data_1EXR
# 
_entry.id   1EXR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EXR         
RCSB  RCSB011001   
WWPDB D_1000011001 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1CLM '1.8 Angstrom structure of wild type Paramecium tetraurelia Calmodulin'    unspecified 
PDB 1OSA '1.68 Angstrom structure of recombinant Paramecium tetraurelia Calmodulin' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EXR 
_pdbx_database_status.recvd_initial_deposition_date   2000-05-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wilson, M.A.'  1 
'Brunger, A.T.' 2 
# 
_citation.id                        primary 
_citation.title                     
;The 1.0 A crystal structure of Ca(2+)-bound calmodulin: an analysis of disorder and implications for functionally relevant plasticity
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            301 
_citation.page_first                1237 
_citation.page_last                 1256 
_citation.year                      2000 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10966818 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2000.4029 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wilson, M.A.'  1 ? 
primary 'Brunger, A.T.' 2 ? 
# 
_cell.entry_id           1EXR 
_cell.length_a           25.015 
_cell.length_b           29.415 
_cell.length_c           52.761 
_cell.angle_alpha        89.54 
_cell.angle_beta         86.10 
_cell.angle_gamma        82.39 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EXR 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man CALMODULIN    16687.420 1   ? ? ? ? 
2 non-polymer syn 'CALCIUM ION' 40.078    5   ? ? ? ? 
3 water       nat water         18.015    178 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQD
SEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQD
SEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   GLU n 
1 3   GLN n 
1 4   LEU n 
1 5   THR n 
1 6   GLU n 
1 7   GLU n 
1 8   GLN n 
1 9   ILE n 
1 10  ALA n 
1 11  GLU n 
1 12  PHE n 
1 13  LYS n 
1 14  GLU n 
1 15  ALA n 
1 16  PHE n 
1 17  ALA n 
1 18  LEU n 
1 19  PHE n 
1 20  ASP n 
1 21  LYS n 
1 22  ASP n 
1 23  GLY n 
1 24  ASP n 
1 25  GLY n 
1 26  THR n 
1 27  ILE n 
1 28  THR n 
1 29  THR n 
1 30  LYS n 
1 31  GLU n 
1 32  LEU n 
1 33  GLY n 
1 34  THR n 
1 35  VAL n 
1 36  MET n 
1 37  ARG n 
1 38  SER n 
1 39  LEU n 
1 40  GLY n 
1 41  GLN n 
1 42  ASN n 
1 43  PRO n 
1 44  THR n 
1 45  GLU n 
1 46  ALA n 
1 47  GLU n 
1 48  LEU n 
1 49  GLN n 
1 50  ASP n 
1 51  MET n 
1 52  ILE n 
1 53  ASN n 
1 54  GLU n 
1 55  VAL n 
1 56  ASP n 
1 57  ALA n 
1 58  ASP n 
1 59  GLY n 
1 60  ASN n 
1 61  GLY n 
1 62  THR n 
1 63  ILE n 
1 64  ASP n 
1 65  PHE n 
1 66  PRO n 
1 67  GLU n 
1 68  PHE n 
1 69  LEU n 
1 70  SER n 
1 71  LEU n 
1 72  MET n 
1 73  ALA n 
1 74  ARG n 
1 75  LYS n 
1 76  MET n 
1 77  LYS n 
1 78  GLU n 
1 79  GLN n 
1 80  ASP n 
1 81  SER n 
1 82  GLU n 
1 83  GLU n 
1 84  GLU n 
1 85  LEU n 
1 86  ILE n 
1 87  GLU n 
1 88  ALA n 
1 89  PHE n 
1 90  LYS n 
1 91  VAL n 
1 92  PHE n 
1 93  ASP n 
1 94  ARG n 
1 95  ASP n 
1 96  GLY n 
1 97  ASN n 
1 98  GLY n 
1 99  LEU n 
1 100 ILE n 
1 101 SER n 
1 102 ALA n 
1 103 ALA n 
1 104 GLU n 
1 105 LEU n 
1 106 ARG n 
1 107 HIS n 
1 108 VAL n 
1 109 MET n 
1 110 THR n 
1 111 ASN n 
1 112 LEU n 
1 113 GLY n 
1 114 GLU n 
1 115 LYS n 
1 116 LEU n 
1 117 THR n 
1 118 ASP n 
1 119 ASP n 
1 120 GLU n 
1 121 VAL n 
1 122 ASP n 
1 123 GLU n 
1 124 MET n 
1 125 ILE n 
1 126 ARG n 
1 127 GLU n 
1 128 ALA n 
1 129 ASP n 
1 130 ILE n 
1 131 ASP n 
1 132 GLY n 
1 133 ASP n 
1 134 GLY n 
1 135 HIS n 
1 136 ILE n 
1 137 ASN n 
1 138 TYR n 
1 139 GLU n 
1 140 GLU n 
1 141 PHE n 
1 142 VAL n 
1 143 ARG n 
1 144 MET n 
1 145 MET n 
1 146 VAL n 
1 147 SER n 
1 148 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Paramecium 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Paramecium tetraurelia' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5888 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               JM109 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PKK233-3 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CALM_PARTE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P07463 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1EXR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 148 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07463 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  149 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       148 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EXR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.99 
_exptl_crystal.density_percent_sol   40 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
'MPD, calcium chloride, sodium cacodylate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-07-21 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.886 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_wavelength             0.886 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EXR 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.000 
_reflns.number_obs                   78247 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            0.073 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.4000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.400 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.00 
_reflns_shell.d_res_low              1.04 
_reflns_shell.percent_possible_all   83.9 
_reflns_shell.Rmerge_I_obs           0.506 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.100 
_reflns_shell.pdbx_redundancy        3.30 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1EXR 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     77150 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             500.0 
_refine.ls_d_res_high                            1.00 
_refine.ls_percent_reflns_obs                    96.0 
_refine.ls_R_factor_obs                          0.134 
_refine.ls_R_factor_all                          0.136 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.163 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.000 
_refine.ls_number_reflns_R_free                  7782 
_refine.ls_number_parameters                     14894 
_refine.ls_number_restraints                     22732 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER, J.MOL.BIOL.91 (1973)201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  'ANISOTROPIC REFINEMENT REDUCED FREE R (NO CUTOFF) BY 9%' 
_refine.pdbx_starting_model                      'UNPUBLISHED 1.1 A PARAMECIUM TETRAURELIA CALMODULIN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1EXR 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      36 
_refine_analyze.occupancy_sum_hydrogen          1089.0 
_refine_analyze.occupancy_sum_non_hydrogen      1327.0 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1467 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             178 
_refine_hist.number_atoms_total               1650 
_refine_hist.d_res_high                       1.00 
_refine_hist.d_res_low                        500.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.030 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.023 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.070 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.080 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.080 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.050 ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.100 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1EXR 
_pdbx_refine.R_factor_all_no_cutoff                      0.136 
_pdbx_refine.R_factor_obs_no_cutoff                      0.134 
_pdbx_refine.free_R_factor_no_cutoff                     0.163 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     10.000 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            7782 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.124 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.122 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.151 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   10.000 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          6361 
_pdbx_refine.number_reflns_obs_4sig_cutoff               63169 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1EXR 
_struct.title                     'THE 1.0 ANGSTROM CRYSTAL STRUCTURE OF CA+2 BOUND CALMODULIN' 
_struct.pdbx_descriptor           CALMODULIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EXR 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            'CALMODULIN, HIGH RESOLUTION, DISORDER, METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 5   ? ASP A 20  ? THR A 5   ASP A 20  1 ? 16 
HELX_P HELX_P2 2 THR A 28  ? LEU A 39  ? THR A 28  LEU A 39  1 ? 12 
HELX_P HELX_P3 3 THR A 44  ? GLU A 54  ? THR A 44  GLU A 54  1 ? 11 
HELX_P HELX_P4 4 PHE A 65  ? ASP A 93  ? PHE A 65  ASP A 93  1 ? 29 
HELX_P HELX_P5 5 SER A 101 ? LEU A 112 ? SER A 101 LEU A 112 1 ? 12 
HELX_P HELX_P6 6 THR A 117 ? ASP A 129 ? THR A 117 ASP A 129 1 ? 13 
HELX_P HELX_P7 7 ASN A 137 ? SER A 147 ? ASN A 137 SER A 147 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 1000 A HOH 2122 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc2  metalc ? ? B CA . CA ? ? ? 1_555 A GLU 31  OE1 ? ? A CA 1000 A GLU 31   1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc3  metalc ? ? B CA . CA ? ? ? 1_555 A THR 26  O   ? ? A CA 1000 A THR 26   1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc4  metalc ? ? B CA . CA ? ? ? 1_555 A ASP 22  OD1 ? ? A CA 1000 A ASP 22   1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc5  metalc ? ? B CA . CA ? ? ? 1_555 A GLU 31  OE2 ? ? A CA 1000 A GLU 31   1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc6  metalc ? ? B CA . CA ? ? ? 1_555 A ASP 20  OD1 ? ? A CA 1000 A ASP 20   1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc7  metalc ? ? B CA . CA ? ? ? 1_555 A ASP 24  OD1 ? ? A CA 1000 A ASP 24   1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc8  metalc ? ? C CA . CA ? ? ? 1_555 A ASP 56  OD1 ? ? A CA 1001 A ASP 56   1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc9  metalc ? ? C CA . CA ? ? ? 1_555 A ASN 60  OD1 ? ? A CA 1001 A ASN 60   1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc10 metalc ? ? C CA . CA ? ? ? 1_555 A THR 62  O   ? ? A CA 1001 A THR 62   1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc11 metalc ? ? C CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 1001 A HOH 2011 1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc12 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 67  OE1 ? ? A CA 1001 A GLU 67   1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc13 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 58  OD1 ? ? A CA 1001 A ASP 58   1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc14 metalc ? ? C CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 1001 A HOH 2127 1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc15 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 67  OE2 ? ? A CA 1001 A GLU 67   1_555 ? ? ? ? ? ? ? 2.599 ? 
metalc16 metalc ? ? D CA . CA ? ? ? 1_555 A GLU 140 OE1 ? ? A CA 1002 A GLU 140  1_555 ? ? ? ? ? ? ? 2.441 ? 
metalc17 metalc ? ? D CA . CA ? ? ? 1_555 A ASP 133 OD1 ? ? A CA 1002 A ASP 133  1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc18 metalc ? ? D CA . CA ? ? ? 1_555 A ASP 129 OD1 ? ? A CA 1002 A ASP 129  1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc19 metalc ? ? D CA . CA ? ? ? 1_555 A GLU 140 OE2 ? ? A CA 1002 A GLU 140  1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc20 metalc ? ? D CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 1002 A HOH 2129 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc21 metalc ? ? D CA . CA ? ? ? 1_555 A HIS 135 O   ? ? A CA 1002 A HIS 135  1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc22 metalc ? ? D CA . CA ? ? ? 1_555 A ASP 131 OD1 ? ? A CA 1002 A ASP 131  1_555 ? ? ? ? ? ? ? 2.345 ? 
metalc23 metalc ? ? E CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 1003 A HOH 2123 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc24 metalc ? ? E CA . CA ? ? ? 1_555 A GLU 47  OE1 ? ? A CA 1003 A GLU 47   1_555 ? ? ? ? ? ? ? 2.504 ? 
metalc25 metalc ? ? E CA . CA ? ? ? 1_555 A GLU 47  OE2 ? ? A CA 1003 A GLU 47   1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc26 metalc ? ? E CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 1003 A HOH 2125 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc27 metalc ? ? E CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 1003 A HOH 2126 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc28 metalc ? ? E CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 1003 A HOH 2124 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc29 metalc ? ? F CA . CA ? ? ? 1_555 A ASP 93  OD1 ? ? A CA 1004 A ASP 93   1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc30 metalc ? ? F CA . CA ? ? ? 1_555 A ASP 95  OD1 ? ? A CA 1004 A ASP 95   1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc31 metalc ? ? F CA . CA ? ? ? 1_555 A LEU 99  O   ? ? A CA 1004 A LEU 99   1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc32 metalc ? ? F CA . CA ? ? ? 1_555 A GLU 104 OE1 ? ? A CA 1004 A GLU 104  1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc33 metalc ? ? F CA . CA ? ? ? 1_555 A GLU 104 OE2 ? ? A CA 1004 A GLU 104  1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc34 metalc ? ? F CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 1004 A HOH 2128 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc35 metalc ? ? F CA . CA ? ? ? 1_555 A ASN 97  OD1 ? ? A CA 1004 A ASN 97   1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc36 metalc ? ? E CA . CA ? ? ? 1_555 A ASP 58  OD2 ? ? A CA 1003 A ASP 58   1_545 ? ? ? ? ? ? ? 2.375 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 26 ? ILE A 27 ? THR A 26 ILE A 27 
A 2 ILE A 63 ? ASP A 64 ? ILE A 63 ASP A 64 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    27 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     27 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    63 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     63 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1000' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 1001' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1002' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1003' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 20  ? ASP A 20   . ? 1_555 ? 
2  AC1 6 ASP A 22  ? ASP A 22   . ? 1_555 ? 
3  AC1 6 ASP A 24  ? ASP A 24   . ? 1_555 ? 
4  AC1 6 THR A 26  ? THR A 26   . ? 1_555 ? 
5  AC1 6 GLU A 31  ? GLU A 31   . ? 1_555 ? 
6  AC1 6 HOH G .   ? HOH A 2122 . ? 1_555 ? 
7  AC2 7 ASP A 56  ? ASP A 56   . ? 1_555 ? 
8  AC2 7 ASP A 58  ? ASP A 58   . ? 1_555 ? 
9  AC2 7 ASN A 60  ? ASN A 60   . ? 1_555 ? 
10 AC2 7 THR A 62  ? THR A 62   . ? 1_555 ? 
11 AC2 7 GLU A 67  ? GLU A 67   . ? 1_555 ? 
12 AC2 7 HOH G .   ? HOH A 2011 . ? 1_555 ? 
13 AC2 7 HOH G .   ? HOH A 2127 . ? 1_555 ? 
14 AC3 6 ASP A 129 ? ASP A 129  . ? 1_555 ? 
15 AC3 6 ASP A 131 ? ASP A 131  . ? 1_555 ? 
16 AC3 6 ASP A 133 ? ASP A 133  . ? 1_555 ? 
17 AC3 6 HIS A 135 ? HIS A 135  . ? 1_555 ? 
18 AC3 6 GLU A 140 ? GLU A 140  . ? 1_555 ? 
19 AC3 6 HOH G .   ? HOH A 2129 . ? 1_555 ? 
20 AC4 6 GLU A 47  ? GLU A 47   . ? 1_555 ? 
21 AC4 6 ASP A 58  ? ASP A 58   . ? 1_545 ? 
22 AC4 6 HOH G .   ? HOH A 2123 . ? 1_555 ? 
23 AC4 6 HOH G .   ? HOH A 2124 . ? 1_555 ? 
24 AC4 6 HOH G .   ? HOH A 2125 . ? 1_555 ? 
25 AC4 6 HOH G .   ? HOH A 2126 . ? 1_555 ? 
26 AC5 6 ASP A 93  ? ASP A 93   . ? 1_555 ? 
27 AC5 6 ASP A 95  ? ASP A 95   . ? 1_555 ? 
28 AC5 6 ASN A 97  ? ASN A 97   . ? 1_555 ? 
29 AC5 6 LEU A 99  ? LEU A 99   . ? 1_555 ? 
30 AC5 6 GLU A 104 ? GLU A 104  . ? 1_555 ? 
31 AC5 6 HOH G .   ? HOH A 2128 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EXR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EXR 
_atom_sites.fract_transf_matrix[1][1]   0.039976 
_atom_sites.fract_transf_matrix[1][2]   -0.005341 
_atom_sites.fract_transf_matrix[1][3]   -0.002731 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.034298 
_atom_sites.fract_transf_matrix[2][3]   0.000034 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018997 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 2   ? 43.445 22.193  16.450  1.00 73.63 ? 2    GLU A N   1 
ATOM   2    C  CA  . GLU A 1 2   ? 44.063 20.888  16.709  1.00 54.51 ? 2    GLU A CA  1 
ATOM   3    C  C   . GLU A 1 2   ? 43.253 19.758  16.065  1.00 43.35 ? 2    GLU A C   1 
ATOM   4    O  O   . GLU A 1 2   ? 42.032 19.888  16.012  1.00 56.10 ? 2    GLU A O   1 
ATOM   5    C  CB  . GLU A 1 2   ? 44.191 20.638  18.194  1.00 47.59 ? 2    GLU A CB  1 
ATOM   6    C  CG  . GLU A 1 2   ? 44.656 19.300  18.619  1.00 45.96 ? 2    GLU A CG  1 
ATOM   7    C  CD  . GLU A 1 2   ? 43.705 18.165  18.854  1.00 48.36 ? 2    GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1 2   ? 43.991 17.337  19.725  1.00 57.68 ? 2    GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1 2   ? 42.673 18.032  18.165  1.00 67.34 ? 2    GLU A OE2 1 
ATOM   10   N  N   . GLN A 1 3   ? 44.017 18.747  15.676  1.00 43.35 ? 3    GLN A N   1 
ATOM   11   C  CA  . GLN A 1 3   ? 43.537 17.695  14.807  1.00 43.98 ? 3    GLN A CA  1 
ATOM   12   C  C   . GLN A 1 3   ? 44.577 16.589  14.589  1.00 32.96 ? 3    GLN A C   1 
ATOM   13   O  O   . GLN A 1 3   ? 44.279 15.499  15.107  1.00 32.39 ? 3    GLN A O   1 
ATOM   14   C  CB  . GLN A 1 3   ? 43.084 18.249  13.460  1.00 55.09 ? 3    GLN A CB  1 
ATOM   15   C  CG  . GLN A 1 3   ? 42.109 17.382  12.679  1.00 54.76 ? 3    GLN A CG  1 
ATOM   16   C  CD  . GLN A 1 3   ? 40.860 17.060  13.478  1.00 56.67 ? 3    GLN A CD  1 
ATOM   17   O  OE1 . GLN A 1 3   ? 40.994 16.649  14.628  1.00 69.10 ? 3    GLN A OE1 1 
ATOM   18   N  NE2 . GLN A 1 3   ? 39.641 17.205  12.979  1.00 57.86 ? 3    GLN A NE2 1 
ATOM   19   N  N   . LEU A 1 4   ? 45.660 16.805  13.868  1.00 30.29 ? 4    LEU A N   1 
ATOM   20   C  CA  . LEU A 1 4   ? 46.704 15.831  13.550  1.00 29.51 ? 4    LEU A CA  1 
ATOM   21   C  C   . LEU A 1 4   ? 48.129 16.353  13.615  1.00 28.22 ? 4    LEU A C   1 
ATOM   22   O  O   . LEU A 1 4   ? 48.508 17.449  13.168  1.00 32.63 ? 4    LEU A O   1 
ATOM   23   C  CB  . LEU A 1 4   ? 46.537 15.239  12.129  1.00 32.41 ? 4    LEU A CB  1 
ATOM   24   C  CG  . LEU A 1 4   ? 45.227 14.533  11.821  1.00 34.37 ? 4    LEU A CG  1 
ATOM   25   C  CD1 . LEU A 1 4   ? 45.072 14.269  10.326  1.00 36.23 ? 4    LEU A CD1 1 
ATOM   26   C  CD2 . LEU A 1 4   ? 45.137 13.224  12.585  1.00 35.72 ? 4    LEU A CD2 1 
ATOM   27   N  N   . THR A 1 5   ? 49.020 15.460  14.115  1.00 24.13 ? 5    THR A N   1 
ATOM   28   C  CA  . THR A 1 5   ? 50.447 15.810  14.079  1.00 23.38 ? 5    THR A CA  1 
ATOM   29   C  C   . THR A 1 5   ? 51.039 15.570  12.684  1.00 22.54 ? 5    THR A C   1 
ATOM   30   O  O   . THR A 1 5   ? 50.461 14.847  11.858  1.00 19.96 ? 5    THR A O   1 
ATOM   31   C  CB  . THR A 1 5   ? 51.236 14.959  15.073  1.00 19.48 ? 5    THR A CB  1 
ATOM   32   O  OG1 . THR A 1 5   ? 51.155 13.611  14.632  1.00 18.67 ? 5    THR A OG1 1 
ATOM   33   C  CG2 . THR A 1 5   ? 50.648 15.068  16.495  1.00 22.08 ? 5    THR A CG2 1 
ATOM   34   N  N   . GLU A 1 6   ? 52.224 16.134  12.437  1.00 24.24 ? 6    GLU A N   1 
ATOM   35   C  CA  . GLU A 1 6   ? 52.947 15.908  11.180  1.00 23.41 ? 6    GLU A CA  1 
ATOM   36   C  C   . GLU A 1 6   ? 53.233 14.406  11.037  1.00 21.17 ? 6    GLU A C   1 
ATOM   37   O  O   . GLU A 1 6   ? 53.136 13.822  9.913   1.00 20.41 ? 6    GLU A O   1 
ATOM   38   C  CB  . GLU A 1 6   ? 54.201 16.766  11.171  1.00 29.54 ? 6    GLU A CB  1 
ATOM   39   C  CG  . GLU A 1 6   ? 54.891 16.943  9.799   1.00 34.48 ? 6    GLU A CG  1 
ATOM   40   C  CD  . GLU A 1 6   ? 55.262 18.434  9.823   1.00 41.97 ? 6    GLU A CD  1 
ATOM   41   O  OE1 . GLU A 1 6   ? 54.687 18.992  10.803  1.00 58.16 ? 6    GLU A OE1 1 
ATOM   42   O  OE2 . GLU A 1 6   ? 56.009 18.919  9.000   1.00 59.80 ? 6    GLU A OE2 1 
ATOM   43   N  N   . GLU A 1 7   ? 53.533 13.702  12.116  1.00 20.13 ? 7    GLU A N   1 
ATOM   44   C  CA  . GLU A 1 7   ? 53.762 12.263  12.038  1.00 18.74 ? 7    GLU A CA  1 
ATOM   45   C  C   . GLU A 1 7   ? 52.498 11.484  11.693  1.00 16.59 ? 7    GLU A C   1 
ATOM   46   O  O   . GLU A 1 7   ? 52.569 10.583  10.885  1.00 17.01 ? 7    GLU A O   1 
ATOM   47   C  CB  . GLU A 1 7   ? 54.372 11.761  13.341  1.00 20.40 ? 7    GLU A CB  1 
ATOM   48   C  CG  . GLU A 1 7   ? 54.593 10.273  13.376  1.00 25.03 ? 7    GLU A CG  1 
ATOM   49   C  CD  . GLU A 1 7   ? 55.520 9.719   12.310  1.00 28.18 ? 7    GLU A CD  1 
ATOM   50   O  OE1 . GLU A 1 7   ? 56.482 10.353  11.807  1.00 41.67 ? 7    GLU A OE1 1 
ATOM   51   O  OE2 . GLU A 1 7   ? 55.305 8.552   11.930  1.00 33.78 ? 7    GLU A OE2 1 
ATOM   52   N  N   . GLN A 1 8   ? 51.345 11.827  12.274  1.00 16.10 ? 8    GLN A N   1 
ATOM   53   C  CA  . GLN A 1 8   ? 50.125 11.194  11.846  1.00 15.79 ? 8    GLN A CA  1 
ATOM   54   C  C   . GLN A 1 8   ? 49.860 11.431  10.346  1.00 14.53 ? 8    GLN A C   1 
ATOM   55   O  O   . GLN A 1 8   ? 49.477 10.500  9.631   1.00 14.74 ? 8    GLN A O   1 
ATOM   56   C  CB  . GLN A 1 8   ? 48.901 11.729  12.636  1.00 17.49 ? 8    GLN A CB  1 
ATOM   57   C  CG  . GLN A 1 8   ? 48.898 11.267  14.104  1.00 19.61 ? 8    GLN A CG  1 
ATOM   58   C  CD  . GLN A 1 8   ? 47.721 11.984  14.800  1.00 22.58 ? 8    GLN A CD  1 
ATOM   59   O  OE1 . GLN A 1 8   ? 47.751 13.197  14.980  1.00 23.84 ? 8    GLN A OE1 1 
ATOM   60   N  NE2 . GLN A 1 8   ? 46.715 11.193  15.121  1.00 25.44 ? 8    GLN A NE2 1 
ATOM   61   N  N   A ILE A 1 9   ? 50.042 12.619  9.863   0.60 15.47 ? 9    ILE A N   1 
ATOM   62   N  N   B ILE A 1 9   ? 50.064 12.669  9.955   0.40 15.79 ? 9    ILE A N   1 
ATOM   63   C  CA  A ILE A 1 9   ? 49.760 12.880  8.443   0.60 16.16 ? 9    ILE A CA  1 
ATOM   64   C  CA  B ILE A 1 9   ? 49.894 13.068  8.557   0.40 14.97 ? 9    ILE A CA  1 
ATOM   65   C  C   A ILE A 1 9   ? 50.740 12.096  7.568   0.60 16.68 ? 9    ILE A C   1 
ATOM   66   C  C   B ILE A 1 9   ? 50.739 12.182  7.629   0.40 15.01 ? 9    ILE A C   1 
ATOM   67   O  O   A ILE A 1 9   ? 50.344 11.527  6.549   0.60 13.30 ? 9    ILE A O   1 
ATOM   68   O  O   B ILE A 1 9   ? 50.215 11.661  6.634   0.40 13.83 ? 9    ILE A O   1 
ATOM   69   C  CB  A ILE A 1 9   ? 49.712 14.388  8.233   0.60 17.94 ? 9    ILE A CB  1 
ATOM   70   C  CB  B ILE A 1 9   ? 50.201 14.546  8.306   0.40 15.90 ? 9    ILE A CB  1 
ATOM   71   C  CG1 A ILE A 1 9   ? 48.529 15.065  8.881   0.60 19.71 ? 9    ILE A CG1 1 
ATOM   72   C  CG1 B ILE A 1 9   ? 49.111 15.466  8.868   0.40 14.83 ? 9    ILE A CG1 1 
ATOM   73   C  CG2 A ILE A 1 9   ? 49.644 14.632  6.712   0.60 18.98 ? 9    ILE A CG2 1 
ATOM   74   C  CG2 B ILE A 1 9   ? 50.339 14.857  6.814   0.40 13.92 ? 9    ILE A CG2 1 
ATOM   75   C  CD1 A ILE A 1 9   ? 48.524 16.563  9.024   0.60 23.19 ? 9    ILE A CD1 1 
ATOM   76   C  CD1 B ILE A 1 9   ? 49.568 16.907  8.941   0.40 21.29 ? 9    ILE A CD1 1 
ATOM   77   N  N   . ALA A 1 10  ? 52.006 12.040  7.976   1.00 16.22 ? 10   ALA A N   1 
ATOM   78   C  CA  . ALA A 1 10  ? 52.970 11.271  7.207   1.00 15.86 ? 10   ALA A CA  1 
ATOM   79   C  C   . ALA A 1 10  ? 52.525 9.824   7.134   1.00 14.08 ? 10   ALA A C   1 
ATOM   80   O  O   . ALA A 1 10  ? 52.586 9.200   6.066   1.00 14.53 ? 10   ALA A O   1 
ATOM   81   C  CB  . ALA A 1 10  ? 54.346 11.404  7.820   1.00 18.40 ? 10   ALA A CB  1 
ATOM   82   N  N   A GLU A 1 11  ? 52.061 9.296   8.275   0.44 15.90 ? 11   GLU A N   1 
ATOM   83   N  N   B GLU A 1 11  ? 52.057 9.197   8.209   0.56 15.09 ? 11   GLU A N   1 
ATOM   84   C  CA  A GLU A 1 11  ? 51.546 7.936   8.363   0.44 14.66 ? 11   GLU A CA  1 
ATOM   85   C  CA  B GLU A 1 11  ? 51.682 7.783   8.120   0.56 15.80 ? 11   GLU A CA  1 
ATOM   86   C  C   A GLU A 1 11  ? 50.383 7.727   7.397   0.44 13.66 ? 11   GLU A C   1 
ATOM   87   C  C   B GLU A 1 11  ? 50.422 7.562   7.298   0.56 14.26 ? 11   GLU A C   1 
ATOM   88   O  O   A GLU A 1 11  ? 50.391 6.775   6.606   0.44 12.45 ? 11   GLU A O   1 
ATOM   89   O  O   B GLU A 1 11  ? 50.190 6.519   6.668   0.56 17.23 ? 11   GLU A O   1 
ATOM   90   C  CB  A GLU A 1 11  ? 51.112 7.561   9.802   0.44 17.94 ? 11   GLU A CB  1 
ATOM   91   C  CB  B GLU A 1 11  ? 51.550 7.251   9.567   0.56 16.15 ? 11   GLU A CB  1 
ATOM   92   C  CG  A GLU A 1 11  ? 52.323 7.209   10.666  0.44 21.16 ? 11   GLU A CG  1 
ATOM   93   C  CG  B GLU A 1 11  ? 52.838 7.443   10.375  0.56 20.25 ? 11   GLU A CG  1 
ATOM   94   C  CD  A GLU A 1 11  ? 52.011 7.191   12.138  0.44 25.14 ? 11   GLU A CD  1 
ATOM   95   C  CD  B GLU A 1 11  ? 52.867 6.691   11.676  0.56 22.28 ? 11   GLU A CD  1 
ATOM   96   O  OE1 A GLU A 1 11  ? 50.841 7.137   12.571  0.44 31.42 ? 11   GLU A OE1 1 
ATOM   97   O  OE1 B GLU A 1 11  ? 51.880 5.993   12.030  0.56 32.07 ? 11   GLU A OE1 1 
ATOM   98   O  OE2 A GLU A 1 11  ? 52.985 7.223   12.925  0.44 28.65 ? 11   GLU A OE2 1 
ATOM   99   O  OE2 B GLU A 1 11  ? 53.923 6.803   12.349  0.56 26.18 ? 11   GLU A OE2 1 
ATOM   100  N  N   A PHE A 1 12  ? 49.411 8.638   7.472   0.74 12.88 ? 12   PHE A N   1 
ATOM   101  N  N   B PHE A 1 12  ? 49.598 8.607   7.312   0.26 13.92 ? 12   PHE A N   1 
ATOM   102  C  CA  A PHE A 1 12  ? 48.304 8.548   6.541   0.74 12.86 ? 12   PHE A CA  1 
ATOM   103  C  CA  B PHE A 1 12  ? 48.330 8.560   6.599   0.26 13.28 ? 12   PHE A CA  1 
ATOM   104  C  C   A PHE A 1 12  ? 48.737 8.638   5.082   0.74 10.52 ? 12   PHE A C   1 
ATOM   105  C  C   B PHE A 1 12  ? 48.559 8.720   5.105   0.26 12.24 ? 12   PHE A C   1 
ATOM   106  O  O   A PHE A 1 12  ? 48.228 7.899   4.227   0.74 10.86 ? 12   PHE A O   1 
ATOM   107  O  O   B PHE A 1 12  ? 47.882 8.163   4.245   0.26 8.55  ? 12   PHE A O   1 
ATOM   108  C  CB  A PHE A 1 12  ? 47.233 9.654   6.827   0.74 13.43 ? 12   PHE A CB  1 
ATOM   109  C  CB  B PHE A 1 12  ? 47.404 9.653   7.146   0.26 14.93 ? 12   PHE A CB  1 
ATOM   110  C  CG  A PHE A 1 12  ? 46.406 9.387   8.081   0.74 15.90 ? 12   PHE A CG  1 
ATOM   111  C  CG  B PHE A 1 12  ? 46.779 9.369   8.508   0.26 18.63 ? 12   PHE A CG  1 
ATOM   112  C  CD1 A PHE A 1 12  ? 45.729 8.177   8.186   0.74 22.70 ? 12   PHE A CD1 1 
ATOM   113  C  CD1 B PHE A 1 12  ? 46.363 8.099   8.866   0.26 22.51 ? 12   PHE A CD1 1 
ATOM   114  C  CD2 A PHE A 1 12  ? 46.355 10.237  9.122   0.74 15.13 ? 12   PHE A CD2 1 
ATOM   115  C  CD2 B PHE A 1 12  ? 46.611 10.372  9.442   0.26 18.09 ? 12   PHE A CD2 1 
ATOM   116  C  CE1 A PHE A 1 12  ? 45.018 7.857   9.320   0.74 24.63 ? 12   PHE A CE1 1 
ATOM   117  C  CE1 B PHE A 1 12  ? 45.792 7.812   10.087  0.26 20.64 ? 12   PHE A CE1 1 
ATOM   118  C  CE2 A PHE A 1 12  ? 45.581 9.970   10.240  0.74 18.86 ? 12   PHE A CE2 1 
ATOM   119  C  CE2 B PHE A 1 12  ? 46.019 10.110  10.665  0.26 19.05 ? 12   PHE A CE2 1 
ATOM   120  C  CZ  A PHE A 1 12  ? 44.940 8.767   10.347  0.74 21.27 ? 12   PHE A CZ  1 
ATOM   121  C  CZ  B PHE A 1 12  ? 45.596 8.836   10.984  0.26 21.51 ? 12   PHE A CZ  1 
ATOM   122  N  N   A LYS A 1 13  ? 49.695 9.522   4.764   0.60 11.31 ? 13   LYS A N   1 
ATOM   123  N  N   B LYS A 1 13  ? 49.588 9.511   4.789   0.40 11.20 ? 13   LYS A N   1 
ATOM   124  C  CA  A LYS A 1 13  ? 50.180 9.678   3.402   0.60 10.51 ? 13   LYS A CA  1 
ATOM   125  C  CA  B LYS A 1 13  ? 50.030 9.641   3.407   0.40 10.54 ? 13   LYS A CA  1 
ATOM   126  C  C   A LYS A 1 13  ? 50.851 8.423   2.882   0.60 9.38  ? 13   LYS A C   1 
ATOM   127  C  C   B LYS A 1 13  ? 50.691 8.339   2.963   0.40 9.21  ? 13   LYS A C   1 
ATOM   128  O  O   A LYS A 1 13  ? 50.784 8.019   1.699   0.60 8.81  ? 13   LYS A O   1 
ATOM   129  O  O   B LYS A 1 13  ? 50.352 7.902   1.842   0.40 8.43  ? 13   LYS A O   1 
ATOM   130  C  CB  A LYS A 1 13  ? 51.173 10.843  3.303   0.60 12.72 ? 13   LYS A CB  1 
ATOM   131  C  CB  B LYS A 1 13  ? 50.949 10.841  3.242   0.40 10.09 ? 13   LYS A CB  1 
ATOM   132  C  CG  A LYS A 1 13  ? 50.554 12.228  3.335   0.60 12.59 ? 13   LYS A CG  1 
ATOM   133  C  CG  B LYS A 1 13  ? 51.423 11.239  1.864   0.40 14.79 ? 13   LYS A CG  1 
ATOM   134  C  CD  A LYS A 1 13  ? 51.479 13.381  3.018   0.60 18.14 ? 13   LYS A CD  1 
ATOM   135  C  CD  B LYS A 1 13  ? 51.239 12.694  1.508   0.40 29.52 ? 13   LYS A CD  1 
ATOM   136  C  CE  A LYS A 1 13  ? 50.713 14.710  2.957   0.60 22.58 ? 13   LYS A CE  1 
ATOM   137  C  CE  B LYS A 1 13  ? 50.819 13.045  0.081   0.40 37.43 ? 13   LYS A CE  1 
ATOM   138  N  NZ  A LYS A 1 13  ? 51.606 15.877  2.828   0.60 29.13 ? 13   LYS A NZ  1 
ATOM   139  N  NZ  B LYS A 1 13  ? 51.381 14.371  -0.347  0.40 30.33 ? 13   LYS A NZ  1 
ATOM   140  N  N   . GLU A 1 14  ? 51.571 7.722   3.759   1.00 10.98 ? 14   GLU A N   1 
ATOM   141  C  CA  . GLU A 1 14  ? 52.197 6.459   3.379   1.00 11.86 ? 14   GLU A CA  1 
ATOM   142  C  C   . GLU A 1 14  ? 51.131 5.406   3.064   1.00 11.82 ? 14   GLU A C   1 
ATOM   143  O  O   . GLU A 1 14  ? 51.230 4.617   2.102   1.00 12.70 ? 14   GLU A O   1 
ATOM   144  C  CB  . GLU A 1 14  ? 53.140 5.974   4.522   1.00 15.01 ? 14   GLU A CB  1 
ATOM   145  C  CG  . GLU A 1 14  ? 54.369 6.835   4.703   1.00 18.80 ? 14   GLU A CG  1 
ATOM   146  C  CD  . GLU A 1 14  ? 55.151 6.551   5.982   1.00 27.48 ? 14   GLU A CD  1 
ATOM   147  O  OE1 . GLU A 1 14  ? 54.567 6.274   7.043   1.00 27.17 ? 14   GLU A OE1 1 
ATOM   148  O  OE2 . GLU A 1 14  ? 56.400 6.660   5.994   1.00 34.88 ? 14   GLU A OE2 1 
ATOM   149  N  N   . ALA A 1 15  ? 50.061 5.384   3.877   1.00 11.67 ? 15   ALA A N   1 
ATOM   150  C  CA  . ALA A 1 15  ? 48.960 4.448   3.626   1.00 11.89 ? 15   ALA A CA  1 
ATOM   151  C  C   . ALA A 1 15  ? 48.280 4.775   2.282   1.00 10.70 ? 15   ALA A C   1 
ATOM   152  O  O   . ALA A 1 15  ? 47.969 3.888   1.488   1.00 13.00 ? 15   ALA A O   1 
ATOM   153  C  CB  . ALA A 1 15  ? 47.971 4.470   4.762   1.00 14.35 ? 15   ALA A CB  1 
ATOM   154  N  N   . PHE A 1 16  ? 48.001 6.075   2.071   1.00 9.34  ? 16   PHE A N   1 
ATOM   155  C  CA  . PHE A 1 16  ? 47.395 6.480   0.792   1.00 8.45  ? 16   PHE A CA  1 
ATOM   156  C  C   . PHE A 1 16  ? 48.233 6.057   -0.379  1.00 8.21  ? 16   PHE A C   1 
ATOM   157  O  O   . PHE A 1 16  ? 47.686 5.591   -1.412  1.00 8.95  ? 16   PHE A O   1 
ATOM   158  C  CB  . PHE A 1 16  ? 47.218 8.009   0.814   1.00 8.36  ? 16   PHE A CB  1 
ATOM   159  C  CG  . PHE A 1 16  ? 46.484 8.571   -0.372  1.00 7.37  ? 16   PHE A CG  1 
ATOM   160  C  CD1 . PHE A 1 16  ? 45.107 8.614   -0.414  1.00 8.53  ? 16   PHE A CD1 1 
ATOM   161  C  CD2 . PHE A 1 16  ? 47.190 9.084   -1.436  1.00 8.44  ? 16   PHE A CD2 1 
ATOM   162  C  CE1 . PHE A 1 16  ? 44.442 9.156   -1.508  1.00 8.92  ? 16   PHE A CE1 1 
ATOM   163  C  CE2 . PHE A 1 16  ? 46.553 9.620   -2.534  1.00 9.01  ? 16   PHE A CE2 1 
ATOM   164  C  CZ  . PHE A 1 16  ? 45.163 9.663   -2.573  1.00 9.14  ? 16   PHE A CZ  1 
ATOM   165  N  N   . ALA A 1 17  ? 49.537 6.223   -0.276  1.00 8.73  ? 17   ALA A N   1 
ATOM   166  C  CA  . ALA A 1 17  ? 50.459 5.882   -1.385  1.00 9.18  ? 17   ALA A CA  1 
ATOM   167  C  C   . ALA A 1 17  ? 50.368 4.440   -1.777  1.00 10.51 ? 17   ALA A C   1 
ATOM   168  O  O   . ALA A 1 17  ? 50.576 4.108   -2.971  1.00 12.06 ? 17   ALA A O   1 
ATOM   169  C  CB  . ALA A 1 17  ? 51.864 6.313   -0.985  1.00 10.81 ? 17   ALA A CB  1 
ATOM   170  N  N   . LEU A 1 18  ? 50.110 3.524   -0.834  1.00 10.59 ? 18   LEU A N   1 
ATOM   171  C  CA  . LEU A 1 18  ? 49.972 2.115   -1.220  1.00 11.42 ? 18   LEU A CA  1 
ATOM   172  C  C   . LEU A 1 18  ? 48.882 1.885   -2.202  1.00 10.28 ? 18   LEU A C   1 
ATOM   173  O  O   . LEU A 1 18  ? 48.956 1.002   -3.054  1.00 12.65 ? 18   LEU A O   1 
ATOM   174  C  CB  . LEU A 1 18  ? 49.698 1.259   0.036   1.00 19.09 ? 18   LEU A CB  1 
ATOM   175  C  CG  . LEU A 1 18  ? 49.301 -0.206  -0.323  1.00 21.34 ? 18   LEU A CG  1 
ATOM   176  C  CD1 . LEU A 1 18  ? 50.511 -0.957  -0.886  1.00 30.08 ? 18   LEU A CD1 1 
ATOM   177  C  CD2 . LEU A 1 18  ? 48.688 -0.926  0.841   1.00 29.88 ? 18   LEU A CD2 1 
ATOM   178  N  N   . PHE A 1 19  ? 47.807 2.685   -2.112  1.00 9.03  ? 19   PHE A N   1 
ATOM   179  C  CA  . PHE A 1 19  ? 46.708 2.595   -3.048  1.00 8.68  ? 19   PHE A CA  1 
ATOM   180  C  C   . PHE A 1 19  ? 46.953 3.396   -4.326  1.00 8.07  ? 19   PHE A C   1 
ATOM   181  O  O   . PHE A 1 19  ? 46.590 2.958   -5.419  1.00 8.74  ? 19   PHE A O   1 
ATOM   182  C  CB  . PHE A 1 19  ? 45.399 3.110   -2.401  1.00 9.31  ? 19   PHE A CB  1 
ATOM   183  C  CG  . PHE A 1 19  ? 44.885 2.254   -1.272  1.00 9.51  ? 19   PHE A CG  1 
ATOM   184  C  CD1 . PHE A 1 19  ? 43.982 1.216   -1.516  1.00 11.46 ? 19   PHE A CD1 1 
ATOM   185  C  CD2 . PHE A 1 19  ? 45.312 2.478   0.019   1.00 11.34 ? 19   PHE A CD2 1 
ATOM   186  C  CE1 . PHE A 1 19  ? 43.539 0.401   -0.518  1.00 12.98 ? 19   PHE A CE1 1 
ATOM   187  C  CE2 . PHE A 1 19  ? 44.855 1.623   1.036   1.00 14.14 ? 19   PHE A CE2 1 
ATOM   188  C  CZ  . PHE A 1 19  ? 43.939 0.627   0.753   1.00 12.90 ? 19   PHE A CZ  1 
ATOM   189  N  N   . ASP A 1 20  ? 47.543 4.587   -4.198  1.00 8.52  ? 20   ASP A N   1 
ATOM   190  C  CA  . ASP A 1 20  ? 47.768 5.491   -5.306  1.00 7.43  ? 20   ASP A CA  1 
ATOM   191  C  C   . ASP A 1 20  ? 49.013 5.082   -6.062  1.00 8.75  ? 20   ASP A C   1 
ATOM   192  O  O   . ASP A 1 20  ? 50.085 5.715   -6.020  1.00 10.32 ? 20   ASP A O   1 
ATOM   193  C  CB  . ASP A 1 20  ? 47.839 6.934   -4.815  1.00 8.19  ? 20   ASP A CB  1 
ATOM   194  C  CG  . ASP A 1 20  ? 48.078 7.909   -5.950  1.00 7.50  ? 20   ASP A CG  1 
ATOM   195  O  OD1 . ASP A 1 20  ? 47.863 7.544   -7.118  1.00 7.79  ? 20   ASP A OD1 1 
ATOM   196  O  OD2 . ASP A 1 20  ? 48.484 9.062   -5.656  1.00 8.56  ? 20   ASP A OD2 1 
ATOM   197  N  N   . LYS A 1 21  ? 48.898 3.976   -6.798  1.00 9.97  ? 21   LYS A N   1 
ATOM   198  C  CA  . LYS A 1 21  ? 49.964 3.285   -7.532  1.00 12.02 ? 21   LYS A CA  1 
ATOM   199  C  C   . LYS A 1 21  ? 50.726 4.183   -8.470  1.00 10.89 ? 21   LYS A C   1 
ATOM   200  O  O   . LYS A 1 21  ? 51.946 4.020   -8.611  1.00 12.86 ? 21   LYS A O   1 
ATOM   201  C  CB  . LYS A 1 21  ? 49.421 2.068   -8.298  1.00 15.07 ? 21   LYS A CB  1 
ATOM   202  C  CG  . LYS A 1 21  ? 48.752 1.002   -7.488  1.00 13.01 ? 21   LYS A CG  1 
ATOM   203  C  CD  . LYS A 1 21  ? 49.673 0.566   -6.366  1.00 15.84 ? 21   LYS A CD  1 
ATOM   204  C  CE  . LYS A 1 21  ? 49.214 -0.839  -5.808  1.00 15.69 ? 21   LYS A CE  1 
ATOM   205  N  NZ  . LYS A 1 21  ? 49.951 -1.144  -4.547  1.00 12.29 ? 21   LYS A NZ  1 
ATOM   206  N  N   . ASP A 1 22  ? 50.005 5.067   -9.128  1.00 10.00 ? 22   ASP A N   1 
ATOM   207  C  CA  . ASP A 1 22  ? 50.622 5.935   -10.122 1.00 9.95  ? 22   ASP A CA  1 
ATOM   208  C  C   . ASP A 1 22  ? 50.954 7.307   -9.605  1.00 9.63  ? 22   ASP A C   1 
ATOM   209  O  O   . ASP A 1 22  ? 51.445 8.143   -10.357 1.00 10.89 ? 22   ASP A O   1 
ATOM   210  C  CB  . ASP A 1 22  ? 49.844 6.029   -11.426 1.00 11.01 ? 22   ASP A CB  1 
ATOM   211  C  CG  . ASP A 1 22  ? 48.534 6.778   -11.338 1.00 10.36 ? 22   ASP A CG  1 
ATOM   212  O  OD1 . ASP A 1 22  ? 48.113 7.194   -10.234 1.00 9.48  ? 22   ASP A OD1 1 
ATOM   213  O  OD2 . ASP A 1 22  ? 47.940 6.899   -12.427 1.00 13.80 ? 22   ASP A OD2 1 
ATOM   214  N  N   . GLY A 1 23  ? 50.758 7.567   -8.294  1.00 9.13  ? 23   GLY A N   1 
ATOM   215  C  CA  . GLY A 1 23  ? 51.165 8.826   -7.701  1.00 9.50  ? 23   GLY A CA  1 
ATOM   216  C  C   . GLY A 1 23  ? 50.452 10.034  -8.231  1.00 8.83  ? 23   GLY A C   1 
ATOM   217  O  O   . GLY A 1 23  ? 51.048 11.142  -8.196  1.00 12.42 ? 23   GLY A O   1 
ATOM   218  N  N   . ASP A 1 24  ? 49.237 9.932   -8.723  1.00 8.29  ? 24   ASP A N   1 
ATOM   219  C  CA  . ASP A 1 24  ? 48.518 11.082  -9.243  1.00 8.33  ? 24   ASP A CA  1 
ATOM   220  C  C   . ASP A 1 24  ? 47.675 11.791  -8.228  1.00 7.68  ? 24   ASP A C   1 
ATOM   221  O  O   . ASP A 1 24  ? 46.955 12.739  -8.570  1.00 8.88  ? 24   ASP A O   1 
ATOM   222  C  CB  . ASP A 1 24  ? 47.656 10.734  -10.479 1.00 8.32  ? 24   ASP A CB  1 
ATOM   223  C  CG  . ASP A 1 24  ? 46.299 10.171  -10.065 1.00 7.96  ? 24   ASP A CG  1 
ATOM   224  O  OD1 . ASP A 1 24  ? 46.270 9.452   -9.049  1.00 7.74  ? 24   ASP A OD1 1 
ATOM   225  O  OD2 . ASP A 1 24  ? 45.304 10.417  -10.768 1.00 9.50  ? 24   ASP A OD2 1 
ATOM   226  N  N   . GLY A 1 25  ? 47.744 11.412  -6.951  1.00 7.54  ? 25   GLY A N   1 
ATOM   227  C  CA  . GLY A 1 25  ? 46.928 12.066  -5.933  1.00 7.50  ? 25   GLY A CA  1 
ATOM   228  C  C   . GLY A 1 25  ? 45.518 11.603  -5.832  1.00 6.87  ? 25   GLY A C   1 
ATOM   229  O  O   . GLY A 1 25  ? 44.725 12.228  -5.118  1.00 7.44  ? 25   GLY A O   1 
ATOM   230  N  N   . THR A 1 26  ? 45.172 10.515  -6.498  1.00 7.15  ? 26   THR A N   1 
ATOM   231  C  CA  . THR A 1 26  ? 43.815 9.967   -6.428  1.00 7.23  ? 26   THR A CA  1 
ATOM   232  C  C   . THR A 1 26  ? 43.920 8.447   -6.389  1.00 7.12  ? 26   THR A C   1 
ATOM   233  O  O   . THR A 1 26  ? 44.880 7.857   -6.907  1.00 7.79  ? 26   THR A O   1 
ATOM   234  C  CB  . THR A 1 26  ? 42.906 10.362  -7.595  1.00 7.78  ? 26   THR A CB  1 
ATOM   235  O  OG1 . THR A 1 26  ? 43.195 9.637   -8.799  1.00 9.17  ? 26   THR A OG1 1 
ATOM   236  C  CG2 . THR A 1 26  ? 42.944 11.850  -7.864  1.00 8.63  ? 26   THR A CG2 1 
ATOM   237  N  N   . ILE A 1 27  ? 42.899 7.839   -5.799  1.00 7.30  ? 27   ILE A N   1 
ATOM   238  C  CA  . ILE A 1 27  ? 42.705 6.385   -5.817  1.00 7.78  ? 27   ILE A CA  1 
ATOM   239  C  C   . ILE A 1 27  ? 41.475 6.112   -6.709  1.00 8.23  ? 27   ILE A C   1 
ATOM   240  O  O   . ILE A 1 27  ? 40.357 6.587   -6.399  1.00 8.36  ? 27   ILE A O   1 
ATOM   241  C  CB  . ILE A 1 27  ? 42.504 5.789   -4.439  1.00 8.29  ? 27   ILE A CB  1 
ATOM   242  C  CG1 . ILE A 1 27  ? 43.641 6.122   -3.466  1.00 8.26  ? 27   ILE A CG1 1 
ATOM   243  C  CG2 . ILE A 1 27  ? 42.276 4.267   -4.544  1.00 9.78  ? 27   ILE A CG2 1 
ATOM   244  C  CD1 . ILE A 1 27  ? 43.331 5.832   -2.049  1.00 10.08 ? 27   ILE A CD1 1 
ATOM   245  N  N   . THR A 1 28  ? 41.688 5.355   -7.772  1.00 8.54  ? 28   THR A N   1 
ATOM   246  C  CA  . THR A 1 28  ? 40.654 4.920   -8.685  1.00 9.03  ? 28   THR A CA  1 
ATOM   247  C  C   . THR A 1 28  ? 40.079 3.575   -8.289  1.00 9.38  ? 28   THR A C   1 
ATOM   248  O  O   . THR A 1 28  ? 40.661 2.835   -7.470  1.00 8.88  ? 28   THR A O   1 
ATOM   249  C  CB  . THR A 1 28  ? 41.171 4.831   -10.130 1.00 10.13 ? 28   THR A CB  1 
ATOM   250  O  OG1 . THR A 1 28  ? 42.194 3.834   -10.095 1.00 10.90 ? 28   THR A OG1 1 
ATOM   251  C  CG2 . THR A 1 28  ? 41.709 6.140   -10.668 1.00 11.16 ? 28   THR A CG2 1 
ATOM   252  N  N   . THR A 1 29  ? 38.943 3.197   -8.898  1.00 10.72 ? 29   THR A N   1 
ATOM   253  C  CA  . THR A 1 29  ? 38.451 1.837   -8.728  1.00 11.81 ? 29   THR A CA  1 
ATOM   254  C  C   . THR A 1 29  ? 39.528 0.822   -9.148  1.00 11.45 ? 29   THR A C   1 
ATOM   255  O  O   . THR A 1 29  ? 39.679 -0.193  -8.483  1.00 13.27 ? 29   THR A O   1 
ATOM   256  C  CB  . THR A 1 29  ? 37.166 1.580   -9.528  1.00 12.84 ? 29   THR A CB  1 
ATOM   257  O  OG1 . THR A 1 29  ? 37.435 1.928   -10.894 1.00 15.81 ? 29   THR A OG1 1 
ATOM   258  C  CG2 . THR A 1 29  ? 35.962 2.315   -8.967  1.00 16.17 ? 29   THR A CG2 1 
ATOM   259  N  N   . LYS A 1 30  ? 40.242 1.124   -10.249 1.00 12.26 ? 30   LYS A N   1 
ATOM   260  C  CA  . LYS A 1 30  ? 41.260 0.174   -10.730 1.00 14.05 ? 30   LYS A CA  1 
ATOM   261  C  C   . LYS A 1 30  ? 42.340 -0.019  -9.668  1.00 11.59 ? 30   LYS A C   1 
ATOM   262  O  O   . LYS A 1 30  ? 42.767 -1.169  -9.415  1.00 13.55 ? 30   LYS A O   1 
ATOM   263  C  CB  . LYS A 1 30  ? 41.855 0.637   -12.053 1.00 20.00 ? 30   LYS A CB  1 
ATOM   264  C  CG  . LYS A 1 30  ? 42.490 -0.532  -12.785 1.00 40.41 ? 30   LYS A CG  1 
ATOM   265  C  CD  . LYS A 1 30  ? 43.951 -0.705  -12.427 1.00 55.99 ? 30   LYS A CD  1 
ATOM   266  C  CE  . LYS A 1 30  ? 44.265 -2.129  -12.010 1.00 59.77 ? 30   LYS A CE  1 
ATOM   267  N  NZ  . LYS A 1 30  ? 44.100 -3.070  -13.168 1.00 68.75 ? 30   LYS A NZ  1 
ATOM   268  N  N   . GLU A 1 31  ? 42.822 1.066   -9.058  1.00 10.25 ? 31   GLU A N   1 
ATOM   269  C  CA  . GLU A 1 31  ? 43.863 0.972   -8.061  1.00 9.87  ? 31   GLU A CA  1 
ATOM   270  C  C   . GLU A 1 31  ? 43.429 0.286   -6.801  1.00 9.32  ? 31   GLU A C   1 
ATOM   271  O  O   . GLU A 1 31  ? 44.145 -0.502  -6.208  1.00 10.13 ? 31   GLU A O   1 
ATOM   272  C  CB  . GLU A 1 31  ? 44.377 2.411   -7.762  1.00 9.48  ? 31   GLU A CB  1 
ATOM   273  C  CG  . GLU A 1 31  ? 45.245 2.934   -8.865  1.00 9.96  ? 31   GLU A CG  1 
ATOM   274  C  CD  . GLU A 1 31  ? 45.654 4.366   -8.696  1.00 9.16  ? 31   GLU A CD  1 
ATOM   275  O  OE1 . GLU A 1 31  ? 44.840 5.164   -8.141  1.00 8.71  ? 31   GLU A OE1 1 
ATOM   276  O  OE2 . GLU A 1 31  ? 46.750 4.748   -9.169  1.00 10.82 ? 31   GLU A OE2 1 
ATOM   277  N  N   . LEU A 1 32  ? 42.208 0.600   -6.351  1.00 9.70  ? 32   LEU A N   1 
ATOM   278  C  CA  . LEU A 1 32  ? 41.670 -0.112  -5.196  1.00 9.76  ? 32   LEU A CA  1 
ATOM   279  C  C   . LEU A 1 32  ? 41.609 -1.636  -5.512  1.00 9.26  ? 32   LEU A C   1 
ATOM   280  O  O   . LEU A 1 32  ? 41.970 -2.483  -4.725  1.00 9.89  ? 32   LEU A O   1 
ATOM   281  C  CB  . LEU A 1 32  ? 40.278 0.415   -4.858  1.00 9.73  ? 32   LEU A CB  1 
ATOM   282  C  CG  . LEU A 1 32  ? 39.548 -0.343  -3.748  1.00 10.00 ? 32   LEU A CG  1 
ATOM   283  C  CD1 . LEU A 1 32  ? 40.339 -0.384  -2.470  1.00 12.02 ? 32   LEU A CD1 1 
ATOM   284  C  CD2 . LEU A 1 32  ? 38.167 0.281   -3.587  1.00 12.66 ? 32   LEU A CD2 1 
ATOM   285  N  N   . GLY A 1 33  ? 41.190 -1.946  -6.746  1.00 9.51  ? 33   GLY A N   1 
ATOM   286  C  CA  . GLY A 1 33  ? 41.182 -3.354  -7.159  1.00 9.58  ? 33   GLY A CA  1 
ATOM   287  C  C   . GLY A 1 33  ? 42.573 -3.992  -7.139  1.00 8.73  ? 33   GLY A C   1 
ATOM   288  O  O   . GLY A 1 33  ? 42.692 -5.121  -6.661  1.00 9.51  ? 33   GLY A O   1 
ATOM   289  N  N   . THR A 1 34  ? 43.589 -3.286  -7.595  1.00 9.22  ? 34   THR A N   1 
