 94  ? 10.817 25.712  29.341 1.00 69.48  ? 70  ARG B NH2 1 
ATOM   2124 N N   . THR B 2 95  ? 15.983 28.770  23.550 1.00 35.31  ? 71  THR B N   1 
ATOM   2125 C CA  . THR B 2 95  ? 17.046 27.811  23.272 1.00 35.31  ? 71  THR B CA  1 
ATOM   2126 C C   . THR B 2 95  ? 18.454 28.383  23.412 1.00 35.31  ? 71  THR B C   1 
ATOM   2127 O O   . THR B 2 95  ? 19.258 27.882  24.196 1.00 35.31  ? 71  THR B O   1 
ATOM   2128 C CB  . THR B 2 95  ? 16.892 27.217  21.858 1.00 34.12  ? 71  THR B CB  1 
ATOM   2129 O OG1 . THR B 2 95  ? 15.570 26.681  21.707 1.00 34.12  ? 71  THR B OG1 1 
ATOM   2130 C CG2 . THR B 2 95  ? 17.901 26.103  21.634 1.00 34.12  ? 71  THR B CG2 1 
ATOM   2131 N N   . ARG B 2 96  ? 18.759 29.433  22.659 1.00 44.19  ? 72  ARG B N   1 
ATOM   2132 C CA  . ARG B 2 96  ? 20.088 30.040  22.724 1.00 44.19  ? 72  ARG B CA  1 
ATOM   2133 C C   . ARG B 2 96  ? 20.524 30.338  24.158 1.00 44.19  ? 72  ARG B C   1 
ATOM   2134 O O   . ARG B 2 96  ? 21.694 30.176  24.511 1.00 44.19  ? 72  ARG B O   1 
ATOM   2135 C CB  . ARG B 2 96  ? 20.126 31.336  21.898 1.00 37.94  ? 72  ARG B CB  1 
ATOM   2136 C CG  . ARG B 2 96  ? 19.957 31.132  20.388 1.00 37.94  ? 72  ARG B CG  1 
ATOM   2137 C CD  . ARG B 2 96  ? 20.028 32.444  19.613 1.00 37.94  ? 72  ARG B CD  1 
ATOM   2138 N NE  . ARG B 2 96  ? 20.047 32.213  18.169 1.00 37.94  ? 72  ARG B NE  1 
ATOM   2139 C CZ  . ARG B 2 96  ? 20.106 33.173  17.247 1.00 37.94  ? 72  ARG B CZ  1 
ATOM   2140 N NH1 . ARG B 2 96  ? 20.152 34.447  17.605 1.00 37.94  ? 72  ARG B NH1 1 
ATOM   2141 N NH2 . ARG B 2 96  ? 20.125 32.855  15.959 1.00 37.94  ? 72  ARG B NH2 1 
ATOM   2142 N N   . ALA B 2 97  ? 19.572 30.759  24.983 1.00 39.34  ? 73  ALA B N   1 
ATOM   2143 C CA  . ALA B 2 97  ? 19.849 31.113  26.368 1.00 39.34  ? 73  ALA B CA  1 
ATOM   2144 C C   . ALA B 2 97  ? 20.318 29.942  27.233 1.00 39.34  ? 73  ALA B C   1 
ATOM   2145 O O   . ALA B 2 97  ? 21.059 30.129  28.205 1.00 39.34  ? 73  ALA B O   1 
ATOM   2146 C CB  . ALA B 2 97  ? 18.612 31.753  26.981 1.00 27.70  ? 73  ALA B CB  1 
ATOM   2147 N N   . GLU B 2 98  ? 19.889 28.733  26.886 1.00 35.55  ? 74  GLU B N   1 
ATOM   2148 C CA  . GLU B 2 98  ? 20.274 27.570  27.666 1.00 35.55  ? 74  GLU B CA  1 
ATOM   2149 C C   . GLU B 2 98  ? 21.783 27.417  27.710 1.00 35.55  ? 74  GLU B C   1 
ATOM   2150 O O   . GLU B 2 98  ? 22.319 26.766  28.605 1.00 35.55  ? 74  GLU B O   1 
ATOM   2151 C CB  . GLU B 2 98  ? 19.616 26.308  27.104 1.00 59.34  ? 74  GLU B CB  1 
ATOM   2152 C CG  . GLU B 2 98  ? 18.117 26.277  27.344 1.00 59.34  ? 74  GLU B CG  1 
ATOM   2153 C CD  . GLU B 2 98  ? 17.464 24.996  26.865 1.00 59.34  ? 74  GLU B CD  1 
ATOM   2154 O OE1 . GLU B 2 98  ? 17.483 24.737  25.641 1.00 59.34  ? 74  GLU B OE1 1 
ATOM   2155 O OE2 . GLU B 2 98  ? 16.931 24.248  27.717 1.00 59.34  ? 74  GLU B OE2 1 
ATOM   2156 N N   . LEU B 2 99  ? 22.469 28.023  26.747 1.00 27.85  ? 75  LEU B N   1 
ATOM   2157 C CA  . LEU B 2 99  ? 23.918 27.942  26.733 1.00 27.85  ? 75  LEU B CA  1 
ATOM   2158 C C   . LEU B 2 99  ? 24.462 28.518  28.042 1.00 27.85  ? 75  LEU B C   1 
ATOM   2159 O O   . LEU B 2 99  ? 25.493 28.063  28.543 1.00 27.85  ? 75  LEU B O   1 
ATOM   2160 C CB  . LEU B 2 99  ? 24.501 28.712  25.551 1.00 35.96  ? 75  LEU B CB  1 
ATOM   2161 C CG  . LEU B 2 99  ? 26.027 28.623  25.477 1.00 35.96  ? 75  LEU B CG  1 
ATOM   2162 C CD1 . LEU B 2 99  ? 26.437 27.213  25.125 1.00 35.96  ? 75  LEU B CD1 1 
ATOM   2163 C CD2 . LEU B 2 99  ? 26.558 29.585  24.440 1.00 35.96  ? 75  LEU B CD2 1 
ATOM   2164 N N   . ASP B 2 100 ? 23.771 29.517  28.596 1.00 37.40  ? 76  ASP B N   1 
ATOM   2165 C CA  . ASP B 2 100 ? 24.196 30.120  29.858 1.00 37.40  ? 76  ASP B CA  1 
ATOM   2166 C C   . ASP B 2 100 ? 23.472 29.545  31.074 1.00 37.40  ? 76  ASP B C   1 
ATOM   2167 O O   . ASP B 2 100 ? 24.113 29.143  32.044 1.00 37.40  ? 76  ASP B O   1 
ATOM   2168 C CB  . ASP B 2 100 ? 24.000 31.644  29.851 1.00 46.25  ? 76  ASP B CB  1 
ATOM   2169 C CG  . ASP B 2 100 ? 25.127 32.381  29.143 1.00 46.25  ? 76  ASP B CG  1 
ATOM   2170 O OD1 . ASP B 2 100 ? 26.304 31.977  29.285 1.00 46.25  ? 76  ASP B OD1 1 
ATOM   2171 O OD2 . ASP B 2 100 ? 24.831 33.382  28.451 1.00 46.25  ? 76  ASP B OD2 1 
ATOM   2172 N N   . THR B 2 101 ? 22.143 29.509  31.026 1.00 30.51  ? 77  THR B N   1 
ATOM   2173 C CA  . THR B 2 101 ? 21.364 29.000  32.146 1.00 30.51  ? 77  THR B CA  1 
ATOM   2174 C C   . THR B 2 101 ? 21.497 27.496  32.367 1.00 30.51  ? 77  THR B C   1 
ATOM   2175 O O   . THR B 2 101 ? 21.169 27.002  33.446 1.00 30.51  ? 77  THR B O   1 
ATOM   2176 C CB  . THR B 2 101 ? 19.866 29.319  31.996 1.00 35.97  ? 77  THR B CB  1 
ATOM   2177 O OG1 . THR B 2 101 ? 19.339 28.596  30.883 1.00 35.97  ? 77  THR B OG1 1 
ATOM   2178 C CG2 . THR B 2 101 ? 19.652 30.800  31.779 1.00 35.97  ? 77  THR B CG2 1 
ATOM   2179 N N   . ALA B 2 102 ? 21.968 26.769  31.356 1.00 32.62  ? 78  ALA B N   1 
ATOM   2180 C CA  . ALA B 2 102 ? 22.141 25.322  31.478 1.00 32.62  ? 78  ALA B CA  1 
ATOM   2181 C C   . ALA B 2 102 ? 23.618 24.945  31.508 1.00 32.62  ? 78  ALA B C   1 
ATOM   2182 O O   . ALA B 2 102 ? 24.129 24.473  32.521 1.00 32.62  ? 78  ALA B O   1 
ATOM   2183 C CB  . ALA B 2 102 ? 21.443 24.600  30.317 1.00 16.16  ? 78  ALA B CB  1 
ATOM   2184 N N   . CYS B 2 103 ? 24.298 25.158  30.388 1.00 32.64  ? 79  CYS B N   1 
ATOM   2185 C CA  . CYS B 2 103 ? 25.706 24.829  30.283 1.00 32.64  ? 79  CYS B CA  1 
ATOM   2186 C C   . CYS B 2 103 ? 26.588 25.595  31.263 1.00 32.64  ? 79  CYS B C   1 
ATOM   2187 O O   . CYS B 2 103 ? 27.212 24.992  32.132 1.00 32.64  ? 79  CYS B O   1 
ATOM   2188 C CB  . CYS B 2 103 ? 26.206 25.075  28.861 1.00 40.33  ? 79  CYS B CB  1 
ATOM   2189 S SG  . CYS B 2 103 ? 25.452 24.037  27.569 1.00 40.33  ? 79  CYS B SG  1 
ATOM   2190 N N   . ARG B 2 104 ? 26.648 26.917  31.128 1.00 41.49  ? 80  ARG B N   1 
ATOM   2191 C CA  . ARG B 2 104 ? 27.490 27.727  32.012 1.00 41.49  ? 80  ARG B CA  1 
ATOM   2192 C C   . ARG B 2 104 ? 27.123 27.577  33.487 1.00 41.49  ? 80  ARG B C   1 
ATOM   2193 O O   . ARG B 2 104 ? 27.998 27.439  34.342 1.00 41.49  ? 80  ARG B O   1 
ATOM   2194 C CB  . ARG B 2 104 ? 27.421 29.209  31.619 1.00 41.90  ? 80  ARG B CB  1 
ATOM   2195 C CG  . ARG B 2 104 ? 28.511 30.074  32.263 1.00 41.90  ? 80  ARG B CG  1 
ATOM   2196 C CD  . ARG B 2 104 ? 28.374 31.546  31.872 1.00 41.90  ? 80  ARG B CD  1 
ATOM   2197 N NE  . ARG B 2 104 ? 28.482 31.735  30.428 1.00 41.90  ? 80  ARG B NE  1 
ATOM   2198 C CZ  . ARG B 2 104 ? 29.614 31.630  29.742 1.00 41.90  ? 80  ARG B CZ  1 
ATOM   2199 N NH1 . ARG B 2 104 ? 30.749 31.347  30.369 1.00 41.90  ? 80  ARG B NH1 1 
ATOM   2200 N NH2 . ARG B 2 104 ? 29.606 31.784  28.425 1.00 41.90  ? 80  ARG B NH2 1 
ATOM   2201 N N   . HIS B 2 105 ? 25.829 27.611  33.784 1.00 33.72  ? 81  HIS B N   1 
ATOM   2202 C CA  . HIS B 2 105 ? 25.367 27.484  35.159 1.00 33.72  ? 81  HIS B CA  1 
ATOM   2203 C C   . HIS B 2 105 ? 25.712 26.135  35.788 1.00 33.72  ? 81  HIS B C   1 
ATOM   2204 O O   . HIS B 2 105 ? 26.273 26.090  36.882 1.00 33.72  ? 81  HIS B O   1 
ATOM   2205 C CB  . HIS B 2 105 ? 23.858 27.695  35.232 1.00 32.76  ? 81  HIS B CB  1 
ATOM   2206 C CG  . HIS B 2 105 ? 23.278 27.402  36.580 1.00 32.76  ? 81  HIS B CG  1 
ATOM   2207 N ND1 . HIS B 2 105 ? 23.415 28.255  37.652 1.00 32.76  ? 81  HIS B ND1 1 
ATOM   2208 C CD2 . HIS B 2 105 ? 22.569 26.340  37.032 1.00 32.76  ? 81  HIS B CD2 1 
ATOM   2209 C CE1 . HIS B 2 105 ? 22.812 27.734  38.706 1.00 32.76  ? 81  HIS B CE1 1 
ATOM   2210 N NE2 . HIS B 2 105 ? 22.291 26.572  38.357 1.00 32.76  ? 81  HIS B NE2 1 
ATOM   2211 N N   . ASN B 2 106 ? 25.367 25.040  35.108 1.00 23.38  ? 82  ASN B N   1 
ATOM   2212 C CA  . ASN B 2 106 ? 25.648 23.708  35.632 1.00 23.38  ? 82  ASN B CA  1 
ATOM   2213 C C   . ASN B 2 106 ? 27.136 23.490  35.866 1.00 23.38  ? 82  ASN B C   1 
ATOM   2214 O O   . ASN B 2 106 ? 27.536 22.928  36.882 1.00 23.38  ? 82  ASN B O   1 
ATOM   2215 C CB  . ASN B 2 106 ? 25.115 22.625  34.686 1.00 26.14  ? 82  ASN B CB  1 
ATOM   2216 C CG  . ASN B 2 106 ? 23.601 22.568  34.667 1.00 26.14  ? 82  ASN B CG  1 
ATOM   2217 O OD1 . ASN B 2 106 ? 22.943 23.121  35.542 1.00 26.14  ? 82  ASN B OD1 1 
ATOM   2218 N ND2 . ASN B 2 106 ? 23.042 21.888  33.673 1.00 26.14  ? 82  ASN B ND2 1 
ATOM   2219 N N   . TYR B 2 107 ? 27.958 23.944  34.931 1.00 29.71  ? 83  TYR B N   1 
ATOM   2220 C CA  . TYR B 2 107 ? 29.393 23.778  35.069 1.00 29.71  ? 83  TYR B CA  1 
ATOM   2221 C C   . TYR B 2 107 ? 29.962 24.540  36.267 1.00 29.71  ? 83  TYR B C   1 
ATOM   2222 O O   . TYR B 2 107 ? 30.611 23.952  37.134 1.00 29.71  ? 83  TYR B O   1 
ATOM   2223 C CB  . TYR B 2 107 ? 30.095 24.231  33.792 1.00 22.16  ? 83  TYR B CB  1 
ATOM   2224 C CG  . TYR B 2 107 ? 31.586 23.988  33.787 1.00 22.16  ? 83  TYR B CG  1 
ATOM   2225 C CD1 . TYR B 2 107 ? 32.440 24.758  34.575 1.00 22.16  ? 83  TYR B CD1 1 
ATOM   2226 C CD2 . TYR B 2 107 ? 32.144 22.985  32.997 1.00 22.16  ? 83  TYR B CD2 1 
ATOM   2227 C CE1 . TYR B 2 107 ? 33.821 24.539  34.574 1.00 22.16  ? 83  TYR B CE1 1 
ATOM   2228 C CE2 . TYR B 2 107 ? 33.513 22.755  32.991 1.00 22.16  ? 83  TYR B CE2 1 
ATOM   2229 C CZ  . TYR B 2 107 ? 34.347 23.539  33.783 1.00 22.16  ? 83  TYR B CZ  1 
ATOM   2230 O OH  . TYR B 2 107 ? 35.707 23.329  33.779 1.00 22.16  ? 83  TYR B OH  1 
ATOM   2231 N N   . GLU B 2 108 ? 29.697 25.843  36.306 1.00 43.19  ? 84  GLU B N   1 
ATOM   2232 C CA  . GLU B 2 108 ? 30.196 26.725  37.356 1.00 43.19  ? 84  GLU B CA  1 
ATOM   2233 C C   . GLU B 2 108 ? 29.619 26.512  38.753 1.00 43.19  ? 84  GLU B C   1 
ATOM   2234 O O   . GLU B 2 108 ? 30.333 26.658  39.744 1.00 43.19  ? 84  GLU B O   1 
ATOM   2235 C CB  . GLU B 2 108 ? 29.984 28.192  36.951 1.00 45.82  ? 84  GLU B CB  1 
ATOM   2236 C CG  . GLU B 2 108 ? 30.736 28.627  35.693 1.00 45.82  ? 84  GLU B CG  1 
ATOM   2237 C CD  . GLU B 2 108 ? 30.582 30.114  35.399 1.00 45.82  ? 84  GLU B CD  1 
ATOM   2238 O OE1 . GLU B 2 108 ? 29.436 30.612  35.420 1.00 45.82  ? 84  GLU B OE1 1 
ATOM   2239 O OE2 . GLU B 2 108 ? 31.600 30.789  35.138 1.00 45.82  ? 84  GLU B OE2 1 
ATOM   2240 N N   . GLU B 2 109 ? 28.340 26.168  38.842 1.00 35.42  ? 85  GLU B N   1 
ATOM   2241 C CA  . GLU B 2 109 ? 27.708 25.986  40.145 1.00 35.42  ? 85  GLU B CA  1 
ATOM   2242 C C   . GLU B 2 109 ? 27.505 24.547  40.640 1.00 35.42  ? 85  GLU B C   1 
ATOM   2243 O O   . GLU B 2 109 ? 27.245 24.343  41.828 1.00 35.42  ? 85  GLU B O   1 
ATOM   2244 C CB  . GLU B 2 109 ? 26.361 26.720  40.168 1.00 40.65  ? 85  GLU B CB  1 
ATOM   2245 N N   . THR B 2 110 ? 27.618 23.553  39.757 1.00 36.79  ? 86  THR B N   1 
ATOM   2246 C CA  . THR B 2 110 ? 27.415 22.168  40.185 1.00 36.79  ? 86  THR B CA  1 
ATOM   2247 C C   . THR B 2 110 ? 28.521 21.153  39.872 1.00 36.79  ? 86  THR B C   1 
ATOM   2248 O O   . THR B 2 110 ? 28.794 20.274  40.692 1.00 36.79  ? 86  THR B O   1 
ATOM   2249 C CB  . THR B 2 110 ? 26.060 21.611  39.662 1.00 26.94  ? 86  THR B CB  1 
ATOM   2250 O OG1 . THR B 2 110 ? 26.060 21.568  38.226 1.00 26.94  ? 86  THR B OG1 1 
ATOM   2251 C CG2 . THR B 2 110 ? 24.913 22.494  40.152 1.00 26.94  ? 86  THR B CG2 1 
ATOM   2252 N N   . GLU B 2 111 ? 29.153 21.258  38.705 1.00 33.77  ? 87  GLU B N   1 
ATOM   2253 C CA  . GLU B 2 111 ? 30.227 20.327  38.345 1.00 33.77  ? 87  GLU B CA  1 
ATOM   2254 C C   . GLU B 2 111 ? 31.549 20.706  39.033 1.00 33.77  ? 87  GLU B C   1 
ATOM   2255 O O   . GLU B 2 111 ? 32.302 19.835  39.466 1.00 33.77  ? 87  GLU B O   1 
ATOM   2256 C CB  . GLU B 2 111 ? 30.425 20.305  36.826 1.00 37.37  ? 87  GLU B CB  1 
ATOM   2257 C CG  . GLU B 2 111 ? 29.146 20.072  36.025 1.00 37.37  ? 87  GLU B CG  1 
ATOM   2258 C CD  . GLU B 2 111 ? 28.688 18.623  36.015 1.00 37.37  ? 87  GLU B CD  1 
ATOM   2259 O OE1 . GLU B 2 111 ? 29.112 17.847  36.896 1.00 37.37  ? 87  GLU B OE1 1 
ATOM   2260 O OE2 . GLU B 2 111 ? 27.886 18.265  35.125 1.00 37.37  ? 87  GLU B OE2 1 
ATOM   2261 N N   . VAL B 2 112 ? 31.823 22.007  39.134 1.00 32.68  ? 88  VAL B N   1 
ATOM   2262 C CA  . VAL B 2 112 ? 33.048 22.488  39.775 1.00 32.68  ? 88  VAL B CA  1 
ATOM   2263 C C   . VAL B 2 112 ? 33.190 21.933  41.191 1.00 32.68  ? 88  VAL B C   1 
ATOM   2264 O O   . VAL B 2 112 ? 34.249 21.420  41.556 1.00 32.68  ? 88  VAL B O   1 
ATOM   2265 C CB  . VAL B 2 112 ? 33.101 24.048  39.833 1.00 24.14  ? 88  VAL B CB  1 
ATOM   2266 C CG1 . VAL B 2 112 ? 34.190 24.512  40.792 1.00 24.14  ? 88  VAL B CG1 1 
ATOM   2267 C CG2 . VAL B 2 112 ? 33.391 24.605  38.458 1.00 24.14  ? 88  VAL B CG2 1 
ATOM   2268 N N   . PRO B 2 113 ? 32.126 22.035  42.007 1.00 36.34  ? 89  PRO B N   1 
ATOM   2269 C CA  . PRO B 2 113 ? 32.170 21.531  43.379 1.00 36.34  ? 89  PRO B CA  1 
ATOM   2270 C C   . PRO B 2 113 ? 32.046 20.011  43.533 1.00 36.34  ? 89  PRO B C   1 
ATOM   2271 O O   . PRO B 2 113 ? 32.238 19.493  44.630 1.00 36.34  ? 89  PRO B O   1 
ATOM   2272 C CB  . PRO B 2 113 ? 31.025 22.278  44.052 1.00 28.01  ? 89  PRO B CB  1 
ATOM   2273 C CG  . PRO B 2 113 ? 30.022 22.380  42.957 1.00 28.01  ? 89  PRO B CG  1 
ATOM   2274 C CD  . PRO B 2 113 ? 30.880 22.788  41.773 1.00 28.01  ? 89  PRO B CD  1 
ATOM   2275 N N   . THR B 2 114 ? 31.721 19.294  42.460 1.00 27.71  ? 90  THR B N   1 
ATOM   2276 C CA  . THR B 2 114 ? 31.615 17.836  42.549 1.00 27.71  ? 90  THR B CA  1 
ATOM   2277 C C   . THR B 2 114 ? 32.555 17.100  41.594 1.00 27.71  ? 90  THR B C   1 
ATOM   2278 O O   . THR B 2 114 ? 33.740 16.926  41.886 1.00 27.71  ? 90  THR B O   1 
