data_1F16
# 
_entry.id   1F16 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1F16         
RCSB  RCSB011117   
WWPDB D_1000011117 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F16 
_pdbx_database_status.recvd_initial_deposition_date   2000-05-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Suzuki, M.'  1 
'Youle, R.J.' 2 
'Tjandra, N.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structure of Bax: coregulation of dimer formation and intracellular localization.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            103 
_citation.page_first                645 
_citation.page_last                 654 
_citation.year                      2000 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11106734 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(00)00167-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Suzuki, M.'  1 
primary 'Youle, R.J.' 2 
primary 'Tjandra, N.' 3 
# 
_cell.entry_id           1F16 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1F16 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PROTEIN (APOPTOSIS REGULATOR BAX, MEMBRANE ISOFORM ALPHA)' 
_entity.formula_weight             21204.355 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   GLY n 
1 4   SER n 
1 5   GLY n 
1 6   GLU n 
1 7   GLN n 
1 8   PRO n 
1 9   ARG n 
1 10  GLY n 
1 11  GLY n 
1 12  GLY n 
1 13  PRO n 
1 14  THR n 
1 15  SER n 
1 16  SER n 
1 17  GLU n 
1 18  GLN n 
1 19  ILE n 
1 20  MET n 
1 21  LYS n 
1 22  THR n 
1 23  GLY n 
1 24  ALA n 
1 25  LEU n 
1 26  LEU n 
1 27  LEU n 
1 28  GLN n 
1 29  GLY n 
1 30  PHE n 
1 31  ILE n 
1 32  GLN n 
1 33  ASP n 
1 34  ARG n 
1 35  ALA n 
1 36  GLY n 
1 37  ARG n 
1 38  MET n 
1 39  GLY n 
1 40  GLY n 
1 41  GLU n 
1 42  ALA n 
1 43  PRO n 
1 44  GLU n 
1 45  LEU n 
1 46  ALA n 
1 47  LEU n 
1 48  ASP n 
1 49  PRO n 
1 50  VAL n 
1 51  PRO n 
1 52  GLN n 
1 53  ASP n 
1 54  ALA n 
1 55  SER n 
1 56  THR n 
1 57  LYS n 
1 58  LYS n 
1 59  LEU n 
1 60  SER n 
1 61  GLU n 
1 62  CYS n 
1 63  LEU n 
1 64  LYS n 
1 65  ARG n 
1 66  ILE n 
1 67  GLY n 
1 68  ASP n 
1 69  GLU n 
1 70  LEU n 
1 71  ASP n 
1 72  SER n 
1 73  ASN n 
1 74  MET n 
1 75  GLU n 
1 76  LEU n 
1 77  GLN n 
1 78  ARG n 
1 79  MET n 
1 80  ILE n 
1 81  ALA n 
1 82  ALA n 
1 83  VAL n 
1 84  ASP n 
1 85  THR n 
1 86  ASP n 
1 87  SER n 
1 88  PRO n 
1 89  ARG n 
1 90  GLU n 
1 91  VAL n 
1 92  PHE n 
1 93  PHE n 
1 94  ARG n 
1 95  VAL n 
1 96  ALA n 
1 97  ALA n 
1 98  ASP n 
1 99  MET n 
1 100 PHE n 
1 101 SER n 
1 102 ASP n 
1 103 GLY n 
1 104 ASN n 
1 105 PHE n 
1 106 ASN n 
1 107 TRP n 
1 108 GLY n 
1 109 ARG n 
1 110 VAL n 
1 111 VAL n 
1 112 ALA n 
1 113 LEU n 
1 114 PHE n 
1 115 TYR n 
1 116 PHE n 
1 117 ALA n 
1 118 SER n 
1 119 LYS n 
1 120 LEU n 
1 121 VAL n 
1 122 LEU n 
1 123 LYS n 
1 124 ALA n 
1 125 LEU n 
1 126 CYS n 
1 127 THR n 
1 128 LYS n 
1 129 VAL n 
1 130 PRO n 
1 131 GLU n 
1 132 LEU n 
1 133 ILE n 
1 134 ARG n 
1 135 THR n 
1 136 ILE n 
1 137 MET n 
1 138 GLY n 
1 139 TRP n 
1 140 THR n 
1 141 LEU n 
1 142 ASP n 
1 143 PHE n 
1 144 LEU n 
1 145 ARG n 
1 146 GLU n 
1 147 ARG n 
1 148 LEU n 
1 149 LEU n 
1 150 GLY n 
1 151 TRP n 
1 152 ILE n 
1 153 GLN n 
1 154 ASP n 
1 155 GLN n 
1 156 GLY n 
1 157 GLY n 
1 158 TRP n 
1 159 ASP n 
1 160 GLY n 
1 161 LEU n 
1 162 LEU n 
1 163 SER n 
1 164 TYR n 
1 165 PHE n 
1 166 GLY n 
1 167 THR n 
1 168 PRO n 
1 169 THR n 
1 170 TRP n 
1 171 GLN n 
1 172 THR n 
1 173 VAL n 
1 174 THR n 
1 175 ILE n 
1 176 PHE n 
1 177 VAL n 
1 178 ALA n 
1 179 GLY n 
1 180 VAL n 
1 181 LEU n 
1 182 THR n 
1 183 ALA n 
1 184 SER n 
1 185 LEU n 
1 186 THR n 
1 187 ILE n 
1 188 TRP n 
1 189 LYS n 
1 190 LYS n 
1 191 MET n 
1 192 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BAXA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q07812 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1F16 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 192 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q07812 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  192 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       192 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '4D_13C/15N-SEPARATED_ NOESY' 1 
2 1 '4D_13C-SEPARATED_ NOESY'     1 
3 1 '3D_15N-SEPARATED_ NOESY'     1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         305.00 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  6.00 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '10 mM' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1MM BAX U-15N,13C; 10mM TRIS-ACETATE PH 6.0 2MM DTT' 
_pdbx_nmr_sample_details.solvent_system   ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DRX Bruker 600 ? 
2 DRX Bruker 800 ? 
# 
_pdbx_nmr_refine.entry_id           1F16 
_pdbx_nmr_refine.method             'DISTANCE GEOMETRY SIMULATED ANNEALING MOLECULAR DYNAMICS' 
_pdbx_nmr_refine.details            
'THE STRUCTURE WAS BASED ON 2426 NOE RESTRAINTS, 123 DIHEDRAL, 178 HYDROGEN BONDS, 575 DIPOLAR COUPLING RESTRAINTS.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1F16 
_pdbx_nmr_details.text       
;STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY. EXPERIMENTAL DIPOLAR COUPLING RESTRAINTS WERE USED IN STRUCTURE DETERMINATION.
;
# 
_pdbx_nmr_ensemble.entry_id                                      1F16 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1F16 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR            3.840          BRUNGER 1 
'structure solution' 'NMRPIPE 1.7 REV' 1999.039.11.31 ?       2 
'structure solution' PIPP              4.1.5          ?       3 
'structure solution' UXNMR             2.5            ?       4 
# 
_exptl.entry_id          1F16 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1F16 
_struct.title                     'SOLUTION STRUCTURE OF A PRO-APOPTOTIC PROTEIN BAX' 
_struct.pdbx_descriptor           'SOLUTION STRUCTURE OF A PRO-APOPTOTIC PROTEIN BAX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F16 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'HELICAL PROTEIN, APOPTOSIS' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 15  ? GLY A 36  ? SER A 15  GLY A 36  1 ? 22 
HELX_P HELX_P2 2 ASP A 53  ? SER A 72  ? ASP A 53  SER A 72  1 ? 20 
HELX_P HELX_P3 3 ASN A 73  ? ALA A 81  ? ASN A 73  ALA A 81  1 ? 9  
HELX_P HELX_P4 4 SER A 87  ? PHE A 100 ? SER A 87  PHE A 100 1 ? 14 
HELX_P HELX_P5 5 TRP A 107 ? LYS A 128 ? TRP A 107 LYS A 128 1 ? 22 
HELX_P HELX_P6 6 VAL A 129 ? ARG A 147 ? VAL A 129 ARG A 147 1 ? 19 
HELX_P HELX_P7 7 LEU A 149 ? GLN A 155 ? LEU A 149 GLN A 155 1 ? 7  
HELX_P HELX_P8 8 TRP A 158 ? PHE A 165 ? TRP A 158 PHE A 165 1 ? 8  
HELX_P HELX_P9 9 TRP A 170 ? LYS A 189 ? TRP A 170 LYS A 189 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1F16 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1F16 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 36.251  3.235   17.113  1.00 17.15 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 36.498  3.800   15.756  1.00 16.73 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 37.058  2.708   14.842  1.00 16.39 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 38.255  2.568   14.687  1.00 16.40 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 37.505  4.948   15.858  1.00 16.98 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 37.568  5.696   14.525  1.00 17.51 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 36.028  6.614   14.274  1.00 17.69 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 36.391  7.214   12.606  1.00 17.86 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 36.920  2.460   17.293  1.00 17.22 ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? 35.277  2.872   17.165  1.00 17.32 ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? 36.383  3.978   17.828  1.00 17.33 ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? 35.570  4.171   15.346  1.00 16.65 ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? 37.198  5.628   16.639  1.00 17.06 ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? 38.482  4.550   16.091  1.00 16.85 ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? 38.400  6.384   14.537  1.00 17.63 ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? 37.699  4.987   13.720  1.00 17.81 ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? 35.620  7.907   12.298  1.00 17.66 ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? 36.419  6.382   11.921  1.00 18.24 ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? 37.351  7.712   12.604  1.00 17.93 ? 1   MET A HE3  1  
ATOM 20    N N    . ASP A 1 2   ? 36.201  1.932   14.236  1.00 16.24 ? 2   ASP A N    1  
ATOM 21    C CA   . ASP A 1 2   ? 36.685  0.850   13.333  1.00 16.07 ? 2   ASP A CA   1  
ATOM 22    C C    . ASP A 1 2   ? 35.502  0.265   12.559  1.00 15.50 ? 2   ASP A C    1  
ATOM 23    O O    . ASP A 1 2   ? 35.168  -0.895  12.700  1.00 15.56 ? 2   ASP A O    1  
ATOM 24    C CB   . ASP A 1 2   ? 37.345  -0.252  14.165  1.00 16.42 ? 2   ASP A CB   1  
ATOM 25    C CG   . ASP A 1 2   ? 36.363  -0.749  15.227  1.00 16.67 ? 2   ASP A CG   1  
ATOM 26    O OD1  . ASP A 1 2   ? 36.207  -0.068  16.227  1.00 16.77 ? 2   ASP A OD1  1  
ATOM 27    O OD2  . ASP A 1 2   ? 35.783  -1.803  15.022  1.00 16.88 ? 2   ASP A OD2  1  
ATOM 28    H H    . ASP A 1 2   ? 35.240  2.061   14.375  1.00 16.34 ? 2   ASP A H    1  
ATOM 29    H HA   . ASP A 1 2   ? 37.405  1.256   12.638  1.00 16.28 ? 2   ASP A HA   1  
ATOM 30    H HB2  . ASP A 1 2   ? 37.624  -1.072  13.519  1.00 16.55 ? 2   ASP A HB2  1  
ATOM 31    H HB3  . ASP A 1 2   ? 38.227  0.141   14.649  1.00 16.53 ? 2   ASP A HB3  1  
ATOM 32    N N    . GLY A 1 3   ? 34.865  1.059   11.742  1.00 15.11 ? 3   GLY A N    1  
ATOM 33    C CA   . GLY A 1 3   ? 33.704  0.548   10.960  1.00 14.72 ? 3   GLY A CA   1  
ATOM 34    C C    . GLY A 1 3   ? 34.177  -0.542  9.996   1.00 14.60 ? 3   GLY A C    1  
ATOM 35    O O    . GLY A 1 3   ? 34.972  -0.299  9.110   1.00 14.88 ? 3   GLY A O    1  
ATOM 36    H H    . GLY A 1 3   ? 35.150  1.991   11.643  1.00 15.19 ? 3   GLY A H    1  
ATOM 37    H HA2  . GLY A 1 3   ? 32.968  0.138   11.636  1.00 14.73 ? 3   GLY A HA2  1  
ATOM 38    H HA3  . GLY A 1 3   ? 33.266  1.356   10.395  1.00 14.69 ? 3   GLY A HA3  1  
ATOM 39    N N    . SER A 1 4   ? 33.695  -1.743  10.162  1.00 14.34 ? 4   SER A N    1  