ATOM   290  C  CA  . THR A 1 34  ? 44.935 -3.839  -7.535  1.00 9.32  ? 34   THR A CA  1 
ATOM   291  C  C   . THR A 1 34  ? 45.311 -4.230  -6.117  1.00 9.04  ? 34   THR A C   1 
ATOM   292  O  O   . THR A 1 34  ? 45.851 -5.320  -5.878  1.00 9.49  ? 34   THR A O   1 
ATOM   293  C  CB  . THR A 1 34  ? 45.921 -2.846  -8.112  1.00 10.72 ? 34   THR A CB  1 
ATOM   294  O  OG1 . THR A 1 34  ? 45.516 -2.497  -9.484  1.00 12.35 ? 34   THR A OG1 1 
ATOM   295  C  CG2 . THR A 1 34  ? 47.326 -3.412  -8.094  1.00 11.87 ? 34   THR A CG2 1 
ATOM   296  N  N   . VAL A 1 35  ? 45.037 -3.348  -5.163  1.00 9.46  ? 35   VAL A N   1 
ATOM   297  C  CA  . VAL A 1 35  ? 45.359 -3.620  -3.778  1.00 9.59  ? 35   VAL A CA  1 
ATOM   298  C  C   . VAL A 1 35  ? 44.587 -4.801  -3.223  1.00 9.99  ? 35   VAL A C   1 
ATOM   299  O  O   . VAL A 1 35  ? 45.106 -5.718  -2.595  1.00 10.98 ? 35   VAL A O   1 
ATOM   300  C  CB  . VAL A 1 35  ? 45.177 -2.379  -2.892  1.00 10.18 ? 35   VAL A CB  1 
ATOM   301  C  CG1 . VAL A 1 35  ? 45.423 -2.743  -1.456  1.00 13.35 ? 35   VAL A CG1 1 
ATOM   302  C  CG2 . VAL A 1 35  ? 46.150 -1.296  -3.347  1.00 10.52 ? 35   VAL A CG2 1 
ATOM   303  N  N   A MET A 1 36  ? 43.265 -4.829  -3.463  0.61 9.55  ? 36   MET A N   1 
ATOM   304  N  N   B MET A 1 36  ? 43.279 -4.765  -3.543  0.40 9.62  ? 36   MET A N   1 
ATOM   305  C  CA  A MET A 1 36  ? 42.563 -5.997  -2.912  0.61 9.67  ? 36   MET A CA  1 
ATOM   306  C  CA  B MET A 1 36  ? 42.392 -5.820  -3.083  0.40 8.43  ? 36   MET A CA  1 
ATOM   307  C  C   A MET A 1 36  ? 43.010 -7.283  -3.537  0.61 8.91  ? 36   MET A C   1 
ATOM   308  C  C   B MET A 1 36  ? 42.842 -7.187  -3.590  0.40 8.25  ? 36   MET A C   1 
ATOM   309  O  O   A MET A 1 36  ? 43.154 -8.328  -2.887  0.61 8.86  ? 36   MET A O   1 
ATOM   310  O  O   B MET A 1 36  ? 42.792 -8.167  -2.830  0.40 9.28  ? 36   MET A O   1 
ATOM   311  C  CB  A MET A 1 36  ? 41.068 -5.722  -3.160  0.61 8.82  ? 36   MET A CB  1 
ATOM   312  C  CB  B MET A 1 36  ? 40.950 -5.559  -3.541  0.40 9.24  ? 36   MET A CB  1 
ATOM   313  C  CG  A MET A 1 36  ? 40.593 -4.532  -2.319  0.61 9.04  ? 36   MET A CG  1 
ATOM   314  C  CG  B MET A 1 36  ? 40.216 -4.404  -2.910  0.40 10.79 ? 36   MET A CG  1 
ATOM   315  S  SD  A MET A 1 36  ? 38.887 -4.074  -2.591  0.61 10.33 ? 36   MET A SD  1 
ATOM   316  S  SD  B MET A 1 36  ? 40.166 -4.292  -1.131  0.40 17.38 ? 36   MET A SD  1 
ATOM   317  C  CE  A MET A 1 36  ? 38.075 -5.513  -1.865  0.61 15.46 ? 36   MET A CE  1 
ATOM   318  C  CE  B MET A 1 36  ? 39.991 -6.002  -0.672  0.40 37.98 ? 36   MET A CE  1 
ATOM   319  N  N   . ARG A 1 37  ? 43.263 -7.249  -4.852  1.00 8.85  ? 37   ARG A N   1 
ATOM   320  C  CA  . ARG A 1 37  ? 43.728 -8.469  -5.523  1.00 8.72  ? 37   ARG A CA  1 
ATOM   321  C  C   . ARG A 1 37  ? 45.013 -8.946  -4.884  1.00 9.08  ? 37   ARG A C   1 
ATOM   322  O  O   . ARG A 1 37  ? 45.238 -10.171 -4.765  1.00 10.13 ? 37   ARG A O   1 
ATOM   323  C  CB  . ARG A 1 37  ? 43.895 -8.238  -7.027  1.00 9.06  ? 37   ARG A CB  1 
ATOM   324  C  CG  . ARG A 1 37  ? 42.607 -8.086  -7.778  1.00 9.04  ? 37   ARG A CG  1 
ATOM   325  C  CD  . ARG A 1 37  ? 42.750 -8.045  -9.295  1.00 11.49 ? 37   ARG A CD  1 
ATOM   326  N  NE  . ARG A 1 37  ? 43.191 -6.785  -9.813  1.00 13.02 ? 37   ARG A NE  1 
ATOM   327  C  CZ  . ARG A 1 37  ? 42.399 -5.726  -10.064 1.00 12.41 ? 37   ARG A CZ  1 
ATOM   328  N  NH1 . ARG A 1 37  ? 41.136 -5.769  -9.835  1.00 13.99 ? 37   ARG A NH1 1 
ATOM   329  N  NH2 . ARG A 1 37  ? 42.920 -4.644  -10.524 1.00 14.76 ? 37   ARG A NH2 1 
ATOM   330  N  N   . SER A 1 38  ? 45.882 -8.040  -4.481  1.00 9.97  ? 38   SER A N   1 
ATOM   331  C  CA  . SER A 1 38  ? 47.143 -8.421  -3.841  1.00 12.32 ? 38   SER A CA  1 
ATOM   332  C  C   . SER A 1 38  ? 46.908 -9.115  -2.537  1.00 14.32 ? 38   SER A C   1 
ATOM   333  O  O   . SER A 1 38  ? 47.789 -9.873  -2.066  1.00 18.89 ? 38   SER A O   1 
ATOM   334  C  CB  . SER A 1 38  ? 48.060 -7.234  -3.628  1.00 13.93 ? 38   SER A CB  1 
ATOM   335  O  OG  . SER A 1 38  ? 47.684 -6.460  -2.462  1.00 18.65 ? 38   SER A OG  1 
ATOM   336  N  N   A LEU A 1 39  ? 45.783 -8.876  -1.911  0.53 13.54 ? 39   LEU A N   1 
ATOM   337  N  N   B LEU A 1 39  ? 45.772 -8.924  -1.907  0.47 14.47 ? 39   LEU A N   1 
ATOM   338  C  CA  A LEU A 1 39  ? 45.351 -9.363  -0.626  0.53 15.72 ? 39   LEU A CA  1 
ATOM   339  C  CA  B LEU A 1 39  ? 45.500 -9.545  -0.623  0.47 16.08 ? 39   LEU A CA  1 
ATOM   340  C  C   A LEU A 1 39  ? 44.531 -10.645 -0.765  0.53 14.17 ? 39   LEU A C   1 
ATOM   341  C  C   B LEU A 1 39  ? 44.423 -10.610 -0.748  0.47 15.17 ? 39   LEU A C   1 
ATOM   342  O  O   A LEU A 1 39  ? 44.232 -11.250 0.251   0.53 19.14 ? 39   LEU A O   1 
ATOM   343  O  O   B LEU A 1 39  ? 43.821 -11.011 0.230   0.47 17.74 ? 39   LEU A O   1 
ATOM   344  C  CB  A LEU A 1 39  ? 44.552 -8.289  0.135   0.53 18.16 ? 39   LEU A CB  1 
ATOM   345  C  CB  B LEU A 1 39  ? 45.124 -8.453  0.385   0.47 19.21 ? 39   LEU A CB  1 
ATOM   346  C  CG  A LEU A 1 39  ? 45.299 -7.041  0.601   0.53 19.15 ? 39   LEU A CG  1 
ATOM   347  C  CG  B LEU A 1 39  ? 46.082 -7.269  0.493   0.47 20.27 ? 39   LEU A CG  1 
ATOM   348  C  CD1 A LEU A 1 39  ? 44.377 -5.968  1.169   0.53 20.90 ? 39   LEU A CD1 1 
ATOM   349  C  CD1 B LEU A 1 39  ? 45.413 -6.124  1.241   0.47 20.56 ? 39   LEU A CD1 1 
ATOM   350  C  CD2 A LEU A 1 39  ? 46.317 -7.478  1.651   0.53 26.65 ? 39   LEU A CD2 1 
ATOM   351  C  CD2 B LEU A 1 39  ? 47.382 -7.707  1.158   0.47 22.49 ? 39   LEU A CD2 1 
ATOM   352  N  N   . GLY A 1 40  ? 44.204 -11.115 -1.967  1.00 12.04 ? 40   GLY A N   1 
ATOM   353  C  CA  . GLY A 1 40  ? 43.453 -12.323 -2.149  1.00 12.21 ? 40   GLY A CA  1 
ATOM   354  C  C   . GLY A 1 40  ? 41.968 -12.180 -2.412  1.00 10.59 ? 40   GLY A C   1 
ATOM   355  O  O   . GLY A 1 40  ? 41.243 -13.157 -2.329  1.00 12.30 ? 40   GLY A O   1 
ATOM   356  N  N   . GLN A 1 41  ? 41.539 -10.952 -2.757  1.00 10.43 ? 41   GLN A N   1 
ATOM   357  C  CA  . GLN A 1 41  ? 40.122 -10.769 -3.117  1.00 10.24 ? 41   GLN A CA  1 
ATOM   358  C  C   . GLN A 1 41  ? 40.076 -10.156 -4.496  1.00 8.24  ? 41   GLN A C   1 
ATOM   359  O  O   . GLN A 1 41  ? 40.897 -9.260  -4.812  1.00 9.91  ? 41   GLN A O   1 
ATOM   360  C  CB  . GLN A 1 41  ? 39.422 -9.912  -2.096  1.00 14.59 ? 41   GLN A CB  1 
ATOM   361  C  CG  . GLN A 1 41  ? 37.914 -10.024 -2.204  1.00 14.86 ? 41   GLN A CG  1 
ATOM   362  C  CD  . GLN A 1 41  ? 37.240 -9.317  -1.010  1.00 18.34 ? 41   GLN A CD  1 
ATOM   363  O  OE1 . GLN A 1 41  ? 37.747 -8.424  -0.429  1.00 19.79 ? 41   GLN A OE1 1 
ATOM   364  N  NE2 . GLN A 1 41  ? 36.123 -9.895  -0.602  1.00 25.29 ? 41   GLN A NE2 1 
ATOM   365  N  N   . ASN A 1 42  ? 39.138 -10.564 -5.336  1.00 8.08  ? 42   ASN A N   1 
ATOM   366  C  CA  . ASN A 1 42  ? 39.061 -10.138 -6.732  1.00 7.42  ? 42   ASN A CA  1 
ATOM   367  C  C   . ASN A 1 42  ? 37.691 -9.551  -6.984  1.00 7.86  ? 42   ASN A C   1 
ATOM   368  O  O   . ASN A 1 42  ? 36.837 -10.148 -7.654  1.00 8.94  ? 42   ASN A O   1 
ATOM   369  C  CB  . ASN A 1 42  ? 39.394 -11.271 -7.686  1.00 7.97  ? 42   ASN A CB  1 
ATOM   370  C  CG  . ASN A 1 42  ? 40.852 -11.647 -7.563  1.00 8.06  ? 42   ASN A CG  1 
ATOM   371  O  OD1 . ASN A 1 42  ? 41.264 -12.217 -6.537  1.00 8.84  ? 42   ASN A OD1 1 
ATOM   372  N  ND2 . ASN A 1 42  ? 41.650 -11.287 -8.557  1.00 8.06  ? 42   ASN A ND2 1 
ATOM   373  N  N   A PRO A 1 43  ? 37.463 -8.342  -6.471  0.63 7.64  ? 43   PRO A N   1 
ATOM   374  N  N   B PRO A 1 43  ? 37.357 -8.412  -6.373  0.37 9.96  ? 43   PRO A N   1 
ATOM   375  C  CA  A PRO A 1 43  ? 36.142 -7.719  -6.570  0.63 8.37  ? 43   PRO A CA  1 
ATOM   376  C  CA  B PRO A 1 43  ? 36.008 -7.850  -6.523  0.37 9.77  ? 43   PRO A CA  1 
ATOM   377  C  C   A PRO A 1 43  ? 35.873 -7.352  -8.028  0.63 9.14  ? 43   PRO A C   1 
ATOM   378  C  C   B PRO A 1 43  ? 35.843 -7.388  -7.971  0.37 8.75  ? 43   PRO A C   1 
ATOM   379  O  O   A PRO A 1 43  ? 36.755 -7.035  -8.834  0.63 9.24  ? 43   PRO A O   1 
ATOM   380  O  O   B PRO A 1 43  ? 36.823 -7.091  -8.663  0.37 13.07 ? 43   PRO A O   1 
ATOM   381  C  CB  A PRO A 1 43  ? 36.273 -6.491  -5.676  0.63 8.22  ? 43   PRO A CB  1 
ATOM   382  C  CB  B PRO A 1 43  ? 35.980 -6.659  -5.571  0.37 10.65 ? 43   PRO A CB  1 
ATOM   383  C  CG  A PRO A 1 43  ? 37.736 -6.145  -5.756  0.63 9.18  ? 43   PRO A CG  1 
ATOM   384  C  CG  B PRO A 1 43  ? 37.206 -6.747  -4.726  0.37 10.55 ? 43   PRO A CG  1 
ATOM   385  C  CD  A PRO A 1 43  ? 38.432 -7.484  -5.799  0.63 8.27  ? 43   PRO A CD  1 
ATOM   386  C  CD  B PRO A 1 43  ? 38.192 -7.576  -5.510  0.37 9.88  ? 43   PRO A CD  1 
ATOM   387  N  N   . THR A 1 44  ? 34.572 -7.297  -8.349  1.00 9.89  ? 44   THR A N   1 
ATOM   388  C  CA  . THR A 1 44  ? 34.194 -6.809  -9.657  1.00 9.95  ? 44   THR A CA  1 
ATOM   389  C  C   . THR A 1 44  ? 34.203 -5.287  -9.677  1.00 10.18 ? 44   THR A C   1 
ATOM   390  O  O   . THR A 1 44  ? 34.267 -4.600  -8.661  1.00 9.39  ? 44   THR A O   1 
ATOM   391  C  CB  . THR A 1 44  ? 32.780 -7.293  -10.004 1.00 11.86 ? 44   THR A CB  1 
ATOM   392  O  OG1 . THR A 1 44  ? 31.885 -6.664  -9.073  1.00 11.69 ? 44   THR A OG1 1 
ATOM   393  C  CG2 . THR A 1 44  ? 32.700 -8.800  -9.937  1.00 12.33 ? 44   THR A CG2 1 
ATOM   394  N  N   . GLU A 1 45  ? 34.106 -4.735  -10.884 1.00 11.19 ? 45   GLU A N   1 
ATOM   395  C  CA  . GLU A 1 45  ? 34.024 -3.296  -11.046 1.00 10.91 ? 45   GLU A CA  1 
ATOM   396  C  C   . GLU A 1 45  ? 32.859 -2.710  -10.254 1.00 10.24 ? 45   GLU A C   1 
ATOM   397  O  O   . GLU A 1 45  ? 32.985 -1.663  -9.641  1.00 10.21 ? 45   GLU A O   1 
ATOM   398  C  CB  . GLU A 1 45  ? 33.982 -2.896  -12.524 1.00 13.87 ? 45   GLU A CB  1 
ATOM   399  C  CG  . GLU A 1 45  ? 34.012 -1.377  -12.677 1.00 15.02 ? 45   GLU A CG  1 
ATOM   400  C  CD  . GLU A 1 45  ? 35.293 -0.664  -12.345 1.00 18.42 ? 45   GLU A CD  1 
ATOM   401  O  OE1 . GLU A 1 45  ? 36.325 -1.270  -12.129 1.00 22.57 ? 45   GLU A OE1 1 
ATOM   402  O  OE2 . GLU A 1 45  ? 35.291 0.598   -12.275 1.00 19.02 ? 45   GLU A OE2 1 
ATOM   403  N  N   . ALA A 1 46  ? 31.689 -3.401  -10.257 1.00 11.49 ? 46   ALA A N   1 
ATOM   404  C  CA  . ALA A 1 46  ? 30.532 -2.900  -9.503  1.00 11.63 ? 46   ALA A CA  1 
ATOM   405  C  C   . ALA A 1 46  ? 30.806 -2.833  -8.006  1.00 10.38 ? 46   ALA A C   1 
ATOM   406  O  O   . ALA A 1 46  ? 30.468 -1.860  -7.337  1.00 11.14 ? 46   ALA A O   1 
ATOM   407  C  CB  . ALA A 1 46  ? 29.299 -3.751  -9.824  1.00 13.84 ? 46   ALA A CB  1 
ATOM   408  N  N   . GLU A 1 47  ? 31.461 -3.847  -7.473  1.00 9.97  ? 47   GLU A N   1 
ATOM   409  C  CA  . GLU A 1 47  ? 31.804 -3.861  -6.070  1.00 9.34  ? 47   GLU A CA  1 
ATOM   410  C  C   . GLU A 1 47  ? 32.816 -2.752  -5.754  1.00 9.06  ? 47   GLU A C   1 
ATOM   411  O  O   . GLU A 1 47  ? 32.706 -2.078  -4.725  1.00 9.24  ? 47   GLU A O   1 
ATOM   412  C  CB  . GLU A 1 47  ? 32.423 -5.228  -5.694  1.00 9.14  ? 47   GLU A CB  1 
ATOM   413  C  CG  . GLU A 1 47  ? 31.378 -6.339  -5.686  1.00 10.97 ? 47   GLU A CG  1 
ATOM   414  C  CD  . GLU A 1 47  ? 31.918 -7.724  -5.482  1.00 10.63 ? 47   GLU A CD  1 
ATOM   415  O  OE1 . GLU A 1 47  ? 32.996 -8.036  -6.051  1.00 10.34 ? 47   GLU A OE1 1 
ATOM   416  O  OE2 . GLU A 1 47  ? 31.201 -8.553  -4.889  1.00 15.87 ? 47   GLU A OE2 1 
ATOM   417  N  N   . LEU A 1 48  ? 33.809 -2.554  -6.615  1.00 8.44  ? 48   LEU A N   1 
ATOM   418  C  CA  . LEU A 1 48  ? 34.792 -1.522  -6.399  1.00 8.88  ? 48   LEU A CA  1 
ATOM   419  C  C   . LEU A 1 48  ? 34.136 -0.133  -6.430  1.00 8.80  ? 48   LEU A C   1 
ATOM   420  O  O   . LEU A 1 48  ? 34.505 0.753   -5.658  1.00 9.21  ? 48   LEU A O   1 
ATOM   421  C  CB  . LEU A 1 48  ? 35.877 -1.639  -7.439  1.00 9.43  ? 48   LEU A CB  1 
ATOM   422  C  CG  . LEU A 1 48  ? 36.815 -2.845  -7.295  1.00 9.53  ? 48   LEU A CG  1 
ATOM   423  C  CD1 . LEU A 1 48  ? 37.596 -3.125  -8.547  1.00 10.64 ? 48   LEU A CD1 1 
ATOM   424  C  CD2 . LEU A 1 48  ? 37.710 -2.653  -6.085  1.00 12.06 ? 48   LEU A CD2 1 
ATOM   425  N  N   . GLN A 1 49  ? 33.192 0.058   -7.343  1.00 9.18  ? 49   GLN A N   1 
ATOM   426  C  CA  . GLN A 1 49  ? 32.508 1.341   -7.432  1.00 9.62  ? 49   GLN A CA  1 
ATOM   427  C  C   . GLN A 1 49  ? 31.743 1.654   -6.195  1.00 9.16  ? 49   GLN A C   1 
ATOM   428  O  O   . GLN A 1 49  ? 31.718 2.819   -5.734  1.00 9.49  ? 49   GLN A O   1 
ATOM   429  C  CB  . GLN A 1 49  ? 31.633 1.364   -8.706  1.00 10.38 ? 49   GLN A CB  1 
ATOM   430  C  CG  . GLN A 1 49  ? 31.076 2.760   -8.971  1.00 11.87 ? 49   GLN A CG  1 
ATOM   431  C  CD  . GLN A 1 49  ? 32.182 3.712   -9.319  1.00 16.01 ? 49   GLN A CD  1 
ATOM   432  O  OE1 . GLN A 1 49  ? 32.403 4.758   -8.681  1.00 17.54 ? 49   GLN A OE1 1 
ATOM   433  N  NE2 . GLN A 1 49  ? 32.885 3.455   -10.382 1.00 22.80 ? 49   GLN A NE2 1 
ATOM   434  N  N   . ASP A 1 50  ? 31.080 0.663   -5.615  1.00 9.52  ? 50   ASP A N   1 
ATOM   435  C  CA  . ASP A 1 50  ? 30.364 0.892   -4.370  1.00 10.37 ? 50   ASP A CA  1 
ATOM   436  C  C   . ASP A 1 50  ? 31.347 1.297   -3.290  1.00 10.69 ? 50   ASP A C   1 
ATOM   437  O  O   . ASP A 1 50  ? 31.034 2.182   -2.484  1.00 11.16 ? 50   ASP A O   1 
ATOM   438  C  CB  . ASP A 1 50  ? 29.587 -0.327  -3.948  1.00 11.57 ? 50   ASP A CB  1 
ATOM   439  C  CG  . ASP A 1 50  ? 28.287 -0.528  -4.671  1.00 13.93 ? 50   ASP A CG  1 
ATOM   440  O  OD1 . ASP A 1 50  ? 27.784 0.387   -5.322  1.00 14.25 ? 50   ASP A OD1 1 
ATOM   441  O  OD2 . ASP A 1 50  ? 27.759 -1.666  -4.571  1.00 16.94 ? 50   ASP A OD2 1 
ATOM   442  N  N   . MET A 1 51  ? 32.512 0.661   -3.226  1.00 10.31 ? 51   MET A N   1 
ATOM   443  C  CA  . MET A 1 51  ? 33.489 1.018   -2.206  1.00 10.93 ? 51   MET A CA  1 
ATOM   444  C  C   . MET A 1 51  ? 33.957 2.444   -2.385  1.00 10.67 ? 51   MET A C   1 
ATOM   445  O  O   . MET A 1 51  ? 34.062 3.206   -1.390  1.00 12.53 ? 51   MET A O   1 
ATOM   446  C  CB  . MET A 1 51  ? 34.687 0.051   -2.252  1.00 10.90 ? 51   MET A CB  1 
ATOM   447  C  CG  . MET A 1 51  ? 34.349 -1.383  -1.879  1.00 12.65 ? 51   MET A CG  1 
ATOM   448  S  SD  . MET A 1 51  ? 35.692 -2.528  -2.020  1.00 15.60 ? 51   MET A SD  1 
ATOM   449  C  CE  . MET A 1 51  ? 36.658 -2.067  -0.588  1.00 20.70 ? 51   MET A CE  1 
ATOM   450  N  N   A ILE A 1 52  ? 34.269 2.924   -3.574  0.52 9.30  ? 52   ILE A N   1 
ATOM   451  N  N   B ILE A 1 52  ? 34.273 2.797   -3.619  0.48 9.90  ? 52   ILE A N   1 
ATOM   452  C  CA  A ILE A 1 52  ? 34.702 4.316   -3.822  0.52 9.63  ? 52   ILE A CA  1 
ATOM   453  C  CA  B ILE A 1 52  ? 34.667 4.198   -3.912  0.48 9.34  ? 52   ILE A CA  1 
ATOM   454  C  C   A ILE A 1 52  ? 33.544 5.238   -3.514  0.52 9.56  ? 52   ILE A C   1 
ATOM   455  C  C   B ILE A 1 52  ? 33.573 5.185   -3.569  0.48 9.48  ? 52   ILE A C   1 
ATOM   456  O  O   A ILE A 1 52  ? 33.655 6.281   -2.865  0.52 12.36 ? 52   ILE A O   1 
ATOM   457  O  O   B ILE A 1 52  ? 33.871 6.232   -2.950  0.48 9.57  ? 52   ILE A O   1 
ATOM   458  C  CB  A ILE A 1 52  ? 35.245 4.446   -5.254  0.52 9.07  ? 52   ILE A CB  1 
ATOM   459  C  CB  B ILE A 1 52  ? 35.118 4.297   -5.382  0.48 10.26 ? 52   ILE A CB  1 
ATOM   460  C  CG1 A ILE A 1 52  ? 36.490 3.596   -5.578  0.52 11.72 ? 52   ILE A CG1 1 
ATOM   461  C  CG1 B ILE A 1 52  ? 36.406 3.460   -5.519  0.48 15.19 ? 52   ILE A CG1 1 
ATOM   462  C  CG2 A ILE A 1 52  ? 35.464 5.933   -5.570  0.52 9.32  ? 52   ILE A CG2 1 
ATOM   463  C  CG2 B ILE A 1 52  ? 35.225 5.730   -5.880  0.48 11.38 ? 52   ILE A CG2 1 
ATOM   464  C  CD1 A ILE A 1 52  ? 37.727 3.880   -4.815  0.52 14.61 ? 52   ILE A CD1 1 
ATOM   465  C  CD1 B ILE A 1 52  ? 37.675 4.193   -5.373  0.48 17.44 ? 52   ILE A CD1 1 
ATOM   466  N  N   . ASN A 1 53  ? 32.326 4.884   -3.952  1.00 9.60  ? 53   ASN A N   1 
ATOM   467  C  CA  . ASN A 1 53  ? 31.204 5.787   -3.722  1.00 10.19 ? 53   ASN A CA  1 
ATOM   468  C  C   . ASN A 1 53  ? 30.979 6.063   -2.257  1.00 11.56 ? 53   ASN A C   1 
ATOM   469  O  O   . ASN A 1 53  ? 30.532 7.158   -1.907  1.00 12.03 ? 53   ASN A O   1 
ATOM   470  C  CB  . ASN A 1 53  ? 29.925 5.245   -4.345  1.00 11.24 ? 53   ASN A CB  1 
ATOM   471  C  CG  . ASN A 1 53  ? 29.854 5.298   -5.847  1.00 10.22 ? 53   ASN A CG  1 
ATOM   472  O  OD1 . ASN A 1 53  ? 28.868 4.704   -6.405  1.00 14.13 ? 53   ASN A OD1 1 
ATOM   473  N  ND2 . ASN A 1 53  ? 30.780 5.883   -6.500  1.00 9.88  ? 53   ASN A ND2 1 
ATOM   474  N  N   . GLU A 1 54  ? 31.267 5.106   -1.386  1.00 14.78 ? 54   GLU A N   1 
ATOM   475  C  CA  . GLU A 1 54  ? 31.153 5.347   0.058   1.00 17.10 ? 54   GLU A CA  1 
ATOM   476  C  C   . GLU A 1 54  ? 32.100 6.390   0.620   1.00 17.45 ? 54   GLU A C   1 
ATOM   477  O  O   . GLU A 1 54  ? 31.804 6.920   1.721   1.00 23.28 ? 54   GLU A O   1 
ATOM   478  C  CB  . GLU A 1 54  ? 31.378 4.019   0.816   1.00 22.44 ? 54   GLU A CB  1 
ATOM   479  C  CG  . GLU A 1 54  ? 30.444 2.959   0.470   1.00 23.76 ? 54   GLU A CG  1 
ATOM   480  C  CD  . GLU A 1 54  ? 29.067 3.203   -0.048  1.00 34.26 ? 54   GLU A CD  1 
ATOM   481  O  OE1 . GLU A 1 54  ? 28.328 3.516   0.907   1.00 33.61 ? 54   GLU A OE1 1 
ATOM   482  O  OE2 . GLU A 1 54  ? 28.926 3.037   -1.303  1.00 46.97 ? 54   GLU A OE2 1 
ATOM   483  N  N   A VAL A 1 55  ? 33.214 6.624   -0.055  0.44 14.25 ? 55   VAL A N   1 
ATOM   484  N  N   B VAL A 1 55  ? 33.142 6.754   -0.095  0.56 14.38 ? 55   VAL A N   1 
ATOM   485  C  CA  A VAL A 1 55  ? 34.359 7.427   0.344   0.44 15.60 ? 55   VAL A CA  1 
ATOM   486  C  CA  B VAL A 1 55  ? 34.178 7.613   0.500   0.56 15.76 ? 55   VAL A CA  1 
ATOM   487  C  C   A VAL A 1 55  ? 34.396 8.791   -0.350  0.44 15.69 ? 55   VAL A C   1 
ATOM   488  C  C   B VAL A 1 55  ? 34.516 8.800   -0.382  0.56 12.87 ? 55   VAL A C   1 
ATOM   489  O  O   A VAL A 1 55  ? 34.767 9.793   0.294   0.44 9.59  ? 55   VAL A O   1 
ATOM   490  O  O   B VAL A 1 55  ? 35.243 9.747   -0.036  0.56 10.18 ? 55   VAL A O   1 
ATOM   491  C  CB  A VAL A 1 55  ? 35.722 6.680   0.143   0.44 14.02 ? 55   VAL A CB  1 
ATOM   492  C  CB  B VAL A 1 55  ? 35.375 6.670   0.806   0.56 18.78 ? 55   VAL A CB  1 
ATOM   493  C  CG1 A VAL A 1 55  ? 36.858 7.533   0.712   0.44 13.81 ? 55   VAL A CG1 1 
ATOM   494  C  CG1 B VAL A 1 55  ? 36.670 7.419   1.113   0.56 19.46 ? 55   VAL A CG1 1 
ATOM   495  C  CG2 A VAL A 1 55  ? 35.670 5.366   0.860   0.44 12.15 ? 55   VAL A CG2 1 
ATOM   496  C  CG2 B VAL A 1 55  ? 35.012 5.715   1.953   0.56 21.35 ? 55   VAL A CG2 1 
ATOM   497  N  N   . ASP A 1 56  ? 34.005 8.834   -1.615  1.00 17.25 ? 56   ASP A N   1 
ATOM   498  C  CA  . ASP A 1 56  ? 34.204 9.907   -2.558  1.00 15.46 ? 56   ASP A CA  1 
ATOM   499  C  C   . ASP A 1 56  ? 33.243 11.039  -2.338  1.00 12.45 ? 56   ASP A C   1 
ATOM   500  O  O   . ASP A 1 56  ? 32.173 11.151  -2.957  1.00 15.88 ? 56   ASP A O   1 
ATOM   501  C  CB  . ASP A 1 56  ? 34.072 9.349   -3.985  1.00 16.84 ? 56   ASP A CB  1 
ATOM   502  C  CG  . ASP A 1 56  ? 34.135 10.417  -5.068  1.00 12.12 ? 56   ASP A CG  1 
ATOM   503  O  OD1 . ASP A 1 56  ? 34.725 11.455  -4.805  1.00 11.25 ? 56   ASP A OD1 1 
ATOM   504  O  OD2 . ASP A 1 56  ? 33.553 10.124  -6.139  1.00 13.16 ? 56   ASP A OD2 1 
ATOM   505  N  N   . ALA A 1 57  ? 33.590 11.959  -1.458  1.00 12.46 ? 57   ALA A N   1 
ATOM   506  C  CA  . ALA A 1 57  ? 32.721 13.009  -1.023  1.00 13.59 ? 57   ALA A CA  1 
ATOM   507  C  C   . ALA A 1 57  ? 32.321 13.972  -2.148  1.00 12.49 ? 57   ALA A C   1 
ATOM   508  O  O   . ALA A 1 57  ? 31.155 14.491  -2.043  1.00 16.56 ? 57   ALA A O   1 
ATOM   509  C  CB  . ALA A 1 57  ? 33.315 13.755  0.183   1.00 14.84 ? 57   ALA A CB  1 
ATOM   510  N  N   . ASP A 1 58  ? 33.167 14.296  -3.085  1.00 12.82 ? 58   ASP A N   1 
ATOM   511  C  CA  . ASP A 1 58  ? 32.787 15.300  -4.096  1.00 12.17 ? 58   ASP A CA  1 
ATOM   512  C  C   . ASP A 1 58  ? 32.242 14.620  -5.352  1.00 14.17 ? 58   ASP A C   1 
ATOM   513  O  O   . ASP A 1 58  ? 31.861 15.310  -6.284  1.00 15.93 ? 58   ASP A O   1 
ATOM   514  C  CB  . ASP A 1 58  ? 33.922 16.255  -4.425  1.00 12.14 ? 58   ASP A CB  1 
ATOM   515  C  CG  . ASP A 1 58  ? 35.182 15.636  -4.962  1.00 10.58 ? 58   ASP A CG  1 
ATOM   516  O  OD1 . ASP A 1 58  ? 35.152 14.395  -5.178  1.00 10.30 ? 58   ASP A OD1 1 
ATOM   517  O  OD2 . ASP A 1 58  ? 36.145 16.393  -5.209  1.00 10.39 ? 58   ASP A OD2 1 
ATOM   518  N  N   . GLY A 1 59  ? 32.173 13.282  -5.408  1.00 14.69 ? 59   GLY A N   1 
ATOM   519  C  CA  . GLY A 1 59  ? 31.512 12.626  -6.522  1.00 16.07 ? 59   GLY A CA  1 
ATOM   520  C  C   . GLY A 1 59  ? 32.329 12.708  -7.800  1.00 14.80 ? 59   GLY A C   1 
ATOM   521  O  O   . GLY A 1 59  ? 31.713 12.494  -8.863  1.00 17.34 ? 59   GLY A O   1 
ATOM   522  N  N   . ASN A 1 60  ? 33.616 12.979  -7.798  1.00 13.93 ? 60   ASN A N   1 
ATOM   523  C  CA  . ASN A 1 60  ? 34.395 13.043  -9.011  1.00 15.63 ? 60   ASN A CA  1 
ATOM   524  C  C   . ASN A 1 60  ? 34.849 11.676  -9.428  1.00 14.22 ? 60   ASN A C   1 
ATOM   525  O  O   . ASN A 1 60  ? 35.497 11.598  -10.498 1.00 17.75 ? 60   ASN A O   1 
ATOM   526  C  CB  . ASN A 1 60  ? 35.533 14.043  -8.916  1.00 15.69 ? 60   ASN A CB  1 
ATOM   527  C  CG  . ASN A 1 60  ? 36.616 13.666  -7.960  1.00 9.01  ? 60   ASN A CG  1 
ATOM   528  O  OD1 . ASN A 1 60  ? 36.522 12.667  -7.198  1.00 9.98  ? 60   ASN A OD1 1 
ATOM   529  N  ND2 . ASN A 1 60  ? 37.638 14.489  -7.969  1.00 10.09 ? 60   ASN A ND2 1 
ATOM   530  N  N   . GLY A 1 61  ? 34.535 10.599  -8.680  1.00 11.70 ? 61   GLY A N   1 
ATOM   531  C  CA  . GLY A 1 61  ? 34.841 9.258   -9.131  1.00 11.82 ? 61   GLY A CA  1 
ATOM   532  C  C   . GLY A 1 61  ? 36.078 8.633   -8.527  1.00 9.90  ? 61   GLY A C   1 
ATOM   533  O  O   . GLY A 1 61  ? 36.330 7.471   -8.747  1.00 11.11 ? 61   GLY A O   1 
ATOM   534  N  N   . THR A 1 62  ? 36.865 9.455   -7.805  1.00 9.11  ? 62   THR A N   1 
ATOM   535  C  CA  . THR A 1 62  ? 38.110 8.977   -7.198  1.00 8.43  ? 62   THR A CA  1 
ATOM   536  C  C   . THR A 1 62  ? 38.230 9.489   -5.779  1.00 7.85  ? 62   THR A C   1 
ATOM   537  O  O   . THR A 1 62  ? 37.498 10.387  -5.389  1.00 8.59  ? 62   THR A O   1 
ATOM   538  C  CB  . THR A 1 62  ? 39.328 9.369   -8.034  1.00 8.31  ? 62   THR A CB  1 
ATOM   539  O  OG1 . THR A 1 62  ? 39.438 10.810  -7.955  1.00 8.31  ? 62   THR A OG1 1 
ATOM   540  C  CG2 . THR A 1 62  ? 39.275 8.884   -9.459  1.00 9.30  ? 62   THR A CG2 1 
ATOM   541  N  N   . ILE A 1 63  ? 39.124 8.894   -5.001  1.00 7.76  ? 63   ILE A N   1 
ATOM   542  C  CA  . ILE A 1 63  ? 39.366 9.286   -3.619  1.00 7.21  ? 63   ILE A CA  1 
ATOM   543  C  C   . ILE A 1 63  ? 40.680 10.068  -3.542  1.00 7.24  ? 63   ILE A C   1 
ATOM   544  O  O   . ILE A 1 63  ? 41.724 9.562   -3.960  1.00 8.41  ? 63   ILE A O   1 
ATOM   545  C  CB  . ILE A 1 63  ? 39.455 8.058   -2.709  1.00 8.03  ? 63   ILE A CB  1 
ATOM   546  C  CG1 . ILE A 1 63  ? 38.219 7.169   -2.781  1.00 9.46  ? 63   ILE A CG1 1 
ATOM   547  C  CG2 . ILE A 1 63  ? 39.756 8.477   -1.283  1.00 9.19  ? 63   ILE A CG2 1 
ATOM   548  C  CD1 . ILE A 1 63  ? 38.439 5.778   -2.148  1.00 15.25 ? 63   ILE A CD1 1 
ATOM   549  N  N   . ASP A 1 64  ? 40.625 11.283  -3.005  1.00 7.71  ? 64   ASP A N   1 
ATOM   550  C  CA  . ASP A 1 64  ? 41.840 12.071  -2.809  1.00 7.73  ? 64   ASP A CA  1 
ATOM   551  C  C   . ASP A 1 64  ? 42.294 11.964  -1.356  1.00 7.85  ? 64   ASP A C   1 
ATOM   552  O  O   . ASP A 1 64  ? 41.684 11.287  -0.519  1.00 7.94  ? 64   ASP A O   1 
ATOM   553  C  CB  . ASP A 1 64  ? 41.623 13.526  -3.250  1.00 8.77  ? 64   ASP A CB  1 
ATOM   554  C  CG  . ASP A 1 64  ? 40.617 14.269  -2.468  1.00 9.08  ? 64   ASP A CG  1 
ATOM   555  O  OD1 . ASP A 1 64  ? 40.310 13.864  -1.340  1.00 10.12 ? 64   ASP A OD1 1 
ATOM   556  O  OD2 . ASP A 1 64  ? 40.151 15.308  -2.978  1.00 11.34 ? 64   ASP A OD2 1 
ATOM   557  N  N   . PHE A 1 65  ? 43.455 12.584  -1.079  1.00 8.91  ? 65   PHE A N   1 
ATOM   558  C  CA  . PHE A 1 65  ? 44.018 12.419  0.278   1.00 9.05  ? 65   PHE A CA  1 
ATOM   559  C  C   . PHE A 1 65  ? 43.115 12.983  1.337   1.00 9.19  ? 65   PHE A C   1 
ATOM   560  O  O   . PHE A 1 65  ? 42.893 12.306  2.353   1.00 9.70  ? 65   PHE A O   1 
ATOM   561  C  CB  . PHE A 1 65  ? 45.458 12.975  0.279   1.00 11.01 ? 65   PHE A CB  1 
ATOM   562  C  CG  . PHE A 1 65  ? 46.075 12.788  1.656   1.00 10.76 ? 65   PHE A CG  1 
ATOM   563  C  CD1 . PHE A 1 65  ? 46.267 11.529  2.155   1.00 10.29 ? 65   PHE A CD1 1 
ATOM   564  C  CD2 . PHE A 1 65  ? 46.438 13.875  2.420   1.00 14.84 ? 65   PHE A CD2 1 
ATOM   565  C  CE1 . PHE A 1 65  ? 46.864 11.320  3.415   1.00 12.17 ? 65   PHE A CE1 1 
ATOM   566  C  CE2 . PHE A 1 65  ? 47.066 13.693  3.644   1.00 16.76 ? 65   PHE A CE2 1 
ATOM   567  C  CZ  . PHE A 1 65  ? 47.305 12.426  4.103   1.00 15.22 ? 65   PHE A CZ  1 
ATOM   568  N  N   . PRO A 1 66  ? 42.545 14.197  1.220   1.00 10.73 ? 66   PRO A N   1 
ATOM   569  C  CA  . PRO A 1 66  ? 41.582 14.635  2.221   1.00 11.62 ? 66   PRO A CA  1 
ATOM   570  C  C   . PRO A 1 66  ? 40.412 13.679  2.475   1.00 9.86  ? 66   PRO A C   1 
ATOM   571  O  O   . PRO A 1 66  ? 39.979 13.435  3.617   1.00 10.97 ? 66   PRO A O   1 
ATOM   572  C  CB  . PRO A 1 66  ? 41.105 16.015  1.748   1.00 16.58 ? 66   PRO A CB  1 
ATOM   573  C  CG  . PRO A 1 66  ? 42.156 16.448  0.851   1.00 18.23 ? 66   PRO A CG  1 
ATOM   574  C  CD  . PRO A 1 66  ? 42.806 15.258  0.250   1.00 12.69 ? 66   PRO A CD  1 
ATOM   575  N  N   . GLU A 1 67  ? 39.864 13.126  1.396   1.00 8.85  ? 67   GLU A N   1 
ATOM   576  C  CA  . GLU A 1 67  ? 38.763 12.166  1.543   1.00 9.06  ? 67   GLU A CA  1 
ATOM   577  C  C   . GLU A 1 67  ? 39.218 10.906  2.271   1.00 8.08  ? 67   GLU A C   1 
ATOM   578  O  O   . GLU A 1 67  ? 38.492 10.324  3.091   1.00 9.22  ? 67   GLU A O   1 
ATOM   579  C  CB  . GLU A 1 67  ? 38.209 11.798  0.132   1.00 8.30  ? 67   GLU A CB  1 
ATOM   580  C  CG  . GLU A 1 67  ? 37.403 12.941  -0.474  1.00 9.37  ? 67   GLU A CG  1 
ATOM   581  C  CD  . GLU A 1 67  ? 37.087 12.757  -1.954  1.00 9.06  ? 67   GLU A CD  1 
ATOM   582  O  OE1 . GLU A 1 67  ? 37.765 11.985  -2.645  1.00 8.97  ? 67   GLU A OE1 1 
ATOM   583  O  OE2 . GLU A 1 67  ? 36.151 13.473  -2.442  1.00 10.71 ? 67   GLU A OE2 1 
ATOM   584  N  N   A PHE A 1 68  ? 40.413 10.448  1.957   0.59 8.66  ? 68   PHE A N   1 
ATOM   585  N  N   B PHE A 1 68  ? 40.412 10.448  1.958   0.41 9.08  ? 68   PHE A N   1 
ATOM   586  C  CA  A PHE A 1 68  ? 41.006 9.276   2.617   0.59 9.62  ? 68   PHE A CA  1 
ATOM   587  C  CA  B PHE A 1 68  ? 41.019 9.332   2.669   0.41 10.27 ? 68   PHE A CA  1 
ATOM   588  C  C   A PHE A 1 68  ? 41.330 9.563   4.070   0.59 10.14 ? 68   PHE A C   1 
ATOM   589  C  C   B PHE A 1 68  ? 41.172 9.601   4.155   0.41 10.40 ? 68   PHE A C   1 
ATOM   590  O  O   A PHE A 1 68  ? 41.069 8.680   4.927   0.59 10.76 ? 68   PHE A O   1 
ATOM   591  O  O   B PHE A 1 68  ? 40.736 8.815   5.013   0.41 11.37 ? 68   PHE A O   1 
ATOM   592  C  CB  A PHE A 1 68  ? 42.212 8.847   1.772   0.59 9.69  ? 68   PHE A CB  1 
ATOM   593  C  CB  B PHE A 1 68  ? 42.413 9.091   2.083   0.41 9.19  ? 68   PHE A CB  1 
ATOM   594  C  CG  A PHE A 1 68  ? 42.954 7.627   2.250   0.59 8.66  ? 68   PHE A CG  1 
ATOM   595  C  CG  B PHE A 1 68  ? 43.147 7.930   2.721   0.41 7.66  ? 68   PHE A CG  1 
ATOM   596  C  CD1 A PHE A 1 68  ? 42.627 6.369   1.821   0.59 9.26  ? 68   PHE A CD1 1 
ATOM   597  C  CD1 B PHE A 1 68  ? 44.239 8.152   3.524   0.41 9.27  ? 68   PHE A CD1 1 
ATOM   598  C  CD2 A PHE A 1 68  ? 44.000 7.759   3.133   0.59 8.74  ? 68   PHE A CD2 1 
ATOM   599  C  CD2 B PHE A 1 68  ? 42.705 6.648   2.465   0.41 11.08 ? 68   PHE A CD2 1 
ATOM   600  C  CE1 A PHE A 1 68  ? 43.365 5.270   2.273   0.59 11.54 ? 68   PHE A CE1 1 
ATOM   601  C  CE1 B PHE A 1 68  ? 44.928 7.061   4.084   0.41 10.54 ? 68   PHE A CE1 1 
ATOM   602  C  CE2 A PHE A 1 68  ? 44.764 6.657   3.589   0.59 10.09 ? 68   PHE A CE2 1 
ATOM   603  C  CE2 B PHE A 1 68  ? 43.395 5.558   3.000   0.41 12.11 ? 68   PHE A CE2 1 
ATOM   604  C  CZ  A PHE A 1 68  ? 44.414 5.407   3.139   0.59 10.16 ? 68   PHE A CZ  1 
ATOM   605  C  CZ  B PHE A 1 68  ? 44.501 5.784   3.787   0.41 11.46 ? 68   PHE A CZ  1 
ATOM   606  N  N   . LEU A 1 69  ? 41.790 10.744  4.426   1.00 11.01 ? 69   LEU A N   1 
ATOM   607  C  CA  . LEU A 1 69  ? 42.046 11.111  5.832   1.00 13.94 ? 69   LEU A CA  1 
ATOM   608  C  C   . LEU A 1 69  ? 40.736 11.117  6.588   1.00 13.06 ? 69   LEU A C   1 
ATOM   609  O  O   . LEU A 1 69  ? 40.652 10.629  7.739   1.00 15.68 ? 69   LEU A O   1 
ATOM   610  C  CB  . LEU A 1 69  ? 42.695 12.449  5.856   1.00 19.23 ? 69   LEU A CB  1 
ATOM   611  C  CG  . LEU A 1 69  ? 44.091 12.789  5.760   1.00 18.98 ? 69   LEU A CG  1 
ATOM   612  C  CD1 . LEU A 1 69  ? 44.321 14.323  5.947   1.00 23.21 ? 69   LEU A CD1 1 
ATOM   613  C  CD2 . LEU A 1 69  ? 44.899 12.115  6.810   1.00 20.92 ? 69   LEU A CD2 1 
ATOM   614  N  N   A SER A 1 70  ? 39.690 11.654  6.026   0.78 12.65 ? 70   SER A N   1 
ATOM   615  N  N   B SER A 1 70  ? 39.683 11.625  5.973   0.22 13.63 ? 70   SER A N   1 
ATOM   616  C  CA  A SER A 1 70  ? 38.429 11.737  6.721   0.78 14.51 ? 70   SER A CA  1 
ATOM   617  C  CA  B SER A 1 70  ? 38.345 11.614  6.524   0.22 15.88 ? 70   SER A CA  1 
ATOM   618  C  C   A SER A 1 70  ? 37.887 10.352  7.027   0.78 14.26 ? 70   SER A C   1 
ATOM   619  C  C   B SER A 1 70  ? 37.880 10.200  6.847   0.22 15.09 ? 70   SER A C   1 
ATOM   620  O  O   A SER A 1 70  ? 37.539 10.065  8.163   0.78 20.07 ? 70   SER A O   1 
ATOM   621  O  O   B SER A 1 70  ? 37.331 9.930   7.906   0.22 15.31 ? 70   SER A O   1 
ATOM   622  C  CB  A SER A 1 70  ? 37.512 12.582  5.842   0.78 15.13 ? 70   SER A CB  1 
ATOM   623  C  CB  B SER A 1 70  ? 37.369 12.244  5.522   0.22 14.49 ? 70   SER A CB  1 
ATOM   624  O  OG  A SER A 1 70  ? 36.227 12.646  6.408   0.78 20.57 ? 70   SER A OG  1 
ATOM   625  O  OG  B SER A 1 70  ? 37.358 13.640  5.727   0.22 16.30 ? 70   SER A OG  1 
ATOM   626  N  N   A LEU A 1 71  ? 37.804 9.453   6.054   0.53 12.15 ? 71   LEU A N   1 
ATOM   627  N  N   B LEU A 1 71  ? 38.108 9.306   5.896   0.47 12.71 ? 71   LEU A N   1 
ATOM   628  C  CA  A LEU A 1 71  ? 37.275 8.094   6.213   0.53 12.64 ? 71   LEU A CA  1 
ATOM   629  C  CA  B LEU A 1 71  ? 37.825 7.871   6.048   0.47 16.16 ? 71   LEU A CA  1 
ATOM   630  C  C   A LEU A 1 71  ? 38.131 7.209   7.110   0.53 12.91 ? 71   LEU A C   1 
ATOM   631  C  C   B LEU A 1 71  ? 38.581 7.412   7.293   0.47 16.18 ? 71   LEU A C   1 
ATOM   632  O  O   A LEU A 1 71  ? 37.686 6.366   7.897   0.53 15.63 ? 71   LEU A O   1 
ATOM   633  O  O   B LEU A 1 71  ? 37.994 6.927   8.278   0.47 17.81 ? 71   LEU A O   1 
ATOM   634  C  CB  A LEU A 1 71  ? 37.175 7.388   4.842   0.53 13.80 ? 71   LEU A CB  1 
ATOM   635  C  CB  B LEU A 1 71  ? 38.215 7.114   4.769   0.47 16.24 ? 71   LEU A CB  1 
ATOM   636  C  CG  A LEU A 1 71  ? 37.583 5.899   4.967   0.53 24.20 ? 71   LEU A CG  1 
ATOM   637  C  CG  B LEU A 1 71  ? 38.549 5.603   4.814   0.47 21.46 ? 71   LEU A CG  1 
ATOM   638  C  CD1 A LEU A 1 71  ? 36.466 4.935   4.686   0.53 32.24 ? 71   LEU A CD1 1 
ATOM   639  C  CD1 B LEU A 1 71  ? 37.592 4.912   3.867   0.47 28.35 ? 71   LEU A CD1 1 
ATOM   640  C  CD2 A LEU A 1 71  ? 38.776 5.772   4.033   0.53 23.71 ? 71   LEU A CD2 1 
ATOM   641  C  CD2 B LEU A 1 71  ? 39.971 5.407   4.357   0.47 29.31 ? 71   LEU A CD2 1 
ATOM   642  N  N   A MET A 1 72  ? 39.474 7.386   7.028   0.67 13.09 ? 72   MET A N   1 
ATOM   643  N  N   B MET A 1 72  ? 39.904 7.599   7.290   0.33 14.06 ? 72   MET A N   1 
ATOM   644  C  CA  A MET A 1 72  ? 40.367 6.603   7.893   0.67 14.57 ? 72   MET A CA  1 
ATOM   645  C  CA  B MET A 1 72  ? 40.795 7.164   8.365   0.33 13.83 ? 72   MET A CA  1 
ATOM   646  C  C   A MET A 1 72  ? 40.298 7.013   9.318   0.67 16.84 ? 72   MET A C   1 
ATOM   647  C  C   B MET A 1 72  ? 40.263 7.478   9.746   0.33 17.29 ? 72   MET A C   1 
ATOM   648  O  O   A MET A 1 72  ? 40.174 6.200   10.235  0.67 19.71 ? 72   MET A O   1 
ATOM   649  O  O   B MET A 1 72  ? 40.369 6.722   10.710  0.33 16.98 ? 72   MET A O   1 
ATOM   650  C  CB  A MET A 1 72  ? 41.848 6.809   7.512   0.67 16.21 ? 72   MET A CB  1 
ATOM   651  C  CB  B MET A 1 72  ? 42.179 7.842   8.295   0.33 18.67 ? 72   MET A CB  1 
ATOM   652  C  CG  A MET A 1 72  ? 42.166 6.091   6.243   0.67 18.79 ? 72   MET A CG  1 
ATOM   653  C  CG  B MET A 1 72  ? 43.055 7.287   7.190   0.33 19.97 ? 72   MET A CG  1 
ATOM   654  S  SD  A MET A 1 72  ? 42.076 4.339   6.456   0.67 23.78 ? 72   MET A SD  1 
ATOM   655  S  SD  B MET A 1 72  ? 43.119 5.490   7.272   0.33 24.09 ? 72   MET A SD  1 
ATOM   656  C  CE  A MET A 1 72  ? 43.386 4.004   7.615   0.67 35.74 ? 72   MET A CE  1 
ATOM   657  C  CE  B MET A 1 72  ? 44.857 5.209   7.039   0.33 30.16 ? 72   MET A CE  1 
ATOM   658  N  N   A ALA A 1 73  ? 40.418 8.307   9.560   0.54 14.98 ? 73   ALA A N   1 
ATOM   659  N  N   B ALA A 1 73  ? 39.668 8.655   9.843   0.46 16.19 ? 73   ALA A N   1 
ATOM   660  C  CA  A ALA A 1 73  ? 40.338 8.769   10.932  0.54 17.68 ? 73   ALA A CA  1 
ATOM   661  C  CA  B ALA A 1 73  ? 39.261 9.082   11.177  0.46 16.55 ? 73   ALA A CA  1 
ATOM   662  C  C   A ALA A 1 73  ? 39.041 8.301   11.600  0.54 17.58 ? 73   ALA A C   1 
ATOM   663  C  C   B ALA A 1 73  ? 38.035 8.292   11.586  0.46 16.51 ? 73   ALA A C   1 
ATOM   664  O  O   A ALA A 1 73  ? 39.056 7.927   12.777  0.54 21.10 ? 73   ALA A O   1 
ATOM   665  O  O   B ALA A 1 73  ? 37.963 7.813   12.716  0.46 16.36 ? 73   ALA A O   1 
ATOM   666  C  CB  A ALA A 1 73  ? 40.422 10.273  10.996  0.54 18.04 ? 73   ALA A CB  1 
ATOM   667  C  CB  B ALA A 1 73  ? 38.976 10.557  11.188  0.46 21.88 ? 73   ALA A CB  1 
ATOM   668  N  N   A ARG A 1 74  ? 37.942 8.291   10.862  0.51 16.68 ? 74   ARG A N   1 
ATOM   669  N  N   B ARG A 1 74  ? 37.075 8.163   10.692  0.49 15.34 ? 74   ARG A N   1 
ATOM   670  C  CA  A ARG A 1 74  ? 36.694 7.773   11.398  0.51 16.59 ? 74   ARG A CA  1 
ATOM   671  C  CA  B ARG A 1 74  ? 35.920 7.332   11.012  0.49 17.15 ? 74   ARG A CA  1 
ATOM   672  C  C   A ARG A 1 74  ? 36.752 6.254   11.532  0.51 18.92 ? 74   ARG A C   1 
ATOM   673  C  C   B ARG A 1 74  ? 36.319 5.950   11.439  0.49 18.66 ? 74   ARG A C   1 
ATOM   674  O  O   A ARG A 1 74  ? 36.329 5.765   12.595  0.51 23.26 ? 74   ARG A O   1 
ATOM   675  O  O   B ARG A 1 74  ? 35.891 5.365   12.424  0.49 24.55 ? 74   ARG A O   1 
ATOM   676  C  CB  A ARG A 1 74  ? 35.525 8.256   10.548  0.51 17.54 ? 74   ARG A CB  1 
ATOM   677  C  CB  B ARG A 1 74  ? 34.994 7.272   9.776   0.49 18.13 ? 74   ARG A CB  1 
ATOM   678  C  CG  A ARG A 1 74  ? 35.327 9.766   10.636  0.51 21.74 ? 74   ARG A CG  1 
ATOM   679  C  CG  B ARG A 1 74  ? 34.195 8.596   9.900   0.49 20.42 ? 74   ARG A CG  1 
ATOM   680  C  CD  A ARG A 1 74  ? 34.302 10.310  9.659   0.51 21.88 ? 74   ARG A CD  1 
ATOM   681  C  CD  B ARG A 1 74  ? 32.913 8.183   10.666  0.49 26.32 ? 74   ARG A CD  1 
ATOM   682  N  NE  A ARG A 1 74  ? 33.072 9.557   9.606   0.51 20.82 ? 74   ARG A NE  1 
ATOM   683  N  NE  B ARG A 1 74  ? 31.808 8.339   9.758   0.49 26.77 ? 74   ARG A NE  1 
ATOM   684  C  CZ  A ARG A 1 74  ? 32.563 8.803   8.641   0.51 24.04 ? 74   ARG A CZ  1 
ATOM   685  C  CZ  B ARG A 1 74  ? 30.881 7.635   9.182   0.49 35.02 ? 74   ARG A CZ  1 
ATOM   686  N  NH1 A ARG A 1 74  ? 33.220 8.641   7.485   0.51 32.15 ? 74   ARG A NH1 1 
ATOM   687  N  NH1 B ARG A 1 74  ? 30.644 6.333   9.284   0.49 37.71 ? 74   ARG A NH1 1 
ATOM   688  N  NH2 A ARG A 1 74  ? 31.393 8.172   8.776   0.51 26.55 ? 74   ARG A NH2 1 
ATOM   689  N  NH2 B ARG A 1 74  ? 30.040 8.299   8.380   0.49 48.87 ? 74   ARG A NH2 1 
ATOM   690  N  N   . LYS A 1 75  ? 37.229 5.418   10.614  1.00 19.83 ? 75   LYS A N   1 
ATOM   691  C  CA  . LYS A 1 75  ? 37.442 3.966   10.753  1.00 22.03 ? 75   LYS A CA  1 
ATOM   692  C  C   . LYS A 1 75  ? 38.219 3.702   12.012  1.00 20.78 ? 75   LYS A C   1 
ATOM   693  O  O   . LYS A 1 75  ? 37.989 2.747   12.748  1.00 22.48 ? 75   LYS A O   1 
ATOM   694  C  CB  . LYS A 1 75  ? 38.121 3.398   9.485   1.00 23.99 ? 75   LYS A CB  1 
ATOM   695  C  CG  . LYS A 1 75  ? 37.109 3.135   8.363   1.00 34.70 ? 75   LYS A CG  1 
ATOM   696  C  CD  . LYS A 1 75  ? 37.787 2.423   7.204   1.00 42.14 ? 75   LYS A CD  1 
ATOM   697  C  CE  . LYS A 1 75  ? 36.930 1.452   6.424   1.00 51.60 ? 75   LYS A CE  1 
ATOM   698  N  NZ  . LYS A 1 75  ? 37.336 1.351   4.982   1.00 60.20 ? 75   LYS A NZ  1 
ATOM   699  N  N   A MET A 1 76  ? 39.168 4.546   12.387  0.60 22.19 ? 76   MET A N   1 
ATOM   700  N  N   B MET A 1 76  ? 39.189 4.574   12.275  0.40 21.46 ? 76   MET A N   1 
ATOM   701  C  CA  A MET A 1 76  ? 39.962 4.230   13.588  0.60 22.35 ? 76   MET A CA  1 
ATOM   702  C  CA  B MET A 1 76  ? 40.015 4.503   13.474  0.40 22.95 ? 76   MET A CA  1 
ATOM   703  C  C   A MET A 1 76  ? 39.234 4.607   14.852  0.60 23.16 ? 76   MET A C   1 
ATOM   704  C  C   B MET A 1 76  ? 39.116 4.451   14.710  0.40 23.38 ? 76   MET A C   1 
ATOM   705  O  O   A MET A 1 76  ? 39.565 4.174   15.974  0.60 27.59 ? 76   MET A O   1 
ATOM   706  O  O   B MET A 1 76  ? 39.251 3.575   15.594  0.40 15.46 ? 76   MET A O   1 
ATOM   707  C  CB  A MET A 1 76  ? 41.265 4.995   13.470  0.60 21.85 ? 76   MET A CB  1 
ATOM   708  C  CB  B MET A 1 76  ? 40.958 5.707   13.556  0.40 23.54 ? 76   MET A CB  1 
ATOM   709  C  CG  A MET A 1 76  ? 41.977 4.702   12.151  0.60 25.41 ? 76   MET A CG  1 
ATOM   710  C  CG  B MET A 1 76  ? 42.320 5.501   12.962  0.40 26.37 ? 76   MET A CG  1 
ATOM   711  S  SD  A MET A 1 76  ? 43.286 5.863   11.871  0.60 27.17 ? 76   MET A SD  1 
ATOM   712  S  SD  B MET A 1 76  ? 43.679 6.613   13.327  0.40 37.03 ? 76   MET A SD  1 
ATOM   713  C  CE  A MET A 1 76  ? 43.081 7.156   13.087  0.60 36.85 ? 76   MET A CE  1 
ATOM   714  C  CE  B MET A 1 76  ? 42.869 8.209   13.366  0.40 26.95 ? 76   MET A CE  1 
ATOM   715  N  N   . LYS A 1 77  ? 38.194 5.414   14.734  1.00 22.41 ? 77   LYS A N   1 
ATOM   716  C  CA  . LYS A 1 77  ? 37.319 5.569   15.927  1.00 25.50 ? 77   LYS A CA  1 
ATOM   717  C  C   . LYS A 1 77  ? 36.402 4.392   16.057  1.00 21.01 ? 77   LYS A C   1 
ATOM   718  O  O   . LYS A 1 77  ? 36.095 3.838   17.136  1.00 22.36 ? 77   LYS A O   1 
ATOM   719  C  CB  . LYS A 1 77  ? 36.528 6.892   15.811  1.00 32.34 ? 77   LYS A CB  1 
ATOM   720  C  CG  . LYS A 1 77  ? 37.274 8.189   16.076  1.00 44.16 ? 77   LYS A CG  1 
ATOM   721  C  CD  . LYS A 1 77  ? 36.396 9.416   15.855  1.00 50.35 ? 77   LYS A CD  1 
ATOM   722  C  CE  . LYS A 1 77  ? 37.056 10.566  15.129  1.00 52.43 ? 77   LYS A CE  1 
ATOM   723  N  NZ  . LYS A 1 77  ? 36.129 11.175  14.121  1.00 59.77 ? 77   LYS A NZ  1 
ATOM   724  N  N   A GLU A 1 78  ? 35.918 3.940   14.899  0.58 20.26 ? 78   GLU A N   1 
ATOM   725  N  N   B GLU A 1 78  ? 35.904 3.837   14.950  0.42 18.75 ? 78   GLU A N   1 
ATOM   726  C  CA  A GLU A 1 78  ? 35.115 2.729   14.852  0.58 19.93 ? 78   GLU A CA  1 
ATOM   727  C  CA  B GLU A 1 78  ? 35.032 2.669   15.101  0.42 20.38 ? 78   GLU A CA  1 
ATOM   728  C  C   A GLU A 1 78  ? 35.859 1.580   15.510  0.58 19.18 ? 78   GLU A C   1 
ATOM   729  C  C   B GLU A 1 78  ? 35.830 1.436   15.462  0.42 16.78 ? 78   GLU A C   1 
ATOM   730  O  O   A GLU A 1 78  ? 35.327 0.857   16.378  0.58 17.77 ? 78   GLU A O   1 
ATOM   731  O  O   B GLU A 1 78  ? 35.319 0.495   16.092  0.42 23.24 ? 78   GLU A O   1 
ATOM   732  C  CB  A GLU A 1 78  ? 34.779 2.385   13.397  0.58 24.34 ? 78   GLU A CB  1 
ATOM   733  C  CB  B GLU A 1 78  ? 34.247 2.457   13.810  0.42 22.00 ? 78   GLU A CB  1 
ATOM   734  C  CG  A GLU A 1 78  ? 33.350 2.523   12.935  0.58 29.15 ? 78   GLU A CG  1 
ATOM   735  C  CG  B GLU A 1 78  ? 33.771 1.056   13.468  0.42 27.10 ? 78   GLU A CG  1 
ATOM   736  C  CD  A GLU A 1 78  ? 33.016 3.192   11.631  0.58 31.19 ? 78   GLU A CD  1 
ATOM   737  C  CD  B GLU A 1 78  ? 33.422 0.981   11.990  0.42 34.22 ? 78   GLU A CD  1 
ATOM   738  O  OE1 A GLU A 1 78  ? 33.609 2.876   10.573  0.58 39.96 ? 78   GLU A OE1 1 
ATOM   739  O  OE1 B GLU A 1 78  ? 33.184 2.063   11.403  0.42 38.35 ? 78   GLU A OE1 1 
ATOM   740  O  OE2 A GLU A 1 78  ? 32.122 4.072   11.518  0.58 42.80 ? 78   GLU A OE2 1 
ATOM   741  O  OE2 B GLU A 1 78  ? 33.388 -0.119  11.389  0.42 52.25 ? 78   GLU A OE2 1 
ATOM   742  N  N   . GLN A 1 79  ? 37.108 1.399   15.084  1.00 18.48 ? 79   GLN A N   1 
ATOM   743  C  CA  . GLN A 1 79  ? 37.882 0.234   15.502  1.00 18.67 ? 79   GLN A CA  1 
ATOM   744  C  C   . GLN A 1 79  ? 38.166 0.301   16.983  1.00 18.14 ? 79   GLN A C   1 
ATOM   745  O  O   . GLN A 1 79  ? 38.151 -0.727  17.681  1.00 18.74 ? 79   GLN A O   1 
ATOM   746  C  CB  . GLN A 1 79  ? 39.108 0.177   14.577  1.00 25.77 ? 79   GLN A CB  1 
ATOM   747  C  CG  . GLN A 1 79  ? 38.747 -0.351  13.185  1.00 39.28 ? 79   GLN A CG  1 
ATOM   748  C  CD  . GLN A 1 79  ? 39.916 -0.689  12.287  1.00 46.38 ? 79   GLN A CD  1 
ATOM   749  O  OE1 . GLN A 1 79  ? 39.881 -1.559  11.409  1.00 61.45 ? 79   GLN A OE1 1 
ATOM   750  N  NE2 . GLN A 1 79  ? 41.046 0.006   12.488  1.00 66.58 ? 79   GLN A NE2 1 
ATOM   751  N  N   A ASP A 1 80  ? 38.453 1.475   17.540  0.31 18.38 ? 80   ASP A N   1 
ATOM   752  N  N   B ASP A 1 80  ? 38.399 1.490   17.507  0.69 18.43 ? 80   ASP A N   1 
ATOM   753  C  CA  A ASP A 1 80  ? 38.646 1.539   18.987  0.31 19.26 ? 80   ASP A CA  1 
ATOM   754  C  CA  B ASP A 1 80  ? 38.672 1.642   18.929  0.69 19.64 ? 80   ASP A CA  1 
ATOM   755  C  C   A ASP A 1 80  ? 37.393 1.016   19.689  0.31 18.83 ? 80   ASP A C   1 
ATOM   756  C  C   B ASP A 1 80  ? 37.432 1.324   19.748  0.69 18.51 ? 80   ASP A C   1 
ATOM   757  O  O   A ASP A 1 80  ? 37.450 0.073   20.479  0.31 19.57 ? 80   ASP A O   1 
ATOM   758  O  O   B ASP A 1 80  ? 37.485 0.721   20.823  0.69 20.94 ? 80   ASP A O   1 
ATOM   759  C  CB  A ASP A 1 80  ? 38.946 2.962   19.427  0.31 22.62 ? 80   ASP A CB  1 
ATOM   760  C  CB  B ASP A 1 80  ? 39.201 3.048   19.135  0.69 24.01 ? 80   ASP A CB  1 
ATOM   761  C  CG  A ASP A 1 80  ? 40.066 3.580   18.625  0.31 27.10 ? 80   ASP A CG  1 
ATOM   762  C  CG  B ASP A 1 80  ? 40.668 3.143   18.763  0.69 27.04 ? 80   ASP A CG  1 