ATOM   2279 C CB  . THR B 2 114 ? 30.160 17.314  42.297 1.00 20.76  ? 90  THR B CB  1 
ATOM   2280 O OG1 . THR B 2 114 ? 29.786 17.512  40.925 1.00 20.76  ? 90  THR B OG1 1 
ATOM   2281 C CG2 . THR B 2 114 ? 29.169 18.025  43.209 1.00 20.76  ? 90  THR B CG2 1 
ATOM   2282 N N   . SER B 2 115 ? 32.029 16.679  40.450 1.00 33.95  ? 91  SER B N   1 
ATOM   2283 C CA  . SER B 2 115 ? 32.798 15.930  39.463 1.00 33.95  ? 91  SER B CA  1 
ATOM   2284 C C   . SER B 2 115 ? 34.200 16.429  39.120 1.00 33.95  ? 91  SER B C   1 
ATOM   2285 O O   . SER B 2 115 ? 35.114 15.629  38.956 1.00 33.95  ? 91  SER B O   1 
ATOM   2286 C CB  . SER B 2 115 ? 31.976 15.786  38.180 1.00 30.29  ? 91  SER B CB  1 
ATOM   2287 O OG  . SER B 2 115 ? 31.312 16.995  37.887 1.00 30.29  ? 91  SER B OG  1 
ATOM   2288 N N   . LEU B 2 116 ? 34.381 17.737  39.003 1.00 30.88  ? 92  LEU B N   1 
ATOM   2289 C CA  . LEU B 2 116 ? 35.694 18.264  38.662 1.00 30.88  ? 92  LEU B CA  1 
ATOM   2290 C C   . LEU B 2 116 ? 36.705 18.239  39.817 1.00 30.88  ? 92  LEU B C   1 
ATOM   2291 O O   . LEU B 2 116 ? 37.864 18.621  39.640 1.00 30.88  ? 92  LEU B O   1 
ATOM   2292 C CB  . LEU B 2 116 ? 35.554 19.680  38.103 1.00 25.97  ? 92  LEU B CB  1 
ATOM   2293 C CG  . LEU B 2 116 ? 34.909 19.775  36.716 1.00 25.97  ? 92  LEU B CG  1 
ATOM   2294 C CD1 . LEU B 2 116 ? 34.751 21.237  36.325 1.00 25.97  ? 92  LEU B CD1 1 
ATOM   2295 C CD2 . LEU B 2 116 ? 35.766 19.034  35.689 1.00 25.97  ? 92  LEU B CD2 1 
ATOM   2296 N N   . ARG B 2 117 ? 36.267 17.789  40.990 1.00 33.95  ? 93  ARG B N   1 
ATOM   2297 C CA  . ARG B 2 117 ? 37.157 17.699  42.146 1.00 33.95  ? 93  ARG B CA  1 
ATOM   2298 C C   . ARG B 2 117 ? 37.323 16.261  42.608 1.00 33.95  ? 93  ARG B C   1 
ATOM   2299 O O   . ARG B 2 117 ? 38.109 15.990  43.513 1.00 33.95  ? 93  ARG B O   1 
ATOM   2300 C CB  . ARG B 2 117 ? 36.626 18.507  43.328 1.00 63.62  ? 93  ARG B CB  1 
ATOM   2301 C CG  . ARG B 2 117 ? 36.766 19.999  43.192 1.00 63.62  ? 93  ARG B CG  1 
ATOM   2302 C CD  . ARG B 2 117 ? 36.431 20.672  44.513 1.00 63.62  ? 93  ARG B CD  1 
ATOM   2303 N NE  . ARG B 2 117 ? 35.258 20.068  45.143 1.00 63.62  ? 93  ARG B NE  1 
ATOM   2304 C CZ  . ARG B 2 117 ? 35.296 19.323  46.245 1.00 63.62  ? 93  ARG B CZ  1 
ATOM   2305 N NH1 . ARG B 2 117 ? 36.453 19.084  46.858 1.00 63.62  ? 93  ARG B NH1 1 
ATOM   2306 N NH2 . ARG B 2 117 ? 34.173 18.810  46.734 1.00 63.62  ? 93  ARG B NH2 1 
ATOM   2307 N N   . ARG B 2 118 ? 36.579 15.343  42.000 1.00 28.06  ? 94  ARG B N   1 
ATOM   2308 C CA  . ARG B 2 118 ? 36.661 13.946  42.401 1.00 28.06  ? 94  ARG B CA  1 
ATOM   2309 C C   . ARG B 2 118 ? 38.019 13.330  42.091 1.00 28.06  ? 94  ARG B C   1 
ATOM   2310 O O   . ARG B 2 118 ? 38.507 13.397  40.967 1.00 28.06  ? 94  ARG B O   1 
ATOM   2311 C CB  . ARG B 2 118 ? 35.565 13.126  41.719 1.00 27.44  ? 94  ARG B CB  1 
ATOM   2312 C CG  . ARG B 2 118 ? 35.485 11.689  42.219 1.00 27.44  ? 94  ARG B CG  1 
ATOM   2313 C CD  . ARG B 2 118 ? 34.654 10.798  41.300 1.00 27.44  ? 94  ARG B CD  1 
ATOM   2314 N NE  . ARG B 2 118 ? 34.197 9.600   41.998 1.00 27.44  ? 94  ARG B NE  1 
ATOM   2315 C CZ  . ARG B 2 118 ? 33.339 9.628   43.015 1.00 27.44  ? 94  ARG B CZ  1 
ATOM   2316 N NH1 . ARG B 2 118 ? 32.847 10.791  43.441 1.00 27.44  ? 94  ARG B NH1 1 
ATOM   2317 N NH2 . ARG B 2 118 ? 32.981 8.502   43.622 1.00 27.44  ? 94  ARG B NH2 1 
ATOM   2318 N N   . LEU B 2 119 A 38.625 12.723  43.099 1.00 18.45  ? 94  LEU B N   1 
ATOM   2319 C CA  . LEU B 2 119 A 39.918 12.083  42.928 1.00 18.45  ? 94  LEU B CA  1 
ATOM   2320 C C   . LEU B 2 119 A 39.963 10.681  43.514 1.00 18.45  ? 94  LEU B C   1 
ATOM   2321 O O   . LEU B 2 119 A 39.760 10.482  44.709 1.00 18.45  ? 94  LEU B O   1 
ATOM   2322 C CB  . LEU B 2 119 A 41.008 12.930  43.567 1.00 25.89  ? 94  LEU B CB  1 
ATOM   2323 C CG  . LEU B 2 119 A 41.431 14.151  42.756 1.00 25.89  ? 94  LEU B CG  1 
ATOM   2324 C CD1 . LEU B 2 119 A 42.416 14.987  43.570 1.00 25.89  ? 94  LEU B CD1 1 
ATOM   2325 C CD2 . LEU B 2 119 A 42.061 13.688  41.445 1.00 25.89  ? 94  LEU B CD2 1 
ATOM   2326 N N   . GLU B 2 120 ? 40.230 9.713   42.653 1.00 27.39  ? 95  GLU B N   1 
ATOM   2327 C CA  . GLU B 2 120 ? 40.333 8.319   43.053 1.00 27.39  ? 95  GLU B CA  1 
ATOM   2328 C C   . GLU B 2 120 ? 41.739 7.807   42.736 1.00 27.39  ? 95  GLU B C   1 
ATOM   2329 O O   . GLU B 2 120 ? 42.143 7.778   41.572 1.00 27.39  ? 95  GLU B O   1 
ATOM   2330 C CB  . GLU B 2 120 ? 39.302 7.485   42.298 1.00 59.13  ? 95  GLU B CB  1 
ATOM   2331 C CG  . GLU B 2 120 ? 38.035 7.238   43.070 1.00 59.13  ? 95  GLU B CG  1 
ATOM   2332 C CD  . GLU B 2 120 ? 38.277 6.322   44.233 1.00 59.13  ? 95  GLU B CD  1 
ATOM   2333 O OE1 . GLU B 2 120 ? 39.155 6.651   45.054 1.00 59.13  ? 95  GLU B OE1 1 
ATOM   2334 O OE2 . GLU B 2 120 ? 37.603 5.273   44.324 1.00 59.13  ? 95  GLU B OE2 1 
ATOM   2335 N N   . GLN B 2 121 ? 42.477 7.416   43.771 1.00 29.05  ? 96  GLN B N   1 
ATOM   2336 C CA  . GLN B 2 121 ? 43.833 6.888   43.611 1.00 29.05  ? 96  GLN B CA  1 
ATOM   2337 C C   . GLN B 2 121 ? 43.791 5.497   43.017 1.00 29.05  ? 96  GLN B C   1 
ATOM   2338 O O   . GLN B 2 121 ? 42.974 4.674   43.413 1.00 29.05  ? 96  GLN B O   1 
ATOM   2339 C CB  . GLN B 2 121 ? 44.545 6.794   44.958 1.00 32.31  ? 96  GLN B CB  1 
ATOM   2340 C CG  . GLN B 2 121 ? 45.019 8.097   45.517 1.00 32.31  ? 96  GLN B CG  1 
ATOM   2341 C CD  . GLN B 2 121 ? 45.743 7.900   46.818 1.00 32.31  ? 96  GLN B CD  1 
ATOM   2342 O OE1 . GLN B 2 121 ? 45.131 7.636   47.849 1.00 32.31  ? 96  GLN B OE1 1 
ATOM   2343 N NE2 . GLN B 2 121 ? 47.063 8.010   46.779 1.00 32.31  ? 96  GLN B NE2 1 
ATOM   2344 N N   . PRO B 2 122 ? 44.675 5.209   42.060 1.00 24.60  ? 97  PRO B N   1 
ATOM   2345 C CA  . PRO B 2 122 ? 44.660 3.871   41.468 1.00 24.60  ? 97  PRO B CA  1 
ATOM   2346 C C   . PRO B 2 122 ? 45.267 2.803   42.368 1.00 24.60  ? 97  PRO B C   1 
ATOM   2347 O O   . PRO B 2 122 ? 46.038 3.107   43.270 1.00 24.60  ? 97  PRO B O   1 
ATOM   2348 C CB  . PRO B 2 122 ? 45.471 4.049   40.184 1.00 15.44  ? 97  PRO B CB  1 
ATOM   2349 C CG  . PRO B 2 122 ? 46.429 5.139   40.532 1.00 15.44  ? 97  PRO B CG  1 
ATOM   2350 C CD  . PRO B 2 122 ? 45.550 6.116   41.298 1.00 15.44  ? 97  PRO B CD  1 
ATOM   2351 N N   . ASN B 2 123 ? 44.876 1.556   42.139 1.00 30.24  ? 98  ASN B N   1 
ATOM   2352 C CA  . ASN B 2 123 ? 45.444 0.434   42.871 1.00 30.24  ? 98  ASN B CA  1 
ATOM   2353 C C   . ASN B 2 123 ? 46.315 -0.212  41.811 1.00 30.24  ? 98  ASN B C   1 
ATOM   2354 O O   . ASN B 2 123 ? 45.929 -0.281  40.637 1.00 30.24  ? 98  ASN B O   1 
ATOM   2355 C CB  . ASN B 2 123 ? 44.370 -0.545  43.343 1.00 37.80  ? 98  ASN B CB  1 
ATOM   2356 C CG  . ASN B 2 123 ? 43.444 0.058   44.386 1.00 37.80  ? 98  ASN B CG  1 
ATOM   2357 O OD1 . ASN B 2 123 ? 43.865 0.852   45.223 1.00 37.80  ? 98  ASN B OD1 1 
ATOM   2358 N ND2 . ASN B 2 123 ? 42.176 -0.333  44.349 1.00 37.80  ? 98  ASN B ND2 1 
ATOM   2359 N N   . VAL B 2 124 ? 47.492 -0.670  42.209 1.00 23.34  ? 99  VAL B N   1 
ATOM   2360 C CA  . VAL B 2 124 ? 48.409 -1.260  41.255 1.00 23.34  ? 99  VAL B CA  1 
ATOM   2361 C C   . VAL B 2 124 ? 48.923 -2.619  41.676 1.00 23.34  ? 99  VAL B C   1 
ATOM   2362 O O   . VAL B 2 124 ? 49.457 -2.782  42.772 1.00 23.34  ? 99  VAL B O   1 
ATOM   2363 C CB  . VAL B 2 124 ? 49.624 -0.363  41.059 1.00 15.73  ? 99  VAL B CB  1 
ATOM   2364 C CG1 . VAL B 2 124 ? 50.460 -0.877  39.895 1.00 15.73  ? 99  VAL B CG1 1 
ATOM   2365 C CG2 . VAL B 2 124 ? 49.182 1.076   40.865 1.00 15.73  ? 99  VAL B CG2 1 
ATOM   2366 N N   . ALA B 2 125 ? 48.794 -3.596  40.794 1.00 32.23  ? 100 ALA B N   1 
ATOM   2367 C CA  . ALA B 2 125 ? 49.276 -4.925  41.106 1.00 32.23  ? 100 ALA B CA  1 
ATOM   2368 C C   . ALA B 2 125 ? 49.866 -5.606  39.877 1.00 32.23  ? 100 ALA B C   1 
ATOM   2369 O O   . ALA B 2 125 ? 49.430 -5.383  38.748 1.00 32.23  ? 100 ALA B O   1 
ATOM   2370 C CB  . ALA B 2 125 ? 48.145 -5.760  41.697 1.00 9.65   ? 100 ALA B CB  1 
ATOM   2371 N N   . ILE B 2 126 ? 50.874 -6.431  40.110 1.00 28.61  ? 101 ILE B N   1 
ATOM   2372 C CA  . ILE B 2 126 ? 51.535 -7.157  39.039 1.00 28.61  ? 101 ILE B CA  1 
ATOM   2373 C C   . ILE B 2 126 ? 51.269 -8.644  39.180 1.00 28.61  ? 101 ILE B C   1 
ATOM   2374 O O   . ILE B 2 126 ? 51.410 -9.204  40.264 1.00 28.61  ? 101 ILE B O   1 
ATOM   2375 C CB  . ILE B 2 126 ? 53.064 -6.971  39.090 1.00 36.25  ? 101 ILE B CB  1 
ATOM   2376 C CG1 . ILE B 2 126 ? 53.419 -5.502  38.895 1.00 36.25  ? 101 ILE B CG1 1 
ATOM   2377 C CG2 . ILE B 2 126 ? 53.736 -7.844  38.027 1.00 36.25  ? 101 ILE B CG2 1 
ATOM   2378 C CD1 . ILE B 2 126 ? 54.909 -5.233  39.010 1.00 36.25  ? 101 ILE B CD1 1 
ATOM   2379 N N   . SER B 2 127 ? 50.881 -9.287  38.091 1.00 31.49  ? 102 SER B N   1 
ATOM   2380 C CA  . SER B 2 127 ? 50.659 -10.724 38.133 1.00 31.49  ? 102 SER B CA  1 
ATOM   2381 C C   . SER B 2 127 ? 51.278 -11.288 36.862 1.00 31.49  ? 102 SER B C   1 
ATOM   2382 O O   . SER B 2 127 ? 51.537 -10.552 35.909 1.00 31.49  ? 102 SER B O   1 
ATOM   2383 C CB  . SER B 2 127 ? 49.167 -11.052 38.186 1.00 41.77  ? 102 SER B CB  1 
ATOM   2384 O OG  . SER B 2 127 ? 48.588 -10.987 36.895 1.00 41.77  ? 102 SER B OG  1 
ATOM   2385 N N   . LEU B 2 128 ? 51.530 -12.588 36.847 1.00 47.51  ? 103 LEU B N   1 
ATOM   2386 C CA  . LEU B 2 128 ? 52.127 -13.222 35.682 1.00 47.51  ? 103 LEU B CA  1 
ATOM   2387 C C   . LEU B 2 128 ? 51.087 -14.080 34.986 1.00 47.51  ? 103 LEU B C   1 
ATOM   2388 O O   . LEU B 2 128 ? 50.472 -14.935 35.615 1.00 47.51  ? 103 LEU B O   1 
ATOM   2389 C CB  . LEU B 2 128 ? 53.309 -14.087 36.116 1.00 78.39  ? 103 LEU B CB  1 
ATOM   2390 C CG  . LEU B 2 128 ? 54.032 -14.885 35.032 1.00 78.39  ? 103 LEU B CG  1 
ATOM   2391 C CD1 . LEU B 2 128 ? 54.650 -13.946 34.005 1.00 78.39  ? 103 LEU B CD1 1 
ATOM   2392 C CD2 . LEU B 2 128 ? 55.100 -15.742 35.686 1.00 78.39  ? 103 LEU B CD2 1 
ATOM   2393 N N   . SER B 2 129 ? 50.888 -13.849 33.693 1.00 66.18  ? 104 SER B N   1 
ATOM   2394 C CA  . SER B 2 129 ? 49.917 -14.621 32.929 1.00 66.18  ? 104 SER B CA  1 
ATOM   2395 C C   . SER B 2 129 ? 50.307 -16.096 32.935 1.00 66.18  ? 104 SER B C   1 
ATOM   2396 O O   . SER B 2 129 ? 49.469 -16.974 33.151 1.00 66.18  ? 104 SER B O   1 
ATOM   2397 C CB  . SER B 2 129 ? 49.854 -14.125 31.487 1.00 72.60  ? 104 SER B CB  1 
ATOM   2398 O OG  . SER B 2 129 ? 51.062 -14.415 30.807 1.00 72.60  ? 104 SER B OG  1 
ATOM   2399 N N   . ASN B 2 138 ? 55.984 -16.062 28.226 1.00 65.21  ? 113 ASN B N   1 
ATOM   2400 C CA  . ASN B 2 138 ? 55.361 -15.573 29.452 1.00 65.21  ? 113 ASN B CA  1 
ATOM   2401 C C   . ASN B 2 138 ? 55.044 -14.078 29.343 1.00 65.21  ? 113 ASN B C   1 
ATOM   2402 O O   . ASN B 2 138 ? 55.646 -13.368 28.536 1.00 65.21  ? 113 ASN B O   1 
ATOM   2403 C CB  . ASN B 2 138 ? 56.285 -15.831 30.650 1.00 34.50  ? 113 ASN B CB  1 
ATOM   2404 N N   . THR B 2 139 ? 54.099 -13.603 30.152 1.00 47.28  ? 114 THR B N   1 
ATOM   2405 C CA  . THR B 2 139 ? 53.716 -12.189 30.123 1.00 47.28  ? 114 THR B CA  1 
ATOM   2406 C C   . THR B 2 139 ? 53.364 -11.600 31.487 1.00 47.28  ? 114 THR B C   1 
ATOM   2407 O O   . THR B 2 139 ? 52.658 -12.222 32.282 1.00 47.28  ? 114 THR B O   1 
ATOM   2408 C CB  . THR B 2 139 ? 52.505 -11.954 29.188 1.00 51.29  ? 114 THR B CB  1 
ATOM   2409 O OG1 . THR B 2 139 ? 52.895 -12.191 27.829 1.00 51.29  ? 114 THR B OG1 1 
ATOM   2410 C CG2 . THR B 2 139 ? 51.994 -10.526 29.319 1.00 51.29  ? 114 THR B CG2 1 
ATOM   2411 N N   . LEU B 2 140 ? 53.865 -10.395 31.748 1.00 30.06  ? 115 LEU B N   1 
ATOM   2412 C CA  . LEU B 2 140 ? 53.574 -9.704  33.005 1.00 30.06  ? 115 LEU B CA  1 
ATOM   2413 C C   . LEU B 2 140 ? 52.400 -8.756  32.799 1.00 30.06  ? 115 LEU B C   1 
ATOM   2414 O O   . LEU B 2 140 ? 52.303 -8.076  31.769 1.00 30.06  ? 115 LEU B O   1 
ATOM   2415 C CB  . LEU B 2 140 ? 54.773 -8.884  33.495 1.00 30.75  ? 115 LEU B CB  1 
ATOM   2416 C CG  . LEU B 2 140 ? 55.959 -9.594  34.145 1.00 30.75  ? 115 LEU B CG  1 
ATOM   2417 C CD1 . LEU B 2 140 ? 56.914 -8.540  34.703 1.00 30.75  ? 115 LEU B CD1 1 
ATOM   2418 C CD2 . LEU B 2 140 ? 55.482 -10.510 35.258 1.00 30.75  ? 115 LEU B CD2 1 
ATOM   2419 N N   . VAL B 2 141 ? 51.508 -8.714  33.779 1.00 25.07  ? 116 VAL B N   1 
ATOM   2420 C CA  . VAL B 2 141 ? 50.364 -7.832  33.685 1.00 25.07  ? 116 VAL B CA  1 
ATOM   2421 C C   . VAL B 2 141 ? 50.288 -6.860  34.850 1.00 25.07  ? 116 VAL B C   1 
ATOM   2422 O O   . VAL B 2 141 ? 50.191 -7.259  36.012 1.00 25.07  ? 116 VAL B O   1 
ATOM   2423 C CB  . VAL B 2 141 ? 49.055 -8.624  33.613 1.00 25.15  ? 116 VAL B CB  1 
ATOM   2424 C CG1 . VAL B 2 141 ? 47.873 -7.676  33.619 1.00 25.15  ? 116 VAL B CG1 1 
ATOM   2425 C CG2 . VAL B 2 141 ? 49.043 -9.468  32.354 1.00 25.15  ? 116 VAL B CG2 1 
ATOM   2426 N N   . CYS B 2 142 ? 50.367 -5.575  34.536 1.00 30.85  ? 117 CYS B N   1 
ATOM   2427 C CA  . CYS B 2 142 ? 50.250 -4.570  35.567 1.00 30.85  ? 117 CYS B CA  1 
ATOM   2428 C C   . CYS B 2 142 ? 48.799 -4.108  35.531 1.00 30.85  ? 117 CYS B C   1 
ATOM   2429 O O   . CYS B 2 142 ? 48.323 -3.578  34.514 1.00 30.85  ? 117 CYS B O   1 
ATOM   2430 C CB  . CYS B 2 142 ? 51.171 -3.383  35.303 1.00 34.33  ? 117 CYS B CB  1 
ATOM   2431 S SG  . CYS B 2 142 ? 51.073 -2.189  36.668 1.00 34.33  ? 117 CYS B SG  1 
ATOM   2432 N N   . SER B 2 143 ? 48.085 -4.336  36.627 1.00 23.11  ? 118 SER B N   1 
ATOM   2433 C CA  . SER B 2 143 ? 46.695 -3.927  36.700 1.00 23.11  ? 118 SER B CA  1 
ATOM   2434 C C   . SER B 2 143 ? 46.587 -2.612  37.459 1.00 23.11  ? 118 SER B C   1 