ATOM 40    C CA   . SER A 1 4   ? 34.117  -2.848  9.256   1.00 14.41 ? 4   SER A CA   1  
ATOM 41    C C    . SER A 1 4   ? 33.707  -2.516  7.820   1.00 13.79 ? 4   SER A C    1  
ATOM 42    O O    . SER A 1 4   ? 34.456  -2.725  6.886   1.00 14.02 ? 4   SER A O    1  
ATOM 43    C CB   . SER A 1 4   ? 33.443  -4.150  9.690   1.00 14.82 ? 4   SER A CB   1  
ATOM 44    O OG   . SER A 1 4   ? 33.791  -5.185  8.780   1.00 14.88 ? 4   SER A OG   1  
ATOM 45    H H    . SER A 1 4   ? 33.055  -1.919  10.883  1.00 14.23 ? 4   SER A H    1  
ATOM 46    H HA   . SER A 1 4   ? 35.190  -2.964  9.306   1.00 14.79 ? 4   SER A HA   1  
ATOM 47    H HB2  . SER A 1 4   ? 33.777  -4.419  10.678  1.00 15.17 ? 4   SER A HB2  1  
ATOM 48    H HB3  . SER A 1 4   ? 32.369  -4.011  9.701   1.00 14.87 ? 4   SER A HB3  1  
ATOM 49    H HG   . SER A 1 4   ? 34.670  -5.497  9.007   1.00 14.91 ? 4   SER A HG   1  
ATOM 50    N N    . GLY A 1 5   ? 32.522  -2.002  7.635   1.00 13.15 ? 5   GLY A N    1  
ATOM 51    C CA   . GLY A 1 5   ? 32.064  -1.658  6.259   1.00 12.67 ? 5   GLY A CA   1  
ATOM 52    C C    . GLY A 1 5   ? 32.800  -0.409  5.769   1.00 12.31 ? 5   GLY A C    1  
ATOM 53    O O    . GLY A 1 5   ? 33.987  -0.256  5.973   1.00 12.37 ? 5   GLY A O    1  
ATOM 54    H H    . GLY A 1 5   ? 31.932  -1.842  8.401   1.00 13.09 ? 5   GLY A H    1  
ATOM 55    H HA2  . GLY A 1 5   ? 32.274  -2.485  5.594   1.00 12.77 ? 5   GLY A HA2  1  
ATOM 56    H HA3  . GLY A 1 5   ? 31.003  -1.465  6.270   1.00 12.67 ? 5   GLY A HA3  1  
ATOM 57    N N    . GLU A 1 6   ? 32.102  0.484   5.122   1.00 12.14 ? 6   GLU A N    1  
ATOM 58    C CA   . GLU A 1 6   ? 32.757  1.723   4.617   1.00 12.01 ? 6   GLU A CA   1  
ATOM 59    C C    . GLU A 1 6   ? 31.683  2.722   4.181   1.00 11.53 ? 6   GLU A C    1  
ATOM 60    O O    . GLU A 1 6   ? 31.456  3.727   4.825   1.00 11.57 ? 6   GLU A O    1  
ATOM 61    C CB   . GLU A 1 6   ? 33.648  1.375   3.422   1.00 12.39 ? 6   GLU A CB   1  
ATOM 62    C CG   . GLU A 1 6   ? 34.461  2.605   3.013   1.00 12.94 ? 6   GLU A CG   1  
ATOM 63    C CD   . GLU A 1 6   ? 35.405  2.235   1.868   1.00 13.31 ? 6   GLU A CD   1  
ATOM 64    O OE1  . GLU A 1 6   ? 34.987  2.332   0.726   1.00 13.50 ? 6   GLU A OE1  1  
ATOM 65    O OE2  . GLU A 1 6   ? 36.531  1.860   2.152   1.00 13.55 ? 6   GLU A OE2  1  
ATOM 66    H H    . GLU A 1 6   ? 31.145  0.339   4.968   1.00 12.23 ? 6   GLU A H    1  
ATOM 67    H HA   . GLU A 1 6   ? 33.359  2.159   5.401   1.00 12.19 ? 6   GLU A HA   1  
ATOM 68    H HB2  . GLU A 1 6   ? 34.319  0.574   3.695   1.00 12.50 ? 6   GLU A HB2  1  
ATOM 69    H HB3  . GLU A 1 6   ? 33.031  1.062   2.592   1.00 12.34 ? 6   GLU A HB3  1  
ATOM 70    H HG2  . GLU A 1 6   ? 33.791  3.388   2.690   1.00 13.05 ? 6   GLU A HG2  1  
ATOM 71    H HG3  . GLU A 1 6   ? 35.040  2.951   3.856   1.00 13.14 ? 6   GLU A HG3  1  
ATOM 72    N N    . GLN A 1 7   ? 31.015  2.449   3.091   1.00 11.25 ? 7   GLN A N    1  
ATOM 73    C CA   . GLN A 1 7   ? 29.946  3.372   2.602   1.00 10.97 ? 7   GLN A CA   1  
ATOM 74    C C    . GLN A 1 7   ? 28.826  2.535   1.954   1.00 10.29 ? 7   GLN A C    1  
ATOM 75    O O    . GLN A 1 7   ? 28.653  2.573   0.752   1.00 10.41 ? 7   GLN A O    1  
ATOM 76    C CB   . GLN A 1 7   ? 30.552  4.345   1.566   1.00 11.52 ? 7   GLN A CB   1  
ATOM 77    C CG   . GLN A 1 7   ? 31.008  5.635   2.259   1.00 12.08 ? 7   GLN A CG   1  
ATOM 78    C CD   . GLN A 1 7   ? 29.779  6.458   2.653   1.00 12.56 ? 7   GLN A CD   1  
ATOM 79    O OE1  . GLN A 1 7   ? 29.904  7.551   3.168   1.00 12.91 ? 7   GLN A OE1  1  
ATOM 80    N NE2  . GLN A 1 7   ? 28.587  5.974   2.430   1.00 12.77 ? 7   GLN A NE2  1  
ATOM 81    H H    . GLN A 1 7   ? 31.215  1.629   2.592   1.00 11.36 ? 7   GLN A H    1  
ATOM 82    H HA   . GLN A 1 7   ? 29.537  3.931   3.432   1.00 11.07 ? 7   GLN A HA   1  
ATOM 83    H HB2  . GLN A 1 7   ? 31.402  3.877   1.092   1.00 11.67 ? 7   GLN A HB2  1  
ATOM 84    H HB3  . GLN A 1 7   ? 29.816  4.593   0.814   1.00 11.58 ? 7   GLN A HB3  1  
ATOM 85    H HG2  . GLN A 1 7   ? 31.577  5.387   3.144   1.00 12.23 ? 7   GLN A HG2  1  
ATOM 86    H HG3  . GLN A 1 7   ? 31.623  6.210   1.584   1.00 12.20 ? 7   GLN A HG3  1  
ATOM 87    H HE21 . GLN A 1 7   ? 28.486  5.092   2.014   1.00 12.61 ? 7   GLN A HE21 1  
ATOM 88    H HE22 . GLN A 1 7   ? 27.793  6.493   2.678   1.00 13.18 ? 7   GLN A HE22 1  
ATOM 89    N N    . PRO A 1 8   ? 28.097  1.796   2.764   1.00 9.81  ? 8   PRO A N    1  
ATOM 90    C CA   . PRO A 1 8   ? 27.000  0.951   2.256   1.00 9.37  ? 8   PRO A CA   1  
ATOM 91    C C    . PRO A 1 8   ? 25.913  1.834   1.628   1.00 9.09  ? 8   PRO A C    1  
ATOM 92    O O    . PRO A 1 8   ? 24.909  1.350   1.144   1.00 9.07  ? 8   PRO A O    1  
ATOM 93    C CB   . PRO A 1 8   ? 26.469  0.195   3.498   1.00 9.20  ? 8   PRO A CB   1  
ATOM 94    C CG   . PRO A 1 8   ? 27.297  0.674   4.728   1.00 9.57  ? 8   PRO A CG   1  
ATOM 95    C CD   . PRO A 1 8   ? 28.302  1.737   4.229   1.00 9.93  ? 8   PRO A CD   1  
ATOM 96    H HA   . PRO A 1 8   ? 27.378  0.250   1.527   1.00 9.66  ? 8   PRO A HA   1  
ATOM 97    H HB2  . PRO A 1 8   ? 25.417  0.412   3.651   1.00 8.88  ? 8   PRO A HB2  1  
ATOM 98    H HB3  . PRO A 1 8   ? 26.601  -0.871  3.367   1.00 9.40  ? 8   PRO A HB3  1  
ATOM 99    H HG2  . PRO A 1 8   ? 26.636  1.106   5.471   1.00 9.46  ? 8   PRO A HG2  1  
ATOM 100   H HG3  . PRO A 1 8   ? 27.833  -0.159  5.162   1.00 9.94  ? 8   PRO A HG3  1  
ATOM 101   H HD2  . PRO A 1 8   ? 28.084  2.696   4.681   1.00 10.00 ? 8   PRO A HD2  1  
ATOM 102   H HD3  . PRO A 1 8   ? 29.316  1.439   4.450   1.00 10.41 ? 8   PRO A HD3  1  
ATOM 103   N N    . ARG A 1 9   ? 26.105  3.127   1.637   1.00 9.13  ? 9   ARG A N    1  
ATOM 104   C CA   . ARG A 1 9   ? 25.086  4.044   1.048   1.00 9.14  ? 9   ARG A CA   1  
ATOM 105   C C    . ARG A 1 9   ? 25.785  5.288   0.494   1.00 8.60  ? 9   ARG A C    1  
ATOM 106   O O    . ARG A 1 9   ? 25.593  6.385   0.980   1.00 8.68  ? 9   ARG A O    1  
ATOM 107   C CB   . ARG A 1 9   ? 24.086  4.457   2.133   1.00 10.09 ? 9   ARG A CB   1  
ATOM 108   C CG   . ARG A 1 9   ? 24.839  4.811   3.418   1.00 10.67 ? 9   ARG A CG   1  
ATOM 109   C CD   . ARG A 1 9   ? 23.845  5.282   4.482   1.00 11.51 ? 9   ARG A CD   1  
ATOM 110   N NE   . ARG A 1 9   ? 23.169  6.525   4.015   1.00 12.05 ? 9   ARG A NE   1  
ATOM 111   C CZ   . ARG A 1 9   ? 22.087  6.942   4.613   1.00 12.65 ? 9   ARG A CZ   1  
ATOM 112   N NH1  . ARG A 1 9   ? 21.600  6.273   5.623   1.00 12.79 ? 9   ARG A NH1  1  
ATOM 113   N NH2  . ARG A 1 9   ? 21.492  8.029   4.204   1.00 13.27 ? 9   ARG A NH2  1  
ATOM 114   H H    . ARG A 1 9   ? 26.920  3.497   2.036   1.00 9.33  ? 9   ARG A H    1  
ATOM 115   H HA   . ARG A 1 9   ? 24.561  3.543   0.247   1.00 9.10  ? 9   ARG A HA   1  
ATOM 116   H HB2  . ARG A 1 9   ? 23.523  5.315   1.797   1.00 10.28 ? 9   ARG A HB2  1  
ATOM 117   H HB3  . ARG A 1 9   ? 23.410  3.638   2.329   1.00 10.40 ? 9   ARG A HB3  1  
ATOM 118   H HG2  . ARG A 1 9   ? 25.365  3.938   3.779   1.00 10.72 ? 9   ARG A HG2  1  
ATOM 119   H HG3  . ARG A 1 9   ? 25.547  5.600   3.216   1.00 10.65 ? 9   ARG A HG3  1  
ATOM 120   H HD2  . ARG A 1 9   ? 23.106  4.512   4.650   1.00 11.82 ? 9   ARG A HD2  1  
ATOM 121   H HD3  . ARG A 1 9   ? 24.372  5.482   5.404   1.00 11.59 ? 9   ARG A HD3  1  
ATOM 122   H HE   . ARG A 1 9   ? 23.536  7.028   3.259   1.00 12.08 ? 9   ARG A HE   1  
ATOM 123   H HH11 . ARG A 1 9   ? 22.056  5.441   5.937   1.00 12.44 ? 9   ARG A HH11 1  
ATOM 124   H HH12 . ARG A 1 9   ? 20.771  6.593   6.081   1.00 13.36 ? 9   ARG A HH12 1  
ATOM 125   H HH21 . ARG A 1 9   ? 21.866  8.543   3.431   1.00 13.29 ? 9   ARG A HH21 1  
ATOM 126   H HH22 . ARG A 1 9   ? 20.663  8.349   4.662   1.00 13.82 ? 9   ARG A HH22 1  
ATOM 127   N N    . GLY A 1 10  ? 26.597  5.119   -0.522  1.00 8.29  ? 10  GLY A N    1  
ATOM 128   C CA   . GLY A 1 10  ? 27.326  6.279   -1.131  1.00 8.00  ? 10  GLY A CA   1  
ATOM 129   C C    . GLY A 1 10  ? 26.872  6.462   -2.580  1.00 7.45  ? 10  GLY A C    1  
ATOM 130   O O    . GLY A 1 10  ? 26.525  7.549   -2.998  1.00 7.68  ? 10  GLY A O    1  
ATOM 131   H H    . GLY A 1 10  ? 26.729  4.220   -0.890  1.00 8.43  ? 10  GLY A H    1  
ATOM 132   H HA2  . GLY A 1 10  ? 27.123  7.184   -0.573  1.00 8.37  ? 10  GLY A HA2  1  
ATOM 133   H HA3  . GLY A 1 10  ? 28.387  6.081   -1.116  1.00 8.08  ? 10  GLY A HA3  1  
ATOM 134   N N    . GLY A 1 11  ? 26.873  5.409   -3.352  1.00 7.01  ? 11  GLY A N    1  
ATOM 135   C CA   . GLY A 1 11  ? 26.442  5.531   -4.774  1.00 6.74  ? 11  GLY A CA   1  
ATOM 136   C C    . GLY A 1 11  ? 26.370  4.144   -5.416  1.00 5.83  ? 11  GLY A C    1  
ATOM 137   O O    . GLY A 1 11  ? 27.364  3.457   -5.548  1.00 6.06  ? 11  GLY A O    1  
ATOM 138   H H    . GLY A 1 11  ? 27.158  4.541   -2.998  1.00 7.06  ? 11  GLY A H    1  
ATOM 139   H HA2  . GLY A 1 11  ? 25.468  5.998   -4.814  1.00 7.27  ? 11  GLY A HA2  1  
ATOM 140   H HA3  . GLY A 1 11  ? 27.154  6.137   -5.314  1.00 6.94  ? 11  GLY A HA3  1  
ATOM 141   N N    . GLY A 1 12  ? 25.200  3.730   -5.823  1.00 5.12  ? 12  GLY A N    1  
ATOM 142   C CA   . GLY A 1 12  ? 25.059  2.391   -6.465  1.00 4.52  ? 12  GLY A CA   1  
ATOM 143   C C    . GLY A 1 12  ? 23.610  1.904   -6.311  1.00 3.52  ? 12  GLY A C    1  
ATOM 144   O O    . GLY A 1 12  ? 22.829  2.528   -5.621  1.00 3.54  ? 12  GLY A O    1  
ATOM 145   H H    . GLY A 1 12  ? 24.413  4.303   -5.711  1.00 5.25  ? 12  GLY A H    1  
ATOM 146   H HA2  . GLY A 1 12  ? 25.307  2.476   -7.512  1.00 4.85  ? 12  GLY A HA2  1  
ATOM 147   H HA3  . GLY A 1 12  ? 25.725  1.687   -5.990  1.00 4.89  ? 12  GLY A HA3  1  
ATOM 148   N N    . PRO A 1 13  ? 23.284  0.800   -6.952  1.00 3.15  ? 13  PRO A N    1  
ATOM 149   C CA   . PRO A 1 13  ? 21.922  0.236   -6.874  1.00 2.77  ? 13  PRO A CA   1  
ATOM 150   C C    . PRO A 1 13  ? 21.567  -0.085  -5.415  1.00 2.05  ? 13  PRO A C    1  
ATOM 151   O O    . PRO A 1 13  ? 22.377  0.070   -4.527  1.00 2.37  ? 13  PRO A O    1  
ATOM 152   C CB   . PRO A 1 13  ? 21.972  -1.050  -7.738  1.00 3.47  ? 13  PRO A CB   1  
ATOM 153   C CG   . PRO A 1 13  ? 23.418  -1.180  -8.302  1.00 3.99  ? 13  PRO A CG   1  
ATOM 154   C CD   . PRO A 1 13  ? 24.228  0.035   -7.796  1.00 3.79  ? 13  PRO A CD   1  