ATOM   763  O  OD1 A ASP A 1 80  ? 40.996 2.825   18.247  0.31 33.96 ? 80   ASP A OD1 1 
ATOM   764  O  OD1 B ASP A 1 80  ? 41.381 2.111   18.795  0.69 31.66 ? 80   ASP A OD1 1 
ATOM   765  O  OD2 A ASP A 1 80  ? 39.998 4.801   18.366  0.31 32.20 ? 80   ASP A OD2 1 
ATOM   766  O  OD2 B ASP A 1 80  ? 41.056 4.293   18.426  0.69 36.98 ? 80   ASP A OD2 1 
ATOM   767  N  N   A SER A 1 81  ? 36.268 1.625   19.339  0.46 19.08 ? 81   SER A N   1 
ATOM   768  N  N   B SER A 1 81  ? 36.239 1.651   19.236  0.54 18.78 ? 81   SER A N   1 
ATOM   769  C  CA  A SER A 1 81  ? 34.956 1.250   19.875  0.46 21.04 ? 81   SER A CA  1 
ATOM   770  C  CA  B SER A 1 81  ? 35.029 1.241   19.972  0.54 20.47 ? 81   SER A CA  1 
ATOM   771  C  C   A SER A 1 81  ? 34.755 -0.249  19.855  0.46 18.93 ? 81   SER A C   1 
ATOM   772  C  C   B SER A 1 81  ? 34.736 -0.241  19.838  0.54 18.30 ? 81   SER A C   1 
ATOM   773  O  O   A SER A 1 81  ? 34.410 -0.916  20.839  0.46 18.83 ? 81   SER A O   1 
ATOM   774  O  O   B SER A 1 81  ? 34.143 -0.857  20.735  0.54 26.66 ? 81   SER A O   1 
ATOM   775  C  CB  A SER A 1 81  ? 33.860 1.963   19.077  0.46 22.72 ? 81   SER A CB  1 
ATOM   776  C  CB  B SER A 1 81  ? 33.784 2.008   19.520  0.54 22.60 ? 81   SER A CB  1 
ATOM   777  O  OG  A SER A 1 81  ? 33.758 3.337   19.417  0.46 29.00 ? 81   SER A OG  1 
ATOM   778  O  OG  B SER A 1 81  ? 32.575 1.286   19.725  0.54 30.44 ? 81   SER A OG  1 
ATOM   779  N  N   A GLU A 1 82  ? 34.983 -0.836  18.675  0.56 17.40 ? 82   GLU A N   1 
ATOM   780  N  N   B GLU A 1 82  ? 35.125 -0.804  18.695  0.44 17.09 ? 82   GLU A N   1 
ATOM   781  C  CA  A GLU A 1 82  ? 34.787 -2.278  18.567  0.56 18.44 ? 82   GLU A CA  1 
ATOM   782  C  CA  B GLU A 1 82  ? 34.895 -2.233  18.479  0.44 16.89 ? 82   GLU A CA  1 
ATOM   783  C  C   A GLU A 1 82  ? 35.764 -3.020  19.467  0.56 15.59 ? 82   GLU A C   1 
ATOM   784  C  C   B GLU A 1 82  ? 35.763 -3.019  19.454  0.44 16.39 ? 82   GLU A C   1 
ATOM   785  O  O   A GLU A 1 82  ? 35.429 -4.041  20.074  0.56 18.16 ? 82   GLU A O   1 
ATOM   786  O  O   B GLU A 1 82  ? 35.332 -3.995  20.067  0.44 19.09 ? 82   GLU A O   1 
ATOM   787  C  CB  A GLU A 1 82  ? 34.877 -2.755  17.120  0.56 20.09 ? 82   GLU A CB  1 
ATOM   788  C  CB  B GLU A 1 82  ? 35.152 -2.645  17.037  0.44 19.94 ? 82   GLU A CB  1 
ATOM   789  C  CG  A GLU A 1 82  ? 34.857 -4.242  17.014  0.56 27.92 ? 82   GLU A CG  1 
ATOM   790  C  CG  B GLU A 1 82  ? 34.127 -2.000  16.103  0.44 24.37 ? 82   GLU A CG  1 
ATOM   791  C  CD  A GLU A 1 82  ? 34.173 -5.034  15.954  0.56 29.69 ? 82   GLU A CD  1 
ATOM   792  C  CD  B GLU A 1 82  ? 34.581 -2.030  14.657  0.44 33.41 ? 82   GLU A CD  1 
ATOM   793  O  OE1 A GLU A 1 82  ? 34.719 -5.035  14.827  0.56 44.98 ? 82   GLU A OE1 1 
ATOM   794  O  OE1 B GLU A 1 82  ? 35.806 -2.087  14.408  0.44 39.09 ? 82   GLU A OE1 1 
ATOM   795  O  OE2 A GLU A 1 82  ? 33.139 -5.712  16.208  0.56 40.68 ? 82   GLU A OE2 1 
ATOM   796  O  OE2 B GLU A 1 82  ? 33.690 -1.994  13.781  0.44 43.13 ? 82   GLU A OE2 1 
ATOM   797  N  N   . GLU A 1 83  ? 37.002 -2.565  19.581  1.00 16.72 ? 83   GLU A N   1 
ATOM   798  C  CA  . GLU A 1 83  ? 37.978 -3.254  20.443  1.00 17.69 ? 83   GLU A CA  1 
ATOM   799  C  C   . GLU A 1 83  ? 37.511 -3.262  21.861  1.00 18.01 ? 83   GLU A C   1 
ATOM   800  O  O   . GLU A 1 83  ? 37.679 -4.245  22.593  1.00 19.20 ? 83   GLU A O   1 
ATOM   801  C  CB  . GLU A 1 83  ? 39.366 -2.565  20.362  1.00 22.30 ? 83   GLU A CB  1 
ATOM   802  C  CG  . GLU A 1 83  ? 40.368 -3.334  21.200  1.00 21.57 ? 83   GLU A CG  1 
ATOM   803  C  CD  . GLU A 1 83  ? 40.507 -4.806  20.825  1.00 23.03 ? 83   GLU A CD  1 
ATOM   804  O  OE1 . GLU A 1 83  ? 40.422 -5.129  19.605  1.00 33.67 ? 83   GLU A OE1 1 
ATOM   805  O  OE2 . GLU A 1 83  ? 40.727 -5.625  21.693  1.00 24.78 ? 83   GLU A OE2 1 
ATOM   806  N  N   . GLU A 1 84  ? 36.922 -2.184  22.331  1.00 17.67 ? 84   GLU A N   1 
ATOM   807  C  CA  . GLU A 1 84  ? 36.393 -2.147  23.682  1.00 21.94 ? 84   GLU A CA  1 
ATOM   808  C  C   . GLU A 1 84  ? 35.289 -3.205  23.887  1.00 18.82 ? 84   GLU A C   1 
ATOM   809  O  O   . GLU A 1 84  ? 35.201 -3.849  24.937  1.00 18.42 ? 84   GLU A O   1 
ATOM   810  C  CB  . GLU A 1 84  ? 35.763 -0.788  24.032  1.00 27.85 ? 84   GLU A CB  1 
ATOM   811  C  CG  . GLU A 1 84  ? 35.160 -0.722  25.422  1.00 43.83 ? 84   GLU A CG  1 
ATOM   812  C  CD  . GLU A 1 84  ? 34.911 0.686   25.941  1.00 60.49 ? 84   GLU A CD  1 
ATOM   813  O  OE1 . GLU A 1 84  ? 34.438 1.590   25.209  1.00 72.38 ? 84   GLU A OE1 1 
ATOM   814  O  OE2 . GLU A 1 84  ? 35.198 0.893   27.146  1.00 76.69 ? 84   GLU A OE2 1 
ATOM   815  N  N   A LEU A 1 85  ? 34.395 -3.404  22.900  0.51 16.08 ? 85   LEU A N   1 
ATOM   816  N  N   B LEU A 1 85  ? 34.432 -3.311  22.863  0.49 15.63 ? 85   LEU A N   1 
ATOM   817  C  CA  A LEU A 1 85  ? 33.347 -4.417  23.071  0.51 14.30 ? 85   LEU A CA  1 
ATOM   818  C  CA  B LEU A 1 85  ? 33.362 -4.293  22.873  0.49 13.88 ? 85   LEU A CA  1 
ATOM   819  C  C   A LEU A 1 85  ? 33.902 -5.819  22.942  0.51 14.71 ? 85   LEU A C   1 
ATOM   820  C  C   B LEU A 1 85  ? 33.936 -5.703  22.946  0.49 13.14 ? 85   LEU A C   1 
ATOM   821  O  O   A LEU A 1 85  ? 33.453 -6.788  23.593  0.51 13.37 ? 85   LEU A O   1 
ATOM   822  O  O   B LEU A 1 85  ? 33.436 -6.503  23.790  0.49 12.75 ? 85   LEU A O   1 
ATOM   823  C  CB  A LEU A 1 85  ? 32.236 -4.134  22.072  0.51 14.03 ? 85   LEU A CB  1 
ATOM   824  C  CB  B LEU A 1 85  ? 32.461 -4.102  21.657  0.49 13.53 ? 85   LEU A CB  1 
ATOM   825  C  CG  A LEU A 1 85  ? 31.422 -2.855  22.324  0.51 15.95 ? 85   LEU A CG  1 
ATOM   826  C  CG  B LEU A 1 85  ? 31.526 -2.880  21.772  0.49 16.24 ? 85   LEU A CG  1 
ATOM   827  C  CD1 A LEU A 1 85  ? 30.501 -2.558  21.165  0.51 22.53 ? 85   LEU A CD1 1 
ATOM   828  C  CD1 B LEU A 1 85  ? 30.995 -2.555  20.374  0.49 17.18 ? 85   LEU A CD1 1 
ATOM   829  C  CD2 A LEU A 1 85  ? 30.624 -2.973  23.620  0.51 23.91 ? 85   LEU A CD2 1 
ATOM   830  C  CD2 B LEU A 1 85  ? 30.379 -3.063  22.747  0.49 20.35 ? 85   LEU A CD2 1 
ATOM   831  N  N   . ILE A 1 86  ? 34.903 -5.986  22.100  1.00 13.12 ? 86   ILE A N   1 
ATOM   832  C  CA  . ILE A 1 86  ? 35.545 -7.291  22.044  1.00 13.46 ? 86   ILE A CA  1 
ATOM   833  C  C   . ILE A 1 86  ? 36.190 -7.633  23.379  1.00 13.88 ? 86   ILE A C   1 
ATOM   834  O  O   . ILE A 1 86  ? 36.045 -8.745  23.865  1.00 15.02 ? 86   ILE A O   1 
ATOM   835  C  CB  . ILE A 1 86  ? 36.566 -7.272  20.878  1.00 15.15 ? 86   ILE A CB  1 
ATOM   836  C  CG1 . ILE A 1 86  ? 35.848 -7.171  19.557  1.00 16.08 ? 86   ILE A CG1 1 
ATOM   837  C  CG2 . ILE A 1 86  ? 37.499 -8.447  20.991  1.00 20.40 ? 86   ILE A CG2 1 
ATOM   838  C  CD1 . ILE A 1 86  ? 36.735 -6.895  18.340  1.00 21.08 ? 86   ILE A CD1 1 
ATOM   839  N  N   A GLU A 1 87  ? 36.954 -6.682  23.950  0.58 15.36 ? 87   GLU A N   1 
ATOM   840  N  N   B GLU A 1 87  ? 36.901 -6.664  23.966  0.42 15.08 ? 87   GLU A N   1 
ATOM   841  C  CA  A GLU A 1 87  ? 37.572 -7.046  25.234  0.58 16.18 ? 87   GLU A CA  1 
ATOM   842  C  CA  B GLU A 1 87  ? 37.573 -6.752  25.256  0.42 16.41 ? 87   GLU A CA  1 
ATOM   843  C  C   A GLU A 1 87  ? 36.497 -7.342  26.257  0.58 15.63 ? 87   GLU A C   1 
ATOM   844  C  C   B GLU A 1 87  ? 36.635 -7.115  26.393  0.42 16.66 ? 87   GLU A C   1 
ATOM   845  O  O   A GLU A 1 87  ? 36.682 -8.390  26.920  0.58 16.03 ? 87   GLU A O   1 
ATOM   846  O  O   B GLU A 1 87  ? 36.851 -7.899  27.331  0.42 17.33 ? 87   GLU A O   1 
ATOM   847  C  CB  A GLU A 1 87  ? 38.543 -5.950  25.674  0.58 15.05 ? 87   GLU A CB  1 
ATOM   848  C  CB  B GLU A 1 87  ? 38.255 -5.414  25.567  0.42 15.91 ? 87   GLU A CB  1 
ATOM   849  C  CG  A GLU A 1 87  ? 39.697 -5.821  24.693  0.58 14.59 ? 87   GLU A CG  1 
ATOM   850  C  CG  B GLU A 1 87  ? 39.510 -5.150  24.746  0.42 15.55 ? 87   GLU A CG  1 
ATOM   851  C  CD  A GLU A 1 87  ? 40.474 -4.530  24.875  0.58 17.38 ? 87   GLU A CD  1 
ATOM   852  C  CD  B GLU A 1 87  ? 40.561 -6.203  25.066  0.42 19.53 ? 87   GLU A CD  1 
ATOM   853  O  OE1 A GLU A 1 87  ? 41.462 -4.360  24.170  0.58 20.46 ? 87   GLU A OE1 1 
ATOM   854  O  OE1 B GLU A 1 87  ? 40.459 -7.347  24.568  0.42 19.23 ? 87   GLU A OE1 1 
ATOM   855  O  OE2 A GLU A 1 87  ? 40.031 -3.721  25.713  0.58 30.39 ? 87   GLU A OE2 1 
ATOM   856  O  OE2 B GLU A 1 87  ? 41.465 -5.816  25.849  0.42 27.40 ? 87   GLU A OE2 1 
ATOM   857  N  N   . ALA A 1 88  ? 35.471 -6.502  26.341  1.00 16.65 ? 88   ALA A N   1 
ATOM   858  C  CA  . ALA A 1 88  ? 34.431 -6.809  27.355  1.00 16.77 ? 88   ALA A CA  1 
ATOM   859  C  C   . ALA A 1 88  ? 33.833 -8.185  27.133  1.00 15.56 ? 88   ALA A C   1 
ATOM   860  O  O   . ALA A 1 88  ? 33.648 -8.970  28.086  1.00 17.40 ? 88   ALA A O   1 
ATOM   861  C  CB  . ALA A 1 88  ? 33.381 -5.723  27.338  1.00 17.83 ? 88   ALA A CB  1 
ATOM   862  N  N   . PHE A 1 89  ? 33.517 -8.535  25.882  1.00 14.06 ? 89   PHE A N   1 
ATOM   863  C  CA  . PHE A 1 89  ? 32.947 -9.835  25.610  1.00 12.77 ? 89   PHE A CA  1 
ATOM   864  C  C   . PHE A 1 89  ? 33.857 -10.945 26.139  1.00 14.13 ? 89   PHE A C   1 
ATOM   865  O  O   . PHE A 1 89  ? 33.395 -11.907 26.729  1.00 14.94 ? 89   PHE A O   1 
ATOM   866  C  CB  . PHE A 1 89  ? 32.695 -9.983  24.094  1.00 11.93 ? 89   PHE A CB  1 
ATOM   867  C  CG  . PHE A 1 89  ? 32.048 -11.290 23.781  1.00 11.55 ? 89   PHE A CG  1 
ATOM   868  C  CD1 . PHE A 1 89  ? 30.666 -11.411 23.837  1.00 11.62 ? 89   PHE A CD1 1 
ATOM   869  C  CD2 . PHE A 1 89  ? 32.771 -12.422 23.466  1.00 14.33 ? 89   PHE A CD2 1 
ATOM   870  C  CE1 . PHE A 1 89  ? 30.027 -12.604 23.616  1.00 12.36 ? 89   PHE A CE1 1 
ATOM   871  C  CE2 . PHE A 1 89  ? 32.156 -13.650 23.215  1.00 14.55 ? 89   PHE A CE2 1 
ATOM   872  C  CZ  . PHE A 1 89  ? 30.780 -13.710 23.299  1.00 13.44 ? 89   PHE A CZ  1 
ATOM   873  N  N   A LYS A 1 90  ? 35.160 -10.937 25.756  0.51 14.25 ? 90   LYS A N   1 
ATOM   874  N  N   B LYS A 1 90  ? 35.152 -10.616 26.002  0.49 16.06 ? 90   LYS A N   1 
ATOM   875  C  CA  A LYS A 1 90  ? 36.035 -12.103 25.959  0.51 11.05 ? 90   LYS A CA  1 
ATOM   876  C  CA  B LYS A 1 90  ? 36.158 -11.518 26.548  0.49 12.55 ? 90   LYS A CA  1 
ATOM   877  C  C   A LYS A 1 90  ? 36.248 -12.375 27.440  0.51 10.13 ? 90   LYS A C   1 
ATOM   878  C  C   B LYS A 1 90  ? 36.204 -11.508 28.066  0.49 12.04 ? 90   LYS A C   1 
ATOM   879  O  O   A LYS A 1 90  ? 36.521 -13.495 27.856  0.51 11.17 ? 90   LYS A O   1 
ATOM   880  O  O   B LYS A 1 90  ? 36.588 -12.574 28.590  0.49 13.23 ? 90   LYS A O   1 
ATOM   881  C  CB  A LYS A 1 90  ? 37.404 -11.881 25.285  0.51 11.72 ? 90   LYS A CB  1 
ATOM   882  C  CB  B LYS A 1 90  ? 37.483 -11.168 25.839  0.49 12.67 ? 90   LYS A CB  1 
ATOM   883  C  CG  A LYS A 1 90  ? 37.407 -12.124 23.785  0.51 12.34 ? 90   LYS A CG  1 
ATOM   884  C  CG  B LYS A 1 90  ? 37.399 -11.451 24.324  0.49 13.60 ? 90   LYS A CG  1 
ATOM   885  C  CD  A LYS A 1 90  ? 38.709 -12.002 23.064  0.51 13.23 ? 90   LYS A CD  1 
ATOM   886  C  CD  B LYS A 1 90  ? 38.717 -11.466 23.627  0.49 16.28 ? 90   LYS A CD  1 
ATOM   887  C  CE  A LYS A 1 90  ? 39.474 -10.740 23.409  0.51 13.05 ? 90   LYS A CE  1 
ATOM   888  C  CE  B LYS A 1 90  ? 38.927 -11.329 22.150  0.49 18.73 ? 90   LYS A CE  1 
ATOM   889  N  NZ  A LYS A 1 90  ? 40.837 -10.800 22.749  0.51 16.79 ? 90   LYS A NZ  1 
ATOM   890  N  NZ  B LYS A 1 90  ? 40.351 -10.847 21.932  0.49 25.86 ? 90   LYS A NZ  1 
ATOM   891  N  N   A VAL A 1 91  ? 36.145 -11.311 28.232  0.54 10.86 ? 91   VAL A N   1 
ATOM   892  N  N   B VAL A 1 91  ? 35.822 -10.469 28.795  0.46 10.85 ? 91   VAL A N   1 
ATOM   893  C  CA  A VAL A 1 91  ? 36.129 -11.496 29.681  0.54 12.30 ? 91   VAL A CA  1 
ATOM   894  C  CA  B VAL A 1 91  ? 35.761 -10.569 30.264  0.46 12.13 ? 91   VAL A CA  1 
ATOM   895  C  C   A VAL A 1 91  ? 34.863 -12.223 30.115  0.54 10.49 ? 91   VAL A C   1 
ATOM   896  C  C   B VAL A 1 91  ? 34.662 -11.546 30.671  0.46 10.23 ? 91   VAL A C   1 
ATOM   897  O  O   A VAL A 1 91  ? 34.974 -13.144 30.907  0.54 12.54 ? 91   VAL A O   1 
ATOM   898  O  O   B VAL A 1 91  ? 34.861 -12.339 31.582  0.46 11.23 ? 91   VAL A O   1 
ATOM   899  C  CB  A VAL A 1 91  ? 36.205 -10.131 30.406  0.54 15.43 ? 91   VAL A CB  1 
ATOM   900  C  CB  B VAL A 1 91  ? 35.560 -9.202  30.952  0.46 14.00 ? 91   VAL A CB  1 
ATOM   901  C  CG1 A VAL A 1 91  ? 36.067 -10.255 31.897  0.54 16.63 ? 91   VAL A CG1 1 
ATOM   902  C  CG1 B VAL A 1 91  ? 35.295 -9.281  32.447  0.46 13.53 ? 91   VAL A CG1 1 
ATOM   903  C  CG2 A VAL A 1 91  ? 37.528 -9.488  30.145  0.54 19.00 ? 91   VAL A CG2 1 
ATOM   904  C  CG2 B VAL A 1 91  ? 36.776 -8.320  30.715  0.46 12.49 ? 91   VAL A CG2 1 
ATOM   905  N  N   A PHE A 1 92  ? 33.682 -11.744 29.707  0.61 12.36 ? 92   PHE A N   1 
ATOM   906  N  N   B PHE A 1 92  ? 33.513 -11.548 29.994  0.39 10.92 ? 92   PHE A N   1 
ATOM   907  C  CA  A PHE A 1 92  ? 32.450 -12.437 30.120  0.61 11.45 ? 92   PHE A CA  1 
ATOM   908  C  CA  B PHE A 1 92  ? 32.393 -12.450 30.271  0.39 10.60 ? 92   PHE A CA  1 
ATOM   909  C  C   A PHE A 1 92  ? 32.549 -13.906 29.746  0.61 11.15 ? 92   PHE A C   1 
ATOM   910  C  C   B PHE A 1 92  ? 32.477 -13.848 29.679  0.39 12.57 ? 92   PHE A C   1 
ATOM   911  O  O   A PHE A 1 92  ? 32.163 -14.813 30.485  0.61 11.44 ? 92   PHE A O   1 
ATOM   912  O  O   B PHE A 1 92  ? 31.933 -14.773 30.312  0.39 11.82 ? 92   PHE A O   1 
ATOM   913  C  CB  A PHE A 1 92  ? 31.204 -11.809 29.509  0.61 10.42 ? 92   PHE A CB  1 
ATOM   914  C  CB  B PHE A 1 92  ? 31.053 -11.829 29.827  0.39 11.10 ? 92   PHE A CB  1 
ATOM   915  C  CG  A PHE A 1 92  ? 30.753 -10.562 30.253  0.61 9.76  ? 92   PHE A CG  1 
ATOM   916  C  CG  B PHE A 1 92  ? 30.664 -10.627 30.690  0.39 13.48 ? 92   PHE A CG  1 
ATOM   917  C  CD1 A PHE A 1 92  ? 30.155 -10.652 31.512  0.61 15.09 ? 92   PHE A CD1 1 
ATOM   918  C  CD1 B PHE A 1 92  ? 29.916 -10.760 31.865  0.39 12.69 ? 92   PHE A CD1 1 
ATOM   919  C  CD2 A PHE A 1 92  ? 30.897 -9.305  29.742  0.61 13.83 ? 92   PHE A CD2 1 
ATOM   920  C  CD2 B PHE A 1 92  ? 31.075 -9.370  30.280  0.39 15.00 ? 92   PHE A CD2 1 
ATOM   921  C  CE1 A PHE A 1 92  ? 29.732 -9.504  32.177  0.61 16.83 ? 92   PHE A CE1 1 
ATOM   922  C  CE1 B PHE A 1 92  ? 29.591 -9.608  32.569  0.39 14.82 ? 92   PHE A CE1 1 
ATOM   923  C  CE2 A PHE A 1 92  ? 30.502 -8.167  30.380  0.61 15.51 ? 92   PHE A CE2 1 
ATOM   924  C  CE2 B PHE A 1 92  ? 30.746 -8.238  30.995  0.39 13.96 ? 92   PHE A CE2 1 
ATOM   925  C  CZ  A PHE A 1 92  ? 29.879 -8.270  31.609  0.61 16.56 ? 92   PHE A CZ  1 
ATOM   926  C  CZ  B PHE A 1 92  ? 29.986 -8.372  32.141  0.39 14.31 ? 92   PHE A CZ  1 
ATOM   927  N  N   . ASP A 1 93  ? 33.054 -14.137 28.512  1.00 12.14 ? 93   ASP A N   1 
ATOM   928  C  CA  . ASP A 1 93  ? 33.108 -15.474 27.968  1.00 12.43 ? 93   ASP A CA  1 
ATOM   929  C  C   . ASP A 1 93  ? 34.299 -16.248 28.524  1.00 13.83 ? 93   ASP A C   1 
ATOM   930  O  O   . ASP A 1 93  ? 35.365 -16.416 27.925  1.00 16.02 ? 93   ASP A O   1 
ATOM   931  C  CB  . ASP A 1 93  ? 33.220 -15.399 26.440  1.00 13.55 ? 93   ASP A CB  1 
ATOM   932  C  CG  . ASP A 1 93  ? 33.299 -16.766 25.770  1.00 14.63 ? 93   ASP A CG  1 
ATOM   933  O  OD1 . ASP A 1 93  ? 32.902 -17.725 26.409  1.00 16.02 ? 93   ASP A OD1 1 
ATOM   934  O  OD2 . ASP A 1 93  ? 33.756 -16.820 24.604  1.00 15.56 ? 93   ASP A OD2 1 
ATOM   935  N  N   . ARG A 1 94  ? 34.136 -16.706 29.792  1.00 13.44 ? 94   ARG A N   1 
ATOM   936  C  CA  . ARG A 1 94  ? 35.261 -17.201 30.584  1.00 15.05 ? 94   ARG A CA  1 
ATOM   937  C  C   . ARG A 1 94  ? 35.967 -18.368 29.930  1.00 15.88 ? 94   ARG A C   1 
ATOM   938  O  O   . ARG A 1 94  ? 37.204 -18.484 30.059  1.00 19.56 ? 94   ARG A O   1 
ATOM   939  C  CB  . ARG A 1 94  ? 34.779 -17.552 31.990  1.00 16.59 ? 94   ARG A CB  1 
ATOM   940  C  CG  . ARG A 1 94  ? 34.216 -16.398 32.818  1.00 19.74 ? 94   ARG A CG  1 
ATOM   941  C  CD  . ARG A 1 94  ? 33.862 -16.888 34.231  1.00 21.05 ? 94   ARG A CD  1 
ATOM   942  N  NE  . ARG A 1 94  ? 35.044 -17.164 35.019  1.00 23.55 ? 94   ARG A NE  1 
ATOM   943  C  CZ  . ARG A 1 94  ? 35.279 -18.159 35.849  1.00 24.35 ? 94   ARG A CZ  1 
ATOM   944  N  NH1 . ARG A 1 94  ? 34.386 -19.122 36.089  1.00 39.46 ? 94   ARG A NH1 1 
ATOM   945  N  NH2 . ARG A 1 94  ? 36.442 -18.178 36.481  1.00 31.24 ? 94   ARG A NH2 1 
ATOM   946  N  N   . ASP A 1 95  ? 35.262 -19.269 29.271  1.00 15.98 ? 95   ASP A N   1 
ATOM   947  C  CA  . ASP A 1 95  ? 35.906 -20.421 28.638  1.00 17.81 ? 95   ASP A CA  1 
ATOM   948  C  C   . ASP A 1 95  ? 36.289 -20.205 27.175  1.00 19.22 ? 95   ASP A C   1 
ATOM   949  O  O   . ASP A 1 95  ? 36.813 -21.108 26.504  1.00 22.32 ? 95   ASP A O   1 
ATOM   950  C  CB  . ASP A 1 95  ? 35.086 -21.702 28.719  1.00 19.56 ? 95   ASP A CB  1 
ATOM   951  C  CG  . ASP A 1 95  ? 33.776 -21.739 27.956  1.00 17.85 ? 95   ASP A CG  1 
ATOM   952  O  OD1 . ASP A 1 95  ? 33.492 -20.727 27.267  1.00 17.47 ? 95   ASP A OD1 1 
ATOM   953  O  OD2 . ASP A 1 95  ? 33.072 -22.760 28.118  1.00 24.93 ? 95   ASP A OD2 1 
ATOM   954  N  N   . GLY A 1 96  ? 36.076 -19.040 26.617  1.00 17.90 ? 96   GLY A N   1 
ATOM   955  C  CA  . GLY A 1 96  ? 36.487 -18.732 25.243  1.00 21.74 ? 96   GLY A CA  1 
ATOM   956  C  C   . GLY A 1 96  ? 35.733 -19.402 24.130  1.00 22.16 ? 96   GLY A C   1 
ATOM   957  O  O   . GLY A 1 96  ? 36.215 -19.335 22.988  1.00 26.10 ? 96   GLY A O   1 
ATOM   958  N  N   . ASN A 1 97  ? 34.568 -19.960 24.372  1.00 21.35 ? 97   ASN A N   1 
ATOM   959  C  CA  . ASN A 1 97  ? 33.880 -20.725 23.317  1.00 21.86 ? 97   ASN A CA  1 
ATOM   960  C  C   . ASN A 1 97  ? 32.966 -19.853 22.462  1.00 20.99 ? 97   ASN A C   1 
ATOM   961  O  O   . ASN A 1 97  ? 32.316 -20.429 21.591  1.00 26.22 ? 97   ASN A O   1 
ATOM   962  C  CB  . ASN A 1 97  ? 33.174 -21.935 23.939  1.00 24.85 ? 97   ASN A CB  1 
ATOM   963  C  CG  . ASN A 1 97  ? 31.832 -21.554 24.547  1.00 20.57 ? 97   ASN A CG  1 
ATOM   964  O  OD1 . ASN A 1 97  ? 31.638 -20.375 24.975  1.00 17.88 ? 97   ASN A OD1 1 
ATOM   965  N  ND2 . ASN A 1 97  ? 30.900 -22.512 24.621  1.00 23.12 ? 97   ASN A ND2 1 
ATOM   966  N  N   . GLY A 1 98  ? 32.971 -18.537 22.683  1.00 19.31 ? 98   GLY A N   1 
ATOM   967  C  CA  . GLY A 1 98  ? 32.236 -17.597 21.873  1.00 18.47 ? 98   GLY A CA  1 
ATOM   968  C  C   . GLY A 1 98  ? 30.782 -17.413 22.320  1.00 15.47 ? 98   GLY A C   1 
ATOM   969  O  O   . GLY A 1 98  ? 30.038 -16.711 21.667  1.00 16.46 ? 98   GLY A O   1 
ATOM   970  N  N   . LEU A 1 99  ? 30.420 -18.008 23.444  1.00 15.63 ? 99   LEU A N   1 
ATOM   971  C  CA  . LEU A 1 99  ? 29.066 -17.939 23.994  1.00 13.28 ? 99   LEU A CA  1 
ATOM   972  C  C   . LEU A 1 99  ? 29.151 -17.604 25.460  1.00 13.78 ? 99   LEU A C   1 
ATOM   973  O  O   . LEU A 1 99  ? 29.819 -18.349 26.199  1.00 17.25 ? 99   LEU A O   1 
ATOM   974  C  CB  . LEU A 1 99  ? 28.310 -19.248 23.788  1.00 14.88 ? 99   LEU A CB  1 
ATOM   975  C  CG  . LEU A 1 99  ? 28.083 -19.739 22.366  1.00 16.59 ? 99   LEU A CG  1 
ATOM   976  C  CD1 . LEU A 1 99  ? 27.464 -21.132 22.354  1.00 23.60 ? 99   LEU A CD1 1 
ATOM   977  C  CD2 . LEU A 1 99  ? 27.172 -18.819 21.607  1.00 18.10 ? 99   LEU A CD2 1 
ATOM   978  N  N   A ILE A 1 100 ? 28.538 -16.516 25.902  0.90 10.61 ? 100  ILE A N   1 
ATOM   979  N  N   B ILE A 1 100 ? 28.470 -16.544 25.873  0.09 10.69 ? 100  ILE A N   1 
ATOM   980  C  CA  A ILE A 1 100 ? 28.485 -16.246 27.333  0.90 9.81  ? 100  ILE A CA  1 
ATOM   981  C  CA  B ILE A 1 100 ? 28.350 -16.259 27.295  0.09 9.32  ? 100  ILE A CA  1 
ATOM   982  C  C   A ILE A 1 100 ? 27.322 -17.050 27.872  0.90 9.50  ? 100  ILE A C   1 
ATOM   983  C  C   B ILE A 1 100 ? 27.232 -17.098 27.891  0.09 8.80  ? 100  ILE A C   1 
ATOM   984  O  O   A ILE A 1 100 ? 26.158 -16.850 27.474  0.90 10.13 ? 100  ILE A O   1 
ATOM   985  O  O   B ILE A 1 100 ? 26.055 -16.970 27.549  0.09 9.08  ? 100  ILE A O   1 
ATOM   986  C  CB  A ILE A 1 100 ? 28.273 -14.768 27.612  0.90 9.13  ? 100  ILE A CB  1 
ATOM   987  C  CB  B ILE A 1 100 ? 28.064 -14.777 27.575  0.09 9.74  ? 100  ILE A CB  1 
ATOM   988  C  CG1 A ILE A 1 100 ? 29.339 -13.864 27.005  0.90 10.36 ? 100  ILE A CG1 1 
ATOM   989  C  CG1 B ILE A 1 100 ? 29.238 -13.874 27.184  0.09 10.04 ? 100  ILE A CG1 1 
ATOM   990  C  CG2 A ILE A 1 100 ? 28.137 -14.537 29.108  0.90 9.18  ? 100  ILE A CG2 1 
ATOM   991  C  CG2 B ILE A 1 100 ? 27.660 -14.567 29.020  0.09 6.20  ? 100  ILE A CG2 1 
ATOM   992  C  CD1 A ILE A 1 100 ? 28.949 -12.423 26.938  0.90 10.75 ? 100  ILE A CD1 1 
ATOM   993  C  CD1 B ILE A 1 100 ? 30.524 -14.681 27.121  0.09 17.34 ? 100  ILE A CD1 1 
ATOM   994  N  N   . SER A 1 101 ? 27.617 -17.988 28.811  1.00 9.89  ? 101  SER A N   1 
ATOM   995  C  CA  . SER A 1 101 ? 26.572 -18.758 29.475  1.00 10.27 ? 101  SER A CA  1 
ATOM   996  C  C   . SER A 1 101 ? 26.039 -18.034 30.674  1.00 9.74  ? 101  SER A C   1 
ATOM   997  O  O   . SER A 1 101 ? 26.607 -17.067 31.197  1.00 9.49  ? 101  SER A O   1 
ATOM   998  C  CB  . SER A 1 101 ? 27.165 -20.108 29.887  1.00 12.14 ? 101  SER A CB  1 
ATOM   999  O  OG  . SER A 1 101 ? 28.049 -19.890 30.983  1.00 11.29 ? 101  SER A OG  1 
ATOM   1000 N  N   . ALA A 1 102 ? 24.902 -18.528 31.178  1.00 10.81 ? 102  ALA A N   1 
ATOM   1001 C  CA  . ALA A 1 102 ? 24.374 -18.005 32.427  1.00 10.69 ? 102  ALA A CA  1 
ATOM   1002 C  C   . ALA A 1 102 ? 25.383 -18.132 33.574  1.00 10.27 ? 102  ALA A C   1 
ATOM   1003 O  O   . ALA A 1 102 ? 25.510 -17.211 34.399  1.00 11.11 ? 102  ALA A O   1 
ATOM   1004 C  CB  . ALA A 1 102 ? 23.071 -18.711 32.730  1.00 13.52 ? 102  ALA A CB  1 
ATOM   1005 N  N   . ALA A 1 103 ? 26.078 -19.251 33.669  1.00 11.12 ? 103  ALA A N   1 
ATOM   1006 C  CA  . ALA A 1 103 ? 27.044 -19.412 34.744  1.00 11.64 ? 103  ALA A CA  1 
ATOM   1007 C  C   . ALA A 1 103 ? 28.186 -18.414 34.623  1.00 9.77  ? 103  ALA A C   1 
ATOM   1008 O  O   . ALA A 1 103 ? 28.620 -17.809 35.617  1.00 10.63 ? 103  ALA A O   1 
ATOM   1009 C  CB  . ALA A 1 103 ? 27.572 -20.847 34.756  1.00 14.26 ? 103  ALA A CB  1 
ATOM   1010 N  N   . GLU A 1 104 ? 28.647 -18.214 33.408  1.00 9.68  ? 104  GLU A N   1 
ATOM   1011 C  CA  . GLU A 1 104 ? 29.733 -17.224 33.187  1.00 9.38  ? 104  GLU A CA  1 
ATOM   1012 C  C   . GLU A 1 104 ? 29.282 -15.833 33.521  1.00 9.15  ? 104  GLU A C   1 
ATOM   1013 O  O   . GLU A 1 104 ? 29.995 -15.072 34.194  1.00 10.22 ? 104  GLU A O   1 
ATOM   1014 C  CB  . GLU A 1 104 ? 30.184 -17.298 31.725  1.00 9.64  ? 104  GLU A CB  1 
ATOM   1015 C  CG  . GLU A 1 104 ? 30.993 -18.518 31.406  1.00 11.21 ? 104  GLU A CG  1 
ATOM   1016 C  CD  . GLU A 1 104 ? 31.281 -18.734 29.941  1.00 12.08 ? 104  GLU A CD  1 
ATOM   1017 O  OE1 . GLU A 1 104 ? 30.537 -18.227 29.084  1.00 11.43 ? 104  GLU A OE1 1 
ATOM   1018 O  OE2 . GLU A 1 104 ? 32.279 -19.456 29.640  1.00 14.06 ? 104  GLU A OE2 1 
ATOM   1019 N  N   . LEU A 1 105 ? 28.110 -15.456 33.036  1.00 9.14  ? 105  LEU A N   1 
ATOM   1020 C  CA  . LEU A 1 105 ? 27.597 -14.119 33.312  1.00 9.41  ? 105  LEU A CA  1 
ATOM   1021 C  C   . LEU A 1 105 ? 27.441 -13.890 34.810  1.00 9.46  ? 105  LEU A C   1 
ATOM   1022 O  O   . LEU A 1 105 ? 27.818 -12.847 35.342  1.00 10.16 ? 105  LEU A O   1 
ATOM   1023 C  CB  . LEU A 1 105 ? 26.258 -13.914 32.583  1.00 9.91  ? 105  LEU A CB  1 
ATOM   1024 C  CG  . LEU A 1 105 ? 25.613 -12.573 32.772  1.00 10.76 ? 105  LEU A CG  1 
ATOM   1025 C  CD1 . LEU A 1 105 ? 26.540 -11.423 32.394  1.00 11.78 ? 105  LEU A CD1 1 
ATOM   1026 C  CD2 . LEU A 1 105 ? 24.310 -12.489 31.952  1.00 12.76 ? 105  LEU A CD2 1 
ATOM   1027 N  N   . ARG A 1 106 ? 26.895 -14.883 35.508  1.00 9.22  ? 106  ARG A N   1 
ATOM   1028 C  CA  . ARG A 1 106 ? 26.719 -14.722 36.953  1.00 9.65  ? 106  ARG A CA  1 
ATOM   1029 C  C   . ARG A 1 106 ? 28.056 -14.566 37.655  1.00 9.45  ? 106  ARG A C   1 
ATOM   1030 O  O   . ARG A 1 106 ? 28.210 -13.758 38.572  1.00 10.64 ? 106  ARG A O   1 
ATOM   1031 C  CB  . ARG A 1 106 ? 25.870 -15.881 37.488  1.00 9.92  ? 106  ARG A CB  1 
ATOM   1032 C  CG  . ARG A 1 106 ? 25.440 -15.634 38.915  1.00 11.16 ? 106  ARG A CG  1 
ATOM   1033 C  CD  . ARG A 1 106 ? 24.342 -16.590 39.346  1.00 11.19 ? 106  ARG A CD  1 
ATOM   1034 N  NE  . ARG A 1 106 ? 24.571 -17.943 39.133  1.00 12.34 ? 106  ARG A NE  1 
ATOM   1035 C  CZ  . ARG A 1 106 ? 25.209 -18.729 39.967  1.00 12.70 ? 106  ARG A CZ  1 
ATOM   1036 N  NH1 . ARG A 1 106 ? 25.783 -18.243 41.075  1.00 13.78 ? 106  ARG A NH1 1 
ATOM   1037 N  NH2 . ARG A 1 106 ? 25.363 -20.040 39.717  1.00 18.51 ? 106  ARG A NH2 1 
ATOM   1038 N  N   A HIS A 1 107 ? 29.019 -15.368 37.207  0.34 8.71  ? 107  HIS A N   1 
ATOM   1039 N  N   B HIS A 1 107 ? 29.054 -15.396 37.312  0.66 10.87 ? 107  HIS A N   1 
ATOM   1040 C  CA  A HIS A 1 107 ? 30.341 -15.358 37.814  0.34 10.82 ? 107  HIS A CA  1 
ATOM   1041 C  CA  B HIS A 1 107 ? 30.352 -15.252 37.989  0.66 10.92 ? 107  HIS A CA  1 
ATOM   1042 C  C   A HIS A 1 107 ? 31.077 -14.031 37.693  0.34 12.08 ? 107  HIS A C   1 
ATOM   1043 C  C   B HIS A 1 107 ? 30.956 -13.870 37.775  0.66 11.22 ? 107  HIS A C   1 
ATOM   1044 O  O   A HIS A 1 107 ? 31.706 -13.553 38.647  0.34 10.34 ? 107  HIS A O   1 
ATOM   1045 O  O   B HIS A 1 107 ? 31.380 -13.167 38.696  0.66 11.35 ? 107  HIS A O   1 
ATOM   1046 C  CB  A HIS A 1 107 ? 31.184 -16.457 37.142  0.34 11.82 ? 107  HIS A CB  1 
ATOM   1047 C  CB  B HIS A 1 107 ? 31.290 -16.355 37.492  0.66 11.21 ? 107  HIS A CB  1 
ATOM   1048 C  CG  A HIS A 1 107 ? 32.441 -16.649 37.944  0.34 14.84 ? 107  HIS A CG  1 
ATOM   1049 C  CG  B HIS A 1 107 ? 32.739 -16.176 37.885  0.66 13.34 ? 107  HIS A CG  1 
ATOM   1050 N  ND1 A HIS A 1 107 ? 33.504 -15.796 37.976  0.34 15.41 ? 107  HIS A ND1 1 
ATOM   1051 N  ND1 B HIS A 1 107 ? 33.159 -16.647 39.130  0.66 16.57 ? 107  HIS A ND1 1 
ATOM   1052 C  CD2 A HIS A 1 107 ? 32.745 -17.648 38.805  0.34 17.00 ? 107  HIS A CD2 1 
ATOM   1053 C  CD2 B HIS A 1 107 ? 33.826 -15.605 37.308  0.66 17.50 ? 107  HIS A CD2 1 
ATOM   1054 C  CE1 A HIS A 1 107 ? 34.432 -16.266 38.805  0.34 16.26 ? 107  HIS A CE1 1 
ATOM   1055 C  CE1 B HIS A 1 107 ? 34.453 -16.356 39.258  0.66 16.43 ? 107  HIS A CE1 1 
ATOM   1056 N  NE2 A HIS A 1 107 ? 33.988 -17.399 39.330  0.34 16.81 ? 107  HIS A NE2 1 
ATOM   1057 N  NE2 B HIS A 1 107 ? 34.900 -15.723 38.175  0.66 16.67 ? 107  HIS A NE2 1 
ATOM   1058 N  N   . VAL A 1 108 ? 30.977 -13.409 36.516  1.00 11.16 ? 108  VAL A N   1 
ATOM   1059 C  CA  . VAL A 1 108 ? 31.596 -12.123 36.256  1.00 11.53 ? 108  VAL A CA  1 
ATOM   1060 C  C   . VAL A 1 108 ? 30.769 -11.023 36.930  1.00 11.56 ? 108  VAL A C   1 
ATOM   1061 O  O   . VAL A 1 108 ? 31.342 -10.062 37.513  1.00 12.76 ? 108  VAL A O   1 
ATOM   1062 C  CB  . VAL A 1 108 ? 31.797 -11.899 34.755  1.00 13.24 ? 108  VAL A CB  1 
ATOM   1063 C  CG1 . VAL A 1 108 ? 32.393 -10.525 34.485  1.00 16.48 ? 108  VAL A CG1 1 
ATOM   1064 C  CG2 . VAL A 1 108 ? 32.707 -13.012 34.228  1.00 15.11 ? 108  VAL A CG2 1 
ATOM   1065 N  N   . MET A 1 109 ? 29.428 -11.088 36.943  1.00 10.64 ? 109  MET A N   1 
ATOM   1066 C  CA  . MET A 1 109 ? 28.666 -10.046 37.624  1.00 10.52 ? 109  MET A CA  1 
ATOM   1067 C  C   . MET A 1 109 ? 28.987 -10.007 39.125  1.00 11.37 ? 109  MET A C   1 
ATOM   1068 O  O   . MET A 1 109 ? 29.093 -8.902  39.674  1.00 11.98 ? 109  MET A O   1 
ATOM   1069 C  CB  . MET A 1 109 ? 27.164 -10.222 37.416  1.00 11.30 ? 109  MET A CB  1 
ATOM   1070 C  CG  . MET A 1 109 ? 26.722 -9.953  35.979  1.00 12.45 ? 109  MET A CG  1 
ATOM   1071 S  SD  . MET A 1 109 ? 27.062 -8.306  35.343  1.00 16.69 ? 109  MET A SD  1 
ATOM   1072 C  CE  . MET A 1 109 ? 25.967 -7.417  36.328  1.00 21.47 ? 109  MET A CE  1 
ATOM   1073 N  N   . THR A 1 110 ? 29.187 -11.175 39.754  1.00 11.08 ? 110  THR A N   1 
ATOM   1074 C  CA  . THR A 1 110 ? 29.596 -11.157 41.171  1.00 11.80 ? 110  THR A CA  1 
ATOM   1075 C  C   . THR A 1 110 ? 30.881 -10.390 41.314  1.00 11.50 ? 110  THR A C   1 
ATOM   1076 O  O   . THR A 1 110 ? 31.060 -9.583  42.258  1.00 12.59 ? 110  THR A O   1 
ATOM   1077 C  CB  . THR A 1 110 ? 29.715 -12.619 41.665  1.00 14.17 ? 110  THR A CB  1 
ATOM   1078 O  OG1 . THR A 1 110 ? 28.415 -13.216 41.608  1.00 18.55 ? 110  THR A OG1 1 
ATOM   1079 C  CG2 . THR A 1 110 ? 30.144 -12.649 43.113  1.00 21.50 ? 110  THR A CG2 1 
ATOM   1080 N  N   A ASN A 1 111 ? 31.845 -10.634 40.457  0.72 11.72 ? 111  ASN A N   1 
ATOM   1081 N  N   B ASN A 1 111 ? 31.778 -10.642 40.375  0.28 11.41 ? 111  ASN A N   1 
ATOM   1082 C  CA  A ASN A 1 111 ? 33.111 -9.834  40.563  0.72 10.91 ? 111  ASN A CA  1 
ATOM   1083 C  CA  B ASN A 1 111 ? 33.114 -10.070 40.212  0.28 11.93 ? 111  ASN A CA  1 
ATOM   1084 C  C   A ASN A 1 111 ? 32.887 -8.368  40.312  0.72 10.52 ? 111  ASN A C   1 
ATOM   1085 C  C   B ASN A 1 111 ? 33.055 -8.580  39.879  0.28 11.88 ? 111  ASN A C   1 
ATOM   1086 O  O   A ASN A 1 111 ? 33.646 -7.556  40.907  0.72 12.14 ? 111  ASN A O   1 
ATOM   1087 O  O   B ASN A 1 111 ? 34.093 -7.890  39.997  0.28 15.67 ? 111  ASN A O   1 
ATOM   1088 C  CB  A ASN A 1 111 ? 34.138 -10.489 39.672  0.72 12.73 ? 111  ASN A CB  1 
ATOM   1089 C  CB  B ASN A 1 111 ? 33.896 -10.846 39.145  0.28 15.73 ? 111  ASN A CB  1 
ATOM   1090 C  CG  A ASN A 1 111 ? 34.671 -11.785 40.267  0.72 15.99 ? 111  ASN A CG  1 
ATOM   1091 C  CG  B ASN A 1 111 ? 35.370 -10.896 39.477  0.28 19.65 ? 111  ASN A CG  1 
ATOM   1092 O  OD1 A ASN A 1 111 ? 35.190 -12.663 39.560  0.72 19.42 ? 111  ASN A OD1 1 
ATOM   1093 O  OD1 B ASN A 1 111 ? 35.791 -10.030 40.232  0.28 36.84 ? 111  ASN A OD1 1 
ATOM   1094 N  ND2 A ASN A 1 111 ? 34.605 -12.004 41.573  0.72 15.05 ? 111  ASN A ND2 1 
ATOM   1095 N  ND2 B ASN A 1 111 ? 36.139 -11.837 38.963  0.28 29.48 ? 111  ASN A ND2 1 
ATOM   1096 N  N   . LEU A 1 112 ? 31.937 -8.018  39.487  1.00 12.23 ? 112  LEU A N   1 
ATOM   1097 C  CA  . LEU A 1 112 ? 31.610 -6.611  39.254  1.00 12.32 ? 112  LEU A CA  1 
ATOM   1098 C  C   . LEU A 1 112 ? 30.797 -6.029  40.410  1.00 12.84 ? 112  LEU A C   1 
ATOM   1099 O  O   . LEU A 1 112 ? 30.411 -4.857  40.312  1.00 15.85 ? 112  LEU A O   1 
ATOM   1100 C  CB  . LEU A 1 112 ? 30.911 -6.438  37.907  1.00 13.96 ? 112  LEU A CB  1 
ATOM   1101 C  CG  . LEU A 1 112 ? 31.781 -6.800  36.683  1.00 16.37 ? 112  LEU A CG  1 
ATOM   1102 C  CD1 . LEU A 1 112 ? 30.943 -6.765  35.414  1.00 17.70 ? 112  LEU A CD1 1 
ATOM   1103 C  CD2 . LEU A 1 112 ? 33.015 -5.878  36.584  1.00 23.78 ? 112  LEU A CD2 1 
ATOM   1104 N  N   . GLY A 1 113 ? 30.573 -6.805  41.478  1.00 12.63 ? 113  GLY A N   1 
ATOM   1105 C  CA  . GLY A 1 113 ? 29.920 -6.340  42.661  1.00 11.96 ? 113  GLY A CA  1 
ATOM   1106 C  C   . GLY A 1 113 ? 28.448 -6.612  42.751  1.00 10.77 ? 113  GLY A C   1 
ATOM   1107 O  O   . GLY A 1 113 ? 27.837 -6.080  43.670  1.00 12.21 ? 113  GLY A O   1 
ATOM   1108 N  N   . GLU A 1 114 ? 27.901 -7.412  41.862  1.00 10.83 ? 114  GLU A N   1 
ATOM   1109 C  CA  . GLU A 1 114 ? 26.501 -7.716  41.763  1.00 10.90 ? 114  GLU A CA  1 
ATOM   1110 C  C   . GLU A 1 114 ? 26.278 -9.211  41.970  1.00 10.53 ? 114  GLU A C   1 
ATOM   1111 O  O   . GLU A 1 114 ? 26.577 -9.996  41.073  1.00 12.62 ? 114  GLU A O   1 
ATOM   1112 C  CB  . GLU A 1 114 ? 25.964 -7.282  40.420  1.00 12.25 ? 114  GLU A CB  1 
ATOM   1113 C  CG  . GLU A 1 114 ? 26.014 -5.799  40.224  1.00 13.47 ? 114  GLU A CG  1 
ATOM   1114 C  CD  . GLU A 1 114 ? 25.043 -5.069  41.132  1.00 13.60 ? 114  GLU A CD  1 
ATOM   1115 O  OE1 . GLU A 1 114 ? 25.117 -3.832  41.051  1.00 20.40 ? 114  GLU A OE1 1 
ATOM   1116 O  OE2 . GLU A 1 114 ? 24.254 -5.684  41.843  1.00 15.09 ? 114  GLU A OE2 1 
ATOM   1117 N  N   A LYS A 1 115 ? 25.682 -9.508  43.109  0.67 10.04 ? 115  LYS A N   1 
ATOM   1118 N  N   B LYS A 1 115 ? 25.797 -9.656  43.134  0.33 8.64  ? 115  LYS A N   1 
ATOM   1119 C  CA  A LYS A 1 115 ? 25.405 -10.896 43.486  0.67 10.41 ? 115  LYS A CA  1 
ATOM   1120 C  CA  B LYS A 1 115 ? 25.539 -11.059 43.429  0.33 8.47  ? 115  LYS A CA  1 
ATOM   1121 C  C   A LYS A 1 115 ? 23.973 -11.208 43.054  0.67 10.09 ? 115  LYS A C   1 
ATOM   1122 C  C   B LYS A 1 115 ? 24.137 -11.435 42.948  0.33 6.77  ? 115  LYS A C   1 
ATOM   1123 O  O   A LYS A 1 115 ? 23.013 -10.824 43.730  0.67 12.99 ? 115  LYS A O   1 
ATOM   1124 O  O   B LYS A 1 115 ? 23.202 -11.044 43.648  0.33 5.93  ? 115  LYS A O   1 
ATOM   1125 C  CB  A LYS A 1 115 ? 25.733 -11.038 44.979  0.67 11.16 ? 115  LYS A CB  1 
ATOM   1126 C  CB  B LYS A 1 115 ? 25.545 -11.421 44.920  0.33 10.13 ? 115  LYS A CB  1 
ATOM   1127 C  CG  A LYS A 1 115 ? 25.739 -12.481 45.437  0.67 11.67 ? 115  LYS A CG  1 
ATOM   1128 C  CG  B LYS A 1 115 ? 26.870 -11.226 45.599  0.33 9.76  ? 115  LYS A CG  1 
ATOM   1129 C  CD  A LYS A 1 115 ? 26.931 -13.306 45.018  0.67 13.90 ? 115  LYS A CD  1 
ATOM   1130 C  CD  B LYS A 1 115 ? 26.906 -11.726 47.045  0.33 9.94  ? 115  LYS A CD  1 
ATOM   1131 C  CE  A LYS A 1 115 ? 26.858 -14.688 45.624  0.67 14.31 ? 115  LYS A CE  1 
ATOM   1132 C  CE  B LYS A 1 115 ? 28.299 -11.434 47.614  0.33 19.02 ? 115  LYS A CE  1 
ATOM   1133 N  NZ  A LYS A 1 115 ? 25.554 -15.404 45.345  0.67 17.14 ? 115  LYS A NZ  1 
ATOM   1134 N  NZ  B LYS A 1 115 ? 28.347 -11.456 49.093  0.33 20.50 ? 115  LYS A NZ  1 
ATOM   1135 N  N   A LEU A 1 116 ? 23.812 -11.835 41.890  0.58 8.48  ? 116  LEU A N   1 
ATOM   1136 N  N   B LEU A 1 116 ? 23.988 -12.078 41.810  0.41 8.29  ? 116  LEU A N   1 
ATOM   1137 C  CA  A LEU A 1 116 ? 22.532 -12.052 41.240  0.58 8.35  ? 116  LEU A CA  1 
ATOM   1138 C  CA  B LEU A 1 116 ? 22.736 -12.250 41.087  0.41 8.35  ? 116  LEU A CA  1 
ATOM   1139 C  C   A LEU A 1 116 ? 22.152 -13.522 41.314  0.58 7.76  ? 116  LEU A C   1 
ATOM   1140 C  C   B LEU A 1 116 ? 22.175 -13.641 41.227  0.41 9.99  ? 116  LEU A C   1 
ATOM   1141 O  O   A LEU A 1 116 ? 23.021 -14.432 41.331  0.58 10.11 ? 116  LEU A O   1 
ATOM   1142 O  O   B LEU A 1 116 ? 22.897 -14.663 41.261  0.41 9.40  ? 116  LEU A O   1 
ATOM   1143 C  CB  A LEU A 1 116 ? 22.543 -11.623 39.777  0.58 8.33  ? 116  LEU A CB  1 
ATOM   1144 C  CB  B LEU A 1 116 ? 22.961 -11.902 39.614  0.41 7.50  ? 116  LEU A CB  1 
ATOM   1145 C  CG  A LEU A 1 116 ? 22.967 -10.178 39.508  0.58 10.10 ? 116  LEU A CG  1 
ATOM   1146 C  CG  B LEU A 1 116 ? 23.448 -10.473 39.341  0.41 10.45 ? 116  LEU A CG  1 
ATOM   1147 C  CD1 A LEU A 1 116 ? 23.186 -9.995  38.021  0.58 12.13 ? 116  LEU A CD1 1 
ATOM   1148 C  CD1 B LEU A 1 116 ? 23.731 -10.307 37.853  0.41 11.53 ? 116  LEU A CD1 1 
ATOM   1149 C  CD2 A LEU A 1 116 ? 21.892 -9.242  40.010  0.58 12.56 ? 116  LEU A CD2 1 
ATOM   1150 C  CD2 B LEU A 1 116 ? 22.427 -9.452  39.821  0.41 12.10 ? 116  LEU A CD2 1 
ATOM   1151 N  N   . THR A 1 117 ? 20.835 -13.742 41.308  1.00 8.50  ? 117  THR A N   1 
ATOM   1152 C  CA  . THR A 1 117 ? 20.290 -15.094 41.300  1.00 8.53  ? 117  THR A CA  1 
ATOM   1153 C  C   . THR A 1 117 ? 20.243 -15.648 39.897  1.00 8.10  ? 117  THR A C   1 
ATOM   1154 O  O   . THR A 1 117 ? 20.332 -14.919 38.892  1.00 8.77  ? 117  THR A O   1 
ATOM   1155 C  CB  . THR A 1 117 ? 18.875 -15.127 41.899  1.00 8.96  ? 117  THR A CB  1 
ATOM   1156 O  OG1 . THR A 1 117 ? 17.973 -14.530 40.989  1.00 9.85  ? 117  THR A OG1 1 
ATOM   1157 C  CG2 . THR A 1 117 ? 18.784 -14.480 43.253  1.00 10.72 ? 117  THR A CG2 1 
ATOM   1158 N  N   . ASP A 1 118 ? 20.031 -16.969 39.790  1.00 8.45  ? 118  ASP A N   1 
ATOM   1159 C  CA  . ASP A 1 118 ? 19.826 -17.590 38.493  1.00 8.68  ? 118  ASP A CA  1 
ATOM   1160 C  C   . ASP A 1 118 ? 18.645 -16.980 37.745  1.00 9.14  ? 118  ASP A C   1 
ATOM   1161 O  O   . ASP A 1 118 ? 18.727 -16.776 36.534  1.00 10.44 ? 118  ASP A O   1 
ATOM   1162 C  CB  . ASP A 1 118 ? 19.624 -19.082 38.653  1.00 9.07  ? 118  ASP A CB  1 
ATOM   1163 C  CG  . ASP A 1 118 ? 20.854 -19.832 39.074  1.00 9.39  ? 118  ASP A CG  1 
ATOM   1164 O  OD1 . ASP A 1 118 ? 21.989 -19.372 38.903  1.00 11.58 ? 118  ASP A OD1 1 
ATOM   1165 O  OD2 . ASP A 1 118 ? 20.610 -20.969 39.618  1.00 11.36 ? 118  ASP A OD2 1 
ATOM   1166 N  N   A ASP A 1 119 ? 17.580 -16.656 38.457  0.34 8.94  ? 119  ASP A N   1 
ATOM   1167 N  N   B ASP A 1 119 ? 17.556 -16.687 38.419  0.66 8.99  ? 119  ASP A N   1 
ATOM   1168 C  CA  A ASP A 1 119 ? 16.379 -16.069 37.854  0.34 8.53  ? 119  ASP A CA  1 
ATOM   1169 C  CA  B ASP A 1 119 ? 16.428 -16.100 37.662  0.66 10.11 ? 119  ASP A CA  1 
ATOM   1170 C  C   A ASP A 1 119 ? 16.650 -14.679 37.279  0.34 8.66  ? 119  ASP A C   1 
ATOM   1171 C  C   B ASP A 1 119 ? 16.837 -14.731 37.126  0.66 8.54  ? 119  ASP A C   1 
ATOM   1172 O  O   A ASP A 1 119 ? 16.090 -14.294 36.242  0.34 6.57  ? 119  ASP A O   1 
ATOM   1173 O  O   B ASP A 1 119 ? 16.543 -14.410 35.961  0.66 8.09  ? 119  ASP A O   1 
ATOM   1174 C  CB  A ASP A 1 119 ? 15.227 -15.989 38.848  0.34 8.93  ? 119  ASP A CB  1 
ATOM   1175 C  CB  B ASP A 1 119 ? 15.180 -16.037 38.509  0.66 11.81 ? 119  ASP A CB  1 
ATOM   1176 C  CG  A ASP A 1 119 ? 14.437 -17.290 38.953  0.34 9.03  ? 119  ASP A CG  1 
ATOM   1177 C  CG  B ASP A 1 119 ? 13.933 -15.929 37.672  0.66 18.19 ? 119  ASP A CG  1 
ATOM   1178 O  OD1 A ASP A 1 119 ? 14.661 -18.205 38.150  0.34 10.97 ? 119  ASP A OD1 1 
ATOM   1179 O  OD1 B ASP A 1 119 ? 13.105 -15.097 37.998  0.66 32.94 ? 119  ASP A OD1 1 
ATOM   1180 O  OD2 A ASP A 1 119 ? 13.596 -17.271 39.874  0.34 10.12 ? 119  ASP A OD2 1 
ATOM   1181 O  OD2 B ASP A 1 119 ? 13.752 -16.725 36.715  0.66 27.56 ? 119  ASP A OD2 1 
ATOM   1182 N  N   . GLU A 1 120 ? 17.489 -13.909 37.951  1.00 9.37  ? 120  GLU A N   1 
ATOM   1183 C  CA  . GLU A 1 120 ? 17.926 -12.592 37.475  1.00 9.37  ? 120  GLU A CA  1 
ATOM   1184 C  C   . GLU A 1 120 ? 18.822 -12.696 36.260  1.00 8.87  ? 120  GLU A C   1 
ATOM   1185 O  O   . GLU A 1 120 ? 18.641 -11.972 35.268  1.00 9.62  ? 120  GLU A O   1 
ATOM   1186 C  CB  . GLU A 1 120 ? 18.610 -11.837 38.627  1.00 9.10  ? 120  GLU A CB  1 
ATOM   1187 C  CG  . GLU A 1 120 ? 17.670 -11.346 39.719  1.00 10.18 ? 120  GLU A CG  1 
ATOM   1188 C  CD  . GLU A 1 120 ? 18.350 -10.772 40.944  1.00 9.58  ? 120  GLU A CD  1 
ATOM   1189 O  OE1 . GLU A 1 120 ? 19.423 -11.212 41.330  1.00 10.95 ? 120  GLU A OE1 1 
ATOM   1190 O  OE2 . GLU A 1 120 ? 17.738 -9.834  41.506  1.00 13.57 ? 120  GLU A OE2 1 
ATOM   1191 N  N   . VAL A 1 121 ? 19.812 -13.583 36.330  1.00 8.69  ? 121  VAL A N   1 
ATOM   1192 C  CA  . VAL A 1 121 ? 20.704 -13.740 35.193  1.00 9.39  ? 121  VAL A CA  1 
ATOM   1193 C  C   . VAL A 1 121 ? 19.965 -14.294 33.983  1.00 9.26  ? 121  VAL A C   1 
ATOM   1194 O  O   . VAL A 1 121 ? 20.222 -13.877 32.835  1.00 9.56  ? 121  VAL A O   1 
ATOM   1195 C  CB  . VAL A 1 121 ? 21.917 -14.604 35.620  1.00 11.33 ? 121  VAL A CB  1 
ATOM   1196 C  CG1 . VAL A 1 121 ? 22.753 -14.972 34.456  1.00 13.67 ? 121  VAL A CG1 1 
ATOM   1197 C  CG2 . VAL A 1 121 ? 22.759 -13.878 36.666  1.00 13.14 ? 121  VAL A CG2 1 
ATOM   1198 N  N   . ASP A 1 122 ? 19.062 -15.232 34.195  1.00 9.34  ? 122  ASP A N   1 
ATOM   1199 C  CA  . ASP A 1 122 ? 18.298 -15.786 33.106  1.00 9.65  ? 122  ASP A CA  1 
ATOM   1200 C  C   . ASP A 1 122 ? 17.495 -14.706 32.394  1.00 9.66  ? 122  ASP A C   1 
ATOM   1201 O  O   . ASP A 1 122 ? 17.394 -14.682 31.167  1.00 10.63 ? 122  ASP A O   1 
ATOM   1202 C  CB  . ASP A 1 122 ? 17.414 -16.926 33.603  1.00 11.21 ? 122  ASP A CB  1 
ATOM   1203 C  CG  . ASP A 1 122 ? 18.238 -18.161 33.995  1.00 14.82 ? 122  ASP A CG  1 
ATOM   1204 O  OD1 . ASP A 1 122 ? 19.452 -18.301 33.757  1.00 17.52 ? 122  ASP A OD1 1 
ATOM   1205 O  OD2 . ASP A 1 122 ? 17.598 -19.076 34.573  1.00 18.06 ? 122  ASP A OD2 1 
ATOM   1206 N  N   . GLU A 1 123 ? 16.897 -13.795 33.152  1.00 10.14 ? 123  GLU A N   1 
ATOM   1207 C  CA  . GLU A 1 123 ? 16.165 -12.682 32.536  1.00 10.75 ? 123  GLU A CA  1 
ATOM   1208 C  C   . GLU A 1 123 ? 17.113 -11.798 31.722  1.00 10.38 ? 123  GLU A C   1 
ATOM   1209 O  O   . GLU A 1 123 ? 16.767 -11.369 30.613  1.00 11.66 ? 123  GLU A O   1 
ATOM   1210 C  CB  . GLU A 1 123 ? 15.441 -11.887 33.623  1.00 11.79 ? 123  GLU A CB  1 
ATOM   1211 C  CG  . GLU A 1 123 ? 14.717 -10.684 33.072  1.00 16.77 ? 123  GLU A CG  1 
ATOM   1212 C  CD  . GLU A 1 123 ? 13.848 -9.963  34.069  1.00 20.94 ? 123  GLU A CD  1 
ATOM   1213 O  OE1 . GLU A 1 123 ? 13.739 -8.701  33.917  1.00 23.44 ? 123  GLU A OE1 1 
ATOM   1214 O  OE2 . GLU A 1 123 ? 13.260 -10.690 34.905  1.00 21.23 ? 123  GLU A OE2 1 
ATOM   1215 N  N   . MET A 1 124 ? 18.320 -11.480 32.251  1.00 10.27 ? 124  MET A N   1 
ATOM   1216 C  CA  . MET A 1 124 ? 19.295 -10.710 31.464  1.00 10.60 ? 124  MET A CA  1 
ATOM   1217 C  C   . MET A 1 124 ? 19.601 -11.382 30.173  1.00 10.70 ? 124  MET A C   1 
ATOM   1218 O  O   . MET A 1 124 ? 19.688 -10.779 29.097  1.00 12.78 ? 124  MET A O   1 
ATOM   1219 C  CB  . MET A 1 124 ? 20.545 -10.506 32.328  1.00 11.74 ? 124  MET A CB  1 
ATOM   1220 C  CG  . MET A 1 124 ? 20.388 -9.623  33.508  1.00 14.03 ? 124  MET A CG  1 
ATOM   1221 S  SD  . MET A 1 124 ? 21.899 -9.653  34.558  1.00 18.86 ? 124  MET A SD  1 
ATOM   1222 C  CE  . MET A 1 124 ? 23.026 -8.794  33.470  1.00 23.40 ? 124  MET A CE  1 
ATOM   1223 N  N   A ILE A 1 125 ? 19.834 -12.693 30.203  0.61 10.10 ? 125  ILE A N   1 
ATOM   1224 N  N   B ILE A 1 125 ? 19.827 -12.699 30.209  0.39 10.71 ? 125  ILE A N   1 
ATOM   1225 C  CA  A ILE A 1 125 ? 20.125 -13.328 28.930  0.61 11.16 ? 125  ILE A CA  1 
ATOM   1226 C  CA  B ILE A 1 125 ? 20.127 -13.570 29.096  0.39 11.33 ? 125  ILE A CA  1 
ATOM   1227 C  C   A ILE A 1 125 ? 18.904 -13.332 28.029  0.61 9.53  ? 125  ILE A C   1 
ATOM   1228 C  C   B ILE A 1 125 ? 18.965 -13.605 28.090  0.39 11.16 ? 125  ILE A C   1 
ATOM   1229 O  O   A ILE A 1 125 ? 19.047 -13.021 26.836  0.61 9.15  ? 125  ILE A O   1 
ATOM   1230 O  O   B ILE A 1 125 ? 19.182 -13.580 26.873  0.39 12.04 ? 125  ILE A O   1 
ATOM   1231 C  CB  A ILE A 1 125 ? 20.625 -14.745 29.177  0.61 11.25 ? 125  ILE A CB  1 
ATOM   1232 C  CB  B ILE A 1 125 ? 20.420 -15.020 29.517  0.39 11.22 ? 125  ILE A CB  1 
ATOM   1233 C  CG1 A ILE A 1 125 ? 22.000 -14.610 29.850  0.61 12.96 ? 125  ILE A CG1 1 
ATOM   1234 C  CG1 B ILE A 1 125 ? 21.666 -15.223 30.391  0.39 14.53 ? 125  ILE A CG1 1 
ATOM   1235 C  CG2 A ILE A 1 125 ? 20.648 -15.581 27.925  0.61 13.92 ? 125  ILE A CG2 1 