ATOM   2435 O O   . SER B 2 143 ? 46.944 -2.537  38.638 1.00 23.11  ? 118 SER B O   1 
ATOM   2436 C CB  . SER B 2 143 ? 45.855 -5.010  37.388 1.00 32.06  ? 118 SER B CB  1 
ATOM   2437 O OG  . SER B 2 143 ? 45.779 -6.184  36.594 1.00 32.06  ? 118 SER B OG  1 
ATOM   2438 N N   . VAL B 2 144 ? 46.105 -1.578  36.767 1.00 30.78  ? 119 VAL B N   1 
ATOM   2439 C CA  . VAL B 2 144 ? 45.925 -0.249  37.352 1.00 30.78  ? 119 VAL B CA  1 
ATOM   2440 C C   . VAL B 2 144 ? 44.417 -0.016  37.408 1.00 30.78  ? 119 VAL B C   1 
ATOM   2441 O O   . VAL B 2 144 ? 43.789 0.299   36.389 1.00 30.78  ? 119 VAL B O   1 
ATOM   2442 C CB  . VAL B 2 144 ? 46.605 0.817   36.477 1.00 26.47  ? 119 VAL B CB  1 
ATOM   2443 C CG1 . VAL B 2 144 ? 46.476 2.194   37.113 1.00 26.47  ? 119 VAL B CG1 1 
ATOM   2444 C CG2 . VAL B 2 144 ? 48.077 0.449   36.290 1.00 26.47  ? 119 VAL B CG2 1 
ATOM   2445 N N   . THR B 2 145 ? 43.842 -0.155  38.603 1.00 22.81  ? 120 THR B N   1 
ATOM   2446 C CA  . THR B 2 145 ? 42.397 -0.047  38.761 1.00 22.81  ? 120 THR B CA  1 
ATOM   2447 C C   . THR B 2 145 ? 41.783 0.966   39.735 1.00 22.81  ? 120 THR B C   1 
ATOM   2448 O O   . THR B 2 145 ? 42.433 1.469   40.664 1.00 22.81  ? 120 THR B O   1 
ATOM   2449 C CB  . THR B 2 145 ? 41.830 -1.424  39.126 1.00 18.21  ? 120 THR B CB  1 
ATOM   2450 O OG1 . THR B 2 145 ? 42.302 -1.803  40.425 1.00 18.21  ? 120 THR B OG1 1 
ATOM   2451 C CG2 . THR B 2 145 ? 42.284 -2.468  38.116 1.00 18.21  ? 120 THR B CG2 1 
ATOM   2452 N N   . ASP B 2 146 ? 40.499 1.235   39.503 1.00 15.90  ? 121 ASP B N   1 
ATOM   2453 C CA  . ASP B 2 146 ? 39.700 2.149   40.316 1.00 15.90  ? 121 ASP B CA  1 
ATOM   2454 C C   . ASP B 2 146 ? 40.214 3.578   40.472 1.00 15.90  ? 121 ASP B C   1 
ATOM   2455 O O   . ASP B 2 146 ? 40.166 4.133   41.573 1.00 15.90  ? 121 ASP B O   1 
ATOM   2456 C CB  . ASP B 2 146 ? 39.492 1.566   41.717 1.00 31.81  ? 121 ASP B CB  1 
ATOM   2457 C CG  . ASP B 2 146 ? 38.872 0.191   41.694 1.00 31.81  ? 121 ASP B CG  1 
ATOM   2458 O OD1 . ASP B 2 146 ? 38.159 -0.149  40.726 1.00 31.81  ? 121 ASP B OD1 1 
ATOM   2459 O OD2 . ASP B 2 146 ? 39.088 -0.552  42.667 1.00 31.81  ? 121 ASP B OD2 1 
ATOM   2460 N N   . PHE B 2 147 ? 40.700 4.180   39.394 1.00 26.44  ? 122 PHE B N   1 
ATOM   2461 C CA  . PHE B 2 147 ? 41.186 5.548   39.493 1.00 26.44  ? 122 PHE B CA  1 
ATOM   2462 C C   . PHE B 2 147 ? 40.233 6.507   38.799 1.00 26.44  ? 122 PHE B C   1 
ATOM   2463 O O   . PHE B 2 147 ? 39.384 6.096   38.001 1.00 26.44  ? 122 PHE B O   1 
ATOM   2464 C CB  . PHE B 2 147 ? 42.598 5.690   38.892 1.00 18.43  ? 122 PHE B CB  1 
ATOM   2465 C CG  . PHE B 2 147 ? 42.724 5.171   37.485 1.00 18.43  ? 122 PHE B CG  1 
ATOM   2466 C CD1 . PHE B 2 147 ? 42.959 3.819   37.242 1.00 18.43  ? 122 PHE B CD1 1 
ATOM   2467 C CD2 . PHE B 2 147 ? 42.601 6.027   36.400 1.00 18.43  ? 122 PHE B CD2 1 
ATOM   2468 C CE1 . PHE B 2 147 ? 43.068 3.332   35.940 1.00 18.43  ? 122 PHE B CE1 1 
ATOM   2469 C CE2 . PHE B 2 147 ? 42.710 5.541   35.093 1.00 18.43  ? 122 PHE B CE2 1 
ATOM   2470 C CZ  . PHE B 2 147 ? 42.943 4.193   34.871 1.00 18.43  ? 122 PHE B CZ  1 
ATOM   2471 N N   . TYR B 2 148 ? 40.373 7.787   39.119 1.00 23.91  ? 123 TYR B N   1 
ATOM   2472 C CA  . TYR B 2 148 ? 39.541 8.824   38.530 1.00 23.91  ? 123 TYR B CA  1 
ATOM   2473 C C   . TYR B 2 148 ? 40.208 10.160  38.820 1.00 23.91  ? 123 TYR B C   1 
ATOM   2474 O O   . TYR B 2 148 ? 40.669 10.395  39.937 1.00 23.91  ? 123 TYR B O   1 
ATOM   2475 C CB  . TYR B 2 148 ? 38.129 8.799   39.139 1.00 17.32  ? 123 TYR B CB  1 
ATOM   2476 C CG  . TYR B 2 148 ? 37.163 9.717   38.422 1.00 17.32  ? 123 TYR B CG  1 
ATOM   2477 C CD1 . TYR B 2 148 ? 37.074 11.073  38.747 1.00 17.32  ? 123 TYR B CD1 1 
ATOM   2478 C CD2 . TYR B 2 148 ? 36.395 9.243   37.351 1.00 17.32  ? 123 TYR B CD2 1 
ATOM   2479 C CE1 . TYR B 2 148 ? 36.247 11.937  38.012 1.00 17.32  ? 123 TYR B CE1 1 
ATOM   2480 C CE2 . TYR B 2 148 ? 35.567 10.088  36.616 1.00 17.32  ? 123 TYR B CE2 1 
ATOM   2481 C CZ  . TYR B 2 148 ? 35.495 11.433  36.945 1.00 17.32  ? 123 TYR B CZ  1 
ATOM   2482 O OH  . TYR B 2 148 ? 34.681 12.259  36.202 1.00 17.32  ? 123 TYR B OH  1 
ATOM   2483 N N   . PRO B 2 149 ? 40.273 11.052  37.820 1.00 29.74  ? 124 PRO B N   1 
ATOM   2484 C CA  . PRO B 2 149 ? 39.774 10.903  36.449 1.00 29.74  ? 124 PRO B CA  1 
ATOM   2485 C C   . PRO B 2 149 ? 40.586 9.961   35.554 1.00 29.74  ? 124 PRO B C   1 
ATOM   2486 O O   . PRO B 2 149 ? 41.478 9.252   36.027 1.00 29.74  ? 124 PRO B O   1 
ATOM   2487 C CB  . PRO B 2 149 ? 39.760 12.342  35.932 1.00 23.54  ? 124 PRO B CB  1 
ATOM   2488 C CG  . PRO B 2 149 ? 40.905 12.947  36.640 1.00 23.54  ? 124 PRO B CG  1 
ATOM   2489 C CD  . PRO B 2 149 ? 40.728 12.433  38.051 1.00 23.54  ? 124 PRO B CD  1 
ATOM   2490 N N   . ALA B 2 150 ? 40.262 9.969   34.260 1.00 22.78  ? 125 ALA B N   1 
ATOM   2491 C CA  . ALA B 2 150 ? 40.906 9.105   33.276 1.00 22.78  ? 125 ALA B CA  1 
ATOM   2492 C C   . ALA B 2 150 ? 42.385 9.342   32.983 1.00 22.78  ? 125 ALA B C   1 
ATOM   2493 O O   . ALA B 2 150 ? 43.101 8.399   32.677 1.00 22.78  ? 125 ALA B O   1 
ATOM   2494 C CB  . ALA B 2 150 ? 40.132 9.153   31.979 1.00 20.56  ? 125 ALA B CB  1 
ATOM   2495 N N   . LYS B 2 151 ? 42.849 10.583  33.049 1.00 34.27  ? 126 LYS B N   1 
ATOM   2496 C CA  . LYS B 2 151 ? 44.254 10.856  32.759 1.00 34.27  ? 126 LYS B CA  1 
ATOM   2497 C C   . LYS B 2 151 ? 45.172 9.987   33.622 1.00 34.27  ? 126 LYS B C   1 
ATOM   2498 O O   . LYS B 2 151 ? 45.111 10.038  34.850 1.00 34.27  ? 126 LYS B O   1 
ATOM   2499 C CB  . LYS B 2 151 ? 44.577 12.334  32.991 1.00 78.81  ? 126 LYS B CB  1 
ATOM   2500 C CG  . LYS B 2 151 ? 46.033 12.689  32.704 1.00 78.81  ? 126 LYS B CG  1 
ATOM   2501 C CD  . LYS B 2 151 ? 46.329 14.172  32.944 1.00 78.81  ? 126 LYS B CD  1 
ATOM   2502 C CE  . LYS B 2 151 ? 47.791 14.504  32.635 1.00 78.81  ? 126 LYS B CE  1 
ATOM   2503 N NZ  . LYS B 2 151 ? 48.105 15.956  32.790 1.00 78.81  ? 126 LYS B NZ  1 
ATOM   2504 N N   . ILE B 2 152 ? 46.017 9.184   32.977 1.00 18.48  ? 127 ILE B N   1 
ATOM   2505 C CA  . ILE B 2 152 ? 46.929 8.315   33.709 1.00 18.48  ? 127 ILE B CA  1 
ATOM   2506 C C   . ILE B 2 152 ? 48.170 7.941   32.901 1.00 18.48  ? 127 ILE B C   1 
ATOM   2507 O O   . ILE B 2 152 ? 48.140 7.882   31.675 1.00 18.48  ? 127 ILE B O   1 
ATOM   2508 C CB  . ILE B 2 152 ? 46.204 7.019   34.171 1.00 18.56  ? 127 ILE B CB  1 
ATOM   2509 C CG1 . ILE B 2 152 ? 46.995 6.355   35.295 1.00 18.56  ? 127 ILE B CG1 1 
ATOM   2510 C CG2 . ILE B 2 152 ? 46.055 6.045   33.010 1.00 18.56  ? 127 ILE B CG2 1 
ATOM   2511 C CD1 . ILE B 2 152 ? 46.148 5.441   36.136 1.00 18.56  ? 127 ILE B CD1 1 
ATOM   2512 N N   . LYS B 2 153 ? 49.271 7.694   33.595 1.00 30.04  ? 128 LYS B N   1 
ATOM   2513 C CA  . LYS B 2 153 ? 50.502 7.323   32.909 1.00 30.04  ? 128 LYS B CA  1 
ATOM   2514 C C   . LYS B 2 153 ? 51.080 6.049   33.515 1.00 30.04  ? 128 LYS B C   1 
ATOM   2515 O O   . LYS B 2 153 ? 51.325 5.972   34.722 1.00 30.04  ? 128 LYS B O   1 
ATOM   2516 C CB  . LYS B 2 153 ? 51.521 8.466   32.997 1.00 60.55  ? 128 LYS B CB  1 
ATOM   2517 C CG  . LYS B 2 153 ? 52.739 8.312   32.089 1.00 60.55  ? 128 LYS B CG  1 
ATOM   2518 C CD  . LYS B 2 153 ? 53.732 9.444   32.332 1.00 60.55  ? 128 LYS B CD  1 
ATOM   2519 C CE  . LYS B 2 153 ? 54.975 9.309   31.470 1.00 60.55  ? 128 LYS B CE  1 
ATOM   2520 N NZ  . LYS B 2 153 ? 55.989 10.338  31.829 1.00 60.55  ? 128 LYS B NZ  1 
ATOM   2521 N N   . VAL B 2 154 ? 51.284 5.044   32.670 1.00 27.84  ? 129 VAL B N   1 
ATOM   2522 C CA  . VAL B 2 154 ? 51.833 3.777   33.128 1.00 27.84  ? 129 VAL B CA  1 
ATOM   2523 C C   . VAL B 2 154 ? 52.969 3.327   32.225 1.00 27.84  ? 129 VAL B C   1 
ATOM   2524 O O   . VAL B 2 154 ? 52.816 3.276   30.997 1.00 27.84  ? 129 VAL B O   1 
ATOM   2525 C CB  . VAL B 2 154 ? 50.763 2.681   33.143 1.00 24.82  ? 129 VAL B CB  1 
ATOM   2526 C CG1 . VAL B 2 154 ? 51.298 1.451   33.853 1.00 24.82  ? 129 VAL B CG1 1 
ATOM   2527 C CG2 . VAL B 2 154 ? 49.504 3.196   33.821 1.00 24.82  ? 129 VAL B CG2 1 
ATOM   2528 N N   . ARG B 2 155 ? 54.105 3.008   32.843 1.00 27.48  ? 130 ARG B N   1 
ATOM   2529 C CA  . ARG B 2 155 ? 55.290 2.545   32.123 1.00 27.48  ? 130 ARG B CA  1 
ATOM   2530 C C   . ARG B 2 155 ? 55.985 1.396   32.869 1.00 27.48  ? 130 ARG B C   1 
ATOM   2531 O O   . ARG B 2 155 ? 56.021 1.374   34.102 1.00 27.48  ? 130 ARG B O   1 
ATOM   2532 C CB  . ARG B 2 155 ? 56.271 3.705   31.933 1.00 71.44  ? 130 ARG B CB  1 
ATOM   2533 C CG  . ARG B 2 155 ? 55.730 4.837   31.086 1.00 71.44  ? 130 ARG B CG  1 
ATOM   2534 C CD  . ARG B 2 155 ? 56.197 6.183   31.624 1.00 71.44  ? 130 ARG B CD  1 
ATOM   2535 N NE  . ARG B 2 155 ? 57.642 6.367   31.507 1.00 71.44  ? 130 ARG B NE  1 
ATOM   2536 C CZ  . ARG B 2 155 ? 58.319 7.382   32.042 1.00 71.44  ? 130 ARG B CZ  1 
ATOM   2537 N NH1 . ARG B 2 155 ? 57.686 8.317   32.745 1.00 71.44  ? 130 ARG B NH1 1 
ATOM   2538 N NH2 . ARG B 2 155 ? 59.633 7.469   31.864 1.00 71.44  ? 130 ARG B NH2 1 
ATOM   2539 N N   . TRP B 2 156 ? 56.522 0.440   32.114 1.00 37.47  ? 131 TRP B N   1 
ATOM   2540 C CA  . TRP B 2 156 ? 57.229 -0.705  32.685 1.00 37.47  ? 131 TRP B CA  1 
ATOM   2541 C C   . TRP B 2 156 ? 58.725 -0.417  32.809 1.00 37.47  ? 131 TRP B C   1 
ATOM   2542 O O   . TRP B 2 156 ? 59.254 0.434   32.102 1.00 37.47  ? 131 TRP B O   1 
ATOM   2543 C CB  . TRP B 2 156 ? 57.034 -1.945  31.812 1.00 28.96  ? 131 TRP B CB  1 
ATOM   2544 C CG  . TRP B 2 156 ? 55.871 -2.785  32.214 1.00 28.96  ? 131 TRP B CG  1 
ATOM   2545 C CD1 . TRP B 2 156 ? 54.678 -2.894  31.568 1.00 28.96  ? 131 TRP B CD1 1 
ATOM   2546 C CD2 . TRP B 2 156 ? 55.785 -3.631  33.369 1.00 28.96  ? 131 TRP B CD2 1 
ATOM   2547 N NE1 . TRP B 2 156 ? 53.848 -3.755  32.246 1.00 28.96  ? 131 TRP B NE1 1 
ATOM   2548 C CE2 . TRP B 2 156 ? 54.502 -4.222  33.356 1.00 28.96  ? 131 TRP B CE2 1 
ATOM   2549 C CE3 . TRP B 2 156 ? 56.666 -3.946  34.412 1.00 28.96  ? 131 TRP B CE3 1 
ATOM   2550 C CZ2 . TRP B 2 156 ? 54.076 -5.113  34.346 1.00 28.96  ? 131 TRP B CZ2 1 
ATOM   2551 C CZ3 . TRP B 2 156 ? 56.244 -4.832  35.398 1.00 28.96  ? 131 TRP B CZ3 1 
ATOM   2552 C CH2 . TRP B 2 156 ? 54.958 -5.405  35.357 1.00 28.96  ? 131 TRP B CH2 1 
ATOM   2553 N N   . PHE B 2 157 ? 59.403 -1.132  33.704 1.00 40.33  ? 132 PHE B N   1 
ATOM   2554 C CA  . PHE B 2 157 ? 60.843 -0.957  33.915 1.00 40.33  ? 132 PHE B CA  1 
ATOM   2555 C C   . PHE B 2 157 ? 61.536 -2.256  34.285 1.00 40.33  ? 132 PHE B C   1 
ATOM   2556 O O   . PHE B 2 157 ? 61.027 -3.027  35.091 1.00 40.33  ? 132 PHE B O   1 
ATOM   2557 C CB  . PHE B 2 157 ? 61.133 0.026   35.052 1.00 41.35  ? 132 PHE B CB  1 
ATOM   2558 C CG  . PHE B 2 157 ? 61.053 1.464   34.662 1.00 41.35  ? 132 PHE B CG  1 
ATOM   2559 C CD1 . PHE B 2 157 ? 59.827 2.111   34.578 1.00 41.35  ? 132 PHE B CD1 1 
ATOM   2560 C CD2 . PHE B 2 157 ? 62.212 2.189   34.419 1.00 41.35  ? 132 PHE B CD2 1 
ATOM   2561 C CE1 . PHE B 2 157 ? 59.760 3.463   34.264 1.00 41.35  ? 132 PHE B CE1 1 
ATOM   2562 C CE2 . PHE B 2 157 ? 62.157 3.541   34.104 1.00 41.35  ? 132 PHE B CE2 1 
ATOM   2563 C CZ  . PHE B 2 157 ? 60.929 4.180   34.027 1.00 41.35  ? 132 PHE B CZ  1 
ATOM   2564 N N   . ARG B 2 158 ? 62.707 -2.485  33.701 1.00 34.86  ? 133 ARG B N   1 
ATOM   2565 C CA  . ARG B 2 158 ? 63.499 -3.666  34.016 1.00 34.86  ? 133 ARG B CA  1 
ATOM   2566 C C   . ARG B 2 158 ? 64.812 -3.122  34.591 1.00 34.86  ? 133 ARG B C   1 
ATOM   2567 O O   . ARG B 2 158 ? 65.518 -2.358  33.931 1.00 34.86  ? 133 ARG B O   1 
ATOM   2568 C CB  . ARG B 2 158 ? 63.763 -4.500  32.764 1.00 57.99  ? 133 ARG B CB  1 
ATOM   2569 C CG  . ARG B 2 158 ? 64.314 -5.880  33.074 1.00 57.99  ? 133 ARG B CG  1 
ATOM   2570 C CD  . ARG B 2 158 ? 64.601 -6.662  31.812 1.00 57.99  ? 133 ARG B CD  1 
ATOM   2571 N NE  . ARG B 2 158 ? 65.992 -6.552  31.382 1.00 57.99  ? 133 ARG B NE  1 
ATOM   2572 C CZ  . ARG B 2 158 ? 66.625 -5.409  31.127 1.00 57.99  ? 133 ARG B CZ  1 
ATOM   2573 N NH1 . ARG B 2 158 ? 66.006 -4.243  31.259 1.00 57.99  ? 133 ARG B NH1 1 
ATOM   2574 N NH2 . ARG B 2 158 ? 67.886 -5.432  30.720 1.00 57.99  ? 133 ARG B NH2 1 
ATOM   2575 N N   . ASN B 2 159 ? 65.106 -3.493  35.836 1.00 44.61  ? 134 ASN B N   1 
ATOM   2576 C CA  . ASN B 2 159 ? 66.308 -3.037  36.534 1.00 44.61  ? 134 ASN B CA  1 
ATOM   2577 C C   . ASN B 2 159 ? 66.509 -1.524  36.414 1.00 44.61  ? 134 ASN B C   1 
ATOM   2578 O O   . ASN B 2 159 ? 67.567 -1.049  35.997 1.00 44.61  ? 134 ASN B O   1 
ATOM   2579 C CB  . ASN B 2 159 ? 67.545 -3.773  36.010 1.00 43.27  ? 134 ASN B CB  1 
ATOM   2580 C CG  . ASN B 2 159 ? 67.500 -5.261  36.294 1.00 43.27  ? 134 ASN B CG  1 
ATOM   2581 O OD1 . ASN B 2 159 ? 67.240 -5.684  37.424 1.00 43.27  ? 134 ASN B OD1 1 
ATOM   2582 N ND2 . ASN B 2 159 ? 67.759 -6.067  35.270 1.00 43.27  ? 134 ASN B ND2 1 
ATOM   2583 N N   . GLY B 2 160 ? 65.481 -0.768  36.779 1.00 45.58  ? 135 GLY B N   1 
ATOM   2584 C CA  . GLY B 2 160 ? 65.571 0.679   36.714 1.00 45.58  ? 135 GLY B CA  1 
ATOM   2585 C C   . GLY B 2 160 ? 65.569 1.231   35.300 1.00 45.58  ? 135 GLY B C   1 
ATOM   2586 O O   . GLY B 2 160 ? 65.460 2.444   35.107 1.00 45.58  ? 135 GLY B O   1 
ATOM   2587 N N   . GLN B 2 161 ? 65.686 0.351   34.311 1.00 56.34  ? 136 GLN B N   1 
ATOM   2588 C CA  . GLN B 2 161 ? 65.701 0.781   32.919 1.00 56.34  ? 136 GLN B CA  1 
ATOM   2589 C C   . GLN B 2 161 ? 64.320 0.609   32.298 1.00 56.34  ? 136 GLN B C   1 
