data_1F15
# 
_entry.id   1F15 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1F15         
RCSB  RCSB011116   
WWPDB D_1000011116 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F15 
_pdbx_database_status.recvd_initial_deposition_date   2000-05-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Smith, T.J.' 1 
'Chase, E.'   2 
'Schmidt, T.' 3 
'Perry, K.'   4 
# 
_citation.id                        primary 
_citation.title                     'The structure of cucumber mosaic virus and comparison to cowpea chlorotic mottle virus.' 
_citation.journal_abbrev            J.Virol. 
_citation.journal_volume            74 
_citation.page_first                7578 
_citation.page_last                 7586 
_citation.year                      2000 
_citation.journal_id_ASTM           JOVIAM 
_citation.country                   US 
_citation.journal_id_ISSN           0022-538X 
_citation.journal_id_CSD            0825 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10906212 
_citation.pdbx_database_id_DOI      10.1128/JVI.74.16.7578-7586.2000 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Smith, T.J.' 1 
primary 'Chase, E.'   2 
primary 'Schmidt, T.' 3 
primary 'Perry, K.L.' 4 
# 
_cell.entry_id           1F15 
_cell.length_a           336 
_cell.length_b           336 
_cell.length_c           336 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              360 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1F15 
_symmetry.space_group_name_H-M             'P 42 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                208 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'COAT PROTEIN' 
_entity.formula_weight             24176.617 
_entity.pdbx_number_of_molecules   3 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKTLAAGRPTINHPTFVGSERCRPGYTFTSITLKPPKI
DRGSYYGKRLLLPDSVTEYDKKLVSRLQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGV
QANNKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKTLAAGRPTINHPTFVGSERCRPGYTFTSITLKPPKI
DRGSYYGKRLLLPDSVTEYDKKLVSRLQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGV
QANNKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   LYS n 
1 4   SER n 
1 5   GLU n 
1 6   SER n 
1 7   THR n 
1 8   SER n 
1 9   ALA n 
1 10  GLY n 
1 11  ARG n 
1 12  ASN n 
1 13  ARG n 
1 14  ARG n 
1 15  ARG n 
1 16  ARG n 
1 17  PRO n 
1 18  ARG n 
1 19  ARG n 
1 20  GLY n 
1 21  SER n 
1 22  ARG n 
1 23  SER n 
1 24  ALA n 
1 25  PRO n 
1 26  SER n 
1 27  SER n 
1 28  ALA n 
1 29  ASP n 
1 30  ALA n 
1 31  ASN n 
1 32  PHE n 
1 33  ARG n 
1 34  VAL n 
1 35  LEU n 
1 36  SER n 
1 37  GLN n 
1 38  GLN n 
1 39  LEU n 
1 40  SER n 
1 41  ARG n 
1 42  LEU n 
1 43  ASN n 
1 44  LYS n 
1 45  THR n 
1 46  LEU n 
1 47  ALA n 
1 48  ALA n 
1 49  GLY n 
1 50  ARG n 
1 51  PRO n 
1 52  THR n 
1 53  ILE n 
1 54  ASN n 
1 55  HIS n 
1 56  PRO n 
1 57  THR n 
1 58  PHE n 
1 59  VAL n 
1 60  GLY n 
1 61  SER n 
1 62  GLU n 
1 63  ARG n 
1 64  CYS n 
1 65  ARG n 
1 66  PRO n 
1 67  GLY n 
1 68  TYR n 
1 69  THR n 
1 70  PHE n 
1 71  THR n 
1 72  SER n 
1 73  ILE n 
1 74  THR n 
1 75  LEU n 
1 76  LYS n 
1 77  PRO n 
1 78  PRO n 
1 79  LYS n 
1 80  ILE n 
1 81  ASP n 
1 82  ARG n 
1 83  GLY n 
1 84  SER n 
1 85  TYR n 
1 86  TYR n 
1 87  GLY n 
1 88  LYS n 
1 89  ARG n 
1 90  LEU n 
1 91  LEU n 
1 92  LEU n 
1 93  PRO n 
1 94  ASP n 
1 95  SER n 
1 96  VAL n 
1 97  THR n 
1 98  GLU n 
1 99  TYR n 
1 100 ASP n 
1 101 LYS n 
1 102 LYS n 
1 103 LEU n 
1 104 VAL n 
1 105 SER n 
1 106 ARG n 
1 107 LEU n 
1 108 GLN n 
1 109 ILE n 
1 110 ARG n 
1 111 VAL n 
1 112 ASN n 
1 113 PRO n 
1 114 LEU n 
1 115 PRO n 
1 116 LYS n 
1 117 PHE n 
1 118 ASP n 
1 119 SER n 
1 120 THR n 
1 121 VAL n 
1 122 TRP n 
1 123 VAL n 
1 124 THR n 
1 125 VAL n 
1 126 ARG n 
1 127 LYS n 
1 128 VAL n 
1 129 PRO n 
1 130 ALA n 
1 131 SER n 
1 132 SER n 
1 133 ASP n 
1 134 LEU n 
1 135 SER n 
1 136 VAL n 
1 137 ALA n 
1 138 ALA n 
1 139 ILE n 
1 140 SER n 
1 141 ALA n 
1 142 MET n 
1 143 PHE n 
1 144 ALA n 
1 145 ASP n 
1 146 GLY n 
1 147 ALA n 
1 148 SER n 
1 149 PRO n 
1 150 VAL n 
1 151 LEU n 
1 152 VAL n 
1 153 TYR n 
1 154 GLN n 
1 155 TYR n 
1 156 ALA n 
1 157 ALA n 
1 158 SER n 
1 159 GLY n 
1 160 VAL n 
1 161 GLN n 
1 162 ALA n 
1 163 ASN n 
1 164 ASN n 
1 165 LYS n 
1 166 LEU n 
1 167 LEU n 
1 168 TYR n 
1 169 ASP n 
1 170 LEU n 
1 171 SER n 
1 172 ALA n 
1 173 MET n 
1 174 ARG n 
1 175 ALA n 
1 176 ASP n 
1 177 ILE n 
1 178 GLY n 
1 179 ASP n 
1 180 MET n 
1 181 ARG n 
1 182 LYS n 
1 183 TYR n 
1 184 ALA n 
1 185 VAL n 
1 186 LEU n 
1 187 VAL n 
1 188 TYR n 
1 189 SER n 
1 190 LYS n 
1 191 ASP n 
1 192 ASP n 
1 193 ALA n 
1 194 LEU n 
1 195 GLU n 
1 196 THR n 
1 197 ASP n 
1 198 GLU n 
1 199 LEU n 
1 200 VAL n 
1 201 LEU n 
1 202 HIS n 
1 203 VAL n 
1 204 ASP n 
1 205 ILE n 
1 206 GLU n 
1 207 HIS n 
1 208 GLN n 
1 209 ARG n 
1 210 ILE n 
1 211 PRO n 
1 212 THR n 
1 213 SER n 
1 214 GLY n 
1 215 VAL n 
1 216 LEU n 
1 217 PRO n 
1 218 VAL n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Cucumber mosaic virus (strain FNY)' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      12307 
_entity_src_nat.genus                      Cucumovirus 
_entity_src_nat.species                    'Cucumber mosaic virus' 
_entity_src_nat.strain                     FNY 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    COAT_CMVFN 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P69466 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1F15 A 1 ? 218 ? P69466 1 ? 218 ? 1 218 
2 1 1F15 B 1 ? 218 ? P69466 1 ? 218 ? 1 218 
3 1 1F15 C 1 ? 218 ? P69466 1 ? 218 ? 1 218 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1F15 LEU A 107 ? UNP P69466 ILE 107 CONFLICT 107 1 
2 1F15 LEU B 107 ? UNP P69466 ILE 107 CONFLICT 107 2 
3 1F15 LEU C 107 ? UNP P69466 ILE 107 CONFLICT 107 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1F15 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'Sodium formate, sodium acetate, PEG 8000, cyclohexyl-pentyl-D-maltoside, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           115 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   1998-10-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   18.6 
_reflns_shell.Rmerge_I_obs           0.131 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1F15 
_refine.ls_number_reflns_obs                     288647 
_refine.ls_number_reflns_all                     288647 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            3.2 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.246 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4200 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4200 
_refine_hist.d_res_high                       3.2 
_refine_hist.d_res_low                        8.0 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given    ? 1.00000000  0.00000000  0.00000000  0.00000000  1.00000000  0.00000000 0.00000000  0.00000000 1.00000000 0.00000 
0.00000 0.00000 
2 generate ? 0.30901699  -0.80901699 0.50000000  0.80901699  0.50000000  0.30901699 -0.50000000 0.30901699 0.80901699 0.00000 
0.00000 0.00000 
3 generate ? -0.80901699 -0.50000000 0.30901699  0.50000000  -0.30901699 0.80901699 -0.30901699 0.80901699 0.50000000 0.00000 
0.00000 0.00000 
4 generate ? -0.80901699 0.50000000  -0.30901699 -0.50000000 -0.30901699 0.80901699 0.30901699  0.80901699 0.50000000 0.00000 
0.00000 0.00000 
5 generate ? 0.30901699  0.80901699  -0.50000000 -0.80901699 0.50000000  0.30901699 0.50000000  0.30901699 0.80901699 0.00000 
0.00000 0.00000 
# 
_struct.entry_id                  1F15 
_struct.title                     'CUCUMBER MOSAIC VIRUS (STRAIN FNY)' 
_struct.pdbx_descriptor           'COAT PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F15 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            'virus, beta barrel, Icosahedral virus' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 93  ? GLU A 98  ? PRO A 93  GLU A 98  1 ? 6  
HELX_P HELX_P2  2  ALA A 138 ? ASP A 145 ? ALA A 138 ASP A 145 1 ? 8  
HELX_P HELX_P3  3  LEU A 170 ? ARG A 174 ? LEU A 170 ARG A 174 5 ? 5  
HELX_P HELX_P4  4  ILE A 177 ? ARG A 181 ? ILE A 177 ARG A 181 1 ? 5  
HELX_P HELX_P5  5  ASN B 31  ? ALA B 48  ? ASN B 31  ALA B 48  1 ? 18 
HELX_P HELX_P6  6  PRO B 93  ? GLU B 98  ? PRO B 93  GLU B 98  1 ? 6  
HELX_P HELX_P7  7  VAL B 136 ? ASP B 145 ? VAL B 136 ASP B 145 1 ? 10 
HELX_P HELX_P8  8  SER B 171 ? ARG B 174 ? SER B 171 ARG B 174 5 ? 4  
HELX_P HELX_P9  9  GLY B 178 ? ARG B 181 ? GLY B 178 ARG B 181 5 ? 4  
HELX_P HELX_P10 10 ALA C 30  ? ALA C 48  ? ALA C 30  ALA C 48  1 ? 19 
HELX_P HELX_P11 11 PRO C 93  ? GLU C 98  ? PRO C 93  GLU C 98  1 ? 6  
HELX_P HELX_P12 12 ALA C 137 ? PHE C 143 ? ALA C 137 PHE C 143 1 ? 7  
HELX_P HELX_P13 13 SER C 171 ? ARG C 174 ? SER C 171 ARG C 174 5 ? 4  
HELX_P HELX_P14 14 GLY C 178 ? ARG C 181 ? GLY C 178 ARG C 181 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 175 ? ASP A 176 ? ALA A 175 ASP A 176 
A 2 LEU A 103 ? PRO A 113 ? LEU A 103 PRO A 113 
A 3 LEU A 199 ? GLN A 208 ? LEU A 199 GLN A 208 
A 4 TYR A 68  ? THR A 69  ? TYR A 68  THR A 69  
B 1 ALA A 175 ? ASP A 176 ? ALA A 175 ASP A 176 
B 2 LEU A 103 ? PRO A 113 ? LEU A 103 PRO A 113 
B 3 LEU A 199 ? GLN A 208 ? LEU A 199 GLN A 208 
B 4 SER A 72  ? LEU A 75  ? SER A 72  LEU A 75  
C 1 TYR A 85  ? ARG A 89  ? TYR A 85  ARG A 89  
C 2 TYR A 183 ? TYR A 188 ? TYR A 183 TYR A 188 
C 3 VAL A 121 ? LYS A 127 ? VAL A 121 LYS A 127 
C 4 LEU A 151 ? TYR A 153 ? LEU A 151 TYR A 153 
D 1 TYR B 68  ? LEU B 75  ? TYR B 68  LEU B 75  
D 2 VAL B 200 ? GLN B 208 ? VAL B 200 GLN B 208 
D 3 LEU B 103 ? ASN B 112 ? LEU B 103 ASN B 112 
D 4 LYS B 165 ? ASP B 169 ? LYS B 165 ASP B 169 
E 1 TYR B 68  ? LEU B 75  ? TYR B 68  LEU B 75  
E 2 VAL B 200 ? GLN B 208 ? VAL B 200 GLN B 208 
E 3 LEU B 103 ? ASN B 112 ? LEU B 103 ASN B 112 
E 4 ALA B 175 ? ASP B 176 ? ALA B 175 ASP B 176 
F 1 TYR B 85  ? ARG B 89  ? TYR B 85  ARG B 89  
F 2 TYR B 183 ? SER B 189 ? TYR B 183 SER B 189 
F 3 THR B 120 ? LYS B 127 ? THR B 120 LYS B 127 
F 4 LEU B 151 ? GLN B 154 ? LEU B 151 GLN B 154 
G 1 TYR C 68  ? LEU C 75  ? TYR C 68  LEU C 75  
G 2 LEU C 199 ? GLN C 208 ? LEU C 199 GLN C 208 
G 3 ARG C 106 ? PRO C 113 ? ARG C 106 PRO C 113 
G 4 LYS C 165 ? ASP C 169 ? LYS C 165 ASP C 169 
H 1 GLY C 87  ? ARG C 89  ? GLY C 87  ARG C 89  
H 2 TYR C 183 ? SER C 189 ? TYR C 183 SER C 189 
H 3 THR C 120 ? LYS C 127 ? THR C 120 LYS C 127 
H 4 LEU C 151 ? GLN C 154 ? LEU C 151 GLN C 154 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 175 ? O ALA A 175 N VAL A 104 ? N VAL A 104 
A 2 3 O ASN A 112 ? O ASN A 112 N VAL A 200 ? N VAL A 200 
A 3 4 O HIS A 207 ? O HIS A 207 N THR A 69  ? N THR A 69  
B 1 2 O ALA A 175 ? O ALA A 175 N VAL A 104 ? N VAL A 104 
B 2 3 O ASN A 112 ? O ASN A 112 N VAL A 200 ? N VAL A 200 
B 3 4 O VAL A 203 ? O VAL A 203 N ILE A 73  ? N ILE A 73  
C 1 2 O LYS A 88  ? O LYS A 88  N VAL A 185 ? N VAL A 185 
C 2 3 O TYR A 188 ? O TYR A 188 N TRP A 122 ? N TRP A 122 
C 3 4 N VAL A 123 ? N VAL A 123 O LEU A 151 ? O LEU A 151 
D 1 2 N LEU B 75  ? N LEU B 75  O LEU B 201 ? O LEU B 201 
D 2 3 N GLN B 208 ? N GLN B 208 O LEU B 103 ? O LEU B 103 
D 3 4 N ILE B 109 ? N ILE B 109 O LEU B 166 ? O LEU B 166 
E 1 2 N LEU B 75  ? N LEU B 75  O LEU B 201 ? O LEU B 201 
E 2 3 N GLN B 208 ? N GLN B 208 O LEU B 103 ? O LEU B 103 
E 3 4 N VAL B 104 ? N VAL B 104 O ALA B 175 ? O ALA B 175 
F 1 2 O LYS B 88  ? O LYS B 88  N VAL B 185 ? N VAL B 185 
F 2 3 N TYR B 188 ? N TYR B 188 O TRP B 122 ? O TRP B 122 
F 3 4 O VAL B 123 ? O VAL B 123 N LEU B 151 ? N LEU B 151 
G 1 2 N LEU C 75  ? N LEU C 75  O LEU C 201 ? O LEU C 201 
G 2 3 N GLU C 206 ? N GLU C 206 O ARG C 106 ? O ARG C 106 
G 3 4 N ILE C 109 ? N ILE C 109 O LEU C 166 ? O LEU C 166 
H 1 2 O LYS C 88  ? O LYS C 88  N VAL C 185 ? N VAL C 185 
H 2 3 O TYR C 188 ? O TYR C 188 N TRP C 122 ? N TRP C 122 
H 3 4 N VAL C 123 ? N VAL C 123 O LEU C 151 ? O LEU C 151 
# 
_database_PDB_matrix.entry_id          1F15 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1F15 
_atom_sites.fract_transf_matrix[1][1]   0.002976 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002976 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002976 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . GLU A 1 62  ? 8.919  50.743 104.089 1.00 42.64 ? 62  GLU A N   1 
ATOM 2    C CA  . GLU A 1 62  ? 9.306  50.945 102.646 1.00 42.72 ? 62  GLU A CA  1 
ATOM 3    C C   . GLU A 1 62  ? 10.215 49.798 102.274 1.00 39.03 ? 62  GLU A C   1 
ATOM 4    O O   . GLU A 1 62  ? 11.293 49.639 102.837 1.00 34.25 ? 62  GLU A O   1 
ATOM 5    C CB  . GLU A 1 62  ? 10.024 52.296 102.422 1.00 45.62 ? 62  GLU A CB  1 
ATOM 6    C CG  . GLU A 1 62  ? 9.127  53.492 101.950 1.00 50.16 ? 62  GLU A CG  1 
ATOM 7    C CD  . GLU A 1 62  ? 8.061  53.991 102.989 1.00 56.18 ? 62  GLU A CD  1 
ATOM 8    O OE1 . GLU A 1 62  ? 8.357  54.103 104.220 1.00 57.13 ? 62  GLU A OE1 1 
ATOM 9    O OE2 . GLU A 1 62  ? 6.918  54.304 102.550 1.00 56.47 ? 62  GLU A OE2 1 
ATOM 10   N N   . ARG A 1 63  ? 9.752  48.985 101.340 1.00 38.68 ? 63  ARG A N   1 
ATOM 11   C CA  . ARG A 1 63  ? 10.494 47.810 100.910 1.00 39.11 ? 63  ARG A CA  1 
ATOM 12   C C   . ARG A 1 63  ? 11.978 48.100 100.667 1.00 37.90 ? 63  ARG A C   1 
ATOM 13   O O   . ARG A 1 63  ? 12.345 48.932 99.818  1.00 38.78 ? 63  ARG A O   1 
ATOM 14   C CB  . ARG A 1 63  ? 9.825  47.154 99.675  1.00 41.31 ? 63  ARG A CB  1 
ATOM 15   C CG  . ARG A 1 63  ? 8.459  46.434 99.948  1.00 44.43 ? 63  ARG A CG  1 
ATOM 16   C CD  . ARG A 1 63  ? 7.181  47.361 99.868  1.00 46.80 ? 63  ARG A CD  1 
ATOM 17   N NE  . ARG A 1 63  ? 6.925  48.223 101.047 1.00 50.14 ? 63  ARG A NE  1 
ATOM 18   C CZ  . ARG A 1 63  ? 6.551  49.513 101.000 1.00 46.80 ? 63  ARG A CZ  1 
ATOM 19   N NH1 . ARG A 1 63  ? 6.375  50.135 99.830  1.00 48.21 ? 63  ARG A NH1 1 
ATOM 20   N NH2 . ARG A 1 63  ? 6.360  50.193 102.130 1.00 41.78 ? 63  ARG A NH2 1 
ATOM 21   N N   . CYS A 1 64  ? 12.822 47.502 101.502 1.00 35.28 ? 64  CYS A N   1 
ATOM 22   C CA  . CYS A 1 64  ? 14.250 47.689 101.345 1.00 34.75 ? 64  CYS A CA  1 
ATOM 23   C C   . CYS A 1 64  ? 14.732 46.869 100.165 1.00 36.07 ? 64  CYS A C   1 
ATOM 24   O O   . CYS A 1 64  ? 14.085 45.896 99.759  1.00 37.24 ? 64  CYS A O   1 
ATOM 25   C CB  . CYS A 1 64  ? 15.027 47.359 102.622 1.00 30.33 ? 64  CYS A CB  1 
ATOM 26   S SG  . CYS A 1 64  ? 14.692 45.797 103.380 1.00 31.08 ? 64  CYS A SG  1 
ATOM 27   N N   . ARG A 1 65  ? 15.810 47.347 99.555  1.00 36.26 ? 65  ARG A N   1 
ATOM 28   C CA  . ARG A 1 65  ? 16.419 46.718 98.386  1.00 33.51 ? 65  ARG A CA  1 
ATOM 29   C C   . ARG A 1 65  ? 16.528 45.202 98.431  1.00 31.54 ? 65  ARG A C   1 
ATOM 30   O O   . ARG A 1 65  ? 16.670 44.582 99.508  1.00 30.84 ? 65  ARG A O   1 
ATOM 31   C CB  . ARG A 1 65  ? 17.825 47.283 98.149  1.00 34.68 ? 65  ARG A CB  1 
ATOM 32   C CG  . ARG A 1 65  ? 17.880 48.774 98.075  1.00 34.42 ? 65  ARG A CG  1 
ATOM 33   C CD  . ARG A 1 65  ? 19.165 49.240 98.658  1.00 37.05 ? 65  ARG A CD  1 
ATOM 34   N NE  . ARG A 1 65  ? 19.260 50.688 98.599  1.00 46.26 ? 65  ARG A NE  1 
ATOM 35   C CZ  . ARG A 1 65  ? 20.107 51.343 97.808  1.00 49.39 ? 65  ARG A CZ  1 
ATOM 36   N NH1 . ARG A 1 65  ? 20.929 50.654 97.008  1.00 48.31 ? 65  ARG A NH1 1 
ATOM 37   N NH2 . ARG A 1 65  ? 20.146 52.682 97.836  1.00 45.49 ? 65  ARG A NH2 1 
ATOM 38   N N   . PRO A 1 66  ? 16.529 44.590 97.244  1.00 29.49 ? 66  PRO A N   1 
ATOM 39   C CA  . PRO A 1 66  ? 16.635 43.140 97.072  1.00 27.29 ? 66  PRO A CA  1 
ATOM 40   C C   . PRO A 1 66  ? 17.993 42.621 97.574  1.00 27.22 ? 66  PRO A C   1 
ATOM 41   O O   . PRO A 1 66  ? 19.061 43.167 97.250  1.00 24.00 ? 66  PRO A O   1 
ATOM 42   C CB  . PRO A 1 66  ? 16.506 42.973 95.555  1.00 29.41 ? 66  PRO A CB  1 
ATOM 43   C CG  . PRO A 1 66  ? 17.126 44.247 95.031  1.00 30.13 ? 66  PRO A CG  1 
ATOM 44   C CD  . PRO A 1 66  ? 16.500 45.276 95.941  1.00 26.09 ? 66  PRO A CD  1 
ATOM 45   N N   . GLY A 1 67  ? 17.943 41.579 98.391  1.00 25.44 ? 67  GLY A N   1 
ATOM 46   C CA  . GLY A 1 67  ? 19.175 41.003 98.891  1.00 20.59 ? 67  GLY A CA  1 
ATOM 47   C C   . GLY A 1 67  ? 19.715 41.795 100.046 1.00 17.20 ? 67  GLY A C   1 
ATOM 48   O O   . GLY A 1 67  ? 20.821 41.540 100.514 1.00 18.17 ? 67  GLY A O   1 
ATOM 49   N N   . TYR A 1 68  ? 18.947 42.783 100.476 1.00 13.06 ? 68  TYR A N   1 
ATOM 50   C CA  . TYR A 1 68  ? 19.333 43.587 101.610 1.00 12.45 ? 68  TYR A CA  1 
ATOM 51   C C   . TYR A 1 68  ? 18.278 43.379 102.670 1.00 12.31 ? 68  TYR A C   1 
ATOM 52   O O   . TYR A 1 68  ? 17.176 42.907 102.352 1.00 19.94 ? 68  TYR A O   1 
ATOM 53   C CB  . TYR A 1 68  ? 19.361 45.037 101.224 1.00 11.28 ? 68  TYR A CB  1 
ATOM 54   C CG  . TYR A 1 68  ? 20.537 45.377 100.393 1.00 8.46  ? 68  TYR A CG  1 
ATOM 55   C CD1 . TYR A 1 68  ? 20.530 45.177 99.027  1.00 6.41  ? 68  TYR A CD1 1 
ATOM 56   C CD2 . TYR A 1 68  ? 21.638 45.973 100.967 1.00 12.49 ? 68  TYR A CD2 1 
ATOM 57   C CE1 . TYR A 1 68  ? 21.598 45.585 98.249  1.00 12.61 ? 68  TYR A CE1 1 
ATOM 58   C CE2 . TYR A 1 68  ? 22.712 46.376 100.215 1.00 17.87 ? 68  TYR A CE2 1 
ATOM 59   C CZ  . TYR A 1 68  ? 22.696 46.189 98.854  1.00 17.04 ? 68  TYR A CZ  1 
ATOM 60   O OH  . TYR A 1 68  ? 23.791 46.624 98.124  1.00 18.48 ? 68  TYR A OH  1 
ATOM 61   N N   . THR A 1 69  ? 18.616 43.718 103.913 1.00 8.18  ? 69  THR A N   1 
ATOM 62   C CA  . THR A 1 69  ? 17.707 43.604 105.052 1.00 8.72  ? 69  THR A CA  1 
ATOM 63   C C   . THR A 1 69  ? 18.262 44.513 106.114 1.00 6.21  ? 69  THR A C   1 
ATOM 64   O O   . THR A 1 69  ? 19.468 44.720 106.170 1.00 13.60 ? 69  THR A O   1 
ATOM 65   C CB  . THR A 1 69  ? 17.677 42.195 105.608 1.00 9.78  ? 69  THR A CB  1 
ATOM 66   O OG1 . THR A 1 69  ? 19.005 41.650 105.582 1.00 11.50 ? 69  THR A OG1 1 
ATOM 67   C CG2 . THR A 1 69  ? 16.738 41.324 104.791 1.00 8.24  ? 69  THR A CG2 1 
ATOM 68   N N   . PHE A 1 70  ? 17.407 45.073 106.956 1.00 6.55  ? 70  PHE A N   1 
ATOM 69   C CA  . PHE A 1 70  ? 17.901 45.981 107.986 1.00 7.93  ? 70  PHE A CA  1 
ATOM 70   C C   . PHE A 1 70  ? 18.488 45.188 109.122 1.00 5.14  ? 70  PHE A C   1 
ATOM 71   O O   . PHE A 1 70  ? 18.303 43.987 109.163 1.00 9.01  ? 70  PHE A O   1 
ATOM 72   C CB  . PHE A 1 70  ? 16.770 46.911 108.455 1.00 14.76 ? 70  PHE A CB  1 
ATOM 73   C CG  . PHE A 1 70  ? 16.452 48.041 107.455 1.00 22.34 ? 70  PHE A CG  1 
ATOM 74   C CD1 . PHE A 1 70  ? 15.626 47.815 106.341 1.00 19.27 ? 70  PHE A CD1 1 
ATOM 75   C CD2 . PHE A 1 70  ? 17.042 49.318 107.595 1.00 24.53 ? 70  PHE A CD2 1 
ATOM 76   C CE1 . PHE A 1 70  ? 15.409 48.828 105.396 1.00 15.46 ? 70  PHE A CE1 1 
ATOM 77   C CE2 . PHE A 1 70  ? 16.820 50.329 106.642 1.00 17.93 ? 70  PHE A CE2 1 
ATOM 78   C CZ  . PHE A 1 70  ? 16.006 50.077 105.549 1.00 16.65 ? 70  PHE A CZ  1 
ATOM 79   N N   . THR A 1 71  ? 19.333 45.815 109.927 1.00 2.00  ? 71  THR A N   1 
ATOM 80   C CA  . THR A 1 71  ? 19.926 45.176 111.117 1.00 4.10  ? 71  THR A CA  1 
ATOM 81   C C   . THR A 1 71  ? 19.836 46.303 112.126 1.00 3.91  ? 71  THR A C   1 
ATOM 82   O O   . THR A 1 71  ? 20.427 47.353 111.904 1.00 9.98  ? 71  THR A O   1 
ATOM 83   C CB  . THR A 1 71  ? 21.403 44.779 110.931 1.00 3.28  ? 71  THR A CB  1 
ATOM 84   O OG1 . THR A 1 71  ? 21.476 43.510 110.273 1.00 2.00  ? 71  THR A OG1 1 
ATOM 85   C CG2 . THR A 1 71  ? 22.104 44.693 112.295 1.00 2.00  ? 71  THR A CG2 1 
ATOM 86   N N   . SER A 1 72  ? 19.139 46.108 113.235 1.00 3.59  ? 72  SER A N   1 
ATOM 87   C CA  . SER A 1 72  ? 18.965 47.229 114.146 1.00 6.84  ? 72  SER A CA  1 
ATOM 88   C C   . SER A 1 72  ? 19.687 47.264 115.464 1.00 7.57  ? 72  SER A C   1 
ATOM 89   O O   . SER A 1 72  ? 19.540 46.363 116.282 1.00 13.28 ? 72  SER A O   1 
ATOM 90   C CB  . SER A 1 72  ? 17.477 47.459 114.401 1.00 10.84 ? 72  SER A CB  1 
ATOM 91   O OG  . SER A 1 72  ? 16.832 48.057 113.284 1.00 11.51 ? 72  SER A OG  1 
ATOM 92   N N   . ILE A 1 73  ? 20.390 48.361 115.701 1.00 4.30  ? 73  ILE A N   1 
ATOM 93   C CA  . ILE A 1 73  ? 21.112 48.554 116.936 1.00 4.48  ? 73  ILE A CA  1 
ATOM 94   C C   . ILE A 1 73  ? 20.163 49.287 117.863 1.00 5.51  ? 73  ILE A C   1 
ATOM 95   O O   . ILE A 1 73  ? 19.546 50.274 117.459 1.00 13.41 ? 73  ILE A O   1 
ATOM 96   C CB  . ILE A 1 73  ? 22.291 49.414 116.675 1.00 2.00  ? 73  ILE A CB  1 
ATOM 97   C CG1 . ILE A 1 73  ? 23.136 48.755 115.612 1.00 4.50  ? 73  ILE A CG1 1 
ATOM 98   C CG2 . ILE A 1 73  ? 23.099 49.627 117.924 1.00 6.57  ? 73  ILE A CG2 1 
ATOM 99   C CD1 . ILE A 1 73  ? 24.367 49.507 115.302 1.00 14.73 ? 73  ILE A CD1 1 
ATOM 100  N N   . THR A 1 74  ? 19.989 48.807 119.086 1.00 6.25  ? 74  THR A N   1 
ATOM 101  C CA  . THR A 1 74  ? 19.087 49.492 119.991 1.00 9.08  ? 74  THR A CA  1 
ATOM 102  C C   . THR A 1 74  ? 19.875 50.163 121.051 1.00 9.82  ? 74  THR A C   1 
ATOM 103  O O   . THR A 1 74  ? 20.640 49.492 121.711 1.00 21.26 ? 74  THR A O   1 
ATOM 104  C CB  . THR A 1 74  ? 18.220 48.532 120.747 1.00 7.05  ? 74  THR A CB  1 
ATOM 105  O OG1 . THR A 1 74  ? 17.164 48.063 119.903 1.00 16.90 ? 74  THR A OG1 1 
ATOM 106  C CG2 . THR A 1 74  ? 17.639 49.222 121.949 1.00 2.00  ? 74  THR A CG2 1 
ATOM 107  N N   . LEU A 1 75  ? 19.689 51.457 121.258 1.00 10.34 ? 75  LEU A N   1 
ATOM 108  C CA  . LEU A 1 75  ? 20.411 52.115 122.332 1.00 11.32 ? 75  LEU A CA  1 
ATOM 109  C C   . LEU A 1 75  ? 19.445 52.703 123.330 1.00 11.51 ? 75  LEU A C   1 
ATOM 110  O O   . LEU A 1 75  ? 18.483 53.371 122.960 1.00 14.31 ? 75  LEU A O   1 
ATOM 111  C CB  . LEU A 1 75  ? 21.355 53.240 121.854 1.00 11.81 ? 75  LEU A CB  1 
ATOM 112  C CG  . LEU A 1 75  ? 21.793 54.060 123.108 1.00 16.96 ? 75  LEU A CG  1 
ATOM 113  C CD1 . LEU A 1 75  ? 22.699 53.205 124.026 1.00 18.05 ? 75  LEU A CD1 1 
ATOM 114  C CD2 . LEU A 1 75  ? 22.472 55.386 122.806 1.00 7.63  ? 75  LEU A CD2 1 
ATOM 115  N N   . LYS A 1 76  ? 19.698 52.406 124.598 1.00 14.16 ? 76  LYS A N   1 
ATOM 116  C CA  . LYS A 1 76  ? 18.931 52.970 125.704 1.00 16.65 ? 76  LYS A CA  1 
ATOM 117  C C   . LYS A 1 76  ? 19.936 53.971 126.311 1.00 19.50 ? 76  LYS A C   1 
ATOM 118  O O   . LYS A 1 76  ? 20.880 53.560 127.002 1.00 20.27 ? 76  LYS A O   1 
ATOM 119  C CB  . LYS A 1 76  ? 18.581 51.885 126.737 1.00 16.64 ? 76  LYS A CB  1 
ATOM 120  C CG  . LYS A 1 76  ? 17.625 50.790 126.254 1.00 17.92 ? 76  LYS A CG  1 
ATOM 121  C CD  . LYS A 1 76  ? 16.640 50.327 127.361 1.00 24.94 ? 76  LYS A CD  1 
ATOM 122  C CE  . LYS A 1 76  ? 15.805 51.510 127.962 1.00 28.73 ? 76  LYS A CE  1 
ATOM 123  N NZ  . LYS A 1 76  ? 14.673 51.102 128.886 1.00 26.36 ? 76  LYS A NZ  1 
ATOM 124  N N   . PRO A 1 77  ? 19.810 55.280 125.999 1.00 18.95 ? 77  PRO A N   1 
ATOM 125  C CA  . PRO A 1 77  ? 20.795 56.190 126.595 1.00 16.60 ? 77  PRO A CA  1 
ATOM 126  C C   . PRO A 1 77  ? 20.723 56.206 128.108 1.00 16.06 ? 77  PRO A C   1 
ATOM 127  O O   . PRO A 1 77  ? 19.722 55.811 128.704 1.00 16.20 ? 77  PRO A O   1 
ATOM 128  C CB  . PRO A 1 77  ? 20.417 57.549 126.005 1.00 16.99 ? 77  PRO A CB  1 
ATOM 129  C CG  . PRO A 1 77  ? 18.935 57.441 125.884 1.00 15.49 ? 77  PRO A CG  1 
ATOM 130  C CD  . PRO A 1 77  ? 18.778 56.047 125.276 1.00 19.22 ? 77  PRO A CD  1 
ATOM 131  N N   . PRO A 1 78  ? 21.817 56.606 128.745 1.00 14.20 ? 78  PRO A N   1 
ATOM 132  C CA  . PRO A 1 78  ? 21.995 56.713 130.186 1.00 16.33 ? 78  PRO A CA  1 
ATOM 133  C C   . PRO A 1 78  ? 21.367 58.036 130.588 1.00 19.09 ? 78  PRO A C   1 
ATOM 134  O O   . PRO A 1 78  ? 20.737 58.667 129.753 1.00 24.04 ? 78  PRO A O   1 
ATOM 135  C CB  . PRO A 1 78  ? 23.506 56.791 130.300 1.00 20.50 ? 78  PRO A CB  1 
ATOM 136  C CG  . PRO A 1 78  ? 23.847 57.662 129.151 1.00 15.36 ? 78  PRO A CG  1 
ATOM 137  C CD  . PRO A 1 78  ? 23.030 57.051 128.045 1.00 14.32 ? 78  PRO A CD  1 
ATOM 138  N N   . LYS A 1 79  ? 21.551 58.479 131.830 1.00 19.47 ? 79  LYS A N   1 
ATOM 139  C CA  . LYS A 1 79  ? 20.985 59.767 132.231 1.00 19.41 ? 79  LYS A CA  1 
ATOM 140  C C   . LYS A 1 79  ? 21.771 60.838 131.494 1.00 17.58 ? 79  LYS A C   1 
ATOM 141  O O   . LYS A 1 79  ? 22.905 60.596 131.100 1.00 20.41 ? 79  LYS A O   1 
ATOM 142  C CB  . LYS A 1 79  ? 21.107 59.974 133.733 1.00 23.01 ? 79  LYS A CB  1 
ATOM 143  C CG  . LYS A 1 79  ? 20.548 61.311 134.225 1.00 26.43 ? 79  LYS A CG  1 
ATOM 144  C CD  . LYS A 1 79  ? 19.751 61.084 135.519 1.00 33.64 ? 79  LYS A CD  1 
ATOM 145  C CE  . LYS A 1 79  ? 19.179 62.367 136.167 1.00 34.14 ? 79  LYS A CE  1 
ATOM 146  N NZ  . LYS A 1 79  ? 20.172 63.272 136.838 1.00 35.80 ? 79  LYS A NZ  1 
ATOM 147  N N   . ILE A 1 80  ? 21.183 62.005 131.284 1.00 14.22 ? 80  ILE A N   1 
ATOM 148  C CA  . ILE A 1 80  ? 21.885 63.064 130.582 1.00 14.77 ? 80  ILE A CA  1 
ATOM 149  C C   . ILE A 1 80  ? 21.391 64.348 131.183 1.00 16.22 ? 80  ILE A C   1 
ATOM 150  O O   . ILE A 1 80  ? 20.214 64.651 131.121 1.00 10.55 ? 80  ILE A O   1 
ATOM 151  C CB  . ILE A 1 80  ? 21.590 63.068 129.056 1.00 15.79 ? 80  ILE A CB  1 
ATOM 152  C CG1 . ILE A 1 80  ? 22.075 61.762 128.393 1.00 10.36 ? 80  ILE A CG1 1 
ATOM 153  C CG2 . ILE A 1 80  ? 22.256 64.291 128.413 1.00 15.05 ? 80  ILE A CG2 1 
ATOM 154  C CD1 . ILE A 1 80  ? 21.826 61.674 126.920 1.00 2.25  ? 80  ILE A CD1 1 
ATOM 155  N N   . ASP A 1 81  ? 22.296 65.115 131.763 1.00 22.69 ? 81  ASP A N   1 
ATOM 156  C CA  . ASP A 1 81  ? 21.896 66.355 132.415 1.00 25.73 ? 81  ASP A CA  1 
ATOM 157  C C   . ASP A 1 81  ? 21.531 67.376 131.382 1.00 24.22 ? 81  ASP A C   1 
ATOM 158  O O   . ASP A 1 81  ? 21.931 67.265 130.217 1.00 21.85 ? 81  ASP A O   1 
ATOM 159  C CB  . ASP A 1 81  ? 23.004 66.905 133.325 1.00 32.84 ? 81  ASP A CB  1 
ATOM 160  C CG  . ASP A 1 81  ? 23.474 65.890 134.379 1.00 38.66 ? 81  ASP A CG  1 
ATOM 161  O OD1 . ASP A 1 81  ? 22.665 65.492 135.268 1.00 39.29 ? 81  ASP A OD1 1 
ATOM 162  O OD2 . ASP A 1 81  ? 24.668 65.499 134.314 1.00 40.77 ? 81  ASP A OD2 1 
ATOM 163  N N   . ARG A 1 82  ? 20.785 68.378 131.831 1.00 22.61 ? 82  ARG A N   1 
ATOM 164  C CA  . ARG A 1 82  ? 20.306 69.458 130.983 1.00 23.52 ? 82  ARG A CA  1 
ATOM 165  C C   . ARG A 1 82  ? 21.449 69.978 130.127 1.00 22.28 ? 82  ARG A C   1 
ATOM 166  O O   . ARG A 1 82  ? 22.565 70.134 130.604 1.00 21.67 ? 82  ARG A O   1 
ATOM 167  C CB  . ARG A 1 82  ? 19.715 70.560 131.863 1.00 28.28 ? 82  ARG A CB  1 
ATOM 168  C CG  . ARG A 1 82  ? 19.013 71.674 131.115 1.00 34.41 ? 82  ARG A CG  1 
ATOM 169  C CD  . ARG A 1 82  ? 19.927 72.892 130.919 1.00 43.95 ? 82  ARG A CD  1 
ATOM 170  N NE  . ARG A 1 82  ? 19.319 73.934 130.086 1.00 47.56 ? 82  ARG A NE  1 
ATOM 171  C CZ  . ARG A 1 82  ? 18.351 74.754 130.492 1.00 48.08 ? 82  ARG A CZ  1 
ATOM 172  N NH1 . ARG A 1 82  ? 17.874 74.664 131.736 1.00 48.48 ? 82  ARG A NH1 1 
ATOM 173  N NH2 . ARG A 1 82  ? 17.829 75.634 129.636 1.00 48.59 ? 82  ARG A NH2 1 
ATOM 174  N N   . GLY A 1 83  ? 21.189 70.169 128.841 1.00 22.20 ? 83  GLY A N   1 
ATOM 175  C CA  . GLY A 1 83  ? 22.230 70.658 127.959 1.00 23.18 ? 83  GLY A CA  1 
ATOM 176  C C   . GLY A 1 83  ? 23.549 69.887 127.986 1.00 20.68 ? 83  GLY A C   1 
ATOM 177  O O   . GLY A 1 83  ? 24.611 70.476 127.762 1.00 23.32 ? 83  GLY A O   1 
ATOM 178  N N   . SER A 1 84  ? 23.513 68.595 128.290 1.00 18.34 ? 84  SER A N   1 
ATOM 179  C CA  . SER A 1 84  ? 24.738 67.805 128.294 1.00 16.81 ? 84  SER A CA  1 
ATOM 180  C C   . SER A 1 84  ? 24.720 66.962 127.027 1.00 14.59 ? 84  SER A C   1 
ATOM 181  O O   . SER A 1 84  ? 23.847 67.160 126.187 1.00 18.46 ? 84  SER A O   1 
ATOM 182  C CB  . SER A 1 84  ? 24.764 66.914 129.522 1.00 20.73 ? 84  SER A CB  1 
ATOM 183  O OG  . SER A 1 84  ? 25.936 66.123 129.547 1.00 25.92 ? 84  SER A OG  1 
ATOM 184  N N   . TYR A 1 85  ? 25.684 66.072 126.835 1.00 8.09  ? 85  TYR A N   1 
ATOM 185  C CA  . TYR A 1 85  ? 25.661 65.239 125.645 1.00 8.01  ? 85  TYR A CA  1 
ATOM 186  C C   . TYR A 1 85  ? 26.069 63.815 125.958 1.00 10.17 ? 85  TYR A C   1 
ATOM 187  O O   . TYR A 1 85  ? 26.589 63.560 127.044 1.00 14.67 ? 85  TYR A O   1 
ATOM 188  C CB  . TYR A 1 85  ? 26.578 65.778 124.580 1.00 8.83  ? 85  TYR A CB  1 
ATOM 189  C CG  . TYR A 1 85  ? 26.241 67.143 124.072 1.00 8.02  ? 85  TYR A CG  1 
ATOM 190  C CD1 . TYR A 1 85  ? 26.361 68.255 124.890 1.00 12.02 ? 85  TYR A CD1 1 
ATOM 191  C CD2 . TYR A 1 85  ? 25.897 67.338 122.735 1.00 13.39 ? 85  TYR A CD2 1 
ATOM 192  C CE1 . TYR A 1 85  ? 26.157 69.532 124.392 1.00 18.95 ? 85  TYR A CE1 1 
ATOM 193  C CE2 . TYR A 1 85  ? 25.693 68.605 122.222 1.00 13.95 ? 85  TYR A CE2 1 
ATOM 194  C CZ  . TYR A 1 85  ? 25.830 69.704 123.055 1.00 16.69 ? 85  TYR A CZ  1 
ATOM 195  O OH  . TYR A 1 85  ? 25.696 70.976 122.552 1.00 17.68 ? 85  TYR A OH  1 
ATOM 196  N N   . TYR A 1 86  ? 25.825 62.893 125.018 1.00 10.62 ? 86  TYR A N   1 
ATOM 197  C CA  . TYR A 1 86  ? 26.170 61.470 125.166 1.00 13.07 ? 86  TYR A CA  1 
ATOM 198  C C   . TYR A 1 86  ? 26.351 60.817 123.806 1.00 16.12 ? 86  TYR A C   1 
ATOM 199  O O   . TYR A 1 86  ? 25.594 61.086 122.879 1.00 18.68 ? 86  TYR A O   1 
ATOM 200  C CB  . TYR A 1 86  ? 25.083 60.707 125.915 1.00 12.01 ? 86  TYR A CB  1 
ATOM 201  C CG  . TYR A 1 86  ? 25.238 59.193 125.852 1.00 13.37 ? 86  TYR A CG  1 
ATOM 202  C CD1 . TYR A 1 86  ? 26.058 58.515 126.747 1.00 19.87 ? 86  TYR A CD1 1 
ATOM 203  C CD2 . TYR A 1 86  ? 24.507 58.426 124.940 1.00 19.77 ? 86  TYR A CD2 1 
ATOM 204  C CE1 . TYR A 1 86  ? 26.147 57.106 126.743 1.00 18.72 ? 86  TYR A CE1 1 
ATOM 205  C CE2 . TYR A 1 86  ? 24.589 57.016 124.929 1.00 21.61 ? 86  TYR A CE2 1 
ATOM 206  C CZ  . TYR A 1 86  ? 25.408 56.368 125.837 1.00 19.59 ? 86  TYR A CZ  1 
ATOM 207  O OH  . TYR A 1 86  ? 25.474 54.993 125.865 1.00 21.08 ? 86  TYR A OH  1 
ATOM 208  N N   . GLY A 1 87  ? 27.331 59.936 123.679 1.00 19.76 ? 87  GLY A N   1 
ATOM 209  C CA  . GLY A 1 87  ? 27.536 59.279 122.398 1.00 17.62 ? 87  GLY A CA  1 
ATOM 210  C C   . GLY A 1 87  ? 27.607 57.783 122.609 1.00 16.67 ? 87  GLY A C   1 
ATOM 211  O O   . GLY A 1 87  ? 27.317 57.318 123.704 1.00 19.13 ? 87  GLY A O   1 
ATOM 212  N N   . LYS A 1 88  ? 27.971 57.033 121.574 1.00 14.14 ? 88  LYS A N   1 
ATOM 213  C CA  . LYS A 1 88  ? 28.101 55.578 121.654 1.00 13.20 ? 88  LYS A CA  1 
ATOM 214  C C   . LYS A 1 88  ? 28.356 55.151 120.243 1.00 11.25 ? 88  LYS A C   1 
ATOM 215  O O   . LYS A 1 88  ? 27.678 55.608 119.343 1.00 13.96 ? 88  LYS A O   1 
ATOM 216  C CB  . LYS A 1 88  ? 26.809 54.931 122.133 1.00 15.27 ? 88  LYS A CB  1 
ATOM 217  C CG  . LYS A 1 88  ? 26.988 53.688 122.994 1.00 23.03 ? 88  LYS A CG  1 
ATOM 218  C CD  . LYS A 1 88  ? 27.355 52.448 122.182 1.00 27.60 ? 88  LYS A CD  1 
ATOM 219  C CE  . LYS A 1 88  ? 26.557 51.199 122.653 1.00 31.48 ? 88  LYS A CE  1 
ATOM 220  N NZ  . LYS A 1 88  ? 25.294 50.871 121.851 1.00 31.98 ? 88  LYS A NZ  1 
ATOM 221  N N   . ARG A 1 89  ? 29.370 54.336 120.029 1.00 10.84 ? 89  ARG A N   1 
ATOM 222  C CA  . ARG A 1 89  ? 29.674 53.888 118.689 1.00 10.23 ? 89  ARG A CA  1 
ATOM 223  C C   . ARG A 1 89  ? 28.701 52.775 118.301 1.00 9.52  ? 89  ARG A C   1 
ATOM 224  O O   . ARG A 1 89  ? 28.207 52.035 119.154 1.00 9.96  ? 89  ARG A O   1 
ATOM 225  C CB  . ARG A 1 89  ? 31.119 53.414 118.632 1.00 13.56 ? 89  ARG A CB  1 
ATOM 226  C CG  . ARG A 1 89  ? 31.931 54.082 117.523 1.00 22.51 ? 89  ARG A CG  1 
ATOM 227  C CD  . ARG A 1 89  ? 33.452 53.838 117.616 1.00 23.39 ? 89  ARG A CD  1 
ATOM 228  N NE  . ARG A 1 89  ? 34.105 54.703 118.593 1.00 23.21 ? 89  ARG A NE  1 
ATOM 229  C CZ  . ARG A 1 89  ? 34.882 55.737 118.277 1.00 22.90 ? 89  ARG A CZ  1 
ATOM 230  N NH1 . ARG A 1 89  ? 35.121 56.033 116.989 1.00 19.35 ? 89  ARG A NH1 1 
ATOM 231  N NH2 . ARG A 1 89  ? 35.359 56.516 119.260 1.00 25.02 ? 89  ARG A NH2 1 
ATOM 232  N N   . LEU A 1 90  ? 28.358 52.697 117.026 1.00 9.97  ? 90  LEU A N   1 
ATOM 233  C CA  . LEU A 1 90  ? 27.425 51.669 116.604 1.00 11.64 ? 90  LEU A CA  1 
ATOM 234  C C   . LEU A 1 90  ? 28.246 50.406 116.588 1.00 15.93 ? 90  LEU A C   1 
ATOM 235  O O   . LEU A 1 90  ? 29.369 50.410 116.088 1.00 16.55 ? 90  LEU A O   1 
ATOM 236  C CB  . LEU A 1 90  ? 26.909 51.911 115.187 1.00 6.47  ? 90  LEU A CB  1 
ATOM 237  C CG  . LEU A 1 90  ? 26.369 53.238 114.668 1.00 6.17  ? 90  LEU A CG  1 
ATOM 238  C CD1 . LEU A 1 90  ? 25.394 52.950 113.547 1.00 3.17  ? 90  LEU A CD1 1 
ATOM 239  C CD2 . LEU A 1 90  ? 25.669 53.995 115.761 1.00 9.94  ? 90  LEU A CD2 1 
ATOM 240  N N   . LEU A 1 91  ? 27.695 49.317 117.112 1.00 19.43 ? 91  LEU A N   1 
ATOM 241  C CA  . LEU A 1 91  ? 28.413 48.033 117.118 1.00 19.73 ? 91  LEU A CA  1 
ATOM 242  C C   . LEU A 1 91  ? 27.447 46.890 116.844 1.00 15.51 ? 91  LEU A C   1 
ATOM 243  O O   . LEU A 1 91  ? 26.699 46.446 117.710 1.00 14.36 ? 91  LEU A O   1 
ATOM 244  C CB  . LEU A 1 91  ? 29.143 47.825 118.448 1.00 20.67 ? 91  LEU A CB  1 
ATOM 245  C CG  . LEU A 1 91  ? 28.636 48.762 119.566 1.00 27.04 ? 91  LEU A CG  1 
ATOM 246  C CD1 . LEU A 1 91  ? 27.130 48.480 119.926 1.00 24.66 ? 91  LEU A CD1 1 
ATOM 247  C CD2 . LEU A 1 91  ? 29.556 48.643 120.794 1.00 27.32 ? 91  LEU A CD2 1 
ATOM 248  N N   . LEU A 1 92  ? 27.423 46.468 115.594 1.00 12.52 ? 92  LEU A N   1 
ATOM 249  C CA  . LEU A 1 92  ? 26.553 45.401 115.195 1.00 11.26 ? 92  LEU A CA  1 
ATOM 250  C C   . LEU A 1 92  ? 27.047 44.077 115.774 1.00 14.54 ? 92  LEU A C   1 
ATOM 251  O O   . LEU A 1 92  ? 28.196 43.964 116.221 1.00 14.63 ? 92  LEU A O   1 
ATOM 252  C CB  . LEU A 1 92  ? 26.573 45.302 113.678 1.00 7.86  ? 92  LEU A CB  1 
ATOM 253  C CG  . LEU A 1 92  ? 26.095 46.476 112.863 1.00 4.67  ? 92  LEU A CG  1 
ATOM 254  C CD1 . LEU A 1 92  ? 26.292 46.180 111.395 1.00 3.02  ? 92  LEU A CD1 1 
ATOM 255  C CD2 . LEU A 1 92  ? 24.646 46.665 113.161 1.00 7.06  ? 92  LEU A CD2 1 
ATOM 256  N N   . PRO A 1 93  ? 26.167 43.062 115.799 1.00 14.80 ? 93  PRO A N   1 
ATOM 257  C CA  . PRO A 1 93  ? 26.424 41.707 116.281 1.00 16.44 ? 93  PRO A CA  1 
ATOM 258  C C   . PRO A 1 93  ? 27.487 41.007 115.444 1.00 18.27 ? 93  PRO A C   1 
ATOM 259  O O   . PRO A 1 93  ? 27.571 41.195 114.216 1.00 21.58 ? 93  PRO A O   1 
ATOM 260  C CB  . PRO A 1 93  ? 25.078 41.016 116.074 1.00 16.31 ? 93  PRO A CB  1 
ATOM 261  C CG  . PRO A 1 93  ? 24.392 41.848 115.054 1.00 13.26 ? 93  PRO A CG  1 
ATOM 262  C CD  . PRO A 1 93  ? 24.728 43.216 115.540 1.00 16.36 ? 93  PRO A CD  1 
ATOM 263  N N   . ASP A 1 94  ? 28.218 40.117 116.095 1.00 16.68 ? 94  ASP A N   1 
ATOM 264  C CA  . ASP A 1 94  ? 29.280 39.374 115.446 1.00 16.96 ? 94  ASP A CA  1 
ATOM 265  C C   . ASP A 1 94  ? 28.776 38.657 114.226 1.00 15.98 ? 94  ASP A C   1 
ATOM 266  O O   . ASP A 1 94  ? 29.439 38.630 113.203 1.00 14.75 ? 94  ASP A O   1 
ATOM 267  C CB  . ASP A 1 94  ? 29.841 38.382 116.428 1.00 24.80 ? 94  ASP A CB  1 
ATOM 268  C CG  . ASP A 1 94  ? 30.175 39.031 117.751 1.00 35.89 ? 94  ASP A CG  1 
ATOM 269  O OD1 . ASP A 1 94  ? 30.287 40.290 117.751 1.00 38.69 ? 94  ASP A OD1 1 
ATOM 270  O OD2 . ASP A 1 94  ? 30.312 38.297 118.778 1.00 41.93 ? 94  ASP A OD2 1 
ATOM 271  N N   . SER A 1 95  ? 27.590 38.088 114.337 1.00 13.30 ? 95  SER A N   1 
ATOM 272  C CA  . SER A 1 95  ? 26.997 37.403 113.216 1.00 15.39 ? 95  SER A CA  1 
ATOM 273  C C   . SER A 1 95  ? 27.068 38.283 111.990 1.00 14.03 ? 95  SER A C   1 
ATOM 274  O O   . SER A 1 95  ? 27.181 37.781 110.880 1.00 16.56 ? 95  SER A O   1 
ATOM 275  C CB  . SER A 1 95  ? 25.536 37.124 113.518 1.00 22.05 ? 95  SER A CB  1 
ATOM 276  O OG  . SER A 1 95  ? 25.100 37.919 114.614 1.00 28.47 ? 95  SER A OG  1 
ATOM 277  N N   . VAL A 1 96  ? 26.964 39.595 112.210 1.00 11.68 ? 96  VAL A N   1 
ATOM 278  C CA  . VAL A 1 96  ? 27.005 40.592 111.155 1.00 9.21  ? 96  VAL A CA  1 
ATOM 279  C C   . VAL A 1 96  ? 28.400 41.107 110.857 1.00 12.50 ? 96  VAL A C   1 
ATOM 280  O O   . VAL A 1 96  ? 28.897 40.972 109.729 1.00 14.32 ? 96  VAL A O   1 
ATOM 281  C CB  . VAL A 1 96  ? 26.116 41.751 111.492 1.00 2.61  ? 96  VAL A CB  1 
ATOM 282  C CG1 . VAL A 1 96  ? 26.225 42.815 110.470 1.00 3.22  ? 96  VAL A CG1 1 
ATOM 283  C CG2 . VAL A 1 96  ? 24.740 41.282 111.520 1.00 5.76  ? 96  VAL A CG2 1 
ATOM 284  N N   . THR A 1 97  ? 29.053 41.666 111.868 1.00 13.21 ? 97  THR A N   1 
ATOM 285  C CA  . THR A 1 97  ? 30.399 42.202 111.691 1.00 13.90 ? 97  THR A CA  1 
ATOM 286  C C   . THR A 1 97  ? 31.360 41.138 111.138 1.00 16.79 ? 97  THR A C   1 
ATOM 287  O O   . THR A 1 97  ? 32.391 41.467 110.584 1.00 16.42 ? 97  THR A O   1 
ATOM 288  C CB  . THR A 1 97  ? 30.960 42.691 113.009 1.00 10.33 ? 97  THR A CB  1 
ATOM 289  O OG1 . THR A 1 97  ? 31.414 41.568 113.764 1.00 17.55 ? 97  THR A OG1 1 
ATOM 290  C CG2 . THR A 1 97  ? 29.891 43.363 113.818 1.00 7.95  ? 97  THR A CG2 1 
ATOM 291  N N   . GLU A 1 98  ? 31.023 39.863 111.291 1.00 19.69 ? 98  GLU A N   1 
ATOM 292  C CA  . GLU A 1 98  ? 31.882 38.791 110.801 1.00 20.51 ? 98  GLU A CA  1 
ATOM 293  C C   . GLU A 1 98  ? 32.111 38.917 109.314 1.00 14.41 ? 98  GLU A C   1 
ATOM 294  O O   . GLU A 1 98  ? 33.194 38.636 108.834 1.00 11.25 ? 98  GLU A O   1 
ATOM 295  C CB  . GLU A 1 98  ? 31.284 37.409 111.104 1.00 33.31 ? 98  GLU A CB  1 
ATOM 296  C CG  . GLU A 1 98  ? 31.990 36.230 110.380 1.00 42.79 ? 98  GLU A CG  1 
ATOM 297  C CD  . GLU A 1 98  ? 31.243 34.869 110.489 1.00 52.54 ? 98  GLU A CD  1 
ATOM 298  O OE1 . GLU A 1 98  ? 31.914 33.807 110.346 1.00 55.76 ? 98  GLU A OE1 1 
ATOM 299  O OE2 . GLU A 1 98  ? 29.993 34.855 110.688 1.00 57.47 ? 98  GLU A OE2 1 
ATOM 300  N N   . TYR A 1 99  ? 31.087 39.319 108.585 1.00 8.95  ? 99  TYR A N   1 
ATOM 301  C CA  . TYR A 1 99  ? 31.220 39.461 107.147 1.00 12.20 ? 99  TYR A CA  1 
ATOM 302  C C   . TYR A 1 99  ? 31.523 40.882 106.740 1.00 16.87 ? 99  TYR A C   1 
ATOM 303  O O   . TYR A 1 99  ? 31.061 41.337 105.683 1.00 18.90 ? 99  TYR A O   1 
ATOM 304  C CB  . TYR A 1 99  ? 29.944 39.018 106.473 1.00 5.51  ? 99  TYR A CB  1 
ATOM 305  C CG  . TYR A 1 99  ? 29.845 37.545 106.437 1.00 9.46  ? 99  TYR A CG  1 
ATOM 306  C CD1 . TYR A 1 99  ? 29.962 36.810 107.598 1.00 11.00 ? 99  TYR A CD1 1 
ATOM 307  C CD2 . TYR A 1 99  ? 29.660 36.875 105.238 1.00 7.80  ? 99  TYR A CD2 1 
ATOM 308  C CE1 . TYR A 1 99  ? 29.892 35.444 107.571 1.00 14.49 ? 99  TYR A CE1 1 
ATOM 309  C CE2 . TYR A 1 99  ? 29.596 35.514 105.193 1.00 7.01  ? 99  TYR A CE2 1 
ATOM 310  C CZ  . TYR A 1 99  ? 29.705 34.794 106.367 1.00 14.25 ? 99  TYR A CZ  1 
ATOM 311  O OH  . TYR A 1 99  ? 29.582 33.421 106.369 1.00 21.70 ? 99  TYR A OH  1 
ATOM 312  N N   . ASP A 1 100 ? 32.418 41.525 107.492 1.00 18.34 ? 100 ASP A N   1 
ATOM 313  C CA  . ASP A 1 100 ? 32.732 42.938 107.288 1.00 14.80 ? 100 ASP A CA  1 
ATOM 314  C C   . ASP A 1 100 ? 32.722 43.568 105.911 1.00 11.20 ? 100 ASP A C   1 
ATOM 315  O O   . ASP A 1 100 ? 32.353 44.728 105.796 1.00 9.84  ? 100 ASP A O   1 
ATOM 316  C CB  . ASP A 1 100 ? 33.916 43.410 108.161 1.00 14.97 ? 100 ASP A CB  1 
ATOM 317  C CG  . ASP A 1 100 ? 35.285 43.105 107.570 1.00 23.47 ? 100 ASP A CG  1 
ATOM 318  O OD1 . ASP A 1 100 ? 35.458 42.068 106.861 1.00 31.65 ? 100 ASP A OD1 1 
ATOM 319  O OD2 . ASP A 1 100 ? 36.211 43.911 107.864 1.00 27.01 ? 100 ASP A OD2 1 
ATOM 320  N N   . LYS A 1 101 ? 32.973 42.798 104.861 1.00 8.86  ? 101 LYS A N   1 
ATOM 321  C CA  . LYS A 1 101 ? 32.984 43.380 103.523 1.00 9.15  ? 101 LYS A CA  1 
ATOM 322  C C   . LYS A 1 101 ? 31.625 43.614 102.842 1.00 12.02 ? 101 LYS A C   1 
ATOM 323  O O   . LYS A 1 101 ? 31.571 44.142 101.721 1.00 7.75  ? 101 LYS A O   1 
ATOM 324  C CB  . LYS A 1 101 ? 33.931 42.596 102.615 1.00 8.46  ? 101 LYS A CB  1 
ATOM 325  C CG  . LYS A 1 101 ? 35.380 43.079 102.673 1.00 2.55  ? 101 LYS A CG  1 
ATOM 326  C CD  . LYS A 1 101 ? 35.729 43.429 104.090 1.00 6.08  ? 101 LYS A CD  1 
ATOM 327  C CE  . LYS A 1 101 ? 37.174 43.724 104.283 1.00 5.01  ? 101 LYS A CE  1 
ATOM 328  N NZ  . LYS A 1 101 ? 37.942 42.538 103.907 1.00 7.90  ? 101 LYS A NZ  1 
ATOM 329  N N   . LYS A 1 102 ? 30.535 43.266 103.533 1.00 13.88 ? 102 LYS A N   1 
ATOM 330  C CA  . LYS A 1 102 ? 29.177 43.423 102.992 1.00 11.90 ? 102 LYS A CA  1 
ATOM 331  C C   . LYS A 1 102 ? 28.705 44.868 102.951 1.00 10.54 ? 102 LYS A C   1 
ATOM 332  O O   . LYS A 1 102 ? 28.881 45.623 103.908 1.00 16.03 ? 102 LYS A O   1 
ATOM 333  C CB  . LYS A 1 102 ? 28.195 42.592 103.791 1.00 7.31  ? 102 LYS A CB  1 
ATOM 334  C CG  . LYS A 1 102 ? 28.383 41.122 103.621 1.00 8.92  ? 102 LYS A CG  1 
ATOM 335  C CD  . LYS A 1 102 ? 27.872 40.681 102.282 1.00 11.45 ? 102 LYS A CD  1 
ATOM 336  C CE  . LYS A 1 102 ? 28.140 39.186 102.052 1.00 15.56 ? 102 LYS A CE  1 
ATOM 337  N NZ  . LYS A 1 102 ? 27.384 38.594 100.877 1.00 18.81 ? 102 LYS A NZ  1 
ATOM 338  N N   . LEU A 1 103 ? 28.087 45.232 101.840 1.00 6.94  ? 103 LEU A N   1 
ATOM 339  C CA  . LEU A 1 103 ? 27.587 46.573 101.608 1.00 6.98  ? 103 LEU A CA  1 
ATOM 340  C C   . LEU A 1 103 ? 26.414 47.079 102.440 1.00 8.91  ? 103 LEU A C   1 
ATOM 341  O O   . LEU A 1 103 ? 25.364 46.421 102.560 1.00 8.92  ? 103 LEU A O   1 
ATOM 342  C CB  . LEU A 1 103 ? 27.267 46.744 100.130 1.00 6.64  ? 103 LEU A CB  1 
ATOM 343  C CG  . LEU A 1 103 ? 28.458 46.418 99.221  1.00 8.60  ? 103 LEU A CG  1 
ATOM 344  C CD1 . LEU A 1 103 ? 28.054 46.554 97.758  1.00 5.42  ? 103 LEU A CD1 1 
ATOM 345  C CD2 . LEU A 1 103 ? 29.654 47.330 99.560  1.00 10.48 ? 103 LEU A CD2 1 
ATOM 346  N N   . VAL A 1 104 ? 26.633 48.275 102.993 1.00 9.56  ? 104 VAL A N   1 
ATOM 347  C CA  . VAL A 1 104 ? 25.686 49.038 103.806 1.00 4.89  ? 104 VAL A CA  1 
ATOM 348  C C   . VAL A 1 104 ? 25.051 50.038 102.842 1.00 5.80  ? 104 VAL A C   1 
ATOM 349  O O   . VAL A 1 104 ? 25.727 50.568 101.954 1.00 9.00  ? 104 VAL A O   1 
ATOM 350  C CB  . VAL A 1 104 ? 26.423 49.832 104.897 1.00 2.00  ? 104 VAL A CB  1 
ATOM 351  C CG1 . VAL A 1 104 ? 25.633 50.984 105.323 1.00 2.00  ? 104 VAL A CG1 1 
ATOM 352  C CG2 . VAL A 1 104 ? 26.684 48.991 106.071 1.00 2.00  ? 104 VAL A CG2 1 
ATOM 353  N N   . SER A 1 105 ? 23.754 50.271 102.979 1.00 5.12  ? 105 SER A N   1 
ATOM 354  C CA  . SER A 1 105 ? 23.068 51.211 102.112 1.00 2.00  ? 105 SER A CA  1 
ATOM 355  C C   . SER A 1 105 ? 22.510 52.360 102.940 1.00 4.02  ? 105 SER A C   1 
ATOM 356  O O   . SER A 1 105 ? 23.281 53.186 103.424 1.00 7.53  ? 105 SER A O   1 
ATOM 357  C CB  . SER A 1 105 ? 21.972 50.528 101.349 1.00 2.00  ? 105 SER A CB  1 
ATOM 358  O OG  . SER A 1 105 ? 21.340 51.514 100.596 1.00 2.00  ? 105 SER A OG  1 
ATOM 359  N N   . ARG A 1 106 ? 21.201 52.441 103.132 1.00 2.00  ? 106 ARG A N   1 
ATOM 360  C CA  . ARG A 1 106 ? 20.688 53.545 103.938 1.00 4.54  ? 106 ARG A CA  1 
ATOM 361  C C   . ARG A 1 106 ? 20.690 53.223 105.418 1.00 3.98  ? 106 ARG A C   1 
ATOM 362  O O   . ARG A 1 106 ? 20.872 52.072 105.798 1.00 7.93  ? 106 ARG A O   1 
ATOM 363  C CB  . ARG A 1 106 ? 19.278 53.936 103.501 1.00 4.99  ? 106 ARG A CB  1 
ATOM 364  C CG  . ARG A 1 106 ? 18.310 52.805 103.364 1.00 5.49  ? 106 ARG A CG  1 
ATOM 365  C CD  . ARG A 1 106 ? 17.252 53.206 102.354 1.00 9.51  ? 106 ARG A CD  1 
ATOM 366  N NE  . ARG A 1 106 ? 16.757 52.048 101.625 1.00 11.22 ? 106 ARG A NE  1 
ATOM 367  C CZ  . ARG A 1 106 ? 15.543 51.532 101.771 1.00 13.58 ? 106 ARG A CZ  1 
ATOM 368  N NH1 . ARG A 1 106 ? 14.675 52.070 102.598 1.00 16.30 ? 106 ARG A NH1 1 
ATOM 369  N NH2 . ARG A 1 106 ? 15.225 50.409 101.160 1.00 19.65 ? 106 ARG A NH2 1 
ATOM 370  N N   . LEU A 1 107 ? 20.519 54.232 106.259 1.00 2.00  ? 107 LEU A N   1 
ATOM 371  C CA  . LEU A 1 107 ? 20.441 53.969 107.684 1.00 2.00  ? 107 LEU A CA  1 
ATOM 372  C C   . LEU A 1 107 ? 19.685 55.097 108.396 1.00 2.00  ? 107 LEU A C   1 
ATOM 373  O O   . LEU A 1 107 ? 19.897 56.255 108.053 1.00 2.00  ? 107 LEU A O   1 
ATOM 374  C CB  . LEU A 1 107 ? 21.822 53.664 108.246 1.00 2.00  ? 107 LEU A CB  1 
ATOM 375  C CG  . LEU A 1 107 ? 22.847 54.746 108.318 1.00 2.00  ? 107 LEU A CG  1 
ATOM 376  C CD1 . LEU A 1 107 ? 22.796 55.264 109.736 1.00 2.00  ? 107 LEU A CD1 1 
ATOM 377  C CD2 . LEU A 1 107 ? 24.225 54.182 107.932 1.00 2.00  ? 107 LEU A CD2 1 
ATOM 378  N N   . GLN A 1 108 ? 18.735 54.742 109.288 1.00 2.00  ? 108 GLN A N   1 
ATOM 379  C CA  . GLN A 1 108 ? 17.864 55.703 110.008 1.00 2.00  ? 108 GLN A CA  1 
ATOM 380  C C   . GLN A 1 108 ? 17.804 55.552 111.521 1.00 2.00  ? 108 GLN A C   1 
ATOM 381  O O   . GLN A 1 108 ? 18.221 54.512 112.022 1.00 9.47  ? 108 GLN A O   1 
ATOM 382  C CB  . GLN A 1 108 ? 16.430 55.526 109.527 1.00 2.00  ? 108 GLN A CB  1 
ATOM 383  C CG  . GLN A 1 108 ? 15.855 54.126 109.745 1.00 2.00  ? 108 GLN A CG  1 
ATOM 384  C CD  . GLN A 1 108 ? 14.317 54.055 109.618 1.00 8.71  ? 108 GLN A CD  1 
ATOM 385  O OE1 . GLN A 1 108 ? 13.714 53.032 109.934 1.00 11.08 ? 108 GLN A OE1 1 
ATOM 386  N NE2 . GLN A 1 108 ? 13.689 55.127 109.145 1.00 5.59  ? 108 GLN A NE2 1 
ATOM 387  N N   . ILE A 1 109 ? 17.357 56.592 112.257 1.00 2.40  ? 109 ILE A N   1 
ATOM 388  C CA  . ILE A 1 109 ? 17.156 56.475 113.732 1.00 2.24  ? 109 ILE A CA  1 
ATOM 389  C C   . ILE A 1 109 ? 15.657 56.456 113.878 1.00 2.43  ? 109 ILE A C   1 
ATOM 390  O O   . ILE A 1 109 ? 14.937 56.882 112.966 1.00 4.83  ? 109 ILE A O   1 
ATOM 391  C CB  . ILE A 1 109 ? 17.573 57.668 114.695 1.00 2.00  ? 109 ILE A CB  1 
ATOM 392  C CG1 . ILE A 1 109 ? 17.173 59.019 114.152 1.00 2.00  ? 109 ILE A CG1 1 
ATOM 393  C CG2 . ILE A 1 109 ? 18.971 57.559 115.161 1.00 2.00  ? 109 ILE A CG2 1 
ATOM 394  C CD1 . ILE A 1 109 ? 18.078 59.503 113.079 1.00 15.34 ? 109 ILE A CD1 1 
ATOM 395  N N   . ARG A 1 110 ? 15.197 55.984 115.030 1.00 2.00  ? 110 ARG A N   1 
ATOM 396  C CA  . ARG A 1 110 ? 13.786 55.935 115.354 1.00 2.00  ? 110 ARG A CA  1 
ATOM 397  C C   . ARG A 1 110 ? 13.772 56.063 116.857 1.00 2.00  ? 110 ARG A C   1 
ATOM 398  O O   . ARG A 1 110 ? 14.566 55.389 117.527 1.00 2.00  ? 110 ARG A O   1 
ATOM 399  C CB  . ARG A 1 110 ? 13.148 54.612 114.899 1.00 3.14  ? 110 ARG A CB  1 
ATOM 400  C CG  . ARG A 1 110 ? 13.192 54.424 113.388 1.00 3.96  ? 110 ARG A CG  1 
ATOM 401  C CD  . ARG A 1 110 ? 12.778 53.041 112.932 1.00 6.67  ? 110 ARG A CD  1 
ATOM 402  N NE  . ARG A 1 110 ? 13.491 51.969 113.621 1.00 8.45  ? 110 ARG A NE  1 
ATOM 403  C CZ  . ARG A 1 110 ? 12.874 50.993 114.269 1.00 5.37  ? 110 ARG A CZ  1 
ATOM 404  N NH1 . ARG A 1 110 ? 11.550 51.003 114.277 1.00 7.72  ? 110 ARG A NH1 1 
ATOM 405  N NH2 . ARG A 1 110 ? 13.553 50.059 114.944 1.00 2.56  ? 110 ARG A NH2 1 
ATOM 406  N N   . VAL A 1 111 ? 12.969 57.005 117.357 1.00 2.00  ? 111 VAL A N   1 
ATOM 407  C CA  . VAL A 1 111 ? 12.818 57.253 118.783 1.00 2.46  ? 111 VAL A CA  1 
ATOM 408  C C   . VAL A 1 111 ? 11.493 56.714 119.285 1.00 5.35  ? 111 VAL A C   1 
ATOM 409  O O   . VAL A 1 111 ? 10.484 56.931 118.648 1.00 11.92 ? 111 VAL A O   1 
ATOM 410  C CB  . VAL A 1 111 ? 12.798 58.735 119.050 1.00 2.12  ? 111 VAL A CB  1 
ATOM 411  C CG1 . VAL A 1 111 ? 12.279 59.027 120.449 1.00 2.00  ? 111 VAL A CG1 1 
ATOM 412  C CG2 . VAL A 1 111 ? 14.172 59.282 118.876 1.00 7.32  ? 111 VAL A CG2 1 
ATOM 413  N N   . ASN A 1 112 ? 11.484 56.001 120.404 1.00 7.03  ? 112 ASN A N   1 
ATOM 414  C CA  . ASN A 1 112 ? 10.237 55.501 120.974 1.00 8.05  ? 112 ASN A CA  1 
ATOM 415  C C   . ASN A 1 112 ? 10.198 56.034 122.355 1.00 7.74  ? 112 ASN A C   1 
ATOM 416  O O   . ASN A 1 112 ? 11.059 55.689 123.166 1.00 12.76 ? 112 ASN A O   1 
ATOM 417  C CB  . ASN A 1 112 ? 10.252 54.003 121.115 1.00 18.78 ? 112 ASN A CB  1 
ATOM 418  C CG  . ASN A 1 112 ? 10.198 53.305 119.808 1.00 29.82 ? 112 ASN A CG  1 
ATOM 419  O OD1 . ASN A 1 112 ? 9.786  53.878 118.796 1.00 38.36 ? 112 ASN A OD1 1 
ATOM 420  N ND2 . ASN A 1 112 ? 10.679 52.075 119.791 1.00 34.59 ? 112 ASN A ND2 1 
ATOM 421  N N   . PRO A 1 113 ? 9.195  56.837 122.676 1.00 2.87  ? 113 PRO A N   1 
ATOM 422  C CA  . PRO A 1 113 ? 9.041  57.433 123.995 1.00 3.51  ? 113 PRO A CA  1 
ATOM 423  C C   . PRO A 1 113 ? 8.530  56.380 124.957 1.00 5.90  ? 113 PRO A C   1 
ATOM 424  O O   . PRO A 1 113 ? 7.642  55.621 124.595 1.00 8.86  ? 113 PRO A O   1 
ATOM 425  C CB  . PRO A 1 113 ? 7.968  58.460 123.749 1.00 2.00  ? 113 PRO A CB  1 
ATOM 426  C CG  . PRO A 1 113 ? 7.091  57.752 122.860 1.00 2.00  ? 113 PRO A CG  1 
ATOM 427  C CD  . PRO A 1 113 ? 8.021  57.122 121.858 1.00 2.00  ? 113 PRO A CD  1 
ATOM 428  N N   . LEU A 1 114 ? 9.162  56.237 126.114 1.00 3.90  ? 114 LEU A N   1 
ATOM 429  C CA  . LEU A 1 114 ? 8.687  55.282 127.103 1.00 4.01  ? 114 LEU A CA  1 
ATOM 430  C C   . LEU A 1 114 ? 7.700  56.128 127.915 1.00 6.38  ? 114 LEU A C   1 
ATOM 431  O O   . LEU A 1 114 ? 7.814  57.361 127.897 1.00 11.02 ? 114 LEU A O   1 
ATOM 432  C CB  . LEU A 1 114 ? 9.842  54.807 127.979 1.00 2.22  ? 114 LEU A CB  1 
ATOM 433  C CG  . LEU A 1 114 ? 10.796 53.848 127.286 1.00 2.00  ? 114 LEU A CG  1 
ATOM 434  C CD1 . LEU A 1 114 ? 12.032 53.617 128.125 1.00 3.62  ? 114 LEU A CD1 1 
ATOM 435  C CD2 . LEU A 1 114 ? 10.106 52.542 127.043 1.00 2.00  ? 114 LEU A CD2 1 
ATOM 436  N N   . PRO A 1 115 ? 6.728  55.510 128.638 1.00 7.61  ? 115 PRO A N   1 
ATOM 437  C CA  . PRO A 1 115 ? 5.790  56.343 129.407 1.00 6.98  ? 115 PRO A CA  1 
ATOM 438  C C   . PRO A 1 115 ? 6.687  57.087 130.311 1.00 4.72  ? 115 PRO A C   1 
ATOM 439  O O   . PRO A 1 115 ? 7.667  56.511 130.760 1.00 11.83 ? 115 PRO A O   1 
ATOM 440  C CB  . PRO A 1 115 ? 5.011  55.329 130.238 1.00 9.44  ? 115 PRO A CB  1 
ATOM 441  C CG  . PRO A 1 115 ? 5.287  53.990 129.559 1.00 12.14 ? 115 PRO A CG  1 
ATOM 442  C CD  . PRO A 1 115 ? 6.698  54.131 129.145 1.00 12.64 ? 115 PRO A CD  1 
ATOM 443  N N   . LYS A 1 116 ? 6.421  58.361 130.505 1.00 3.87  ? 116 LYS A N   1 
ATOM 444  C CA  . LYS A 1 116 ? 7.245  59.214 131.370 1.00 10.57 ? 116 LYS A CA  1 
ATOM 445  C C   . LYS A 1 116 ? 8.240  60.011 130.593 1.00 12.43 ? 116 LYS A C   1 
ATOM 446  O O   . LYS A 1 116 ? 9.021  60.776 131.179 1.00 15.88 ? 116 LYS A O   1 
ATOM 447  C CB  . LYS A 1 116 ? 7.952  58.473 132.530 1.00 14.46 ? 116 LYS A CB  1 
ATOM 448  C CG  . LYS A 1 116 ? 9.430  58.130 132.361 1.00 19.20 ? 116 LYS A CG  1 
ATOM 449  C CD  . LYS A 1 116 ? 9.878  57.053 133.393 1.00 25.99 ? 116 LYS A CD  1 
ATOM 450  C CE  . LYS A 1 116 ? 10.810 57.611 134.507 1.00 29.46 ? 116 LYS A CE  1 
ATOM 451  N NZ  . LYS A 1 116 ? 11.630 56.572 135.236 1.00 27.73 ? 116 LYS A NZ  1 
ATOM 452  N N   . PHE A 1 117 ? 8.231  59.835 129.276 1.00 12.78 ? 117 PHE A N   1 
ATOM 453  C CA  . PHE A 1 117 ? 9.117  60.623 128.445 1.00 9.27  ? 117 PHE A CA  1 
ATOM 454  C C   . PHE A 1 117 ? 8.720  62.069 128.762 1.00 9.26  ? 117 PHE A C   1 
ATOM 455  O O   . PHE A 1 117 ? 7.540  62.381 128.956 1.00 2.69  ? 117 PHE A O   1 
ATOM 456  C CB  . PHE A 1 117 ? 8.884  60.329 126.951 1.00 6.86  ? 117 PHE A CB  1 
ATOM 457  C CG  . PHE A 1 117 ? 9.415  61.399 126.025 1.00 2.00  ? 117 PHE A CG  1 