ATOM   1236 C  CG2 B ILE A 1 125 ? 20.445 -15.900 28.265  0.39 14.25 ? 125  ILE A CG2 1 
ATOM   1237 C  CD1 A ILE A 1 125 ? 22.517 -15.974 30.335  0.61 20.00 ? 125  ILE A CD1 1 
ATOM   1238 C  CD1 B ILE A 1 125 ? 22.964 -15.183 29.569  0.39 21.27 ? 125  ILE A CD1 1 
ATOM   1239 N  N   . ARG A 1 126 ? 17.716 -13.660 28.551  1.00 11.02 ? 126  ARG A N   1 
ATOM   1240 C  CA  . ARG A 1 126 ? 16.539 -13.658 27.653  1.00 11.30 ? 126  ARG A CA  1 
ATOM   1241 C  C   . ARG A 1 126 ? 16.372 -12.342 26.918  1.00 11.97 ? 126  ARG A C   1 
ATOM   1242 O  O   . ARG A 1 126 ? 16.005 -12.337 25.748  1.00 12.83 ? 126  ARG A O   1 
ATOM   1243 C  CB  . ARG A 1 126 ? 15.257 -13.974 28.392  1.00 14.12 ? 126  ARG A CB  1 
ATOM   1244 C  CG  . ARG A 1 126 ? 15.102 -15.397 28.805  1.00 15.95 ? 126  ARG A CG  1 
ATOM   1245 C  CD  . ARG A 1 126 ? 13.690 -15.825 29.053  1.00 18.87 ? 126  ARG A CD  1 
ATOM   1246 N  NE  . ARG A 1 126 ? 12.984 -14.957 29.956  1.00 18.33 ? 126  ARG A NE  1 
ATOM   1247 C  CZ  . ARG A 1 126 ? 13.124 -14.986 31.285  1.00 20.06 ? 126  ARG A CZ  1 
ATOM   1248 N  NH1 . ARG A 1 126 ? 13.908 -15.819 31.897  1.00 29.89 ? 126  ARG A NH1 1 
ATOM   1249 N  NH2 . ARG A 1 126 ? 12.387 -14.116 31.958  1.00 31.46 ? 126  ARG A NH2 1 
ATOM   1250 N  N   . GLU A 1 127 ? 16.633 -11.202 27.589  1.00 11.44 ? 127  GLU A N   1 
ATOM   1251 C  CA  . GLU A 1 127 ? 16.505 -9.895  26.987  1.00 13.24 ? 127  GLU A CA  1 
ATOM   1252 C  C   . GLU A 1 127 ? 17.405 -9.749  25.780  1.00 13.55 ? 127  GLU A C   1 
ATOM   1253 O  O   . GLU A 1 127 ? 17.067 -9.057  24.784  1.00 17.27 ? 127  GLU A O   1 
ATOM   1254 C  CB  . GLU A 1 127 ? 16.871 -8.811  28.021  1.00 15.78 ? 127  GLU A CB  1 
ATOM   1255 C  CG  . GLU A 1 127 ? 15.854 -8.616  29.107  1.00 15.70 ? 127  GLU A CG  1 
ATOM   1256 C  CD  . GLU A 1 127 ? 14.651 -7.870  28.655  1.00 18.96 ? 127  GLU A CD  1 
ATOM   1257 O  OE1 . GLU A 1 127 ? 13.882 -8.665  27.984  1.00 26.39 ? 127  GLU A OE1 1 
ATOM   1258 O  OE2 . GLU A 1 127 ? 14.388 -6.681  28.943  1.00 30.29 ? 127  GLU A OE2 1 
ATOM   1259 N  N   . ALA A 1 128 ? 18.597 -10.326 25.833  1.00 12.83 ? 128  ALA A N   1 
ATOM   1260 C  CA  . ALA A 1 128 ? 19.595 -10.149 24.779  1.00 13.38 ? 128  ALA A CA  1 
ATOM   1261 C  C   . ALA A 1 128 ? 19.624 -11.312 23.775  1.00 11.41 ? 128  ALA A C   1 
ATOM   1262 O  O   . ALA A 1 128 ? 20.235 -11.144 22.712  1.00 12.07 ? 128  ALA A O   1 
ATOM   1263 C  CB  . ALA A 1 128 ? 20.994 -9.986  25.432  1.00 16.33 ? 128  ALA A CB  1 
ATOM   1264 N  N   . ASP A 1 129 ? 19.001 -12.427 24.107  1.00 11.64 ? 129  ASP A N   1 
ATOM   1265 C  CA  . ASP A 1 129 ? 19.113 -13.634 23.321  1.00 11.01 ? 129  ASP A CA  1 
ATOM   1266 C  C   . ASP A 1 129 ? 18.226 -13.501 22.097  1.00 12.37 ? 129  ASP A C   1 
ATOM   1267 O  O   . ASP A 1 129 ? 17.025 -13.191 22.230  1.00 15.64 ? 129  ASP A O   1 
ATOM   1268 C  CB  . ASP A 1 129 ? 18.673 -14.832 24.154  1.00 11.77 ? 129  ASP A CB  1 
ATOM   1269 C  CG  . ASP A 1 129 ? 19.058 -16.181 23.593  1.00 11.96 ? 129  ASP A CG  1 
ATOM   1270 O  OD1 . ASP A 1 129 ? 19.882 -16.270 22.638  1.00 11.78 ? 129  ASP A OD1 1 
ATOM   1271 O  OD2 . ASP A 1 129 ? 18.564 -17.201 24.118  1.00 12.90 ? 129  ASP A OD2 1 
ATOM   1272 N  N   . ILE A 1 130 ? 18.800 -13.687 20.919  1.00 11.70 ? 130  ILE A N   1 
ATOM   1273 C  CA  . ILE A 1 130 ? 18.120 -13.580 19.661  1.00 12.45 ? 130  ILE A CA  1 
ATOM   1274 C  C   . ILE A 1 130 ? 17.918 -14.959 19.049  1.00 12.82 ? 130  ILE A C   1 
ATOM   1275 O  O   . ILE A 1 130 ? 16.827 -15.278 18.579  1.00 15.29 ? 130  ILE A O   1 
ATOM   1276 C  CB  . ILE A 1 130 ? 18.873 -12.655 18.666  1.00 12.83 ? 130  ILE A CB  1 
ATOM   1277 C  CG1 . ILE A 1 130 ? 18.906 -11.247 19.213  1.00 14.12 ? 130  ILE A CG1 1 
ATOM   1278 C  CG2 . ILE A 1 130 ? 18.216 -12.756 17.261  1.00 15.31 ? 130  ILE A CG2 1 
ATOM   1279 C  CD1 . ILE A 1 130 ? 19.792 -10.306 18.470  1.00 15.40 ? 130  ILE A CD1 1 
ATOM   1280 N  N   . ASP A 1 131 ? 18.923 -15.781 19.040  1.00 12.60 ? 131  ASP A N   1 
ATOM   1281 C  CA  . ASP A 1 131 ? 18.873 -17.126 18.450  1.00 14.06 ? 131  ASP A CA  1 
ATOM   1282 C  C   . ASP A 1 131 ? 18.258 -18.155 19.387  1.00 14.22 ? 131  ASP A C   1 
ATOM   1283 O  O   . ASP A 1 131 ? 17.993 -19.266 18.966  1.00 18.56 ? 131  ASP A O   1 
ATOM   1284 C  CB  . ASP A 1 131 ? 20.223 -17.553 17.893  1.00 13.91 ? 131  ASP A CB  1 
ATOM   1285 C  CG  . ASP A 1 131 ? 21.295 -17.707 18.949  1.00 13.35 ? 131  ASP A CG  1 
ATOM   1286 O  OD1 . ASP A 1 131 ? 20.947 -17.777 20.151  1.00 12.41 ? 131  ASP A OD1 1 
ATOM   1287 O  OD2 . ASP A 1 131 ? 22.477 -17.704 18.551  1.00 16.01 ? 131  ASP A OD2 1 
ATOM   1288 N  N   . GLY A 1 132 ? 17.952 -17.786 20.631  1.00 13.64 ? 132  GLY A N   1 
ATOM   1289 C  CA  . GLY A 1 132 ? 17.216 -18.664 21.533  1.00 14.95 ? 132  GLY A CA  1 
ATOM   1290 C  C   . GLY A 1 132 ? 18.030 -19.773 22.180  1.00 15.58 ? 132  GLY A C   1 
ATOM   1291 O  O   . GLY A 1 132 ? 17.408 -20.621 22.799  1.00 17.82 ? 132  GLY A O   1 
ATOM   1292 N  N   . ASP A 1 133 ? 19.346 -19.753 22.096  1.00 14.03 ? 133  ASP A N   1 
ATOM   1293 C  CA  . ASP A 1 133 ? 20.161 -20.822 22.653  1.00 14.21 ? 133  ASP A CA  1 
ATOM   1294 C  C   . ASP A 1 133 ? 20.470 -20.622 24.149  1.00 13.90 ? 133  ASP A C   1 
ATOM   1295 O  O   . ASP A 1 133 ? 21.230 -21.404 24.724  1.00 15.49 ? 133  ASP A O   1 
ATOM   1296 C  CB  . ASP A 1 133 ? 21.453 -20.983 21.843  1.00 14.67 ? 133  ASP A CB  1 
ATOM   1297 C  CG  . ASP A 1 133 ? 22.472 -19.875 22.040  1.00 12.97 ? 133  ASP A CG  1 
ATOM   1298 O  OD1 . ASP A 1 133 ? 22.101 -18.863 22.674  1.00 12.15 ? 133  ASP A OD1 1 
ATOM   1299 O  OD2 . ASP A 1 133 ? 23.634 -20.050 21.609  1.00 15.35 ? 133  ASP A OD2 1 
ATOM   1300 N  N   . GLY A 1 134 ? 19.882 -19.609 24.801  1.00 12.75 ? 134  GLY A N   1 
ATOM   1301 C  CA  . GLY A 1 134 ? 20.151 -19.402 26.217  1.00 12.69 ? 134  GLY A CA  1 
ATOM   1302 C  C   . GLY A 1 134 ? 21.520 -18.950 26.582  1.00 11.23 ? 134  GLY A C   1 
ATOM   1303 O  O   . GLY A 1 134 ? 21.878 -18.934 27.740  1.00 12.48 ? 134  GLY A O   1 
ATOM   1304 N  N   . HIS A 1 135 ? 22.262 -18.487 25.583  1.00 10.65 ? 135  HIS A N   1 
ATOM   1305 C  CA  . HIS A 1 135 ? 23.592 -17.964 25.708  1.00 10.74 ? 135  HIS A CA  1 
ATOM   1306 C  C   . HIS A 1 135 ? 23.663 -16.625 24.943  1.00 9.80  ? 135  HIS A C   1 
ATOM   1307 O  O   . HIS A 1 135 ? 22.819 -16.377 24.083  1.00 10.62 ? 135  HIS A O   1 
ATOM   1308 C  CB  . HIS A 1 135 ? 24.632 -18.908 25.112  1.00 11.75 ? 135  HIS A CB  1 
ATOM   1309 C  CG  . HIS A 1 135 ? 24.770 -20.221 25.825  1.00 12.54 ? 135  HIS A CG  1 
ATOM   1310 N  ND1 . HIS A 1 135 ? 23.791 -21.162 25.867  1.00 14.75 ? 135  HIS A ND1 1 
ATOM   1311 C  CD2 . HIS A 1 135 ? 25.839 -20.693 26.494  1.00 14.36 ? 135  HIS A CD2 1 
ATOM   1312 C  CE1 . HIS A 1 135 ? 24.204 -22.213 26.567  1.00 17.51 ? 135  HIS A CE1 1 
ATOM   1313 N  NE2 . HIS A 1 135 ? 25.443 -21.954 26.963  1.00 16.16 ? 135  HIS A NE2 1 
ATOM   1314 N  N   A ILE A 1 136 ? 24.678 -15.819 25.205  0.71 9.88  ? 136  ILE A N   1 
ATOM   1315 N  N   B ILE A 1 136 ? 24.655 -15.791 25.209  0.29 10.01 ? 136  ILE A N   1 
ATOM   1316 C  CA  A ILE A 1 136 ? 24.876 -14.565 24.480  0.71 9.61  ? 136  ILE A CA  1 
ATOM   1317 C  CA  B ILE A 1 136 ? 24.838 -14.521 24.513  0.29 9.64  ? 136  ILE A CA  1 
ATOM   1318 C  C   A ILE A 1 136 ? 26.127 -14.728 23.623  0.71 9.93  ? 136  ILE A C   1 
ATOM   1319 C  C   B ILE A 1 136 ? 26.084 -14.587 23.633  0.29 8.42  ? 136  ILE A C   1 
ATOM   1320 O  O   A ILE A 1 136 ? 27.245 -14.925 24.143  0.71 10.63 ? 136  ILE A O   1 
ATOM   1321 O  O   B ILE A 1 136 ? 27.214 -14.600 24.154  0.29 8.58  ? 136  ILE A O   1 
ATOM   1322 C  CB  A ILE A 1 136 ? 24.931 -13.381 25.453  0.71 10.39 ? 136  ILE A CB  1 
ATOM   1323 C  CB  B ILE A 1 136 ? 24.957 -13.349 25.507  0.29 9.21  ? 136  ILE A CB  1 
ATOM   1324 C  CG1 A ILE A 1 136 ? 23.610 -13.285 26.242  0.71 10.88 ? 136  ILE A CG1 1 
ATOM   1325 C  CG1 B ILE A 1 136 ? 23.850 -13.334 26.562  0.29 9.71  ? 136  ILE A CG1 1 
ATOM   1326 C  CG2 A ILE A 1 136 ? 25.280 -12.101 24.690  0.71 10.63 ? 136  ILE A CG2 1 
ATOM   1327 C  CG2 B ILE A 1 136 ? 25.042 -12.036 24.732  0.29 12.86 ? 136  ILE A CG2 1 
ATOM   1328 C  CD1 A ILE A 1 136 ? 22.353 -13.198 25.337  0.71 14.80 ? 136  ILE A CD1 1 
ATOM   1329 C  CD1 B ILE A 1 136 ? 23.945 -12.201 27.562  0.29 10.99 ? 136  ILE A CD1 1 
ATOM   1330 N  N   . ASN A 1 137 ? 25.925 -14.621 22.319  1.00 10.13 ? 137  ASN A N   1 
ATOM   1331 C  CA  . ASN A 1 137 ? 27.063 -14.577 21.388  1.00 10.65 ? 137  ASN A CA  1 
ATOM   1332 C  C   . ASN A 1 137 ? 27.506 -13.130 21.175  1.00 10.20 ? 137  ASN A C   1 
ATOM   1333 O  O   . ASN A 1 137 ? 26.960 -12.179 21.722  1.00 10.48 ? 137  ASN A O   1 
ATOM   1334 C  CB  . ASN A 1 137 ? 26.753 -15.363 20.120  1.00 12.30 ? 137  ASN A CB  1 
ATOM   1335 C  CG  . ASN A 1 137 ? 25.835 -14.630 19.160  1.00 12.91 ? 137  ASN A CG  1 
ATOM   1336 O  OD1 . ASN A 1 137 ? 25.464 -13.484 19.300  1.00 13.08 ? 137  ASN A OD1 1 
ATOM   1337 N  ND2 . ASN A 1 137 ? 25.456 -15.404 18.142  1.00 17.67 ? 137  ASN A ND2 1 
ATOM   1338 N  N   A TYR A 1 138 ? 28.601 -12.898 20.410  0.62 11.24 ? 138  TYR A N   1 
ATOM   1339 N  N   B TYR A 1 138 ? 28.549 -13.012 20.355  0.38 12.52 ? 138  TYR A N   1 
ATOM   1340 C  CA  A TYR A 1 138 ? 29.139 -11.533 20.318  0.62 11.57 ? 138  TYR A CA  1 
ATOM   1341 C  CA  B TYR A 1 138 ? 29.168 -11.698 20.210  0.38 11.47 ? 138  TYR A CA  1 
ATOM   1342 C  C   A TYR A 1 138 ? 28.145 -10.598 19.645  0.62 11.03 ? 138  TYR A C   1 
ATOM   1343 C  C   B TYR A 1 138 ? 28.202 -10.683 19.631  0.38 11.23 ? 138  TYR A C   1 
ATOM   1344 O  O   A TYR A 1 138 ? 27.965 -9.464  20.090  0.62 11.46 ? 138  TYR A O   1 
ATOM   1345 O  O   B TYR A 1 138 ? 28.052 -9.563  20.129  0.38 11.67 ? 138  TYR A O   1 
ATOM   1346 C  CB  A TYR A 1 138 ? 30.504 -11.526 19.611  0.62 11.58 ? 138  TYR A CB  1 
ATOM   1347 C  CB  B TYR A 1 138 ? 30.454 -11.923 19.397  0.38 12.51 ? 138  TYR A CB  1 
ATOM   1348 C  CG  A TYR A 1 138 ? 31.102 -10.134 19.453  0.62 11.63 ? 138  TYR A CG  1 
ATOM   1349 C  CG  B TYR A 1 138 ? 31.088 -10.573 19.136  0.38 11.75 ? 138  TYR A CG  1 
ATOM   1350 C  CD1 A TYR A 1 138 ? 31.630 -9.407  20.494  0.62 13.43 ? 138  TYR A CD1 1 
ATOM   1351 C  CD1 B TYR A 1 138 ? 31.582 -9.811  20.168  0.38 12.75 ? 138  TYR A CD1 1 
ATOM   1352 C  CD2 A TYR A 1 138 ? 31.129 -9.501  18.213  0.62 12.62 ? 138  TYR A CD2 1 
ATOM   1353 C  CD2 B TYR A 1 138 ? 31.143 -10.115 17.828  0.38 13.80 ? 138  TYR A CD2 1 
ATOM   1354 C  CE1 A TYR A 1 138 ? 32.169 -8.146  20.363  0.62 13.62 ? 138  TYR A CE1 1 
ATOM   1355 C  CE1 B TYR A 1 138 ? 32.164 -8.570  19.956  0.38 12.13 ? 138  TYR A CE1 1 
ATOM   1356 C  CE2 A TYR A 1 138 ? 31.657 -8.235  18.055  0.62 13.84 ? 138  TYR A CE2 1 
ATOM   1357 C  CE2 B TYR A 1 138 ? 31.714 -8.882  17.616  0.38 13.76 ? 138  TYR A CE2 1 
ATOM   1358 C  CZ  A TYR A 1 138 ? 32.174 -7.567  19.119  0.62 14.20 ? 138  TYR A CZ  1 
ATOM   1359 C  CZ  B TYR A 1 138 ? 32.200 -8.134  18.649  0.38 12.44 ? 138  TYR A CZ  1 
ATOM   1360 O  OH  A TYR A 1 138 ? 32.691 -6.313  18.944  0.62 18.58 ? 138  TYR A OH  1 
ATOM   1361 O  OH  B TYR A 1 138 ? 32.771 -6.914  18.382  0.38 17.62 ? 138  TYR A OH  1 
ATOM   1362 N  N   . GLU A 1 139 ? 27.507 -11.037 18.565  1.00 12.23 ? 139  GLU A N   1 
ATOM   1363 C  CA  . GLU A 1 139 ? 26.509 -10.119 17.954  1.00 12.62 ? 139  GLU A CA  1 
ATOM   1364 C  C   . GLU A 1 139 ? 25.437 -9.725  18.941  1.00 11.70 ? 139  GLU A C   1 
ATOM   1365 O  O   . GLU A 1 139 ? 25.050 -8.564  18.981  1.00 12.48 ? 139  GLU A O   1 
ATOM   1366 C  CB  . GLU A 1 139 ? 25.898 -10.791 16.718  1.00 14.60 ? 139  GLU A CB  1 
ATOM   1367 C  CG  . GLU A 1 139 ? 24.786 -9.935  16.138  1.00 16.29 ? 139  GLU A CG  1 
ATOM   1368 C  CD  . GLU A 1 139 ? 24.171 -10.532 14.873  1.00 18.94 ? 139  GLU A CD  1 
ATOM   1369 O  OE1 . GLU A 1 139 ? 24.709 -11.550 14.351  1.00 25.46 ? 139  GLU A OE1 1 
ATOM   1370 O  OE2 . GLU A 1 139 ? 23.200 -9.930  14.412  1.00 22.86 ? 139  GLU A OE2 1 
ATOM   1371 N  N   . GLU A 1 140 ? 24.904 -10.690 19.703  1.00 10.87 ? 140  GLU A N   1 
ATOM   1372 C  CA  . GLU A 1 140 ? 23.851 -10.374 20.685  1.00 10.88 ? 140  GLU A CA  1 
ATOM   1373 C  C   . GLU A 1 140 ? 24.372 -9.404  21.732  1.00 10.19 ? 140  GLU A C   1 
ATOM   1374 O  O   . GLU A 1 140 ? 23.643 -8.506  22.185  1.00 11.84 ? 140  GLU A O   1 
ATOM   1375 C  CB  . GLU A 1 140 ? 23.353 -11.674 21.314  1.00 10.64 ? 140  GLU A CB  1 
ATOM   1376 C  CG  . GLU A 1 140 ? 22.596 -12.575 20.327  1.00 11.64 ? 140  GLU A CG  1 
ATOM   1377 C  CD  . GLU A 1 140 ? 22.381 -13.972 20.819  1.00 10.30 ? 140  GLU A CD  1 
ATOM   1378 O  OE1 . GLU A 1 140 ? 23.155 -14.459 21.708  1.00 11.28 ? 140  GLU A OE1 1 
ATOM   1379 O  OE2 . GLU A 1 140 ? 21.417 -14.652 20.364  1.00 11.33 ? 140  GLU A OE2 1 
ATOM   1380 N  N   A PHE A 1 141 ? 25.615 -9.612  22.151  0.53 10.23 ? 141  PHE A N   1 
ATOM   1381 N  N   B PHE A 1 141 ? 25.607 -9.618  22.156  0.47 10.37 ? 141  PHE A N   1 
ATOM   1382 C  CA  A PHE A 1 141 ? 26.249 -8.753  23.133  0.53 10.57 ? 141  PHE A CA  1 
ATOM   1383 C  CA  B PHE A 1 141 ? 26.241 -8.740  23.123  0.47 10.57 ? 141  PHE A CA  1 
ATOM   1384 C  C   A PHE A 1 141 ? 26.373 -7.309  22.641  0.53 11.42 ? 141  PHE A C   1 
ATOM   1385 C  C   B PHE A 1 141 ? 26.305 -7.302  22.613  0.47 12.26 ? 141  PHE A C   1 
ATOM   1386 O  O   A PHE A 1 141 ? 26.015 -6.358  23.321  0.53 13.10 ? 141  PHE A O   1 
ATOM   1387 O  O   B PHE A 1 141 ? 25.855 -6.355  23.241  0.47 12.32 ? 141  PHE A O   1 
ATOM   1388 C  CB  A PHE A 1 141 ? 27.604 -9.328  23.501  0.53 10.77 ? 141  PHE A CB  1 
ATOM   1389 C  CB  B PHE A 1 141 ? 27.620 -9.284  23.420  0.47 11.51 ? 141  PHE A CB  1 
ATOM   1390 C  CG  A PHE A 1 141 ? 28.401 -8.512  24.494  0.53 11.51 ? 141  PHE A CG  1 
ATOM   1391 C  CG  B PHE A 1 141 ? 28.434 -8.569  24.470  0.47 11.83 ? 141  PHE A CG  1 
ATOM   1392 C  CD1 A PHE A 1 141 ? 28.037 -8.501  25.850  0.53 11.44 ? 141  PHE A CD1 1 
ATOM   1393 C  CD1 B PHE A 1 141 ? 28.329 -8.946  25.817  0.47 11.36 ? 141  PHE A CD1 1 
ATOM   1394 C  CD2 A PHE A 1 141 ? 29.506 -7.770  24.084  0.53 10.93 ? 141  PHE A CD2 1 
ATOM   1395 C  CD2 B PHE A 1 141 ? 29.306 -7.547  24.112  0.47 12.44 ? 141  PHE A CD2 1 
ATOM   1396 C  CE1 A PHE A 1 141 ? 28.782 -7.762  26.760  0.53 14.05 ? 141  PHE A CE1 1 
ATOM   1397 C  CE1 B PHE A 1 141 ? 29.101 -8.312  26.769  0.47 13.87 ? 141  PHE A CE1 1 
ATOM   1398 C  CE2 A PHE A 1 141 ? 30.239 -7.050  25.021  0.53 13.97 ? 141  PHE A CE2 1 
ATOM   1399 C  CE2 B PHE A 1 141 ? 30.067 -6.916  25.091  0.47 14.08 ? 141  PHE A CE2 1 
ATOM   1400 C  CZ  A PHE A 1 141 ? 29.871 -7.038  26.339  0.53 15.57 ? 141  PHE A CZ  1 
ATOM   1401 C  CZ  B PHE A 1 141 ? 29.951 -7.303  26.403  0.47 15.41 ? 141  PHE A CZ  1 
ATOM   1402 N  N   . VAL A 1 142 ? 26.880 -7.163  21.407  1.00 11.84 ? 142  VAL A N   1 
ATOM   1403 C  CA  . VAL A 1 142 ? 27.032 -5.837  20.820  1.00 13.02 ? 142  VAL A CA  1 
ATOM   1404 C  C   . VAL A 1 142 ? 25.696 -5.170  20.666  1.00 14.52 ? 142  VAL A C   1 
ATOM   1405 O  O   . VAL A 1 142 ? 25.537 -3.995  21.022  1.00 16.40 ? 142  VAL A O   1 
ATOM   1406 C  CB  . VAL A 1 142 ? 27.748 -5.896  19.448  1.00 15.32 ? 142  VAL A CB  1 
ATOM   1407 C  CG1 . VAL A 1 142 ? 27.741 -4.547  18.742  1.00 17.14 ? 142  VAL A CG1 1 
ATOM   1408 C  CG2 . VAL A 1 142 ? 29.195 -6.327  19.651  1.00 16.14 ? 142  VAL A CG2 1 
ATOM   1409 N  N   A ARG A 1 143 ? 24.658 -5.867  20.143  0.48 13.09 ? 143  ARG A N   1 
ATOM   1410 N  N   B ARG A 1 143 ? 24.738 -5.948  20.138  0.52 15.49 ? 143  ARG A N   1 
ATOM   1411 C  CA  A ARG A 1 143 ? 23.375 -5.186  19.950  0.48 16.92 ? 143  ARG A CA  1 
ATOM   1412 C  CA  B ARG A 1 143 ? 23.436 -5.352  19.888  0.52 15.37 ? 143  ARG A CA  1 
ATOM   1413 C  C   A ARG A 1 143 ? 22.788 -4.782  21.272  0.48 17.47 ? 143  ARG A C   1 
ATOM   1414 C  C   B ARG A 1 143 ? 22.848 -4.751  21.136  0.52 16.52 ? 143  ARG A C   1 
ATOM   1415 O  O   A ARG A 1 143 ? 22.081 -3.787  21.510  0.48 25.79 ? 143  ARG A O   1 
ATOM   1416 O  O   B ARG A 1 143 ? 22.340 -3.621  21.110  0.52 17.37 ? 143  ARG A O   1 
ATOM   1417 C  CB  A ARG A 1 143 ? 22.413 -6.070  19.148  0.48 15.79 ? 143  ARG A CB  1 
ATOM   1418 C  CB  B ARG A 1 143 ? 22.551 -6.424  19.247  0.52 16.33 ? 143  ARG A CB  1 
ATOM   1419 C  CG  A ARG A 1 143 ? 23.006 -6.543  17.831  0.48 17.08 ? 143  ARG A CG  1 
ATOM   1420 C  CG  B ARG A 1 143 ? 22.545 -6.266  17.721  0.52 18.56 ? 143  ARG A CG  1 
ATOM   1421 C  CD  A ARG A 1 143 ? 22.082 -7.373  17.042  0.48 19.77 ? 143  ARG A CD  1 
ATOM   1422 C  CD  B ARG A 1 143 ? 21.104 -6.426  17.194  0.52 25.74 ? 143  ARG A CD  1 
ATOM   1423 N  NE  A ARG A 1 143 ? 21.784 -8.715  16.782  0.48 27.69 ? 143  ARG A NE  1 
ATOM   1424 N  NE  B ARG A 1 143 ? 21.003 -7.587  16.371  0.52 21.60 ? 143  ARG A NE  1 
ATOM   1425 C  CZ  A ARG A 1 143 ? 20.983 -9.086  15.763  0.48 28.04 ? 143  ARG A CZ  1 
ATOM   1426 C  CZ  B ARG A 1 143 ? 20.125 -8.267  15.690  0.52 18.59 ? 143  ARG A CZ  1 
ATOM   1427 N  NH1 A ARG A 1 143 ? 20.414 -8.251  14.923  0.48 30.24 ? 143  ARG A NH1 1 
ATOM   1428 N  NH1 B ARG A 1 143 ? 18.846 -7.940  15.634  0.52 20.93 ? 143  ARG A NH1 1 
ATOM   1429 N  NH2 A ARG A 1 143 ? 20.781 -10.389 15.646  0.48 39.02 ? 143  ARG A NH2 1 
ATOM   1430 N  NH2 B ARG A 1 143 ? 20.552 -9.343  15.034  0.52 21.02 ? 143  ARG A NH2 1 
ATOM   1431 N  N   A MET A 1 144 ? 23.047 -5.567  22.330  0.73 15.87 ? 144  MET A N   1 
ATOM   1432 N  N   B MET A 1 144 ? 22.894 -5.446  22.256  0.27 14.60 ? 144  MET A N   1 
ATOM   1433 C  CA  A MET A 1 144 ? 22.470 -5.063  23.570  0.73 17.91 ? 144  MET A CA  1 
ATOM   1434 C  CA  B MET A 1 144 ? 22.379 -5.018  23.543  0.27 16.96 ? 144  MET A CA  1 
ATOM   1435 C  C   A MET A 1 144 ? 23.234 -3.844  24.042  0.73 19.05 ? 144  MET A C   1 
ATOM   1436 C  C   B MET A 1 144 ? 23.252 -3.970  24.212  0.27 19.69 ? 144  MET A C   1 
ATOM   1437 O  O   A MET A 1 144 ? 22.658 -2.849  24.455  0.73 23.19 ? 144  MET A O   1 
ATOM   1438 O  O   B MET A 1 144 ? 22.733 -3.159  24.986  0.27 24.03 ? 144  MET A O   1 
ATOM   1439 C  CB  A MET A 1 144 ? 22.452 -6.204  24.592  0.73 16.63 ? 144  MET A CB  1 
ATOM   1440 C  CB  B MET A 1 144 ? 22.208 -6.258  24.442  0.27 18.71 ? 144  MET A CB  1 
ATOM   1441 C  CG  A MET A 1 144 ? 21.903 -5.792  25.947  0.73 19.80 ? 144  MET A CG  1 
ATOM   1442 C  CG  B MET A 1 144 ? 21.330 -6.070  25.665  0.27 21.28 ? 144  MET A CG  1 
ATOM   1443 S  SD  A MET A 1 144 ? 20.260 -5.027  25.910  0.73 20.95 ? 144  MET A SD  1 
ATOM   1444 S  SD  B MET A 1 144 ? 19.574 -6.430  25.425  0.27 25.43 ? 144  MET A SD  1 
ATOM   1445 C  CE  A MET A 1 144 ? 19.693 -5.647  27.489  0.73 43.25 ? 144  MET A CE  1 
ATOM   1446 C  CE  B MET A 1 144 ? 18.960 -4.748  25.277  0.27 36.14 ? 144  MET A CE  1 
ATOM   1447 N  N   . MET A 1 145 ? 24.565 -3.924  23.977  1.00 19.22 ? 145  MET A N   1 
ATOM   1448 C  CA  . MET A 1 145 ? 25.390 -2.897  24.568  1.00 23.30 ? 145  MET A CA  1 
ATOM   1449 C  C   . MET A 1 145 ? 25.225 -1.570  23.860  1.00 26.92 ? 145  MET A C   1 
ATOM   1450 O  O   . MET A 1 145 ? 25.295 -0.510  24.471  1.00 37.49 ? 145  MET A O   1 
ATOM   1451 C  CB  . MET A 1 145 ? 26.892 -3.256  24.504  1.00 24.29 ? 145  MET A CB  1 
ATOM   1452 C  CG  . MET A 1 145 ? 27.267 -4.404  25.410  1.00 26.10 ? 145  MET A CG  1 
ATOM   1453 S  SD  . MET A 1 145 ? 27.021 -4.174  27.148  1.00 35.69 ? 145  MET A SD  1 
ATOM   1454 C  CE  . MET A 1 145 ? 25.397 -4.813  27.441  1.00 87.86 ? 145  MET A CE  1 
ATOM   1455 N  N   . VAL A 1 146 ? 24.997 -1.636  22.552  1.00 26.75 ? 146  VAL A N   1 
ATOM   1456 C  CA  . VAL A 1 146 ? 24.857 -0.329  21.867  1.00 30.36 ? 146  VAL A CA  1 
ATOM   1457 C  C   . VAL A 1 146 ? 23.396 0.103   21.704  1.00 34.19 ? 146  VAL A C   1 
ATOM   1458 O  O   . VAL A 1 146 ? 23.211 1.192   21.177  1.00 38.65 ? 146  VAL A O   1 
ATOM   1459 C  CB  . VAL A 1 146 ? 25.536 -0.395  20.500  1.00 31.65 ? 146  VAL A CB  1 
ATOM   1460 C  CG1 . VAL A 1 146 ? 26.973 -0.899  20.708  1.00 34.55 ? 146  VAL A CG1 1 
ATOM   1461 C  CG2 . VAL A 1 146 ? 24.761 -1.253  19.521  1.00 31.34 ? 146  VAL A CG2 1 
ATOM   1462 N  N   . SER A 1 147 ? 22.457 -0.728  22.138  1.00 42.05 ? 147  SER A N   1 
ATOM   1463 C  CA  . SER A 1 147 ? 21.035 -0.555  21.893  1.00 49.83 ? 147  SER A CA  1 
ATOM   1464 C  C   . SER A 1 147 ? 20.156 -1.376  22.809  1.00 44.39 ? 147  SER A C   1 
ATOM   1465 O  O   . SER A 1 147 ? 20.339 -2.042  23.820  1.00 43.47 ? 147  SER A O   1 
ATOM   1466 C  CB  . SER A 1 147 ? 20.729 -0.885  20.424  1.00 55.45 ? 147  SER A CB  1 
ATOM   1467 O  OG  . SER A 1 147 ? 21.172 -2.131  19.875  1.00 50.29 ? 147  SER A OG  1 
HETATM 1468 CA CA  . CA  B 2 .   ? 46.224 7.128   -8.698  1.00 7.59  ? 1000 CA  A CA  1 
HETATM 1469 CA CA  . CA  C 2 .   ? 36.763 12.606  -4.815  1.00 10.83 ? 1001 CA  A CA  1 
HETATM 1470 CA CA  . CA  D 2 .   ? 22.026 -16.616 21.879  1.00 10.84 ? 1002 CA  A CA  1 
HETATM 1471 CA CA  . CA  E 2 .   ? 32.674 -10.435 -5.410  1.00 10.87 ? 1003 CA  A CA  1 
HETATM 1472 CA CA  . CA  F 2 .   ? 31.568 -19.422 27.202  1.00 14.02 ? 1004 CA  A CA  1 
HETATM 1473 O  O   . HOH G 3 .   ? 40.789 16.842  -5.083  1.00 9.89  ? 2000 HOH A O   1 
HETATM 1474 O  O   . HOH G 3 .   ? 42.295 10.880  -11.518 1.00 10.57 ? 2001 HOH A O   1 
HETATM 1475 O  O   . HOH G 3 .   ? 41.705 -15.715 -2.868  1.00 10.01 ? 2002 HOH A O   1 
HETATM 1476 O  O   . HOH G 3 .   ? 14.809 -17.116 42.346  1.00 10.54 ? 2003 HOH A O   1 
HETATM 1477 O  O   . HOH G 3 .   ? 17.979 -8.051  43.547  1.00 10.03 ? 2004 HOH A O   1 
HETATM 1478 O  O   . HOH G 3 .   ? 20.902 -8.716  21.717  1.00 13.83 ? 2005 HOH A O   1 
HETATM 1479 O  O   . HOH G 3 .   ? 39.631 -14.352 -5.796  1.00 10.60 ? 2006 HOH A O   1 
HETATM 1480 O  O   . HOH G 3 .   ? 25.821 -7.292  45.147  1.00 11.30 ? 2007 HOH A O   1 
HETATM 1481 O  O   . HOH G 3 .   ? 36.202 16.090  -1.527  1.00 13.74 ? 2008 HOH A O   1 
HETATM 1482 O  O   . HOH G 3 .   ? 43.816 -12.458 -5.592  1.00 11.57 ? 2009 HOH A O   1 
HETATM 1483 O  O   . HOH G 3 .   ? 52.000 7.240   -4.484  1.00 12.61 ? 2010 HOH A O   1 
HETATM 1484 O  O   . HOH G 3 .   ? 39.438 12.591  -5.939  1.00 14.76 ? 2011 HOH A O   1 
HETATM 1485 O  O   . HOH G 3 .   ? 23.594 -20.291 29.426  1.00 14.53 ? 2012 HOH A O   1 
HETATM 1486 O  O   . HOH G 3 .   ? 36.982 -12.298 42.999  1.00 11.44 ? 2013 HOH A O   1 
HETATM 1487 O  O   . HOH G 3 .   ? 26.036 -12.451 39.997  1.00 14.73 ? 2014 HOH A O   1 
HETATM 1488 O  O   . HOH G 3 .   ? 35.716 10.477  2.709   1.00 14.74 ? 2015 HOH A O   1 
HETATM 1489 O  O   . HOH G 3 .   ? 27.219 2.992   -4.838  1.00 15.82 ? 2016 HOH A O   1 
HETATM 1490 O  O   . HOH G 3 .   ? 37.759 5.553   -10.145 1.00 17.36 ? 2017 HOH A O   1 
HETATM 1491 O  O   . HOH G 3 .   ? 29.677 -8.242  -8.575  1.00 15.18 ? 2018 HOH A O   1 
HETATM 1492 O  O   . HOH G 3 .   ? 15.594 -14.445 42.575  1.00 15.21 ? 2019 HOH A O   1 
HETATM 1493 O  O   . HOH G 3 .   ? 34.849 -5.298  40.077  1.00 15.75 ? 2020 HOH A O   1 
HETATM 1494 O  O   . HOH G 3 .   ? 52.321 11.732  16.151  1.00 20.53 ? 2021 HOH A O   1 
HETATM 1495 O  O   . HOH G 3 .   ? 30.227 -15.187 19.454  1.00 16.24 ? 2022 HOH A O   1 
HETATM 1496 O  O   . HOH G 3 .   ? 25.425 -15.277 42.324  1.00 20.37 ? 2023 HOH A O   1 
HETATM 1497 O  O   . HOH G 3 .   ? 37.556 -5.765  -11.157 1.00 18.63 ? 2024 HOH A O   1 
HETATM 1498 O  O   . HOH G 3 .   ? 15.998 -20.312 39.410  1.00 15.31 ? 2025 HOH A O   1 
HETATM 1499 O  O   . HOH G 3 .   ? 38.753 17.085  -1.700  1.00 17.50 ? 2026 HOH A O   1 
HETATM 1500 O  O   . HOH G 3 .   ? 15.168 -10.056 42.106  1.00 17.48 ? 2027 HOH A O   1 
HETATM 1501 O  O   . HOH G 3 .   ? 31.388 -3.465  -2.591  1.00 17.30 ? 2028 HOH A O   1 
HETATM 1502 O  O   . HOH G 3 .   ? 14.857 -14.876 24.857  1.00 18.72 ? 2029 HOH A O   1 
HETATM 1503 O  O   . HOH G 3 .   ? 30.080 9.422   -3.288  1.00 25.13 ? 2030 HOH A O   1 
HETATM 1504 O  O   . HOH G 3 .   ? 28.414 -19.030 38.108  1.00 21.58 ? 2031 HOH A O   1 
HETATM 1505 O  O   . HOH G 3 .   ? 37.256 -15.167 25.836  1.00 19.46 ? 2032 HOH A O   1 
HETATM 1506 O  O   . HOH G 3 .   ? 35.576 -14.982 23.690  1.00 20.02 ? 2033 HOH A O   1 
HETATM 1507 O  O   . HOH G 3 .   ? 49.137 -3.694  -3.983  1.00 25.91 ? 2034 HOH A O   1 
HETATM 1508 O  O   . HOH G 3 .   ? 48.451 15.002  -7.827  1.00 20.97 ? 2035 HOH A O   1 
HETATM 1509 O  O   . HOH G 3 .   ? 23.660 -18.477 36.405  1.00 18.12 ? 2036 HOH A O   1 
HETATM 1510 O  O   . HOH G 3 .   ? 28.956 -4.454  45.659  1.00 29.98 ? 2037 HOH A O   1 
HETATM 1511 O  O   . HOH G 3 .   ? 34.472 6.204   -10.276 1.00 20.50 ? 2038 HOH A O   1 
HETATM 1512 O  O   . HOH G 3 .   ? 33.741 16.608  -8.484  1.00 20.72 ? 2039 HOH A O   1 
HETATM 1513 O  O   . HOH G 3 .   ? 24.111 -14.449 48.050  1.00 18.73 ? 2040 HOH A O   1 
HETATM 1514 O  O   A HOH G 3 .   ? 44.207 4.663   -11.870 0.33 8.04  ? 2041 HOH A O   1 
HETATM 1515 O  O   B HOH G 3 .   ? 44.917 5.551   -12.815 0.33 11.39 ? 2042 HOH A O   1 
HETATM 1516 O  O   C HOH G 3 .   ? 43.481 3.315   -12.617 0.33 10.33 ? 2043 HOH A O   1 
HETATM 1517 O  O   A HOH G 3 .   ? 50.218 9.127   -3.434  0.33 9.19  ? 2044 HOH A O   1 
HETATM 1518 O  O   B HOH G 3 .   ? 49.736 10.701  -4.027  0.33 7.48  ? 2045 HOH A O   1 
HETATM 1519 O  O   C HOH G 3 .   ? 51.287 9.050   -2.513  0.33 11.21 ? 2046 HOH A O   1 
HETATM 1520 O  O   . HOH G 3 .   ? 47.397 3.482   -11.670 1.00 20.63 ? 2047 HOH A O   1 
HETATM 1521 O  O   . HOH G 3 .   ? 16.293 -17.085 25.525  1.00 30.98 ? 2048 HOH A O   1 
HETATM 1522 O  O   . HOH G 3 .   ? 25.164 -21.850 32.473  1.00 21.55 ? 2049 HOH A O   1 
HETATM 1523 O  O   . HOH G 3 .   ? 25.731 -13.988 14.636  1.00 24.46 ? 2050 HOH A O   1 
HETATM 1524 O  O   . HOH G 3 .   ? 31.745 8.394   -7.046  1.00 25.10 ? 2051 HOH A O   1 
HETATM 1525 O  O   . HOH G 3 .   ? 26.999 -17.592 47.052  1.00 34.68 ? 2052 HOH A O   1 
HETATM 1526 O  O   . HOH G 3 .   ? 15.486 -21.459 23.871  1.00 25.28 ? 2053 HOH A O   1 
HETATM 1527 O  O   . HOH G 3 .   ? 31.784 -19.349 35.227  1.00 24.96 ? 2054 HOH A O   1 
HETATM 1528 O  O   . HOH G 3 .   ? 20.516 -8.178  28.667  1.00 21.77 ? 2055 HOH A O   1 
HETATM 1529 O  O   . HOH G 3 .   ? 33.690 -6.382  -13.311 1.00 26.11 ? 2056 HOH A O   1 
HETATM 1530 O  O   . HOH G 3 .   ? 18.395 -21.278 35.724  1.00 29.60 ? 2057 HOH A O   1 
HETATM 1531 O  O   . HOH G 3 .   ? 28.258 -13.517 16.993  1.00 26.77 ? 2058 HOH A O   1 
HETATM 1532 O  O   . HOH G 3 .   ? 33.145 -21.122 31.767  1.00 27.90 ? 2059 HOH A O   1 
HETATM 1533 O  O   . HOH G 3 .   ? 46.453 -0.102  -10.432 1.00 24.45 ? 2060 HOH A O   1 
HETATM 1534 O  O   . HOH G 3 .   ? 15.569 -18.233 30.784  1.00 30.01 ? 2061 HOH A O   1 
HETATM 1535 O  O   . HOH G 3 .   ? 50.446 9.900   -0.399  1.00 24.97 ? 2062 HOH A O   1 
HETATM 1536 O  O   . HOH G 3 .   ? 40.283 -3.190  -10.892 1.00 29.39 ? 2063 HOH A O   1 
HETATM 1537 O  O   . HOH G 3 .   ? 39.387 3.086   -12.642 1.00 26.45 ? 2064 HOH A O   1 
HETATM 1538 O  O   . HOH G 3 .   ? 36.943 -15.021 40.078  1.00 30.53 ? 2065 HOH A O   1 
HETATM 1539 O  O   A HOH G 3 .   ? 28.229 -0.346  -7.875  0.50 16.14 ? 2066 HOH A O   1 
HETATM 1540 O  O   B HOH G 3 .   ? 28.242 1.640   -7.765  0.50 18.24 ? 2067 HOH A O   1 
HETATM 1541 O  O   . HOH G 3 .   ? 18.045 -17.159 29.531  1.00 22.90 ? 2068 HOH A O   1 
HETATM 1542 O  O   . HOH G 3 .   ? 31.525 -17.270 41.211  1.00 31.52 ? 2069 HOH A O   1 
HETATM 1543 O  O   . HOH G 3 .   ? 32.863 1.752   -12.347 1.00 31.70 ? 2070 HOH A O   1 
HETATM 1544 O  O   . HOH G 3 .   ? 20.972 -18.610 35.394  1.00 28.01 ? 2071 HOH A O   1 
HETATM 1545 O  O   . HOH G 3 .   ? 28.748 -3.705  -3.267  1.00 34.68 ? 2072 HOH A O   1 
HETATM 1546 O  O   . HOH G 3 .   ? 15.587 -16.467 16.379  1.00 32.32 ? 2073 HOH A O   1 
HETATM 1547 O  O   . HOH G 3 .   ? 29.658 -22.002 31.223  1.00 29.80 ? 2074 HOH A O   1 
HETATM 1548 O  O   . HOH G 3 .   ? 11.848 -19.490 39.935  1.00 31.49 ? 2075 HOH A O   1 
HETATM 1549 O  O   . HOH G 3 .   ? 15.520 -15.402 22.225  1.00 31.54 ? 2076 HOH A O   1 
HETATM 1550 O  O   . HOH G 3 .   ? 39.228 -19.578 28.304  1.00 30.97 ? 2077 HOH A O   1 
HETATM 1551 O  O   . HOH G 3 .   ? 11.322 -9.487  36.308  1.00 32.13 ? 2078 HOH A O   1 
HETATM 1552 O  O   . HOH G 3 .   ? 41.463 -8.024  20.962  1.00 29.34 ? 2079 HOH A O   1 
HETATM 1553 O  O   . HOH G 3 .   ? 46.531 0.288   -6.478  1.00 30.19 ? 2080 HOH A O   1 
HETATM 1554 O  O   . HOH G 3 .   ? 28.505 -22.554 26.178  1.00 35.77 ? 2081 HOH A O   1 
HETATM 1555 O  O   . HOH G 3 .   ? 26.111 -18.062 17.264  1.00 35.20 ? 2082 HOH A O   1 
HETATM 1556 O  O   . HOH G 3 .   ? 28.956 -8.336  -3.895  1.00 40.58 ? 2083 HOH A O   1 
HETATM 1557 O  O   . HOH G 3 .   ? 28.838 11.990  -8.810  1.00 30.27 ? 2084 HOH A O   1 
HETATM 1558 O  O   . HOH G 3 .   ? 14.146 -15.462 34.876  1.00 28.44 ? 2085 HOH A O   1 
HETATM 1559 O  O   . HOH G 3 .   ? 41.018 14.774  -6.961  1.00 13.41 ? 2086 HOH A O   1 
HETATM 1560 O  O   . HOH G 3 .   ? 23.068 -16.227 49.942  1.00 16.27 ? 2087 HOH A O   1 
HETATM 1561 O  O   . HOH G 3 .   ? 28.790 9.197   -5.602  1.00 18.68 ? 2088 HOH A O   1 
HETATM 1562 O  O   . HOH G 3 .   ? 13.505 -21.891 40.162  1.00 21.85 ? 2089 HOH A O   1 
HETATM 1563 O  O   . HOH G 3 .   ? 17.746 -22.206 38.316  1.00 22.80 ? 2090 HOH A O   1 
HETATM 1564 O  O   . HOH G 3 .   ? 49.941 2.266   -12.115 1.00 30.06 ? 2091 HOH A O   1 
HETATM 1565 O  O   . HOH G 3 .   ? 29.078 -17.394 40.211  1.00 24.67 ? 2092 HOH A O   1 
HETATM 1566 O  O   . HOH G 3 .   ? 14.282 -12.479 41.334  1.00 18.84 ? 2093 HOH A O   1 
HETATM 1567 O  O   . HOH G 3 .   ? 45.616 1.495   -12.291 1.00 22.63 ? 2094 HOH A O   1 
HETATM 1568 O  O   . HOH G 3 .   ? 43.962 -6.979  20.675  1.00 23.43 ? 2095 HOH A O   1 
HETATM 1569 O  O   . HOH G 3 .   ? 34.096 -2.838  38.969  1.00 27.61 ? 2096 HOH A O   1 
HETATM 1570 O  O   . HOH G 3 .   ? 37.858 -3.308  -12.223 1.00 30.27 ? 2097 HOH A O   1 
HETATM 1571 O  O   . HOH G 3 .   ? 27.988 13.514  -10.750 1.00 30.50 ? 2098 HOH A O   1 
HETATM 1572 O  O   . HOH G 3 .   ? 31.491 -2.699  39.010  1.00 34.83 ? 2099 HOH A O   1 
HETATM 1573 O  O   . HOH G 3 .   ? 30.500 -0.552  -12.203 1.00 34.35 ? 2100 HOH A O   1 
HETATM 1574 O  O   . HOH G 3 .   ? 23.055 -22.517 30.895  1.00 41.33 ? 2101 HOH A O   1 
HETATM 1575 O  O   . HOH G 3 .   ? 32.697 -14.477 41.218  1.00 30.96 ? 2102 HOH A O   1 
HETATM 1576 O  O   . HOH G 3 .   ? 26.549 -23.790 28.538  1.00 37.33 ? 2103 HOH A O   1 
HETATM 1577 O  O   . HOH G 3 .   ? 11.478 -14.774 35.326  1.00 31.02 ? 2104 HOH A O   1 
HETATM 1578 O  O   . HOH G 3 .   ? 28.056 -6.616  -6.850  1.00 38.06 ? 2105 HOH A O   1 
HETATM 1579 O  O   . HOH G 3 .   ? 36.197 -2.990  27.461  1.00 29.68 ? 2106 HOH A O   1 
HETATM 1580 O  O   . HOH G 3 .   ? 16.712 -7.855  39.856  1.00 30.20 ? 2107 HOH A O   1 
HETATM 1581 O  O   . HOH G 3 .   ? 12.346 -4.992  29.012  1.00 45.21 ? 2108 HOH A O   1 
HETATM 1582 O  O   . HOH G 3 .   ? 10.155 -12.003 36.709  1.00 30.46 ? 2109 HOH A O   1 
HETATM 1583 O  O   . HOH G 3 .   ? 40.058 15.687  5.385   1.00 31.23 ? 2110 HOH A O   1 
HETATM 1584 O  O   . HOH G 3 .   ? 34.298 10.749  6.300   1.00 36.71 ? 2111 HOH A O   1 
HETATM 1585 O  O   . HOH G 3 .   ? 49.250 -0.811  -10.669 1.00 34.23 ? 2112 HOH A O   1 
HETATM 1586 O  O   . HOH G 3 .   ? 54.037 8.829   0.426   1.00 32.37 ? 2113 HOH A O   1 
HETATM 1587 O  O   . HOH G 3 .   ? 27.204 -23.904 33.047  1.00 39.38 ? 2114 HOH A O   1 
HETATM 1588 O  O   . HOH G 3 .   ? 31.012 -20.152 38.014  1.00 34.73 ? 2115 HOH A O   1 
HETATM 1589 O  O   . HOH G 3 .   ? 46.425 19.891  13.066  1.00 38.24 ? 2116 HOH A O   1 
HETATM 1590 O  O   . HOH G 3 .   ? 13.323 -22.008 24.319  1.00 34.66 ? 2117 HOH A O   1 
HETATM 1591 O  O   . HOH G 3 .   ? 34.988 13.024  3.462   1.00 37.72 ? 2118 HOH A O   1 
HETATM 1592 O  O   . HOH G 3 .   ? 43.378 15.388  18.789  1.00 37.05 ? 2119 HOH A O   1 
HETATM 1593 O  O   . HOH G 3 .   ? 11.628 -7.194  35.152  1.00 34.74 ? 2120 HOH A O   1 
HETATM 1594 O  O   . HOH G 3 .   ? 35.496 1.898   0.764   1.00 38.61 ? 2121 HOH A O   1 
HETATM 1595 O  O   . HOH G 3 .   ? 44.846 7.205   -10.602 1.00 10.47 ? 2122 HOH A O   1 
HETATM 1596 O  O   . HOH G 3 .   ? 34.133 -10.927 -7.266  1.00 11.31 ? 2123 HOH A O   1 
HETATM 1597 O  O   . HOH G 3 .   ? 34.869 -10.511 -4.411  1.00 12.42 ? 2124 HOH A O   1 
HETATM 1598 O  O   . HOH G 3 .   ? 31.016 -10.538 -7.141  1.00 14.55 ? 2125 HOH A O   1 
HETATM 1599 O  O   . HOH G 3 .   ? 32.204 -10.618 -3.104  1.00 13.84 ? 2126 HOH A O   1 
HETATM 1600 O  O   . HOH G 3 .   ? 38.095 14.626  -4.782  1.00 10.00 ? 2127 HOH A O   1 
HETATM 1601 O  O   . HOH G 3 .   ? 30.336 -21.323 27.900  1.00 20.07 ? 2128 HOH A O   1 
HETATM 1602 O  O   . HOH G 3 .   ? 24.034 -17.418 20.784  1.00 13.22 ? 2129 HOH A O   1 
HETATM 1603 O  O   . HOH G 3 .   ? 54.504 10.989  0.679   1.00 31.62 ? 2130 HOH A O   1 
HETATM 1604 O  O   . HOH G 3 .   ? 14.288 -12.648 38.691  1.00 26.44 ? 2131 HOH A O   1 
HETATM 1605 O  O   . HOH G 3 .   ? 51.344 8.866   15.549  1.00 34.98 ? 2132 HOH A O   1 
HETATM 1606 O  O   . HOH G 3 .   ? 35.549 16.220  0.968   1.00 29.81 ? 2133 HOH A O   1 
HETATM 1607 O  O   . HOH G 3 .   ? 50.710 18.958  12.127  1.00 38.85 ? 2134 HOH A O   1 
HETATM 1608 O  O   . HOH G 3 .   ? 26.874 -2.390  39.940  1.00 31.54 ? 2135 HOH A O   1 
HETATM 1609 O  O   . HOH G 3 .   ? 24.232 -22.923 34.520  1.00 36.16 ? 2136 HOH A O   1 
HETATM 1610 O  O   . HOH G 3 .   ? 37.758 2.743   1.818   1.00 34.10 ? 2137 HOH A O   1 
HETATM 1611 O  O   . HOH G 3 .   ? 32.486 -23.743 19.584  1.00 36.99 ? 2138 HOH A O   1 
HETATM 1612 O  O   . HOH G 3 .   ? 28.537 10.101  -10.082 1.00 38.26 ? 2139 HOH A O   1 
HETATM 1613 O  O   . HOH G 3 .   ? 48.262 7.843   12.020  1.00 33.39 ? 2140 HOH A O   1 
HETATM 1614 O  O   . HOH G 3 .   ? 20.126 -18.971 29.987  1.00 38.03 ? 2141 HOH A O   1 
HETATM 1615 O  O   . HOH G 3 .   ? 31.325 -21.709 33.349  1.00 41.34 ? 2142 HOH A O   1 
HETATM 1616 O  O   . HOH G 3 .   ? 17.558 -9.167  35.767  1.00 31.17 ? 2143 HOH A O   1 
HETATM 1617 O  O   . HOH G 3 .   ? 14.755 -10.646 37.436  1.00 39.09 ? 2144 HOH A O   1 
HETATM 1618 O  O   . HOH G 3 .   ? 28.210 0.410   -10.786 1.00 39.91 ? 2145 HOH A O   1 
HETATM 1619 O  O   . HOH G 3 .   ? 31.958 -8.877  -0.889  1.00 41.14 ? 2146 HOH A O   1 
HETATM 1620 O  O   . HOH G 3 .   ? 52.336 2.719   -11.133 1.00 39.73 ? 2147 HOH A O   1 
HETATM 1621 O  O   . HOH G 3 .   ? 15.782 -25.622 38.405  1.00 49.95 ? 2148 HOH A O   1 
HETATM 1622 O  O   . HOH G 3 .   ? 25.784 -13.682 49.774  1.00 41.68 ? 2149 HOH A O   1 
HETATM 1623 O  O   . HOH G 3 .   ? 24.095 -21.106 35.938  1.00 43.78 ? 2150 HOH A O   1 
HETATM 1624 O  O   . HOH G 3 .   ? 55.502 10.834  3.254   1.00 44.34 ? 2151 HOH A O   1 
HETATM 1625 O  O   . HOH G 3 .   ? 39.636 15.429  7.957   1.00 40.60 ? 2152 HOH A O   1 
HETATM 1626 O  O   . HOH G 3 .   ? 15.626 -18.799 36.163  1.00 40.93 ? 2153 HOH A O   1 
HETATM 1627 O  O   . HOH G 3 .   ? 30.627 -22.589 20.476  1.00 41.87 ? 2154 HOH A O   1 
HETATM 1628 O  O   . HOH G 3 .   ? 28.295 -8.221  46.335  1.00 27.60 ? 2155 HOH A O   1 
HETATM 1629 O  O   . HOH G 3 .   ? 35.232 4.130   -11.736 1.00 33.35 ? 2156 HOH A O   1 
HETATM 1630 O  O   . HOH G 3 .   ? 29.782 -9.676  44.753  1.00 25.48 ? 2157 HOH A O   1 
HETATM 1631 O  O   . HOH G 3 .   ? 27.322 -21.607 37.930  1.00 38.67 ? 2158 HOH A O   1 
HETATM 1632 O  O   . HOH G 3 .   ? 39.004 -22.581 27.995  1.00 37.05 ? 2159 HOH A O   1 
HETATM 1633 O  O   . HOH G 3 .   ? 31.707 8.248   -10.026 1.00 38.85 ? 2160 HOH A O   1 
HETATM 1634 O  O   . HOH G 3 .   ? 12.461 -17.449 40.907  0.60 18.47 ? 2161 HOH A O   1 
HETATM 1635 O  O   . HOH G 3 .   ? 20.148 -20.536 31.989  1.00 38.29 ? 2162 HOH A O   1 
HETATM 1636 O  O   . HOH G 3 .   ? 13.610 -8.988  39.913  1.00 35.06 ? 2163 HOH A O   1 
HETATM 1637 O  O   . HOH G 3 .   ? 31.426 -2.634  -0.089  1.00 42.14 ? 2164 HOH A O   1 
HETATM 1638 O  O   . HOH G 3 .   ? 46.501 8.766   14.370  1.00 47.02 ? 2165 HOH A O   1 
HETATM 1639 O  O   . HOH G 3 .   ? 38.771 17.316  18.874  1.00 49.37 ? 2166 HOH A O   1 
HETATM 1640 O  O   . HOH G 3 .   ? 29.639 -1.703  43.748  1.00 44.48 ? 2167 HOH A O   1 
HETATM 1641 O  O   . HOH G 3 .   ? 50.504 -5.523  -4.771  1.00 34.24 ? 2168 HOH A O   1 
HETATM 1642 O  O   . HOH G 3 .   ? 23.084 -7.778  29.256  1.00 42.05 ? 2169 HOH A O   1 
HETATM 1643 O  O   . HOH G 3 .   ? 27.942 -16.414 49.674  1.00 42.67 ? 2170 HOH A O   1 
HETATM 1644 O  O   . HOH G 3 .   ? 42.750 -2.232  25.172  1.00 40.65 ? 2171 HOH A O   1 
HETATM 1645 O  O   . HOH G 3 .   ? 25.329 -7.136  30.407  1.00 36.12 ? 2172 HOH A O   1 
HETATM 1646 O  O   . HOH G 3 .   ? 11.730 -12.749 34.283  1.00 40.97 ? 2173 HOH A O   1 
HETATM 1647 O  O   . HOH G 3 .   ? 40.613 17.745  17.101  1.00 40.87 ? 2174 HOH A O   1 
HETATM 1648 O  O   . HOH G 3 .   ? 47.441 1.538   3.068   1.00 39.60 ? 2175 HOH A O   1 
HETATM 1649 O  O   . HOH G 3 .   ? 33.898 -7.037  -2.077  1.00 45.34 ? 2176 HOH A O   1 
HETATM 1650 O  O   . HOH G 3 .   ? 43.807 -4.841  21.930  1.00 47.83 ? 2177 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLU A 2   ? 1.0821  0.6903 1.0252 0.2913  0.0678  -0.3029 2    GLU A N   
2    C  CA  . GLU A 2   ? 0.5247  0.7113 0.8351 0.1480  0.1726  -0.1999 2    GLU A CA  
3    C  C   . GLU A 2   ? 0.4470  0.6363 0.5639 0.1361  0.1887  -0.0217 2    GLU A C   
4    O  O   . GLU A 2   ? 0.4505  0.7071 0.9741 0.1301  0.1176  0.1385  2    GLU A O   
5    C  CB  . GLU A 2   ? 0.2385  0.7778 0.7918 0.0372  0.2340  -0.2864 2    GLU A CB  
6    C  CG  . GLU A 2   ? 0.2506  0.7992 0.6964 -0.0232 0.0650  -0.2519 2    GLU A CG  
7    C  CD  . GLU A 2   ? 0.1406  0.7640 0.9329 0.0295  0.0131  -0.2609 2    GLU A CD  
8    O  OE1 . GLU A 2   ? 0.2541  0.6219 1.3156 0.0058  -0.1026 -0.1530 2    GLU A OE1 
9    O  OE2 . GLU A 2   ? 0.3276  1.3352 0.8958 -0.2242 -0.0843 -0.1859 2    GLU A OE2 
10   N  N   . GLN A 3   ? 0.6161  0.5708 0.4604 0.2258  0.0621  0.0350  3    GLN A N   
11   C  CA  . GLN A 3   ? 0.4857  0.8152 0.3702 0.3008  0.0429  -0.0946 3    GLN A CA  
12   C  C   . GLN A 3   ? 0.3143  0.7390 0.1991 0.1992  -0.1068 -0.1051 3    GLN A C   
13   O  O   . GLN A 3   ? 0.2268  0.7297 0.2741 0.1297  -0.0686 -0.1546 3    GLN A O   
14   C  CB  . GLN A 3   ? 0.6475  0.9073 0.5384 0.4718  -0.0881 -0.0183 3    GLN A CB  
15   C  CG  . GLN A 3   ? 0.5513  1.0285 0.5010 0.4907  -0.1304 0.0161  3    GLN A CG  
16   C  CD  . GLN A 3   ? 0.8340  0.8986 0.4205 0.3073  -0.0552 0.1570  3    GLN A CD  
17   O  OE1 . GLN A 3   ? 1.4801  0.7863 0.3590 0.7630  0.0584  0.0440  3    GLN A OE1 
18   N  NE2 . GLN A 3   ? 0.6432  0.9081 0.6471 0.3758  0.1612  0.2237  3    GLN A NE2 
19   N  N   . LEU A 4   ? 0.3783  0.6249 0.1475 0.2510  -0.0776 -0.0357 4    LEU A N   
20   C  CA  . LEU A 4   ? 0.3353  0.6103 0.1759 0.2153  -0.1296 -0.1419 4    LEU A CA  
21   C  C   . LEU A 4   ? 0.3559  0.5792 0.1371 0.1859  -0.1123 -0.0968 4    LEU A C   
22   O  O   . LEU A 4   ? 0.4314  0.5139 0.2943 0.2114  -0.1446 -0.1021 4    LEU A O   
23   C  CB  . LEU A 4   ? 0.3079  0.7462 0.1772 0.1995  -0.1335 -0.1555 4    LEU A CB  
24   C  CG  . LEU A 4   ? 0.3344  0.7442 0.2273 0.1731  -0.1308 -0.1842 4    LEU A CG  
25   C  CD1 . LEU A 4   ? 0.3852  0.7473 0.2440 0.1899  -0.1753 -0.1959 4    LEU A CD1 
26   C  CD2 . LEU A 4   ? 0.3306  0.7584 0.2683 0.1818  -0.1207 -0.1601 4    LEU A CD2 
27   N  N   . THR A 5   ? 0.2946  0.4924 0.1296 0.1323  -0.0918 -0.1167 5    THR A N   
28   C  CA  . THR A 5   ? 0.3172  0.4470 0.1241 0.1093  -0.0939 -0.0721 5    THR A CA  
29   C  C   . THR A 5   ? 0.3035  0.4509 0.1022 0.0385  -0.1020 -0.0657 5    THR A C   
30   O  O   . THR A 5   ? 0.2985  0.3520 0.1081 0.0321  -0.0634 -0.0520 5    THR A O   
31   C  CB  . THR A 5   ? 0.2373  0.3971 0.1058 0.0623  -0.0462 -0.0572 5    THR A CB  
32   O  OG1 . THR A 5   ? 0.1970  0.4091 0.1032 0.0318  -0.0398 -0.0575 5    THR A OG1 
33   C  CG2 . THR A 5   ? 0.2805  0.4618 0.0969 -0.0141 -0.0445 -0.0769 5    THR A CG2 
34   N  N   . GLU A 6   ? 0.3620  0.4190 0.1401 -0.0117 -0.0852 -0.0921 6    GLU A N   
35   C  CA  . GLU A 6   ? 0.3530  0.4065 0.1300 -0.0244 -0.0729 -0.0405 6    GLU A CA  
36   C  C   . GLU A 6   ? 0.2756  0.4230 0.1057 0.0062  -0.0372 -0.0271 6    GLU A C   
37   O  O   . GLU A 6   ? 0.2690  0.3943 0.1121 -0.0555 -0.0481 -0.0220 6    GLU A O   
38   C  CB  . GLU A 6   ? 0.3963  0.4952 0.2309 -0.0875 -0.0662 -0.0992 6    GLU A CB  
39   C  CG  . GLU A 6   ? 0.4984  0.4430 0.3686 -0.0355 0.0511  0.0739  6    GLU A CG  
40   C  CD  . GLU A 6   ? 0.7150  0.3939 0.4858 0.0424  0.0836  0.0195  6    GLU A CD  
41   O  OE1 . GLU A 6   ? 1.1624  0.6703 0.3771 0.3540  -0.0904 -0.1012 6    GLU A OE1 
42   O  OE2 . GLU A 6   ? 0.6138  0.5293 1.1288 -0.2129 0.2556  0.0305  6    GLU A OE2 
43   N  N   . GLU A 7   ? 0.2165  0.4220 0.1262 -0.0334 -0.0373 -0.0135 7    GLU A N   
44   C  CA  . GLU A 7   ? 0.1656  0.4340 0.1124 0.0108  -0.0470 -0.0177 7    GLU A CA  
45   C  C   . GLU A 7   ? 0.1625  0.3792 0.0888 0.0310  -0.0347 -0.0274 7    GLU A C   
46   O  O   . GLU A 7   ? 0.1644  0.3692 0.1128 0.0494  -0.0374 -0.0322 7    GLU A O   
47   C  CB  . GLU A 7   ? 0.1515  0.5030 0.1205 -0.0318 -0.0461 0.0297  7    GLU A CB  
48   C  CG  . GLU A 7   ? 0.3005  0.5273 0.1233 0.0604  -0.0981 0.0253  7    GLU A CG  
49   C  CD  . GLU A 7   ? 0.3212  0.5821 0.1675 0.1431  -0.0829 0.0620  7    GLU A CD  
50   O  OE1 . GLU A 7   ? 0.2978  0.7764 0.5090 0.1280  0.0591  0.0426  7    GLU A OE1 
51   O  OE2 . GLU A 7   ? 0.3733  0.6252 0.2849 0.1979  -0.1138 -0.0518 7    GLU A OE2 
52   N  N   . GLN A 8   ? 0.1606  0.3693 0.0820 0.0377  -0.0360 -0.0202 8    GLN A N   
53   C  CA  . GLN A 8   ? 0.1603  0.3596 0.0802 0.0340  -0.0439 -0.0149 8    GLN A CA  
54   C  C   . GLN A 8   ? 0.1676  0.3012 0.0834 0.0335  -0.0299 -0.0187 8    GLN A C   
55   O  O   . GLN A 8   ? 0.1746  0.2968 0.0887 0.0282  -0.0398 -0.0150 8    GLN A O   
56   C  CB  . GLN A 8   ? 0.1570  0.4211 0.0865 0.0362  -0.0308 -0.0146 8    GLN A CB  
57   C  CG  . GLN A 8   ? 0.1712  0.4811 0.0929 -0.0061 -0.0237 -0.0066 8    GLN A CG  
58   C  CD  . GLN A 8   ? 0.1907  0.5782 0.0890 0.0194  -0.0286 -0.0480 8    GLN A CD  