ATOM   2590 O O   . GLN B 2 161 ? 63.671 -0.423  32.477 1.00 56.34  ? 136 GLN B O   1 
ATOM   2591 C CB  . GLN B 2 161 ? 66.737 -0.020  32.121 1.00 68.49  ? 136 GLN B CB  1 
ATOM   2592 C CG  . GLN B 2 161 ? 66.930 0.476   30.694 1.00 68.49  ? 136 GLN B CG  1 
ATOM   2593 C CD  . GLN B 2 161 ? 67.971 -0.322  29.931 1.00 68.49  ? 136 GLN B CD  1 
ATOM   2594 O OE1 . GLN B 2 161 ? 67.797 -1.518  29.697 1.00 68.49  ? 136 GLN B OE1 1 
ATOM   2595 N NE2 . GLN B 2 161 ? 69.060 0.337   29.542 1.00 68.49  ? 136 GLN B NE2 1 
ATOM   2596 N N   . GLU B 2 162 ? 63.884 1.623   31.556 1.00 55.32  ? 137 GLU B N   1 
ATOM   2597 C CA  . GLU B 2 162 ? 62.573 1.596   30.925 1.00 55.32  ? 137 GLU B CA  1 
ATOM   2598 C C   . GLU B 2 162 ? 62.479 0.600   29.778 1.00 55.32  ? 137 GLU B C   1 
ATOM   2599 O O   . GLU B 2 162 ? 63.402 0.460   28.975 1.00 55.32  ? 137 GLU B O   1 
ATOM   2600 C CB  . GLU B 2 162 ? 62.205 2.991   30.423 1.00 65.94  ? 137 GLU B CB  1 
ATOM   2601 C CG  . GLU B 2 162 ? 60.780 3.102   29.915 1.00 65.94  ? 137 GLU B CG  1 
ATOM   2602 C CD  . GLU B 2 162 ? 60.460 4.489   29.400 1.00 65.94  ? 137 GLU B CD  1 
ATOM   2603 O OE1 . GLU B 2 162 ? 61.097 4.915   28.409 1.00 65.94  ? 137 GLU B OE1 1 
ATOM   2604 O OE2 . GLU B 2 162 ? 59.579 5.155   29.989 1.00 65.94  ? 137 GLU B OE2 1 
ATOM   2605 N N   . GLU B 2 163 ? 61.348 -0.090  29.712 1.00 42.32  ? 138 GLU B N   1 
ATOM   2606 C CA  . GLU B 2 163 ? 61.114 -1.075  28.670 1.00 42.32  ? 138 GLU B CA  1 
ATOM   2607 C C   . GLU B 2 163 ? 60.621 -0.412  27.394 1.00 42.32  ? 138 GLU B C   1 
ATOM   2608 O O   . GLU B 2 163 ? 59.556 0.199   27.369 1.00 42.32  ? 138 GLU B O   1 
ATOM   2609 C CB  . GLU B 2 163 ? 60.112 -2.117  29.162 1.00 35.67  ? 138 GLU B CB  1 
ATOM   2610 C CG  . GLU B 2 163 ? 60.743 -3.157  30.071 1.00 35.67  ? 138 GLU B CG  1 
ATOM   2611 C CD  . GLU B 2 163 ? 61.537 -4.206  29.302 1.00 35.67  ? 138 GLU B CD  1 
ATOM   2612 O OE1 . GLU B 2 163 ? 62.105 -3.875  28.236 1.00 35.67  ? 138 GLU B OE1 1 
ATOM   2613 O OE2 . GLU B 2 163 ? 61.602 -5.364  29.772 1.00 35.67  ? 138 GLU B OE2 1 
ATOM   2614 N N   . THR B 2 164 ? 61.411 -0.549  26.335 1.00 50.08  ? 139 THR B N   1 
ATOM   2615 C CA  . THR B 2 164 ? 61.095 0.054   25.046 1.00 50.08  ? 139 THR B CA  1 
ATOM   2616 C C   . THR B 2 164 ? 60.408 -0.875  24.049 1.00 50.08  ? 139 THR B C   1 
ATOM   2617 O O   . THR B 2 164 ? 60.088 -0.452  22.941 1.00 50.08  ? 139 THR B O   1 
ATOM   2618 C CB  . THR B 2 164 ? 62.369 0.613   24.380 1.00 49.34  ? 139 THR B CB  1 
ATOM   2619 O OG1 . THR B 2 164 ? 63.319 -0.446  24.203 1.00 49.34  ? 139 THR B OG1 1 
ATOM   2620 C CG2 . THR B 2 164 ? 62.994 1.699   25.247 1.00 49.34  ? 139 THR B CG2 1 
ATOM   2621 N N   . VAL B 2 165 ? 60.194 -2.134  24.428 1.00 38.85  ? 140 VAL B N   1 
ATOM   2622 C CA  . VAL B 2 165 ? 59.529 -3.100  23.545 1.00 38.85  ? 140 VAL B CA  1 
ATOM   2623 C C   . VAL B 2 165 ? 58.743 -4.161  24.307 1.00 38.85  ? 140 VAL B C   1 
ATOM   2624 O O   . VAL B 2 165 ? 58.950 -4.361  25.502 1.00 38.85  ? 140 VAL B O   1 
ATOM   2625 C CB  . VAL B 2 165 ? 60.534 -3.847  22.646 1.00 56.16  ? 140 VAL B CB  1 
ATOM   2626 C CG1 . VAL B 2 165 ? 61.078 -2.914  21.574 1.00 56.16  ? 140 VAL B CG1 1 
ATOM   2627 C CG2 . VAL B 2 165 ? 61.655 -4.429  23.500 1.00 56.16  ? 140 VAL B CG2 1 
ATOM   2628 N N   . GLY B 2 166 ? 57.853 -4.845  23.592 1.00 35.79  ? 141 GLY B N   1 
ATOM   2629 C CA  . GLY B 2 166 ? 57.047 -5.895  24.188 1.00 35.79  ? 141 GLY B CA  1 
ATOM   2630 C C   . GLY B 2 166 ? 56.038 -5.372  25.189 1.00 35.79  ? 141 GLY B C   1 
ATOM   2631 O O   . GLY B 2 166 ? 55.639 -6.082  26.116 1.00 35.79  ? 141 GLY B O   1 
ATOM   2632 N N   . VAL B 2 167 ? 55.625 -4.125  24.996 1.00 30.40  ? 142 VAL B N   1 
ATOM   2633 C CA  . VAL B 2 167 ? 54.670 -3.485  25.881 1.00 30.40  ? 142 VAL B CA  1 
ATOM   2634 C C   . VAL B 2 167 ? 53.362 -3.211  25.170 1.00 30.40  ? 142 VAL B C   1 
ATOM   2635 O O   . VAL B 2 167 ? 53.321 -2.447  24.204 1.00 30.40  ? 142 VAL B O   1 
ATOM   2636 C CB  . VAL B 2 167 ? 55.203 -2.137  26.393 1.00 29.07  ? 142 VAL B CB  1 
ATOM   2637 C CG1 . VAL B 2 167 ? 54.118 -1.417  27.172 1.00 29.07  ? 142 VAL B CG1 1 
ATOM   2638 C CG2 . VAL B 2 167 ? 56.429 -2.351  27.256 1.00 29.07  ? 142 VAL B CG2 1 
ATOM   2639 N N   . SER B 2 168 ? 52.291 -3.832  25.647 1.00 29.07  ? 143 SER B N   1 
ATOM   2640 C CA  . SER B 2 168 ? 50.977 -3.614  25.063 1.00 29.07  ? 143 SER B CA  1 
ATOM   2641 C C   . SER B 2 168 ? 50.015 -3.164  26.164 1.00 29.07  ? 143 SER B C   1 
ATOM   2642 O O   . SER B 2 168 ? 50.296 -3.314  27.347 1.00 29.07  ? 143 SER B O   1 
ATOM   2643 C CB  . SER B 2 168 ? 50.464 -4.900  24.410 1.00 37.54  ? 143 SER B CB  1 
ATOM   2644 O OG  . SER B 2 168 ? 50.191 -5.890  25.385 1.00 37.54  ? 143 SER B OG  1 
ATOM   2645 N N   . SER B 2 169 ? 48.881 -2.598  25.786 1.00 29.88  ? 144 SER B N   1 
ATOM   2646 C CA  . SER B 2 169 ? 47.927 -2.166  26.795 1.00 29.88  ? 144 SER B CA  1 
ATOM   2647 C C   . SER B 2 169 ? 46.496 -2.194  26.291 1.00 29.88  ? 144 SER B C   1 
ATOM   2648 O O   . SER B 2 169 ? 46.232 -1.963  25.112 1.00 29.88  ? 144 SER B O   1 
ATOM   2649 C CB  . SER B 2 169 ? 48.267 -0.753  27.290 1.00 28.55  ? 144 SER B CB  1 
ATOM   2650 O OG  . SER B 2 169 ? 48.107 0.202   26.261 1.00 28.55  ? 144 SER B OG  1 
ATOM   2651 N N   . THR B 2 170 ? 45.576 -2.497  27.195 1.00 13.57  ? 145 THR B N   1 
ATOM   2652 C CA  . THR B 2 170 ? 44.164 -2.521  26.843 1.00 13.57  ? 145 THR B CA  1 
ATOM   2653 C C   . THR B 2 170 ? 43.733 -1.072  26.664 1.00 13.57  ? 145 THR B C   1 
ATOM   2654 O O   . THR B 2 170 ? 44.456 -0.150  27.028 1.00 13.57  ? 145 THR B O   1 
ATOM   2655 C CB  . THR B 2 170 ? 43.303 -3.102  27.979 1.00 21.18  ? 145 THR B CB  1 
ATOM   2656 O OG1 . THR B 2 170 ? 43.214 -2.137  29.035 1.00 21.18  ? 145 THR B OG1 1 
ATOM   2657 C CG2 . THR B 2 170 ? 43.918 -4.388  28.519 1.00 21.18  ? 145 THR B CG2 1 
ATOM   2658 N N   . GLN B 2 171 ? 42.554 -0.884  26.092 1.00 26.56  ? 146 GLN B N   1 
ATOM   2659 C CA  . GLN B 2 171 ? 41.984 0.448   25.907 1.00 26.56  ? 146 GLN B CA  1 
ATOM   2660 C C   . GLN B 2 171 ? 41.709 0.955   27.328 1.00 26.56  ? 146 GLN B C   1 
ATOM   2661 O O   . GLN B 2 171 ? 41.774 0.180   28.280 1.00 26.56  ? 146 GLN B O   1 
ATOM   2662 C CB  . GLN B 2 171 ? 40.659 0.315   25.157 1.00 42.85  ? 146 GLN B CB  1 
ATOM   2663 C CG  . GLN B 2 171 ? 39.747 -0.741  25.803 1.00 42.85  ? 146 GLN B CG  1 
ATOM   2664 C CD  . GLN B 2 171 ? 38.346 -0.812  25.205 1.00 42.85  ? 146 GLN B CD  1 
ATOM   2665 O OE1 . GLN B 2 171 ? 38.128 -1.401  24.142 1.00 42.85  ? 146 GLN B OE1 1 
ATOM   2666 N NE2 . GLN B 2 171 ? 37.386 -0.200  25.896 1.00 42.85  ? 146 GLN B NE2 1 
ATOM   2667 N N   . LEU B 2 172 ? 41.435 2.243   27.489 1.00 20.50  ? 147 LEU B N   1 
ATOM   2668 C CA  . LEU B 2 172 ? 41.091 2.739   28.817 1.00 20.50  ? 147 LEU B CA  1 
ATOM   2669 C C   . LEU B 2 172 ? 39.729 2.092   29.069 1.00 20.50  ? 147 LEU B C   1 
ATOM   2670 O O   . LEU B 2 172 ? 38.874 2.106   28.188 1.00 20.50  ? 147 LEU B O   1 
ATOM   2671 C CB  . LEU B 2 172 ? 40.929 4.254   28.818 1.00 33.11  ? 147 LEU B CB  1 
ATOM   2672 C CG  . LEU B 2 172 ? 40.615 4.825   30.201 1.00 33.11  ? 147 LEU B CG  1 
ATOM   2673 C CD1 . LEU B 2 172 ? 41.850 4.694   31.085 1.00 33.11  ? 147 LEU B CD1 1 
ATOM   2674 C CD2 . LEU B 2 172 ? 40.193 6.283   30.083 1.00 33.11  ? 147 LEU B CD2 1 
ATOM   2675 N N   . ILE B 2 173 ? 39.521 1.519   30.250 1.00 23.00  ? 148 ILE B N   1 
ATOM   2676 C CA  . ILE B 2 173 ? 38.258 0.851   30.535 1.00 23.00  ? 148 ILE B CA  1 
ATOM   2677 C C   . ILE B 2 173 ? 37.379 1.587   31.534 1.00 23.00  ? 148 ILE B C   1 
ATOM   2678 O O   . ILE B 2 173 ? 37.786 1.835   32.663 1.00 23.00  ? 148 ILE B O   1 
ATOM   2679 C CB  . ILE B 2 173 ? 38.512 -0.574  31.053 1.00 19.47  ? 148 ILE B CB  1 
ATOM   2680 C CG1 . ILE B 2 173 ? 39.418 -1.314  30.061 1.00 19.47  ? 148 ILE B CG1 1 
ATOM   2681 C CG2 . ILE B 2 173 ? 37.181 -1.309  31.257 1.00 19.47  ? 148 ILE B CG2 1 
ATOM   2682 C CD1 . ILE B 2 173 ? 39.700 -2.753  30.424 1.00 19.47  ? 148 ILE B CD1 1 
ATOM   2683 N N   . ARG B 2 174 ? 36.167 1.928   31.107 1.00 26.10  ? 149 ARG B N   1 
ATOM   2684 C CA  . ARG B 2 174 ? 35.208 2.633   31.955 1.00 26.10  ? 149 ARG B CA  1 
ATOM   2685 C C   . ARG B 2 174 ? 34.360 1.600   32.704 1.00 26.10  ? 149 ARG B C   1 
ATOM   2686 O O   . ARG B 2 174 ? 33.622 0.832   32.084 1.00 26.10  ? 149 ARG B O   1 
ATOM   2687 C CB  . ARG B 2 174 ? 34.317 3.521   31.081 1.00 26.18  ? 149 ARG B CB  1 
ATOM   2688 C CG  . ARG B 2 174 ? 33.321 4.403   31.816 1.00 26.18  ? 149 ARG B CG  1 
ATOM   2689 C CD  . ARG B 2 174 ? 32.476 5.225   30.828 1.00 26.18  ? 149 ARG B CD  1 
ATOM   2690 N NE  . ARG B 2 174 ? 33.285 6.183   30.085 1.00 26.18  ? 149 ARG B NE  1 
ATOM   2691 C CZ  . ARG B 2 174 ? 33.651 7.380   30.540 1.00 26.18  ? 149 ARG B CZ  1 
ATOM   2692 N NH1 . ARG B 2 174 ? 33.265 7.789   31.749 1.00 26.18  ? 149 ARG B NH1 1 
ATOM   2693 N NH2 . ARG B 2 174 ? 34.437 8.159   29.795 1.00 26.18  ? 149 ARG B NH2 1 
ATOM   2694 N N   . ASN B 2 175 ? 34.472 1.574   34.031 1.00 16.88  ? 150 ASN B N   1 
ATOM   2695 C CA  . ASN B 2 175 ? 33.711 0.615   34.836 1.00 16.88  ? 150 ASN B CA  1 
ATOM   2696 C C   . ASN B 2 175 ? 32.231 0.991   34.974 1.00 16.88  ? 150 ASN B C   1 
ATOM   2697 O O   . ASN B 2 175 ? 31.415 0.190   35.433 1.00 16.88  ? 150 ASN B O   1 
ATOM   2698 C CB  . ASN B 2 175 ? 34.310 0.484   36.241 1.00 19.45  ? 150 ASN B CB  1 
ATOM   2699 C CG  . ASN B 2 175 ? 35.754 0.023   36.233 1.00 19.45  ? 150 ASN B CG  1 
ATOM   2700 O OD1 . ASN B 2 175 ? 36.152 -0.845  35.451 1.00 19.45  ? 150 ASN B OD1 1 
ATOM   2701 N ND2 . ASN B 2 175 ? 36.547 0.590   37.135 1.00 19.45  ? 150 ASN B ND2 1 
ATOM   2702 N N   . GLY B 2 176 ? 31.895 2.212   34.582 1.00 24.28  ? 151 GLY B N   1 
ATOM   2703 C CA  . GLY B 2 176 ? 30.526 2.668   34.683 1.00 24.28  ? 151 GLY B CA  1 
ATOM   2704 C C   . GLY B 2 176 ? 30.164 3.133   36.081 1.00 24.28  ? 151 GLY B C   1 
ATOM   2705 O O   . GLY B 2 176 ? 29.045 3.599   36.303 1.00 24.28  ? 151 GLY B O   1 
ATOM   2706 N N   . ASP B 2 177 ? 31.099 3.012   37.024 1.00 27.42  ? 152 ASP B N   1 
ATOM   2707 C CA  . ASP B 2 177 ? 30.849 3.421   38.408 1.00 27.42  ? 152 ASP B CA  1 
ATOM   2708 C C   . ASP B 2 177 ? 31.765 4.574   38.830 1.00 27.42  ? 152 ASP B C   1 
ATOM   2709 O O   . ASP B 2 177 ? 32.122 4.708   40.001 1.00 27.42  ? 152 ASP B O   1 
ATOM   2710 C CB  . ASP B 2 177 ? 31.059 2.232   39.345 1.00 23.26  ? 152 ASP B CB  1 
ATOM   2711 C CG  . ASP B 2 177 ? 32.521 1.827   39.451 1.00 23.26  ? 152 ASP B CG  1 
ATOM   2712 O OD1 . ASP B 2 177 ? 33.343 2.339   38.658 1.00 23.26  ? 152 ASP B OD1 1 
ATOM   2713 O OD2 . ASP B 2 177 ? 32.850 0.995   40.322 1.00 23.26  ? 152 ASP B OD2 1 
ATOM   2714 N N   . TRP B 2 178 ? 32.146 5.395   37.859 1.00 22.26  ? 153 TRP B N   1 
ATOM   2715 C CA  . TRP B 2 178 ? 33.013 6.541   38.091 1.00 22.26  ? 153 TRP B CA  1 
ATOM   2716 C C   . TRP B 2 178 ? 34.468 6.212   38.433 1.00 22.26  ? 153 TRP B C   1 
ATOM   2717 O O   . TRP B 2 178 ? 35.132 6.970   39.135 1.00 22.26  ? 153 TRP B O   1 
ATOM   2718 C CB  . TRP B 2 178 ? 32.421 7.471   39.156 1.00 22.75  ? 153 TRP B CB  1 
ATOM   2719 C CG  . TRP B 2 178 ? 31.233 8.274   38.669 1.00 22.75  ? 153 TRP B CG  1 
ATOM   2720 C CD1 . TRP B 2 178 ? 29.952 7.825   38.498 1.00 22.75  ? 153 TRP B CD1 1 
ATOM   2721 C CD2 . TRP B 2 178 ? 31.230 9.648   38.255 1.00 22.75  ? 153 TRP B CD2 1 
ATOM   2722 N NE1 . TRP B 2 178 ? 29.154 8.830   38.004 1.00 22.75  ? 153 TRP B NE1 1 
ATOM   2723 C CE2 . TRP B 2 178 ? 29.910 9.961   37.846 1.00 22.75  ? 153 TRP B CE2 1 
ATOM   2724 C CE3 . TRP B 2 178 ? 32.212 10.646  38.186 1.00 22.75  ? 153 TRP B CE3 1 
ATOM   2725 C CZ2 . TRP B 2 178 ? 29.548 11.236  37.376 1.00 22.75  ? 153 TRP B CZ2 1 
ATOM   2726 C CZ3 . TRP B 2 178 ? 31.856 11.905  37.720 1.00 22.75  ? 153 TRP B CZ3 1 
ATOM   2727 C CH2 . TRP B 2 178 ? 30.530 12.190  37.321 1.00 22.75  ? 153 TRP B CH2 1 
ATOM   2728 N N   . THR B 2 179 ? 34.949 5.076   37.939 1.00 20.61  ? 154 THR B N   1 
ATOM   2729 C CA  . THR B 2 179 ? 36.342 4.682   38.119 1.00 20.61  ? 154 THR B CA  1 
ATOM   2730 C C   . THR B 2 179 ? 36.757 4.019   36.819 1.00 20.61  ? 154 THR B C   1 
ATOM   2731 O O   . THR B 2 179 ? 35.930 3.455   36.108 1.00 20.61  ? 154 THR B O   1 
ATOM   2732 C CB  . THR B 2 179 ? 36.574 3.671   39.280 1.00 16.77  ? 154 THR B CB  1 
ATOM   2733 O OG1 . THR B 2 179 ? 35.949 2.418   38.973 1.00 16.77  ? 154 THR B OG1 1 
ATOM   2734 C CG2 . THR B 2 179 ? 36.058 4.228   40.588 1.00 16.77  ? 154 THR B CG2 1 
ATOM   2735 N N   . PHE B 2 180 ? 38.040 4.100   36.507 1.00 25.63  ? 155 PHE B N   1 
ATOM   2736 C CA  . PHE B 2 180 ? 38.570 3.522   35.285 1.00 25.63  ? 155 PHE B CA  1 
ATOM   2737 C C   . PHE B 2 180 ? 39.614 2.472   35.617 1.00 25.63  ? 155 PHE B C   1 
ATOM   2738 O O   . PHE B 2 180 ? 40.114 2.421   36.745 1.00 25.63  ? 155 PHE B O   1 
ATOM   2739 C CB  . PHE B 2 180 ? 39.247 4.606   34.452 1.00 16.75  ? 155 PHE B CB  1 
ATOM   2740 C CG  . PHE B 2 180 ? 38.301 5.574   33.809 1.00 16.75  ? 155 PHE B CG  1 
ATOM   2741 C CD1 . PHE B 2 180 ? 37.572 5.210   32.685 1.00 16.75  ? 155 PHE B CD1 1 
ATOM   2742 C CD2 . PHE B 2 180 ? 38.195 6.878   34.286 1.00 16.75  ? 155 PHE B CD2 1 
ATOM   2743 C CE1 . PHE B 2 180 ? 36.753 6.143   32.040 1.00 16.75  ? 155 PHE B CE1 1 
ATOM   2744 C CE2 . PHE B 2 180 ? 37.380 7.812   33.649 1.00 16.75  ? 155 PHE B CE2 1 
ATOM   2745 C CZ  . PHE B 2 180 ? 36.662 7.448   32.528 1.00 16.75  ? 155 PHE B CZ  1 