ATOM 155   H HA   . PRO A 1 13  ? 21.207  0.933   -7.286  1.00 3.21  ? 13  PRO A HA   1  
ATOM 156   H HB2  . PRO A 1 13  ? 21.730  -1.919  -7.135  1.00 3.49  ? 13  PRO A HB2  1  
ATOM 157   H HB3  . PRO A 1 13  ? 21.268  -0.969  -8.556  1.00 4.08  ? 13  PRO A HB3  1  
ATOM 158   H HG2  . PRO A 1 13  ? 23.871  -2.100  -7.948  1.00 4.37  ? 13  PRO A HG2  1  
ATOM 159   H HG3  . PRO A 1 13  ? 23.395  -1.177  -9.384  1.00 4.57  ? 13  PRO A HG3  1  
ATOM 160   H HD2  . PRO A 1 13  ? 25.079  -0.290  -7.209  1.00 4.09  ? 13  PRO A HD2  1  
ATOM 161   H HD3  . PRO A 1 13  ? 24.555  0.640   -8.628  1.00 4.27  ? 13  PRO A HD3  1  
ATOM 162   N N    . THR A 1 14  ? 20.346  -0.491  -5.171  1.00 1.59  ? 14  THR A N    1  
ATOM 163   C CA   . THR A 1 14  ? 19.899  -0.794  -3.777  1.00 1.24  ? 14  THR A CA   1  
ATOM 164   C C    . THR A 1 14  ? 20.092  0.447   -2.904  1.00 1.07  ? 14  THR A C    1  
ATOM 165   O O    . THR A 1 14  ? 20.592  0.369   -1.799  1.00 1.20  ? 14  THR A O    1  
ATOM 166   C CB   . THR A 1 14  ? 20.689  -1.973  -3.188  1.00 1.43  ? 14  THR A CB   1  
ATOM 167   O OG1  . THR A 1 14  ? 22.053  -1.617  -3.027  1.00 2.16  ? 14  THR A OG1  1  
ATOM 168   C CG2  . THR A 1 14  ? 20.578  -3.185  -4.114  1.00 1.78  ? 14  THR A CG2  1  
ATOM 169   H H    . THR A 1 14  ? 19.703  -0.563  -5.908  1.00 1.96  ? 14  THR A H    1  
ATOM 170   H HA   . THR A 1 14  ? 18.849  -1.047  -3.795  1.00 1.69  ? 14  THR A HA   1  
ATOM 171   H HB   . THR A 1 14  ? 20.273  -2.220  -2.224  1.00 1.94  ? 14  THR A HB   1  
ATOM 172   H HG1  . THR A 1 14  ? 22.090  -0.814  -2.502  1.00 2.49  ? 14  THR A HG1  1  
ATOM 173   H HG21 . THR A 1 14  ? 21.061  -4.034  -3.655  1.00 2.04  ? 14  THR A HG21 1  
ATOM 174   H HG22 . THR A 1 14  ? 21.060  -2.962  -5.055  1.00 2.29  ? 14  THR A HG22 1  
ATOM 175   H HG23 . THR A 1 14  ? 19.537  -3.412  -4.288  1.00 2.23  ? 14  THR A HG23 1  
ATOM 176   N N    . SER A 1 15  ? 19.700  1.594   -3.405  1.00 1.07  ? 15  SER A N    1  
ATOM 177   C CA   . SER A 1 15  ? 19.852  2.866   -2.629  1.00 0.91  ? 15  SER A CA   1  
ATOM 178   C C    . SER A 1 15  ? 18.477  3.404   -2.220  1.00 0.75  ? 15  SER A C    1  
ATOM 179   O O    . SER A 1 15  ? 17.531  3.366   -2.981  1.00 0.78  ? 15  SER A O    1  
ATOM 180   C CB   . SER A 1 15  ? 20.557  3.907   -3.499  1.00 0.99  ? 15  SER A CB   1  
ATOM 181   O OG   . SER A 1 15  ? 19.649  4.394   -4.477  1.00 1.38  ? 15  SER A OG   1  
ATOM 182   H H    . SER A 1 15  ? 19.309  1.611   -4.304  1.00 1.34  ? 15  SER A H    1  
ATOM 183   H HA   . SER A 1 15  ? 20.444  2.689   -1.741  1.00 0.94  ? 15  SER A HA   1  
ATOM 184   H HB2  . SER A 1 15  ? 20.889  4.727   -2.884  1.00 1.46  ? 15  SER A HB2  1  
ATOM 185   H HB3  . SER A 1 15  ? 21.412  3.452   -3.980  1.00 1.34  ? 15  SER A HB3  1  
ATOM 186   H HG   . SER A 1 15  ? 18.958  4.883   -4.023  1.00 1.70  ? 15  SER A HG   1  
ATOM 187   N N    . SER A 1 16  ? 18.365  3.905   -1.021  1.00 0.72  ? 16  SER A N    1  
ATOM 188   C CA   . SER A 1 16  ? 17.058  4.453   -0.548  1.00 0.82  ? 16  SER A CA   1  
ATOM 189   C C    . SER A 1 16  ? 16.511  5.469   -1.562  1.00 0.81  ? 16  SER A C    1  
ATOM 190   O O    . SER A 1 16  ? 15.430  5.993   -1.395  1.00 0.92  ? 16  SER A O    1  
ATOM 191   C CB   . SER A 1 16  ? 17.256  5.143   0.802   1.00 1.06  ? 16  SER A CB   1  
ATOM 192   O OG   . SER A 1 16  ? 18.142  6.243   0.642   1.00 1.64  ? 16  SER A OG   1  
ATOM 193   H H    . SER A 1 16  ? 19.147  3.911   -0.430  1.00 0.74  ? 16  SER A H    1  
ATOM 194   H HA   . SER A 1 16  ? 16.351  3.645   -0.435  1.00 0.88  ? 16  SER A HA   1  
ATOM 195   H HB2  . SER A 1 16  ? 16.308  5.502   1.168   1.00 1.49  ? 16  SER A HB2  1  
ATOM 196   H HB3  . SER A 1 16  ? 17.668  4.436   1.510   1.00 1.64  ? 16  SER A HB3  1  
ATOM 197   H HG   . SER A 1 16  ? 18.647  6.102   -0.163  1.00 2.08  ? 16  SER A HG   1  
ATOM 198   N N    . GLU A 1 17  ? 17.230  5.739   -2.618  1.00 0.80  ? 17  GLU A N    1  
ATOM 199   C CA   . GLU A 1 17  ? 16.740  6.705   -3.643  1.00 0.94  ? 17  GLU A CA   1  
ATOM 200   C C    . GLU A 1 17  ? 15.873  5.976   -4.676  1.00 0.85  ? 17  GLU A C    1  
ATOM 201   O O    . GLU A 1 17  ? 14.765  6.382   -4.964  1.00 0.89  ? 17  GLU A O    1  
ATOM 202   C CB   . GLU A 1 17  ? 17.945  7.365   -4.330  1.00 1.13  ? 17  GLU A CB   1  
ATOM 203   C CG   . GLU A 1 17  ? 17.476  8.358   -5.421  1.00 1.71  ? 17  GLU A CG   1  
ATOM 204   C CD   . GLU A 1 17  ? 17.491  7.683   -6.798  1.00 2.26  ? 17  GLU A CD   1  
ATOM 205   O OE1  . GLU A 1 17  ? 17.248  6.489   -6.854  1.00 2.90  ? 17  GLU A OE1  1  
ATOM 206   O OE2  . GLU A 1 17  ? 17.747  8.373   -7.771  1.00 2.68  ? 17  GLU A OE2  1  
ATOM 207   H H    . GLU A 1 17  ? 18.087  5.294   -2.767  1.00 0.79  ? 17  GLU A H    1  
ATOM 208   H HA   . GLU A 1 17  ? 16.113  7.466   -3.204  1.00 1.09  ? 17  GLU A HA   1  
ATOM 209   H HB2  . GLU A 1 17  ? 18.523  7.895   -3.585  1.00 1.54  ? 17  GLU A HB2  1  
ATOM 210   H HB3  . GLU A 1 17  ? 18.563  6.598   -4.775  1.00 1.46  ? 17  GLU A HB3  1  
ATOM 211   H HG2  . GLU A 1 17  ? 16.473  8.700   -5.202  1.00 2.27  ? 17  GLU A HG2  1  
ATOM 212   H HG3  . GLU A 1 17  ? 18.142  9.210   -5.441  1.00 2.07  ? 17  GLU A HG3  1  
ATOM 213   N N    . GLN A 1 18  ? 16.359  4.899   -5.227  1.00 0.80  ? 18  GLN A N    1  
ATOM 214   C CA   . GLN A 1 18  ? 15.551  4.147   -6.231  1.00 0.83  ? 18  GLN A CA   1  
ATOM 215   C C    . GLN A 1 18  ? 14.295  3.577   -5.556  1.00 0.68  ? 18  GLN A C    1  
ATOM 216   O O    . GLN A 1 18  ? 13.225  3.549   -6.132  1.00 0.69  ? 18  GLN A O    1  
ATOM 217   C CB   . GLN A 1 18  ? 16.389  2.999   -6.812  1.00 0.96  ? 18  GLN A CB   1  
ATOM 218   C CG   . GLN A 1 18  ? 17.191  2.321   -5.705  1.00 1.53  ? 18  GLN A CG   1  
ATOM 219   C CD   . GLN A 1 18  ? 17.884  1.080   -6.271  1.00 2.23  ? 18  GLN A CD   1  
ATOM 220   O OE1  . GLN A 1 18  ? 18.730  1.186   -7.138  1.00 2.69  ? 18  GLN A OE1  1  
ATOM 221   N NE2  . GLN A 1 18  ? 17.560  -0.099  -5.818  1.00 3.07  ? 18  GLN A NE2  1  
ATOM 222   H H    . GLN A 1 18  ? 17.251  4.584   -4.979  1.00 0.80  ? 18  GLN A H    1  
ATOM 223   H HA   . GLN A 1 18  ? 15.274  4.805   -7.044  1.00 0.96  ? 18  GLN A HA   1  
ATOM 224   H HB2  . GLN A 1 18  ? 15.735  2.274   -7.277  1.00 1.31  ? 18  GLN A HB2  1  
ATOM 225   H HB3  . GLN A 1 18  ? 17.069  3.392   -7.553  1.00 1.16  ? 18  GLN A HB3  1  
ATOM 226   H HG2  . GLN A 1 18  ? 17.933  3.007   -5.327  1.00 1.79  ? 18  GLN A HG2  1  
ATOM 227   H HG3  . GLN A 1 18  ? 16.527  2.030   -4.909  1.00 2.17  ? 18  GLN A HG3  1  
ATOM 228   H HE21 . GLN A 1 18  ? 16.878  -0.186  -5.120  1.00 3.31  ? 18  GLN A HE21 1  
ATOM 229   H HE22 . GLN A 1 18  ? 18.000  -0.899  -6.176  1.00 3.76  ? 18  GLN A HE22 1  
ATOM 230   N N    . ILE A 1 19  ? 14.421  3.119   -4.334  1.00 0.59  ? 19  ILE A N    1  
ATOM 231   C CA   . ILE A 1 19  ? 13.242  2.548   -3.613  1.00 0.58  ? 19  ILE A CA   1  
ATOM 232   C C    . ILE A 1 19  ? 12.179  3.632   -3.423  1.00 0.52  ? 19  ILE A C    1  
ATOM 233   O O    . ILE A 1 19  ? 11.100  3.562   -3.976  1.00 0.59  ? 19  ILE A O    1  
ATOM 234   C CB   . ILE A 1 19  ? 13.690  2.002   -2.252  1.00 0.64  ? 19  ILE A CB   1  
ATOM 235   C CG1  . ILE A 1 19  ? 14.566  0.769   -2.480  1.00 0.74  ? 19  ILE A CG1  1  
ATOM 236   C CG2  . ILE A 1 19  ? 12.465  1.606   -1.423  1.00 0.73  ? 19  ILE A CG2  1  
ATOM 237   C CD1  . ILE A 1 19  ? 15.257  0.363   -1.178  1.00 0.81  ? 19  ILE A CD1  1  
ATOM 238   H H    . ILE A 1 19  ? 15.294  3.152   -3.890  1.00 0.59  ? 19  ILE A H    1  
ATOM 239   H HA   . ILE A 1 19  ? 12.817  1.742   -4.194  1.00 0.68  ? 19  ILE A HA   1  
ATOM 240   H HB   . ILE A 1 19  ? 14.255  2.758   -1.727  1.00 0.65  ? 19  ILE A HB   1  
ATOM 241   H HG12 . ILE A 1 19  ? 13.950  -0.048  -2.829  1.00 0.83  ? 19  ILE A HG12 1  
ATOM 242   H HG13 . ILE A 1 19  ? 15.313  0.994   -3.224  1.00 0.77  ? 19  ILE A HG13 1  
ATOM 243   H HG21 . ILE A 1 19  ? 11.965  2.495   -1.071  1.00 1.13  ? 19  ILE A HG21 1  
ATOM 244   H HG22 . ILE A 1 19  ? 12.781  1.012   -0.577  1.00 1.26  ? 19  ILE A HG22 1  
ATOM 245   H HG23 . ILE A 1 19  ? 11.787  1.029   -2.034  1.00 1.33  ? 19  ILE A HG23 1  
ATOM 246   H HD11 . ILE A 1 19  ? 15.864  -0.513  -1.350  1.00 1.45  ? 19  ILE A HD11 1  
ATOM 247   H HD12 . ILE A 1 19  ? 14.511  0.142   -0.428  1.00 1.18  ? 19  ILE A HD12 1  
ATOM 248   H HD13 . ILE A 1 19  ? 15.883  1.173   -0.835  1.00 1.28  ? 19  ILE A HD13 1  
ATOM 249   N N    . MET A 1 20  ? 12.485  4.640   -2.657  1.00 0.51  ? 20  MET A N    1  
ATOM 250   C CA   . MET A 1 20  ? 11.525  5.751   -2.425  1.00 0.60  ? 20  MET A CA   1  
ATOM 251   C C    . MET A 1 20  ? 10.845  6.211   -3.720  1.00 0.55  ? 20  MET A C    1  
ATOM 252   O O    . MET A 1 20  ? 9.646   6.403   -3.785  1.00 0.59  ? 20  MET A O    1  
ATOM 253   C CB   . MET A 1 20  ? 12.340  6.944   -1.863  1.00 0.82  ? 20  MET A CB   1  
ATOM 254   C CG   . MET A 1 20  ? 11.464  7.787   -0.908  1.00 1.07  ? 20  MET A CG   1  
ATOM 255   S SD   . MET A 1 20  ? 11.139  6.848   0.618   1.00 1.43  ? 20  MET A SD   1  
ATOM 256   C CE   . MET A 1 20  ? 9.326   6.764   0.517   1.00 0.93  ? 20  MET A CE   1  
ATOM 257   H H    . MET A 1 20  ? 13.367  4.705   -2.227  1.00 0.57  ? 20  MET A H    1  
ATOM 258   H HA   . MET A 1 20  ? 10.800  5.520   -1.658  1.00 0.71  ? 20  MET A HA   1  
ATOM 259   H HB2  . MET A 1 20  ? 13.184  6.562   -1.314  1.00 0.95  ? 20  MET A HB2  1  
ATOM 260   H HB3  . MET A 1 20  ? 12.696  7.571   -2.670  1.00 1.15  ? 20  MET A HB3  1  
ATOM 261   H HG2  . MET A 1 20  ? 11.984  8.698   -0.659  1.00 1.52  ? 20  MET A HG2  1  
ATOM 262   H HG3  . MET A 1 20  ? 10.530  8.026   -1.394  1.00 1.72  ? 20  MET A HG3  1  
ATOM 263   H HE1  . MET A 1 20  ? 9.030   6.472   -0.481  1.00 1.32  ? 20  MET A HE1  1  
ATOM 264   H HE2  . MET A 1 20  ? 8.905   7.730   0.745   1.00 1.36  ? 20  MET A HE2  1  
ATOM 265   H HE3  . MET A 1 20  ? 8.958   6.037   1.232   1.00 1.55  ? 20  MET A HE3  1  
ATOM 266   N N    . LYS A 1 21  ? 11.636  6.408   -4.748  1.00 0.57  ? 21  LYS A N    1  
ATOM 267   C CA   . LYS A 1 21  ? 11.098  6.882   -6.057  1.00 0.61  ? 21  LYS A CA   1  
ATOM 268   C C    . LYS A 1 21  ? 10.101  5.881   -6.639  1.00 0.53  ? 21  LYS A C    1  
ATOM 269   O O    . LYS A 1 21  ? 8.967   6.218   -6.907  1.00 0.51  ? 21  LYS A O    1  