ATOM 458  C CD1 . PHE A 1 117 ? 10.710 61.350 125.551 1.00 2.00  ? 117 PHE A CD1 1 
ATOM 459  C CD2 . PHE A 1 117 ? 8.636  62.471 125.673 1.00 2.00  ? 117 PHE A CD2 1 
ATOM 460  C CE1 . PHE A 1 117 ? 11.208 62.341 124.761 1.00 2.00  ? 117 PHE A CE1 1 
ATOM 461  C CE2 . PHE A 1 117 ? 9.147  63.467 124.881 1.00 2.00  ? 117 PHE A CE2 1 
ATOM 462  C CZ  . PHE A 1 117 ? 10.431 63.400 124.429 1.00 2.00  ? 117 PHE A CZ  1 
ATOM 463  N N   . ASP A 1 118 ? 9.710  62.925 128.929 1.00 9.85  ? 118 ASP A N   1 
ATOM 464  C CA  . ASP A 1 118 ? 9.408  64.308 129.165 1.00 13.36 ? 118 ASP A CA  1 
ATOM 465  C C   . ASP A 1 118 ? 10.613 65.189 128.878 1.00 14.66 ? 118 ASP A C   1 
ATOM 466  O O   . ASP A 1 118 ? 11.128 65.825 129.781 1.00 16.25 ? 118 ASP A O   1 
ATOM 467  C CB  . ASP A 1 118 ? 8.896  64.507 130.582 1.00 21.25 ? 118 ASP A CB  1 
ATOM 468  C CG  . ASP A 1 118 ? 8.188  65.854 130.761 1.00 29.23 ? 118 ASP A CG  1 
ATOM 469  O OD1 . ASP A 1 118 ? 7.386  66.242 129.864 1.00 28.96 ? 118 ASP A OD1 1 
ATOM 470  O OD2 . ASP A 1 118 ? 8.425  66.518 131.804 1.00 30.00 ? 118 ASP A OD2 1 
ATOM 471  N N   . SER A 1 119 ? 11.031 65.263 127.612 1.00 13.42 ? 119 SER A N   1 
ATOM 472  C CA  . SER A 1 119 ? 12.191 66.072 127.230 1.00 11.25 ? 119 SER A CA  1 
ATOM 473  C C   . SER A 1 119 ? 12.168 66.534 125.779 1.00 10.86 ? 119 SER A C   1 
ATOM 474  O O   . SER A 1 119 ? 11.161 66.381 125.071 1.00 15.68 ? 119 SER A O   1 
ATOM 475  C CB  . SER A 1 119 ? 13.446 65.250 127.436 1.00 4.51  ? 119 SER A CB  1 
ATOM 476  O OG  . SER A 1 119 ? 13.349 64.550 128.645 1.00 3.84  ? 119 SER A OG  1 
ATOM 477  N N   . THR A 1 120 ? 13.291 67.096 125.346 1.00 6.81  ? 120 THR A N   1 
ATOM 478  C CA  . THR A 1 120 ? 13.460 67.541 123.975 1.00 2.52  ? 120 THR A CA  1 
ATOM 479  C C   . THR A 1 120 ? 14.830 67.018 123.554 1.00 3.04  ? 120 THR A C   1 
ATOM 480  O O   . THR A 1 120 ? 15.835 67.663 123.738 1.00 7.15  ? 120 THR A O   1 
ATOM 481  C CB  . THR A 1 120 ? 13.469 69.034 123.889 1.00 2.00  ? 120 THR A CB  1 
ATOM 482  O OG1 . THR A 1 120 ? 12.454 69.579 124.735 1.00 2.00  ? 120 THR A OG1 1 
ATOM 483  C CG2 . THR A 1 120 ? 13.171 69.433 122.513 1.00 8.02  ? 120 THR A CG2 1 
ATOM 484  N N   . VAL A 1 121 ? 14.872 65.800 123.061 1.00 4.22  ? 121 VAL A N   1 
ATOM 485  C CA  . VAL A 1 121 ? 16.108 65.172 122.667 1.00 3.18  ? 121 VAL A CA  1 
ATOM 486  C C   . VAL A 1 121 ? 16.522 65.599 121.254 1.00 4.16  ? 121 VAL A C   1 
ATOM 487  O O   . VAL A 1 121 ? 15.680 66.028 120.462 1.00 5.99  ? 121 VAL A O   1 
ATOM 488  C CB  . VAL A 1 121 ? 15.860 63.670 122.708 1.00 2.00  ? 121 VAL A CB  1 
ATOM 489  C CG1 . VAL A 1 121 ? 16.960 62.930 122.070 1.00 9.37  ? 121 VAL A CG1 1 
ATOM 490  C CG2 . VAL A 1 121 ? 15.721 63.222 124.124 1.00 4.54  ? 121 VAL A CG2 1 
ATOM 491  N N   . TRP A 1 122 ? 17.819 65.546 120.960 1.00 4.69  ? 122 TRP A N   1 
ATOM 492  C CA  . TRP A 1 122 ? 18.362 65.847 119.613 1.00 6.92  ? 122 TRP A CA  1 
ATOM 493  C C   . TRP A 1 122 ? 19.169 64.574 119.307 1.00 7.03  ? 122 TRP A C   1 
ATOM 494  O O   . TRP A 1 122 ? 19.935 64.146 120.155 1.00 13.76 ? 122 TRP A O   1 
ATOM 495  C CB  . TRP A 1 122 ? 19.296 67.089 119.615 1.00 3.75  ? 122 TRP A CB  1 
ATOM 496  C CG  . TRP A 1 122 ? 18.571 68.400 119.575 1.00 2.00  ? 122 TRP A CG  1 
ATOM 497  C CD1 . TRP A 1 122 ? 17.609 68.835 120.439 1.00 6.47  ? 122 TRP A CD1 1 
ATOM 498  C CD2 . TRP A 1 122 ? 18.713 69.419 118.606 1.00 2.00  ? 122 TRP A CD2 1 
ATOM 499  N NE1 . TRP A 1 122 ? 17.129 70.070 120.062 1.00 2.00  ? 122 TRP A NE1 1 
ATOM 500  C CE2 . TRP A 1 122 ? 17.793 70.450 118.935 1.00 2.00  ? 122 TRP A CE2 1 
ATOM 501  C CE3 . TRP A 1 122 ? 19.520 69.569 117.492 1.00 2.00  ? 122 TRP A CE3 1 
ATOM 502  C CZ2 . TRP A 1 122 ? 17.663 71.595 118.198 1.00 2.00  ? 122 TRP A CZ2 1 
ATOM 503  C CZ3 . TRP A 1 122 ? 19.398 70.707 116.755 1.00 2.00  ? 122 TRP A CZ3 1 
ATOM 504  C CH2 . TRP A 1 122 ? 18.470 71.714 117.105 1.00 5.05  ? 122 TRP A CH2 1 
ATOM 505  N N   . VAL A 1 123 ? 19.029 63.955 118.143 1.00 2.81  ? 123 VAL A N   1 
ATOM 506  C CA  . VAL A 1 123 ? 19.763 62.721 117.909 1.00 2.00  ? 123 VAL A CA  1 
ATOM 507  C C   . VAL A 1 123 ? 20.411 62.677 116.530 1.00 2.00  ? 123 VAL A C   1 
ATOM 508  O O   . VAL A 1 123 ? 19.921 63.318 115.600 1.00 2.88  ? 123 VAL A O   1 
ATOM 509  C CB  . VAL A 1 123 ? 18.798 61.537 118.001 1.00 2.00  ? 123 VAL A CB  1 
ATOM 510  C CG1 . VAL A 1 123 ? 19.535 60.275 118.288 1.00 4.18  ? 123 VAL A CG1 1 
ATOM 511  C CG2 . VAL A 1 123 ? 17.763 61.769 119.052 1.00 2.00  ? 123 VAL A CG2 1 
ATOM 512  N N   . THR A 1 124 ? 21.507 61.939 116.376 1.00 2.00  ? 124 THR A N   1 
ATOM 513  C CA  . THR A 1 124 ? 22.142 61.805 115.059 1.00 2.00  ? 124 THR A CA  1 
ATOM 514  C C   . THR A 1 124 ? 23.003 60.576 115.016 1.00 2.00  ? 124 THR A C   1 
ATOM 515  O O   . THR A 1 124 ? 23.130 59.843 115.982 1.00 7.32  ? 124 THR A O   1 
ATOM 516  C CB  . THR A 1 124 ? 23.155 62.913 114.719 1.00 6.87  ? 124 THR A CB  1 
ATOM 517  O OG1 . THR A 1 124 ? 22.824 64.136 115.370 1.00 20.89 ? 124 THR A OG1 1 
ATOM 518  C CG2 . THR A 1 124 ? 23.177 63.155 113.237 1.00 3.89  ? 124 THR A CG2 1 
ATOM 519  N N   . VAL A 1 125 ? 23.593 60.357 113.862 1.00 2.00  ? 125 VAL A N   1 
ATOM 520  C CA  . VAL A 1 125 ? 24.539 59.296 113.677 1.00 4.41  ? 125 VAL A CA  1 
ATOM 521  C C   . VAL A 1 125 ? 25.616 59.993 112.841 1.00 6.86  ? 125 VAL A C   1 
ATOM 522  O O   . VAL A 1 125 ? 25.293 60.765 111.929 1.00 6.56  ? 125 VAL A O   1 
ATOM 523  C CB  . VAL A 1 125 ? 23.911 58.120 113.020 1.00 3.53  ? 125 VAL A CB  1 
ATOM 524  C CG1 . VAL A 1 125 ? 24.977 57.192 112.512 1.00 6.76  ? 125 VAL A CG1 1 
ATOM 525  C CG2 . VAL A 1 125 ? 23.053 57.407 114.044 1.00 2.00  ? 125 VAL A CG2 1 
ATOM 526  N N   . ARG A 1 126 ? 26.879 59.846 113.252 1.00 9.94  ? 126 ARG A N   1 
ATOM 527  C CA  . ARG A 1 126 ? 27.998 60.514 112.595 1.00 14.40 ? 126 ARG A CA  1 
ATOM 528  C C   . ARG A 1 126 ? 29.257 59.733 112.546 1.00 18.20 ? 126 ARG A C   1 
ATOM 529  O O   . ARG A 1 126 ? 29.576 58.992 113.482 1.00 18.43 ? 126 ARG A O   1 
ATOM 530  C CB  . ARG A 1 126 ? 28.388 61.750 113.361 1.00 20.90 ? 126 ARG A CB  1 
ATOM 531  C CG  . ARG A 1 126 ? 27.732 62.966 112.900 1.00 23.65 ? 126 ARG A CG  1 
ATOM 532  C CD  . ARG A 1 126 ? 28.719 63.935 112.284 1.00 26.63 ? 126 ARG A CD  1 
ATOM 533  N NE  . ARG A 1 126 ? 28.062 65.225 112.321 1.00 26.53 ? 126 ARG A NE  1 
ATOM 534  C CZ  . ARG A 1 126 ? 28.422 66.231 113.099 1.00 25.99 ? 126 ARG A CZ  1 
ATOM 535  N NH1 . ARG A 1 126 ? 29.497 66.125 113.892 1.00 18.62 ? 126 ARG A NH1 1 
ATOM 536  N NH2 . ARG A 1 126 ? 27.569 67.250 113.211 1.00 25.11 ? 126 ARG A NH2 1 
ATOM 537  N N   . LYS A 1 127 ? 30.044 60.031 111.513 1.00 23.38 ? 127 LYS A N   1 
ATOM 538  C CA  . LYS A 1 127 ? 31.342 59.397 111.329 1.00 25.13 ? 127 LYS A CA  1 
ATOM 539  C C   . LYS A 1 127 ? 32.238 60.142 112.303 1.00 26.12 ? 127 LYS A C   1 
ATOM 540  O O   . LYS A 1 127 ? 32.713 61.210 111.949 1.00 29.92 ? 127 LYS A O   1 
ATOM 541  C CB  . LYS A 1 127 ? 31.853 59.638 109.909 1.00 17.75 ? 127 LYS A CB  1 
ATOM 542  C CG  . LYS A 1 127 ? 32.076 58.374 109.100 1.00 22.30 ? 127 LYS A CG  1 
ATOM 543  C CD  . LYS A 1 127 ? 33.087 58.601 107.936 1.00 33.49 ? 127 LYS A CD  1 
ATOM 544  C CE  . LYS A 1 127 ? 32.610 59.653 106.859 1.00 41.33 ? 127 LYS A CE  1 
ATOM 545  N NZ  . LYS A 1 127 ? 33.614 60.718 106.306 1.00 42.33 ? 127 LYS A NZ  1 
ATOM 546  N N   . VAL A 1 128 ? 32.389 59.654 113.538 1.00 24.10 ? 128 VAL A N   1 
ATOM 547  C CA  . VAL A 1 128 ? 33.241 60.332 114.514 1.00 24.57 ? 128 VAL A CA  1 
ATOM 548  C C   . VAL A 1 128 ? 34.689 59.879 114.317 1.00 28.94 ? 128 VAL A C   1 
ATOM 549  O O   . VAL A 1 128 ? 35.097 58.771 114.710 1.00 28.43 ? 128 VAL A O   1 
ATOM 550  C CB  . VAL A 1 128 ? 32.733 60.145 115.945 1.00 23.51 ? 128 VAL A CB  1 
ATOM 551  C CG1 . VAL A 1 128 ? 32.830 58.721 116.377 1.00 27.21 ? 128 VAL A CG1 1 
ATOM 552  C CG2 . VAL A 1 128 ? 33.499 61.028 116.886 1.00 29.13 ? 128 VAL A CG2 1 
ATOM 553  N N   . PRO A 1 129 ? 35.508 60.772 113.736 1.00 34.26 ? 129 PRO A N   1 
ATOM 554  C CA  . PRO A 1 129 ? 36.898 60.471 113.457 1.00 37.04 ? 129 PRO A CA  1 
ATOM 555  C C   . PRO A 1 129 ? 37.962 61.194 114.260 1.00 36.92 ? 129 PRO A C   1 
ATOM 556  O O   . PRO A 1 129 ? 37.746 62.266 114.831 1.00 33.78 ? 129 PRO A O   1 
ATOM 557  C CB  . PRO A 1 129 ? 36.993 60.853 111.978 1.00 41.12 ? 129 PRO A CB  1 
ATOM 558  C CG  . PRO A 1 129 ? 36.164 62.177 111.935 1.00 36.10 ? 129 PRO A CG  1 
ATOM 559  C CD  . PRO A 1 129 ? 35.181 62.087 113.150 1.00 37.06 ? 129 PRO A CD  1 
ATOM 560  N N   . ALA A 1 130 ? 39.157 60.693 113.988 1.00 39.60 ? 130 ALA A N   1 
ATOM 561  C CA  . ALA A 1 130 ? 40.468 61.021 114.551 1.00 42.45 ? 130 ALA A CA  1 
ATOM 562  C C   . ALA A 1 130 ? 40.678 59.621 115.157 1.00 43.64 ? 130 ALA A C   1 
ATOM 563  O O   . ALA A 1 130 ? 41.172 59.451 116.297 1.00 42.30 ? 130 ALA A O   1 
ATOM 564  C CB  . ALA A 1 130 ? 40.417 62.142 115.641 1.00 39.58 ? 130 ALA A CB  1 
ATOM 565  N N   . SER A 1 131 ? 40.225 58.642 114.346 1.00 44.23 ? 131 SER A N   1 
ATOM 566  C CA  . SER A 1 131 ? 40.253 57.205 114.618 1.00 45.53 ? 131 SER A CA  1 
ATOM 567  C C   . SER A 1 131 ? 40.088 56.924 116.108 1.00 43.92 ? 131 SER A C   1 
ATOM 568  O O   . SER A 1 131 ? 41.074 56.660 116.827 1.00 45.64 ? 131 SER A O   1 
ATOM 569  C CB  . SER A 1 131 ? 41.529 56.541 114.019 1.00 48.16 ? 131 SER A CB  1 
ATOM 570  O OG  . SER A 1 131 ? 42.644 57.435 113.883 1.00 49.06 ? 131 SER A OG  1 
ATOM 571  N N   . SER A 1 132 ? 38.838 56.972 116.566 1.00 41.51 ? 132 SER A N   1 
ATOM 572  C CA  . SER A 1 132 ? 38.578 56.777 117.988 1.00 43.66 ? 132 SER A CA  1 
ATOM 573  C C   . SER A 1 132 ? 39.120 58.027 118.723 1.00 43.82 ? 132 SER A C   1 
ATOM 574  O O   . SER A 1 132 ? 40.151 58.004 119.432 1.00 42.46 ? 132 SER A O   1 
ATOM 575  C CB  . SER A 1 132 ? 39.220 55.470 118.517 1.00 43.47 ? 132 SER A CB  1 
ATOM 576  O OG  . SER A 1 132 ? 38.257 54.637 119.169 1.00 44.37 ? 132 SER A OG  1 
ATOM 577  N N   . ASP A 1 133 ? 38.410 59.127 118.478 1.00 44.28 ? 133 ASP A N   1 
ATOM 578  C CA  . ASP A 1 133 ? 38.694 60.444 119.057 1.00 43.15 ? 133 ASP A CA  1 
ATOM 579  C C   . ASP A 1 133 ? 37.692 60.709 120.198 1.00 40.03 ? 133 ASP A C   1 
ATOM 580  O O   . ASP A 1 133 ? 37.283 61.859 120.442 1.00 39.11 ? 133 ASP A O   1 
ATOM 581  C CB  . ASP A 1 133 ? 38.511 61.516 117.975 1.00 42.77 ? 133 ASP A CB  1 
ATOM 582  C CG  . ASP A 1 133 ? 37.108 61.504 117.373 1.00 45.26 ? 133 ASP A CG  1 
ATOM 583  O OD1 . ASP A 1 133 ? 36.766 60.489 116.684 1.00 44.64 ? 133 ASP A OD1 1 
ATOM 584  O OD2 . ASP A 1 133 ? 36.364 62.500 117.611 1.00 45.54 ? 133 ASP A OD2 1 
ATOM 585  N N   . LEU A 1 134 ? 37.305 59.632 120.877 1.00 37.07 ? 134 LEU A N   1 
ATOM 586  C CA  . LEU A 1 134 ? 36.332 59.679 121.968 1.00 37.47 ? 134 LEU A CA  1 
ATOM 587  C C   . LEU A 1 134 ? 35.025 60.458 121.715 1.00 35.14 ? 134 LEU A C   1 
ATOM 588  O O   . LEU A 1 134 ? 34.821 61.130 120.682 1.00 30.62 ? 134 LEU A O   1 
ATOM 589  C CB  . LEU A 1 134 ? 36.966 60.089 123.317 1.00 37.08 ? 134 LEU A CB  1 
ATOM 590  C CG  . LEU A 1 134 ? 37.540 61.482 123.596 1.00 38.82 ? 134 LEU A CG  1 
ATOM 591  C CD1 . LEU A 1 134 ? 36.514 62.622 123.315 1.00 36.70 ? 134 LEU A CD1 1 
ATOM 592  C CD2 . LEU A 1 134 ? 38.021 61.490 125.049 1.00 35.81 ? 134 LEU A CD2 1 
ATOM 593  N N   . SER A 1 135 ? 34.148 60.348 122.699 1.00 32.32 ? 135 SER A N   1 
ATOM 594  C CA  . SER A 1 135 ? 32.855 60.958 122.613 1.00 31.22 ? 135 SER A CA  1 
ATOM 595  C C   . SER A 1 135 ? 32.507 61.502 123.991 1.00 31.57 ? 135 SER A C   1 
ATOM 596  O O   . SER A 1 135 ? 31.740 60.899 124.750 1.00 36.36 ? 135 SER A O   1 
ATOM 597  C CB  . SER A 1 135 ? 31.815 59.914 122.125 1.00 29.14 ? 135 SER A CB  1 
ATOM 598  O OG  . SER A 1 135 ? 32.148 59.345 120.852 1.00 22.35 ? 135 SER A OG  1 
ATOM 599  N N   . VAL A 1 136 ? 33.131 62.623 124.324 1.00 30.65 ? 136 VAL A N   1 
ATOM 600  C CA  . VAL A 1 136 ? 32.887 63.315 125.592 1.00 31.82 ? 136 VAL A CA  1 
ATOM 601  C C   . VAL A 1 136 ? 32.039 64.544 125.227 1.00 32.82 ? 136 VAL A C   1 
ATOM 602  O O   . VAL A 1 136 ? 31.326 64.499 124.211 1.00 38.32 ? 136 VAL A O   1 
ATOM 603  C CB  . VAL A 1 136 ? 34.220 63.753 126.187 1.00 35.07 ? 136 VAL A CB  1 
ATOM 604  C CG1 . VAL A 1 136 ? 35.111 62.514 126.326 1.00 35.13 ? 136 VAL A CG1 1 
ATOM 605  C CG2 . VAL A 1 136 ? 34.895 64.828 125.302 1.00 28.74 ? 136 VAL A CG2 1 
ATOM 606  N N   . ALA A 1 137 ? 32.088 65.631 126.003 1.00 29.30 ? 137 ALA A N   1 
ATOM 607  C CA  . ALA A 1 137 ? 31.349 66.833 125.606 1.00 25.02 ? 137 ALA A CA  1 
ATOM 608  C C   . ALA A 1 137 ? 32.217 67.513 124.485 1.00 22.89 ? 137 ALA A C   1 
ATOM 609  O O   . ALA A 1 137 ? 32.565 68.696 124.505 1.00 19.43 ? 137 ALA A O   1 
ATOM 610  C CB  . ALA A 1 137 ? 31.090 67.739 126.812 1.00 25.45 ? 137 ALA A CB  1 
ATOM 611  N N   . ALA A 1 138 ? 32.609 66.655 123.546 1.00 23.29 ? 138 ALA A N   1 
ATOM 612  C CA  . ALA A 1 138 ? 33.386 66.938 122.356 1.00 24.27 ? 138 ALA A CA  1 
ATOM 613  C C   . ALA A 1 138 ? 32.300 66.799 121.284 1.00 27.43 ? 138 ALA A C   1 
ATOM 614  O O   . ALA A 1 138 ? 32.223 67.584 120.316 1.00 29.44 ? 138 ALA A O   1 
ATOM 615  C CB  . ALA A 1 138 ? 34.439 65.834 122.167 1.00 17.30 ? 138 ALA A CB  1 
ATOM 616  N N   . ILE A 1 139 ? 31.400 65.840 121.534 1.00 27.40 ? 139 ILE A N   1 
ATOM 617  C CA  . ILE A 1 139 ? 30.272 65.561 120.652 1.00 27.50 ? 139 ILE A CA  1 
ATOM 618  C C   . ILE A 1 139 ? 29.407 66.797 120.490 1.00 25.67 ? 139 ILE A C   1 
ATOM 619  O O   . ILE A 1 139 ? 28.512 66.846 119.639 1.00 26.09 ? 139 ILE A O   1 
ATOM 620  C CB  . ILE A 1 139 ? 29.437 64.335 121.126 1.00 23.41 ? 139 ILE A CB  1 
ATOM 621  C CG1 . ILE A 1 139 ? 28.991 64.469 122.573 1.00 21.25 ? 139 ILE A CG1 1 
ATOM 622  C CG2 . ILE A 1 139 ? 30.260 63.051 120.952 1.00 27.71 ? 139 ILE A CG2 1 
ATOM 623  C CD1 . ILE A 1 139 ? 28.626 63.129 123.191 1.00 18.80 ? 139 ILE A CD1 1 
ATOM 624  N N   . SER A 1 140 ? 29.705 67.798 121.311 1.00 24.80 ? 140 SER A N   1 
ATOM 625  C CA  . SER A 1 140 ? 29.039 69.080 121.257 1.00 24.76 ? 140 SER A CA  1 
ATOM 626  C C   . SER A 1 140 ? 29.372 69.816 119.944 1.00 22.16 ? 140 SER A C   1 
ATOM 627  O O   . SER A 1 140 ? 28.475 70.180 119.168 1.00 20.02 ? 140 SER A O   1 
ATOM 628  C CB  . SER A 1 140 ? 29.488 69.929 122.447 1.00 25.41 ? 140 SER A CB  1 
ATOM 629  O OG  . SER A 1 140 ? 29.581 71.308 122.092 1.00 29.58 ? 140 SER A OG  1 
ATOM 630  N N   . ALA A 1 141 ? 30.660 70.046 119.708 1.00 19.71 ? 141 ALA A N   1 
ATOM 631  C CA  . ALA A 1 141 ? 31.082 70.757 118.515 1.00 20.39 ? 141 ALA A CA  1 
ATOM 632  C C   . ALA A 1 141 ? 30.513 70.006 117.353 1.00 23.01 ? 141 ALA A C   1 
ATOM 633  O O   . ALA A 1 141 ? 30.025 70.602 116.377 1.00 20.35 ? 141 ALA A O   1 
ATOM 634  C CB  . ALA A 1 141 ? 32.576 70.779 118.416 1.00 22.01 ? 141 ALA A CB  1 
ATOM 635  N N   . MET A 1 142 ? 30.563 68.681 117.487 1.00 22.15 ? 142 MET A N   1 
ATOM 636  C CA  . MET A 1 142 ? 30.041 67.784 116.472 1.00 17.35 ? 142 MET A CA  1 
ATOM 637  C C   . MET A 1 142 ? 28.630 68.276 116.119 1.00 15.08 ? 142 MET A C   1 
ATOM 638  O O   . MET A 1 142 ? 28.414 68.806 115.031 1.00 6.59  ? 142 MET A O   1 
ATOM 639  C CB  . MET A 1 142 ? 30.029 66.350 117.001 1.00 18.00 ? 142 MET A CB  1 
ATOM 640  C CG  . MET A 1 142 ? 31.381 65.859 117.515 1.00 13.69 ? 142 MET A CG  1 
ATOM 641  S SD  . MET A 1 142 ? 31.527 64.043 117.369 1.00 20.68 ? 142 MET A SD  1 
ATOM 642  C CE  . MET A 1 142 ? 31.584 63.878 115.460 1.00 9.42  ? 142 MET A CE  1 
ATOM 643  N N   . PHE A 1 143 ? 27.712 68.240 117.083 1.00 15.83 ? 143 PHE A N   1 
ATOM 644  C CA  . PHE A 1 143 ? 26.343 68.717 116.834 1.00 19.21 ? 143 PHE A CA  1 
ATOM 645  C C   . PHE A 1 143 ? 26.327 70.122 116.203 1.00 22.30 ? 143 PHE A C   1 
ATOM 646  O O   . PHE A 1 143 ? 25.659 70.369 115.164 1.00 19.89 ? 143 PHE A O   1 
ATOM 647  C CB  . PHE A 1 143 ? 25.551 68.778 118.136 1.00 16.14 ? 143 PHE A CB  1 
ATOM 648  C CG  . PHE A 1 143 ? 24.765 67.546 118.431 1.00 11.44 ? 143 PHE A CG  1 
ATOM 649  C CD1 . PHE A 1 143 ? 25.167 66.684 119.441 1.00 10.32 ? 143 PHE A CD1 1 
ATOM 650  C CD2 . PHE A 1 143 ? 23.559 67.309 117.791 1.00 10.73 ? 143 PHE A CD2 1 
ATOM 651  C CE1 . PHE A 1 143 ? 24.371 65.606 119.828 1.00 10.57 ? 143 PHE A CE1 1 
ATOM 652  C CE2 . PHE A 1 143 ? 22.757 66.229 118.176 1.00 11.49 ? 143 PHE A CE2 1 
ATOM 653  C CZ  . PHE A 1 143 ? 23.174 65.378 119.204 1.00 12.39 ? 143 PHE A CZ  1 
ATOM 654  N N   . ALA A 1 144 ? 27.114 71.004 116.826 1.00 21.86 ? 144 ALA A N   1 
ATOM 655  C CA  . ALA A 1 144 ? 27.234 72.401 116.453 1.00 19.26 ? 144 ALA A CA  1 
ATOM 656  C C   . ALA A 1 144 ? 27.624 72.721 115.029 1.00 20.33 ? 144 ALA A C   1 
ATOM 657  O O   . ALA A 1 144 ? 27.329 73.814 114.545 1.00 23.44 ? 144 ALA A O   1 
ATOM 658  C CB  . ALA A 1 144 ? 28.165 73.100 117.405 1.00 15.42 ? 144 ALA A CB  1 
ATOM 659  N N   . ASP A 1 145 ? 28.234 71.794 114.315 1.00 20.12 ? 145 ASP A N   1 
ATOM 660  C CA  . ASP A 1 145 ? 28.629 72.158 112.962 1.00 22.91 ? 145 ASP A CA  1 
ATOM 661  C C   . ASP A 1 145 ? 27.622 71.933 111.838 1.00 21.03 ? 145 ASP A C   1 
ATOM 662  O O   . ASP A 1 145 ? 27.961 72.131 110.674 1.00 19.20 ? 145 ASP A O   1 
ATOM 663  C CB  . ASP A 1 145 ? 29.978 71.540 112.617 1.00 27.37 ? 145 ASP A CB  1 
ATOM 664  C CG  . ASP A 1 145 ? 30.036 70.092 112.971 1.00 33.39 ? 145 ASP A CG  1 
ATOM 665  O OD1 . ASP A 1 145 ? 28.982 69.448 112.790 1.00 36.28 ? 145 ASP A OD1 1 
ATOM 666  O OD2 . ASP A 1 145 ? 31.098 69.604 113.443 1.00 34.31 ? 145 ASP A OD2 1 
ATOM 667  N N   . GLY A 1 146 ? 26.398 71.524 112.174 1.00 22.47 ? 146 GLY A N   1 
ATOM 668  C CA  . GLY A 1 146 ? 25.380 71.291 111.150 1.00 26.56 ? 146 GLY A CA  1 
ATOM 669  C C   . GLY A 1 146 ? 25.866 70.373 110.026 1.00 29.32 ? 146 GLY A C   1 
ATOM 670  O O   . GLY A 1 146 ? 25.425 70.475 108.844 1.00 25.01 ? 146 GLY A O   1 
ATOM 671  N N   . ALA A 1 147 ? 26.755 69.450 110.414 1.00 26.49 ? 147 ALA A N   1 
ATOM 672  C CA  . ALA A 1 147 ? 27.373 68.513 109.489 1.00 23.76 ? 147 ALA A CA  1 
ATOM 673  C C   . ALA A 1 147 ? 26.496 67.322 109.139 1.00 22.23 ? 147 ALA A C   1 
ATOM 674  O O   . ALA A 1 147 ? 26.355 66.975 107.960 1.00 28.91 ? 147 ALA A O   1 
ATOM 675  C CB  . ALA A 1 147 ? 28.713 68.050 110.032 1.00 19.93 ? 147 ALA A CB  1 
ATOM 676  N N   . SER A 1 148 ? 25.926 66.670 110.142 1.00 16.91 ? 148 SER A N   1 
ATOM 677  C CA  . SER A 1 148 ? 25.071 65.524 109.860 1.00 17.65 ? 148 SER A CA  1 
ATOM 678  C C   . SER A 1 148 ? 23.660 65.962 110.196 1.00 16.71 ? 148 SER A C   1 
ATOM 679  O O   . SER A 1 148 ? 23.488 66.904 110.982 1.00 22.52 ? 148 SER A O   1 
ATOM 680  C CB  . SER A 1 148 ? 25.417 64.397 110.807 1.00 18.38 ? 148 SER A CB  1 
ATOM 681  O OG  . SER A 1 148 ? 25.342 64.921 112.135 1.00 22.39 ? 148 SER A OG  1 
ATOM 682  N N   . PRO A 1 149 ? 22.641 65.347 109.553 1.00 12.85 ? 149 PRO A N   1 
ATOM 683  C CA  . PRO A 1 149 ? 21.219 65.640 109.785 1.00 11.88 ? 149 PRO A CA  1 
ATOM 684  C C   . PRO A 1 149 ? 20.768 65.023 111.130 1.00 9.61  ? 149 PRO A C   1 
ATOM 685  O O   . PRO A 1 149 ? 21.265 63.981 111.562 1.00 2.00  ? 149 PRO A O   1 
ATOM 686  C CB  . PRO A 1 149 ? 20.524 65.041 108.557 1.00 8.86  ? 149 PRO A CB  1 
ATOM 687  C CG  . PRO A 1 149 ? 21.434 63.982 108.116 1.00 13.38 ? 149 PRO A CG  1 
ATOM 688  C CD  . PRO A 1 149 ? 22.812 64.592 108.304 1.00 13.20 ? 149 PRO A CD  1 
ATOM 689  N N   . VAL A 1 150 ? 19.795 65.678 111.759 1.00 7.58  ? 150 VAL A N   1 
ATOM 690  C CA  . VAL A 1 150 ? 19.331 65.324 113.084 1.00 4.39  ? 150 VAL A CA  1 
ATOM 691  C C   . VAL A 1 150 ? 17.834 65.144 113.199 1.00 2.00  ? 150 VAL A C   1 
ATOM 692  O O   . VAL A 1 150 ? 17.081 65.750 112.466 1.00 4.71  ? 150 VAL A O   1 
ATOM 693  C CB  . VAL A 1 150 ? 19.735 66.459 114.020 1.00 3.59  ? 150 VAL A CB  1 
ATOM 694  C CG1 . VAL A 1 150 ? 19.218 67.753 113.484 1.00 2.00  ? 150 VAL A CG1 1 
ATOM 695  C CG2 . VAL A 1 150 ? 19.166 66.257 115.373 1.00 11.97 ? 150 VAL A CG2 1 
ATOM 696  N N   . LEU A 1 151 ? 17.409 64.287 114.110 1.00 2.00  ? 151 LEU A N   1 
ATOM 697  C CA  . LEU A 1 151 ? 16.007 64.067 114.349 1.00 2.00  ? 151 LEU A CA  1 
ATOM 698  C C   . LEU A 1 151 ? 15.861 64.793 115.662 1.00 3.72  ? 151 LEU A C   1 
ATOM 699  O O   . LEU A 1 151 ? 16.716 64.635 116.533 1.00 3.13  ? 151 LEU A O   1 
ATOM 700  C CB  . LEU A 1 151 ? 15.729 62.583 114.555 1.00 2.00  ? 151 LEU A CB  1 
ATOM 701  C CG  . LEU A 1 151 ? 14.352 62.329 115.141 1.00 2.00  ? 151 LEU A CG  1 
ATOM 702  C CD1 . LEU A 1 151 ? 13.338 62.598 114.111 1.00 2.00  ? 151 LEU A CD1 1 
ATOM 703  C CD2 . LEU A 1 151 ? 14.243 60.943 115.593 1.00 2.00  ? 151 LEU A CD2 1 
ATOM 704  N N   . VAL A 1 152 ? 14.818 65.616 115.790 1.00 5.79  ? 152 VAL A N   1 
ATOM 705  C CA  . VAL A 1 152 ? 14.528 66.391 117.016 1.00 5.01  ? 152 VAL A CA  1 
ATOM 706  C C   . VAL A 1 152 ? 13.204 65.956 117.645 1.00 2.15  ? 152 VAL A C   1 
ATOM 707  O O   . VAL A 1 152 ? 12.127 66.399 117.231 1.00 2.30  ? 152 VAL A O   1 
ATOM 708  C CB  . VAL A 1 152 ? 14.465 67.900 116.730 1.00 2.00  ? 152 VAL A CB  1 
ATOM 709  C CG1 . VAL A 1 152 ? 14.082 68.654 117.976 1.00 2.28  ? 152 VAL A CG1 1 
ATOM 710  C CG2 . VAL A 1 152 ? 15.801 68.376 116.245 1.00 7.73  ? 152 VAL A CG2 1 
ATOM 711  N N   . TYR A 1 153 ? 13.307 65.152 118.696 1.00 2.00  ? 153 TYR A N   1 
ATOM 712  C CA  . TYR A 1 153 ? 12.143 64.609 119.364 1.00 4.34  ? 153 TYR A CA  1 
ATOM 713  C C   . TYR A 1 153 ? 11.646 65.399 120.547 1.00 5.37  ? 153 TYR A C   1 
ATOM 714  O O   . TYR A 1 153 ? 12.337 65.510 121.568 1.00 6.20  ? 153 TYR A O   1 
ATOM 715  C CB  . TYR A 1 153 ? 12.393 63.151 119.780 1.00 5.87  ? 153 TYR A CB  1 
ATOM 716  C CG  . TYR A 1 153 ? 11.122 62.362 120.061 1.00 2.00  ? 153 TYR A CG  1 
ATOM 717  C CD1 . TYR A 1 153 ? 10.328 61.921 119.031 1.00 2.00  ? 153 TYR A CD1 1 
ATOM 718  C CD2 . TYR A 1 153 ? 10.744 62.046 121.351 1.00 2.00  ? 153 TYR A CD2 1 
ATOM 719  C CE1 . TYR A 1 153 ? 9.209  61.200 119.266 1.00 2.00  ? 153 TYR A CE1 1 
ATOM 720  C CE2 . TYR A 1 153 ? 9.621  61.317 121.591 1.00 2.00  ? 153 TYR A CE2 1 
ATOM 721  C CZ  . TYR A 1 153 ? 8.866  60.889 120.538 1.00 2.00  ? 153 TYR A CZ  1 
ATOM 722  O OH  . TYR A 1 153 ? 7.796  60.070 120.734 1.00 2.00  ? 153 TYR A OH  1 
ATOM 723  N N   . GLN A 1 154 ? 10.370 65.768 120.458 1.00 3.65  ? 154 GLN A N   1 
ATOM 724  C CA  . GLN A 1 154 ? 9.722  66.552 121.488 1.00 5.14  ? 154 GLN A CA  1 
ATOM 725  C C   . GLN A 1 154 ? 8.236  66.254 121.827 1.00 5.48  ? 154 GLN A C   1 
ATOM 726  O O   . GLN A 1 154 ? 7.767  66.666 122.886 1.00 4.23  ? 154 GLN A O   1 
ATOM 727  C CB  . GLN A 1 154 ? 9.881  68.005 121.087 1.00 2.00  ? 154 GLN A CB  1 
ATOM 728  C CG  . GLN A 1 154 ? 9.244  68.975 121.977 1.00 8.76  ? 154 GLN A CG  1 
ATOM 729  C CD  . GLN A 1 154 ? 9.516  70.378 121.526 1.00 12.58 ? 154 GLN A CD  1 
ATOM 730  O OE1 . GLN A 1 154 ? 10.626 70.710 121.114 1.00 12.81 ? 154 GLN A OE1 1 
ATOM 731  N NE2 . GLN A 1 154 ? 8.496  71.219 121.585 1.00 19.45 ? 154 GLN A NE2 1 
ATOM 732  N N   . TYR A 1 155 ? 7.522  65.483 120.995 1.00 8.49  ? 155 TYR A N   1 
ATOM 733  C CA  . TYR A 1 155 ? 6.100  65.240 121.255 1.00 7.08  ? 155 TYR A CA  1 
ATOM 734  C C   . TYR A 1 155 ? 5.456  63.954 121.779 1.00 10.01 ? 155 TYR A C   1 
ATOM 735  O O   . TYR A 1 155 ? 4.742  64.010 122.783 1.00 22.31 ? 155 TYR A O   1 
ATOM 736  C CB  . TYR A 1 155 ? 5.279  65.840 120.143 1.00 3.71  ? 155 TYR A CB  1 
ATOM 737  C CG  . TYR A 1 155 ? 5.476  67.324 120.163 1.00 3.70  ? 155 TYR A CG  1 
ATOM 738  C CD1 . TYR A 1 155 ? 6.257  67.950 119.212 1.00 8.41  ? 155 TYR A CD1 1 
ATOM 739  C CD2 . TYR A 1 155 ? 4.957  68.099 121.184 1.00 7.87  ? 155 TYR A CD2 1 
ATOM 740  C CE1 . TYR A 1 155 ? 6.517  69.298 119.280 1.00 5.78  ? 155 TYR A CE1 1 
ATOM 741  C CE2 . TYR A 1 155 ? 5.218  69.466 121.257 1.00 6.53  ? 155 TYR A CE2 1 
ATOM 742  C CZ  . TYR A 1 155 ? 5.999  70.049 120.298 1.00 6.33  ? 155 TYR A CZ  1 
ATOM 743  O OH  . TYR A 1 155 ? 6.286  71.393 120.339 1.00 10.73 ? 155 TYR A OH  1 
ATOM 744  N N   . ALA A 1 156 ? 5.563  62.831 121.087 1.00 6.98  ? 156 ALA A N   1 
ATOM 745  C CA  . ALA A 1 156 ? 4.972  61.604 121.638 1.00 5.83  ? 156 ALA A CA  1 
ATOM 746  C C   . ALA A 1 156 ? 3.463  61.399 121.496 1.00 6.82  ? 156 ALA A C   1 
ATOM 747  O O   . ALA A 1 156 ? 2.962  60.310 121.763 1.00 13.30 ? 156 ALA A O   1 
ATOM 748  C CB  . ALA A 1 156 ? 5.416  61.384 123.101 1.00 2.00  ? 156 ALA A CB  1 
ATOM 749  N N   . ALA A 1 157 ? 2.709  62.428 121.148 1.00 6.37  ? 157 ALA A N   1 
ATOM 750  C CA  . ALA A 1 157 ? 1.292  62.209 120.911 1.00 2.00  ? 157 ALA A CA  1 
ATOM 751  C C   . ALA A 1 157 ? 1.417  61.494 119.594 1.00 2.00  ? 157 ALA A C   1 
ATOM 752  O O   . ALA A 1 157 ? 2.210  61.917 118.746 1.00 2.61  ? 157 ALA A O   1 
ATOM 753  C CB  . ALA A 1 157 ? 0.594  63.501 120.714 1.00 2.00  ? 157 ALA A CB  1 
ATOM 754  N N   . SER A 1 158 ? 0.723  60.385 119.410 1.00 2.00  ? 158 SER A N   1 
ATOM 755  C CA  . SER A 1 158 ? 0.877  59.690 118.138 1.00 2.00  ? 158 SER A CA  1 
ATOM 756  C C   . SER A 1 158 ? 0.609  60.510 116.873 1.00 2.00  ? 158 SER A C   1 
ATOM 757  O O   . SER A 1 158 ? -0.503 61.006 116.589 1.00 2.00  ? 158 SER A O   1 
ATOM 758  C CB  . SER A 1 158 ? 0.110  58.372 118.113 1.00 2.51  ? 158 SER A CB  1 
ATOM 759  O OG  . SER A 1 158 ? 0.774  57.386 118.889 1.00 7.42  ? 158 SER A OG  1 
ATOM 760  N N   . GLY A 1 159 ? 1.669  60.703 116.128 1.00 2.00  ? 159 GLY A N   1 
ATOM 761  C CA  . GLY A 1 159 ? 1.524  61.419 114.895 1.00 3.61  ? 159 GLY A CA  1 
ATOM 762  C C   . GLY A 1 159 ? 1.599  62.920 114.906 1.00 4.48  ? 159 GLY A C   1 
ATOM 763  O O   . GLY A 1 159 ? 1.536  63.484 113.820 1.00 14.07 ? 159 GLY A O   1 
ATOM 764  N N   . VAL A 1 160 ? 1.768  63.574 116.051 1.00 3.17  ? 160 VAL A N   1 
ATOM 765  C CA  . VAL A 1 160 ? 1.836  65.039 116.065 1.00 3.70  ? 160 VAL A CA  1 
ATOM 766  C C   . VAL A 1 160 ? 3.146  65.570 115.474 1.00 8.69  ? 160 VAL A C   1 
ATOM 767  O O   . VAL A 1 160 ? 3.165  66.377 114.529 1.00 5.51  ? 160 VAL A O   1 
ATOM 768  C CB  . VAL A 1 160 ? 1.680  65.568 117.462 1.00 2.00  ? 160 VAL A CB  1 
ATOM 769  C CG1 . VAL A 1 160 ? 1.847  67.054 117.477 1.00 2.00  ? 160 VAL A CG1 1 
ATOM 770  C CG2 . VAL A 1 160 ? 0.345  65.200 117.949 1.00 2.00  ? 160 VAL A CG2 1 
ATOM 771  N N   . GLN A 1 161 ? 4.246  65.201 116.121 1.00 13.24 ? 161 GLN A N   1 
ATOM 772  C CA  . GLN A 1 161 ? 5.576  65.570 115.651 1.00 9.91  ? 161 GLN A CA  1 
ATOM 773  C C   . GLN A 1 161 ? 5.725  64.402 114.739 1.00 9.71  ? 161 GLN A C   1 
ATOM 774  O O   . GLN A 1 161 ? 5.944  63.270 115.169 1.00 6.80  ? 161 GLN A O   1 
ATOM 775  C CB  . GLN A 1 161 ? 6.602  65.446 116.749 1.00 2.54  ? 161 GLN A CB  1 
ATOM 776  C CG  . GLN A 1 161 ? 7.920  65.337 116.191 1.00 2.00  ? 161 GLN A CG  1 
ATOM 777  C CD  . GLN A 1 161 ? 8.905  65.227 117.249 1.00 2.00  ? 161 GLN A CD  1 
ATOM 778  O OE1 . GLN A 1 161 ? 8.881  65.966 118.216 1.00 2.00  ? 161 GLN A OE1 1 
ATOM 779  N NE2 . GLN A 1 161 ? 9.786  64.278 117.105 1.00 6.15  ? 161 GLN A NE2 1 
ATOM 780  N N   . ALA A 1 162 ? 5.423  64.650 113.486 1.00 15.19 ? 162 ALA A N   1 
ATOM 781  C CA  . ALA A 1 162 ? 5.487  63.593 112.485 1.00 19.69 ? 162 ALA A CA  1 
ATOM 782  C C   . ALA A 1 162 ? 6.866  62.840 112.557 1.00 15.21 ? 162 ALA A C   1 
ATOM 783  O O   . ALA A 1 162 ? 7.164  61.976 111.716 1.00 23.21 ? 162 ALA A O   1 
ATOM 784  C CB  . ALA A 1 162 ? 5.111  64.187 110.951 1.00 10.85 ? 162 ALA A CB  1 
ATOM 785  N N   . ASN A 1 163 ? 7.688  63.076 113.570 1.00 6.59  ? 163 ASN A N   1 
ATOM 786  C CA  . ASN A 1 163 ? 8.896  62.359 113.494 1.00 7.56  ? 163 ASN A CA  1 
ATOM 787  C C   . ASN A 1 163 ? 9.389  61.532 114.592 1.00 7.51  ? 163 ASN A C   1 
ATOM 788  O O   . ASN A 1 163 ? 9.349  61.909 115.738 1.00 14.83 ? 163 ASN A O   1 
ATOM 789  C CB  . ASN A 1 163 ? 10.024 63.274 113.073 1.00 14.68 ? 163 ASN A CB  1 
ATOM 790  C CG  . ASN A 1 163 ? 9.936  63.668 111.603 1.00 31.63 ? 163 ASN A CG  1 
ATOM 791  O OD1 . ASN A 1 163 ? 10.670 63.166 110.731 1.00 36.86 ? 163 ASN A OD1 1 
ATOM 792  N ND2 . ASN A 1 163 ? 9.013  64.571 111.313 1.00 41.80 ? 163 ASN A ND2 1 
ATOM 793  N N   . ASN A 1 164 ? 9.891  60.388 114.183 1.00 7.27  ? 164 ASN A N   1 
ATOM 794  C CA  . ASN A 1 164 ? 10.619 59.465 115.023 1.00 9.73  ? 164 ASN A CA  1 
ATOM 795  C C   . ASN A 1 164 ? 11.380 58.668 113.990 1.00 13.35 ? 164 ASN A C   1 
ATOM 796  O O   . ASN A 1 164 ? 11.678 57.512 114.207 1.00 24.42 ? 164 ASN A O   1 
ATOM 797  C CB  . ASN A 1 164 ? 9.761  58.580 115.904 1.00 9.53  ? 164 ASN A CB  1 
ATOM 798  C CG  . ASN A 1 164 ? 8.479  58.207 115.274 1.00 15.57 ? 164 ASN A CG  1 
ATOM 799  O OD1 . ASN A 1 164 ? 7.541  57.852 115.973 1.00 22.94 ? 164 ASN A OD1 1 
ATOM 800  N ND2 . ASN A 1 164 ? 8.412  58.254 113.954 1.00 22.79 ? 164 ASN A ND2 1 
ATOM 801  N N   . LYS A 1 165 ? 11.637 59.294 112.840 1.00 10.06 ? 165 LYS A N   1 
ATOM 802  C CA  . LYS A 1 165 ? 12.363 58.684 111.749 1.00 12.55 ? 165 LYS A CA  1 
ATOM 803  C C   . LYS A 1 165 ? 13.205 59.800 111.120 1.00 11.30 ? 165 LYS A C   1 
ATOM 804  O O   . LYS A 1 165 ? 12.902 60.955 111.350 1.00 14.60 ? 165 LYS A O   1 
ATOM 805  C CB  . LYS A 1 165 ? 11.370 58.157 110.718 1.00 16.34 ? 165 LYS A CB  1 
ATOM 806  C CG  . LYS A 1 165 ? 10.589 56.904 111.125 1.00 30.21 ? 165 LYS A CG  1 
ATOM 807  C CD  . LYS A 1 165 ? 10.657 55.790 110.029 1.00 35.81 ? 165 LYS A CD  1 
ATOM 808  C CE  . LYS A 1 165 ? 9.248  55.230 109.612 1.00 36.41 ? 165 LYS A CE  1 
ATOM 809  N NZ  . LYS A 1 165 ? 9.172  54.182 108.495 1.00 36.26 ? 165 LYS A NZ  1 
ATOM 810  N N   . LEU A 1 166 ? 14.287 59.472 110.403 1.00 8.88  ? 166 LEU A N   1 
ATOM 811  C CA  . LEU A 1 166 ? 15.133 60.449 109.693 1.00 8.13  ? 166 LEU A CA  1 
ATOM 812  C C   . LEU A 1 166 ? 16.120 59.597 108.820 1.00 8.37  ? 166 LEU A C   1 
ATOM 813  O O   . LEU A 1 166 ? 15.845 58.418 108.695 1.00 3.70  ? 166 LEU A O   1 
ATOM 814  C CB  . LEU A 1 166 ? 15.798 61.447 110.664 1.00 7.00  ? 166 LEU A CB  1 
ATOM 815  C CG  . LEU A 1 166 ? 15.696 62.987 110.431 1.00 10.19 ? 166 LEU A CG  1 
ATOM 816  C CD1 . LEU A 1 166 ? 16.372 63.497 109.172 1.00 10.67 ? 166 LEU A CD1 1 
ATOM 817  C CD2 . LEU A 1 166 ? 14.266 63.424 110.351 1.00 16.03 ? 166 LEU A CD2 1 
ATOM 818  N N   . LEU A 1 167 ? 17.251 60.126 108.279 1.00 8.50  ? 167 LEU A N   1 
ATOM 819  C CA  . LEU A 1 167 ? 18.185 59.356 107.397 1.00 4.19  ? 167 LEU A CA  1 
ATOM 820  C C   . LEU A 1 167 ? 19.808 59.517 107.320 1.00 5.21  ? 167 LEU A C   1 
ATOM 821  O O   . LEU A 1 167 ? 20.449 59.929 108.319 1.00 2.00  ? 167 LEU A O   1 
ATOM 822  C CB  . LEU A 1 167 ? 17.576 59.457 105.995 1.00 2.80  ? 167 LEU A CB  1 
ATOM 823  C CG  . LEU A 1 167 ? 16.567 58.513 105.281 1.00 4.05  ? 167 LEU A CG  1 
ATOM 824  C CD1 . LEU A 1 167 ? 17.219 57.439 104.396 1.00 2.00  ? 167 LEU A CD1 1 
ATOM 825  C CD2 . LEU A 1 167 ? 15.590 57.890 106.193 1.00 3.89  ? 167 LEU A CD2 1 
ATOM 826  N N   . TYR A 1 168 ? 20.352 58.988 106.167 1.00 5.64  ? 168 TYR A N   1 
ATOM 827  C CA  . TYR A 1 168 ? 21.727 58.822 105.495 1.00 2.00  ? 168 TYR A CA  1 
ATOM 828  C C   . TYR A 1 168 ? 21.566 57.673 104.387 1.00 2.00  ? 168 TYR A C   1 
ATOM 829  O O   . TYR A 1 168 ? 20.770 56.762 104.601 1.00 2.00  ? 168 TYR A O   1 
ATOM 830  C CB  . TYR A 1 168 ? 22.762 58.161 106.366 1.00 2.00  ? 168 TYR A CB  1 
ATOM 831  C CG  . TYR A 1 168 ? 23.765 58.990 107.075 1.00 5.17  ? 168 TYR A CG  1 
ATOM 832  C CD1 . TYR A 1 168 ? 23.860 58.924 108.464 1.00 12.58 ? 168 TYR A CD1 1 
ATOM 833  C CD2 . TYR A 1 168 ? 24.662 59.790 106.404 1.00 9.14  ? 168 TYR A CD2 1 
ATOM 834  C CE1 . TYR A 1 168 ? 24.798 59.619 109.165 1.00 3.97  ? 168 TYR A CE1 1 
ATOM 835  C CE2 . TYR A 1 168 ? 25.635 60.516 107.122 1.00 6.43  ? 168 TYR A CE2 1 
ATOM 836  C CZ  . TYR A 1 168 ? 25.669 60.411 108.504 1.00 4.52  ? 168 TYR A CZ  1 
ATOM 837  O OH  . TYR A 1 168 ? 26.551 61.125 109.261 1.00 15.86 ? 168 TYR A OH  1 
ATOM 838  N N   . ASP A 1 169 ? 22.306 57.670 103.256 1.00 2.58  ? 169 ASP A N   1 
ATOM 839  C CA  . ASP A 1 169 ? 22.254 56.549 102.243 1.00 2.00  ? 169 ASP A CA  1 
ATOM 840  C C   . ASP A 1 169 ? 23.568 56.348 101.453 1.00 3.71  ? 169 ASP A C   1 
ATOM 841  O O   . ASP A 1 169 ? 23.648 56.614 100.241 1.00 2.00  ? 169 ASP A O   1 
ATOM 842  C CB  . ASP A 1 169 ? 21.089 56.596 101.240 1.00 2.00  ? 169 ASP A CB  1 
ATOM 843  C CG  . ASP A 1 169 ? 21.042 55.336 100.290 1.00 4.28  ? 169 ASP A CG  1 
ATOM 844  O OD1 . ASP A 1 169 ? 21.920 54.448 100.389 1.00 4.74  ? 169 ASP A OD1 1 
ATOM 845  O OD2 . ASP A 1 169 ? 20.114 55.203 99.447  1.00 3.65  ? 169 ASP A OD2 1 
ATOM 846  N N   . LEU A 1 170 ? 24.510 55.678 102.119 1.00 4.91  ? 170 LEU A N   1 
ATOM 847  C CA  . LEU A 1 170 ? 25.839 55.395 101.605 1.00 4.45  ? 170 LEU A CA  1 
ATOM 848  C C   . LEU A 1 170 ? 25.839 54.456 100.417 1.00 6.87  ? 170 LEU A C   1 
ATOM 849  O O   . LEU A 1 170 ? 26.907 54.157 99.878  1.00 6.27  ? 170 LEU A O   1 
ATOM 850  C CB  . LEU A 1 170 ? 26.714 54.782 102.690 1.00 2.00  ? 170 LEU A CB  1 
ATOM 851  C CG  . LEU A 1 170 ? 26.359 55.072 104.135 1.00 2.00  ? 170 LEU A CG  1 
ATOM 852  C CD1 . LEU A 1 170 ? 27.412 54.517 105.079 1.00 2.19  ? 170 LEU A CD1 1 
ATOM 853  C CD2 . LEU A 1 170 ? 26.250 56.546 104.312 1.00 4.22  ? 170 LEU A CD2 1 
ATOM 854  N N   . SER A 1 171 ? 24.663 54.013 99.990  1.00 7.87  ? 171 SER A N   1 
ATOM 855  C CA  . SER A 1 171 ? 24.581 53.091 98.867  1.00 12.43 ? 171 SER A CA  1 
ATOM 856  C C   . SER A 1 171 ? 25.679 53.259 97.841  1.00 12.77 ? 171 SER A C   1 
ATOM 857  O O   . SER A 1 171 ? 26.505 52.368 97.655  1.00 11.04 ? 171 SER A O   1 
ATOM 858  C CB  . SER A 1 171 ? 23.249 53.212 98.127  1.00 15.69 ? 171 SER A CB  1 
ATOM 859  O OG  . SER A 1 171 ? 23.303 52.492 96.892  1.00 16.00 ? 171 SER A OG  1 
ATOM 860  N N   . ALA A 1 172 ? 25.709 54.442 97.236  1.00 14.18 ? 172 ALA A N   1 
ATOM 861  C CA  . ALA A 1 172 ? 26.656 54.758 96.176  1.00 12.90 ? 172 ALA A CA  1 
ATOM 862  C C   . ALA A 1 172 ? 28.086 55.092 96.520  1.00 9.73  ? 172 ALA A C   1 
ATOM 863  O O   . ALA A 1 172 ? 28.836 55.497 95.641  1.00 9.75  ? 172 ALA A O   1 
ATOM 864  C CB  . ALA A 1 172 ? 26.091 55.804 95.266  1.00 20.14 ? 172 ALA A CB  1 
ATOM 865  N N   . MET A 1 173 ? 28.448 55.056 97.788  1.00 6.19  ? 173 MET A N   1 
ATOM 866  C CA  . MET A 1 173 ? 29.842 55.266 98.114  1.00 9.53  ? 173 MET A CA  1 
ATOM 867  C C   . MET A 1 173 ? 30.337 53.908 98.656  1.00 10.68 ? 173 MET A C   1 
ATOM 868  O O   . MET A 1 173 ? 31.336 53.810 99.387  1.00 13.03 ? 173 MET A O   1 
ATOM 869  C CB  . MET A 1 173 ? 30.029 56.411 99.105  1.00 14.05 ? 173 MET A CB  1 
ATOM 870  C CG  . MET A 1 173 ? 28.860 56.666 100.010 1.00 17.32 ? 173 MET A CG  1 
ATOM 871  S SD  . MET A 1 173 ? 28.101 58.259 99.688  1.00 22.72 ? 173 MET A SD  1 
ATOM 872  C CE  . MET A 1 173 ? 27.290 57.862 98.116  1.00 19.51 ? 173 MET A CE  1 
ATOM 873  N N   . ARG A 1 174 ? 29.638 52.864 98.202  1.00 10.09 ? 174 ARG A N   1 
ATOM 874  C CA  . ARG A 1 174 ? 29.851 51.471 98.580  1.00 9.77  ? 174 ARG A CA  1 
ATOM 875  C C   . ARG A 1 174 ? 30.569 51.331 99.865  1.00 7.66  ? 174 ARG A C   1 
ATOM 876  O O   . ARG A 1 174 ? 31.786 51.212 99.872  1.00 9.29  ? 174 ARG A O   1 
ATOM 877  C CB  . ARG A 1 174 ? 30.627 50.687 97.560  1.00 9.01  ? 174 ARG A CB  1 
ATOM 878  C CG  . ARG A 1 174 ? 30.679 51.269 96.191  1.00 19.57 ? 174 ARG A CG  1 
ATOM 879  C CD  . ARG A 1 174 ? 30.943 50.130 95.205  1.00 29.11 ? 174 ARG A CD  1 
ATOM 880  N NE  . ARG A 1 174 ? 31.779 49.072 95.797  1.00 32.13 ? 174 ARG A NE  1 
ATOM 881  C CZ  . ARG A 1 174 ? 31.610 47.772 95.580  1.00 30.75 ? 174 ARG A CZ  1 
ATOM 882  N NH1 . ARG A 1 174 ? 30.631 47.360 94.767  1.00 30.93 ? 174 ARG A NH1 1 
ATOM 883  N NH2 . ARG A 1 174 ? 32.377 46.891 96.231  1.00 34.75 ? 174 ARG A NH2 1 
ATOM 884  N N   . ALA A 1 175 ? 29.809 51.411 100.945 1.00 8.90  ? 175 ALA A N   1 
ATOM 885  C CA  . ALA A 1 175 ? 30.330 51.283 102.288 1.00 6.25  ? 175 ALA A CA  1 
ATOM 886  C C   . ALA A 1 175 ? 29.941 49.887 102.744 1.00 5.21  ? 175 ALA A C   1 
ATOM 887  O O   . ALA A 1 175 ? 29.054 49.273 102.150 1.00 7.78  ? 175 ALA A O   1 
ATOM 888  C CB  . ALA A 1 175 ? 29.682 52.306 103.158 1.00 2.00  ? 175 ALA A CB  1 
ATOM 889  N N   . ASP A 1 176 ? 30.683 49.331 103.687 1.00 2.00  ? 176 ASP A N   1 
ATOM 890  C CA  . ASP A 1 176 ? 30.365 48.020 104.209 1.00 2.00  ? 176 ASP A CA  1 
ATOM 891  C C   . ASP A 1 176 ? 30.230 47.971 105.708 1.00 2.00  ? 176 ASP A C   1 
ATOM 892  O O   . ASP A 1 176 ? 30.578 48.913 106.407 1.00 2.00  ? 176 ASP A O   1 
ATOM 893  C CB  . ASP A 1 176 ? 31.333 46.929 103.715 1.00 2.11  ? 176 ASP A CB  1 
ATOM 894  C CG  . ASP A 1 176 ? 32.826 47.316 103.802 1.00 10.94 ? 176 ASP A CG  1 
ATOM 895  O OD1 . ASP A 1 176 ? 33.488 47.228 102.734 1.00 13.63 ? 176 ASP A OD1 1 
ATOM 896  O OD2 . ASP A 1 176 ? 33.375 47.621 104.901 1.00 8.86  ? 176 ASP A OD2 1 
ATOM 897  N N   . ILE A 1 177 ? 29.759 46.836 106.203 1.00 3.85  ? 177 ILE A N   1 
ATOM 898  C CA  . ILE A 1 177 ? 29.543 46.615 107.627 1.00 2.62  ? 177 ILE A CA  1 
ATOM 899  C C   . ILE A 1 177 ? 30.779 46.985 108.424 1.00 4.36  ? 177 ILE A C   1 
ATOM 900  O O   . ILE A 1 177 ? 30.728 47.329 109.605 1.00 5.85  ? 177 ILE A O   1 
ATOM 901  C CB  . ILE A 1 177 ? 29.137 45.144 107.877 1.00 2.05  ? 177 ILE A CB  1 
ATOM 902  C CG1 . ILE A 1 177 ? 27.894 44.830 107.049 1.00 2.38  ? 177 ILE A CG1 1 
ATOM 903  C CG2 . ILE A 1 177 ? 28.820 44.897 109.340 1.00 2.00  ? 177 ILE A CG2 1 
ATOM 904  C CD1 . ILE A 1 177 ? 26.721 45.712 107.395 1.00 2.00  ? 177 ILE A CD1 1 
ATOM 905  N N   . GLY A 1 178 ? 31.901 46.990 107.750 1.00 4.16  ? 178 GLY A N   1 
ATOM 906  C CA  . GLY A 1 178 ? 33.113 47.318 108.453 1.00 12.41 ? 178 GLY A CA  1 
ATOM 907  C C   . GLY A 1 178 ? 33.237 48.766 108.844 1.00 12.18 ? 178 GLY A C   1 
ATOM 908  O O   . GLY A 1 178 ? 33.669 49.073 109.948 1.00 19.06 ? 178 GLY A O   1 
ATOM 909  N N   . ASP A 1 179 ? 32.821 49.662 107.962 1.00 12.41 ? 179 ASP A N   1 
ATOM 910  C CA  . ASP A 1 179 ? 32.964 51.074 108.245 1.00 10.19 ? 179 ASP A CA  1 
ATOM 911  C C   . ASP A 1 179 ? 31.905 51.547 109.189 1.00 10.73 ? 179 ASP A C   1 
ATOM 912  O O   . ASP A 1 179 ? 32.059 52.609 109.775 1.00 11.63 ? 179 ASP A O   1 
ATOM 913  C CB  . ASP A 1 179 ? 32.932 51.915 106.969 1.00 13.46 ? 179 ASP A CB  1 
ATOM 914  C CG  . ASP A 1 179 ? 33.314 51.117 105.730 1.00 14.97 ? 179 ASP A CG  1 
ATOM 915  O OD1 . ASP A 1 179 ? 34.480 51.176 105.277 1.00 17.05 ? 179 ASP A OD1 1 
ATOM 916  O OD2 . ASP A 1 179 ? 32.426 50.427 105.206 1.00 18.05 ? 179 ASP A OD2 1 
ATOM 917  N N   . MET A 1 180 ? 30.835 50.769 109.344 1.00 11.34 ? 180 MET A N   1 
ATOM 918  C CA  . MET A 1 180 ? 29.757 51.164 110.241 1.00 12.60 ? 180 MET A CA  1 
ATOM 919  C C   . MET A 1 180 ? 30.341 51.519 111.581 1.00 16.78 ? 180 MET A C   1 
ATOM 920  O O   . MET A 1 180 ? 30.073 52.590 112.123 1.00 19.02 ? 180 MET A O   1 
ATOM 921  C CB  . MET A 1 180 ? 28.720 50.062 110.416 1.00 7.80  ? 180 MET A CB  1 
ATOM 922  C CG  . MET A 1 180 ? 27.801 49.927 109.240 1.00 5.66  ? 180 MET A CG  1 
ATOM 923  S SD  . MET A 1 180 ? 27.533 51.489 108.456 1.00 2.00  ? 180 MET A SD  1 
ATOM 924  C CE  . MET A 1 180 ? 26.520 52.169 109.647 1.00 2.83  ? 180 MET A CE  1 
ATOM 925  N N   . ARG A 1 181 ? 31.252 50.673 112.032 1.00 19.12 ? 181 ARG A N   1 
ATOM 926  C CA  . ARG A 1 181 ? 31.924 50.830 113.316 1.00 19.62 ? 181 ARG A CA  1 
ATOM 927  C C   . ARG A 1 181 ? 32.614 52.184 113.473 1.00 15.19 ? 181 ARG A C   1 
ATOM 928  O O   . ARG A 1 181 ? 32.959 52.579 114.569 1.00 12.61 ? 181 ARG A O   1 
ATOM 929  C CB  . ARG A 1 181 ? 32.856 49.625 113.523 1.00 26.99 ? 181 ARG A CB  1 
ATOM 930  C CG  . ARG A 1 181 ? 32.054 48.251 113.295 1.00 37.42 ? 181 ARG A CG  1 
ATOM 931  C CD  . ARG A 1 181 ? 32.928 46.968 112.970 1.00 42.10 ? 181 ARG A CD  1 
ATOM 932  N NE  . ARG A 1 181 ? 32.483 45.758 113.707 1.00 52.45 ? 181 ARG A NE  1 
ATOM 933  C CZ  . ARG A 1 181 ? 32.916 45.371 114.923 1.00 51.28 ? 181 ARG A CZ  1 
ATOM 934  N NH1 . ARG A 1 181 ? 33.843 46.071 115.580 1.00 48.04 ? 181 ARG A NH1 1 
ATOM 935  N NH2 . ARG A 1 181 ? 32.359 44.313 115.533 1.00 48.93 ? 181 ARG A NH2 1 
ATOM 936  N N   . LYS A 1 182 ? 32.713 52.932 112.382 1.00 14.85 ? 182 LYS A N   1 
ATOM 937  C CA  . LYS A 1 182 ? 33.321 54.261 112.382 1.00 16.96 ? 182 LYS A CA  1 
ATOM 938  C C   . LYS A 1 182 ? 32.365 55.362 112.862 1.00 17.12 ? 182 LYS A C   1 
ATOM 939  O O   . LYS A 1 182 ? 32.804 56.445 113.264 1.00 23.56 ? 182 LYS A O   1 
ATOM 940  C CB  . LYS A 1 182 ? 33.825 54.608 110.978 1.00 17.62 ? 182 LYS A CB  1 
ATOM 941  C CG  . LYS A 1 182 ? 35.303 54.312 110.769 1.00 25.63 ? 182 LYS A CG  1 
ATOM 942  C CD  . LYS A 1 182 ? 35.588 53.122 109.862 1.00 29.33 ? 182 LYS A CD  1 
ATOM 943  C CE  . LYS A 1 182 ? 35.542 53.489 108.384 1.00 29.55 ? 182 LYS A CE  1 
ATOM 944  N NZ  . LYS A 1 182 ? 36.256 52.446 107.575 1.00 34.18 ? 182 LYS A NZ  1 
ATOM 945  N N   . TYR A 1 183 ? 31.064 55.107 112.736 1.00 13.55 ? 183 TYR A N   1 
ATOM 946  C CA  . TYR A 1 183 ? 30.020 56.032 113.145 1.00 5.35  ? 183 TYR A CA  1 
ATOM 947  C C   . TYR A 1 183 ? 29.629 55.888 114.613 1.00 5.68  ? 183 TYR A C   1 
ATOM 948  O O   . TYR A 1 183 ? 29.818 54.848 115.234 1.00 5.14  ? 183 TYR A O   1 
ATOM 949  C CB  . TYR A 1 183 ? 28.778 55.750 112.342 1.00 2.00  ? 183 TYR A CB  1 
ATOM 950  C CG  . TYR A 1 183 ? 28.944 55.938 110.898 1.00 2.00  ? 183 TYR A CG  1 
ATOM 951  C CD1 . TYR A 1 183 ? 29.457 54.940 110.120 1.00 2.00  ? 183 TYR A CD1 1 
ATOM 952  C CD2 . TYR A 1 183 ? 28.560 57.109 110.296 1.00 2.00  ? 183 TYR A CD2 1 
ATOM 953  C CE1 . TYR A 1 183 ? 29.578 55.100 108.751 1.00 3.21  ? 183 TYR A CE1 1 
ATOM 954  C CE2 . TYR A 1 183 ? 28.676 57.292 108.952 1.00 3.81  ? 183 TYR A CE2 1 
ATOM 955  C CZ  . TYR A 1 183 ? 29.183 56.287 108.169 1.00 5.45  ? 183 TYR A CZ  1 
ATOM 956  O OH  . TYR A 1 183 ? 29.274 56.460 106.800 1.00 5.44  ? 183 TYR A OH  1 
ATOM 957  N N   . ALA A 1 184 ? 28.945 56.893 115.133 1.00 6.37  ? 184 ALA A N   1 
ATOM 958  C CA  . ALA A 1 184 ? 28.490 56.846 116.512 1.00 7.56  ? 184 ALA A CA  1 
ATOM 959  C C   . ALA A 1 184 ? 27.175 57.622 116.701 1.00 8.66  ? 184 ALA A C   1 
ATOM 960  O O   . ALA A 1 184 ? 26.872 58.539 115.928 1.00 7.07  ? 184 ALA A O   1 
ATOM 961  C CB  . ALA A 1 184 ? 29.552 57.410 117.404 1.00 5.97  ? 184 ALA A CB  1 
ATOM 962  N N   . VAL A 1 185 ? 26.351 57.188 117.649 1.00 5.31  ? 185 VAL A N   1 
ATOM 963  C CA  . VAL A 1 185 ? 25.121 57.898 117.950 1.00 3.94  ? 185 VAL A CA  1 
ATOM 964  C C   . VAL A 1 185 ? 25.470 59.061 118.901 1.00 7.05  ? 185 VAL A C   1 
ATOM 965  O O   . VAL A 1 185 ? 26.384 58.947 119.728 1.00 7.13  ? 185 VAL A O   1 
ATOM 966  C CB  . VAL A 1 185 ? 24.117 56.957 118.612 1.00 2.71  ? 185 VAL A CB  1 
ATOM 967  C CG1 . VAL A 1 185 ? 22.894 57.721 119.109 1.00 2.00  ? 185 VAL A CG1 1 
ATOM 968  C CG2 . VAL A 1 185 ? 23.706 55.914 117.627 1.00 2.00  ? 185 VAL A CG2 1 
ATOM 969  N N   . LEU A 1 186 ? 24.800 60.198 118.740 1.00 5.81  ? 186 LEU A N   1 
ATOM 970  C CA  . LEU A 1 186 ? 25.037 61.358 119.600 1.00 4.56  ? 186 LEU A CA  1 
ATOM 971  C C   . LEU A 1 186 ? 23.653 61.814 120.037 1.00 4.35  ? 186 LEU A C   1 
ATOM 972  O O   . LEU A 1 186 ? 22.716 61.751 119.249 1.00 5.49  ? 186 LEU A O   1 
ATOM 973  C CB  . LEU A 1 186 ? 25.745 62.486 118.830 1.00 6.13  ? 186 LEU A CB  1 
ATOM 974  C CG  . LEU A 1 186 ? 26.863 62.166 117.821 1.00 3.36  ? 186 LEU A CG  1 
ATOM 975  C CD1 . LEU A 1 186 ? 27.579 63.427 117.409 1.00 2.00  ? 186 LEU A CD1 1 
ATOM 976  C CD2 . LEU A 1 186 ? 27.865 61.216 118.403 1.00 7.31  ? 186 LEU A CD2 1 
ATOM 977  N N   . VAL A 1 187 ? 23.506 62.192 121.299 1.00 3.40  ? 187 VAL A N   1 
ATOM 978  C CA  . VAL A 1 187 ? 22.231 62.652 121.860 1.00 2.79  ? 187 VAL A CA  1 
ATOM 979  C C   . VAL A 1 187 ? 22.545 63.932 122.600 1.00 2.07  ? 187 VAL A C   1 
ATOM 980  O O   . VAL A 1 187 ? 23.649 64.084 123.065 1.00 7.95  ? 187 VAL A O   1 
ATOM 981  C CB  . VAL A 1 187 ? 21.660 61.636 122.890 1.00 2.00  ? 187 VAL A CB  1 
ATOM 982  C CG1 . VAL A 1 187 ? 20.374 62.144 123.490 1.00 2.00  ? 187 VAL A CG1 1 
ATOM 983  C CG2 . VAL A 1 187 ? 21.414 60.312 122.236 1.00 2.00  ? 187 VAL A CG2 1 
ATOM 984  N N   . TYR A 1 188 ? 21.596 64.838 122.739 1.00 2.00  ? 188 TYR A N   1 
ATOM 985  C CA  . TYR A 1 188 ? 21.831 66.080 123.458 1.00 3.80  ? 188 TYR A CA  1 
ATOM 986  C C   . TYR A 1 188 ? 20.521 66.350 124.149 1.00 4.04  ? 188 TYR A C   1 
ATOM 987  O O   . TYR A 1 188 ? 19.480 66.191 123.524 1.00 7.06  ? 188 TYR A O   1 
ATOM 988  C CB  . TYR A 1 188 ? 22.162 67.203 122.460 1.00 10.93 ? 188 TYR A CB  1 
ATOM 989  C CG  . TYR A 1 188 ? 21.896 68.628 122.950 1.00 13.06 ? 188 TYR A CG  1 
ATOM 990  C CD1 . TYR A 1 188 ? 22.804 69.302 123.783 1.00 13.52 ? 188 TYR A CD1 1 
ATOM 991  C CD2 . TYR A 1 188 ? 20.728 69.297 122.579 1.00 7.94  ? 188 TYR A CD2 1 
ATOM 992  C CE1 . TYR A 1 188 ? 22.547 70.607 124.237 1.00 13.53 ? 188 TYR A CE1 1 
ATOM 993  C CE2 . TYR A 1 188 ? 20.455 70.594 123.025 1.00 10.75 ? 188 TYR A CE2 1 
ATOM 994  C CZ  . TYR A 1 188 ? 21.360 71.249 123.853 1.00 15.91 ? 188 TYR A CZ  1 
ATOM 995  O OH  . TYR A 1 188 ? 21.030 72.514 124.327 1.00 14.49 ? 188 TYR A OH  1 
ATOM 996  N N   . SER A 1 189 ? 20.513 66.631 125.442 1.00 3.08  ? 189 SER A N   1 
ATOM 997  C CA  . SER A 1 189 ? 19.216 66.912 126.043 1.00 7.42  ? 189 SER A CA  1 
ATOM 998  C C   . SER A 1 189 ? 19.088 68.391 125.962 1.00 10.37 ? 189 SER A C   1 
ATOM 999  O O   . SER A 1 189 ? 20.076 69.058 125.695 1.00 16.62 ? 189 SER A O   1 
ATOM 1000 C CB  . SER A 1 189 ? 19.099 66.529 127.499 1.00 9.07  ? 189 SER A CB  1 
ATOM 1001 O OG  . SER A 1 189 ? 17.932 67.165 128.025 1.00 10.83 ? 189 SER A OG  1 
ATOM 1002 N N   . LYS A 1 190 ? 17.902 68.927 126.221 1.00 10.97 ? 190 LYS A N   1 
ATOM 1003 C CA  . LYS A 1 190 ? 17.790 70.361 126.137 1.00 14.78 ? 190 LYS A CA  1 
ATOM 1004 C C   . LYS A 1 190 ? 17.283 71.057 127.369 1.00 16.08 ? 190 LYS A C   1 
ATOM 1005 O O   . LYS A 1 190 ? 17.729 72.157 127.669 1.00 20.99 ? 190 LYS A O   1 
ATOM 1006 C CB  . LYS A 1 190 ? 17.029 70.803 124.885 1.00 16.10 ? 190 LYS A CB  1 
ATOM 1007 C CG  . LYS A 1 190 ? 17.296 72.255 124.517 1.00 18.61 ? 190 LYS A CG  1 
ATOM 1008 C CD  . LYS A 1 190 ? 16.965 72.563 123.078 1.00 20.43 ? 190 LYS A CD  1 
ATOM 1009 C CE  . LYS A 1 190 ? 16.986 74.079 122.820 1.00 22.29 ? 190 LYS A CE  1 
ATOM 1010 N NZ  . LYS A 1 190 ? 16.564 74.460 121.418 1.00 26.30 ? 190 LYS A NZ  1 
ATOM 1011 N N   . ASP A 1 191 ? 16.360 70.453 128.097 1.00 17.69 ? 191 ASP A N   1 
ATOM 1012 C CA  . ASP A 1 191 ? 15.866 71.111 129.305 1.00 18.58 ? 191 ASP A CA  1 
ATOM 1013 C C   . ASP A 1 191 ? 15.829 70.043 130.415 1.00 21.13 ? 191 ASP A C   1 
ATOM 1014 O O   . ASP A 1 191 ? 16.839 69.765 131.083 1.00 19.66 ? 191 ASP A O   1 
ATOM 1015 C CB  . ASP A 1 191 ? 14.497 71.704 128.995 1.00 20.53 ? 191 ASP A CB  1 
ATOM 1016 C CG  . ASP A 1 191 ? 14.387 72.218 127.529 1.00 25.13 ? 191 ASP A CG  1 
ATOM 1017 O OD1 . ASP A 1 191 ? 15.306 72.936 127.055 1.00 26.76 ? 191 ASP A OD1 1 
ATOM 1018 O OD2 . ASP A 1 191 ? 13.372 71.904 126.845 1.00 30.40 ? 191 ASP A OD2 1 
ATOM 1019 N N   . ASP A 1 192 ? 14.691 69.373 130.517 1.00 22.21 ? 192 ASP A N   1 
ATOM 1020 C CA  . ASP A 1 192 ? 14.465 68.282 131.458 1.00 22.04 ? 192 ASP A CA  1 
ATOM 1021 C C   . ASP A 1 192 ? 15.732 67.558 131.937 1.00 18.33 ? 192 ASP A C   1 
ATOM 1022 O O   . ASP A 1 192 ? 15.886 67.356 133.135 1.00 24.73 ? 192 ASP A O   1 
ATOM 1023 C CB  . ASP A 1 192 ? 13.463 67.293 130.785 1.00 26.80 ? 192 ASP A CB  1 
ATOM 1024 C CG  . ASP A 1 192 ? 13.432 65.851 131.411 1.00 28.50 ? 192 ASP A CG  1 
ATOM 1025 O OD1 . ASP A 1 192 ? 12.451 65.520 132.135 1.00 31.59 ? 192 ASP A OD1 1 
ATOM 1026 O OD2 . ASP A 1 192 ? 14.318 65.016 131.095 1.00 24.01 ? 192 ASP A OD2 1 
ATOM 1027 N N   . ALA A 1 193 ? 16.686 67.311 131.046 1.00 13.38 ? 193 ALA A N   1 
ATOM 1028 C CA  . ALA A 1 193 ? 17.872 66.527 131.404 1.00 18.79 ? 193 ALA A CA  1 
ATOM 1029 C C   . ALA A 1 193 ? 17.344 65.091 131.362 1.00 21.02 ? 193 ALA A C   1 
ATOM 1030 O O   . ALA A 1 193 ? 16.843 64.551 132.368 1.00 18.41 ? 193 ALA A O   1 
ATOM 1031 C CB  . ALA A 1 193 ? 18.392 66.842 132.804 1.00 22.46 ? 193 ALA A CB  1 
ATOM 1032 N N   . LEU A 1 194 ? 17.450 64.504 130.168 1.00 21.84 ? 194 LEU A N   1 
ATOM 1033 C CA  . LEU A 1 194 ? 16.948 63.171 129.864 1.00 18.58 ? 194 LEU A CA  1 
ATOM 1034 C C   . LEU A 1 194 ? 17.122 62.223 131.005 1.00 16.86 ? 194 LEU A C   1 
ATOM 1035 O O   . LEU A 1 194 ? 18.241 61.958 131.434 1.00 20.60 ? 194 LEU A O   1 
ATOM 1036 C CB  . LEU A 1 194 ? 17.618 62.603 128.606 1.00 14.29 ? 194 LEU A CB  1 
ATOM 1037 C CG  . LEU A 1 194 ? 16.810 61.518 127.881 1.00 13.27 ? 194 LEU A CG  1 
ATOM 1038 C CD1 . LEU A 1 194 ? 15.534 62.096 127.301 1.00 4.03  ? 194 LEU A CD1 1 
ATOM 1039 C CD2 . LEU A 1 194 ? 17.643 60.903 126.777 1.00 14.01 ? 194 LEU A CD2 1 
ATOM 1040 N N   . GLU A 1 195 ? 16.011 61.780 131.559 1.00 14.81 ? 195 GLU A N   1 
ATOM 1041 C CA  . GLU A 1 195 ? 16.111 60.834 132.635 1.00 17.55 ? 195 GLU A CA  1 
ATOM 1042 C C   . GLU A 1 195 ? 16.437 59.474 132.076 1.00 20.74 ? 195 GLU A C   1 
ATOM 1043 O O   . GLU A 1 195 ? 16.718 59.301 130.882 1.00 24.77 ? 195 GLU A O   1 
ATOM 1044 C CB  . GLU A 1 195 ? 14.796 60.742 133.380 1.00 21.01 ? 195 GLU A CB  1 
ATOM 1045 C CG  . GLU A 1 195 ? 14.617 61.836 134.383 1.00 32.72 ? 195 GLU A CG  1 
ATOM 1046 C CD  . GLU A 1 195 ? 15.792 61.918 135.354 1.00 37.33 ? 195 GLU A CD  1 
ATOM 1047 O OE1 . GLU A 1 195 ? 16.528 60.897 135.506 1.00 37.93 ? 195 GLU A OE1 1 
ATOM 1048 O OE2 . GLU A 1 195 ? 15.971 63.013 135.956 1.00 39.14 ? 195 GLU A OE2 1 
ATOM 1049 N N   . THR A 1 196 ? 16.420 58.495 132.956 1.00 20.57 ? 196 THR A N   1 
ATOM 1050 C CA  . THR A 1 196 ? 16.647 57.131 132.531 1.00 21.19 ? 196 THR A CA  1 
ATOM 1051 C C   . THR A 1 196 ? 15.254 56.605 132.177 1.00 19.83 ? 196 THR A C   1 
ATOM 1052 O O   . THR A 1 196 ? 14.237 57.142 132.630 1.00 23.57 ? 196 THR A O   1 
ATOM 1053 C CB  . THR A 1 196 ? 17.248 56.320 133.667 1.00 21.10 ? 196 THR A CB  1 
ATOM 1054 O OG1 . THR A 1 196 ? 16.368 56.361 134.806 1.00 27.71 ? 196 THR A OG1 1 
ATOM 1055 C CG2 . THR A 1 196 ? 18.607 56.918 134.055 1.00 26.88 ? 196 THR A CG2 1 
ATOM 1056 N N   . ASP A 1 197 ? 15.186 55.573 131.357 1.00 18.73 ? 197 ASP A N   1 
ATOM 1057 C CA  . ASP A 1 197 ? 13.888 55.044 130.985 1.00 19.70 ? 197 ASP A CA  1 
ATOM 1058 C C   . ASP A 1 197 ? 12.894 56.087 130.500 1.00 17.55 ? 197 ASP A C   1 
ATOM 1059 O O   . ASP A 1 197 ? 11.721 56.023 130.856 1.00 17.72 ? 197 ASP A O   1 