ATOM   2746 N N   . GLN B 2 181 ? 39.939 1.639   34.633 1.00 25.48  ? 156 GLN B N   1 
ATOM   2747 C CA  . GLN B 2 181 ? 40.971 0.632   34.806 1.00 25.48  ? 156 GLN B CA  1 
ATOM   2748 C C   . GLN B 2 181 ? 41.685 0.432   33.480 1.00 25.48  ? 156 GLN B C   1 
ATOM   2749 O O   . GLN B 2 181 ? 41.135 0.738   32.416 1.00 25.48  ? 156 GLN B O   1 
ATOM   2750 C CB  . GLN B 2 181 ? 40.398 -0.706  35.322 1.00 20.02  ? 156 GLN B CB  1 
ATOM   2751 C CG  . GLN B 2 181 ? 39.590 -1.546  34.345 1.00 20.02  ? 156 GLN B CG  1 
ATOM   2752 C CD  . GLN B 2 181 ? 39.221 -2.901  34.950 1.00 20.02  ? 156 GLN B CD  1 
ATOM   2753 O OE1 . GLN B 2 181 ? 40.091 -3.716  35.232 1.00 20.02  ? 156 GLN B OE1 1 
ATOM   2754 N NE2 . GLN B 2 181 ? 37.931 -3.132  35.167 1.00 20.02  ? 156 GLN B NE2 1 
ATOM   2755 N N   . VAL B 2 182 ? 42.920 -0.060  33.552 1.00 16.84  ? 157 VAL B N   1 
ATOM   2756 C CA  . VAL B 2 182 ? 43.716 -0.311  32.362 1.00 16.84  ? 157 VAL B CA  1 
ATOM   2757 C C   . VAL B 2 182 ? 44.760 -1.353  32.706 1.00 16.84  ? 157 VAL B C   1 
ATOM   2758 O O   . VAL B 2 182 ? 45.366 -1.292  33.773 1.00 16.84  ? 157 VAL B O   1 
ATOM   2759 C CB  . VAL B 2 182 ? 44.429 0.972   31.872 1.00 18.86  ? 157 VAL B CB  1 
ATOM   2760 C CG1 . VAL B 2 182 ? 45.513 1.396   32.872 1.00 18.86  ? 157 VAL B CG1 1 
ATOM   2761 C CG2 . VAL B 2 182 ? 45.017 0.735   30.491 1.00 18.86  ? 157 VAL B CG2 1 
ATOM   2762 N N   . LEU B 2 183 ? 44.956 -2.316  31.815 1.00 22.92  ? 158 LEU B N   1 
ATOM   2763 C CA  . LEU B 2 183 ? 45.926 -3.367  32.057 1.00 22.92  ? 158 LEU B CA  1 
ATOM   2764 C C   . LEU B 2 183 ? 47.085 -3.172  31.095 1.00 22.92  ? 158 LEU B C   1 
ATOM   2765 O O   . LEU B 2 183 ? 46.889 -3.094  29.876 1.00 22.92  ? 158 LEU B O   1 
ATOM   2766 C CB  . LEU B 2 183 ? 45.289 -4.737  31.829 1.00 26.20  ? 158 LEU B CB  1 
ATOM   2767 C CG  . LEU B 2 183 ? 43.876 -4.918  32.382 1.00 26.20  ? 158 LEU B CG  1 
ATOM   2768 C CD1 . LEU B 2 183 ? 43.434 -6.349  32.174 1.00 26.20  ? 158 LEU B CD1 1 
ATOM   2769 C CD2 . LEU B 2 183 ? 43.837 -4.560  33.860 1.00 26.20  ? 158 LEU B CD2 1 
ATOM   2770 N N   . VAL B 2 184 ? 48.291 -3.082  31.640 1.00 21.70  ? 159 VAL B N   1 
ATOM   2771 C CA  . VAL B 2 184 ? 49.463 -2.895  30.809 1.00 21.70  ? 159 VAL B CA  1 
ATOM   2772 C C   . VAL B 2 184 ? 50.321 -4.143  30.872 1.00 21.70  ? 159 VAL B C   1 
ATOM   2773 O O   . VAL B 2 184 ? 50.823 -4.512  31.943 1.00 21.70  ? 159 VAL B O   1 
ATOM   2774 C CB  . VAL B 2 184 ? 50.279 -1.671  31.264 1.00 24.56  ? 159 VAL B CB  1 
ATOM   2775 C CG1 . VAL B 2 184 ? 51.417 -1.418  30.285 1.00 24.56  ? 159 VAL B CG1 1 
ATOM   2776 C CG2 . VAL B 2 184 ? 49.366 -0.435  31.349 1.00 24.56  ? 159 VAL B CG2 1 
ATOM   2777 N N   . MET B 2 185 ? 50.460 -4.791  29.714 1.00 40.21  ? 160 MET B N   1 
ATOM   2778 C CA  . MET B 2 185 ? 51.219 -6.031  29.551 1.00 40.21  ? 160 MET B CA  1 
ATOM   2779 C C   . MET B 2 185 ? 52.688 -5.832  29.175 1.00 40.21  ? 160 MET B C   1 
ATOM   2780 O O   . MET B 2 185 ? 53.071 -4.809  28.604 1.00 40.21  ? 160 MET B O   1 
ATOM   2781 C CB  . MET B 2 185 ? 50.573 -6.907  28.465 1.00 43.52  ? 160 MET B CB  1 
ATOM   2782 C CG  . MET B 2 185 ? 49.294 -7.641  28.852 1.00 43.52  ? 160 MET B CG  1 
ATOM   2783 S SD  . MET B 2 185 ? 47.844 -6.605  29.089 1.00 43.52  ? 160 MET B SD  1 
ATOM   2784 C CE  . MET B 2 185 ? 47.381 -6.264  27.390 1.00 43.52  ? 160 MET B CE  1 
ATOM   2785 N N   . LEU B 2 186 ? 53.504 -6.833  29.488 1.00 31.25  ? 161 LEU B N   1 
ATOM   2786 C CA  . LEU B 2 186 ? 54.922 -6.807  29.154 1.00 31.25  ? 161 LEU B CA  1 
ATOM   2787 C C   . LEU B 2 186 ? 55.415 -8.207  28.811 1.00 31.25  ? 161 LEU B C   1 
ATOM   2788 O O   . LEU B 2 186 ? 55.399 -9.101  29.660 1.00 31.25  ? 161 LEU B O   1 
ATOM   2789 C CB  . LEU B 2 186 ? 55.751 -6.272  30.320 1.00 31.18  ? 161 LEU B CB  1 
ATOM   2790 C CG  . LEU B 2 186 ? 57.265 -6.306  30.068 1.00 31.18  ? 161 LEU B CG  1 
ATOM   2791 C CD1 . LEU B 2 186 ? 57.630 -5.322  28.952 1.00 31.18  ? 161 LEU B CD1 1 
ATOM   2792 C CD2 . LEU B 2 186 ? 58.002 -5.948  31.339 1.00 31.18  ? 161 LEU B CD2 1 
ATOM   2793 N N   . GLU B 2 187 ? 55.836 -8.407  27.567 1.00 46.99  ? 162 GLU B N   1 
ATOM   2794 C CA  . GLU B 2 187 ? 56.367 -9.707  27.160 1.00 46.99  ? 162 GLU B CA  1 
ATOM   2795 C C   . GLU B 2 187 ? 57.802 -9.790  27.688 1.00 46.99  ? 162 GLU B C   1 
ATOM   2796 O O   . GLU B 2 187 ? 58.578 -8.845  27.534 1.00 46.99  ? 162 GLU B O   1 
ATOM   2797 C CB  . GLU B 2 187 ? 56.367 -9.851  25.632 1.00 71.74  ? 162 GLU B CB  1 
ATOM   2798 C CG  . GLU B 2 187 ? 54.985 -9.845  24.991 1.00 71.74  ? 162 GLU B CG  1 
ATOM   2799 C CD  . GLU B 2 187 ? 55.021 -10.133 23.491 1.00 71.74  ? 162 GLU B CD  1 
ATOM   2800 O OE1 . GLU B 2 187 ? 55.731 -9.414  22.751 1.00 71.74  ? 162 GLU B OE1 1 
ATOM   2801 O OE2 . GLU B 2 187 ? 54.331 -11.078 23.048 1.00 71.74  ? 162 GLU B OE2 1 
ATOM   2802 N N   . MET B 2 188 ? 58.150 -10.908 28.321 1.00 52.30  ? 163 MET B N   1 
ATOM   2803 C CA  . MET B 2 188 ? 59.495 -11.077 28.864 1.00 52.30  ? 163 MET B CA  1 
ATOM   2804 C C   . MET B 2 188 ? 59.869 -12.518 29.226 1.00 52.30  ? 163 MET B C   1 
ATOM   2805 O O   . MET B 2 188 ? 59.043 -13.435 29.163 1.00 52.30  ? 163 MET B O   1 
ATOM   2806 C CB  . MET B 2 188 ? 59.680 -10.174 30.094 1.00 63.55  ? 163 MET B CB  1 
ATOM   2807 C CG  . MET B 2 188 ? 58.679 -10.386 31.238 1.00 63.55  ? 163 MET B CG  1 
ATOM   2808 S SD  . MET B 2 188 ? 58.921 -11.869 32.277 1.00 63.55  ? 163 MET B SD  1 
ATOM   2809 C CE  . MET B 2 188 ? 57.562 -12.887 31.735 1.00 63.55  ? 163 MET B CE  1 
ATOM   2810 N N   . THR B 2 189 ? 61.138 -12.702 29.581 1.00 75.66  ? 164 THR B N   1 
ATOM   2811 C CA  . THR B 2 189 ? 61.663 -14.000 29.992 1.00 75.66  ? 164 THR B CA  1 
ATOM   2812 C C   . THR B 2 189 ? 62.196 -13.796 31.407 1.00 75.66  ? 164 THR B C   1 
ATOM   2813 O O   . THR B 2 189 ? 63.210 -13.127 31.608 1.00 75.66  ? 164 THR B O   1 
ATOM   2814 C CB  . THR B 2 189 ? 62.817 -14.482 29.070 1.00 57.12  ? 164 THR B CB  1 
ATOM   2815 O OG1 . THR B 2 189 ? 63.830 -13.468 28.992 1.00 57.12  ? 164 THR B OG1 1 
ATOM   2816 C CG2 . THR B 2 189 ? 62.299 -14.788 27.668 1.00 57.12  ? 164 THR B CG2 1 
ATOM   2817 N N   . PRO B 2 190 ? 61.502 -14.357 32.411 1.00 99.77  ? 165 PRO B N   1 
ATOM   2818 C CA  . PRO B 2 190 ? 61.899 -14.235 33.820 1.00 99.77  ? 165 PRO B CA  1 
ATOM   2819 C C   . PRO B 2 190 ? 63.299 -14.746 34.167 1.00 99.77  ? 165 PRO B C   1 
ATOM   2820 O O   . PRO B 2 190 ? 63.451 -15.740 34.875 1.00 99.77  ? 165 PRO B O   1 
ATOM   2821 C CB  . PRO B 2 190 ? 60.790 -14.992 34.558 1.00 81.76  ? 165 PRO B CB  1 
ATOM   2822 C CG  . PRO B 2 190 ? 60.323 -16.001 33.541 1.00 81.76  ? 165 PRO B CG  1 
ATOM   2823 C CD  . PRO B 2 190 ? 60.290 -15.186 32.276 1.00 81.76  ? 165 PRO B CD  1 
ATOM   2824 N N   . HIS B 2 191 ? 64.319 -14.056 33.671 1.00 59.01  ? 166 HIS B N   1 
ATOM   2825 C CA  . HIS B 2 191 ? 65.696 -14.440 33.948 1.00 59.01  ? 166 HIS B CA  1 
ATOM   2826 C C   . HIS B 2 191 ? 66.004 -14.115 35.411 1.00 59.01  ? 166 HIS B C   1 
ATOM   2827 O O   . HIS B 2 191 ? 65.814 -12.986 35.861 1.00 59.01  ? 166 HIS B O   1 
ATOM   2828 C CB  . HIS B 2 191 ? 66.658 -13.685 33.022 1.00 62.70  ? 166 HIS B CB  1 
ATOM   2829 N N   . GLN B 2 192 ? 66.471 -15.122 36.141 1.00 81.89  ? 167 GLN B N   1 
ATOM   2830 C CA  . GLN B 2 192 ? 66.810 -15.005 37.561 1.00 81.89  ? 167 GLN B CA  1 
ATOM   2831 C C   . GLN B 2 192 ? 67.447 -13.684 37.989 1.00 81.89  ? 167 GLN B C   1 
ATOM   2832 O O   . GLN B 2 192 ? 68.325 -13.152 37.309 1.00 81.89  ? 167 GLN B O   1 
ATOM   2833 C CB  . GLN B 2 192 ? 67.738 -16.155 37.952 1.00 117.44 ? 167 GLN B CB  1 
ATOM   2834 C CG  . GLN B 2 192 ? 69.005 -16.230 37.111 1.00 117.44 ? 167 GLN B CG  1 
ATOM   2835 C CD  . GLN B 2 192 ? 69.802 -17.496 37.365 1.00 117.44 ? 167 GLN B CD  1 
ATOM   2836 O OE1 . GLN B 2 192 ? 69.312 -18.606 37.148 1.00 117.44 ? 167 GLN B OE1 1 
ATOM   2837 N NE2 . GLN B 2 192 ? 71.037 -17.336 37.826 1.00 117.44 ? 167 GLN B NE2 1 
ATOM   2838 N N   . GLY B 2 193 ? 66.998 -13.168 39.130 1.00 66.46  ? 168 GLY B N   1 
ATOM   2839 C CA  . GLY B 2 193 ? 67.536 -11.927 39.656 1.00 66.46  ? 168 GLY B CA  1 
ATOM   2840 C C   . GLY B 2 193 ? 67.000 -10.639 39.049 1.00 66.46  ? 168 GLY B C   1 
ATOM   2841 O O   . GLY B 2 193 ? 67.193 -9.558  39.615 1.00 66.46  ? 168 GLY B O   1 
ATOM   2842 N N   . GLU B 2 194 ? 66.336 -10.731 37.900 1.00 68.59  ? 169 GLU B N   1 
ATOM   2843 C CA  . GLU B 2 194 ? 65.800 -9.535  37.266 1.00 68.59  ? 169 GLU B CA  1 
ATOM   2844 C C   . GLU B 2 194 ? 64.716 -8.897  38.124 1.00 68.59  ? 169 GLU B C   1 
ATOM   2845 O O   . GLU B 2 194 ? 64.008 -9.578  38.868 1.00 68.59  ? 169 GLU B O   1 
ATOM   2846 C CB  . GLU B 2 194 ? 65.245 -9.861  35.881 1.00 60.22  ? 169 GLU B CB  1 
ATOM   2847 C CG  . GLU B 2 194 ? 66.309 -10.102 34.835 1.00 60.22  ? 169 GLU B CG  1 
ATOM   2848 C CD  . GLU B 2 194 ? 65.721 -10.302 33.454 1.00 60.22  ? 169 GLU B CD  1 
ATOM   2849 O OE1 . GLU B 2 194 ? 64.903 -11.232 33.290 1.00 60.22  ? 169 GLU B OE1 1 
ATOM   2850 O OE2 . GLU B 2 194 ? 66.075 -9.530  32.534 1.00 60.22  ? 169 GLU B OE2 1 
ATOM   2851 N N   . VAL B 2 195 ? 64.596 -7.579  38.012 1.00 47.18  ? 170 VAL B N   1 
ATOM   2852 C CA  . VAL B 2 195 ? 63.614 -6.827  38.777 1.00 47.18  ? 170 VAL B CA  1 
ATOM   2853 C C   . VAL B 2 195 ? 62.750 -5.949  37.885 1.00 47.18  ? 170 VAL B C   1 
ATOM   2854 O O   . VAL B 2 195 ? 63.245 -5.006  37.265 1.00 47.18  ? 170 VAL B O   1 
ATOM   2855 C CB  . VAL B 2 195 ? 64.307 -5.924  39.820 1.00 66.73  ? 170 VAL B CB  1 
ATOM   2856 C CG1 . VAL B 2 195 ? 63.293 -4.983  40.455 1.00 66.73  ? 170 VAL B CG1 1 
ATOM   2857 C CG2 . VAL B 2 195 ? 64.982 -6.784  40.882 1.00 66.73  ? 170 VAL B CG2 1 
ATOM   2858 N N   . TYR B 2 196 ? 61.457 -6.261  37.830 1.00 40.31  ? 171 TYR B N   1 
ATOM   2859 C CA  . TYR B 2 196 ? 60.509 -5.488  37.028 1.00 40.31  ? 171 TYR B CA  1 
ATOM   2860 C C   . TYR B 2 196 ? 59.725 -4.507  37.895 1.00 40.31  ? 171 TYR B C   1 
ATOM   2861 O O   . TYR B 2 196 ? 59.410 -4.793  39.052 1.00 40.31  ? 171 TYR B O   1 
ATOM   2862 C CB  . TYR B 2 196 ? 59.551 -6.432  36.312 1.00 46.18  ? 171 TYR B CB  1 
ATOM   2863 C CG  . TYR B 2 196 ? 60.238 -7.276  35.271 1.00 46.18  ? 171 TYR B CG  1 
ATOM   2864 C CD1 . TYR B 2 196 ? 60.568 -6.747  34.024 1.00 46.18  ? 171 TYR B CD1 1 
ATOM   2865 C CD2 . TYR B 2 196 ? 60.585 -8.600  35.540 1.00 46.18  ? 171 TYR B CD2 1 
ATOM   2866 C CE1 . TYR B 2 196 ? 61.223 -7.517  33.066 1.00 46.18  ? 171 TYR B CE1 1 
ATOM   2867 C CE2 . TYR B 2 196 ? 61.246 -9.377  34.588 1.00 46.18  ? 171 TYR B CE2 1 
ATOM   2868 C CZ  . TYR B 2 196 ? 61.559 -8.828  33.355 1.00 46.18  ? 171 TYR B CZ  1 
ATOM   2869 O OH  . TYR B 2 196 ? 62.203 -9.595  32.414 1.00 46.18  ? 171 TYR B OH  1 
ATOM   2870 N N   . THR B 2 197 ? 59.416 -3.345  37.333 1.00 32.58  ? 172 THR B N   1 
ATOM   2871 C CA  . THR B 2 197 ? 58.680 -2.323  38.067 1.00 32.58  ? 172 THR B CA  1 
ATOM   2872 C C   . THR B 2 197 ? 57.606 -1.646  37.236 1.00 32.58  ? 172 THR B C   1 
ATOM   2873 O O   . THR B 2 197 ? 57.852 -1.236  36.102 1.00 32.58  ? 172 THR B O   1 
ATOM   2874 C CB  . THR B 2 197 ? 59.627 -1.230  38.592 1.00 47.79  ? 172 THR B CB  1 
ATOM   2875 O OG1 . THR B 2 197 ? 60.403 -1.753  39.676 1.00 47.79  ? 172 THR B OG1 1 
ATOM   2876 C CG2 . THR B 2 197 ? 58.835 -0.018  39.070 1.00 47.79  ? 172 THR B CG2 1 
ATOM   2877 N N   . CYS B 2 198 ? 56.413 -1.526  37.809 1.00 34.61  ? 173 CYS B N   1 
ATOM   2878 C CA  . CYS B 2 198 ? 55.314 -0.865  37.120 1.00 34.61  ? 173 CYS B CA  1 
ATOM   2879 C C   . CYS B 2 198 ? 55.219 0.543   37.694 1.00 34.61  ? 173 CYS B C   1 
ATOM   2880 O O   . CYS B 2 198 ? 54.947 0.722   38.879 1.00 34.61  ? 173 CYS B O   1 
ATOM   2881 C CB  . CYS B 2 198 ? 54.001 -1.624  37.332 1.00 38.11  ? 173 CYS B CB  1 
ATOM   2882 S SG  . CYS B 2 198 ? 52.615 -0.906  36.389 1.00 38.11  ? 173 CYS B SG  1 
ATOM   2883 N N   . HIS B 2 199 ? 55.461 1.541   36.850 1.00 37.06  ? 174 HIS B N   1 
ATOM   2884 C CA  . HIS B 2 199 ? 55.431 2.939   37.272 1.00 37.06  ? 174 HIS B CA  1 
ATOM   2885 C C   . HIS B 2 199 ? 54.088 3.554   36.908 1.00 37.06  ? 174 HIS B C   1 
ATOM   2886 O O   . HIS B 2 199 ? 53.673 3.506   35.755 1.00 37.06  ? 174 HIS B O   1 
ATOM   2887 C CB  . HIS B 2 199 ? 56.552 3.704   36.570 1.00 64.09  ? 174 HIS B CB  1 
ATOM   2888 C CG  . HIS B 2 199 ? 56.992 4.936   37.294 1.00 64.09  ? 174 HIS B CG  1 
ATOM   2889 N ND1 . HIS B 2 199 ? 57.715 4.890   38.466 1.00 64.09  ? 174 HIS B ND1 1 
ATOM   2890 C CD2 . HIS B 2 199 ? 56.814 6.249   37.012 1.00 64.09  ? 174 HIS B CD2 1 
ATOM   2891 C CE1 . HIS B 2 199 ? 57.964 6.121   38.875 1.00 64.09  ? 174 HIS B CE1 1 
ATOM   2892 N NE2 . HIS B 2 199 ? 57.428 6.965   38.011 1.00 64.09  ? 174 HIS B NE2 1 
ATOM   2893 N N   . VAL B 2 200 ? 53.415 4.151   37.884 1.00 22.76  ? 175 VAL B N   1 
ATOM   2894 C CA  . VAL B 2 200 ? 52.105 4.742   37.643 1.00 22.76  ? 175 VAL B CA  1 
ATOM   2895 C C   . VAL B 2 200 ? 51.996 6.161   38.155 1.00 22.76  ? 175 VAL B C   1 
ATOM   2896 O O   . VAL B 2 200 ? 52.319 6.440   39.304 1.00 22.76  ? 175 VAL B O   1 
ATOM   2897 C CB  . VAL B 2 200 ? 51.008 3.909   38.315 1.00 19.39  ? 175 VAL B CB  1 
ATOM   2898 C CG1 . VAL B 2 200 ? 49.639 4.494   37.993 1.00 19.39  ? 175 VAL B CG1 1 
ATOM   2899 C CG2 . VAL B 2 200 ? 51.107 2.465   37.848 1.00 19.39  ? 175 VAL B CG2 1 
ATOM   2900 N N   . GLU B 2 201 ? 51.533 7.057   37.293 1.00 35.02  ? 176 GLU B N   1 