ATOM 270   C CB   . LYS A 1 21  ? 12.249  7.047   -7.053  1.00 0.72  ? 21  LYS A CB   1  
ATOM 271   C CG   . LYS A 1 21  ? 13.133  8.226   -6.643  1.00 1.09  ? 21  LYS A CG   1  
ATOM 272   C CD   . LYS A 1 21  ? 14.466  8.155   -7.399  1.00 1.24  ? 21  LYS A CD   1  
ATOM 273   C CE   . LYS A 1 21  ? 14.221  8.257   -8.910  1.00 1.80  ? 21  LYS A CE   1  
ATOM 274   N NZ   . LYS A 1 21  ? 13.253  9.355   -9.191  1.00 2.40  ? 21  LYS A NZ   1  
ATOM 275   H H    . LYS A 1 21  ? 12.599  6.261   -4.651  1.00 0.62  ? 21  LYS A H    1  
ATOM 276   H HA   . LYS A 1 21  ? 10.611  7.835   -5.918  1.00 0.64  ? 21  LYS A HA   1  
ATOM 277   H HB2  . LYS A 1 21  ? 12.840  6.143   -7.071  1.00 0.99  ? 21  LYS A HB2  1  
ATOM 278   H HB3  . LYS A 1 21  ? 11.844  7.231   -8.038  1.00 0.93  ? 21  LYS A HB3  1  
ATOM 279   H HG2  . LYS A 1 21  ? 12.631  9.153   -6.880  1.00 1.39  ? 21  LYS A HG2  1  
ATOM 280   H HG3  . LYS A 1 21  ? 13.323  8.180   -5.582  1.00 1.41  ? 21  LYS A HG3  1  
ATOM 281   H HD2  . LYS A 1 21  ? 15.101  8.970   -7.084  1.00 1.54  ? 21  LYS A HD2  1  
ATOM 282   H HD3  . LYS A 1 21  ? 14.953  7.215   -7.180  1.00 1.52  ? 21  LYS A HD3  1  
ATOM 283   H HE2  . LYS A 1 21  ? 15.154  8.466   -9.411  1.00 2.25  ? 21  LYS A HE2  1  
ATOM 284   H HE3  . LYS A 1 21  ? 13.821  7.322   -9.274  1.00 2.26  ? 21  LYS A HE3  1  
ATOM 285   H HZ1  . LYS A 1 21  ? 13.563  10.223  -8.710  1.00 2.80  ? 21  LYS A HZ1  1  
ATOM 286   H HZ2  . LYS A 1 21  ? 12.310  9.083   -8.846  1.00 2.67  ? 21  LYS A HZ2  1  
ATOM 287   H HZ3  . LYS A 1 21  ? 13.211  9.527   -10.216 1.00 2.91  ? 21  LYS A HZ3  1  
ATOM 288   N N    . THR A 1 22  ? 10.498  4.653   -6.835  1.00 0.53  ? 22  THR A N    1  
ATOM 289   C CA   . THR A 1 22  ? 9.549   3.661   -7.409  1.00 0.52  ? 22  THR A CA   1  
ATOM 290   C C    . THR A 1 22  ? 8.334   3.539   -6.490  1.00 0.45  ? 22  THR A C    1  
ATOM 291   O O    . THR A 1 22  ? 7.219   3.358   -6.936  1.00 0.48  ? 22  THR A O    1  
ATOM 292   C CB   . THR A 1 22  ? 10.257  2.302   -7.538  1.00 0.55  ? 22  THR A CB   1  
ATOM 293   O OG1  . THR A 1 22  ? 11.604  2.513   -7.937  1.00 0.64  ? 22  THR A OG1  1  
ATOM 294   C CG2  . THR A 1 22  ? 9.547   1.439   -8.584  1.00 0.62  ? 22  THR A CG2  1  
ATOM 295   H H    . THR A 1 22  ? 11.405  4.366   -6.590  1.00 0.56  ? 22  THR A H    1  
ATOM 296   H HA   . THR A 1 22  ? 9.229   3.998   -8.385  1.00 0.57  ? 22  THR A HA   1  
ATOM 297   H HB   . THR A 1 22  ? 10.242  1.792   -6.586  1.00 0.52  ? 22  THR A HB   1  
ATOM 298   H HG1  . THR A 1 22  ? 11.598  2.866   -8.830  1.00 1.05  ? 22  THR A HG1  1  
ATOM 299   H HG21 . THR A 1 22  ? 9.998   0.458   -8.607  1.00 1.17  ? 22  THR A HG21 1  
ATOM 300   H HG22 . THR A 1 22  ? 9.641   1.901   -9.556  1.00 1.27  ? 22  THR A HG22 1  
ATOM 301   H HG23 . THR A 1 22  ? 8.502   1.349   -8.328  1.00 1.12  ? 22  THR A HG23 1  
ATOM 302   N N    . GLY A 1 23  ? 8.547   3.630   -5.209  1.00 0.42  ? 23  GLY A N    1  
ATOM 303   C CA   . GLY A 1 23  ? 7.415   3.514   -4.252  1.00 0.43  ? 23  GLY A CA   1  
ATOM 304   C C    . GLY A 1 23  ? 6.393   4.629   -4.498  1.00 0.41  ? 23  GLY A C    1  
ATOM 305   O O    . GLY A 1 23  ? 5.205   4.381   -4.549  1.00 0.47  ? 23  GLY A O    1  
ATOM 306   H H    . GLY A 1 23  ? 9.459   3.765   -4.875  1.00 0.42  ? 23  GLY A H    1  
ATOM 307   H HA2  . GLY A 1 23  ? 6.936   2.553   -4.382  1.00 0.47  ? 23  GLY A HA2  1  
ATOM 308   H HA3  . GLY A 1 23  ? 7.790   3.593   -3.244  1.00 0.46  ? 23  GLY A HA3  1  
ATOM 309   N N    . ALA A 1 24  ? 6.828   5.855   -4.639  1.00 0.40  ? 24  ALA A N    1  
ATOM 310   C CA   . ALA A 1 24  ? 5.859   6.967   -4.865  1.00 0.41  ? 24  ALA A CA   1  
ATOM 311   C C    . ALA A 1 24  ? 5.293   6.911   -6.284  1.00 0.41  ? 24  ALA A C    1  
ATOM 312   O O    . ALA A 1 24  ? 4.236   7.445   -6.556  1.00 0.41  ? 24  ALA A O    1  
ATOM 313   C CB   . ALA A 1 24  ? 6.576   8.305   -4.678  1.00 0.42  ? 24  ALA A CB   1  
ATOM 314   H H    . ALA A 1 24  ? 7.784   6.065   -4.585  1.00 0.44  ? 24  ALA A H    1  
ATOM 315   H HA   . ALA A 1 24  ? 5.059   6.902   -4.143  1.00 0.41  ? 24  ALA A HA   1  
ATOM 316   H HB1  . ALA A 1 24  ? 7.080   8.313   -3.723  1.00 1.06  ? 24  ALA A HB1  1  
ATOM 317   H HB2  . ALA A 1 24  ? 5.850   9.106   -4.709  1.00 1.11  ? 24  ALA A HB2  1  
ATOM 318   H HB3  . ALA A 1 24  ? 7.298   8.442   -5.469  1.00 1.11  ? 24  ALA A HB3  1  
ATOM 319   N N    . LEU A 1 25  ? 5.974   6.264   -7.198  1.00 0.42  ? 25  LEU A N    1  
ATOM 320   C CA   . LEU A 1 25  ? 5.432   6.193   -8.590  1.00 0.44  ? 25  LEU A CA   1  
ATOM 321   C C    . LEU A 1 25  ? 4.405   5.060   -8.623  1.00 0.44  ? 25  LEU A C    1  
ATOM 322   O O    . LEU A 1 25  ? 3.296   5.220   -9.092  1.00 0.46  ? 25  LEU A O    1  
ATOM 323   C CB   . LEU A 1 25  ? 6.569   5.926   -9.603  1.00 0.47  ? 25  LEU A CB   1  
ATOM 324   C CG   . LEU A 1 25  ? 7.173   7.250   -10.111 1.00 0.77  ? 25  LEU A CG   1  
ATOM 325   C CD1  . LEU A 1 25  ? 8.071   7.858   -9.033  1.00 1.58  ? 25  LEU A CD1  1  
ATOM 326   C CD2  . LEU A 1 25  ? 8.013   6.978   -11.361 1.00 1.67  ? 25  LEU A CD2  1  
ATOM 327   H H    . LEU A 1 25  ? 6.812   5.819   -6.953  1.00 0.43  ? 25  LEU A H    1  
ATOM 328   H HA   . LEU A 1 25  ? 4.950   7.139   -8.799  1.00 0.43  ? 25  LEU A HA   1  
ATOM 329   H HB2  . LEU A 1 25  ? 7.343   5.347   -9.122  1.00 0.82  ? 25  LEU A HB2  1  
ATOM 330   H HB3  . LEU A 1 25  ? 6.181   5.370   -10.446 1.00 0.85  ? 25  LEU A HB3  1  
ATOM 331   H HG   . LEU A 1 25  ? 6.384   7.945   -10.357 1.00 1.46  ? 25  LEU A HG   1  
ATOM 332   H HD11 . LEU A 1 25  ? 7.552   7.858   -8.086  1.00 2.16  ? 25  LEU A HD11 1  
ATOM 333   H HD12 . LEU A 1 25  ? 8.322   8.869   -9.306  1.00 2.10  ? 25  LEU A HD12 1  
ATOM 334   H HD13 . LEU A 1 25  ? 8.975   7.277   -8.951  1.00 2.08  ? 25  LEU A HD13 1  
ATOM 335   H HD21 . LEU A 1 25  ? 7.379   6.590   -12.144 1.00 2.29  ? 25  LEU A HD21 1  
ATOM 336   H HD22 . LEU A 1 25  ? 8.782   6.257   -11.129 1.00 2.15  ? 25  LEU A HD22 1  
ATOM 337   H HD23 . LEU A 1 25  ? 8.472   7.899   -11.693 1.00 2.16  ? 25  LEU A HD23 1  
ATOM 338   N N    . LEU A 1 26  ? 4.791   3.903   -8.155  1.00 0.45  ? 26  LEU A N    1  
ATOM 339   C CA   . LEU A 1 26  ? 3.874   2.734   -8.179  1.00 0.47  ? 26  LEU A CA   1  
ATOM 340   C C    . LEU A 1 26  ? 2.513   3.089   -7.585  1.00 0.49  ? 26  LEU A C    1  
ATOM 341   O O    . LEU A 1 26  ? 1.494   2.924   -8.227  1.00 0.52  ? 26  LEU A O    1  
ATOM 342   C CB   . LEU A 1 26  ? 4.509   1.565   -7.392  1.00 0.51  ? 26  LEU A CB   1  
ATOM 343   C CG   . LEU A 1 26  ? 5.577   0.864   -8.257  1.00 0.69  ? 26  LEU A CG   1  
ATOM 344   C CD1  . LEU A 1 26  ? 6.450   -0.046  -7.389  1.00 1.17  ? 26  LEU A CD1  1  
ATOM 345   C CD2  . LEU A 1 26  ? 4.889   0.020   -9.343  1.00 1.35  ? 26  LEU A CD2  1  
ATOM 346   H H    . LEU A 1 26  ? 5.700   3.787   -7.809  1.00 0.46  ? 26  LEU A H    1  
ATOM 347   H HA   . LEU A 1 26  ? 3.730   2.432   -9.196  1.00 0.49  ? 26  LEU A HA   1  
ATOM 348   H HB2  . LEU A 1 26  ? 4.971   1.949   -6.495  1.00 0.80  ? 26  LEU A HB2  1  
ATOM 349   H HB3  . LEU A 1 26  ? 3.743   0.852   -7.123  1.00 0.81  ? 26  LEU A HB3  1  
ATOM 350   H HG   . LEU A 1 26  ? 6.198   1.613   -8.715  1.00 1.43  ? 26  LEU A HG   1  
ATOM 351   H HD11 . LEU A 1 26  ? 5.825   -0.763  -6.877  1.00 1.78  ? 26  LEU A HD11 1  
ATOM 352   H HD12 . LEU A 1 26  ? 6.981   0.552   -6.663  1.00 1.70  ? 26  LEU A HD12 1  
ATOM 353   H HD13 . LEU A 1 26  ? 7.160   -0.568  -8.015  1.00 1.68  ? 26  LEU A HD13 1  
ATOM 354   H HD21 . LEU A 1 26  ? 4.444   0.649   -10.091 1.00 1.84  ? 26  LEU A HD21 1  
ATOM 355   H HD22 . LEU A 1 26  ? 4.130   -0.603  -8.896  1.00 1.93  ? 26  LEU A HD22 1  
ATOM 356   H HD23 . LEU A 1 26  ? 5.634   -0.608  -9.812  1.00 1.89  ? 26  LEU A HD23 1  
ATOM 357   N N    . LEU A 1 27  ? 2.464   3.547   -6.368  1.00 0.50  ? 27  LEU A N    1  
ATOM 358   C CA   . LEU A 1 27  ? 1.136   3.865   -5.780  1.00 0.56  ? 27  LEU A CA   1  
ATOM 359   C C    . LEU A 1 27  ? 0.474   4.973   -6.608  1.00 0.56  ? 27  LEU A C    1  
ATOM 360   O O    . LEU A 1 27  ? -0.659  4.846   -7.028  1.00 0.60  ? 27  LEU A O    1  
ATOM 361   C CB   . LEU A 1 27  ? 1.304   4.287   -4.314  1.00 0.64  ? 27  LEU A CB   1  
ATOM 362   C CG   . LEU A 1 27  ? -0.043  4.692   -3.702  1.00 0.95  ? 27  LEU A CG   1  
ATOM 363   C CD1  . LEU A 1 27  ? -1.007  3.497   -3.709  1.00 1.66  ? 27  LEU A CD1  1  
ATOM 364   C CD2  . LEU A 1 27  ? 0.189   5.156   -2.261  1.00 1.42  ? 27  LEU A CD2  1  
ATOM 365   H H    . LEU A 1 27  ? 3.285   3.661   -5.844  1.00 0.49  ? 27  LEU A H    1  
ATOM 366   H HA   . LEU A 1 27  ? 0.530   2.976   -5.856  1.00 0.58  ? 27  LEU A HA   1  
ATOM 367   H HB2  . LEU A 1 27  ? 1.716   3.461   -3.753  1.00 1.45  ? 27  LEU A HB2  1  
ATOM 368   H HB3  . LEU A 1 27  ? 1.984   5.125   -4.262  1.00 1.04  ? 27  LEU A HB3  1  
ATOM 369   H HG   . LEU A 1 27  ? -0.471  5.501   -4.272  1.00 1.71  ? 27  LEU A HG   1  
ATOM 370   H HD11 . LEU A 1 27  ? -0.470  2.596   -3.451  1.00 2.02  ? 27  LEU A HD11 1  
ATOM 371   H HD12 . LEU A 1 27  ? -1.440  3.390   -4.693  1.00 2.23  ? 27  LEU A HD12 1  
ATOM 372   H HD13 . LEU A 1 27  ? -1.796  3.664   -2.990  1.00 2.21  ? 27  LEU A HD13 1  
ATOM 373   H HD21 . LEU A 1 27  ? -0.755  5.434   -1.816  1.00 1.98  ? 27  LEU A HD21 1  
ATOM 374   H HD22 . LEU A 1 27  ? 0.853   6.008   -2.260  1.00 1.93  ? 27  LEU A HD22 1  
ATOM 375   H HD23 . LEU A 1 27  ? 0.633   4.353   -1.691  1.00 1.88  ? 27  LEU A HD23 1  
ATOM 376   N N    . GLN A 1 28  ? 1.161   6.056   -6.850  1.00 0.55  ? 28  GLN A N    1  
ATOM 377   C CA   . GLN A 1 28  ? 0.552   7.156   -7.654  1.00 0.58  ? 28  GLN A CA   1  
ATOM 378   C C    . GLN A 1 28  ? 0.069   6.603   -9.001  1.00 0.54  ? 28  GLN A C    1  
ATOM 379   O O    . GLN A 1 28  ? -0.771  7.181   -9.662  1.00 0.58  ? 28  GLN A O    1  
ATOM 380   C CB   . GLN A 1 28  ? 1.610   8.233   -7.904  1.00 0.60  ? 28  GLN A CB   1  
ATOM 381   C CG   . GLN A 1 28  ? 0.988   9.386   -8.691  1.00 1.00  ? 28  GLN A CG   1  
ATOM 382   C CD   . GLN A 1 28  ? 1.927   10.594  -8.654  1.00 1.40  ? 28  GLN A CD   1  
ATOM 383   O OE1  . GLN A 1 28  ? 1.691   11.540  -7.929  1.00 2.09  ? 28  GLN A OE1  1  
ATOM 384   N NE2  . GLN A 1 28  ? 2.991   10.602  -9.410  1.00 1.91  ? 28  GLN A NE2  1  