59   O  OE1 . GLN A 8   ? 0.1583  0.5869 0.1605 0.0416  -0.0332 -0.0822 8    GLN A OE1 
60   N  NE2 . GLN A 8   ? 0.1702  0.6546 0.1416 -0.0258 -0.0188 -0.1222 8    GLN A NE2 
61   N  N   A ILE A 9   ? 0.1965  0.2991 0.0922 0.0202  -0.0781 -0.0308 9    ILE A N   
62   N  N   B ILE A 9   ? 0.2130  0.2878 0.0993 0.0465  -0.0167 -0.0275 9    ILE A N   
63   C  CA  A ILE A 9   ? 0.2382  0.3000 0.0756 0.0385  -0.0545 -0.0300 9    ILE A CA  
64   C  CA  B ILE A 9   ? 0.2288  0.2477 0.0923 -0.0033 -0.0270 -0.0374 9    ILE A CA  
65   C  C   A ILE A 9   ? 0.2239  0.3039 0.1059 0.0311  -0.0573 -0.0379 9    ILE A C   
66   C  C   B ILE A 9   ? 0.2285  0.2689 0.0729 0.0302  -0.0548 -0.0222 9    ILE A C   
67   O  O   A ILE A 9   ? 0.2127  0.2080 0.0845 0.0387  -0.0510 -0.0091 9    ILE A O   
68   O  O   B ILE A 9   ? 0.1927  0.2592 0.0737 -0.0175 -0.0109 -0.0359 9    ILE A O   
69   C  CB  A ILE A 9   ? 0.2984  0.3034 0.0796 0.0414  -0.0406 -0.0347 9    ILE A CB  
70   C  CB  B ILE A 9   ? 0.2289  0.2546 0.1204 -0.0086 -0.0466 -0.0365 9    ILE A CB  
71   C  CG1 A ILE A 9   ? 0.2456  0.3151 0.1883 0.0413  -0.0672 -0.0810 9    ILE A CG1 
72   C  CG1 B ILE A 9   ? 0.2099  0.2377 0.1158 -0.0108 -0.0545 -0.0224 9    ILE A CG1 
73   C  CG2 A ILE A 9   ? 0.2856  0.3403 0.0954 0.0399  -0.1131 -0.0062 9    ILE A CG2 
74   C  CG2 B ILE A 9   ? 0.1554  0.2455 0.1279 -0.0617 -0.0478 -0.0279 9    ILE A CG2 
75   C  CD1 A ILE A 9   ? 0.3229  0.3191 0.2390 0.0507  -0.0920 -0.0988 9    ILE A CD1 
76   C  CD1 B ILE A 9   ? 0.3756  0.2333 0.1999 -0.0249 -0.0881 -0.0495 9    ILE A CD1 
77   N  N   . ALA A 10  ? 0.2140  0.2976 0.1047 0.0096  -0.0428 -0.0316 10   ALA A N   
78   C  CA  . ALA A 10  ? 0.2032  0.3012 0.0983 -0.0114 -0.0280 -0.0258 10   ALA A CA  
79   C  C   . ALA A 10  ? 0.1514  0.2837 0.0999 0.0143  -0.0389 -0.0098 10   ALA A C   
80   O  O   . ALA A 10  ? 0.1636  0.2715 0.1170 0.0140  -0.0266 -0.0110 10   ALA A O   
81   C  CB  . ALA A 10  ? 0.1848  0.3480 0.1663 -0.0359 -0.0211 -0.0704 10   ALA A CB  
82   N  N   A GLU A 11  ? 0.1831  0.3026 0.1186 0.0246  -0.0330 0.0151  11   GLU A N   
83   N  N   B GLU A 11  ? 0.1665  0.2902 0.1165 0.0433  -0.0482 0.0269  11   GLU A N   
84   C  CA  A GLU A 11  ? 0.1882  0.2833 0.0856 0.0460  -0.0290 0.0113  11   GLU A CA  
85   C  CA  B GLU A 11  ? 0.2067  0.2757 0.1179 0.0592  -0.0547 0.0425  11   GLU A CA  
86   C  C   A GLU A 11  ? 0.1864  0.2650 0.0678 0.0294  -0.0196 0.0291  11   GLU A C   
87   C  C   B GLU A 11  ? 0.1683  0.2643 0.1091 0.0413  -0.0107 0.0064  11   GLU A C   
88   O  O   A GLU A 11  ? 0.1812  0.1781 0.1137 -0.0214 -0.0195 0.0611  11   GLU A O   
89   O  O   B GLU A 11  ? 0.2665  0.2656 0.1227 0.0718  -0.0516 -0.0085 11   GLU A O   
90   C  CB  A GLU A 11  ? 0.2935  0.3147 0.0734 0.0350  -0.0485 0.0358  11   GLU A CB  
91   C  CB  B GLU A 11  ? 0.1706  0.3260 0.1169 -0.0032 -0.0211 0.0333  11   GLU A CB  
92   C  CG  A GLU A 11  ? 0.3062  0.3861 0.1116 0.0374  -0.0698 0.0432  11   GLU A CG  
93   C  CG  B GLU A 11  ? 0.2411  0.3868 0.1415 -0.0199 -0.0868 0.0717  11   GLU A CG  
94   C  CD  A GLU A 11  ? 0.4149  0.4432 0.0971 0.0744  -0.0895 0.0485  11   GLU A CD  
95   C  CD  B GLU A 11  ? 0.3111  0.3902 0.1452 0.0180  -0.0621 0.0808  11   GLU A CD  
96   O  OE1 A GLU A 11  ? 0.4924  0.5490 0.1523 0.0835  0.0277  0.0930  11   GLU A OE1 
97   O  OE1 B GLU A 11  ? 0.2816  0.6477 0.2893 0.0154  -0.0342 0.2594  11   GLU A OE1 
98   O  OE2 A GLU A 11  ? 0.5697  0.3481 0.1709 0.1159  -0.2106 -0.0124 11   GLU A OE2 
99   O  OE2 B GLU A 11  ? 0.3245  0.4686 0.2018 0.0462  -0.0993 0.1298  11   GLU A OE2 
100  N  N   A PHE A 12  ? 0.1674  0.2288 0.0930 0.0018  -0.0214 0.0370  12   PHE A N   
101  N  N   B PHE A 12  ? 0.1671  0.2721 0.0895 0.0440  -0.0304 -0.0236 12   PHE A N   
102  C  CA  A PHE A 12  ? 0.1631  0.2357 0.0897 -0.0088 -0.0231 0.0288  12   PHE A CA  
103  C  CA  B PHE A 12  ? 0.1701  0.2406 0.0939 0.0104  -0.0350 0.0315  12   PHE A CA  
104  C  C   A PHE A 12  ? 0.1469  0.1587 0.0943 0.0148  -0.0223 0.0093  12   PHE A C   
105  C  C   B PHE A 12  ? 0.1437  0.2278 0.0937 0.0230  -0.0249 0.0171  12   PHE A C   
106  O  O   A PHE A 12  ? 0.1282  0.1715 0.1128 0.0259  -0.0266 -0.0012 12   PHE A O   
107  O  O   B PHE A 12  ? 0.0728  0.1626 0.0893 0.0533  -0.0113 0.0372  12   PHE A O   
108  C  CB  A PHE A 12  ? 0.1516  0.2905 0.0682 0.0074  -0.0261 -0.0133 12   PHE A CB  
109  C  CB  B PHE A 12  ? 0.1644  0.3229 0.0801 0.0470  -0.0210 0.0245  12   PHE A CB  
110  C  CG  A PHE A 12  ? 0.1522  0.3568 0.0950 -0.0439 -0.0177 -0.0191 12   PHE A CG  
111  C  CG  B PHE A 12  ? 0.1868  0.4193 0.1019 -0.0816 0.0047  -0.0219 12   PHE A CG  
112  C  CD1 A PHE A 12  ? 0.2592  0.4631 0.1403 -0.1692 0.0511  -0.0951 12   PHE A CD1 
113  C  CD1 B PHE A 12  ? 0.2286  0.4506 0.1761 -0.1195 0.0860  -0.0239 12   PHE A CD1 
114  C  CD2 A PHE A 12  ? 0.1375  0.3374 0.0998 -0.0167 -0.0071 -0.0164 12   PHE A CD2 
115  C  CD2 B PHE A 12  ? 0.2022  0.4183 0.0668 0.0171  -0.0363 0.0053  12   PHE A CD2 
116  C  CE1 A PHE A 12  ? 0.3016  0.4877 0.1464 -0.1686 0.0412  -0.0313 12   PHE A CE1 
117  C  CE1 B PHE A 12  ? 0.1481  0.4958 0.1404 -0.1364 0.0272  -0.0211 12   PHE A CE1 
118  C  CE2 A PHE A 12  ? 0.1439  0.4836 0.0893 -0.0801 -0.0213 -0.0347 12   PHE A CE2 
119  C  CE2 B PHE A 12  ? 0.2004  0.4757 0.0478 -0.0375 -0.0640 -0.0044 12   PHE A CE2 
120  C  CZ  A PHE A 12  ? 0.1691  0.5343 0.1047 -0.1284 0.0249  -0.0355 12   PHE A CZ  
121  C  CZ  B PHE A 12  ? 0.2052  0.5044 0.1079 -0.0690 -0.0067 -0.0054 12   PHE A CZ  
122  N  N   A LYS A 13  ? 0.1421  0.1923 0.0954 0.0041  -0.0184 0.0233  13   LYS A N   
123  N  N   B LYS A 13  ? 0.1573  0.2039 0.0644 0.0144  -0.0252 -0.0222 13   LYS A N   
124  C  CA  A LYS A 13  ? 0.1492  0.1590 0.0911 -0.0022 -0.0297 0.0075  13   LYS A CA  
125  C  CA  B LYS A 13  ? 0.1569  0.1678 0.0760 0.0126  -0.0194 -0.0203 13   LYS A CA  
126  C  C   A LYS A 13  ? 0.1187  0.1366 0.1011 -0.0270 -0.0166 0.0211  13   LYS A C   
127  C  C   B LYS A 13  ? 0.1178  0.1618 0.0705 -0.0005 0.0039  0.0090  13   LYS A C   
128  O  O   A LYS A 13  ? 0.0977  0.1342 0.1027 -0.0368 -0.0007 0.0216  13   LYS A O   
129  O  O   B LYS A 13  ? 0.1023  0.1402 0.0779 -0.0064 0.0202  -0.0020 13   LYS A O   
130  C  CB  A LYS A 13  ? 0.2131  0.1434 0.1270 -0.0202 0.0064  0.0089  13   LYS A CB  
131  C  CB  B LYS A 13  ? 0.1382  0.1764 0.0687 0.0017  -0.0498 -0.0316 13   LYS A CB  
132  C  CG  A LYS A 13  ? 0.2189  0.1533 0.1063 -0.0098 -0.0388 -0.0110 13   LYS A CG  
133  C  CG  B LYS A 13  ? 0.2183  0.2402 0.1035 -0.0089 -0.0189 0.0290  13   LYS A CG  
134  C  CD  A LYS A 13  ? 0.3360  0.1456 0.2075 -0.0551 -0.0179 -0.0272 13   LYS A CD  
135  C  CD  B LYS A 13  ? 0.4350  0.3420 0.3444 0.1755  0.1073  0.1838  13   LYS A CD  
136  C  CE  A LYS A 13  ? 0.5076  0.1494 0.2011 -0.0008 0.0385  -0.0136 13   LYS A CE  
137  C  CE  B LYS A 13  ? 0.6485  0.4456 0.3280 0.3071  0.1589  0.2220  13   LYS A CE  
138  N  NZ  A LYS A 13  ? 0.5726  0.1526 0.3816 -0.0110 0.1640  0.0147  13   LYS A NZ  
139  N  NZ  B LYS A 13  ? 0.5235  0.4254 0.2036 0.3109  0.1281  0.1490  13   LYS A NZ  
140  N  N   . GLU A 14  ? 0.1347  0.1675 0.1150 -0.0018 -0.0197 0.0236  14   GLU A N   
141  C  CA  . GLU A 14  ? 0.1455  0.1747 0.1304 0.0096  -0.0123 0.0168  14   GLU A CA  
142  C  C   . GLU A 14  ? 0.1486  0.1587 0.1420 0.0119  -0.0166 0.0385  14   GLU A C   
143  O  O   . GLU A 14  ? 0.1497  0.1554 0.1776 0.0263  -0.0221 0.0095  14   GLU A O   
144  C  CB  . GLU A 14  ? 0.1469  0.2064 0.2168 0.0163  -0.0446 0.0433  14   GLU A CB  
145  C  CG  . GLU A 14  ? 0.1574  0.2933 0.2637 -0.0120 -0.0456 0.0273  14   GLU A CG  
146  C  CD  . GLU A 14  ? 0.1914  0.5971 0.2555 0.0028  -0.0802 -0.0358 14   GLU A CD  
147  O  OE1 . GLU A 14  ? 0.2854  0.4832 0.2638 0.0423  -0.0835 0.0271  14   GLU A OE1 
148  O  OE2 . GLU A 14  ? 0.1873  0.6901 0.4478 0.0622  -0.1047 0.0156  14   GLU A OE2 
149  N  N   . ALA A 15  ? 0.1490  0.1646 0.1297 0.0008  -0.0226 0.0494  15   ALA A N   
150  C  CA  . ALA A 15  ? 0.1565  0.1354 0.1598 0.0076  -0.0200 0.0661  15   ALA A CA  
151  C  C   . ALA A 15  ? 0.1467  0.1100 0.1499 -0.0050 -0.0192 0.0496  15   ALA A C   
152  O  O   . ALA A 15  ? 0.1874  0.1094 0.1973 -0.0183 -0.0442 0.0509  15   ALA A O   
153  C  CB  . ALA A 15  ? 0.1697  0.2067 0.1687 0.0002  -0.0009 0.0935  15   ALA A CB  
154  N  N   . PHE A 16  ? 0.1288  0.1201 0.1057 0.0061  -0.0145 0.0364  16   PHE A N   
155  C  CA  . PHE A 16  ? 0.1162  0.1007 0.1040 -0.0080 -0.0188 0.0204  16   PHE A CA  
156  C  C   . PHE A 16  ? 0.1226  0.0835 0.1058 -0.0035 -0.0109 0.0135  16   PHE A C   
157  O  O   . PHE A 16  ? 0.1329  0.0813 0.1259 0.0103  -0.0228 0.0097  16   PHE A O   
158  C  CB  . PHE A 16  ? 0.1231  0.0994 0.0950 -0.0015 -0.0154 0.0090  16   PHE A CB  
159  C  CG  . PHE A 16  ? 0.1157  0.0766 0.0877 -0.0138 -0.0109 0.0086  16   PHE A CG  
160  C  CD1 . PHE A 16  ? 0.1117  0.0941 0.1181 -0.0145 -0.0109 0.0236  16   PHE A CD1 
161  C  CD2 . PHE A 16  ? 0.1212  0.0929 0.1067 -0.0064 -0.0040 0.0165  16   PHE A CD2 
162  C  CE1 . PHE A 16  ? 0.1217  0.0812 0.1361 -0.0159 -0.0316 0.0149  16   PHE A CE1 
163  C  CE2 . PHE A 16  ? 0.1548  0.0841 0.1036 -0.0092 -0.0050 0.0235  16   PHE A CE2 
164  C  CZ  . PHE A 16  ? 0.1594  0.0600 0.1279 -0.0121 -0.0381 0.0221  16   PHE A CZ  
165  N  N   . ALA A 17  ? 0.1193  0.0969 0.1155 -0.0062 -0.0074 0.0109  17   ALA A N   
166  C  CA  . ALA A 17  ? 0.1273  0.1083 0.1133 0.0086  -0.0069 0.0079  17   ALA A CA  
167  C  C   . ALA A 17  ? 0.1424  0.1056 0.1515 0.0224  -0.0125 -0.0007 17   ALA A C   
168  O  O   . ALA A 17  ? 0.1739  0.1241 0.1601 0.0201  -0.0030 -0.0157 17   ALA A O   
169  C  CB  . ALA A 17  ? 0.1244  0.1553 0.1312 -0.0171 0.0076  0.0120  17   ALA A CB  
170  N  N   . LEU A 18  ? 0.1372  0.1091 0.1559 0.0261  -0.0321 0.0088  18   LEU A N   
171  C  CA  . LEU A 18  ? 0.1441  0.0981 0.1915 0.0347  -0.0265 0.0010  18   LEU A CA  
172  C  C   . LEU A 18  ? 0.1376  0.0761 0.1769 0.0215  -0.0112 0.0119  18   LEU A C   
173  O  O   . LEU A 18  ? 0.1439  0.0973 0.2395 0.0306  -0.0314 -0.0268 18   LEU A O   
174  C  CB  . LEU A 18  ? 0.3617  0.1256 0.2380 0.0405  -0.0900 0.0725  18   LEU A CB  
175  C  CG  . LEU A 18  ? 0.3608  0.1227 0.3273 0.0265  -0.0544 0.0576  18   LEU A CG  
176  C  CD1 . LEU A 18  ? 0.4137  0.1663 0.5631 0.0528  0.0041  0.0030  18   LEU A CD1 
177  C  CD2 . LEU A 18  ? 0.5620  0.1848 0.3883 -0.0109 0.0049  0.1039  18   LEU A CD2 
178  N  N   . PHE A 19  ? 0.1285  0.0745 0.1402 0.0118  -0.0092 0.0225  19   PHE A N   
179  C  CA  . PHE A 19  ? 0.1162  0.0598 0.1537 -0.0056 -0.0080 0.0243  19   PHE A CA  
180  C  C   . PHE A 19  ? 0.1072  0.0547 0.1447 -0.0069 -0.0175 0.0106  19   PHE A C   
181  O  O   . PHE A 19  ? 0.1114  0.0653 0.1555 -0.0208 -0.0225 0.0062  19   PHE A O   
182  C  CB  . PHE A 19  ? 0.1210  0.0694 0.1635 -0.0052 -0.0024 0.0194  19   PHE A CB  
183  C  CG  . PHE A 19  ? 0.1174  0.0773 0.1667 -0.0034 -0.0058 0.0326  19   PHE A CG  
184  C  CD1 . PHE A 19  ? 0.1342  0.1170 0.1843 -0.0324 -0.0051 0.0370  19   PHE A CD1 
185  C  CD2 . PHE A 19  ? 0.1629  0.1086 0.1591 -0.0301 0.0129  0.0153  19   PHE A CD2 
186  C  CE1 . PHE A 19  ? 0.1603  0.1352 0.1976 -0.0434 0.0023  0.0553  19   PHE A CE1 
187  C  CE2 . PHE A 19  ? 0.2076  0.1616 0.1682 -0.0455 -0.0198 0.0542  19   PHE A CE2 
188  C  CZ  . PHE A 19  ? 0.1771  0.1275 0.1854 -0.0296 0.0166  0.0561  19   PHE A CZ  
189  N  N   . ASP A 20  ? 0.1329  0.0631 0.1278 -0.0281 -0.0234 0.0216  20   ASP A N   
190  C  CA  . ASP A 20  ? 0.1118  0.0538 0.1166 -0.0112 -0.0222 0.0087  20   ASP A CA  
191  C  C   . ASP A 20  ? 0.1186  0.0618 0.1521 -0.0047 -0.0131 0.0228  20   ASP A C   
192  O  O   . ASP A 20  ? 0.1035  0.0920 0.1963 -0.0191 -0.0249 0.0310  20   ASP A O   
193  C  CB  . ASP A 20  ? 0.1316  0.0574 0.1221 -0.0222 -0.0297 0.0158  20   ASP A CB  
194  C  CG  . ASP A 20  ? 0.1044  0.0538 0.1269 -0.0136 -0.0315 0.0150  20   ASP A CG  
195  O  OD1 . ASP A 20  ? 0.1037  0.0703 0.1219 -0.0187 -0.0205 0.0170  20   ASP A OD1 
196  O  OD2 . ASP A 20  ? 0.1247  0.0559 0.1447 -0.0266 -0.0292 0.0156  20   ASP A OD2 
197  N  N   . LYS A 21  ? 0.1254  0.0666 0.1867 0.0026  0.0144  0.0027  21   LYS A N   
198  C  CA  . LYS A 21  ? 0.1460  0.0721 0.2385 0.0149  0.0349  0.0156  21   LYS A CA  
199  C  C   . LYS A 21  ? 0.1324  0.0904 0.1909 0.0173  0.0113  0.0032  21   LYS A C   
200  O  O   . LYS A 21  ? 0.1314  0.1409 0.2164 0.0341  0.0273  0.0360  21   LYS A O   
201  C  CB  . LYS A 21  ? 0.2263  0.0807 0.2655 0.0024  0.0547  -0.0209 21   LYS A CB  
202  C  CG  . LYS A 21  ? 0.1328  0.1196 0.2420 -0.0159 -0.0029 -0.0204 21   LYS A CG  
203  C  CD  . LYS A 21  ? 0.0919  0.2255 0.2843 -0.0248 -0.0120 0.0611  21   LYS A CD  
204  C  CE  . LYS A 21  ? 0.1483  0.1393 0.3087 -0.0179 -0.0414 -0.0053 21   LYS A CE  
205  N  NZ  . LYS A 21  ? 0.1341  0.0695 0.2634 -0.0102 0.0227  0.0079  21   LYS A NZ  
206  N  N   . ASP A 22  ? 0.1098  0.0867 0.1834 0.0026  0.0121  0.0027  22   ASP A N   
207  C  CA  . ASP A 22  ? 0.1048  0.1059 0.1674 -0.0068 0.0130  -0.0007 22   ASP A CA  
208  C  C   . ASP A 22  ? 0.1056  0.0932 0.1670 0.0019  -0.0118 0.0108  22   ASP A C   
209  O  O   . ASP A 22  ? 0.1373  0.1191 0.1576 -0.0294 0.0030  0.0229  22   ASP A O   
210  C  CB  . ASP A 22  ? 0.1241  0.1202 0.1742 0.0014  -0.0001 -0.0121 22   ASP A CB  
211  C  CG  . ASP A 22  ? 0.1309  0.0985 0.1641 0.0042  -0.0210 -0.0241 22   ASP A CG  
212  O  OD1 . ASP A 22  ? 0.1050  0.0883 0.1668 -0.0135 -0.0056 -0.0087 22   ASP A OD1 
213  O  OD2 . ASP A 22  ? 0.1744  0.1709 0.1789 0.0513  -0.0345 -0.0355 22   ASP A OD2 
214  N  N   . GLY A 23  ? 0.0996  0.0807 0.1667 -0.0141 -0.0073 0.0200  23   GLY A N   
215  C  CA  . GLY A 23  ? 0.1154  0.0924 0.1532 -0.0197 -0.0186 0.0155  23   GLY A CA  
216  C  C   . GLY A 23  ? 0.1053  0.0875 0.1426 -0.0386 -0.0289 0.0217  23   GLY A C   
217  O  O   . GLY A 23  ? 0.1492  0.0945 0.2284 -0.0480 -0.0759 0.0394  23   GLY A O   
218  N  N   . ASP A 24  ? 0.0995  0.0722 0.1434 -0.0230 -0.0185 0.0134  24   ASP A N   
219  C  CA  . ASP A 24  ? 0.1049  0.0825 0.1292 -0.0261 -0.0201 0.0152  24   ASP A CA  
220  C  C   . ASP A 24  ? 0.1086  0.0614 0.1216 -0.0233 -0.0300 0.0166  24   ASP A C   
221  O  O   . ASP A 24  ? 0.1318  0.0708 0.1350 -0.0133 -0.0272 0.0120  24   ASP A O   
222  C  CB  . ASP A 24  ? 0.1191  0.0842 0.1127 -0.0177 -0.0099 0.0131  24   ASP A CB  
223  C  CG  . ASP A 24  ? 0.1212  0.0739 0.1071 -0.0320 -0.0238 0.0129  24   ASP A CG  
224  O  OD1 . ASP A 24  ? 0.1264  0.0599 0.1078 -0.0223 -0.0182 0.0058  24   ASP A OD1 
225  O  OD2 . ASP A 24  ? 0.1197  0.1021 0.1393 -0.0358 -0.0214 0.0424  24   ASP A OD2 
226  N  N   . GLY A 25  ? 0.0987  0.0589 0.1289 -0.0185 -0.0319 0.0062  25   GLY A N   
227  C  CA  . GLY A 25  ? 0.1106  0.0563 0.1182 -0.0257 -0.0301 0.0104  25   GLY A CA  
228  C  C   . GLY A 25  ? 0.1082  0.0485 0.1043 -0.0140 -0.0251 0.0179  25   GLY A C   
229  O  O   . GLY A 25  ? 0.1158  0.0469 0.1201 -0.0118 -0.0271 0.0063  25   GLY A O   
230  N  N   . THR A 26  ? 0.1003  0.0455 0.1259 -0.0171 -0.0181 0.0087  26   THR A N   
231  C  CA  . THR A 26  ? 0.1085  0.0492 0.1170 -0.0225 -0.0165 0.0148  26   THR A CA  
232  C  C   . THR A 26  ? 0.0972  0.0403 0.1328 -0.0150 -0.0179 0.0044  26   THR A C   
233  O  O   . THR A 26  ? 0.1093  0.0506 0.1362 -0.0228 -0.0119 0.0037  26   THR A O   
234  C  CB  . THR A 26  ? 0.1038  0.0549 0.1367 -0.0141 -0.0215 0.0057  26   THR A CB  
235  O  OG1 . THR A 26  ? 0.1298  0.0864 0.1321 -0.0082 -0.0388 -0.0143 26   THR A OG1 
236  C  CG2 . THR A 26  ? 0.1350  0.0652 0.1275 -0.0136 -0.0423 0.0134  26   THR A CG2 
237  N  N   . ILE A 27  ? 0.1001  0.0404 0.1366 -0.0135 -0.0064 0.0077  27   ILE A N   
238  C  CA  . ILE A 27  ? 0.1015  0.0439 0.1502 -0.0202 -0.0116 0.0146  27   ILE A CA  
239  C  C   . ILE A 27  ? 0.1091  0.0442 0.1594 -0.0241 -0.0195 0.0231  27   ILE A C   
240  O  O   . ILE A 27  ? 0.1019  0.0613 0.1544 -0.0134 -0.0166 0.0214  27   ILE A O   
241  C  CB  . ILE A 27  ? 0.1036  0.0561 0.1555 -0.0091 -0.0142 0.0194  27   ILE A CB  
242  C  CG1 . ILE A 27  ? 0.1220  0.0538 0.1381 -0.0080 -0.0152 0.0092  27   ILE A CG1 
243  C  CG2 . ILE A 27  ? 0.1296  0.0574 0.1845 -0.0324 -0.0408 0.0338  27   ILE A CG2 
244  C  CD1 . ILE A 27  ? 0.1552  0.0850 0.1429 0.0016  -0.0001 0.0173  27   ILE A CD1 
245  N  N   . THR A 28  ? 0.0977  0.0500 0.1768 -0.0204 -0.0298 0.0085  28   THR A N   
246  C  CA  . THR A 28  ? 0.0941  0.0734 0.1757 -0.0225 -0.0347 0.0136  28   THR A CA  
247  C  C   . THR A 28  ? 0.0974  0.0613 0.1977 -0.0206 -0.0344 0.0113  28   THR A C   
248  O  O   . THR A 28  ? 0.1106  0.0615 0.1652 -0.0257 -0.0329 0.0093  28   THR A O   
249  C  CB  . THR A 28  ? 0.1330  0.0813 0.1707 -0.0151 -0.0299 0.0135  28   THR A CB  
250  O  OG1 . THR A 28  ? 0.1397  0.0923 0.1822 -0.0038 -0.0209 0.0121  28   THR A OG1 
251  C  CG2 . THR A 28  ? 0.1398  0.0977 0.1866 -0.0177 -0.0191 0.0231  28   THR A CG2 
252  N  N   . THR A 29  ? 0.1343  0.0902 0.1830 -0.0400 -0.0623 0.0311  29   THR A N   
253  C  CA  . THR A 29  ? 0.1648  0.0958 0.1881 -0.0681 -0.0720 0.0238  29   THR A CA  
254  C  C   . THR A 29  ? 0.1800  0.0807 0.1742 -0.0700 -0.0730 0.0112  29   THR A C   
255  O  O   . THR A 29  ? 0.1761  0.0986 0.2295 -0.0762 -0.0805 0.0460  29   THR A O   
256  C  CB  . THR A 29  ? 0.1545  0.1361 0.1973 -0.0794 -0.0585 0.0310  29   THR A CB  
257  O  OG1 . THR A 29  ? 0.1876  0.2131 0.1999 -0.0839 -0.0856 0.0706  29   THR A OG1 
258  C  CG2 . THR A 29  ? 0.1689  0.1960 0.2497 -0.0318 -0.0841 0.0154  29   THR A CG2 
259  N  N   . LYS A 30  ? 0.2011  0.1031 0.1614 -0.0526 -0.0681 0.0086  30   LYS A N   
260  C  CA  . LYS A 30  ? 0.2459  0.1239 0.1640 -0.0307 -0.0669 -0.0186 30   LYS A CA  
261  C  C   . LYS A 30  ? 0.1877  0.0892 0.1633 -0.0326 -0.0360 -0.0236 30   LYS A C   
262  O  O   . LYS A 30  ? 0.2331  0.0771 0.2046 -0.0353 -0.0556 -0.0238 30   LYS A O   
263  C  CB  . LYS A 30  ? 0.2974  0.3010 0.1616 0.0177  -0.0430 0.0084  30   LYS A CB  
264  C  CG  . LYS A 30  ? 0.5830  0.5266 0.4259 0.2717  0.2134  0.0403  30   LYS A CG  
265  C  CD  . LYS A 30  ? 0.6299  0.6762 0.8212 0.3700  0.1173  0.0334  30   LYS A CD  
266  C  CE  . LYS A 30  ? 0.6650  0.6592 0.9467 0.4128  0.1356  0.0003  30   LYS A CE  
267  N  NZ  . LYS A 30  ? 0.6620  0.7709 1.1793 0.1119  0.3740  -0.1940 30   LYS A NZ  
268  N  N   . GLU A 31  ? 0.1596  0.0658 0.1642 -0.0217 -0.0330 -0.0099 31   GLU A N   
269  C  CA  . GLU A 31  ? 0.1586  0.0474 0.1690 -0.0281 -0.0284 -0.0081 31   GLU A CA  
270  C  C   . GLU A 31  ? 0.1358  0.0473 0.1710 -0.0193 -0.0317 -0.0085 31   GLU A C   
271  O  O   . GLU A 31  ? 0.1376  0.0525 0.1949 -0.0172 -0.0304 0.0098  31   GLU A O   
272  C  CB  . GLU A 31  ? 0.1402  0.0516 0.1685 -0.0254 -0.0278 -0.0008 31   GLU A CB  
273  C  CG  . GLU A 31  ? 0.1136  0.0589 0.2060 -0.0204 -0.0131 -0.0134 31   GLU A CG  
274  C  CD  . GLU A 31  ? 0.1171  0.0471 0.1837 -0.0116 -0.0302 0.0003  31   GLU A CD  
275  O  OE1 . GLU A 31  ? 0.1226  0.0475 0.1607 -0.0188 -0.0072 0.0058  31   GLU A OE1 
276  O  OE2 . GLU A 31  ? 0.1012  0.0639 0.2459 -0.0178 -0.0120 -0.0190 31   GLU A OE2 
277  N  N   . LEU A 32  ? 0.1393  0.0387 0.1903 -0.0154 -0.0320 0.0135  32   LEU A N   
278  C  CA  . LEU A 32  ? 0.1358  0.0478 0.1873 -0.0156 -0.0233 0.0082  32   LEU A CA  
279  C  C   . LEU A 32  ? 0.1435  0.0439 0.1643 -0.0041 -0.0105 0.0026  32   LEU A C   
280  O  O   . LEU A 32  ? 0.1465  0.0493 0.1799 -0.0087 -0.0048 0.0113  32   LEU A O   
281  C  CB  . LEU A 32  ? 0.1522  0.0493 0.1683 -0.0024 -0.0313 0.0022  32   LEU A CB  
282  C  CG  . LEU A 32  ? 0.1483  0.0720 0.1595 -0.0092 -0.0131 -0.0141 32   LEU A CG  
283  C  CD1 . LEU A 32  ? 0.1835  0.1222 0.1512 -0.0018 -0.0099 -0.0088 32   LEU A CD1 
284  C  CD2 . LEU A 32  ? 0.1682  0.1187 0.1940 0.0250  0.0003  -0.0033 32   LEU A CD2 
285  N  N   . GLY A 33  ? 0.1291  0.0536 0.1785 -0.0138 -0.0168 -0.0005 33   GLY A N   
286  C  CA  . GLY A 33  ? 0.1354  0.0505 0.1780 -0.0122 -0.0298 -0.0042 33   GLY A CA  
287  C  C   . GLY A 33  ? 0.1392  0.0485 0.1443 -0.0139 -0.0197 0.0009  33   GLY A C   
288  O  O   . GLY A 33  ? 0.1407  0.0470 0.1737 -0.0123 -0.0105 0.0007  33   GLY A O   
289  N  N   . THR A 34  ? 0.1438  0.0437 0.1629 -0.0101 -0.0084 0.0035  34   THR A N   
290  C  CA  . THR A 34  ? 0.1410  0.0613 0.1518 -0.0037 -0.0010 -0.0035 34   THR A CA  
291  C  C   . THR A 34  ? 0.1391  0.0519 0.1526 -0.0157 -0.0118 -0.0066 34   THR A C   
292  O  O   . THR A 34  ? 0.1501  0.0575 0.1530 -0.0021 -0.0194 -0.0126 34   THR A O   
293  C  CB  . THR A 34  ? 0.1671  0.0624 0.1780 0.0023  0.0092  0.0105  34   THR A CB  
294  O  OG1 . THR A 34  ? 0.1730  0.1030 0.1934 -0.0084 0.0147  0.0415  34   THR A OG1 
295  C  CG2 . THR A 34  ? 0.1536  0.0893 0.2081 -0.0111 0.0101  0.0064  34   THR A CG2 
296  N  N   . VAL A 35  ? 0.1435  0.0594 0.1564 -0.0189 -0.0137 -0.0127 35   VAL A N   
297  C  CA  . VAL A 35  ? 0.1474  0.0671 0.1499 -0.0327 -0.0082 -0.0115 35   VAL A CA  
298  C  C   . VAL A 35  ? 0.1546  0.0676 0.1576 -0.0336 -0.0260 -0.0034 35   VAL A C   
299  O  O   . VAL A 35  ? 0.1812  0.0710 0.1650 -0.0294 -0.0435 -0.0030 35   VAL A O   
300  C  CB  . VAL A 35  ? 0.1513  0.0687 0.1667 -0.0284 -0.0038 -0.0200 35   VAL A CB  
301  C  CG1 . VAL A 35  ? 0.2470  0.1072 0.1529 -0.0584 0.0091  -0.0234 35   VAL A CG1 
302  C  CG2 . VAL A 35  ? 0.1407  0.0726 0.1865 -0.0293 -0.0072 -0.0079 35   VAL A CG2 
303  N  N   A MET A 36  ? 0.1529  0.0622 0.1479 -0.0402 -0.0194 -0.0008 36   MET A N   
304  N  N   B MET A 36  ? 0.1391  0.0511 0.1754 -0.0199 -0.0013 -0.0352 36   MET A N   
305  C  CA  A MET A 36  ? 0.1511  0.0689 0.1473 -0.0182 0.0191  0.0094  36   MET A CA  
306  C  CA  B MET A 36  ? 0.1514  0.0502 0.1189 -0.0208 -0.0419 -0.0022 36   MET A CA  
307  C  C   A MET A 36  ? 0.1441  0.0619 0.1326 -0.0153 -0.0338 0.0016  36   MET A C   
308  C  C   B MET A 36  ? 0.1276  0.0505 0.1352 -0.0074 -0.0344 0.0054  36   MET A C   
309  O  O   A MET A 36  ? 0.1335  0.0654 0.1378 -0.0135 -0.0400 0.0090  36   MET A O   
310  O  O   B MET A 36  ? 0.1774  0.0481 0.1271 -0.0262 -0.0306 -0.0003 36   MET A O   
311  C  CB  A MET A 36  ? 0.1549  0.0394 0.1408 -0.0253 0.0055  0.0138  36   MET A CB  
312  C  CB  B MET A 36  ? 0.1304  0.0641 0.1565 -0.0027 0.0092  0.0306  36   MET A CB  
313  C  CG  A MET A 36  ? 0.1407  0.0807 0.1221 -0.0200 0.0024  -0.0063 36   MET A CG  
314  C  CG  B MET A 36  ? 0.1358  0.1227 0.1516 -0.0126 0.0348  -0.0135 36   MET A CG  
315  S  SD  A MET A 36  ? 0.1564  0.0699 0.1663 -0.0082 -0.0152 0.0051  36   MET A SD  
316  S  SD  B MET A 36  ? 0.3104  0.2006 0.1492 0.0869  -0.0007 0.0072  36   MET A SD  
317  C  CE  A MET A 36  ? 0.1525  0.0943 0.3408 -0.0101 0.0561  0.0252  36   MET A CE  
318  C  CE  B MET A 36  ? 0.8122  0.3349 0.2960 -0.2581 -0.1598 0.1724  36   MET A CE  
319  N  N   . ARG A 37  ? 0.1412  0.0560 0.1389 -0.0182 -0.0315 0.0040  37   ARG A N   
320  C  CA  . ARG A 37  ? 0.1352  0.0557 0.1404 -0.0107 -0.0256 0.0013  37   ARG A CA  
321  C  C   . ARG A 37  ? 0.1343  0.0593 0.1515 -0.0166 -0.0301 0.0117  37   ARG A C   
322  O  O   . ARG A 37  ? 0.1591  0.0643 0.1616 0.0013  -0.0496 0.0082  37   ARG A O   
323  C  CB  . ARG A 37  ? 0.1395  0.0657 0.1391 -0.0096 -0.0199 0.0057  37   ARG A CB  
324  C  CG  . ARG A 37  ? 0.1422  0.0605 0.1408 -0.0079 -0.0164 0.0038  37   ARG A CG  
325  C  CD  . ARG A 37  ? 0.1843  0.1063 0.1459 0.0118  -0.0292 0.0244  37   ARG A CD  
326  N  NE  . ARG A 37  ? 0.1810  0.1358 0.1780 -0.0111 -0.0181 0.0461  37   ARG A NE  
327  C  CZ  . ARG A 37  ? 0.1966  0.1080 0.1670 -0.0208 -0.0247 0.0506  37   ARG A CZ  
328  N  NH1 . ARG A 37  ? 0.1830  0.1004 0.2481 -0.0185 -0.0586 0.0412  37   ARG A NH1 
329  N  NH2 . ARG A 37  ? 0.1914  0.1485 0.2209 -0.0313 -0.0259 0.0794  37   ARG A NH2 
330  N  N   . SER A 38  ? 0.1335  0.0761 0.1692 -0.0185 -0.0354 0.0070  38   SER A N   
331  C  CA  . SER A 38  ? 0.1660  0.1042 0.1980 -0.0105 -0.0731 0.0033  38   SER A CA  
332  C  C   . SER A 38  ? 0.2050  0.1410 0.1981 -0.0129 -0.0876 0.0220  38   SER A C   
333  O  O   . SER A 38  ? 0.2368  0.1925 0.2885 0.0096  -0.1047 0.0691  38   SER A O   
334  C  CB  . SER A 38  ? 0.1422  0.1319 0.2553 -0.0234 -0.0680 -0.0068 38   SER A CB  
335  O  OG  . SER A 38  ? 0.1942  0.1843 0.3300 -0.0257 -0.0776 -0.0959 38   SER A OG  
336  N  N   A LEU A 39  ? 0.2156  0.1271 0.1717 -0.0357 -0.0815 0.0170  39   LEU A N   
337  N  N   B LEU A 39  ? 0.2205  0.1573 0.1722 -0.0248 -0.0783 0.0222  39   LEU A N   
338  C  CA  A LEU A 39  ? 0.2721  0.1819 0.1433 -0.0310 -0.0949 0.0144  39   LEU A CA  
339  C  CA  B LEU A 39  ? 0.2850  0.1576 0.1684 -0.0405 -0.0792 0.0177  39   LEU A CA  
340  C  C   A LEU A 39  ? 0.2606  0.1395 0.1382 -0.0162 -0.0563 0.0373  39   LEU A C   
341  C  C   B LEU A 39  ? 0.2436  0.1750 0.1579 -0.0361 -0.0652 0.0196  39   LEU A C   
342  O  O   A LEU A 39  ? 0.3005  0.2694 0.1573 -0.0119 -0.0476 0.0984  39   LEU A O   
343  O  O   B LEU A 39  ? 0.2545  0.2639 0.1556 -0.0458 -0.0366 -0.0065 39   LEU A O   
344  C  CB  A LEU A 39  ? 0.3988  0.1719 0.1192 -0.0271 -0.0827 -0.0083 39   LEU A CB  
345  C  CB  B LEU A 39  ? 0.3474  0.2142 0.1683 -0.0415 -0.0916 -0.0231 39   LEU A CB  
346  C  CG  A LEU A 39  ? 0.3191  0.2473 0.1614 -0.0809 -0.0026 -0.0487 39   LEU A CG  
347  C  CG  B LEU A 39  ? 0.3413  0.2490 0.1798 -0.0597 -0.0743 -0.0691 39   LEU A CG  
348  C  CD1 A LEU A 39  ? 0.4673  0.1809 0.1458 -0.0481 -0.0016 -0.0270 39   LEU A CD1 
349  C  CD1 B LEU A 39  ? 0.3664  0.1992 0.2155 -0.0574 -0.0227 -0.0145 39   LEU A CD1 
350  C  CD2 A LEU A 39  ? 0.4239  0.3530 0.2357 -0.0157 -0.1145 -0.1407 39   LEU A CD2 
351  C  CD2 B LEU A 39  ? 0.3575  0.2210 0.2760 -0.0512 -0.1033 -0.0605 39   LEU A CD2 
352  N  N   . GLY A 40  ? 0.2007  0.1065 0.1502 -0.0138 -0.0459 0.0344  40   GLY A N   
353  C  CA  . GLY A 40  ? 0.2014  0.0922 0.1705 0.0095  -0.0357 0.0285  40   GLY A CA  
354  C  C   . GLY A 40  ? 0.1914  0.0668 0.1440 -0.0171 -0.0176 0.0268  40   GLY A C   
355  O  O   . GLY A 40  ? 0.2145  0.0764 0.1765 -0.0242 0.0141  0.0239  40   GLY A O   
356  N  N   . GLN A 41  ? 0.1753  0.0817 0.1394 -0.0254 -0.0560 0.0264  41   GLN A N   
357  C  CA  . GLN A 41  ? 0.1600  0.0988 0.1304 -0.0353 -0.0431 0.0237  41   GLN A CA  
358  C  C   . GLN A 41  ? 0.1336  0.0693 0.1102 -0.0191 -0.0191 0.0105  41   GLN A C   
359  O  O   . GLN A 41  ? 0.1558  0.0897 0.1312 -0.0302 -0.0294 0.0219  41   GLN A O   
360  C  CB  . GLN A 41  ? 0.2000  0.2517 0.1027 -0.0260 0.0039  0.0103  41   GLN A CB  
361  C  CG  . GLN A 41  ? 0.2037  0.1430 0.2181 0.0080  -0.0126 0.0074  41   GLN A CG  
362  C  CD  . GLN A 41  ? 0.2499  0.1301 0.3168 -0.0351 0.0849  -0.0118 41   GLN A CD  
363  O  OE1 . GLN A 41  ? 0.2892  0.1926 0.2702 -0.0149 0.0478  -0.0556 41   GLN A OE1 
364  N  NE2 . GLN A 41  ? 0.2621  0.1981 0.5006 -0.0230 0.1543  -0.0351 41   GLN A NE2 
365  N  N   . ASN A 42  ? 0.1374  0.0655 0.1040 -0.0114 -0.0191 0.0098  42   ASN A N   
366  C  CA  . ASN A 42  ? 0.1215  0.0623 0.0981 -0.0114 -0.0099 0.0111  42   ASN A CA  
367  C  C   . ASN A 42  ? 0.1247  0.0558 0.1183 -0.0085 -0.0219 0.0069  42   ASN A C   
368  O  O   . ASN A 42  ? 0.1307  0.0747 0.1341 -0.0129 -0.0363 0.0021  42   ASN A O   
369  C  CB  . ASN A 42  ? 0.1292  0.0580 0.1156 -0.0061 -0.0214 0.0031  42   ASN A CB  
370  C  CG  . ASN A 42  ? 0.1274  0.0544 0.1245 -0.0154 -0.0192 0.0105  42   ASN A CG  
371  O  OD1 . ASN A 42  ? 0.1382  0.0801 0.1176 0.0010  -0.0263 0.0165  42   ASN A OD1 
372  N  ND2 . ASN A 42  ? 0.1246  0.0589 0.1226 -0.0167 -0.0127 0.0056  42   ASN A ND2 
373  N  N   A PRO A 43  ? 0.1224  0.0498 0.1180 -0.0117 -0.0090 0.0102  43   PRO A N   
374  N  N   B PRO A 43  ? 0.1518  0.0718 0.1547 0.0100  -0.0501 -0.0181 43   PRO A N   
375  C  CA  A PRO A 43  ? 0.1256  0.0508 0.1415 -0.0092 -0.0150 0.0195  43   PRO A CA  
376  C  CA  B PRO A 43  ? 0.1557  0.0858 0.1298 0.0210  -0.0410 -0.0203 43   PRO A CA  
377  C  C   A PRO A 43  ? 0.1362  0.0840 0.1270 0.0154  -0.0190 -0.0020 43   PRO A C   
378  C  C   B PRO A 43  ? 0.1368  0.0605 0.1351 -0.0229 -0.0313 0.0038  43   PRO A C   
379  O  O   A PRO A 43  ? 0.1521  0.0762 0.1228 0.0203  -0.0253 0.0248  43   PRO A O   
380  O  O   B PRO A 43  ? 0.1732  0.1327 0.1907 0.0097  0.0362  -0.0122 43   PRO A O   
381  C  CB  A PRO A 43  ? 0.1188  0.0725 0.1212 -0.0062 -0.0181 0.0065  43   PRO A CB  
382  C  CB  B PRO A 43  ? 0.1445  0.1036 0.1567 -0.0113 -0.0319 -0.0468 43   PRO A CB  
383  C  CG  A PRO A 43  ? 0.1263  0.0558 0.1668 -0.0123 -0.0232 0.0003  43   PRO A CG  
384  C  CG  B PRO A 43  ? 0.1564  0.0848 0.1597 -0.0243 -0.0370 -0.0275 43   PRO A CG  
385  C  CD  A PRO A 43  ? 0.1235  0.0624 0.1284 -0.0136 -0.0026 -0.0141 43   PRO A CD  
386  C  CD  B PRO A 43  ? 0.1441  0.0778 0.1533 -0.0230 -0.0332 -0.0102 43   PRO A CD  
387  N  N   . THR A 44  ? 0.1541  0.0618 0.1599 -0.0061 -0.0458 0.0006  44   THR A N   
388  C  CA  . THR A 44  ? 0.1598  0.0728 0.1452 -0.0045 -0.0434 0.0012  44   THR A CA  
389  C  C   . THR A 44  ? 0.1686  0.0714 0.1468 0.0021  -0.0466 -0.0020 44   THR A C   
390  O  O   . THR A 44  ? 0.1413  0.0690 0.1465 -0.0018 -0.0361 -0.0012 44   THR A O   
391  C  CB  . THR A 44  ? 0.1652  0.0837 0.2016 0.0024  -0.0632 -0.0024 44   THR A CB  
392  O  OG1 . THR A 44  ? 0.1472  0.0876 0.2093 -0.0088 -0.0529 0.0269  44   THR A OG1 
393  C  CG2 . THR A 44  ? 0.2241  0.0756 0.1688 -0.0234 -0.0549 0.0085  44   THR A CG2 
394  N  N   . GLU A 45  ? 0.2050  0.0808 0.1393 0.0117  -0.0487 0.0005  45   GLU A N   
395  C  CA  . GLU A 45  ? 0.1825  0.0722 0.1598 0.0102  -0.0378 0.0050  45   GLU A CA  
396  C  C   . GLU A 45  ? 0.1509  0.0693 0.1690 0.0047  -0.0516 0.0138  45   GLU A C   
397  O  O   . GLU A 45  ? 0.1540  0.0692 0.1647 0.0007  -0.0309 0.0070  45   GLU A O   
398  C  CB  . GLU A 45  ? 0.2390  0.1214 0.1664 -0.0025 -0.0269 0.0340  45   GLU A CB  
399  C  CG  . GLU A 45  ? 0.2616  0.1217 0.1875 -0.0145 -0.0112 0.0397  45   GLU A CG  
400  C  CD  . GLU A 45  ? 0.2525  0.1378 0.3094 -0.0142 -0.0531 0.0782  45   GLU A CD  
401  O  OE1 . GLU A 45  ? 0.2353  0.2203 0.4019 0.0300  0.0228  0.0956  45   GLU A OE1 
402  O  OE2 . GLU A 45  ? 0.3064  0.1469 0.2693 -0.0277 -0.0375 0.0274  45   GLU A OE2 
403  N  N   . ALA A 46  ? 0.1573  0.0834 0.1958 -0.0033 -0.0736 0.0111  46   ALA A N   
404  C  CA  . ALA A 46  ? 0.1305  0.0950 0.2165 -0.0035 -0.0671 0.0323  46   ALA A CA  
405  C  C   . ALA A 46  ? 0.1125  0.0640 0.2177 0.0044  -0.0484 0.0216  46   ALA A C   
406  O  O   . ALA A 46  ? 0.1090  0.0656 0.2485 0.0114  -0.0404 0.0173  46   ALA A O   
407  C  CB  . ALA A 46  ? 0.1641  0.1094 0.2522 -0.0181 -0.0813 0.0063  46   ALA A CB  
408  N  N   . GLU A 47  ? 0.1158  0.0573 0.2056 -0.0127 -0.0544 0.0202  47   GLU A N   
409  C  CA  . GLU A 47  ? 0.1287  0.0562 0.1699 -0.0096 -0.0321 0.0209  47   GLU A CA  
410  C  C   . GLU A 47  ? 0.1253  0.0689 0.1500 -0.0071 -0.0261 0.0169  47   GLU A C   
411  O  O   . GLU A 47  ? 0.1184  0.0723 0.1601 -0.0050 -0.0162 0.0061  47   GLU A O   
412  C  CB  . GLU A 47  ? 0.0992  0.0670 0.1809 -0.0074 -0.0196 0.0198  47   GLU A CB  
413  C  CG  . GLU A 47  ? 0.1166  0.0666 0.2334 -0.0162 -0.0372 0.0343  47   GLU A CG  
414  C  CD  . GLU A 47  ? 0.1193  0.0623 0.2222 -0.0156 -0.0184 0.0033  47   GLU A CD  
415  O  OE1 . GLU A 47  ? 0.1286  0.0671 0.1972 -0.0047 -0.0295 0.0180  47   GLU A OE1 
416  O  OE2 . GLU A 47  ? 0.1700  0.0871 0.3460 0.0104  0.0532  0.0656  47   GLU A OE2 
417  N  N   . LEU A 48  ? 0.1076  0.0597 0.1536 -0.0039 -0.0328 -0.0053 48   LEU A N   
418  C  CA  . LEU A 48  ? 0.1167  0.0514 0.1693 -0.0121 -0.0281 0.0037  48   LEU A CA  
419  C  C   . LEU A 48  ? 0.1105  0.0581 0.1656 -0.0092 -0.0289 0.0060  48   LEU A C   
420  O  O   . LEU A 48  ? 0.1152  0.0571 0.1776 -0.0088 -0.0271 -0.0044 48   LEU A O   
421  C  CB  . LEU A 48  ? 0.1207  0.0602 0.1774 -0.0106 -0.0293 -0.0068 48   LEU A CB  
422  C  CG  . LEU A 48  ? 0.1271  0.0615 0.1734 -0.0082 -0.0242 -0.0072 48   LEU A CG  
423  C  CD1 . LEU A 48  ? 0.1225  0.0868 0.1949 -0.0112 -0.0222 -0.0232 48   LEU A CD1 
424  C  CD2 . LEU A 48  ? 0.1555  0.1195 0.1834 0.0090  -0.0404 -0.0044 48   LEU A CD2 
425  N  N   . GLN A 49  ? 0.1163  0.0480 0.1847 -0.0005 -0.0382 -0.0064 49   GLN A N   
426  C  CA  . GLN A 49  ? 0.1182  0.0616 0.1858 0.0090  -0.0184 0.0068  49   GLN A CA  
427  C  C   . GLN A 49  ? 0.1049  0.0629 0.1804 -0.0023 -0.0230 0.0131  49   GLN A C   
428  O  O   . GLN A 49  ? 0.1287  0.0577 0.1741 0.0014  -0.0240 0.0038  49   GLN A O   
429  C  CB  . GLN A 49  ? 0.1322  0.0860 0.1762 0.0209  -0.0181 0.0155  49   GLN A CB  
430  C  CG  . GLN A 49  ? 0.1843  0.1041 0.1627 0.0489  0.0032  0.0301  49   GLN A CG  
431  C  CD  . GLN A 49  ? 0.2386  0.1098 0.2600 0.0564  0.0842  0.0678  49   GLN A CD  
432  O  OE1 . GLN A 49  ? 0.2057  0.1291 0.3316 0.0077  0.0066  0.0666  49   GLN A OE1 
433  N  NE2 . GLN A 49  ? 0.3615  0.1701 0.3345 0.1165  0.1951  0.1347  49   GLN A NE2 
434  N  N   . ASP A 50  ? 0.1192  0.0634 0.1790 -0.0101 -0.0287 0.0074  50   ASP A N   
435  C  CA  . ASP A 50  ? 0.1196  0.0824 0.1921 -0.0071 -0.0128 0.0136  50   ASP A CA  
436  C  C   . ASP A 50  ? 0.1438  0.0959 0.1666 -0.0076 -0.0087 0.0197  50   ASP A C   
437  O  O   . ASP A 50  ? 0.1425  0.1192 0.1624 -0.0088 0.0009  0.0208  50   ASP A O   
438  C  CB  . ASP A 50  ? 0.1181  0.1028 0.2186 -0.0091 0.0005  0.0156  50   ASP A CB  
439  C  CG  . ASP A 50  ? 0.1306  0.1177 0.2810 -0.0284 -0.0116 0.0096  50   ASP A CG  
440  O  OD1 . ASP A 50  ? 0.1282  0.1420 0.2711 0.0305  -0.0173 -0.0086 50   ASP A OD1 
441  O  OD2 . ASP A 50  ? 0.1518  0.1568 0.3352 -0.0512 -0.0223 0.0208  50   ASP A OD2 
442  N  N   . MET A 51  ? 0.1330  0.0963 0.1623 -0.0141 -0.0261 0.0308  51   MET A N   
443  C  CA  . MET A 51  ? 0.1596  0.0962 0.1595 -0.0044 -0.0317 0.0248  51   MET A CA  
444  C  C   . MET A 51  ? 0.1601  0.0905 0.1547 -0.0001 -0.0419 0.0167  51   MET A C   
445  O  O   . MET A 51  ? 0.1961  0.1096 0.1704 0.0000  -0.0326 -0.0085 51   MET A O   
446  C  CB  . MET A 51  ? 0.1544  0.0927 0.1670 -0.0029 -0.0320 0.0292  51   MET A CB  
447  C  CG  . MET A 51  ? 0.1880  0.0954 0.1973 -0.0062 -0.0551 0.0268  51   MET A CG  
448  S  SD  . MET A 51  ? 0.2216  0.0983 0.2727 0.0181  -0.0621 0.0366  51   MET A SD  
449  C  CE  . MET A 51  ? 0.2317  0.2188 0.3359 -0.0133 -0.1206 0.0538  51   MET A CE  
450  N  N   A ILE A 52  ? 0.1012  0.0873 0.1648 -0.0350 -0.0524 0.0136  52   ILE A N   
451  N  N   B ILE A 52  ? 0.1606  0.0453 0.1701 0.0088  -0.0187 0.0054  52   ILE A N   
452  C  CA  A ILE A 52  ? 0.1268  0.0742 0.1650 -0.0307 -0.0359 -0.0008 52   ILE A CA  
453  C  CA  B ILE A 52  ? 0.1416  0.0411 0.1722 0.0005  -0.0529 -0.0028 52   ILE A CA  
454  C  C   A ILE A 52  ? 0.1363  0.0743 0.1528 -0.0323 -0.0088 0.0214  52   ILE A C   
455  C  C   B ILE A 52  ? 0.1471  0.0382 0.1747 -0.0078 -0.0342 0.0079  52   ILE A C   
456  O  O   A ILE A 52  ? 0.1636  0.1417 0.1642 0.0082  -0.0420 -0.0444 52   ILE A O   
457  O  O   B ILE A 52  ? 0.1809  0.0321 0.1508 -0.0109 -0.0086 0.0104  52   ILE A O   
458  C  CB  A ILE A 52  ? 0.1311  0.0447 0.1688 -0.0133 -0.0245 -0.0144 52   ILE A CB  
459  C  CB  B ILE A 52  ? 0.1199  0.0725 0.1976 -0.0186 -0.0204 0.0095  52   ILE A CB  
460  C  CG1 A ILE A 52  ? 0.1136  0.0602 0.2714 -0.0141 0.0045  0.0072  52   ILE A CG1 
461  C  CG1 B ILE A 52  ? 0.1515  0.1345 0.2910 0.0179  0.0209  0.0180  52   ILE A CG1 
462  C  CG2 A ILE A 52  ? 0.1346  0.0545 0.1650 -0.0025 0.0001  -0.0106 52   ILE A CG2 
463  C  CG2 B ILE A 52  ? 0.1990  0.0680 0.1654 -0.0321 -0.0246 -0.0113 52   ILE A CG2 
464  C  CD1 A ILE A 52  ? 0.1519  0.0458 0.3572 -0.0168 -0.0614 0.0262  52   ILE A CD1 
465  C  CD1 B ILE A 52  ? 0.1301  0.1399 0.3927 0.0211  0.0531  0.0451  52   ILE A CD1 
466  N  N   . ASN A 53  ? 0.1298  0.0669 0.1680 -0.0089 0.0052  -0.0096 53   ASN A N   
467  C  CA  . ASN A 53  ? 0.1490  0.0731 0.1652 0.0037  0.0106  -0.0036 53   ASN A CA  
468  C  C   . ASN A 53  ? 0.1506  0.1173 0.1713 0.0068  0.0147  -0.0161 53   ASN A C   
469  O  O   . ASN A 53  ? 0.1626  0.1203 0.1741 0.0201  0.0169  -0.0133 53   ASN A O   
470  C  CB  . ASN A 53  ? 0.1345  0.1042 0.1882 0.0036  0.0192  -0.0046 53   ASN A CB  
471  C  CG  . ASN A 53  ? 0.1291  0.0773 0.1819 0.0150  0.0069  -0.0046 53   ASN A CG  
472  O  OD1 . ASN A 53  ? 0.1461  0.1562 0.2347 0.0135  -0.0113 -0.0285 53   ASN A OD1 
473  N  ND2 . ASN A 53  ? 0.1708  0.0706 0.1341 0.0065  -0.0094 -0.0013 53   ASN A ND2 
474  N  N   . GLU A 54  ? 0.2779  0.1056 0.1780 0.0003  0.0556  0.0103  54   GLU A N   
475  C  CA  . GLU A 54  ? 0.3281  0.1452 0.1763 -0.0157 0.0739  0.0238  54   GLU A CA  
476  C  C   . GLU A 54  ? 0.3701  0.1436 0.1493 -0.0077 0.0158  0.0223  54   GLU A C   
477  O  O   . GLU A 54  ? 0.5280  0.1852 0.1715 -0.0300 0.0705  -0.0091 54   GLU A O   
478  C  CB  . GLU A 54  ? 0.4971  0.1459 0.2098 -0.0153 0.1313  0.0510  54   GLU A CB  
479  C  CG  . GLU A 54  ? 0.3779  0.1821 0.3427 -0.0122 0.1533  0.0838  54   GLU A CG  
480  C  CD  . GLU A 54  ? 0.4297  0.5043 0.3677 0.0499  0.0840  0.0157  54   GLU A CD  
481  O  OE1 . GLU A 54  ? 0.4235  0.5245 0.3290 0.2106  0.0751  0.1802  54   GLU A OE1 
482  O  OE2 . GLU A 54  ? 0.5939  0.8299 0.3607 0.2642  0.0593  0.0188  54   GLU A OE2 
483  N  N   A VAL A 55  ? 0.2568  0.0901 0.1945 0.0548  -0.0386 0.0109  55   VAL A N   
484  N  N   B VAL A 55  ? 0.2852  0.1324 0.1289 0.0004  -0.0509 0.0000  55   VAL A N   
485  C  CA  A VAL A 55  ? 0.2728  0.1437 0.1762 0.0590  -0.0870 -0.0074 55   VAL A CA  
486  C  CA  B VAL A 55  ? 0.3372  0.0830 0.1787 0.0169  -0.0863 -0.0219 55   VAL A CA  
487  C  C   A VAL A 55  ? 0.2786  0.1582 0.1595 -0.0211 -0.0676 -0.0061 55   VAL A C   
488  C  C   B VAL A 55  ? 0.2350  0.0710 0.1832 0.0492  -0.0873 -0.0183 55   VAL A C   
489  O  O   A VAL A 55  ? 0.1103  0.1534 0.1005 0.0466  0.0105  -0.0361 55   VAL A O   
490  O  O   B VAL A 55  ? 0.1250  0.1239 0.1380 0.0336  -0.0020 -0.0432 55   VAL A O   
491  C  CB  A VAL A 55  ? 0.2318  0.2465 0.0545 0.0248  0.0576  0.0702  55   VAL A CB  
492  C  CB  B VAL A 55  ? 0.3918  0.1110 0.2106 0.0204  -0.2125 0.0205  55   VAL A CB  
493  C  CG1 A VAL A 55  ? 0.2095  0.1172 0.1980 0.0489  0.0962  0.0609  55   VAL A CG1 
494  C  CG1 B VAL A 55  ? 0.3031  0.3614 0.0748 -0.0437 -0.0229 0.0304  55   VAL A CG1 
495  C  CG2 A VAL A 55  ? 0.1973  0.1107 0.1537 0.0297  -0.0243 -0.0341 55   VAL A CG2 
496  C  CG2 B VAL A 55  ? 0.3856  0.1044 0.3214 -0.0586 -0.1879 0.0404  55   VAL A CG2 
497  N  N   . ASP A 56  ? 0.3858  0.0900 0.1794 -0.0149 -0.1161 -0.0070 56   ASP A N   
498  C  CA  . ASP A 56  ? 0.3448  0.0507 0.1920 0.0147  -0.1108 -0.0055 56   ASP A CA  
499  C  C   . ASP A 56  ? 0.1987  0.0907 0.1836 -0.0411 -0.0561 0.0189  56   ASP A C   
500  O  O   . ASP A 56  ? 0.2173  0.1558 0.2303 -0.0605 -0.0874 0.0225  56   ASP A O   
501  C  CB  . ASP A 56  ? 0.3815  0.0726 0.1859 -0.0050 -0.1180 0.0032  56   ASP A CB  
502  C  CG  . ASP A 56  ? 0.1958  0.0696 0.1952 0.0007  -0.0689 0.0106  56   ASP A CG  
503  O  OD1 . ASP A 56  ? 0.1409  0.0777 0.2088 0.0114  -0.0504 -0.0259 56   ASP A OD1 
504  O  OD2 . ASP A 56  ? 0.2268  0.0887 0.1844 -0.0136 -0.0893 0.0117  56   ASP A OD2 
505  N  N   . ALA A 57  ? 0.1615  0.0873 0.2247 -0.0115 -0.0397 -0.0137 57   ALA A N   
506  C  CA  . ALA A 57  ? 0.1703  0.1140 0.2322 -0.0090 -0.0194 0.0025  57   ALA A CA  
507  C  C   . ALA A 57  ? 0.1309  0.0893 0.2544 -0.0060 -0.0126 0.0138  57   ALA A C   
508  O  O   . ALA A 57  ? 0.1468  0.1865 0.2961 0.0272  0.0017  0.0128  57   ALA A O   
509  C  CB  . ALA A 57  ? 0.1924  0.1411 0.2304 0.0113  -0.0028 -0.0345 57   ALA A CB  
510  N  N   . ASP A 58  ? 0.1339  0.0968 0.2565 -0.0105 -0.0149 0.0114  58   ASP A N   
511  C  CA  . ASP A 58  ? 0.1060  0.1061 0.2505 0.0229  -0.0135 0.0178  58   ASP A CA  
512  C  C   . ASP A 58  ? 0.1150  0.1158 0.3077 -0.0004 -0.0616 0.0242  58   ASP A C   
513  O  O   . ASP A 58  ? 0.1843  0.1338 0.2869 0.0380  -0.0846 0.0137  58   ASP A O   
514  C  CB  . ASP A 58  ? 0.1338  0.0691 0.2583 0.0041  -0.0249 0.0012  58   ASP A CB  
515  C  CG  . ASP A 58  ? 0.1145  0.0569 0.2305 0.0032  -0.0381 0.0383  58   ASP A CG  
516  O  OD1 . ASP A 58  ? 0.1539  0.0589 0.1784 0.0066  -0.0592 0.0008  58   ASP A OD1 
517  O  OD2 . ASP A 58  ? 0.1344  0.0613 0.1990 -0.0042 -0.0331 0.0119  58   ASP A OD2 
518  N  N   . GLY A 59  ? 0.1650  0.1093 0.2840 -0.0146 -0.0542 0.0196  59   GLY A N   
519  C  CA  . GLY A 59  ? 0.1370  0.1507 0.3227 0.0009  -0.1054 0.0069  59   GLY A CA  
520  C  C   . GLY A 59  ? 0.1671  0.0967 0.2986 -0.0086 -0.1048 -0.0069 59   GLY A C   
521  O  O   . GLY A 59  ? 0.1704  0.1767 0.3117 -0.0024 -0.1257 -0.0028 59   GLY A O   
522  N  N   . ASN A 60  ? 0.1659  0.0834 0.2802 -0.0267 -0.1189 0.0490  60   ASN A N   
523  C  CA  . ASN A 60  ? 0.2002  0.1308 0.2628 -0.0657 -0.1259 0.0934  60   ASN A CA  
524  C  C   . ASN A 60  ? 0.1600  0.1593 0.2211 -0.0584 -0.0943 0.0621  60   ASN A C   
525  O  O   . ASN A 60  ? 0.1912  0.2630 0.2204 -0.0807 -0.0790 0.0827  60   ASN A O   
526  C  CB  . ASN A 60  ? 0.1963  0.1471 0.2526 -0.0642 -0.1392 0.0841  60   ASN A CB  
527  C  CG  . ASN A 60  ? 0.1299  0.0785 0.1338 -0.0038 -0.0428 0.0148  60   ASN A CG  
528  O  OD1 . ASN A 60  ? 0.1413  0.0728 0.1652 -0.0110 -0.0553 0.0258  60   ASN A OD1 
529  N  ND2 . ASN A 60  ? 0.1264  0.0938 0.1632 -0.0207 -0.0479 0.0415  60   ASN A ND2 
530  N  N   . GLY A 61  ? 0.1400  0.1140 0.1905 -0.0301 -0.0754 0.0301  61   GLY A N   
531  C  CA  . GLY A 61  ? 0.1274  0.1379 0.1839 -0.0265 -0.0569 0.0116  61   GLY A CA  
532  C  C   . GLY A 61  ? 0.1174  0.1228 0.1359 -0.0266 -0.0315 0.0007  61   GLY A C   
533  O  O   . GLY A 61  ? 0.1345  0.1142 0.1735 -0.0325 -0.0397 -0.0087 61   GLY A O   
534  N  N   . THR A 62  ? 0.1140  0.0960 0.1361 -0.0201 -0.0414 0.0131  62   THR A N   
535  C  CA  . THR A 62  ? 0.1154  0.0862 0.1188 -0.0151 -0.0296 0.0161  62   THR A CA  
536  C  C   . THR A 62  ? 0.1140  0.0612 0.1229 -0.0038 -0.0299 0.0175  62   THR A C   
537  O  O   . THR A 62  ? 0.1234  0.0817 0.1214 0.0071  -0.0299 0.0163  62   THR A O   