ATOM 1060 C CB  . ASP A 1 197 ? 13.297 54.245 132.131 1.00 24.58 ? 197 ASP A CB  1 
ATOM 1061 C CG  . ASP A 1 197 ? 14.131 53.027 132.456 1.00 35.03 ? 197 ASP A CG  1 
ATOM 1062 O OD1 . ASP A 1 197 ? 13.854 51.939 131.889 1.00 38.69 ? 197 ASP A OD1 1 
ATOM 1063 O OD2 . ASP A 1 197 ? 15.099 53.169 133.246 1.00 40.30 ? 197 ASP A OD2 1 
ATOM 1064 N N   . GLU A 1 198 ? 13.385 57.059 129.725 1.00 15.11 ? 198 GLU A N   1 
ATOM 1065 C CA  . GLU A 1 198 ? 12.523 58.067 129.139 1.00 13.08 ? 198 GLU A CA  1 
ATOM 1066 C C   . GLU A 1 198 ? 12.196 57.736 127.665 1.00 13.86 ? 198 GLU A C   1 
ATOM 1067 O O   . GLU A 1 198 ? 11.062 57.989 127.216 1.00 14.00 ? 198 GLU A O   1 
ATOM 1068 C CB  . GLU A 1 198 ? 13.092 59.469 129.304 1.00 8.53  ? 198 GLU A CB  1 
ATOM 1069 C CG  . GLU A 1 198 ? 12.432 60.214 130.452 1.00 15.20 ? 198 GLU A CG  1 
ATOM 1070 C CD  . GLU A 1 198 ? 12.630 61.734 130.416 1.00 18.07 ? 198 GLU A CD  1 
ATOM 1071 O OE1 . GLU A 1 198 ? 12.650 62.302 129.313 1.00 19.71 ? 198 GLU A OE1 1 
ATOM 1072 O OE2 . GLU A 1 198 ? 12.725 62.374 131.489 1.00 17.68 ? 198 GLU A OE2 1 
ATOM 1073 N N   . LEU A 1 199 ? 13.159 57.162 126.922 1.00 11.09 ? 199 LEU A N   1 
ATOM 1074 C CA  . LEU A 1 199 ? 12.958 56.754 125.503 1.00 7.78  ? 199 LEU A CA  1 
ATOM 1075 C C   . LEU A 1 199 ? 13.935 55.673 125.038 1.00 4.77  ? 199 LEU A C   1 
ATOM 1076 O O   . LEU A 1 199 ? 14.911 55.405 125.708 1.00 8.70  ? 199 LEU A O   1 
ATOM 1077 C CB  . LEU A 1 199 ? 12.992 57.952 124.533 1.00 7.22  ? 199 LEU A CB  1 
ATOM 1078 C CG  . LEU A 1 199 ? 14.022 59.079 124.606 1.00 7.87  ? 199 LEU A CG  1 
ATOM 1079 C CD1 . LEU A 1 199 ? 15.419 58.505 124.532 1.00 9.54  ? 199 LEU A CD1 1 
ATOM 1080 C CD2 . LEU A 1 199 ? 13.792 60.070 123.491 1.00 2.00  ? 199 LEU A CD2 1 
ATOM 1081 N N   . VAL A 1 200 ? 13.655 54.993 123.940 1.00 3.02  ? 200 VAL A N   1 
ATOM 1082 C CA  . VAL A 1 200 ? 14.583 53.964 123.479 1.00 4.83  ? 200 VAL A CA  1 
ATOM 1083 C C   . VAL A 1 200 ? 14.980 54.353 122.069 1.00 6.03  ? 200 VAL A C   1 
ATOM 1084 O O   . VAL A 1 200 ? 14.097 54.585 121.238 1.00 8.91  ? 200 VAL A O   1 
ATOM 1085 C CB  . VAL A 1 200 ? 13.920 52.574 123.425 1.00 5.57  ? 200 VAL A CB  1 
ATOM 1086 C CG1 . VAL A 1 200 ? 14.914 51.541 122.995 1.00 2.00  ? 200 VAL A CG1 1 
ATOM 1087 C CG2 . VAL A 1 200 ? 13.345 52.218 124.750 1.00 4.67  ? 200 VAL A CG2 1 
ATOM 1088 N N   . LEU A 1 201 ? 16.278 54.408 121.787 1.00 4.21  ? 201 LEU A N   1 
ATOM 1089 C CA  . LEU A 1 201 ? 16.763 54.779 120.467 1.00 2.00  ? 201 LEU A CA  1 
ATOM 1090 C C   . LEU A 1 201 ? 17.055 53.566 119.584 1.00 4.27  ? 201 LEU A C   1 
ATOM 1091 O O   . LEU A 1 201 ? 17.383 52.504 120.092 1.00 9.82  ? 201 LEU A O   1 
ATOM 1092 C CB  . LEU A 1 201 ? 18.008 55.644 120.605 1.00 2.00  ? 201 LEU A CB  1 
ATOM 1093 C CG  . LEU A 1 201 ? 17.782 57.029 121.206 1.00 2.00  ? 201 LEU A CG  1 
ATOM 1094 C CD1 . LEU A 1 201 ? 19.026 57.860 121.059 1.00 2.00  ? 201 LEU A CD1 1 
ATOM 1095 C CD2 . LEU A 1 201 ? 16.642 57.694 120.493 1.00 2.00  ? 201 LEU A CD2 1 
ATOM 1096 N N   . HIS A 1 202 ? 16.866 53.694 118.274 1.00 2.00  ? 202 HIS A N   1 
ATOM 1097 C CA  . HIS A 1 202 ? 17.156 52.601 117.362 1.00 2.00  ? 202 HIS A CA  1 
ATOM 1098 C C   . HIS A 1 202 ? 17.814 53.174 116.134 1.00 4.42  ? 202 HIS A C   1 
ATOM 1099 O O   . HIS A 1 202 ? 17.388 54.220 115.663 1.00 10.72 ? 202 HIS A O   1 
ATOM 1100 C CB  . HIS A 1 202 ? 15.888 51.947 116.907 1.00 4.48  ? 202 HIS A CB  1 
ATOM 1101 C CG  . HIS A 1 202 ? 15.208 51.151 117.966 1.00 12.48 ? 202 HIS A CG  1 
ATOM 1102 N ND1 . HIS A 1 202 ? 14.239 51.681 118.788 1.00 16.42 ? 202 HIS A ND1 1 
ATOM 1103 C CD2 . HIS A 1 202 ? 15.357 49.858 118.342 1.00 16.73 ? 202 HIS A CD2 1 
ATOM 1104 C CE1 . HIS A 1 202 ? 13.822 50.751 119.631 1.00 17.59 ? 202 HIS A CE1 1 
ATOM 1105 N NE2 . HIS A 1 202 ? 14.487 49.634 119.382 1.00 16.95 ? 202 HIS A NE2 1 
ATOM 1106 N N   . VAL A 1 203 ? 18.837 52.492 115.620 1.00 3.46  ? 203 VAL A N   1 
ATOM 1107 C CA  . VAL A 1 203 ? 19.578 52.890 114.435 1.00 2.00  ? 203 VAL A CA  1 
ATOM 1108 C C   . VAL A 1 203 ? 19.529 51.661 113.554 1.00 2.00  ? 203 VAL A C   1 
ATOM 1109 O O   . VAL A 1 203 ? 20.138 50.657 113.853 1.00 2.00  ? 203 VAL A O   1 
ATOM 1110 C CB  . VAL A 1 203 ? 21.020 53.181 114.793 1.00 2.00  ? 203 VAL A CB  1 
ATOM 1111 C CG1 . VAL A 1 203 ? 21.830 53.291 113.570 1.00 3.72  ? 203 VAL A CG1 1 
ATOM 1112 C CG2 . VAL A 1 203 ? 21.121 54.455 115.554 1.00 2.00  ? 203 VAL A CG2 1 
ATOM 1113 N N   . ASP A 1 204 ? 18.751 51.723 112.493 1.00 2.00  ? 204 ASP A N   1 
ATOM 1114 C CA  . ASP A 1 204 ? 18.568 50.593 111.574 1.00 6.25  ? 204 ASP A CA  1 
ATOM 1115 C C   . ASP A 1 204 ? 19.579 50.705 110.455 1.00 6.70  ? 204 ASP A C   1 
ATOM 1116 O O   . ASP A 1 204 ? 19.638 51.766 109.838 1.00 11.28 ? 204 ASP A O   1 
ATOM 1117 C CB  . ASP A 1 204 ? 17.173 50.642 110.916 1.00 8.65  ? 204 ASP A CB  1 
ATOM 1118 C CG  . ASP A 1 204 ? 16.027 50.811 111.922 1.00 13.03 ? 204 ASP A CG  1 
ATOM 1119 O OD1 . ASP A 1 204 ? 16.243 50.902 113.161 1.00 10.92 ? 204 ASP A OD1 1 
ATOM 1120 O OD2 . ASP A 1 204 ? 14.881 50.873 111.449 1.00 10.13 ? 204 ASP A OD2 1 
ATOM 1121 N N   . ILE A 1 205 ? 20.247 49.598 110.098 1.00 4.94  ? 205 ILE A N   1 
ATOM 1122 C CA  . ILE A 1 205 ? 21.286 49.585 109.053 1.00 2.44  ? 205 ILE A CA  1 
ATOM 1123 C C   . ILE A 1 205 ? 21.020 48.612 107.922 1.00 3.84  ? 205 ILE A C   1 
ATOM 1124 O O   . ILE A 1 205 ? 21.218 47.422 108.082 1.00 8.42  ? 205 ILE A O   1 
ATOM 1125 C CB  . ILE A 1 205 ? 22.643 49.231 109.659 1.00 2.00  ? 205 ILE A CB  1 
ATOM 1126 C CG1 . ILE A 1 205 ? 22.976 50.240 110.745 1.00 2.00  ? 205 ILE A CG1 1 
ATOM 1127 C CG2 . ILE A 1 205 ? 23.694 49.268 108.611 1.00 2.00  ? 205 ILE A CG2 1 
ATOM 1128 C CD1 . ILE A 1 205 ? 24.022 49.810 111.652 1.00 2.00  ? 205 ILE A CD1 1 
ATOM 1129 N N   . GLU A 1 206 ? 20.604 49.116 106.769 1.00 5.00  ? 206 GLU A N   1 
ATOM 1130 C CA  . GLU A 1 206 ? 20.309 48.267 105.605 1.00 4.46  ? 206 GLU A CA  1 
ATOM 1131 C C   . GLU A 1 206 ? 21.635 47.766 105.026 1.00 2.66  ? 206 GLU A C   1 
ATOM 1132 O O   . GLU A 1 206 ? 22.590 48.511 105.005 1.00 8.06  ? 206 GLU A O   1 
ATOM 1133 C CB  . GLU A 1 206 ? 19.544 49.089 104.555 1.00 2.94  ? 206 GLU A CB  1 
ATOM 1134 C CG  . GLU A 1 206 ? 18.780 48.258 103.531 1.00 8.90  ? 206 GLU A CG  1 
ATOM 1135 C CD  . GLU A 1 206 ? 18.321 49.061 102.306 1.00 11.50 ? 206 GLU A CD  1 
ATOM 1136 O OE1 . GLU A 1 206 ? 18.897 50.139 102.020 1.00 9.06  ? 206 GLU A OE1 1 
ATOM 1137 O OE2 . GLU A 1 206 ? 17.400 48.584 101.606 1.00 6.10  ? 206 GLU A OE2 1 
ATOM 1138 N N   . HIS A 1 207 ? 21.708 46.540 104.531 1.00 2.00  ? 207 HIS A N   1 
ATOM 1139 C CA  . HIS A 1 207 ? 22.968 46.034 103.989 1.00 2.27  ? 207 HIS A CA  1 
ATOM 1140 C C   . HIS A 1 207 ? 22.751 44.680 103.361 1.00 4.97  ? 207 HIS A C   1 
ATOM 1141 O O   . HIS A 1 207 ? 21.776 44.013 103.668 1.00 11.12 ? 207 HIS A O   1 
ATOM 1142 C CB  . HIS A 1 207 ? 23.970 45.851 105.103 1.00 2.00  ? 207 HIS A CB  1 
ATOM 1143 C CG  . HIS A 1 207 ? 23.504 44.924 106.174 1.00 2.00  ? 207 HIS A CG  1 
ATOM 1144 N ND1 . HIS A 1 207 ? 23.315 43.580 105.959 1.00 2.00  ? 207 HIS A ND1 1 
ATOM 1145 C CD2 . HIS A 1 207 ? 23.187 45.144 107.469 1.00 2.00  ? 207 HIS A CD2 1 
ATOM 1146 C CE1 . HIS A 1 207 ? 22.908 43.010 107.075 1.00 2.00  ? 207 HIS A CE1 1 
ATOM 1147 N NE2 . HIS A 1 207 ? 22.820 43.938 108.007 1.00 2.00  ? 207 HIS A NE2 1 
ATOM 1148 N N   . GLN A 1 208 ? 23.673 44.236 102.525 1.00 3.80  ? 208 GLN A N   1 
ATOM 1149 C CA  . GLN A 1 208 ? 23.495 42.945 101.899 1.00 5.57  ? 208 GLN A CA  1 
ATOM 1150 C C   . GLN A 1 208 ? 23.221 41.832 102.864 1.00 6.78  ? 208 GLN A C   1 
ATOM 1151 O O   . GLN A 1 208 ? 23.719 41.818 103.980 1.00 12.29 ? 208 GLN A O   1 
ATOM 1152 C CB  . GLN A 1 208 ? 24.698 42.584 101.110 1.00 6.04  ? 208 GLN A CB  1 
ATOM 1153 C CG  . GLN A 1 208 ? 24.758 43.306 99.857  1.00 12.69 ? 208 GLN A CG  1 
ATOM 1154 C CD  . GLN A 1 208 ? 26.156 43.462 99.467  1.00 16.30 ? 208 GLN A CD  1 
ATOM 1155 O OE1 . GLN A 1 208 ? 27.026 43.553 100.332 1.00 19.55 ? 208 GLN A OE1 1 
ATOM 1156 N NE2 . GLN A 1 208 ? 26.420 43.449 98.173  1.00 16.44 ? 208 GLN A NE2 1 
ATOM 1157 N N   . ARG A 1 209 ? 22.531 40.820 102.384 1.00 9.79  ? 209 ARG A N   1 
ATOM 1158 C CA  . ARG A 1 209 ? 22.164 39.724 103.245 1.00 13.48 ? 209 ARG A CA  1 
ATOM 1159 C C   . ARG A 1 209 ? 23.329 38.857 103.605 1.00 11.04 ? 209 ARG A C   1 
ATOM 1160 O O   . ARG A 1 209 ? 24.092 38.480 102.739 1.00 10.44 ? 209 ARG A O   1 
ATOM 1161 C CB  . ARG A 1 209 ? 21.062 38.905 102.591 1.00 20.31 ? 209 ARG A CB  1 
ATOM 1162 C CG  . ARG A 1 209 ? 20.139 38.246 103.593 1.00 32.19 ? 209 ARG A CG  1 
ATOM 1163 C CD  . ARG A 1 209 ? 18.864 37.754 102.920 1.00 38.01 ? 209 ARG A CD  1 
ATOM 1164 N NE  . ARG A 1 209 ? 17.965 38.849 102.554 1.00 42.45 ? 209 ARG A NE  1 
ATOM 1165 C CZ  . ARG A 1 209 ? 17.278 38.907 101.416 1.00 48.08 ? 209 ARG A CZ  1 
ATOM 1166 N NH1 . ARG A 1 209 ? 17.388 37.935 100.508 1.00 50.27 ? 209 ARG A NH1 1 
ATOM 1167 N NH2 . ARG A 1 209 ? 16.460 39.934 101.189 1.00 51.67 ? 209 ARG A NH2 1 
ATOM 1168 N N   . ILE A 1 210 ? 23.489 38.595 104.895 1.00 12.90 ? 210 ILE A N   1 
ATOM 1169 C CA  . ILE A 1 210 ? 24.564 37.733 105.388 1.00 12.18 ? 210 ILE A CA  1 
ATOM 1170 C C   . ILE A 1 210 ? 24.192 36.258 105.175 1.00 16.44 ? 210 ILE A C   1 
ATOM 1171 O O   . ILE A 1 210 ? 23.156 35.786 105.648 1.00 21.69 ? 210 ILE A O   1 
ATOM 1172 C CB  . ILE A 1 210 ? 24.860 37.991 106.855 1.00 6.01  ? 210 ILE A CB  1 
ATOM 1173 C CG1 . ILE A 1 210 ? 25.562 39.332 106.985 1.00 3.14  ? 210 ILE A CG1 1 
ATOM 1174 C CG2 . ILE A 1 210 ? 25.660 36.854 107.442 1.00 2.00  ? 210 ILE A CG2 1 
ATOM 1175 C CD1 . ILE A 1 210 ? 26.250 39.509 108.305 1.00 3.34  ? 210 ILE A CD1 1 
ATOM 1176 N N   . PRO A 1 211 ? 25.074 35.501 104.524 1.00 18.60 ? 211 PRO A N   1 
ATOM 1177 C CA  . PRO A 1 211 ? 24.871 34.089 104.218 1.00 21.60 ? 211 PRO A CA  1 
ATOM 1178 C C   . PRO A 1 211 ? 24.814 33.091 105.378 1.00 26.27 ? 211 PRO A C   1 
ATOM 1179 O O   . PRO A 1 211 ? 25.682 33.104 106.265 1.00 27.64 ? 211 PRO A O   1 
ATOM 1180 C CB  . PRO A 1 211 ? 26.041 33.799 103.294 1.00 20.80 ? 211 PRO A CB  1 
ATOM 1181 C CG  . PRO A 1 211 ? 27.112 34.617 103.882 1.00 19.10 ? 211 PRO A CG  1 
ATOM 1182 C CD  . PRO A 1 211 ? 26.442 35.918 104.176 1.00 17.18 ? 211 PRO A CD  1 
ATOM 1183 N N   . THR A 1 212 ? 23.829 32.182 105.304 1.00 30.35 ? 212 THR A N   1 
ATOM 1184 C CA  . THR A 1 212 ? 23.598 31.112 106.300 1.00 30.00 ? 212 THR A CA  1 
ATOM 1185 C C   . THR A 1 212 ? 24.619 30.012 106.072 1.00 28.92 ? 212 THR A C   1 
ATOM 1186 O O   . THR A 1 212 ? 25.131 29.870 104.947 1.00 27.84 ? 212 THR A O   1 
ATOM 1187 C CB  . THR A 1 212 ? 22.188 30.442 106.121 1.00 34.04 ? 212 THR A CB  1 
ATOM 1188 O OG1 . THR A 1 212 ? 22.049 29.915 104.788 1.00 32.65 ? 212 THR A OG1 1 
ATOM 1189 C CG2 . THR A 1 212 ? 21.057 31.443 106.380 1.00 31.06 ? 212 THR A CG2 1 
ATOM 1190 N N   . SER A 1 213 ? 24.936 29.232 107.104 1.00 28.92 ? 213 SER A N   1 
ATOM 1191 C CA  . SER A 1 213 ? 25.893 28.148 106.863 1.00 30.36 ? 213 SER A CA  1 
ATOM 1192 C C   . SER A 1 213 ? 25.114 26.960 106.350 1.00 31.19 ? 213 SER A C   1 
ATOM 1193 O O   . SER A 1 213 ? 23.936 26.754 106.746 1.00 32.48 ? 213 SER A O   1 
ATOM 1194 C CB  . SER A 1 213 ? 26.688 27.731 108.103 1.00 31.65 ? 213 SER A CB  1 
ATOM 1195 O OG  . SER A 1 213 ? 27.710 26.809 107.713 1.00 31.91 ? 213 SER A OG  1 
ATOM 1196 N N   . GLY A 1 214 ? 25.772 26.177 105.491 1.00 25.98 ? 214 GLY A N   1 
ATOM 1197 C CA  . GLY A 1 214 ? 25.100 25.020 104.929 1.00 22.47 ? 214 GLY A CA  1 
ATOM 1198 C C   . GLY A 1 214 ? 25.267 23.761 105.742 1.00 15.10 ? 214 GLY A C   1 
ATOM 1199 O O   . GLY A 1 214 ? 24.684 22.725 105.435 1.00 19.92 ? 214 GLY A O   1 
ATOM 1200 N N   . VAL A 1 215 ? 25.968 23.881 106.848 1.00 8.93  ? 215 VAL A N   1 
ATOM 1201 C CA  . VAL A 1 215 ? 26.263 22.736 107.656 1.00 8.89  ? 215 VAL A CA  1 
ATOM 1202 C C   . VAL A 1 215 ? 26.186 23.046 109.122 1.00 6.50  ? 215 VAL A C   1 
ATOM 1203 O O   . VAL A 1 215 ? 26.425 24.166 109.524 1.00 17.98 ? 215 VAL A O   1 
ATOM 1204 C CB  . VAL A 1 215 ? 27.661 22.339 107.326 1.00 8.13  ? 215 VAL A CB  1 
ATOM 1205 C CG1 . VAL A 1 215 ? 28.189 21.345 108.315 1.00 13.24 ? 215 VAL A CG1 1 
ATOM 1206 C CG2 . VAL A 1 215 ? 27.704 21.816 105.908 1.00 13.00 ? 215 VAL A CG2 1 
ATOM 1207 N N   . LEU A 1 216 ? 25.862 22.062 109.935 1.00 3.16  ? 216 LEU A N   1 
ATOM 1208 C CA  . LEU A 1 216 ? 25.798 22.294 111.361 1.00 2.00  ? 216 LEU A CA  1 
ATOM 1209 C C   . LEU A 1 216 ? 27.182 22.547 111.968 1.00 2.00  ? 216 LEU A C   1 
ATOM 1210 O O   . LEU A 1 216 ? 28.201 22.258 111.369 1.00 2.00  ? 216 LEU A O   1 
ATOM 1211 C CB  . LEU A 1 216 ? 25.156 21.100 112.041 1.00 3.34  ? 216 LEU A CB  1 
ATOM 1212 C CG  . LEU A 1 216 ? 23.720 20.861 111.664 1.00 2.00  ? 216 LEU A CG  1 
ATOM 1213 C CD1 . LEU A 1 216 ? 23.283 19.708 112.496 1.00 6.54  ? 216 LEU A CD1 1 
ATOM 1214 C CD2 . LEU A 1 216 ? 22.881 22.072 111.933 1.00 2.00  ? 216 LEU A CD2 1 
ATOM 1215 N N   . PRO A 1 217 ? 27.222 23.155 113.144 1.00 2.00  ? 217 PRO A N   1 
ATOM 1216 C CA  . PRO A 1 217 ? 28.410 23.491 113.917 1.00 2.00  ? 217 PRO A CA  1 
ATOM 1217 C C   . PRO A 1 217 ? 29.285 22.307 114.207 1.00 2.00  ? 217 PRO A C   1 
ATOM 1218 O O   . PRO A 1 217 ? 28.787 21.206 114.303 1.00 2.00  ? 217 PRO A O   1 
ATOM 1219 C CB  . PRO A 1 217 ? 27.815 23.998 115.207 1.00 2.00  ? 217 PRO A CB  1 
ATOM 1220 C CG  . PRO A 1 217 ? 26.646 24.732 114.723 1.00 2.62  ? 217 PRO A CG  1 
ATOM 1221 C CD  . PRO A 1 217 ? 26.045 23.839 113.684 1.00 2.00  ? 217 PRO A CD  1 
ATOM 1222 N N   . VAL A 1 218 ? 30.562 22.568 114.478 1.00 2.91  ? 218 VAL A N   1 
ATOM 1223 C CA  . VAL A 1 218 ? 31.539 21.526 114.775 1.00 4.36  ? 218 VAL A CA  1 
ATOM 1224 C C   . VAL A 1 218 ? 32.023 21.577 116.238 1.00 7.04  ? 218 VAL A C   1 
ATOM 1225 O O   . VAL A 1 218 ? 31.793 22.603 116.936 1.00 10.21 ? 218 VAL A O   1 
ATOM 1226 C CB  . VAL A 1 218 ? 32.731 21.638 113.815 1.00 2.49  ? 218 VAL A CB  1 
ATOM 1227 C CG1 . VAL A 1 218 ? 33.583 20.426 113.880 1.00 2.00  ? 218 VAL A CG1 1 
ATOM 1228 C CG2 . VAL A 1 218 ? 32.229 21.784 112.412 1.00 9.05  ? 218 VAL A CG2 1 
ATOM 1229 O OXT . VAL A 1 218 ? 32.596 20.558 116.705 1.00 10.03 ? 218 VAL A OXT 1 
ATOM 1230 N N   . ASP B 1 29  ? 25.447 11.839 84.152  1.00 44.37 ? 29  ASP B N   1 
ATOM 1231 C CA  . ASP B 1 29  ? 25.466 10.676 83.200  1.00 45.53 ? 29  ASP B CA  1 
ATOM 1232 C C   . ASP B 1 29  ? 24.714 9.434  83.723  1.00 43.32 ? 29  ASP B C   1 
ATOM 1233 O O   . ASP B 1 29  ? 25.047 8.879  84.777  1.00 41.46 ? 29  ASP B O   1 
ATOM 1234 C CB  . ASP B 1 29  ? 26.909 10.345 82.780  1.00 46.81 ? 29  ASP B CB  1 
ATOM 1235 C CG  . ASP B 1 29  ? 27.912 10.430 83.940  1.00 50.78 ? 29  ASP B CG  1 
ATOM 1236 O OD1 . ASP B 1 29  ? 28.706 11.408 83.954  1.00 47.63 ? 29  ASP B OD1 1 
ATOM 1237 O OD2 . ASP B 1 29  ? 27.921 9.519  84.811  1.00 50.86 ? 29  ASP B OD2 1 
ATOM 1238 N N   . ALA B 1 30  ? 23.707 9.021  82.955  1.00 42.69 ? 30  ALA B N   1 
ATOM 1239 C CA  . ALA B 1 30  ? 22.795 7.909  83.268  1.00 40.81 ? 30  ALA B CA  1 
ATOM 1240 C C   . ALA B 1 30  ? 23.326 6.594  83.831  1.00 39.00 ? 30  ALA B C   1 
ATOM 1241 O O   . ALA B 1 30  ? 24.116 5.910  83.155  1.00 37.42 ? 30  ALA B O   1 
ATOM 1242 C CB  . ALA B 1 30  ? 21.914 7.631  82.064  1.00 43.01 ? 30  ALA B CB  1 
ATOM 1243 N N   . ASN B 1 31  ? 22.746 6.210  84.990  1.00 36.22 ? 31  ASN B N   1 
ATOM 1244 C CA  . ASN B 1 31  ? 23.052 4.999  85.803  1.00 36.61 ? 31  ASN B CA  1 
ATOM 1245 C C   . ASN B 1 31  ? 24.422 4.984  86.527  1.00 37.01 ? 31  ASN B C   1 
ATOM 1246 O O   . ASN B 1 31  ? 24.571 4.360  87.601  1.00 34.75 ? 31  ASN B O   1 
ATOM 1247 C CB  . ASN B 1 31  ? 22.754 3.654  85.060  1.00 39.40 ? 31  ASN B CB  1 
ATOM 1248 C CG  . ASN B 1 31  ? 24.036 2.925  84.504  1.00 42.82 ? 31  ASN B CG  1 
ATOM 1249 O OD1 . ASN B 1 31  ? 24.095 2.580  83.306  1.00 43.10 ? 31  ASN B OD1 1 
ATOM 1250 N ND2 . ASN B 1 31  ? 25.003 2.615  85.385  1.00 42.57 ? 31  ASN B ND2 1 
ATOM 1251 N N   . PHE B 1 32  ? 25.435 5.592  85.908  1.00 34.98 ? 32  PHE B N   1 
ATOM 1252 C CA  . PHE B 1 32  ? 26.738 5.686  86.534  1.00 33.01 ? 32  PHE B CA  1 
ATOM 1253 C C   . PHE B 1 32  ? 26.518 6.485  87.792  1.00 34.25 ? 32  PHE B C   1 
ATOM 1254 O O   . PHE B 1 32  ? 27.217 6.288  88.791  1.00 35.52 ? 32  PHE B O   1 
ATOM 1255 C CB  . PHE B 1 32  ? 27.716 6.390  85.636  1.00 31.13 ? 32  PHE B CB  1 
ATOM 1256 C CG  . PHE B 1 32  ? 28.537 5.459  84.844  1.00 33.89 ? 32  PHE B CG  1 
ATOM 1257 C CD1 . PHE B 1 32  ? 27.936 4.610  83.921  1.00 36.04 ? 32  PHE B CD1 1 
ATOM 1258 C CD2 . PHE B 1 32  ? 29.919 5.427  85.007  1.00 34.13 ? 32  PHE B CD2 1 
ATOM 1259 C CE1 . PHE B 1 32  ? 28.708 3.738  83.151  1.00 39.92 ? 32  PHE B CE1 1 
ATOM 1260 C CE2 . PHE B 1 32  ? 30.711 4.568  84.254  1.00 37.27 ? 32  PHE B CE2 1 
ATOM 1261 C CZ  . PHE B 1 32  ? 30.106 3.714  83.319  1.00 40.31 ? 32  PHE B CZ  1 
ATOM 1262 N N   . ARG B 1 33  ? 25.512 7.359  87.743  1.00 34.47 ? 33  ARG B N   1 
ATOM 1263 C CA  . ARG B 1 33  ? 25.117 8.149  88.902  1.00 35.85 ? 33  ARG B CA  1 
ATOM 1264 C C   . ARG B 1 33  ? 25.005 7.176  90.104  1.00 35.68 ? 33  ARG B C   1 
ATOM 1265 O O   . ARG B 1 33  ? 25.375 7.517  91.234  1.00 39.51 ? 33  ARG B O   1 
ATOM 1266 C CB  . ARG B 1 33  ? 23.750 8.799  88.666  1.00 38.78 ? 33  ARG B CB  1 
ATOM 1267 C CG  . ARG B 1 33  ? 23.385 8.986  87.208  1.00 42.42 ? 33  ARG B CG  1 
ATOM 1268 C CD  . ARG B 1 33  ? 23.470 10.459 86.743  1.00 45.82 ? 33  ARG B CD  1 
ATOM 1269 N NE  . ARG B 1 33  ? 22.163 11.123 86.617  1.00 46.37 ? 33  ARG B NE  1 
ATOM 1270 C CZ  . ARG B 1 33  ? 21.059 10.591 86.072  1.00 50.45 ? 33  ARG B CZ  1 
ATOM 1271 N NH1 . ARG B 1 33  ? 21.046 9.346  85.573  1.00 45.99 ? 33  ARG B NH1 1 
ATOM 1272 N NH2 . ARG B 1 33  ? 19.943 11.324 86.026  1.00 49.18 ? 33  ARG B NH2 1 
ATOM 1273 N N   . VAL B 1 34  ? 24.496 5.964  89.873  1.00 32.42 ? 34  VAL B N   1 
ATOM 1274 C CA  . VAL B 1 34  ? 24.385 4.998  90.961  1.00 30.50 ? 34  VAL B CA  1 
ATOM 1275 C C   . VAL B 1 34  ? 25.746 4.599  91.515  1.00 27.18 ? 34  VAL B C   1 
ATOM 1276 O O   . VAL B 1 34  ? 26.059 4.921  92.656  1.00 21.49 ? 34  VAL B O   1 
ATOM 1277 C CB  . VAL B 1 34  ? 23.681 3.731  90.538  1.00 33.54 ? 34  VAL B CB  1 
ATOM 1278 C CG1 . VAL B 1 34  ? 23.446 2.843  91.768  1.00 33.88 ? 34  VAL B CG1 1 
ATOM 1279 C CG2 . VAL B 1 34  ? 22.384 4.073  89.826  1.00 34.75 ? 34  VAL B CG2 1 
ATOM 1280 N N   . LEU B 1 35  ? 26.549 3.893  90.717  1.00 26.06 ? 35  LEU B N   1 
ATOM 1281 C CA  . LEU B 1 35  ? 27.872 3.469  91.174  1.00 25.84 ? 35  LEU B CA  1 
ATOM 1282 C C   . LEU B 1 35  ? 28.545 4.610  91.898  1.00 25.20 ? 35  LEU B C   1 
ATOM 1283 O O   . LEU B 1 35  ? 29.126 4.405  92.964  1.00 30.39 ? 35  LEU B O   1 
ATOM 1284 C CB  . LEU B 1 35  ? 28.749 2.964  90.024  1.00 20.72 ? 35  LEU B CB  1 
ATOM 1285 C CG  . LEU B 1 35  ? 28.133 1.679  89.456  1.00 28.71 ? 35  LEU B CG  1 
ATOM 1286 C CD1 . LEU B 1 35  ? 28.895 1.133  88.270  1.00 27.49 ? 35  LEU B CD1 1 
ATOM 1287 C CD2 . LEU B 1 35  ? 28.069 0.630  90.542  1.00 29.94 ? 35  LEU B CD2 1 
ATOM 1288 N N   . SER B 1 36  ? 28.361 5.829  91.400  1.00 24.96 ? 36  SER B N   1 
ATOM 1289 C CA  . SER B 1 36  ? 28.983 6.964  92.060  1.00 28.93 ? 36  SER B CA  1 
ATOM 1290 C C   . SER B 1 36  ? 28.273 7.369  93.349  1.00 29.16 ? 36  SER B C   1 
ATOM 1291 O O   . SER B 1 36  ? 28.909 7.905  94.258  1.00 31.95 ? 36  SER B O   1 
ATOM 1292 C CB  . SER B 1 36  ? 29.148 8.156  91.119  1.00 32.78 ? 36  SER B CB  1 
ATOM 1293 O OG  . SER B 1 36  ? 27.921 8.828  90.907  1.00 38.97 ? 36  SER B OG  1 
ATOM 1294 N N   . GLN B 1 37  ? 26.970 7.137  93.458  1.00 27.60 ? 37  GLN B N   1 
ATOM 1295 C CA  . GLN B 1 37  ? 26.321 7.498  94.708  1.00 27.52 ? 37  GLN B CA  1 
ATOM 1296 C C   . GLN B 1 37  ? 26.783 6.472  95.728  1.00 23.42 ? 37  GLN B C   1 
ATOM 1297 O O   . GLN B 1 37  ? 27.147 6.831  96.845  1.00 24.99 ? 37  GLN B O   1 
ATOM 1298 C CB  . GLN B 1 37  ? 24.792 7.576  94.585  1.00 31.90 ? 37  GLN B CB  1 
ATOM 1299 C CG  . GLN B 1 37  ? 24.092 6.307  94.135  1.00 38.94 ? 37  GLN B CG  1 
ATOM 1300 C CD  . GLN B 1 37  ? 22.680 6.569  93.580  1.00 46.39 ? 37  GLN B CD  1 
ATOM 1301 O OE1 . GLN B 1 37  ? 21.670 6.206  94.203  1.00 52.40 ? 37  GLN B OE1 1 
ATOM 1302 N NE2 . GLN B 1 37  ? 22.609 7.186  92.400  1.00 45.74 ? 37  GLN B NE2 1 
ATOM 1303 N N   . GLN B 1 38  ? 26.921 5.226  95.279  1.00 20.78 ? 38  GLN B N   1 
ATOM 1304 C CA  . GLN B 1 38  ? 27.366 4.126  96.129  1.00 15.34 ? 38  GLN B CA  1 
ATOM 1305 C C   . GLN B 1 38  ? 28.735 4.398  96.621  1.00 11.87 ? 38  GLN B C   1 
ATOM 1306 O O   . GLN B 1 38  ? 29.041 4.205  97.801  1.00 12.62 ? 38  GLN B O   1 
ATOM 1307 C CB  . GLN B 1 38  ? 27.425 2.814  95.347  1.00 20.77 ? 38  GLN B CB  1 
ATOM 1308 C CG  . GLN B 1 38  ? 26.197 1.983  95.530  1.00 24.21 ? 38  GLN B CG  1 
ATOM 1309 C CD  . GLN B 1 38  ? 25.665 2.178  96.915  1.00 27.48 ? 38  GLN B CD  1 
ATOM 1310 O OE1 . GLN B 1 38  ? 26.231 1.664  97.879  1.00 31.90 ? 38  GLN B OE1 1 
ATOM 1311 N NE2 . GLN B 1 38  ? 24.650 3.026  97.044  1.00 29.80 ? 38  GLN B NE2 1 
ATOM 1312 N N   . LEU B 1 39  ? 29.551 4.865  95.685  1.00 9.97  ? 39  LEU B N   1 
ATOM 1313 C CA  . LEU B 1 39  ? 30.936 5.172  95.950  1.00 9.22  ? 39  LEU B CA  1 
ATOM 1314 C C   . LEU B 1 39  ? 31.061 6.209  97.005  1.00 10.76 ? 39  LEU B C   1 
ATOM 1315 O O   . LEU B 1 39  ? 31.967 6.129  97.811  1.00 12.12 ? 39  LEU B O   1 
ATOM 1316 C CB  . LEU B 1 39  ? 31.654 5.612  94.685  1.00 6.20  ? 39  LEU B CB  1 
ATOM 1317 C CG  . LEU B 1 39  ? 32.307 4.407  94.035  1.00 4.15  ? 39  LEU B CG  1 
ATOM 1318 C CD1 . LEU B 1 39  ? 33.172 4.803  92.838  1.00 3.61  ? 39  LEU B CD1 1 
ATOM 1319 C CD2 . LEU B 1 39  ? 33.116 3.730  95.137  1.00 4.25  ? 39  LEU B CD2 1 
ATOM 1320 N N   . SER B 1 40  ? 30.123 7.150  97.040  1.00 14.46 ? 40  SER B N   1 
ATOM 1321 C CA  . SER B 1 40  ? 30.160 8.207  98.047  1.00 18.29 ? 40  SER B CA  1 
ATOM 1322 C C   . SER B 1 40  ? 29.836 7.688  99.458  1.00 17.91 ? 40  SER B C   1 
ATOM 1323 O O   . SER B 1 40  ? 30.623 7.910  100.394 1.00 18.62 ? 40  SER B O   1 
ATOM 1324 C CB  . SER B 1 40  ? 29.231 9.351  97.664  1.00 19.77 ? 40  SER B CB  1 
ATOM 1325 O OG  . SER B 1 40  ? 29.502 10.495 98.467  1.00 28.47 ? 40  SER B OG  1 
ATOM 1326 N N   . ARG B 1 41  ? 28.700 6.998  99.602  1.00 16.03 ? 41  ARG B N   1 
ATOM 1327 C CA  . ARG B 1 41  ? 28.298 6.406  100.881 1.00 16.17 ? 41  ARG B CA  1 
ATOM 1328 C C   . ARG B 1 41  ? 29.551 5.796  101.545 1.00 14.64 ? 41  ARG B C   1 
ATOM 1329 O O   . ARG B 1 41  ? 29.844 6.047  102.718 1.00 18.28 ? 41  ARG B O   1 
ATOM 1330 C CB  . ARG B 1 41  ? 27.214 5.323  100.656 1.00 20.42 ? 41  ARG B CB  1 
ATOM 1331 C CG  . ARG B 1 41  ? 25.846 5.619  101.354 1.00 28.47 ? 41  ARG B CG  1 
ATOM 1332 C CD  . ARG B 1 41  ? 24.647 4.692  100.935 1.00 33.44 ? 41  ARG B CD  1 
ATOM 1333 N NE  . ARG B 1 41  ? 24.625 3.415  101.672 1.00 40.22 ? 41  ARG B NE  1 
ATOM 1334 C CZ  . ARG B 1 41  ? 24.318 2.224  101.142 1.00 39.29 ? 41  ARG B CZ  1 
ATOM 1335 N NH1 . ARG B 1 41  ? 23.973 2.134  99.859  1.00 37.35 ? 41  ARG B NH1 1 
ATOM 1336 N NH2 . ARG B 1 41  ? 24.456 1.106  101.871 1.00 36.92 ? 41  ARG B NH2 1 
ATOM 1337 N N   . LEU B 1 42  ? 30.335 5.089  100.739 1.00 13.85 ? 42  LEU B N   1 
ATOM 1338 C CA  . LEU B 1 42  ? 31.573 4.445  101.176 1.00 12.33 ? 42  LEU B CA  1 
ATOM 1339 C C   . LEU B 1 42  ? 32.578 5.437  101.736 1.00 11.13 ? 42  LEU B C   1 
ATOM 1340 O O   . LEU B 1 42  ? 33.095 5.303  102.857 1.00 7.97  ? 42  LEU B O   1 
ATOM 1341 C CB  . LEU B 1 42  ? 32.212 3.796  99.970  1.00 10.84 ? 42  LEU B CB  1 
ATOM 1342 C CG  . LEU B 1 42  ? 32.661 2.359  100.051 1.00 9.31  ? 42  LEU B CG  1 
ATOM 1343 C CD1 . LEU B 1 42  ? 31.592 1.465  100.682 1.00 7.62  ? 42  LEU B CD1 1 
ATOM 1344 C CD2 . LEU B 1 42  ? 32.900 1.976  98.609  1.00 13.22 ? 42  LEU B CD2 1 
ATOM 1345 N N   . ASN B 1 43  ? 32.898 6.409  100.897 1.00 13.30 ? 43  ASN B N   1 
ATOM 1346 C CA  . ASN B 1 43  ? 33.841 7.420  101.273 1.00 13.40 ? 43  ASN B CA  1 
ATOM 1347 C C   . ASN B 1 43  ? 33.417 8.029  102.586 1.00 10.23 ? 43  ASN B C   1 
ATOM 1348 O O   . ASN B 1 43  ? 34.220 8.125  103.511 1.00 12.34 ? 43  ASN B O   1 
ATOM 1349 C CB  . ASN B 1 43  ? 33.934 8.526  100.230 1.00 15.23 ? 43  ASN B CB  1 
ATOM 1350 C CG  . ASN B 1 43  ? 35.026 9.530  100.575 1.00 19.94 ? 43  ASN B CG  1 
ATOM 1351 O OD1 . ASN B 1 43  ? 36.069 9.585  99.921  1.00 25.90 ? 43  ASN B OD1 1 
ATOM 1352 N ND2 . ASN B 1 43  ? 34.821 10.281 101.655 1.00 16.21 ? 43  ASN B ND2 1 
ATOM 1353 N N   . LYS B 1 44  ? 32.156 8.440  102.666 1.00 7.19  ? 44  LYS B N   1 
ATOM 1354 C CA  . LYS B 1 44  ? 31.673 9.065  103.880 1.00 8.26  ? 44  LYS B CA  1 
ATOM 1355 C C   . LYS B 1 44  ? 31.856 8.185  105.090 1.00 8.61  ? 44  LYS B C   1 
ATOM 1356 O O   . LYS B 1 44  ? 32.209 8.676  106.158 1.00 11.95 ? 44  LYS B O   1 
ATOM 1357 C CB  . LYS B 1 44  ? 30.229 9.495  103.752 1.00 10.27 ? 44  LYS B CB  1 
ATOM 1358 C CG  . LYS B 1 44  ? 29.693 10.199 104.988 1.00 14.77 ? 44  LYS B CG  1 
ATOM 1359 C CD  . LYS B 1 44  ? 28.254 10.675 104.758 1.00 18.45 ? 44  LYS B CD  1 
ATOM 1360 C CE  . LYS B 1 44  ? 27.393 10.600 106.037 1.00 21.69 ? 44  LYS B CE  1 
ATOM 1361 N NZ  . LYS B 1 44  ? 27.278 11.867 106.854 1.00 20.23 ? 44  LYS B NZ  1 
ATOM 1362 N N   . THR B 1 45  ? 31.662 6.886  104.917 1.00 9.25  ? 45  THR B N   1 
ATOM 1363 C CA  . THR B 1 45  ? 31.833 5.959  106.019 1.00 5.38  ? 45  THR B CA  1 
ATOM 1364 C C   . THR B 1 45  ? 33.288 6.000  106.470 1.00 4.63  ? 45  THR B C   1 
ATOM 1365 O O   . THR B 1 45  ? 33.558 6.339  107.617 1.00 2.30  ? 45  THR B O   1 
ATOM 1366 C CB  . THR B 1 45  ? 31.436 4.521  105.626 1.00 7.35  ? 45  THR B CB  1 
ATOM 1367 O OG1 . THR B 1 45  ? 30.093 4.500  105.106 1.00 6.44  ? 45  THR B OG1 1 
ATOM 1368 C CG2 . THR B 1 45  ? 31.532 3.600  106.842 1.00 4.79  ? 45  THR B CG2 1 
ATOM 1369 N N   . LEU B 1 46  ? 34.222 5.743  105.557 1.00 4.79  ? 46  LEU B N   1 
ATOM 1370 C CA  . LEU B 1 46  ? 35.648 5.761  105.914 1.00 6.94  ? 46  LEU B CA  1 
ATOM 1371 C C   . LEU B 1 46  ? 36.061 7.095  106.556 1.00 10.88 ? 46  LEU B C   1 
ATOM 1372 O O   . LEU B 1 46  ? 36.876 7.169  107.491 1.00 8.65  ? 46  LEU B O   1 
ATOM 1373 C CB  . LEU B 1 46  ? 36.493 5.569  104.672 1.00 2.53  ? 46  LEU B CB  1 
ATOM 1374 C CG  . LEU B 1 46  ? 36.129 4.403  103.790 1.00 2.23  ? 46  LEU B CG  1 
ATOM 1375 C CD1 . LEU B 1 46  ? 36.946 4.445  102.523 1.00 2.00  ? 46  LEU B CD1 1 
ATOM 1376 C CD2 . LEU B 1 46  ? 36.415 3.161  104.556 1.00 5.38  ? 46  LEU B CD2 1 
ATOM 1377 N N   . ALA B 1 47  ? 35.476 8.145  106.014 1.00 11.76 ? 47  ALA B N   1 
ATOM 1378 C CA  . ALA B 1 47  ? 35.725 9.493  106.441 1.00 13.43 ? 47  ALA B CA  1 
ATOM 1379 C C   . ALA B 1 47  ? 35.285 9.759  107.839 1.00 14.04 ? 47  ALA B C   1 
ATOM 1380 O O   . ALA B 1 47  ? 36.016 10.364 108.632 1.00 15.32 ? 47  ALA B O   1 
ATOM 1381 C CB  . ALA B 1 47  ? 34.984 10.415 105.557 1.00 16.85 ? 47  ALA B CB  1 
ATOM 1382 N N   . ALA B 1 48  ? 34.029 9.390  108.073 1.00 16.25 ? 48  ALA B N   1 
ATOM 1383 C CA  . ALA B 1 48  ? 33.324 9.612  109.326 1.00 13.83 ? 48  ALA B CA  1 
ATOM 1384 C C   . ALA B 1 48  ? 33.990 9.313  110.631 1.00 12.84 ? 48  ALA B C   1 
ATOM 1385 O O   . ALA B 1 48  ? 34.714 8.333  110.783 1.00 9.36  ? 48  ALA B O   1 
ATOM 1386 C CB  . ALA B 1 48  ? 32.001 8.955  109.291 1.00 16.90 ? 48  ALA B CB  1 
ATOM 1387 N N   . GLY B 1 49  ? 33.721 10.198 111.580 1.00 12.79 ? 49  GLY B N   1 
ATOM 1388 C CA  . GLY B 1 49  ? 34.258 10.058 112.923 1.00 20.38 ? 49  GLY B CA  1 
ATOM 1389 C C   . GLY B 1 49  ? 35.705 10.471 113.031 1.00 20.08 ? 49  GLY B C   1 
ATOM 1390 O O   . GLY B 1 49  ? 36.364 10.247 114.064 1.00 19.80 ? 49  GLY B O   1 
ATOM 1391 N N   . ARG B 1 50  ? 36.176 11.150 111.989 1.00 18.10 ? 50  ARG B N   1 
ATOM 1392 C CA  . ARG B 1 50  ? 37.549 11.584 111.936 1.00 14.63 ? 50  ARG B CA  1 
ATOM 1393 C C   . ARG B 1 50  ? 37.588 13.084 111.848 1.00 9.77  ? 50  ARG B C   1 
ATOM 1394 O O   . ARG B 1 50  ? 36.705 13.681 111.215 1.00 12.06 ? 50  ARG B O   1 
ATOM 1395 C CB  . ARG B 1 50  ? 38.211 10.994 110.693 1.00 20.96 ? 50  ARG B CB  1 
ATOM 1396 C CG  . ARG B 1 50  ? 37.992 9.513  110.527 1.00 26.06 ? 50  ARG B CG  1 
ATOM 1397 C CD  . ARG B 1 50  ? 39.297 8.752  110.541 1.00 34.28 ? 50  ARG B CD  1 
ATOM 1398 N NE  . ARG B 1 50  ? 39.607 8.134  109.248 1.00 41.76 ? 50  ARG B NE  1 
ATOM 1399 C CZ  . ARG B 1 50  ? 40.048 8.788  108.169 1.00 45.27 ? 50  ARG B CZ  1 
ATOM 1400 N NH1 . ARG B 1 50  ? 40.239 10.111 108.185 1.00 44.95 ? 50  ARG B NH1 1 
ATOM 1401 N NH2 . ARG B 1 50  ? 40.328 8.104  107.064 1.00 47.27 ? 50  ARG B NH2 1 
ATOM 1402 N N   . PRO B 1 51  ? 38.519 13.714 112.600 1.00 3.36  ? 51  PRO B N   1 
ATOM 1403 C CA  . PRO B 1 51  ? 38.752 15.157 112.650 1.00 3.49  ? 51  PRO B CA  1 
ATOM 1404 C C   . PRO B 1 51  ? 39.503 15.446 111.365 1.00 6.77  ? 51  PRO B C   1 
ATOM 1405 O O   . PRO B 1 51  ? 39.980 14.499 110.730 1.00 11.91 ? 51  PRO B O   1 
ATOM 1406 C CB  . PRO B 1 51  ? 39.700 15.299 113.832 1.00 2.00  ? 51  PRO B CB  1 
ATOM 1407 C CG  . PRO B 1 51  ? 39.317 14.213 114.687 1.00 3.58  ? 51  PRO B CG  1 
ATOM 1408 C CD  . PRO B 1 51  ? 39.202 13.076 113.723 1.00 3.67  ? 51  PRO B CD  1 
ATOM 1409 N N   . THR B 1 52  ? 39.589 16.711 110.934 1.00 5.39  ? 52  THR B N   1 
ATOM 1410 C CA  . THR B 1 52  ? 40.340 17.016 109.721 1.00 2.00  ? 52  THR B CA  1 
ATOM 1411 C C   . THR B 1 52  ? 41.228 18.202 109.964 1.00 2.00  ? 52  THR B C   1 
ATOM 1412 O O   . THR B 1 52  ? 41.199 18.780 111.051 1.00 2.00  ? 52  THR B O   1 
ATOM 1413 C CB  . THR B 1 52  ? 39.460 17.216 108.468 1.00 2.00  ? 52  THR B CB  1 
ATOM 1414 O OG1 . THR B 1 52  ? 38.798 18.490 108.493 1.00 4.76  ? 52  THR B OG1 1 
ATOM 1415 C CG2 . THR B 1 52  ? 38.430 16.105 108.366 1.00 5.00  ? 52  THR B CG2 1 
ATOM 1416 N N   . ILE B 1 53  ? 42.018 18.568 108.954 1.00 2.00  ? 53  ILE B N   1 
ATOM 1417 C CA  . ILE B 1 53  ? 42.941 19.688 109.090 1.00 3.21  ? 53  ILE B CA  1 
ATOM 1418 C C   . ILE B 1 53  ? 42.228 20.961 109.460 1.00 5.52  ? 53  ILE B C   1 
ATOM 1419 O O   . ILE B 1 53  ? 42.805 21.838 110.092 1.00 12.51 ? 53  ILE B O   1 
ATOM 1420 C CB  . ILE B 1 53  ? 43.823 19.912 107.855 1.00 2.00  ? 53  ILE B CB  1 
ATOM 1421 C CG1 . ILE B 1 53  ? 44.989 20.829 108.220 1.00 2.00  ? 53  ILE B CG1 1 
ATOM 1422 C CG2 . ILE B 1 53  ? 43.060 20.563 106.781 1.00 2.00  ? 53  ILE B CG2 1 
ATOM 1423 C CD1 . ILE B 1 53  ? 46.202 20.700 107.288 1.00 7.11  ? 53  ILE B CD1 1 
ATOM 1424 N N   . ASN B 1 54  ? 40.964 21.055 109.104 1.00 2.00  ? 54  ASN B N   1 
ATOM 1425 C CA  . ASN B 1 54  ? 40.227 22.233 109.440 1.00 2.00  ? 54  ASN B CA  1 
ATOM 1426 C C   . ASN B 1 54  ? 39.618 22.124 110.810 1.00 2.00  ? 54  ASN B C   1 
ATOM 1427 O O   . ASN B 1 54  ? 39.028 23.078 111.285 1.00 7.80  ? 54  ASN B O   1 
ATOM 1428 C CB  . ASN B 1 54  ? 39.162 22.448 108.433 1.00 2.22  ? 54  ASN B CB  1 
ATOM 1429 C CG  . ASN B 1 54  ? 39.581 21.989 107.131 1.00 5.11  ? 54  ASN B CG  1 
ATOM 1430 O OD1 . ASN B 1 54  ? 40.505 22.535 106.573 1.00 7.68  ? 54  ASN B OD1 1 
ATOM 1431 N ND2 . ASN B 1 54  ? 39.005 20.887 106.672 1.00 9.27  ? 54  ASN B ND2 1 
ATOM 1432 N N   . HIS B 1 55  ? 39.636 20.938 111.396 1.00 2.00  ? 55  HIS B N   1 
ATOM 1433 C CA  . HIS B 1 55  ? 39.133 20.783 112.744 1.00 2.00  ? 55  HIS B CA  1 
ATOM 1434 C C   . HIS B 1 55  ? 39.826 19.614 113.367 1.00 6.29  ? 55  HIS B C   1 
ATOM 1435 O O   . HIS B 1 55  ? 39.201 18.615 113.672 1.00 15.03 ? 55  HIS B O   1 
ATOM 1436 C CB  . HIS B 1 55  ? 37.620 20.635 112.799 1.00 4.30  ? 55  HIS B CB  1 
ATOM 1437 C CG  . HIS B 1 55  ? 37.051 19.563 111.927 1.00 9.21  ? 55  HIS B CG  1 
ATOM 1438 N ND1 . HIS B 1 55  ? 36.629 19.799 110.634 1.00 9.43  ? 55  HIS B ND1 1 
ATOM 1439 C CD2 . HIS B 1 55  ? 36.720 18.278 112.197 1.00 5.34  ? 55  HIS B CD2 1 
ATOM 1440 C CE1 . HIS B 1 55  ? 36.049 18.715 110.150 1.00 4.61  ? 55  HIS B CE1 1 
ATOM 1441 N NE2 . HIS B 1 55  ? 36.091 17.775 111.081 1.00 4.82  ? 55  HIS B NE2 1 
ATOM 1442 N N   . PRO B 1 56  ? 41.157 19.728 113.552 1.00 5.56  ? 56  PRO B N   1 
ATOM 1443 C CA  . PRO B 1 56  ? 42.123 18.791 114.113 1.00 5.59  ? 56  PRO B CA  1 
ATOM 1444 C C   . PRO B 1 56  ? 41.915 18.288 115.543 1.00 6.64  ? 56  PRO B C   1 
ATOM 1445 O O   . PRO B 1 56  ? 42.790 17.580 116.075 1.00 10.48 ? 56  PRO B O   1 
ATOM 1446 C CB  . PRO B 1 56  ? 43.423 19.579 114.019 1.00 2.92  ? 56  PRO B CB  1 
ATOM 1447 C CG  . PRO B 1 56  ? 42.978 20.951 114.234 1.00 2.64  ? 56  PRO B CG  1 
ATOM 1448 C CD  . PRO B 1 56  ? 41.837 20.992 113.262 1.00 5.65  ? 56  PRO B CD  1 
ATOM 1449 N N   . THR B 1 57  ? 40.834 18.704 116.210 1.00 5.82  ? 57  THR B N   1 
ATOM 1450 C CA  . THR B 1 57  ? 40.598 18.189 117.552 1.00 2.84  ? 57  THR B CA  1 
ATOM 1451 C C   . THR B 1 57  ? 39.269 17.424 117.725 1.00 6.59  ? 57  THR B C   1 
ATOM 1452 O O   . THR B 1 57  ? 39.267 16.315 118.271 1.00 11.00 ? 57  THR B O   1 
ATOM 1453 C CB  . THR B 1 57  ? 40.844 19.254 118.629 1.00 2.40  ? 57  THR B CB  1 
ATOM 1454 O OG1 . THR B 1 57  ? 42.257 19.506 118.717 1.00 2.00  ? 57  THR B OG1 1 
ATOM 1455 C CG2 . THR B 1 57  ? 40.334 18.782 119.996 1.00 3.00  ? 57  THR B CG2 1 
ATOM 1456 N N   . PHE B 1 58  ? 38.176 17.951 117.176 1.00 5.31  ? 58  PHE B N   1 
ATOM 1457 C CA  . PHE B 1 58  ? 36.875 17.309 117.277 1.00 2.00  ? 58  PHE B CA  1 
ATOM 1458 C C   . PHE B 1 58  ? 36.360 16.786 115.950 1.00 2.35  ? 58  PHE B C   1 
ATOM 1459 O O   . PHE B 1 58  ? 36.700 17.282 114.881 1.00 2.00  ? 58  PHE B O   1 
ATOM 1460 C CB  . PHE B 1 58  ? 35.887 18.282 117.882 1.00 2.00  ? 58  PHE B CB  1 
ATOM 1461 C CG  . PHE B 1 58  ? 36.322 18.791 119.212 1.00 2.00  ? 58  PHE B CG  1 
ATOM 1462 C CD1 . PHE B 1 58  ? 36.803 20.078 119.355 1.00 2.00  ? 58  PHE B CD1 1 
ATOM 1463 C CD2 . PHE B 1 58  ? 36.300 17.956 120.336 1.00 7.90  ? 58  PHE B CD2 1 
ATOM 1464 C CE1 . PHE B 1 58  ? 37.267 20.534 120.607 1.00 4.11  ? 58  PHE B CE1 1 
ATOM 1465 C CE2 . PHE B 1 58  ? 36.763 18.405 121.594 1.00 2.71  ? 58  PHE B CE2 1 
ATOM 1466 C CZ  . PHE B 1 58  ? 37.245 19.697 121.721 1.00 2.00  ? 58  PHE B CZ  1 
ATOM 1467 N N   . VAL B 1 59  ? 35.551 15.744 116.024 1.00 4.97  ? 59  VAL B N   1 
ATOM 1468 C CA  . VAL B 1 59  ? 34.972 15.112 114.842 1.00 2.34  ? 59  VAL B CA  1 
ATOM 1469 C C   . VAL B 1 59  ? 34.105 16.136 114.153 1.00 2.00  ? 59  VAL B C   1 
ATOM 1470 O O   . VAL B 1 59  ? 33.733 17.114 114.759 1.00 2.66  ? 59  VAL B O   1 
ATOM 1471 C CB  . VAL B 1 59  ? 34.119 13.900 115.251 1.00 2.00  ? 59  VAL B CB  1 
ATOM 1472 C CG1 . VAL B 1 59  ? 34.739 13.191 116.454 1.00 2.00  ? 59  VAL B CG1 1 
ATOM 1473 C CG2 . VAL B 1 59  ? 32.735 14.319 115.577 1.00 5.76  ? 59  VAL B CG2 1 
ATOM 1474 N N   . GLY B 1 60  ? 33.735 15.898 112.916 1.00 2.00  ? 60  GLY B N   1 
ATOM 1475 C CA  . GLY B 1 60  ? 32.913 16.887 112.226 1.00 4.68  ? 60  GLY B CA  1 
ATOM 1476 C C   . GLY B 1 60  ? 31.421 16.759 112.442 1.00 2.00  ? 60  GLY B C   1 
ATOM 1477 O O   . GLY B 1 60  ? 31.051 15.996 113.304 1.00 2.11  ? 60  GLY B O   1 
ATOM 1478 N N   . SER B 1 61  ? 30.581 17.508 111.727 1.00 2.00  ? 61  SER B N   1 
ATOM 1479 C CA  . SER B 1 61  ? 29.123 17.357 111.893 1.00 2.80  ? 61  SER B CA  1 
ATOM 1480 C C   . SER B 1 61  ? 28.448 17.140 110.563 1.00 2.00  ? 61  SER B C   1 
ATOM 1481 O O   . SER B 1 61  ? 29.098 16.627 109.684 1.00 6.26  ? 61  SER B O   1 
ATOM 1482 C CB  . SER B 1 61  ? 28.454 18.507 112.649 1.00 5.66  ? 61  SER B CB  1 
ATOM 1483 O OG  . SER B 1 61  ? 27.052 18.270 112.786 1.00 2.71  ? 61  SER B OG  1 
ATOM 1484 N N   . GLU B 1 62  ? 27.176 17.506 110.399 1.00 2.03  ? 62  GLU B N   1 
ATOM 1485 C CA  . GLU B 1 62  ? 26.482 17.285 109.125 1.00 6.95  ? 62  GLU B CA  1 
ATOM 1486 C C   . GLU B 1 62  ? 25.902 18.451 108.314 1.00 6.70  ? 62  GLU B C   1 
ATOM 1487 O O   . GLU B 1 62  ? 25.641 19.547 108.813 1.00 5.54  ? 62  GLU B O   1 
ATOM 1488 C CB  . GLU B 1 62  ? 25.356 16.295 109.332 1.00 12.11 ? 62  GLU B CB  1 
ATOM 1489 C CG  . GLU B 1 62  ? 25.438 15.101 108.442 1.00 15.37 ? 62  GLU B CG  1 
ATOM 1490 C CD  . GLU B 1 62  ? 25.514 13.859 109.274 1.00 21.85 ? 62  GLU B CD  1 
ATOM 1491 O OE1 . GLU B 1 62  ? 24.563 13.055 109.219 1.00 28.09 ? 62  GLU B OE1 1 
ATOM 1492 O OE2 . GLU B 1 62  ? 26.495 13.717 110.038 1.00 23.82 ? 62  GLU B OE2 1 
ATOM 1493 N N   . ARG B 1 63  ? 25.607 18.148 107.060 1.00 7.16  ? 63  ARG B N   1 
ATOM 1494 C CA  . ARG B 1 63  ? 25.013 19.109 106.145 1.00 10.21 ? 63  ARG B CA  1 
ATOM 1495 C C   . ARG B 1 63  ? 23.592 19.270 106.671 1.00 8.87  ? 63  ARG B C   1 
ATOM 1496 O O   . ARG B 1 63  ? 23.070 18.374 107.338 1.00 12.05 ? 63  ARG B O   1 
ATOM 1497 C CB  . ARG B 1 63  ? 24.994 18.509 104.729 1.00 19.06 ? 63  ARG B CB  1 
ATOM 1498 C CG  . ARG B 1 63  ? 24.622 19.449 103.567 1.00 28.24 ? 63  ARG B CG  1 
ATOM 1499 C CD  . ARG B 1 63  ? 25.777 20.390 103.172 1.00 38.45 ? 63  ARG B CD  1 
ATOM 1500 N NE  . ARG B 1 63  ? 25.524 21.101 101.910 1.00 49.29 ? 63  ARG B NE  1 
ATOM 1501 C CZ  . ARG B 1 63  ? 25.506 20.517 100.706 1.00 53.85 ? 63  ARG B CZ  1 
ATOM 1502 N NH1 . ARG B 1 63  ? 25.718 19.203 100.604 1.00 56.89 ? 63  ARG B NH1 1 
ATOM 1503 N NH2 . ARG B 1 63  ? 25.325 21.242 99.595  1.00 51.24 ? 63  ARG B NH2 1 
ATOM 1504 N N   . CYS B 1 64  ? 22.955 20.392 106.387 1.00 8.31  ? 64  CYS B N   1 
ATOM 1505 C CA  . CYS B 1 64  ? 21.612 20.588 106.891 1.00 12.85 ? 64  CYS B CA  1 
ATOM 1506 C C   . CYS B 1 64  ? 20.529 20.056 105.969 1.00 17.87 ? 64  CYS B C   1 
ATOM 1507 O O   . CYS B 1 64  ? 20.706 19.973 104.740 1.00 20.91 ? 64  CYS B O   1 
ATOM 1508 C CB  . CYS B 1 64  ? 21.331 22.070 107.117 1.00 11.41 ? 64  CYS B CB  1 
ATOM 1509 S SG  . CYS B 1 64  ? 22.475 22.929 108.148 1.00 10.65 ? 64  CYS B SG  1 
ATOM 1510 N N   . ARG B 1 65  ? 19.394 19.710 106.581 1.00 21.75 ? 65  ARG B N   1 
ATOM 1511 C CA  . ARG B 1 65  ? 18.223 19.261 105.844 1.00 19.19 ? 65  ARG B CA  1 
ATOM 1512 C C   . ARG B 1 65  ? 17.901 20.458 104.957 1.00 14.92 ? 65  ARG B C   1 
ATOM 1513 O O   . ARG B 1 65  ? 17.777 21.584 105.444 1.00 12.36 ? 65  ARG B O   1 
ATOM 1514 C CB  . ARG B 1 65  ? 17.039 19.032 106.798 1.00 24.47 ? 65  ARG B CB  1 
ATOM 1515 C CG  . ARG B 1 65  ? 16.777 17.588 107.210 1.00 30.89 ? 65  ARG B CG  1 
ATOM 1516 C CD  . ARG B 1 65  ? 17.860 17.010 108.126 1.00 34.44 ? 65  ARG B CD  1 
ATOM 1517 N NE  . ARG B 1 65  ? 18.012 15.564 107.922 1.00 39.95 ? 65  ARG B NE  1 
ATOM 1518 C CZ  . ARG B 1 65  ? 18.908 15.013 107.093 1.00 47.38 ? 65  ARG B CZ  1 
ATOM 1519 N NH1 . ARG B 1 65  ? 19.760 15.768 106.380 1.00 45.23 ? 65  ARG B NH1 1 
ATOM 1520 N NH2 . ARG B 1 65  ? 18.935 13.690 106.947 1.00 47.80 ? 65  ARG B NH2 1 
ATOM 1521 N N   . PRO B 1 66  ? 17.907 20.261 103.642 1.00 14.92 ? 66  PRO B N   1 
ATOM 1522 C CA  . PRO B 1 66  ? 17.608 21.313 102.680 1.00 16.80 ? 66  PRO B CA  1 
ATOM 1523 C C   . PRO B 1 66  ? 16.463 22.131 103.168 1.00 15.03 ? 66  PRO B C   1 
ATOM 1524 O O   . PRO B 1 66  ? 15.491 21.593 103.718 1.00 21.24 ? 66  PRO B O   1 
ATOM 1525 C CB  . PRO B 1 66  ? 17.188 20.529 101.465 1.00 15.11 ? 66  PRO B CB  1 
ATOM 1526 C CG  . PRO B 1 66  ? 18.210 19.457 101.467 1.00 24.58 ? 66  PRO B CG  1 
ATOM 1527 C CD  . PRO B 1 66  ? 18.309 19.037 102.944 1.00 22.08 ? 66  PRO B CD  1 
ATOM 1528 N N   . GLY B 1 67  ? 16.629 23.440 103.030 1.00 15.59 ? 67  GLY B N   1 
ATOM 1529 C CA  . GLY B 1 67  ? 15.606 24.371 103.444 1.00 12.13 ? 67  GLY B CA  1 
ATOM 1530 C C   . GLY B 1 67  ? 15.699 24.723 104.900 1.00 10.85 ? 67  GLY B C   1 
ATOM 1531 O O   . GLY B 1 67  ? 15.004 25.634 105.369 1.00 19.25 ? 67  GLY B O   1 
ATOM 1532 N N   . TYR B 1 68  ? 16.533 24.005 105.629 1.00 7.81  ? 68  TYR B N   1 
ATOM 1533 C CA  . TYR B 1 68  ? 16.680 24.292 107.036 1.00 8.87  ? 68  TYR B CA  1 
ATOM 1534 C C   . TYR B 1 68  ? 17.956 25.038 107.360 1.00 8.31  ? 68  TYR B C   1 
ATOM 1535 O O   . TYR B 1 68  ? 18.895 25.085 106.536 1.00 12.89 ? 68  TYR B O   1 
ATOM 1536 C CB  . TYR B 1 68  ? 16.670 22.997 107.826 1.00 9.07  ? 68  TYR B CB  1 
ATOM 1537 C CG  . TYR B 1 68  ? 15.325 22.376 107.867 1.00 5.24  ? 68  TYR B CG  1 
ATOM 1538 C CD1 . TYR B 1 68  ? 14.639 22.104 106.690 1.00 2.48  ? 68  TYR B CD1 1 
ATOM 1539 C CD2 . TYR B 1 68  ? 14.718 22.092 109.084 1.00 5.39  ? 68  TYR B CD2 1 
ATOM 1540 C CE1 . TYR B 1 68  ? 13.372 21.567 106.718 1.00 7.05  ? 68  TYR B CE1 1 
ATOM 1541 C CE2 . TYR B 1 68  ? 13.456 21.559 109.136 1.00 9.10  ? 68  TYR B CE2 1 
ATOM 1542 C CZ  . TYR B 1 68  ? 12.771 21.295 107.951 1.00 11.98 ? 68  TYR B CZ  1 
ATOM 1543 O OH  . TYR B 1 68  ? 11.479 20.783 108.005 1.00 13.65 ? 68  TYR B OH  1 
ATOM 1544 N N   . THR B 1 69  ? 17.951 25.661 108.536 1.00 4.50  ? 69  THR B N   1 
ATOM 1545 C CA  . THR B 1 69  ? 19.114 26.339 109.078 1.00 4.35  ? 69  THR B CA  1 
ATOM 1546 C C   . THR B 1 69  ? 19.080 26.039 110.571 1.00 2.28  ? 69  THR B C   1 
ATOM 1547 O O   . THR B 1 69  ? 18.217 25.292 111.023 1.00 4.40  ? 69  THR B O   1 
ATOM 1548 C CB  . THR B 1 69  ? 19.148 27.820 108.775 1.00 5.22  ? 69  THR B CB  1 
ATOM 1549 O OG1 . THR B 1 69  ? 17.910 28.414 109.163 1.00 17.15 ? 69  THR B OG1 1 
ATOM 1550 C CG2 . THR B 1 69  ? 19.370 28.039 107.280 1.00 11.15 ? 69  THR B CG2 1 
ATOM 1551 N N   . PHE B 1 70  ? 19.983 26.597 111.355 1.00 2.00  ? 70  PHE B N   1 
ATOM 1552 C CA  . PHE B 1 70  ? 19.984 26.249 112.759 1.00 4.34  ? 70  PHE B CA  1 
ATOM 1553 C C   . PHE B 1 70  ? 20.293 27.454 113.587 1.00 8.43  ? 70  PHE B C   1 
ATOM 1554 O O   . PHE B 1 70  ? 21.073 28.293 113.147 1.00 14.85 ? 70  PHE B O   1 
ATOM 1555 C CB  . PHE B 1 70  ? 21.070 25.222 113.013 1.00 4.38  ? 70  PHE B CB  1 
ATOM 1556 C CG  . PHE B 1 70  ? 22.442 25.740 112.732 1.00 2.26  ? 70  PHE B CG  1 
ATOM 1557 C CD1 . PHE B 1 70  ? 23.210 26.303 113.745 1.00 5.35  ? 70  PHE B CD1 1 
ATOM 1558 C CD2 . PHE B 1 70  ? 22.955 25.707 111.444 1.00 2.00  ? 70  PHE B CD2 1 
ATOM 1559 C CE1 . PHE B 1 70  ? 24.464 26.829 113.472 1.00 2.33  ? 70  PHE B CE1 1 
ATOM 1560 C CE2 . PHE B 1 70  ? 24.206 26.230 111.166 1.00 2.00  ? 70  PHE B CE2 1 
ATOM 1561 C CZ  . PHE B 1 70  ? 24.958 26.791 112.185 1.00 3.31  ? 70  PHE B CZ  1 
ATOM 1562 N N   . THR B 1 71  ? 19.770 27.472 114.817 1.00 8.95  ? 71  THR B N   1 
ATOM 1563 C CA  . THR B 1 71  ? 19.959 28.551 115.798 1.00 4.88  ? 71  THR B CA  1 
ATOM 1564 C C   . THR B 1 71  ? 20.664 27.892 116.972 1.00 2.00  ? 71  THR B C   1 
ATOM 1565 O O   . THR B 1 71  ? 20.287 26.808 117.350 1.00 4.50  ? 71  THR B O   1 
ATOM 1566 C CB  . THR B 1 71  ? 18.588 29.113 116.210 1.00 2.00  ? 71  THR B CB  1 
ATOM 1567 O OG1 . THR B 1 71  ? 18.062 29.900 115.131 1.00 2.00  ? 71  THR B OG1 1 
ATOM 1568 C CG2 . THR B 1 71  ? 18.682 29.924 117.465 1.00 2.00  ? 71  THR B CG2 1 
ATOM 1569 N N   . SER B 1 72  ? 21.724 28.467 117.505 1.00 2.00  ? 72  SER B N   1 
ATOM 1570 C CA  . SER B 1 72  ? 22.394 27.796 118.604 1.00 2.00  ? 72  SER B CA  1 
ATOM 1571 C C   . SER B 1 72  ? 22.178 28.479 119.926 1.00 2.00  ? 72  SER B C   1 
ATOM 1572 O O   . SER B 1 72  ? 21.903 29.641 119.982 1.00 3.92  ? 72  SER B O   1 
ATOM 1573 C CB  . SER B 1 72  ? 23.884 27.647 118.320 1.00 4.58  ? 72  SER B CB  1 
ATOM 1574 O OG  . SER B 1 72  ? 24.147 26.805 117.198 1.00 5.72  ? 72  SER B OG  1 
ATOM 1575 N N   . ILE B 1 73  ? 22.289 27.747 121.006 1.00 2.00  ? 73  ILE B N   1 
ATOM 1576 C CA  . ILE B 1 73  ? 22.094 28.288 122.336 1.00 2.00  ? 73  ILE B CA  1 
ATOM 1577 C C   . ILE B 1 73  ? 23.297 27.765 123.064 1.00 2.23  ? 73  ILE B C   1 
ATOM 1578 O O   . ILE B 1 73  ? 23.544 26.568 123.030 1.00 2.00  ? 73  ILE B O   1 
ATOM 1579 C CB  . ILE B 1 73  ? 20.916 27.599 123.015 1.00 2.00  ? 73  ILE B CB  1 
ATOM 1580 C CG1 . ILE B 1 73  ? 19.639 27.834 122.262 1.00 2.00  ? 73  ILE B CG1 1 
ATOM 1581 C CG2 . ILE B 1 73  ? 20.787 28.000 124.441 1.00 2.00  ? 73  ILE B CG2 1 
ATOM 1582 C CD1 . ILE B 1 73  ? 18.524 27.111 122.903 1.00 2.00  ? 73  ILE B CD1 1 
ATOM 1583 N N   . THR B 1 74  ? 24.114 28.604 123.661 1.00 3.91  ? 74  THR B N   1 
ATOM 1584 C CA  . THR B 1 74  ? 25.207 27.988 124.373 1.00 7.53  ? 74  THR B CA  1 
ATOM 1585 C C   . THR B 1 74  ? 24.844 28.073 125.806 1.00 7.45  ? 74  THR B C   1 
ATOM 1586 O O   . THR B 1 74  ? 23.944 28.818 126.163 1.00 14.36 ? 74  THR B O   1 
ATOM 1587 C CB  . THR B 1 74  ? 26.572 28.652 124.171 1.00 10.20 ? 74  THR B CB  1 
ATOM 1588 O OG1 . THR B 1 74  ? 26.903 29.448 125.314 1.00 7.30  ? 74  THR B OG1 1 
ATOM 1589 C CG2 . THR B 1 74  ? 26.607 29.462 122.893 1.00 16.63 ? 74  THR B CG2 1 
ATOM 1590 N N   . LEU B 1 75  ? 25.498 27.280 126.634 1.00 8.89  ? 75  LEU B N   1 
ATOM 1591 C CA  . LEU B 1 75  ? 25.219 27.340 128.055 1.00 10.35 ? 75  LEU B CA  1 
ATOM 1592 C C   . LEU B 1 75  ? 26.279 26.708 128.887 1.00 9.32  ? 75  LEU B C   1 
ATOM 1593 O O   . LEU B 1 75  ? 26.707 25.592 128.639 1.00 7.96  ? 75  LEU B O   1 
ATOM 1594 C CB  . LEU B 1 75  ? 23.844 26.771 128.405 1.00 11.11 ? 75  LEU B CB  1 
ATOM 1595 C CG  . LEU B 1 75  ? 23.310 25.570 127.642 1.00 4.80  ? 75  LEU B CG  1 
ATOM 1596 C CD1 . LEU B 1 75  ? 23.179 24.368 128.580 1.00 7.07  ? 75  LEU B CD1 1 
ATOM 1597 C CD2 . LEU B 1 75  ? 21.975 25.961 127.074 1.00 2.00  ? 75  LEU B CD2 1 
ATOM 1598 N N   . LYS B 1 76  ? 26.738 27.474 129.852 1.00 11.62 ? 76  LYS B N   1 
ATOM 1599 C CA  . LYS B 1 76  ? 27.765 27.000 130.745 1.00 15.87 ? 76  LYS B CA  1 
ATOM 1600 C C   . LYS B 1 76  ? 27.065 26.608 132.018 1.00 13.05 ? 76  LYS B C   1 
ATOM 1601 O O   . LYS B 1 76  ? 26.527 27.460 132.732 1.00 15.67 ? 76  LYS B O   1 
ATOM 1602 C CB  . LYS B 1 76  ? 28.798 28.094 131.027 1.00 22.56 ? 76  LYS B CB  1 
ATOM 1603 C CG  . LYS B 1 76  ? 29.379 28.746 129.785 1.00 25.75 ? 76  LYS B CG  1 
ATOM 1604 C CD  . LYS B 1 76  ? 30.232 29.933 130.184 1.00 30.14 ? 76  LYS B CD  1 
ATOM 1605 C CE  . LYS B 1 76  ? 29.908 31.144 129.305 1.00 33.11 ? 76  LYS B CE  1 
ATOM 1606 N NZ  . LYS B 1 76  ? 31.071 31.514 128.409 1.00 41.50 ? 76  LYS B NZ  1 
ATOM 1607 N N   . PRO B 1 77  ? 27.045 25.306 132.309 1.00 10.01 ? 77  PRO B N   1 
ATOM 1608 C CA  . PRO B 1 77  ? 26.409 24.763 133.490 1.00 9.22  ? 77  PRO B CA  1 
ATOM 1609 C C   . PRO B 1 77  ? 27.144 25.239 134.703 1.00 10.43 ? 77  PRO B C   1 
ATOM 1610 O O   . PRO B 1 77  ? 28.314 25.596 134.600 1.00 13.43 ? 77  PRO B O   1 
ATOM 1611 C CB  . PRO B 1 77  ? 26.673 23.271 133.348 1.00 5.82  ? 77  PRO B CB  1 
ATOM 1612 C CG  . PRO B 1 77  ? 26.866 23.088 131.911 1.00 9.35  ? 77  PRO B CG  1 
ATOM 1613 C CD  . PRO B 1 77  ? 27.718 24.231 131.576 1.00 8.00  ? 77  PRO B CD  1 
ATOM 1614 N N   . PRO B 1 78  ? 26.440 25.354 135.849 1.00 13.01 ? 78  PRO B N   1 
ATOM 1615 C CA  . PRO B 1 78  ? 27.054 25.773 137.108 1.00 14.32 ? 78  PRO B CA  1 
ATOM 1616 C C   . PRO B 1 78  ? 27.777 24.503 137.544 1.00 16.92 ? 78  PRO B C   1 
ATOM 1617 O O   . PRO B 1 78  ? 27.870 23.548 136.757 1.00 19.37 ? 78  PRO B O   1 
ATOM 1618 C CB  . PRO B 1 78  ? 25.853 26.011 137.998 1.00 10.91 ? 78  PRO B CB  1 
ATOM 1619 C CG  . PRO B 1 78  ? 24.859 25.034 137.477 1.00 11.85 ? 78  PRO B CG  1 
ATOM 1620 C CD  . PRO B 1 78  ? 24.980 25.280 136.011 1.00 12.68 ? 78  PRO B CD  1 
ATOM 1621 N N   . LYS B 1 79  ? 28.244 24.437 138.787 1.00 16.74 ? 79  LYS B N   1 
ATOM 1622 C CA  . LYS B 1 79  ? 28.933 23.217 139.199 1.00 12.14 ? 79  LYS B CA  1 
ATOM 1623 C C   . LYS B 1 79  ? 27.906 22.120 139.228 1.00 9.04  ? 79  LYS B C   1 
ATOM 1624 O O   . LYS B 1 79  ? 26.737 22.368 139.479 1.00 12.36 ? 79  LYS B O   1 
ATOM 1625 C CB  . LYS B 1 79  ? 29.574 23.364 140.564 1.00 9.56  ? 79  LYS B CB  1 
ATOM 1626 C CG  . LYS B 1 79  ? 29.148 22.299 141.503 1.00 10.41 ? 79  LYS B CG  1 
ATOM 1627 C CD  . LYS B 1 79  ? 30.332 21.620 142.092 1.00 16.07 ? 79  LYS B CD  1 
ATOM 1628 C CE  . LYS B 1 79  ? 30.869 22.387 143.291 1.00 19.26 ? 79  LYS B CE  1 
ATOM 1629 N NZ  . LYS B 1 79  ? 32.213 21.848 143.692 1.00 23.67 ? 79  LYS B NZ  1 
ATOM 1630 N N   . ILE B 1 80  ? 28.327 20.920 138.891 1.00 8.32  ? 80  ILE B N   1 
ATOM 1631 C CA  . ILE B 1 80  ? 27.418 19.801 138.911 1.00 5.84  ? 80  ILE B CA  1 
ATOM 1632 C C   . ILE B 1 80  ? 28.045 18.911 139.928 1.00 5.15  ? 80  ILE B C   1 
ATOM 1633 O O   . ILE B 1 80  ? 29.187 18.487 139.794 1.00 5.29  ? 80  ILE B O   1 
ATOM 1634 C CB  . ILE B 1 80  ? 27.308 19.057 137.589 1.00 5.73  ? 80  ILE B CB  1 
ATOM 1635 C CG1 . ILE B 1 80  ? 26.792 19.979 136.484 1.00 4.52  ? 80  ILE B CG1 1 
ATOM 1636 C CG2 . ILE B 1 80  ? 26.331 17.937 137.763 1.00 8.27  ? 80  ILE B CG2 1 
ATOM 1637 C CD1 . ILE B 1 80  ? 26.798 19.342 135.135 1.00 2.00  ? 80  ILE B CD1 1 
ATOM 1638 N N   . ASP B 1 81  ? 27.325 18.725 141.009 1.00 8.14  ? 81  ASP B N   1 
ATOM 1639 C CA  . ASP B 1 81  ? 27.833 17.925 142.068 1.00 11.87 ? 81  ASP B CA  1 
ATOM 1640 C C   . ASP B 1 81  ? 28.122 16.504 141.647 1.00 14.90 ? 81  ASP B C   1 
ATOM 1641 O O   . ASP B 1 81  ? 27.551 16.005 140.654 1.00 12.13 ? 81  ASP B O   1 
ATOM 1642 C CB  . ASP B 1 81  ? 26.881 17.992 143.238 1.00 16.82 ? 81  ASP B CB  1 
ATOM 1643 C CG  . ASP B 1 81  ? 27.537 18.589 144.458 1.00 23.48 ? 81  ASP B CG  1 
ATOM 1644 O OD1 . ASP B 1 81  ? 28.724 18.233 144.730 1.00 25.41 ? 81  ASP B OD1 1 
ATOM 1645 O OD2 . ASP B 1 81  ? 26.866 19.416 145.130 1.00 26.04 ? 81  ASP B OD2 1 
ATOM 1646 N N   . ARG B 1 82  ? 29.040 15.872 142.378 1.00 15.18 ? 82  ARG B N   1 
ATOM 1647 C CA  . ARG B 1 82  ? 29.428 14.500 142.075 1.00 16.40 ? 82  ARG B CA  1 
ATOM 1648 C C   . ARG B 1 82  ? 28.223 13.595 142.082 1.00 9.70  ? 82  ARG B C   1 
ATOM 1649 O O   . ARG B 1 82  ? 27.424 13.646 142.976 1.00 12.32 ? 82  ARG B O   1 
ATOM 1650 C CB  . ARG B 1 82  ? 30.441 14.002 143.091 1.00 27.44 ? 82  ARG B CB  1 
ATOM 1651 C CG  . ARG B 1 82  ? 31.236 12.777 142.624 1.00 35.42 ? 82  ARG B CG  1 
ATOM 1652 C CD  . ARG B 1 82  ? 30.585 11.429 142.968 1.00 45.26 ? 82  ARG B CD  1 
ATOM 1653 N NE  . ARG B 1 82  ? 31.146 10.341 142.147 1.00 55.23 ? 82  ARG B NE  1 
ATOM 1654 C CZ  . ARG B 1 82  ? 32.342 9.773  142.332 1.00 53.89 ? 82  ARG B CZ  1 
ATOM 1655 N NH1 . ARG B 1 82  ? 33.131 10.169 143.331 1.00 55.90 ? 82  ARG B NH1 1 
ATOM 1656 N NH2 . ARG B 1 82  ? 32.775 8.845  141.477 1.00 53.98 ? 82  ARG B NH2 1 
ATOM 1657 N N   . GLY B 1 83  ? 28.062 12.780 141.069 1.00 6.51  ? 83  GLY B N   1 
ATOM 1658 C CA  . GLY B 1 83  ? 26.910 11.911 141.076 1.00 6.14  ? 83  GLY B CA  1 
ATOM 1659 C C   . GLY B 1 83  ? 25.576 12.620 140.952 1.00 4.91  ? 83  GLY B C   1 
ATOM 1660 O O   . GLY B 1 83  ? 24.546 11.996 141.120 1.00 6.74  ? 83  GLY B O   1 
ATOM 1661 N N   . SER B 1 84  ? 25.570 13.906 140.664 1.00 4.28  ? 84  SER B N   1 