ATOM 385   H H    . GLN A 1 28  ? 2.073   6.156   -6.503  1.00 0.53  ? 28  GLN A H    1  
ATOM 386   H HA   . GLN A 1 28  ? -0.269  7.585   -7.101  1.00 0.65  ? 28  GLN A HA   1  
ATOM 387   H HB2  . GLN A 1 28  ? 1.980   8.600   -6.957  1.00 0.99  ? 28  GLN A HB2  1  
ATOM 388   H HB3  . GLN A 1 28  ? 2.427   7.811   -8.471  1.00 0.92  ? 28  GLN A HB3  1  
ATOM 389   H HG2  . GLN A 1 28  ? 0.833   9.079   -9.715  1.00 1.47  ? 28  GLN A HG2  1  
ATOM 390   H HG3  . GLN A 1 28  ? 0.042   9.654   -8.247  1.00 1.50  ? 28  GLN A HG3  1  
ATOM 391   H HE21 . GLN A 1 28  ? 3.182   9.839   -9.995  1.00 2.26  ? 28  GLN A HE21 1  
ATOM 392   H HE22 . GLN A 1 28  ? 3.599   11.370  -9.393  1.00 2.37  ? 28  GLN A HE22 1  
ATOM 393   N N    . GLY A 1 29  ? 0.625   5.500   -9.420  1.00 0.50  ? 29  GLY A N    1  
ATOM 394   C CA   . GLY A 1 29  ? 0.237   4.910   -10.737 1.00 0.48  ? 29  GLY A CA   1  
ATOM 395   C C    . GLY A 1 29  ? -1.113  4.194   -10.638 1.00 0.44  ? 29  GLY A C    1  
ATOM 396   O O    . GLY A 1 29  ? -2.062  4.548   -11.310 1.00 0.50  ? 29  GLY A O    1  
ATOM 397   H H    . GLY A 1 29  ? 1.319   5.081   -8.869  1.00 0.50  ? 29  GLY A H    1  
ATOM 398   H HA2  . GLY A 1 29  ? 0.168   5.699   -11.472 1.00 0.49  ? 29  GLY A HA2  1  
ATOM 399   H HA3  . GLY A 1 29  ? 0.991   4.201   -11.046 1.00 0.50  ? 29  GLY A HA3  1  
ATOM 400   N N    . PHE A 1 30  ? -1.205  3.179   -9.826  1.00 0.44  ? 30  PHE A N    1  
ATOM 401   C CA   . PHE A 1 30  ? -2.491  2.433   -9.711  1.00 0.43  ? 30  PHE A CA   1  
ATOM 402   C C    . PHE A 1 30  ? -3.635  3.399   -9.390  1.00 0.40  ? 30  PHE A C    1  
ATOM 403   O O    . PHE A 1 30  ? -4.792  3.063   -9.557  1.00 0.43  ? 30  PHE A O    1  
ATOM 404   C CB   . PHE A 1 30  ? -2.377  1.378   -8.599  1.00 0.47  ? 30  PHE A CB   1  
ATOM 405   C CG   . PHE A 1 30  ? -3.730  0.746   -8.340  1.00 0.47  ? 30  PHE A CG   1  
ATOM 406   C CD1  . PHE A 1 30  ? -4.328  -0.050  -9.324  1.00 1.20  ? 30  PHE A CD1  1  
ATOM 407   C CD2  . PHE A 1 30  ? -4.382  0.950   -7.115  1.00 1.39  ? 30  PHE A CD2  1  
ATOM 408   C CE1  . PHE A 1 30  ? -5.575  -0.641  -9.087  1.00 1.21  ? 30  PHE A CE1  1  
ATOM 409   C CE2  . PHE A 1 30  ? -5.629  0.359   -6.879  1.00 1.42  ? 30  PHE A CE2  1  
ATOM 410   C CZ   . PHE A 1 30  ? -6.225  -0.436  -7.864  1.00 0.58  ? 30  PHE A CZ   1  
ATOM 411   H H    . PHE A 1 30  ? -0.425  2.899   -9.303  1.00 0.53  ? 30  PHE A H    1  
ATOM 412   H HA   . PHE A 1 30  ? -2.688  1.926   -10.645 1.00 0.42  ? 30  PHE A HA   1  
ATOM 413   H HB2  . PHE A 1 30  ? -1.686  0.607   -8.912  1.00 0.46  ? 30  PHE A HB2  1  
ATOM 414   H HB3  . PHE A 1 30  ? -2.013  1.842   -7.695  1.00 0.54  ? 30  PHE A HB3  1  
ATOM 415   H HD1  . PHE A 1 30  ? -3.827  -0.208  -10.268 1.00 2.10  ? 30  PHE A HD1  1  
ATOM 416   H HD2  . PHE A 1 30  ? -3.922  1.564   -6.355  1.00 2.27  ? 30  PHE A HD2  1  
ATOM 417   H HE1  . PHE A 1 30  ? -6.035  -1.255  -9.847  1.00 2.09  ? 30  PHE A HE1  1  
ATOM 418   H HE2  . PHE A 1 30  ? -6.132  0.517   -5.936  1.00 2.33  ? 30  PHE A HE2  1  
ATOM 419   H HZ   . PHE A 1 30  ? -7.187  -0.893  -7.681  1.00 0.65  ? 30  PHE A HZ   1  
ATOM 420   N N    . ILE A 1 31  ? -3.348  4.597   -8.936  1.00 0.40  ? 31  ILE A N    1  
ATOM 421   C CA   . ILE A 1 31  ? -4.454  5.549   -8.619  1.00 0.40  ? 31  ILE A CA   1  
ATOM 422   C C    . ILE A 1 31  ? -4.855  6.291   -9.899  1.00 0.40  ? 31  ILE A C    1  
ATOM 423   O O    . ILE A 1 31  ? -5.976  6.196   -10.358 1.00 0.43  ? 31  ILE A O    1  
ATOM 424   C CB   . ILE A 1 31  ? -3.965  6.556   -7.568  1.00 0.41  ? 31  ILE A CB   1  
ATOM 425   C CG1  . ILE A 1 31  ? -3.737  5.844   -6.232  1.00 0.53  ? 31  ILE A CG1  1  
ATOM 426   C CG2  . ILE A 1 31  ? -5.000  7.668   -7.386  1.00 0.72  ? 31  ILE A CG2  1  
ATOM 427   C CD1  . ILE A 1 31  ? -2.919  6.749   -5.304  1.00 0.48  ? 31  ILE A CD1  1  
ATOM 428   H H    . ILE A 1 31  ? -2.424  4.893   -8.799  1.00 0.44  ? 31  ILE A H    1  
ATOM 429   H HA   . ILE A 1 31  ? -5.301  4.989   -8.250  1.00 0.43  ? 31  ILE A HA   1  
ATOM 430   H HB   . ILE A 1 31  ? -3.034  6.992   -7.903  1.00 0.63  ? 31  ILE A HB   1  
ATOM 431   H HG12 . ILE A 1 31  ? -4.690  5.624   -5.774  1.00 0.77  ? 31  ILE A HG12 1  
ATOM 432   H HG13 . ILE A 1 31  ? -3.197  4.925   -6.402  1.00 0.81  ? 31  ILE A HG13 1  
ATOM 433   H HG21 . ILE A 1 31  ? -5.981  7.232   -7.275  1.00 1.21  ? 31  ILE A HG21 1  
ATOM 434   H HG22 . ILE A 1 31  ? -4.987  8.316   -8.250  1.00 1.35  ? 31  ILE A HG22 1  
ATOM 435   H HG23 . ILE A 1 31  ? -4.758  8.242   -6.503  1.00 1.33  ? 31  ILE A HG23 1  
ATOM 436   H HD11 . ILE A 1 31  ? -3.317  7.751   -5.333  1.00 1.20  ? 31  ILE A HD11 1  
ATOM 437   H HD12 . ILE A 1 31  ? -1.890  6.763   -5.630  1.00 0.94  ? 31  ILE A HD12 1  
ATOM 438   H HD13 . ILE A 1 31  ? -2.971  6.370   -4.293  1.00 1.15  ? 31  ILE A HD13 1  
ATOM 439   N N    . GLN A 1 32  ? -3.946  7.028   -10.476 1.00 0.42  ? 32  GLN A N    1  
ATOM 440   C CA   . GLN A 1 32  ? -4.264  7.779   -11.727 1.00 0.47  ? 32  GLN A CA   1  
ATOM 441   C C    . GLN A 1 32  ? -4.997  6.858   -12.713 1.00 0.50  ? 32  GLN A C    1  
ATOM 442   O O    . GLN A 1 32  ? -5.946  7.255   -13.359 1.00 0.61  ? 32  GLN A O    1  
ATOM 443   C CB   . GLN A 1 32  ? -2.956  8.292   -12.353 1.00 0.57  ? 32  GLN A CB   1  
ATOM 444   C CG   . GLN A 1 32  ? -3.237  9.518   -13.227 1.00 1.19  ? 32  GLN A CG   1  
ATOM 445   C CD   . GLN A 1 32  ? -4.226  9.145   -14.331 1.00 1.59  ? 32  GLN A CD   1  
ATOM 446   O OE1  . GLN A 1 32  ? -5.328  9.657   -14.374 1.00 2.16  ? 32  GLN A OE1  1  
ATOM 447   N NE2  . GLN A 1 32  ? -3.878  8.269   -15.233 1.00 2.21  ? 32  GLN A NE2  1  
ATOM 448   H H    . GLN A 1 32  ? -3.048  7.089   -10.087 1.00 0.42  ? 32  GLN A H    1  
ATOM 449   H HA   . GLN A 1 32  ? -4.909  8.615   -11.497 1.00 0.48  ? 32  GLN A HA   1  
ATOM 450   H HB2  . GLN A 1 32  ? -2.269  8.565   -11.565 1.00 0.98  ? 32  GLN A HB2  1  
ATOM 451   H HB3  . GLN A 1 32  ? -2.512  7.515   -12.958 1.00 1.06  ? 32  GLN A HB3  1  
ATOM 452   H HG2  . GLN A 1 32  ? -3.657  10.306  -12.617 1.00 1.85  ? 32  GLN A HG2  1  
ATOM 453   H HG3  . GLN A 1 32  ? -2.315  9.861   -13.673 1.00 1.72  ? 32  GLN A HG3  1  
ATOM 454   H HE21 . GLN A 1 32  ? -2.990  7.857   -15.198 1.00 2.56  ? 32  GLN A HE21 1  
ATOM 455   H HE22 . GLN A 1 32  ? -4.505  8.024   -15.945 1.00 2.71  ? 32  GLN A HE22 1  
ATOM 456   N N    . ASP A 1 33  ? -4.564  5.633   -12.829 1.00 0.49  ? 33  ASP A N    1  
ATOM 457   C CA   . ASP A 1 33  ? -5.239  4.693   -13.770 1.00 0.58  ? 33  ASP A CA   1  
ATOM 458   C C    . ASP A 1 33  ? -6.654  4.403   -13.260 1.00 0.61  ? 33  ASP A C    1  
ATOM 459   O O    . ASP A 1 33  ? -7.596  4.310   -14.021 1.00 0.70  ? 33  ASP A O    1  
ATOM 460   C CB   . ASP A 1 33  ? -4.446  3.387   -13.852 1.00 0.61  ? 33  ASP A CB   1  
ATOM 461   C CG   . ASP A 1 33  ? -3.010  3.688   -14.287 1.00 1.10  ? 33  ASP A CG   1  
ATOM 462   O OD1  . ASP A 1 33  ? -2.812  4.688   -14.957 1.00 1.78  ? 33  ASP A OD1  1  
ATOM 463   O OD2  . ASP A 1 33  ? -2.133  2.913   -13.942 1.00 1.89  ? 33  ASP A OD2  1  
ATOM 464   H H    . ASP A 1 33  ? -3.797  5.340   -12.294 1.00 0.49  ? 33  ASP A H    1  
ATOM 465   H HA   . ASP A 1 33  ? -5.296  5.144   -14.750 1.00 0.64  ? 33  ASP A HA   1  
ATOM 466   H HB2  . ASP A 1 33  ? -4.437  2.911   -12.882 1.00 1.22  ? 33  ASP A HB2  1  
ATOM 467   H HB3  . ASP A 1 33  ? -4.908  2.730   -14.573 1.00 1.02  ? 33  ASP A HB3  1  
ATOM 468   N N    . ARG A 1 34  ? -6.802  4.261   -11.973 1.00 0.58  ? 34  ARG A N    1  
ATOM 469   C CA   . ARG A 1 34  ? -8.145  3.979   -11.388 1.00 0.71  ? 34  ARG A CA   1  
ATOM 470   C C    . ARG A 1 34  ? -8.979  5.262   -11.311 1.00 0.65  ? 34  ARG A C    1  
ATOM 471   O O    . ARG A 1 34  ? -10.169 5.208   -11.072 1.00 0.85  ? 34  ARG A O    1  
ATOM 472   C CB   . ARG A 1 34  ? -7.972  3.401   -9.978  1.00 0.85  ? 34  ARG A CB   1  
ATOM 473   C CG   . ARG A 1 34  ? -7.361  1.988   -10.053 1.00 1.25  ? 34  ARG A CG   1  
ATOM 474   C CD   . ARG A 1 34  ? -8.463  0.940   -10.264 1.00 1.31  ? 34  ARG A CD   1  
ATOM 475   N NE   . ARG A 1 34  ? -9.450  1.021   -9.151  1.00 1.58  ? 34  ARG A NE   1  
ATOM 476   C CZ   . ARG A 1 34  ? -10.616 0.445   -9.270  1.00 2.09  ? 34  ARG A CZ   1  
ATOM 477   N NH1  . ARG A 1 34  ? -10.919 -0.194  -10.367 1.00 2.58  ? 34  ARG A NH1  1  
ATOM 478   N NH2  . ARG A 1 34  ? -11.478 0.509   -8.293  1.00 2.75  ? 34  ARG A NH2  1  
ATOM 479   H H    . ARG A 1 34  ? -6.022  4.340   -11.382 1.00 0.52  ? 34  ARG A H    1  
ATOM 480   H HA   . ARG A 1 34  ? -8.693  3.276   -11.995 1.00 0.89  ? 34  ARG A HA   1  
ATOM 481   H HB2  . ARG A 1 34  ? -7.316  4.045   -9.410  1.00 1.23  ? 34  ARG A HB2  1  
ATOM 482   H HB3  . ARG A 1 34  ? -8.935  3.354   -9.490  1.00 1.14  ? 34  ARG A HB3  1  
ATOM 483   H HG2  . ARG A 1 34  ? -6.658  1.938   -10.872 1.00 1.91  ? 34  ARG A HG2  1  
ATOM 484   H HG3  . ARG A 1 34  ? -6.844  1.775   -9.128  1.00 1.90  ? 34  ARG A HG3  1  
ATOM 485   H HD2  . ARG A 1 34  ? -8.963  1.121   -11.203 1.00 1.72  ? 34  ARG A HD2  1  
ATOM 486   H HD3  . ARG A 1 34  ? -8.021  -0.045  -10.279 1.00 2.00  ? 34  ARG A HD3  1  
ATOM 487   H HE   . ARG A 1 34  ? -9.224  1.503   -8.329  1.00 2.02  ? 34  ARG A HE   1  
ATOM 488   H HH11 . ARG A 1 34  ? -10.259 -0.242  -11.117 1.00 2.61  ? 34  ARG A HH11 1  
ATOM 489   H HH12 . ARG A 1 34  ? -11.812 -0.634  -10.458 1.00 3.26  ? 34  ARG A HH12 1  
ATOM 490   H HH21 . ARG A 1 34  ? -11.246 0.999   -7.453  1.00 3.04  ? 34  ARG A HH21 1  
ATOM 491   H HH22 . ARG A 1 34  ? -12.371 0.068   -8.384  1.00 3.25  ? 34  ARG A HH22 1  
ATOM 492   N N    . ALA A 1 35  ? -8.396  6.415   -11.517 1.00 0.59  ? 35  ALA A N    1  
ATOM 493   C CA   . ALA A 1 35  ? -9.218  7.666   -11.453 1.00 0.66  ? 35  ALA A CA   1  
ATOM 494   C C    . ALA A 1 35  ? -9.895  7.889   -12.810 1.00 0.80  ? 35  ALA A C    1  
ATOM 495   O O    . ALA A 1 35  ? -10.989 8.411   -12.894 1.00 0.88  ? 35  ALA A O    1  
ATOM 496   C CB   . ALA A 1 35  ? -8.337  8.865   -11.096 1.00 0.94  ? 35  ALA A CB   1  
ATOM 497   H H    . ALA A 1 35  ? -7.438  6.458   -11.717 1.00 0.67  ? 35  ALA A H    1  
ATOM 498   H HA   . ALA A 1 35  ? -9.995  7.535   -10.713 1.00 0.91  ? 35  ALA A HA   1  