538  C  CB  . THR A 62  ? 0.1223  0.0845 0.1091 -0.0281 -0.0324 0.0111  62   THR A CB  
539  O  OG1 . THR A 62  ? 0.1202  0.0768 0.1186 -0.0149 -0.0199 0.0025  62   THR A OG1 
540  C  CG2 . THR A 62  ? 0.1414  0.0951 0.1167 -0.0172 -0.0163 -0.0009 62   THR A CG2 
541  N  N   . ILE A 63  ? 0.1180  0.0709 0.1058 -0.0068 -0.0229 0.0101  63   ILE A N   
542  C  CA  . ILE A 63  ? 0.1053  0.0569 0.1116 -0.0022 -0.0219 0.0095  63   ILE A CA  
543  C  C   . ILE A 63  ? 0.1109  0.0570 0.1073 -0.0042 -0.0166 0.0204  63   ILE A C   
544  O  O   . ILE A 63  ? 0.1096  0.0742 0.1357 -0.0141 -0.0173 0.0102  63   ILE A O   
545  C  CB  . ILE A 63  ? 0.1213  0.0680 0.1158 -0.0106 -0.0156 0.0247  63   ILE A CB  
546  C  CG1 . ILE A 63  ? 0.1362  0.0848 0.1384 -0.0263 -0.0097 0.0173  63   ILE A CG1 
547  C  CG2 . ILE A 63  ? 0.1535  0.0822 0.1135 -0.0174 -0.0224 0.0228  63   ILE A CG2 
548  C  CD1 . ILE A 63  ? 0.2459  0.0926 0.2408 -0.0392 -0.0106 0.0367  63   ILE A CD1 
549  N  N   . ASP A 64  ? 0.1154  0.0673 0.1100 -0.0132 -0.0236 0.0224  64   ASP A N   
550  C  CA  . ASP A 64  ? 0.1284  0.0704 0.0949 -0.0165 -0.0197 0.0182  64   ASP A CA  
551  C  C   . ASP A 64  ? 0.1308  0.0698 0.0978 -0.0200 -0.0260 0.0246  64   ASP A C   
552  O  O   . ASP A 64  ? 0.1241  0.0776 0.0999 -0.0212 -0.0173 0.0280  64   ASP A O   
553  C  CB  . ASP A 64  ? 0.1625  0.0676 0.1030 -0.0301 -0.0287 0.0255  64   ASP A CB  
554  C  CG  . ASP A 64  ? 0.1705  0.0582 0.1163 -0.0153 -0.0440 0.0250  64   ASP A CG  
555  O  OD1 . ASP A 64  ? 0.1917  0.0739 0.1189 -0.0057 -0.0275 0.0212  64   ASP A OD1 
556  O  OD2 . ASP A 64  ? 0.2141  0.0676 0.1493 -0.0073 -0.0330 0.0293  64   ASP A OD2 
557  N  N   . PHE A 65  ? 0.1418  0.0962 0.1004 -0.0464 -0.0323 0.0398  65   PHE A N   
558  C  CA  . PHE A 65  ? 0.1306  0.1089 0.1043 -0.0409 -0.0343 0.0312  65   PHE A CA  
559  C  C   . PHE A 65  ? 0.1456  0.0905 0.1131 -0.0394 -0.0304 0.0344  65   PHE A C   
560  O  O   . PHE A 65  ? 0.1469  0.1098 0.1119 -0.0315 -0.0244 0.0350  65   PHE A O   
561  C  CB  . PHE A 65  ? 0.1466  0.1632 0.1085 -0.0661 -0.0259 0.0473  65   PHE A CB  
562  C  CG  . PHE A 65  ? 0.1300  0.1810 0.0979 -0.0660 -0.0212 0.0287  65   PHE A CG  
563  C  CD1 . PHE A 65  ? 0.1245  0.1747 0.0918 -0.0043 -0.0076 0.0120  65   PHE A CD1 
564  C  CD2 . PHE A 65  ? 0.2515  0.1827 0.1297 -0.1014 -0.0548 0.0292  65   PHE A CD2 
565  C  CE1 . PHE A 65  ? 0.1512  0.2070 0.1042 0.0083  -0.0245 0.0039  65   PHE A CE1 
566  C  CE2 . PHE A 65  ? 0.2924  0.2217 0.1228 -0.0949 -0.0580 0.0097  65   PHE A CE2 
567  C  CZ  . PHE A 65  ? 0.2335  0.2472 0.0977 -0.0250 -0.0476 -0.0016 65   PHE A CZ  
568  N  N   . PRO A 66  ? 0.1925  0.0880 0.1271 -0.0400 -0.0336 0.0177  66   PRO A N   
569  C  CA  . PRO A 66  ? 0.1896  0.0916 0.1605 -0.0074 -0.0453 -0.0033 66   PRO A CA  
570  C  C   . PRO A 66  ? 0.1698  0.0946 0.1103 0.0097  -0.0358 0.0038  66   PRO A C   
571  O  O   . PRO A 66  ? 0.1864  0.1110 0.1195 0.0041  -0.0292 -0.0045 66   PRO A O   
572  C  CB  . PRO A 66  ? 0.2826  0.0807 0.2667 -0.0060 -0.0587 0.0088  66   PRO A CB  
573  C  CG  . PRO A 66  ? 0.3831  0.1200 0.1895 0.0114  -0.0452 0.0466  66   PRO A CG  
574  C  CD  . PRO A 66  ? 0.2474  0.0733 0.1616 -0.0569 -0.0716 0.0467  66   PRO A CD  
575  N  N   . GLU A 67  ? 0.1500  0.0743 0.1119 0.0021  -0.0234 0.0072  67   GLU A N   
576  C  CA  . GLU A 67  ? 0.1453  0.0915 0.1075 0.0079  -0.0205 0.0036  67   GLU A CA  
577  C  C   . GLU A 67  ? 0.1244  0.0882 0.0943 -0.0020 -0.0064 0.0084  67   GLU A C   
578  O  O   . GLU A 67  ? 0.1224  0.1202 0.1078 -0.0049 -0.0058 0.0204  67   GLU A O   
579  C  CB  . GLU A 67  ? 0.1262  0.0772 0.1120 0.0010  -0.0224 0.0008  67   GLU A CB  
580  C  CG  . GLU A 67  ? 0.1484  0.0822 0.1253 0.0214  -0.0281 -0.0049 67   GLU A CG  
581  C  CD  . GLU A 67  ? 0.1426  0.0656 0.1361 0.0156  -0.0393 -0.0052 67   GLU A CD  
582  O  OE1 . GLU A 67  ? 0.1560  0.0667 0.1179 0.0101  -0.0422 0.0002  67   GLU A OE1 
583  O  OE2 . GLU A 67  ? 0.1615  0.0901 0.1554 0.0244  -0.0567 -0.0076 67   GLU A OE2 
584  N  N   A PHE A 68  ? 0.1280  0.0874 0.1138 0.0032  -0.0011 0.0376  68   PHE A N   
585  N  N   B PHE A 68  ? 0.1313  0.0839 0.1299 -0.0003 0.0076  0.0351  68   PHE A N   
586  C  CA  A PHE A 68  ? 0.1251  0.1076 0.1327 0.0070  0.0111  0.0625  68   PHE A CA  
587  C  CA  B PHE A 68  ? 0.1431  0.0995 0.1477 0.0153  0.0200  0.0474  68   PHE A CA  
588  C  C   A PHE A 68  ? 0.1296  0.1281 0.1275 0.0024  0.0117  0.0698  68   PHE A C   
589  C  C   B PHE A 68  ? 0.1256  0.1266 0.1429 0.0059  0.0098  0.0525  68   PHE A C   
590  O  O   A PHE A 68  ? 0.1287  0.1391 0.1412 0.0107  0.0281  0.0816  68   PHE A O   
591  O  O   B PHE A 68  ? 0.1488  0.1270 0.1560 -0.0039 -0.0050 0.0695  68   PHE A O   
592  C  CB  A PHE A 68  ? 0.1227  0.0982 0.1472 0.0045  0.0140  0.0557  68   PHE A CB  
593  C  CB  B PHE A 68  ? 0.1138  0.1084 0.1268 -0.0120 -0.0066 0.0479  68   PHE A CB  
594  C  CG  A PHE A 68  ? 0.1229  0.0923 0.1139 -0.0058 0.0087  0.0479  68   PHE A CG  
595  C  CG  B PHE A 68  ? 0.1145  0.0935 0.0831 -0.0138 -0.0063 0.0268  68   PHE A CG  
596  C  CD1 A PHE A 68  ? 0.1298  0.0963 0.1256 0.0037  0.0048  0.0309  68   PHE A CD1 
597  C  CD1 B PHE A 68  ? 0.1260  0.1305 0.0958 -0.0096 -0.0216 0.0078  68   PHE A CD1 
598  C  CD2 A PHE A 68  ? 0.1315  0.0950 0.1055 -0.0070 0.0066  0.0389  68   PHE A CD2 
599  C  CD2 B PHE A 68  ? 0.1669  0.0969 0.1573 0.0012  -0.0629 -0.0079 68   PHE A CD2 
600  C  CE1 A PHE A 68  ? 0.1726  0.0938 0.1721 0.0068  -0.0181 0.0334  68   PHE A CE1 
601  C  CE1 B PHE A 68  ? 0.1113  0.1677 0.1214 -0.0010 -0.0241 0.0289  68   PHE A CE1 
602  C  CE2 A PHE A 68  ? 0.1437  0.1247 0.1150 0.0162  -0.0019 0.0351  68   PHE A CE2 
603  C  CE2 B PHE A 68  ? 0.1615  0.0953 0.2033 -0.0003 -0.0286 0.0192  68   PHE A CE2 
604  C  CZ  A PHE A 68  ? 0.1247  0.1066 0.1547 0.0261  0.0175  0.0454  68   PHE A CZ  
605  C  CZ  B PHE A 68  ? 0.1438  0.1394 0.1523 0.0394  -0.0114 0.0164  68   PHE A CZ  
606  N  N   . LEU A 69  ? 0.1335  0.1445 0.1403 -0.0161 -0.0124 0.0735  69   LEU A N   
607  C  CA  . LEU A 69  ? 0.1891  0.1945 0.1460 -0.0574 -0.0568 0.0853  69   LEU A CA  
608  C  C   . LEU A 69  ? 0.2229  0.1672 0.1060 -0.0173 -0.0470 0.0215  69   LEU A C   
609  O  O   . LEU A 69  ? 0.2183  0.2655 0.1118 -0.0465 -0.0403 0.0539  69   LEU A O   
610  C  CB  . LEU A 69  ? 0.2993  0.2064 0.2250 -0.1048 -0.1315 0.0944  69   LEU A CB  
611  C  CG  . LEU A 69  ? 0.3003  0.1918 0.2291 -0.0988 -0.0821 0.0368  69   LEU A CG  
612  C  CD1 . LEU A 69  ? 0.2971  0.2017 0.3828 -0.0879 -0.1184 -0.0278 69   LEU A CD1 
613  C  CD2 . LEU A 69  ? 0.2966  0.2714 0.2267 -0.0484 -0.1066 0.0074  69   LEU A CD2 
614  N  N   A SER A 70  ? 0.2100  0.1806 0.0899 -0.0197 -0.0256 0.0117  70   SER A N   
615  N  N   B SER A 70  ? 0.2138  0.2054 0.0985 -0.0073 -0.0431 -0.0004 70   SER A N   
616  C  CA  A SER A 70  ? 0.2410  0.2216 0.0887 0.0251  -0.0089 -0.0241 70   SER A CA  
617  C  CA  B SER A 70  ? 0.2343  0.2511 0.1181 0.0307  -0.0142 -0.0100 70   SER A CA  
618  C  C   A SER A 70  ? 0.1871  0.2580 0.0967 0.0103  0.0238  0.0178  70   SER A C   
619  C  C   B SER A 70  ? 0.1711  0.2858 0.1166 0.0163  -0.0239 0.0363  70   SER A C   
620  O  O   A SER A 70  ? 0.2621  0.3893 0.1111 0.0369  0.0381  0.0665  70   SER A O   
621  O  O   B SER A 70  ? 0.1921  0.3061 0.0835 0.0579  -0.0425 0.0359  70   SER A O   
622  C  CB  A SER A 70  ? 0.2508  0.2030 0.1210 0.0465  -0.0090 -0.0423 70   SER A CB  
623  C  CB  B SER A 70  ? 0.2289  0.1636 0.1579 0.0343  -0.0355 -0.0504 70   SER A CB  
624  O  OG  A SER A 70  ? 0.2523  0.3235 0.2057 0.0671  0.0151  -0.0329 70   SER A OG  
625  O  OG  B SER A 70  ? 0.2280  0.1397 0.2517 -0.0646 0.0226  0.0098  70   SER A OG  
626  N  N   A LEU A 71  ? 0.1369  0.2036 0.1213 0.0053  0.0054  0.0410  71   LEU A N   
627  N  N   B LEU A 71  ? 0.1338  0.2276 0.1214 -0.0248 0.0204  0.0610  71   LEU A N   
628  C  CA  A LEU A 71  ? 0.1254  0.2422 0.1126 -0.0394 -0.0053 0.0787  71   LEU A CA  
629  C  CA  B LEU A 71  ? 0.1722  0.2355 0.2063 -0.0458 -0.0025 0.1068  71   LEU A CA  
630  C  C   A LEU A 71  ? 0.1342  0.2264 0.1299 -0.0500 -0.0162 0.0837  71   LEU A C   
631  C  C   B LEU A 71  ? 0.1741  0.2682 0.1725 -0.0180 0.0353  0.1141  71   LEU A C   
632  O  O   A LEU A 71  ? 0.1532  0.2323 0.2084 -0.0949 -0.0378 0.1223  71   LEU A O   
633  O  O   B LEU A 71  ? 0.2380  0.2603 0.1783 -0.0929 0.0442  0.0956  71   LEU A O   
634  C  CB  A LEU A 71  ? 0.1640  0.2302 0.1300 -0.0925 -0.0295 0.0838  71   LEU A CB  
635  C  CB  B LEU A 71  ? 0.2409  0.1677 0.2083 -0.0698 -0.0529 0.0940  71   LEU A CB  
636  C  CG  A LEU A 71  ? 0.3262  0.2610 0.3323 0.0050  0.0848  0.0200  71   LEU A CG  
637  C  CG  B LEU A 71  ? 0.3692  0.2100 0.2362 0.0281  -0.0846 0.1227  71   LEU A CG  
638  C  CD1 A LEU A 71  ? 0.4563  0.2006 0.5681 -0.0673 0.1340  0.0271  71   LEU A CD1 
639  C  CD1 B LEU A 71  ? 0.4177  0.2533 0.4062 -0.0693 0.0070  -0.0738 71   LEU A CD1 
640  C  CD2 A LEU A 71  ? 0.2953  0.4770 0.1287 0.0264  -0.0107 -0.0118 71   LEU A CD2 
641  C  CD2 B LEU A 71  ? 0.3668  0.2934 0.4536 0.0801  -0.0743 0.1436  71   LEU A CD2 
642  N  N   A MET A 72  ? 0.1306  0.2273 0.1395 -0.0435 -0.0083 0.0908  72   MET A N   
643  N  N   B MET A 72  ? 0.1671  0.2305 0.1366 0.0111  0.0346  0.0994  72   MET A N   
644  C  CA  A MET A 72  ? 0.1462  0.2245 0.1828 -0.0497 -0.0234 0.1080  72   MET A CA  
645  C  CA  B MET A 72  ? 0.2047  0.1562 0.1647 -0.0028 0.0019  0.1049  72   MET A CA  
646  C  C   A MET A 72  ? 0.2045  0.2702 0.1652 -0.0661 -0.0504 0.1178  72   MET A C   
647  C  C   B MET A 72  ? 0.2416  0.2644 0.1508 0.0147  -0.0015 0.1135  72   MET A C   
648  O  O   A MET A 72  ? 0.2867  0.2841 0.1782 -0.0571 -0.0603 0.1413  72   MET A O   
649  O  O   B MET A 72  ? 0.1703  0.3067 0.1680 -0.0266 -0.0180 0.1454  72   MET A O   
650  C  CB  A MET A 72  ? 0.1477  0.2081 0.2599 -0.0274 -0.0161 0.1526  72   MET A CB  
651  C  CB  B MET A 72  ? 0.1862  0.2592 0.2640 -0.0172 -0.0054 0.1358  72   MET A CB  
652  C  CG  A MET A 72  ? 0.2128  0.2274 0.2740 0.0345  0.0392  0.1694  72   MET A CG  
653  C  CG  B MET A 72  ? 0.2096  0.2458 0.3036 -0.0260 0.0304  0.1309  72   MET A CG  
654  S  SD  A MET A 72  ? 0.3707  0.2244 0.3085 0.0563  0.0677  0.1424  72   MET A SD  
655  S  SD  B MET A 72  ? 0.3883  0.2338 0.2933 -0.0589 -0.0635 0.0624  72   MET A SD  
656  C  CE  A MET A 72  ? 0.5244  0.4514 0.3820 0.2553  0.0217  0.2557  72   MET A CE  
657  C  CE  B MET A 72  ? 0.5255  0.4085 0.2120 0.1939  0.1666  0.1337  72   MET A CE  
658  N  N   A ALA A 73  ? 0.1465  0.2636 0.1591 -0.0136 -0.0171 0.1050  73   ALA A N   
659  N  N   B ALA A 73  ? 0.1948  0.2989 0.1215 0.0337  0.0144  0.0886  73   ALA A N   
660  C  CA  A ALA A 73  ? 0.1627  0.3417 0.1673 -0.0272 -0.0245 0.0736  73   ALA A CA  
661  C  CA  B ALA A 73  ? 0.1863  0.3428 0.0998 -0.0103 -0.0132 0.0806  73   ALA A CA  
662  C  C   A ALA A 73  ? 0.1767  0.3639 0.1273 -0.0336 -0.0312 0.0947  73   ALA A C   
663  C  C   B ALA A 73  ? 0.1786  0.3487 0.1000 -0.0030 -0.0029 0.0706  73   ALA A C   
664  O  O   A ALA A 73  ? 0.2003  0.4506 0.1507 -0.0079 -0.0371 0.1410  73   ALA A O   
665  O  O   B ALA A 73  ? 0.2032  0.3099 0.1083 -0.0430 -0.0306 0.0738  73   ALA A O   
666  C  CB  A ALA A 73  ? 0.1402  0.3456 0.1997 -0.0414 -0.0449 0.0379  73   ALA A CB  
667  C  CB  B ALA A 73  ? 0.3603  0.3309 0.1403 -0.0252 0.0643  0.0270  73   ALA A CB  
668  N  N   A ARG A 74  ? 0.1508  0.3502 0.1326 0.0013  -0.0140 0.0997  74   ARG A N   
669  N  N   B ARG A 74  ? 0.1629  0.2979 0.1221 0.0227  -0.0147 0.0830  74   ARG A N   
670  C  CA  A ARG A 74  ? 0.1473  0.3394 0.1438 0.0167  -0.0052 0.0919  74   ARG A CA  
671  C  CA  B ARG A 74  ? 0.1521  0.3387 0.1606 0.0191  0.0079  0.0948  74   ARG A CA  
672  C  C   A ARG A 74  ? 0.2091  0.3422 0.1674 0.0372  0.0512  0.1397  74   ARG A C   
673  C  C   B ARG A 74  ? 0.1852  0.3451 0.1786 0.0195  0.0352  0.1347  74   ARG A C   
674  O  O   A ARG A 74  ? 0.2527  0.4192 0.2120 0.0703  0.1023  0.1785  74   ARG A O   
675  O  O   B ARG A 74  ? 0.2278  0.4621 0.2430 0.0570  0.0825  0.2123  74   ARG A O   
676  C  CB  A ARG A 74  ? 0.1448  0.3633 0.1582 0.0309  0.0098  0.1142  74   ARG A CB  
677  C  CB  B ARG A 74  ? 0.1557  0.3283 0.2049 0.0108  -0.0226 0.0911  74   ARG A CB  
678  C  CG  A ARG A 74  ? 0.2076  0.3579 0.2606 0.0198  -0.0336 0.1517  74   ARG A CG  
679  C  CG  B ARG A 74  ? 0.2036  0.3578 0.2146 0.0417  -0.1001 -0.0202 74   ARG A CG  
680  C  CD  A ARG A 74  ? 0.1585  0.3699 0.3028 0.0340  -0.0445 0.1142  74   ARG A CD  
681  C  CD  B ARG A 74  ? 0.2669  0.3903 0.3427 0.1148  0.0189  0.0347  74   ARG A CD  
682  N  NE  A ARG A 74  ? 0.1526  0.3449 0.2935 0.0389  0.0151  0.1308  74   ARG A NE  
683  N  NE  B ARG A 74  ? 0.1859  0.4084 0.4230 0.0464  0.0436  0.1755  74   ARG A NE  
684  C  CZ  A ARG A 74  ? 0.1428  0.4225 0.3482 0.0217  -0.0784 0.1361  74   ARG A CZ  
685  C  CZ  B ARG A 74  ? 0.3281  0.5328 0.4696 0.0576  -0.0639 0.0568  74   ARG A CZ  
686  N  NH1 A ARG A 74  ? 0.3992  0.6029 0.2196 -0.3214 -0.0682 0.1214  74   ARG A NH1 
687  N  NH1 B ARG A 74  ? 0.6834  0.5729 0.1766 -0.1107 -0.1467 -0.0029 74   ARG A NH1 
688  N  NH2 A ARG A 74  ? 0.1755  0.4204 0.4129 -0.0070 -0.0758 0.2097  74   ARG A NH2 
689  N  NH2 B ARG A 74  ? 0.6373  0.7275 0.4920 0.0817  -0.2713 0.0640  74   ARG A NH2 
690  N  N   . LYS A 75  ? 0.2555  0.3263 0.1716 0.0484  0.0484  0.1422  75   LYS A N   
691  C  CA  . LYS A 75  ? 0.2984  0.3276 0.2111 0.0415  0.0554  0.1413  75   LYS A CA  
692  C  C   . LYS A 75  ? 0.2285  0.3139 0.2471 0.0634  0.0694  0.1735  75   LYS A C   
693  O  O   . LYS A 75  ? 0.2628  0.3243 0.2672 0.0563  0.0831  0.1939  75   LYS A O   
694  C  CB  . LYS A 75  ? 0.3419  0.2961 0.2737 -0.0611 0.1080  0.0689  75   LYS A CB  
695  C  CG  . LYS A 75  ? 0.6082  0.4501 0.2601 0.0104  -0.0264 0.0865  75   LYS A CG  
696  C  CD  . LYS A 75  ? 0.8026  0.4719 0.3266 0.1413  -0.0927 -0.0019 75   LYS A CD  
697  C  CE  . LYS A 75  ? 0.8855  0.6371 0.4382 0.1291  -0.1848 -0.0913 75   LYS A CE  
698  N  NZ  . LYS A 75  ? 1.0628  0.6522 0.5724 -0.1121 0.0260  -0.3055 75   LYS A NZ  
699  N  N   A MET A 76  ? 0.2672  0.3398 0.2360 0.0357  0.0450  0.1897  76   MET A N   
700  N  N   B MET A 76  ? 0.2600  0.3333 0.2221 0.0426  0.0529  0.1875  76   MET A N   
701  C  CA  A MET A 76  ? 0.2896  0.3127 0.2470 0.0093  0.0401  0.2084  76   MET A CA  
702  C  CA  B MET A 76  ? 0.3278  0.3211 0.2233 0.0206  0.0312  0.1986  76   MET A CA  
703  C  C   A MET A 76  ? 0.3711  0.2780 0.2310 0.0138  0.0486  0.2001  76   MET A C   
704  C  C   B MET A 76  ? 0.3880  0.2848 0.2156 0.0352  0.0502  0.1606  76   MET A C   
705  O  O   A MET A 76  ? 0.4752  0.3568 0.2162 0.0557  -0.0282 0.1446  76   MET A O   
706  O  O   B MET A 76  ? 0.2480  0.1927 0.1467 -0.0490 -0.0003 0.0846  76   MET A O   
707  C  CB  A MET A 76  ? 0.3072  0.2568 0.2663 0.0011  0.0150  0.1854  76   MET A CB  
708  C  CB  B MET A 76  ? 0.3507  0.3016 0.2422 0.0276  0.0052  0.1861  76   MET A CB  
709  C  CG  A MET A 76  ? 0.2557  0.4113 0.2985 -0.0495 0.0319  0.1563  76   MET A CG  
710  C  CG  B MET A 76  ? 0.3580  0.4020 0.2420 -0.0215 0.0399  0.2216  76   MET A CG  
711  S  SD  A MET A 76  ? 0.3068  0.4389 0.2867 -0.1066 0.0143  0.1267  76   MET A SD  
712  S  SD  B MET A 76  ? 0.4551  0.4482 0.5035 -0.1171 0.1578  0.1153  76   MET A SD  
713  C  CE  A MET A 76  ? 0.6020  0.2272 0.5709 0.0473  0.0544  0.1340  76   MET A CE  
714  C  CE  B MET A 76  ? 0.2949  0.4416 0.2875 -0.1471 -0.0019 0.2751  76   MET A CE  
715  N  N   . LYS A 77  ? 0.3846  0.2473 0.2196 0.0104  0.0401  0.1469  77   LYS A N   
716  C  CA  . LYS A 77  ? 0.4985  0.2177 0.2525 0.0264  0.0906  0.0943  77   LYS A CA  
717  C  C   . LYS A 77  ? 0.3571  0.2311 0.2100 0.0716  0.0762  0.1137  77   LYS A C   
718  O  O   . LYS A 77  ? 0.4364  0.2240 0.1890 0.0506  0.1002  0.0758  77   LYS A O   
719  C  CB  . LYS A 77  ? 0.7437  0.2200 0.2652 0.1034  0.1437  0.0957  77   LYS A CB  
720  C  CG  . LYS A 77  ? 0.9962  0.2251 0.4568 0.0065  0.2761  0.0445  77   LYS A CG  
721  C  CD  . LYS A 77  ? 0.9575  0.2120 0.7434 -0.0287 0.1121  -0.0160 77   LYS A CD  
722  C  CE  . LYS A 77  ? 1.0166  0.2339 0.7415 0.0109  0.0363  0.0926  77   LYS A CE  
723  N  NZ  . LYS A 77  ? 1.0508  0.3418 0.8782 0.1563  -0.0006 0.0646  77   LYS A NZ  
724  N  N   A GLU A 78  ? 0.2793  0.2897 0.2006 0.0654  0.0972  0.1196  78   GLU A N   
725  N  N   B GLU A 78  ? 0.2409  0.2730 0.1985 0.0975  0.0724  0.1303  78   GLU A N   
726  C  CA  A GLU A 78  ? 0.2482  0.3068 0.2022 0.0598  0.0914  0.1137  78   GLU A CA  
727  C  CA  B GLU A 78  ? 0.2380  0.3418 0.1947 0.0497  0.0239  0.1522  78   GLU A CA  
728  C  C   A GLU A 78  ? 0.2415  0.2918 0.1955 0.0270  0.0735  0.1189  78   GLU A C   
729  C  C   B GLU A 78  ? 0.1963  0.2715 0.1697 -0.0119 0.0007  0.1077  78   GLU A C   
730  O  O   A GLU A 78  ? 0.2470  0.2702 0.1579 -0.0377 0.0343  0.0835  78   GLU A O   
731  O  O   B GLU A 78  ? 0.2534  0.3854 0.2442 0.0100  0.0489  0.2275  78   GLU A O   
732  C  CB  A GLU A 78  ? 0.3661  0.3504 0.2082 0.0291  0.0392  0.1337  78   GLU A CB  
733  C  CB  B GLU A 78  ? 0.3138  0.3395 0.1828 0.0899  0.0043  0.1294  78   GLU A CB  
734  C  CG  A GLU A 78  ? 0.3639  0.4537 0.2900 -0.0073 0.0056  0.0618  78   GLU A CG  
735  C  CG  B GLU A 78  ? 0.3620  0.4034 0.2643 0.0259  0.0431  0.0528  78   GLU A CG  
736  C  CD  A GLU A 78  ? 0.3636  0.5163 0.3053 -0.0002 -0.0661 0.0565  78   GLU A CD  
737  C  CD  B GLU A 78  ? 0.5215  0.4426 0.3360 0.1250  -0.1321 0.0271  78   GLU A CD  
738  O  OE1 A GLU A 78  ? 0.7659  0.4987 0.2535 -0.1179 -0.0261 -0.0440 78   GLU A OE1 
739  O  OE1 B GLU A 78  ? 0.6041  0.5046 0.3487 0.0785  -0.0053 0.1406  78   GLU A OE1 
740  O  OE2 A GLU A 78  ? 0.2622  0.7129 0.6511 0.0255  -0.1541 0.1769  78   GLU A OE2 
741  O  OE2 B GLU A 78  ? 0.9877  0.5596 0.4380 0.3217  -0.2996 -0.1093 78   GLU A OE2 
742  N  N   . GLN A 79  ? 0.2179  0.2918 0.1926 0.0177  0.0429  0.1344  79   GLN A N   
743  C  CA  . GLN A 79  ? 0.2189  0.2773 0.2131 0.0117  0.0417  0.1145  79   GLN A CA  
744  C  C   . GLN A 79  ? 0.2317  0.2466 0.2108 0.0195  0.0441  0.1205  79   GLN A C   
745  O  O   . GLN A 79  ? 0.2288  0.2549 0.2285 -0.0031 0.0523  0.1358  79   GLN A O   
746  C  CB  . GLN A 79  ? 0.3485  0.3532 0.2773 0.1068  0.1516  0.1487  79   GLN A CB  
747  C  CG  . GLN A 79  ? 0.6660  0.5905 0.2358 0.0111  0.1832  0.1396  79   GLN A CG  
748  C  CD  . GLN A 79  ? 0.6828  0.7354 0.3441 0.0484  0.1643  -0.0823 79   GLN A CD  
749  O  OE1 . GLN A 79  ? 0.8974  0.8925 0.5448 0.5108  -0.1684 -0.2698 79   GLN A OE1 
750  N  NE2 . GLN A 79  ? 0.6736  1.1273 0.7289 -0.1052 0.2585  -0.0746 79   GLN A NE2 
751  N  N   A ASP A 80  ? 0.2376  0.2448 0.2160 0.0165  0.0241  0.1266  80   ASP A N   
752  N  N   B ASP A 80  ? 0.2349  0.2475 0.2177 -0.0050 0.0362  0.1227  80   ASP A N   
753  C  CA  A ASP A 80  ? 0.2569  0.2548 0.2203 -0.0402 0.0124  0.1352  80   ASP A CA  
754  C  CA  B ASP A 80  ? 0.2504  0.2592 0.2366 -0.0281 -0.0020 0.1229  80   ASP A CA  
755  C  C   A ASP A 80  ? 0.2655  0.2354 0.2146 -0.0366 0.0207  0.1234  80   ASP A C   
756  C  C   B ASP A 80  ? 0.2902  0.2339 0.1793 -0.0516 0.0108  0.0725  80   ASP A C   
757  O  O   A ASP A 80  ? 0.2600  0.3097 0.1741 -0.0497 -0.0029 0.1496  80   ASP A O   
758  O  O   B ASP A 80  ? 0.3604  0.2598 0.1755 -0.1160 -0.0230 0.0758  80   ASP A O   
759  C  CB  A ASP A 80  ? 0.2687  0.2971 0.2937 -0.0866 -0.0013 0.0894  80   ASP A CB  
760  C  CB  B ASP A 80  ? 0.3294  0.3027 0.2803 -0.0940 0.0397  0.0863  80   ASP A CB  
761  C  CG  A ASP A 80  ? 0.3328  0.3370 0.3599 -0.1293 0.0275  0.1170  80   ASP A CG  
762  C  CG  B ASP A 80  ? 0.3183  0.3305 0.3788 -0.1013 0.0168  0.1006  80   ASP A CG  
763  O  OD1 A ASP A 80  ? 0.4381  0.4338 0.4186 -0.1007 0.1858  0.1178  80   ASP A OD1 
764  O  OD1 B ASP A 80  ? 0.3910  0.4307 0.3814 0.0015  0.0648  0.1077  80   ASP A OD1 
765  O  OD2 A ASP A 80  ? 0.3240  0.3660 0.5336 -0.1658 -0.0953 0.2055  80   ASP A OD2 
766  O  OD2 B ASP A 80  ? 0.3670  0.4041 0.6339 -0.1775 -0.0124 0.1974  80   ASP A OD2 
767  N  N   A SER A 81  ? 0.2725  0.2279 0.2245 -0.0101 0.0445  0.1158  81   SER A N   
768  N  N   B SER A 81  ? 0.2732  0.2323 0.2078 -0.0089 0.0436  0.0573  81   SER A N   
769  C  CA  A SER A 81  ? 0.2894  0.3098 0.2001 0.0137  0.0915  0.0945  81   SER A CA  
770  C  CA  B SER A 81  ? 0.3003  0.2823 0.1952 0.0394  0.0856  0.0847  81   SER A CA  
771  C  C   A SER A 81  ? 0.2163  0.3212 0.1816 -0.0423 0.0468  0.1138  81   SER A C   
772  C  C   B SER A 81  ? 0.2237  0.3147 0.1570 -0.0336 0.0137  0.0890  81   SER A C   
773  O  O   A SER A 81  ? 0.1380  0.3584 0.2193 0.0328  0.0707  0.1612  81   SER A O   
774  O  O   B SER A 81  ? 0.4883  0.3829 0.1418 -0.1190 0.0449  0.0965  81   SER A O   
775  C  CB  A SER A 81  ? 0.2757  0.3569 0.2306 0.0681  0.1201  0.0870  81   SER A CB  
776  C  CB  B SER A 81  ? 0.3020  0.3704 0.1861 0.0641  0.0548  0.0603  81   SER A CB  
777  O  OG  A SER A 81  ? 0.4470  0.3031 0.3519 0.0328  0.1186  0.1786  81   SER A OG  
778  O  OG  B SER A 81  ? 0.2898  0.5070 0.3599 0.0778  0.1463  0.1521  81   SER A OG  
779  N  N   A GLU A 82  ? 0.1885  0.2823 0.1902 -0.0242 0.0365  0.1267  82   GLU A N   
780  N  N   B GLU A 82  ? 0.2093  0.2630 0.1770 -0.0220 0.0222  0.1011  82   GLU A N   
781  C  CA  A GLU A 82  ? 0.2052  0.2867 0.2089 -0.0343 0.0034  0.1278  82   GLU A CA  
782  C  CA  B GLU A 82  ? 0.1780  0.2639 0.1999 -0.0344 0.0310  0.1131  82   GLU A CA  
783  C  C   A GLU A 82  ? 0.2061  0.2449 0.1413 -0.0495 -0.0001 0.0846  82   GLU A C   
784  C  C   B GLU A 82  ? 0.1985  0.2456 0.1787 -0.0451 0.0073  0.0915  82   GLU A C   
785  O  O   A GLU A 82  ? 0.2198  0.3267 0.1436 -0.0985 -0.0286 0.1416  82   GLU A O   
786  O  O   B GLU A 82  ? 0.1952  0.2006 0.3295 -0.0353 -0.0148 0.1234  82   GLU A O   
787  C  CB  A GLU A 82  ? 0.2656  0.3036 0.1942 -0.0436 -0.0702 0.1261  82   GLU A CB  
788  C  CB  B GLU A 82  ? 0.2811  0.2938 0.1829 -0.1225 -0.0319 0.0788  82   GLU A CB  
789  C  CG  A GLU A 82  ? 0.4915  0.3075 0.2618 -0.0327 -0.0745 0.0927  82   GLU A CG  
790  C  CG  B GLU A 82  ? 0.3022  0.4170 0.2066 -0.0259 -0.0002 0.0978  82   GLU A CG  
791  C  CD  A GLU A 82  ? 0.5849  0.3410 0.2021 -0.1405 -0.0078 0.1054  82   GLU A CD  
792  C  CD  B GLU A 82  ? 0.4661  0.5951 0.2084 0.0337  0.0372  0.2087  82   GLU A CD  
793  O  OE1 A GLU A 82  ? 0.9073  0.6186 0.1831 -0.2168 0.0551  0.1354  82   GLU A OE1 
794  O  OE1 B GLU A 82  ? 0.4966  0.7677 0.2211 0.0939  0.1029  0.1390  82   GLU A OE1 
795  O  OE2 A GLU A 82  ? 0.8092  0.4241 0.3123 -0.3386 -0.0601 0.2146  82   GLU A OE2 
796  O  OE2 B GLU A 82  ? 0.5706  0.8682 0.2000 0.2046  -0.0037 0.2183  82   GLU A OE2 
797  N  N   . GLU A 83  ? 0.2112  0.2400 0.1841 -0.0526 -0.0030 0.1127  83   GLU A N   
798  C  CA  . GLU A 83  ? 0.2066  0.2699 0.1956 -0.0517 -0.0116 0.1172  83   GLU A CA  
799  C  C   . GLU A 83  ? 0.2066  0.2850 0.1925 -0.0858 -0.0320 0.1224  83   GLU A C   
800  O  O   . GLU A 83  ? 0.1989  0.3138 0.2168 -0.0987 -0.0582 0.1566  83   GLU A O   
801  C  CB  . GLU A 83  ? 0.2007  0.3831 0.2636 -0.0666 -0.0040 0.1685  83   GLU A CB  
802  C  CG  . GLU A 83  ? 0.2105  0.3417 0.2673 -0.0515 -0.0159 0.1263  83   GLU A CG  
803  C  CD  . GLU A 83  ? 0.2742  0.3612 0.2397 -0.0433 -0.0016 0.0993  83   GLU A CD  
804  O  OE1 . GLU A 83  ? 0.5469  0.4831 0.2492 0.0487  -0.0367 0.0572  83   GLU A OE1 
805  O  OE2 . GLU A 83  ? 0.3591  0.3279 0.2544 -0.0119 0.0070  0.0949  83   GLU A OE2 
806  N  N   . GLU A 84  ? 0.1895  0.2983 0.1834 -0.0976 -0.0201 0.0913  84   GLU A N   
807  C  CA  . GLU A 84  ? 0.3203  0.3444 0.1691 -0.1892 -0.0134 0.0449  84   GLU A CA  
808  C  C   . GLU A 84  ? 0.2382  0.3203 0.1564 -0.1330 -0.0219 0.0705  84   GLU A C   
809  O  O   . GLU A 84  ? 0.2147  0.3311 0.1540 -0.1069 -0.0190 0.0732  84   GLU A O   
810  C  CB  . GLU A 84  ? 0.4409  0.3579 0.2595 -0.2230 0.0704  -0.0530 84   GLU A CB  
811  C  CG  . GLU A 84  ? 0.7790  0.5464 0.3398 -0.1628 0.2311  -0.0577 84   GLU A CG  
812  C  CD  . GLU A 84  ? 1.0902  0.6743 0.5339 -0.0891 0.3107  -0.2320 84   GLU A CD  
813  O  OE1 . GLU A 84  ? 1.5567  0.4550 0.7384 -0.1257 0.1738  -0.2549 84   GLU A OE1 
814  O  OE2 . GLU A 84  ? 1.3858  0.9456 0.5824 -0.0349 0.2500  -0.3710 84   GLU A OE2 
815  N  N   A LEU A 85  ? 0.2007  0.2507 0.1597 -0.0717 -0.0174 0.0704  85   LEU A N   
816  N  N   B LEU A 85  ? 0.1889  0.2687 0.1362 -0.0804 0.0086  0.0723  85   LEU A N   
817  C  CA  A LEU A 85  ? 0.1708  0.2286 0.1439 -0.0460 -0.0223 0.0461  85   LEU A CA  
818  C  CA  B LEU A 85  ? 0.1426  0.2519 0.1328 -0.0466 -0.0016 0.0692  85   LEU A CA  
819  C  C   A LEU A 85  ? 0.1384  0.2399 0.1806 -0.0360 0.0116  0.0818  85   LEU A C   
820  C  C   B LEU A 85  ? 0.1122  0.2577 0.1295 -0.0484 -0.0179 0.0692  85   LEU A C   
821  O  O   A LEU A 85  ? 0.1301  0.2534 0.1245 -0.0383 -0.0173 0.1048  85   LEU A O   
822  O  O   B LEU A 85  ? 0.1273  0.2333 0.1238 -0.0754 -0.0073 0.0524  85   LEU A O   
823  C  CB  A LEU A 85  ? 0.1535  0.2375 0.1420 -0.0097 0.0008  0.0353  85   LEU A CB  
824  C  CB  B LEU A 85  ? 0.1539  0.2303 0.1298 -0.0295 0.0054  0.0789  85   LEU A CB  
825  C  CG  A LEU A 85  ? 0.1423  0.2152 0.2487 -0.0319 0.0408  0.0598  85   LEU A CG  
826  C  CG  B LEU A 85  ? 0.1888  0.2305 0.1978 -0.0161 0.0022  0.0822  85   LEU A CG  
827  C  CD1 A LEU A 85  ? 0.2172  0.2727 0.3660 -0.0017 -0.0184 0.1745  85   LEU A CD1 
828  C  CD1 B LEU A 85  ? 0.2277  0.1897 0.2354 -0.0411 -0.0200 0.1296  85   LEU A CD1 
829  C  CD2 A LEU A 85  ? 0.2119  0.3857 0.3107 0.0607  0.1207  0.0594  85   LEU A CD2 
830  C  CD2 B LEU A 85  ? 0.1765  0.4043 0.1925 0.0238  0.0104  0.0202  85   LEU A CD2 
831  N  N   . ILE A 86  ? 0.1312  0.2435 0.1239 -0.0417 -0.0093 0.0906  86   ILE A N   
832  C  CA  . ILE A 86  ? 0.1233  0.2546 0.1336 -0.0289 -0.0150 0.0880  86   ILE A CA  
833  C  C   . ILE A 86  ? 0.1094  0.2773 0.1409 -0.0515 -0.0208 0.1041  86   ILE A C   
834  O  O   . ILE A 86  ? 0.1140  0.2906 0.1662 -0.0595 -0.0240 0.1300  86   ILE A O   
835  C  CB  . ILE A 86  ? 0.1357  0.2987 0.1413 -0.0232 -0.0131 0.0703  86   ILE A CB  
836  C  CG1 . ILE A 86  ? 0.1825  0.2949 0.1336 -0.0198 -0.0128 0.0849  86   ILE A CG1 
837  C  CG2 . ILE A 86  ? 0.1837  0.3950 0.1964 0.0609  0.0195  0.1157  86   ILE A CG2 
838  C  CD1 . ILE A 86  ? 0.2271  0.4141 0.1596 0.0219  0.0280  0.1196  86   ILE A CD1 
839  N  N   A GLU A 87  ? 0.1496  0.2904 0.1434 -0.0645 -0.0261 0.1059  87   GLU A N   
840  N  N   B GLU A 87  ? 0.1240  0.3063 0.1425 -0.0794 -0.0241 0.1171  87   GLU A N   
841  C  CA  A GLU A 87  ? 0.1191  0.3410 0.1545 -0.0954 -0.0377 0.1121  87   GLU A CA  
842  C  CA  B GLU A 87  ? 0.1295  0.3503 0.1436 -0.1072 -0.0285 0.1162  87   GLU A CA  
843  C  C   A GLU A 87  ? 0.1305  0.3228 0.1406 -0.1153 -0.0386 0.0912  87   GLU A C   
844  C  C   B GLU A 87  ? 0.1329  0.3600 0.1402 -0.1065 -0.0334 0.1158  87   GLU A C   
845  O  O   A GLU A 87  ? 0.1356  0.3575 0.1160 -0.1162 -0.0556 0.1091  87   GLU A O   
846  O  O   B GLU A 87  ? 0.1195  0.4357 0.1033 -0.1221 -0.0538 0.1223  87   GLU A O   
847  C  CB  A GLU A 87  ? 0.1304  0.2626 0.1790 -0.0719 -0.0284 0.1136  87   GLU A CB  
848  C  CB  B GLU A 87  ? 0.1403  0.3238 0.1406 -0.0861 -0.0424 0.1275  87   GLU A CB  
849  C  CG  A GLU A 87  ? 0.1134  0.2448 0.1962 -0.0581 -0.0215 0.0692  87   GLU A CG  
850  C  CG  B GLU A 87  ? 0.1595  0.2673 0.1639 -0.0972 -0.0132 0.0856  87   GLU A CG  
851  C  CD  A GLU A 87  ? 0.1425  0.2506 0.2673 -0.0745 0.0122  0.0595  87   GLU A CD  
852  C  CD  B GLU A 87  ? 0.1502  0.3174 0.2744 -0.0790 -0.0277 0.0885  87   GLU A CD  
853  O  OE1 A GLU A 87  ? 0.1387  0.2698 0.3689 -0.0643 0.0460  0.0697  87   GLU A OE1 
854  O  OE1 B GLU A 87  ? 0.1428  0.3529 0.2347 -0.0056 -0.0375 0.0438  87   GLU A OE1 
855  O  OE2 A GLU A 87  ? 0.3318  0.4215 0.4014 -0.2508 0.1535  -0.1385 87   GLU A OE2 
856  O  OE2 B GLU A 87  ? 0.2109  0.3510 0.4790 -0.0656 -0.1450 0.0524  87   GLU A OE2 
857  N  N   . ALA A 88  ? 0.1331  0.3482 0.1513 -0.1077 -0.0273 0.0959  88   ALA A N   
858  C  CA  . ALA A 88  ? 0.1570  0.3570 0.1232 -0.1122 -0.0176 0.0644  88   ALA A CA  
859  C  C   . ALA A 88  ? 0.1246  0.3455 0.1209 -0.1011 -0.0228 0.0859  88   ALA A C   
860  O  O   . ALA A 88  ? 0.1458  0.3811 0.1341 -0.0992 -0.0224 0.1094  88   ALA A O   
861  C  CB  . ALA A 88  ? 0.1839  0.3552 0.1383 -0.0984 -0.0174 0.0418  88   ALA A CB  
862  N  N   . PHE A 89  ? 0.1298  0.2740 0.1303 -0.0799 -0.0293 0.0941  89   PHE A N   
863  C  CA  . PHE A 89  ? 0.1085  0.2553 0.1215 -0.0389 -0.0259 0.0838  89   PHE A CA  
864  C  C   . PHE A 89  ? 0.0960  0.2828 0.1582 -0.0407 -0.0287 0.1115  89   PHE A C   
865  O  O   . PHE A 89  ? 0.1097  0.2949 0.1629 -0.0405 -0.0242 0.1404  89   PHE A O   
866  C  CB  . PHE A 89  ? 0.1010  0.2295 0.1228 -0.0225 -0.0098 0.0816  89   PHE A CB  
867  C  CG  . PHE A 89  ? 0.0963  0.2256 0.1168 -0.0220 -0.0088 0.0707  89   PHE A CG  
868  C  CD1 . PHE A 89  ? 0.1016  0.2234 0.1165 -0.0185 -0.0135 0.0504  89   PHE A CD1 
869  C  CD2 . PHE A 89  ? 0.1125  0.2341 0.1978 -0.0039 -0.0276 0.0772  89   PHE A CD2 
870  C  CE1 . PHE A 89  ? 0.1075  0.2471 0.1148 -0.0297 0.0015  0.0187  89   PHE A CE1 
871  C  CE2 . PHE A 89  ? 0.1368  0.2292 0.1866 0.0095  -0.0172 0.0474  89   PHE A CE2 
872  C  CZ  . PHE A 89  ? 0.1427  0.2357 0.1324 -0.0202 -0.0067 0.0323  89   PHE A CZ  
873  N  N   A LYS A 90  ? 0.1000  0.2629 0.1783 -0.0387 -0.0294 0.1324  90   LYS A N   
874  N  N   B LYS A 90  ? 0.0992  0.3095 0.2015 -0.0523 -0.0406 0.1443  90   LYS A N   
875  C  CA  A LYS A 90  ? 0.0833  0.2218 0.1145 -0.0635 -0.0471 0.0570  90   LYS A CA  
876  C  CA  B LYS A 90  ? 0.0973  0.2491 0.1304 -0.0483 -0.0609 0.0325  90   LYS A CA  
877  C  C   A LYS A 90  ? 0.0957  0.1731 0.1161 -0.0427 -0.0257 0.0543  90   LYS A C   
878  C  C   B LYS A 90  ? 0.1140  0.2147 0.1287 -0.0368 -0.0404 0.0358  90   LYS A C   
879  O  O   A LYS A 90  ? 0.1197  0.1754 0.1291 -0.0191 -0.0199 0.0575  90   LYS A O   
880  O  O   B LYS A 90  ? 0.1462  0.2211 0.1356 -0.0080 -0.0350 0.0333  90   LYS A O   
881  C  CB  A LYS A 90  ? 0.1134  0.1961 0.1358 -0.0569 -0.0129 0.0621  90   LYS A CB  
882  C  CB  B LYS A 90  ? 0.1100  0.2245 0.1469 -0.0352 -0.0337 0.0557  90   LYS A CB  
883  C  CG  A LYS A 90  ? 0.1478  0.1716 0.1495 -0.0129 0.0054  0.0329  90   LYS A CG  
884  C  CG  B LYS A 90  ? 0.1416  0.2275 0.1478 -0.0094 -0.0399 0.0438  90   LYS A CG  
885  C  CD  A LYS A 90  ? 0.1302  0.2276 0.1450 0.0077  -0.0061 0.0627  90   LYS A CD  
886  C  CD  B LYS A 90  ? 0.1485  0.2944 0.1756 0.0610  -0.0315 -0.0365 90   LYS A CD  
887  C  CE  A LYS A 90  ? 0.1364  0.2280 0.1313 -0.0057 0.0187  0.0647  90   LYS A CE  
888  C  CE  B LYS A 90  ? 0.1043  0.3839 0.2235 0.0269  -0.0050 0.1178  90   LYS A CE  
889  N  NZ  A LYS A 90  ? 0.1285  0.2972 0.2125 -0.0130 0.0173  -0.0124 90   LYS A NZ  
890  N  NZ  B LYS A 90  ? 0.1530  0.3153 0.5143 -0.0308 0.0121  0.2315  90   LYS A NZ  
891  N  N   A VAL A 91  ? 0.1108  0.1839 0.1180 -0.0044 -0.0174 0.0494  91   VAL A N   
892  N  N   B VAL A 91  ? 0.1010  0.1999 0.1113 -0.0381 -0.0227 0.0661  91   VAL A N   
893  C  CA  A VAL A 91  ? 0.1184  0.2329 0.1159 -0.0472 -0.0224 0.0374  91   VAL A CA  
894  C  CA  B VAL A 91  ? 0.1311  0.2224 0.1073 -0.0757 -0.0417 0.0497  91   VAL A CA  
895  C  C   A VAL A 91  ? 0.1192  0.1776 0.1019 -0.0295 -0.0273 0.0379  91   VAL A C   
896  C  C   B VAL A 91  ? 0.1029  0.2007 0.0850 -0.0490 -0.0155 0.0281  91   VAL A C   
897  O  O   A VAL A 91  ? 0.1328  0.2130 0.1308 -0.0059 -0.0094 0.0639  91   VAL A O   
898  O  O   B VAL A 91  ? 0.1027  0.2066 0.1173 -0.0279 -0.0132 0.0524  91   VAL A O   
899  C  CB  A VAL A 91  ? 0.2152  0.2441 0.1270 -0.1063 -0.0298 0.0299  91   VAL A CB  
900  C  CB  B VAL A 91  ? 0.1867  0.2278 0.1175 -0.1031 -0.0421 0.0313  91   VAL A CB  
901  C  CG1 A VAL A 91  ? 0.2523  0.2603 0.1193 -0.0887 -0.0655 0.0214  91   VAL A CG1 
902  C  CG1 B VAL A 91  ? 0.1448  0.2280 0.1411 -0.0381 0.0084  0.0489  91   VAL A CG1 
903  C  CG2 A VAL A 91  ? 0.2257  0.3032 0.1930 -0.1408 -0.1037 0.1129  91   VAL A CG2 
904  C  CG2 B VAL A 91  ? 0.1587  0.1900 0.1256 -0.0544 -0.0031 0.0281  91   VAL A CG2 
905  N  N   A PHE A 92  ? 0.1106  0.2092 0.1499 -0.0261 -0.0130 0.0721  92   PHE A N   
906  N  N   B PHE A 92  ? 0.1024  0.2032 0.1092 -0.0440 -0.0217 0.0428  92   PHE A N   
907  C  CA  A PHE A 92  ? 0.1136  0.1949 0.1265 -0.0269 -0.0054 0.0605  92   PHE A CA  
908  C  CA  B PHE A 92  ? 0.0930  0.1907 0.1191 -0.0375 -0.0265 0.0535  92   PHE A CA  
909  C  C   A PHE A 92  ? 0.0971  0.1961 0.1304 -0.0054 -0.0131 0.0612  92   PHE A C   
910  C  C   B PHE A 92  ? 0.1403  0.1699 0.1674 -0.0300 0.0498  0.0697  92   PHE A C   
911  O  O   A PHE A 92  ? 0.1447  0.1872 0.1029 -0.0135 -0.0022 0.0342  92   PHE A O   
912  O  O   B PHE A 92  ? 0.0724  0.1752 0.2017 0.0076  0.0276  0.1099  92   PHE A O   
913  C  CB  A PHE A 92  ? 0.1122  0.1604 0.1234 -0.0334 -0.0060 0.0552  92   PHE A CB  
914  C  CB  B PHE A 92  ? 0.0982  0.2239 0.0996 -0.0087 -0.0154 0.0317  92   PHE A CB  
915  C  CG  A PHE A 92  ? 0.0975  0.1702 0.1033 -0.0420 -0.0114 0.0565  92   PHE A CG  
916  C  CG  B PHE A 92  ? 0.1590  0.2043 0.1487 -0.0180 0.0534  0.0388  92   PHE A CG  
917  C  CD1 A PHE A 92  ? 0.1930  0.2347 0.1455 -0.0189 0.0508  0.0562  92   PHE A CD1 
918  C  CD1 B PHE A 92  ? 0.1584  0.2366 0.0871 -0.0489 0.0077  0.0313  92   PHE A CD1 
919  C  CD2 A PHE A 92  ? 0.2252  0.1610 0.1393 -0.0266 0.0374  0.0413  92   PHE A CD2 
920  C  CD2 B PHE A 92  ? 0.2325  0.2124 0.1251 -0.0121 0.0528  0.0620  92   PHE A CD2 
921  C  CE1 A PHE A 92  ? 0.2282  0.2459 0.1654 -0.0781 0.0662  0.0028  92   PHE A CE1 
922  C  CE1 B PHE A 92  ? 0.1914  0.2619 0.1099 -0.0646 0.0408  0.0069  92   PHE A CE1 
923  C  CE2 A PHE A 92  ? 0.2475  0.1802 0.1615 -0.0186 0.0354  0.0192  92   PHE A CE2 
924  C  CE2 B PHE A 92  ? 0.2096  0.2011 0.1197 -0.0439 -0.0026 0.0441  92   PHE A CE2 
925  C  CZ  A PHE A 92  ? 0.2536  0.2307 0.1449 -0.0425 0.0296  -0.0040 92   PHE A CZ  
926  C  CZ  B PHE A 92  ? 0.1788  0.2416 0.1235 -0.0543 -0.0009 -0.0042 92   PHE A CZ  
927  N  N   . ASP A 93  ? 0.1167  0.2049 0.1395 -0.0071 0.0175  0.0666  93   ASP A N   
928  C  CA  . ASP A 93  ? 0.1247  0.2123 0.1354 -0.0039 0.0122  0.0665  93   ASP A CA  
929  C  C   . ASP A 93  ? 0.1291  0.2353 0.1610 0.0184  0.0228  0.0687  93   ASP A C   
930  O  O   . ASP A 93  ? 0.1507  0.2697 0.1880 0.0439  0.0454  0.0867  93   ASP A O   
931  C  CB  . ASP A 93  ? 0.1486  0.2293 0.1369 0.0160  0.0302  0.0572  93   ASP A CB  
932  C  CG  . ASP A 93  ? 0.1496  0.2353 0.1710 0.0412  0.0469  0.0508  93   ASP A CG  
933  O  OD1 . ASP A 93  ? 0.2107  0.2261 0.1719 0.0272  0.0536  0.0437  93   ASP A OD1 
934  O  OD2 . ASP A 93  ? 0.1473  0.2860 0.1579 0.0352  0.0461  0.0286  93   ASP A OD2 
935  N  N   . ARG A 94  ? 0.1242  0.2283 0.1583 0.0056  0.0092  0.0728  94   ARG A N   
936  C  CA  . ARG A 94  ? 0.1367  0.2183 0.2169 0.0144  0.0027  0.1015  94   ARG A CA  
937  C  C   . ARG A 94  ? 0.1238  0.2324 0.2471 0.0144  0.0223  0.1088  94   ARG A C   
938  O  O   . ARG A 94  ? 0.1205  0.2765 0.3460 0.0191  0.0153  0.0957  94   ARG A O   
939  C  CB  . ARG A 94  ? 0.1446  0.2919 0.1939 0.0400  -0.0235 0.1074  94   ARG A CB  
940  C  CG  . ARG A 94  ? 0.1877  0.3312 0.2311 0.0603  0.0195  0.0934  94   ARG A CG  
941  C  CD  . ARG A 94  ? 0.2643  0.3292 0.2062 0.0527  -0.0112 0.0822  94   ARG A CD  
942  N  NE  . ARG A 94  ? 0.2107  0.4210 0.2632 0.0719  0.0246  0.1468  94   ARG A NE  
943  C  CZ  . ARG A 94  ? 0.3906  0.3048 0.2298 0.0436  -0.1420 0.0379  94   ARG A CZ  
944  N  NH1 . ARG A 94  ? 0.3733  0.3266 0.7995 0.1083  -0.0176 0.2508  94   ARG A NH1 
945  N  NH2 . ARG A 94  ? 0.3266  0.5241 0.3362 0.2173  -0.0980 0.0009  94   ARG A NH2 
946  N  N   . ASP A 95  ? 0.1283  0.2485 0.2302 0.0450  0.0233  0.0680  95   ASP A N   
947  C  CA  . ASP A 95  ? 0.1461  0.2757 0.2550 0.0912  0.0129  0.0644  95   ASP A CA  
948  C  C   . ASP A 95  ? 0.1983  0.2782 0.2538 0.1077  0.0188  0.0514  95   ASP A C   
949  O  O   . ASP A 95  ? 0.2320  0.3119 0.3044 0.1393  0.0784  0.0545  95   ASP A O   
950  C  CB  . ASP A 95  ? 0.2047  0.2558 0.2827 0.0884  0.0212  0.0405  95   ASP A CB  
951  C  CG  . ASP A 95  ? 0.2150  0.2134 0.2497 0.0635  0.0191  0.0321  95   ASP A CG  
952  O  OD1 . ASP A 95  ? 0.2080  0.2218 0.2340 0.0853  0.0327  0.0307  95   ASP A OD1 
953  O  OD2 . ASP A 95  ? 0.2982  0.2409 0.4081 0.0130  -0.0255 0.0664  95   ASP A OD2 
954  N  N   . GLY A 96  ? 0.1609  0.2576 0.2618 0.0546  0.0722  0.0612  96   GLY A N   
955  C  CA  . GLY A 96  ? 0.1999  0.3674 0.2586 0.0977  0.0827  0.0774  96   GLY A CA  
956  C  C   . GLY A 96  ? 0.2284  0.3588 0.2547 0.1484  0.0690  0.0559  96   GLY A C   
957  O  O   . GLY A 96  ? 0.2654  0.4511 0.2753 0.1341  0.1031  0.0090  96   GLY A O   
958  N  N   . ASN A 97  ? 0.2106  0.3656 0.2348 0.1487  0.0388  0.0276  97   ASN A N   
959  C  CA  . ASN A 97  ? 0.2887  0.3208 0.2209 0.1524  0.0710  -0.0048 97   ASN A CA  
960  C  C   . ASN A 97  ? 0.2711  0.3422 0.1840 0.1264  0.0534  -0.0073 97   ASN A C   
961  O  O   . ASN A 97  ? 0.4514  0.3535 0.1914 0.1470  0.0015  -0.0392 97   ASN A O   
962  C  CB  . ASN A 97  ? 0.3483  0.2905 0.3055 0.1533  0.1042  -0.0050 97   ASN A CB  
963  C  CG  . ASN A 97  ? 0.2913  0.2445 0.2459 0.1001  0.0494  -0.0314 97   ASN A CG  
964  O  OD1 . ASN A 97  ? 0.2599  0.2306 0.1888 0.1058  0.0216  -0.0214 97   ASN A OD1 
965  N  ND2 . ASN A 97  ? 0.3070  0.2551 0.3164 0.0738  -0.0261 -0.0719 97   ASN A ND2 
966  N  N   . GLY A 98  ? 0.2185  0.3205 0.1947 0.1124  0.0608  0.0195  98   GLY A N   
967  C  CA  . GLY A 98  ? 0.2067  0.3271 0.1678 0.0708  0.0206  0.0058  98   GLY A CA  
968  C  C   . GLY A 98  ? 0.2012  0.2378 0.1488 0.0601  0.0229  -0.0045 98   GLY A C   
969  O  O   . GLY A 98  ? 0.2143  0.2670 0.1443 0.0448  0.0051  0.0145  98   GLY A O   
970  N  N   . LEU A 99  ? 0.1826  0.2666 0.1446 0.0643  0.0067  0.0067  99   LEU A N   
971  C  CA  . LEU A 99  ? 0.1757  0.2016 0.1274 0.0540  0.0032  0.0045  99   LEU A CA  
972  C  C   . LEU A 99  ? 0.1666  0.2286 0.1282 0.0783  -0.0031 -0.0031 99   LEU A C   
973  O  O   . LEU A 99  ? 0.2758  0.2515 0.1282 0.1394  0.0215  0.0249  99   LEU A O   
974  C  CB  . LEU A 99  ? 0.2160  0.1745 0.1748 0.0583  0.0229  -0.0085 99   LEU A CB  
975  C  CG  . LEU A 99  ? 0.1884  0.2513 0.1906 0.0440  0.0028  -0.0321 99   LEU A CG  
976  C  CD1 . LEU A 99  ? 0.3195  0.2305 0.3465 0.0451  -0.0502 -0.0893 99   LEU A CD1 
977  C  CD2 . LEU A 99  ? 0.1923  0.3040 0.1915 0.0424  0.0026  0.0008  99   LEU A CD2 
978  N  N   A ILE A 100 ? 0.1296  0.1742 0.0994 0.0255  -0.0037 0.0125  100  ILE A N   
979  N  N   B ILE A 100 ? 0.1055  0.1795 0.1211 0.0262  -0.0014 0.0105  100  ILE A N   
980  C  CA  A ILE A 100 ? 0.1142  0.1653 0.0933 0.0154  -0.0036 0.0088  100  ILE A CA  
981  C  CA  B ILE A 100 ? 0.0801  0.1536 0.1204 0.0167  -0.0033 0.0110  100  ILE A CA  
982  C  C   A ILE A 100 ? 0.1237  0.1444 0.0928 -0.0070 -0.0177 -0.0020 100  ILE A C   
983  C  C   B ILE A 100 ? 0.0906  0.1362 0.1075 -0.0063 -0.0252 0.0003  100  ILE A C   
984  O  O   A ILE A 100 ? 0.1305  0.1502 0.1043 -0.0003 -0.0210 0.0115  100  ILE A O   
985  O  O   B ILE A 100 ? 0.0866  0.1423 0.1163 -0.0025 -0.0237 -0.0247 100  ILE A O   
986  C  CB  A ILE A 100 ? 0.0932  0.1553 0.0985 -0.0018 -0.0059 0.0172  100  ILE A CB  
987  C  CB  B ILE A 100 ? 0.0953  0.1393 0.1354 -0.0098 -0.0238 0.0127  100  ILE A CB  
988  C  CG1 A ILE A 100 ? 0.0930  0.1873 0.1134 -0.0005 -0.0091 0.0364  100  ILE A CG1 
989  C  CG1 B ILE A 100 ? 0.1082  0.1825 0.0907 -0.0244 -0.0205 0.0309  100  ILE A CG1 
990  C  CG2 A ILE A 100 ? 0.0880  0.1538 0.1070 -0.0211 -0.0026 0.0076  100  ILE A CG2 
991  C  CG2 B ILE A 100 ? -0.0109 0.1021 0.1444 -0.0145 -0.0327 0.0065  100  ILE A CG2 
992  C  CD1 A ILE A 100 ? 0.1241  0.1735 0.1109 -0.0136 -0.0196 0.0430  100  ILE A CD1 
993  C  CD1 B ILE A 100 ? 0.1137  0.3066 0.2385 0.0194  0.0324  0.1969  100  ILE A CD1 
994  N  N   . SER A 101 ? 0.1199  0.1393 0.1166 0.0070  -0.0184 0.0049  101  SER A N   
995  C  CA  . SER A 101 ? 0.1393  0.1349 0.1158 -0.0150 -0.0287 0.0071  101  SER A CA  
996  C  C   . SER A 101 ? 0.1246  0.1387 0.1068 -0.0240 -0.0230 0.0132  101  SER A C   
997  O  O   . SER A 101 ? 0.1092  0.1401 0.1114 -0.0300 -0.0188 0.0068  101  SER A O   
998  C  CB  . SER A 101 ? 0.1618  0.1398 0.1598 -0.0171 -0.0292 0.0048  101  SER A CB  
999  O  OG  . SER A 101 ? 0.1516  0.1356 0.1417 -0.0119 -0.0310 0.0269  101  SER A OG  
1000 N  N   . ALA A 102 ? 0.1387  0.1535 0.1185 -0.0576 -0.0204 0.0082  102  ALA A N   
1001 C  CA  . ALA A 102 ? 0.1240  0.1619 0.1200 -0.0452 -0.0181 0.0167  102  ALA A CA  
1002 C  C   . ALA A 102 ? 0.1139  0.1620 0.1142 -0.0513 -0.0111 0.0231  102  ALA A C   
1003 O  O   . ALA A 102 ? 0.1330  0.1795 0.1097 -0.0464 -0.0091 0.0094  102  ALA A O   
1004 C  CB  . ALA A 102 ? 0.1044  0.2527 0.1565 -0.0573 -0.0190 0.0010  102  ALA A CB  
1005 N  N   . ALA A 103 ? 0.1428  0.1503 0.1295 -0.0491 -0.0242 0.0334  103  ALA A N   
1006 C  CA  . ALA A 103 ? 0.1386  0.1750 0.1286 -0.0517 -0.0186 0.0434  103  ALA A CA  
1007 C  C   . ALA A 103 ? 0.1248  0.1340 0.1124 -0.0223 -0.0212 0.0511  103  ALA A C   
1008 O  O   . ALA A 103 ? 0.1336  0.1610 0.1093 -0.0417 -0.0268 0.0425  103  ALA A O   
1009 C  CB  . ALA A 103 ? 0.1862  0.1563 0.1992 -0.0653 -0.0574 0.0729  103  ALA A CB  
1010 N  N   . GLU A 104 ? 0.1191  0.1358 0.1129 -0.0361 -0.0143 0.0303  104  GLU A N   
1011 C  CA  . GLU A 104 ? 0.0985  0.1418 0.1161 -0.0202 -0.0098 0.0364  104  GLU A CA  
1012 C  C   . GLU A 104 ? 0.1026  0.1359 0.1091 -0.0259 -0.0114 0.0273  104  GLU A C   
1013 O  O   . GLU A 104 ? 0.1244  0.1476 0.1164 -0.0422 -0.0297 0.0300  104  GLU A O   
1014 C  CB  . GLU A 104 ? 0.1132  0.1332 0.1199 -0.0152 -0.0015 0.0327  104  GLU A CB  
1015 C  CG  . GLU A 104 ? 0.1193  0.1549 0.1518 0.0122  0.0094  0.0486  104  GLU A CG  