ATOM 1662 C CA  . SER B 1 84  ? 24.305 14.607 140.507 1.00 8.97  ? 84  SER B CA  1 
ATOM 1663 C C   . SER B 1 84  ? 24.132 14.955 139.021 1.00 8.37  ? 84  SER B C   1 
ATOM 1664 O O   . SER B 1 84  ? 24.876 14.444 138.198 1.00 16.32 ? 84  SER B O   1 
ATOM 1665 C CB  . SER B 1 84  ? 24.314 15.855 141.376 1.00 15.58 ? 84  SER B CB  1 
ATOM 1666 O OG  . SER B 1 84  ? 23.264 16.749 141.026 1.00 28.34 ? 84  SER B OG  1 
ATOM 1667 N N   . TYR B 1 85  ? 23.183 15.803 138.647 1.00 4.32  ? 85  TYR B N   1 
ATOM 1668 C CA  . TYR B 1 85  ? 23.037 16.135 137.234 1.00 9.90  ? 85  TYR B CA  1 
ATOM 1669 C C   . TYR B 1 85  ? 22.468 17.526 137.094 1.00 12.21 ? 85  TYR B C   1 
ATOM 1670 O O   . TYR B 1 85  ? 21.736 17.971 137.959 1.00 21.09 ? 85  TYR B O   1 
ATOM 1671 C CB  . TYR B 1 85  ? 22.068 15.182 136.564 1.00 13.98 ? 85  TYR B CB  1 
ATOM 1672 C CG  . TYR B 1 85  ? 20.647 15.585 136.818 1.00 19.04 ? 85  TYR B CG  1 
ATOM 1673 C CD1 . TYR B 1 85  ? 19.939 16.345 135.888 1.00 21.95 ? 85  TYR B CD1 1 
ATOM 1674 C CD2 . TYR B 1 85  ? 20.044 15.306 138.034 1.00 22.22 ? 85  TYR B CD2 1 
ATOM 1675 C CE1 . TYR B 1 85  ? 18.662 16.826 136.174 1.00 24.79 ? 85  TYR B CE1 1 
ATOM 1676 C CE2 . TYR B 1 85  ? 18.769 15.780 138.333 1.00 25.17 ? 85  TYR B CE2 1 
ATOM 1677 C CZ  . TYR B 1 85  ? 18.086 16.539 137.403 1.00 23.87 ? 85  TYR B CZ  1 
ATOM 1678 O OH  . TYR B 1 85  ? 16.835 17.001 137.727 1.00 25.61 ? 85  TYR B OH  1 
ATOM 1679 N N   . TYR B 1 86  ? 22.707 18.161 135.958 1.00 10.70 ? 86  TYR B N   1 
ATOM 1680 C CA  . TYR B 1 86  ? 22.204 19.493 135.693 1.00 8.28  ? 86  TYR B CA  1 
ATOM 1681 C C   . TYR B 1 86  ? 21.230 19.257 134.573 1.00 10.08 ? 86  TYR B C   1 
ATOM 1682 O O   . TYR B 1 86  ? 21.374 18.304 133.820 1.00 13.35 ? 86  TYR B O   1 
ATOM 1683 C CB  . TYR B 1 86  ? 23.366 20.402 135.274 1.00 5.61  ? 86  TYR B CB  1 
ATOM 1684 C CG  . TYR B 1 86  ? 23.072 21.552 134.316 1.00 10.87 ? 86  TYR B CG  1 
ATOM 1685 C CD1 . TYR B 1 86  ? 22.968 22.868 134.777 1.00 11.33 ? 86  TYR B CD1 1 
ATOM 1686 C CD2 . TYR B 1 86  ? 23.042 21.352 132.929 1.00 13.61 ? 86  TYR B CD2 1 
ATOM 1687 C CE1 . TYR B 1 86  ? 22.850 23.966 133.881 1.00 15.61 ? 86  TYR B CE1 1 
ATOM 1688 C CE2 . TYR B 1 86  ? 22.930 22.446 132.022 1.00 15.20 ? 86  TYR B CE2 1 
ATOM 1689 C CZ  . TYR B 1 86  ? 22.843 23.746 132.509 1.00 16.41 ? 86  TYR B CZ  1 
ATOM 1690 O OH  . TYR B 1 86  ? 22.821 24.819 131.637 1.00 15.41 ? 86  TYR B OH  1 
ATOM 1691 N N   . GLY B 1 87  ? 20.186 20.059 134.511 1.00 10.65 ? 87  GLY B N   1 
ATOM 1692 C CA  . GLY B 1 87  ? 19.198 19.925 133.454 1.00 7.18  ? 87  GLY B CA  1 
ATOM 1693 C C   . GLY B 1 87  ? 18.921 21.351 133.041 1.00 8.20  ? 87  GLY B C   1 
ATOM 1694 O O   . GLY B 1 87  ? 19.283 22.263 133.789 1.00 14.73 ? 87  GLY B O   1 
ATOM 1695 N N   . LYS B 1 88  ? 18.318 21.579 131.883 1.00 5.00  ? 88  LYS B N   1 
ATOM 1696 C CA  . LYS B 1 88  ? 18.061 22.951 131.453 1.00 5.29  ? 88  LYS B CA  1 
ATOM 1697 C C   . LYS B 1 88  ? 17.241 22.942 130.184 1.00 4.50  ? 88  LYS B C   1 
ATOM 1698 O O   . LYS B 1 88  ? 17.574 22.259 129.224 1.00 6.13  ? 88  LYS B O   1 
ATOM 1699 C CB  . LYS B 1 88  ? 19.387 23.715 131.269 1.00 6.95  ? 88  LYS B CB  1 
ATOM 1700 C CG  . LYS B 1 88  ? 19.273 25.086 130.655 1.00 13.97 ? 88  LYS B CG  1 
ATOM 1701 C CD  . LYS B 1 88  ? 18.011 25.810 131.103 1.00 23.66 ? 88  LYS B CD  1 
ATOM 1702 C CE  . LYS B 1 88  ? 17.953 27.240 130.562 1.00 26.61 ? 88  LYS B CE  1 
ATOM 1703 N NZ  . LYS B 1 88  ? 18.720 28.175 131.443 1.00 31.07 ? 88  LYS B NZ  1 
ATOM 1704 N N   . ARG B 1 89  ? 16.157 23.700 130.200 1.00 3.33  ? 89  ARG B N   1 
ATOM 1705 C CA  . ARG B 1 89  ? 15.268 23.744 129.071 1.00 2.00  ? 89  ARG B CA  1 
ATOM 1706 C C   . ARG B 1 89  ? 15.847 24.455 127.892 1.00 2.00  ? 89  ARG B C   1 
ATOM 1707 O O   . ARG B 1 89  ? 16.602 25.400 128.014 1.00 2.00  ? 89  ARG B O   1 
ATOM 1708 C CB  . ARG B 1 89  ? 13.975 24.418 129.466 1.00 7.94  ? 89  ARG B CB  1 
ATOM 1709 C CG  . ARG B 1 89  ? 13.181 23.628 130.453 1.00 9.66  ? 89  ARG B CG  1 
ATOM 1710 C CD  . ARG B 1 89  ? 11.713 24.013 130.487 1.00 11.04 ? 89  ARG B CD  1 
ATOM 1711 N NE  . ARG B 1 89  ? 11.008 23.019 131.281 1.00 20.31 ? 89  ARG B NE  1 
ATOM 1712 C CZ  . ARG B 1 89  ? 10.356 21.979 130.760 1.00 28.55 ? 89  ARG B CZ  1 
ATOM 1713 N NH1 . ARG B 1 89  ? 10.303 21.824 129.432 1.00 21.10 ? 89  ARG B NH1 1 
ATOM 1714 N NH2 . ARG B 1 89  ? 9.846  21.038 131.571 1.00 27.38 ? 89  ARG B NH2 1 
ATOM 1715 N N   . LEU B 1 90  ? 15.461 24.028 126.721 1.00 2.00  ? 90  LEU B N   1 
ATOM 1716 C CA  . LEU B 1 90  ? 15.965 24.678 125.555 1.00 3.32  ? 90  LEU B CA  1 
ATOM 1717 C C   . LEU B 1 90  ? 15.214 25.983 125.387 1.00 4.89  ? 90  LEU B C   1 
ATOM 1718 O O   . LEU B 1 90  ? 14.136 26.034 124.785 1.00 9.41  ? 90  LEU B O   1 
ATOM 1719 C CB  . LEU B 1 90  ? 15.787 23.778 124.350 1.00 2.00  ? 90  LEU B CB  1 
ATOM 1720 C CG  . LEU B 1 90  ? 16.478 22.450 124.538 1.00 2.00  ? 90  LEU B CG  1 
ATOM 1721 C CD1 . LEU B 1 90  ? 16.887 22.027 123.193 1.00 2.00  ? 90  LEU B CD1 1 
ATOM 1722 C CD2 . LEU B 1 90  ? 17.694 22.563 125.421 1.00 2.00  ? 90  LEU B CD2 1 
ATOM 1723 N N   . LEU B 1 91  ? 15.779 27.064 125.891 1.00 6.12  ? 91  LEU B N   1 
ATOM 1724 C CA  . LEU B 1 91  ? 15.068 28.319 125.740 1.00 9.20  ? 91  LEU B CA  1 
ATOM 1725 C C   . LEU B 1 91  ? 15.637 29.192 124.639 1.00 8.14  ? 91  LEU B C   1 
ATOM 1726 O O   . LEU B 1 91  ? 16.659 29.836 124.853 1.00 12.13 ? 91  LEU B O   1 
ATOM 1727 C CB  . LEU B 1 91  ? 15.051 29.047 127.078 1.00 13.62 ? 91  LEU B CB  1 
ATOM 1728 C CG  . LEU B 1 91  ? 14.155 28.321 128.096 1.00 16.97 ? 91  LEU B CG  1 
ATOM 1729 C CD1 . LEU B 1 91  ? 14.407 28.808 129.551 1.00 12.12 ? 91  LEU B CD1 1 
ATOM 1730 C CD2 . LEU B 1 91  ? 12.678 28.473 127.664 1.00 15.59 ? 91  LEU B CD2 1 
ATOM 1731 N N   . LEU B 1 92  ? 15.000 29.197 123.463 1.00 5.74  ? 92  LEU B N   1 
ATOM 1732 C CA  . LEU B 1 92  ? 15.492 30.010 122.342 1.00 5.88  ? 92  LEU B CA  1 
ATOM 1733 C C   . LEU B 1 92  ? 15.164 31.495 122.462 1.00 10.80 ? 92  LEU B C   1 
ATOM 1734 O O   . LEU B 1 92  ? 14.247 31.883 123.197 1.00 17.76 ? 92  LEU B O   1 
ATOM 1735 C CB  . LEU B 1 92  ? 14.915 29.543 121.011 1.00 2.20  ? 92  LEU B CB  1 
ATOM 1736 C CG  . LEU B 1 92  ? 15.397 28.280 120.329 1.00 2.00  ? 92  LEU B CG  1 
ATOM 1737 C CD1 . LEU B 1 92  ? 14.902 28.311 118.932 1.00 2.00  ? 92  LEU B CD1 1 
ATOM 1738 C CD2 . LEU B 1 92  ? 16.869 28.241 120.293 1.00 2.00  ? 92  LEU B CD2 1 
ATOM 1739 N N   . PRO B 1 93  ? 15.887 32.347 121.706 1.00 13.56 ? 93  PRO B N   1 
ATOM 1740 C CA  . PRO B 1 93  ? 15.802 33.808 121.594 1.00 14.57 ? 93  PRO B CA  1 
ATOM 1741 C C   . PRO B 1 93  ? 14.472 34.271 121.021 1.00 15.93 ? 93  PRO B C   1 
ATOM 1742 O O   . PRO B 1 93  ? 13.968 33.688 120.049 1.00 19.18 ? 93  PRO B O   1 
ATOM 1743 C CB  . PRO B 1 93  ? 16.896 34.124 120.594 1.00 12.60 ? 93  PRO B CB  1 
ATOM 1744 C CG  . PRO B 1 93  ? 17.927 33.146 120.929 1.00 19.95 ? 93  PRO B CG  1 
ATOM 1745 C CD  . PRO B 1 93  ? 17.124 31.876 121.064 1.00 20.87 ? 93  PRO B CD  1 
ATOM 1746 N N   . ASP B 1 94  ? 13.980 35.404 121.511 1.00 17.14 ? 94  ASP B N   1 
ATOM 1747 C CA  . ASP B 1 94  ? 12.712 35.898 121.028 1.00 15.85 ? 94  ASP B CA  1 
ATOM 1748 C C   . ASP B 1 94  ? 12.668 36.171 119.546 1.00 11.95 ? 94  ASP B C   1 
ATOM 1749 O O   . ASP B 1 94  ? 11.679 35.907 118.890 1.00 9.54  ? 94  ASP B O   1 
ATOM 1750 C CB  . ASP B 1 94  ? 12.245 37.055 121.880 1.00 20.34 ? 94  ASP B CB  1 
ATOM 1751 C CG  . ASP B 1 94  ? 11.649 36.572 123.212 1.00 29.96 ? 94  ASP B CG  1 
ATOM 1752 O OD1 . ASP B 1 94  ? 11.195 35.392 123.272 1.00 38.80 ? 94  ASP B OD1 1 
ATOM 1753 O OD2 . ASP B 1 94  ? 11.642 37.342 124.207 1.00 36.51 ? 94  ASP B OD2 1 
ATOM 1754 N N   . SER B 1 95  ? 13.780 36.613 118.998 1.00 10.70 ? 95  SER B N   1 
ATOM 1755 C CA  . SER B 1 95  ? 13.862 36.850 117.566 1.00 11.82 ? 95  SER B CA  1 
ATOM 1756 C C   . SER B 1 95  ? 13.317 35.640 116.852 1.00 9.94  ? 95  SER B C   1 
ATOM 1757 O O   . SER B 1 95  ? 12.646 35.762 115.845 1.00 14.75 ? 95  SER B O   1 
ATOM 1758 C CB  . SER B 1 95  ? 15.323 36.959 117.142 1.00 16.75 ? 95  SER B CB  1 
ATOM 1759 O OG  . SER B 1 95  ? 16.138 37.423 118.222 1.00 29.62 ? 95  SER B OG  1 
ATOM 1760 N N   . VAL B 1 96  ? 13.606 34.470 117.409 1.00 7.88  ? 96  VAL B N   1 
ATOM 1761 C CA  . VAL B 1 96  ? 13.216 33.200 116.820 1.00 5.63  ? 96  VAL B CA  1 
ATOM 1762 C C   . VAL B 1 96  ? 11.918 32.631 117.321 1.00 6.05  ? 96  VAL B C   1 
ATOM 1763 O O   . VAL B 1 96  ? 11.087 32.152 116.538 1.00 3.82  ? 96  VAL B O   1 
ATOM 1764 C CB  . VAL B 1 96  ? 14.232 32.127 117.130 1.00 4.21  ? 96  VAL B CB  1 
ATOM 1765 C CG1 . VAL B 1 96  ? 14.019 30.973 116.233 1.00 4.10  ? 96  VAL B CG1 1 
ATOM 1766 C CG2 . VAL B 1 96  ? 15.628 32.656 117.024 1.00 4.16  ? 96  VAL B CG2 1 
ATOM 1767 N N   . THR B 1 97  ? 11.762 32.628 118.638 1.00 5.47  ? 97  THR B N   1 
ATOM 1768 C CA  . THR B 1 97  ? 10.573 32.048 119.225 1.00 4.41  ? 97  THR B CA  1 
ATOM 1769 C C   . THR B 1 97  ? 9.282  32.661 118.750 1.00 5.35  ? 97  THR B C   1 
ATOM 1770 O O   . THR B 1 97  ? 8.219  32.116 118.955 1.00 6.04  ? 97  THR B O   1 
ATOM 1771 C CB  . THR B 1 97  ? 10.639 32.038 120.723 1.00 2.00  ? 97  THR B CB  1 
ATOM 1772 O OG1 . THR B 1 97  ? 10.726 33.368 121.219 1.00 2.00  ? 97  THR B OG1 1 
ATOM 1773 C CG2 . THR B 1 97  ? 11.849 31.271 121.155 1.00 2.42  ? 97  THR B CG2 1 
ATOM 1774 N N   . GLU B 1 98  ? 9.364  33.783 118.073 1.00 7.71  ? 98  GLU B N   1 
ATOM 1775 C CA  . GLU B 1 98  ? 8.154  34.374 117.585 1.00 12.13 ? 98  GLU B CA  1 
ATOM 1776 C C   . GLU B 1 98  ? 7.763  33.601 116.362 1.00 13.55 ? 98  GLU B C   1 
ATOM 1777 O O   . GLU B 1 98  ? 6.580  33.450 116.075 1.00 16.94 ? 98  GLU B O   1 
ATOM 1778 C CB  . GLU B 1 98  ? 8.344  35.845 117.250 1.00 20.93 ? 98  GLU B CB  1 
ATOM 1779 C CG  . GLU B 1 98  ? 9.507  36.125 116.340 1.00 27.07 ? 98  GLU B CG  1 
ATOM 1780 C CD  . GLU B 1 98  ? 9.671  37.603 116.091 1.00 36.78 ? 98  GLU B CD  1 
ATOM 1781 O OE1 . GLU B 1 98  ? 10.823 38.092 116.159 1.00 37.72 ? 98  GLU B OE1 1 
ATOM 1782 O OE2 . GLU B 1 98  ? 8.639  38.277 115.832 1.00 41.48 ? 98  GLU B OE2 1 
ATOM 1783 N N   . TYR B 1 99  ? 8.743  33.080 115.642 1.00 10.96 ? 99  TYR B N   1 
ATOM 1784 C CA  . TYR B 1 99  ? 8.407  32.334 114.449 1.00 10.60 ? 99  TYR B CA  1 
ATOM 1785 C C   . TYR B 1 99  ? 8.154  30.910 114.862 1.00 14.01 ? 99  TYR B C   1 
ATOM 1786 O O   . TYR B 1 99  ? 8.398  29.976 114.099 1.00 18.04 ? 99  TYR B O   1 
ATOM 1787 C CB  . TYR B 1 99  ? 9.525  32.421 113.430 1.00 4.96  ? 99  TYR B CB  1 
ATOM 1788 C CG  . TYR B 1 99  ? 9.605  33.750 112.750 1.00 3.54  ? 99  TYR B CG  1 
ATOM 1789 C CD1 . TYR B 1 99  ? 10.151 34.856 113.393 1.00 7.84  ? 99  TYR B CD1 1 
ATOM 1790 C CD2 . TYR B 1 99  ? 9.139  33.904 111.459 1.00 4.38  ? 99  TYR B CD2 1 
ATOM 1791 C CE1 . TYR B 1 99  ? 10.232 36.083 112.763 1.00 10.14 ? 99  TYR B CE1 1 
ATOM 1792 C CE2 . TYR B 1 99  ? 9.212  35.115 110.816 1.00 8.40  ? 99  TYR B CE2 1 
ATOM 1793 C CZ  . TYR B 1 99  ? 9.761  36.205 111.466 1.00 11.86 ? 99  TYR B CZ  1 
ATOM 1794 O OH  . TYR B 1 99  ? 9.865  37.397 110.783 1.00 15.09 ? 99  TYR B OH  1 
ATOM 1795 N N   . ASP B 1 100 ? 7.492  30.768 116.004 1.00 13.78 ? 100 ASP B N   1 
ATOM 1796 C CA  . ASP B 1 100 ? 7.230  29.465 116.592 1.00 14.49 ? 100 ASP B CA  1 
ATOM 1797 C C   . ASP B 1 100 ? 6.585  28.328 115.786 1.00 11.03 ? 100 ASP B C   1 
ATOM 1798 O O   . ASP B 1 100 ? 6.589  27.182 116.241 1.00 9.87  ? 100 ASP B O   1 
ATOM 1799 C CB  . ASP B 1 100 ? 6.496  29.637 117.920 1.00 19.24 ? 100 ASP B CB  1 
ATOM 1800 C CG  . ASP B 1 100 ? 5.014  29.432 117.785 1.00 23.31 ? 100 ASP B CG  1 
ATOM 1801 O OD1 . ASP B 1 100 ? 4.447  29.899 116.767 1.00 25.99 ? 100 ASP B OD1 1 
ATOM 1802 O OD2 . ASP B 1 100 ? 4.424  28.780 118.679 1.00 27.22 ? 100 ASP B OD2 1 
ATOM 1803 N N   . LYS B 1 101 ? 6.000  28.597 114.633 1.00 6.37  ? 101 LYS B N   1 
ATOM 1804 C CA  . LYS B 1 101 ? 5.416  27.468 113.958 1.00 10.07 ? 101 LYS B CA  1 
ATOM 1805 C C   . LYS B 1 101 ? 6.363  26.798 112.994 1.00 13.64 ? 101 LYS B C   1 
ATOM 1806 O O   . LYS B 1 101 ? 6.022  25.779 112.385 1.00 19.38 ? 101 LYS B O   1 
ATOM 1807 C CB  . LYS B 1 101 ? 4.081  27.807 113.316 1.00 11.92 ? 101 LYS B CB  1 
ATOM 1808 C CG  . LYS B 1 101 ? 2.879  27.465 114.210 1.00 15.24 ? 101 LYS B CG  1 
ATOM 1809 C CD  . LYS B 1 101 ? 2.353  28.653 115.049 1.00 12.65 ? 101 LYS B CD  1 
ATOM 1810 C CE  . LYS B 1 101 ? 0.867  28.698 114.907 1.00 15.07 ? 101 LYS B CE  1 
ATOM 1811 N NZ  . LYS B 1 101 ? 0.478  28.257 113.492 1.00 19.61 ? 101 LYS B NZ  1 
ATOM 1812 N N   . LYS B 1 102 ? 7.562  27.352 112.857 1.00 14.64 ? 102 LYS B N   1 
ATOM 1813 C CA  . LYS B 1 102 ? 8.552  26.755 111.969 1.00 11.06 ? 102 LYS B CA  1 
ATOM 1814 C C   . LYS B 1 102 ? 9.005  25.422 112.580 1.00 9.79  ? 102 LYS B C   1 
ATOM 1815 O O   . LYS B 1 102 ? 9.236  25.325 113.807 1.00 3.50  ? 102 LYS B O   1 
ATOM 1816 C CB  . LYS B 1 102 ? 9.757  27.685 111.805 1.00 9.10  ? 102 LYS B CB  1 
ATOM 1817 C CG  . LYS B 1 102 ? 9.417  29.094 111.387 1.00 5.98  ? 102 LYS B CG  1 
ATOM 1818 C CD  . LYS B 1 102 ? 10.031 29.451 110.047 1.00 8.85  ? 102 LYS B CD  1 
ATOM 1819 C CE  . LYS B 1 102 ? 9.084  29.154 108.897 1.00 12.98 ? 102 LYS B CE  1 
ATOM 1820 N NZ  . LYS B 1 102 ? 9.639  29.588 107.579 1.00 11.86 ? 102 LYS B NZ  1 
ATOM 1821 N N   . LEU B 1 103 ? 9.138  24.422 111.704 1.00 7.89  ? 103 LEU B N   1 
ATOM 1822 C CA  . LEU B 1 103 ? 9.556  23.052 112.032 1.00 6.82  ? 103 LEU B CA  1 
ATOM 1823 C C   . LEU B 1 103 ? 11.006 22.825 112.484 1.00 7.02  ? 103 LEU B C   1 
ATOM 1824 O O   . LEU B 1 103 ? 11.943 23.332 111.859 1.00 7.35  ? 103 LEU B O   1 
ATOM 1825 C CB  . LEU B 1 103 ? 9.290  22.142 110.828 1.00 2.00  ? 103 LEU B CB  1 
ATOM 1826 C CG  . LEU B 1 103 ? 7.828  21.804 110.536 1.00 2.00  ? 103 LEU B CG  1 
ATOM 1827 C CD1 . LEU B 1 103 ? 7.671  21.085 109.228 1.00 2.00  ? 103 LEU B CD1 1 
ATOM 1828 C CD2 . LEU B 1 103 ? 7.268  20.971 111.672 1.00 3.02  ? 103 LEU B CD2 1 
ATOM 1829 N N   . VAL B 1 104 ? 11.180 22.082 113.582 1.00 5.88  ? 104 VAL B N   1 
ATOM 1830 C CA  . VAL B 1 104 ? 12.500 21.702 114.101 1.00 4.05  ? 104 VAL B CA  1 
ATOM 1831 C C   . VAL B 1 104 ? 12.716 20.308 113.518 1.00 4.12  ? 104 VAL B C   1 
ATOM 1832 O O   . VAL B 1 104 ? 11.812 19.476 113.577 1.00 4.76  ? 104 VAL B O   1 
ATOM 1833 C CB  . VAL B 1 104 ? 12.522 21.526 115.630 1.00 2.00  ? 104 VAL B CB  1 
ATOM 1834 C CG1 . VAL B 1 104 ? 13.784 20.876 116.042 1.00 2.00  ? 104 VAL B CG1 1 
ATOM 1835 C CG2 . VAL B 1 104 ? 12.460 22.818 116.310 1.00 3.21  ? 104 VAL B CG2 1 
ATOM 1836 N N   . SER B 1 105 ? 13.868 20.065 112.905 1.00 3.93  ? 105 SER B N   1 
ATOM 1837 C CA  . SER B 1 105 ? 14.151 18.759 112.332 1.00 3.52  ? 105 SER B CA  1 
ATOM 1838 C C   . SER B 1 105 ? 14.988 18.008 113.336 1.00 4.35  ? 105 SER B C   1 
ATOM 1839 O O   . SER B 1 105 ? 14.621 16.906 113.719 1.00 9.43  ? 105 SER B O   1 
ATOM 1840 C CB  . SER B 1 105 ? 14.840 18.857 110.984 1.00 2.37  ? 105 SER B CB  1 
ATOM 1841 O OG  . SER B 1 105 ? 15.958 19.711 111.082 1.00 15.90 ? 105 SER B OG  1 
ATOM 1842 N N   . ARG B 1 106 ? 16.123 18.554 113.755 1.00 2.00  ? 106 ARG B N   1 
ATOM 1843 C CA  . ARG B 1 106 ? 16.885 17.866 114.793 1.00 3.10  ? 106 ARG B CA  1 
ATOM 1844 C C   . ARG B 1 106 ? 17.664 18.797 115.682 1.00 3.03  ? 106 ARG B C   1 
ATOM 1845 O O   . ARG B 1 106 ? 17.868 19.954 115.324 1.00 4.26  ? 106 ARG B O   1 
ATOM 1846 C CB  . ARG B 1 106 ? 17.795 16.764 114.239 1.00 3.63  ? 106 ARG B CB  1 
ATOM 1847 C CG  . ARG B 1 106 ? 17.821 16.567 112.751 1.00 4.30  ? 106 ARG B CG  1 
ATOM 1848 C CD  . ARG B 1 106 ? 19.119 17.095 112.254 1.00 9.69  ? 106 ARG B CD  1 
ATOM 1849 N NE  . ARG B 1 106 ? 19.893 16.144 111.470 1.00 12.22 ? 106 ARG B NE  1 
ATOM 1850 C CZ  . ARG B 1 106 ? 20.586 16.475 110.379 1.00 22.93 ? 106 ARG B CZ  1 
ATOM 1851 N NH1 . ARG B 1 106 ? 20.590 17.733 109.921 1.00 18.17 ? 106 ARG B NH1 1 
ATOM 1852 N NH2 . ARG B 1 106 ? 21.337 15.557 109.771 1.00 25.98 ? 106 ARG B NH2 1 
ATOM 1853 N N   . LEU B 1 107 ? 17.986 18.346 116.887 1.00 2.00  ? 107 LEU B N   1 
ATOM 1854 C CA  . LEU B 1 107 ? 18.780 19.174 117.782 1.00 3.85  ? 107 LEU B CA  1 
ATOM 1855 C C   . LEU B 1 107 ? 20.066 18.452 118.065 1.00 4.92  ? 107 LEU B C   1 
ATOM 1856 O O   . LEU B 1 107 ? 20.045 17.253 118.259 1.00 8.49  ? 107 LEU B O   1 
ATOM 1857 C CB  . LEU B 1 107 ? 18.089 19.509 119.104 1.00 3.90  ? 107 LEU B CB  1 
ATOM 1858 C CG  . LEU B 1 107 ? 16.838 18.801 119.587 1.00 4.27  ? 107 LEU B CG  1 
ATOM 1859 C CD1 . LEU B 1 107 ? 16.545 19.230 121.030 1.00 4.10  ? 107 LEU B CD1 1 
ATOM 1860 C CD2 . LEU B 1 107 ? 15.676 19.126 118.676 1.00 2.52  ? 107 LEU B CD2 1 
ATOM 1861 N N   . GLN B 1 108 ? 21.183 19.168 117.977 1.00 4.32  ? 108 GLN B N   1 
ATOM 1862 C CA  . GLN B 1 108 ? 22.506 18.614 118.220 1.00 3.86  ? 108 GLN B CA  1 
ATOM 1863 C C   . GLN B 1 108 ? 23.064 19.152 119.526 1.00 2.00  ? 108 GLN B C   1 
ATOM 1864 O O   . GLN B 1 108 ? 22.911 20.320 119.781 1.00 9.14  ? 108 GLN B O   1 
ATOM 1865 C CB  . GLN B 1 108 ? 23.432 19.025 117.067 1.00 4.90  ? 108 GLN B CB  1 
ATOM 1866 C CG  . GLN B 1 108 ? 24.918 18.835 117.390 1.00 10.61 ? 108 GLN B CG  1 
ATOM 1867 C CD  . GLN B 1 108 ? 25.867 19.164 116.241 1.00 12.58 ? 108 GLN B CD  1 
ATOM 1868 O OE1 . GLN B 1 108 ? 26.048 18.369 115.310 1.00 9.63  ? 108 GLN B OE1 1 
ATOM 1869 N NE2 . GLN B 1 108 ? 26.540 20.306 116.346 1.00 12.31 ? 108 GLN B NE2 1 
ATOM 1870 N N   . ILE B 1 109 ? 23.741 18.347 120.330 1.00 2.00  ? 109 ILE B N   1 
ATOM 1871 C CA  . ILE B 1 109 ? 24.313 18.847 121.569 1.00 2.00  ? 109 ILE B CA  1 
ATOM 1872 C C   . ILE B 1 109 ? 25.777 18.710 121.365 1.00 2.26  ? 109 ILE B C   1 
ATOM 1873 O O   . ILE B 1 109 ? 26.188 17.692 120.839 1.00 9.24  ? 109 ILE B O   1 
ATOM 1874 C CB  . ILE B 1 109 ? 24.011 17.947 122.725 1.00 2.00  ? 109 ILE B CB  1 
ATOM 1875 C CG1 . ILE B 1 109 ? 22.516 17.740 122.842 1.00 6.26  ? 109 ILE B CG1 1 
ATOM 1876 C CG2 . ILE B 1 109 ? 24.570 18.543 124.007 1.00 2.00  ? 109 ILE B CG2 1 
ATOM 1877 C CD1 . ILE B 1 109 ? 21.778 19.001 123.188 1.00 9.68  ? 109 ILE B CD1 1 
ATOM 1878 N N   . ARG B 1 110 ? 26.578 19.677 121.806 1.00 3.50  ? 110 ARG B N   1 
ATOM 1879 C CA  . ARG B 1 110 ? 28.040 19.625 121.646 1.00 2.00  ? 110 ARG B CA  1 
ATOM 1880 C C   . ARG B 1 110 ? 28.731 19.896 122.942 1.00 2.00  ? 110 ARG B C   1 
ATOM 1881 O O   . ARG B 1 110 ? 28.507 20.928 123.535 1.00 4.39  ? 110 ARG B O   1 
ATOM 1882 C CB  . ARG B 1 110 ? 28.535 20.709 120.698 1.00 2.00  ? 110 ARG B CB  1 
ATOM 1883 C CG  . ARG B 1 110 ? 28.108 20.598 119.290 1.00 2.00  ? 110 ARG B CG  1 
ATOM 1884 C CD  . ARG B 1 110 ? 28.899 21.585 118.467 1.00 6.15  ? 110 ARG B CD  1 
ATOM 1885 N NE  . ARG B 1 110 ? 28.162 22.792 118.082 1.00 3.56  ? 110 ARG B NE  1 
ATOM 1886 C CZ  . ARG B 1 110 ? 28.427 24.023 118.520 1.00 6.12  ? 110 ARG B CZ  1 
ATOM 1887 N NH1 . ARG B 1 110 ? 29.417 24.244 119.388 1.00 12.57 ? 110 ARG B NH1 1 
ATOM 1888 N NH2 . ARG B 1 110 ? 27.709 25.048 118.074 1.00 6.59  ? 110 ARG B NH2 1 
ATOM 1889 N N   . VAL B 1 111 ? 29.606 19.017 123.373 1.00 2.00  ? 111 VAL B N   1 
ATOM 1890 C CA  . VAL B 1 111 ? 30.346 19.276 124.585 1.00 2.00  ? 111 VAL B CA  1 
ATOM 1891 C C   . VAL B 1 111 ? 31.761 19.669 124.172 1.00 2.00  ? 111 VAL B C   1 
ATOM 1892 O O   . VAL B 1 111 ? 32.432 18.880 123.520 1.00 2.00  ? 111 VAL B O   1 
ATOM 1893 C CB  . VAL B 1 111 ? 30.417 18.055 125.459 1.00 2.00  ? 111 VAL B CB  1 
ATOM 1894 C CG1 . VAL B 1 111 ? 31.250 18.358 126.679 1.00 2.00  ? 111 VAL B CG1 1 
ATOM 1895 C CG2 . VAL B 1 111 ? 29.025 17.628 125.832 1.00 2.00  ? 111 VAL B CG2 1 
ATOM 1896 N N   . ASN B 1 112 ? 32.144 20.930 124.403 1.00 2.00  ? 112 ASN B N   1 
ATOM 1897 C CA  . ASN B 1 112 ? 33.494 21.421 124.091 1.00 2.00  ? 112 ASN B CA  1 
ATOM 1898 C C   . ASN B 1 112 ? 34.138 21.573 125.455 1.00 2.00  ? 112 ASN B C   1 
ATOM 1899 O O   . ASN B 1 112 ? 33.555 22.156 126.340 1.00 2.00  ? 112 ASN B O   1 
ATOM 1900 C CB  . ASN B 1 112 ? 33.463 22.781 123.399 1.00 2.77  ? 112 ASN B CB  1 
ATOM 1901 C CG  . ASN B 1 112 ? 33.085 22.697 121.923 1.00 7.95  ? 112 ASN B CG  1 
ATOM 1902 O OD1 . ASN B 1 112 ? 33.881 22.247 121.099 1.00 11.72 ? 112 ASN B OD1 1 
ATOM 1903 N ND2 . ASN B 1 112 ? 31.880 23.173 121.573 1.00 5.12  ? 112 ASN B ND2 1 
ATOM 1904 N N   . PRO B 1 113 ? 35.324 21.020 125.668 1.00 2.00  ? 113 PRO B N   1 
ATOM 1905 C CA  . PRO B 1 113 ? 35.844 21.216 127.015 1.00 2.00  ? 113 PRO B CA  1 
ATOM 1906 C C   . PRO B 1 113 ? 36.836 22.337 127.149 1.00 6.05  ? 113 PRO B C   1 
ATOM 1907 O O   . PRO B 1 113 ? 37.498 22.721 126.181 1.00 10.33 ? 113 PRO B O   1 
ATOM 1908 C CB  . PRO B 1 113 ? 36.515 19.889 127.297 1.00 2.00  ? 113 PRO B CB  1 
ATOM 1909 C CG  . PRO B 1 113 ? 37.119 19.544 125.990 1.00 2.00  ? 113 PRO B CG  1 
ATOM 1910 C CD  . PRO B 1 113 ? 36.077 19.971 124.958 1.00 2.00  ? 113 PRO B CD  1 
ATOM 1911 N N   . LEU B 1 114 ? 36.956 22.857 128.360 1.00 7.02  ? 114 LEU B N   1 
ATOM 1912 C CA  . LEU B 1 114 ? 37.928 23.903 128.610 1.00 6.99  ? 114 LEU B CA  1 
ATOM 1913 C C   . LEU B 1 114 ? 39.173 23.172 129.016 1.00 9.44  ? 114 LEU B C   1 
ATOM 1914 O O   . LEU B 1 114 ? 39.082 22.071 129.544 1.00 12.02 ? 114 LEU B O   1 
ATOM 1915 C CB  . LEU B 1 114 ? 37.491 24.777 129.755 1.00 10.76 ? 114 LEU B CB  1 
ATOM 1916 C CG  . LEU B 1 114 ? 36.343 25.657 129.343 1.00 7.77  ? 114 LEU B CG  1 
ATOM 1917 C CD1 . LEU B 1 114 ? 36.164 26.717 130.432 1.00 10.08 ? 114 LEU B CD1 1 
ATOM 1918 C CD2 . LEU B 1 114 ? 36.680 26.284 127.994 1.00 4.06  ? 114 LEU B CD2 1 
ATOM 1919 N N   . PRO B 1 115 ? 40.328 23.837 128.962 1.00 10.78 ? 115 PRO B N   1 
ATOM 1920 C CA  . PRO B 1 115 ? 41.573 23.175 129.331 1.00 12.03 ? 115 PRO B CA  1 
ATOM 1921 C C   . PRO B 1 115 ? 41.615 22.569 130.748 1.00 13.65 ? 115 PRO B C   1 
ATOM 1922 O O   . PRO B 1 115 ? 42.138 21.473 130.944 1.00 18.92 ? 115 PRO B O   1 
ATOM 1923 C CB  . PRO B 1 115 ? 42.598 24.281 129.116 1.00 6.82  ? 115 PRO B CB  1 
ATOM 1924 C CG  . PRO B 1 115 ? 41.896 25.424 129.597 1.00 14.76 ? 115 PRO B CG  1 
ATOM 1925 C CD  . PRO B 1 115 ? 40.538 25.290 128.932 1.00 11.69 ? 115 PRO B CD  1 
ATOM 1926 N N   . LYS B 1 116 ? 40.994 23.223 131.712 1.00 12.69 ? 116 LYS B N   1 
ATOM 1927 C CA  . LYS B 1 116 ? 41.011 22.723 133.076 1.00 13.31 ? 116 LYS B CA  1 
ATOM 1928 C C   . LYS B 1 116 ? 40.146 21.480 133.346 1.00 13.11 ? 116 LYS B C   1 
ATOM 1929 O O   . LYS B 1 116 ? 40.280 20.840 134.389 1.00 13.04 ? 116 LYS B O   1 
ATOM 1930 C CB  . LYS B 1 116 ? 40.649 23.889 133.997 1.00 18.20 ? 116 LYS B CB  1 
ATOM 1931 C CG  . LYS B 1 116 ? 39.744 23.586 135.170 1.00 23.20 ? 116 LYS B CG  1 
ATOM 1932 C CD  . LYS B 1 116 ? 39.062 24.872 135.600 1.00 26.37 ? 116 LYS B CD  1 
ATOM 1933 C CE  . LYS B 1 116 ? 38.160 24.703 136.815 1.00 25.97 ? 116 LYS B CE  1 
ATOM 1934 N NZ  . LYS B 1 116 ? 37.472 26.011 137.010 1.00 32.10 ? 116 LYS B NZ  1 
ATOM 1935 N N   . PHE B 1 117 ? 39.291 21.120 132.394 1.00 13.46 ? 117 PHE B N   1 
ATOM 1936 C CA  . PHE B 1 117 ? 38.386 19.961 132.515 1.00 12.56 ? 117 PHE B CA  1 
ATOM 1937 C C   . PHE B 1 117 ? 39.058 18.630 132.707 1.00 11.41 ? 117 PHE B C   1 
ATOM 1938 O O   . PHE B 1 117 ? 40.018 18.331 132.009 1.00 14.81 ? 117 PHE B O   1 
ATOM 1939 C CB  . PHE B 1 117 ? 37.516 19.860 131.259 1.00 14.37 ? 117 PHE B CB  1 
ATOM 1940 C CG  . PHE B 1 117 ? 36.846 18.522 131.064 1.00 8.75  ? 117 PHE B CG  1 
ATOM 1941 C CD1 . PHE B 1 117 ? 35.943 18.028 131.992 1.00 10.52 ? 117 PHE B CD1 1 
ATOM 1942 C CD2 . PHE B 1 117 ? 37.081 17.793 129.911 1.00 5.09  ? 117 PHE B CD2 1 
ATOM 1943 C CE1 . PHE B 1 117 ? 35.286 16.838 131.765 1.00 9.55  ? 117 PHE B CE1 1 
ATOM 1944 C CE2 . PHE B 1 117 ? 36.428 16.603 129.671 1.00 5.95  ? 117 PHE B CE2 1 
ATOM 1945 C CZ  . PHE B 1 117 ? 35.533 16.121 130.595 1.00 9.34  ? 117 PHE B CZ  1 
ATOM 1946 N N   . ASP B 1 118 ? 38.425 17.768 133.494 1.00 10.12 ? 118 ASP B N   1 
ATOM 1947 C CA  . ASP B 1 118 ? 38.964 16.443 133.763 1.00 12.18 ? 118 ASP B CA  1 
ATOM 1948 C C   . ASP B 1 118 ? 37.900 15.591 134.439 1.00 10.23 ? 118 ASP B C   1 
ATOM 1949 O O   . ASP B 1 118 ? 38.116 15.065 135.525 1.00 13.91 ? 118 ASP B O   1 
ATOM 1950 C CB  . ASP B 1 118 ? 40.146 16.580 134.703 1.00 18.02 ? 118 ASP B CB  1 
ATOM 1951 C CG  . ASP B 1 118 ? 39.721 17.053 136.078 1.00 24.96 ? 118 ASP B CG  1 
ATOM 1952 O OD1 . ASP B 1 118 ? 38.711 17.803 136.169 1.00 26.94 ? 118 ASP B OD1 1 
ATOM 1953 O OD2 . ASP B 1 118 ? 40.346 16.621 137.076 1.00 29.38 ? 118 ASP B OD2 1 
ATOM 1954 N N   . SER B 1 119 ? 36.778 15.365 133.780 1.00 9.15  ? 119 SER B N   1 
ATOM 1955 C CA  . SER B 1 119 ? 35.718 14.605 134.436 1.00 9.93  ? 119 SER B CA  1 
ATOM 1956 C C   . SER B 1 119 ? 35.088 13.632 133.466 1.00 10.35 ? 119 SER B C   1 
ATOM 1957 O O   . SER B 1 119 ? 35.670 13.335 132.420 1.00 16.24 ? 119 SER B O   1 
ATOM 1958 C CB  . SER B 1 119 ? 34.649 15.570 134.950 1.00 13.93 ? 119 SER B CB  1 
ATOM 1959 O OG  . SER B 1 119 ? 35.206 16.813 135.376 1.00 11.66 ? 119 SER B OG  1 
ATOM 1960 N N   . THR B 1 120 ? 33.910 13.129 133.814 1.00 6.50  ? 120 THR B N   1 
ATOM 1961 C CA  . THR B 1 120 ? 33.175 12.215 132.954 1.00 4.26  ? 120 THR B CA  1 
ATOM 1962 C C   . THR B 1 120 ? 31.738 12.681 133.030 1.00 2.00  ? 120 THR B C   1 
ATOM 1963 O O   . THR B 1 120 ? 31.205 12.886 134.111 1.00 5.77  ? 120 THR B O   1 
ATOM 1964 C CB  . THR B 1 120 ? 33.263 10.794 133.467 1.00 2.95  ? 120 THR B CB  1 
ATOM 1965 O OG1 . THR B 1 120 ? 33.157 10.816 134.895 1.00 18.32 ? 120 THR B OG1 1 
ATOM 1966 C CG2 . THR B 1 120 ? 34.550 10.176 133.084 1.00 2.00  ? 120 THR B CG2 1 
ATOM 1967 N N   . VAL B 1 121 ? 31.129 12.929 131.899 1.00 2.00  ? 121 VAL B N   1 
ATOM 1968 C CA  . VAL B 1 121 ? 29.776 13.385 131.931 1.00 4.72  ? 121 VAL B CA  1 
ATOM 1969 C C   . VAL B 1 121 ? 29.007 12.518 130.974 1.00 7.86  ? 121 VAL B C   1 
ATOM 1970 O O   . VAL B 1 121 ? 29.575 11.953 130.034 1.00 9.70  ? 121 VAL B O   1 
ATOM 1971 C CB  . VAL B 1 121 ? 29.657 14.877 131.522 1.00 3.29  ? 121 VAL B CB  1 
ATOM 1972 C CG1 . VAL B 1 121 ? 30.590 15.720 132.331 1.00 2.00  ? 121 VAL B CG1 1 
ATOM 1973 C CG2 . VAL B 1 121 ? 29.936 15.068 130.053 1.00 2.00  ? 121 VAL B CG2 1 
ATOM 1974 N N   . TRP B 1 122 ? 27.709 12.424 131.212 1.00 8.13  ? 122 TRP B N   1 
ATOM 1975 C CA  . TRP B 1 122 ? 26.794 11.623 130.409 1.00 8.16  ? 122 TRP B CA  1 
ATOM 1976 C C   . TRP B 1 122 ? 25.749 12.638 129.929 1.00 4.16  ? 122 TRP B C   1 
ATOM 1977 O O   . TRP B 1 122 ? 25.165 13.321 130.764 1.00 4.55  ? 122 TRP B O   1 
ATOM 1978 C CB  . TRP B 1 122 ? 26.167 10.552 131.325 1.00 5.86  ? 122 TRP B CB  1 
ATOM 1979 C CG  . TRP B 1 122 ? 27.016 9.308  131.588 1.00 3.73  ? 122 TRP B CG  1 
ATOM 1980 C CD1 . TRP B 1 122 ? 28.344 9.247  131.900 1.00 4.72  ? 122 TRP B CD1 1 
ATOM 1981 C CD2 . TRP B 1 122 ? 26.559 7.971  131.560 1.00 2.00  ? 122 TRP B CD2 1 
ATOM 1982 N NE1 . TRP B 1 122 ? 28.739 7.939  132.063 1.00 2.00  ? 122 TRP B NE1 1 
ATOM 1983 C CE2 . TRP B 1 122 ? 27.651 7.142  131.855 1.00 2.00  ? 122 TRP B CE2 1 
ATOM 1984 C CE3 . TRP B 1 122 ? 25.325 7.390  131.313 1.00 2.00  ? 122 TRP B CE3 1 
ATOM 1985 C CZ2 . TRP B 1 122 ? 27.540 5.777  131.907 1.00 2.05  ? 122 TRP B CZ2 1 
ATOM 1986 C CZ3 . TRP B 1 122 ? 25.219 6.034  131.364 1.00 4.03  ? 122 TRP B CZ3 1 
ATOM 1987 C CH2 . TRP B 1 122 ? 26.314 5.238  131.657 1.00 2.18  ? 122 TRP B CH2 1 
ATOM 1988 N N   . VAL B 1 123 ? 25.427 12.670 128.640 1.00 2.00  ? 123 VAL B N   1 
ATOM 1989 C CA  . VAL B 1 123 ? 24.523 13.698 128.133 1.00 2.00  ? 123 VAL B CA  1 
ATOM 1990 C C   . VAL B 1 123 ? 23.392 13.225 127.177 1.00 4.55  ? 123 VAL B C   1 
ATOM 1991 O O   . VAL B 1 123 ? 23.604 12.280 126.441 1.00 7.69  ? 123 VAL B O   1 
ATOM 1992 C CB  . VAL B 1 123 ? 25.428 14.744 127.417 1.00 2.00  ? 123 VAL B CB  1 
ATOM 1993 C CG1 . VAL B 1 123 ? 24.648 15.908 126.917 1.00 4.79  ? 123 VAL B CG1 1 
ATOM 1994 C CG2 . VAL B 1 123 ? 26.525 15.233 128.335 1.00 2.00  ? 123 VAL B CG2 1 
ATOM 1995 N N   . THR B 1 124 ? 22.224 13.887 127.159 1.00 2.18  ? 124 THR B N   1 
ATOM 1996 C CA  . THR B 1 124 ? 21.081 13.545 126.269 1.00 2.00  ? 124 THR B CA  1 
ATOM 1997 C C   . THR B 1 124 ? 20.193 14.771 126.132 1.00 3.14  ? 124 THR B C   1 
ATOM 1998 O O   . THR B 1 124 ? 20.317 15.707 126.897 1.00 11.29 ? 124 THR B O   1 
ATOM 1999 C CB  . THR B 1 124 ? 20.083 12.639 126.939 1.00 2.00  ? 124 THR B CB  1 
ATOM 2000 O OG1 . THR B 1 124 ? 20.733 11.863 127.926 1.00 10.80 ? 124 THR B OG1 1 
ATOM 2001 C CG2 . THR B 1 124 ? 19.378 11.788 125.966 1.00 2.00  ? 124 THR B CG2 1 
ATOM 2002 N N   . VAL B 1 125 ? 19.200 14.696 125.263 1.00 2.00  ? 125 VAL B N   1 
ATOM 2003 C CA  . VAL B 1 125 ? 18.249 15.760 125.104 1.00 3.02  ? 125 VAL B CA  1 
ATOM 2004 C C   . VAL B 1 125 ? 16.942 15.055 125.040 1.00 7.89  ? 125 VAL B C   1 
ATOM 2005 O O   . VAL B 1 125 ? 16.805 14.085 124.303 1.00 11.59 ? 125 VAL B O   1 
ATOM 2006 C CB  . VAL B 1 125 ? 18.363 16.478 123.835 1.00 2.00  ? 125 VAL B CB  1 
ATOM 2007 C CG1 . VAL B 1 125 ? 18.651 17.878 124.145 1.00 11.34 ? 125 VAL B CG1 1 
ATOM 2008 C CG2 . VAL B 1 125 ? 19.381 15.873 122.951 1.00 2.00  ? 125 VAL B CG2 1 
ATOM 2009 N N   . ARG B 1 126 ? 15.922 15.599 125.681 1.00 13.45 ? 126 ARG B N   1 
ATOM 2010 C CA  . ARG B 1 126 ? 14.664 14.891 125.710 1.00 15.04 ? 126 ARG B CA  1 
ATOM 2011 C C   . ARG B 1 126 ? 13.526 15.798 126.088 1.00 17.37 ? 126 ARG B C   1 
ATOM 2012 O O   . ARG B 1 126 ? 13.738 16.792 126.780 1.00 20.01 ? 126 ARG B O   1 
ATOM 2013 C CB  . ARG B 1 126 ? 14.822 13.826 126.774 1.00 16.17 ? 126 ARG B CB  1 
ATOM 2014 C CG  . ARG B 1 126 ? 13.671 12.923 126.984 1.00 22.99 ? 126 ARG B CG  1 
ATOM 2015 C CD  . ARG B 1 126 ? 14.062 11.907 128.035 1.00 24.94 ? 126 ARG B CD  1 
ATOM 2016 N NE  . ARG B 1 126 ? 15.103 11.033 127.526 1.00 26.39 ? 126 ARG B NE  1 
ATOM 2017 C CZ  . ARG B 1 126 ? 15.136 9.729  127.737 1.00 26.17 ? 126 ARG B CZ  1 
ATOM 2018 N NH1 . ARG B 1 126 ? 14.176 9.185  128.469 1.00 23.38 ? 126 ARG B NH1 1 
ATOM 2019 N NH2 . ARG B 1 126 ? 16.108 8.981  127.196 1.00 26.44 ? 126 ARG B NH2 1 
ATOM 2020 N N   . LYS B 1 127 ? 12.328 15.449 125.608 1.00 19.93 ? 127 LYS B N   1 
ATOM 2021 C CA  . LYS B 1 127 ? 11.070 16.166 125.889 1.00 18.25 ? 127 LYS B CA  1 
ATOM 2022 C C   . LYS B 1 127 ? 10.831 15.968 127.407 1.00 17.22 ? 127 LYS B C   1 
ATOM 2023 O O   . LYS B 1 127 ? 10.731 14.849 127.901 1.00 10.23 ? 127 LYS B O   1 
ATOM 2024 C CB  . LYS B 1 127 ? 9.948  15.529 125.036 1.00 19.99 ? 127 LYS B CB  1 
ATOM 2025 C CG  . LYS B 1 127 ? 8.740  16.398 124.589 1.00 22.27 ? 127 LYS B CG  1 
ATOM 2026 C CD  . LYS B 1 127 ? 7.991  15.742 123.342 1.00 27.00 ? 127 LYS B CD  1 
ATOM 2027 C CE  . LYS B 1 127 ? 6.694  16.513 122.833 1.00 30.38 ? 127 LYS B CE  1 
ATOM 2028 N NZ  . LYS B 1 127 ? 6.240  16.248 121.382 1.00 24.76 ? 127 LYS B NZ  1 
ATOM 2029 N N   . VAL B 1 128 ? 10.847 17.043 128.169 1.00 17.10 ? 128 VAL B N   1 
ATOM 2030 C CA  . VAL B 1 128 ? 10.673 16.888 129.583 1.00 16.57 ? 128 VAL B CA  1 
ATOM 2031 C C   . VAL B 1 128 ? 9.543  17.670 130.153 1.00 22.88 ? 128 VAL B C   1 
ATOM 2032 O O   . VAL B 1 128 ? 9.669  18.858 130.424 1.00 18.10 ? 128 VAL B O   1 
ATOM 2033 C CB  . VAL B 1 128 ? 11.923 17.223 130.324 1.00 14.51 ? 128 VAL B CB  1 
ATOM 2034 C CG1 . VAL B 1 128 ? 11.654 17.222 131.809 1.00 15.89 ? 128 VAL B CG1 1 
ATOM 2035 C CG2 . VAL B 1 128 ? 12.976 16.211 129.961 1.00 17.17 ? 128 VAL B CG2 1 
ATOM 2036 N N   . PRO B 1 129 ? 8.424  16.978 130.396 1.00 30.85 ? 129 PRO B N   1 
ATOM 2037 C CA  . PRO B 1 129 ? 7.167  17.483 130.954 1.00 32.22 ? 129 PRO B CA  1 
ATOM 2038 C C   . PRO B 1 129 ? 7.264  18.089 132.350 1.00 35.03 ? 129 PRO B C   1 
ATOM 2039 O O   . PRO B 1 129 ? 7.738  17.463 133.304 1.00 30.67 ? 129 PRO B O   1 
ATOM 2040 C CB  . PRO B 1 129 ? 6.255  16.247 130.950 1.00 32.41 ? 129 PRO B CB  1 
ATOM 2041 C CG  . PRO B 1 129 ? 7.203  15.107 131.011 1.00 33.90 ? 129 PRO B CG  1 
ATOM 2042 C CD  . PRO B 1 129 ? 8.286  15.553 130.055 1.00 35.61 ? 129 PRO B CD  1 
ATOM 2043 N N   . ALA B 1 130 ? 6.749  19.314 132.440 1.00 39.52 ? 130 ALA B N   1 
ATOM 2044 C CA  . ALA B 1 130 ? 6.687  20.067 133.681 1.00 40.14 ? 130 ALA B CA  1 
ATOM 2045 C C   . ALA B 1 130 ? 5.701  19.350 134.635 1.00 41.63 ? 130 ALA B C   1 
ATOM 2046 O O   . ALA B 1 130 ? 5.384  19.849 135.729 1.00 42.85 ? 130 ALA B O   1 
ATOM 2047 C CB  . ALA B 1 130 ? 6.247  21.502 133.399 1.00 39.18 ? 130 ALA B CB  1 
ATOM 2048 N N   . SER B 1 131 ? 5.191  18.191 134.196 1.00 41.36 ? 131 SER B N   1 
ATOM 2049 C CA  . SER B 1 131 ? 4.343  17.336 135.030 1.00 39.79 ? 131 SER B CA  1 
ATOM 2050 C C   . SER B 1 131 ? 5.178  17.106 136.309 1.00 40.24 ? 131 SER B C   1 
ATOM 2051 O O   . SER B 1 131 ? 4.690  16.554 137.307 1.00 37.28 ? 131 SER B O   1 
ATOM 2052 C CB  . SER B 1 131 ? 4.125  15.984 134.327 1.00 41.67 ? 131 SER B CB  1 
ATOM 2053 O OG  . SER B 1 131 ? 5.355  15.285 134.099 1.00 35.57 ? 131 SER B OG  1 
ATOM 2054 N N   . SER B 1 132 ? 6.477  17.424 136.178 1.00 41.45 ? 132 SER B N   1 
ATOM 2055 C CA  . SER B 1 132 ? 7.507  17.364 137.213 1.00 40.78 ? 132 SER B CA  1 
ATOM 2056 C C   . SER B 1 132 ? 7.971  15.947 137.417 1.00 38.77 ? 132 SER B C   1 
ATOM 2057 O O   . SER B 1 132 ? 8.469  15.582 138.483 1.00 40.16 ? 132 SER B O   1 
ATOM 2058 C CB  . SER B 1 132 ? 7.018  18.011 138.519 1.00 43.23 ? 132 SER B CB  1 
ATOM 2059 O OG  . SER B 1 132 ? 6.660  19.377 138.293 1.00 45.05 ? 132 SER B OG  1 
ATOM 2060 N N   . ASP B 1 133 ? 7.751  15.171 136.365 1.00 38.08 ? 133 ASP B N   1 
ATOM 2061 C CA  . ASP B 1 133 ? 8.100  13.766 136.238 1.00 39.55 ? 133 ASP B CA  1 
ATOM 2062 C C   . ASP B 1 133 ? 9.395  13.278 136.954 1.00 39.17 ? 133 ASP B C   1 
ATOM 2063 O O   . ASP B 1 133 ? 10.338 12.817 136.307 1.00 42.06 ? 133 ASP B O   1 
ATOM 2064 C CB  . ASP B 1 133 ? 8.141  13.460 134.729 1.00 42.43 ? 133 ASP B CB  1 
ATOM 2065 C CG  . ASP B 1 133 ? 8.932  14.532 133.910 1.00 45.09 ? 133 ASP B CG  1 
ATOM 2066 O OD1 . ASP B 1 133 ? 9.038  15.705 134.347 1.00 44.02 ? 133 ASP B OD1 1 
ATOM 2067 O OD2 . ASP B 1 133 ? 9.462  14.188 132.823 1.00 45.39 ? 133 ASP B OD2 1 
ATOM 2068 N N   . LEU B 1 134 ? 9.418  13.350 138.285 1.00 33.75 ? 134 LEU B N   1 
ATOM 2069 C CA  . LEU B 1 134 ? 10.557 12.927 139.111 1.00 30.11 ? 134 LEU B CA  1 
ATOM 2070 C C   . LEU B 1 134 ? 11.917 13.574 138.767 1.00 28.93 ? 134 LEU B C   1 
ATOM 2071 O O   . LEU B 1 134 ? 12.061 14.316 137.781 1.00 28.13 ? 134 LEU B O   1 
ATOM 2072 C CB  . LEU B 1 134 ? 10.678 11.386 139.079 1.00 29.36 ? 134 LEU B CB  1 
ATOM 2073 C CG  . LEU B 1 134 ? 11.161 10.551 140.286 1.00 30.15 ? 134 LEU B CG  1 
ATOM 2074 C CD1 . LEU B 1 134 ? 10.890 9.080  140.014 1.00 29.76 ? 134 LEU B CD1 1 
ATOM 2075 C CD2 . LEU B 1 134 ? 12.639 10.746 140.614 1.00 28.24 ? 134 LEU B CD2 1 
ATOM 2076 N N   . SER B 1 135 ? 12.882 13.350 139.661 1.00 30.84 ? 135 SER B N   1 
ATOM 2077 C CA  . SER B 1 135 ? 14.256 13.831 139.502 1.00 31.09 ? 135 SER B CA  1 
ATOM 2078 C C   . SER B 1 135 ? 15.318 12.906 140.131 1.00 30.45 ? 135 SER B C   1 
ATOM 2079 O O   . SER B 1 135 ? 15.150 12.342 141.210 1.00 28.76 ? 135 SER B O   1 
ATOM 2080 C CB  . SER B 1 135 ? 14.386 15.299 139.919 1.00 31.04 ? 135 SER B CB  1 
ATOM 2081 O OG  . SER B 1 135 ? 13.598 16.121 139.046 1.00 31.06 ? 135 SER B OG  1 
ATOM 2082 N N   . VAL B 1 136 ? 16.371 12.716 139.345 1.00 32.49 ? 136 VAL B N   1 
ATOM 2083 C CA  . VAL B 1 136 ? 17.520 11.820 139.574 1.00 34.16 ? 136 VAL B CA  1 
ATOM 2084 C C   . VAL B 1 136 ? 17.175 10.398 139.095 1.00 34.33 ? 136 VAL B C   1 
ATOM 2085 O O   . VAL B 1 136 ? 17.891 9.834  138.263 1.00 34.69 ? 136 VAL B O   1 
ATOM 2086 C CB  . VAL B 1 136 ? 18.122 11.793 141.024 1.00 34.84 ? 136 VAL B CB  1 
ATOM 2087 C CG1 . VAL B 1 136 ? 18.553 10.343 141.374 1.00 34.13 ? 136 VAL B CG1 1 
ATOM 2088 C CG2 . VAL B 1 136 ? 19.399 12.662 141.083 1.00 26.73 ? 136 VAL B CG2 1 
ATOM 2089 N N   . ALA B 1 137 ? 16.079 9.833  139.589 1.00 32.54 ? 137 ALA B N   1 
ATOM 2090 C CA  . ALA B 1 137 ? 15.711 8.505  139.148 1.00 31.26 ? 137 ALA B CA  1 
ATOM 2091 C C   . ALA B 1 137 ? 15.577 8.644  137.653 1.00 29.82 ? 137 ALA B C   1 
ATOM 2092 O O   . ALA B 1 137 ? 16.519 8.351  136.919 1.00 26.74 ? 137 ALA B O   1 
ATOM 2093 C CB  . ALA B 1 137 ? 14.379 8.064  139.759 1.00 35.41 ? 137 ALA B CB  1 
ATOM 2094 N N   . ALA B 1 138 ? 14.474 9.239  137.216 1.00 28.24 ? 138 ALA B N   1 
ATOM 2095 C CA  . ALA B 1 138 ? 14.246 9.402  135.786 1.00 30.74 ? 138 ALA B CA  1 
ATOM 2096 C C   . ALA B 1 138 ? 15.419 10.119 135.028 1.00 28.30 ? 138 ALA B C   1 
ATOM 2097 O O   . ALA B 1 138 ? 15.591 9.960  133.809 1.00 28.62 ? 138 ALA B O   1 
ATOM 2098 C CB  . ALA B 1 138 ? 12.859 10.058 135.526 1.00 33.31 ? 138 ALA B CB  1 
ATOM 2099 N N   . ILE B 1 139 ? 16.245 10.881 135.740 1.00 22.76 ? 139 ILE B N   1 
ATOM 2100 C CA  . ILE B 1 139 ? 17.380 11.479 135.062 1.00 17.67 ? 139 ILE B CA  1 
ATOM 2101 C C   . ILE B 1 139 ? 18.175 10.263 134.597 1.00 18.77 ? 139 ILE B C   1 
ATOM 2102 O O   . ILE B 1 139 ? 18.125 9.895  133.402 1.00 18.21 ? 139 ILE B O   1 
ATOM 2103 C CB  . ILE B 1 139 ? 18.182 12.375 136.020 1.00 15.02 ? 139 ILE B CB  1 
ATOM 2104 C CG1 . ILE B 1 139 ? 17.458 13.712 136.136 1.00 10.89 ? 139 ILE B CG1 1 
ATOM 2105 C CG2 . ILE B 1 139 ? 19.650 12.494 135.603 1.00 12.67 ? 139 ILE B CG2 1 
ATOM 2106 C CD1 . ILE B 1 139 ? 16.358 13.925 135.069 1.00 12.84 ? 139 ILE B CD1 1 
ATOM 2107 N N   . SER B 1 140 ? 18.724 9.539  135.576 1.00 16.93 ? 140 SER B N   1 
ATOM 2108 C CA  . SER B 1 140 ? 19.506 8.327  135.332 1.00 16.22 ? 140 SER B CA  1 
ATOM 2109 C C   . SER B 1 140 ? 18.738 7.226  134.594 1.00 16.00 ? 140 SER B C   1 
ATOM 2110 O O   . SER B 1 140 ? 19.325 6.327  133.996 1.00 18.81 ? 140 SER B O   1 
ATOM 2111 C CB  . SER B 1 140 ? 20.035 7.787  136.644 1.00 13.38 ? 140 SER B CB  1 
ATOM 2112 O OG  . SER B 1 140 ? 20.875 8.739  137.258 1.00 13.80 ? 140 SER B OG  1 
ATOM 2113 N N   . ALA B 1 141 ? 17.423 7.299  134.642 1.00 13.96 ? 141 ALA B N   1 
ATOM 2114 C CA  . ALA B 1 141 ? 16.597 6.338  133.949 1.00 13.15 ? 141 ALA B CA  1 
ATOM 2115 C C   . ALA B 1 141 ? 16.658 6.652  132.470 1.00 14.34 ? 141 ALA B C   1 
ATOM 2116 O O   . ALA B 1 141 ? 16.596 5.746  131.639 1.00 17.14 ? 141 ALA B O   1 
ATOM 2117 C CB  . ALA B 1 141 ? 15.165 6.469  134.408 1.00 17.01 ? 141 ALA B CB  1 
ATOM 2118 N N   . MET B 1 142 ? 16.752 7.938  132.146 1.00 12.77 ? 142 MET B N   1 
ATOM 2119 C CA  . MET B 1 142 ? 16.773 8.375  130.766 1.00 12.98 ? 142 MET B CA  1 
ATOM 2120 C C   . MET B 1 142 ? 18.008 7.936  129.995 1.00 12.36 ? 142 MET B C   1 
ATOM 2121 O O   . MET B 1 142 ? 17.989 7.828  128.741 1.00 8.77  ? 142 MET B O   1 
ATOM 2122 C CB  . MET B 1 142 ? 16.551 9.870  130.712 1.00 15.25 ? 142 MET B CB  1 
ATOM 2123 C CG  . MET B 1 142 ? 15.126 10.256 131.065 1.00 17.04 ? 142 MET B CG  1 
ATOM 2124 S SD  . MET B 1 142 ? 15.007 11.890 131.787 1.00 22.35 ? 142 MET B SD  1 
ATOM 2125 C CE  . MET B 1 142 ? 13.418 12.276 131.183 1.00 20.86 ? 142 MET B CE  1 
ATOM 2126 N N   . PHE B 1 143 ? 19.061 7.630  130.749 1.00 10.85 ? 143 PHE B N   1 
ATOM 2127 C CA  . PHE B 1 143 ? 20.295 7.128  130.156 1.00 11.70 ? 143 PHE B CA  1 
ATOM 2128 C C   . PHE B 1 143 ? 20.179 5.648  129.702 1.00 12.32 ? 143 PHE B C   1 
ATOM 2129 O O   . PHE B 1 143 ? 20.768 5.228  128.699 1.00 13.00 ? 143 PHE B O   1 
ATOM 2130 C CB  . PHE B 1 143 ? 21.428 7.292  131.155 1.00 5.49  ? 143 PHE B CB  1 
ATOM 2131 C CG  . PHE B 1 143 ? 21.736 8.706  131.455 1.00 4.75  ? 143 PHE B CG  1 
ATOM 2132 C CD1 . PHE B 1 143 ? 21.669 9.187  132.748 1.00 9.99  ? 143 PHE B CD1 1 
ATOM 2133 C CD2 . PHE B 1 143 ? 22.054 9.578  130.437 1.00 2.00  ? 143 PHE B CD2 1 
ATOM 2134 C CE1 . PHE B 1 143 ? 21.913 10.538 133.021 1.00 6.47  ? 143 PHE B CE1 1 
ATOM 2135 C CE2 . PHE B 1 143 ? 22.297 10.915 130.696 1.00 3.76  ? 143 PHE B CE2 1 
ATOM 2136 C CZ  . PHE B 1 143 ? 22.226 11.395 131.991 1.00 4.86  ? 143 PHE B CZ  1 
ATOM 2137 N N   . ALA B 1 144 ? 19.373 4.883  130.432 1.00 11.39 ? 144 ALA B N   1 
ATOM 2138 C CA  . ALA B 1 144 ? 19.168 3.464  130.169 1.00 9.24  ? 144 ALA B CA  1 
ATOM 2139 C C   . ALA B 1 144 ? 17.923 3.112  129.380 1.00 9.76  ? 144 ALA B C   1 
ATOM 2140 O O   . ALA B 1 144 ? 17.896 2.103  128.697 1.00 10.25 ? 144 ALA B O   1 
ATOM 2141 C CB  . ALA B 1 144 ? 19.156 2.694  131.488 1.00 7.78  ? 144 ALA B CB  1 
ATOM 2142 N N   . ASP B 1 145 ? 16.884 3.921  129.466 1.00 11.63 ? 145 ASP B N   1 
ATOM 2143 C CA  . ASP B 1 145 ? 15.656 3.577  128.764 1.00 13.03 ? 145 ASP B CA  1 
ATOM 2144 C C   . ASP B 1 145 ? 15.714 3.457  127.242 1.00 11.11 ? 145 ASP B C   1 
ATOM 2145 O O   . ASP B 1 145 ? 14.790 2.950  126.616 1.00 9.00  ? 145 ASP B O   1 
ATOM 2146 C CB  . ASP B 1 145 ? 14.503 4.482  129.211 1.00 18.89 ? 145 ASP B CB  1 
ATOM 2147 C CG  . ASP B 1 145 ? 14.659 5.932  128.767 1.00 20.19 ? 145 ASP B CG  1 
ATOM 2148 O OD1 . ASP B 1 145 ? 15.732 6.345  128.274 1.00 23.72 ? 145 ASP B OD1 1 
ATOM 2149 O OD2 . ASP B 1 145 ? 13.667 6.666  128.922 1.00 21.00 ? 145 ASP B OD2 1 
ATOM 2150 N N   . GLY B 1 146 ? 16.803 3.904  126.640 1.00 11.46 ? 146 GLY B N   1 
ATOM 2151 C CA  . GLY B 1 146 ? 16.888 3.812  125.195 1.00 12.54 ? 146 GLY B CA  1 
ATOM 2152 C C   . GLY B 1 146 ? 15.889 4.721  124.503 1.00 14.79 ? 146 GLY B C   1 
ATOM 2153 O O   . GLY B 1 146 ? 15.509 4.489  123.350 1.00 15.96 ? 146 GLY B O   1 
ATOM 2154 N N   . ALA B 1 147 ? 15.493 5.784  125.207 1.00 13.83 ? 147 ALA B N   1 
ATOM 2155 C CA  . ALA B 1 147 ? 14.539 6.757  124.692 1.00 11.75 ? 147 ALA B CA  1 
ATOM 2156 C C   . ALA B 1 147 ? 15.246 7.819  123.850 1.00 13.01 ? 147 ALA B C   1 
ATOM 2157 O O   . ALA B 1 147 ? 14.843 8.103  122.716 1.00 11.45 ? 147 ALA B O   1 
ATOM 2158 C CB  . ALA B 1 147 ? 13.817 7.410  125.832 1.00 4.34  ? 147 ALA B CB  1 
ATOM 2159 N N   . SER B 1 148 ? 16.320 8.380  124.404 1.00 11.82 ? 148 SER B N   1 
ATOM 2160 C CA  . SER B 1 148 ? 17.075 9.417  123.727 1.00 10.32 ? 148 SER B CA  1 
ATOM 2161 C C   . SER B 1 148 ? 18.533 9.064  123.638 1.00 8.52  ? 148 SER B C   1 
ATOM 2162 O O   . SER B 1 148 ? 19.030 8.336  124.496 1.00 12.16 ? 148 SER B O   1 
ATOM 2163 C CB  . SER B 1 148 ? 16.925 10.696 124.502 1.00 11.70 ? 148 SER B CB  1 
ATOM 2164 O OG  . SER B 1 148 ? 15.602 11.160 124.378 1.00 24.59 ? 148 SER B OG  1 
ATOM 2165 N N   . PRO B 1 149 ? 19.261 9.652  122.665 1.00 5.43  ? 149 PRO B N   1 
ATOM 2166 C CA  . PRO B 1 149 ? 20.689 9.462  122.381 1.00 4.72  ? 149 PRO B CA  1 
ATOM 2167 C C   . PRO B 1 149 ? 21.612 9.814  123.546 1.00 5.48  ? 149 PRO B C   1 
ATOM 2168 O O   . PRO B 1 149 ? 21.459 10.883 124.138 1.00 9.77  ? 149 PRO B O   1 
ATOM 2169 C CB  . PRO B 1 149 ? 20.940 10.455 121.231 1.00 4.07  ? 149 PRO B CB  1 
ATOM 2170 C CG  . PRO B 1 149 ? 19.638 10.633 120.604 1.00 2.13  ? 149 PRO B CG  1 
ATOM 2171 C CD  . PRO B 1 149 ? 18.723 10.712 121.792 1.00 2.24  ? 149 PRO B CD  1 
ATOM 2172 N N   . VAL B 1 150 ? 22.599 8.964  123.829 1.00 2.00  ? 150 VAL B N   1 
ATOM 2173 C CA  . VAL B 1 150 ? 23.560 9.232  124.898 1.00 2.53  ? 150 VAL B CA  1 
ATOM 2174 C C   . VAL B 1 150 ? 25.011 9.460  124.430 1.00 4.33  ? 150 VAL B C   1 
ATOM 2175 O O   . VAL B 1 150 ? 25.543 8.721  123.589 1.00 3.34  ? 150 VAL B O   1 
ATOM 2176 C CB  . VAL B 1 150 ? 23.537 8.148  125.952 1.00 2.00  ? 150 VAL B CB  1 
ATOM 2177 C CG1 . VAL B 1 150 ? 24.477 8.470  127.057 1.00 2.00  ? 150 VAL B CG1 1 
ATOM 2178 C CG2 . VAL B 1 150 ? 22.189 8.061  126.514 1.00 2.00  ? 150 VAL B CG2 1 
ATOM 2179 N N   . LEU B 1 151 ? 25.612 10.530 124.943 1.00 3.67  ? 151 LEU B N   1 
ATOM 2180 C CA  . LEU B 1 151 ? 26.994 10.873 124.657 1.00 4.50  ? 151 LEU B CA  1 
ATOM 2181 C C   . LEU B 1 151 ? 27.723 10.606 125.950 1.00 5.16  ? 151 LEU B C   1 
ATOM 2182 O O   . LEU B 1 151 ? 27.110 10.653 127.018 1.00 11.27 ? 151 LEU B O   1 
ATOM 2183 C CB  . LEU B 1 151 ? 27.137 12.361 124.386 1.00 3.98  ? 151 LEU B CB  1 
ATOM 2184 C CG  . LEU B 1 151 ? 28.558 12.693 123.916 1.00 3.33  ? 151 LEU B CG  1 
ATOM 2185 C CD1 . LEU B 1 151 ? 28.614 12.590 122.362 1.00 6.56  ? 151 LEU B CD1 1 
ATOM 2186 C CD2 . LEU B 1 151 ? 28.974 14.067 124.383 1.00 2.00  ? 151 LEU B CD2 1 
ATOM 2187 N N   . VAL B 1 152 ? 29.027 10.370 125.880 1.00 4.41  ? 152 VAL B N   1 
ATOM 2188 C CA  . VAL B 1 152 ? 29.830 10.135 127.097 1.00 7.09  ? 152 VAL B CA  1 
ATOM 2189 C C   . VAL B 1 152 ? 31.200 10.842 126.920 1.00 8.90  ? 152 VAL B C   1 
ATOM 2190 O O   . VAL B 1 152 ? 32.134 10.301 126.315 1.00 18.45 ? 152 VAL B O   1 
ATOM 2191 C CB  . VAL B 1 152 ? 30.024 8.594  127.409 1.00 2.39  ? 152 VAL B CB  1 
ATOM 2192 C CG1 . VAL B 1 152 ? 30.542 8.402  128.808 1.00 2.00  ? 152 VAL B CG1 1 
ATOM 2193 C CG2 . VAL B 1 152 ? 28.728 7.837  127.249 1.00 2.00  ? 152 VAL B CG2 1 
ATOM 2194 N N   . TYR B 1 153 ? 31.309 12.063 127.415 1.00 5.42  ? 153 TYR B N   1 
ATOM 2195 C CA  . TYR B 1 153 ? 32.529 12.807 127.273 1.00 2.00  ? 153 TYR B CA  1 
ATOM 2196 C C   . TYR B 1 153 ? 33.308 12.512 128.497 1.00 2.00  ? 153 TYR B C   1 
ATOM 2197 O O   . TYR B 1 153 ? 32.792 12.719 129.574 1.00 2.00  ? 153 TYR B O   1 
ATOM 2198 C CB  . TYR B 1 153 ? 32.210 14.269 127.224 1.00 2.00  ? 153 TYR B CB  1 
ATOM 2199 C CG  . TYR B 1 153 ? 33.151 14.974 126.376 1.00 2.00  ? 153 TYR B CG  1 
ATOM 2200 C CD1 . TYR B 1 153 ? 33.167 14.744 125.033 1.00 2.00  ? 153 TYR B CD1 1 
ATOM 2201 C CD2 . TYR B 1 153 ? 34.122 15.773 126.931 1.00 2.00  ? 153 TYR B CD2 1 
ATOM 2202 C CE1 . TYR B 1 153 ? 34.139 15.278 124.251 1.00 2.00  ? 153 TYR B CE1 1 
ATOM 2203 C CE2 . TYR B 1 153 ? 35.110 16.324 126.160 1.00 2.00  ? 153 TYR B CE2 1 
ATOM 2204 C CZ  . TYR B 1 153 ? 35.119 16.073 124.815 1.00 2.00  ? 153 TYR B CZ  1 
ATOM 2205 O OH  . TYR B 1 153 ? 36.101 16.620 124.024 1.00 4.96  ? 153 TYR B OH  1 
ATOM 2206 N N   . GLN B 1 154 ? 34.574 12.147 128.332 1.00 2.00  ? 154 GLN B N   1 
ATOM 2207 C CA  . GLN B 1 154 ? 35.463 11.757 129.429 1.00 3.58  ? 154 GLN B CA  1 
ATOM 2208 C C   . GLN B 1 154 ? 36.874 12.299 129.247 1.00 5.13  ? 154 GLN B C   1 
ATOM 2209 O O   . GLN B 1 154 ? 37.433 12.166 128.171 1.00 7.11  ? 154 GLN B O   1 
ATOM 2210 C CB  . GLN B 1 154 ? 35.523 10.244 129.362 1.00 8.05  ? 154 GLN B CB  1 
ATOM 2211 C CG  . GLN B 1 154 ? 36.150 9.465  130.491 1.00 16.24 ? 154 GLN B CG  1 
ATOM 2212 C CD  . GLN B 1 154 ? 35.567 8.044  130.504 1.00 24.57 ? 154 GLN B CD  1 
ATOM 2213 O OE1 . GLN B 1 154 ? 35.122 7.535  129.457 1.00 27.83 ? 154 GLN B OE1 1 
ATOM 2214 N NE2 . GLN B 1 154 ? 35.485 7.433  131.691 1.00 26.22 ? 154 GLN B NE2 1 
ATOM 2215 N N   . TYR B 1 155 ? 37.494 12.857 130.281 1.00 9.24  ? 155 TYR B N   1 
ATOM 2216 C CA  . TYR B 1 155 ? 38.860 13.383 130.110 1.00 12.21 ? 155 TYR B CA  1 
ATOM 2217 C C   . TYR B 1 155 ? 39.871 12.355 129.663 1.00 14.39 ? 155 TYR B C   1 
ATOM 2218 O O   . TYR B 1 155 ? 40.168 11.419 130.390 1.00 12.12 ? 155 TYR B O   1 
ATOM 2219 C CB  . TYR B 1 155 ? 39.441 14.028 131.372 1.00 15.06 ? 155 TYR B CB  1 
ATOM 2220 C CG  . TYR B 1 155 ? 40.952 14.237 131.249 1.00 18.12 ? 155 TYR B CG  1 
ATOM 2221 C CD1 . TYR B 1 155 ? 41.484 15.090 130.281 1.00 24.84 ? 155 TYR B CD1 1 
ATOM 2222 C CD2 . TYR B 1 155 ? 41.842 13.518 132.037 1.00 21.24 ? 155 TYR B CD2 1 
ATOM 2223 C CE1 . TYR B 1 155 ? 42.864 15.212 130.103 1.00 31.27 ? 155 TYR B CE1 1 
ATOM 2224 C CE2 . TYR B 1 155 ? 43.225 13.625 131.871 1.00 25.28 ? 155 TYR B CE2 1 
ATOM 2225 C CZ  . TYR B 1 155 ? 43.735 14.470 130.906 1.00 28.82 ? 155 TYR B CZ  1 
ATOM 2226 O OH  . TYR B 1 155 ? 45.110 14.564 130.724 1.00 33.68 ? 155 TYR B OH  1 
ATOM 2227 N N   . ALA B 1 156 ? 40.539 12.636 128.555 1.00 17.89 ? 156 ALA B N   1 
ATOM 2228 C CA  . ALA B 1 156 ? 41.535 11.695 128.059 1.00 20.11 ? 156 ALA B CA  1 
ATOM 2229 C C   . ALA B 1 156 ? 42.882 12.070 128.581 1.00 20.31 ? 156 ALA B C   1 
ATOM 2230 O O   . ALA B 1 156 ? 43.339 13.188 128.342 1.00 19.97 ? 156 ALA B O   1 
ATOM 2231 C CB  . ALA B 1 156 ? 41.591 11.707 126.535 1.00 21.86 ? 156 ALA B CB  1 
ATOM 2232 N N   . ALA B 1 157 ? 43.538 11.140 129.264 1.00 21.16 ? 157 ALA B N   1 
ATOM 2233 C CA  . ALA B 1 157 ? 44.907 11.402 129.744 1.00 26.38 ? 157 ALA B CA  1 
ATOM 2234 C C   . ALA B 1 157 ? 45.756 11.814 128.486 1.00 28.96 ? 157 ALA B C   1 
ATOM 2235 O O   . ALA B 1 157 ? 46.500 12.831 128.466 1.00 25.83 ? 157 ALA B O   1 
ATOM 2236 C CB  . ALA B 1 157 ? 45.500 10.111 130.400 1.00 24.34 ? 157 ALA B CB  1 
ATOM 2237 N N   . SER B 1 158 ? 45.544 11.016 127.434 1.00 29.04 ? 158 SER B N   1 
ATOM 2238 C CA  . SER B 1 158 ? 46.151 11.114 126.100 1.00 25.27 ? 158 SER B CA  1 
ATOM 2239 C C   . SER B 1 158 ? 45.889 12.448 125.343 1.00 24.39 ? 158 SER B C   1 
ATOM 2240 O O   . SER B 1 158 ? 46.722 12.879 124.504 1.00 24.03 ? 158 SER B O   1 
ATOM 2241 C CB  . SER B 1 158 ? 45.615 9.925  125.273 1.00 25.53 ? 158 SER B CB  1 
ATOM 2242 O OG  . SER B 1 158 ? 44.366 9.458  125.823 1.00 26.51 ? 158 SER B OG  1 
ATOM 2243 N N   . GLY B 1 159 ? 44.721 13.053 125.603 1.00 21.59 ? 159 GLY B N   1 
ATOM 2244 C CA  . GLY B 1 159 ? 44.351 14.309 124.960 1.00 25.05 ? 159 GLY B CA  1 
ATOM 2245 C C   . GLY B 1 159 ? 42.970 14.890 125.304 1.00 26.91 ? 159 GLY B C   1 
ATOM 2246 O O   . GLY B 1 159 ? 42.608 15.086 126.502 1.00 31.35 ? 159 GLY B O   1 
ATOM 2247 N N   . VAL B 1 160 ? 42.209 15.200 124.245 1.00 20.28 ? 160 VAL B N   1 
ATOM 2248 C CA  . VAL B 1 160 ? 40.868 15.772 124.351 1.00 12.16 ? 160 VAL B CA  1 
ATOM 2249 C C   . VAL B 1 160 ? 40.056 14.835 123.484 1.00 10.24 ? 160 VAL B C   1 
ATOM 2250 O O   . VAL B 1 160 ? 40.502 14.479 122.377 1.00 12.04 ? 160 VAL B O   1 
ATOM 2251 C CB  . VAL B 1 160 ? 40.866 17.219 123.770 1.00 7.24  ? 160 VAL B CB  1 
ATOM 2252 C CG1 . VAL B 1 160 ? 39.544 17.593 123.126 1.00 4.47  ? 160 VAL B CG1 1 
ATOM 2253 C CG2 . VAL B 1 160 ? 41.186 18.186 124.848 1.00 5.17  ? 160 VAL B CG2 1 
ATOM 2254 N N   . GLN B 1 161 ? 38.932 14.360 124.021 1.00 7.09  ? 161 GLN B N   1 
ATOM 2255 C CA  . GLN B 1 161 ? 38.047 13.444 123.291 1.00 3.81  ? 161 GLN B CA  1 
ATOM 2256 C C   . GLN B 1 161 ? 37.512 14.036 122.000 1.00 3.84  ? 161 GLN B C   1 
ATOM 2257 O O   . GLN B 1 161 ? 36.654 14.908 122.030 1.00 2.00  ? 161 GLN B O   1 
ATOM 2258 C CB  . GLN B 1 161 ? 36.884 13.039 124.176 1.00 2.00  ? 161 GLN B CB  1 
ATOM 2259 C CG  . GLN B 1 161 ? 35.842 12.214 123.463 1.00 2.00  ? 161 GLN B CG  1 
ATOM 2260 C CD  . GLN B 1 161 ? 35.030 11.407 124.435 1.00 4.12  ? 161 GLN B CD  1 
ATOM 2261 O OE1 . GLN B 1 161 ? 35.526 11.026 125.514 1.00 5.28  ? 161 GLN B OE1 1 
ATOM 2262 N NE2 . GLN B 1 161 ? 33.772 11.160 124.090 1.00 2.00  ? 161 GLN B NE2 1 
ATOM 2263 N N   . ALA B 1 162 ? 37.935 13.498 120.867 1.00 2.00  ? 162 ALA B N   1 