ATOM 499   H HB1  . ALA A 1 35  ? -8.941  9.759   -11.067 1.00 1.48  ? 35  ALA A HB1  1  
ATOM 500   H HB2  . ALA A 1 35  ? -7.563  8.978   -11.841 1.00 1.33  ? 35  ALA A HB2  1  
ATOM 501   H HB3  . ALA A 1 35  ? -7.884  8.704   -10.129 1.00 1.41  ? 35  ALA A HB3  1  
ATOM 502   N N    . GLY A 1 36  ? -9.270  7.450   -13.869 1.00 1.15  ? 36  GLY A N    1  
ATOM 503   C CA   . GLY A 1 36  ? -9.889  7.582   -15.218 1.00 1.62  ? 36  GLY A CA   1  
ATOM 504   C C    . GLY A 1 36  ? -8.811  7.685   -16.296 1.00 1.54  ? 36  GLY A C    1  
ATOM 505   O O    . GLY A 1 36  ? -7.806  7.003   -16.265 1.00 2.10  ? 36  GLY A O    1  
ATOM 506   H H    . GLY A 1 36  ? -8.408  7.002   -13.763 1.00 1.22  ? 36  GLY A H    1  
ATOM 507   H HA2  . GLY A 1 36  ? -10.501 6.710   -15.396 1.00 2.27  ? 36  GLY A HA2  1  
ATOM 508   H HA3  . GLY A 1 36  ? -10.519 8.459   -15.268 1.00 2.17  ? 36  GLY A HA3  1  
ATOM 509   N N    . ARG A 1 37  ? -9.030  8.543   -17.251 1.00 2.07  ? 37  ARG A N    1  
ATOM 510   C CA   . ARG A 1 37  ? -8.049  8.724   -18.357 1.00 2.87  ? 37  ARG A CA   1  
ATOM 511   C C    . ARG A 1 37  ? -6.945  9.685   -17.909 1.00 3.46  ? 37  ARG A C    1  
ATOM 512   O O    . ARG A 1 37  ? -5.976  9.292   -17.290 1.00 4.10  ? 37  ARG A O    1  
ATOM 513   C CB   . ARG A 1 37  ? -8.771  9.314   -19.573 1.00 3.63  ? 37  ARG A CB   1  
ATOM 514   C CG   . ARG A 1 37  ? -9.818  8.318   -20.079 1.00 4.34  ? 37  ARG A CG   1  
ATOM 515   C CD   . ARG A 1 37  ? -10.755 9.015   -21.069 1.00 5.18  ? 37  ARG A CD   1  
ATOM 516   N NE   . ARG A 1 37  ? -11.601 10.004  -20.341 1.00 5.74  ? 37  ARG A NE   1  
ATOM 517   C CZ   . ARG A 1 37  ? -12.267 10.909  -21.006 1.00 6.53  ? 37  ARG A CZ   1  
ATOM 518   N NH1  . ARG A 1 37  ? -12.200 10.942  -22.309 1.00 6.88  ? 37  ARG A NH1  1  
ATOM 519   N NH2  . ARG A 1 37  ? -13.002 11.778  -20.369 1.00 7.21  ? 37  ARG A NH2  1  
ATOM 520   H H    . ARG A 1 37  ? -9.852  9.072   -17.241 1.00 2.46  ? 37  ARG A H    1  
ATOM 521   H HA   . ARG A 1 37  ? -7.621  7.770   -18.627 1.00 3.07  ? 37  ARG A HA   1  
ATOM 522   H HB2  . ARG A 1 37  ? -9.259  10.236  -19.291 1.00 3.83  ? 37  ARG A HB2  1  
ATOM 523   H HB3  . ARG A 1 37  ? -8.056  9.510   -20.358 1.00 3.99  ? 37  ARG A HB3  1  
ATOM 524   H HG2  . ARG A 1 37  ? -9.322  7.494   -20.571 1.00 4.58  ? 37  ARG A HG2  1  
ATOM 525   H HG3  . ARG A 1 37  ? -10.393 7.946   -19.244 1.00 4.48  ? 37  ARG A HG3  1  
ATOM 526   H HD2  . ARG A 1 37  ? -10.171 9.526   -21.819 1.00 5.49  ? 37  ARG A HD2  1  
ATOM 527   H HD3  . ARG A 1 37  ? -11.387 8.279   -21.544 1.00 5.44  ? 37  ARG A HD3  1  
ATOM 528   H HE   . ARG A 1 37  ? -11.655 9.976   -19.363 1.00 5.74  ? 37  ARG A HE   1  
ATOM 529   H HH11 . ARG A 1 37  ? -11.638 10.275  -22.799 1.00 6.59  ? 37  ARG A HH11 1  
ATOM 530   H HH12 . ARG A 1 37  ? -12.710 11.635  -22.818 1.00 7.60  ? 37  ARG A HH12 1  
ATOM 531   H HH21 . ARG A 1 37  ? -13.055 11.751  -19.370 1.00 7.21  ? 37  ARG A HH21 1  
ATOM 532   H HH22 . ARG A 1 37  ? -13.512 12.471  -20.878 1.00 7.88  ? 37  ARG A HH22 1  
ATOM 533   N N    . MET A 1 38  ? -7.090  10.945  -18.217 1.00 3.74  ? 38  MET A N    1  
ATOM 534   C CA   . MET A 1 38  ? -6.061  11.944  -17.813 1.00 4.68  ? 38  MET A CA   1  
ATOM 535   C C    . MET A 1 38  ? -6.654  13.348  -17.957 1.00 4.70  ? 38  MET A C    1  
ATOM 536   O O    . MET A 1 38  ? -7.786  13.518  -18.366 1.00 5.17  ? 38  MET A O    1  
ATOM 537   C CB   . MET A 1 38  ? -4.818  11.804  -18.710 1.00 5.62  ? 38  MET A CB   1  
ATOM 538   C CG   . MET A 1 38  ? -5.231  11.476  -20.152 1.00 5.93  ? 38  MET A CG   1  
ATOM 539   S SD   . MET A 1 38  ? -6.262  12.807  -20.817 1.00 6.79  ? 38  MET A SD   1  
ATOM 540   C CE   . MET A 1 38  ? -6.830  11.935  -22.298 1.00 7.04  ? 38  MET A CE   1  
ATOM 541   H H    . MET A 1 38  ? -7.881  11.237  -18.714 1.00 3.65  ? 38  MET A H    1  
ATOM 542   H HA   . MET A 1 38  ? -5.783  11.776  -16.784 1.00 5.03  ? 38  MET A HA   1  
ATOM 543   H HB2  . MET A 1 38  ? -4.258  12.729  -18.701 1.00 5.87  ? 38  MET A HB2  1  
ATOM 544   H HB3  . MET A 1 38  ? -4.194  11.008  -18.331 1.00 6.19  ? 38  MET A HB3  1  
ATOM 545   H HG2  . MET A 1 38  ? -4.346  11.374  -20.762 1.00 6.03  ? 38  MET A HG2  1  
ATOM 546   H HG3  . MET A 1 38  ? -5.784  10.548  -20.169 1.00 5.95  ? 38  MET A HG3  1  
ATOM 547   H HE1  . MET A 1 38  ? -7.221  10.968  -22.016 1.00 7.30  ? 38  MET A HE1  1  
ATOM 548   H HE2  . MET A 1 38  ? -6.003  11.802  -22.977 1.00 7.32  ? 38  MET A HE2  1  
ATOM 549   H HE3  . MET A 1 38  ? -7.603  12.515  -22.782 1.00 6.96  ? 38  MET A HE3  1  
ATOM 550   N N    . GLY A 1 39  ? -5.898  14.356  -17.615 1.00 4.57  ? 39  GLY A N    1  
ATOM 551   C CA   . GLY A 1 39  ? -6.416  15.748  -17.722 1.00 4.85  ? 39  GLY A CA   1  
ATOM 552   C C    . GLY A 1 39  ? -5.244  16.730  -17.719 1.00 4.67  ? 39  GLY A C    1  
ATOM 553   O O    . GLY A 1 39  ? -4.532  16.865  -16.744 1.00 4.95  ? 39  GLY A O    1  
ATOM 554   H H    . GLY A 1 39  ? -4.990  14.195  -17.282 1.00 4.53  ? 39  GLY A H    1  
ATOM 555   H HA2  . GLY A 1 39  ? -6.976  15.855  -18.640 1.00 5.27  ? 39  GLY A HA2  1  
ATOM 556   H HA3  . GLY A 1 39  ? -7.058  15.959  -16.881 1.00 5.09  ? 39  GLY A HA3  1  
ATOM 557   N N    . GLY A 1 40  ? -5.033  17.408  -18.813 1.00 4.58  ? 40  GLY A N    1  
ATOM 558   C CA   . GLY A 1 40  ? -3.901  18.372  -18.892 1.00 4.69  ? 40  GLY A CA   1  
ATOM 559   C C    . GLY A 1 40  ? -3.939  19.330  -17.699 1.00 4.20  ? 40  GLY A C    1  
ATOM 560   O O    . GLY A 1 40  ? -4.928  19.439  -17.003 1.00 4.34  ? 40  GLY A O    1  
ATOM 561   H H    . GLY A 1 40  ? -5.615  17.274  -19.590 1.00 4.70  ? 40  GLY A H    1  
ATOM 562   H HA2  . GLY A 1 40  ? -2.967  17.828  -18.886 1.00 5.07  ? 40  GLY A HA2  1  
ATOM 563   H HA3  . GLY A 1 40  ? -3.979  18.941  -19.806 1.00 5.10  ? 40  GLY A HA3  1  
ATOM 564   N N    . GLU A 1 41  ? -2.864  20.033  -17.475 1.00 4.01  ? 41  GLU A N    1  
ATOM 565   C CA   . GLU A 1 41  ? -2.810  21.000  -16.349 1.00 3.88  ? 41  GLU A CA   1  
ATOM 566   C C    . GLU A 1 41  ? -2.864  20.255  -15.008 1.00 3.63  ? 41  GLU A C    1  
ATOM 567   O O    . GLU A 1 41  ? -2.134  20.582  -14.094 1.00 4.16  ? 41  GLU A O    1  
ATOM 568   C CB   . GLU A 1 41  ? -3.990  21.987  -16.476 1.00 4.26  ? 41  GLU A CB   1  
ATOM 569   C CG   . GLU A 1 41  ? -3.523  23.408  -16.145 1.00 4.51  ? 41  GLU A CG   1  
ATOM 570   C CD   . GLU A 1 41  ? -2.712  23.967  -17.316 1.00 4.90  ? 41  GLU A CD   1  
ATOM 571   O OE1  . GLU A 1 41  ? -3.279  24.118  -18.386 1.00 5.19  ? 41  GLU A OE1  1  
ATOM 572   O OE2  . GLU A 1 41  ? -1.537  24.234  -17.123 1.00 5.28  ? 41  GLU A OE2  1  
ATOM 573   H H    . GLU A 1 41  ? -2.090  19.933  -18.060 1.00 4.25  ? 41  GLU A H    1  
ATOM 574   H HA   . GLU A 1 41  ? -1.872  21.535  -16.412 1.00 4.04  ? 41  GLU A HA   1  
ATOM 575   H HB2  . GLU A 1 41  ? -4.365  21.962  -17.488 1.00 4.56  ? 41  GLU A HB2  1  
ATOM 576   H HB3  . GLU A 1 41  ? -4.784  21.707  -15.797 1.00 4.55  ? 41  GLU A HB3  1  
ATOM 577   H HG2  . GLU A 1 41  ? -4.381  24.036  -15.966 1.00 4.73  ? 41  GLU A HG2  1  
ATOM 578   H HG3  . GLU A 1 41  ? -2.903  23.380  -15.264 1.00 4.68  ? 41  GLU A HG3  1  
ATOM 579   N N    . ALA A 1 42  ? -3.706  19.248  -14.898 1.00 3.19  ? 42  ALA A N    1  
ATOM 580   C CA   . ALA A 1 42  ? -3.811  18.452  -13.624 1.00 3.24  ? 42  ALA A CA   1  
ATOM 581   C C    . ALA A 1 42  ? -3.508  19.329  -12.400 1.00 2.77  ? 42  ALA A C    1  
ATOM 582   O O    . ALA A 1 42  ? -2.440  19.222  -11.831 1.00 3.06  ? 42  ALA A O    1  
ATOM 583   C CB   . ALA A 1 42  ? -2.798  17.312  -13.665 1.00 4.08  ? 42  ALA A CB   1  
ATOM 584   H H    . ALA A 1 42  ? -4.257  18.992  -15.667 1.00 3.13  ? 42  ALA A H    1  
ATOM 585   H HA   . ALA A 1 42  ? -4.802  18.038  -13.540 1.00 3.53  ? 42  ALA A HA   1  
ATOM 586   H HB1  . ALA A 1 42  ? -3.016  16.665  -14.501 1.00 4.56  ? 42  ALA A HB1  1  
ATOM 587   H HB2  . ALA A 1 42  ? -2.857  16.748  -12.746 1.00 4.42  ? 42  ALA A HB2  1  
ATOM 588   H HB3  . ALA A 1 42  ? -1.804  17.720  -13.774 1.00 4.35  ? 42  ALA A HB3  1  
ATOM 589   N N    . PRO A 1 43  ? -4.429  20.188  -12.034 1.00 2.70  ? 43  PRO A N    1  
ATOM 590   C CA   . PRO A 1 43  ? -4.209  21.086  -10.889 1.00 3.03  ? 43  PRO A CA   1  
ATOM 591   C C    . PRO A 1 43  ? -3.993  20.264  -9.609  1.00 2.67  ? 43  PRO A C    1  
ATOM 592   O O    . PRO A 1 43  ? -3.438  20.742  -8.640  1.00 2.87  ? 43  PRO A O    1  
ATOM 593   C CB   . PRO A 1 43  ? -5.481  21.958  -10.815 1.00 3.84  ? 43  PRO A CB   1  
ATOM 594   C CG   . PRO A 1 43  ? -6.414  21.524  -11.986 1.00 3.86  ? 43  PRO A CG   1  
ATOM 595   C CD   . PRO A 1 43  ? -5.733  20.340  -12.710 1.00 3.12  ? 43  PRO A CD   1  
ATOM 596   H HA   . PRO A 1 43  ? -3.340  21.692  -11.095 1.00 3.46  ? 43  PRO A HA   1  
ATOM 597   H HB2  . PRO A 1 43  ? -5.982  21.806  -9.865  1.00 4.15  ? 43  PRO A HB2  1  
ATOM 598   H HB3  . PRO A 1 43  ? -5.221  23.001  -10.925 1.00 4.45  ? 43  PRO A HB3  1  
ATOM 599   H HG2  . PRO A 1 43  ? -7.378  21.217  -11.594 1.00 4.34  ? 43  PRO A HG2  1  
ATOM 600   H HG3  . PRO A 1 43  ? -6.549  22.346  -12.676 1.00 4.30  ? 43  PRO A HG3  1  
ATOM 601   H HD2  . PRO A 1 43  ? -6.327  19.443  -12.596 1.00 3.37  ? 43  PRO A HD2  1  
ATOM 602   H HD3  . PRO A 1 43  ? -5.584  20.564  -13.757 1.00 3.16  ? 43  PRO A HD3  1  
ATOM 603   N N    . GLU A 1 44  ? -4.422  19.031  -9.603  1.00 2.45  ? 44  GLU A N    1  
ATOM 604   C CA   . GLU A 1 44  ? -4.233  18.185  -8.392  1.00 2.23  ? 44  GLU A CA   1  
ATOM 605   C C    . GLU A 1 44  ? -2.762  17.763  -8.300  1.00 1.75  ? 44  GLU A C    1  
ATOM 606   O O    . GLU A 1 44  ? -1.913  18.537  -7.906  1.00 2.00  ? 44  GLU A O    1  
ATOM 607   C CB   . GLU A 1 44  ? -5.135  16.950  -8.489  1.00 2.55  ? 44  GLU A CB   1  
ATOM 608   C CG   . GLU A 1 44  ? -5.064  16.157  -7.182  1.00 2.70  ? 44  GLU A CG   1  
ATOM 609   C CD   . GLU A 1 44  ? -5.911  14.889  -7.308  1.00 3.17  ? 44  GLU A CD   1  
ATOM 610   O OE1  . GLU A 1 44  ? -7.115  15.017  -7.458  1.00 3.77  ? 44  GLU A OE1  1  
ATOM 611   O OE2  . GLU A 1 44  ? -5.341  13.812  -7.253  1.00 3.42  ? 44  GLU A OE2  1  
ATOM 612   H H    . GLU A 1 44  ? -4.863  18.662  -10.396 1.00 2.65  ? 44  GLU A H    1  
ATOM 613   H HA   . GLU A 1 44  ? -4.497  18.755  -7.512  1.00 2.52  ? 44  GLU A HA   1  