ATOM   2901 C CA  . GLU B 2 201 ? 51.373 8.462   37.650 1.00 35.02  ? 176 GLU B CA  1 
ATOM   2902 C C   . GLU B 2 201 ? 49.928 8.903   37.424 1.00 35.02  ? 176 GLU B C   1 
ATOM   2903 O O   . GLU B 2 201 ? 49.338 8.621   36.377 1.00 35.02  ? 176 GLU B O   1 
ATOM   2904 C CB  . GLU B 2 201 ? 52.332 9.331   36.825 1.00 71.95  ? 176 GLU B CB  1 
ATOM   2905 C CG  . GLU B 2 201 ? 53.807 9.101   37.147 1.00 71.95  ? 176 GLU B CG  1 
ATOM   2906 C CD  . GLU B 2 201 ? 54.743 9.960   36.308 1.00 71.95  ? 176 GLU B CD  1 
ATOM   2907 O OE1 . GLU B 2 201 ? 54.772 9.791   35.069 1.00 71.95  ? 176 GLU B OE1 1 
ATOM   2908 O OE2 . GLU B 2 201 ? 55.454 10.807  36.890 1.00 71.95  ? 176 GLU B OE2 1 
ATOM   2909 N N   . HIS B 2 202 ? 49.377 9.611   38.406 1.00 27.79  ? 177 HIS B N   1 
ATOM   2910 C CA  . HIS B 2 202 ? 47.993 10.064  38.363 1.00 27.79  ? 177 HIS B CA  1 
ATOM   2911 C C   . HIS B 2 202 ? 47.824 11.280  39.285 1.00 27.79  ? 177 HIS B C   1 
ATOM   2912 O O   . HIS B 2 202 ? 48.406 11.345  40.361 1.00 27.79  ? 177 HIS B O   1 
ATOM   2913 C CB  . HIS B 2 202 ? 47.096 8.898   38.803 1.00 28.03  ? 177 HIS B CB  1 
ATOM   2914 C CG  . HIS B 2 202 ? 45.633 9.141   38.624 1.00 28.03  ? 177 HIS B CG  1 
ATOM   2915 N ND1 . HIS B 2 202 ? 44.836 9.656   39.623 1.00 28.03  ? 177 HIS B ND1 1 
ATOM   2916 C CD2 . HIS B 2 202 ? 44.817 8.922   37.565 1.00 28.03  ? 177 HIS B CD2 1 
ATOM   2917 C CE1 . HIS B 2 202 ? 43.591 9.742   39.187 1.00 28.03  ? 177 HIS B CE1 1 
ATOM   2918 N NE2 . HIS B 2 202 ? 43.552 9.303   37.942 1.00 28.03  ? 177 HIS B NE2 1 
ATOM   2919 N N   . PRO B 2 203 ? 47.009 12.253  38.871 1.00 35.91  ? 178 PRO B N   1 
ATOM   2920 C CA  . PRO B 2 203 ? 46.768 13.472  39.653 1.00 35.91  ? 178 PRO B CA  1 
ATOM   2921 C C   . PRO B 2 203 ? 46.431 13.222  41.115 1.00 35.91  ? 178 PRO B C   1 
ATOM   2922 O O   . PRO B 2 203 ? 46.723 14.045  41.973 1.00 35.91  ? 178 PRO B O   1 
ATOM   2923 C CB  . PRO B 2 203 ? 45.608 14.140  38.917 1.00 20.71  ? 178 PRO B CB  1 
ATOM   2924 C CG  . PRO B 2 203 ? 45.773 13.657  37.514 1.00 20.71  ? 178 PRO B CG  1 
ATOM   2925 C CD  . PRO B 2 203 ? 46.128 12.203  37.694 1.00 20.71  ? 178 PRO B CD  1 
ATOM   2926 N N   . SER B 2 204 ? 45.808 12.089  41.401 1.00 35.98  ? 179 SER B N   1 
ATOM   2927 C CA  . SER B 2 204 ? 45.429 11.764  42.769 1.00 35.98  ? 179 SER B CA  1 
ATOM   2928 C C   . SER B 2 204 ? 46.640 11.415  43.622 1.00 35.98  ? 179 SER B C   1 
ATOM   2929 O O   . SER B 2 204 ? 46.610 11.533  44.845 1.00 35.98  ? 179 SER B O   1 
ATOM   2930 C CB  . SER B 2 204 ? 44.480 10.569  42.776 1.00 40.51  ? 179 SER B CB  1 
ATOM   2931 O OG  . SER B 2 204 ? 45.162 9.398   42.361 1.00 40.51  ? 179 SER B OG  1 
ATOM   2932 N N   . LEU B 2 205 ? 47.702 10.975  42.964 1.00 49.74  ? 180 LEU B N   1 
ATOM   2933 C CA  . LEU B 2 205 ? 48.904 10.556  43.659 1.00 49.74  ? 180 LEU B CA  1 
ATOM   2934 C C   . LEU B 2 205 ? 49.811 11.689  44.092 1.00 49.74  ? 180 LEU B C   1 
ATOM   2935 O O   . LEU B 2 205 ? 50.093 12.613  43.322 1.00 49.74  ? 180 LEU B O   1 
ATOM   2936 C CB  . LEU B 2 205 ? 49.691 9.582   42.783 1.00 38.39  ? 180 LEU B CB  1 
ATOM   2937 C CG  . LEU B 2 205 ? 48.888 8.387   42.268 1.00 38.39  ? 180 LEU B CG  1 
ATOM   2938 C CD1 . LEU B 2 205 ? 49.798 7.459   41.470 1.00 38.39  ? 180 LEU B CD1 1 
ATOM   2939 C CD2 . LEU B 2 205 ? 48.258 7.647   43.451 1.00 38.39  ? 180 LEU B CD2 1 
ATOM   2940 N N   . LYS B 2 206 ? 50.264 11.607  45.337 1.00 51.10  ? 181 LYS B N   1 
ATOM   2941 C CA  . LYS B 2 206 ? 51.172 12.600  45.878 1.00 51.10  ? 181 LYS B CA  1 
ATOM   2942 C C   . LYS B 2 206 ? 52.483 12.352  45.143 1.00 51.10  ? 181 LYS B C   1 
ATOM   2943 O O   . LYS B 2 206 ? 53.126 13.277  44.646 1.00 51.10  ? 181 LYS B O   1 
ATOM   2944 C CB  . LYS B 2 206 ? 51.326 12.389  47.383 1.00 87.24  ? 181 LYS B CB  1 
ATOM   2945 C CG  . LYS B 2 206 ? 49.977 12.286  48.077 1.00 87.24  ? 181 LYS B CG  1 
ATOM   2946 C CD  . LYS B 2 206 ? 50.058 12.426  49.586 1.00 87.24  ? 181 LYS B CD  1 
ATOM   2947 C CE  . LYS B 2 206 ? 48.650 12.497  50.172 1.00 87.24  ? 181 LYS B CE  1 
ATOM   2948 N NZ  . LYS B 2 206 ? 48.636 12.756  51.635 1.00 87.24  ? 181 LYS B NZ  1 
ATOM   2949 N N   . SER B 2 207 ? 52.849 11.079  45.062 1.00 51.56  ? 182 SER B N   1 
ATOM   2950 C CA  . SER B 2 207 ? 54.052 10.646  44.365 1.00 51.56  ? 182 SER B CA  1 
ATOM   2951 C C   . SER B 2 207 ? 53.703 9.410   43.553 1.00 51.56  ? 182 SER B C   1 
ATOM   2952 O O   . SER B 2 207 ? 52.785 8.665   43.897 1.00 51.56  ? 182 SER B O   1 
ATOM   2953 C CB  . SER B 2 207 ? 55.166 10.303  45.353 1.00 67.28  ? 182 SER B CB  1 
ATOM   2954 O OG  . SER B 2 207 ? 55.691 11.472  45.951 1.00 67.28  ? 182 SER B OG  1 
ATOM   2955 N N   . PRO B 2 208 ? 54.438 9.174   42.463 1.00 43.79  ? 183 PRO B N   1 
ATOM   2956 C CA  . PRO B 2 208 ? 54.184 8.009   41.613 1.00 43.79  ? 183 PRO B CA  1 
ATOM   2957 C C   . PRO B 2 208 ? 54.160 6.715   42.419 1.00 43.79  ? 183 PRO B C   1 
ATOM   2958 O O   . PRO B 2 208 ? 54.793 6.620   43.467 1.00 43.79  ? 183 PRO B O   1 
ATOM   2959 C CB  . PRO B 2 208 ? 55.351 8.046   40.629 1.00 36.53  ? 183 PRO B CB  1 
ATOM   2960 C CG  . PRO B 2 208 ? 55.639 9.522   40.511 1.00 36.53  ? 183 PRO B CG  1 
ATOM   2961 C CD  . PRO B 2 208 ? 55.570 9.967   41.950 1.00 36.53  ? 183 PRO B CD  1 
ATOM   2962 N N   . ILE B 2 209 ? 53.415 5.729   41.932 1.00 33.15  ? 184 ILE B N   1 
ATOM   2963 C CA  . ILE B 2 209 ? 53.348 4.430   42.590 1.00 33.15  ? 184 ILE B CA  1 
ATOM   2964 C C   . ILE B 2 209 ? 54.247 3.489   41.810 1.00 33.15  ? 184 ILE B C   1 
ATOM   2965 O O   . ILE B 2 209 ? 54.297 3.541   40.584 1.00 33.15  ? 184 ILE B O   1 
ATOM   2966 C CB  . ILE B 2 209 ? 51.932 3.835   42.580 1.00 26.03  ? 184 ILE B CB  1 
ATOM   2967 C CG1 . ILE B 2 209 ? 51.002 4.673   43.462 1.00 26.03  ? 184 ILE B CG1 1 
ATOM   2968 C CG2 . ILE B 2 209 ? 51.982 2.388   43.055 1.00 26.03  ? 184 ILE B CG2 1 
ATOM   2969 C CD1 . ILE B 2 209 ? 49.586 4.116   43.591 1.00 26.03  ? 184 ILE B CD1 1 
ATOM   2970 N N   . THR B 2 210 ? 54.963 2.634   42.523 1.00 43.87  ? 185 THR B N   1 
ATOM   2971 C CA  . THR B 2 210 ? 55.851 1.679   41.881 1.00 43.87  ? 185 THR B CA  1 
ATOM   2972 C C   . THR B 2 210 ? 55.700 0.330   42.552 1.00 43.87  ? 185 THR B C   1 
ATOM   2973 O O   . THR B 2 210 ? 55.871 0.212   43.764 1.00 43.87  ? 185 THR B O   1 
ATOM   2974 C CB  . THR B 2 210 ? 57.323 2.096   42.015 1.00 52.71  ? 185 THR B CB  1 
ATOM   2975 O OG1 . THR B 2 210 ? 57.736 1.917   43.376 1.00 52.71  ? 185 THR B OG1 1 
ATOM   2976 C CG2 . THR B 2 210 ? 57.511 3.561   41.615 1.00 52.71  ? 185 THR B CG2 1 
ATOM   2977 N N   . VAL B 2 211 ? 55.363 -0.682  41.766 1.00 27.46  ? 186 VAL B N   1 
ATOM   2978 C CA  . VAL B 2 211 ? 55.227 -2.035  42.286 1.00 27.46  ? 186 VAL B CA  1 
ATOM   2979 C C   . VAL B 2 211 ? 56.328 -2.830  41.607 1.00 27.46  ? 186 VAL B C   1 
ATOM   2980 O O   . VAL B 2 211 ? 56.560 -2.659  40.410 1.00 27.46  ? 186 VAL B O   1 
ATOM   2981 C CB  . VAL B 2 211 ? 53.850 -2.649  41.937 1.00 40.68  ? 186 VAL B CB  1 
ATOM   2982 C CG1 . VAL B 2 211 ? 53.754 -4.075  42.475 1.00 40.68  ? 186 VAL B CG1 1 
ATOM   2983 C CG2 . VAL B 2 211 ? 52.744 -1.800  42.534 1.00 40.68  ? 186 VAL B CG2 1 
ATOM   2984 N N   . GLU B 2 212 ? 57.003 -3.690  42.367 1.00 43.22  ? 187 GLU B N   1 
ATOM   2985 C CA  . GLU B 2 212 ? 58.101 -4.489  41.831 1.00 43.22  ? 187 GLU B CA  1 
ATOM   2986 C C   . GLU B 2 212 ? 57.783 -5.970  41.762 1.00 43.22  ? 187 GLU B C   1 
ATOM   2987 O O   . GLU B 2 212 ? 56.954 -6.474  42.518 1.00 43.22  ? 187 GLU B O   1 
ATOM   2988 C CB  . GLU B 2 212 ? 59.358 -4.280  42.674 1.00 54.19  ? 187 GLU B CB  1 
ATOM   2989 C CG  . GLU B 2 212 ? 59.662 -2.819  42.948 1.00 54.19  ? 187 GLU B CG  1 
ATOM   2990 C CD  . GLU B 2 212 ? 61.089 -2.591  43.403 1.00 54.19  ? 187 GLU B CD  1 
ATOM   2991 O OE1 . GLU B 2 212 ? 61.494 -3.176  44.435 1.00 54.19  ? 187 GLU B OE1 1 
ATOM   2992 O OE2 . GLU B 2 212 ? 61.804 -1.823  42.721 1.00 54.19  ? 187 GLU B OE2 1 
ATOM   2993 N N   . TRP B 2 213 ? 58.461 -6.664  40.854 1.00 52.74  ? 188 TRP B N   1 
ATOM   2994 C CA  . TRP B 2 213 ? 58.261 -8.095  40.660 1.00 52.74  ? 188 TRP B CA  1 
ATOM   2995 C C   . TRP B 2 213 ? 59.599 -8.772  40.362 1.00 52.74  ? 188 TRP B C   1 
ATOM   2996 O O   . TRP B 2 213 ? 60.442 -8.206  39.661 1.00 52.74  ? 188 TRP B O   1 
ATOM   2997 C CB  . TRP B 2 213 ? 57.307 -8.321  39.489 1.00 37.49  ? 188 TRP B CB  1 
ATOM   2998 C CG  . TRP B 2 213 ? 56.819 -9.724  39.359 1.00 37.49  ? 188 TRP B CG  1 
ATOM   2999 C CD1 . TRP B 2 213 ? 55.693 -10.256 39.919 1.00 37.49  ? 188 TRP B CD1 1 
ATOM   3000 C CD2 . TRP B 2 213 ? 57.436 -10.779 38.615 1.00 37.49  ? 188 TRP B CD2 1 
ATOM   3001 N NE1 . TRP B 2 213 ? 55.568 -11.578 39.567 1.00 37.49  ? 188 TRP B NE1 1 
ATOM   3002 C CE2 . TRP B 2 213 ? 56.626 -11.925 38.767 1.00 37.49  ? 188 TRP B CE2 1 
ATOM   3003 C CE3 . TRP B 2 213 ? 58.597 -10.867 37.834 1.00 37.49  ? 188 TRP B CE3 1 
ATOM   3004 C CZ2 . TRP B 2 213 ? 56.939 -13.150 38.166 1.00 37.49  ? 188 TRP B CZ2 1 
ATOM   3005 C CZ3 . TRP B 2 213 ? 58.909 -12.084 37.235 1.00 37.49  ? 188 TRP B CZ3 1 
ATOM   3006 C CH2 . TRP B 2 213 ? 58.081 -13.210 37.405 1.00 37.49  ? 188 TRP B CH2 1 
ATOM   3007 N N   . SER B 2 214 ? 59.786 -9.981  40.888 1.00 68.57  ? 189 SER B N   1 
ATOM   3008 C CA  . SER B 2 214 ? 61.023 -10.735 40.674 1.00 68.57  ? 189 SER B CA  1 
ATOM   3009 C C   . SER B 2 214 ? 60.746 -12.185 40.272 1.00 68.57  ? 189 SER B C   1 
ATOM   3010 O O   . SER B 2 214 ? 59.627 -12.661 40.563 1.00 68.57  ? 189 SER B O   1 
ATOM   3011 C CB  . SER B 2 214 ? 61.887 -10.712 41.940 1.00 78.69  ? 189 SER B CB  1 
ATOM   3012 O OG  . SER B 2 214 ? 61.220 -11.321 43.035 1.00 78.69  ? 189 SER B OG  1 
HETATM 3013 O O   . HOH C 3 .   ? 34.288 -4.796  44.705 1.00 18.55  ? 187 HOH A O   1 
HETATM 3014 O O   . HOH C 3 .   ? 17.715 3.218   35.830 1.00 17.11  ? 188 HOH A O   1 
HETATM 3015 O O   . HOH C 3 .   ? 29.626 5.313   32.684 1.00 17.95  ? 189 HOH A O   1 
HETATM 3016 O O   . HOH C 3 .   ? 41.944 -7.275  44.462 1.00 20.91  ? 190 HOH A O   1 
HETATM 3017 O O   . HOH C 3 .   ? 26.703 9.197   23.966 1.00 16.59  ? 191 HOH A O   1 
HETATM 3018 O O   . HOH C 3 .   ? 17.754 9.149   29.567 1.00 18.09  ? 192 HOH A O   1 
HETATM 3019 O O   . HOH C 3 .   ? 31.686 6.064   45.959 1.00 37.09  ? 193 HOH A O   1 
HETATM 3020 O O   . HOH C 3 .   ? 20.878 -6.747  36.035 1.00 25.40  ? 194 HOH A O   1 
HETATM 3021 O O   . HOH C 3 .   ? 39.294 -10.384 44.403 1.00 15.78  ? 195 HOH A O   1 
HETATM 3022 O O   . HOH C 3 .   ? 22.111 14.137  26.319 1.00 17.87  ? 196 HOH A O   1 
HETATM 3023 O O   . HOH C 3 .   ? 21.532 3.748   37.910 1.00 22.70  ? 197 HOH A O   1 
HETATM 3024 O O   . HOH C 3 .   ? 11.104 -10.982 31.929 1.00 25.47  ? 198 HOH A O   1 
HETATM 3025 O O   . HOH C 3 .   ? 21.901 4.417   42.175 1.00 30.95  ? 199 HOH A O   1 
HETATM 3026 O O   . HOH C 3 .   ? 39.391 -6.232  34.472 1.00 35.04  ? 200 HOH A O   1 
HETATM 3027 O O   . HOH C 3 .   ? 17.145 -5.863  33.677 1.00 27.20  ? 201 HOH A O   1 
HETATM 3028 O O   . HOH C 3 .   ? 38.302 -6.500  48.455 1.00 15.55  ? 202 HOH A O   1 
HETATM 3029 O O   . HOH C 3 .   ? 28.523 13.122  29.453 1.00 23.23  ? 203 HOH A O   1 
HETATM 3030 O O   . HOH C 3 .   ? 14.754 20.211  37.505 1.00 24.15  ? 204 HOH A O   1 
HETATM 3031 O O   . HOH C 3 .   ? 30.328 14.729  50.207 1.00 23.66  ? 205 HOH A O   1 
HETATM 3032 O O   . HOH C 3 .   ? 35.625 1.989   43.457 1.00 26.73  ? 206 HOH A O   1 
HETATM 3033 O O   . HOH C 3 .   ? 25.197 -17.265 24.442 1.00 36.23  ? 207 HOH A O   1 
HETATM 3034 O O   . HOH C 3 .   ? 36.402 13.979  34.221 1.00 30.62  ? 208 HOH A O   1 
HETATM 3035 O O   . HOH C 3 .   ? 17.921 -12.088 31.808 1.00 32.97  ? 209 HOH A O   1 
HETATM 3036 O O   . HOH C 3 .   ? 13.956 -6.323  24.205 1.00 28.39  ? 210 HOH A O   1 
HETATM 3037 O O   . HOH C 3 .   ? 14.446 7.877   34.558 1.00 35.26  ? 211 HOH A O   1 
HETATM 3038 O O   . HOH C 3 .   ? 25.422 11.846  18.364 1.00 25.88  ? 212 HOH A O   1 
HETATM 3039 O O   . HOH C 3 .   ? 14.263 13.408  44.638 1.00 28.62  ? 213 HOH A O   1 
HETATM 3040 O O   . HOH C 3 .   ? 34.797 7.012   34.952 1.00 45.25  ? 214 HOH A O   1 
HETATM 3041 O O   . HOH C 3 .   ? 16.516 21.309  39.119 1.00 25.43  ? 215 HOH A O   1 
HETATM 3042 O O   . HOH C 3 .   ? 12.899 -9.917  27.374 1.00 22.54  ? 216 HOH A O   1 
HETATM 3043 O O   . HOH C 3 .   ? 26.738 -19.889 36.063 1.00 25.30  ? 217 HOH A O   1 
HETATM 3044 O O   . HOH C 3 .   ? 23.835 -0.744  15.625 1.00 40.80  ? 218 HOH A O   1 
HETATM 3045 O O   . HOH C 3 .   ? 29.405 6.132   22.075 1.00 34.44  ? 219 HOH A O   1 
HETATM 3046 O O   . HOH C 3 .   ? 12.961 -5.179  14.169 1.00 28.03  ? 220 HOH A O   1 
HETATM 3047 O O   . HOH C 3 .   ? 38.524 -11.815 33.025 1.00 39.18  ? 221 HOH A O   1 
HETATM 3048 O O   . HOH C 3 .   ? 29.158 9.639   23.215 1.00 39.84  ? 222 HOH A O   1 
HETATM 3049 O O   . HOH C 3 .   ? 16.269 -2.917  32.485 1.00 37.88  ? 223 HOH A O   1 
HETATM 3050 O O   . HOH C 3 .   ? 27.179 -10.728 22.479 1.00 34.08  ? 224 HOH A O   1 
HETATM 3051 O O   . HOH C 3 .   ? 23.754 17.286  35.873 1.00 33.70  ? 225 HOH A O   1 
HETATM 3052 O O   . HOH C 3 .   ? 16.039 12.467  46.239 1.00 35.05  ? 226 HOH A O   1 
HETATM 3053 O O   . HOH C 3 .   ? 42.068 -11.063 37.728 1.00 33.21  ? 227 HOH A O   1 
HETATM 3054 O O   . HOH D 3 .   ? 20.827 6.817   22.649 1.00 20.21  ? 221 HOH B O   1 
HETATM 3055 O O   . HOH D 3 .   ? 15.906 22.213  21.688 1.00 19.43  ? 222 HOH B O   1 
HETATM 3056 O O   . HOH D 3 .   ? 34.395 0.415   28.680 1.00 27.97  ? 223 HOH B O   1 