ATOM 2264 C CA  . ALA B 1 162 ? 37.493 14.075 119.605 1.00 8.94  ? 162 ALA B CA  1 
ATOM 2265 C C   . ALA B 1 162 ? 36.007 14.011 119.399 1.00 12.41 ? 162 ALA B C   1 
ATOM 2266 O O   . ALA B 1 162 ? 35.410 14.910 118.789 1.00 11.47 ? 162 ALA B O   1 
ATOM 2267 C CB  . ALA B 1 162 ? 38.191 13.455 118.450 1.00 11.68 ? 162 ALA B CB  1 
ATOM 2268 N N   . ASN B 1 163 ? 35.419 12.912 119.860 1.00 15.64 ? 163 ASN B N   1 
ATOM 2269 C CA  . ASN B 1 163 ? 33.974 12.693 119.762 1.00 15.39 ? 163 ASN B CA  1 
ATOM 2270 C C   . ASN B 1 163 ? 33.198 13.512 120.844 1.00 11.54 ? 163 ASN B C   1 
ATOM 2271 O O   . ASN B 1 163 ? 32.901 13.040 121.939 1.00 3.26  ? 163 ASN B O   1 
ATOM 2272 C CB  . ASN B 1 163 ? 33.714 11.195 119.855 1.00 17.05 ? 163 ASN B CB  1 
ATOM 2273 C CG  . ASN B 1 163 ? 32.326 10.884 120.335 1.00 26.99 ? 163 ASN B CG  1 
ATOM 2274 O OD1 . ASN B 1 163 ? 32.136 10.513 121.499 1.00 31.85 ? 163 ASN B OD1 1 
ATOM 2275 N ND2 . ASN B 1 163 ? 31.334 11.068 119.464 1.00 30.69 ? 163 ASN B ND2 1 
ATOM 2276 N N   . ASN B 1 164 ? 32.912 14.760 120.508 1.00 9.49  ? 164 ASN B N   1 
ATOM 2277 C CA  . ASN B 1 164 ? 32.256 15.688 121.399 1.00 7.28  ? 164 ASN B CA  1 
ATOM 2278 C C   . ASN B 1 164 ? 30.798 15.929 121.157 1.00 8.87  ? 164 ASN B C   1 
ATOM 2279 O O   . ASN B 1 164 ? 30.291 16.888 121.711 1.00 11.24 ? 164 ASN B O   1 
ATOM 2280 C CB  . ASN B 1 164 ? 32.925 17.068 121.268 1.00 8.05  ? 164 ASN B CB  1 
ATOM 2281 C CG  . ASN B 1 164 ? 32.622 17.763 119.908 1.00 12.68 ? 164 ASN B CG  1 
ATOM 2282 O OD1 . ASN B 1 164 ? 32.124 17.140 118.951 1.00 11.30 ? 164 ASN B OD1 1 
ATOM 2283 N ND2 . ASN B 1 164 ? 32.961 19.048 119.814 1.00 18.74 ? 164 ASN B ND2 1 
ATOM 2284 N N   . LYS B 1 165 ? 30.105 15.155 120.331 1.00 7.28  ? 165 LYS B N   1 
ATOM 2285 C CA  . LYS B 1 165 ? 28.706 15.525 120.095 1.00 6.19  ? 165 LYS B CA  1 
ATOM 2286 C C   . LYS B 1 165 ? 27.736 14.453 119.638 1.00 9.26  ? 165 LYS B C   1 
ATOM 2287 O O   . LYS B 1 165 ? 28.145 13.481 118.976 1.00 12.17 ? 165 LYS B O   1 
ATOM 2288 C CB  . LYS B 1 165 ? 28.623 16.714 119.113 1.00 2.99  ? 165 LYS B CB  1 
ATOM 2289 C CG  . LYS B 1 165 ? 29.353 16.519 117.799 1.00 2.00  ? 165 LYS B CG  1 
ATOM 2290 C CD  . LYS B 1 165 ? 28.806 17.379 116.666 1.00 2.00  ? 165 LYS B CD  1 
ATOM 2291 C CE  . LYS B 1 165 ? 29.833 18.399 116.224 1.00 2.00  ? 165 LYS B CE  1 
ATOM 2292 N NZ  . LYS B 1 165 ? 31.258 17.997 116.485 1.00 2.00  ? 165 LYS B NZ  1 
ATOM 2293 N N   . LEU B 1 166 ? 26.447 14.716 119.912 1.00 6.25  ? 166 LEU B N   1 
ATOM 2294 C CA  . LEU B 1 166 ? 25.311 13.846 119.576 1.00 3.20  ? 166 LEU B CA  1 
ATOM 2295 C C   . LEU B 1 166 ? 24.279 14.560 118.692 1.00 2.00  ? 166 LEU B C   1 
ATOM 2296 O O   . LEU B 1 166 ? 23.880 15.665 118.999 1.00 5.49  ? 166 LEU B O   1 
ATOM 2297 C CB  . LEU B 1 166 ? 24.622 13.407 120.865 1.00 3.84  ? 166 LEU B CB  1 
ATOM 2298 C CG  . LEU B 1 166 ? 23.489 14.269 121.413 1.00 2.00  ? 166 LEU B CG  1 
ATOM 2299 C CD1 . LEU B 1 166 ? 22.174 13.902 120.732 1.00 2.00  ? 166 LEU B CD1 1 
ATOM 2300 C CD2 . LEU B 1 166 ? 23.385 14.026 122.900 1.00 4.24  ? 166 LEU B CD2 1 
ATOM 2301 N N   . LEU B 1 167 ? 23.739 13.880 117.691 1.00 2.00  ? 167 LEU B N   1 
ATOM 2302 C CA  . LEU B 1 167 ? 22.778 14.493 116.790 1.00 2.00  ? 167 LEU B CA  1 
ATOM 2303 C C   . LEU B 1 167 ? 21.469 13.775 116.878 1.00 2.00  ? 167 LEU B C   1 
ATOM 2304 O O   . LEU B 1 167 ? 21.279 12.759 116.241 1.00 7.58  ? 167 LEU B O   1 
ATOM 2305 C CB  . LEU B 1 167 ? 23.260 14.398 115.365 1.00 2.00  ? 167 LEU B CB  1 
ATOM 2306 C CG  . LEU B 1 167 ? 22.266 15.157 114.515 1.00 2.00  ? 167 LEU B CG  1 
ATOM 2307 C CD1 . LEU B 1 167 ? 22.562 16.626 114.692 1.00 6.05  ? 167 LEU B CD1 1 
ATOM 2308 C CD2 . LEU B 1 167 ? 22.383 14.774 113.066 1.00 4.17  ? 167 LEU B CD2 1 
ATOM 2309 N N   . TYR B 1 168 ? 20.527 14.382 117.571 1.00 3.44  ? 168 TYR B N   1 
ATOM 2310 C CA  . TYR B 1 168 ? 19.195 13.819 117.839 1.00 4.20  ? 168 TYR B CA  1 
ATOM 2311 C C   . TYR B 1 168 ? 18.094 14.301 116.902 1.00 3.00  ? 168 TYR B C   1 
ATOM 2312 O O   . TYR B 1 168 ? 17.689 15.450 116.971 1.00 7.51  ? 168 TYR B O   1 
ATOM 2313 C CB  . TYR B 1 168 ? 18.879 14.192 119.280 1.00 6.34  ? 168 TYR B CB  1 
ATOM 2314 C CG  . TYR B 1 168 ? 17.533 13.890 119.815 1.00 8.11  ? 168 TYR B CG  1 
ATOM 2315 C CD1 . TYR B 1 168 ? 16.656 13.056 119.154 1.00 9.36  ? 168 TYR B CD1 1 
ATOM 2316 C CD2 . TYR B 1 168 ? 17.170 14.398 121.052 1.00 11.24 ? 168 TYR B CD2 1 
ATOM 2317 C CE1 . TYR B 1 168 ? 15.448 12.728 119.720 1.00 13.84 ? 168 TYR B CE1 1 
ATOM 2318 C CE2 . TYR B 1 168 ? 15.977 14.084 121.630 1.00 12.18 ? 168 TYR B CE2 1 
ATOM 2319 C CZ  . TYR B 1 168 ? 15.116 13.247 120.966 1.00 14.35 ? 168 TYR B CZ  1 
ATOM 2320 O OH  . TYR B 1 168 ? 13.928 12.923 121.567 1.00 21.79 ? 168 TYR B OH  1 
ATOM 2321 N N   . ASP B 1 169 ? 17.522 13.385 116.135 1.00 2.81  ? 169 ASP B N   1 
ATOM 2322 C CA  . ASP B 1 169 ? 16.486 13.708 115.150 1.00 5.85  ? 169 ASP B CA  1 
ATOM 2323 C C   . ASP B 1 169 ? 15.022 13.551 115.585 1.00 7.61  ? 169 ASP B C   1 
ATOM 2324 O O   . ASP B 1 169 ? 14.517 12.427 115.637 1.00 11.47 ? 169 ASP B O   1 
ATOM 2325 C CB  . ASP B 1 169 ? 16.726 12.853 113.884 1.00 7.82  ? 169 ASP B CB  1 
ATOM 2326 C CG  . ASP B 1 169 ? 15.656 13.029 112.783 1.00 8.00  ? 169 ASP B CG  1 
ATOM 2327 O OD1 . ASP B 1 169 ? 14.469 13.241 113.081 1.00 6.50  ? 169 ASP B OD1 1 
ATOM 2328 O OD2 . ASP B 1 169 ? 16.001 12.904 111.586 1.00 11.42 ? 169 ASP B OD2 1 
ATOM 2329 N N   . LEU B 1 170 ? 14.282 14.653 115.715 1.00 5.54  ? 170 LEU B N   1 
ATOM 2330 C CA  . LEU B 1 170 ? 12.888 14.493 116.056 1.00 3.99  ? 170 LEU B CA  1 
ATOM 2331 C C   . LEU B 1 170 ? 11.966 14.776 114.899 1.00 6.57  ? 170 LEU B C   1 
ATOM 2332 O O   . LEU B 1 170 ? 10.756 14.831 115.067 1.00 10.90 ? 170 LEU B O   1 
ATOM 2333 C CB  . LEU B 1 170 ? 12.493 15.268 117.285 1.00 2.00  ? 170 LEU B CB  1 
ATOM 2334 C CG  . LEU B 1 170 ? 13.186 16.527 117.665 1.00 2.00  ? 170 LEU B CG  1 
ATOM 2335 C CD1 . LEU B 1 170 ? 12.194 17.594 117.583 1.00 2.00  ? 170 LEU B CD1 1 
ATOM 2336 C CD2 . LEU B 1 170 ? 13.581 16.381 119.088 1.00 2.00  ? 170 LEU B CD2 1 
ATOM 2337 N N   . SER B 1 171 ? 12.539 14.812 113.705 1.00 7.84  ? 171 SER B N   1 
ATOM 2338 C CA  . SER B 1 171 ? 11.817 15.086 112.465 1.00 15.31 ? 171 SER B CA  1 
ATOM 2339 C C   . SER B 1 171 ? 10.479 14.409 112.319 1.00 16.87 ? 171 SER B C   1 
ATOM 2340 O O   . SER B 1 171 ? 9.498  15.010 111.879 1.00 19.46 ? 171 SER B O   1 
ATOM 2341 C CB  . SER B 1 171 ? 12.674 14.686 111.269 1.00 19.05 ? 171 SER B CB  1 
ATOM 2342 O OG  . SER B 1 171 ? 12.829 13.281 111.187 1.00 26.50 ? 171 SER B OG  1 
ATOM 2343 N N   . ALA B 1 172 ? 10.498 13.120 112.613 1.00 21.43 ? 172 ALA B N   1 
ATOM 2344 C CA  . ALA B 1 172 ? 9.349  12.235 112.552 1.00 22.65 ? 172 ALA B CA  1 
ATOM 2345 C C   . ALA B 1 172 ? 8.080  12.792 113.159 1.00 22.38 ? 172 ALA B C   1 
ATOM 2346 O O   . ALA B 1 172 ? 6.998  12.590 112.620 1.00 24.50 ? 172 ALA B O   1 
ATOM 2347 C CB  . ALA B 1 172 ? 9.697  10.958 113.262 1.00 24.66 ? 172 ALA B CB  1 
ATOM 2348 N N   . MET B 1 173 ? 8.220  13.486 114.280 1.00 20.26 ? 173 MET B N   1 
ATOM 2349 C CA  . MET B 1 173 ? 7.078  14.034 115.003 1.00 20.24 ? 173 MET B CA  1 
ATOM 2350 C C   . MET B 1 173 ? 6.624  15.499 114.755 1.00 20.23 ? 173 MET B C   1 
ATOM 2351 O O   . MET B 1 173 ? 5.878  16.085 115.570 1.00 17.33 ? 173 MET B O   1 
ATOM 2352 C CB  . MET B 1 173 ? 7.353  13.829 116.469 1.00 20.44 ? 173 MET B CB  1 
ATOM 2353 C CG  . MET B 1 173 ? 7.844  12.484 116.741 1.00 20.24 ? 173 MET B CG  1 
ATOM 2354 S SD  . MET B 1 173 ? 8.389  12.552 118.382 1.00 28.19 ? 173 MET B SD  1 
ATOM 2355 C CE  . MET B 1 173 ? 9.766  11.369 118.284 1.00 31.07 ? 173 MET B CE  1 
ATOM 2356 N N   . ARG B 1 174 ? 7.010  16.048 113.606 1.00 17.90 ? 174 ARG B N   1 
ATOM 2357 C CA  . ARG B 1 174 ? 6.691  17.422 113.247 1.00 16.82 ? 174 ARG B CA  1 
ATOM 2358 C C   . ARG B 1 174 ? 6.806  18.345 114.457 1.00 15.10 ? 174 ARG B C   1 
ATOM 2359 O O   . ARG B 1 174 ? 5.795  18.846 114.932 1.00 21.25 ? 174 ARG B O   1 
ATOM 2360 C CB  . ARG B 1 174 ? 5.275  17.533 112.685 1.00 19.06 ? 174 ARG B CB  1 
ATOM 2361 C CG  . ARG B 1 174 ? 4.966  16.596 111.553 1.00 27.29 ? 174 ARG B CG  1 
ATOM 2362 C CD  . ARG B 1 174 ? 5.800  16.909 110.311 1.00 36.35 ? 174 ARG B CD  1 
ATOM 2363 N NE  . ARG B 1 174 ? 4.978  17.095 109.109 1.00 39.80 ? 174 ARG B NE  1 
ATOM 2364 C CZ  . ARG B 1 174 ? 4.083  18.075 108.942 1.00 44.10 ? 174 ARG B CZ  1 
ATOM 2365 N NH1 . ARG B 1 174 ? 3.861  18.989 109.898 1.00 40.83 ? 174 ARG B NH1 1 
ATOM 2366 N NH2 . ARG B 1 174 ? 3.422  18.157 107.788 1.00 46.04 ? 174 ARG B NH2 1 
ATOM 2367 N N   . ALA B 1 175 ? 7.996  18.522 115.017 1.00 8.89  ? 175 ALA B N   1 
ATOM 2368 C CA  . ALA B 1 175 ? 8.074  19.436 116.137 1.00 6.18  ? 175 ALA B CA  1 
ATOM 2369 C C   . ALA B 1 175 ? 8.463  20.785 115.555 1.00 9.43  ? 175 ALA B C   1 
ATOM 2370 O O   . ALA B 1 175 ? 8.959  20.855 114.419 1.00 10.41 ? 175 ALA B O   1 
ATOM 2371 C CB  . ALA B 1 175 ? 9.073  18.977 117.138 1.00 3.13  ? 175 ALA B CB  1 
ATOM 2372 N N   . ASP B 1 176 ? 8.091  21.850 116.265 1.00 11.10 ? 176 ASP B N   1 
ATOM 2373 C CA  . ASP B 1 176 ? 8.411  23.236 115.878 1.00 8.66  ? 176 ASP B CA  1 
ATOM 2374 C C   . ASP B 1 176 ? 8.999  24.080 117.010 1.00 6.90  ? 176 ASP B C   1 
ATOM 2375 O O   . ASP B 1 176 ? 8.868  23.737 118.200 1.00 3.11  ? 176 ASP B O   1 
ATOM 2376 C CB  . ASP B 1 176 ? 7.215  23.974 115.217 1.00 10.46 ? 176 ASP B CB  1 
ATOM 2377 C CG  . ASP B 1 176 ? 5.923  24.017 116.084 1.00 15.00 ? 176 ASP B CG  1 
ATOM 2378 O OD1 . ASP B 1 176 ? 5.954  24.188 117.343 1.00 13.06 ? 176 ASP B OD1 1 
ATOM 2379 O OD2 . ASP B 1 176 ? 4.842  23.924 115.448 1.00 16.22 ? 176 ASP B OD2 1 
ATOM 2380 N N   . ILE B 1 177 ? 9.612  25.196 116.622 1.00 4.84  ? 177 ILE B N   1 
ATOM 2381 C CA  . ILE B 1 177 ? 10.247 26.126 117.546 1.00 3.97  ? 177 ILE B CA  1 
ATOM 2382 C C   . ILE B 1 177 ? 9.418  26.289 118.831 1.00 6.43  ? 177 ILE B C   1 
ATOM 2383 O O   . ILE B 1 177 ? 9.943  26.529 119.922 1.00 7.52  ? 177 ILE B O   1 
ATOM 2384 C CB  . ILE B 1 177 ? 10.430 27.505 116.888 1.00 2.50  ? 177 ILE B CB  1 
ATOM 2385 C CG1 . ILE B 1 177 ? 10.906 27.370 115.448 1.00 4.79  ? 177 ILE B CG1 1 
ATOM 2386 C CG2 . ILE B 1 177 ? 11.479 28.266 117.622 1.00 4.82  ? 177 ILE B CG2 1 
ATOM 2387 C CD1 . ILE B 1 177 ? 12.315 27.962 115.189 1.00 11.78 ? 177 ILE B CD1 1 
ATOM 2388 N N   . GLY B 1 178 ? 8.107  26.177 118.695 1.00 9.49  ? 178 GLY B N   1 
ATOM 2389 C CA  . GLY B 1 178 ? 7.247  26.280 119.856 1.00 15.09 ? 178 GLY B CA  1 
ATOM 2390 C C   . GLY B 1 178 ? 7.599  25.240 120.908 1.00 14.62 ? 178 GLY B C   1 
ATOM 2391 O O   . GLY B 1 178 ? 8.113  25.581 121.981 1.00 15.47 ? 178 GLY B O   1 
ATOM 2392 N N   . ASP B 1 179 ? 7.433  23.968 120.564 1.00 14.49 ? 179 ASP B N   1 
ATOM 2393 C CA  . ASP B 1 179 ? 7.720  22.900 121.515 1.00 16.06 ? 179 ASP B CA  1 
ATOM 2394 C C   . ASP B 1 179 ? 9.150  22.820 122.039 1.00 16.33 ? 179 ASP B C   1 
ATOM 2395 O O   . ASP B 1 179 ? 9.414  21.997 122.916 1.00 20.60 ? 179 ASP B O   1 
ATOM 2396 C CB  . ASP B 1 179 ? 7.323  21.516 120.990 1.00 18.96 ? 179 ASP B CB  1 
ATOM 2397 C CG  . ASP B 1 179 ? 6.396  21.583 119.805 1.00 21.90 ? 179 ASP B CG  1 
ATOM 2398 O OD1 . ASP B 1 179 ? 5.175  21.358 119.974 1.00 23.38 ? 179 ASP B OD1 1 
ATOM 2399 O OD2 . ASP B 1 179 ? 6.908  21.848 118.702 1.00 21.25 ? 179 ASP B OD2 1 
ATOM 2400 N N   . MET B 1 180 ? 10.075 23.649 121.555 1.00 14.96 ? 180 MET B N   1 
ATOM 2401 C CA  . MET B 1 180 ? 11.425 23.530 122.085 1.00 12.46 ? 180 MET B CA  1 
ATOM 2402 C C   . MET B 1 180 ? 11.468 23.867 123.562 1.00 12.27 ? 180 MET B C   1 
ATOM 2403 O O   . MET B 1 180 ? 12.352 23.411 124.269 1.00 14.79 ? 180 MET B O   1 
ATOM 2404 C CB  . MET B 1 180 ? 12.463 24.340 121.319 1.00 9.36  ? 180 MET B CB  1 
ATOM 2405 C CG  . MET B 1 180 ? 12.679 23.947 119.858 1.00 7.41  ? 180 MET B CG  1 
ATOM 2406 S SD  . MET B 1 180 ? 12.889 22.246 119.342 1.00 2.00  ? 180 MET B SD  1 
ATOM 2407 C CE  . MET B 1 180 ? 13.672 21.574 120.637 1.00 5.39  ? 180 MET B CE  1 
ATOM 2408 N N   . ARG B 1 181 ? 10.486 24.599 124.057 1.00 11.39 ? 181 ARG B N   1 
ATOM 2409 C CA  . ARG B 1 181 ? 10.484 24.908 125.479 1.00 14.96 ? 181 ARG B CA  1 
ATOM 2410 C C   . ARG B 1 181 ? 10.273 23.624 126.257 1.00 15.08 ? 181 ARG B C   1 
ATOM 2411 O O   . ARG B 1 181 ? 10.622 23.532 127.446 1.00 16.13 ? 181 ARG B O   1 
ATOM 2412 C CB  . ARG B 1 181 ? 9.356  25.870 125.835 1.00 19.40 ? 181 ARG B CB  1 
ATOM 2413 C CG  . ARG B 1 181 ? 9.630  27.281 125.453 1.00 36.39 ? 181 ARG B CG  1 
ATOM 2414 C CD  . ARG B 1 181 ? 10.117 27.422 123.979 1.00 48.16 ? 181 ARG B CD  1 
ATOM 2415 N NE  . ARG B 1 181 ? 10.389 28.827 123.686 1.00 54.88 ? 181 ARG B NE  1 
ATOM 2416 C CZ  . ARG B 1 181 ? 9.452  29.728 123.373 1.00 56.58 ? 181 ARG B CZ  1 
ATOM 2417 N NH1 . ARG B 1 181 ? 8.170  29.376 123.252 1.00 52.67 ? 181 ARG B NH1 1 
ATOM 2418 N NH2 . ARG B 1 181 ? 9.769  31.024 123.399 1.00 60.95 ? 181 ARG B NH2 1 
ATOM 2419 N N   . LYS B 1 182 ? 9.669  22.643 125.590 1.00 13.15 ? 182 LYS B N   1 
ATOM 2420 C CA  . LYS B 1 182 ? 9.364  21.377 126.220 1.00 10.70 ? 182 LYS B CA  1 
ATOM 2421 C C   . LYS B 1 182 ? 10.554 20.478 126.409 1.00 9.41  ? 182 LYS B C   1 
ATOM 2422 O O   . LYS B 1 182 ? 10.492 19.551 127.203 1.00 17.86 ? 182 LYS B O   1 
ATOM 2423 C CB  . LYS B 1 182 ? 8.297  20.640 125.441 1.00 7.09  ? 182 LYS B CB  1 
ATOM 2424 C CG  . LYS B 1 182 ? 7.018  21.416 125.342 1.00 16.71 ? 182 LYS B CG  1 
ATOM 2425 C CD  . LYS B 1 182 ? 5.950  20.659 124.541 1.00 24.48 ? 182 LYS B CD  1 
ATOM 2426 C CE  . LYS B 1 182 ? 5.103  21.612 123.697 1.00 23.93 ? 182 LYS B CE  1 
ATOM 2427 N NZ  . LYS B 1 182 ? 4.414  20.879 122.613 1.00 27.81 ? 182 LYS B NZ  1 
ATOM 2428 N N   . TYR B 1 183 ? 11.650 20.748 125.725 1.00 4.50  ? 183 TYR B N   1 
ATOM 2429 C CA  . TYR B 1 183 ? 12.799 19.881 125.872 1.00 2.35  ? 183 TYR B CA  1 
ATOM 2430 C C   . TYR B 1 183 ? 13.903 20.407 126.772 1.00 2.85  ? 183 TYR B C   1 
ATOM 2431 O O   . TYR B 1 183 ? 14.045 21.606 126.951 1.00 3.54  ? 183 TYR B O   1 
ATOM 2432 C CB  . TYR B 1 183 ? 13.390 19.574 124.514 1.00 6.63  ? 183 TYR B CB  1 
ATOM 2433 C CG  . TYR B 1 183 ? 12.471 18.888 123.549 1.00 2.00  ? 183 TYR B CG  1 
ATOM 2434 C CD1 . TYR B 1 183 ? 11.160 19.285 123.402 1.00 2.00  ? 183 TYR B CD1 1 
ATOM 2435 C CD2 . TYR B 1 183 ? 12.953 17.900 122.720 1.00 2.00  ? 183 TYR B CD2 1 
ATOM 2436 C CE1 . TYR B 1 183 ? 10.363 18.720 122.446 1.00 2.35  ? 183 TYR B CE1 1 
ATOM 2437 C CE2 . TYR B 1 183 ? 12.169 17.328 121.762 1.00 3.47  ? 183 TYR B CE2 1 
ATOM 2438 C CZ  . TYR B 1 183 ? 10.874 17.736 121.624 1.00 6.07  ? 183 TYR B CZ  1 
ATOM 2439 O OH  . TYR B 1 183 ? 10.091 17.136 120.669 1.00 10.91 ? 183 TYR B OH  1 
ATOM 2440 N N   . ALA B 1 184 ? 14.744 19.515 127.278 1.00 4.67  ? 184 ALA B N   1 
ATOM 2441 C CA  . ALA B 1 184 ? 15.843 19.952 128.134 1.00 5.90  ? 184 ALA B CA  1 
ATOM 2442 C C   . ALA B 1 184 ? 17.103 19.105 128.010 1.00 4.98  ? 184 ALA B C   1 
ATOM 2443 O O   . ALA B 1 184 ? 17.027 17.946 127.618 1.00 5.22  ? 184 ALA B O   1 
ATOM 2444 C CB  . ALA B 1 184 ? 15.392 19.995 129.557 1.00 6.80  ? 184 ALA B CB  1 
ATOM 2445 N N   . VAL B 1 185 ? 18.260 19.709 128.275 1.00 3.65  ? 185 VAL B N   1 
ATOM 2446 C CA  . VAL B 1 185 ? 19.518 18.989 128.218 1.00 4.57  ? 185 VAL B CA  1 
ATOM 2447 C C   . VAL B 1 185 ? 19.822 18.479 129.598 1.00 7.52  ? 185 VAL B C   1 
ATOM 2448 O O   . VAL B 1 185 ? 19.611 19.187 130.579 1.00 12.83 ? 185 VAL B O   1 
ATOM 2449 C CB  . VAL B 1 185 ? 20.662 19.879 127.787 1.00 2.35  ? 185 VAL B CB  1 
ATOM 2450 C CG1 . VAL B 1 185 ? 21.990 19.203 128.041 1.00 2.00  ? 185 VAL B CG1 1 
ATOM 2451 C CG2 . VAL B 1 185 ? 20.549 20.124 126.338 1.00 8.29  ? 185 VAL B CG2 1 
ATOM 2452 N N   . LEU B 1 186 ? 20.310 17.253 129.689 1.00 8.55  ? 186 LEU B N   1 
ATOM 2453 C CA  . LEU B 1 186 ? 20.637 16.687 130.988 1.00 9.95  ? 186 LEU B CA  1 
ATOM 2454 C C   . LEU B 1 186 ? 22.147 16.400 131.030 1.00 8.75  ? 186 LEU B C   1 
ATOM 2455 O O   . LEU B 1 186 ? 22.714 16.020 130.018 1.00 10.68 ? 186 LEU B O   1 
ATOM 2456 C CB  . LEU B 1 186 ? 19.760 15.449 131.219 1.00 10.78 ? 186 LEU B CB  1 
ATOM 2457 C CG  . LEU B 1 186 ? 18.269 15.840 131.277 1.00 8.28  ? 186 LEU B CG  1 
ATOM 2458 C CD1 . LEU B 1 186 ? 17.355 14.718 130.864 1.00 9.80  ? 186 LEU B CD1 1 
ATOM 2459 C CD2 . LEU B 1 186 ? 17.929 16.295 132.660 1.00 10.47 ? 186 LEU B CD2 1 
ATOM 2460 N N   . VAL B 1 187 ? 22.811 16.634 132.156 1.00 4.20  ? 187 VAL B N   1 
ATOM 2461 C CA  . VAL B 1 187 ? 24.247 16.420 132.235 1.00 3.96  ? 187 VAL B CA  1 
ATOM 2462 C C   . VAL B 1 187 ? 24.616 15.801 133.583 1.00 7.77  ? 187 VAL B C   1 
ATOM 2463 O O   . VAL B 1 187 ? 24.766 16.504 134.578 1.00 12.29 ? 187 VAL B O   1 
ATOM 2464 C CB  . VAL B 1 187 ? 25.014 17.764 132.052 1.00 2.00  ? 187 VAL B CB  1 
ATOM 2465 C CG1 . VAL B 1 187 ? 26.493 17.579 132.247 1.00 2.00  ? 187 VAL B CG1 1 
ATOM 2466 C CG2 . VAL B 1 187 ? 24.786 18.306 130.704 1.00 2.00  ? 187 VAL B CG2 1 
ATOM 2467 N N   . TYR B 1 188 ? 24.784 14.486 133.619 1.00 8.50  ? 188 TYR B N   1 
ATOM 2468 C CA  . TYR B 1 188 ? 25.123 13.782 134.861 1.00 6.32  ? 188 TYR B CA  1 
ATOM 2469 C C   . TYR B 1 188 ? 26.641 13.675 135.099 1.00 3.93  ? 188 TYR B C   1 
ATOM 2470 O O   . TYR B 1 188 ? 27.350 13.117 134.287 1.00 10.10 ? 188 TYR B O   1 
ATOM 2471 C CB  . TYR B 1 188 ? 24.446 12.397 134.821 1.00 4.17  ? 188 TYR B CB  1 
ATOM 2472 C CG  . TYR B 1 188 ? 24.893 11.454 135.890 1.00 8.87  ? 188 TYR B CG  1 
ATOM 2473 C CD1 . TYR B 1 188 ? 24.232 11.386 137.104 1.00 11.79 ? 188 TYR B CD1 1 
ATOM 2474 C CD2 . TYR B 1 188 ? 26.028 10.677 135.713 1.00 8.67  ? 188 TYR B CD2 1 
ATOM 2475 C CE1 . TYR B 1 188 ? 24.711 10.571 138.127 1.00 15.35 ? 188 TYR B CE1 1 
ATOM 2476 C CE2 . TYR B 1 188 ? 26.508 9.870  136.707 1.00 10.12 ? 188 TYR B CE2 1 
ATOM 2477 C CZ  . TYR B 1 188 ? 25.860 9.821  137.921 1.00 14.20 ? 188 TYR B CZ  1 
ATOM 2478 O OH  . TYR B 1 188 ? 26.429 9.083  138.952 1.00 21.09 ? 188 TYR B OH  1 
ATOM 2479 N N   . SER B 1 189 ? 27.160 14.226 136.178 1.00 2.00  ? 189 SER B N   1 
ATOM 2480 C CA  . SER B 1 189 ? 28.591 14.126 136.423 1.00 2.13  ? 189 SER B CA  1 
ATOM 2481 C C   . SER B 1 189 ? 28.828 12.802 137.093 1.00 6.12  ? 189 SER B C   1 
ATOM 2482 O O   . SER B 1 189 ? 28.187 12.510 138.087 1.00 11.93 ? 189 SER B O   1 
ATOM 2483 C CB  . SER B 1 189 ? 29.079 15.230 137.344 1.00 3.94  ? 189 SER B CB  1 
ATOM 2484 O OG  . SER B 1 189 ? 30.420 14.983 137.734 1.00 6.35  ? 189 SER B OG  1 
ATOM 2485 N N   . LYS B 1 190 ? 29.836 12.064 136.641 1.00 9.86  ? 190 LYS B N   1 
ATOM 2486 C CA  . LYS B 1 190 ? 30.098 10.749 137.199 1.00 11.64 ? 190 LYS B CA  1 
ATOM 2487 C C   . LYS B 1 190 ? 31.139 10.590 138.291 1.00 14.20 ? 190 LYS B C   1 
ATOM 2488 O O   . LYS B 1 190 ? 30.877 9.868  139.263 1.00 18.85 ? 190 LYS B O   1 
ATOM 2489 C CB  . LYS B 1 190 ? 30.370 9.759  136.079 1.00 11.59 ? 190 LYS B CB  1 
ATOM 2490 C CG  . LYS B 1 190 ? 30.342 8.296  136.468 1.00 15.68 ? 190 LYS B CG  1 
ATOM 2491 C CD  . LYS B 1 190 ? 30.624 7.478  135.215 1.00 20.86 ? 190 LYS B CD  1 
ATOM 2492 C CE  . LYS B 1 190 ? 30.839 5.980  135.457 1.00 23.86 ? 190 LYS B CE  1 
ATOM 2493 N NZ  . LYS B 1 190 ? 30.814 5.274  134.108 1.00 29.39 ? 190 LYS B NZ  1 
ATOM 2494 N N   . ASP B 1 191 ? 32.312 11.211 138.157 1.00 15.26 ? 191 ASP B N   1 
ATOM 2495 C CA  . ASP B 1 191 ? 33.334 11.033 139.207 1.00 16.43 ? 191 ASP B CA  1 
ATOM 2496 C C   . ASP B 1 191 ? 33.972 12.281 139.810 1.00 17.55 ? 191 ASP B C   1 
ATOM 2497 O O   . ASP B 1 191 ? 34.598 12.206 140.859 1.00 18.03 ? 191 ASP B O   1 
ATOM 2498 C CB  . ASP B 1 191 ? 34.492 10.163 138.707 1.00 20.04 ? 191 ASP B CB  1 
ATOM 2499 C CG  . ASP B 1 191 ? 34.064 9.092  137.706 1.00 26.45 ? 191 ASP B CG  1 
ATOM 2500 O OD1 . ASP B 1 191 ? 33.192 8.247  138.052 1.00 31.08 ? 191 ASP B OD1 1 
ATOM 2501 O OD2 . ASP B 1 191 ? 34.651 9.068  136.585 1.00 24.69 ? 191 ASP B OD2 1 
ATOM 2502 N N   . ASP B 1 192 ? 33.897 13.396 139.094 1.00 20.63 ? 192 ASP B N   1 
ATOM 2503 C CA  . ASP B 1 192 ? 34.521 14.659 139.499 1.00 20.28 ? 192 ASP B CA  1 
ATOM 2504 C C   . ASP B 1 192 ? 33.486 15.394 140.323 1.00 17.05 ? 192 ASP B C   1 
ATOM 2505 O O   . ASP B 1 192 ? 33.233 15.039 141.458 1.00 18.59 ? 192 ASP B O   1 
ATOM 2506 C CB  . ASP B 1 192 ? 34.907 15.456 138.198 1.00 26.99 ? 192 ASP B CB  1 
ATOM 2507 C CG  . ASP B 1 192 ? 35.779 16.760 138.442 1.00 28.21 ? 192 ASP B CG  1 
ATOM 2508 O OD1 . ASP B 1 192 ? 36.740 16.682 139.251 1.00 30.70 ? 192 ASP B OD1 1 
ATOM 2509 O OD2 . ASP B 1 192 ? 35.534 17.824 137.754 1.00 14.57 ? 192 ASP B OD2 1 
ATOM 2510 N N   . ALA B 1 193 ? 32.783 16.290 139.645 1.00 13.39 ? 193 ALA B N   1 
ATOM 2511 C CA  . ALA B 1 193 ? 31.767 17.190 140.166 1.00 10.21 ? 193 ALA B CA  1 
ATOM 2512 C C   . ALA B 1 193 ? 32.143 18.313 139.219 1.00 8.63  ? 193 ALA B C   1 
ATOM 2513 O O   . ALA B 1 193 ? 33.059 19.062 139.483 1.00 13.48 ? 193 ALA B O   1 
ATOM 2514 C CB  . ALA B 1 193 ? 32.055 17.598 141.611 1.00 13.30 ? 193 ALA B CB  1 
ATOM 2515 N N   . LEU B 1 194 ? 31.581 18.272 138.021 1.00 9.87  ? 194 LEU B N   1 
ATOM 2516 C CA  . LEU B 1 194 ? 31.864 19.246 136.973 1.00 8.79  ? 194 LEU B CA  1 
ATOM 2517 C C   . LEU B 1 194 ? 31.934 20.681 137.503 1.00 10.39 ? 194 LEU B C   1 
ATOM 2518 O O   . LEU B 1 194 ? 30.914 21.333 137.749 1.00 9.44  ? 194 LEU B O   1 
ATOM 2519 C CB  . LEU B 1 194 ? 30.804 19.138 135.886 1.00 3.80  ? 194 LEU B CB  1 
ATOM 2520 C CG  . LEU B 1 194 ? 31.189 19.758 134.565 1.00 2.00  ? 194 LEU B CG  1 
ATOM 2521 C CD1 . LEU B 1 194 ? 32.014 18.815 133.728 1.00 2.00  ? 194 LEU B CD1 1 
ATOM 2522 C CD2 . LEU B 1 194 ? 29.940 20.064 133.877 1.00 2.00  ? 194 LEU B CD2 1 
ATOM 2523 N N   . GLU B 1 195 ? 33.152 21.152 137.735 1.00 13.50 ? 195 GLU B N   1 
ATOM 2524 C CA  . GLU B 1 195 ? 33.338 22.501 138.229 1.00 16.33 ? 195 GLU B CA  1 
ATOM 2525 C C   . GLU B 1 195 ? 33.069 23.527 137.153 1.00 19.39 ? 195 GLU B C   1 
ATOM 2526 O O   . GLU B 1 195 ? 33.160 23.257 135.947 1.00 23.17 ? 195 GLU B O   1 
ATOM 2527 C CB  . GLU B 1 195 ? 34.734 22.685 138.762 1.00 14.12 ? 195 GLU B CB  1 
ATOM 2528 C CG  . GLU B 1 195 ? 34.994 21.854 139.988 1.00 23.08 ? 195 GLU B CG  1 
ATOM 2529 C CD  . GLU B 1 195 ? 34.319 22.400 141.253 1.00 26.96 ? 195 GLU B CD  1 
ATOM 2530 O OE1 . GLU B 1 195 ? 33.596 23.440 141.179 1.00 31.07 ? 195 GLU B OE1 1 
ATOM 2531 O OE2 . GLU B 1 195 ? 34.537 21.781 142.330 1.00 26.74 ? 195 GLU B OE2 1 
ATOM 2532 N N   . THR B 1 196 ? 32.734 24.721 137.613 1.00 22.03 ? 196 THR B N   1 
ATOM 2533 C CA  . THR B 1 196 ? 32.432 25.832 136.731 1.00 22.38 ? 196 THR B CA  1 
ATOM 2534 C C   . THR B 1 196 ? 33.624 26.026 135.833 1.00 18.69 ? 196 THR B C   1 
ATOM 2535 O O   . THR B 1 196 ? 34.715 26.269 136.326 1.00 19.93 ? 196 THR B O   1 
ATOM 2536 C CB  . THR B 1 196 ? 32.244 27.086 137.562 1.00 22.10 ? 196 THR B CB  1 
ATOM 2537 O OG1 . THR B 1 196 ? 33.164 27.050 138.669 1.00 25.52 ? 196 THR B OG1 1 
ATOM 2538 C CG2 . THR B 1 196 ? 30.821 27.151 138.089 1.00 21.52 ? 196 THR B CG2 1 
ATOM 2539 N N   . ASP B 1 197 ? 33.439 25.833 134.535 1.00 18.12 ? 197 ASP B N   1 
ATOM 2540 C CA  . ASP B 1 197 ? 34.531 26.028 133.582 1.00 21.92 ? 197 ASP B CA  1 
ATOM 2541 C C   . ASP B 1 197 ? 35.473 24.836 133.422 1.00 20.80 ? 197 ASP B C   1 
ATOM 2542 O O   . ASP B 1 197 ? 36.558 24.775 133.997 1.00 26.55 ? 197 ASP B O   1 
ATOM 2543 C CB  . ASP B 1 197 ? 35.305 27.319 133.892 1.00 22.99 ? 197 ASP B CB  1 
ATOM 2544 C CG  . ASP B 1 197 ? 34.377 28.537 134.031 1.00 31.93 ? 197 ASP B CG  1 
ATOM 2545 O OD1 . ASP B 1 197 ? 33.621 28.830 133.052 1.00 34.70 ? 197 ASP B OD1 1 
ATOM 2546 O OD2 . ASP B 1 197 ? 34.397 29.181 135.118 1.00 26.54 ? 197 ASP B OD2 1 
ATOM 2547 N N   . GLU B 1 198 ? 35.002 23.937 132.570 1.00 16.26 ? 198 GLU B N   1 
ATOM 2548 C CA  . GLU B 1 198 ? 35.561 22.671 132.112 1.00 9.36  ? 198 GLU B CA  1 
ATOM 2549 C C   . GLU B 1 198 ? 34.216 22.483 131.430 1.00 9.17  ? 198 GLU B C   1 
ATOM 2550 O O   . GLU B 1 198 ? 33.211 22.452 132.128 1.00 16.86 ? 198 GLU B O   1 
ATOM 2551 C CB  . GLU B 1 198 ? 35.622 21.552 133.185 1.00 4.78  ? 198 GLU B CB  1 
ATOM 2552 C CG  . GLU B 1 198 ? 35.942 21.814 134.680 1.00 10.79 ? 198 GLU B CG  1 
ATOM 2553 C CD  . GLU B 1 198 ? 36.015 20.469 135.525 1.00 20.64 ? 198 GLU B CD  1 
ATOM 2554 O OE1 . GLU B 1 198 ? 36.151 19.385 134.913 1.00 26.73 ? 198 GLU B OE1 1 
ATOM 2555 O OE2 . GLU B 1 198 ? 35.943 20.465 136.787 1.00 21.20 ? 198 GLU B OE2 1 
ATOM 2556 N N   . LEU B 1 199 ? 34.117 22.507 130.114 1.00 7.26  ? 199 LEU B N   1 
ATOM 2557 C CA  . LEU B 1 199 ? 32.787 22.347 129.478 1.00 5.56  ? 199 LEU B CA  1 
ATOM 2558 C C   . LEU B 1 199 ? 31.930 23.590 129.270 1.00 2.00  ? 199 LEU B C   1 
ATOM 2559 O O   . LEU B 1 199 ? 31.779 24.410 130.166 1.00 2.00  ? 199 LEU B O   1 
ATOM 2560 C CB  . LEU B 1 199 ? 31.891 21.338 130.217 1.00 2.82  ? 199 LEU B CB  1 
ATOM 2561 C CG  . LEU B 1 199 ? 31.805 19.917 129.699 1.00 2.68  ? 199 LEU B CG  1 
ATOM 2562 C CD1 . LEU B 1 199 ? 32.920 19.095 130.285 1.00 7.57  ? 199 LEU B CD1 1 
ATOM 2563 C CD2 . LEU B 1 199 ? 30.489 19.353 130.126 1.00 5.29  ? 199 LEU B CD2 1 
ATOM 2564 N N   . VAL B 1 200 ? 31.346 23.663 128.081 1.00 2.00  ? 200 VAL B N   1 
ATOM 2565 C CA  . VAL B 1 200 ? 30.432 24.695 127.651 1.00 2.00  ? 200 VAL B CA  1 
ATOM 2566 C C   . VAL B 1 200 ? 29.618 23.908 126.641 1.00 2.83  ? 200 VAL B C   1 
ATOM 2567 O O   . VAL B 1 200 ? 30.132 23.544 125.600 1.00 5.09  ? 200 VAL B O   1 
ATOM 2568 C CB  . VAL B 1 200 ? 31.133 25.820 126.899 1.00 2.00  ? 200 VAL B CB  1 
ATOM 2569 C CG1 . VAL B 1 200 ? 30.109 26.881 126.483 1.00 2.45  ? 200 VAL B CG1 1 
ATOM 2570 C CG2 . VAL B 1 200 ? 32.176 26.437 127.762 1.00 2.00  ? 200 VAL B CG2 1 
ATOM 2571 N N   . LEU B 1 201 ? 28.377 23.580 126.947 1.00 2.08  ? 201 LEU B N   1 
ATOM 2572 C CA  . LEU B 1 201 ? 27.580 22.818 126.008 1.00 2.00  ? 201 LEU B CA  1 
ATOM 2573 C C   . LEU B 1 201 ? 26.996 23.823 125.051 1.00 2.00  ? 201 LEU B C   1 
ATOM 2574 O O   . LEU B 1 201 ? 26.965 24.990 125.345 1.00 2.00  ? 201 LEU B O   1 
ATOM 2575 C CB  . LEU B 1 201 ? 26.469 22.078 126.753 1.00 2.00  ? 201 LEU B CB  1 
ATOM 2576 C CG  . LEU B 1 201 ? 26.789 21.584 128.167 1.00 2.00  ? 201 LEU B CG  1 
ATOM 2577 C CD1 . LEU B 1 201 ? 25.523 21.330 128.929 1.00 2.12  ? 201 LEU B CD1 1 
ATOM 2578 C CD2 . LEU B 1 201 ? 27.623 20.356 128.129 1.00 2.00  ? 201 LEU B CD2 1 
ATOM 2579 N N   . HIS B 1 202 ? 26.599 23.378 123.880 1.00 2.00  ? 202 HIS B N   1 
ATOM 2580 C CA  . HIS B 1 202 ? 25.987 24.244 122.889 1.00 2.00  ? 202 HIS B CA  1 
ATOM 2581 C C   . HIS B 1 202 ? 24.842 23.419 122.356 1.00 2.00  ? 202 HIS B C   1 
ATOM 2582 O O   . HIS B 1 202 ? 25.026 22.247 122.074 1.00 2.00  ? 202 HIS B O   1 
ATOM 2583 C CB  . HIS B 1 202 ? 26.915 24.476 121.702 1.00 2.71  ? 202 HIS B CB  1 
ATOM 2584 C CG  . HIS B 1 202 ? 28.135 25.294 122.002 1.00 7.55  ? 202 HIS B CG  1 
ATOM 2585 N ND1 . HIS B 1 202 ? 29.071 24.928 122.944 1.00 12.40 ? 202 HIS B ND1 1 
ATOM 2586 C CD2 . HIS B 1 202 ? 28.616 26.411 121.412 1.00 6.04  ? 202 HIS B CD2 1 
ATOM 2587 C CE1 . HIS B 1 202 ? 30.082 25.777 122.918 1.00 6.05  ? 202 HIS B CE1 1 
ATOM 2588 N NE2 . HIS B 1 202 ? 29.829 26.687 121.994 1.00 7.48  ? 202 HIS B NE2 1 
ATOM 2589 N N   . VAL B 1 203 ? 23.672 24.005 122.192 1.00 2.00  ? 203 VAL B N   1 
ATOM 2590 C CA  . VAL B 1 203 ? 22.547 23.266 121.669 1.00 2.00  ? 203 VAL B CA  1 
ATOM 2591 C C   . VAL B 1 203 ? 22.277 23.886 120.317 1.00 2.00  ? 203 VAL B C   1 
ATOM 2592 O O   . VAL B 1 203 ? 21.976 25.046 120.252 1.00 2.40  ? 203 VAL B O   1 
ATOM 2593 C CB  . VAL B 1 203 ? 21.311 23.426 122.580 1.00 2.00  ? 203 VAL B CB  1 
ATOM 2594 C CG1 . VAL B 1 203 ? 20.192 22.637 122.059 1.00 2.00  ? 203 VAL B CG1 1 
ATOM 2595 C CG2 . VAL B 1 203 ? 21.619 22.990 123.958 1.00 2.00  ? 203 VAL B CG2 1 
ATOM 2596 N N   . ASP B 1 204 ? 22.507 23.199 119.218 1.00 2.00  ? 204 ASP B N   1 
ATOM 2597 C CA  . ASP B 1 204 ? 22.187 23.856 117.951 1.00 6.81  ? 204 ASP B CA  1 
ATOM 2598 C C   . ASP B 1 204 ? 20.900 23.277 117.402 1.00 7.79  ? 204 ASP B C   1 
ATOM 2599 O O   . ASP B 1 204 ? 20.871 22.115 116.964 1.00 10.36 ? 204 ASP B O   1 
ATOM 2600 C CB  . ASP B 1 204 ? 23.266 23.698 116.866 1.00 9.74  ? 204 ASP B CB  1 
ATOM 2601 C CG  . ASP B 1 204 ? 24.650 23.502 117.423 1.00 12.26 ? 204 ASP B CG  1 
ATOM 2602 O OD1 . ASP B 1 204 ? 24.990 24.091 118.474 1.00 10.91 ? 204 ASP B OD1 1 
ATOM 2603 O OD2 . ASP B 1 204 ? 25.401 22.734 116.788 1.00 13.03 ? 204 ASP B OD2 1 
ATOM 2604 N N   . ILE B 1 205 ? 19.857 24.097 117.371 1.00 5.39  ? 205 ILE B N   1 
ATOM 2605 C CA  . ILE B 1 205 ? 18.555 23.679 116.882 1.00 2.23  ? 205 ILE B CA  1 
ATOM 2606 C C   . ILE B 1 205 ? 18.338 23.873 115.381 1.00 2.63  ? 205 ILE B C   1 
ATOM 2607 O O   . ILE B 1 205 ? 18.167 24.995 114.937 1.00 6.02  ? 205 ILE B O   1 
ATOM 2608 C CB  . ILE B 1 205 ? 17.505 24.417 117.667 1.00 2.00  ? 205 ILE B CB  1 
ATOM 2609 C CG1 . ILE B 1 205 ? 17.552 23.886 119.067 1.00 2.00  ? 205 ILE B CG1 1 
ATOM 2610 C CG2 . ILE B 1 205 ? 16.152 24.254 117.080 1.00 2.00  ? 205 ILE B CG2 1 
ATOM 2611 C CD1 . ILE B 1 205 ? 17.357 24.904 120.039 1.00 2.00  ? 205 ILE B CD1 1 
ATOM 2612 N N   . GLU B 1 206 ? 18.361 22.806 114.591 1.00 2.00  ? 206 GLU B N   1 
ATOM 2613 C CA  . GLU B 1 206 ? 18.099 22.942 113.157 1.00 5.63  ? 206 GLU B CA  1 
ATOM 2614 C C   . GLU B 1 206 ? 16.568 23.081 112.951 1.00 9.56  ? 206 GLU B C   1 
ATOM 2615 O O   . GLU B 1 206 ? 15.805 22.263 113.465 1.00 21.08 ? 206 GLU B O   1 
ATOM 2616 C CB  . GLU B 1 206 ? 18.576 21.705 112.432 1.00 2.00  ? 206 GLU B CB  1 
ATOM 2617 C CG  . GLU B 1 206 ? 18.368 21.745 110.944 1.00 7.97  ? 206 GLU B CG  1 
ATOM 2618 C CD  . GLU B 1 206 ? 18.831 20.470 110.300 1.00 8.73  ? 206 GLU B CD  1 
ATOM 2619 O OE1 . GLU B 1 206 ? 19.660 20.491 109.364 1.00 8.74  ? 206 GLU B OE1 1 
ATOM 2620 O OE2 . GLU B 1 206 ? 18.385 19.421 110.778 1.00 9.92  ? 206 GLU B OE2 1 
ATOM 2621 N N   . HIS B 1 207 ? 16.103 24.076 112.199 1.00 7.97  ? 207 HIS B N   1 
ATOM 2622 C CA  . HIS B 1 207 ? 14.668 24.270 111.990 1.00 4.78  ? 207 HIS B CA  1 
ATOM 2623 C C   . HIS B 1 207 ? 14.511 24.854 110.625 1.00 7.25  ? 207 HIS B C   1 
ATOM 2624 O O   . HIS B 1 207 ? 15.499 25.065 109.944 1.00 13.14 ? 207 HIS B O   1 
ATOM 2625 C CB  . HIS B 1 207 ? 14.116 25.259 112.991 1.00 3.44  ? 207 HIS B CB  1 
ATOM 2626 C CG  . HIS B 1 207 ? 14.802 26.592 112.966 1.00 4.85  ? 207 HIS B CG  1 
ATOM 2627 N ND1 . HIS B 1 207 ? 15.454 27.116 114.060 1.00 6.95  ? 207 HIS B ND1 1 
ATOM 2628 C CD2 . HIS B 1 207 ? 14.949 27.502 111.977 1.00 2.00  ? 207 HIS B CD2 1 
ATOM 2629 C CE1 . HIS B 1 207 ? 15.976 28.288 113.749 1.00 2.00  ? 207 HIS B CE1 1 
ATOM 2630 N NE2 . HIS B 1 207 ? 15.680 28.542 112.488 1.00 2.60  ? 207 HIS B NE2 1 
ATOM 2631 N N   . GLN B 1 208 ? 13.300 25.205 110.231 1.00 6.18  ? 208 GLN B N   1 
ATOM 2632 C CA  . GLN B 1 208 ? 13.140 25.753 108.895 1.00 7.06  ? 208 GLN B CA  1 
ATOM 2633 C C   . GLN B 1 208 ? 13.608 27.166 108.886 1.00 8.00  ? 208 GLN B C   1 
ATOM 2634 O O   . GLN B 1 208 ? 13.543 27.842 109.908 1.00 10.83 ? 208 GLN B O   1 
ATOM 2635 C CB  . GLN B 1 208 ? 11.707 25.717 108.448 1.00 8.07  ? 208 GLN B CB  1 
ATOM 2636 C CG  . GLN B 1 208 ? 11.079 24.390 108.633 1.00 10.08 ? 208 GLN B CG  1 
ATOM 2637 C CD  . GLN B 1 208 ? 9.630  24.423 108.290 1.00 12.57 ? 208 GLN B CD  1 
ATOM 2638 O OE1 . GLN B 1 208 ? 8.784  24.669 109.147 1.00 13.66 ? 208 GLN B OE1 1 
ATOM 2639 N NE2 . GLN B 1 208 ? 9.325  24.214 107.021 1.00 9.34  ? 208 GLN B NE2 1 
ATOM 2640 N N   . ARG B 1 209 ? 14.026 27.617 107.711 1.00 10.46 ? 209 ARG B N   1 
ATOM 2641 C CA  . ARG B 1 209 ? 14.539 28.962 107.520 1.00 13.76 ? 209 ARG B CA  1 
ATOM 2642 C C   . ARG B 1 209 ? 13.522 30.034 107.900 1.00 13.08 ? 209 ARG B C   1 
ATOM 2643 O O   . ARG B 1 209 ? 12.338 29.885 107.615 1.00 14.73 ? 209 ARG B O   1 
ATOM 2644 C CB  . ARG B 1 209 ? 14.913 29.127 106.052 1.00 21.37 ? 209 ARG B CB  1 
ATOM 2645 C CG  . ARG B 1 209 ? 15.282 30.555 105.646 1.00 33.41 ? 209 ARG B CG  1 
ATOM 2646 C CD  . ARG B 1 209 ? 16.782 30.800 105.706 1.00 40.68 ? 209 ARG B CD  1 
ATOM 2647 N NE  . ARG B 1 209 ? 17.448 30.449 104.451 1.00 43.40 ? 209 ARG B NE  1 
ATOM 2648 C CZ  . ARG B 1 209 ? 17.776 29.216 104.067 1.00 47.49 ? 209 ARG B CZ  1 
ATOM 2649 N NH1 . ARG B 1 209 ? 17.523 28.157 104.827 1.00 46.26 ? 209 ARG B NH1 1 
ATOM 2650 N NH2 . ARG B 1 209 ? 18.349 29.045 102.886 1.00 52.60 ? 209 ARG B NH2 1 
ATOM 2651 N N   . ILE B 1 210 ? 13.979 31.104 108.546 1.00 12.77 ? 210 ILE B N   1 
ATOM 2652 C CA  . ILE B 1 210 ? 13.105 32.223 108.934 1.00 9.75  ? 210 ILE B CA  1 
ATOM 2653 C C   . ILE B 1 210 ? 13.513 33.358 108.006 1.00 12.81 ? 210 ILE B C   1 
ATOM 2654 O O   . ILE B 1 210 ? 14.673 33.732 107.972 1.00 15.79 ? 210 ILE B O   1 
ATOM 2655 C CB  . ILE B 1 210 ? 13.356 32.698 110.386 1.00 5.53  ? 210 ILE B CB  1 
ATOM 2656 C CG1 . ILE B 1 210 ? 13.095 31.580 111.388 1.00 2.00  ? 210 ILE B CG1 1 
ATOM 2657 C CG2 . ILE B 1 210 ? 12.471 33.841 110.703 1.00 3.35  ? 210 ILE B CG2 1 
ATOM 2658 C CD1 . ILE B 1 210 ? 13.274 32.014 112.809 1.00 2.00  ? 210 ILE B CD1 1 
ATOM 2659 N N   . PRO B 1 211 ? 12.555 33.971 107.311 1.00 17.11 ? 211 PRO B N   1 
ATOM 2660 C CA  . PRO B 1 211 ? 12.805 35.071 106.372 1.00 21.68 ? 211 PRO B CA  1 
ATOM 2661 C C   . PRO B 1 211 ? 13.513 36.318 106.916 1.00 25.97 ? 211 PRO B C   1 
ATOM 2662 O O   . PRO B 1 211 ? 13.491 36.614 108.121 1.00 30.30 ? 211 PRO B O   1 
ATOM 2663 C CB  . PRO B 1 211 ? 11.401 35.439 105.915 1.00 23.56 ? 211 PRO B CB  1 
ATOM 2664 C CG  . PRO B 1 211 ? 10.593 35.238 107.187 1.00 24.28 ? 211 PRO B CG  1 
ATOM 2665 C CD  . PRO B 1 211 ? 11.117 33.868 107.613 1.00 22.96 ? 211 PRO B CD  1 
ATOM 2666 N N   . THR B 1 212 ? 14.109 37.060 105.983 1.00 28.53 ? 212 THR B N   1 
ATOM 2667 C CA  . THR B 1 212 ? 14.819 38.309 106.263 1.00 29.60 ? 212 THR B CA  1 
ATOM 2668 C C   . THR B 1 212 ? 14.094 39.344 105.411 1.00 31.58 ? 212 THR B C   1 
ATOM 2669 O O   . THR B 1 212 ? 14.220 39.378 104.173 1.00 31.12 ? 212 THR B O   1 
ATOM 2670 C CB  . THR B 1 212 ? 16.305 38.195 105.885 1.00 29.42 ? 212 THR B CB  1 
ATOM 2671 O OG1 . THR B 1 212 ? 16.451 37.436 104.667 1.00 29.72 ? 212 THR B OG1 1 
ATOM 2672 C CG2 . THR B 1 212 ? 17.067 37.523 107.017 1.00 29.92 ? 212 THR B CG2 1 
ATOM 2673 N N   . SER B 1 213 ? 13.265 40.130 106.082 1.00 34.03 ? 213 SER B N   1 
ATOM 2674 C CA  . SER B 1 213 ? 12.443 41.106 105.389 1.00 37.01 ? 213 SER B CA  1 
ATOM 2675 C C   . SER B 1 213 ? 13.115 42.238 104.633 1.00 38.36 ? 213 SER B C   1 
ATOM 2676 O O   . SER B 1 213 ? 14.272 42.623 104.894 1.00 38.41 ? 213 SER B O   1 
ATOM 2677 C CB  . SER B 1 213 ? 11.366 41.689 106.322 1.00 38.76 ? 213 SER B CB  1 
ATOM 2678 O OG  . SER B 1 213 ? 10.447 42.517 105.604 1.00 36.91 ? 213 SER B OG  1 
ATOM 2679 N N   . GLY B 1 214 ? 12.303 42.794 103.736 1.00 37.87 ? 214 GLY B N   1 
ATOM 2680 C CA  . GLY B 1 214 ? 12.700 43.909 102.916 1.00 38.46 ? 214 GLY B CA  1 
ATOM 2681 C C   . GLY B 1 214 ? 11.764 45.084 103.169 1.00 37.16 ? 214 GLY B C   1 
ATOM 2682 O O   . GLY B 1 214 ? 10.769 45.257 102.444 1.00 40.14 ? 214 GLY B O   1 
ATOM 2683 N N   . VAL B 1 215 ? 12.029 45.845 104.230 1.00 31.25 ? 215 VAL B N   1 
ATOM 2684 C CA  . VAL B 1 215 ? 11.233 47.026 104.550 1.00 28.77 ? 215 VAL B CA  1 
ATOM 2685 C C   . VAL B 1 215 ? 11.938 47.838 105.599 1.00 29.14 ? 215 VAL B C   1 
ATOM 2686 O O   . VAL B 1 215 ? 12.446 47.307 106.584 1.00 31.15 ? 215 VAL B O   1 
ATOM 2687 C CB  . VAL B 1 215 ? 9.809  46.725 105.121 1.00 26.54 ? 215 VAL B CB  1 
ATOM 2688 C CG1 . VAL B 1 215 ? 8.758  46.584 103.994 1.00 22.25 ? 215 VAL B CG1 1 
ATOM 2689 C CG2 . VAL B 1 215 ? 9.861  45.514 106.052 1.00 24.98 ? 215 VAL B CG2 1 
ATOM 2690 N N   . LEU B 1 216 ? 12.016 49.132 105.333 1.00 29.09 ? 216 LEU B N   1 
ATOM 2691 C CA  . LEU B 1 216 ? 12.609 50.097 106.233 1.00 27.46 ? 216 LEU B CA  1 
ATOM 2692 C C   . LEU B 1 216 ? 11.583 50.115 107.367 1.00 27.30 ? 216 LEU B C   1 
ATOM 2693 O O   . LEU B 1 216 ? 10.370 50.142 107.106 1.00 33.71 ? 216 LEU B O   1 
ATOM 2694 C CB  . LEU B 1 216 ? 12.684 51.448 105.499 1.00 23.88 ? 216 LEU B CB  1 
ATOM 2695 C CG  . LEU B 1 216 ? 13.419 52.692 106.019 1.00 26.47 ? 216 LEU B CG  1 
ATOM 2696 C CD1 . LEU B 1 216 ? 12.436 53.695 106.642 1.00 28.23 ? 216 LEU B CD1 1 
ATOM 2697 C CD2 . LEU B 1 216 ? 14.534 52.318 106.971 1.00 22.29 ? 216 LEU B CD2 1 
ATOM 2698 N N   . PRO B 1 217 ? 12.041 49.946 108.613 1.00 26.82 ? 217 PRO B N   1 
ATOM 2699 C CA  . PRO B 1 217 ? 11.188 49.938 109.793 1.00 25.86 ? 217 PRO B CA  1 
ATOM 2700 C C   . PRO B 1 217 ? 10.411 51.191 110.106 1.00 27.93 ? 217 PRO B C   1 
ATOM 2701 O O   . PRO B 1 217 ? 10.761 52.302 109.688 1.00 22.50 ? 217 PRO B O   1 
ATOM 2702 C CB  . PRO B 1 217 ? 12.151 49.608 110.917 1.00 25.21 ? 217 PRO B CB  1 
ATOM 2703 C CG  . PRO B 1 217 ? 13.086 48.682 110.247 1.00 27.37 ? 217 PRO B CG  1 
ATOM 2704 C CD  . PRO B 1 217 ? 13.368 49.415 108.953 1.00 25.35 ? 217 PRO B CD  1 
ATOM 2705 N N   . VAL B 1 218 ? 9.413  50.917 110.945 1.00 31.96 ? 218 VAL B N   1 
ATOM 2706 C CA  . VAL B 1 218 ? 8.370  51.769 111.537 1.00 35.86 ? 218 VAL B CA  1 
ATOM 2707 C C   . VAL B 1 218 ? 8.646  53.162 112.153 1.00 39.74 ? 218 VAL B C   1 
ATOM 2708 O O   . VAL B 1 218 ? 9.681  53.395 112.837 1.00 44.18 ? 218 VAL B O   1 
ATOM 2709 C CB  . VAL B 1 218 ? 7.636  50.937 112.630 1.00 35.69 ? 218 VAL B CB  1 
ATOM 2710 C CG1 . VAL B 1 218 ? 7.584  49.458 112.225 1.00 37.59 ? 218 VAL B CG1 1 
ATOM 2711 C CG2 . VAL B 1 218 ? 8.336  51.067 113.999 1.00 33.20 ? 218 VAL B CG2 1 
ATOM 2712 O OXT . VAL B 1 218 ? 7.710  53.990 112.052 1.00 43.86 ? 218 VAL B OXT 1 
ATOM 2713 N N   . ALA C 1 28  ? 38.964 11.022 79.694  1.00 44.56 ? 28  ALA C N   1 
ATOM 2714 C CA  . ALA C 1 28  ? 37.917 12.089 79.739  1.00 44.31 ? 28  ALA C CA  1 
ATOM 2715 C C   . ALA C 1 28  ? 36.715 11.518 79.008  1.00 44.34 ? 28  ALA C C   1 
ATOM 2716 O O   . ALA C 1 28  ? 36.788 11.350 77.783  1.00 45.60 ? 28  ALA C O   1 
ATOM 2717 C CB  . ALA C 1 28  ? 38.429 13.350 79.008  1.00 43.30 ? 28  ALA C CB  1 
ATOM 2718 N N   . ASP C 1 29  ? 35.680 11.111 79.756  1.00 41.24 ? 29  ASP C N   1 
ATOM 2719 C CA  . ASP C 1 29  ? 34.456 10.521 79.166  1.00 39.63 ? 29  ASP C CA  1 
ATOM 2720 C C   . ASP C 1 29  ? 33.254 10.421 80.121  1.00 37.67 ? 29  ASP C C   1 
ATOM 2721 O O   . ASP C 1 29  ? 32.529 9.409  80.156  1.00 35.01 ? 29  ASP C O   1 
ATOM 2722 C CB  . ASP C 1 29  ? 34.739 9.163  78.461  1.00 39.32 ? 29  ASP C CB  1 
ATOM 2723 C CG  . ASP C 1 29  ? 35.786 8.280  79.195  1.00 43.93 ? 29  ASP C CG  1 
ATOM 2724 O OD1 . ASP C 1 29  ? 37.008 8.620  79.262  1.00 40.74 ? 29  ASP C OD1 1 
ATOM 2725 O OD2 . ASP C 1 29  ? 35.382 7.193  79.652  1.00 43.27 ? 29  ASP C OD2 1 
ATOM 2726 N N   . ALA C 1 30  ? 33.038 11.549 80.809  1.00 38.46 ? 30  ALA C N   1 
ATOM 2727 C CA  . ALA C 1 30  ? 31.984 11.816 81.818  1.00 36.39 ? 30  ALA C CA  1 
ATOM 2728 C C   . ALA C 1 30  ? 31.401 10.698 82.687  1.00 34.20 ? 30  ALA C C   1 
ATOM 2729 O O   . ALA C 1 30  ? 31.530 10.780 83.912  1.00 30.45 ? 30  ALA C O   1 
ATOM 2730 C CB  . ALA C 1 30  ? 30.891 12.709 81.255  1.00 36.69 ? 30  ALA C CB  1 
ATOM 2731 N N   . ASN C 1 31  ? 30.737 9.695  82.099  1.00 32.98 ? 31  ASN C N   1 
ATOM 2732 C CA  . ASN C 1 31  ? 30.208 8.585  82.910  1.00 33.88 ? 31  ASN C CA  1 
ATOM 2733 C C   . ASN C 1 31  ? 31.386 8.042  83.728  1.00 34.12 ? 31  ASN C C   1 
ATOM 2734 O O   . ASN C 1 31  ? 31.287 7.873  84.952  1.00 33.00 ? 31  ASN C O   1 
ATOM 2735 C CB  . ASN C 1 31  ? 29.592 7.472  82.046  1.00 37.94 ? 31  ASN C CB  1 
ATOM 2736 C CG  . ASN C 1 31  ? 28.069 7.624  81.869  1.00 40.70 ? 31  ASN C CG  1 
ATOM 2737 O OD1 . ASN C 1 31  ? 27.274 7.151  82.688  1.00 41.40 ? 31  ASN C OD1 1 
ATOM 2738 N ND2 . ASN C 1 31  ? 27.664 8.296  80.795  1.00 41.96 ? 31  ASN C ND2 1 
ATOM 2739 N N   . PHE C 1 32  ? 32.522 7.861  83.050  1.00 34.14 ? 32  PHE C N   1 
ATOM 2740 C CA  . PHE C 1 32  ? 33.752 7.396  83.691  1.00 34.87 ? 32  PHE C CA  1 
ATOM 2741 C C   . PHE C 1 32  ? 34.422 8.532  84.407  1.00 33.81 ? 32  PHE C C   1 
ATOM 2742 O O   . PHE C 1 32  ? 34.898 8.412  85.548  1.00 33.67 ? 32  PHE C O   1 
ATOM 2743 C CB  . PHE C 1 32  ? 34.710 6.888  82.656  1.00 33.72 ? 32  PHE C CB  1 
ATOM 2744 C CG  . PHE C 1 32  ? 34.277 5.626  82.052  1.00 36.41 ? 32  PHE C CG  1 
ATOM 2745 C CD1 . PHE C 1 32  ? 33.393 5.638  80.981  1.00 39.93 ? 32  PHE C CD1 1 
ATOM 2746 C CD2 . PHE C 1 32  ? 34.770 4.411  82.537  1.00 38.09 ? 32  PHE C CD2 1 
ATOM 2747 C CE1 . PHE C 1 32  ? 33.004 4.454  80.384  1.00 44.53 ? 32  PHE C CE1 1 
ATOM 2748 C CE2 . PHE C 1 32  ? 34.394 3.205  81.960  1.00 42.64 ? 32  PHE C CE2 1 
ATOM 2749 C CZ  . PHE C 1 32  ? 33.507 3.217  80.873  1.00 46.29 ? 32  PHE C CZ  1 
ATOM 2750 N N   . ARG C 1 33  ? 34.494 9.632  83.688  1.00 31.89 ? 33  ARG C N   1 
ATOM 2751 C CA  . ARG C 1 33  ? 35.083 10.827 84.223  1.00 35.43 ? 33  ARG C CA  1 
ATOM 2752 C C   . ARG C 1 33  ? 34.582 11.158 85.656  1.00 33.65 ? 33  ARG C C   1 
ATOM 2753 O O   . ARG C 1 33  ? 35.225 11.931 86.365  1.00 35.37 ? 33  ARG C O   1 
ATOM 2754 C CB  . ARG C 1 33  ? 34.799 11.969 83.253  1.00 41.61 ? 33  ARG C CB  1 
ATOM 2755 C CG  . ARG C 1 33  ? 35.784 13.107 83.275  1.00 50.17 ? 33  ARG C CG  1 
ATOM 2756 C CD  . ARG C 1 33  ? 35.524 14.057 82.113  1.00 55.09 ? 33  ARG C CD  1 
ATOM 2757 N NE  . ARG C 1 33  ? 36.741 14.814 81.828  1.00 62.12 ? 33  ARG C NE  1 
ATOM 2758 C CZ  . ARG C 1 33  ? 36.821 15.878 81.029  1.00 66.05 ? 33  ARG C CZ  1 
ATOM 2759 N NH1 . ARG C 1 33  ? 35.733 16.355 80.412  1.00 65.52 ? 33  ARG C NH1 1 
ATOM 2760 N NH2 . ARG C 1 33  ? 38.018 16.430 80.803  1.00 65.53 ? 33  ARG C NH2 1 
ATOM 2761 N N   . VAL C 1 34  ? 33.457 10.599 86.100  1.00 32.31 ? 34  VAL C N   1 
ATOM 2762 C CA  . VAL C 1 34  ? 33.006 10.902 87.468  1.00 32.61 ? 34  VAL C CA  1 
ATOM 2763 C C   . VAL C 1 34  ? 33.422 9.849  88.475  1.00 31.88 ? 34  VAL C C   1 
ATOM 2764 O O   . VAL C 1 34  ? 33.566 10.159 89.669  1.00 30.11 ? 34  VAL C O   1 
ATOM 2765 C CB  . VAL C 1 34  ? 31.459 11.136 87.602  1.00 36.27 ? 34  VAL C CB  1 
ATOM 2766 C CG1 . VAL C 1 34  ? 31.014 12.244 86.656  1.00 39.76 ? 34  VAL C CG1 1 
ATOM 2767 C CG2 . VAL C 1 34  ? 30.653 9.831  87.386  1.00 32.61 ? 34  VAL C CG2 1 
ATOM 2768 N N   . LEU C 1 35  ? 33.556 8.603  88.004  1.00 30.32 ? 35  LEU C N   1 
ATOM 2769 C CA  . LEU C 1 35  ? 33.949 7.482  88.858  1.00 27.58 ? 35  LEU C CA  1 
ATOM 2770 C C   . LEU C 1 35  ? 35.299 7.831  89.428  1.00 27.97 ? 35  LEU C C   1 
ATOM 2771 O O   . LEU C 1 35  ? 35.532 7.766  90.642  1.00 28.63 ? 35  LEU C O   1 
ATOM 2772 C CB  . LEU C 1 35  ? 34.049 6.192  88.050  1.00 22.77 ? 35  LEU C CB  1 
ATOM 2773 C CG  . LEU C 1 35  ? 32.708 5.753  87.469  1.00 24.28 ? 35  LEU C CG  1 
ATOM 2774 C CD1 . LEU C 1 35  ? 32.830 4.331  86.946  1.00 27.04 ? 35  LEU C CD1 1 
ATOM 2775 C CD2 . LEU C 1 35  ? 31.613 5.834  88.530  1.00 25.63 ? 35  LEU C CD2 1 
ATOM 2776 N N   . SER C 1 36  ? 36.164 8.263  88.527  1.00 27.04 ? 36  SER C N   1 
ATOM 2777 C CA  . SER C 1 36  ? 37.507 8.676  88.859  1.00 26.30 ? 36  SER C CA  1 
ATOM 2778 C C   . SER C 1 36  ? 37.412 9.676  89.991  1.00 24.35 ? 36  SER C C   1 
ATOM 2779 O O   . SER C 1 36  ? 37.983 9.455  91.062  1.00 24.40 ? 36  SER C O   1 
ATOM 2780 C CB  . SER C 1 36  ? 38.077 9.351  87.640  1.00 28.69 ? 36  SER C CB  1 
ATOM 2781 O OG  . SER C 1 36  ? 36.996 9.980  86.966  1.00 31.17 ? 36  SER C OG  1 
ATOM 2782 N N   . GLN C 1 37  ? 36.631 10.734 89.761  1.00 24.37 ? 37  GLN C N   1 
ATOM 2783 C CA  . GLN C 1 37  ? 36.422 11.804 90.741  1.00 27.00 ? 37  GLN C CA  1 
ATOM 2784 C C   . GLN C 1 37  ? 36.143 11.270 92.151  1.00 23.92 ? 37  GLN C C   1 
ATOM 2785 O O   . GLN C 1 37  ? 36.735 11.729 93.137  1.00 25.14 ? 37  GLN C O   1 
ATOM 2786 C CB  . GLN C 1 37  ? 35.280 12.699 90.273  1.00 33.66 ? 37  GLN C CB  1 
ATOM 2787 C CG  . GLN C 1 37  ? 35.574 13.411 88.948  1.00 45.57 ? 37  GLN C CG  1 
ATOM 2788 C CD  . GLN C 1 37  ? 36.674 14.488 89.068  1.00 51.32 ? 37  GLN C CD  1 
ATOM 2789 O OE1 . GLN C 1 37  ? 36.768 15.181 90.091  1.00 56.33 ? 37  GLN C OE1 1 
ATOM 2790 N NE2 . GLN C 1 37  ? 37.505 14.633 88.021  1.00 52.18 ? 37  GLN C NE2 1 
ATOM 2791 N N   . GLN C 1 38  ? 35.246 10.290 92.229  1.00 20.73 ? 38  GLN C N   1 
ATOM 2792 C CA  . GLN C 1 38  ? 34.896 9.635  93.486  1.00 19.70 ? 38  GLN C CA  1 
ATOM 2793 C C   . GLN C 1 38  ? 36.133 8.925  94.042  1.00 18.20 ? 38  GLN C C   1 
ATOM 2794 O O   . GLN C 1 38  ? 36.523 9.130  95.203  1.00 19.18 ? 38  GLN C O   1 
ATOM 2795 C CB  . GLN C 1 38  ? 33.814 8.580  93.246  1.00 22.08 ? 38  GLN C CB  1 
ATOM 2796 C CG  . GLN C 1 38  ? 32.523 9.105  92.664  1.00 23.61 ? 38  GLN C CG  1 
ATOM 2797 C CD  . GLN C 1 38  ? 32.000 10.264 93.472  1.00 22.84 ? 38  GLN C CD  1 
ATOM 2798 O OE1 . GLN C 1 38  ? 31.523 10.097 94.603  1.00 22.07 ? 38  GLN C OE1 1 
ATOM 2799 N NE2 . GLN C 1 38  ? 32.138 11.462 92.922  1.00 28.25 ? 38  GLN C NE2 1 
ATOM 2800 N N   . LEU C 1 39  ? 36.744 8.093  93.194  1.00 15.65 ? 39  LEU C N   1 
ATOM 2801 C CA  . LEU C 1 39  ? 37.930 7.323  93.560  1.00 11.74 ? 39  LEU C CA  1 
ATOM 2802 C C   . LEU C 1 39  ? 39.023 8.180  94.191  1.00 10.52 ? 39  LEU C C   1 
ATOM 2803 O O   . LEU C 1 39  ? 39.628 7.785  95.188  1.00 9.41  ? 39  LEU C O   1 
ATOM 2804 C CB  . LEU C 1 39  ? 38.463 6.551  92.348  1.00 8.07  ? 39  LEU C CB  1 
ATOM 2805 C CG  . LEU C 1 39  ? 37.468 5.537  91.775  1.00 5.58  ? 39  LEU C CG  1 
ATOM 2806 C CD1 . LEU C 1 39  ? 38.188 4.486  90.953  1.00 2.00  ? 39  LEU C CD1 1 
ATOM 2807 C CD2 . LEU C 1 39  ? 36.694 4.886  92.904  1.00 4.36  ? 39  LEU C CD2 1 
ATOM 2808 N N   . SER C 1 40  ? 39.270 9.356  93.631  1.00 11.36 ? 40  SER C N   1 
ATOM 2809 C CA  . SER C 1 40  ? 40.271 10.236 94.207  1.00 15.99 ? 40  SER C CA  1 
ATOM 2810 C C   . SER C 1 40  ? 39.896 10.539 95.654  1.00 17.44 ? 40  SER C C   1 
ATOM 2811 O O   . SER C 1 40  ? 40.705 10.317 96.572  1.00 17.46 ? 40  SER C O   1 
ATOM 2812 C CB  . SER C 1 40  ? 40.365 11.527 93.419  1.00 15.88 ? 40  SER C CB  1 
ATOM 2813 O OG  . SER C 1 40  ? 40.901 11.261 92.139  1.00 24.83 ? 40  SER C OG  1 
ATOM 2814 N N   . ARG C 1 41  ? 38.664 11.005 95.859  1.00 17.31 ? 41  ARG C N   1 
ATOM 2815 C CA  . ARG C 1 41  ? 38.182 11.309 97.203  1.00 17.13 ? 41  ARG C CA  1 
ATOM 2816 C C   . ARG C 1 41  ? 38.449 10.136 98.167  1.00 16.07 ? 41  ARG C C   1 
ATOM 2817 O O   . ARG C 1 41  ? 38.916 10.357 99.298  1.00 20.38 ? 41  ARG C O   1 
ATOM 2818 C CB  . ARG C 1 41  ? 36.690 11.636 97.170  1.00 18.40 ? 41  ARG C CB  1 
ATOM 2819 C CG  . ARG C 1 41  ? 36.356 13.089 97.442  1.00 27.05 ? 41  ARG C CG  1 
ATOM 2820 C CD  . ARG C 1 41  ? 35.189 13.577 96.545  1.00 37.33 ? 41  ARG C CD  1 
ATOM 2821 N NE  . ARG C 1 41  ? 33.817 13.233 96.991  1.00 46.30 ? 41  ARG C NE  1 
ATOM 2822 C CZ  . ARG C 1 41  ? 33.137 12.123 96.662  1.00 44.74 ? 41  ARG C CZ  1 
ATOM 2823 N NH1 . ARG C 1 41  ? 33.672 11.177 95.887  1.00 43.91 ? 41  ARG C NH1 1 
ATOM 2824 N NH2 . ARG C 1 41  ? 31.861 12.007 97.030  1.00 44.52 ? 41  ARG C NH2 1 
ATOM 2825 N N   . LEU C 1 42  ? 38.188 8.900  97.721  1.00 10.91 ? 42  LEU C N   1 
ATOM 2826 C CA  . LEU C 1 42  ? 38.419 7.739  98.579  1.00 6.72  ? 42  LEU C CA  1 
ATOM 2827 C C   . LEU C 1 42  ? 39.889 7.717  98.932  1.00 5.06  ? 42  LEU C C   1 
ATOM 2828 O O   . LEU C 1 42  ? 40.279 7.575  100.093 1.00 2.00  ? 42  LEU C O   1 
ATOM 2829 C CB  . LEU C 1 42  ? 38.049 6.420  97.877  1.00 5.43  ? 42  LEU C CB  1 
ATOM 2830 C CG  . LEU C 1 42  ? 36.619 5.891  97.978  1.00 4.54  ? 42  LEU C CG  1 
ATOM 2831 C CD1 . LEU C 1 42  ? 36.271 5.413  99.378  1.00 2.98  ? 42  LEU C CD1 1 
ATOM 2832 C CD2 . LEU C 1 42  ? 35.697 7.009  97.575  1.00 9.99  ? 42  LEU C CD2 1 
ATOM 2833 N N   . ASN C 1 43  ? 40.703 7.929  97.916  1.00 6.15  ? 43  ASN C N   1 
ATOM 2834 C CA  . ASN C 1 43  ? 42.115 7.904  98.124  1.00 7.31  ? 43  ASN C CA  1 
ATOM 2835 C C   . ASN C 1 43  ? 42.455 8.900  99.194  1.00 5.49  ? 43  ASN C C   1 
ATOM 2836 O O   . ASN C 1 43  ? 42.977 8.548  100.243 1.00 6.07  ? 43  ASN C O   1 
ATOM 2837 C CB  . ASN C 1 43  ? 42.856 8.252  96.851  1.00 12.45 ? 43  ASN C CB  1 
ATOM 2838 C CG  . ASN C 1 43  ? 44.320 7.901  96.939  1.00 17.80 ? 43  ASN C CG  1 
ATOM 2839 O OD1 . ASN C 1 43  ? 44.890 7.793  98.030  1.00 15.50 ? 43  ASN C OD1 1 
ATOM 2840 N ND2 . ASN C 1 43  ? 44.931 7.675  95.791  1.00 20.55 ? 43  ASN C ND2 1 
ATOM 2841 N N   . LYS C 1 44  ? 42.080 10.140 98.955  1.00 6.21  ? 44  LYS C N   1 
ATOM 2842 C CA  . LYS C 1 44  ? 42.368 11.199 99.900  1.00 12.19 ? 44  LYS C CA  1 
ATOM 2843 C C   . LYS C 1 44  ? 42.045 10.783 101.342 1.00 13.77 ? 44  LYS C C   1 
ATOM 2844 O O   . LYS C 1 44  ? 42.951 10.645 102.181 1.00 17.58 ? 44  LYS C O   1 
ATOM 2845 C CB  . LYS C 1 44  ? 41.604 12.473 99.503  1.00 18.86 ? 44  LYS C CB  1 
ATOM 2846 C CG  . LYS C 1 44  ? 41.740 12.834 97.995  1.00 28.02 ? 44  LYS C CG  1 
ATOM 2847 C CD  . LYS C 1 44  ? 40.831 14.033 97.567  1.00 34.82 ? 44  LYS C CD  1 
ATOM 2848 C CE  . LYS C 1 44  ? 40.804 14.295 96.017  1.00 34.52 ? 44  LYS C CE  1 
ATOM 2849 N NZ  . LYS C 1 44  ? 39.832 15.387 95.577  1.00 34.90 ? 44  LYS C NZ  1 
ATOM 2850 N N   . THR C 1 45  ? 40.775 10.473 101.591 1.00 14.61 ? 45  THR C N   1 
ATOM 2851 C CA  . THR C 1 45  ? 40.315 10.097 102.923 1.00 12.95 ? 45  THR C CA  1 
ATOM 2852 C C   . THR C 1 45  ? 41.140 8.976  103.528 1.00 12.64 ? 45  THR C C   1 
ATOM 2853 O O   . THR C 1 45  ? 41.480 9.036  104.707 1.00 15.01 ? 45  THR C O   1 
ATOM 2854 C CB  . THR C 1 45  ? 38.820 9.781  102.917 1.00 8.32  ? 45  THR C CB  1 
ATOM 2855 O OG1 . THR C 1 45  ? 38.539 8.870  101.863 1.00 11.24 ? 45  THR C OG1 1 
ATOM 2856 C CG2 . THR C 1 45  ? 38.049 11.036 102.592 1.00 16.49 ? 45  THR C CG2 1 
ATOM 2857 N N   . LEU C 1 46  ? 41.546 8.018  102.695 1.00 11.75 ? 46  LEU C N   1 
ATOM 2858 C CA  . LEU C 1 46  ? 42.367 6.881  103.135 1.00 9.01  ? 46  LEU C CA  1 
ATOM 2859 C C   . LEU C 1 46  ? 43.775 7.317  103.471 1.00 8.76  ? 46  LEU C C   1 
ATOM 2860 O O   . LEU C 1 46  ? 44.354 6.851  104.460 1.00 5.07  ? 46  LEU C O   1 
ATOM 2861 C CB  . LEU C 1 46  ? 42.456 5.858  102.032 1.00 4.70  ? 46  LEU C CB  1 
ATOM 2862 C CG  . LEU C 1 46  ? 41.173 5.104  101.854 1.00 3.39  ? 46  LEU C CG  1 
ATOM 2863 C CD1 . LEU C 1 46  ? 41.215 4.436  100.508 1.00 8.11  ? 46  LEU C CD1 1 
ATOM 2864 C CD2 . LEU C 1 46  ? 41.075 4.109  102.979 1.00 3.72  ? 46  LEU C CD2 1 
ATOM 2865 N N   . ALA C 1 47  ? 44.328 8.158  102.587 1.00 9.24  ? 47  ALA C N   1 