ATOM 614   H HB2  . GLU A 1 44  ? -6.154  17.266  -8.662  1.00 3.09  ? 44  GLU A HB2  1  
ATOM 615   H HB3  . GLU A 1 44  ? -4.811  16.327  -9.307  1.00 2.66  ? 44  GLU A HB3  1  
ATOM 616   H HG2  . GLU A 1 44  ? -4.038  15.888  -6.979  1.00 2.90  ? 44  GLU A HG2  1  
ATOM 617   H HG3  . GLU A 1 44  ? -5.445  16.762  -6.373  1.00 2.84  ? 44  GLU A HG3  1  
ATOM 618   N N    . LEU A 1 45  ? -2.445  16.549  -8.669  1.00 1.80  ? 45  LEU A N    1  
ATOM 619   C CA   . LEU A 1 45  ? -1.024  16.102  -8.608  1.00 1.80  ? 45  LEU A CA   1  
ATOM 620   C C    . LEU A 1 45  ? -0.208  16.888  -9.639  1.00 2.29  ? 45  LEU A C    1  
ATOM 621   O O    . LEU A 1 45  ? 0.163   16.373  -10.675 1.00 3.01  ? 45  LEU A O    1  
ATOM 622   C CB   . LEU A 1 45  ? -0.940  14.607  -8.928  1.00 2.23  ? 45  LEU A CB   1  
ATOM 623   C CG   . LEU A 1 45  ? -1.968  13.836  -8.094  1.00 2.52  ? 45  LEU A CG   1  
ATOM 624   C CD1  . LEU A 1 45  ? -1.915  12.354  -8.470  1.00 3.22  ? 45  LEU A CD1  1  
ATOM 625   C CD2  . LEU A 1 45  ? -1.651  13.997  -6.600  1.00 3.00  ? 45  LEU A CD2  1  
ATOM 626   H H    . LEU A 1 45  ? -3.136  15.937  -8.993  1.00 2.30  ? 45  LEU A H    1  
ATOM 627   H HA   . LEU A 1 45  ? -0.627  16.283  -7.619  1.00 1.80  ? 45  LEU A HA   1  
ATOM 628   H HB2  . LEU A 1 45  ? -1.143  14.454  -9.978  1.00 2.70  ? 45  LEU A HB2  1  
ATOM 629   H HB3  . LEU A 1 45  ? 0.050   14.246  -8.697  1.00 2.51  ? 45  LEU A HB3  1  
ATOM 630   H HG   . LEU A 1 45  ? -2.957  14.222  -8.297  1.00 2.66  ? 45  LEU A HG   1  
ATOM 631   H HD11 . LEU A 1 45  ? -2.620  11.803  -7.866  1.00 3.55  ? 45  LEU A HD11 1  
ATOM 632   H HD12 . LEU A 1 45  ? -0.919  11.974  -8.297  1.00 3.48  ? 45  LEU A HD12 1  
ATOM 633   H HD13 . LEU A 1 45  ? -2.168  12.238  -9.514  1.00 3.69  ? 45  LEU A HD13 1  
ATOM 634   H HD21 . LEU A 1 45  ? -2.159  13.226  -6.038  1.00 3.29  ? 45  LEU A HD21 1  
ATOM 635   H HD22 . LEU A 1 45  ? -1.988  14.965  -6.262  1.00 3.34  ? 45  LEU A HD22 1  
ATOM 636   H HD23 . LEU A 1 45  ? -0.586  13.911  -6.445  1.00 3.35  ? 45  LEU A HD23 1  
ATOM 637   N N    . ALA A 1 46  ? 0.065   18.136  -9.367  1.00 2.46  ? 46  ALA A N    1  
ATOM 638   C CA   . ALA A 1 46  ? 0.848   18.958  -10.334 1.00 3.15  ? 46  ALA A CA   1  
ATOM 639   C C    . ALA A 1 46  ? 2.299   18.474  -10.375 1.00 2.91  ? 46  ALA A C    1  
ATOM 640   O O    . ALA A 1 46  ? 2.681   17.697  -11.227 1.00 3.07  ? 46  ALA A O    1  
ATOM 641   C CB   . ALA A 1 46  ? 0.814   20.424  -9.898  1.00 4.05  ? 46  ALA A CB   1  
ATOM 642   H H    . ALA A 1 46  ? -0.249  18.534  -8.528  1.00 2.52  ? 46  ALA A H    1  
ATOM 643   H HA   . ALA A 1 46  ? 0.411   18.867  -11.318 1.00 3.67  ? 46  ALA A HA   1  
ATOM 644   H HB1  . ALA A 1 46  ? 1.439   21.010  -10.556 1.00 4.47  ? 46  ALA A HB1  1  
ATOM 645   H HB2  . ALA A 1 46  ? 1.180   20.507  -8.885  1.00 4.32  ? 46  ALA A HB2  1  
ATOM 646   H HB3  . ALA A 1 46  ? -0.201  20.791  -9.945  1.00 4.43  ? 46  ALA A HB3  1  
ATOM 647   N N    . LEU A 1 47  ? 3.112   18.930  -9.461  1.00 3.18  ? 47  LEU A N    1  
ATOM 648   C CA   . LEU A 1 47  ? 4.537   18.502  -9.448  1.00 3.43  ? 47  LEU A CA   1  
ATOM 649   C C    . LEU A 1 47  ? 4.607   17.019  -9.079  1.00 3.14  ? 47  LEU A C    1  
ATOM 650   O O    . LEU A 1 47  ? 4.886   16.659  -7.952  1.00 3.51  ? 47  LEU A O    1  
ATOM 651   C CB   . LEU A 1 47  ? 5.316   19.357  -8.435  1.00 4.05  ? 47  LEU A CB   1  
ATOM 652   C CG   . LEU A 1 47  ? 6.803   19.456  -8.826  1.00 4.77  ? 47  LEU A CG   1  
ATOM 653   C CD1  . LEU A 1 47  ? 7.385   18.050  -9.007  1.00 5.26  ? 47  LEU A CD1  1  
ATOM 654   C CD2  . LEU A 1 47  ? 6.975   20.268  -10.130 1.00 5.35  ? 47  LEU A CD2  1  
ATOM 655   H H    . LEU A 1 47  ? 2.785   19.554  -8.787  1.00 3.59  ? 47  LEU A H    1  
ATOM 656   H HA   . LEU A 1 47  ? 4.951   18.629  -10.435 1.00 3.88  ? 47  LEU A HA   1  
ATOM 657   H HB2  . LEU A 1 47  ? 4.887   20.346  -8.410  1.00 4.17  ? 47  LEU A HB2  1  
ATOM 658   H HB3  . LEU A 1 47  ? 5.235   18.914  -7.455  1.00 4.35  ? 47  LEU A HB3  1  
ATOM 659   H HG   . LEU A 1 47  ? 7.338   19.953  -8.028  1.00 5.01  ? 47  LEU A HG   1  
ATOM 660   H HD11 . LEU A 1 47  ? 8.462   18.112  -9.056  1.00 5.48  ? 47  LEU A HD11 1  
ATOM 661   H HD12 . LEU A 1 47  ? 7.008   17.619  -9.922  1.00 5.52  ? 47  LEU A HD12 1  
ATOM 662   H HD13 . LEU A 1 47  ? 7.099   17.430  -8.171  1.00 5.56  ? 47  LEU A HD13 1  
ATOM 663   H HD21 . LEU A 1 47  ? 6.958   19.607  -10.986 1.00 5.82  ? 47  LEU A HD21 1  
ATOM 664   H HD22 . LEU A 1 47  ? 7.922   20.784  -10.103 1.00 5.59  ? 47  LEU A HD22 1  
ATOM 665   H HD23 . LEU A 1 47  ? 6.179   20.994  -10.222 1.00 5.48  ? 47  LEU A HD23 1  
ATOM 666   N N    . ASP A 1 48  ? 4.366   16.153  -10.019 1.00 3.02  ? 48  ASP A N    1  
ATOM 667   C CA   . ASP A 1 48  ? 4.432   14.690  -9.720  1.00 3.07  ? 48  ASP A CA   1  
ATOM 668   C C    . ASP A 1 48  ? 4.808   13.916  -11.013 1.00 2.77  ? 48  ASP A C    1  
ATOM 669   O O    . ASP A 1 48  ? 4.371   14.295  -12.081 1.00 2.85  ? 48  ASP A O    1  
ATOM 670   C CB   . ASP A 1 48  ? 3.060   14.219  -9.187  1.00 3.61  ? 48  ASP A CB   1  
ATOM 671   C CG   . ASP A 1 48  ? 2.129   13.823  -10.342 1.00 4.22  ? 48  ASP A CG   1  
ATOM 672   O OD1  . ASP A 1 48  ? 1.873   14.665  -11.186 1.00 4.68  ? 48  ASP A OD1  1  
ATOM 673   O OD2  . ASP A 1 48  ? 1.690   12.684  -10.360 1.00 4.69  ? 48  ASP A OD2  1  
ATOM 674   H H    . ASP A 1 48  ? 4.148   16.466  -10.918 1.00 3.25  ? 48  ASP A H    1  
ATOM 675   H HA   . ASP A 1 48  ? 5.176   14.534  -8.959  1.00 3.56  ? 48  ASP A HA   1  
ATOM 676   H HB2  . ASP A 1 48  ? 3.203   13.370  -8.535  1.00 4.01  ? 48  ASP A HB2  1  
ATOM 677   H HB3  . ASP A 1 48  ? 2.601   15.024  -8.631  1.00 3.81  ? 48  ASP A HB3  1  
ATOM 678   N N    . PRO A 1 49  ? 5.584   12.846  -10.899 1.00 3.11  ? 49  PRO A N    1  
ATOM 679   C CA   . PRO A 1 49  ? 5.964   12.047  -12.087 1.00 3.40  ? 49  PRO A CA   1  
ATOM 680   C C    . PRO A 1 49  ? 4.689   11.518  -12.759 1.00 3.08  ? 49  PRO A C    1  
ATOM 681   O O    . PRO A 1 49  ? 3.586   11.891  -12.411 1.00 3.32  ? 49  PRO A O    1  
ATOM 682   C CB   . PRO A 1 49  ? 6.836   10.896  -11.532 1.00 4.36  ? 49  PRO A CB   1  
ATOM 683   C CG   . PRO A 1 49  ? 6.885   11.051  -9.983  1.00 4.66  ? 49  PRO A CG   1  
ATOM 684   C CD   . PRO A 1 49  ? 6.138   12.350  -9.620  1.00 3.86  ? 49  PRO A CD   1  
ATOM 685   H HA   . PRO A 1 49  ? 6.531   12.651  -12.779 1.00 3.68  ? 49  PRO A HA   1  
ATOM 686   H HB2  . PRO A 1 49  ? 6.408   9.935   -11.797 1.00 4.57  ? 49  PRO A HB2  1  
ATOM 687   H HB3  . PRO A 1 49  ? 7.838   10.967  -11.933 1.00 4.94  ? 49  PRO A HB3  1  
ATOM 688   H HG2  . PRO A 1 49  ? 6.404   10.202  -9.512  1.00 5.13  ? 49  PRO A HG2  1  
ATOM 689   H HG3  . PRO A 1 49  ? 7.912   11.118  -9.650  1.00 5.26  ? 49  PRO A HG3  1  
ATOM 690   H HD2  . PRO A 1 49  ? 5.341   12.150  -8.915  1.00 4.06  ? 49  PRO A HD2  1  
ATOM 691   H HD3  . PRO A 1 49  ? 6.831   13.072  -9.212  1.00 4.03  ? 49  PRO A HD3  1  
ATOM 692   N N    . VAL A 1 50  ? 4.839   10.627  -13.714 1.00 3.08  ? 50  VAL A N    1  
ATOM 693   C CA   . VAL A 1 50  ? 3.648   10.046  -14.404 1.00 3.10  ? 50  VAL A CA   1  
ATOM 694   C C    . VAL A 1 50  ? 4.001   8.615   -14.854 1.00 2.75  ? 50  VAL A C    1  
ATOM 695   O O    . VAL A 1 50  ? 5.157   8.338   -15.108 1.00 2.91  ? 50  VAL A O    1  
ATOM 696   C CB   . VAL A 1 50  ? 3.319   10.907  -15.628 1.00 3.88  ? 50  VAL A CB   1  
ATOM 697   C CG1  . VAL A 1 50  ? 2.664   12.214  -15.179 1.00 4.44  ? 50  VAL A CG1  1  
ATOM 698   C CG2  . VAL A 1 50  ? 4.612   11.224  -16.383 1.00 4.50  ? 50  VAL A CG2  1  
ATOM 699   H H    . VAL A 1 50  ? 5.737   10.333  -13.968 1.00 3.41  ? 50  VAL A H    1  
ATOM 700   H HA   . VAL A 1 50  ? 2.823   10.049  -13.706 1.00 3.39  ? 50  VAL A HA   1  
ATOM 701   H HB   . VAL A 1 50  ? 2.649   10.373  -16.278 1.00 4.18  ? 50  VAL A HB   1  
ATOM 702   H HG11 . VAL A 1 50  ? 1.813   11.993  -14.552 1.00 4.70  ? 50  VAL A HG11 1  
ATOM 703   H HG12 . VAL A 1 50  ? 2.338   12.769  -16.046 1.00 4.81  ? 50  VAL A HG12 1  
ATOM 704   H HG13 . VAL A 1 50  ? 3.378   12.802  -14.623 1.00 4.69  ? 50  VAL A HG13 1  
ATOM 705   H HG21 . VAL A 1 50  ? 4.374   11.715  -17.315 1.00 4.87  ? 50  VAL A HG21 1  
ATOM 706   H HG22 . VAL A 1 50  ? 5.144   10.306  -16.586 1.00 4.87  ? 50  VAL A HG22 1  
ATOM 707   H HG23 . VAL A 1 50  ? 5.231   11.874  -15.783 1.00 4.69  ? 50  VAL A HG23 1  
ATOM 708   N N    . PRO A 1 51  ? 3.022   7.738   -14.954 1.00 2.91  ? 51  PRO A N    1  
ATOM 709   C CA   . PRO A 1 51  ? 3.285   6.351   -15.388 1.00 3.22  ? 51  PRO A CA   1  
ATOM 710   C C    . PRO A 1 51  ? 4.157   6.358   -16.653 1.00 2.93  ? 51  PRO A C    1  
ATOM 711   O O    . PRO A 1 51  ? 3.745   6.805   -17.704 1.00 3.37  ? 51  PRO A O    1  
ATOM 712   C CB   . PRO A 1 51  ? 1.887   5.744   -15.644 1.00 4.09  ? 51  PRO A CB   1  
ATOM 713   C CG   . PRO A 1 51  ? 0.834   6.794   -15.174 1.00 4.27  ? 51  PRO A CG   1  
ATOM 714   C CD   . PRO A 1 51  ? 1.605   8.032   -14.658 1.00 3.50  ? 51  PRO A CD   1  
ATOM 715   H HA   . PRO A 1 51  ? 3.785   5.808   -14.599 1.00 3.54  ? 51  PRO A HA   1  
ATOM 716   H HB2  . PRO A 1 51  ? 1.757   5.532   -16.699 1.00 4.31  ? 51  PRO A HB2  1  
ATOM 717   H HB3  . PRO A 1 51  ? 1.769   4.832   -15.074 1.00 4.69  ? 51  PRO A HB3  1  
ATOM 718   H HG2  . PRO A 1 51  ? 0.197   7.072   -16.006 1.00 4.68  ? 51  PRO A HG2  1  
ATOM 719   H HG3  . PRO A 1 51  ? 0.229   6.382   -14.377 1.00 4.85  ? 51  PRO A HG3  1  
ATOM 720   H HD2  . PRO A 1 51  ? 1.277   8.922   -15.174 1.00 3.62  ? 51  PRO A HD2  1  
ATOM 721   H HD3  . PRO A 1 51  ? 1.469   8.139   -13.591 1.00 3.69  ? 51  PRO A HD3  1  
ATOM 722   N N    . GLN A 1 52  ? 5.353   5.845   -16.553 1.00 2.70  ? 52  GLN A N    1  
ATOM 723   C CA   . GLN A 1 52  ? 6.258   5.796   -17.737 1.00 2.85  ? 52  GLN A CA   1  
ATOM 724   C C    . GLN A 1 52  ? 7.504   4.984   -17.368 1.00 2.14  ? 52  GLN A C    1  
ATOM 725   O O    . GLN A 1 52  ? 8.418   5.487   -16.748 1.00 2.38  ? 52  GLN A O    1  
ATOM 726   C CB   . GLN A 1 52  ? 6.663   7.224   -18.137 1.00 3.67  ? 52  GLN A CB   1  
ATOM 727   C CG   . GLN A 1 52  ? 7.136   7.248   -19.599 1.00 4.37  ? 52  GLN A CG   1  
ATOM 728   C CD   . GLN A 1 52  ? 5.926   7.279   -20.537 1.00 5.22  ? 52  GLN A CD   1  