HETATM 3057 O O   . HOH D 3 .   ? 33.140 11.022  34.565 1.00 23.64  ? 224 HOH B O   1 
HETATM 3058 O O   . HOH D 3 .   ? 44.924 -2.862  40.417 1.00 29.48  ? 225 HOH B O   1 
HETATM 3059 O O   . HOH D 3 .   ? 39.024 -0.811  38.275 1.00 28.51  ? 226 HOH B O   1 
HETATM 3060 O O   . HOH D 3 .   ? 40.263 18.097  45.096 1.00 30.13  ? 227 HOH B O   1 
HETATM 3061 O O   . HOH D 3 .   ? 23.103 12.045  14.653 1.00 22.46  ? 228 HOH B O   1 
HETATM 3062 O O   . HOH D 3 .   ? 32.744 5.003   35.351 1.00 24.34  ? 229 HOH B O   1 
HETATM 3063 O O   . HOH D 3 .   ? 23.828 13.005  24.286 1.00 28.10  ? 230 HOH B O   1 
HETATM 3064 O O   . HOH D 3 .   ? 24.978 10.445  22.620 1.00 25.95  ? 231 HOH B O   1 
HETATM 3065 O O   . HOH D 3 .   ? 26.527 15.909  12.013 1.00 33.83  ? 232 HOH B O   1 
HETATM 3066 O O   . HOH D 3 .   ? 38.100 15.381  38.989 1.00 19.75  ? 233 HOH B O   1 
HETATM 3067 O O   . HOH D 3 .   ? 39.338 0.748   45.176 1.00 32.23  ? 234 HOH B O   1 
HETATM 3068 O O   . HOH D 3 .   ? 40.654 -5.943  37.270 1.00 33.30  ? 235 HOH B O   1 
HETATM 3069 O O   . HOH D 3 .   ? 52.762 -7.231  25.394 1.00 33.29  ? 236 HOH B O   1 
HETATM 3070 O O   . HOH D 3 .   ? 23.974 30.961  37.327 1.00 35.29  ? 237 HOH B O   1 
HETATM 3071 O O   . HOH D 3 .   ? 46.860 7.382   50.316 1.00 25.41  ? 238 HOH B O   1 
HETATM 3072 O O   . HOH D 3 .   ? 28.107 16.498  16.324 1.00 30.17  ? 239 HOH B O   1 
HETATM 3073 O O   . HOH D 3 .   ? 51.496 -7.270  42.933 1.00 26.06  ? 240 HOH B O   1 
HETATM 3074 O O   . HOH D 3 .   ? 31.741 30.189  24.736 1.00 30.77  ? 241 HOH B O   1 
HETATM 3075 O O   . HOH D 3 .   ? 37.313 29.436  32.572 1.00 40.52  ? 242 HOH B O   1 
HETATM 3076 O O   . HOH D 3 .   ? 49.984 4.715   29.861 1.00 35.17  ? 243 HOH B O   1 
HETATM 3077 O O   . HOH D 3 .   ? 28.166 5.778   34.873 1.00 33.70  ? 244 HOH B O   1 
HETATM 3078 O O   . HOH D 3 .   ? 16.501 22.882  24.206 1.00 25.35  ? 245 HOH B O   1 
HETATM 3079 O O   . HOH D 3 .   ? 25.546 19.190  36.282 1.00 41.85  ? 246 HOH B O   1 
HETATM 3080 O O   . HOH D 3 .   ? 20.290 11.372  10.908 1.00 24.12  ? 247 HOH B O   1 
HETATM 3081 O O   . HOH D 3 .   ? 16.222 5.180   13.185 1.00 24.51  ? 248 HOH B O   1 
HETATM 3082 O O   . HOH D 3 .   ? 29.329 27.877  20.167 1.00 34.73  ? 249 HOH B O   1 
HETATM 3083 O O   . HOH D 3 .   ? 41.301 13.724  33.003 1.00 30.15  ? 250 HOH B O   1 
HETATM 3084 O O   . HOH D 3 .   ? 25.963 16.004  34.994 1.00 23.81  ? 251 HOH B O   1 
HETATM 3085 O O   . HOH D 3 .   ? 13.635 24.316  39.818 1.00 34.58  ? 252 HOH B O   1 
HETATM 3086 O O   . HOH D 3 .   ? 35.832 10.843  29.963 1.00 28.79  ? 253 HOH B O   1 
HETATM 3087 O O   . HOH D 3 .   ? 30.708 33.466  34.774 1.00 38.27  ? 254 HOH B O   1 
HETATM 3088 O O   . HOH D 3 .   ? 21.192 10.310  13.024 1.00 20.38  ? 255 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   ?   ?   ?   A D n 
A 1 2   ASP 2   1   ?   ?   ?   A C n 
A 1 3   ASP 3   1   1   ASP ASP A B n 
A 1 4   ILE 4   1   1   ILE ILE A A n 
A 1 5   GLU 5   1   1   GLU GLU A . n 
A 1 6   ALA 6   2   2   ALA ALA A . n 
A 1 7   ASP 7   3   3   ASP ASP A . n 
A 1 8   HIS 8   4   4   HIS HIS A . n 
A 1 9   VAL 9   5   5   VAL VAL A . n 
A 1 10  GLY 10  6   6   GLY GLY A . n 
A 1 11  PHE 11  7   7   PHE PHE A . n 
A 1 12  TYR 12  8   8   TYR TYR A . n 
A 1 13  GLY 13  9   9   GLY GLY A . n 
A 1 14  THR 14  10  10  THR THR A . n 
A 1 15  THR 15  11  11  THR THR A . n 
A 1 16  VAL 16  12  12  VAL VAL A . n 
A 1 17  TYR 17  13  13  TYR TYR A . n 
A 1 18  GLN 18  14  14  GLN GLN A . n 
A 1 19  SER 19  15  15  SER SER A . n 
A 1 20  PRO 20  16  16  PRO PRO A . n 
A 1 21  GLY 21  17  17  GLY GLY A . n 
A 1 22  ASP 22  18  18  ASP ASP A . n 
A 1 23  ILE 23  19  19  ILE ILE A . n 
A 1 24  GLY 24  20  20  GLY GLY A . n 
A 1 25  GLN 25  21  21  GLN GLN A . n 
A 1 26  TYR 26  22  22  TYR TYR A . n 
A 1 27  THR 27  23  23  THR THR A . n 
A 1 28  HIS 28  24  24  HIS HIS A . n 
A 1 29  GLU 29  25  25  GLU GLU A . n 
A 1 30  PHE 30  26  26  PHE PHE A . n 
A 1 31  ASP 31  27  27  ASP ASP A . n 
A 1 32  GLY 32  28  28  GLY GLY A . n 
A 1 33  ASP 33  29  29  ASP ASP A . n 
A 1 34  GLU 34  30  30  GLU GLU A . n 
A 1 35  LEU 35  31  31  LEU LEU A . n 
A 1 36  PHE 36  32  32  PHE PHE A . n 
A 1 37  TYR 37  33  33  TYR TYR A . n 
A 1 38  VAL 38  34  34  VAL VAL A . n 
A 1 39  ASP 39  35  35  ASP ASP A . n 
A 1 40  LEU 40  36  36  LEU LEU A . n 
A 1 41  ASP 41  37  37  ASP ASP A . n 
A 1 42  LYS 42  38  38  LYS LYS A . n 
A 1 43  LYS 43  39  39  LYS LYS A . n 
A 1 44  LYS 44  40  40  LYS LYS A . n 
A 1 45  THR 45  41  41  THR THR A . n 
A 1 46  VAL 46  42  42  VAL VAL A . n 
A 1 47  TRP 47  43  43  TRP TRP A . n 
A 1 48  ARG 48  44  44  ARG ARG A . n 
A 1 49  LEU 49  45  45  LEU LEU A . n 
A 1 50  PRO 50  46  46  PRO PRO A . n 
A 1 51  GLU 51  47  47  GLU GLU A . n 
A 1 52  PHE 52  48  48  PHE PHE A . n 
A 1 53  GLY 53  49  49  GLY GLY A . n 
A 1 54  GLN 54  50  50  GLN GLN A . n 
A 1 55  LEU 55  51  51  LEU LEU A . n 
A 1 56  ILE 56  52  52  ILE ILE A . n 
A 1 57  LEU 57  53  53  LEU LEU A . n 
A 1 58  PHE 58  54  54  PHE PHE A . n 
A 1 59  GLU 59  55  55  GLU GLU A . n 
A 1 60  PRO 60  56  56  PRO PRO A . n 
A 1 61  GLN 61  57  57  GLN GLN A . n 
A 1 62  GLY 62  58  58  GLY GLY A . n 
A 1 63  GLY 63  59  59  GLY GLY A . n 
A 1 64  LEU 64  60  60  LEU LEU A . n 
A 1 65  GLN 65  61  61  GLN GLN A . n 
A 1 66  ASN 66  62  62  ASN ASN A . n 
A 1 67  ILE 67  63  63  ILE ILE A . n 
A 1 68  ALA 68  64  64  ALA ALA A . n 
A 1 69  ALA 69  65  65  ALA ALA A . n 
A 1 70  GLU 70  66  66  GLU GLU A . n 
A 1 71  LYS 71  67  67  LYS LYS A . n 
A 1 72  HIS 72  68  68  HIS HIS A . n 
A 1 73  ASN 73  69  69  ASN ASN A . n 
A 1 74  LEU 74  70  70  LEU LEU A . n 
A 1 75  GLY 75  71  71  GLY GLY A . n 
A 1 76  ILE 76  72  72  ILE ILE A . n 
A 1 77  LEU 77  73  73  LEU LEU A . n 
A 1 78  THR 78  74  74  THR THR A . n 
A 1 79  LYS 79  75  75  LYS LYS A . n 
A 1 80  ARG 80  76  76  ARG ARG A . n 
A 1 81  SER 81  77  77  SER SER A . n 
A 1 82  ASN 82  78  78  ASN ASN A . n 
A 1 83  PHE 83  79  79  PHE PHE A . n 
A 1 84  THR 84  80  80  THR THR A . n 
A 1 85  PRO 85  81  81  PRO PRO A . n 
A 1 86  ALA 86  82  82  ALA ALA A . n 
A 1 87  THR 87  83  83  THR THR A . n 
A 1 88  ASN 88  84  84  ASN ASN A . n 
A 1 89  GLU 89  85  85  GLU GLU A . n 
A 1 90  ALA 90  86  86  ALA ALA A . n 
A 1 91  PRO 91  87  87  PRO PRO A . n 
A 1 92  GLN 92  88  88  GLN GLN A . n 
A 1 93  ALA 93  89  89  ALA ALA A . n 
A 1 94  THR 94  90  90  THR THR A . n 
A 1 95  VAL 95  91  91  VAL VAL A . n 
A 1 96  PHE 96  92  92  PHE PHE A . n 
A 1 97  PRO 97  93  93  PRO PRO A . n 
A 1 98  LYS 98  94  94  LYS LYS A . n 
A 1 99  SER 99  95  95  SER SER A . n 
A 1 100 PRO 100 96  96  PRO PRO A . n 
A 1 101 VAL 101 97  97  VAL VAL A . n 
A 1 102 LEU 102 98  98  LEU LEU A . n 
A 1 103 LEU 103 99  99  LEU LEU A . n 
A 1 104 GLY 104 100 100 GLY GLY A . n 
A 1 105 GLN 105 101 101 GLN GLN A . n 
A 1 106 PRO 106 102 102 PRO PRO A . n 
A 1 107 ASN 107 103 103 ASN ASN A . n 
A 1 108 THR 108 104 104 THR THR A . n 
A 1 109 LEU 109 105 105 LEU LEU A . n 
A 1 110 ILE 110 106 106 ILE ILE A . n 
A 1 111 CYS 111 107 107 CYS CYS A . n 
A 1 112 PHE 112 108 108 PHE PHE A . n 
A 1 113 VAL 113 109 109 VAL VAL A . n 
A 1 114 ASP 114 110 110 ASP ASP A . n 
A 1 115 ASN 115 111 111 ASN ASN A . n 
A 1 116 ILE 116 112 112 ILE ILE A . n 
A 1 117 PHE 117 113 113 PHE PHE A . n 
A 1 118 PRO 118 114 114 PRO PRO A . n 
A 1 119 PRO 119 115 115 PRO PRO A . n 
A 1 120 VAL 120 116 116 VAL VAL A . n 
A 1 121 ILE 121 117 117 ILE ILE A . n 
A 1 122 ASN 122 118 118 ASN ASN A . n 
A 1 123 ILE 123 119 119 ILE ILE A . n 
A 1 124 THR 124 120 120 THR THR A . n 
A 1 125 TRP 125 121 121 TRP TRP A . n 
A 1 126 LEU 126 122 122 LEU LEU A . n 
A 1 127 ARG 127 123 123 ARG ARG A . n 
A 1 128 ASN 128 124 124 ASN ASN A . n 
A 1 129 SER 129 125 125 SER SER A . n 
A 1 130 LYS 130 126 126 LYS LYS A . n 
A 1 131 SER 131 127 127 SER SER A . n 
A 1 132 VAL 132 128 128 VAL VAL A . n 
A 1 133 THR 133 129 129 THR THR A . n 
A 1 134 ASP 134 130 130 ASP ASP A . n 
A 1 135 GLY 135 131 131 GLY GLY A . n 
A 1 136 VAL 136 132 132 VAL VAL A . n 
A 1 137 TYR 137 133 133 TYR TYR A . n 
A 1 138 GLU 138 134 134 GLU GLU A . n 
A 1 139 THR 139 135 135 THR THR A . n 
A 1 140 SER 140 136 136 SER SER A . n 
A 1 141 PHE 141 137 137 PHE PHE A . n 
A 1 142 LEU 142 138 138 LEU LEU A . n 
A 1 143 VAL 143 139 139 VAL VAL A . n 
A 1 144 ASN 144 140 140 ASN ASN A . n 
A 1 145 ARG 145 141 141 ARG ARG A . n 
A 1 146 ASP 146 142 142 ASP ASP A . n 
A 1 147 HIS 147 143 143 HIS HIS A . n 
A 1 148 SER 148 144 144 SER SER A . n 
A 1 149 PHE 149 145 145 PHE PHE A . n 
A 1 150 HIS 150 146 146 HIS HIS A . n 
A 1 151 LYS 151 147 147 LYS LYS A . n 
A 1 152 LEU 152 148 148 LEU LEU A . n 
A 1 153 SER 153 149 149 SER SER A . n 
A 1 154 TYR 154 150 150 TYR TYR A . n 
A 1 155 LEU 155 151 151 LEU LEU A . n 
A 1 156 THR 156 152 152 THR THR A . n 
A 1 157 PHE 157 153 153 PHE PHE A . n 
A 1 158 ILE 158 154 154 ILE ILE A . n 
A 1 159 PRO 159 155 155 PRO PRO A . n 
A 1 160 SER 160 156 156 SER SER A . n 
A 1 161 ASP 161 157 157 ASP ASP A . n 
A 1 162 ASP 162 158 158 ASP ASP A . n 
A 1 163 ASP 163 159 159 ASP ASP A . n 
A 1 164 ILE 164 160 160 ILE ILE A . n 
A 1 165 TYR 165 161 161 TYR TYR A . n 
A 1 166 ASP 166 162 162 ASP ASP A . n 
A 1 167 CYS 167 163 163 CYS CYS A . n 
A 1 168 LYS 168 164 164 LYS LYS A . n 
A 1 169 VAL 169 165 165 VAL VAL A . n 
A 1 170 GLU 170 166 166 GLU GLU A . n 
A 1 171 HIS 171 167 167 HIS HIS A . n 
A 1 172 TRP 172 168 168 TRP TRP A . n 
A 1 173 GLY 173 169 169 GLY GLY A . n 
A 1 174 LEU 174 170 170 LEU LEU A . n 
A 1 175 GLU 175 171 171 GLU GLU A . n 
A 1 176 GLU 176 172 172 GLU GLU A . n 
A 1 177 PRO 177 173 173 PRO PRO A . n 
A 1 178 VAL 178 174 174 VAL VAL A . n 
A 1 179 LEU 179 175 175 LEU LEU A . n 
A 1 180 LYS 180 176 176 LYS LYS A . n 
A 1 181 HIS 181 177 177 HIS HIS A . n 
A 1 182 TRP 182 178 178 TRP TRP A . n 
A 1 183 SER 183 179 179 SER SER A . n 
A 1 184 SER 184 180 180 SER SER A . n 
A 1 185 ALA 185 181 ?   ?   ?   A . n 
A 1 186 ASP 186 182 ?   ?   ?   A . n 
A 1 187 LEU 187 183 ?   ?   ?   A . n 
A 1 188 VAL 188 184 ?   ?   ?   A . n 
A 1 189 PRO 189 185 ?   ?   ?   A . n 
A 1 190 ARG 190 186 ?   ?   ?   A . n 
B 2 1   GLY 1   201 ?   ?   ?   B P n 
B 2 2   SER 2   202 ?   ?   ?   B P n 
B 2 3   HIS 3   203 ?   ?   ?   B P n 
B 2 4   SER 4   204 ?   ?   ?   B P n 
B 2 5   ARG 5   205 ?   ?   ?   B P n 
B 2 6   GLY 6   206 ?   ?   ?   B P n 
B 2 7   TYR 7   207 207 TYR TYR B P n 
B 2 8   GLU 8   208 208 GLU GLU B P n 
B 2 9   ILE 9   209 209 ILE ILE B P n 
B 2 10  ALA 10  210 210 ALA ALA B P n 
B 2 11  PRO 11  211 211 PRO PRO B P n 
B 2 12  VAL 12  212 212 VAL VAL B P n 
B 2 13  PHE 13  213 213 PHE PHE B P n 
B 2 14  VAL 14  214 214 VAL VAL B P n 
B 2 15  LEU 15  215 215 LEU LEU B P n 
B 2 16  LEU 16  216 216 LEU LEU B P n 
B 2 17  GLU 17  217 217 GLU GLU B P n 
B 2 18  TYR 18  218 218 TYR TYR B P n 
B 2 19  VAL 19  219 219 VAL VAL B P n 
B 2 20  THR 20  220 220 THR THR B P n 
B 2 21  GLY 21  -5  ?   ?   ?   B . n 
B 2 22  SER 22  -4  ?   ?   ?   B . n 
B 2 23  GLY 23  -3  ?   ?   ?   B . n 
B 2 24  SER 24  -2  ?   ?   ?   B . n 
B 2 25  GLY 25  -1  ?   ?   ?   B . n 
B 2 26  SER 26  0   ?   ?   ?   B . n 
B 2 27  GLY 27  1   ?   ?   ?   B . n 
B 2 28  ASP 28  2   ?   ?   ?   B . n 
B 2 29  SER 29  3   ?   ?   ?   B . n 
B 2 30  GLU 30  4   ?   ?   ?   B . n 
B 2 31  ARG 31  5   5   ARG ARG B . n 
B 2 32  HIS 32  6   6   HIS HIS B . n 
B 2 33  PHE 33  7   7   PHE PHE B . n 
B 2 34  VAL 34  8   8   VAL VAL B . n 
B 2 35  HIS 35  9   9   HIS HIS B . n 
B 2 36  GLN 36  10  10  GLN GLN B . n 
B 2 37  PHE 37  11  11  PHE PHE B . n 
B 2 38  LYS 38  12  12  LYS LYS B . n 
B 2 39  GLY 39  13  13  GLY GLY B . n 
B 2 40  GLU 40  14  14  GLU GLU B . n 
B 2 41  CYS 41  15  15  CYS CYS B . n 
B 2 42  TYR 42  16  16  TYR TYR B . n 
B 2 43  PHE 43  17  17  PHE PHE B . n 
B 2 44  THR 44  18  18  THR THR B . n 
B 2 45  ASN 45  19  19  ASN ASN B . n 
B 2 46  GLY 46  20  20  GLY GLY B . n 
B 2 47  THR 47  21  21  THR THR B . n 
B 2 48  GLN 48  22  22  GLN GLN B . n 
B 2 49  ARG 49  23  23  ARG ARG B . n 
B 2 50  ILE 50  24  24  ILE ILE B . n 
B 2 51  ARG 51  25  25  ARG ARG B . n 
B 2 52  LEU 52  26  26  LEU LEU B . n 
B 2 53  VAL 53  27  27  VAL VAL B . n 
B 2 54  THR 54  28  28  THR THR B . n 
B 2 55  ARG 55  29  29  ARG ARG B . n 
B 2 56  TYR 56  30  30  TYR TYR B . n 
B 2 57  ILE 57  31  31  ILE ILE B . n 
B 2 58  TYR 58  32  32  TYR TYR B . n 
B 2 59  ASN 59  33  33  ASN ASN B . n 
B 2 60  ARG 60  34  34  ARG ARG B . n 
B 2 61  GLU 61  35  35  GLU GLU B . n 
B 2 62  GLU 62  36  36  GLU GLU B . n 
B 2 63  TYR 63  37  37  TYR TYR B . n 
B 2 64  LEU 64  38  38  LEU LEU B . n 
B 2 65  ARG 65  39  39  ARG ARG B . n 
B 2 66  PHE 66  40  40  PHE PHE B . n 
B 2 67  ASP 67  41  41  ASP ASP B . n 
B 2 68  SER 68  42  42  SER SER B . n 
B 2 69  ASP 69  43  43  ASP ASP B . n 
B 2 70  VAL 70  44  44  VAL VAL B . n 
B 2 71  GLY 71  45  45  GLY GLY B . n 
B 2 72  GLU 72  46  46  GLU GLU B . n 
B 2 73  TYR 73  47  47  TYR TYR B . n 
B 2 74  ARG 74  48  48  ARG ARG B . n 
B 2 75  ALA 75  49  49  ALA ALA B . n 
B 2 76  VAL 76  50  50  VAL VAL B . n 
B 2 77  THR 77  51  51  THR THR B . n 
B 2 78  GLU 78  52  52  GLU GLU B . n 
B 2 79  LEU 79  53  53  LEU LEU B . n 
B 2 80  GLY 80  54  54  GLY GLY B . n 
B 2 81  ARG 81  55  55  ARG ARG B . n 
B 2 82  HIS 82  56  56  HIS HIS B . n 
B 2 83  SER 83  57  57  SER SER B . n 
B 2 84  ALA 84  58  58  ALA ALA B . n 
B 2 85  GLU 85  59  59  GLU GLU B . n 