ATOM 2866 C CA  . ALA C 1 47  ? 45.656 8.756  102.731 1.00 11.95 ? 47  ALA C CA  1 
ATOM 2867 C C   . ALA C 1 47  ? 45.652 9.301  104.131 1.00 16.39 ? 47  ALA C C   1 
ATOM 2868 O O   . ALA C 1 47  ? 46.715 9.434  104.769 1.00 17.22 ? 47  ALA C O   1 
ATOM 2869 C CB  . ALA C 1 47  ? 45.806 9.894  101.785 1.00 9.81  ? 47  ALA C CB  1 
ATOM 2870 N N   . ALA C 1 48  ? 44.430 9.701  104.528 1.00 20.50 ? 48  ALA C N   1 
ATOM 2871 C CA  . ALA C 1 48  ? 44.070 10.214 105.846 1.00 18.86 ? 48  ALA C CA  1 
ATOM 2872 C C   . ALA C 1 48  ? 45.027 11.317 106.190 1.00 19.17 ? 48  ALA C C   1 
ATOM 2873 O O   . ALA C 1 48  ? 45.311 12.162 105.331 1.00 18.97 ? 48  ALA C O   1 
ATOM 2874 C CB  . ALA C 1 48  ? 44.122 9.066  106.905 1.00 18.67 ? 48  ALA C CB  1 
ATOM 2875 N N   . GLY C 1 49  ? 45.507 11.298 107.436 1.00 18.26 ? 49  GLY C N   1 
ATOM 2876 C CA  . GLY C 1 49  ? 46.481 12.263 107.925 1.00 19.22 ? 49  GLY C CA  1 
ATOM 2877 C C   . GLY C 1 49  ? 47.619 11.390 108.404 1.00 16.14 ? 49  GLY C C   1 
ATOM 2878 O O   . GLY C 1 49  ? 47.842 11.177 109.608 1.00 13.79 ? 49  GLY C O   1 
ATOM 2879 N N   . ARG C 1 50  ? 48.235 10.758 107.414 1.00 18.43 ? 50  ARG C N   1 
ATOM 2880 C CA  . ARG C 1 50  ? 49.336 9.838  107.624 1.00 15.45 ? 50  ARG C CA  1 
ATOM 2881 C C   . ARG C 1 50  ? 50.602 10.505 107.105 1.00 11.40 ? 50  ARG C C   1 
ATOM 2882 O O   . ARG C 1 50  ? 50.552 11.237 106.115 1.00 13.84 ? 50  ARG C O   1 
ATOM 2883 C CB  . ARG C 1 50  ? 49.086 8.546  106.821 1.00 23.34 ? 50  ARG C CB  1 
ATOM 2884 C CG  . ARG C 1 50  ? 47.708 7.861  106.994 1.00 23.18 ? 50  ARG C CG  1 
ATOM 2885 C CD  . ARG C 1 50  ? 47.859 6.315  106.980 1.00 32.31 ? 50  ARG C CD  1 
ATOM 2886 N NE  . ARG C 1 50  ? 47.469 5.587  105.749 1.00 37.19 ? 50  ARG C NE  1 
ATOM 2887 C CZ  . ARG C 1 50  ? 48.153 5.523  104.592 1.00 42.47 ? 50  ARG C CZ  1 
ATOM 2888 N NH1 . ARG C 1 50  ? 49.320 6.165  104.418 1.00 43.14 ? 50  ARG C NH1 1 
ATOM 2889 N NH2 . ARG C 1 50  ? 47.686 4.758  103.601 1.00 41.17 ? 50  ARG C NH2 1 
ATOM 2890 N N   . PRO C 1 51  ? 51.706 10.397 107.854 1.00 6.43  ? 51  PRO C N   1 
ATOM 2891 C CA  . PRO C 1 51  ? 52.988 10.987 107.430 1.00 5.48  ? 51  PRO C CA  1 
ATOM 2892 C C   . PRO C 1 51  ? 53.409 10.233 106.179 1.00 2.63  ? 51  PRO C C   1 
ATOM 2893 O O   . PRO C 1 51  ? 52.692 9.336  105.775 1.00 2.63  ? 51  PRO C O   1 
ATOM 2894 C CB  . PRO C 1 51  ? 53.911 10.675 108.605 1.00 7.23  ? 51  PRO C CB  1 
ATOM 2895 C CG  . PRO C 1 51  ? 52.962 10.821 109.789 1.00 9.24  ? 51  PRO C CG  1 
ATOM 2896 C CD  . PRO C 1 51  ? 51.701 10.108 109.298 1.00 4.77  ? 51  PRO C CD  1 
ATOM 2897 N N   . THR C 1 52  ? 54.550 10.565 105.573 1.00 2.00  ? 52  THR C N   1 
ATOM 2898 C CA  . THR C 1 52  ? 54.989 9.861  104.361 1.00 2.00  ? 52  THR C CA  1 
ATOM 2899 C C   . THR C 1 52  ? 56.472 9.600  104.401 1.00 2.00  ? 52  THR C C   1 
ATOM 2900 O O   . THR C 1 52  ? 57.152 10.107 105.277 1.00 2.40  ? 52  THR C O   1 
ATOM 2901 C CB  . THR C 1 52  ? 54.750 10.704 103.174 1.00 2.00  ? 52  THR C CB  1 
ATOM 2902 O OG1 . THR C 1 52  ? 53.403 11.130 103.200 1.00 8.22  ? 52  THR C OG1 1 
ATOM 2903 C CG2 . THR C 1 52  ? 54.960 9.951  101.929 1.00 6.93  ? 52  THR C CG2 1 
ATOM 2904 N N   . ILE C 1 53  ? 56.990 8.797  103.481 1.00 2.00  ? 53  ILE C N   1 
ATOM 2905 C CA  . ILE C 1 53  ? 58.440 8.575  103.452 1.00 5.44  ? 53  ILE C CA  1 
ATOM 2906 C C   . ILE C 1 53  ? 59.087 9.923  103.117 1.00 6.21  ? 53  ILE C C   1 
ATOM 2907 O O   . ILE C 1 53  ? 60.273 10.133 103.358 1.00 10.70 ? 53  ILE C O   1 
ATOM 2908 C CB  . ILE C 1 53  ? 58.873 7.527  102.396 1.00 7.32  ? 53  ILE C CB  1 
ATOM 2909 C CG1 . ILE C 1 53  ? 60.330 7.123  102.646 1.00 3.87  ? 53  ILE C CG1 1 
ATOM 2910 C CG2 . ILE C 1 53  ? 58.657 8.061  100.969 1.00 2.45  ? 53  ILE C CG2 1 
ATOM 2911 C CD1 . ILE C 1 53  ? 60.975 6.378  101.487 1.00 5.34  ? 53  ILE C CD1 1 
ATOM 2912 N N   . ASN C 1 54  ? 58.299 10.816 102.523 1.00 2.00  ? 54  ASN C N   1 
ATOM 2913 C CA  . ASN C 1 54  ? 58.771 12.143 102.205 1.00 2.46  ? 54  ASN C CA  1 
ATOM 2914 C C   . ASN C 1 54  ? 58.728 13.056 103.427 1.00 3.27  ? 54  ASN C C   1 
ATOM 2915 O O   . ASN C 1 54  ? 59.504 13.999 103.507 1.00 5.75  ? 54  ASN C O   1 
ATOM 2916 C CB  . ASN C 1 54  ? 57.962 12.717 101.083 1.00 6.66  ? 54  ASN C CB  1 
ATOM 2917 C CG  . ASN C 1 54  ? 58.119 11.928 99.831  1.00 12.93 ? 54  ASN C CG  1 
ATOM 2918 O OD1 . ASN C 1 54  ? 59.072 12.123 99.085  1.00 17.22 ? 54  ASN C OD1 1 
ATOM 2919 N ND2 . ASN C 1 54  ? 57.185 11.014 99.583  1.00 18.76 ? 54  ASN C ND2 1 
ATOM 2920 N N   . HIS C 1 55  ? 57.813 12.816 104.364 1.00 2.68  ? 55  HIS C N   1 
ATOM 2921 C CA  . HIS C 1 55  ? 57.796 13.633 105.574 1.00 5.21  ? 55  HIS C CA  1 
ATOM 2922 C C   . HIS C 1 55  ? 57.610 12.938 106.933 1.00 8.74  ? 55  HIS C C   1 
ATOM 2923 O O   . HIS C 1 55  ? 57.305 13.635 107.923 1.00 4.75  ? 55  HIS C O   1 
ATOM 2924 C CB  . HIS C 1 55  ? 56.835 14.785 105.436 1.00 6.91  ? 55  HIS C CB  1 
ATOM 2925 C CG  . HIS C 1 55  ? 55.452 14.399 105.027 1.00 5.66  ? 55  HIS C CG  1 
ATOM 2926 N ND1 . HIS C 1 55  ? 54.980 14.582 103.741 1.00 10.19 ? 55  HIS C ND1 1 
ATOM 2927 C CD2 . HIS C 1 55  ? 54.390 13.993 105.757 1.00 4.76  ? 55  HIS C CD2 1 
ATOM 2928 C CE1 . HIS C 1 55  ? 53.688 14.320 103.697 1.00 3.97  ? 55  HIS C CE1 1 
ATOM 2929 N NE2 . HIS C 1 55  ? 53.304 13.962 104.908 1.00 8.29  ? 55  HIS C NE2 1 
ATOM 2930 N N   . PRO C 1 56  ? 58.123 11.669 107.050 1.00 10.44 ? 56  PRO C N   1 
ATOM 2931 C CA  . PRO C 1 56  ? 58.169 10.653 108.122 1.00 12.40 ? 56  PRO C CA  1 
ATOM 2932 C C   . PRO C 1 56  ? 57.616 10.897 109.525 1.00 13.65 ? 56  PRO C C   1 
ATOM 2933 O O   . PRO C 1 56  ? 57.208 9.914  110.182 1.00 17.32 ? 56  PRO C O   1 
ATOM 2934 C CB  . PRO C 1 56  ? 59.663 10.244 108.186 1.00 5.99  ? 56  PRO C CB  1 
ATOM 2935 C CG  . PRO C 1 56  ? 60.377 11.218 107.296 1.00 10.35 ? 56  PRO C CG  1 
ATOM 2936 C CD  . PRO C 1 56  ? 59.345 11.476 106.239 1.00 7.77  ? 56  PRO C CD  1 
ATOM 2937 N N   . THR C 1 57  ? 57.671 12.153 110.004 1.00 9.93  ? 57  THR C N   1 
ATOM 2938 C CA  . THR C 1 57  ? 57.194 12.505 111.342 1.00 4.61  ? 57  THR C CA  1 
ATOM 2939 C C   . THR C 1 57  ? 55.871 13.217 111.416 1.00 2.57  ? 57  THR C C   1 
ATOM 2940 O O   . THR C 1 57  ? 55.017 12.848 112.199 1.00 4.31  ? 57  THR C O   1 
ATOM 2941 C CB  . THR C 1 57  ? 58.211 13.348 112.081 1.00 2.00  ? 57  THR C CB  1 
ATOM 2942 O OG1 . THR C 1 57  ? 59.304 12.510 112.477 1.00 7.75  ? 57  THR C OG1 1 
ATOM 2943 C CG2 . THR C 1 57  ? 57.594 14.038 113.305 1.00 2.00  ? 57  THR C CG2 1 
ATOM 2944 N N   . PHE C 1 58  ? 55.702 14.245 110.604 1.00 5.03  ? 58  PHE C N   1 
ATOM 2945 C CA  . PHE C 1 58  ? 54.481 15.028 110.630 1.00 3.19  ? 58  PHE C CA  1 
ATOM 2946 C C   . PHE C 1 58  ? 53.641 14.695 109.441 1.00 4.78  ? 58  PHE C C   1 
ATOM 2947 O O   . PHE C 1 58  ? 54.132 14.118 108.469 1.00 6.44  ? 58  PHE C O   1 
ATOM 2948 C CB  . PHE C 1 58  ? 54.806 16.524 110.666 1.00 2.00  ? 58  PHE C CB  1 
ATOM 2949 C CG  . PHE C 1 58  ? 55.653 16.919 111.848 1.00 2.00  ? 58  PHE C CG  1 
ATOM 2950 C CD1 . PHE C 1 58  ? 56.944 17.361 111.681 1.00 5.17  ? 58  PHE C CD1 1 
ATOM 2951 C CD2 . PHE C 1 58  ? 55.177 16.784 113.126 1.00 5.98  ? 58  PHE C CD2 1 
ATOM 2952 C CE1 . PHE C 1 58  ? 57.748 17.651 112.771 1.00 3.91  ? 58  PHE C CE1 1 
ATOM 2953 C CE2 . PHE C 1 58  ? 55.976 17.072 114.210 1.00 6.18  ? 58  PHE C CE2 1 
ATOM 2954 C CZ  . PHE C 1 58  ? 57.264 17.506 114.029 1.00 6.09  ? 58  PHE C CZ  1 
ATOM 2955 N N   . VAL C 1 59  ? 52.352 14.956 109.590 1.00 5.20  ? 59  VAL C N   1 
ATOM 2956 C CA  . VAL C 1 59  ? 51.346 14.713 108.565 1.00 2.82  ? 59  VAL C CA  1 
ATOM 2957 C C   . VAL C 1 59  ? 51.493 15.707 107.447 1.00 2.00  ? 59  VAL C C   1 
ATOM 2958 O O   . VAL C 1 59  ? 52.222 16.667 107.575 1.00 2.00  ? 59  VAL C O   1 
ATOM 2959 C CB  . VAL C 1 59  ? 49.971 14.863 109.151 1.00 4.07  ? 59  VAL C CB  1 
ATOM 2960 C CG1 . VAL C 1 59  ? 49.759 13.785 110.160 1.00 6.68  ? 59  VAL C CG1 1 
ATOM 2961 C CG2 . VAL C 1 59  ? 49.838 16.219 109.843 1.00 2.19  ? 59  VAL C CG2 1 
ATOM 2962 N N   . GLY C 1 60  ? 50.767 15.501 106.361 1.00 2.00  ? 60  GLY C N   1 
ATOM 2963 C CA  . GLY C 1 60  ? 50.891 16.406 105.231 1.00 5.20  ? 60  GLY C CA  1 
ATOM 2964 C C   . GLY C 1 60  ? 50.116 17.705 105.325 1.00 6.42  ? 60  GLY C C   1 
ATOM 2965 O O   . GLY C 1 60  ? 49.733 18.112 106.421 1.00 12.78 ? 60  GLY C O   1 
ATOM 2966 N N   . SER C 1 61  ? 49.937 18.387 104.193 1.00 2.00  ? 61  SER C N   1 
ATOM 2967 C CA  . SER C 1 61  ? 49.165 19.615 104.183 1.00 3.71  ? 61  SER C CA  1 
ATOM 2968 C C   . SER C 1 61  ? 48.413 19.717 102.901 1.00 2.12  ? 61  SER C C   1 
ATOM 2969 O O   . SER C 1 61  ? 48.351 18.758 102.167 1.00 11.27 ? 61  SER C O   1 
ATOM 2970 C CB  . SER C 1 61  ? 50.010 20.847 104.400 1.00 7.02  ? 61  SER C CB  1 
ATOM 2971 O OG  . SER C 1 61  ? 49.160 21.925 104.747 1.00 9.42  ? 61  SER C OG  1 
ATOM 2972 N N   . GLU C 1 62  ? 47.903 20.887 102.582 1.00 2.00  ? 62  GLU C N   1 
ATOM 2973 C CA  . GLU C 1 62  ? 47.080 21.028 101.397 1.00 4.72  ? 62  GLU C CA  1 
ATOM 2974 C C   . GLU C 1 62  ? 47.641 21.792 100.223 1.00 4.81  ? 62  GLU C C   1 
ATOM 2975 O O   . GLU C 1 62  ? 48.411 22.724 100.397 1.00 9.43  ? 62  GLU C O   1 
ATOM 2976 C CB  . GLU C 1 62  ? 45.769 21.674 101.821 1.00 13.49 ? 62  GLU C CB  1 
ATOM 2977 C CG  . GLU C 1 62  ? 45.037 20.904 102.915 1.00 17.27 ? 62  GLU C CG  1 
ATOM 2978 C CD  . GLU C 1 62  ? 44.409 19.625 102.372 1.00 24.11 ? 62  GLU C CD  1 
ATOM 2979 O OE1 . GLU C 1 62  ? 43.902 19.688 101.214 1.00 25.94 ? 62  GLU C OE1 1 
ATOM 2980 O OE2 . GLU C 1 62  ? 44.431 18.575 103.085 1.00 23.76 ? 62  GLU C OE2 1 
ATOM 2981 N N   . ARG C 1 63  ? 47.149 21.463 99.036  1.00 4.43  ? 63  ARG C N   1 
ATOM 2982 C CA  . ARG C 1 63  ? 47.564 22.108 97.802  1.00 4.71  ? 63  ARG C CA  1 
ATOM 2983 C C   . ARG C 1 63  ? 46.861 23.433 97.697  1.00 5.62  ? 63  ARG C C   1 
ATOM 2984 O O   . ARG C 1 63  ? 45.683 23.549 98.012  1.00 7.64  ? 63  ARG C O   1 
ATOM 2985 C CB  . ARG C 1 63  ? 47.198 21.239 96.616  1.00 7.45  ? 63  ARG C CB  1 
ATOM 2986 C CG  . ARG C 1 63  ? 47.530 21.843 95.271  1.00 22.04 ? 63  ARG C CG  1 
ATOM 2987 C CD  . ARG C 1 63  ? 47.733 20.755 94.203  1.00 30.87 ? 63  ARG C CD  1 
ATOM 2988 N NE  . ARG C 1 63  ? 49.135 20.331 94.075  1.00 39.91 ? 63  ARG C NE  1 
ATOM 2989 C CZ  . ARG C 1 63  ? 49.796 20.249 92.916  1.00 44.20 ? 63  ARG C CZ  1 
ATOM 2990 N NH1 . ARG C 1 63  ? 49.175 20.564 91.774  1.00 46.17 ? 63  ARG C NH1 1 
ATOM 2991 N NH2 . ARG C 1 63  ? 51.072 19.845 92.887  1.00 40.50 ? 63  ARG C NH2 1 
ATOM 2992 N N   . CYS C 1 64  ? 47.572 24.429 97.202  1.00 9.78  ? 64  CYS C N   1 
ATOM 2993 C CA  . CYS C 1 64  ? 47.027 25.780 97.090  1.00 13.29 ? 64  CYS C CA  1 
ATOM 2994 C C   . CYS C 1 64  ? 45.861 26.033 96.158  1.00 14.98 ? 64  CYS C C   1 
ATOM 2995 O O   . CYS C 1 64  ? 45.753 25.437 95.073  1.00 14.72 ? 64  CYS C O   1 
ATOM 2996 C CB  . CYS C 1 64  ? 48.129 26.760 96.713  1.00 8.72  ? 64  CYS C CB  1 
ATOM 2997 S SG  . CYS C 1 64  ? 49.467 26.757 97.860  1.00 16.83 ? 64  CYS C SG  1 
ATOM 2998 N N   . ARG C 1 65  ? 44.991 26.942 96.601  1.00 15.73 ? 65  ARG C N   1 
ATOM 2999 C CA  . ARG C 1 65  ? 43.863 27.385 95.803  1.00 15.24 ? 65  ARG C CA  1 
ATOM 3000 C C   . ARG C 1 65  ? 44.576 27.936 94.583  1.00 11.06 ? 65  ARG C C   1 
ATOM 3001 O O   . ARG C 1 65  ? 45.616 28.585 94.710  1.00 14.04 ? 65  ARG C O   1 
ATOM 3002 C CB  . ARG C 1 65  ? 43.144 28.542 96.498  1.00 17.04 ? 65  ARG C CB  1 
ATOM 3003 C CG  . ARG C 1 65  ? 41.945 28.163 97.319  1.00 26.33 ? 65  ARG C CG  1 
ATOM 3004 C CD  . ARG C 1 65  ? 42.345 27.364 98.561  1.00 34.32 ? 65  ARG C CD  1 
ATOM 3005 N NE  . ARG C 1 65  ? 41.548 26.131 98.689  1.00 37.41 ? 65  ARG C NE  1 
ATOM 3006 C CZ  . ARG C 1 65  ? 40.377 26.028 99.330  1.00 39.68 ? 65  ARG C CZ  1 
ATOM 3007 N NH1 . ARG C 1 65  ? 39.831 27.091 99.939  1.00 40.50 ? 65  ARG C NH1 1 
ATOM 3008 N NH2 . ARG C 1 65  ? 39.731 24.859 99.330  1.00 37.58 ? 65  ARG C NH2 1 
ATOM 3009 N N   . PRO C 1 66  ? 44.064 27.665 93.392  1.00 6.66  ? 66  PRO C N   1 
ATOM 3010 C CA  . PRO C 1 66  ? 44.704 28.173 92.181  1.00 9.44  ? 66  PRO C CA  1 
ATOM 3011 C C   . PRO C 1 66  ? 45.004 29.657 92.254  1.00 9.71  ? 66  PRO C C   1 
ATOM 3012 O O   . PRO C 1 66  ? 44.375 30.405 93.007  1.00 11.14 ? 66  PRO C O   1 
ATOM 3013 C CB  . PRO C 1 66  ? 43.662 27.908 91.121  1.00 7.93  ? 66  PRO C CB  1 
ATOM 3014 C CG  . PRO C 1 66  ? 43.068 26.655 91.587  1.00 10.16 ? 66  PRO C CG  1 
ATOM 3015 C CD  . PRO C 1 66  ? 42.854 26.918 93.058  1.00 9.56  ? 66  PRO C CD  1 
ATOM 3016 N N   . GLY C 1 67  ? 46.006 30.080 91.499  1.00 12.69 ? 67  GLY C N   1 
ATOM 3017 C CA  . GLY C 1 67  ? 46.354 31.490 91.486  1.00 12.11 ? 67  GLY C CA  1 
ATOM 3018 C C   . GLY C 1 67  ? 46.714 32.071 92.830  1.00 8.03  ? 67  GLY C C   1 
ATOM 3019 O O   . GLY C 1 67  ? 46.946 33.281 92.935  1.00 7.27  ? 67  GLY C O   1 
ATOM 3020 N N   . TYR C 1 68  ? 46.696 31.235 93.861  1.00 6.52  ? 68  TYR C N   1 
ATOM 3021 C CA  . TYR C 1 68  ? 47.072 31.684 95.179  1.00 4.75  ? 68  TYR C CA  1 
ATOM 3022 C C   . TYR C 1 68  ? 48.397 31.057 95.472  1.00 3.97  ? 68  TYR C C   1 
ATOM 3023 O O   . TYR C 1 68  ? 48.785 30.061 94.837  1.00 2.46  ? 68  TYR C O   1 
ATOM 3024 C CB  . TYR C 1 68  ? 46.077 31.243 96.235  1.00 3.62  ? 68  TYR C CB  1 
ATOM 3025 C CG  . TYR C 1 68  ? 44.856 32.099 96.294  1.00 3.00  ? 68  TYR C CG  1 
ATOM 3026 C CD1 . TYR C 1 68  ? 43.962 32.119 95.242  1.00 2.00  ? 68  TYR C CD1 1 
ATOM 3027 C CD2 . TYR C 1 68  ? 44.582 32.882 97.416  1.00 2.78  ? 68  TYR C CD2 1 
ATOM 3028 C CE1 . TYR C 1 68  ? 42.821 32.893 95.294  1.00 3.72  ? 68  TYR C CE1 1 
ATOM 3029 C CE2 . TYR C 1 68  ? 43.437 33.662 97.487  1.00 4.69  ? 68  TYR C CE2 1 
ATOM 3030 C CZ  . TYR C 1 68  ? 42.554 33.664 96.419  1.00 6.40  ? 68  TYR C CZ  1 
ATOM 3031 O OH  . TYR C 1 68  ? 41.392 34.413 96.470  1.00 9.77  ? 68  TYR C OH  1 
ATOM 3032 N N   . THR C 1 69  ? 49.130 31.736 96.338  1.00 2.95  ? 69  THR C N   1 
ATOM 3033 C CA  . THR C 1 69  ? 50.421 31.291 96.806  1.00 6.53  ? 69  THR C CA  1 
ATOM 3034 C C   . THR C 1 69  ? 50.343 31.667 98.284  1.00 6.86  ? 69  THR C C   1 
ATOM 3035 O O   . THR C 1 69  ? 49.279 32.059 98.762  1.00 9.60  ? 69  THR C O   1 
ATOM 3036 C CB  . THR C 1 69  ? 51.551 32.050 96.167  1.00 5.39  ? 69  THR C CB  1 
ATOM 3037 O OG1 . THR C 1 69  ? 51.698 33.290 96.848  1.00 13.47 ? 69  THR C OG1 1 
ATOM 3038 C CG2 . THR C 1 69  ? 51.261 32.331 94.695  1.00 8.51  ? 69  THR C CG2 1 
ATOM 3039 N N   . PHE C 1 70  ? 51.457 31.673 98.995  1.00 7.42  ? 70  PHE C N   1 
ATOM 3040 C CA  . PHE C 1 70  ? 51.377 31.984 100.416 1.00 6.96  ? 70  PHE C CA  1 
ATOM 3041 C C   . PHE C 1 70  ? 52.668 32.574 100.912 1.00 6.38  ? 70  PHE C C   1 
ATOM 3042 O O   . PHE C 1 70  ? 53.722 32.253 100.365 1.00 7.97  ? 70  PHE C O   1 
ATOM 3043 C CB  . PHE C 1 70  ? 51.145 30.691 101.188 1.00 4.35  ? 70  PHE C CB  1 
ATOM 3044 C CG  . PHE C 1 70  ? 52.264 29.723 101.054 1.00 2.00  ? 70  PHE C CG  1 
ATOM 3045 C CD1 . PHE C 1 70  ? 53.384 29.826 101.859 1.00 2.00  ? 70  PHE C CD1 1 
ATOM 3046 C CD2 . PHE C 1 70  ? 52.218 28.733 100.096 1.00 2.00  ? 70  PHE C CD2 1 
ATOM 3047 C CE1 . PHE C 1 70  ? 54.431 28.968 101.710 1.00 2.00  ? 70  PHE C CE1 1 
ATOM 3048 C CE2 . PHE C 1 70  ? 53.265 27.865 99.940  1.00 2.00  ? 70  PHE C CE2 1 
ATOM 3049 C CZ  . PHE C 1 70  ? 54.375 27.983 100.750 1.00 2.00  ? 70  PHE C CZ  1 
ATOM 3050 N N   . THR C 1 71  ? 52.605 33.416 101.935 1.00 2.00  ? 71  THR C N   1 
ATOM 3051 C CA  . THR C 1 71  ? 53.829 33.945 102.496 1.00 2.00  ? 71  THR C CA  1 
ATOM 3052 C C   . THR C 1 71  ? 53.724 33.496 103.912 1.00 2.00  ? 71  THR C C   1 
ATOM 3053 O O   . THR C 1 71  ? 52.640 33.475 104.429 1.00 2.00  ? 71  THR C O   1 
ATOM 3054 C CB  . THR C 1 71  ? 53.981 35.471 102.378 1.00 5.14  ? 71  THR C CB  1 
ATOM 3055 O OG1 . THR C 1 71  ? 52.953 36.122 103.113 1.00 9.37  ? 71  THR C OG1 1 
ATOM 3056 C CG2 . THR C 1 71  ? 53.911 35.917 100.911 1.00 2.64  ? 71  THR C CG2 1 
ATOM 3057 N N   . SER C 1 72  ? 54.836 33.073 104.495 1.00 2.00  ? 72  SER C N   1 
ATOM 3058 C CA  . SER C 1 72  ? 54.882 32.536 105.853 1.00 2.76  ? 72  SER C CA  1 
ATOM 3059 C C   . SER C 1 72  ? 55.483 33.471 106.860 1.00 2.00  ? 72  SER C C   1 
ATOM 3060 O O   . SER C 1 72  ? 56.251 34.326 106.515 1.00 6.34  ? 72  SER C O   1 
ATOM 3061 C CB  . SER C 1 72  ? 55.729 31.259 105.864 1.00 12.19 ? 72  SER C CB  1 
ATOM 3062 O OG  . SER C 1 72  ? 55.290 30.257 104.939 1.00 18.22 ? 72  SER C OG  1 
ATOM 3063 N N   . ILE C 1 73  ? 55.207 33.242 108.123 1.00 2.00  ? 73  ILE C N   1 
ATOM 3064 C CA  . ILE C 1 73  ? 55.732 34.071 109.185 1.00 2.00  ? 73  ILE C CA  1 
ATOM 3065 C C   . ILE C 1 73  ? 56.170 33.067 110.209 1.00 3.73  ? 73  ILE C C   1 
ATOM 3066 O O   . ILE C 1 73  ? 55.446 32.116 110.475 1.00 11.68 ? 73  ILE C O   1 
ATOM 3067 C CB  . ILE C 1 73  ? 54.613 34.915 109.815 1.00 2.00  ? 73  ILE C CB  1 
ATOM 3068 C CG1 . ILE C 1 73  ? 54.285 36.101 108.932 1.00 2.00  ? 73  ILE C CG1 1 
ATOM 3069 C CG2 . ILE C 1 73  ? 54.972 35.355 111.197 1.00 2.00  ? 73  ILE C CG2 1 
ATOM 3070 C CD1 . ILE C 1 73  ? 52.932 36.644 109.157 1.00 2.00  ? 73  ILE C CD1 1 
ATOM 3071 N N   . THR C 1 74  ? 57.361 33.215 110.749 1.00 2.93  ? 74  THR C N   1 
ATOM 3072 C CA  . THR C 1 74  ? 57.809 32.288 111.763 1.00 2.00  ? 74  THR C CA  1 
ATOM 3073 C C   . THR C 1 74  ? 57.737 33.039 113.062 1.00 3.64  ? 74  THR C C   1 
ATOM 3074 O O   . THR C 1 74  ? 57.988 34.234 113.066 1.00 14.60 ? 74  THR C O   1 
ATOM 3075 C CB  . THR C 1 74  ? 59.265 31.907 111.548 1.00 2.00  ? 74  THR C CB  1 
ATOM 3076 O OG1 . THR C 1 74  ? 59.415 31.309 110.262 1.00 8.95  ? 74  THR C OG1 1 
ATOM 3077 C CG2 . THR C 1 74  ? 59.723 30.922 112.603 1.00 4.26  ? 74  THR C CG2 1 
ATOM 3078 N N   . LEU C 1 75  ? 57.358 32.395 114.155 1.00 3.90  ? 75  LEU C N   1 
ATOM 3079 C CA  . LEU C 1 75  ? 57.358 33.101 115.424 1.00 6.28  ? 75  LEU C CA  1 
ATOM 3080 C C   . LEU C 1 75  ? 57.729 32.169 116.553 1.00 7.39  ? 75  LEU C C   1 
ATOM 3081 O O   . LEU C 1 75  ? 57.082 31.133 116.744 1.00 5.92  ? 75  LEU C O   1 
ATOM 3082 C CB  . LEU C 1 75  ? 56.050 33.879 115.668 1.00 10.08 ? 75  LEU C CB  1 
ATOM 3083 C CG  . LEU C 1 75  ? 54.656 33.281 115.824 1.00 13.22 ? 75  LEU C CG  1 
ATOM 3084 C CD1 . LEU C 1 75  ? 54.285 33.280 117.299 1.00 13.99 ? 75  LEU C CD1 1 
ATOM 3085 C CD2 . LEU C 1 75  ? 53.643 34.110 115.054 1.00 10.20 ? 75  LEU C CD2 1 
ATOM 3086 N N   . LYS C 1 76  ? 58.858 32.483 117.196 1.00 10.45 ? 76  LYS C N   1 
ATOM 3087 C CA  . LYS C 1 76  ? 59.405 31.706 118.320 1.00 14.23 ? 76  LYS C CA  1 
ATOM 3088 C C   . LYS C 1 76  ? 59.008 32.423 119.607 1.00 13.10 ? 76  LYS C C   1 
ATOM 3089 O O   . LYS C 1 76  ? 59.708 33.306 120.088 1.00 17.15 ? 76  LYS C O   1 
ATOM 3090 C CB  . LYS C 1 76  ? 60.938 31.629 118.242 1.00 17.56 ? 76  LYS C CB  1 
ATOM 3091 C CG  . LYS C 1 76  ? 61.541 31.143 116.906 1.00 22.08 ? 76  LYS C CG  1 
ATOM 3092 C CD  . LYS C 1 76  ? 63.086 31.229 116.962 1.00 26.81 ? 76  LYS C CD  1 
ATOM 3093 C CE  . LYS C 1 76  ? 63.830 30.422 115.864 1.00 32.07 ? 76  LYS C CE  1 
ATOM 3094 N NZ  . LYS C 1 76  ? 64.012 28.915 116.100 1.00 37.77 ? 76  LYS C NZ  1 
ATOM 3095 N N   . PRO C 1 77  ? 57.909 31.998 120.220 1.00 12.08 ? 77  PRO C N   1 
ATOM 3096 C CA  . PRO C 1 77  ? 57.399 32.604 121.445 1.00 11.44 ? 77  PRO C CA  1 
ATOM 3097 C C   . PRO C 1 77  ? 58.222 32.479 122.696 1.00 9.28  ? 77  PRO C C   1 
ATOM 3098 O O   . PRO C 1 77  ? 58.808 31.437 122.950 1.00 11.47 ? 77  PRO C O   1 
ATOM 3099 C CB  . PRO C 1 77  ? 56.065 31.902 121.615 1.00 13.93 ? 77  PRO C CB  1 
ATOM 3100 C CG  . PRO C 1 77  ? 56.367 30.545 121.126 1.00 13.98 ? 77  PRO C CG  1 
ATOM 3101 C CD  . PRO C 1 77  ? 57.125 30.808 119.864 1.00 12.00 ? 77  PRO C CD  1 
ATOM 3102 N N   . PRO C 1 78  ? 58.188 33.517 123.545 1.00 11.43 ? 78  PRO C N   1 
ATOM 3103 C CA  . PRO C 1 78  ? 58.893 33.627 124.831 1.00 14.57 ? 78  PRO C CA  1 
ATOM 3104 C C   . PRO C 1 78  ? 58.266 32.625 125.786 1.00 14.14 ? 78  PRO C C   1 
ATOM 3105 O O   . PRO C 1 78  ? 57.193 32.076 125.486 1.00 13.39 ? 78  PRO C O   1 
ATOM 3106 C CB  . PRO C 1 78  ? 58.552 35.036 125.276 1.00 13.01 ? 78  PRO C CB  1 
ATOM 3107 C CG  . PRO C 1 78  ? 57.135 35.157 124.792 1.00 13.41 ? 78  PRO C CG  1 
ATOM 3108 C CD  . PRO C 1 78  ? 57.300 34.672 123.362 1.00 13.53 ? 78  PRO C CD  1 
ATOM 3109 N N   . LYS C 1 79  ? 58.898 32.405 126.940 1.00 15.00 ? 79  LYS C N   1 
ATOM 3110 C CA  . LYS C 1 79  ? 58.333 31.444 127.881 1.00 13.99 ? 79  LYS C CA  1 
ATOM 3111 C C   . LYS C 1 79  ? 56.857 31.727 128.048 1.00 13.66 ? 79  LYS C C   1 
ATOM 3112 O O   . LYS C 1 79  ? 56.455 32.877 128.054 1.00 17.16 ? 79  LYS C O   1 
ATOM 3113 C CB  . LYS C 1 79  ? 58.975 31.556 129.259 1.00 14.25 ? 79  LYS C CB  1 
ATOM 3114 C CG  . LYS C 1 79  ? 57.969 31.214 130.383 1.00 14.75 ? 79  LYS C CG  1 
ATOM 3115 C CD  . LYS C 1 79  ? 58.559 31.259 131.760 1.00 18.10 ? 79  LYS C CD  1 
ATOM 3116 C CE  . LYS C 1 79  ? 59.808 30.405 131.789 1.00 23.94 ? 79  LYS C CE  1 
ATOM 3117 N NZ  . LYS C 1 79  ? 60.274 30.080 133.147 1.00 24.61 ? 79  LYS C NZ  1 
ATOM 3118 N N   . ILE C 1 80  ? 56.042 30.690 128.065 1.00 11.55 ? 80  ILE C N   1 
ATOM 3119 C CA  . ILE C 1 80  ? 54.632 30.869 128.321 1.00 10.01 ? 80  ILE C CA  1 
ATOM 3120 C C   . ILE C 1 80  ? 54.474 30.223 129.680 1.00 11.66 ? 80  ILE C C   1 
ATOM 3121 O O   . ILE C 1 80  ? 54.860 29.072 129.877 1.00 11.05 ? 80  ILE C O   1 
ATOM 3122 C CB  . ILE C 1 80  ? 53.767 30.129 127.340 1.00 8.57  ? 80  ILE C CB  1 
ATOM 3123 C CG1 . ILE C 1 80  ? 53.660 30.925 126.036 1.00 9.89  ? 80  ILE C CG1 1 
ATOM 3124 C CG2 . ILE C 1 80  ? 52.417 29.912 127.955 1.00 8.28  ? 80  ILE C CG2 1 
ATOM 3125 C CD1 . ILE C 1 80  ? 53.088 30.115 124.866 1.00 6.48  ? 80  ILE C CD1 1 
ATOM 3126 N N   . ASP C 1 81  ? 53.978 30.973 130.646 1.00 14.44 ? 81  ASP C N   1 
ATOM 3127 C CA  . ASP C 1 81  ? 53.810 30.398 131.959 1.00 16.89 ? 81  ASP C CA  1 
ATOM 3128 C C   . ASP C 1 81  ? 52.815 29.285 131.972 1.00 16.53 ? 81  ASP C C   1 
ATOM 3129 O O   . ASP C 1 81  ? 52.025 29.090 131.039 1.00 15.86 ? 81  ASP C O   1 
ATOM 3130 C CB  . ASP C 1 81  ? 53.359 31.423 132.970 1.00 26.63 ? 81  ASP C CB  1 
ATOM 3131 C CG  . ASP C 1 81  ? 54.496 32.228 133.510 1.00 32.23 ? 81  ASP C CG  1 
ATOM 3132 O OD1 . ASP C 1 81  ? 54.491 33.462 133.268 1.00 39.39 ? 81  ASP C OD1 1 
ATOM 3133 O OD2 . ASP C 1 81  ? 55.387 31.618 134.162 1.00 35.51 ? 81  ASP C OD2 1 
ATOM 3134 N N   . ARG C 1 82  ? 52.845 28.568 133.077 1.00 15.87 ? 82  ARG C N   1 
ATOM 3135 C CA  . ARG C 1 82  ? 51.958 27.459 133.271 1.00 16.70 ? 82  ARG C CA  1 
ATOM 3136 C C   . ARG C 1 82  ? 50.570 28.052 133.194 1.00 15.98 ? 82  ARG C C   1 
ATOM 3137 O O   . ARG C 1 82  ? 50.266 29.004 133.912 1.00 19.55 ? 82  ARG C O   1 
ATOM 3138 C CB  . ARG C 1 82  ? 52.209 26.889 134.652 1.00 21.98 ? 82  ARG C CB  1 
ATOM 3139 C CG  . ARG C 1 82  ? 51.721 25.481 134.818 1.00 27.71 ? 82  ARG C CG  1 
ATOM 3140 C CD  . ARG C 1 82  ? 50.201 25.400 134.851 1.00 31.73 ? 82  ARG C CD  1 
ATOM 3141 N NE  . ARG C 1 82  ? 49.774 24.023 135.064 1.00 40.83 ? 82  ARG C NE  1 
ATOM 3142 C CZ  . ARG C 1 82  ? 50.115 23.286 136.124 1.00 43.14 ? 82  ARG C CZ  1 
ATOM 3143 N NH1 . ARG C 1 82  ? 50.887 23.778 137.097 1.00 40.25 ? 82  ARG C NH1 1 
ATOM 3144 N NH2 . ARG C 1 82  ? 49.682 22.032 136.204 1.00 45.62 ? 82  ARG C NH2 1 
ATOM 3145 N N   . GLY C 1 83  ? 49.765 27.554 132.266 1.00 14.12 ? 83  GLY C N   1 
ATOM 3146 C CA  . GLY C 1 83  ? 48.410 28.054 132.139 1.00 14.47 ? 83  GLY C CA  1 
ATOM 3147 C C   . GLY C 1 83  ? 48.211 29.546 131.928 1.00 13.98 ? 83  GLY C C   1 
ATOM 3148 O O   . GLY C 1 83  ? 47.451 30.168 132.656 1.00 19.72 ? 83  GLY C O   1 
ATOM 3149 N N   . SER C 1 84  ? 48.913 30.132 130.971 1.00 12.77 ? 84  SER C N   1 
ATOM 3150 C CA  . SER C 1 84  ? 48.749 31.542 130.657 1.00 15.12 ? 84  SER C CA  1 
ATOM 3151 C C   . SER C 1 84  ? 48.782 31.535 129.139 1.00 14.65 ? 84  SER C C   1 
ATOM 3152 O O   . SER C 1 84  ? 49.021 30.486 128.553 1.00 12.78 ? 84  SER C O   1 
ATOM 3153 C CB  . SER C 1 84  ? 49.895 32.375 131.227 1.00 19.18 ? 84  SER C CB  1 
ATOM 3154 O OG  . SER C 1 84  ? 51.103 32.180 130.501 1.00 26.30 ? 84  SER C OG  1 
ATOM 3155 N N   . TYR C 1 85  ? 48.553 32.660 128.474 1.00 14.89 ? 85  TYR C N   1 
ATOM 3156 C CA  . TYR C 1 85  ? 48.578 32.575 127.030 1.00 15.36 ? 85  TYR C CA  1 
ATOM 3157 C C   . TYR C 1 85  ? 49.741 33.235 126.335 1.00 11.62 ? 85  TYR C C   1 
ATOM 3158 O O   . TYR C 1 85  ? 50.809 33.413 126.908 1.00 16.11 ? 85  TYR C O   1 
ATOM 3159 C CB  . TYR C 1 85  ? 47.228 32.946 126.412 1.00 16.89 ? 85  TYR C CB  1 
ATOM 3160 C CG  . TYR C 1 85  ? 46.931 34.410 126.250 1.00 23.64 ? 85  TYR C CG  1 
ATOM 3161 C CD1 . TYR C 1 85  ? 46.959 35.019 124.985 1.00 28.72 ? 85  TYR C CD1 1 
ATOM 3162 C CD2 . TYR C 1 85  ? 46.555 35.184 127.335 1.00 30.37 ? 85  TYR C CD2 1 
ATOM 3163 C CE1 . TYR C 1 85  ? 46.610 36.376 124.810 1.00 28.95 ? 85  TYR C CE1 1 
ATOM 3164 C CE2 . TYR C 1 85  ? 46.199 36.546 127.178 1.00 31.84 ? 85  TYR C CE2 1 
ATOM 3165 C CZ  . TYR C 1 85  ? 46.229 37.127 125.919 1.00 29.99 ? 85  TYR C CZ  1 
ATOM 3166 O OH  . TYR C 1 85  ? 45.871 38.448 125.798 1.00 33.32 ? 85  TYR C OH  1 
ATOM 3167 N N   . TYR C 1 86  ? 49.563 33.467 125.055 1.00 7.58  ? 86  TYR C N   1 
ATOM 3168 C CA  . TYR C 1 86  ? 50.561 34.074 124.219 1.00 9.38  ? 86  TYR C CA  1 
ATOM 3169 C C   . TYR C 1 86  ? 49.749 34.416 122.968 1.00 12.06 ? 86  TYR C C   1 
ATOM 3170 O O   . TYR C 1 86  ? 48.841 33.672 122.583 1.00 16.77 ? 86  TYR C O   1 
ATOM 3171 C CB  . TYR C 1 86  ? 51.668 33.052 123.929 1.00 5.81  ? 86  TYR C CB  1 
ATOM 3172 C CG  . TYR C 1 86  ? 52.561 33.442 122.786 1.00 11.13 ? 86  TYR C CG  1 
ATOM 3173 C CD1 . TYR C 1 86  ? 53.617 34.328 122.969 1.00 14.69 ? 86  TYR C CD1 1 
ATOM 3174 C CD2 . TYR C 1 86  ? 52.267 33.038 121.491 1.00 11.09 ? 86  TYR C CD2 1 
ATOM 3175 C CE1 . TYR C 1 86  ? 54.340 34.818 121.885 1.00 13.17 ? 86  TYR C CE1 1 
ATOM 3176 C CE2 . TYR C 1 86  ? 52.981 33.518 120.400 1.00 17.37 ? 86  TYR C CE2 1 
ATOM 3177 C CZ  . TYR C 1 86  ? 54.010 34.416 120.603 1.00 16.74 ? 86  TYR C CZ  1 
ATOM 3178 O OH  . TYR C 1 86  ? 54.670 34.953 119.521 1.00 22.37 ? 86  TYR C OH  1 
ATOM 3179 N N   . GLY C 1 87  ? 49.967 35.588 122.403 1.00 10.95 ? 87  GLY C N   1 
ATOM 3180 C CA  . GLY C 1 87  ? 49.229 35.960 121.214 1.00 8.90  ? 87  GLY C CA  1 
ATOM 3181 C C   . GLY C 1 87  ? 50.194 36.727 120.347 1.00 10.63 ? 87  GLY C C   1 
ATOM 3182 O O   . GLY C 1 87  ? 51.291 37.055 120.813 1.00 18.56 ? 87  GLY C O   1 
ATOM 3183 N N   . LYS C 1 88  ? 49.839 37.004 119.100 1.00 5.94  ? 88  LYS C N   1 
ATOM 3184 C CA  . LYS C 1 88  ? 50.738 37.747 118.252 1.00 5.85  ? 88  LYS C CA  1 
ATOM 3185 C C   . LYS C 1 88  ? 49.981 38.076 117.011 1.00 6.56  ? 88  LYS C C   1 
ATOM 3186 O O   . LYS C 1 88  ? 49.393 37.183 116.408 1.00 10.09 ? 88  LYS C O   1 
ATOM 3187 C CB  . LYS C 1 88  ? 51.937 36.889 117.899 1.00 10.58 ? 88  LYS C CB  1 
ATOM 3188 C CG  . LYS C 1 88  ? 53.180 37.690 117.669 1.00 21.63 ? 88  LYS C CG  1 
ATOM 3189 C CD  . LYS C 1 88  ? 53.014 38.705 116.545 1.00 27.02 ? 88  LYS C CD  1 
ATOM 3190 C CE  . LYS C 1 88  ? 53.884 39.948 116.753 1.00 29.48 ? 88  LYS C CE  1 
ATOM 3191 N NZ  . LYS C 1 88  ? 55.343 39.636 116.790 1.00 35.83 ? 88  LYS C NZ  1 
ATOM 3192 N N   . ARG C 1 89  ? 49.955 39.345 116.626 1.00 5.30  ? 89  ARG C N   1 
ATOM 3193 C CA  . ARG C 1 89  ? 49.235 39.688 115.418 1.00 3.46  ? 89  ARG C CA  1 
ATOM 3194 C C   . ARG C 1 89  ? 49.937 39.237 114.157 1.00 4.25  ? 89  ARG C C   1 
ATOM 3195 O O   . ARG C 1 89  ? 51.158 39.262 114.029 1.00 2.00  ? 89  ARG C O   1 
ATOM 3196 C CB  . ARG C 1 89  ? 49.001 41.166 115.317 1.00 4.78  ? 89  ARG C CB  1 
ATOM 3197 C CG  . ARG C 1 89  ? 48.195 41.741 116.411 1.00 10.68 ? 89  ARG C CG  1 
ATOM 3198 C CD  . ARG C 1 89  ? 47.546 43.043 115.953 1.00 15.45 ? 89  ARG C CD  1 
ATOM 3199 N NE  . ARG C 1 89  ? 46.514 43.421 116.892 1.00 19.07 ? 89  ARG C NE  1 
ATOM 3200 C CZ  . ARG C 1 89  ? 45.238 43.090 116.761 1.00 22.81 ? 89  ARG C CZ  1 
ATOM 3201 N NH1 . ARG C 1 89  ? 44.828 42.402 115.702 1.00 20.64 ? 89  ARG C NH1 1 
ATOM 3202 N NH2 . ARG C 1 89  ? 44.409 43.286 117.777 1.00 22.40 ? 89  ARG C NH2 1 
ATOM 3203 N N   . LEU C 1 90  ? 49.168 38.788 113.201 1.00 5.96  ? 90  LEU C N   1 
ATOM 3204 C CA  . LEU C 1 90  ? 49.809 38.389 111.977 1.00 8.89  ? 90  LEU C CA  1 
ATOM 3205 C C   . LEU C 1 90  ? 50.209 39.704 111.315 1.00 9.87  ? 90  LEU C C   1 
ATOM 3206 O O   . LEU C 1 90  ? 49.441 40.666 111.308 1.00 13.71 ? 90  LEU C O   1 
ATOM 3207 C CB  . LEU C 1 90  ? 48.858 37.568 111.101 1.00 2.70  ? 90  LEU C CB  1 
ATOM 3208 C CG  . LEU C 1 90  ? 48.238 36.431 111.894 1.00 2.00  ? 90  LEU C CG  1 
ATOM 3209 C CD1 . LEU C 1 90  ? 47.344 35.684 111.019 1.00 2.14  ? 90  LEU C CD1 1 
ATOM 3210 C CD2 . LEU C 1 90  ? 49.281 35.531 112.420 1.00 2.00  ? 90  LEU C CD2 1 
ATOM 3211 N N   . LEU C 1 91  ? 51.456 39.778 110.873 1.00 10.84 ? 91  LEU C N   1 
ATOM 3212 C CA  . LEU C 1 91  ? 51.966 40.964 110.200 1.00 10.21 ? 91  LEU C CA  1 
ATOM 3213 C C   . LEU C 1 91  ? 53.012 40.566 109.165 1.00 8.85  ? 91  LEU C C   1 
ATOM 3214 O O   . LEU C 1 91  ? 54.156 40.226 109.499 1.00 5.46  ? 91  LEU C O   1 
ATOM 3215 C CB  . LEU C 1 91  ? 52.550 41.947 111.213 1.00 11.59 ? 91  LEU C CB  1 
ATOM 3216 C CG  . LEU C 1 91  ? 52.823 41.341 112.587 1.00 15.35 ? 91  LEU C CG  1 
ATOM 3217 C CD1 . LEU C 1 91  ? 53.941 40.270 112.506 1.00 10.66 ? 91  LEU C CD1 1 
ATOM 3218 C CD2 . LEU C 1 91  ? 53.124 42.480 113.583 1.00 12.30 ? 91  LEU C CD2 1 
ATOM 3219 N N   . LEU C 1 92  ? 52.578 40.541 107.911 1.00 8.09  ? 92  LEU C N   1 
ATOM 3220 C CA  . LEU C 1 92  ? 53.442 40.187 106.802 1.00 8.78  ? 92  LEU C CA  1 
ATOM 3221 C C   . LEU C 1 92  ? 54.539 41.201 106.563 1.00 11.48 ? 92  LEU C C   1 
ATOM 3222 O O   . LEU C 1 92  ? 54.471 42.327 107.041 1.00 15.00 ? 92  LEU C O   1 
ATOM 3223 C CB  . LEU C 1 92  ? 52.623 40.075 105.534 1.00 4.09  ? 92  LEU C CB  1 
ATOM 3224 C CG  . LEU C 1 92  ? 51.591 38.980 105.594 1.00 2.03  ? 92  LEU C CG  1 
ATOM 3225 C CD1 . LEU C 1 92  ? 51.177 38.733 104.197 1.00 5.05  ? 92  LEU C CD1 1 
ATOM 3226 C CD2 . LEU C 1 92  ? 52.183 37.736 106.196 1.00 2.00  ? 92  LEU C CD2 1 
ATOM 3227 N N   . PRO C 1 93  ? 55.598 40.806 105.849 1.00 16.87 ? 93  PRO C N   1 
ATOM 3228 C CA  . PRO C 1 93  ? 56.638 41.801 105.611 1.00 21.53 ? 93  PRO C CA  1 
ATOM 3229 C C   . PRO C 1 93  ? 56.098 42.868 104.647 1.00 24.41 ? 93  PRO C C   1 
ATOM 3230 O O   . PRO C 1 93  ? 55.227 42.578 103.791 1.00 22.75 ? 93  PRO C O   1 
ATOM 3231 C CB  . PRO C 1 93  ? 57.747 40.973 104.973 1.00 24.93 ? 93  PRO C CB  1 
ATOM 3232 C CG  . PRO C 1 93  ? 57.006 39.885 104.280 1.00 18.75 ? 93  PRO C CG  1 
ATOM 3233 C CD  . PRO C 1 93  ? 56.021 39.492 105.343 1.00 19.39 ? 93  PRO C CD  1 
ATOM 3234 N N   . ASP C 1 94  ? 56.628 44.087 104.788 1.00 25.55 ? 94  ASP C N   1 
ATOM 3235 C CA  . ASP C 1 94  ? 56.227 45.240 103.981 1.00 26.00 ? 94  ASP C CA  1 
ATOM 3236 C C   . ASP C 1 94  ? 55.896 44.915 102.533 1.00 21.45 ? 94  ASP C C   1 
ATOM 3237 O O   . ASP C 1 94  ? 54.835 45.245 102.023 1.00 20.19 ? 94  ASP C O   1 
ATOM 3238 C CB  . ASP C 1 94  ? 57.322 46.301 104.043 1.00 34.68 ? 94  ASP C CB  1 
ATOM 3239 C CG  . ASP C 1 94  ? 57.346 47.045 105.383 1.00 44.06 ? 94  ASP C CG  1 
ATOM 3240 O OD1 . ASP C 1 94  ? 56.356 46.914 106.157 1.00 48.39 ? 94  ASP C OD1 1 
ATOM 3241 O OD2 . ASP C 1 94  ? 58.343 47.773 105.654 1.00 45.54 ? 94  ASP C OD2 1 
ATOM 3242 N N   . SER C 1 95  ? 56.819 44.225 101.903 1.00 18.52 ? 95  SER C N   1 
ATOM 3243 C CA  . SER C 1 95  ? 56.718 43.790 100.530 1.00 19.97 ? 95  SER C CA  1 
ATOM 3244 C C   . SER C 1 95  ? 55.364 43.199 100.125 1.00 20.80 ? 95  SER C C   1 
ATOM 3245 O O   . SER C 1 95  ? 55.047 43.173 98.936  1.00 24.67 ? 95  SER C O   1 
ATOM 3246 C CB  . SER C 1 95  ? 57.793 42.725 100.311 1.00 22.58 ? 95  SER C CB  1 
ATOM 3247 O OG  . SER C 1 95  ? 58.708 42.679 101.417 1.00 27.53 ? 95  SER C OG  1 
ATOM 3248 N N   . VAL C 1 96  ? 54.595 42.673 101.082 1.00 19.06 ? 96  VAL C N   1 
ATOM 3249 C CA  . VAL C 1 96  ? 53.297 42.053 100.771 1.00 14.43 ? 96  VAL C CA  1 
ATOM 3250 C C   . VAL C 1 96  ? 52.185 42.999 101.125 1.00 11.19 ? 96  VAL C C   1 
ATOM 3251 O O   . VAL C 1 96  ? 51.256 43.255 100.344 1.00 7.15  ? 96  VAL C O   1 
ATOM 3252 C CB  . VAL C 1 96  ? 53.007 40.822 101.647 1.00 13.27 ? 96  VAL C CB  1 
ATOM 3253 C CG1 . VAL C 1 96  ? 52.079 39.875 100.915 1.00 11.90 ? 96  VAL C CG1 1 
ATOM 3254 C CG2 . VAL C 1 96  ? 54.268 40.172 102.125 1.00 10.31 ? 96  VAL C CG2 1 
ATOM 3255 N N   . THR C 1 97  ? 52.303 43.486 102.354 1.00 6.92  ? 97  THR C N   1 
ATOM 3256 C CA  . THR C 1 97  ? 51.347 44.385 102.936 1.00 8.23  ? 97  THR C CA  1 
ATOM 3257 C C   . THR C 1 97  ? 51.105 45.541 101.992 1.00 9.31  ? 97  THR C C   1 
ATOM 3258 O O   . THR C 1 97  ? 50.119 46.237 102.106 1.00 14.52 ? 97  THR C O   1 
ATOM 3259 C CB  . THR C 1 97  ? 51.838 44.881 104.278 1.00 5.49  ? 97  THR C CB  1 
ATOM 3260 O OG1 . THR C 1 97  ? 52.729 45.975 104.090 1.00 14.15 ? 97  THR C OG1 1 
ATOM 3261 C CG2 . THR C 1 97  ? 52.605 43.796 104.973 1.00 5.50  ? 97  THR C CG2 1 
ATOM 3262 N N   . GLU C 1 98  ? 52.021 45.739 101.057 1.00 14.63 ? 98  GLU C N   1 
ATOM 3263 C CA  . GLU C 1 98  ? 51.913 46.788 100.063 1.00 18.42 ? 98  GLU C CA  1 
ATOM 3264 C C   . GLU C 1 98  ? 50.719 46.451 99.231  1.00 17.33 ? 98  GLU C C   1 
ATOM 3265 O O   . GLU C 1 98  ? 49.934 47.317 98.914  1.00 22.04 ? 98  GLU C O   1 
ATOM 3266 C CB  . GLU C 1 98  ? 53.123 46.769 99.136  1.00 27.14 ? 98  GLU C CB  1 
ATOM 3267 C CG  . GLU C 1 98  ? 53.351 48.050 98.340  1.00 36.83 ? 98  GLU C CG  1 
ATOM 3268 C CD  . GLU C 1 98  ? 54.643 48.749 98.755  1.00 40.31 ? 98  GLU C CD  1 
ATOM 3269 O OE1 . GLU C 1 98  ? 55.733 48.134 98.588  1.00 42.87 ? 98  GLU C OE1 1 
ATOM 3270 O OE2 . GLU C 1 98  ? 54.562 49.897 99.262  1.00 43.43 ? 98  GLU C OE2 1 
ATOM 3271 N N   . TYR C 1 99  ? 50.615 45.198 98.820  1.00 14.13 ? 99  TYR C N   1 
ATOM 3272 C CA  . TYR C 1 99  ? 49.486 44.779 98.002  1.00 17.62 ? 99  TYR C CA  1 
ATOM 3273 C C   . TYR C 1 99  ? 48.309 44.334 98.857  1.00 19.57 ? 99  TYR C C   1 
ATOM 3274 O O   . TYR C 1 99  ? 47.758 43.244 98.638  1.00 24.02 ? 99  TYR C O   1 
ATOM 3275 C CB  . TYR C 1 99  ? 49.908 43.640 97.080  1.00 17.44 ? 99  TYR C CB  1 
ATOM 3276 C CG  . TYR C 1 99  ? 50.793 44.076 95.950  1.00 15.27 ? 99  TYR C CG  1 
ATOM 3277 C CD1 . TYR C 1 99  ? 52.116 44.457 96.182  1.00 13.68 ? 99  TYR C CD1 1 
ATOM 3278 C CD2 . TYR C 1 99  ? 50.296 44.114 94.640  1.00 13.45 ? 99  TYR C CD2 1 
ATOM 3279 C CE1 . TYR C 1 99  ? 52.923 44.867 95.134  1.00 17.70 ? 99  TYR C CE1 1 
ATOM 3280 C CE2 . TYR C 1 99  ? 51.087 44.520 93.578  1.00 11.75 ? 99  TYR C CE2 1 
ATOM 3281 C CZ  . TYR C 1 99  ? 52.399 44.894 93.826  1.00 19.13 ? 99  TYR C CZ  1 
ATOM 3282 O OH  . TYR C 1 99  ? 53.190 45.267 92.763  1.00 22.58 ? 99  TYR C OH  1 
ATOM 3283 N N   . ASP C 1 100 ? 47.842 45.211 99.743  1.00 18.24 ? 100 ASP C N   1 
ATOM 3284 C CA  . ASP C 1 100 ? 46.770 44.838 100.655 1.00 16.43 ? 100 ASP C CA  1 
ATOM 3285 C C   . ASP C 1 100 ? 45.389 44.532 100.132 1.00 14.39 ? 100 ASP C C   1 
ATOM 3286 O O   . ASP C 1 100 ? 44.607 43.925 100.835 1.00 16.98 ? 100 ASP C O   1 
ATOM 3287 C CB  . ASP C 1 100 ? 46.684 45.798 101.839 1.00 17.17 ? 100 ASP C CB  1 
ATOM 3288 C CG  . ASP C 1 100 ? 46.083 47.145 101.477 1.00 26.50 ? 100 ASP C CG  1 
ATOM 3289 O OD1 . ASP C 1 100 ? 44.999 47.187 100.839 1.00 28.94 ? 100 ASP C OD1 1 
ATOM 3290 O OD2 . ASP C 1 100 ? 46.675 48.175 101.891 1.00 33.09 ? 100 ASP C OD2 1 
ATOM 3291 N N   . LYS C 1 101 ? 45.068 44.961 98.930  1.00 10.60 ? 101 LYS C N   1 
ATOM 3292 C CA  . LYS C 1 101 ? 43.751 44.681 98.391  1.00 10.39 ? 101 LYS C CA  1 
ATOM 3293 C C   . LYS C 1 101 ? 43.702 43.201 97.923  1.00 12.20 ? 101 LYS C C   1 
ATOM 3294 O O   . LYS C 1 101 ? 42.769 42.772 97.228  1.00 13.49 ? 101 LYS C O   1 
ATOM 3295 C CB  . LYS C 1 101 ? 43.501 45.631 97.214  1.00 14.96 ? 101 LYS C CB  1 
ATOM 3296 C CG  . LYS C 1 101 ? 42.248 46.543 97.259  1.00 13.72 ? 101 LYS C CG  1 
ATOM 3297 C CD  . LYS C 1 101 ? 42.258 47.518 98.428  1.00 13.12 ? 101 LYS C CD  1 
ATOM 3298 C CE  . LYS C 1 101 ? 43.410 48.478 98.388  1.00 11.05 ? 101 LYS C CE  1 
ATOM 3299 N NZ  . LYS C 1 101 ? 43.583 49.195 99.684  1.00 8.75  ? 101 LYS C NZ  1 
ATOM 3300 N N   . LYS C 1 102 ? 44.731 42.426 98.262  1.00 13.11 ? 102 LYS C N   1 
ATOM 3301 C CA  . LYS C 1 102 ? 44.785 41.017 97.860  1.00 11.24 ? 102 LYS C CA  1 
ATOM 3302 C C   . LYS C 1 102 ? 44.105 40.068 98.846  1.00 11.22 ? 102 LYS C C   1 
ATOM 3303 O O   . LYS C 1 102 ? 44.346 40.111 100.068 1.00 11.47 ? 102 LYS C O   1 
ATOM 3304 C CB  . LYS C 1 102 ? 46.233 40.569 97.622  1.00 9.87  ? 102 LYS C CB  1 
ATOM 3305 C CG  . LYS C 1 102 ? 46.552 40.240 96.167  1.00 8.54  ? 102 LYS C CG  1 
ATOM 3306 C CD  . LYS C 1 102 ? 47.244 41.407 95.441  1.00 12.01 ? 102 LYS C CD  1 
ATOM 3307 C CE  . LYS C 1 102 ? 47.839 41.008 94.058  1.00 10.17 ? 102 LYS C CE  1 
ATOM 3308 N NZ  . LYS C 1 102 ? 46.884 40.583 92.956  1.00 4.30  ? 102 LYS C NZ  1 
ATOM 3309 N N   . LEU C 1 103 ? 43.251 39.222 98.293  1.00 6.01  ? 103 LEU C N   1 
ATOM 3310 C CA  . LEU C 1 103 ? 42.508 38.245 99.044  1.00 2.00  ? 103 LEU C CA  1 
ATOM 3311 C C   . LEU C 1 103 ? 43.360 37.187 99.679  1.00 2.42  ? 103 LEU C C   1 
ATOM 3312 O O   . LEU C 1 103 ? 44.209 36.598 99.016  1.00 8.47  ? 103 LEU C O   1 
ATOM 3313 C CB  . LEU C 1 103 ? 41.531 37.563 98.122  1.00 2.00  ? 103 LEU C CB  1 
ATOM 3314 C CG  . LEU C 1 103 ? 40.468 38.532 97.649  1.00 3.01  ? 103 LEU C CG  1 
ATOM 3315 C CD1 . LEU C 1 103 ? 39.496 37.879 96.685  1.00 2.99  ? 103 LEU C CD1 1 
ATOM 3316 C CD2 . LEU C 1 103 ? 39.743 39.068 98.857  1.00 6.95  ? 103 LEU C CD2 1 
ATOM 3317 N N   . VAL C 1 104 ? 43.137 36.963 100.970 1.00 3.11  ? 104 VAL C N   1 
ATOM 3318 C CA  . VAL C 1 104 ? 43.802 35.928 101.773 1.00 2.07  ? 104 VAL C CA  1 
ATOM 3319 C C   . VAL C 1 104 ? 42.724 34.813 101.769 1.00 4.68  ? 104 VAL C C   1 
ATOM 3320 O O   . VAL C 1 104 ? 41.578 35.080 102.106 1.00 11.54 ? 104 VAL C O   1 
ATOM 3321 C CB  . VAL C 1 104 ? 44.045 36.470 103.205 1.00 2.00  ? 104 VAL C CB  1 
ATOM 3322 C CG1 . VAL C 1 104 ? 43.859 35.420 104.220 1.00 2.00  ? 104 VAL C CG1 1 
ATOM 3323 C CG2 . VAL C 1 104 ? 45.400 37.014 103.318 1.00 2.00  ? 104 VAL C CG2 1 
ATOM 3324 N N   . SER C 1 105 ? 43.035 33.604 101.318 1.00 4.62  ? 105 SER C N   1 
ATOM 3325 C CA  . SER C 1 105 ? 42.026 32.548 101.255 1.00 4.16  ? 105 SER C CA  1 
ATOM 3326 C C   . SER C 1 105 ? 41.915 31.659 102.497 1.00 5.81  ? 105 SER C C   1 
ATOM 3327 O O   . SER C 1 105 ? 40.812 31.307 102.905 1.00 7.39  ? 105 SER C O   1 
ATOM 3328 C CB  . SER C 1 105 ? 42.268 31.684 100.054 1.00 2.41  ? 105 SER C CB  1 
ATOM 3329 O OG  . SER C 1 105 ? 43.448 30.949 100.275 1.00 9.95  ? 105 SER C OG  1 
ATOM 3330 N N   . ARG C 1 106 ? 43.036 31.159 103.005 1.00 5.55  ? 106 ARG C N   1 
ATOM 3331 C CA  . ARG C 1 106 ? 42.996 30.361 104.237 1.00 3.57  ? 106 ARG C CA  1 
ATOM 3332 C C   . ARG C 1 106 ? 44.232 30.831 104.947 1.00 2.00  ? 106 ARG C C   1 
ATOM 3333 O O   . ARG C 1 106 ? 45.088 31.457 104.337 1.00 2.00  ? 106 ARG C O   1 
ATOM 3334 C CB  . ARG C 1 106 ? 43.228 28.857 104.054 1.00 2.74  ? 106 ARG C CB  1 
ATOM 3335 C CG  . ARG C 1 106 ? 42.602 28.061 102.935 1.00 3.55  ? 106 ARG C CG  1 
ATOM 3336 C CD  . ARG C 1 106 ? 43.550 26.871 102.847 1.00 4.68  ? 106 ARG C CD  1 
ATOM 3337 N NE  . ARG C 1 106 ? 43.164 25.746 102.026 1.00 5.69  ? 106 ARG C NE  1 
ATOM 3338 C CZ  . ARG C 1 106 ? 43.660 25.505 100.821 1.00 8.43  ? 106 ARG C CZ  1 
ATOM 3339 N NH1 . ARG C 1 106 ? 44.534 26.327 100.264 1.00 4.95  ? 106 ARG C NH1 1 
ATOM 3340 N NH2 . ARG C 1 106 ? 43.403 24.340 100.234 1.00 17.00 ? 106 ARG C NH2 1 
ATOM 3341 N N   . LEU C 1 107 ? 44.393 30.442 106.194 1.00 2.00  ? 107 LEU C N   1 
ATOM 3342 C CA  . LEU C 1 107 ? 45.578 30.835 106.866 1.00 2.00  ? 107 LEU C CA  1 
ATOM 3343 C C   . LEU C 1 107 ? 46.036 29.812 107.897 1.00 3.73  ? 107 LEU C C   1 
ATOM 3344 O O   . LEU C 1 107 ? 45.730 29.941 109.067 1.00 8.95  ? 107 LEU C O   1 
ATOM 3345 C CB  . LEU C 1 107 ? 45.404 32.242 107.412 1.00 2.00  ? 107 LEU C CB  1 
ATOM 3346 C CG  . LEU C 1 107 ? 44.658 32.610 108.658 1.00 2.00  ? 107 LEU C CG  1 
ATOM 3347 C CD1 . LEU C 1 107 ? 45.589 32.695 109.851 1.00 2.00  ? 107 LEU C CD1 1 
ATOM 3348 C CD2 . LEU C 1 107 ? 44.052 33.931 108.409 1.00 2.00  ? 107 LEU C CD2 1 
ATOM 3349 N N   . GLN C 1 108 ? 46.819 28.824 107.446 1.00 3.56  ? 108 GLN C N   1 
ATOM 3350 C CA  . GLN C 1 108 ? 47.368 27.722 108.270 1.00 3.58  ? 108 GLN C CA  1 
ATOM 3351 C C   . GLN C 1 108 ? 48.383 28.066 109.351 1.00 2.00  ? 108 GLN C C   1 
ATOM 3352 O O   . GLN C 1 108 ? 49.277 28.853 109.116 1.00 7.86  ? 108 GLN C O   1 
ATOM 3353 C CB  . GLN C 1 108 ? 48.025 26.687 107.350 1.00 3.17  ? 108 GLN C CB  1 
ATOM 3354 C CG  . GLN C 1 108 ? 48.861 25.596 108.051 1.00 3.29  ? 108 GLN C CG  1 
ATOM 3355 C CD  . GLN C 1 108 ? 49.492 24.585 107.082 1.00 2.00  ? 108 GLN C CD  1 
ATOM 3356 O OE1 . GLN C 1 108 ? 50.708 24.452 107.013 1.00 2.00  ? 108 GLN C OE1 1 
ATOM 3357 N NE2 . GLN C 1 108 ? 48.666 23.867 106.350 1.00 2.00  ? 108 GLN C NE2 1 
ATOM 3358 N N   . ILE C 1 109 ? 48.279 27.412 110.503 1.00 2.00  ? 109 ILE C N   1 
ATOM 3359 C CA  . ILE C 1 109 ? 49.207 27.584 111.624 1.00 2.00  ? 109 ILE C CA  1 
ATOM 3360 C C   . ILE C 1 109 ? 49.853 26.229 111.658 1.00 2.00  ? 109 ILE C C   1 
ATOM 3361 O O   . ILE C 1 109 ? 49.241 25.262 111.217 1.00 2.15  ? 109 ILE C O   1 
ATOM 3362 C CB  . ILE C 1 109 ? 48.473 27.732 112.988 1.00 2.00  ? 109 ILE C CB  1 
ATOM 3363 C CG1 . ILE C 1 109 ? 47.601 28.960 112.988 1.00 2.00  ? 109 ILE C CG1 1 
ATOM 3364 C CG2 . ILE C 1 109 ? 49.435 27.936 114.107 1.00 2.00  ? 109 ILE C CG2 1 
ATOM 3365 C CD1 . ILE C 1 109 ? 48.362 30.184 112.588 1.00 7.31  ? 109 ILE C CD1 1 
ATOM 3366 N N   . ARG C 1 110 ? 51.095 26.138 112.102 1.00 2.00  ? 110 ARG C N   1 
ATOM 3367 C CA  . ARG C 1 110 ? 51.742 24.837 112.208 1.00 2.00  ? 110 ARG C CA  1 
ATOM 3368 C C   . ARG C 1 110 ? 52.824 24.860 113.248 1.00 2.00  ? 110 ARG C C   1 
ATOM 3369 O O   . ARG C 1 110 ? 53.773 25.665 113.191 1.00 2.00  ? 110 ARG C O   1 
ATOM 3370 C CB  . ARG C 1 110 ? 52.219 24.271 110.862 1.00 2.00  ? 110 ARG C CB  1 
ATOM 3371 C CG  . ARG C 1 110 ? 53.207 25.073 110.083 1.00 6.51  ? 110 ARG C CG  1 
ATOM 3372 C CD  . ARG C 1 110 ? 53.516 24.431 108.720 1.00 6.08  ? 110 ARG C CD  1 
ATOM 3373 N NE  . ARG C 1 110 ? 54.157 25.407 107.838 1.00 11.19 ? 110 ARG C NE  1 
ATOM 3374 C CZ  . ARG C 1 110 ? 55.393 25.880 107.998 1.00 13.35 ? 110 ARG C CZ  1 
ATOM 3375 N NH1 . ARG C 1 110 ? 56.174 25.463 109.000 1.00 14.96 ? 110 ARG C NH1 1 
ATOM 3376 N NH2 . ARG C 1 110 ? 55.824 26.841 107.197 1.00 14.10 ? 110 ARG C NH2 1 
ATOM 3377 N N   . VAL C 1 111 ? 52.625 23.991 114.229 1.00 2.00  ? 111 VAL C N   1 
ATOM 3378 C CA  . VAL C 1 111 ? 53.500 23.875 115.376 1.00 2.00  ? 111 VAL C CA  1 
ATOM 3379 C C   . VAL C 1 111 ? 54.535 22.771 115.256 1.00 2.99  ? 111 VAL C C   1 
ATOM 3380 O O   . VAL C 1 111 ? 54.143 21.621 115.152 1.00 7.10  ? 111 VAL C O   1 
ATOM 3381 C CB  . VAL C 1 111 ? 52.656 23.550 116.595 1.00 2.00  ? 111 VAL C CB  1 
ATOM 3382 C CG1 . VAL C 1 111 ? 53.527 23.418 117.826 1.00 2.00  ? 111 VAL C CG1 1 
ATOM 3383 C CG2 . VAL C 1 111 ? 51.561 24.564 116.741 1.00 2.00  ? 111 VAL C CG2 1 
ATOM 3384 N N   . ASN C 1 112 ? 55.832 23.094 115.273 1.00 2.00  ? 112 ASN C N   1 
ATOM 3385 C CA  . ASN C 1 112 ? 56.876 22.060 115.205 1.00 2.00  ? 112 ASN C CA  1 
ATOM 3386 C C   . ASN C 1 112 ? 57.611 21.967 116.539 1.00 3.19  ? 112 ASN C C   1 
ATOM 3387 O O   . ASN C 1 112 ? 58.010 22.976 117.124 1.00 10.98 ? 112 ASN C O   1 
ATOM 3388 C CB  . ASN C 1 112 ? 57.895 22.346 114.109 1.00 2.63  ? 112 ASN C CB  1 
ATOM 3389 C CG  . ASN C 1 112 ? 57.269 22.517 112.758 1.00 5.42  ? 112 ASN C CG  1 
ATOM 3390 O OD1 . ASN C 1 112 ? 57.179 21.571 111.972 1.00 8.89  ? 112 ASN C OD1 1 
ATOM 3391 N ND2 . ASN C 1 112 ? 56.857 23.742 112.452 1.00 6.34  ? 112 ASN C ND2 1 
ATOM 3392 N N   . PRO C 1 113 ? 57.746 20.765 117.085 1.00 2.00  ? 113 PRO C N   1 
ATOM 3393 C CA  . PRO C 1 113 ? 58.461 20.747 118.360 1.00 2.00  ? 113 PRO C CA  1 
ATOM 3394 C C   . PRO C 1 113 ? 59.937 20.559 118.169 1.00 2.41  ? 113 PRO C C   1 
ATOM 3395 O O   . PRO C 1 113 ? 60.356 20.003 117.154 1.00 4.46  ? 113 PRO C O   1 
ATOM 3396 C CB  . PRO C 1 113 ? 57.846 19.551 119.079 1.00 2.00  ? 113 PRO C CB  1 
ATOM 3397 C CG  . PRO C 1 113 ? 57.510 18.643 117.978 1.00 4.26  ? 113 PRO C CG  1 
ATOM 3398 C CD  . PRO C 1 113 ? 56.964 19.537 116.891 1.00 2.00  ? 113 PRO C CD  1 
ATOM 3399 N N   . LEU C 1 114 ? 60.719 21.073 119.117 1.00 4.09  ? 114 LEU C N   1 
ATOM 3400 C CA  . LEU C 1 114 ? 62.176 20.939 119.106 1.00 6.83  ? 114 LEU C CA  1 
ATOM 3401 C C   . LEU C 1 114 ? 62.447 19.834 120.079 1.00 10.15 ? 114 LEU C C   1 
ATOM 3402 O O   . LEU C 1 114 ? 61.689 19.672 121.025 1.00 15.82 ? 114 LEU C O   1 
ATOM 3403 C CB  . LEU C 1 114 ? 62.884 22.175 119.655 1.00 7.52  ? 114 LEU C CB  1 
ATOM 3404 C CG  . LEU C 1 114 ? 62.942 23.512 118.920 1.00 5.67  ? 114 LEU C CG  1 
ATOM 3405 C CD1 . LEU C 1 114 ? 64.069 24.306 119.561 1.00 8.96  ? 114 LEU C CD1 1 
ATOM 3406 C CD2 . LEU C 1 114 ? 63.200 23.328 117.423 1.00 6.08  ? 114 LEU C CD2 1 
ATOM 3407 N N   . PRO C 1 115 ? 63.548 19.084 119.892 1.00 12.03 ? 115 PRO C N   1 
ATOM 3408 C CA  . PRO C 1 115 ? 63.882 17.997 120.796 1.00 12.78 ? 115 PRO C CA  1 
ATOM 3409 C C   . PRO C 1 115 ? 63.395 18.143 122.230 1.00 13.45 ? 115 PRO C C   1 
ATOM 3410 O O   . PRO C 1 115 ? 62.521 17.403 122.668 1.00 17.32 ? 115 PRO C O   1 
ATOM 3411 C CB  . PRO C 1 115 ? 65.391 17.953 120.672 1.00 13.13 ? 115 PRO C CB  1 
ATOM 3412 C CG  . PRO C 1 115 ? 65.535 18.020 119.180 1.00 10.06 ? 115 PRO C CG  1 
ATOM 3413 C CD  . PRO C 1 115 ? 64.522 19.110 118.780 1.00 13.82 ? 115 PRO C CD  1 
ATOM 3414 N N   . LYS C 1 116 ? 63.808 19.189 122.907 1.00 12.20 ? 116 LYS C N   1 
ATOM 3415 C CA  . LYS C 1 116 ? 63.394 19.323 124.290 1.00 14.54 ? 116 LYS C CA  1 
ATOM 3416 C C   . LYS C 1 116 ? 61.937 19.627 124.668 1.00 14.60 ? 116 LYS C C   1 
ATOM 3417 O O   . LYS C 1 116 ? 61.648 19.818 125.846 1.00 18.44 ? 116 LYS C O   1 
ATOM 3418 C CB  . LYS C 1 116 ? 64.321 20.283 124.992 1.00 19.47 ? 116 LYS C CB  1 
ATOM 3419 C CG  . LYS C 1 116 ? 65.122 21.160 124.042 1.00 29.25 ? 116 LYS C CG  1 
ATOM 3420 C CD  . LYS C 1 116 ? 66.238 21.851 124.813 1.00 40.64 ? 116 LYS C CD  1 
ATOM 3421 C CE  . LYS C 1 116 ? 66.907 20.864 125.835 1.00 43.25 ? 116 LYS C CE  1 
ATOM 3422 N NZ  . LYS C 1 116 ? 68.257 21.299 126.351 1.00 46.34 ? 116 LYS C NZ  1 
ATOM 3423 N N   . PHE C 1 117 ? 61.017 19.656 123.712 1.00 13.06 ? 117 PHE C N   1 
ATOM 3424 C CA  . PHE C 1 117 ? 59.612 19.935 124.019 1.00 13.79 ? 117 PHE C CA  1 
ATOM 3425 C C   . PHE C 1 117 ? 59.085 18.925 125.012 1.00 17.32 ? 117 PHE C C   1 
ATOM 3426 O O   . PHE C 1 117 ? 59.365 17.746 124.859 1.00 25.37 ? 117 PHE C O   1 
ATOM 3427 C CB  . PHE C 1 117 ? 58.775 19.771 122.768 1.00 14.74 ? 117 PHE C CB  1 
ATOM 3428 C CG  . PHE C 1 117 ? 57.310 20.019 122.980 1.00 15.71 ? 117 PHE C CG  1 
ATOM 3429 C CD1 . PHE C 1 117 ? 56.871 21.166 123.636 1.00 22.55 ? 117 PHE C CD1 1 
ATOM 3430 C CD2 . PHE C 1 117 ? 56.368 19.149 122.472 1.00 13.36 ? 117 PHE C CD2 1 
ATOM 3431 C CE1 . PHE C 1 117 ? 55.522 21.434 123.767 1.00 16.23 ? 117 PHE C CE1 1 
ATOM 3432 C CE2 . PHE C 1 117 ? 55.022 19.414 122.601 1.00 14.46 ? 117 PHE C CE2 1 
ATOM 3433 C CZ  . PHE C 1 117 ? 54.601 20.553 123.245 1.00 13.97 ? 117 PHE C CZ  1 
ATOM 3434 N N   . ASP C 1 118 ? 58.249 19.345 125.959 1.00 18.38 ? 118 ASP C N   1 
ATOM 3435 C CA  . ASP C 1 118 ? 57.692 18.394 126.928 1.00 19.29 ? 118 ASP C CA  1 
ATOM 3436 C C   . ASP C 1 118 ? 56.345 18.775 127.530 1.00 20.31 ? 118 ASP C C   1 
ATOM 3437 O O   . ASP C 1 118 ? 55.808 18.048 128.352 1.00 20.78 ? 118 ASP C O   1 
ATOM 3438 C CB  . ASP C 1 118 ? 58.663 18.189 128.071 1.00 24.68 ? 118 ASP C CB  1 
ATOM 3439 C CG  . ASP C 1 118 ? 58.898 19.464 128.869 1.00 32.43 ? 118 ASP C CG  1 
ATOM 3440 O OD1 . ASP C 1 118 ? 58.342 20.536 128.504 1.00 34.53 ? 118 ASP C OD1 1 
ATOM 3441 O OD2 . ASP C 1 118 ? 59.648 19.394 129.877 1.00 38.69 ? 118 ASP C OD2 1 
ATOM 3442 N N   . SER C 1 119 ? 55.831 19.941 127.166 1.00 20.99 ? 119 SER C N   1 
ATOM 3443 C CA  . SER C 1 119 ? 54.568 20.429 127.698 1.00 19.51 ? 119 SER C CA  1 
ATOM 3444 C C   . SER C 1 119 ? 53.443 20.155 126.671 1.00 19.24 ? 119 SER C C   1 
ATOM 3445 O O   . SER C 1 119 ? 53.676 19.436 125.698 1.00 19.45 ? 119 SER C O   1 
ATOM 3446 C CB  . SER C 1 119 ? 54.739 21.931 127.972 1.00 19.60 ? 119 SER C CB  1 
ATOM 3447 O OG  . SER C 1 119 ? 56.013 22.210 128.553 1.00 13.60 ? 119 SER C OG  1 
ATOM 3448 N N   . THR C 1 120 ? 52.222 20.643 126.913 1.00 15.43 ? 120 THR C N   1 
ATOM 3449 C CA  . THR C 1 120 ? 51.110 20.468 125.965 1.00 12.32 ? 120 THR C CA  1 
ATOM 3450 C C   . THR C 1 120 ? 50.523 21.860 125.809 1.00 9.29  ? 120 THR C C   1 
ATOM 3451 O O   . THR C 1 120 ? 50.430 22.603 126.791 1.00 11.75 ? 120 THR C O   1 
ATOM 3452 C CB  . THR C 1 120 ? 49.995 19.528 126.466 1.00 11.30 ? 120 THR C CB  1 
ATOM 3453 O OG1 . THR C 1 120 ? 49.056 20.270 127.242 1.00 19.35 ? 120 THR C OG1 1 
ATOM 3454 C CG2 . THR C 1 120 ? 50.554 18.429 127.337 1.00 16.42 ? 120 THR C CG2 1 
ATOM 3455 N N   . VAL C 1 121 ? 50.121 22.196 124.591 1.00 6.31  ? 121 VAL C N   1 
ATOM 3456 C CA  . VAL C 1 121 ? 49.600 23.512 124.279 1.00 3.85  ? 121 VAL C CA  1 
ATOM 3457 C C   . VAL C 1 121 ? 48.332 23.403 123.477 1.00 7.32  ? 121 VAL C C   1 
ATOM 3458 O O   . VAL C 1 121 ? 48.123 22.412 122.775 1.00 10.27 ? 121 VAL C O   1 
ATOM 3459 C CB  . VAL C 1 121 ? 50.617 24.333 123.437 1.00 2.00  ? 121 VAL C CB  1 
ATOM 3460 C CG1 . VAL C 1 121 ? 51.931 24.392 124.131 1.00 2.00  ? 121 VAL C CG1 1 
ATOM 3461 C CG2 . VAL C 1 121 ? 50.793 23.758 122.041 1.00 2.00  ? 121 VAL C CG2 1 
ATOM 3462 N N   . TRP C 1 122 ? 47.514 24.449 123.546 1.00 8.06  ? 122 TRP C N   1 
ATOM 3463 C CA  . TRP C 1 122 ? 46.236 24.533 122.830 1.00 8.55  ? 122 TRP C CA  1 
ATOM 3464 C C   . TRP C 1 122 ? 46.332 25.794 121.941 1.00 8.37  ? 122 TRP C C   1 
ATOM 3465 O O   . TRP C 1 122 ? 46.391 26.894 122.496 1.00 13.28 ? 122 TRP C O   1 
ATOM 3466 C CB  . TRP C 1 122 ? 45.100 24.738 123.853 1.00 6.38  ? 122 TRP C CB  1 
ATOM 3467 C CG  . TRP C 1 122 ? 44.685 23.540 124.655 1.00 3.97  ? 122 TRP C CG  1 
ATOM 3468 C CD1 . TRP C 1 122 ? 45.489 22.595 125.231 1.00 6.10  ? 122 TRP C CD1 1 