1016 C  CD  . GLU A 104 ? 0.1384  0.1670 0.1535 0.0381  0.0235  0.0479  104  GLU A CD  
1017 O  OE1 . GLU A 104 ? 0.1428  0.1557 0.1356 0.0204  -0.0025 0.0245  104  GLU A OE1 
1018 O  OE2 . GLU A 104 ? 0.1542  0.2084 0.1717 0.0649  0.0202  0.0510  104  GLU A OE2 
1019 N  N   . LEU A 105 ? 0.1126  0.1273 0.1075 -0.0221 -0.0248 0.0201  105  LEU A N   
1020 C  CA  . LEU A 105 ? 0.1242  0.1290 0.1042 -0.0239 -0.0204 0.0222  105  LEU A CA  
1021 C  C   . LEU A 105 ? 0.1179  0.1309 0.1105 -0.0260 -0.0245 0.0177  105  LEU A C   
1022 O  O   . LEU A 105 ? 0.1523  0.1273 0.1064 -0.0319 -0.0332 0.0243  105  LEU A O   
1023 C  CB  . LEU A 105 ? 0.1334  0.1433 0.0999 -0.0132 -0.0220 0.0189  105  LEU A CB  
1024 C  CG  . LEU A 105 ? 0.1403  0.1625 0.1058 0.0054  -0.0141 0.0231  105  LEU A CG  
1025 C  CD1 . LEU A 105 ? 0.1617  0.1493 0.1365 -0.0077 -0.0113 0.0312  105  LEU A CD1 
1026 C  CD2 . LEU A 105 ? 0.1580  0.1713 0.1555 -0.0010 -0.0506 0.0216  105  LEU A CD2 
1027 N  N   . ARG A 106 ? 0.1224  0.1234 0.1043 -0.0231 -0.0173 0.0136  106  ARG A N   
1028 C  CA  . ARG A 106 ? 0.1425  0.1214 0.1027 -0.0229 -0.0228 0.0160  106  ARG A CA  
1029 C  C   . ARG A 106 ? 0.1550  0.1164 0.0878 -0.0290 -0.0212 0.0202  106  ARG A C   
1030 O  O   . ARG A 106 ? 0.1605  0.1354 0.1083 -0.0341 -0.0257 0.0038  106  ARG A O   
1031 C  CB  . ARG A 106 ? 0.1580  0.1118 0.1071 -0.0245 -0.0105 0.0045  106  ARG A CB  
1032 C  CG  . ARG A 106 ? 0.1712  0.1444 0.1085 -0.0441 -0.0125 0.0016  106  ARG A CG  
1033 C  CD  . ARG A 106 ? 0.1669  0.1292 0.1290 -0.0276 0.0083  0.0091  106  ARG A CD  
1034 N  NE  . ARG A 106 ? 0.1841  0.1334 0.1514 -0.0297 -0.0164 0.0218  106  ARG A NE  
1035 C  CZ  . ARG A 106 ? 0.1914  0.1616 0.1296 0.0001  -0.0077 0.0248  106  ARG A CZ  
1036 N  NH1 . ARG A 106 ? 0.1710  0.2065 0.1461 -0.0061 -0.0148 0.0267  106  ARG A NH1 
1037 N  NH2 . ARG A 106 ? 0.3315  0.1395 0.2324 -0.0102 -0.0613 0.0491  106  ARG A NH2 
1038 N  N   A HIS A 107 ? 0.1338  0.1275 0.0698 -0.0394 -0.0167 0.0278  107  HIS A N   
1039 N  N   B HIS A 107 ? 0.1564  0.1243 0.1322 -0.0137 -0.0313 0.0089  107  HIS A N   
1040 C  CA  A HIS A 107 ? 0.1341  0.1812 0.0957 -0.0526 -0.0254 0.0099  107  HIS A CA  
1041 C  CA  B HIS A 107 ? 0.1699  0.1429 0.1020 -0.0078 -0.0407 0.0103  107  HIS A CA  
1042 C  C   A HIS A 107 ? 0.1434  0.1933 0.1225 -0.0608 -0.0250 0.0220  107  HIS A C   
1043 C  C   B HIS A 107 ? 0.1529  0.1508 0.1228 -0.0114 -0.0458 0.0152  107  HIS A C   
1044 O  O   A HIS A 107 ? 0.1185  0.1313 0.1430 -0.0333 -0.0574 0.0536  107  HIS A O   
1045 O  O   B HIS A 107 ? 0.1425  0.1552 0.1338 0.0032  -0.0565 -0.0022 107  HIS A O   
1046 C  CB  A HIS A 107 ? 0.1495  0.1992 0.1002 -0.0049 -0.0738 0.0143  107  HIS A CB  
1047 C  CB  B HIS A 107 ? 0.1582  0.1529 0.1148 -0.0119 -0.0360 0.0000  107  HIS A CB  
1048 C  CG  A HIS A 107 ? 0.1867  0.1761 0.2012 -0.0231 -0.1208 0.0429  107  HIS A CG  
1049 C  CG  B HIS A 107 ? 0.1600  0.1881 0.1588 -0.0106 -0.0497 0.0320  107  HIS A CG  
1050 N  ND1 A HIS A 107 ? 0.1653  0.2031 0.2172 -0.0184 -0.1192 0.0460  107  HIS A ND1 
1051 N  ND1 B HIS A 107 ? 0.1780  0.2900 0.1615 0.0246  -0.0608 0.0392  107  HIS A ND1 
1052 C  CD2 A HIS A 107 ? 0.2150  0.1900 0.2408 -0.0208 -0.1576 0.0617  107  HIS A CD2 
1053 C  CD2 B HIS A 107 ? 0.1734  0.2369 0.2546 -0.0538 -0.0846 0.0932  107  HIS A CD2 
1054 C  CE1 A HIS A 107 ? 0.1611  0.2672 0.1897 -0.0226 -0.0997 0.0917  107  HIS A CE1 
1055 C  CE1 B HIS A 107 ? 0.1833  0.2463 0.1946 0.0236  -0.0754 -0.0002 107  HIS A CE1 
1056 N  NE2 A HIS A 107 ? 0.1992  0.2032 0.2363 -0.0207 -0.1290 0.0511  107  HIS A NE2 
1057 N  NE2 B HIS A 107 ? 0.1648  0.2367 0.2319 -0.0008 -0.0711 0.0140  107  HIS A NE2 
1058 N  N   . VAL A 108 ? 0.1430  0.1596 0.1215 -0.0411 -0.0345 0.0099  108  VAL A N   
1059 C  CA  . VAL A 108 ? 0.1309  0.1750 0.1322 -0.0500 -0.0195 0.0150  108  VAL A CA  
1060 C  C   . VAL A 108 ? 0.1444  0.1521 0.1426 -0.0458 -0.0223 0.0204  108  VAL A C   
1061 O  O   . VAL A 108 ? 0.1533  0.1794 0.1522 -0.0642 -0.0118 0.0014  108  VAL A O   
1062 C  CB  . VAL A 108 ? 0.1521  0.2127 0.1382 -0.0551 -0.0220 0.0254  108  VAL A CB  
1063 C  CG1 . VAL A 108 ? 0.2430  0.2328 0.1502 -0.0907 -0.0419 0.0539  108  VAL A CG1 
1064 C  CG2 . VAL A 108 ? 0.1690  0.2541 0.1509 -0.0577 -0.0041 -0.0057 108  VAL A CG2 
1065 N  N   . MET A 109 ? 0.1487  0.1281 0.1275 -0.0457 -0.0182 0.0227  109  MET A N   
1066 C  CA  . MET A 109 ? 0.1643  0.1102 0.1250 -0.0457 -0.0138 0.0182  109  MET A CA  
1067 C  C   . MET A 109 ? 0.1689  0.1371 0.1259 -0.0723 -0.0241 0.0127  109  MET A C   
1068 O  O   . MET A 109 ? 0.1696  0.1448 0.1409 -0.0648 -0.0246 0.0136  109  MET A O   
1069 C  CB  . MET A 109 ? 0.1620  0.1337 0.1336 -0.0334 -0.0275 0.0175  109  MET A CB  
1070 C  CG  . MET A 109 ? 0.1683  0.1642 0.1404 -0.0247 -0.0365 0.0382  109  MET A CG  
1071 S  SD  . MET A 109 ? 0.2467  0.1701 0.2175 -0.0164 -0.0516 0.0573  109  MET A SD  
1072 C  CE  . MET A 109 ? 0.4936  0.1711 0.1510 -0.0375 0.0532  0.0174  109  MET A CE  
1073 N  N   . THR A 110 ? 0.1682  0.1393 0.1136 -0.0691 -0.0235 0.0228  110  THR A N   
1074 C  CA  . THR A 110 ? 0.1691  0.1629 0.1161 -0.0519 -0.0261 0.0055  110  THR A CA  
1075 C  C   . THR A 110 ? 0.1652  0.1411 0.1308 -0.0441 -0.0369 0.0165  110  THR A C   
1076 O  O   . THR A 110 ? 0.1734  0.1601 0.1450 -0.0441 -0.0469 0.0143  110  THR A O   
1077 C  CB  . THR A 110 ? 0.2201  0.1864 0.1320 -0.0894 -0.0481 0.0515  110  THR A CB  
1078 O  OG1 . THR A 110 ? 0.2584  0.2643 0.1822 -0.1402 -0.0510 0.0633  110  THR A OG1 
1079 C  CG2 . THR A 110 ? 0.3647  0.2947 0.1576 -0.1607 -0.1122 0.0922  110  THR A CG2 
1080 N  N   A ASN A 111 ? 0.1473  0.1537 0.1443 -0.0487 -0.0484 0.0125  111  ASN A N   
1081 N  N   B ASN A 111 ? 0.1573  0.1090 0.1671 -0.0117 -0.0238 0.0416  111  ASN A N   
1082 C  CA  A ASN A 111 ? 0.1423  0.1157 0.1564 -0.0216 -0.0409 -0.0124 111  ASN A CA  
1083 C  CA  B ASN A 111 ? 0.1564  0.1283 0.1687 -0.0165 -0.0293 -0.0049 111  ASN A CA  
1084 C  C   A ASN A 111 ? 0.1163  0.1266 0.1567 -0.0204 -0.0281 0.0187  111  ASN A C   
1085 C  C   B ASN A 111 ? 0.1444  0.1471 0.1600 -0.0322 -0.0262 0.0550  111  ASN A C   
1086 O  O   A ASN A 111 ? 0.1534  0.1135 0.1946 -0.0241 -0.0566 -0.0071 111  ASN A O   
1087 O  O   B ASN A 111 ? 0.1583  0.1638 0.2733 -0.0484 -0.0401 -0.0054 111  ASN A O   
1088 C  CB  A ASN A 111 ? 0.1267  0.1689 0.1880 -0.0169 -0.0507 -0.0402 111  ASN A CB  
1089 C  CB  B ASN A 111 ? 0.1653  0.2340 0.1984 0.0128  -0.0155 -0.0302 111  ASN A CB  
1090 C  CG  A ASN A 111 ? 0.1335  0.1742 0.2997 0.0198  -0.0650 -0.0333 111  ASN A CG  
1091 C  CG  B ASN A 111 ? 0.1390  0.2986 0.3089 -0.0487 0.0243  -0.0218 111  ASN A CG  
1092 O  OD1 A ASN A 111 ? 0.1830  0.2230 0.3317 0.0324  -0.0760 -0.0719 111  ASN A OD1 
1093 O  OD1 B ASN A 111 ? 0.3093  0.5201 0.5705 -0.2046 -0.0725 -0.1532 111  ASN A OD1 
1094 N  ND2 A ASN A 111 ? 0.1571  0.1204 0.2942 0.0413  -0.1201 -0.0353 111  ASN A ND2 
1095 N  ND2 B ASN A 111 ? 0.2146  0.5504 0.3552 0.1186  0.1321  0.0360  111  ASN A ND2 
1096 N  N   . LEU A 112 ? 0.1596  0.1354 0.1696 -0.0309 -0.0546 0.0194  112  LEU A N   
1097 C  CA  . LEU A 112 ? 0.1326  0.1393 0.1964 -0.0377 -0.0453 0.0531  112  LEU A CA  
1098 C  C   . LEU A 112 ? 0.1651  0.1205 0.2023 -0.0262 -0.0513 0.0352  112  LEU A C   
1099 O  O   . LEU A 112 ? 0.2048  0.1466 0.2510 -0.0087 -0.0700 0.0268  112  LEU A O   
1100 C  CB  . LEU A 112 ? 0.1828  0.1567 0.1908 -0.0731 -0.0522 0.0582  112  LEU A CB  
1101 C  CG  . LEU A 112 ? 0.2403  0.1921 0.1895 -0.0839 -0.0328 0.0600  112  LEU A CG  
1102 C  CD1 . LEU A 112 ? 0.2493  0.2376 0.1855 -0.0242 -0.0263 0.0522  112  LEU A CD1 
1103 C  CD2 . LEU A 112 ? 0.2959  0.3862 0.2215 -0.1852 0.0241  0.0270  112  LEU A CD2 
1104 N  N   . GLY A 113 ? 0.1447  0.1319 0.2031 -0.0538 -0.0090 0.0113  113  GLY A N   
1105 C  CA  . GLY A 113 ? 0.1384  0.1136 0.2024 -0.0368 -0.0373 -0.0098 113  GLY A CA  
1106 C  C   . GLY A 113 ? 0.1437  0.0846 0.1808 -0.0400 -0.0153 -0.0089 113  GLY A C   
1107 O  O   . GLY A 113 ? 0.1610  0.1251 0.1779 -0.0263 -0.0344 -0.0325 113  GLY A O   
1108 N  N   . GLU A 114 ? 0.1457  0.0999 0.1659 -0.0404 -0.0156 -0.0117 114  GLU A N   
1109 C  CA  . GLU A 114 ? 0.1500  0.1094 0.1547 -0.0485 -0.0201 -0.0033 114  GLU A CA  
1110 C  C   . GLU A 114 ? 0.1542  0.1085 0.1373 -0.0444 -0.0186 -0.0050 114  GLU A C   
1111 O  O   . GLU A 114 ? 0.1878  0.1342 0.1576 -0.0612 0.0201  -0.0378 114  GLU A O   
1112 C  CB  . GLU A 114 ? 0.1808  0.1359 0.1488 -0.0336 -0.0258 -0.0004 114  GLU A CB  
1113 C  CG  . GLU A 114 ? 0.2053  0.1422 0.1642 -0.0224 -0.0460 0.0065  114  GLU A CG  
1114 C  CD  . GLU A 114 ? 0.2043  0.1242 0.1883 -0.0347 -0.0355 0.0089  114  GLU A CD  
1115 O  OE1 . GLU A 114 ? 0.3909  0.1235 0.2607 -0.0002 0.0399  0.0186  114  GLU A OE1 
1116 O  OE2 . GLU A 114 ? 0.1562  0.1634 0.2536 -0.0212 -0.0206 0.0097  114  GLU A OE2 
1117 N  N   A LYS A 115 ? 0.1489  0.0997 0.1330 -0.0278 -0.0079 -0.0066 115  LYS A N   
1118 N  N   B LYS A 115 ? 0.1343  0.0805 0.1135 -0.0204 -0.0413 -0.0159 115  LYS A N   
1119 C  CA  A LYS A 115 ? 0.1692  0.0959 0.1306 -0.0327 -0.0183 -0.0021 115  LYS A CA  
1120 C  CA  B LYS A 115 ? 0.1218  0.0692 0.1309 0.0133  -0.0208 0.0015  115  LYS A CA  
1121 C  C   A LYS A 115 ? 0.1661  0.1001 0.1172 -0.0373 0.0064  -0.0337 115  LYS A C   
1122 C  C   B LYS A 115 ? 0.1295  0.0372 0.0906 0.0025  -0.0077 0.0180  115  LYS A C   
1123 O  O   A LYS A 115 ? 0.1756  0.1448 0.1732 -0.0231 0.0197  -0.0559 115  LYS A O   
1124 O  O   B LYS A 115 ? 0.1110  0.0307 0.0835 -0.0172 -0.0284 0.0037  115  LYS A O   
1125 C  CB  A LYS A 115 ? 0.1927  0.1002 0.1311 0.0009  -0.0143 -0.0066 115  LYS A CB  
1126 C  CB  B LYS A 115 ? 0.1638  0.0944 0.1269 -0.0217 -0.0392 -0.0059 115  LYS A CB  
1127 C  CG  A LYS A 115 ? 0.1761  0.1024 0.1650 -0.0301 -0.0353 0.0128  115  LYS A CG  
1128 C  CG  B LYS A 115 ? 0.1449  0.1046 0.1215 -0.0422 -0.0207 0.0174  115  LYS A CG  
1129 C  CD  A LYS A 115 ? 0.2532  0.1009 0.1739 0.0063  0.0030  0.0259  115  LYS A CD  
1130 C  CD  B LYS A 115 ? 0.1464  0.1081 0.1233 0.0019  -0.0168 0.0211  115  LYS A CD  
1131 C  CE  A LYS A 115 ? 0.3151  0.0841 0.1447 -0.0053 -0.0026 0.0046  115  LYS A CE  
1132 C  CE  B LYS A 115 ? 0.1911  0.3209 0.2106 -0.0738 -0.0816 0.1103  115  LYS A CE  
1133 N  NZ  A LYS A 115 ? 0.3780  0.0702 0.2029 -0.0360 -0.0726 -0.0209 115  LYS A NZ  
1134 N  NZ  B LYS A 115 ? 0.1611  0.4085 0.2091 -0.0675 -0.0790 0.0795  115  LYS A NZ  
1135 N  N   A LEU A 116 ? 0.1437  0.0726 0.1059 -0.0335 0.0069  -0.0041 116  LEU A N   
1136 N  N   B LEU A 116 ? 0.1441  0.0783 0.0927 0.0050  -0.0095 -0.0025 116  LEU A N   
1137 C  CA  A LEU A 116 ? 0.1499  0.0673 0.1002 -0.0261 0.0047  -0.0018 116  LEU A CA  
1138 C  CA  B LEU A 116 ? 0.1168  0.0989 0.1017 -0.0116 0.0153  -0.0069 116  LEU A CA  
1139 C  C   A LEU A 116 ? 0.1429  0.0699 0.0821 -0.0276 -0.0183 -0.0041 116  LEU A C   
1140 C  C   B LEU A 116 ? 0.1465  0.1053 0.1278 -0.0307 0.0293  0.0044  116  LEU A C   
1141 O  O   A LEU A 116 ? 0.1507  0.0660 0.1672 -0.0227 -0.0115 0.0007  116  LEU A O   
1142 O  O   B LEU A 116 ? 0.1342  0.1057 0.1171 -0.0307 -0.0061 0.0102  116  LEU A O   
1143 C  CB  A LEU A 116 ? 0.1322  0.0824 0.1020 -0.0259 0.0171  -0.0001 116  LEU A CB  
1144 C  CB  B LEU A 116 ? 0.1088  0.0782 0.0979 -0.0021 -0.0015 -0.0060 116  LEU A CB  
1145 C  CG  A LEU A 116 ? 0.1634  0.0887 0.1318 -0.0207 0.0207  0.0208  116  LEU A CG  
1146 C  CG  B LEU A 116 ? 0.2058  0.0802 0.1112 -0.0042 0.0207  -0.0020 116  LEU A CG  
1147 C  CD1 A LEU A 116 ? 0.1982  0.1199 0.1428 -0.0088 0.0259  0.0483  116  LEU A CD1 
1148 C  CD1 B LEU A 116 ? 0.1581  0.1712 0.1089 -0.0145 -0.0239 0.0496  116  LEU A CD1 
1149 C  CD2 A LEU A 116 ? 0.2014  0.0801 0.1958 -0.0052 0.0487  0.0282  116  LEU A CD2 
1150 C  CD2 B LEU A 116 ? 0.1872  0.0637 0.2088 -0.0008 0.0367  0.0391  116  LEU A CD2 
1151 N  N   . THR A 117 ? 0.1503  0.0777 0.0949 -0.0253 -0.0177 0.0097  117  THR A N   
1152 C  CA  . THR A 117 ? 0.1681  0.0727 0.0832 -0.0396 -0.0219 0.0129  117  THR A CA  
1153 C  C   . THR A 117 ? 0.1394  0.0824 0.0860 -0.0165 -0.0208 0.0028  117  THR A C   
1154 O  O   . THR A 117 ? 0.1602  0.0868 0.0861 -0.0305 -0.0203 0.0126  117  THR A O   
1155 C  CB  . THR A 117 ? 0.1758  0.0796 0.0851 -0.0301 -0.0145 0.0143  117  THR A CB  
1156 O  OG1 . THR A 117 ? 0.1572  0.0940 0.1231 -0.0183 -0.0098 0.0054  117  THR A OG1 
1157 C  CG2 . THR A 117 ? 0.2395  0.0642 0.1034 -0.0377 0.0148  -0.0015 117  THR A CG2 
1158 N  N   . ASP A 118 ? 0.1547  0.0805 0.0859 -0.0324 -0.0265 0.0043  118  ASP A N   
1159 C  CA  . ASP A 118 ? 0.1519  0.0977 0.0802 -0.0298 -0.0152 0.0020  118  ASP A CA  
1160 C  C   . ASP A 118 ? 0.1518  0.1012 0.0943 -0.0307 -0.0288 -0.0020 118  ASP A C   
1161 O  O   . ASP A 118 ? 0.1811  0.1385 0.0771 -0.0196 -0.0224 -0.0003 118  ASP A O   
1162 C  CB  . ASP A 118 ? 0.1432  0.0860 0.1153 -0.0218 -0.0213 -0.0171 118  ASP A CB  
1163 C  CG  . ASP A 118 ? 0.1383  0.0959 0.1228 -0.0147 -0.0159 -0.0199 118  ASP A CG  
1164 O  OD1 . ASP A 118 ? 0.1410  0.1469 0.1521 -0.0351 -0.0111 -0.0154 118  ASP A OD1 
1165 O  OD2 . ASP A 118 ? 0.1506  0.1003 0.1807 -0.0053 -0.0131 0.0030  118  ASP A OD2 
1166 N  N   A ASP A 119 ? 0.1346  0.1263 0.0787 -0.0291 -0.0375 0.0083  119  ASP A N   
1167 N  N   B ASP A 119 ? 0.1574  0.0994 0.0849 -0.0301 -0.0255 0.0051  119  ASP A N   
1168 C  CA  A ASP A 119 ? 0.1329  0.1254 0.0658 -0.0368 -0.0324 0.0173  119  ASP A CA  
1169 C  CA  B ASP A 119 ? 0.1673  0.1024 0.1146 -0.0150 -0.0222 0.0173  119  ASP A CA  
1170 C  C   A ASP A 119 ? 0.1060  0.1284 0.0948 -0.0181 -0.0091 0.0179  119  ASP A C   
1171 C  C   B ASP A 119 ? 0.1176  0.1058 0.1012 -0.0065 -0.0257 0.0026  119  ASP A C   
1172 O  O   A ASP A 119 ? 0.0537  0.1190 0.0769 0.0102  0.0288  0.0236  119  ASP A O   
1173 O  O   B ASP A 119 ? 0.0974  0.1327 0.0772 0.0053  0.0102  0.0151  119  ASP A O   
1174 C  CB  A ASP A 119 ? 0.1304  0.1075 0.1013 -0.0079 -0.0215 0.0454  119  ASP A CB  
1175 C  CB  B ASP A 119 ? 0.1420  0.1699 0.1366 -0.0480 -0.0278 0.0215  119  ASP A CB  
1176 C  CG  A ASP A 119 ? 0.1129  0.1488 0.0815 -0.0353 -0.0139 -0.0082 119  ASP A CG  
1177 C  CG  B ASP A 119 ? 0.1685  0.3622 0.1605 -0.1125 -0.0541 0.0288  119  ASP A CG  
1178 O  OD1 A ASP A 119 ? 0.1409  0.1445 0.1314 -0.0450 0.0184  -0.0151 119  ASP A OD1 
1179 O  OD1 B ASP A 119 ? 0.3448  0.3365 0.5703 0.0883  -0.3170 0.0142  119  ASP A OD1 
1180 O  OD2 A ASP A 119 ? 0.1037  0.1778 0.1030 -0.0393 -0.0047 0.0013  119  ASP A OD2 
1181 O  OD2 B ASP A 119 ? 0.3507  0.5035 0.1930 -0.2534 -0.0831 -0.0228 119  ASP A OD2 
1182 N  N   . GLU A 120 ? 0.1717  0.0909 0.0933 -0.0207 -0.0145 0.0129  120  GLU A N   
1183 C  CA  . GLU A 120 ? 0.1689  0.0905 0.0965 -0.0075 -0.0029 0.0130  120  GLU A CA  
1184 C  C   . GLU A 120 ? 0.1414  0.1029 0.0925 -0.0137 -0.0106 0.0100  120  GLU A C   
1185 O  O   . GLU A 120 ? 0.1455  0.1107 0.1094 -0.0041 -0.0010 0.0270  120  GLU A O   
1186 C  CB  . GLU A 120 ? 0.1555  0.0891 0.1011 -0.0140 -0.0009 0.0087  120  GLU A CB  
1187 C  CG  . GLU A 120 ? 0.1835  0.0935 0.1097 0.0021  -0.0029 0.0037  120  GLU A CG  
1188 C  CD  . GLU A 120 ? 0.1841  0.0695 0.1105 -0.0053 0.0133  0.0006  120  GLU A CD  
1189 O  OE1 . GLU A 120 ? 0.2148  0.0886 0.1127 -0.0054 -0.0282 0.0058  120  GLU A OE1 
1190 O  OE2 . GLU A 120 ? 0.2406  0.1224 0.1526 0.0232  -0.0124 -0.0317 120  GLU A OE2 
1191 N  N   . VAL A 121 ? 0.1449  0.1009 0.0846 -0.0127 -0.0224 0.0128  121  VAL A N   
1192 C  CA  . VAL A 121 ? 0.1531  0.1073 0.0962 -0.0144 -0.0172 0.0018  121  VAL A CA  
1193 C  C   . VAL A 121 ? 0.1366  0.1211 0.0941 -0.0130 -0.0271 0.0147  121  VAL A C   
1194 O  O   . VAL A 121 ? 0.1315  0.1401 0.0918 -0.0186 -0.0204 0.0140  121  VAL A O   
1195 C  CB  . VAL A 121 ? 0.1448  0.1815 0.1042 0.0031  -0.0359 -0.0075 121  VAL A CB  
1196 C  CG1 . VAL A 121 ? 0.1449  0.2579 0.1165 0.0022  -0.0045 0.0010  121  VAL A CG1 
1197 C  CG2 . VAL A 121 ? 0.1701  0.1894 0.1399 -0.0061 -0.0396 -0.0289 121  VAL A CG2 
1198 N  N   . ASP A 122 ? 0.1407  0.1264 0.0877 -0.0183 -0.0199 0.0055  122  ASP A N   
1199 C  CA  . ASP A 122 ? 0.1417  0.1402 0.0850 -0.0176 -0.0260 0.0009  122  ASP A CA  
1200 C  C   . ASP A 122 ? 0.1210  0.1510 0.0949 -0.0217 -0.0212 0.0096  122  ASP A C   
1201 O  O   . ASP A 122 ? 0.1567  0.1644 0.0826 -0.0199 -0.0304 0.0075  122  ASP A O   
1202 C  CB  . ASP A 122 ? 0.1696  0.1602 0.0960 -0.0469 -0.0417 0.0054  122  ASP A CB  
1203 C  CG  . ASP A 122 ? 0.2127  0.1765 0.1740 -0.0284 -0.0336 0.0419  122  ASP A CG  
1204 O  OD1 . ASP A 122 ? 0.2130  0.2204 0.2323 -0.0101 -0.0198 0.0150  122  ASP A OD1 
1205 O  OD2 . ASP A 122 ? 0.2635  0.1845 0.2381 -0.0200 -0.0082 0.0500  122  ASP A OD2 
1206 N  N   . GLU A 123 ? 0.1560  0.1452 0.0843 -0.0087 -0.0185 0.0191  123  GLU A N   
1207 C  CA  . GLU A 123 ? 0.1437  0.1616 0.1030 -0.0025 -0.0212 0.0309  123  GLU A CA  
1208 C  C   . GLU A 123 ? 0.1516  0.1440 0.0987 -0.0013 -0.0134 0.0212  123  GLU A C   
1209 O  O   . GLU A 123 ? 0.1768  0.1752 0.0910 0.0033  -0.0252 0.0329  123  GLU A O   
1210 C  CB  . GLU A 123 ? 0.1454  0.1922 0.1105 0.0093  -0.0128 0.0207  123  GLU A CB  
1211 C  CG  . GLU A 123 ? 0.2039  0.2478 0.1855 0.0708  -0.0291 0.0366  123  GLU A CG  
1212 C  CD  . GLU A 123 ? 0.2158  0.2554 0.3245 0.0571  0.0453  0.0202  123  GLU A CD  
1213 O  OE1 . GLU A 123 ? 0.3861  0.2549 0.2496 0.0891  0.0024  -0.0038 123  GLU A OE1 
1214 O  OE2 . GLU A 123 ? 0.2265  0.2986 0.2817 0.0244  0.0552  -0.0057 123  GLU A OE2 
1215 N  N   . MET A 124 ? 0.1523  0.1445 0.0933 -0.0132 -0.0139 0.0129  124  MET A N   
1216 C  CA  . MET A 124 ? 0.1477  0.1583 0.0966 -0.0088 -0.0092 0.0234  124  MET A CA  
1217 C  C   . MET A 124 ? 0.1387  0.1733 0.0947 -0.0222 -0.0243 0.0208  124  MET A C   
1218 O  O   . MET A 124 ? 0.1782  0.2089 0.0985 -0.0433 -0.0155 0.0420  124  MET A O   
1219 C  CB  . MET A 124 ? 0.1752  0.1634 0.1076 -0.0378 -0.0225 0.0071  124  MET A CB  
1220 C  CG  . MET A 124 ? 0.2692  0.1603 0.1038 -0.0353 -0.0222 0.0103  124  MET A CG  
1221 S  SD  . MET A 124 ? 0.3500  0.1891 0.1775 -0.0332 -0.1137 -0.0050 124  MET A SD  
1222 C  CE  . MET A 124 ? 0.2240  0.3864 0.2787 0.0091  -0.0345 0.0044  124  MET A CE  
1223 N  N   A ILE A 125 ? 0.1368  0.1735 0.0733 -0.0272 -0.0281 0.0054  125  ILE A N   
1224 N  N   B ILE A 125 ? 0.1526  0.1804 0.0741 -0.0119 -0.0089 0.0118  125  ILE A N   
1225 C  CA  A ILE A 125 ? 0.1442  0.1970 0.0829 0.0003  -0.0306 -0.0009 125  ILE A CA  
1226 C  CA  B ILE A 125 ? 0.1314  0.2091 0.0901 -0.0193 -0.0064 -0.0098 125  ILE A CA  
1227 C  C   A ILE A 125 ? 0.1206  0.1720 0.0697 0.0034  -0.0185 0.0189  125  ILE A C   
1228 C  C   B ILE A 125 ? 0.1332  0.1916 0.0992 -0.0208 -0.0224 0.0166  125  ILE A C   
1229 O  O   A ILE A 125 ? 0.1372  0.1413 0.0692 0.0128  -0.0136 0.0052  125  ILE A O   
1230 O  O   B ILE A 125 ? 0.1571  0.1983 0.1022 -0.0064 -0.0144 -0.0055 125  ILE A O   
1231 C  CB  A ILE A 125 ? 0.1419  0.2110 0.0745 0.0276  -0.0297 0.0053  125  ILE A CB  
1232 C  CB  B ILE A 125 ? 0.1344  0.2185 0.0732 0.0190  -0.0243 -0.0259 125  ILE A CB  
1233 C  CG1 A ILE A 125 ? 0.1332  0.2767 0.0823 0.0483  -0.0157 -0.0303 125  ILE A CG1 
1234 C  CG1 B ILE A 125 ? 0.1409  0.3104 0.1008 0.0057  -0.0409 0.0034  125  ILE A CG1 
1235 C  CG2 A ILE A 125 ? 0.2168  0.2214 0.0908 0.0539  -0.0560 -0.0147 125  ILE A CG2 
1236 C  CG2 B ILE A 125 ? 0.1996  0.2525 0.0895 0.0449  -0.0308 -0.0490 125  ILE A CG2 
1237 C  CD1 A ILE A 125 ? 0.2484  0.3304 0.1811 0.1591  -0.1069 -0.0659 125  ILE A CD1 
1238 C  CD1 B ILE A 125 ? 0.1242  0.5294 0.1545 -0.0537 -0.0377 -0.0559 125  ILE A CD1 
1239 N  N   . ARG A 126 ? 0.1442  0.1914 0.0828 -0.0353 -0.0236 0.0126  126  ARG A N   
1240 C  CA  . ARG A 126 ? 0.1292  0.2008 0.0994 -0.0175 -0.0281 0.0011  126  ARG A CA  
1241 C  C   . ARG A 126 ? 0.1423  0.2166 0.0958 0.0016  -0.0154 0.0142  126  ARG A C   
1242 O  O   . ARG A 126 ? 0.1459  0.2474 0.0944 0.0010  -0.0321 0.0094  126  ARG A O   
1243 C  CB  . ARG A 126 ? 0.1548  0.2625 0.1191 -0.0376 -0.0120 0.0419  126  ARG A CB  
1244 C  CG  . ARG A 126 ? 0.1929  0.2532 0.1598 -0.0523 -0.0383 0.0482  126  ARG A CG  
1245 C  CD  . ARG A 126 ? 0.1796  0.2688 0.2685 -0.0593 -0.0445 0.0833  126  ARG A CD  
1246 N  NE  . ARG A 126 ? 0.1769  0.2964 0.2230 -0.0240 -0.0676 0.1045  126  ARG A NE  
1247 C  CZ  . ARG A 126 ? 0.1906  0.3475 0.2241 -0.0387 -0.0963 0.0984  126  ARG A CZ  
1248 N  NH1 . ARG A 126 ? 0.2194  0.5535 0.3628 -0.0210 -0.1305 0.2480  126  ARG A NH1 
1249 N  NH2 . ARG A 126 ? 0.2952  0.5615 0.3386 0.0068  -0.1055 -0.1068 126  ARG A NH2 
1250 N  N   . GLU A 127 ? 0.1428  0.2074 0.0844 0.0042  -0.0059 0.0183  127  GLU A N   
1251 C  CA  . GLU A 127 ? 0.1628  0.2141 0.1260 0.0273  0.0000  0.0337  127  GLU A CA  
1252 C  C   . GLU A 127 ? 0.1966  0.1986 0.1197 0.0009  0.0106  0.0308  127  GLU A C   
1253 O  O   . GLU A 127 ? 0.2493  0.2761 0.1309 0.0174  -0.0148 0.0583  127  GLU A O   
1254 C  CB  . GLU A 127 ? 0.2572  0.1971 0.1454 0.0532  0.0187  0.0092  127  GLU A CB  
1255 C  CG  . GLU A 127 ? 0.2113  0.2334 0.1519 -0.0144 0.0163  0.0205  127  GLU A CG  
1256 C  CD  . GLU A 127 ? 0.1720  0.3046 0.2438 -0.0190 -0.0058 0.0217  127  GLU A CD  
1257 O  OE1 . GLU A 127 ? 0.2645  0.4687 0.2693 -0.1486 -0.0621 0.0633  127  GLU A OE1 
1258 O  OE2 . GLU A 127 ? 0.2614  0.2599 0.6295 0.0179  0.0139  0.0869  127  GLU A OE2 
1259 N  N   . ALA A 128 ? 0.1803  0.1987 0.1087 -0.0080 0.0135  0.0202  128  ALA A N   
1260 C  CA  . ALA A 128 ? 0.1954  0.1918 0.1213 -0.0348 0.0221  0.0175  128  ALA A CA  
1261 C  C   . ALA A 128 ? 0.1402  0.2003 0.0930 -0.0093 -0.0099 0.0243  128  ALA A C   
1262 O  O   . ALA A 128 ? 0.1515  0.2101 0.0969 -0.0236 -0.0059 0.0218  128  ALA A O   
1263 C  CB  . ALA A 128 ? 0.2132  0.2718 0.1355 -0.1054 0.0220  -0.0220 128  ALA A CB  
1264 N  N   . ASP A 129 ? 0.1533  0.2046 0.0842 -0.0188 0.0053  0.0018  129  ASP A N   
1265 C  CA  . ASP A 129 ? 0.1259  0.2126 0.0798 -0.0304 -0.0058 -0.0067 129  ASP A CA  
1266 C  C   . ASP A 129 ? 0.1298  0.2513 0.0887 -0.0061 -0.0036 0.0108  129  ASP A C   
1267 O  O   . ASP A 129 ? 0.1276  0.3231 0.1436 0.0074  -0.0062 0.0118  129  ASP A O   
1268 C  CB  . ASP A 129 ? 0.1522  0.2064 0.0886 -0.0136 0.0045  0.0058  129  ASP A CB  
1269 C  CG  . ASP A 129 ? 0.1394  0.2097 0.1052 -0.0386 -0.0062 -0.0065 129  ASP A CG  
1270 O  OD1 . ASP A 129 ? 0.1426  0.2034 0.1017 -0.0252 -0.0067 -0.0129 129  ASP A OD1 
1271 O  OD2 . ASP A 129 ? 0.1434  0.1937 0.1531 -0.0176 0.0208  0.0069  129  ASP A OD2 
1272 N  N   . ILE A 130 ? 0.1034  0.2500 0.0911 -0.0201 -0.0137 0.0077  130  ILE A N   
1273 C  CA  . ILE A 130 ? 0.1185  0.2604 0.0941 -0.0048 -0.0242 0.0039  130  ILE A CA  
1274 C  C   . ILE A 130 ? 0.1288  0.2694 0.0888 -0.0118 -0.0271 -0.0039 130  ILE A C   
1275 O  O   . ILE A 130 ? 0.1283  0.3077 0.1449 -0.0150 -0.0387 -0.0238 130  ILE A O   
1276 C  CB  . ILE A 130 ? 0.1397  0.2580 0.0897 0.0036  -0.0255 0.0095  130  ILE A CB  
1277 C  CG1 . ILE A 130 ? 0.1640  0.2532 0.1194 0.0019  -0.0330 0.0197  130  ILE A CG1 
1278 C  CG2 . ILE A 130 ? 0.1875  0.2911 0.1029 0.0055  -0.0444 0.0228  130  ILE A CG2 
1279 C  CD1 . ILE A 130 ? 0.1998  0.2427 0.1427 0.0097  -0.0120 0.0363  130  ILE A CD1 
1280 N  N   . ASP A 131 ? 0.1225  0.2656 0.0908 -0.0117 -0.0110 -0.0105 131  ASP A N   
1281 C  CA  . ASP A 131 ? 0.1516  0.2822 0.1004 -0.0095 -0.0239 -0.0261 131  ASP A CA  
1282 C  C   . ASP A 131 ? 0.1526  0.2593 0.1284 -0.0263 -0.0272 -0.0391 131  ASP A C   
1283 O  O   . ASP A 131 ? 0.2315  0.3034 0.1703 -0.0697 -0.0253 -0.0546 131  ASP A O   
1284 C  CB  . ASP A 131 ? 0.1674  0.2547 0.1065 -0.0047 -0.0176 -0.0345 131  ASP A CB  
1285 C  CG  . ASP A 131 ? 0.1515  0.2446 0.1111 -0.0196 -0.0183 -0.0314 131  ASP A CG  
1286 O  OD1 . ASP A 131 ? 0.1513  0.2163 0.1041 -0.0285 -0.0093 -0.0181 131  ASP A OD1 
1287 O  OD2 . ASP A 131 ? 0.1640  0.3397 0.1046 0.0126  -0.0031 -0.0196 131  ASP A OD2 
1288 N  N   . GLY A 132 ? 0.1442  0.2501 0.1238 -0.0283 -0.0081 -0.0073 132  GLY A N   
1289 C  CA  . GLY A 132 ? 0.1386  0.2522 0.1772 -0.0303 0.0035  -0.0070 132  GLY A CA  
1290 C  C   . GLY A 132 ? 0.1580  0.2743 0.1598 -0.0572 -0.0304 0.0287  132  GLY A C   
1291 O  O   . GLY A 132 ? 0.1995  0.2706 0.2071 -0.0818 -0.0123 0.0177  132  GLY A O   
1292 N  N   . ASP A 133 ? 0.1465  0.2282 0.1584 -0.0422 -0.0267 -0.0010 133  ASP A N   
1293 C  CA  . ASP A 133 ? 0.1764  0.2009 0.1628 -0.0264 -0.0203 -0.0406 133  ASP A CA  
1294 C  C   . ASP A 133 ? 0.1878  0.1823 0.1582 -0.0339 -0.0287 -0.0102 133  ASP A C   
1295 O  O   . ASP A 133 ? 0.2127  0.1760 0.1997 -0.0351 -0.0487 0.0063  133  ASP A O   
1296 C  CB  . ASP A 133 ? 0.1976  0.1748 0.1851 -0.0186 0.0017  -0.0409 133  ASP A CB  
1297 C  CG  . ASP A 133 ? 0.1730  0.1848 0.1351 -0.0119 -0.0090 -0.0178 133  ASP A CG  
1298 O  OD1 . ASP A 133 ? 0.1616  0.1733 0.1266 -0.0196 -0.0125 -0.0051 133  ASP A OD1 
1299 O  OD2 . ASP A 133 ? 0.1785  0.2108 0.1939 -0.0008 -0.0021 -0.0300 133  ASP A OD2 
1300 N  N   . GLY A 134 ? 0.1598  0.1935 0.1310 -0.0472 -0.0040 -0.0082 134  GLY A N   
1301 C  CA  . GLY A 134 ? 0.1583  0.1917 0.1322 -0.0497 -0.0100 0.0128  134  GLY A CA  
1302 C  C   . GLY A 134 ? 0.1419  0.1624 0.1223 -0.0145 -0.0105 0.0045  134  GLY A C   
1303 O  O   . GLY A 134 ? 0.1684  0.1857 0.1201 -0.0167 -0.0159 0.0256  134  GLY A O   
1304 N  N   . HIS A 135 ? 0.1339  0.1587 0.1120 -0.0232 -0.0222 0.0017  135  HIS A N   
1305 C  CA  . HIS A 135 ? 0.1312  0.1593 0.1177 -0.0131 -0.0069 -0.0017 135  HIS A CA  
1306 C  C   . HIS A 135 ? 0.1166  0.1600 0.0956 -0.0073 -0.0177 0.0056  135  HIS A C   
1307 O  O   . HIS A 135 ? 0.1254  0.1724 0.1055 -0.0233 -0.0223 -0.0016 135  HIS A O   
1308 C  CB  . HIS A 135 ? 0.1440  0.1728 0.1298 0.0033  -0.0046 0.0021  135  HIS A CB  
1309 C  CG  . HIS A 135 ? 0.1920  0.1560 0.1283 0.0072  -0.0292 -0.0228 135  HIS A CG  
1310 N  ND1 . HIS A 135 ? 0.2202  0.1657 0.1744 -0.0111 -0.0290 -0.0104 135  HIS A ND1 
1311 C  CD2 . HIS A 135 ? 0.2071  0.1883 0.1501 0.0227  -0.0289 0.0073  135  HIS A CD2 
1312 C  CE1 . HIS A 135 ? 0.3048  0.1433 0.2174 -0.0103 -0.0672 -0.0170 135  HIS A CE1 
1313 N  NE2 . HIS A 135 ? 0.2601  0.1590 0.1950 0.0346  -0.0233 -0.0063 135  HIS A NE2 
1314 N  N   A ILE A 136 ? 0.1105  0.1630 0.1019 -0.0059 -0.0133 0.0082  136  ILE A N   
1315 N  N   B ILE A 136 ? 0.1221  0.1621 0.0961 -0.0106 -0.0226 0.0092  136  ILE A N   
1316 C  CA  A ILE A 136 ? 0.1006  0.1685 0.0961 -0.0033 -0.0239 0.0141  136  ILE A CA  
1317 C  CA  B ILE A 136 ? 0.1100  0.1555 0.1009 0.0042  -0.0096 0.0067  136  ILE A CA  
1318 C  C   A ILE A 136 ? 0.1114  0.1643 0.1017 -0.0236 -0.0190 0.0095  136  ILE A C   
1319 C  C   B ILE A 136 ? 0.0995  0.1191 0.1014 0.0170  -0.0199 0.0093  136  ILE A C   
1320 O  O   A ILE A 136 ? 0.1054  0.2032 0.0952 0.0021  -0.0045 0.0063  136  ILE A O   
1321 O  O   B ILE A 136 ? 0.1025  0.0951 0.1286 -0.0039 -0.0319 0.0186  136  ILE A O   
1322 C  CB  A ILE A 136 ? 0.1190  0.1580 0.1176 0.0080  -0.0317 0.0101  136  ILE A CB  
1323 C  CB  B ILE A 136 ? 0.0990  0.1630 0.0880 -0.0147 0.0021  0.0076  136  ILE A CB  
1324 C  CG1 A ILE A 136 ? 0.1501  0.1555 0.1078 -0.0043 -0.0146 0.0018  136  ILE A CG1 
1325 C  CG1 B ILE A 136 ? 0.0948  0.1877 0.0865 -0.0174 -0.0010 0.0078  136  ILE A CG1 
1326 C  CG2 A ILE A 136 ? 0.1412  0.1689 0.0937 -0.0129 -0.0388 0.0039  136  ILE A CG2 
1327 C  CG2 B ILE A 136 ? 0.1418  0.1427 0.2041 0.0483  0.1140  0.0241  136  ILE A CG2 
1328 C  CD1 A ILE A 136 ? 0.1205  0.2553 0.1867 0.0357  -0.0089 -0.0002 136  ILE A CD1 
1329 C  CD1 B ILE A 136 ? 0.1234  0.1987 0.0956 0.0155  -0.0065 -0.0053 136  ILE A CD1 
1330 N  N   . ASN A 137 ? 0.1033  0.1800 0.1017 0.0033  -0.0131 -0.0013 137  ASN A N   
1331 C  CA  . ASN A 137 ? 0.1165  0.1804 0.1077 0.0090  -0.0061 -0.0016 137  ASN A CA  
1332 C  C   . ASN A 137 ? 0.1041  0.1890 0.0945 0.0061  -0.0112 0.0049  137  ASN A C   
1333 O  O   . ASN A 137 ? 0.1125  0.1860 0.0998 0.0019  -0.0110 0.0078  137  ASN A O   
1334 C  CB  . ASN A 137 ? 0.1358  0.2076 0.1241 -0.0043 -0.0019 -0.0224 137  ASN A CB  
1335 C  CG  . ASN A 137 ? 0.1689  0.2125 0.1090 -0.0141 -0.0184 -0.0114 137  ASN A CG  
1336 O  OD1 . ASN A 137 ? 0.1566  0.2251 0.1151 0.0054  -0.0260 -0.0075 137  ASN A OD1 
1337 N  ND2 . ASN A 137 ? 0.2309  0.2860 0.1545 0.0139  -0.0534 -0.0693 137  ASN A ND2 
1338 N  N   A TYR A 138 ? 0.1183  0.2035 0.1052 -0.0043 -0.0054 0.0077  138  TYR A N   
1339 N  N   B TYR A 138 ? 0.1456  0.2144 0.1155 0.0066  0.0213  0.0250  138  TYR A N   
1340 C  CA  A TYR A 138 ? 0.1049  0.2051 0.1298 -0.0016 0.0056  0.0169  138  TYR A CA  
1341 C  CA  B TYR A 138 ? 0.1330  0.2176 0.0852 0.0008  0.0104  0.0123  138  TYR A CA  
1342 C  C   A TYR A 138 ? 0.1147  0.2133 0.0909 -0.0004 0.0089  0.0124  138  TYR A C   
1343 C  C   B TYR A 138 ? 0.1280  0.2147 0.0838 -0.0075 0.0090  0.0173  138  TYR A C   
1344 O  O   A TYR A 138 ? 0.1273  0.1935 0.1146 -0.0076 -0.0160 0.0239  138  TYR A O   
1345 O  O   B TYR A 138 ? 0.1071  0.2203 0.1160 -0.0009 0.0003  0.0043  138  TYR A O   
1346 C  CB  A TYR A 138 ? 0.1295  0.1989 0.1118 0.0123  0.0343  0.0162  138  TYR A CB  
1347 C  CB  B TYR A 138 ? 0.1468  0.2117 0.1167 0.0020  0.0337  0.0025  138  TYR A CB  
1348 C  CG  A TYR A 138 ? 0.1105  0.2074 0.1241 -0.0057 0.0080  0.0272  138  TYR A CG  
1349 C  CG  B TYR A 138 ? 0.1328  0.2116 0.1019 0.0090  0.0206  0.0075  138  TYR A CG  
1350 C  CD1 A TYR A 138 ? 0.1225  0.2595 0.1283 -0.0407 -0.0073 0.0377  138  TYR A CD1 
1351 C  CD1 B TYR A 138 ? 0.1159  0.2630 0.1056 -0.0423 -0.0121 0.0347  138  TYR A CD1 
1352 C  CD2 A TYR A 138 ? 0.1609  0.2125 0.1060 0.0059  0.0432  0.0110  138  TYR A CD2 
1353 C  CD2 B TYR A 138 ? 0.1558  0.2671 0.1015 -0.0328 0.0208  0.0183  138  TYR A CD2 
1354 C  CE1 A TYR A 138 ? 0.1243  0.2548 0.1383 -0.0428 -0.0014 0.0045  138  TYR A CE1 
1355 C  CE1 B TYR A 138 ? 0.0793  0.2461 0.1354 -0.0192 -0.0049 0.0297  138  TYR A CE1 
1356 C  CE2 A TYR A 138 ? 0.1526  0.2416 0.1316 -0.0111 0.0027  0.0610  138  TYR A CE2 
1357 C  CE2 B TYR A 138 ? 0.1422  0.2657 0.1149 -0.0199 0.0455  0.0225  138  TYR A CE2 
1358 C  CZ  A TYR A 138 ? 0.1715  0.1940 0.1739 0.0022  0.0292  0.0208  138  TYR A CZ  
1359 C  CZ  B TYR A 138 ? 0.0965  0.2358 0.1402 -0.0072 0.0179  0.0326  138  TYR A CZ  
1360 O  OH  A TYR A 138 ? 0.1676  0.2304 0.3079 -0.0366 -0.0188 0.0640  138  TYR A OH  
1361 O  OH  B TYR A 138 ? 0.2008  0.2544 0.2142 -0.0469 -0.0058 0.0678  138  TYR A OH  
1362 N  N   . GLU A 139 ? 0.1441  0.2190 0.1016 0.0009  -0.0049 0.0113  139  GLU A N   
1363 C  CA  . GLU A 139 ? 0.1501  0.2276 0.1019 -0.0068 -0.0134 0.0169  139  GLU A CA  
1364 C  C   . GLU A 139 ? 0.1247  0.2167 0.1033 -0.0055 -0.0235 0.0244  139  GLU A C   
1365 O  O   . GLU A 139 ? 0.1528  0.2072 0.1142 -0.0017 -0.0242 0.0282  139  GLU A O   
1366 C  CB  . GLU A 139 ? 0.1886  0.2691 0.0970 -0.0303 -0.0216 0.0170  139  GLU A CB  
1367 C  CG  . GLU A 139 ? 0.2256  0.2801 0.1134 -0.0226 -0.0563 0.0239  139  GLU A CG  
1368 C  CD  . GLU A 139 ? 0.2547  0.3223 0.1427 -0.0485 -0.0787 0.0161  139  GLU A CD  
1369 O  OE1 . GLU A 139 ? 0.4119  0.3939 0.1616 0.0227  -0.1436 -0.0615 139  GLU A OE1 
1370 O  OE2 . GLU A 139 ? 0.2687  0.4150 0.1850 -0.0266 -0.1126 0.0068  139  GLU A OE2 
1371 N  N   . GLU A 140 ? 0.1266  0.1935 0.0929 -0.0070 -0.0254 0.0050  140  GLU A N   
1372 C  CA  . GLU A 140 ? 0.1143  0.1999 0.0991 -0.0129 -0.0189 0.0121  140  GLU A CA  
1373 C  C   . GLU A 140 ? 0.1018  0.1801 0.1051 -0.0087 -0.0102 0.0180  140  GLU A C   
1374 O  O   . GLU A 140 ? 0.1197  0.1900 0.1402 0.0041  -0.0231 0.0064  140  GLU A O   
1375 C  CB  . GLU A 140 ? 0.1226  0.1806 0.1008 -0.0031 -0.0197 0.0044  140  GLU A CB  
1376 C  CG  . GLU A 140 ? 0.1200  0.2147 0.1077 -0.0245 -0.0441 0.0245  140  GLU A CG  
1377 C  CD  . GLU A 140 ? 0.1115  0.1978 0.0820 -0.0160 -0.0083 0.0049  140  GLU A CD  
1378 O  OE1 . GLU A 140 ? 0.1139  0.2077 0.1070 -0.0129 -0.0256 0.0149  140  GLU A OE1 
1379 O  OE2 . GLU A 140 ? 0.1211  0.2125 0.0969 -0.0223 -0.0256 0.0038  140  GLU A OE2 
1380 N  N   A PHE A 141 ? 0.1117  0.1732 0.1039 -0.0051 -0.0206 0.0109  141  PHE A N   
1381 N  N   B PHE A 141 ? 0.1119  0.1825 0.0997 -0.0023 -0.0185 0.0041  141  PHE A N   
1382 C  CA  A PHE A 141 ? 0.1089  0.1908 0.1020 -0.0110 -0.0118 0.0072  141  PHE A CA  
1383 C  CA  B PHE A 141 ? 0.1108  0.1858 0.1051 -0.0148 -0.0089 0.0037  141  PHE A CA  
1384 C  C   A PHE A 141 ? 0.1172  0.1918 0.1249 -0.0217 -0.0155 0.0059  141  PHE A C   
1385 C  C   B PHE A 141 ? 0.1368  0.1904 0.1386 -0.0173 0.0007  0.0111  141  PHE A C   
1386 O  O   A PHE A 141 ? 0.1620  0.1880 0.1478 -0.0219 -0.0069 -0.0026 141  PHE A O   
1387 O  O   B PHE A 141 ? 0.1492  0.1845 0.1344 -0.0043 -0.0153 0.0153  141  PHE A O   
1388 C  CB  A PHE A 141 ? 0.1028  0.2187 0.0879 -0.0099 -0.0067 0.0115  141  PHE A CB  
1389 C  CB  B PHE A 141 ? 0.1086  0.2057 0.1231 -0.0139 -0.0153 -0.0058 141  PHE A CB  
1390 C  CG  A PHE A 141 ? 0.1101  0.2261 0.1009 -0.0302 -0.0054 0.0116  141  PHE A CG  
1391 C  CG  B PHE A 141 ? 0.1129  0.2219 0.1148 -0.0415 -0.0069 0.0078  141  PHE A CG  
1392 C  CD1 A PHE A 141 ? 0.1019  0.2253 0.1076 -0.0438 0.0112  -0.0239 141  PHE A CD1 
1393 C  CD1 B PHE A 141 ? 0.1417  0.1772 0.1127 0.0032  -0.0096 0.0086  141  PHE A CD1 
1394 C  CD2 A PHE A 141 ? 0.1115  0.1976 0.1063 -0.0133 0.0120  0.0063  141  PHE A CD2 
1395 C  CD2 B PHE A 141 ? 0.1308  0.1987 0.1432 -0.0355 -0.0135 0.0160  141  PHE A CD2 
1396 C  CE1 A PHE A 141 ? 0.1349  0.2760 0.1231 -0.0476 -0.0239 -0.0206 141  PHE A CE1 
1397 C  CE1 B PHE A 141 ? 0.1919  0.2161 0.1190 -0.0269 -0.0244 0.0165  141  PHE A CE1 
1398 C  CE2 A PHE A 141 ? 0.1058  0.2719 0.1532 -0.0386 -0.0187 0.0013  141  PHE A CE2 
1399 C  CE2 B PHE A 141 ? 0.1140  0.2693 0.1515 -0.0680 -0.0060 0.0104  141  PHE A CE2 
1400 C  CZ  A PHE A 141 ? 0.1401  0.3062 0.1452 -0.0757 -0.0332 -0.0460 141  PHE A CZ  
1401 C  CZ  B PHE A 141 ? 0.1560  0.2893 0.1402 -0.0575 -0.0071 -0.0061 141  PHE A CZ  
1402 N  N   . VAL A 142 ? 0.1214  0.1994 0.1292 -0.0161 -0.0130 0.0230  142  VAL A N   
1403 C  CA  . VAL A 142 ? 0.1547  0.1907 0.1491 -0.0198 -0.0146 0.0235  142  VAL A CA  
1404 C  C   . VAL A 142 ? 0.1521  0.1940 0.2056 -0.0115 0.0055  0.0430  142  VAL A C   
1405 O  O   . VAL A 142 ? 0.1876  0.1849 0.2504 -0.0101 0.0161  0.0420  142  VAL A O   
1406 C  CB  . VAL A 142 ? 0.1637  0.2324 0.1859 0.0019  0.0145  0.0644  142  VAL A CB  
1407 C  CG1 . VAL A 142 ? 0.2203  0.2429 0.1882 -0.0071 -0.0049 0.0689  142  VAL A CG1 
1408 C  CG2 . VAL A 142 ? 0.1503  0.2631 0.1997 -0.0088 0.0072  0.0572  142  VAL A CG2 
1409 N  N   A ARG A 143 ? 0.1358  0.1833 0.1784 -0.0052 0.0069  0.0765  143  ARG A N   
1410 N  N   B ARG A 143 ? 0.1481  0.2355 0.2048 0.0181  -0.0170 -0.0060 143  ARG A N   
1411 C  CA  A ARG A 143 ? 0.1505  0.2485 0.2441 0.0280  -0.0005 0.0957  143  ARG A CA  
1412 C  CA  B ARG A 143 ? 0.1572  0.2156 0.2114 0.0121  -0.0157 0.0816  143  ARG A CA  
1413 C  C   A ARG A 143 ? 0.1655  0.2196 0.2787 0.0342  0.0415  0.0943  143  ARG A C   
1414 C  C   B ARG A 143 ? 0.1452  0.2419 0.2406 0.0424  0.0196  0.0920  143  ARG A C   
1415 O  O   A ARG A 143 ? 0.3288  0.2491 0.4021 0.1078  0.1691  0.1635  143  ARG A O   
1416 O  O   B ARG A 143 ? 0.2067  0.2399 0.2134 0.0458  0.0153  0.0987  143  ARG A O   
1417 C  CB  A ARG A 143 ? 0.1377  0.2146 0.2477 0.0290  -0.0149 0.1395  143  ARG A CB  
1418 C  CB  B ARG A 143 ? 0.1451  0.2180 0.2573 -0.0009 -0.0270 0.1073  143  ARG A CB  
1419 C  CG  A ARG A 143 ? 0.1430  0.2865 0.2195 0.0358  -0.0523 0.1152  143  ARG A CG  
1420 C  CG  B ARG A 143 ? 0.2157  0.2396 0.2499 -0.0089 -0.0639 0.0676  143  ARG A CG  
1421 C  CD  A ARG A 143 ? 0.2045  0.3037 0.2431 -0.0190 -0.0810 0.1431  143  ARG A CD  
1422 C  CD  B ARG A 143 ? 0.2566  0.3669 0.3544 0.0010  -0.1325 0.0269  143  ARG A CD  
1423 N  NE  A ARG A 143 ? 0.3402  0.3249 0.3869 0.0043  -0.1205 0.0540  143  ARG A NE  
1424 N  NE  B ARG A 143 ? 0.2484  0.2993 0.2731 -0.0172 -0.1569 0.1143  143  ARG A NE  
1425 C  CZ  A ARG A 143 ? 0.3542  0.3460 0.3651 0.0179  -0.0897 -0.0026 143  ARG A CZ  
1426 C  CZ  B ARG A 143 ? 0.1966  0.3023 0.2075 -0.0062 -0.1120 0.1164  143  ARG A CZ  
1427 N  NH1 A ARG A 143 ? 0.3583  0.4129 0.3780 -0.0901 -0.1453 0.0681  143  ARG A NH1 
1428 N  NH1 B ARG A 143 ? 0.1878  0.3056 0.3017 -0.0223 -0.0770 0.0956  143  ARG A NH1 
1429 N  NH2 A ARG A 143 ? 0.5905  0.3331 0.5589 0.1231  -0.1969 -0.1283 143  ARG A NH2 
1430 N  NH2 B ARG A 143 ? 0.2307  0.2987 0.2693 0.0009  -0.0879 0.0998  143  ARG A NH2 
1431 N  N   A MET A 144 ? 0.1645  0.1991 0.2394 0.0073  0.0272  0.0551  144  MET A N   
1432 N  N   B MET A 144 ? 0.1432  0.1910 0.2205 0.0634  0.0112  0.0523  144  MET A N   
1433 C  CA  A MET A 144 ? 0.2090  0.2116 0.2599 0.0198  0.0378  0.0406  144  MET A CA  
1434 C  CA  B MET A 144 ? 0.1956  0.2195 0.2292 0.0402  0.0293  0.0408  144  MET A CA  
1435 C  C   A MET A 144 ? 0.2359  0.2174 0.2706 -0.0005 0.0954  0.0203  144  MET A C   
1436 C  C   B MET A 144 ? 0.2205  0.2446 0.2829 0.0335  0.0537  -0.0187 144  MET A C   
1437 O  O   A MET A 144 ? 0.2891  0.1788 0.4134 0.0009  0.1377  0.0449  144  MET A O   
1438 O  O   B MET A 144 ? 0.3385  0.2199 0.3547 -0.0176 0.1766  -0.0239 144  MET A O   
1439 C  CB  A MET A 144 ? 0.1898  0.2145 0.2275 0.0233  0.0389  0.0340  144  MET A CB  
1440 C  CB  B MET A 144 ? 0.3168  0.2225 0.1715 0.0469  -0.0203 0.0348  144  MET A CB  
1441 C  CG  A MET A 144 ? 0.2383  0.3172 0.1968 0.0274  -0.0209 -0.0117 144  MET A CG  
1442 C  CG  B MET A 144 ? 0.2656  0.2986 0.2442 -0.0205 0.0308  0.0553  144  MET A CG  
1443 S  SD  A MET A 144 ? 0.2403  0.2217 0.3339 0.0249  0.1055  0.0084  144  MET A SD  
1444 S  SD  B MET A 144 ? 0.2752  0.2230 0.4681 -0.0018 -0.0443 0.0836  144  MET A SD  
1445 C  CE  A MET A 144 ? 0.5606  0.5619 0.5208 0.1101  0.3236  0.1791  144  MET A CE  
1446 C  CE  B MET A 144 ? 0.4698  0.2898 0.6137 0.1941  -0.0019 -0.1330 144  MET A CE  
1447 N  N   . MET A 145 ? 0.2357  0.2495 0.2452 -0.0199 0.0717  0.0026  145  MET A N   
1448 C  CA  . MET A 145 ? 0.2722  0.2579 0.3553 -0.0333 0.0752  -0.0289 145  MET A CA  
1449 C  C   . MET A 145 ? 0.4104  0.2359 0.3765 -0.0145 0.1938  -0.0286 145  MET A C   
1450 O  O   . MET A 145 ? 0.7055  0.2591 0.4600 -0.0271 0.2411  -0.0838 145  MET A O   
1451 C  CB  . MET A 145 ? 0.2596  0.3612 0.3022 -0.0468 0.0417  -0.1345 145  MET A CB  
1452 C  CG  . MET A 145 ? 0.3175  0.3867 0.2875 0.0268  -0.0763 -0.1897 145  MET A CG  
1453 S  SD  . MET A 145 ? 0.5435  0.5324 0.2800 0.0206  0.0225  -0.1330 145  MET A SD  
1454 C  CE  . MET A 145 ? 1.0721  1.2955 0.9706 -0.6473 0.6217  -0.6376 145  MET A CE  
1455 N  N   . VAL A 146 ? 0.4101  0.2230 0.3835 -0.0301 0.1589  0.0167  146  VAL A N   
1456 C  CA  . VAL A 146 ? 0.4249  0.2394 0.4893 -0.0083 0.2020  0.0623  146  VAL A CA  
1457 C  C   . VAL A 146 ? 0.4430  0.2695 0.5865 0.0128  0.2079  0.1238  146  VAL A C   
1458 O  O   . VAL A 146 ? 0.5842  0.2925 0.5920 0.0719  0.1689  0.1174  146  VAL A O   
1459 C  CB  . VAL A 146 ? 0.4308  0.3201 0.4515 0.0113  0.1588  0.1163  146  VAL A CB  
1460 C  CG1 . VAL A 146 ? 0.3889  0.2998 0.6241 -0.0123 0.2159  0.0678  146  VAL A CG1 
1461 C  CG2 . VAL A 146 ? 0.4886  0.2586 0.4437 0.0331  0.1471  0.1182  146  VAL A CG2 
1462 N  N   . SER A 147 ? 0.4338  0.3855 0.7786 0.0012  0.3105  0.1274  147  SER A N   
1463 C  CA  . SER A 147 ? 0.4726  0.5049 0.9159 -0.0885 0.1231  0.2093  147  SER A CA  
1464 C  C   . SER A 147 ? 0.3643  0.3666 0.9559 -0.0970 0.1280  0.1031  147  SER A C   
1465 O  O   . SER A 147 ? 0.4227  0.3007 0.9284 0.0158  0.2931  0.0904  147  SER A O   
1466 C  CB  . SER A 147 ? 0.6665  0.5178 0.9226 0.1015  0.1128  0.1380  147  SER A CB  
1467 O  OG  . SER A 147 ? 0.5747  0.4965 0.8395 0.2358  0.0906  0.2864  147  SER A OG  
1468 CA CA  . CA  B .   ? 0.1024  0.0529 0.1331 -0.0178 -0.0193 0.0033  1000 CA  A CA  
1469 CA CA  . CA  C .   ? 0.2049  0.0526 0.1538 0.0133  -0.0782 -0.0018 1001 CA  A CA  
1470 CA CA  . CA  D .   ? 0.1227  0.1912 0.0981 -0.0198 -0.0186 -0.0032 1002 CA  A CA  
1471 CA CA  . CA  E .   ? 0.1374  0.0673 0.2082 -0.0102 -0.0294 0.0225  1003 CA  A CA  
1472 CA CA  . CA  F .   ? 0.1781  0.1881 0.1666 0.0585  0.0235  0.0275  1004 CA  A CA  
1473 O  O   . HOH G .   ? 0.1318  0.0765 0.1674 -0.0196 -0.0139 0.0256  2000 HOH A O   
1474 O  O   . HOH G .   ? 0.1520  0.1232 0.1265 -0.0167 -0.0306 -0.0012 2001 HOH A O   
1475 O  O   . HOH G .   ? 0.1710  0.0890 0.1203 -0.0384 -0.0226 0.0257  2002 HOH A O   
1476 O  O   . HOH G .   ? 0.1581  0.1114 0.1308 0.0013  -0.0139 0.0085  2003 HOH A O   
1477 O  O   . HOH G .   ? 0.1550  0.0932 0.1329 -0.0018 -0.0109 0.0188  2004 HOH A O   
1478 O  O   . HOH G .   ? 0.1326  0.2395 0.1533 -0.0052 -0.0167 0.0488  2005 HOH A O   
1479 O  O   . HOH G .   ? 0.1647  0.0863 0.1517 -0.0023 -0.0105 0.0286  2006 HOH A O   
1480 O  O   . HOH G .   ? 0.1685  0.1004 0.1605 0.0026  -0.0208 -0.0273 2007 HOH A O   
1481 O  O   . HOH G .   ? 0.2183  0.0821 0.2215 0.0098  -0.0378 0.0104  2008 HOH A O   
1482 O  O   . HOH G .   ? 0.1594  0.0766 0.2035 -0.0195 -0.0444 0.0249  2009 HOH A O   
1483 O  O   . HOH G .   ? 0.1508  0.1433 0.1848 -0.0032 -0.0285 0.0022  2010 HOH A O   
1484 O  O   . HOH G .   ? 0.2127  0.1702 0.1778 0.0645  -0.1049 -0.0645 2011 HOH A O   
1485 O  O   . HOH G .   ? 0.1887  0.1811 0.1825 -0.0451 -0.0435 -0.0082 2012 HOH A O   
1486 O  O   . HOH G .   ? 0.1751  0.0890 0.1707 -0.0140 -0.0330 0.0239  2013 HOH A O   
1487 O  O   . HOH G .   ? 0.2215  0.1561 0.1821 -0.0861 0.0463  -0.0286 2014 HOH A O   
1488 O  O   . HOH G .   ? 0.1380  0.2379 0.1840 0.0075  -0.0089 -0.0758 2015 HOH A O   
1489 O  O   . HOH G .   ? 0.1744  0.1582 0.2685 0.0166  0.0540  0.0130  2016 HOH A O   
1490 O  O   . HOH G .   ? 0.1629  0.1413 0.3555 -0.0124 -0.0878 0.0334  2017 HOH A O   
1491 O  O   . HOH G .   ? 0.1771  0.1812 0.2183 -0.0416 -0.0281 0.0231  2018 HOH A O   
1492 O  O   . HOH G .   ? 0.2105  0.1375 0.2298 -0.0263 0.0303  -0.0108 2019 HOH A O   
1493 O  O   . HOH G .   ? 0.2204  0.1532 0.2246 -0.0387 -0.1002 0.0151  2020 HOH A O   