B 2 86  TYR 86  60  60  TYR TYR B . n 
B 2 87  TYR 87  61  61  TYR TYR B . n 
B 2 88  ASN 88  62  62  ASN ASN B . n 
B 2 89  LYS 89  63  63  LYS LYS B . n 
B 2 90  GLN 90  64  64  GLN GLN B . n 
B 2 91  TYR 91  66  66  TYR TYR B . n 
B 2 92  LEU 92  68  68  LEU LEU B . n 
B 2 93  GLU 93  69  69  GLU GLU B . n 
B 2 94  ARG 94  70  70  ARG ARG B . n 
B 2 95  THR 95  71  71  THR THR B . n 
B 2 96  ARG 96  72  72  ARG ARG B . n 
B 2 97  ALA 97  73  73  ALA ALA B . n 
B 2 98  GLU 98  74  74  GLU GLU B . n 
B 2 99  LEU 99  75  75  LEU LEU B . n 
B 2 100 ASP 100 76  76  ASP ASP B . n 
B 2 101 THR 101 77  77  THR THR B . n 
B 2 102 ALA 102 78  78  ALA ALA B . n 
B 2 103 CYS 103 79  79  CYS CYS B . n 
B 2 104 ARG 104 80  80  ARG ARG B . n 
B 2 105 HIS 105 81  81  HIS HIS B . n 
B 2 106 ASN 106 82  82  ASN ASN B . n 
B 2 107 TYR 107 83  83  TYR TYR B . n 
B 2 108 GLU 108 84  84  GLU GLU B . n 
B 2 109 GLU 109 85  85  GLU GLU B . n 
B 2 110 THR 110 86  86  THR THR B . n 
B 2 111 GLU 111 87  87  GLU GLU B . n 
B 2 112 VAL 112 88  88  VAL VAL B . n 
B 2 113 PRO 113 89  89  PRO PRO B . n 
B 2 114 THR 114 90  90  THR THR B . n 
B 2 115 SER 115 91  91  SER SER B . n 
B 2 116 LEU 116 92  92  LEU LEU B . n 
B 2 117 ARG 117 93  93  ARG ARG B . n 
B 2 118 ARG 118 94  94  ARG ARG B . n 
B 2 119 LEU 119 94  94  LEU LEU B A n 
B 2 120 GLU 120 95  95  GLU GLU B . n 
B 2 121 GLN 121 96  96  GLN GLN B . n 
B 2 122 PRO 122 97  97  PRO PRO B . n 
B 2 123 ASN 123 98  98  ASN ASN B . n 
B 2 124 VAL 124 99  99  VAL VAL B . n 
B 2 125 ALA 125 100 100 ALA ALA B . n 
B 2 126 ILE 126 101 101 ILE ILE B . n 
B 2 127 SER 127 102 102 SER SER B . n 
B 2 128 LEU 128 103 103 LEU LEU B . n 
B 2 129 SER 129 104 104 SER SER B . n 
B 2 130 ARG 130 105 ?   ?   ?   B . n 
B 2 131 THR 131 106 ?   ?   ?   B . n 
B 2 132 GLU 132 107 ?   ?   ?   B . n 
B 2 133 ALA 133 108 ?   ?   ?   B . n 
B 2 134 LEU 134 109 ?   ?   ?   B . n 
B 2 135 ASN 135 110 ?   ?   ?   B . n 
B 2 136 HIS 136 111 ?   ?   ?   B . n 
B 2 137 HIS 137 112 ?   ?   ?   B . n 
B 2 138 ASN 138 113 113 ASN ASN B . n 
B 2 139 THR 139 114 114 THR THR B . n 
B 2 140 LEU 140 115 115 LEU LEU B . n 
B 2 141 VAL 141 116 116 VAL VAL B . n 
B 2 142 CYS 142 117 117 CYS CYS B . n 
B 2 143 SER 143 118 118 SER SER B . n 
B 2 144 VAL 144 119 119 VAL VAL B . n 
B 2 145 THR 145 120 120 THR THR B . n 
B 2 146 ASP 146 121 121 ASP ASP B . n 
B 2 147 PHE 147 122 122 PHE PHE B . n 
B 2 148 TYR 148 123 123 TYR TYR B . n 
B 2 149 PRO 149 124 124 PRO PRO B . n 
B 2 150 ALA 150 125 125 ALA ALA B . n 
B 2 151 LYS 151 126 126 LYS LYS B . n 
B 2 152 ILE 152 127 127 ILE ILE B . n 
B 2 153 LYS 153 128 128 LYS LYS B . n 
B 2 154 VAL 154 129 129 VAL VAL B . n 
B 2 155 ARG 155 130 130 ARG ARG B . n 
B 2 156 TRP 156 131 131 TRP TRP B . n 
B 2 157 PHE 157 132 132 PHE PHE B . n 
B 2 158 ARG 158 133 133 ARG ARG B . n 
B 2 159 ASN 159 134 134 ASN ASN B . n 
B 2 160 GLY 160 135 135 GLY GLY B . n 
B 2 161 GLN 161 136 136 GLN GLN B . n 
B 2 162 GLU 162 137 137 GLU GLU B . n 
B 2 163 GLU 163 138 138 GLU GLU B . n 
B 2 164 THR 164 139 139 THR THR B . n 
B 2 165 VAL 165 140 140 VAL VAL B . n 
B 2 166 GLY 166 141 141 GLY GLY B . n 
B 2 167 VAL 167 142 142 VAL VAL B . n 
B 2 168 SER 168 143 143 SER SER B . n 
B 2 169 SER 169 144 144 SER SER B . n 
B 2 170 THR 170 145 145 THR THR B . n 
B 2 171 GLN 171 146 146 GLN GLN B . n 
B 2 172 LEU 172 147 147 LEU LEU B . n 
B 2 173 ILE 173 148 148 ILE ILE B . n 
B 2 174 ARG 174 149 149 ARG ARG B . n 
B 2 175 ASN 175 150 150 ASN ASN B . n 
B 2 176 GLY 176 151 151 GLY GLY B . n 
B 2 177 ASP 177 152 152 ASP ASP B . n 
B 2 178 TRP 178 153 153 TRP TRP B . n 
B 2 179 THR 179 154 154 THR THR B . n 
B 2 180 PHE 180 155 155 PHE PHE B . n 
B 2 181 GLN 181 156 156 GLN GLN B . n 
B 2 182 VAL 182 157 157 VAL VAL B . n 
B 2 183 LEU 183 158 158 LEU LEU B . n 
B 2 184 VAL 184 159 159 VAL VAL B . n 
B 2 185 MET 185 160 160 MET MET B . n 
B 2 186 LEU 186 161 161 LEU LEU B . n 
B 2 187 GLU 187 162 162 GLU GLU B . n 
B 2 188 MET 188 163 163 MET MET B . n 
B 2 189 THR 189 164 164 THR THR B . n 
B 2 190 PRO 190 165 165 PRO PRO B . n 
B 2 191 HIS 191 166 166 HIS HIS B . n 
B 2 192 GLN 192 167 167 GLN GLN B . n 
B 2 193 GLY 193 168 168 GLY GLY B . n 
B 2 194 GLU 194 169 169 GLU GLU B . n 
B 2 195 VAL 195 170 170 VAL VAL B . n 
B 2 196 TYR 196 171 171 TYR TYR B . n 
B 2 197 THR 197 172 172 THR THR B . n 
B 2 198 CYS 198 173 173 CYS CYS B . n 
B 2 199 HIS 199 174 174 HIS HIS B . n 
B 2 200 VAL 200 175 175 VAL VAL B . n 
B 2 201 GLU 201 176 176 GLU GLU B . n 
B 2 202 HIS 202 177 177 HIS HIS B . n 
B 2 203 PRO 203 178 178 PRO PRO B . n 
B 2 204 SER 204 179 179 SER SER B . n 
B 2 205 LEU 205 180 180 LEU LEU B . n 
B 2 206 LYS 206 181 181 LYS LYS B . n 
B 2 207 SER 207 182 182 SER SER B . n 
B 2 208 PRO 208 183 183 PRO PRO B . n 
B 2 209 ILE 209 184 184 ILE ILE B . n 
B 2 210 THR 210 185 185 THR THR B . n 
B 2 211 VAL 211 186 186 VAL VAL B . n 
B 2 212 GLU 212 187 187 GLU GLU B . n 
B 2 213 TRP 213 188 188 TRP TRP B . n 
B 2 214 SER 214 189 189 SER SER B . n 
B 2 215 SER 215 190 ?   ?   ?   B . n 
B 2 216 ALA 216 191 ?   ?   ?   B . n 
B 2 217 ASP 217 192 ?   ?   ?   B . n 
B 2 218 LEU 218 193 ?   ?   ?   B . n 
B 2 219 VAL 219 194 ?   ?   ?   B . n 
B 2 220 PRO 220 195 ?   ?   ?   B . n 
B 2 221 ARG 221 196 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  187 4  HOH HOH A . 
C 3 HOH 2  188 8  HOH HOH A . 
C 3 HOH 3  189 9  HOH HOH A . 
C 3 HOH 4  190 10 HOH HOH A . 
C 3 HOH 5  191 12 HOH HOH A . 
C 3 HOH 6  192 14 HOH HOH A . 
C 3 HOH 7  193 15 HOH HOH A . 
C 3 HOH 8  194 16 HOH HOH A . 
C 3 HOH 9  195 18 HOH HOH A . 
C 3 HOH 10 196 19 HOH HOH A . 
C 3 HOH 11 197 20 HOH HOH A . 
C 3 HOH 12 198 22 HOH HOH A . 
C 3 HOH 13 199 25 HOH HOH A . 
C 3 HOH 14 200 26 HOH HOH A . 
C 3 HOH 15 201 27 HOH HOH A . 
C 3 HOH 16 202 29 HOH HOH A . 
C 3 HOH 17 203 30 HOH HOH A . 
C 3 HOH 18 204 31 HOH HOH A . 
C 3 HOH 19 205 32 HOH HOH A . 
C 3 HOH 20 206 33 HOH HOH A . 
C 3 HOH 21 207 35 HOH HOH A . 
C 3 HOH 22 208 36 HOH HOH A . 
C 3 HOH 23 209 37 HOH HOH A . 
C 3 HOH 24 210 38 HOH HOH A . 
C 3 HOH 25 211 39 HOH HOH A . 
C 3 HOH 26 212 40 HOH HOH A . 
C 3 HOH 27 213 44 HOH HOH A . 
C 3 HOH 28 214 45 HOH HOH A . 
C 3 HOH 29 215 48 HOH HOH A . 
C 3 HOH 30 216 52 HOH HOH A . 
C 3 HOH 31 217 56 HOH HOH A . 
C 3 HOH 32 218 59 HOH HOH A . 
C 3 HOH 33 219 63 HOH HOH A . 
C 3 HOH 34 220 64 HOH HOH A . 
C 3 HOH 35 221 65 HOH HOH A . 
C 3 HOH 36 222 68 HOH HOH A . 
C 3 HOH 37 223 69 HOH HOH A . 
C 3 HOH 38 224 70 HOH HOH A . 
C 3 HOH 39 225 71 HOH HOH A . 
C 3 HOH 40 226 73 HOH HOH A . 
C 3 HOH 41 227 74 HOH HOH A . 
D 3 HOH 1  221 1  HOH HOH B . 
D 3 HOH 2  222 2  HOH HOH B . 
D 3 HOH 3  223 3  HOH HOH B . 
D 3 HOH 4  224 5  HOH HOH B . 
D 3 HOH 5  225 6  HOH HOH B . 
D 3 HOH 6  226 7  HOH HOH B . 
D 3 HOH 7  227 11 HOH HOH B . 
D 3 HOH 8  228 13 HOH HOH B . 
D 3 HOH 9  229 17 HOH HOH B . 
D 3 HOH 10 230 21 HOH HOH B . 
D 3 HOH 11 231 23 HOH HOH B . 
D 3 HOH 12 232 24 HOH HOH B . 
D 3 HOH 13 233 28 HOH HOH B . 
D 3 HOH 14 234 34 HOH HOH B . 
D 3 HOH 15 235 41 HOH HOH B . 
D 3 HOH 16 236 42 HOH HOH B . 
D 3 HOH 17 237 43 HOH HOH B . 
D 3 HOH 18 238 46 HOH HOH B . 
D 3 HOH 19 239 47 HOH HOH B . 
D 3 HOH 20 240 49 HOH HOH B . 
D 3 HOH 21 241 50 HOH HOH B . 
D 3 HOH 22 242 51 HOH HOH B . 
D 3 HOH 23 243 53 HOH HOH B . 
D 3 HOH 24 244 54 HOH HOH B . 
D 3 HOH 25 245 55 HOH HOH B . 
D 3 HOH 26 246 57 HOH HOH B . 
D 3 HOH 27 247 58 HOH HOH B . 
D 3 HOH 28 248 60 HOH HOH B . 
D 3 HOH 29 249 61 HOH HOH B . 
D 3 HOH 30 250 62 HOH HOH B . 
D 3 HOH 31 251 66 HOH HOH B . 
D 3 HOH 32 252 67 HOH HOH B . 
D 3 HOH 33 253 72 HOH HOH B . 
D 3 HOH 34 254 75 HOH HOH B . 
D 3 HOH 35 255 76 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5990  ? 
1 MORE         -28   ? 
1 'SSA (A^2)'  17770 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-06-28 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-08-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen 
2 4 'Structure model' software       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO    'data reduction' .            ? 1 
TRUNCATE 'data reduction' .            ? 2 
AMoRE    phasing          .            ? 3 
CNS      refinement       0.9          ? 4 
CCP4     'data scaling'   '(TRUNCATE)' ? 5 
# 
_pdbx_entry_details.entry_id             1ES0 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THIS ENTRY CONTAINS COORDINATES FOR THE EXTRACELLULAR
DOMAINS OF THE MURINE MHC CLASS II ALLELE I-A(G7) WITH A
FRAGMENT FROM GAD65 (207 - 220) COVALENTLY ATTACHED TO THE
FIRST RESIDUE OF THE AMINO TERMINUS OF THE MATURE BETA
CHAIN. THE NUMBERING SCHEME FOR THE I-A(G7) RESIDUES IS AS
DESCRIBED IN "SEQUENCES OF PROTEINS OF IMMUNOLOGICAL
INTEREST" (1991), EDITED BY E.A. KABAT, T.T. WU, H.M.
PERRY, K.S. GOTTESMAN AND C. FOELLER.
DIMERIZATION OF THE I-A(G7) HETERODIMER WAS FACILITATED BY
ADDING A LEUCINE ZIPPER TAIL TO THE CARBOXY TERMINUS OF
EACH CHAIN. IN ADDITION, A HEXAHISTIDINE SEQUENCE WAS
ENGINEERED TO THE CARBOXY TERMINAL END OF THE LEUCINE
ZIPPER. THIS ALLOWED THE SECRETED PROTEIN TO BE PURIFIED
BY NI-NTA CHROMATOGRAPHY. A THROMBIN CUT SITE WAS
ENGINEERED IN A SPACER SEQUENCE BETWEEN THE CARBOXY
TERMINAL RESIDUE OF EACH CHAIN AND THE LEUCINE ZIPPER-
HEXAHISTIDINE SEQUENCE SO THAT MOST OF THE ENGINEERED
RESIDUES COULD BE REMOVED FOR CRYSTALLIZATION. AFTER
THROMBIN DIGESTION, EIGHT ENGINEERED RESIDUES (SSADLVPR)
REMAINED ATTACHED TO THE CARBOXY TERMINAL END OF EACH
I-A(G7) CHAIN.
NO ELECTRON DENSITY WAS VISIBLE FOR 1) THE FIRST 2 RESIDUES
OF THE ALPHA CHAIN 2) THE LAST 6 RESIDUES OF THE SPACER
SEQUENCE ATTACHED TO THE C-TERMINUS OF THE ALPHA CHAIN,
3) THE 6 RESIDUE (GSGSGS) LINKER BETWEEN GAD65 AND THE BETA
CHAIN, 4) THE FIRST 4 RESIDUES OF THE BETA CHAIN, AND 5)
THE LAST 7 RESIDUES OF THE SPACER SEQUENCE ATTACHED TO THE
C-TERMINUS OF THE BETA CHAIN. SIX ADDITIONAL RESIDUES
(GSHSRG) FROM THE SIGNAL SEQUENCE REMAIN CONNECTED TO THE
AMINO TERMINUS OF THE GAD65 PEPTIDE; NO DENSITY IS PRESENT
FOR THESE RESIDUES.

THE RESIDUE NUMBERING FOR THE TWO PROTEIN CHAINS IS:
  A   1B - A 178  : MHC CLASS II ALPHA CHAIN
  A 179 -  A 186  : SPACER SEQUENCE
  B 207P - B 220P : RESIDUES 207-220 OF GAD65
  B   1  - B 188  : MHC CLASS II BETA CHAIN
  B 189  - B 196  : SPACER SEQUENCE
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 48  ? ? -29.26  -80.83 
2 1 LEU A 51  ? ? -108.38 -70.17 
3 1 ASP A 158 ? ? 78.63   -33.23 
4 1 ASN B 33  ? ? 66.04   -97.94 
5 1 THR B 90  ? ? -121.37 -98.02 
6 1 PRO B 165 ? ? -57.95  67.99  
7 1 GLN B 167 ? ? -37.16  137.21 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 1   B CG  ? A ASP 3   CG  
2  1 Y 1 A ASP 1   B OD1 ? A ASP 3   OD1 
3  1 Y 1 A ASP 1   B OD2 ? A ASP 3   OD2 
4  1 Y 1 A LYS 40  ? CG  ? A LYS 44  CG  
5  1 Y 1 A LYS 40  ? CD  ? A LYS 44  CD  
6  1 Y 1 A LYS 40  ? CE  ? A LYS 44  CE  
7  1 Y 1 A LYS 40  ? NZ  ? A LYS 44  NZ  
8  1 Y 1 B TYR 207 P CG  ? B TYR 7   CG  
9  1 Y 1 B TYR 207 P CD1 ? B TYR 7   CD1 
10 1 Y 1 B TYR 207 P CD2 ? B TYR 7   CD2 
11 1 Y 1 B TYR 207 P CE1 ? B TYR 7   CE1 
12 1 Y 1 B TYR 207 P CE2 ? B TYR 7   CE2 
13 1 Y 1 B TYR 207 P CZ  ? B TYR 7   CZ  
14 1 Y 1 B TYR 207 P OH  ? B TYR 7   OH  
15 1 Y 1 B TYR 218 P CG  ? B TYR 18  CG  
16 1 Y 1 B TYR 218 P CD1 ? B TYR 18  CD1 
17 1 Y 1 B TYR 218 P CD2 ? B TYR 18  CD2 
18 1 Y 1 B TYR 218 P CE1 ? B TYR 18  CE1 
19 1 Y 1 B TYR 218 P CE2 ? B TYR 18  CE2 
20 1 Y 1 B TYR 218 P CZ  ? B TYR 18  CZ  
21 1 Y 1 B TYR 218 P OH  ? B TYR 18  OH  
22 1 Y 1 B THR 220 P OG1 ? B THR 20  OG1 
23 1 Y 1 B THR 220 P CG2 ? B THR 20  CG2 
24 1 Y 1 B LYS 63  ? CG  ? B LYS 89  CG  
25 1 Y 1 B LYS 63  ? CD  ? B LYS 89  CD  
26 1 Y 1 B LYS 63  ? CE  ? B LYS 89  CE  
27 1 Y 1 B LYS 63  ? NZ  ? B LYS 89  NZ  
28 1 Y 1 B GLU 85  ? CG  ? B GLU 109 CG  
29 1 Y 1 B GLU 85  ? CD  ? B GLU 109 CD  
30 1 Y 1 B GLU 85  ? OE1 ? B GLU 109 OE1 
31 1 Y 1 B GLU 85  ? OE2 ? B GLU 109 OE2 
32 1 Y 1 B ASN 113 ? CG  ? B ASN 138 CG  
33 1 Y 1 B ASN 113 ? OD1 ? B ASN 138 OD1 
34 1 Y 1 B ASN 113 ? ND2 ? B ASN 138 ND2 
35 1 Y 1 B HIS 166 ? CG  ? B HIS 191 CG  
36 1 Y 1 B HIS 166 ? ND1 ? B HIS 191 ND1 
37 1 Y 1 B HIS 166 ? CD2 ? B HIS 191 CD2 
38 1 Y 1 B HIS 166 ? CE1 ? B HIS 191 CE1 
39 1 Y 1 B HIS 166 ? NE2 ? B HIS 191 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 1   D A GLU 1   
2  1 Y 1 A ASP 1   C A ASP 2   
3  1 Y 1 A ALA 181 ? A ALA 185 
4  1 Y 1 A ASP 182 ? A ASP 186 
5  1 Y 1 A LEU 183 ? A LEU 187 
6  1 Y 1 A VAL 184 ? A VAL 188 
7  1 Y 1 A PRO 185 ? A PRO 189 
8  1 Y 1 A ARG 186 ? A ARG 190 
9  1 Y 1 B GLY 201 P B GLY 1   
10 1 Y 1 B SER 202 P B SER 2   
11 1 Y 1 B HIS 203 P B HIS 3   
12 1 Y 1 B SER 204 P B SER 4   
13 1 Y 1 B ARG 205 P B ARG 5   
14 1 Y 1 B GLY 206 P B GLY 6   
15 1 Y 1 B GLY -5  ? B GLY 21  
16 1 Y 1 B SER -4  ? B SER 22  
17 1 Y 1 B GLY -3  ? B GLY 23  
18 1 Y 1 B SER -2  ? B SER 24  
19 1 Y 1 B GLY -1  ? B GLY 25  
20 1 Y 1 B SER 0   ? B SER 26  
21 1 Y 1 B GLY 1   ? B GLY 27  
22 1 Y 1 B ASP 2   ? B ASP 28  
23 1 Y 1 B SER 3   ? B SER 29  
24 1 Y 1 B GLU 4   ? B GLU 30  
25 1 Y 1 B ARG 105 ? B ARG 130 
26 1 Y 1 B THR 106 ? B THR 131 
27 1 Y 1 B GLU 107 ? B GLU 132 
28 1 Y 1 B ALA 108 ? B ALA 133 
29 1 Y 1 B LEU 109 ? B LEU 134 
30 1 Y 1 B ASN 110 ? B ASN 135 
31 1 Y 1 B HIS 111 ? B HIS 136 
32 1 Y 1 B HIS 112 ? B HIS 137 
33 1 Y 1 B SER 190 ? B SER 215 
34 1 Y 1 B ALA 191 ? B ALA 216 
35 1 Y 1 B ASP 192 ? B ASP 217 
36 1 Y 1 B LEU 193 ? B LEU 218 
37 1 Y 1 B VAL 194 ? B VAL 219 
38 1 Y 1 B PRO 195 ? B PRO 220 
39 1 Y 1 B ARG 196 ? B ARG 221 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#