ATOM 3469 C CD2 . TRP C 1 122 ? 43.360 23.205 125.019 1.00 4.68  ? 122 TRP C CD2 1 
ATOM 3470 N NE1 . TRP C 1 122 ? 44.734 21.696 125.941 1.00 2.00  ? 122 TRP C NE1 1 
ATOM 3471 C CE2 . TRP C 1 122 ? 43.419 22.055 125.822 1.00 3.02  ? 122 TRP C CE2 1 
ATOM 3472 C CE3 . TRP C 1 122 ? 42.118 23.768 124.753 1.00 9.74  ? 122 TRP C CE3 1 
ATOM 3473 C CZ2 . TRP C 1 122 ? 42.287 21.467 126.352 1.00 7.67  ? 122 TRP C CZ2 1 
ATOM 3474 C CZ3 . TRP C 1 122 ? 40.982 23.173 125.288 1.00 6.62  ? 122 TRP C CZ3 1 
ATOM 3475 C CH2 . TRP C 1 122 ? 41.075 22.043 126.073 1.00 3.18  ? 122 TRP C CH2 1 
ATOM 3476 N N   . VAL C 1 123 ? 46.284 25.684 120.611 1.00 2.00  ? 123 VAL C N   1 
ATOM 3477 C CA  . VAL C 1 123 ? 46.431 26.891 119.799 1.00 2.26  ? 123 VAL C CA  1 
ATOM 3478 C C   . VAL C 1 123 ? 45.344 27.182 118.768 1.00 4.25  ? 123 VAL C C   1 
ATOM 3479 O O   . VAL C 1 123 ? 44.725 26.248 118.254 1.00 4.70  ? 123 VAL C O   1 
ATOM 3480 C CB  . VAL C 1 123 ? 47.857 26.943 119.136 1.00 4.38  ? 123 VAL C CB  1 
ATOM 3481 C CG1 . VAL C 1 123 ? 48.709 25.755 119.572 1.00 2.00  ? 123 VAL C CG1 1 
ATOM 3482 C CG2 . VAL C 1 123 ? 47.777 27.044 117.620 1.00 2.00  ? 123 VAL C CG2 1 
ATOM 3483 N N   . THR C 1 124 ? 45.140 28.470 118.452 1.00 2.00  ? 124 THR C N   1 
ATOM 3484 C CA  . THR C 1 124 ? 44.131 28.913 117.466 1.00 2.00  ? 124 THR C CA  1 
ATOM 3485 C C   . THR C 1 124 ? 44.506 30.251 116.889 1.00 2.51  ? 124 THR C C   1 
ATOM 3486 O O   . THR C 1 124 ? 45.394 30.918 117.410 1.00 5.74  ? 124 THR C O   1 
ATOM 3487 C CB  . THR C 1 124 ? 42.837 29.341 118.096 1.00 2.00  ? 124 THR C CB  1 
ATOM 3488 O OG1 . THR C 1 124 ? 42.659 28.710 119.355 1.00 9.59  ? 124 THR C OG1 1 
ATOM 3489 C CG2 . THR C 1 124 ? 41.715 29.080 117.195 1.00 2.00  ? 124 THR C CG2 1 
ATOM 3490 N N   . VAL C 1 125 ? 43.733 30.686 115.895 1.00 2.00  ? 125 VAL C N   1 
ATOM 3491 C CA  . VAL C 1 125 ? 43.899 31.992 115.288 1.00 3.89  ? 125 VAL C CA  1 
ATOM 3492 C C   . VAL C 1 125 ? 42.524 32.514 115.073 1.00 8.55  ? 125 VAL C C   1 
ATOM 3493 O O   . VAL C 1 125 ? 41.622 31.730 114.816 1.00 10.71 ? 125 VAL C O   1 
ATOM 3494 C CB  . VAL C 1 125 ? 44.577 31.969 113.948 1.00 2.00  ? 125 VAL C CB  1 
ATOM 3495 C CG1 . VAL C 1 125 ? 46.027 31.866 114.165 1.00 6.20  ? 125 VAL C CG1 1 
ATOM 3496 C CG2 . VAL C 1 125 ? 44.053 30.849 113.095 1.00 2.00  ? 125 VAL C CG2 1 
ATOM 3497 N N   . ARG C 1 126 ? 42.343 33.820 115.255 1.00 9.39  ? 126 ARG C N   1 
ATOM 3498 C CA  . ARG C 1 126 ? 41.048 34.465 115.060 1.00 10.24 ? 126 ARG C CA  1 
ATOM 3499 C C   . ARG C 1 126 ? 41.204 35.970 115.034 1.00 11.22 ? 126 ARG C C   1 
ATOM 3500 O O   . ARG C 1 126 ? 42.244 36.500 115.434 1.00 12.27 ? 126 ARG C O   1 
ATOM 3501 C CB  . ARG C 1 126 ? 40.041 34.072 116.153 1.00 6.73  ? 126 ARG C CB  1 
ATOM 3502 C CG  . ARG C 1 126 ? 40.515 34.324 117.570 1.00 9.74  ? 126 ARG C CG  1 
ATOM 3503 C CD  . ARG C 1 126 ? 39.344 34.242 118.553 1.00 14.79 ? 126 ARG C CD  1 
ATOM 3504 N NE  . ARG C 1 126 ? 38.751 32.907 118.627 1.00 18.67 ? 126 ARG C NE  1 
ATOM 3505 C CZ  . ARG C 1 126 ? 37.495 32.645 118.998 1.00 16.84 ? 126 ARG C CZ  1 
ATOM 3506 N NH1 . ARG C 1 126 ? 36.676 33.630 119.340 1.00 17.28 ? 126 ARG C NH1 1 
ATOM 3507 N NH2 . ARG C 1 126 ? 37.053 31.388 119.026 1.00 13.38 ? 126 ARG C NH2 1 
ATOM 3508 N N   . LYS C 1 127 ? 40.185 36.651 114.515 1.00 13.34 ? 127 LYS C N   1 
ATOM 3509 C CA  . LYS C 1 127 ? 40.192 38.101 114.448 1.00 13.08 ? 127 LYS C CA  1 
ATOM 3510 C C   . LYS C 1 127 ? 40.122 38.559 115.896 1.00 12.99 ? 127 LYS C C   1 
ATOM 3511 O O   . LYS C 1 127 ? 39.328 38.045 116.665 1.00 16.23 ? 127 LYS C O   1 
ATOM 3512 C CB  . LYS C 1 127 ? 38.976 38.587 113.678 1.00 12.25 ? 127 LYS C CB  1 
ATOM 3513 C CG  . LYS C 1 127 ? 39.127 39.978 113.118 1.00 19.58 ? 127 LYS C CG  1 
ATOM 3514 C CD  . LYS C 1 127 ? 38.860 39.982 111.602 1.00 30.57 ? 127 LYS C CD  1 
ATOM 3515 C CE  . LYS C 1 127 ? 37.367 40.085 111.225 1.00 30.62 ? 127 LYS C CE  1 
ATOM 3516 N NZ  . LYS C 1 127 ? 36.976 41.510 110.913 1.00 36.86 ? 127 LYS C NZ  1 
ATOM 3517 N N   . VAL C 1 128 ? 40.991 39.465 116.295 1.00 13.09 ? 128 VAL C N   1 
ATOM 3518 C CA  . VAL C 1 128 ? 40.998 39.935 117.665 1.00 14.47 ? 128 VAL C CA  1 
ATOM 3519 C C   . VAL C 1 128 ? 41.116 41.443 117.614 1.00 21.32 ? 128 VAL C C   1 
ATOM 3520 O O   . VAL C 1 128 ? 42.213 41.995 117.606 1.00 23.02 ? 128 VAL C O   1 
ATOM 3521 C CB  . VAL C 1 128 ? 42.126 39.264 118.429 1.00 8.91  ? 128 VAL C CB  1 
ATOM 3522 C CG1 . VAL C 1 128 ? 42.524 40.034 119.624 1.00 4.17  ? 128 VAL C CG1 1 
ATOM 3523 C CG2 . VAL C 1 128 ? 41.659 37.926 118.855 1.00 9.25  ? 128 VAL C CG2 1 
ATOM 3524 N N   . PRO C 1 129 ? 39.961 42.131 117.616 1.00 27.38 ? 129 PRO C N   1 
ATOM 3525 C CA  . PRO C 1 129 ? 39.712 43.574 117.560 1.00 30.33 ? 129 PRO C CA  1 
ATOM 3526 C C   . PRO C 1 129 ? 40.420 44.371 118.650 1.00 31.83 ? 129 PRO C C   1 
ATOM 3527 O O   . PRO C 1 129 ? 39.922 44.460 119.780 1.00 28.85 ? 129 PRO C O   1 
ATOM 3528 C CB  . PRO C 1 129 ? 38.196 43.642 117.720 1.00 30.83 ? 129 PRO C CB  1 
ATOM 3529 C CG  . PRO C 1 129 ? 37.954 42.568 118.716 1.00 29.29 ? 129 PRO C CG  1 
ATOM 3530 C CD  . PRO C 1 129 ? 38.745 41.445 118.082 1.00 31.22 ? 129 PRO C CD  1 
ATOM 3531 N N   . ALA C 1 130 ? 41.549 44.980 118.279 1.00 33.94 ? 130 ALA C N   1 
ATOM 3532 C CA  . ALA C 1 130 ? 42.389 45.777 119.187 1.00 35.17 ? 130 ALA C CA  1 
ATOM 3533 C C   . ALA C 1 130 ? 41.626 46.375 120.355 1.00 34.51 ? 130 ALA C C   1 
ATOM 3534 O O   . ALA C 1 130 ? 40.764 47.261 120.202 1.00 33.09 ? 130 ALA C O   1 
ATOM 3535 C CB  . ALA C 1 130 ? 43.152 46.874 118.419 1.00 38.40 ? 130 ALA C CB  1 
ATOM 3536 N N   . SER C 1 131 ? 41.891 45.786 121.509 1.00 34.77 ? 131 SER C N   1 
ATOM 3537 C CA  . SER C 1 131 ? 41.277 46.156 122.761 1.00 37.32 ? 131 SER C CA  1 
ATOM 3538 C C   . SER C 1 131 ? 39.774 46.267 122.841 1.00 38.33 ? 131 SER C C   1 
ATOM 3539 O O   . SER C 1 131 ? 39.231 46.356 123.939 1.00 40.55 ? 131 SER C O   1 
ATOM 3540 C CB  . SER C 1 131 ? 41.930 47.358 123.385 1.00 36.83 ? 131 SER C CB  1 
ATOM 3541 O OG  . SER C 1 131 ? 42.100 47.053 124.767 1.00 46.84 ? 131 SER C OG  1 
ATOM 3542 N N   . SER C 1 132 ? 39.092 46.212 121.699 1.00 40.38 ? 132 SER C N   1 
ATOM 3543 C CA  . SER C 1 132 ? 37.636 46.181 121.675 1.00 40.28 ? 132 SER C CA  1 
ATOM 3544 C C   . SER C 1 132 ? 37.349 44.739 122.198 1.00 38.90 ? 132 SER C C   1 
ATOM 3545 O O   . SER C 1 132 ? 36.210 44.252 122.193 1.00 40.85 ? 132 SER C O   1 
ATOM 3546 C CB  . SER C 1 132 ? 37.138 46.357 120.228 1.00 41.87 ? 132 SER C CB  1 
ATOM 3547 O OG  . SER C 1 132 ? 35.721 46.191 120.100 1.00 47.52 ? 132 SER C OG  1 
ATOM 3548 N N   . ASP C 1 133 ? 38.427 44.052 122.582 1.00 35.56 ? 133 ASP C N   1 
ATOM 3549 C CA  . ASP C 1 133 ? 38.403 42.715 123.138 1.00 34.14 ? 133 ASP C CA  1 
ATOM 3550 C C   . ASP C 1 133 ? 39.129 42.657 124.484 1.00 30.36 ? 133 ASP C C   1 
ATOM 3551 O O   . ASP C 1 133 ? 40.090 43.398 124.736 1.00 24.94 ? 133 ASP C O   1 
ATOM 3552 C CB  . ASP C 1 133 ? 39.084 41.751 122.186 1.00 36.43 ? 133 ASP C CB  1 
ATOM 3553 C CG  . ASP C 1 133 ? 40.381 42.303 121.642 1.00 32.18 ? 133 ASP C CG  1 
ATOM 3554 O OD1 . ASP C 1 133 ? 41.192 42.896 122.413 1.00 29.98 ? 133 ASP C OD1 1 
ATOM 3555 O OD2 . ASP C 1 133 ? 40.564 42.142 120.422 1.00 30.08 ? 133 ASP C OD2 1 
ATOM 3556 N N   . LEU C 1 134 ? 38.640 41.743 125.318 1.00 29.50 ? 134 LEU C N   1 
ATOM 3557 C CA  . LEU C 1 134 ? 39.159 41.473 126.652 1.00 29.05 ? 134 LEU C CA  1 
ATOM 3558 C C   . LEU C 1 134 ? 40.400 40.611 126.401 1.00 28.52 ? 134 LEU C C   1 
ATOM 3559 O O   . LEU C 1 134 ? 40.352 39.735 125.533 1.00 31.96 ? 134 LEU C O   1 
ATOM 3560 C CB  . LEU C 1 134 ? 38.094 40.679 127.421 1.00 28.75 ? 134 LEU C CB  1 
ATOM 3561 C CG  . LEU C 1 134 ? 38.179 40.515 128.939 1.00 30.28 ? 134 LEU C CG  1 
ATOM 3562 C CD1 . LEU C 1 134 ? 37.142 39.493 129.412 1.00 29.52 ? 134 LEU C CD1 1 
ATOM 3563 C CD2 . LEU C 1 134 ? 39.579 40.105 129.342 1.00 30.02 ? 134 LEU C CD2 1 
ATOM 3564 N N   . SER C 1 135 ? 41.489 40.822 127.149 1.00 26.17 ? 135 SER C N   1 
ATOM 3565 C CA  . SER C 1 135 ? 42.700 40.030 126.905 1.00 25.72 ? 135 SER C CA  1 
ATOM 3566 C C   . SER C 1 135 ? 43.242 39.052 127.970 1.00 26.30 ? 135 SER C C   1 
ATOM 3567 O O   . SER C 1 135 ? 44.465 38.962 128.193 1.00 25.82 ? 135 SER C O   1 
ATOM 3568 C CB  . SER C 1 135 ? 43.822 40.921 126.337 1.00 22.21 ? 135 SER C CB  1 
ATOM 3569 O OG  . SER C 1 135 ? 43.555 41.278 124.977 1.00 21.79 ? 135 SER C OG  1 
ATOM 3570 N N   . VAL C 1 136 ? 42.343 38.256 128.552 1.00 27.07 ? 136 VAL C N   1 
ATOM 3571 C CA  . VAL C 1 136 ? 42.738 37.257 129.557 1.00 30.51 ? 136 VAL C CA  1 
ATOM 3572 C C   . VAL C 1 136 ? 42.034 35.924 129.279 1.00 35.59 ? 136 VAL C C   1 
ATOM 3573 O O   . VAL C 1 136 ? 41.970 35.496 128.130 1.00 43.09 ? 136 VAL C O   1 
ATOM 3574 C CB  . VAL C 1 136 ? 42.364 37.702 130.953 1.00 28.61 ? 136 VAL C CB  1 
ATOM 3575 C CG1 . VAL C 1 136 ? 43.248 38.839 131.392 1.00 33.04 ? 136 VAL C CG1 1 
ATOM 3576 C CG2 . VAL C 1 136 ? 40.899 38.090 130.990 1.00 23.61 ? 136 VAL C CG2 1 
ATOM 3577 N N   . ALA C 1 137 ? 41.500 35.270 130.312 1.00 34.06 ? 137 ALA C N   1 
ATOM 3578 C CA  . ALA C 1 137 ? 40.757 34.018 130.158 1.00 28.72 ? 137 ALA C CA  1 
ATOM 3579 C C   . ALA C 1 137 ? 39.710 34.051 129.015 1.00 25.98 ? 137 ALA C C   1 
ATOM 3580 O O   . ALA C 1 137 ? 39.249 33.003 128.565 1.00 25.65 ? 137 ALA C O   1 
ATOM 3581 C CB  . ALA C 1 137 ? 40.097 33.671 131.462 1.00 30.89 ? 137 ALA C CB  1 
ATOM 3582 N N   . ALA C 1 138 ? 39.285 35.243 128.597 1.00 23.37 ? 138 ALA C N   1 
ATOM 3583 C CA  . ALA C 1 138 ? 38.375 35.360 127.458 1.00 24.55 ? 138 ALA C CA  1 
ATOM 3584 C C   . ALA C 1 138 ? 39.015 34.508 126.360 1.00 26.00 ? 138 ALA C C   1 
ATOM 3585 O O   . ALA C 1 138 ? 38.335 33.792 125.628 1.00 32.23 ? 138 ALA C O   1 
ATOM 3586 C CB  . ALA C 1 138 ? 38.324 36.775 127.003 1.00 25.13 ? 138 ALA C CB  1 
ATOM 3587 N N   . ILE C 1 139 ? 40.338 34.620 126.270 1.00 22.83 ? 139 ILE C N   1 
ATOM 3588 C CA  . ILE C 1 139 ? 41.180 33.879 125.346 1.00 20.93 ? 139 ILE C CA  1 
ATOM 3589 C C   . ILE C 1 139 ? 40.886 32.371 125.485 1.00 21.89 ? 139 ILE C C   1 
ATOM 3590 O O   . ILE C 1 139 ? 40.509 31.725 124.495 1.00 19.46 ? 139 ILE C O   1 
ATOM 3591 C CB  . ILE C 1 139 ? 42.696 34.197 125.640 1.00 20.19 ? 139 ILE C CB  1 
ATOM 3592 C CG1 . ILE C 1 139 ? 43.125 35.483 124.933 1.00 17.27 ? 139 ILE C CG1 1 
ATOM 3593 C CG2 . ILE C 1 139 ? 43.607 33.069 125.249 1.00 18.97 ? 139 ILE C CG2 1 
ATOM 3594 C CD1 . ILE C 1 139 ? 42.463 36.737 125.443 1.00 14.30 ? 139 ILE C CD1 1 
ATOM 3595 N N   . SER C 1 140 ? 41.015 31.820 126.705 1.00 22.82 ? 140 SER C N   1 
ATOM 3596 C CA  . SER C 1 140 ? 40.756 30.373 126.942 1.00 23.30 ? 140 SER C CA  1 
ATOM 3597 C C   . SER C 1 140 ? 39.403 30.028 126.374 1.00 21.48 ? 140 SER C C   1 
ATOM 3598 O O   . SER C 1 140 ? 39.224 29.005 125.722 1.00 21.93 ? 140 SER C O   1 
ATOM 3599 C CB  . SER C 1 140 ? 40.749 29.988 128.437 1.00 20.03 ? 140 SER C CB  1 
ATOM 3600 O OG  . SER C 1 140 ? 42.056 29.843 128.982 1.00 19.43 ? 140 SER C OG  1 
ATOM 3601 N N   . ALA C 1 141 ? 38.460 30.926 126.584 1.00 20.38 ? 141 ALA C N   1 
ATOM 3602 C CA  . ALA C 1 141 ? 37.125 30.720 126.087 1.00 21.01 ? 141 ALA C CA  1 
ATOM 3603 C C   . ALA C 1 141 ? 37.067 30.601 124.540 1.00 19.09 ? 141 ALA C C   1 
ATOM 3604 O O   . ALA C 1 141 ? 36.147 29.994 123.976 1.00 18.67 ? 141 ALA C O   1 
ATOM 3605 C CB  . ALA C 1 141 ? 36.232 31.827 126.596 1.00 22.16 ? 141 ALA C CB  1 
ATOM 3606 N N   . MET C 1 142 ? 38.064 31.137 123.856 1.00 13.61 ? 142 MET C N   1 
ATOM 3607 C CA  . MET C 1 142 ? 38.074 31.058 122.413 1.00 12.22 ? 142 MET C CA  1 
ATOM 3608 C C   . MET C 1 142 ? 38.195 29.585 122.025 1.00 8.37  ? 142 MET C C   1 
ATOM 3609 O O   . MET C 1 142 ? 37.807 29.176 120.911 1.00 9.46  ? 142 MET C O   1 
ATOM 3610 C CB  . MET C 1 142 ? 39.192 31.956 121.855 1.00 17.06 ? 142 MET C CB  1 
ATOM 3611 C CG  . MET C 1 142 ? 38.948 33.443 122.204 1.00 20.31 ? 142 MET C CG  1 
ATOM 3612 S SD  . MET C 1 142 ? 40.294 34.655 122.066 1.00 28.04 ? 142 MET C SD  1 
ATOM 3613 C CE  . MET C 1 142 ? 39.438 35.959 121.132 1.00 23.48 ? 142 MET C CE  1 
ATOM 3614 N N   . PHE C 1 143 ? 38.665 28.783 122.982 1.00 6.12  ? 143 PHE C N   1 
ATOM 3615 C CA  . PHE C 1 143 ? 38.804 27.337 122.783 1.00 11.57 ? 143 PHE C CA  1 
ATOM 3616 C C   . PHE C 1 143 ? 37.452 26.591 122.960 1.00 12.97 ? 143 PHE C C   1 
ATOM 3617 O O   . PHE C 1 143 ? 37.231 25.505 122.387 1.00 17.89 ? 143 PHE C O   1 
ATOM 3618 C CB  . PHE C 1 143 ? 39.859 26.743 123.737 1.00 8.10  ? 143 PHE C CB  1 
ATOM 3619 C CG  . PHE C 1 143 ? 41.208 27.406 123.655 1.00 6.29  ? 143 PHE C CG  1 
ATOM 3620 C CD1 . PHE C 1 143 ? 41.678 28.182 124.712 1.00 8.17  ? 143 PHE C CD1 1 
ATOM 3621 C CD2 . PHE C 1 143 ? 41.993 27.285 122.513 1.00 4.32  ? 143 PHE C CD2 1 
ATOM 3622 C CE1 . PHE C 1 143 ? 42.905 28.838 124.638 1.00 6.91  ? 143 PHE C CE1 1 
ATOM 3623 C CE2 . PHE C 1 143 ? 43.227 27.935 122.424 1.00 6.73  ? 143 PHE C CE2 1 
ATOM 3624 C CZ  . PHE C 1 143 ? 43.681 28.715 123.490 1.00 8.19  ? 143 PHE C CZ  1 
ATOM 3625 N N   . ALA C 1 144 ? 36.534 27.200 123.713 1.00 11.92 ? 144 ALA C N   1 
ATOM 3626 C CA  . ALA C 1 144 ? 35.222 26.606 123.977 1.00 7.30  ? 144 ALA C CA  1 
ATOM 3627 C C   . ALA C 1 144 ? 34.112 27.144 123.107 1.00 5.78  ? 144 ALA C C   1 
ATOM 3628 O O   . ALA C 1 144 ? 33.154 26.446 122.840 1.00 5.22  ? 144 ALA C O   1 
ATOM 3629 C CB  . ALA C 1 144 ? 34.844 26.805 125.420 1.00 7.46  ? 144 ALA C CB  1 
ATOM 3630 N N   . ASP C 1 145 ? 34.190 28.412 122.733 1.00 4.20  ? 145 ASP C N   1 
ATOM 3631 C CA  . ASP C 1 145 ? 33.149 28.994 121.917 1.00 2.98  ? 145 ASP C CA  1 
ATOM 3632 C C   . ASP C 1 145 ? 33.043 28.315 120.574 1.00 2.18  ? 145 ASP C C   1 
ATOM 3633 O O   . ASP C 1 145 ? 32.074 28.487 119.855 1.00 2.00  ? 145 ASP C O   1 
ATOM 3634 C CB  . ASP C 1 145 ? 33.350 30.512 121.751 1.00 11.64 ? 145 ASP C CB  1 
ATOM 3635 C CG  . ASP C 1 145 ? 34.713 30.904 121.136 1.00 14.18 ? 145 ASP C CG  1 
ATOM 3636 O OD1 . ASP C 1 145 ? 35.413 30.057 120.543 1.00 21.33 ? 145 ASP C OD1 1 
ATOM 3637 O OD2 . ASP C 1 145 ? 35.083 32.090 121.233 1.00 12.25 ? 145 ASP C OD2 1 
ATOM 3638 N N   . GLY C 1 146 ? 34.036 27.503 120.253 1.00 6.11  ? 146 GLY C N   1 
ATOM 3639 C CA  . GLY C 1 146 ? 34.032 26.837 118.962 1.00 13.74 ? 146 GLY C CA  1 
ATOM 3640 C C   . GLY C 1 146 ? 33.806 27.860 117.846 1.00 15.35 ? 146 GLY C C   1 
ATOM 3641 O O   . GLY C 1 146 ? 33.017 27.644 116.910 1.00 17.00 ? 146 GLY C O   1 
ATOM 3642 N N   . ALA C 1 147 ? 34.530 28.973 117.944 1.00 14.17 ? 147 ALA C N   1 
ATOM 3643 C CA  . ALA C 1 147 ? 34.420 30.058 116.989 1.00 10.32 ? 147 ALA C CA  1 
ATOM 3644 C C   . ALA C 1 147 ? 35.525 29.996 115.923 1.00 10.97 ? 147 ALA C C   1 
ATOM 3645 O O   . ALA C 1 147 ? 35.359 30.476 114.793 1.00 9.60  ? 147 ALA C O   1 
ATOM 3646 C CB  . ALA C 1 147 ? 34.485 31.370 117.746 1.00 11.22 ? 147 ALA C CB  1 
ATOM 3647 N N   . SER C 1 148 ? 36.638 29.367 116.293 1.00 8.77  ? 148 SER C N   1 
ATOM 3648 C CA  . SER C 1 148 ? 37.819 29.243 115.453 1.00 5.57  ? 148 SER C CA  1 
ATOM 3649 C C   . SER C 1 148 ? 38.342 27.866 115.791 1.00 6.01  ? 148 SER C C   1 
ATOM 3650 O O   . SER C 1 148 ? 38.205 27.455 116.954 1.00 9.56  ? 148 SER C O   1 
ATOM 3651 C CB  . SER C 1 148 ? 38.826 30.241 115.989 1.00 4.71  ? 148 SER C CB  1 
ATOM 3652 O OG  . SER C 1 148 ? 38.997 29.986 117.390 1.00 8.79  ? 148 SER C OG  1 
ATOM 3653 N N   . PRO C 1 149 ? 39.045 27.197 114.841 1.00 3.84  ? 149 PRO C N   1 
ATOM 3654 C CA  . PRO C 1 149 ? 39.658 25.861 114.905 1.00 2.00  ? 149 PRO C CA  1 
ATOM 3655 C C   . PRO C 1 149 ? 40.631 25.737 116.066 1.00 2.00  ? 149 PRO C C   1 
ATOM 3656 O O   . PRO C 1 149 ? 41.471 26.599 116.236 1.00 2.28  ? 149 PRO C O   1 
ATOM 3657 C CB  . PRO C 1 149 ? 40.462 25.795 113.613 1.00 2.00  ? 149 PRO C CB  1 
ATOM 3658 C CG  . PRO C 1 149 ? 39.758 26.672 112.706 1.00 2.00  ? 149 PRO C CG  1 
ATOM 3659 C CD  . PRO C 1 149 ? 39.407 27.847 113.571 1.00 2.00  ? 149 PRO C CD  1 
ATOM 3660 N N   . VAL C 1 150 ? 40.590 24.638 116.807 1.00 2.00  ? 150 VAL C N   1 
ATOM 3661 C CA  . VAL C 1 150 ? 41.511 24.457 117.928 1.00 2.00  ? 150 VAL C CA  1 
ATOM 3662 C C   . VAL C 1 150 ? 42.460 23.276 117.655 1.00 3.94  ? 150 VAL C C   1 
ATOM 3663 O O   . VAL C 1 150 ? 42.018 22.245 117.140 1.00 8.12  ? 150 VAL C O   1 
ATOM 3664 C CB  . VAL C 1 150 ? 40.736 24.255 119.230 1.00 2.00  ? 150 VAL C CB  1 
ATOM 3665 C CG1 . VAL C 1 150 ? 41.569 23.550 120.260 1.00 4.16  ? 150 VAL C CG1 1 
ATOM 3666 C CG2 . VAL C 1 150 ? 40.309 25.570 119.771 1.00 2.00  ? 150 VAL C CG2 1 
ATOM 3667 N N   . LEU C 1 151 ? 43.750 23.441 117.962 1.00 2.00  ? 151 LEU C N   1 
ATOM 3668 C CA  . LEU C 1 151 ? 44.767 22.414 117.739 1.00 2.00  ? 151 LEU C CA  1 
ATOM 3669 C C   . LEU C 1 151 ? 45.254 22.105 119.105 1.00 2.00  ? 151 LEU C C   1 
ATOM 3670 O O   . LEU C 1 151 ? 45.462 23.027 119.877 1.00 5.31  ? 151 LEU C O   1 
ATOM 3671 C CB  . LEU C 1 151 ? 45.946 23.019 116.969 1.00 2.00  ? 151 LEU C CB  1 
ATOM 3672 C CG  . LEU C 1 151 ? 47.098 22.240 116.320 1.00 2.00  ? 151 LEU C CG  1 
ATOM 3673 C CD1 . LEU C 1 151 ? 47.928 21.516 117.299 1.00 3.33  ? 151 LEU C CD1 1 
ATOM 3674 C CD2 . LEU C 1 151 ? 46.565 21.259 115.343 1.00 2.42  ? 151 LEU C CD2 1 
ATOM 3675 N N   . VAL C 1 152 ? 45.471 20.837 119.422 1.00 3.35  ? 152 VAL C N   1 
ATOM 3676 C CA  . VAL C 1 152 ? 45.994 20.501 120.753 1.00 6.90  ? 152 VAL C CA  1 
ATOM 3677 C C   . VAL C 1 152 ? 47.304 19.694 120.686 1.00 7.65  ? 152 VAL C C   1 
ATOM 3678 O O   . VAL C 1 152 ? 47.259 18.463 120.657 1.00 13.39 ? 152 VAL C O   1 
ATOM 3679 C CB  . VAL C 1 152 ? 44.992 19.692 121.567 1.00 3.86  ? 152 VAL C CB  1 
ATOM 3680 C CG1 . VAL C 1 152 ? 45.531 19.489 122.972 1.00 5.53  ? 152 VAL C CG1 1 
ATOM 3681 C CG2 . VAL C 1 152 ? 43.644 20.389 121.604 1.00 10.59 ? 152 VAL C CG2 1 
ATOM 3682 N N   . TYR C 1 153 ? 48.458 20.364 120.710 1.00 6.56  ? 153 TYR C N   1 
ATOM 3683 C CA  . TYR C 1 153 ? 49.733 19.667 120.621 1.00 3.95  ? 153 TYR C CA  1 
ATOM 3684 C C   . TYR C 1 153 ? 50.231 19.161 121.974 1.00 4.52  ? 153 TYR C C   1 
ATOM 3685 O O   . TYR C 1 153 ? 50.640 19.933 122.823 1.00 4.61  ? 153 TYR C O   1 
ATOM 3686 C CB  . TYR C 1 153 ? 50.758 20.552 119.946 1.00 3.21  ? 153 TYR C CB  1 
ATOM 3687 C CG  . TYR C 1 153 ? 51.755 19.747 119.183 1.00 2.00  ? 153 TYR C CG  1 
ATOM 3688 C CD1 . TYR C 1 153 ? 51.455 19.238 117.936 1.00 2.00  ? 153 TYR C CD1 1 
ATOM 3689 C CD2 . TYR C 1 153 ? 52.987 19.457 119.726 1.00 2.98  ? 153 TYR C CD2 1 
ATOM 3690 C CE1 . TYR C 1 153 ? 52.362 18.458 117.249 1.00 2.00  ? 153 TYR C CE1 1 
ATOM 3691 C CE2 . TYR C 1 153 ? 53.900 18.679 119.046 1.00 5.69  ? 153 TYR C CE2 1 
ATOM 3692 C CZ  . TYR C 1 153 ? 53.586 18.182 117.804 1.00 4.56  ? 153 TYR C CZ  1 
ATOM 3693 O OH  . TYR C 1 153 ? 54.515 17.430 117.114 1.00 3.50  ? 153 TYR C OH  1 
ATOM 3694 N N   . GLN C 1 154 ? 50.229 17.848 122.139 1.00 5.70  ? 154 GLN C N   1 
ATOM 3695 C CA  . GLN C 1 154 ? 50.597 17.208 123.395 1.00 9.55  ? 154 GLN C CA  1 
ATOM 3696 C C   . GLN C 1 154 ? 51.849 16.354 123.257 1.00 12.40 ? 154 GLN C C   1 
ATOM 3697 O O   . GLN C 1 154 ? 51.923 15.471 122.397 1.00 17.97 ? 154 GLN C O   1 
ATOM 3698 C CB  . GLN C 1 154 ? 49.415 16.304 123.815 1.00 14.25 ? 154 GLN C CB  1 
ATOM 3699 C CG  . GLN C 1 154 ? 49.337 15.825 125.280 1.00 15.37 ? 154 GLN C CG  1 
ATOM 3700 C CD  . GLN C 1 154 ? 47.896 15.434 125.713 1.00 24.46 ? 154 GLN C CD  1 
ATOM 3701 O OE1 . GLN C 1 154 ? 46.907 15.903 125.136 1.00 25.53 ? 154 GLN C OE1 1 
ATOM 3702 N NE2 . GLN C 1 154 ? 47.783 14.601 126.752 1.00 26.06 ? 154 GLN C NE2 1 
ATOM 3703 N N   . TYR C 1 155 ? 52.835 16.592 124.108 1.00 13.80 ? 155 TYR C N   1 
ATOM 3704 C CA  . TYR C 1 155 ? 54.051 15.788 124.074 1.00 14.69 ? 155 TYR C CA  1 
ATOM 3705 C C   . TYR C 1 155 ? 53.778 14.324 124.432 1.00 15.11 ? 155 TYR C C   1 
ATOM 3706 O O   . TYR C 1 155 ? 53.250 14.035 125.509 1.00 14.11 ? 155 TYR C O   1 
ATOM 3707 C CB  . TYR C 1 155 ? 55.079 16.318 125.066 1.00 17.71 ? 155 TYR C CB  1 
ATOM 3708 C CG  . TYR C 1 155 ? 56.039 15.237 125.464 1.00 18.53 ? 155 TYR C CG  1 
ATOM 3709 C CD1 . TYR C 1 155 ? 56.956 14.733 124.554 1.00 20.98 ? 155 TYR C CD1 1 
ATOM 3710 C CD2 . TYR C 1 155 ? 55.984 14.675 126.714 1.00 19.85 ? 155 TYR C CD2 1 
ATOM 3711 C CE1 . TYR C 1 155 ? 57.788 13.700 124.883 1.00 25.38 ? 155 TYR C CE1 1 
ATOM 3712 C CE2 . TYR C 1 155 ? 56.814 13.636 127.061 1.00 25.62 ? 155 TYR C CE2 1 
ATOM 3713 C CZ  . TYR C 1 155 ? 57.722 13.146 126.141 1.00 25.44 ? 155 TYR C CZ  1 
ATOM 3714 O OH  . TYR C 1 155 ? 58.572 12.111 126.487 1.00 30.10 ? 155 TYR C OH  1 
ATOM 3715 N N   . ALA C 1 156 ? 54.283 13.411 123.601 1.00 18.73 ? 156 ALA C N   1 
ATOM 3716 C CA  . ALA C 1 156 ? 54.102 11.964 123.818 1.00 20.05 ? 156 ALA C CA  1 
ATOM 3717 C C   . ALA C 1 156 ? 55.372 11.186 124.078 1.00 21.26 ? 156 ALA C C   1 
ATOM 3718 O O   . ALA C 1 156 ? 56.395 11.388 123.419 1.00 22.82 ? 156 ALA C O   1 
ATOM 3719 C CB  . ALA C 1 156 ? 53.394 11.338 122.651 1.00 21.99 ? 156 ALA C CB  1 
ATOM 3720 N N   . ALA C 1 157 ? 55.241 10.191 124.945 1.00 23.19 ? 157 ALA C N   1 
ATOM 3721 C CA  . ALA C 1 157 ? 56.360 9.345  125.322 1.00 22.90 ? 157 ALA C CA  1 
ATOM 3722 C C   . ALA C 1 157 ? 57.005 8.615  124.158 1.00 22.02 ? 157 ALA C C   1 
ATOM 3723 O O   . ALA C 1 157 ? 58.222 8.478  124.113 1.00 24.04 ? 157 ALA C O   1 
ATOM 3724 C CB  . ALA C 1 157 ? 55.914 8.352  126.344 1.00 24.64 ? 157 ALA C CB  1 
ATOM 3725 N N   . SER C 1 158 ? 56.198 8.167  123.211 1.00 18.98 ? 158 SER C N   1 
ATOM 3726 C CA  . SER C 1 158 ? 56.724 7.420  122.088 1.00 19.74 ? 158 SER C CA  1 
ATOM 3727 C C   . SER C 1 158 ? 56.981 8.191  120.806 1.00 19.31 ? 158 SER C C   1 
ATOM 3728 O O   . SER C 1 158 ? 57.005 7.594  119.727 1.00 20.18 ? 158 SER C O   1 
ATOM 3729 C CB  . SER C 1 158 ? 55.763 6.300  121.747 1.00 26.13 ? 158 SER C CB  1 
ATOM 3730 O OG  . SER C 1 158 ? 54.504 6.846  121.362 1.00 31.20 ? 158 SER C OG  1 
ATOM 3731 N N   . GLY C 1 159 ? 57.133 9.500  120.866 1.00 18.88 ? 159 GLY C N   1 
ATOM 3732 C CA  . GLY C 1 159 ? 57.367 10.189 119.617 1.00 19.88 ? 159 GLY C CA  1 
ATOM 3733 C C   . GLY C 1 159 ? 56.670 11.522 119.552 1.00 21.61 ? 159 GLY C C   1 
ATOM 3734 O O   . GLY C 1 159 ? 55.869 11.851 120.434 1.00 25.73 ? 159 GLY C O   1 
ATOM 3735 N N   . VAL C 1 160 ? 56.970 12.304 118.519 1.00 17.71 ? 160 VAL C N   1 
ATOM 3736 C CA  . VAL C 1 160 ? 56.362 13.612 118.418 1.00 16.19 ? 160 VAL C CA  1 
ATOM 3737 C C   . VAL C 1 160 ? 55.049 13.410 117.694 1.00 14.12 ? 160 VAL C C   1 
ATOM 3738 O O   . VAL C 1 160 ? 54.923 12.510 116.858 1.00 16.75 ? 160 VAL C O   1 
ATOM 3739 C CB  . VAL C 1 160 ? 57.316 14.685 117.764 1.00 14.13 ? 160 VAL C CB  1 
ATOM 3740 C CG1 . VAL C 1 160 ? 58.610 14.069 117.300 1.00 10.11 ? 160 VAL C CG1 1 
ATOM 3741 C CG2 . VAL C 1 160 ? 56.631 15.425 116.647 1.00 12.51 ? 160 VAL C CG2 1 
ATOM 3742 N N   . GLN C 1 161 ? 54.053 14.167 118.123 1.00 9.99  ? 161 GLN C N   1 
ATOM 3743 C CA  . GLN C 1 161 ? 52.726 14.096 117.560 1.00 6.80  ? 161 GLN C CA  1 
ATOM 3744 C C   . GLN C 1 161 ? 52.732 14.387 116.082 1.00 2.00  ? 161 GLN C C   1 
ATOM 3745 O O   . GLN C 1 161 ? 53.192 15.415 115.685 1.00 2.00  ? 161 GLN C O   1 
ATOM 3746 C CB  . GLN C 1 161 ? 51.859 15.113 118.305 1.00 11.89 ? 161 GLN C CB  1 
ATOM 3747 C CG  . GLN C 1 161 ? 50.442 15.323 117.775 1.00 9.30  ? 161 GLN C CG  1 
ATOM 3748 C CD  . GLN C 1 161 ? 49.572 16.045 118.767 1.00 5.26  ? 161 GLN C CD  1 
ATOM 3749 O OE1 . GLN C 1 161 ? 49.579 15.738 119.965 1.00 2.00  ? 161 GLN C OE1 1 
ATOM 3750 N NE2 . GLN C 1 161 ? 48.829 17.017 118.286 1.00 8.81  ? 161 GLN C NE2 1 
ATOM 3751 N N   . ALA C 1 162 ? 52.167 13.527 115.263 1.00 2.00  ? 162 ALA C N   1 
ATOM 3752 C CA  . ALA C 1 162 ? 52.191 13.821 113.845 1.00 2.05  ? 162 ALA C CA  1 
ATOM 3753 C C   . ALA C 1 162 ? 51.121 14.799 113.449 1.00 5.49  ? 162 ALA C C   1 
ATOM 3754 O O   . ALA C 1 162 ? 51.105 15.307 112.327 1.00 3.71  ? 162 ALA C O   1 
ATOM 3755 C CB  . ALA C 1 162 ? 52.060 12.581 113.038 1.00 6.41  ? 162 ALA C CB  1 
ATOM 3756 N N   . ASN C 1 163 ? 50.180 15.022 114.351 1.00 10.50 ? 163 ASN C N   1 
ATOM 3757 C CA  . ASN C 1 163 ? 49.101 15.962 114.071 1.00 12.61 ? 163 ASN C CA  1 
ATOM 3758 C C   . ASN C 1 163 ? 49.516 17.348 114.543 1.00 12.47 ? 163 ASN C C   1 
ATOM 3759 O O   . ASN C 1 163 ? 49.248 17.674 115.701 1.00 17.38 ? 163 ASN C O   1 
ATOM 3760 C CB  . ASN C 1 163 ? 47.835 15.555 114.815 1.00 11.96 ? 163 ASN C CB  1 
ATOM 3761 C CG  . ASN C 1 163 ? 46.646 16.365 114.380 1.00 16.81 ? 163 ASN C CG  1 
ATOM 3762 O OD1 . ASN C 1 163 ? 46.807 17.470 113.858 1.00 19.31 ? 163 ASN C OD1 1 
ATOM 3763 N ND2 . ASN C 1 163 ? 45.446 15.806 114.531 1.00 21.39 ? 163 ASN C ND2 1 
ATOM 3764 N N   . ASN C 1 164 ? 50.106 18.175 113.671 1.00 5.73  ? 164 ASN C N   1 
ATOM 3765 C CA  . ASN C 1 164 ? 50.573 19.502 114.100 1.00 5.79  ? 164 ASN C CA  1 
ATOM 3766 C C   . ASN C 1 164 ? 50.182 20.699 113.226 1.00 6.83  ? 164 ASN C C   1 
ATOM 3767 O O   . ASN C 1 164 ? 50.898 21.710 113.214 1.00 10.84 ? 164 ASN C O   1 
ATOM 3768 C CB  . ASN C 1 164 ? 52.096 19.469 114.180 1.00 2.00  ? 164 ASN C CB  1 
ATOM 3769 C CG  . ASN C 1 164 ? 52.737 19.470 112.823 1.00 2.00  ? 164 ASN C CG  1 
ATOM 3770 O OD1 . ASN C 1 164 ? 52.078 19.271 111.810 1.00 4.23  ? 164 ASN C OD1 1 
ATOM 3771 N ND2 . ASN C 1 164 ? 54.023 19.723 112.784 1.00 2.00  ? 164 ASN C ND2 1 
ATOM 3772 N N   . LYS C 1 165 ? 49.016 20.651 112.606 1.00 4.31  ? 165 LYS C N   1 
ATOM 3773 C CA  . LYS C 1 165 ? 48.614 21.686 111.678 1.00 2.19  ? 165 LYS C CA  1 
ATOM 3774 C C   . LYS C 1 165 ? 47.131 21.973 111.873 1.00 3.55  ? 165 LYS C C   1 
ATOM 3775 O O   . LYS C 1 165 ? 46.381 21.063 112.212 1.00 9.94  ? 165 LYS C O   1 
ATOM 3776 C CB  . LYS C 1 165 ? 48.822 21.096 110.299 1.00 2.22  ? 165 LYS C CB  1 
ATOM 3777 C CG  . LYS C 1 165 ? 49.410 21.983 109.247 1.00 8.54  ? 165 LYS C CG  1 
ATOM 3778 C CD  . LYS C 1 165 ? 50.241 21.126 108.315 1.00 2.50  ? 165 LYS C CD  1 
ATOM 3779 C CE  . LYS C 1 165 ? 51.304 20.433 109.152 1.00 2.00  ? 165 LYS C CE  1 
ATOM 3780 N NZ  . LYS C 1 165 ? 52.094 19.575 108.321 1.00 2.00  ? 165 LYS C NZ  1 
ATOM 3781 N N   . LEU C 1 166 ? 46.696 23.177 111.495 1.00 2.00  ? 166 LEU C N   1 
ATOM 3782 C CA  . LEU C 1 166 ? 45.323 23.651 111.643 1.00 2.00  ? 166 LEU C CA  1 
ATOM 3783 C C   . LEU C 1 166 ? 45.084 24.622 110.492 1.00 2.00  ? 166 LEU C C   1 
ATOM 3784 O O   . LEU C 1 166 ? 45.774 25.617 110.391 1.00 4.57  ? 166 LEU C O   1 
ATOM 3785 C CB  . LEU C 1 166 ? 45.292 24.370 112.982 1.00 2.45  ? 166 LEU C CB  1 
ATOM 3786 C CG  . LEU C 1 166 ? 44.389 25.462 113.530 1.00 3.40  ? 166 LEU C CG  1 
ATOM 3787 C CD1 . LEU C 1 166 ? 45.032 25.951 114.827 1.00 4.90  ? 166 LEU C CD1 1 
ATOM 3788 C CD2 . LEU C 1 166 ? 44.282 26.625 112.577 1.00 9.43  ? 166 LEU C CD2 1 
ATOM 3789 N N   . LEU C 1 167 ? 44.138 24.344 109.610 1.00 2.00  ? 167 LEU C N   1 
ATOM 3790 C CA  . LEU C 1 167 ? 43.869 25.211 108.448 1.00 2.00  ? 167 LEU C CA  1 
ATOM 3791 C C   . LEU C 1 167 ? 42.633 26.075 108.652 1.00 5.55  ? 167 LEU C C   1 
ATOM 3792 O O   . LEU C 1 167 ? 41.521 25.599 108.451 1.00 9.17  ? 167 LEU C O   1 
ATOM 3793 C CB  . LEU C 1 167 ? 43.587 24.355 107.216 1.00 2.00  ? 167 LEU C CB  1 
ATOM 3794 C CG  . LEU C 1 167 ? 44.532 24.333 106.040 1.00 2.00  ? 167 LEU C CG  1 
ATOM 3795 C CD1 . LEU C 1 167 ? 43.740 23.949 104.821 1.00 2.00  ? 167 LEU C CD1 1 
ATOM 3796 C CD2 . LEU C 1 167 ? 45.150 25.687 105.861 1.00 2.00  ? 167 LEU C CD2 1 
ATOM 3797 N N   . TYR C 1 168 ? 42.796 27.359 108.935 1.00 4.79  ? 168 TYR C N   1 
ATOM 3798 C CA  . TYR C 1 168 ? 41.629 28.197 109.161 1.00 4.45  ? 168 TYR C CA  1 
ATOM 3799 C C   . TYR C 1 168 ? 41.170 28.858 107.902 1.00 2.00  ? 168 TYR C C   1 
ATOM 3800 O O   . TYR C 1 168 ? 41.672 29.890 107.560 1.00 6.17  ? 168 TYR C O   1 
ATOM 3801 C CB  . TYR C 1 168 ? 41.965 29.261 110.189 1.00 9.47  ? 168 TYR C CB  1 
ATOM 3802 C CG  . TYR C 1 168 ? 40.819 30.137 110.618 1.00 13.56 ? 168 TYR C CG  1 
ATOM 3803 C CD1 . TYR C 1 168 ? 39.546 29.950 110.117 1.00 15.68 ? 168 TYR C CD1 1 
ATOM 3804 C CD2 . TYR C 1 168 ? 41.017 31.128 111.569 1.00 16.02 ? 168 TYR C CD2 1 
ATOM 3805 C CE1 . TYR C 1 168 ? 38.483 30.722 110.555 1.00 24.07 ? 168 TYR C CE1 1 
ATOM 3806 C CE2 . TYR C 1 168 ? 39.982 31.905 112.017 1.00 24.89 ? 168 TYR C CE2 1 
ATOM 3807 C CZ  . TYR C 1 168 ? 38.700 31.706 111.516 1.00 27.81 ? 168 TYR C CZ  1 
ATOM 3808 O OH  . TYR C 1 168 ? 37.639 32.481 111.992 1.00 32.24 ? 168 TYR C OH  1 
ATOM 3809 N N   . ASP C 1 169 ? 40.149 28.341 107.254 1.00 3.32  ? 169 ASP C N   1 
ATOM 3810 C CA  . ASP C 1 169 ? 39.687 28.962 106.012 1.00 6.36  ? 169 ASP C CA  1 
ATOM 3811 C C   . ASP C 1 169 ? 38.905 30.268 106.206 1.00 8.51  ? 169 ASP C C   1 
ATOM 3812 O O   . ASP C 1 169 ? 37.879 30.269 106.873 1.00 13.42 ? 169 ASP C O   1 
ATOM 3813 C CB  . ASP C 1 169 ? 38.843 27.953 105.209 1.00 8.04  ? 169 ASP C CB  1 
ATOM 3814 C CG  . ASP C 1 169 ? 38.345 28.503 103.890 1.00 4.20  ? 169 ASP C CG  1 
ATOM 3815 O OD1 . ASP C 1 169 ? 37.591 29.484 103.977 1.00 6.56  ? 169 ASP C OD1 1 
ATOM 3816 O OD2 . ASP C 1 169 ? 38.667 27.954 102.797 1.00 2.00  ? 169 ASP C OD2 1 
ATOM 3817 N N   . LEU C 1 170 ? 39.356 31.362 105.585 1.00 7.76  ? 170 LEU C N   1 
ATOM 3818 C CA  . LEU C 1 170 ? 38.637 32.637 105.673 1.00 5.72  ? 170 LEU C CA  1 
ATOM 3819 C C   . LEU C 1 170 ? 37.984 32.863 104.317 1.00 8.09  ? 170 LEU C C   1 
ATOM 3820 O O   . LEU C 1 170 ? 37.323 33.867 104.091 1.00 7.07  ? 170 LEU C O   1 
ATOM 3821 C CB  . LEU C 1 170 ? 39.596 33.796 105.870 1.00 2.00  ? 170 LEU C CB  1 
ATOM 3822 C CG  . LEU C 1 170 ? 40.633 33.769 106.975 1.00 4.77  ? 170 LEU C CG  1 
ATOM 3823 C CD1 . LEU C 1 170 ? 41.385 35.103 106.976 1.00 3.87  ? 170 LEU C CD1 1 
ATOM 3824 C CD2 . LEU C 1 170 ? 39.974 33.533 108.315 1.00 4.09  ? 170 LEU C CD2 1 
ATOM 3825 N N   . SER C 1 171 ? 38.169 31.911 103.416 1.00 11.47 ? 171 SER C N   1 
ATOM 3826 C CA  . SER C 1 171 ? 37.691 32.053 102.055 1.00 16.95 ? 171 SER C CA  1 
ATOM 3827 C C   . SER C 1 171 ? 36.478 32.887 101.795 1.00 16.74 ? 171 SER C C   1 
ATOM 3828 O O   . SER C 1 171 ? 36.635 33.942 101.204 1.00 20.56 ? 171 SER C O   1 
ATOM 3829 C CB  . SER C 1 171 ? 37.682 30.720 101.250 1.00 23.86 ? 171 SER C CB  1 
ATOM 3830 O OG  . SER C 1 171 ? 36.551 29.878 101.478 1.00 32.83 ? 171 SER C OG  1 
ATOM 3831 N N   . ALA C 1 172 ? 35.323 32.530 102.351 1.00 18.14 ? 172 ALA C N   1 
ATOM 3832 C CA  . ALA C 1 172 ? 34.097 33.274 102.047 1.00 17.22 ? 172 ALA C CA  1 
ATOM 3833 C C   . ALA C 1 172 ? 33.638 34.480 102.852 1.00 15.49 ? 172 ALA C C   1 
ATOM 3834 O O   . ALA C 1 172 ? 32.440 34.761 102.954 1.00 15.83 ? 172 ALA C O   1 
ATOM 3835 C CB  . ALA C 1 172 ? 32.942 32.316 101.827 1.00 20.90 ? 172 ALA C CB  1 
ATOM 3836 N N   . MET C 1 173 ? 34.579 35.188 103.439 1.00 13.98 ? 173 MET C N   1 
ATOM 3837 C CA  . MET C 1 173 ? 34.241 36.392 104.154 1.00 17.48 ? 173 MET C CA  1 
ATOM 3838 C C   . MET C 1 173 ? 34.920 37.580 103.471 1.00 20.23 ? 173 MET C C   1 
ATOM 3839 O O   . MET C 1 173 ? 34.690 38.736 103.849 1.00 27.40 ? 173 MET C O   1 
ATOM 3840 C CB  . MET C 1 173 ? 34.714 36.274 105.580 1.00 15.50 ? 173 MET C CB  1 
ATOM 3841 C CG  . MET C 1 173 ? 33.810 35.439 106.391 1.00 24.94 ? 173 MET C CG  1 
ATOM 3842 S SD  . MET C 1 173 ? 34.654 34.948 107.854 1.00 39.61 ? 173 MET C SD  1 
ATOM 3843 C CE  . MET C 1 173 ? 35.127 33.266 107.289 1.00 34.46 ? 173 MET C CE  1 
ATOM 3844 N N   . ARG C 1 174 ? 35.656 37.277 102.393 1.00 19.17 ? 174 ARG C N   1 
ATOM 3845 C CA  . ARG C 1 174 ? 36.452 38.233 101.645 1.00 15.55 ? 174 ARG C CA  1 
ATOM 3846 C C   . ARG C 1 174 ? 37.296 39.017 102.632 1.00 16.20 ? 174 ARG C C   1 
ATOM 3847 O O   . ARG C 1 174 ? 36.803 39.802 103.437 1.00 22.64 ? 174 ARG C O   1 
ATOM 3848 C CB  . ARG C 1 174 ? 35.589 39.104 100.758 1.00 15.40 ? 174 ARG C CB  1 
ATOM 3849 C CG  . ARG C 1 174 ? 35.167 38.341 99.524  1.00 25.99 ? 174 ARG C CG  1 
ATOM 3850 C CD  . ARG C 1 174 ? 34.357 39.189 98.545  1.00 31.42 ? 174 ARG C CD  1 
ATOM 3851 N NE  . ARG C 1 174 ? 34.704 38.895 97.145  1.00 39.21 ? 174 ARG C NE  1 
ATOM 3852 C CZ  . ARG C 1 174 ? 35.629 39.567 96.450  1.00 43.63 ? 174 ARG C CZ  1 
ATOM 3853 N NH1 . ARG C 1 174 ? 36.300 40.563 97.028  1.00 41.82 ? 174 ARG C NH1 1 
ATOM 3854 N NH2 . ARG C 1 174 ? 35.875 39.259 95.174  1.00 42.54 ? 174 ARG C NH2 1 
ATOM 3855 N N   . ALA C 1 175 ? 38.543 38.610 102.740 1.00 16.56 ? 175 ALA C N   1 
ATOM 3856 C CA  . ALA C 1 175 ? 39.444 39.286 103.643 1.00 16.73 ? 175 ALA C CA  1 
ATOM 3857 C C   . ALA C 1 175 ? 40.627 39.528 102.754 1.00 19.30 ? 175 ALA C C   1 
ATOM 3858 O O   . ALA C 1 175 ? 40.749 38.867 101.706 1.00 25.49 ? 175 ALA C O   1 
ATOM 3859 C CB  . ALA C 1 175 ? 39.811 38.394 104.790 1.00 14.26 ? 175 ALA C CB  1 
ATOM 3860 N N   . ASP C 1 176 ? 41.515 40.431 103.161 1.00 17.05 ? 176 ASP C N   1 
ATOM 3861 C CA  . ASP C 1 176 ? 42.679 40.741 102.353 1.00 13.88 ? 176 ASP C CA  1 
ATOM 3862 C C   . ASP C 1 176 ? 43.869 40.953 103.224 1.00 10.86 ? 176 ASP C C   1 
ATOM 3863 O O   . ASP C 1 176 ? 43.738 41.092 104.443 1.00 11.36 ? 176 ASP C O   1 
ATOM 3864 C CB  . ASP C 1 176 ? 42.449 41.945 101.447 1.00 16.83 ? 176 ASP C CB  1 
ATOM 3865 C CG  . ASP C 1 176 ? 41.984 43.177 102.192 1.00 20.87 ? 176 ASP C CG  1 
ATOM 3866 O OD1 . ASP C 1 176 ? 42.558 43.520 103.260 1.00 18.81 ? 176 ASP C OD1 1 
ATOM 3867 O OD2 . ASP C 1 176 ? 41.058 43.836 101.652 1.00 24.58 ? 176 ASP C OD2 1 
ATOM 3868 N N   . ILE C 1 177 ? 45.031 40.981 102.583 1.00 10.46 ? 177 ILE C N   1 
ATOM 3869 C CA  . ILE C 1 177 ? 46.303 41.148 103.269 1.00 7.11  ? 177 ILE C CA  1 
ATOM 3870 C C   . ILE C 1 177 ? 46.158 42.261 104.276 1.00 8.61  ? 177 ILE C C   1 
ATOM 3871 O O   . ILE C 1 177 ? 46.678 42.176 105.390 1.00 10.00 ? 177 ILE C O   1 
ATOM 3872 C CB  . ILE C 1 177 ? 47.432 41.417 102.279 1.00 2.46  ? 177 ILE C CB  1 
ATOM 3873 C CG1 . ILE C 1 177 ? 47.423 40.331 101.207 1.00 5.02  ? 177 ILE C CG1 1 
ATOM 3874 C CG2 . ILE C 1 177 ? 48.743 41.350 102.970 1.00 2.00  ? 177 ILE C CG2 1 
ATOM 3875 C CD1 . ILE C 1 177 ? 48.592 40.374 100.279 1.00 11.12 ? 177 ILE C CD1 1 
ATOM 3876 N N   . GLY C 1 178 ? 45.350 43.251 103.911 1.00 7.37  ? 178 GLY C N   1 
ATOM 3877 C CA  . GLY C 1 178 ? 45.098 44.356 104.808 1.00 10.25 ? 178 GLY C CA  1 
ATOM 3878 C C   . GLY C 1 178 ? 44.620 43.902 106.183 1.00 12.31 ? 178 GLY C C   1 
ATOM 3879 O O   . GLY C 1 178 ? 45.231 44.262 107.191 1.00 15.96 ? 178 GLY C O   1 
ATOM 3880 N N   . ASP C 1 179 ? 43.585 43.056 106.216 1.00 14.04 ? 179 ASP C N   1 
ATOM 3881 C CA  . ASP C 1 179 ? 42.984 42.547 107.454 1.00 10.13 ? 179 ASP C CA  1 
ATOM 3882 C C   . ASP C 1 179 ? 43.844 41.725 108.405 1.00 10.29 ? 179 ASP C C   1 
ATOM 3883 O O   . ASP C 1 179 ? 43.632 41.799 109.620 1.00 10.82 ? 179 ASP C O   1 
ATOM 3884 C CB  . ASP C 1 179 ? 41.755 41.685 107.169 1.00 8.91  ? 179 ASP C CB  1 
ATOM 3885 C CG  . ASP C 1 179 ? 40.758 42.342 106.241 1.00 12.47 ? 179 ASP C CG  1 
ATOM 3886 O OD1 . ASP C 1 179 ? 39.956 43.205 106.664 1.00 12.60 ? 179 ASP C OD1 1 
ATOM 3887 O OD2 . ASP C 1 179 ? 40.733 41.926 105.077 1.00 12.34 ? 179 ASP C OD2 1 
ATOM 3888 N N   . MET C 1 180 ? 44.775 40.919 107.887 1.00 9.74  ? 180 MET C N   1 
ATOM 3889 C CA  . MET C 1 180 ? 45.574 40.048 108.770 1.00 8.75  ? 180 MET C CA  1 
ATOM 3890 C C   . MET C 1 180 ? 46.059 40.717 110.064 1.00 10.21 ? 180 MET C C   1 
ATOM 3891 O O   . MET C 1 180 ? 46.084 40.086 111.114 1.00 13.43 ? 180 MET C O   1 
ATOM 3892 C CB  . MET C 1 180 ? 46.746 39.364 108.052 1.00 2.98  ? 180 MET C CB  1 
ATOM 3893 C CG  . MET C 1 180 ? 46.467 38.861 106.655 1.00 4.23  ? 180 MET C CG  1 
ATOM 3894 S SD  . MET C 1 180 ? 45.226 37.609 106.445 1.00 3.26  ? 180 MET C SD  1 
ATOM 3895 C CE  . MET C 1 180 ? 45.528 36.735 107.793 1.00 8.95  ? 180 MET C CE  1 
ATOM 3896 N N   . ARG C 1 181 ? 46.345 42.010 110.004 1.00 9.12  ? 181 ARG C N   1 
ATOM 3897 C CA  . ARG C 1 181 ? 46.816 42.762 111.166 1.00 8.23  ? 181 ARG C CA  1 
ATOM 3898 C C   . ARG C 1 181 ? 45.856 42.524 112.312 1.00 4.76  ? 181 ARG C C   1 
ATOM 3899 O O   . ARG C 1 181 ? 46.236 42.516 113.487 1.00 2.00  ? 181 ARG C O   1 
ATOM 3900 C CB  . ARG C 1 181 ? 46.787 44.260 110.828 1.00 19.04 ? 181 ARG C CB  1 
ATOM 3901 C CG  . ARG C 1 181 ? 47.823 45.134 111.534 1.00 24.75 ? 181 ARG C CG  1 
ATOM 3902 C CD  . ARG C 1 181 ? 47.215 46.425 112.053 1.00 30.27 ? 181 ARG C CD  1 
ATOM 3903 N NE  . ARG C 1 181 ? 46.667 46.230 113.400 1.00 37.72 ? 181 ARG C NE  1 
ATOM 3904 C CZ  . ARG C 1 181 ? 45.364 46.239 113.707 1.00 45.19 ? 181 ARG C CZ  1 
ATOM 3905 N NH1 . ARG C 1 181 ? 44.438 46.442 112.762 1.00 45.64 ? 181 ARG C NH1 1 
ATOM 3906 N NH2 . ARG C 1 181 ? 44.982 46.040 114.971 1.00 42.30 ? 181 ARG C NH2 1 
ATOM 3907 N N   . LYS C 1 182 ? 44.595 42.402 111.917 1.00 2.00  ? 182 LYS C N   1 
ATOM 3908 C CA  . LYS C 1 182 ? 43.477 42.212 112.802 1.00 5.34  ? 182 LYS C CA  1 
ATOM 3909 C C   . LYS C 1 182 ? 43.408 40.873 113.482 1.00 7.53  ? 182 LYS C C   1 
ATOM 3910 O O   . LYS C 1 182 ? 42.845 40.778 114.569 1.00 12.65 ? 182 LYS C O   1 
ATOM 3911 C CB  . LYS C 1 182 ? 42.194 42.499 112.048 1.00 9.75  ? 182 LYS C CB  1 
ATOM 3912 C CG  . LYS C 1 182 ? 42.228 43.911 111.443 1.00 19.83 ? 182 LYS C CG  1 
ATOM 3913 C CD  . LYS C 1 182 ? 40.893 44.393 110.845 1.00 27.97 ? 182 LYS C CD  1 
ATOM 3914 C CE  . LYS C 1 182 ? 40.408 43.529 109.674 1.00 29.40 ? 182 LYS C CE  1 
ATOM 3915 N NZ  . LYS C 1 182 ? 38.966 43.758 109.284 1.00 28.68 ? 182 LYS C NZ  1 
ATOM 3916 N N   . TYR C 1 183 ? 43.990 39.849 112.862 1.00 7.03  ? 183 TYR C N   1 
ATOM 3917 C CA  . TYR C 1 183 ? 44.006 38.488 113.399 1.00 3.84  ? 183 TYR C CA  1 
ATOM 3918 C C   . TYR C 1 183 ? 45.163 38.151 114.339 1.00 5.52  ? 183 TYR C C   1 
ATOM 3919 O O   . TYR C 1 183 ? 46.222 38.760 114.276 1.00 10.90 ? 183 TYR C O   1 
ATOM 3920 C CB  . TYR C 1 183 ? 44.079 37.523 112.253 1.00 2.00  ? 183 TYR C CB  1 
ATOM 3921 C CG  . TYR C 1 183 ? 42.829 37.434 111.492 1.00 2.00  ? 183 TYR C CG  1 
ATOM 3922 C CD1 . TYR C 1 183 ? 42.547 38.333 110.483 1.00 4.20  ? 183 TYR C CD1 1 
ATOM 3923 C CD2 . TYR C 1 183 ? 41.948 36.416 111.734 1.00 2.00  ? 183 TYR C CD2 1 
ATOM 3924 C CE1 . TYR C 1 183 ? 41.406 38.220 109.717 1.00 6.03  ? 183 TYR C CE1 1 
ATOM 3925 C CE2 . TYR C 1 183 ? 40.801 36.275 110.984 1.00 10.25 ? 183 TYR C CE2 1 
ATOM 3926 C CZ  . TYR C 1 183 ? 40.526 37.184 109.971 1.00 9.38  ? 183 TYR C CZ  1 
ATOM 3927 O OH  . TYR C 1 183 ? 39.355 37.055 109.249 1.00 9.20  ? 183 TYR C OH  1 
ATOM 3928 N N   . ALA C 1 184 ? 45.009 37.104 115.142 1.00 5.94  ? 184 ALA C N   1 
ATOM 3929 C CA  . ALA C 1 184 ? 46.086 36.703 116.039 1.00 4.35  ? 184 ALA C CA  1 
ATOM 3930 C C   . ALA C 1 184 ? 46.169 35.192 116.309 1.00 4.05  ? 184 ALA C C   1 
ATOM 3931 O O   . ALA C 1 184 ? 45.180 34.482 116.191 1.00 5.92  ? 184 ALA C O   1 
ATOM 3932 C CB  . ALA C 1 184 ? 45.946 37.449 117.333 1.00 2.00  ? 184 ALA C CB  1 
ATOM 3933 N N   . VAL C 1 185 ? 47.365 34.690 116.586 1.00 3.09  ? 185 VAL C N   1 
ATOM 3934 C CA  . VAL C 1 185 ? 47.527 33.290 116.933 1.00 2.38  ? 185 VAL C CA  1 
ATOM 3935 C C   . VAL C 1 185 ? 47.590 33.353 118.468 1.00 4.97  ? 185 VAL C C   1 
ATOM 3936 O O   . VAL C 1 185 ? 48.102 34.319 119.029 1.00 6.58  ? 185 VAL C O   1 
ATOM 3937 C CB  . VAL C 1 185 ? 48.801 32.703 116.325 1.00 2.00  ? 185 VAL C CB  1 
ATOM 3938 C CG1 . VAL C 1 185 ? 49.993 33.134 117.064 1.00 2.80  ? 185 VAL C CG1 1 
ATOM 3939 C CG2 . VAL C 1 185 ? 48.740 31.250 116.330 1.00 2.00  ? 185 VAL C CG2 1 
ATOM 3940 N N   . LEU C 1 186 ? 46.975 32.400 119.150 1.00 7.24  ? 186 LEU C N   1 
ATOM 3941 C CA  . LEU C 1 186 ? 46.954 32.391 120.621 1.00 9.70  ? 186 LEU C CA  1 
ATOM 3942 C C   . LEU C 1 186 ? 47.446 31.022 121.061 1.00 8.51  ? 186 LEU C C   1 
ATOM 3943 O O   . LEU C 1 186 ? 46.962 30.012 120.541 1.00 12.82 ? 186 LEU C O   1 
ATOM 3944 C CB  . LEU C 1 186 ? 45.515 32.597 121.125 1.00 8.69  ? 186 LEU C CB  1 
ATOM 3945 C CG  . LEU C 1 186 ? 44.791 33.905 120.778 1.00 7.81  ? 186 LEU C CG  1 
ATOM 3946 C CD1 . LEU C 1 186 ? 43.282 33.797 120.920 1.00 5.06  ? 186 LEU C CD1 1 
ATOM 3947 C CD2 . LEU C 1 186 ? 45.314 34.959 121.706 1.00 13.09 ? 186 LEU C CD2 1 
ATOM 3948 N N   . VAL C 1 187 ? 48.407 30.974 121.979 1.00 5.00  ? 187 VAL C N   1 
ATOM 3949 C CA  . VAL C 1 187 ? 48.954 29.710 122.448 1.00 2.00  ? 187 VAL C CA  1 
ATOM 3950 C C   . VAL C 1 187 ? 48.847 29.679 123.961 1.00 4.67  ? 187 VAL C C   1 
ATOM 3951 O O   . VAL C 1 187 ? 49.424 30.514 124.642 1.00 9.52  ? 187 VAL C O   1 
ATOM 3952 C CB  . VAL C 1 187 ? 50.422 29.546 122.017 1.00 2.00  ? 187 VAL C CB  1 
ATOM 3953 C CG1 . VAL C 1 187 ? 50.943 28.186 122.397 1.00 2.00  ? 187 VAL C CG1 1 
ATOM 3954 C CG2 . VAL C 1 187 ? 50.555 29.745 120.537 1.00 2.00  ? 187 VAL C CG2 1 
ATOM 3955 N N   . TYR C 1 188 ? 48.017 28.778 124.469 1.00 6.01  ? 188 TYR C N   1 
ATOM 3956 C CA  . TYR C 1 188 ? 47.791 28.607 125.900 1.00 5.62  ? 188 TYR C CA  1 
ATOM 3957 C C   . TYR C 1 188 ? 48.594 27.380 126.333 1.00 6.56  ? 188 TYR C C   1 
ATOM 3958 O O   . TYR C 1 188 ? 48.601 26.369 125.633 1.00 9.38  ? 188 TYR C O   1 
ATOM 3959 C CB  . TYR C 1 188 ? 46.282 28.402 126.157 1.00 8.11  ? 188 TYR C CB  1 
ATOM 3960 C CG  . TYR C 1 188 ? 45.937 27.858 127.536 1.00 11.72 ? 188 TYR C CG  1 
ATOM 3961 C CD1 . TYR C 1 188 ? 45.819 28.703 128.639 1.00 13.66 ? 188 TYR C CD1 1 
ATOM 3962 C CD2 . TYR C 1 188 ? 45.809 26.486 127.747 1.00 7.23  ? 188 TYR C CD2 1 
ATOM 3963 C CE1 . TYR C 1 188 ? 45.602 28.184 129.912 1.00 12.03 ? 188 TYR C CE1 1 
ATOM 3964 C CE2 . TYR C 1 188 ? 45.596 25.969 128.999 1.00 3.00  ? 188 TYR C CE2 1 
ATOM 3965 C CZ  . TYR C 1 188 ? 45.505 26.810 130.080 1.00 9.72  ? 188 TYR C CZ  1 
ATOM 3966 O OH  . TYR C 1 188 ? 45.435 26.259 131.348 1.00 16.58 ? 188 TYR C OH  1 
ATOM 3967 N N   . SER C 1 189 ? 49.264 27.457 127.473 1.00 5.49  ? 189 SER C N   1 
ATOM 3968 C CA  . SER C 1 189 ? 50.067 26.349 127.968 1.00 7.53  ? 189 SER C CA  1 
ATOM 3969 C C   . SER C 1 189 ? 49.264 25.587 128.992 1.00 11.55 ? 189 SER C C   1 
ATOM 3970 O O   . SER C 1 189 ? 48.809 26.194 129.944 1.00 15.36 ? 189 SER C O   1 
ATOM 3971 C CB  . SER C 1 189 ? 51.298 26.895 128.651 1.00 10.35 ? 189 SER C CB  1 
ATOM 3972 O OG  . SER C 1 189 ? 52.245 25.871 128.811 1.00 16.48 ? 189 SER C OG  1 
ATOM 3973 N N   . LYS C 1 190 ? 49.167 24.261 128.883 1.00 16.35 ? 190 LYS C N   1 
ATOM 3974 C CA  . LYS C 1 190 ? 48.350 23.531 129.851 1.00 20.50 ? 190 LYS C CA  1 
ATOM 3975 C C   . LYS C 1 190 ? 48.933 22.991 131.151 1.00 23.01 ? 190 LYS C C   1 
ATOM 3976 O O   . LYS C 1 190 ? 48.548 23.470 132.234 1.00 26.64 ? 190 LYS C O   1 
ATOM 3977 C CB  . LYS C 1 190 ? 47.498 22.448 129.191 1.00 19.88 ? 190 LYS C CB  1 
ATOM 3978 C CG  . LYS C 1 190 ? 46.624 21.657 130.204 1.00 20.37 ? 190 LYS C CG  1 
ATOM 3979 C CD  . LYS C 1 190 ? 45.506 20.903 129.503 1.00 27.98 ? 190 LYS C CD  1 
ATOM 3980 C CE  . LYS C 1 190 ? 45.598 19.387 129.681 1.00 32.99 ? 190 LYS C CE  1 
ATOM 3981 N NZ  . LYS C 1 190 ? 45.092 18.596 128.473 1.00 39.86 ? 190 LYS C NZ  1 
ATOM 3982 N N   . ASP C 1 191 ? 49.784 21.967 131.086 1.00 21.75 ? 191 ASP C N   1 
ATOM 3983 C CA  . ASP C 1 191 ? 50.289 21.431 132.338 1.00 21.73 ? 191 ASP C CA  1 
ATOM 3984 C C   . ASP C 1 191 ? 51.709 21.746 132.749 1.00 21.21 ? 191 ASP C C   1 
ATOM 3985 O O   . ASP C 1 191 ? 52.176 21.298 133.789 1.00 25.10 ? 191 ASP C O   1 
ATOM 3986 C CB  . ASP C 1 191 ? 49.935 19.941 132.543 1.00 26.78 ? 191 ASP C CB  1 
ATOM 3987 C CG  . ASP C 1 191 ? 49.977 19.112 131.253 1.00 33.57 ? 191 ASP C CG  1 
ATOM 3988 O OD1 . ASP C 1 191 ? 51.083 18.830 130.737 1.00 38.33 ? 191 ASP C OD1 1 
ATOM 3989 O OD2 . ASP C 1 191 ? 48.896 18.689 130.774 1.00 38.46 ? 191 ASP C OD2 1 
ATOM 3990 N N   . ASP C 1 192 ? 52.392 22.556 131.968 1.00 20.00 ? 192 ASP C N   1 
ATOM 3991 C CA  . ASP C 1 192 ? 53.750 22.942 132.329 1.00 22.73 ? 192 ASP C CA  1 
ATOM 3992 C C   . ASP C 1 192 ? 53.978 24.274 131.659 1.00 21.73 ? 192 ASP C C   1 
ATOM 3993 O O   . ASP C 1 192 ? 53.195 24.661 130.798 1.00 27.91 ? 192 ASP C O   1 
ATOM 3994 C CB  . ASP C 1 192 ? 54.779 21.919 131.823 1.00 26.36 ? 192 ASP C CB  1 
ATOM 3995 C CG  . ASP C 1 192 ? 56.222 22.276 132.232 1.00 38.45 ? 192 ASP C CG  1 
ATOM 3996 O OD1 . ASP C 1 192 ? 56.396 22.728 133.396 1.00 40.70 ? 192 ASP C OD1 1 
ATOM 3997 O OD2 . ASP C 1 192 ? 57.167 22.123 131.395 1.00 38.40 ? 192 ASP C OD2 1 
ATOM 3998 N N   . ALA C 1 193 ? 55.005 25.002 132.067 1.00 17.91 ? 193 ALA C N   1 
ATOM 3999 C CA  . ALA C 1 193 ? 55.272 26.279 131.434 1.00 16.53 ? 193 ALA C CA  1 
ATOM 4000 C C   . ALA C 1 193 ? 56.074 26.038 130.172 1.00 16.67 ? 193 ALA C C   1 
ATOM 4001 O O   . ALA C 1 193 ? 57.149 25.426 130.223 1.00 21.83 ? 193 ALA C O   1 
ATOM 4002 C CB  . ALA C 1 193 ? 56.029 27.187 132.367 1.00 19.43 ? 193 ALA C CB  1 
ATOM 4003 N N   . LEU C 1 194 ? 55.499 26.407 129.028 1.00 16.69 ? 194 LEU C N   1 
ATOM 4004 C CA  . LEU C 1 194 ? 56.194 26.263 127.760 1.00 12.94 ? 194 LEU C CA  1 
ATOM 4005 C C   . LEU C 1 194 ? 57.405 27.174 127.886 1.00 15.91 ? 194 LEU C C   1 
ATOM 4006 O O   . LEU C 1 194 ? 57.300 28.330 128.283 1.00 18.74 ? 194 LEU C O   1 
ATOM 4007 C CB  . LEU C 1 194 ? 55.331 26.710 126.592 1.00 5.80  ? 194 LEU C CB  1 
ATOM 4008 C CG  . LEU C 1 194 ? 56.093 26.579 125.286 1.00 4.01  ? 194 LEU C CG  1 
ATOM 4009 C CD1 . LEU C 1 194 ? 56.486 25.150 125.112 1.00 3.48  ? 194 LEU C CD1 1 
ATOM 4010 C CD2 . LEU C 1 194 ? 55.232 27.010 124.123 1.00 7.98  ? 194 LEU C CD2 1 
ATOM 4011 N N   . GLU C 1 195 ? 58.576 26.613 127.675 1.00 17.85 ? 195 GLU C N   1 
ATOM 4012 C CA  . GLU C 1 195 ? 59.756 27.405 127.779 1.00 17.99 ? 195 GLU C CA  1 
ATOM 4013 C C   . GLU C 1 195 ? 60.074 28.066 126.483 1.00 22.18 ? 195 GLU C C   1 
ATOM 4014 O O   . GLU C 1 195 ? 59.209 28.175 125.591 1.00 22.64 ? 195 GLU C O   1 
ATOM 4015 C CB  . GLU C 1 195 ? 60.884 26.564 128.261 1.00 11.96 ? 195 GLU C CB  1 
ATOM 4016 C CG  . GLU C 1 195 ? 60.672 26.224 129.707 1.00 21.56 ? 195 GLU C CG  1 
ATOM 4017 C CD  . GLU C 1 195 ? 61.140 27.325 130.649 1.00 25.31 ? 195 GLU C CD  1 
ATOM 4018 O OE1 . GLU C 1 195 ? 61.505 28.432 130.169 1.00 29.64 ? 195 GLU C OE1 1 
ATOM 4019 O OE2 . GLU C 1 195 ? 61.165 27.073 131.878 1.00 24.35 ? 195 GLU C OE2 1 
ATOM 4020 N N   . THR C 1 196 ? 61.324 28.497 126.376 1.00 23.43 ? 196 THR C N   1 
ATOM 4021 C CA  . THR C 1 196 ? 61.778 29.209 125.193 1.00 25.13 ? 196 THR C CA  1 
ATOM 4022 C C   . THR C 1 196 ? 62.046 28.358 123.998 1.00 24.05 ? 196 THR C C   1 
ATOM 4023 O O   . THR C 1 196 ? 61.542 28.653 122.912 1.00 31.21 ? 196 THR C O   1 
ATOM 4024 C CB  . THR C 1 196 ? 63.023 30.000 125.457 1.00 25.51 ? 196 THR C CB  1 
ATOM 4025 O OG1 . THR C 1 196 ? 63.913 29.187 126.233 1.00 32.90 ? 196 THR C OG1 1 
ATOM 4026 C CG2 . THR C 1 196 ? 62.682 31.303 126.183 1.00 26.85 ? 196 THR C CG2 1 
ATOM 4027 N N   . ASP C 1 197 ? 62.848 27.318 124.137 1.00 19.27 ? 197 ASP C N   1 
ATOM 4028 C CA  . ASP C 1 197 ? 63.046 26.576 122.928 1.00 22.64 ? 197 ASP C CA  1 
ATOM 4029 C C   . ASP C 1 197 ? 62.562 25.164 122.788 1.00 25.32 ? 197 ASP C C   1 
ATOM 4030 O O   . ASP C 1 197 ? 63.283 24.274 122.309 1.00 25.26 ? 197 ASP C O   1 
ATOM 4031 C CB  . ASP C 1 197 ? 64.423 26.817 122.366 1.00 27.98 ? 197 ASP C CB  1 
ATOM 4032 C CG  . ASP C 1 197 ? 64.545 28.218 121.754 1.00 34.99 ? 197 ASP C CG  1 
ATOM 4033 O OD1 . ASP C 1 197 ? 63.845 28.477 120.703 1.00 36.25 ? 197 ASP C OD1 1 
ATOM 4034 O OD2 . ASP C 1 197 ? 65.311 29.043 122.357 1.00 34.72 ? 197 ASP C OD2 1 
ATOM 4035 N N   . GLU C 1 198 ? 61.276 25.018 123.120 1.00 24.78 ? 198 GLU C N   1 
ATOM 4036 C CA  . GLU C 1 198 ? 60.538 23.765 123.045 1.00 19.10 ? 198 GLU C CA  1 
ATOM 4037 C C   . GLU C 1 198 ? 59.698 23.805 121.778 1.00 16.90 ? 198 GLU C C   1 
ATOM 4038 O O   . GLU C 1 198 ? 59.609 22.823 121.059 1.00 14.95 ? 198 GLU C O   1 
ATOM 4039 C CB  . GLU C 1 198 ? 59.583 23.610 124.232 1.00 16.11 ? 198 GLU C CB  1 
ATOM 4040 C CG  . GLU C 1 198 ? 60.191 23.639 125.647 1.00 22.52 ? 198 GLU C CG  1 
ATOM 4041 C CD  . GLU C 1 198 ? 59.147 23.248 126.732 1.00 31.27 ? 198 GLU C CD  1 
ATOM 4042 O OE1 . GLU C 1 198 ? 58.117 22.606 126.375 1.00 29.56 ? 198 GLU C OE1 1 
ATOM 4043 O OE2 . GLU C 1 198 ? 59.340 23.576 127.936 1.00 29.06 ? 198 GLU C OE2 1 
ATOM 4044 N N   . LEU C 1 199 ? 59.168 24.970 121.444 1.00 12.59 ? 199 LEU C N   1 
ATOM 4045 C CA  . LEU C 1 199 ? 58.301 25.055 120.291 1.00 9.35  ? 199 LEU C CA  1 
ATOM 4046 C C   . LEU C 1 199 ? 58.624 26.152 119.311 1.00 7.82  ? 199 LEU C C   1 
ATOM 4047 O O   . LEU C 1 199 ? 59.190 27.156 119.698 1.00 13.67 ? 199 LEU C O   1 
ATOM 4048 C CB  . LEU C 1 199 ? 56.906 25.337 120.805 1.00 11.48 ? 199 LEU C CB  1 
ATOM 4049 C CG  . LEU C 1 199 ? 55.783 24.516 120.219 1.00 9.44  ? 199 LEU C CG  1 
ATOM 4050 C CD1 . LEU C 1 199 ? 55.736 23.194 120.952 1.00 10.50 ? 199 LEU C CD1 1 
ATOM 4051 C CD2 . LEU C 1 199 ? 54.497 25.275 120.395 1.00 11.17 ? 199 LEU C CD2 1 
ATOM 4052 N N   . VAL C 1 200 ? 58.221 25.991 118.057 1.00 2.00  ? 200 VAL C N   1 
ATOM 4053 C CA  . VAL C 1 200 ? 58.396 27.034 117.061 1.00 2.00  ? 200 VAL C CA  1 
ATOM 4054 C C   . VAL C 1 200 ? 57.200 26.957 116.134 1.00 4.12  ? 200 VAL C C   1 
ATOM 4055 O O   . VAL C 1 200 ? 57.000 25.924 115.500 1.00 9.85  ? 200 VAL C O   1 
ATOM 4056 C CB  . VAL C 1 200 ? 59.646 26.850 116.240 1.00 2.00  ? 200 VAL C CB  1 
ATOM 4057 C CG1 . VAL C 1 200 ? 59.638 27.851 115.074 1.00 2.00  ? 200 VAL C CG1 1 
ATOM 4058 C CG2 . VAL C 1 200 ? 60.869 27.034 117.111 1.00 2.00  ? 200 VAL C CG2 1 
ATOM 4059 N N   . LEU C 1 201 ? 56.397 28.020 116.041 1.00 5.84  ? 201 LEU C N   1 
ATOM 4060 C CA  . LEU C 1 201 ? 55.198 28.009 115.172 1.00 5.03  ? 201 LEU C CA  1 
ATOM 4061 C C   . LEU C 1 201 ? 55.383 28.755 113.876 1.00 2.71  ? 201 LEU C C   1 
ATOM 4062 O O   . LEU C 1 201 ? 56.262 29.582 113.774 1.00 8.77  ? 201 LEU C O   1 
ATOM 4063 C CB  . LEU C 1 201 ? 54.024 28.665 115.879 1.00 2.08  ? 201 LEU C CB  1 
ATOM 4064 C CG  . LEU C 1 201 ? 53.624 28.138 117.232 1.00 2.00  ? 201 LEU C CG  1 
ATOM 4065 C CD1 . LEU C 1 201 ? 54.183 29.051 118.295 1.00 2.00  ? 201 LEU C CD1 1 
ATOM 4066 C CD2 . LEU C 1 201 ? 52.119 28.148 117.258 1.00 2.00  ? 201 LEU C CD2 1 
ATOM 4067 N N   . HIS C 1 202 ? 54.584 28.466 112.870 1.00 2.00  ? 202 HIS C N   1 
ATOM 4068 C CA  . HIS C 1 202 ? 54.710 29.222 111.631 1.00 2.00  ? 202 HIS C CA  1 
ATOM 4069 C C   . HIS C 1 202 ? 53.320 29.601 111.239 1.00 3.03  ? 202 HIS C C   1 
ATOM 4070 O O   . HIS C 1 202 ? 52.378 28.884 111.552 1.00 8.10  ? 202 HIS C O   1 