1494 O  O   . HOH G .   ? 0.2114  0.4519 0.1168 0.0446  -0.0133 -0.0099 2021 HOH A O   
1495 O  O   . HOH G .   ? 0.1832  0.2640 0.1697 0.0495  0.0479  0.0186  2022 HOH A O   
1496 O  O   . HOH G .   ? 0.2678  0.2671 0.2390 0.0228  -0.0986 -0.0139 2023 HOH A O   
1497 O  O   . HOH G .   ? 0.3099  0.1655 0.2325 0.0743  0.0579  0.0560  2024 HOH A O   
1498 O  O   . HOH G .   ? 0.2310  0.1700 0.1807 -0.0124 -0.0743 -0.0349 2025 HOH A O   
1499 O  O   . HOH G .   ? 0.2335  0.1342 0.2974 0.0074  -0.0435 -0.0612 2026 HOH A O   
1500 O  O   . HOH G .   ? 0.2573  0.2104 0.1966 0.0000  -0.0671 -0.0248 2027 HOH A O   
1501 O  O   . HOH G .   ? 0.2121  0.2158 0.2294 -0.0437 0.0065  0.0222  2028 HOH A O   
1502 O  O   . HOH G .   ? 0.1591  0.3297 0.2223 0.0150  -0.0447 -0.0159 2029 HOH A O   
1503 O  O   . HOH G .   ? 0.4448  0.1999 0.3100 -0.1048 -0.1775 0.0523  2030 HOH A O   
1504 O  O   . HOH G .   ? 0.3345  0.3068 0.1786 -0.0663 -0.0346 0.1031  2031 HOH A O   
1505 O  O   . HOH G .   ? 0.1600  0.3695 0.2098 -0.0188 -0.0101 0.1177  2032 HOH A O   
1506 O  O   . HOH G .   ? 0.1659  0.3898 0.2049 -0.0161 0.0210  0.0677  2033 HOH A O   
1507 O  O   . HOH G .   ? 0.1797  0.1104 0.6943 -0.0091 0.0215  0.0892  2034 HOH A O   
1508 O  O   . HOH G .   ? 0.3576  0.1511 0.2880 -0.1106 0.0554  -0.0697 2035 HOH A O   
1509 O  O   . HOH G .   ? 0.2422  0.2817 0.1646 -0.0894 -0.0073 -0.0175 2036 HOH A O   
1510 O  O   . HOH G .   ? 0.2068  0.3536 0.5787 0.0428  -0.1277 -0.3095 2037 HOH A O   
1511 O  O   . HOH G .   ? 0.2733  0.2217 0.2839 -0.1216 -0.1045 0.0355  2038 HOH A O   
1512 O  O   . HOH G .   ? 0.2883  0.2058 0.2931 -0.0145 -0.0631 0.0134  2039 HOH A O   
1513 O  O   . HOH G .   ? 0.2142  0.1555 0.3420 0.0143  -0.0001 0.0949  2040 HOH A O   
1514 O  O   A HOH G .   ? 0.1265  0.0769 0.1023 -0.0355 0.0032  -0.0043 2041 HOH A O   
1515 O  O   B HOH G .   ? 0.1655  0.1283 0.1388 -0.0186 0.0063  -0.0542 2042 HOH A O   
1516 O  O   C HOH G .   ? 0.1649  0.1064 0.1211 -0.0330 -0.0108 -0.0338 2043 HOH A O   
1517 O  O   A HOH G .   ? 0.1117  0.1001 0.1374 0.0199  -0.0334 -0.0183 2044 HOH A O   
1518 O  O   B HOH G .   ? 0.1018  0.0726 0.1097 -0.0123 -0.0512 -0.0122 2045 HOH A O   
1519 O  O   C HOH G .   ? 0.1748  0.1097 0.1416 0.0374  -0.0333 0.0062  2046 HOH A O   
1520 O  O   . HOH G .   ? 0.2579  0.2275 0.2984 -0.0186 0.0468  -0.0864 2047 HOH A O   
1521 O  O   . HOH G .   ? 0.3938  0.2807 0.5026 -0.0269 0.3132  0.0072  2048 HOH A O   
1522 O  O   . HOH G .   ? 0.3106  0.1886 0.3196 -0.1009 -0.1134 0.0515  2049 HOH A O   
1523 O  O   . HOH G .   ? 0.2866  0.4590 0.1837 -0.0183 -0.0798 -0.0469 2050 HOH A O   
1524 O  O   . HOH G .   ? 0.5320  0.1669 0.2547 -0.1788 -0.1586 0.0668  2051 HOH A O   
1525 O  O   . HOH G .   ? 0.6884  0.1673 0.4618 -0.0820 -0.3553 0.0570  2052 HOH A O   
1526 O  O   . HOH G .   ? 0.2687  0.2558 0.4359 -0.1118 0.1656  -0.0863 2053 HOH A O   
1527 O  O   . HOH G .   ? 0.2962  0.3319 0.3204 0.0563  -0.0524 0.1205  2054 HOH A O   
1528 O  O   . HOH G .   ? 0.3056  0.2487 0.2728 -0.0597 -0.0258 -0.0064 2055 HOH A O   
1529 O  O   . HOH G .   ? 0.4594  0.2986 0.2340 0.0414  -0.0715 -0.1124 2056 HOH A O   
1530 O  O   . HOH G .   ? 0.5373  0.2809 0.3064 -0.0589 0.0829  0.0441  2057 HOH A O   
1531 O  O   . HOH G .   ? 0.4393  0.3632 0.2145 0.0304  0.0890  -0.0717 2058 HOH A O   
1532 O  O   . HOH G .   ? 0.3806  0.3703 0.3092 0.1795  0.0326  0.1349  2059 HOH A O   
1533 O  O   . HOH G .   ? 0.4282  0.1463 0.3544 0.0225  0.1548  0.0596  2060 HOH A O   
1534 O  O   . HOH G .   ? 0.3443  0.3683 0.4275 0.0986  -0.0632 0.0358  2061 HOH A O   
1535 O  O   . HOH G .   ? 0.3612  0.3117 0.2758 0.0384  -0.0878 -0.0091 2062 HOH A O   
1536 O  O   . HOH G .   ? 0.5875  0.2085 0.3208 0.1422  0.1155  0.1090  2063 HOH A O   
1537 O  O   . HOH G .   ? 0.4416  0.3057 0.2576 0.0511  -0.0861 -0.0537 2064 HOH A O   
1538 O  O   . HOH G .   ? 0.2017  0.3403 0.6179 0.0658  0.0448  0.1391  2065 HOH A O   
1539 O  O   A HOH G .   ? 0.0889  0.1620 0.3621 0.0546  -0.0354 0.0332  2066 HOH A O   
1540 O  O   B HOH G .   ? 0.1546  0.1273 0.4111 0.0432  0.0292  0.0940  2067 HOH A O   
1541 O  O   . HOH G .   ? 0.2382  0.3397 0.2922 -0.0036 -0.0656 -0.0386 2068 HOH A O   
1542 O  O   . HOH G .   ? 0.2671  0.6699 0.2606 -0.1672 -0.1059 0.1043  2069 HOH A O   
1543 O  O   . HOH G .   ? 0.5844  0.3564 0.2639 0.2412  -0.0268 0.0309  2070 HOH A O   
1544 O  O   . HOH G .   ? 0.3017  0.4667 0.2958 -0.0975 0.1383  -0.0583 2071 HOH A O   
1545 O  O   . HOH G .   ? 0.2096  0.2647 0.8433 -0.0079 0.0321  0.2826  2072 HOH A O   
1546 O  O   . HOH G .   ? 0.1796  0.7329 0.3156 0.0236  -0.0441 -0.2028 2073 HOH A O   
1547 O  O   . HOH G .   ? 0.3148  0.2023 0.6152 0.0777  -0.1103 -0.0157 2074 HOH A O   
1548 O  O   . HOH G .   ? 0.2628  0.3687 0.5652 -0.0588 -0.0420 0.1449  2075 HOH A O   
1549 O  O   . HOH G .   ? 0.4672  0.4970 0.2341 -0.1503 0.0119  -0.0235 2076 HOH A O   
1550 O  O   . HOH G .   ? 0.2360  0.4808 0.4598 0.0426  0.0319  0.0327  2077 HOH A O   
1551 O  O   . HOH G .   ? 0.3370  0.5299 0.3537 0.0943  0.0695  -0.0263 2078 HOH A O   
1552 O  O   . HOH G .   ? 0.2080  0.4803 0.4265 -0.0814 -0.0869 -0.0134 2079 HOH A O   
1553 O  O   . HOH G .   ? 0.2682  0.2419 0.6372 -0.0092 0.0891  -0.0817 2080 HOH A O   
1554 O  O   . HOH G .   ? 0.2961  0.2821 0.7810 0.0653  -0.2212 -0.0717 2081 HOH A O   
1555 O  O   . HOH G .   ? 0.4451  0.3739 0.5184 0.1023  -0.0285 -0.2081 2082 HOH A O   
1556 O  O   . HOH G .   ? 0.3825  0.4834 0.6758 0.0771  0.1988  0.2585  2083 HOH A O   
1557 O  O   . HOH G .   ? 0.1832  0.5945 0.3724 -0.0567 -0.0461 0.1226  2084 HOH A O   
1558 O  O   . HOH G .   ? 0.1966  0.4936 0.3905 -0.0341 -0.0835 0.0761  2085 HOH A O   
1559 O  O   . HOH G .   ? 0.2018  0.1042 0.2036 0.0332  -0.0391 -0.0085 2086 HOH A O   
1560 O  O   . HOH G .   ? 0.2237  0.1668 0.2279 -0.0388 -0.0883 0.0609  2087 HOH A O   
1561 O  O   . HOH G .   ? 0.2085  0.2560 0.2451 -0.0624 -0.0714 0.0483  2088 HOH A O   
1562 O  O   . HOH G .   ? 0.2307  0.3116 0.2880 -0.0509 -0.0489 -0.0601 2089 HOH A O   
1563 O  O   . HOH G .   ? 0.3076  0.2731 0.2857 -0.0557 -0.0124 -0.0658 2090 HOH A O   
1564 O  O   . HOH G .   ? 0.3859  0.2894 0.4668 0.0780  0.1954  -0.0351 2091 HOH A O   
1565 O  O   . HOH G .   ? 0.2279  0.5146 0.1948 -0.0617 -0.0412 0.0668  2092 HOH A O   
1566 O  O   . HOH G .   ? 0.2765  0.2104 0.2290 -0.0433 -0.0215 0.0286  2093 HOH A O   
1567 O  O   . HOH G .   ? 0.3109  0.2305 0.3185 0.0132  -0.0180 -0.0263 2094 HOH A O   
1568 O  O   . HOH G .   ? 0.2145  0.3534 0.3224 0.0436  -0.0620 -0.0122 2095 HOH A O   
1569 O  O   . HOH G .   ? 0.4038  0.3072 0.3380 0.0399  -0.1060 0.0901  2096 HOH A O   
1570 O  O   . HOH G .   ? 0.4549  0.2581 0.4373 0.1177  0.1488  0.1705  2097 HOH A O   
1571 O  O   . HOH G .   ? 0.4411  0.4001 0.3175 -0.0151 -0.1748 0.0705  2098 HOH A O   
1572 O  O   . HOH G .   ? 0.4619  0.3171 0.5443 -0.0629 0.0606  0.1848  2099 HOH A O   
1573 O  O   . HOH G .   ? 0.5618  0.3391 0.4042 0.0925  -0.1358 0.1000  2100 HOH A O   
1574 O  O   . HOH G .   ? 0.6061  0.4378 0.5266 -0.3240 -0.2015 0.2137  2101 HOH A O   
1575 O  O   . HOH G .   ? 0.3725  0.4325 0.3712 0.0041  -0.0760 0.1758  2102 HOH A O   
1576 O  O   . HOH G .   ? 0.6377  0.3851 0.3956 0.2119  -0.1668 0.0716  2103 HOH A O   
1577 O  O   . HOH G .   ? 0.1989  0.5453 0.4343 -0.0244 -0.0743 0.1086  2104 HOH A O   
1578 O  O   . HOH G .   ? 0.2896  0.7786 0.3780 0.0294  -0.0670 -0.1041 2105 HOH A O   
1579 O  O   . HOH G .   ? 0.4127  0.4742 0.2408 -0.1148 0.0261  -0.0088 2106 HOH A O   
1580 O  O   . HOH G .   ? 0.6475  0.2478 0.2523 0.1899  -0.1087 -0.0330 2107 HOH A O   
1581 O  O   . HOH G .   ? 0.3953  0.5986 0.7238 0.0085  0.0132  0.2059  2108 HOH A O   
1582 O  O   . HOH G .   ? 0.3040  0.5391 0.3144 0.0499  -0.0143 -0.0659 2109 HOH A O   
1583 O  O   . HOH G .   ? 0.4408  0.4397 0.3061 -0.0502 -0.0159 -0.0743 2110 HOH A O   
1584 O  O   . HOH G .   ? 0.3130  0.6610 0.4206 -0.1274 -0.1161 0.1748  2111 HOH A O   
1585 O  O   . HOH G .   ? 0.3312  0.5350 0.4343 0.0326  0.0811  -0.1704 2112 HOH A O   
1586 O  O   . HOH G .   ? 0.2490  0.4792 0.5020 -0.1216 0.0564  -0.0798 2113 HOH A O   
1587 O  O   . HOH G .   ? 0.7651  0.3085 0.4228 -0.1065 0.0450  0.0568  2114 HOH A O   
1588 O  O   . HOH G .   ? 0.3086  0.5025 0.5083 0.1158  0.0050  0.0933  2115 HOH A O   
1589 O  O   . HOH G .   ? 0.4236  0.4889 0.5405 0.0402  -0.0419 0.1227  2116 HOH A O   
1590 O  O   . HOH G .   ? 0.5075  0.4313 0.3780 0.0770  0.1437  -0.0455 2117 HOH A O   
1591 O  O   . HOH G .   ? 0.5139  0.4743 0.4448 0.1985  -0.1852 -0.2073 2118 HOH A O   
1592 O  O   . HOH G .   ? 0.1755  0.5343 0.6978 0.0846  -0.0665 -0.0818 2119 HOH A O   
1593 O  O   . HOH G .   ? 0.5382  0.4614 0.3205 0.0562  0.0110  -0.0319 2120 HOH A O   
1594 O  O   . HOH G .   ? 0.8466  0.2921 0.3283 0.0923  -0.2247 -0.0207 2121 HOH A O   
1595 O  O   . HOH G .   ? 0.1196  0.1221 0.1563 -0.0288 -0.0311 -0.0076 2122 HOH A O   
1596 O  O   . HOH G .   ? 0.1535  0.0882 0.1882 -0.0223 -0.0523 0.0177  2123 HOH A O   
1597 O  O   . HOH G .   ? 0.1507  0.1129 0.2082 0.0068  -0.0393 -0.0093 2124 HOH A O   
1598 O  O   . HOH G .   ? 0.1686  0.1230 0.2611 -0.0322 -0.0567 0.0507  2125 HOH A O   
1599 O  O   . HOH G .   ? 0.2118  0.0977 0.2165 -0.0032 -0.0280 0.0119  2126 HOH A O   
1600 O  O   . HOH G .   ? 0.1390  0.0940 0.1472 0.0101  -0.0287 0.0015  2127 HOH A O   
1601 O  O   . HOH G .   ? 0.2637  0.2157 0.2833 -0.0361 0.0720  -0.0496 2128 HOH A O   
1602 O  O   . HOH G .   ? 0.1336  0.2307 0.1380 0.0013  -0.0104 -0.0166 2129 HOH A O   
1603 O  O   . HOH G .   ? 0.2390  0.5962 0.3662 -0.1983 0.1059  -0.1732 2130 HOH A O   
1604 O  O   . HOH G .   ? 0.2821  0.3485 0.3738 -0.0145 -0.0281 -0.0805 2131 HOH A O   
1605 O  O   . HOH G .   ? 0.5324  0.3380 0.4587 -0.0417 -0.0041 -0.0444 2132 HOH A O   
1606 O  O   . HOH G .   ? 0.4368  0.4442 0.2515 -0.1362 -0.0180 -0.0594 2133 HOH A O   
1607 O  O   . HOH G .   ? 0.6513  0.5317 0.2930 0.0321  -0.2981 0.0069  2134 HOH A O   
1608 O  O   . HOH G .   ? 0.5196  0.3069 0.3718 -0.0523 0.0260  -0.0225 2135 HOH A O   
1609 O  O   . HOH G .   ? 0.5527  0.3831 0.4382 -0.1972 0.0631  -0.0202 2136 HOH A O   
1610 O  O   . HOH G .   ? 0.3859  0.5122 0.3975 0.0155  0.0608  0.0042  2137 HOH A O   
1611 O  O   . HOH G .   ? 0.7124  0.2770 0.4161 -0.0809 0.1801  -0.0500 2138 HOH A O   
1612 O  O   . HOH G .   ? 0.4266  0.5226 0.5047 -0.2026 -0.1457 0.2017  2139 HOH A O   
1613 O  O   . HOH G .   ? 0.3796  0.4932 0.3959 0.0146  0.0158  0.0279  2140 HOH A O   
1614 O  O   . HOH G .   ? 0.3862  0.7056 0.3533 -0.0658 0.0559  0.2159  2141 HOH A O   
1615 O  O   . HOH G .   ? 0.4909  0.6175 0.4624 0.0042  -0.0482 0.3036  2142 HOH A O   
1616 O  O   . HOH G .   ? 0.4455  0.3474 0.3913 0.0017  -0.0030 0.0341  2143 HOH A O   
1617 O  O   . HOH G .   ? 0.5216  0.6296 0.3342 0.0508  -0.1175 0.1263  2144 HOH A O   
1618 O  O   . HOH G .   ? 0.4518  0.4790 0.5856 0.1062  -0.0460 -0.0947 2145 HOH A O   
1619 O  O   . HOH G .   ? 0.6785  0.4193 0.4654 0.1804  -0.1029 -0.2411 2146 HOH A O   
1620 O  O   . HOH G .   ? 0.4678  0.3833 0.6584 -0.0447 0.1558  -0.2356 2147 HOH A O   
1621 O  O   . HOH G .   ? 0.4982  0.8385 0.5612 -0.2872 -0.2171 -0.0044 2148 HOH A O   
1622 O  O   . HOH G .   ? 0.4563  0.6245 0.5028 -0.1688 0.0075  0.0975  2149 HOH A O   
1623 O  O   . HOH G .   ? 0.5573  0.3715 0.7344 0.0060  0.2629  0.1675  2150 HOH A O   
1624 O  O   . HOH G .   ? 0.2987  0.6732 0.7129 0.0073  0.0776  0.0569  2151 HOH A O   
1625 O  O   . HOH G .   ? 0.5747  0.4545 0.5135 -0.0149 -0.0465 -0.2376 2152 HOH A O   
1626 O  O   . HOH G .   ? 0.6110  0.4452 0.4989 0.0312  0.0463  -0.1955 2153 HOH A O   
1627 O  O   . HOH G .   ? 0.6985  0.4112 0.4811 -0.1786 0.2608  -0.0714 2154 HOH A O   
1628 O  O   . HOH G .   ? 0.3930  0.2901 0.3655 -0.1036 -0.1376 0.1248  2155 HOH A O   
1629 O  O   . HOH G .   ? 0.5015  0.4039 0.3616 -0.1341 -0.0837 -0.0553 2156 HOH A O   
1630 O  O   . HOH G .   ? 0.3546  0.3281 0.2855 -0.0026 0.0269  0.0363  2157 HOH A O   
1631 O  O   . HOH G .   ? 0.5444  0.4155 0.5092 -0.1964 -0.0405 0.0400  2158 HOH A O   
1632 O  O   . HOH G .   ? 0.3922  0.6049 0.4106 -0.0015 0.0421  0.0026  2159 HOH A O   
1633 O  O   . HOH G .   ? 0.2787  0.6406 0.5566 -0.1599 -0.1048 0.2082  2160 HOH A O   
1634 O  O   . HOH G .   ? 0.1998  0.3164 0.1856 -0.0146 -0.0892 0.0777  2161 HOH A O   
1635 O  O   . HOH G .   ? 0.4009  0.7624 0.2917 -0.2727 -0.1119 0.1574  2162 HOH A O   
1636 O  O   . HOH G .   ? 0.6338  0.3072 0.3913 0.0824  0.0719  0.0166  2163 HOH A O   
1637 O  O   . HOH G .   ? 0.5008  0.5203 0.5799 -0.1938 0.0215  -0.1721 2164 HOH A O   
1638 O  O   . HOH G .   ? 0.5001  0.5698 0.7167 -0.1765 0.1128  -0.1584 2165 HOH A O   
1639 O  O   . HOH G .   ? 0.4083  0.6573 0.8102 0.1386  -0.0247 -0.2279 2166 HOH A O   
1640 O  O   . HOH G .   ? 0.2803  0.7178 0.6919 0.1904  -0.0659 -0.1772 2167 HOH A O   
1641 O  O   . HOH G .   ? 0.3314  0.4699 0.4997 -0.0911 -0.0357 -0.0738 2168 HOH A O   
1642 O  O   . HOH G .   ? 0.3828  0.6752 0.5396 -0.1253 0.0735  -0.0932 2169 HOH A O   
1643 O  O   . HOH G .   ? 0.5750  0.4861 0.5603 -0.2378 0.0430  -0.1587 2170 HOH A O   
1644 O  O   . HOH G .   ? 0.4187  0.3405 0.7851 -0.0599 0.1874  -0.0493 2171 HOH A O   
1645 O  O   . HOH G .   ? 0.3941  0.5373 0.4411 -0.1079 -0.1045 0.0969  2172 HOH A O   
1646 O  O   . HOH G .   ? 0.4388  0.4054 0.7124 0.0125  0.1621  0.0762  2173 HOH A O   
1647 O  O   . HOH G .   ? 0.4378  0.5789 0.5360 0.0634  -0.1192 0.0640  2174 HOH A O   
1648 O  O   . HOH G .   ? 0.5682  0.4324 0.5039 -0.1542 0.0436  0.0284  2175 HOH A O   
1649 O  O   . HOH G .   ? 0.7010  0.3666 0.6552 0.0518  -0.1305 0.1918  2176 HOH A O   
1650 O  O   . HOH G .   ? 0.4646  0.7132 0.6395 -0.0435 -0.0914 0.0592  2177 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?    ?   ?   A . n 
A 1 2   GLU 2   2   2    GLU GLU A . n 
A 1 3   GLN 3   3   3    GLN GLN A . n 
A 1 4   LEU 4   4   4    LEU LEU A . n 
A 1 5   THR 5   5   5    THR THR A . n 
A 1 6   GLU 6   6   6    GLU GLU A . n 
A 1 7   GLU 7   7   7    GLU GLU A . n 
A 1 8   GLN 8   8   8    GLN GLN A . n 
A 1 9   ILE 9   9   9    ILE ILE A . n 
A 1 10  ALA 10  10  10   ALA ALA A . n 
A 1 11  GLU 11  11  11   GLU GLU A . n 
A 1 12  PHE 12  12  12   PHE PHE A . n 
A 1 13  LYS 13  13  13   LYS LYS A . n 
A 1 14  GLU 14  14  14   GLU GLU A . n 
A 1 15  ALA 15  15  15   ALA ALA A . n 
A 1 16  PHE 16  16  16   PHE PHE A . n 
A 1 17  ALA 17  17  17   ALA ALA A . n 
A 1 18  LEU 18  18  18   LEU LEU A . n 
A 1 19  PHE 19  19  19   PHE PHE A . n 
A 1 20  ASP 20  20  20   ASP ASP A . n 
A 1 21  LYS 21  21  21   LYS LYS A . n 
A 1 22  ASP 22  22  22   ASP ASP A . n 
A 1 23  GLY 23  23  23   GLY GLY A . n 
A 1 24  ASP 24  24  24   ASP ASP A . n 
A 1 25  GLY 25  25  25   GLY GLY A . n 
A 1 26  THR 26  26  26   THR THR A . n 
A 1 27  ILE 27  27  27   ILE ILE A . n 
A 1 28  THR 28  28  28   THR THR A . n 
A 1 29  THR 29  29  29   THR THR A . n 
A 1 30  LYS 30  30  30   LYS LYS A . n 
A 1 31  GLU 31  31  31   GLU GLU A . n 
A 1 32  LEU 32  32  32   LEU LEU A . n 
A 1 33  GLY 33  33  33   GLY GLY A . n 
A 1 34  THR 34  34  34   THR THR A . n 
A 1 35  VAL 35  35  35   VAL VAL A . n 
A 1 36  MET 36  36  36   MET MET A . n 
A 1 37  ARG 37  37  37   ARG ARG A . n 
A 1 38  SER 38  38  38   SER SER A . n 
A 1 39  LEU 39  39  39   LEU LEU A . n 
A 1 40  GLY 40  40  40   GLY GLY A . n 
A 1 41  GLN 41  41  41   GLN GLN A . n 
A 1 42  ASN 42  42  42   ASN ASN A . n 
A 1 43  PRO 43  43  43   PRO PRO A . n 
A 1 44  THR 44  44  44   THR THR A . n 
A 1 45  GLU 45  45  45   GLU GLU A . n 
A 1 46  ALA 46  46  46   ALA ALA A . n 
A 1 47  GLU 47  47  47   GLU GLU A . n 
A 1 48  LEU 48  48  48   LEU LEU A . n 
A 1 49  GLN 49  49  49   GLN GLN A . n 
A 1 50  ASP 50  50  50   ASP ASP A . n 
A 1 51  MET 51  51  51   MET MET A . n 
A 1 52  ILE 52  52  52   ILE ILE A . n 
A 1 53  ASN 53  53  53   ASN ASN A . n 
A 1 54  GLU 54  54  54   GLU GLU A . n 
A 1 55  VAL 55  55  55   VAL VAL A . n 
A 1 56  ASP 56  56  56   ASP ASP A . n 
A 1 57  ALA 57  57  57   ALA ALA A . n 
A 1 58  ASP 58  58  58   ASP ASP A . n 
A 1 59  GLY 59  59  59   GLY GLY A . n 
A 1 60  ASN 60  60  60   ASN ASN A . n 
A 1 61  GLY 61  61  61   GLY GLY A . n 
A 1 62  THR 62  62  62   THR THR A . n 
A 1 63  ILE 63  63  63   ILE ILE A . n 
A 1 64  ASP 64  64  64   ASP ASP A . n 
A 1 65  PHE 65  65  65   PHE PHE A . n 
A 1 66  PRO 66  66  66   PRO PRO A . n 
A 1 67  GLU 67  67  67   GLU GLU A . n 
A 1 68  PHE 68  68  68   PHE PHE A . n 
A 1 69  LEU 69  69  69   LEU LEU A . n 
A 1 70  SER 70  70  70   SER SER A . n 
A 1 71  LEU 71  71  71   LEU LEU A . n 
A 1 72  MET 72  72  72   MET MET A . n 
A 1 73  ALA 73  73  73   ALA ALA A . n 
A 1 74  ARG 74  74  74   ARG ARG A . n 
A 1 75  LYS 75  75  75   LYS LYS A . n 
A 1 76  MET 76  76  76   MET MET A . n 
A 1 77  LYS 77  77  77   LYS LYS A . n 
A 1 78  GLU 78  78  78   GLU GLU A . n 
A 1 79  GLN 79  79  79   GLN GLN A . n 
A 1 80  ASP 80  80  80   ASP ASP A . n 
A 1 81  SER 81  81  81   SER SER A . n 
A 1 82  GLU 82  82  82   GLU GLU A . n 
A 1 83  GLU 83  83  83   GLU GLU A . n 
A 1 84  GLU 84  84  84   GLU GLU A . n 
A 1 85  LEU 85  85  85   LEU LEU A . n 
A 1 86  ILE 86  86  86   ILE ILE A . n 
A 1 87  GLU 87  87  87   GLU GLU A . n 
A 1 88  ALA 88  88  88   ALA ALA A . n 
A 1 89  PHE 89  89  89   PHE PHE A . n 
A 1 90  LYS 90  90  90   LYS LYS A . n 
A 1 91  VAL 91  91  91   VAL VAL A . n 
A 1 92  PHE 92  92  92   PHE PHE A . n 
A 1 93  ASP 93  93  93   ASP ASP A . n 
A 1 94  ARG 94  94  94   ARG ARG A . n 
A 1 95  ASP 95  95  95   ASP ASP A . n 
A 1 96  GLY 96  96  96   GLY GLY A . n 
A 1 97  ASN 97  97  97   ASN ASN A . n 
A 1 98  GLY 98  98  98   GLY GLY A . n 
A 1 99  LEU 99  99  99   LEU LEU A . n 
A 1 100 ILE 100 100 100  ILE ILE A . n 
A 1 101 SER 101 101 101  SER SER A . n 
A 1 102 ALA 102 102 102  ALA ALA A . n 
A 1 103 ALA 103 103 103  ALA ALA A . n 
A 1 104 GLU 104 104 104  GLU GLU A . n 
A 1 105 LEU 105 105 105  LEU LEU A . n 
A 1 106 ARG 106 106 106  ARG ARG A . n 
A 1 107 HIS 107 107 107  HIS HIS A . n 
A 1 108 VAL 108 108 108  VAL VAL A . n 
A 1 109 MET 109 109 109  MET MET A . n 
A 1 110 THR 110 110 110  THR THR A . n 
A 1 111 ASN 111 111 111  ASN ASN A . n 
A 1 112 LEU 112 112 112  LEU LEU A . n 
A 1 113 GLY 113 113 113  GLY GLY A . n 
A 1 114 GLU 114 114 114  GLU GLU A . n 
A 1 115 LYS 115 115 115  LYS LYS A . n 
A 1 116 LEU 116 116 116  LEU LEU A . n 
A 1 117 THR 117 117 117  THR THR A . n 
A 1 118 ASP 118 118 118  ASP ASP A . n 
A 1 119 ASP 119 119 119  ASP ASP A . n 
A 1 120 GLU 120 120 120  GLU GLU A . n 
A 1 121 VAL 121 121 121  VAL VAL A . n 
A 1 122 ASP 122 122 122  ASP ASP A . n 
A 1 123 GLU 123 123 123  GLU GLU A . n 
A 1 124 MET 124 124 124  MET MET A . n 
A 1 125 ILE 125 125 125  ILE ILE A . n 
A 1 126 ARG 126 126 126  ARG ARG A . n 
A 1 127 GLU 127 127 127  GLU GLU A . n 
A 1 128 ALA 128 128 128  ALA ALA A . n 
A 1 129 ASP 129 129 129  ASP ASP A . n 
A 1 130 ILE 130 130 130  ILE ILE A . n 
A 1 131 ASP 131 131 131  ASP ASP A . n 
A 1 132 GLY 132 132 132  GLY GLY A . n 
A 1 133 ASP 133 133 133  ASP ASP A . n 
A 1 134 GLY 134 134 134  GLY GLY A . n 
A 1 135 HIS 135 135 135  HIS HIS A . n 
A 1 136 ILE 136 136 136  ILE ILE A . n 
A 1 137 ASN 137 137 137  ASN ASN A . n 
A 1 138 TYR 138 138 138  TYR TYR A . n 
A 1 139 GLU 139 139 139  GLU GLU A . n 
A 1 140 GLU 140 140 140  GLU GLU A . n 
A 1 141 PHE 141 141 141  PHE PHE A . n 
A 1 142 VAL 142 142 142  VAL VAL A . n 
A 1 143 ARG 143 143 143  ARG ARG A . n 
A 1 144 MET 144 144 144  MET MET A . n 
A 1 145 MET 145 145 145  MET MET A . n 
A 1 146 VAL 146 146 146  VAL VAL A . n 
A 1 147 SER 147 147 1147 SER SER A . n 
A 1 148 LYS 148 148 ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   1000 1000 CA  CA  A . 
C 2 CA  1   1001 1001 CA  CA  A . 
D 2 CA  1   1002 1002 CA  CA  A . 
E 2 CA  1   1003 1003 CA  CA  A . 
F 2 CA  1   1004 1004 CA  CA  A . 
G 3 HOH 1   2000 2000 HOH HOH A . 
G 3 HOH 2   2001 2001 HOH HOH A . 
G 3 HOH 3   2002 2002 HOH HOH A . 
G 3 HOH 4   2003 2003 HOH HOH A . 
G 3 HOH 5   2004 2004 HOH HOH A . 
G 3 HOH 6   2005 2005 HOH HOH A . 
G 3 HOH 7   2006 2006 HOH HOH A . 
G 3 HOH 8   2007 2007 HOH HOH A . 
G 3 HOH 9   2008 2008 HOH HOH A . 
G 3 HOH 10  2009 2009 HOH HOH A . 
G 3 HOH 11  2010 2010 HOH HOH A . 
G 3 HOH 12  2011 2011 HOH HOH A . 
G 3 HOH 13  2012 2012 HOH HOH A . 
G 3 HOH 14  2013 2013 HOH HOH A . 
G 3 HOH 15  2014 2014 HOH HOH A . 
G 3 HOH 16  2015 2015 HOH HOH A . 
G 3 HOH 17  2016 2016 HOH HOH A . 
G 3 HOH 18  2017 2017 HOH HOH A . 
G 3 HOH 19  2018 2018 HOH HOH A . 
G 3 HOH 20  2019 2019 HOH HOH A . 
G 3 HOH 21  2020 2020 HOH HOH A . 
G 3 HOH 22  2021 2021 HOH HOH A . 
G 3 HOH 23  2022 2022 HOH HOH A . 
G 3 HOH 24  2023 2023 HOH HOH A . 
G 3 HOH 25  2024 2024 HOH HOH A . 
G 3 HOH 26  2025 2025 HOH HOH A . 
G 3 HOH 27  2026 2026 HOH HOH A . 
G 3 HOH 28  2027 2027 HOH HOH A . 
G 3 HOH 29  2028 2028 HOH HOH A . 
G 3 HOH 30  2029 2029 HOH HOH A . 
G 3 HOH 31  2030 2030 HOH HOH A . 
G 3 HOH 32  2031 2031 HOH HOH A . 
G 3 HOH 33  2032 2032 HOH HOH A . 
G 3 HOH 34  2033 2033 HOH HOH A . 
G 3 HOH 35  2034 2034 HOH HOH A . 
G 3 HOH 36  2035 2035 HOH HOH A . 
G 3 HOH 37  2036 2036 HOH HOH A . 
G 3 HOH 38  2037 2037 HOH HOH A . 
G 3 HOH 39  2038 2038 HOH HOH A . 
G 3 HOH 40  2039 2039 HOH HOH A . 
G 3 HOH 41  2040 2040 HOH HOH A . 
G 3 HOH 42  2041 2041 HOH HOH A . 
G 3 HOH 43  2042 2042 HOH HOH A . 
G 3 HOH 44  2043 2043 HOH HOH A . 
G 3 HOH 45  2044 2044 HOH HOH A . 
G 3 HOH 46  2045 2045 HOH HOH A . 
G 3 HOH 47  2046 2046 HOH HOH A . 
G 3 HOH 48  2047 2047 HOH HOH A . 
G 3 HOH 49  2048 2048 HOH HOH A . 
G 3 HOH 50  2049 2049 HOH HOH A . 
G 3 HOH 51  2050 2050 HOH HOH A . 
G 3 HOH 52  2051 2051 HOH HOH A . 
G 3 HOH 53  2052 2052 HOH HOH A . 
G 3 HOH 54  2053 2053 HOH HOH A . 
G 3 HOH 55  2054 2054 HOH HOH A . 
G 3 HOH 56  2055 2055 HOH HOH A . 
G 3 HOH 57  2056 2056 HOH HOH A . 
G 3 HOH 58  2057 2057 HOH HOH A . 
G 3 HOH 59  2058 2058 HOH HOH A . 
G 3 HOH 60  2059 2059 HOH HOH A . 
G 3 HOH 61  2060 2060 HOH HOH A . 
G 3 HOH 62  2061 2061 HOH HOH A . 
G 3 HOH 63  2062 2062 HOH HOH A . 
G 3 HOH 64  2063 2063 HOH HOH A . 
G 3 HOH 65  2064 2064 HOH HOH A . 
G 3 HOH 66  2065 2065 HOH HOH A . 
G 3 HOH 67  2066 2066 HOH HOH A . 
G 3 HOH 68  2067 2067 HOH HOH A . 
G 3 HOH 69  2068 2068 HOH HOH A . 
G 3 HOH 70  2069 2069 HOH HOH A . 
G 3 HOH 71  2070 2070 HOH HOH A . 
G 3 HOH 72  2071 2071 HOH HOH A . 
G 3 HOH 73  2072 2072 HOH HOH A . 
G 3 HOH 74  2073 2073 HOH HOH A . 
G 3 HOH 75  2074 2074 HOH HOH A . 
G 3 HOH 76  2075 2075 HOH HOH A . 
G 3 HOH 77  2076 2076 HOH HOH A . 
G 3 HOH 78  2077 2077 HOH HOH A . 
G 3 HOH 79  2078 2078 HOH HOH A . 
G 3 HOH 80  2079 2079 HOH HOH A . 
G 3 HOH 81  2080 2080 HOH HOH A . 
G 3 HOH 82  2081 2081 HOH HOH A . 
G 3 HOH 83  2082 2082 HOH HOH A . 
G 3 HOH 84  2083 2083 HOH HOH A . 
G 3 HOH 85  2084 2084 HOH HOH A . 
G 3 HOH 86  2085 2085 HOH HOH A . 
G 3 HOH 87  2086 2086 HOH HOH A . 
G 3 HOH 88  2087 2087 HOH HOH A . 
G 3 HOH 89  2088 2088 HOH HOH A . 
G 3 HOH 90  2089 2089 HOH HOH A . 
G 3 HOH 91  2090 2090 HOH HOH A . 
G 3 HOH 92  2091 2091 HOH HOH A . 
G 3 HOH 93  2092 2092 HOH HOH A . 
G 3 HOH 94  2093 2093 HOH HOH A . 
G 3 HOH 95  2094 2094 HOH HOH A . 
G 3 HOH 96  2095 2095 HOH HOH A . 
G 3 HOH 97  2096 2096 HOH HOH A . 
G 3 HOH 98  2097 2097 HOH HOH A . 
G 3 HOH 99  2098 2098 HOH HOH A . 
G 3 HOH 100 2099 2099 HOH HOH A . 
G 3 HOH 101 2100 2100 HOH HOH A . 
G 3 HOH 102 2101 2101 HOH HOH A . 
G 3 HOH 103 2102 2102 HOH HOH A . 
G 3 HOH 104 2103 2103 HOH HOH A . 
G 3 HOH 105 2104 2104 HOH HOH A . 
G 3 HOH 106 2105 2105 HOH HOH A . 
G 3 HOH 107 2106 2106 HOH HOH A . 
G 3 HOH 108 2107 2107 HOH HOH A . 
G 3 HOH 109 2108 2108 HOH HOH A . 
G 3 HOH 110 2109 2109 HOH HOH A . 
G 3 HOH 111 2110 2110 HOH HOH A . 
G 3 HOH 112 2111 2111 HOH HOH A . 
G 3 HOH 113 2112 2112 HOH HOH A . 
G 3 HOH 114 2113 2113 HOH HOH A . 
G 3 HOH 115 2114 2114 HOH HOH A . 
G 3 HOH 116 2115 2115 HOH HOH A . 
G 3 HOH 117 2116 2116 HOH HOH A . 
G 3 HOH 118 2117 2117 HOH HOH A . 
G 3 HOH 119 2118 2118 HOH HOH A . 
G 3 HOH 120 2119 2119 HOH HOH A . 
G 3 HOH 121 2120 2120 HOH HOH A . 
G 3 HOH 122 2121 2121 HOH HOH A . 
G 3 HOH 123 2122 2122 HOH HOH A . 
G 3 HOH 124 2123 2123 HOH HOH A . 
G 3 HOH 125 2124 2124 HOH HOH A . 
G 3 HOH 126 2125 2125 HOH HOH A . 
G 3 HOH 127 2126 2126 HOH HOH A . 
G 3 HOH 128 2127 2127 HOH HOH A . 
G 3 HOH 129 2128 2128 HOH HOH A . 
G 3 HOH 130 2129 2129 HOH HOH A . 
G 3 HOH 131 2130 2130 HOH HOH A . 
G 3 HOH 132 2131 2131 HOH HOH A . 
G 3 HOH 133 2132 2132 HOH HOH A . 
G 3 HOH 134 2133 2133 HOH HOH A . 
G 3 HOH 135 2134 2134 HOH HOH A . 
G 3 HOH 136 2135 2135 HOH HOH A . 
G 3 HOH 137 2136 2136 HOH HOH A . 
G 3 HOH 138 2137 2137 HOH HOH A . 
G 3 HOH 139 2138 2138 HOH HOH A . 
G 3 HOH 140 2139 2139 HOH HOH A . 
G 3 HOH 141 2140 2140 HOH HOH A . 
G 3 HOH 142 2141 2141 HOH HOH A . 
G 3 HOH 143 2142 2142 HOH HOH A . 
G 3 HOH 144 2143 2143 HOH HOH A . 
G 3 HOH 145 2144 2144 HOH HOH A . 
G 3 HOH 146 2145 2145 HOH HOH A . 
G 3 HOH 147 2146 2146 HOH HOH A . 
G 3 HOH 148 2147 2147 HOH HOH A . 
G 3 HOH 149 2148 2148 HOH HOH A . 
G 3 HOH 150 2149 2149 HOH HOH A . 
G 3 HOH 151 2150 2150 HOH HOH A . 
G 3 HOH 152 2151 2151 HOH HOH A . 
G 3 HOH 153 2152 2152 HOH HOH A . 
G 3 HOH 154 2153 2153 HOH HOH A . 
G 3 HOH 155 2154 2154 HOH HOH A . 
G 3 HOH 156 2155 2155 HOH HOH A . 
G 3 HOH 157 2156 2156 HOH HOH A . 
G 3 HOH 158 2157 2157 HOH HOH A . 
G 3 HOH 159 2158 2158 HOH HOH A . 
G 3 HOH 160 2159 2159 HOH HOH A . 
G 3 HOH 161 2160 2160 HOH HOH A . 
G 3 HOH 162 2161 2161 HOH HOH A . 
G 3 HOH 163 2162 2162 HOH HOH A . 
G 3 HOH 164 2163 2163 HOH HOH A . 
G 3 HOH 165 2164 2164 HOH HOH A . 
G 3 HOH 166 2165 2165 HOH HOH A . 
G 3 HOH 167 2166 2166 HOH HOH A . 
G 3 HOH 168 2167 2167 HOH HOH A . 
G 3 HOH 169 2168 2168 HOH HOH A . 
G 3 HOH 170 2169 2169 HOH HOH A . 
G 3 HOH 171 2170 2170 HOH HOH A . 
G 3 HOH 172 2171 2171 HOH HOH A . 
G 3 HOH 173 2172 2172 HOH HOH A . 
G 3 HOH 174 2173 2173 HOH HOH A . 
G 3 HOH 175 2174 2174 HOH HOH A . 
G 3 HOH 176 2175 2175 HOH HOH A . 
G 3 HOH 177 2176 2176 HOH HOH A . 
G 3 HOH 178 2177 2177 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   O   ? G HOH .   ? A HOH 2122 ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OE1 ? A GLU 31  ? A GLU 31   ? 1_555 83.1  ? 
2   O   ? G HOH .   ? A HOH 2122 ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 O   ? A THR 26  ? A THR 26   ? 1_555 105.7 ? 
3   OE1 ? A GLU 31  ? A GLU 31   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 O   ? A THR 26  ? A THR 26   ? 1_555 75.8  ? 
4   O   ? G HOH .   ? A HOH 2122 ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 22  ? A ASP 22   ? 1_555 86.7  ? 
5   OE1 ? A GLU 31  ? A GLU 31   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 22  ? A ASP 22   ? 1_555 126.8 ? 
6   O   ? A THR 26  ? A THR 26   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 22  ? A ASP 22   ? 1_555 156.1 ? 
7   O   ? G HOH .   ? A HOH 2122 ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OE2 ? A GLU 31  ? A GLU 31   ? 1_555 90.1  ? 
8   OE1 ? A GLU 31  ? A GLU 31   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OE2 ? A GLU 31  ? A GLU 31   ? 1_555 53.0  ? 
9   O   ? A THR 26  ? A THR 26   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OE2 ? A GLU 31  ? A GLU 31   ? 1_555 124.2 ? 
10  OD1 ? A ASP 22  ? A ASP 22   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OE2 ? A GLU 31  ? A GLU 31   ? 1_555 75.0  ? 
11  O   ? G HOH .   ? A HOH 2122 ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 20  ? A ASP 20   ? 1_555 164.1 ? 
12  OE1 ? A GLU 31  ? A GLU 31   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 20  ? A ASP 20   ? 1_555 112.7 ? 
13  O   ? A THR 26  ? A THR 26   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 20  ? A ASP 20   ? 1_555 80.2  ? 
14  OD1 ? A ASP 22  ? A ASP 22   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 20  ? A ASP 20   ? 1_555 82.9  ? 
15  OE2 ? A GLU 31  ? A GLU 31   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 20  ? A ASP 20   ? 1_555 98.7  ? 
16  O   ? G HOH .   ? A HOH 2122 ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 24  ? A ASP 24   ? 1_555 81.8  ? 
17  OE1 ? A GLU 31  ? A GLU 31   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 24  ? A ASP 24   ? 1_555 146.3 ? 
18  O   ? A THR 26  ? A THR 26   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 24  ? A ASP 24   ? 1_555 79.6  ? 
19  OD1 ? A ASP 22  ? A ASP 22   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 24  ? A ASP 24   ? 1_555 82.2  ? 
20  OE2 ? A GLU 31  ? A GLU 31   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 24  ? A ASP 24   ? 1_555 156.2 ? 
21  OD1 ? A ASP 20  ? A ASP 20   ? 1_555 CA ? B CA . ? A CA 1000 ? 1_555 OD1 ? A ASP 24  ? A ASP 24   ? 1_555 84.9  ? 
22  OD1 ? A ASP 56  ? A ASP 56   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OD1 ? A ASN 60  ? A ASN 60   ? 1_555 85.9  ? 
23  OD1 ? A ASP 56  ? A ASP 56   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? A THR 62  ? A THR 62   ? 1_555 79.3  ? 
24  OD1 ? A ASN 60  ? A ASN 60   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? A THR 62  ? A THR 62   ? 1_555 79.5  ? 
25  OD1 ? A ASP 56  ? A ASP 56   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? G HOH .   ? A HOH 2011 ? 1_555 143.3 ? 
26  OD1 ? A ASN 60  ? A ASN 60   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? G HOH .   ? A HOH 2011 ? 1_555 73.0  ? 
27  O   ? A THR 62  ? A THR 62   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? G HOH .   ? A HOH 2011 ? 1_555 67.7  ? 
28  OD1 ? A ASP 56  ? A ASP 56   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE1 ? A GLU 67  ? A GLU 67   ? 1_555 103.1 ? 
29  OD1 ? A ASN 60  ? A ASN 60   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE1 ? A GLU 67  ? A GLU 67   ? 1_555 157.1 ? 
30  O   ? A THR 62  ? A THR 62   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE1 ? A GLU 67  ? A GLU 67   ? 1_555 81.6  ? 
31  O   ? G HOH .   ? A HOH 2011 ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE1 ? A GLU 67  ? A GLU 67   ? 1_555 88.0  ? 
32  OD1 ? A ASP 56  ? A ASP 56   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OD1 ? A ASP 58  ? A ASP 58   ? 1_555 77.6  ? 
33  OD1 ? A ASN 60  ? A ASN 60   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OD1 ? A ASP 58  ? A ASP 58   ? 1_555 76.5  ? 
34  O   ? A THR 62  ? A THR 62   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OD1 ? A ASP 58  ? A ASP 58   ? 1_555 147.6 ? 
35  O   ? G HOH .   ? A HOH 2011 ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OD1 ? A ASP 58  ? A ASP 58   ? 1_555 123.8 ? 
36  OE1 ? A GLU 67  ? A GLU 67   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OD1 ? A ASP 58  ? A ASP 58   ? 1_555 125.8 ? 
37  OD1 ? A ASP 56  ? A ASP 56   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? G HOH .   ? A HOH 2127 ? 1_555 152.8 ? 
38  OD1 ? A ASN 60  ? A ASN 60   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? G HOH .   ? A HOH 2127 ? 1_555 92.7  ? 
39  O   ? A THR 62  ? A THR 62   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? G HOH .   ? A HOH 2127 ? 1_555 127.2 ? 
40  O   ? G HOH .   ? A HOH 2011 ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? G HOH .   ? A HOH 2127 ? 1_555 60.1  ? 
41  OE1 ? A GLU 67  ? A GLU 67   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? G HOH .   ? A HOH 2127 ? 1_555 88.5  ? 
42  OD1 ? A ASP 58  ? A ASP 58   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 O   ? G HOH .   ? A HOH 2127 ? 1_555 75.7  ? 
43  OD1 ? A ASP 56  ? A ASP 56   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 1_555 87.4  ? 
44  OD1 ? A ASN 60  ? A ASN 60   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 1_555 151.1 ? 
45  O   ? A THR 62  ? A THR 62   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 1_555 126.7 ? 
46  O   ? G HOH .   ? A HOH 2011 ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 1_555 124.9 ? 
47  OE1 ? A GLU 67  ? A GLU 67   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 1_555 51.5  ? 
48  OD1 ? A ASP 58  ? A ASP 58   ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 1_555 74.6  ? 
49  O   ? G HOH .   ? A HOH 2127 ? 1_555 CA ? C CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 1_555 80.7  ? 
50  OE1 ? A GLU 140 ? A GLU 140  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 133 ? A ASP 133  ? 1_555 147.3 ? 
51  OE1 ? A GLU 140 ? A GLU 140  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 129 ? A ASP 129  ? 1_555 108.7 ? 
52  OD1 ? A ASP 133 ? A ASP 133  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 129 ? A ASP 129  ? 1_555 93.5  ? 
53  OE1 ? A GLU 140 ? A GLU 140  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OE2 ? A GLU 140 ? A GLU 140  ? 1_555 52.3  ? 
54  OD1 ? A ASP 133 ? A ASP 133  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OE2 ? A GLU 140 ? A GLU 140  ? 1_555 158.4 ? 
55  OD1 ? A ASP 129 ? A ASP 129  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OE2 ? A GLU 140 ? A GLU 140  ? 1_555 81.8  ? 
56  OE1 ? A GLU 140 ? A GLU 140  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 O   ? G HOH .   ? A HOH 2129 ? 1_555 83.0  ? 
57  OD1 ? A ASP 133 ? A ASP 133  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 O   ? G HOH .   ? A HOH 2129 ? 1_555 79.2  ? 
58  OD1 ? A ASP 129 ? A ASP 129  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 O   ? G HOH .   ? A HOH 2129 ? 1_555 166.2 ? 
59  OE2 ? A GLU 140 ? A GLU 140  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 O   ? G HOH .   ? A HOH 2129 ? 1_555 100.6 ? 
60  OE1 ? A GLU 140 ? A GLU 140  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 O   ? A HIS 135 ? A HIS 135  ? 1_555 79.6  ? 
61  OD1 ? A ASP 133 ? A ASP 133  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 O   ? A HIS 135 ? A HIS 135  ? 1_555 76.9  ? 
62  OD1 ? A ASP 129 ? A ASP 129  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 O   ? A HIS 135 ? A HIS 135  ? 1_555 89.4  ? 
63  OE2 ? A GLU 140 ? A GLU 140  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 O   ? A HIS 135 ? A HIS 135  ? 1_555 123.9 ? 
64  O   ? G HOH .   ? A HOH 2129 ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 O   ? A HIS 135 ? A HIS 135  ? 1_555 100.2 ? 
65  OE1 ? A GLU 140 ? A GLU 140  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 131 ? A ASP 131  ? 1_555 126.8 ? 
66  OD1 ? A ASP 133 ? A ASP 133  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 131 ? A ASP 131  ? 1_555 78.1  ? 
67  OD1 ? A ASP 129 ? A ASP 129  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 131 ? A ASP 131  ? 1_555 83.6  ? 
68  OE2 ? A GLU 140 ? A GLU 140  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 131 ? A ASP 131  ? 1_555 80.4  ? 
69  O   ? G HOH .   ? A HOH 2129 ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 131 ? A ASP 131  ? 1_555 83.4  ? 
70  O   ? A HIS 135 ? A HIS 135  ? 1_555 CA ? D CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 131 ? A ASP 131  ? 1_555 153.5 ? 
71  O   ? G HOH .   ? A HOH 2123 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 OE1 ? A GLU 47  ? A GLU 47   ? 1_555 85.4  ? 
72  O   ? G HOH .   ? A HOH 2123 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 OE2 ? A GLU 47  ? A GLU 47   ? 1_555 133.3 ? 
73  OE1 ? A GLU 47  ? A GLU 47   ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 OE2 ? A GLU 47  ? A GLU 47   ? 1_555 52.8  ? 
74  O   ? G HOH .   ? A HOH 2123 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2125 ? 1_555 81.6  ? 
75  OE1 ? A GLU 47  ? A GLU 47   ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2125 ? 1_555 86.9  ? 
76  OE2 ? A GLU 47  ? A GLU 47   ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2125 ? 1_555 76.7  ? 
77  O   ? G HOH .   ? A HOH 2123 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2126 ? 1_555 148.9 ? 
78  OE1 ? A GLU 47  ? A GLU 47   ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2126 ? 1_555 110.5 ? 
79  OE2 ? A GLU 47  ? A GLU 47   ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2126 ? 1_555 74.4  ? 
80  O   ? G HOH .   ? A HOH 2125 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2126 ? 1_555 124.3 ? 
81  O   ? G HOH .   ? A HOH 2123 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2124 ? 1_555 76.2  ? 
82  OE1 ? A GLU 47  ? A GLU 47   ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2124 ? 1_555 91.1  ? 
83  OE2 ? A GLU 47  ? A GLU 47   ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2124 ? 1_555 118.9 ? 
84  O   ? G HOH .   ? A HOH 2125 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2124 ? 1_555 157.8 ? 
85  O   ? G HOH .   ? A HOH 2126 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 O   ? G HOH .   ? A HOH 2124 ? 1_555 77.0  ? 
86  O   ? G HOH .   ? A HOH 2123 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 58  ? A ASP 58   ? 1_545 88.5  ? 
87  OE1 ? A GLU 47  ? A GLU 47   ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 58  ? A ASP 58   ? 1_545 169.7 ? 
88  OE2 ? A GLU 47  ? A GLU 47   ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 58  ? A ASP 58   ? 1_545 128.9 ? 
89  O   ? G HOH .   ? A HOH 2125 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 58  ? A ASP 58   ? 1_545 84.0  ? 
90  O   ? G HOH .   ? A HOH 2126 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 58  ? A ASP 58   ? 1_545 78.8  ? 
91  O   ? G HOH .   ? A HOH 2124 ? 1_555 CA ? E CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 58  ? A ASP 58   ? 1_545 95.5  ? 
92  OD1 ? A ASP 93  ? A ASP 93   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OD1 ? A ASP 95  ? A ASP 95   ? 1_555 86.8  ? 
93  OD1 ? A ASP 93  ? A ASP 93   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 O   ? A LEU 99  ? A LEU 99   ? 1_555 86.9  ? 
94  OD1 ? A ASP 95  ? A ASP 95   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 O   ? A LEU 99  ? A LEU 99   ? 1_555 155.4 ? 
95  OD1 ? A ASP 93  ? A ASP 93   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OE1 ? A GLU 104 ? A GLU 104  ? 1_555 98.6  ? 
96  OD1 ? A ASP 95  ? A ASP 95   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OE1 ? A GLU 104 ? A GLU 104  ? 1_555 126.8 ? 
97  O   ? A LEU 99  ? A LEU 99   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OE1 ? A GLU 104 ? A GLU 104  ? 1_555 77.7  ? 
98  OD1 ? A ASP 93  ? A ASP 93   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OE2 ? A GLU 104 ? A GLU 104  ? 1_555 100.3 ? 
99  OD1 ? A ASP 95  ? A ASP 95   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OE2 ? A GLU 104 ? A GLU 104  ? 1_555 74.6  ? 
100 O   ? A LEU 99  ? A LEU 99   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OE2 ? A GLU 104 ? A GLU 104  ? 1_555 130.0 ? 
101 OE1 ? A GLU 104 ? A GLU 104  ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OE2 ? A GLU 104 ? A GLU 104  ? 1_555 52.3  ? 
102 OD1 ? A ASP 93  ? A ASP 93   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 O   ? G HOH .   ? A HOH 2128 ? 1_555 174.2 ? 
103 OD1 ? A ASP 95  ? A ASP 95   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 O   ? G HOH .   ? A HOH 2128 ? 1_555 88.4  ? 
104 O   ? A LEU 99  ? A LEU 99   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 O   ? G HOH .   ? A HOH 2128 ? 1_555 96.2  ? 
105 OE1 ? A GLU 104 ? A GLU 104  ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 O   ? G HOH .   ? A HOH 2128 ? 1_555 86.9  ? 
106 OE2 ? A GLU 104 ? A GLU 104  ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 O   ? G HOH .   ? A HOH 2128 ? 1_555 81.5  ? 
107 OD1 ? A ASP 93  ? A ASP 93   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OD1 ? A ASN 97  ? A ASN 97   ? 1_555 87.5  ? 
108 OD1 ? A ASP 95  ? A ASP 95   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OD1 ? A ASN 97  ? A ASN 97   ? 1_555 77.4  ? 
109 O   ? A LEU 99  ? A LEU 99   ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OD1 ? A ASN 97  ? A ASN 97   ? 1_555 78.7  ? 
110 OE1 ? A GLU 104 ? A GLU 104  ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OD1 ? A ASN 97  ? A ASN 97   ? 1_555 155.2 ? 
111 OE2 ? A GLU 104 ? A GLU 104  ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OD1 ? A ASN 97  ? A ASN 97   ? 1_555 150.3 ? 
112 O   ? G HOH .   ? A HOH 2128 ? 1_555 CA ? F CA . ? A CA 1004 ? 1_555 OD1 ? A ASN 97  ? A ASN 97   ? 1_555 88.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-09-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-97 refinement       . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
DENZO     'data reduction' . ? 4 
CNS       phasing          . ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 OE1 A GLU 54  ? ? CD A GLU 54  ? ? OE2 A GLU 54  ? ? 136.17 123.30 12.87 1.20 N 
2  1 CA  A LEU 69  ? ? CB A LEU 69  ? ? CG  A LEU 69  ? ? 129.37 115.30 14.07 2.30 N 
3  1 CD  A ARG 74  ? B NE A ARG 74  ? B CZ  A ARG 74  ? B 140.30 123.60 16.70 1.40 N 
4  1 NE  A ARG 74  ? B CZ A ARG 74  ? B NH1 A ARG 74  ? B 128.69 120.30 8.39  0.50 N 
5  1 NE  A ARG 74  ? B CZ A ARG 74  ? B NH2 A ARG 74  ? B 116.44 120.30 -3.86 0.50 N 
6  1 OE1 A GLU 78  ? A CD A GLU 78  ? A OE2 A GLU 78  ? A 115.86 123.30 -7.44 1.20 N 
7  1 CB  A ASP 119 ? A CG A ASP 119 ? A OD2 A ASP 119 ? A 112.76 118.30 -5.54 0.90 N 
8  1 CB  A ASP 122 ? ? CG A ASP 122 ? ? OD1 A ASP 122 ? ? 124.40 118.30 6.10  0.90 N 
9  1 NE  A ARG 126 ? ? CZ A ARG 126 ? ? NH2 A ARG 126 ? ? 115.65 120.30 -4.65 0.50 N 
10 1 CG  A ARG 143 ? A CD A ARG 143 ? A NE  A ARG 143 ? A 140.76 111.80 28.96 2.10 N 
11 1 CD  A ARG 143 ? B NE A ARG 143 ? B CZ  A ARG 143 ? B 140.72 123.60 17.12 1.40 N 
12 1 NE  A ARG 143 ? A CZ A ARG 143 ? A NH1 A ARG 143 ? A 124.44 120.30 4.14  0.50 N 
13 1 NE  A ARG 143 ? A CZ A ARG 143 ? A NH2 A ARG 143 ? A 115.36 120.30 -4.94 0.50 N 
14 1 CA  A SER 147 ? ? C  A SER 147 ? ? O   A SER 147 ? ? 135.13 120.10 15.03 2.10 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    GLN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     3 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -175.69 
_pdbx_validate_torsion.psi             -70.65 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 1   ? A ALA 1   
2 1 Y 1 A LYS 148 ? A LYS 148 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 water         HOH 
#