ATOM 4071 C CB  . HIS C 1 202 ? 55.297 28.396 110.496 1.00 4.95  ? 202 HIS C CB  1 
ATOM 4072 C CG  . HIS C 1 202 ? 56.667 27.878 110.771 1.00 7.32  ? 202 HIS C CG  1 
ATOM 4073 N ND1 . HIS C 1 202 ? 56.964 27.134 111.890 1.00 11.03 ? 202 HIS C ND1 1 
ATOM 4074 C CD2 . HIS C 1 202 ? 57.827 28.024 110.095 1.00 9.04  ? 202 HIS C CD2 1 
ATOM 4075 C CE1 . HIS C 1 202 ? 58.253 26.847 111.897 1.00 11.35 ? 202 HIS C CE1 1 
ATOM 4076 N NE2 . HIS C 1 202 ? 58.800 27.376 110.819 1.00 11.64 ? 202 HIS C NE2 1 
ATOM 4077 N N   . VAL C 1 203 ? 53.179 30.678 110.496 1.00 2.00  ? 203 VAL C N   1 
ATOM 4078 C CA  . VAL C 1 203 ? 51.874 31.103 110.096 1.00 2.00  ? 203 VAL C CA  1 
ATOM 4079 C C   . VAL C 1 203 ? 51.972 31.309 108.607 1.00 2.00  ? 203 VAL C C   1 
ATOM 4080 O O   . VAL C 1 203 ? 52.644 32.213 108.170 1.00 2.00  ? 203 VAL C O   1 
ATOM 4081 C CB  . VAL C 1 203 ? 51.488 32.417 110.806 1.00 2.00  ? 203 VAL C CB  1 
ATOM 4082 C CG1 . VAL C 1 203 ? 50.125 32.805 110.407 1.00 7.58  ? 203 VAL C CG1 1 
ATOM 4083 C CG2 . VAL C 1 203 ? 51.542 32.284 112.316 1.00 2.00  ? 203 VAL C CG2 1 
ATOM 4084 N N   . ASP C 1 204 ? 51.439 30.386 107.824 1.00 2.00  ? 204 ASP C N   1 
ATOM 4085 C CA  . ASP C 1 204 ? 51.478 30.539 106.376 1.00 4.21  ? 204 ASP C CA  1 
ATOM 4086 C C   . ASP C 1 204 ? 50.130 31.158 106.051 1.00 5.35  ? 204 ASP C C   1 
ATOM 4087 O O   . ASP C 1 204 ? 49.104 30.628 106.454 1.00 6.44  ? 204 ASP C O   1 
ATOM 4088 C CB  . ASP C 1 204 ? 51.609 29.214 105.613 1.00 3.63  ? 204 ASP C CB  1 
ATOM 4089 C CG  . ASP C 1 204 ? 52.317 28.144 106.397 1.00 9.65  ? 204 ASP C CG  1 
ATOM 4090 O OD1 . ASP C 1 204 ? 53.481 28.331 106.798 1.00 6.98  ? 204 ASP C OD1 1 
ATOM 4091 O OD2 . ASP C 1 204 ? 51.701 27.077 106.583 1.00 13.65 ? 204 ASP C OD2 1 
ATOM 4092 N N   . ILE C 1 205 ? 50.150 32.200 105.221 1.00 6.16  ? 205 ILE C N   1 
ATOM 4093 C CA  . ILE C 1 205 ? 48.988 32.979 104.852 1.00 2.00  ? 205 ILE C CA  1 
ATOM 4094 C C   . ILE C 1 205 ? 48.772 32.934 103.379 1.00 2.00  ? 205 ILE C C   1 
ATOM 4095 O O   . ILE C 1 205 ? 49.424 33.640 102.663 1.00 2.00  ? 205 ILE C O   1 
ATOM 4096 C CB  . ILE C 1 205 ? 49.241 34.423 105.289 1.00 2.00  ? 205 ILE C CB  1 
ATOM 4097 C CG1 . ILE C 1 205 ? 49.455 34.436 106.796 1.00 2.00  ? 205 ILE C CG1 1 
ATOM 4098 C CG2 . ILE C 1 205 ? 48.149 35.334 104.873 1.00 2.00  ? 205 ILE C CG2 1 
ATOM 4099 C CD1 . ILE C 1 205 ? 49.174 35.735 107.424 1.00 5.80  ? 205 ILE C CD1 1 
ATOM 4100 N N   . GLU C 1 206 ? 47.830 32.125 102.928 1.00 2.00  ? 206 GLU C N   1 
ATOM 4101 C CA  . GLU C 1 206 ? 47.520 31.979 101.496 1.00 2.72  ? 206 GLU C CA  1 
ATOM 4102 C C   . GLU C 1 206 ? 46.913 33.236 100.877 1.00 3.67  ? 206 GLU C C   1 
ATOM 4103 O O   . GLU C 1 206 ? 45.946 33.757 101.386 1.00 12.21 ? 206 GLU C O   1 
ATOM 4104 C CB  . GLU C 1 206 ? 46.520 30.848 101.314 1.00 2.00  ? 206 GLU C CB  1 
ATOM 4105 C CG  . GLU C 1 206 ? 46.576 30.187 99.969  1.00 6.41  ? 206 GLU C CG  1 
ATOM 4106 C CD  . GLU C 1 206 ? 45.642 29.002 99.892  1.00 11.82 ? 206 GLU C CD  1 
ATOM 4107 O OE1 . GLU C 1 206 ? 44.816 28.870 100.812 1.00 13.72 ? 206 GLU C OE1 1 
ATOM 4108 O OE2 . GLU C 1 206 ? 45.714 28.207 98.929  1.00 8.74  ? 206 GLU C OE2 1 
ATOM 4109 N N   . HIS C 1 207 ? 47.386 33.705 99.744  1.00 2.28  ? 207 HIS C N   1 
ATOM 4110 C CA  . HIS C 1 207 ? 46.772 34.908 99.217  1.00 4.87  ? 207 HIS C CA  1 
ATOM 4111 C C   . HIS C 1 207 ? 46.992 35.019 97.747  1.00 6.04  ? 207 HIS C C   1 
ATOM 4112 O O   . HIS C 1 207 ? 48.029 34.593 97.267  1.00 15.67 ? 207 HIS C O   1 
ATOM 4113 C CB  . HIS C 1 207 ? 47.358 36.138 99.894  1.00 7.77  ? 207 HIS C CB  1 
ATOM 4114 C CG  . HIS C 1 207 ? 48.847 36.234 99.799  1.00 5.39  ? 207 HIS C CG  1 
ATOM 4115 N ND1 . HIS C 1 207 ? 49.517 36.289 98.598  1.00 2.00  ? 207 HIS C ND1 1 
ATOM 4116 C CD2 . HIS C 1 207 ? 49.796 36.271 100.763 1.00 4.61  ? 207 HIS C CD2 1 
ATOM 4117 C CE1 . HIS C 1 207 ? 50.816 36.349 98.830  1.00 5.31  ? 207 HIS C CE1 1 
ATOM 4118 N NE2 . HIS C 1 207 ? 51.011 36.341 100.135 1.00 2.00  ? 207 HIS C NE2 1 
ATOM 4119 N N   . GLN C 1 208 ? 46.061 35.636 97.035  1.00 4.66  ? 208 GLN C N   1 
ATOM 4120 C CA  . GLN C 1 208 ? 46.190 35.775 95.599  1.00 4.80  ? 208 GLN C CA  1 
ATOM 4121 C C   . GLN C 1 208 ? 47.594 36.168 95.275  1.00 5.90  ? 208 GLN C C   1 
ATOM 4122 O O   . GLN C 1 208 ? 48.284 36.803 96.096  1.00 3.44  ? 208 GLN C O   1 
ATOM 4123 C CB  . GLN C 1 208 ? 45.260 36.827 95.075  1.00 11.65 ? 208 GLN C CB  1 
ATOM 4124 C CG  . GLN C 1 208 ? 43.832 36.611 95.478  1.00 14.98 ? 208 GLN C CG  1 
ATOM 4125 C CD  . GLN C 1 208 ? 42.977 37.797 95.130  1.00 14.35 ? 208 GLN C CD  1 
ATOM 4126 O OE1 . GLN C 1 208 ? 43.002 38.814 95.831  1.00 17.94 ? 208 GLN C OE1 1 
ATOM 4127 N NE2 . GLN C 1 208 ? 42.263 37.709 94.007  1.00 10.12 ? 208 GLN C NE2 1 
ATOM 4128 N N   . ARG C 1 209 ? 48.011 35.769 94.080  1.00 9.32  ? 209 ARG C N   1 
ATOM 4129 C CA  . ARG C 1 209 ? 49.376 35.981 93.595  1.00 14.07 ? 209 ARG C CA  1 
ATOM 4130 C C   . ARG C 1 209 ? 49.740 37.414 93.331  1.00 14.91 ? 209 ARG C C   1 
ATOM 4131 O O   . ARG C 1 209 ? 48.968 38.116 92.667  1.00 17.87 ? 209 ARG C O   1 
ATOM 4132 C CB  . ARG C 1 209 ? 49.595 35.175 92.308  1.00 18.62 ? 209 ARG C CB  1 
ATOM 4133 C CG  . ARG C 1 209 ? 50.998 35.276 91.700  1.00 21.95 ? 209 ARG C CG  1 
ATOM 4134 C CD  . ARG C 1 209 ? 51.253 34.193 90.639  1.00 28.04 ? 209 ARG C CD  1 
ATOM 4135 N NE  . ARG C 1 209 ? 51.327 32.837 91.216  1.00 35.53 ? 209 ARG C NE  1 
ATOM 4136 C CZ  . ARG C 1 209 ? 50.484 31.832 90.928  1.00 40.40 ? 209 ARG C CZ  1 
ATOM 4137 N NH1 . ARG C 1 209 ? 49.480 32.011 90.057  1.00 38.51 ? 209 ARG C NH1 1 
ATOM 4138 N NH2 . ARG C 1 209 ? 50.623 30.639 91.531  1.00 41.91 ? 209 ARG C NH2 1 
ATOM 4139 N N   . ILE C 1 210 ? 50.898 37.843 93.846  1.00 13.88 ? 210 ILE C N   1 
ATOM 4140 C CA  . ILE C 1 210 ? 51.401 39.208 93.617  1.00 11.72 ? 210 ILE C CA  1 
ATOM 4141 C C   . ILE C 1 210 ? 52.289 39.258 92.346  1.00 15.39 ? 210 ILE C C   1 
ATOM 4142 O O   . ILE C 1 210 ? 53.278 38.533 92.218  1.00 14.86 ? 210 ILE C O   1 
ATOM 4143 C CB  . ILE C 1 210 ? 52.237 39.710 94.766  1.00 7.32  ? 210 ILE C CB  1 
ATOM 4144 C CG1 . ILE C 1 210 ? 51.475 39.624 96.064  1.00 6.19  ? 210 ILE C CG1 1 
ATOM 4145 C CG2 . ILE C 1 210 ? 52.600 41.144 94.550  1.00 8.31  ? 210 ILE C CG2 1 
ATOM 4146 C CD1 . ILE C 1 210 ? 52.228 40.351 97.197  1.00 8.37  ? 210 ILE C CD1 1 
ATOM 4147 N N   . PRO C 1 211 ? 51.994 40.187 91.438  1.00 18.65 ? 211 PRO C N   1 
ATOM 4148 C CA  . PRO C 1 211 ? 52.690 40.396 90.173  1.00 22.37 ? 211 PRO C CA  1 
ATOM 4149 C C   . PRO C 1 211 ? 54.220 40.579 90.291  1.00 28.20 ? 211 PRO C C   1 
ATOM 4150 O O   . PRO C 1 211 ? 54.704 41.269 91.214  1.00 29.77 ? 211 PRO C O   1 
ATOM 4151 C CB  . PRO C 1 211 ? 51.994 41.644 89.637  1.00 23.54 ? 211 PRO C CB  1 
ATOM 4152 C CG  . PRO C 1 211 ? 51.674 42.421 90.905  1.00 22.14 ? 211 PRO C CG  1 
ATOM 4153 C CD  . PRO C 1 211 ? 51.093 41.319 91.730  1.00 20.73 ? 211 PRO C CD  1 
ATOM 4154 N N   . THR C 1 212 ? 54.952 40.046 89.296  1.00 30.85 ? 212 THR C N   1 
ATOM 4155 C CA  . THR C 1 212 ? 56.438 40.073 89.248  1.00 33.90 ? 212 THR C CA  1 
ATOM 4156 C C   . THR C 1 212 ? 57.209 41.244 88.583  1.00 34.29 ? 212 THR C C   1 
ATOM 4157 O O   . THR C 1 212 ? 58.448 41.306 88.710  1.00 36.79 ? 212 THR C O   1 
ATOM 4158 C CB  . THR C 1 212 ? 57.025 38.757 88.585  1.00 37.32 ? 212 THR C CB  1 
ATOM 4159 O OG1 . THR C 1 212 ? 56.588 38.660 87.215  1.00 40.33 ? 212 THR C OG1 1 
ATOM 4160 C CG2 . THR C 1 212 ? 56.602 37.489 89.345  1.00 35.64 ? 212 THR C CG2 1 
ATOM 4161 N N   . SER C 1 213 ? 56.507 42.151 87.897  1.00 35.14 ? 213 SER C N   1 
ATOM 4162 C CA  . SER C 1 213 ? 57.138 43.284 87.156  1.00 35.38 ? 213 SER C CA  1 
ATOM 4163 C C   . SER C 1 213 ? 58.152 42.901 86.049  1.00 36.19 ? 213 SER C C   1 
ATOM 4164 O O   . SER C 1 213 ? 59.252 42.350 86.309  1.00 30.50 ? 213 SER C O   1 
ATOM 4165 C CB  . SER C 1 213 ? 57.779 44.349 88.055  1.00 34.12 ? 213 SER C CB  1 
ATOM 4166 O OG  . SER C 1 213 ? 58.355 45.361 87.215  1.00 32.76 ? 213 SER C OG  1 
ATOM 4167 N N   . GLY C 1 214 ? 57.793 43.284 84.822  1.00 33.56 ? 214 GLY C N   1 
ATOM 4168 C CA  . GLY C 1 214 ? 58.618 42.964 83.671  1.00 29.04 ? 214 GLY C CA  1 
ATOM 4169 C C   . GLY C 1 214 ? 59.438 44.111 83.144  1.00 21.22 ? 214 GLY C C   1 
ATOM 4170 O O   . GLY C 1 214 ? 59.541 44.302 81.936  1.00 23.85 ? 214 GLY C O   1 
ATOM 4171 N N   . VAL C 1 215 ? 60.019 44.882 84.046  1.00 14.06 ? 215 VAL C N   1 
ATOM 4172 C CA  . VAL C 1 215 ? 60.824 45.999 83.642  1.00 7.88  ? 215 VAL C CA  1 
ATOM 4173 C C   . VAL C 1 215 ? 61.804 46.270 84.757  1.00 7.20  ? 215 VAL C C   1 
ATOM 4174 O O   . VAL C 1 215 ? 61.397 46.437 85.902  1.00 11.65 ? 215 VAL C O   1 
ATOM 4175 C CB  . VAL C 1 215 ? 59.946 47.199 83.381  1.00 4.69  ? 215 VAL C CB  1 
ATOM 4176 C CG1 . VAL C 1 215 ? 60.748 48.441 83.465  1.00 4.92  ? 215 VAL C CG1 1 
ATOM 4177 C CG2 . VAL C 1 215 ? 59.336 47.093 82.015  1.00 2.67  ? 215 VAL C CG2 1 
ATOM 4178 N N   . LEU C 1 216 ? 63.094 46.232 84.431  1.00 6.01  ? 216 LEU C N   1 
ATOM 4179 C CA  . LEU C 1 216 ? 64.152 46.470 85.409  1.00 4.40  ? 216 LEU C CA  1 
ATOM 4180 C C   . LEU C 1 216 ? 63.952 47.846 86.028  1.00 3.48  ? 216 LEU C C   1 
ATOM 4181 O O   . LEU C 1 216 ? 63.364 48.725 85.423  1.00 2.00  ? 216 LEU C O   1 
ATOM 4182 C CB  . LEU C 1 216 ? 65.546 46.410 84.763  1.00 6.56  ? 216 LEU C CB  1 
ATOM 4183 C CG  . LEU C 1 216 ? 66.033 45.307 83.816  1.00 2.00  ? 216 LEU C CG  1 
ATOM 4184 C CD1 . LEU C 1 216 ? 67.379 45.756 83.337  1.00 8.40  ? 216 LEU C CD1 1 
ATOM 4185 C CD2 . LEU C 1 216 ? 66.156 43.939 84.439  1.00 3.09  ? 216 LEU C CD2 1 
ATOM 4186 N N   . PRO C 1 217 ? 64.441 48.037 87.252  1.00 3.71  ? 217 PRO C N   1 
ATOM 4187 C CA  . PRO C 1 217 ? 64.347 49.287 88.011  1.00 5.14  ? 217 PRO C CA  1 
ATOM 4188 C C   . PRO C 1 217 ? 64.979 50.526 87.326  1.00 10.88 ? 217 PRO C C   1 
ATOM 4189 O O   . PRO C 1 217 ? 65.681 50.393 86.322  1.00 14.45 ? 217 PRO C O   1 
ATOM 4190 C CB  . PRO C 1 217 ? 65.078 48.935 89.309  1.00 2.00  ? 217 PRO C CB  1 
ATOM 4191 C CG  . PRO C 1 217 ? 66.055 47.880 88.889  1.00 2.00  ? 217 PRO C CG  1 
ATOM 4192 C CD  . PRO C 1 217 ? 65.207 47.027 87.998  1.00 2.00  ? 217 PRO C CD  1 
ATOM 4193 N N   . VAL C 1 218 ? 64.796 51.707 87.925  1.00 10.90 ? 218 VAL C N   1 
ATOM 4194 C CA  . VAL C 1 218 ? 65.325 52.966 87.406  1.00 7.22  ? 218 VAL C CA  1 
ATOM 4195 C C   . VAL C 1 218 ? 66.155 53.727 88.471  1.00 11.33 ? 218 VAL C C   1 
ATOM 4196 O O   . VAL C 1 218 ? 66.002 53.488 89.690  1.00 14.16 ? 218 VAL C O   1 
ATOM 4197 C CB  . VAL C 1 218 ? 64.156 53.819 86.879  1.00 2.00  ? 218 VAL C CB  1 
ATOM 4198 C CG1 . VAL C 1 218 ? 64.593 55.157 86.434  1.00 2.00  ? 218 VAL C CG1 1 
ATOM 4199 C CG2 . VAL C 1 218 ? 63.536 53.130 85.714  1.00 3.24  ? 218 VAL C CG2 1 
ATOM 4200 O OXT . VAL C 1 218 ? 67.015 54.544 88.081  1.00 18.60 ? 218 VAL C OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   THR 7   7   ?   ?   ?   A . n 
A 1 8   SER 8   8   ?   ?   ?   A . n 
A 1 9   ALA 9   9   ?   ?   ?   A . n 
A 1 10  GLY 10  10  ?   ?   ?   A . n 
A 1 11  ARG 11  11  ?   ?   ?   A . n 
A 1 12  ASN 12  12  ?   ?   ?   A . n 
A 1 13  ARG 13  13  ?   ?   ?   A . n 
A 1 14  ARG 14  14  ?   ?   ?   A . n 
A 1 15  ARG 15  15  ?   ?   ?   A . n 
A 1 16  ARG 16  16  ?   ?   ?   A . n 
A 1 17  PRO 17  17  ?   ?   ?   A . n 
A 1 18  ARG 18  18  ?   ?   ?   A . n 
A 1 19  ARG 19  19  ?   ?   ?   A . n 
A 1 20  GLY 20  20  ?   ?   ?   A . n 
A 1 21  SER 21  21  ?   ?   ?   A . n 
A 1 22  ARG 22  22  ?   ?   ?   A . n 
A 1 23  SER 23  23  ?   ?   ?   A . n 
A 1 24  ALA 24  24  ?   ?   ?   A . n 
A 1 25  PRO 25  25  ?   ?   ?   A . n 
A 1 26  SER 26  26  ?   ?   ?   A . n 
A 1 27  SER 27  27  ?   ?   ?   A . n 
A 1 28  ALA 28  28  ?   ?   ?   A . n 
A 1 29  ASP 29  29  ?   ?   ?   A . n 
A 1 30  ALA 30  30  ?   ?   ?   A . n 
A 1 31  ASN 31  31  ?   ?   ?   A . n 
A 1 32  PHE 32  32  ?   ?   ?   A . n 
A 1 33  ARG 33  33  ?   ?   ?   A . n 
A 1 34  VAL 34  34  ?   ?   ?   A . n 
A 1 35  LEU 35  35  ?   ?   ?   A . n 
A 1 36  SER 36  36  ?   ?   ?   A . n 
A 1 37  GLN 37  37  ?   ?   ?   A . n 
A 1 38  GLN 38  38  ?   ?   ?   A . n 
A 1 39  LEU 39  39  ?   ?   ?   A . n 
A 1 40  SER 40  40  ?   ?   ?   A . n 
A 1 41  ARG 41  41  ?   ?   ?   A . n 
A 1 42  LEU 42  42  ?   ?   ?   A . n 
A 1 43  ASN 43  43  ?   ?   ?   A . n 
A 1 44  LYS 44  44  ?   ?   ?   A . n 
A 1 45  THR 45  45  ?   ?   ?   A . n 
A 1 46  LEU 46  46  ?   ?   ?   A . n 
A 1 47  ALA 47  47  ?   ?   ?   A . n 
A 1 48  ALA 48  48  ?   ?   ?   A . n 
A 1 49  GLY 49  49  ?   ?   ?   A . n 
A 1 50  ARG 50  50  ?   ?   ?   A . n 
A 1 51  PRO 51  51  ?   ?   ?   A . n 
A 1 52  THR 52  52  ?   ?   ?   A . n 
A 1 53  ILE 53  53  ?   ?   ?   A . n 
A 1 54  ASN 54  54  ?   ?   ?   A . n 
A 1 55  HIS 55  55  ?   ?   ?   A . n 
A 1 56  PRO 56  56  ?   ?   ?   A . n 
A 1 57  THR 57  57  ?   ?   ?   A . n 
A 1 58  PHE 58  58  ?   ?   ?   A . n 
A 1 59  VAL 59  59  ?   ?   ?   A . n 
A 1 60  GLY 60  60  ?   ?   ?   A . n 
A 1 61  SER 61  61  ?   ?   ?   A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ARG 63  63  63  ARG ARG A . n 
A 1 64  CYS 64  64  64  CYS CYS A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  PRO 66  66  66  PRO PRO A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 GLN 108 108 108 GLN GLN A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 ARG 110 110 110 ARG ARG A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 TRP 122 122 122 TRP TRP A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 MET 142 142 142 MET MET A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 TYR 153 153 153 TYR TYR A . n 
A 1 154 GLN 154 154 154 GLN GLN A . n 
A 1 155 TYR 155 155 155 TYR TYR A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 ASN 164 164 164 ASN ASN A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 TYR 168 168 168 TYR TYR A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 MET 173 173 173 MET MET A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 ASP 176 176 176 ASP ASP A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 MET 180 180 180 MET MET A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 ASP 191 191 191 ASP ASP A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 HIS 202 202 202 HIS HIS A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ILE 205 205 205 ILE ILE A . n 
A 1 206 GLU 206 206 206 GLU GLU A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 GLN 208 208 208 GLN GLN A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ASP 2   2   ?   ?   ?   B . n 
B 1 3   LYS 3   3   ?   ?   ?   B . n 
B 1 4   SER 4   4   ?   ?   ?   B . n 
B 1 5   GLU 5   5   ?   ?   ?   B . n 
B 1 6   SER 6   6   ?   ?   ?   B . n 
B 1 7   THR 7   7   ?   ?   ?   B . n 
B 1 8   SER 8   8   ?   ?   ?   B . n 
B 1 9   ALA 9   9   ?   ?   ?   B . n 
B 1 10  GLY 10  10  ?   ?   ?   B . n 
B 1 11  ARG 11  11  ?   ?   ?   B . n 
B 1 12  ASN 12  12  ?   ?   ?   B . n 
B 1 13  ARG 13  13  ?   ?   ?   B . n 
B 1 14  ARG 14  14  ?   ?   ?   B . n 
B 1 15  ARG 15  15  ?   ?   ?   B . n 
B 1 16  ARG 16  16  ?   ?   ?   B . n 
B 1 17  PRO 17  17  ?   ?   ?   B . n 
B 1 18  ARG 18  18  ?   ?   ?   B . n 
B 1 19  ARG 19  19  ?   ?   ?   B . n 
B 1 20  GLY 20  20  ?   ?   ?   B . n 
B 1 21  SER 21  21  ?   ?   ?   B . n 
B 1 22  ARG 22  22  ?   ?   ?   B . n 
B 1 23  SER 23  23  ?   ?   ?   B . n 
B 1 24  ALA 24  24  ?   ?   ?   B . n 
B 1 25  PRO 25  25  ?   ?   ?   B . n 
B 1 26  SER 26  26  ?   ?   ?   B . n 
B 1 27  SER 27  27  ?   ?   ?   B . n 
B 1 28  ALA 28  28  ?   ?   ?   B . n 
B 1 29  ASP 29  29  29  ASP ASP B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  ASN 31  31  31  ASN ASN B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  ARG 33  33  33  ARG ARG B . n 
B 1 34  VAL 34  34  34  VAL VAL B . n 
B 1 35  LEU 35  35  35  LEU LEU B . n 
B 1 36  SER 36  36  36  SER SER B . n 
B 1 37  GLN 37  37  37  GLN GLN B . n 
B 1 38  GLN 38  38  38  GLN GLN B . n 
B 1 39  LEU 39  39  39  LEU LEU B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  ARG 41  41  41  ARG ARG B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  ASN 43  43  43  ASN ASN B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  GLY 49  49  49  GLY GLY B . n 
B 1 50  ARG 50  50  50  ARG ARG B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  THR 52  52  52  THR THR B . n 
B 1 53  ILE 53  53  53  ILE ILE B . n 
B 1 54  ASN 54  54  54  ASN ASN B . n 
B 1 55  HIS 55  55  55  HIS HIS B . n 
B 1 56  PRO 56  56  56  PRO PRO B . n 
B 1 57  THR 57  57  57  THR THR B . n 
B 1 58  PHE 58  58  58  PHE PHE B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  GLY 60  60  60  GLY GLY B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  ARG 63  63  63  ARG ARG B . n 
B 1 64  CYS 64  64  64  CYS CYS B . n 
B 1 65  ARG 65  65  65  ARG ARG B . n 
B 1 66  PRO 66  66  66  PRO PRO B . n 
B 1 67  GLY 67  67  67  GLY GLY B . n 
B 1 68  TYR 68  68  68  TYR TYR B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  PHE 70  70  70  PHE PHE B . n 
B 1 71  THR 71  71  71  THR THR B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  THR 74  74  74  THR THR B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  PRO 77  77  77  PRO PRO B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  ILE 80  80  80  ILE ILE B . n 
B 1 81  ASP 81  81  81  ASP ASP B . n 
B 1 82  ARG 82  82  82  ARG ARG B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  SER 84  84  84  SER SER B . n 
B 1 85  TYR 85  85  85  TYR TYR B . n 
B 1 86  TYR 86  86  86  TYR TYR B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  ARG 89  89  89  ARG ARG B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  ASP 94  94  94  ASP ASP B . n 
B 1 95  SER 95  95  95  SER SER B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  THR 97  97  97  THR THR B . n 
B 1 98  GLU 98  98  98  GLU GLU B . n 
B 1 99  TYR 99  99  99  TYR TYR B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 LYS 102 102 102 LYS LYS B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 VAL 104 104 104 VAL VAL B . n 
B 1 105 SER 105 105 105 SER SER B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 GLN 108 108 108 GLN GLN B . n 
B 1 109 ILE 109 109 109 ILE ILE B . n 
B 1 110 ARG 110 110 110 ARG ARG B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 ASN 112 112 112 ASN ASN B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 LEU 114 114 114 LEU LEU B . n 
B 1 115 PRO 115 115 115 PRO PRO B . n 
B 1 116 LYS 116 116 116 LYS LYS B . n 
B 1 117 PHE 117 117 117 PHE PHE B . n 
B 1 118 ASP 118 118 118 ASP ASP B . n 
B 1 119 SER 119 119 119 SER SER B . n 
B 1 120 THR 120 120 120 THR THR B . n 
B 1 121 VAL 121 121 121 VAL VAL B . n 
B 1 122 TRP 122 122 122 TRP TRP B . n 
B 1 123 VAL 123 123 123 VAL VAL B . n 
B 1 124 THR 124 124 124 THR THR B . n 
B 1 125 VAL 125 125 125 VAL VAL B . n 
B 1 126 ARG 126 126 126 ARG ARG B . n 
B 1 127 LYS 127 127 127 LYS LYS B . n 
B 1 128 VAL 128 128 128 VAL VAL B . n 
B 1 129 PRO 129 129 129 PRO PRO B . n 
B 1 130 ALA 130 130 130 ALA ALA B . n 
B 1 131 SER 131 131 131 SER SER B . n 
B 1 132 SER 132 132 132 SER SER B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 SER 135 135 135 SER SER B . n 
B 1 136 VAL 136 136 136 VAL VAL B . n 
B 1 137 ALA 137 137 137 ALA ALA B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 SER 140 140 140 SER SER B . n 
B 1 141 ALA 141 141 141 ALA ALA B . n 
B 1 142 MET 142 142 142 MET MET B . n 
B 1 143 PHE 143 143 143 PHE PHE B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ASP 145 145 145 ASP ASP B . n 
B 1 146 GLY 146 146 146 GLY GLY B . n 
B 1 147 ALA 147 147 147 ALA ALA B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 LEU 151 151 151 LEU LEU B . n 
B 1 152 VAL 152 152 152 VAL VAL B . n 
B 1 153 TYR 153 153 153 TYR TYR B . n 
B 1 154 GLN 154 154 154 GLN GLN B . n 
B 1 155 TYR 155 155 155 TYR TYR B . n 
B 1 156 ALA 156 156 156 ALA ALA B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 SER 158 158 158 SER SER B . n 
B 1 159 GLY 159 159 159 GLY GLY B . n 
B 1 160 VAL 160 160 160 VAL VAL B . n 
B 1 161 GLN 161 161 161 GLN GLN B . n 
B 1 162 ALA 162 162 162 ALA ALA B . n 
B 1 163 ASN 163 163 163 ASN ASN B . n 
B 1 164 ASN 164 164 164 ASN ASN B . n 
B 1 165 LYS 165 165 165 LYS LYS B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 LEU 167 167 167 LEU LEU B . n 
B 1 168 TYR 168 168 168 TYR TYR B . n 
B 1 169 ASP 169 169 169 ASP ASP B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 SER 171 171 171 SER SER B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 MET 173 173 173 MET MET B . n 
B 1 174 ARG 174 174 174 ARG ARG B . n 
B 1 175 ALA 175 175 175 ALA ALA B . n 
B 1 176 ASP 176 176 176 ASP ASP B . n 
B 1 177 ILE 177 177 177 ILE ILE B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 ASP 179 179 179 ASP ASP B . n 
B 1 180 MET 180 180 180 MET MET B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 LYS 182 182 182 LYS LYS B . n 
B 1 183 TYR 183 183 183 TYR TYR B . n 
B 1 184 ALA 184 184 184 ALA ALA B . n 
B 1 185 VAL 185 185 185 VAL VAL B . n 
B 1 186 LEU 186 186 186 LEU LEU B . n 
B 1 187 VAL 187 187 187 VAL VAL B . n 
B 1 188 TYR 188 188 188 TYR TYR B . n 
B 1 189 SER 189 189 189 SER SER B . n 
B 1 190 LYS 190 190 190 LYS LYS B . n 
B 1 191 ASP 191 191 191 ASP ASP B . n 
B 1 192 ASP 192 192 192 ASP ASP B . n 
B 1 193 ALA 193 193 193 ALA ALA B . n 
B 1 194 LEU 194 194 194 LEU LEU B . n 
B 1 195 GLU 195 195 195 GLU GLU B . n 
B 1 196 THR 196 196 196 THR THR B . n 
B 1 197 ASP 197 197 197 ASP ASP B . n 
B 1 198 GLU 198 198 198 GLU GLU B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 VAL 200 200 200 VAL VAL B . n 
B 1 201 LEU 201 201 201 LEU LEU B . n 
B 1 202 HIS 202 202 202 HIS HIS B . n 
B 1 203 VAL 203 203 203 VAL VAL B . n 
B 1 204 ASP 204 204 204 ASP ASP B . n 
B 1 205 ILE 205 205 205 ILE ILE B . n 
B 1 206 GLU 206 206 206 GLU GLU B . n 
B 1 207 HIS 207 207 207 HIS HIS B . n 
B 1 208 GLN 208 208 208 GLN GLN B . n 
B 1 209 ARG 209 209 209 ARG ARG B . n 
B 1 210 ILE 210 210 210 ILE ILE B . n 
B 1 211 PRO 211 211 211 PRO PRO B . n 
B 1 212 THR 212 212 212 THR THR B . n 
B 1 213 SER 213 213 213 SER SER B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 VAL 215 215 215 VAL VAL B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 VAL 218 218 218 VAL VAL B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   ASP 2   2   ?   ?   ?   C . n 
C 1 3   LYS 3   3   ?   ?   ?   C . n 
C 1 4   SER 4   4   ?   ?   ?   C . n 
C 1 5   GLU 5   5   ?   ?   ?   C . n 
C 1 6   SER 6   6   ?   ?   ?   C . n 
C 1 7   THR 7   7   ?   ?   ?   C . n 
C 1 8   SER 8   8   ?   ?   ?   C . n 
C 1 9   ALA 9   9   ?   ?   ?   C . n 
C 1 10  GLY 10  10  ?   ?   ?   C . n 
C 1 11  ARG 11  11  ?   ?   ?   C . n 
C 1 12  ASN 12  12  ?   ?   ?   C . n 
C 1 13  ARG 13  13  ?   ?   ?   C . n 
C 1 14  ARG 14  14  ?   ?   ?   C . n 
C 1 15  ARG 15  15  ?   ?   ?   C . n 
C 1 16  ARG 16  16  ?   ?   ?   C . n 
C 1 17  PRO 17  17  ?   ?   ?   C . n 
C 1 18  ARG 18  18  ?   ?   ?   C . n 
C 1 19  ARG 19  19  ?   ?   ?   C . n 
C 1 20  GLY 20  20  ?   ?   ?   C . n 
C 1 21  SER 21  21  ?   ?   ?   C . n 
C 1 22  ARG 22  22  ?   ?   ?   C . n 
C 1 23  SER 23  23  ?   ?   ?   C . n 
C 1 24  ALA 24  24  ?   ?   ?   C . n 
C 1 25  PRO 25  25  ?   ?   ?   C . n 
C 1 26  SER 26  26  ?   ?   ?   C . n 
C 1 27  SER 27  27  ?   ?   ?   C . n 
C 1 28  ALA 28  28  28  ALA ALA C . n 
C 1 29  ASP 29  29  29  ASP ASP C . n 
C 1 30  ALA 30  30  30  ALA ALA C . n 
C 1 31  ASN 31  31  31  ASN ASN C . n 
C 1 32  PHE 32  32  32  PHE PHE C . n 
C 1 33  ARG 33  33  33  ARG ARG C . n 
C 1 34  VAL 34  34  34  VAL VAL C . n 
C 1 35  LEU 35  35  35  LEU LEU C . n 
C 1 36  SER 36  36  36  SER SER C . n 
C 1 37  GLN 37  37  37  GLN GLN C . n 
C 1 38  GLN 38  38  38  GLN GLN C . n 
C 1 39  LEU 39  39  39  LEU LEU C . n 
C 1 40  SER 40  40  40  SER SER C . n 
C 1 41  ARG 41  41  41  ARG ARG C . n 
C 1 42  LEU 42  42  42  LEU LEU C . n 
C 1 43  ASN 43  43  43  ASN ASN C . n 
C 1 44  LYS 44  44  44  LYS LYS C . n 
C 1 45  THR 45  45  45  THR THR C . n 
C 1 46  LEU 46  46  46  LEU LEU C . n 
C 1 47  ALA 47  47  47  ALA ALA C . n 
C 1 48  ALA 48  48  48  ALA ALA C . n 
C 1 49  GLY 49  49  49  GLY GLY C . n 
C 1 50  ARG 50  50  50  ARG ARG C . n 
C 1 51  PRO 51  51  51  PRO PRO C . n 
C 1 52  THR 52  52  52  THR THR C . n 
C 1 53  ILE 53  53  53  ILE ILE C . n 
C 1 54  ASN 54  54  54  ASN ASN C . n 
C 1 55  HIS 55  55  55  HIS HIS C . n 
C 1 56  PRO 56  56  56  PRO PRO C . n 
C 1 57  THR 57  57  57  THR THR C . n 
C 1 58  PHE 58  58  58  PHE PHE C . n 
C 1 59  VAL 59  59  59  VAL VAL C . n 
C 1 60  GLY 60  60  60  GLY GLY C . n 
C 1 61  SER 61  61  61  SER SER C . n 
C 1 62  GLU 62  62  62  GLU GLU C . n 
C 1 63  ARG 63  63  63  ARG ARG C . n 
C 1 64  CYS 64  64  64  CYS CYS C . n 
C 1 65  ARG 65  65  65  ARG ARG C . n 
C 1 66  PRO 66  66  66  PRO PRO C . n 
C 1 67  GLY 67  67  67  GLY GLY C . n 
C 1 68  TYR 68  68  68  TYR TYR C . n 
C 1 69  THR 69  69  69  THR THR C . n 
C 1 70  PHE 70  70  70  PHE PHE C . n 
C 1 71  THR 71  71  71  THR THR C . n 
C 1 72  SER 72  72  72  SER SER C . n 
C 1 73  ILE 73  73  73  ILE ILE C . n 
C 1 74  THR 74  74  74  THR THR C . n 
C 1 75  LEU 75  75  75  LEU LEU C . n 
C 1 76  LYS 76  76  76  LYS LYS C . n 
C 1 77  PRO 77  77  77  PRO PRO C . n 
C 1 78  PRO 78  78  78  PRO PRO C . n 
C 1 79  LYS 79  79  79  LYS LYS C . n 
C 1 80  ILE 80  80  80  ILE ILE C . n 
C 1 81  ASP 81  81  81  ASP ASP C . n 
C 1 82  ARG 82  82  82  ARG ARG C . n 
C 1 83  GLY 83  83  83  GLY GLY C . n 
C 1 84  SER 84  84  84  SER SER C . n 
C 1 85  TYR 85  85  85  TYR TYR C . n 
C 1 86  TYR 86  86  86  TYR TYR C . n 
C 1 87  GLY 87  87  87  GLY GLY C . n 
C 1 88  LYS 88  88  88  LYS LYS C . n 
C 1 89  ARG 89  89  89  ARG ARG C . n 
C 1 90  LEU 90  90  90  LEU LEU C . n 
C 1 91  LEU 91  91  91  LEU LEU C . n 
C 1 92  LEU 92  92  92  LEU LEU C . n 
C 1 93  PRO 93  93  93  PRO PRO C . n 
C 1 94  ASP 94  94  94  ASP ASP C . n 
C 1 95  SER 95  95  95  SER SER C . n 
C 1 96  VAL 96  96  96  VAL VAL C . n 
C 1 97  THR 97  97  97  THR THR C . n 
C 1 98  GLU 98  98  98  GLU GLU C . n 
C 1 99  TYR 99  99  99  TYR TYR C . n 
C 1 100 ASP 100 100 100 ASP ASP C . n 
C 1 101 LYS 101 101 101 LYS LYS C . n 
C 1 102 LYS 102 102 102 LYS LYS C . n 
C 1 103 LEU 103 103 103 LEU LEU C . n 
C 1 104 VAL 104 104 104 VAL VAL C . n 
C 1 105 SER 105 105 105 SER SER C . n 
C 1 106 ARG 106 106 106 ARG ARG C . n 
C 1 107 LEU 107 107 107 LEU LEU C . n 
C 1 108 GLN 108 108 108 GLN GLN C . n 
C 1 109 ILE 109 109 109 ILE ILE C . n 
C 1 110 ARG 110 110 110 ARG ARG C . n 
C 1 111 VAL 111 111 111 VAL VAL C . n 
C 1 112 ASN 112 112 112 ASN ASN C . n 
C 1 113 PRO 113 113 113 PRO PRO C . n 
C 1 114 LEU 114 114 114 LEU LEU C . n 
C 1 115 PRO 115 115 115 PRO PRO C . n 
C 1 116 LYS 116 116 116 LYS LYS C . n 
C 1 117 PHE 117 117 117 PHE PHE C . n 
C 1 118 ASP 118 118 118 ASP ASP C . n 
C 1 119 SER 119 119 119 SER SER C . n 
C 1 120 THR 120 120 120 THR THR C . n 
C 1 121 VAL 121 121 121 VAL VAL C . n 
C 1 122 TRP 122 122 122 TRP TRP C . n 
C 1 123 VAL 123 123 123 VAL VAL C . n 
C 1 124 THR 124 124 124 THR THR C . n 
C 1 125 VAL 125 125 125 VAL VAL C . n 
C 1 126 ARG 126 126 126 ARG ARG C . n 
C 1 127 LYS 127 127 127 LYS LYS C . n 
C 1 128 VAL 128 128 128 VAL VAL C . n 
C 1 129 PRO 129 129 129 PRO PRO C . n 
C 1 130 ALA 130 130 130 ALA ALA C . n 
C 1 131 SER 131 131 131 SER SER C . n 
C 1 132 SER 132 132 132 SER SER C . n 
C 1 133 ASP 133 133 133 ASP ASP C . n 
C 1 134 LEU 134 134 134 LEU LEU C . n 
C 1 135 SER 135 135 135 SER SER C . n 
C 1 136 VAL 136 136 136 VAL VAL C . n 
C 1 137 ALA 137 137 137 ALA ALA C . n 
C 1 138 ALA 138 138 138 ALA ALA C . n 
C 1 139 ILE 139 139 139 ILE ILE C . n 
C 1 140 SER 140 140 140 SER SER C . n 
C 1 141 ALA 141 141 141 ALA ALA C . n 
C 1 142 MET 142 142 142 MET MET C . n 
C 1 143 PHE 143 143 143 PHE PHE C . n 
C 1 144 ALA 144 144 144 ALA ALA C . n 
C 1 145 ASP 145 145 145 ASP ASP C . n 
C 1 146 GLY 146 146 146 GLY GLY C . n 
C 1 147 ALA 147 147 147 ALA ALA C . n 
C 1 148 SER 148 148 148 SER SER C . n 
C 1 149 PRO 149 149 149 PRO PRO C . n 
C 1 150 VAL 150 150 150 VAL VAL C . n 
C 1 151 LEU 151 151 151 LEU LEU C . n 
C 1 152 VAL 152 152 152 VAL VAL C . n 
C 1 153 TYR 153 153 153 TYR TYR C . n 
C 1 154 GLN 154 154 154 GLN GLN C . n 
C 1 155 TYR 155 155 155 TYR TYR C . n 
C 1 156 ALA 156 156 156 ALA ALA C . n 
C 1 157 ALA 157 157 157 ALA ALA C . n 
C 1 158 SER 158 158 158 SER SER C . n 
C 1 159 GLY 159 159 159 GLY GLY C . n 
C 1 160 VAL 160 160 160 VAL VAL C . n 
C 1 161 GLN 161 161 161 GLN GLN C . n 
C 1 162 ALA 162 162 162 ALA ALA C . n 
C 1 163 ASN 163 163 163 ASN ASN C . n 
C 1 164 ASN 164 164 164 ASN ASN C . n 
C 1 165 LYS 165 165 165 LYS LYS C . n 
C 1 166 LEU 166 166 166 LEU LEU C . n 
C 1 167 LEU 167 167 167 LEU LEU C . n 
C 1 168 TYR 168 168 168 TYR TYR C . n 
C 1 169 ASP 169 169 169 ASP ASP C . n 
C 1 170 LEU 170 170 170 LEU LEU C . n 
C 1 171 SER 171 171 171 SER SER C . n 
C 1 172 ALA 172 172 172 ALA ALA C . n 
C 1 173 MET 173 173 173 MET MET C . n 
C 1 174 ARG 174 174 174 ARG ARG C . n 
C 1 175 ALA 175 175 175 ALA ALA C . n 
C 1 176 ASP 176 176 176 ASP ASP C . n 
C 1 177 ILE 177 177 177 ILE ILE C . n 
C 1 178 GLY 178 178 178 GLY GLY C . n 
C 1 179 ASP 179 179 179 ASP ASP C . n 
C 1 180 MET 180 180 180 MET MET C . n 
C 1 181 ARG 181 181 181 ARG ARG C . n 
C 1 182 LYS 182 182 182 LYS LYS C . n 
C 1 183 TYR 183 183 183 TYR TYR C . n 
C 1 184 ALA 184 184 184 ALA ALA C . n 
C 1 185 VAL 185 185 185 VAL VAL C . n 
C 1 186 LEU 186 186 186 LEU LEU C . n 
C 1 187 VAL 187 187 187 VAL VAL C . n 
C 1 188 TYR 188 188 188 TYR TYR C . n 
C 1 189 SER 189 189 189 SER SER C . n 
C 1 190 LYS 190 190 190 LYS LYS C . n 
C 1 191 ASP 191 191 191 ASP ASP C . n 
C 1 192 ASP 192 192 192 ASP ASP C . n 
C 1 193 ALA 193 193 193 ALA ALA C . n 
C 1 194 LEU 194 194 194 LEU LEU C . n 
C 1 195 GLU 195 195 195 GLU GLU C . n 
C 1 196 THR 196 196 196 THR THR C . n 
C 1 197 ASP 197 197 197 ASP ASP C . n 
C 1 198 GLU 198 198 198 GLU GLU C . n 
C 1 199 LEU 199 199 199 LEU LEU C . n 
C 1 200 VAL 200 200 200 VAL VAL C . n 
C 1 201 LEU 201 201 201 LEU LEU C . n 
C 1 202 HIS 202 202 202 HIS HIS C . n 
C 1 203 VAL 203 203 203 VAL VAL C . n 
C 1 204 ASP 204 204 204 ASP ASP C . n 
C 1 205 ILE 205 205 205 ILE ILE C . n 
C 1 206 GLU 206 206 206 GLU GLU C . n 
C 1 207 HIS 207 207 207 HIS HIS C . n 
C 1 208 GLN 208 208 208 GLN GLN C . n 
C 1 209 ARG 209 209 209 ARG ARG C . n 
C 1 210 ILE 210 210 210 ILE ILE C . n 
C 1 211 PRO 211 211 211 PRO PRO C . n 
C 1 212 THR 212 212 212 THR THR C . n 
C 1 213 SER 213 213 213 SER SER C . n 
C 1 214 GLY 214 214 214 GLY GLY C . n 
C 1 215 VAL 215 215 215 VAL VAL C . n 
C 1 216 LEU 216 216 216 LEU LEU C . n 
C 1 217 PRO 217 217 217 PRO PRO C . n 
C 1 218 VAL 218 218 218 VAL VAL C . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'complete icosahedral assembly'                ? 'complete icosahedral assembly' 180 
2 'icosahedral asymmetric unit'                  ? trimeric                        3   
3 'icosahedral pentamer'                         ? pentadecameric                  15  
4 'icosahedral 23 hexamer'                       ? octadecameric                   18  
5 'icosahedral asymmetric unit, std point frame' ? trimeric                        3   
6 'crystal asymmetric unit, crystal frame'       ? pentadecameric                  15  
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-60)'           A,B,C 
2 1                  A,B,C 
3 '(1-5)'            A,B,C 
4 '(1,2,6,10,23,24)' A,B,C 
5 P                  A,B,C 
6 '(X0)(1-5)'        A,B,C 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
P  'transform to point frame'   ? ? 1.00000000  0.00000000  0.00000000  -0.00000 0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  -0.00000 
X0 'transform to crystal frame' ? ? 1.00000000  0.00000000  0.00000000  0.00000  0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000  
1  'point symmetry operation'   ? ? 1.00000000  0.00000000  0.00000000  0.00000  0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000  
2  'point symmetry operation'   ? ? 0.30901699  -0.80901699 0.50000000  0.00000  0.80901699  0.50000000  0.30901699  0.00000 
-0.50000000 0.30901699  0.80901699  0.00000  
3  'point symmetry operation'   ? ? -0.80901699 -0.50000000 0.30901699  0.00000  0.50000000  -0.30901699 0.80901699  0.00000 
-0.30901699 0.80901699  0.50000000  0.00000  
4  'point symmetry operation'   ? ? -0.80901699 0.50000000  -0.30901699 0.00000  -0.50000000 -0.30901699 0.80901699  0.00000 
0.30901699  0.80901699  0.50000000  0.00000  
5  'point symmetry operation'   ? ? 0.30901699  0.80901699  -0.50000000 0.00000  -0.80901699 0.50000000  0.30901699  0.00000 
0.50000000  0.30901699  0.80901699  0.00000  
6  'point symmetry operation'   ? ? -1.00000000 0.00000000  0.00000000  0.00000  0.00000000  -1.00000000 0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000  
7  'point symmetry operation'   ? ? -0.30901699 0.80901699  -0.50000000 0.00000  -0.80901699 -0.50000000 -0.30901699 0.00000 
-0.50000000 0.30901699  0.80901699  0.00000  
8  'point symmetry operation'   ? ? 0.80901699  0.50000000  -0.30901699 0.00000  -0.50000000 0.30901699  -0.80901699 0.00000 
-0.30901699 0.80901699  0.50000000  0.00000  
9  'point symmetry operation'   ? ? 0.80901699  -0.50000000 0.30901699  0.00000  0.50000000  0.30901699  -0.80901699 0.00000 
0.30901699  0.80901699  0.50000000  0.00000  
10 'point symmetry operation'   ? ? -0.30901699 -0.80901699 0.50000000  0.00000  0.80901699  -0.50000000 -0.30901699 0.00000 
0.50000000  0.30901699  0.80901699  0.00000  
11 'point symmetry operation'   ? ? -1.00000000 0.00000000  0.00000000  0.00000  0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  -1.00000000 0.00000  
12 'point symmetry operation'   ? ? -0.30901699 0.80901699  -0.50000000 0.00000  0.80901699  0.50000000  0.30901699  0.00000 
0.50000000  -0.30901699 -0.80901699 0.00000  
13 'point symmetry operation'   ? ? 0.80901699  0.50000000  -0.30901699 0.00000  0.50000000  -0.30901699 0.80901699  0.00000 
0.30901699  -0.80901699 -0.50000000 0.00000  
14 'point symmetry operation'   ? ? 0.80901699  -0.50000000 0.30901699  0.00000  -0.50000000 -0.30901699 0.80901699  0.00000 
-0.30901699 -0.80901699 -0.50000000 0.00000  
15 'point symmetry operation'   ? ? -0.30901699 -0.80901699 0.50000000  0.00000  -0.80901699 0.50000000  0.30901699  0.00000 
-0.50000000 -0.30901699 -0.80901699 0.00000  
16 'point symmetry operation'   ? ? 1.00000000  0.00000000  0.00000000  0.00000  0.00000000  -1.00000000 0.00000000  0.00000 
0.00000000  0.00000000  -1.00000000 0.00000  
17 'point symmetry operation'   ? ? 0.30901699  -0.80901699 0.50000000  0.00000  -0.80901699 -0.50000000 -0.30901699 0.00000 
0.50000000  -0.30901699 -0.80901699 0.00000  
18 'point symmetry operation'   ? ? -0.80901699 -0.50000000 0.30901699  0.00000  -0.50000000 0.30901699  -0.80901699 0.00000 
0.30901699  -0.80901699 -0.50000000 0.00000  
19 'point symmetry operation'   ? ? -0.80901699 0.50000000  -0.30901699 0.00000  0.50000000  0.30901699  -0.80901699 0.00000 
-0.30901699 -0.80901699 -0.50000000 0.00000  
20 'point symmetry operation'   ? ? 0.30901699  0.80901699  -0.50000000 0.00000  0.80901699  -0.50000000 -0.30901699 0.00000 
-0.50000000 -0.30901699 -0.80901699 0.00000  
21 'point symmetry operation'   ? ? 0.00000000  0.00000000  1.00000000  0.00000  1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000  
22 'point symmetry operation'   ? ? -0.50000000 0.30901699  0.80901699  0.00000  0.30901699  -0.80901699 0.50000000  0.00000 
0.80901699  0.50000000  0.30901699  0.00000  
23 'point symmetry operation'   ? ? -0.30901699 0.80901699  0.50000000  0.00000  -0.80901699 -0.50000000 0.30901699  0.00000 
0.50000000  -0.30901699 0.80901699  0.00000  
24 'point symmetry operation'   ? ? 0.30901699  0.80901699  0.50000000  0.00000  -0.80901699 0.50000000  -0.30901699 0.00000 
-0.50000000 -0.30901699 0.80901699  0.00000  
25 'point symmetry operation'   ? ? 0.50000000  0.30901699  0.80901699  0.00000  0.30901699  0.80901699  -0.50000000 0.00000 
-0.80901699 0.50000000  0.30901699  0.00000  
26 'point symmetry operation'   ? ? 0.00000000  0.00000000  1.00000000  0.00000  -1.00000000 0.00000000  0.00000000  0.00000 
0.00000000  -1.00000000 0.00000000  0.00000  
27 'point symmetry operation'   ? ? -0.50000000 0.30901699  0.80901699  0.00000  -0.30901699 0.80901699  -0.50000000 0.00000 
-0.80901699 -0.50000000 -0.30901699 0.00000  
28 'point symmetry operation'   ? ? -0.30901699 0.80901699  0.50000000  0.00000  0.80901699  0.50000000  -0.30901699 0.00000 
-0.50000000 0.30901699  -0.80901699 0.00000  
29 'point symmetry operation'   ? ? 0.30901699  0.80901699  0.50000000  0.00000  0.80901699  -0.50000000 0.30901699  0.00000 
0.50000000  0.30901699  -0.80901699 0.00000  
30 'point symmetry operation'   ? ? 0.50000000  0.30901699  0.80901699  0.00000  -0.30901699 -0.80901699 0.50000000  0.00000 
0.80901699  -0.50000000 -0.30901699 0.00000  
31 'point symmetry operation'   ? ? 0.00000000  0.00000000  -1.00000000 0.00000  -1.00000000 0.00000000  0.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000  
32 'point symmetry operation'   ? ? 0.50000000  -0.30901699 -0.80901699 0.00000  -0.30901699 0.80901699  -0.50000000 0.00000 
0.80901699  0.50000000  0.30901699  0.00000  
33 'point symmetry operation'   ? ? 0.30901699  -0.80901699 -0.50000000 0.00000  0.80901699  0.50000000  -0.30901699 0.00000 
0.50000000  -0.30901699 0.80901699  0.00000  
34 'point symmetry operation'   ? ? -0.30901699 -0.80901699 -0.50000000 0.00000  0.80901699  -0.50000000 0.30901699  0.00000 
-0.50000000 -0.30901699 0.80901699  0.00000  
35 'point symmetry operation'   ? ? -0.50000000 -0.30901699 -0.80901699 0.00000  -0.30901699 -0.80901699 0.50000000  0.00000 
-0.80901699 0.50000000  0.30901699  0.00000  
36 'point symmetry operation'   ? ? 0.00000000  0.00000000  -1.00000000 0.00000  1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  -1.00000000 0.00000000  0.00000  
37 'point symmetry operation'   ? ? 0.50000000  -0.30901699 -0.80901699 0.00000  0.30901699  -0.80901699 0.50000000  0.00000 
-0.80901699 -0.50000000 -0.30901699 0.00000  
38 'point symmetry operation'   ? ? 0.30901699  -0.80901699 -0.50000000 0.00000  -0.80901699 -0.50000000 0.30901699  0.00000 
-0.50000000 0.30901699  -0.80901699 0.00000  
39 'point symmetry operation'   ? ? -0.30901699 -0.80901699 -0.50000000 0.00000  -0.80901699 0.50000000  -0.30901699 0.00000 
0.50000000  0.30901699  -0.80901699 0.00000  
40 'point symmetry operation'   ? ? -0.50000000 -0.30901699 -0.80901699 0.00000  0.30901699  0.80901699  -0.50000000 0.00000 
0.80901699  -0.50000000 -0.30901699 0.00000  
41 'point symmetry operation'   ? ? 0.00000000  1.00000000  0.00000000  0.00000  0.00000000  0.00000000  1.00000000  0.00000 
1.00000000  0.00000000  0.00000000  0.00000  
42 'point symmetry operation'   ? ? 0.80901699  0.50000000  0.30901699  0.00000  -0.50000000 0.30901699  0.80901699  0.00000 
0.30901699  -0.80901699 0.50000000  0.00000  
43 'point symmetry operation'   ? ? 0.50000000  -0.30901699 0.80901699  0.00000  -0.30901699 0.80901699  0.50000000  0.00000 
-0.80901699 -0.50000000 0.30901699  0.00000  
44 'point symmetry operation'   ? ? -0.50000000 -0.30901699 0.80901699  0.00000  0.30901699  0.80901699  0.50000000  0.00000 
-0.80901699 0.50000000  -0.30901699 0.00000  
45 'point symmetry operation'   ? ? -0.80901699 0.50000000  0.30901699  0.00000  0.50000000  0.30901699  0.80901699  0.00000 
0.30901699  0.80901699  -0.50000000 0.00000  
46 'point symmetry operation'   ? ? 0.00000000  -1.00000000 0.00000000  0.00000  0.00000000  0.00000000  1.00000000  0.00000 
-1.00000000 0.00000000  0.00000000  0.00000  
47 'point symmetry operation'   ? ? -0.80901699 -0.50000000 -0.30901699 0.00000  -0.50000000 0.30901699  0.80901699  0.00000 
-0.30901699 0.80901699  -0.50000000 0.00000  
48 'point symmetry operation'   ? ? -0.50000000 0.30901699  -0.80901699 0.00000  -0.30901699 0.80901699  0.50000000  0.00000 
0.80901699  0.50000000  -0.30901699 0.00000  
49 'point symmetry operation'   ? ? 0.50000000  0.30901699  -0.80901699 0.00000  0.30901699  0.80901699  0.50000000  0.00000 
0.80901699  -0.50000000 0.30901699  0.00000  
50 'point symmetry operation'   ? ? 0.80901699  -0.50000000 -0.30901699 0.00000  0.50000000  0.30901699  0.80901699  0.00000 
-0.30901699 -0.80901699 0.50000000  0.00000  
51 'point symmetry operation'   ? ? 0.00000000  1.00000000  0.00000000  0.00000  0.00000000  0.00000000  -1.00000000 0.00000 
-1.00000000 0.00000000  0.00000000  0.00000  
52 'point symmetry operation'   ? ? 0.80901699  0.50000000  0.30901699  0.00000  0.50000000  -0.30901699 -0.80901699 0.00000 
-0.30901699 0.80901699  -0.50000000 0.00000  
53 'point symmetry operation'   ? ? 0.50000000  -0.30901699 0.80901699  0.00000  0.30901699  -0.80901699 -0.50000000 0.00000 
0.80901699  0.50000000  -0.30901699 0.00000  
54 'point symmetry operation'   ? ? -0.50000000 -0.30901699 0.80901699  0.00000  -0.30901699 -0.80901699 -0.50000000 0.00000 
0.80901699  -0.50000000 0.30901699  0.00000  
55 'point symmetry operation'   ? ? -0.80901699 0.50000000  0.30901699  0.00000  -0.50000000 -0.30901699 -0.80901699 0.00000 
-0.30901699 -0.80901699 0.50000000  0.00000  
56 'point symmetry operation'   ? ? 0.00000000  -1.00000000 0.00000000  0.00000  0.00000000  0.00000000  -1.00000000 0.00000 
1.00000000  0.00000000  0.00000000  0.00000  
57 'point symmetry operation'   ? ? -0.80901699 -0.50000000 -0.30901699 0.00000  0.50000000  -0.30901699 -0.80901699 0.00000 
0.30901699  -0.80901699 0.50000000  0.00000  
58 'point symmetry operation'   ? ? -0.50000000 0.30901699  -0.80901699 0.00000  0.30901699  -0.80901699 -0.50000000 0.00000 
-0.80901699 -0.50000000 0.30901699  0.00000  
59 'point symmetry operation'   ? ? 0.50000000  0.30901699  -0.80901699 0.00000  -0.30901699 -0.80901699 -0.50000000 0.00000 
-0.80901699 0.50000000  -0.30901699 0.00000  
60 'point symmetry operation'   ? ? 0.80901699  -0.50000000 -0.30901699 0.00000  -0.50000000 -0.30901699 -0.80901699 0.00000 
0.30901699  0.80901699  -0.50000000 0.00000  
# 
_pdbx_point_symmetry.entry_id             1F15 
_pdbx_point_symmetry.Schoenflies_symbol   I 
_pdbx_point_symmetry.H-M_notation         532 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-06-21 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
RAVE      'model building' .   ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
RAVE      phasing          .   ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CA 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ALA 
_pdbx_validate_rmsd_bond.auth_seq_id_1             162 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ALA 
_pdbx_validate_rmsd_bond.auth_seq_id_2             162 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.687 
_pdbx_validate_rmsd_bond.bond_target_value         1.520 
_pdbx_validate_rmsd_bond.bond_deviation            0.167 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.021 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 126 ? ? CZ A ARG 126 ? ? NH2 A ARG 126 ? ? 117.18 120.30 -3.12  0.50 N 
2  1 N  A ALA 130 ? ? CA A ALA 130 ? ? C   A ALA 130 ? ? 94.00  111.00 -17.00 2.70 N 
3  1 N  A TYR 155 ? ? CA A TYR 155 ? ? C   A TYR 155 ? ? 127.45 111.00 16.45  2.70 N 
4  1 CA A LEU 167 ? ? CB A LEU 167 ? ? CG  A LEU 167 ? ? 129.65 115.30 14.35  2.30 N 
5  1 C  A LEU 167 ? ? N  A TYR 168 ? ? CA  A TYR 168 ? ? 139.29 121.70 17.59  2.50 Y 
6  1 C  B HIS 55  ? ? N  B PRO 56  ? ? CA  B PRO 56  ? ? 130.72 119.30 11.42  1.50 Y 
7  1 C  B LEU 92  ? ? N  B PRO 93  ? ? CA  B PRO 93  ? ? 129.82 119.30 10.52  1.50 Y 
8  1 N  B ALA 193 ? ? CA B ALA 193 ? ? C   B ALA 193 ? ? 93.52  111.00 -17.48 2.70 N 
9  1 N  B GLU 198 ? ? CA B GLU 198 ? ? C   B GLU 198 ? ? 84.78  111.00 -26.22 2.70 N 
10 1 C  C HIS 55  ? ? N  C PRO 56  ? ? CA  C PRO 56  ? ? 135.12 119.30 15.82  1.50 Y 
11 1 C  C HIS 55  ? ? N  C PRO 56  ? ? CD  C PRO 56  ? ? 112.48 128.40 -15.92 2.10 Y 
12 1 C  C VAL 128 ? ? N  C PRO 129 ? ? CA  C PRO 129 ? ? 130.53 119.30 11.23  1.50 Y 
13 1 C  C SER 148 ? ? N  C PRO 149 ? ? CA  C PRO 149 ? ? 129.24 119.30 9.94   1.50 Y 
14 1 CA C LEU 166 ? ? CB C LEU 166 ? ? CG  C LEU 166 ? ? 132.05 115.30 16.75  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 65  ? ? -42.42  152.64  
2  1 LYS A 88  ? ? 173.20  130.65  
3  1 TYR A 99  ? ? -96.39  42.42   
4  1 ASP A 100 ? ? -33.97  -27.54  
5  1 SER A 105 ? ? -117.63 -108.12 
6  1 LYS A 116 ? ? 97.57   0.02    
7  1 ASP A 118 ? ? -161.27 66.22   
8  1 ALA A 130 ? ? 116.58  38.75   
9  1 SER A 131 ? ? 32.66   80.10   
10 1 SER A 132 ? ? 70.14   69.38   
11 1 LEU A 134 ? ? 48.09   174.00  
12 1 VAL A 136 ? ? -105.31 -153.39 
13 1 ALA A 137 ? ? -78.01  48.35   
14 1 ILE A 139 ? ? -58.54  -9.76   
15 1 GLN A 154 ? ? -143.10 -13.20  
16 1 TYR A 155 ? ? -106.03 -60.89  
17 1 ALA A 156 ? ? 79.18   -14.05  
18 1 ALA A 162 ? ? -50.13  9.75    
19 1 ASN A 164 ? ? -159.10 26.55   
20 1 LEU A 166 ? ? -171.13 -163.77 
21 1 TYR A 168 ? ? 161.67  149.59  
22 1 ASP A 169 ? ? -151.11 79.31   
23 1 LEU A 170 ? ? -66.09  0.14    
24 1 ARG A 174 ? ? 21.04   83.52   
25 1 ASP A 191 ? ? -134.76 -90.13  
26 1 ASP A 192 ? ? -23.74  -40.65  
27 1 ALA A 193 ? ? 78.52   89.52   
28 1 LEU A 194 ? ? -37.19  114.43  
29 1 ASN B 31  ? ? 69.61   -33.43  
30 1 HIS B 55  ? ? -153.58 64.65   
31 1 PRO B 56  ? ? -58.48  1.65    
32 1 SER B 61  ? ? -127.77 -153.11 
33 1 PRO B 78  ? ? -76.96  -167.41 
34 1 SER B 84  ? ? -109.71 -167.82 
35 1 LYS B 88  ? ? -174.05 128.91  
36 1 TYR B 99  ? ? -86.88  39.73   
37 1 ASP B 118 ? ? -168.07 60.77   
38 1 ALA B 130 ? ? -66.91  4.11    
39 1 ASP B 133 ? ? -33.44  63.98   
40 1 LEU B 134 ? ? 54.92   169.33  
41 1 VAL B 136 ? ? 84.70   -54.65  
42 1 ALA B 137 ? ? -57.81  -76.33  
43 1 ARG B 174 ? ? 39.51   64.81   
44 1 ILE B 177 ? ? -39.17  -31.90  
45 1 ASP B 192 ? ? -90.00  -96.61  
46 1 ALA B 193 ? ? 145.12  85.30   
47 1 LEU B 194 ? ? -42.11  98.42   
48 1 ASP B 197 ? ? 83.46   83.34   
49 1 GLU B 198 ? ? 172.78  111.62  
50 1 LEU B 199 ? ? 86.93   136.03  
51 1 ASP C 29  ? ? -166.14 46.63   
52 1 ALA C 30  ? ? 29.17   -63.08  
53 1 ARG C 33  ? ? -46.54  -18.40  
54 1 ALA C 48  ? ? 51.46   -135.87 
55 1 PRO C 56  ? ? -2.99   -31.56  
56 1 PRO C 66  ? ? -49.61  154.12  
57 1 TYR C 85  ? ? -109.65 -162.09 
58 1 LYS C 88  ? ? -171.40 127.65  
59 1 PRO C 115 ? ? -28.32  -59.27  
60 1 LYS C 116 ? ? -69.44  5.74    
61 1 ASP C 118 ? ? -153.48 -2.49   
62 1 PRO C 129 ? ? -55.21  99.75   
63 1 ALA C 130 ? ? -25.99  107.50  
64 1 SER C 131 ? ? 50.70   -9.80   
65 1 VAL C 136 ? ? -135.34 -135.67 
66 1 SER C 171 ? ? -29.30  -61.42  
67 1 ARG C 174 ? ? 49.32   99.55   
68 1 ASP C 197 ? ? -114.64 51.38   
69 1 GLN C 208 ? ? -43.48  151.61  
70 1 SER C 213 ? ? 58.88   117.57  
71 1 PRO C 217 ? ? -58.47  173.52  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1  ? A MET 1  
2   1 Y 1 A ASP 2  ? A ASP 2  
3   1 Y 1 A LYS 3  ? A LYS 3  
4   1 Y 1 A SER 4  ? A SER 4  
5   1 Y 1 A GLU 5  ? A GLU 5  
6   1 Y 1 A SER 6  ? A SER 6  
7   1 Y 1 A THR 7  ? A THR 7  
8   1 Y 1 A SER 8  ? A SER 8  
9   1 Y 1 A ALA 9  ? A ALA 9  
10  1 Y 1 A GLY 10 ? A GLY 10 
11  1 Y 1 A ARG 11 ? A ARG 11 
12  1 Y 1 A ASN 12 ? A ASN 12 
13  1 Y 1 A ARG 13 ? A ARG 13 
14  1 Y 1 A ARG 14 ? A ARG 14 
15  1 Y 1 A ARG 15 ? A ARG 15 
16  1 Y 1 A ARG 16 ? A ARG 16 
17  1 Y 1 A PRO 17 ? A PRO 17 
18  1 Y 1 A ARG 18 ? A ARG 18 
19  1 Y 1 A ARG 19 ? A ARG 19 
20  1 Y 1 A GLY 20 ? A GLY 20 
21  1 Y 1 A SER 21 ? A SER 21 
22  1 Y 1 A ARG 22 ? A ARG 22 
23  1 Y 1 A SER 23 ? A SER 23 
24  1 Y 1 A ALA 24 ? A ALA 24 
25  1 Y 1 A PRO 25 ? A PRO 25 
26  1 Y 1 A SER 26 ? A SER 26 
27  1 Y 1 A SER 27 ? A SER 27 
28  1 Y 1 A ALA 28 ? A ALA 28 
29  1 Y 1 A ASP 29 ? A ASP 29 
30  1 Y 1 A ALA 30 ? A ALA 30 
31  1 Y 1 A ASN 31 ? A ASN 31 
32  1 Y 1 A PHE 32 ? A PHE 32 
33  1 Y 1 A ARG 33 ? A ARG 33 
34  1 Y 1 A VAL 34 ? A VAL 34 
35  1 Y 1 A LEU 35 ? A LEU 35 
36  1 Y 1 A SER 36 ? A SER 36 
37  1 Y 1 A GLN 37 ? A GLN 37 
38  1 Y 1 A GLN 38 ? A GLN 38 
39  1 Y 1 A LEU 39 ? A LEU 39 
40  1 Y 1 A SER 40 ? A SER 40 
41  1 Y 1 A ARG 41 ? A ARG 41 
42  1 Y 1 A LEU 42 ? A LEU 42 
43  1 Y 1 A ASN 43 ? A ASN 43 
44  1 Y 1 A LYS 44 ? A LYS 44 
45  1 Y 1 A THR 45 ? A THR 45 
46  1 Y 1 A LEU 46 ? A LEU 46 
47  1 Y 1 A ALA 47 ? A ALA 47 
48  1 Y 1 A ALA 48 ? A ALA 48 
49  1 Y 1 A GLY 49 ? A GLY 49 
50  1 Y 1 A ARG 50 ? A ARG 50 
51  1 Y 1 A PRO 51 ? A PRO 51 
52  1 Y 1 A THR 52 ? A THR 52 
53  1 Y 1 A ILE 53 ? A ILE 53 
54  1 Y 1 A ASN 54 ? A ASN 54 
55  1 Y 1 A HIS 55 ? A HIS 55 
56  1 Y 1 A PRO 56 ? A PRO 56 
57  1 Y 1 A THR 57 ? A THR 57 
58  1 Y 1 A PHE 58 ? A PHE 58 
59  1 Y 1 A VAL 59 ? A VAL 59 
60  1 Y 1 A GLY 60 ? A GLY 60 
61  1 Y 1 A SER 61 ? A SER 61 
62  1 Y 1 B MET 1  ? B MET 1  
63  1 Y 1 B ASP 2  ? B ASP 2  
64  1 Y 1 B LYS 3  ? B LYS 3  
65  1 Y 1 B SER 4  ? B SER 4  
66  1 Y 1 B GLU 5  ? B GLU 5  
67  1 Y 1 B SER 6  ? B SER 6  
68  1 Y 1 B THR 7  ? B THR 7  
69  1 Y 1 B SER 8  ? B SER 8  
70  1 Y 1 B ALA 9  ? B ALA 9  
71  1 Y 1 B GLY 10 ? B GLY 10 
72  1 Y 1 B ARG 11 ? B ARG 11 
73  1 Y 1 B ASN 12 ? B ASN 12 
74  1 Y 1 B ARG 13 ? B ARG 13 
75  1 Y 1 B ARG 14 ? B ARG 14 
76  1 Y 1 B ARG 15 ? B ARG 15 
77  1 Y 1 B ARG 16 ? B ARG 16 
78  1 Y 1 B PRO 17 ? B PRO 17 
79  1 Y 1 B ARG 18 ? B ARG 18 
80  1 Y 1 B ARG 19 ? B ARG 19 
81  1 Y 1 B GLY 20 ? B GLY 20 
82  1 Y 1 B SER 21 ? B SER 21 
83  1 Y 1 B ARG 22 ? B ARG 22 
84  1 Y 1 B SER 23 ? B SER 23 
85  1 Y 1 B ALA 24 ? B ALA 24 
86  1 Y 1 B PRO 25 ? B PRO 25 
87  1 Y 1 B SER 26 ? B SER 26 
88  1 Y 1 B SER 27 ? B SER 27 
89  1 Y 1 B ALA 28 ? B ALA 28 
90  1 Y 1 C MET 1  ? C MET 1  
91  1 Y 1 C ASP 2  ? C ASP 2  
92  1 Y 1 C LYS 3  ? C LYS 3  
93  1 Y 1 C SER 4  ? C SER 4  
94  1 Y 1 C GLU 5  ? C GLU 5  
95  1 Y 1 C SER 6  ? C SER 6  
96  1 Y 1 C THR 7  ? C THR 7  
97  1 Y 1 C SER 8  ? C SER 8  
98  1 Y 1 C ALA 9  ? C ALA 9  
99  1 Y 1 C GLY 10 ? C GLY 10 
100 1 Y 1 C ARG 11 ? C ARG 11 
101 1 Y 1 C ASN 12 ? C ASN 12 
102 1 Y 1 C ARG 13 ? C ARG 13 
103 1 Y 1 C ARG 14 ? C ARG 14 
104 1 Y 1 C ARG 15 ? C ARG 15 
105 1 Y 1 C ARG 16 ? C ARG 16 
106 1 Y 1 C PRO 17 ? C PRO 17 
107 1 Y 1 C ARG 18 ? C ARG 18 
108 1 Y 1 C ARG 19 ? C ARG 19 
109 1 Y 1 C GLY 20 ? C GLY 20 
110 1 Y 1 C SER 21 ? C SER 21 
111 1 Y 1 C ARG 22 ? C ARG 22 
112 1 Y 1 C SER 23 ? C SER 23 
113 1 Y 1 C ALA 24 ? C ALA 24 
114 1 Y 1 C PRO 25 ? C PRO 25 
115 1 Y 1 C SER 26 ? C SER 26 
116 1 Y 1 C SER 27 ? C SER 27 
#