ATOM 729   O OE1  . GLN A 1 52  ? 5.355   8.325   -20.777 1.00 5.74  ? 52  GLN A OE1  1  
ATOM 730   N NE2  . GLN A 1 52  ? 5.509   6.169   -21.083 1.00 5.74  ? 52  GLN A NE2  1  
ATOM 731   H H    . GLN A 1 52  ? 5.656   5.480   -15.695 1.00 2.82  ? 52  GLN A H    1  
ATOM 732   H HA   . GLN A 1 52  ? 5.746   5.318   -18.560 1.00 3.35  ? 52  GLN A HA   1  
ATOM 733   H HB2  . GLN A 1 52  ? 5.813   7.882   -18.022 1.00 4.06  ? 52  GLN A HB2  1  
ATOM 734   H HB3  . GLN A 1 52  ? 7.464   7.566   -17.498 1.00 3.91  ? 52  GLN A HB3  1  
ATOM 735   H HG2  . GLN A 1 52  ? 7.741   8.128   -19.762 1.00 4.50  ? 52  GLN A HG2  1  
ATOM 736   H HG3  . GLN A 1 52  ? 7.724   6.366   -19.807 1.00 4.63  ? 52  GLN A HG3  1  
ATOM 737   H HE21 . GLN A 1 52  ? 5.970   5.326   -20.891 1.00 5.63  ? 52  GLN A HE21 1  
ATOM 738   H HE22 . GLN A 1 52  ? 4.736   6.179   -21.685 1.00 6.45  ? 52  GLN A HE22 1  
ATOM 739   N N    . ASP A 1 53  ? 7.547   3.732   -17.744 1.00 1.78  ? 53  ASP A N    1  
ATOM 740   C CA   . ASP A 1 53  ? 8.725   2.869   -17.423 1.00 1.30  ? 53  ASP A CA   1  
ATOM 741   C C    . ASP A 1 53  ? 8.299   1.409   -17.634 1.00 1.07  ? 53  ASP A C    1  
ATOM 742   O O    . ASP A 1 53  ? 7.344   0.938   -17.049 1.00 1.19  ? 53  ASP A O    1  
ATOM 743   C CB   . ASP A 1 53  ? 9.182   3.093   -15.959 1.00 1.65  ? 53  ASP A CB   1  
ATOM 744   C CG   . ASP A 1 53  ? 10.412  4.011   -15.909 1.00 2.27  ? 53  ASP A CG   1  
ATOM 745   O OD1  . ASP A 1 53  ? 10.645  4.720   -16.875 1.00 2.91  ? 53  ASP A OD1  1  
ATOM 746   O OD2  . ASP A 1 53  ? 11.101  3.986   -14.902 1.00 2.80  ? 53  ASP A OD2  1  
ATOM 747   H H    . ASP A 1 53  ? 6.806   3.338   -18.251 1.00 2.24  ? 53  ASP A H    1  
ATOM 748   H HA   . ASP A 1 53  ? 9.526   3.087   -18.116 1.00 1.41  ? 53  ASP A HA   1  
ATOM 749   H HB2  . ASP A 1 53  ? 8.379   3.547   -15.399 1.00 2.08  ? 53  ASP A HB2  1  
ATOM 750   H HB3  . ASP A 1 53  ? 9.436   2.145   -15.504 1.00 2.01  ? 53  ASP A HB3  1  
ATOM 751   N N    . ALA A 1 54  ? 8.994   0.702   -18.481 1.00 0.91  ? 54  ALA A N    1  
ATOM 752   C CA   . ALA A 1 54  ? 8.626   -0.716  -18.754 1.00 0.84  ? 54  ALA A CA   1  
ATOM 753   C C    . ALA A 1 54  ? 8.672   -1.537  -17.462 1.00 0.76  ? 54  ALA A C    1  
ATOM 754   O O    . ALA A 1 54  ? 7.980   -2.527  -17.326 1.00 0.75  ? 54  ALA A O    1  
ATOM 755   C CB   . ALA A 1 54  ? 9.606   -1.310  -19.769 1.00 0.95  ? 54  ALA A CB   1  
ATOM 756   H H    . ALA A 1 54  ? 9.753   1.111   -18.949 1.00 0.99  ? 54  ALA A H    1  
ATOM 757   H HA   . ALA A 1 54  ? 7.625   -0.744  -19.163 1.00 0.99  ? 54  ALA A HA   1  
ATOM 758   H HB1  . ALA A 1 54  ? 9.568   -0.737  -20.684 1.00 1.41  ? 54  ALA A HB1  1  
ATOM 759   H HB2  . ALA A 1 54  ? 9.334   -2.335  -19.974 1.00 1.35  ? 54  ALA A HB2  1  
ATOM 760   H HB3  . ALA A 1 54  ? 10.606  -1.276  -19.364 1.00 1.49  ? 54  ALA A HB3  1  
ATOM 761   N N    . SER A 1 55  ? 9.471   -1.139  -16.505 1.00 0.75  ? 55  SER A N    1  
ATOM 762   C CA   . SER A 1 55  ? 9.538   -1.910  -15.229 1.00 0.71  ? 55  SER A CA   1  
ATOM 763   C C    . SER A 1 55  ? 8.355   -1.520  -14.346 1.00 0.66  ? 55  SER A C    1  
ATOM 764   O O    . SER A 1 55  ? 7.614   -2.357  -13.871 1.00 0.66  ? 55  SER A O    1  
ATOM 765   C CB   . SER A 1 55  ? 10.847  -1.590  -14.498 1.00 0.76  ? 55  SER A CB   1  
ATOM 766   O OG   . SER A 1 55  ? 11.155  -0.214  -14.672 1.00 1.37  ? 55  SER A OG   1  
ATOM 767   H H    . SER A 1 55  ? 10.018  -0.333  -16.614 1.00 0.79  ? 55  SER A H    1  
ATOM 768   H HA   . SER A 1 55  ? 9.492   -2.968  -15.448 1.00 0.71  ? 55  SER A HA   1  
ATOM 769   H HB2  . SER A 1 55  ? 10.740  -1.799  -13.443 1.00 0.95  ? 55  SER A HB2  1  
ATOM 770   H HB3  . SER A 1 55  ? 11.642  -2.201  -14.903 1.00 1.26  ? 55  SER A HB3  1  
ATOM 771   H HG   . SER A 1 55  ? 10.579  0.294   -14.096 1.00 1.82  ? 55  SER A HG   1  
ATOM 772   N N    . THR A 1 56  ? 8.188   -0.249  -14.109 1.00 0.65  ? 56  THR A N    1  
ATOM 773   C CA   . THR A 1 56  ? 7.071   0.200   -13.239 1.00 0.62  ? 56  THR A CA   1  
ATOM 774   C C    . THR A 1 56  ? 5.747   -0.060  -13.954 1.00 0.59  ? 56  THR A C    1  
ATOM 775   O O    . THR A 1 56  ? 4.706   -0.198  -13.340 1.00 0.57  ? 56  THR A O    1  
ATOM 776   C CB   . THR A 1 56  ? 7.232   1.696   -12.946 1.00 0.67  ? 56  THR A CB   1  
ATOM 777   O OG1  . THR A 1 56  ? 8.607   1.987   -12.730 1.00 1.09  ? 56  THR A OG1  1  
ATOM 778   C CG2  . THR A 1 56  ? 6.437   2.063   -11.700 1.00 1.06  ? 56  THR A CG2  1  
ATOM 779   H H    . THR A 1 56  ? 8.804   0.407   -14.497 1.00 0.67  ? 56  THR A H    1  
ATOM 780   H HA   . THR A 1 56  ? 7.111   -0.370  -12.323 1.00 0.61  ? 56  THR A HA   1  
ATOM 781   H HB   . THR A 1 56  ? 6.870   2.273   -13.783 1.00 1.01  ? 56  THR A HB   1  
ATOM 782   H HG1  . THR A 1 56  ? 8.729   2.167   -11.795 1.00 1.69  ? 56  THR A HG1  1  
ATOM 783   H HG21 . THR A 1 56  ? 5.392   1.842   -11.861 1.00 1.65  ? 56  THR A HG21 1  
ATOM 784   H HG22 . THR A 1 56  ? 6.556   3.116   -11.491 1.00 1.60  ? 56  THR A HG22 1  
ATOM 785   H HG23 . THR A 1 56  ? 6.804   1.486   -10.871 1.00 1.42  ? 56  THR A HG23 1  
ATOM 786   N N    . LYS A 1 57  ? 5.785   -0.125  -15.253 1.00 0.61  ? 57  LYS A N    1  
ATOM 787   C CA   . LYS A 1 57  ? 4.542   -0.369  -16.027 1.00 0.59  ? 57  LYS A CA   1  
ATOM 788   C C    . LYS A 1 57  ? 4.073   -1.810  -15.808 1.00 0.54  ? 57  LYS A C    1  
ATOM 789   O O    . LYS A 1 57  ? 2.892   -2.075  -15.692 1.00 0.52  ? 57  LYS A O    1  
ATOM 790   C CB   . LYS A 1 57  ? 4.833   -0.123  -17.513 1.00 0.65  ? 57  LYS A CB   1  
ATOM 791   C CG   . LYS A 1 57  ? 3.649   -0.598  -18.396 1.00 1.20  ? 57  LYS A CG   1  
ATOM 792   C CD   . LYS A 1 57  ? 3.931   -1.987  -18.999 1.00 1.33  ? 57  LYS A CD   1  
ATOM 793   C CE   . LYS A 1 57  ? 2.936   -2.258  -20.127 1.00 1.94  ? 57  LYS A CE   1  
ATOM 794   N NZ   . LYS A 1 57  ? 3.027   -3.687  -20.540 1.00 2.73  ? 57  LYS A NZ   1  
ATOM 795   H H    . LYS A 1 57  ? 6.637   -0.009  -15.722 1.00 0.68  ? 57  LYS A H    1  
ATOM 796   H HA   . LYS A 1 57  ? 3.774   0.313   -15.692 1.00 0.59  ? 57  LYS A HA   1  
ATOM 797   H HB2  . LYS A 1 57  ? 4.989   0.938   -17.663 1.00 0.96  ? 57  LYS A HB2  1  
ATOM 798   H HB3  . LYS A 1 57  ? 5.734   -0.649  -17.784 1.00 1.25  ? 57  LYS A HB3  1  
ATOM 799   H HG2  . LYS A 1 57  ? 2.746   -0.648  -17.803 1.00 1.84  ? 57  LYS A HG2  1  
ATOM 800   H HG3  . LYS A 1 57  ? 3.499   0.109   -19.201 1.00 1.68  ? 57  LYS A HG3  1  
ATOM 801   H HD2  . LYS A 1 57  ? 4.934   -2.018  -19.399 1.00 1.66  ? 57  LYS A HD2  1  
ATOM 802   H HD3  . LYS A 1 57  ? 3.821   -2.742  -18.236 1.00 1.74  ? 57  LYS A HD3  1  
ATOM 803   H HE2  . LYS A 1 57  ? 1.935   -2.045  -19.784 1.00 2.29  ? 57  LYS A HE2  1  
ATOM 804   H HE3  . LYS A 1 57  ? 3.171   -1.624  -20.969 1.00 2.31  ? 57  LYS A HE3  1  
ATOM 805   H HZ1  . LYS A 1 57  ? 2.232   -3.917  -21.169 1.00 3.19  ? 57  LYS A HZ1  1  
ATOM 806   H HZ2  . LYS A 1 57  ? 2.990   -4.294  -19.696 1.00 3.07  ? 57  LYS A HZ2  1  
ATOM 807   H HZ3  . LYS A 1 57  ? 3.922   -3.846  -21.044 1.00 3.14  ? 57  LYS A HZ3  1  
ATOM 808   N N    . LYS A 1 58  ? 4.982   -2.747  -15.745 1.00 0.55  ? 58  LYS A N    1  
ATOM 809   C CA   . LYS A 1 58  ? 4.561   -4.161  -15.530 1.00 0.53  ? 58  LYS A CA   1  
ATOM 810   C C    . LYS A 1 58  ? 4.087   -4.318  -14.081 1.00 0.48  ? 58  LYS A C    1  
ATOM 811   O O    . LYS A 1 58  ? 3.081   -4.950  -13.824 1.00 0.46  ? 58  LYS A O    1  
ATOM 812   C CB   . LYS A 1 58  ? 5.745   -5.101  -15.831 1.00 0.56  ? 58  LYS A CB   1  
ATOM 813   C CG   . LYS A 1 58  ? 5.422   -6.564  -15.464 1.00 0.78  ? 58  LYS A CG   1  
ATOM 814   C CD   . LYS A 1 58  ? 4.445   -7.165  -16.479 1.00 0.96  ? 58  LYS A CD   1  
ATOM 815   C CE   . LYS A 1 58  ? 4.214   -8.638  -16.143 1.00 0.85  ? 58  LYS A CE   1  
ATOM 816   N NZ   . LYS A 1 58  ? 3.468   -8.740  -14.857 1.00 1.75  ? 58  LYS A NZ   1  
ATOM 817   H H    . LYS A 1 58  ? 5.933   -2.524  -15.837 1.00 0.59  ? 58  LYS A H    1  
ATOM 818   H HA   . LYS A 1 58  ? 3.737   -4.370  -16.193 1.00 0.53  ? 58  LYS A HA   1  
ATOM 819   H HB2  . LYS A 1 58  ? 5.979   -5.047  -16.883 1.00 0.79  ? 58  LYS A HB2  1  
ATOM 820   H HB3  . LYS A 1 58  ? 6.605   -4.777  -15.262 1.00 0.71  ? 58  LYS A HB3  1  
ATOM 821   H HG2  . LYS A 1 58  ? 6.338   -7.138  -15.477 1.00 1.49  ? 58  LYS A HG2  1  
ATOM 822   H HG3  . LYS A 1 58  ? 4.991   -6.618  -14.478 1.00 1.56  ? 58  LYS A HG3  1  
ATOM 823   H HD2  . LYS A 1 58  ? 3.505   -6.638  -16.436 1.00 1.72  ? 58  LYS A HD2  1  
ATOM 824   H HD3  . LYS A 1 58  ? 4.861   -7.085  -17.472 1.00 1.67  ? 58  LYS A HD3  1  
ATOM 825   H HE2  . LYS A 1 58  ? 3.639   -9.102  -16.931 1.00 1.27  ? 58  LYS A HE2  1  
ATOM 826   H HE3  . LYS A 1 58  ? 5.166   -9.140  -16.046 1.00 1.24  ? 58  LYS A HE3  1  
ATOM 827   H HZ1  . LYS A 1 58  ? 4.020   -8.293  -14.099 1.00 2.20  ? 58  LYS A HZ1  1  
ATOM 828   H HZ2  . LYS A 1 58  ? 3.309   -9.743  -14.627 1.00 2.19  ? 58  LYS A HZ2  1  
ATOM 829   H HZ3  . LYS A 1 58  ? 2.552   -8.256  -14.948 1.00 2.31  ? 58  LYS A HZ3  1  
ATOM 830   N N    . LEU A 1 59  ? 4.796   -3.781  -13.126 1.00 0.50  ? 59  LEU A N    1  
ATOM 831   C CA   . LEU A 1 59  ? 4.346   -3.959  -11.717 1.00 0.47  ? 59  LEU A CA   1  
ATOM 832   C C    . LEU A 1 59  ? 2.946   -3.342  -11.563 1.00 0.43  ? 59  LEU A C    1  
ATOM 833   O O    . LEU A 1 59  ? 2.200   -3.683  -10.667 1.00 0.42  ? 59  LEU A O    1  
ATOM 834   C CB   . LEU A 1 59  ? 5.341   -3.284  -10.744 1.00 0.53  ? 59  LEU A CB   1  
ATOM 835   C CG   . LEU A 1 59  ? 6.251   -4.312  -10.044 1.00 0.71  ? 59  LEU A CG   1  
ATOM 836   C CD1  . LEU A 1 59  ? 7.382   -3.549  -9.347  1.00 1.07  ? 59  LEU A CD1  1  
ATOM 837   C CD2  . LEU A 1 59  ? 5.455   -5.078  -8.976  1.00 1.34  ? 59  LEU A CD2  1  
ATOM 838   H H    . LEU A 1 59  ? 5.618   -3.287  -13.331 1.00 0.54  ? 59  LEU A H    1  
ATOM 839   H HA   . LEU A 1 59  ? 4.276   -5.017  -11.532 1.00 0.47  ? 59  LEU A HA   1  
ATOM 840   H HB2  . LEU A 1 59  ? 5.957   -2.594  -11.300 1.00 0.91  ? 59  LEU A HB2  1  
ATOM 841   H HB3  . LEU A 1 59  ? 4.795   -2.734  -9.991  1.00 0.65  ? 59  LEU A HB3  1  
ATOM 842   H HG   . LEU A 1 59  ? 6.661   -5.000  -10.770 1.00 1.29  ? 59  LEU A HG   1  
ATOM 843   H HD11 . LEU A 1 59  ? 8.008   -4.245  -8.808  1.00 1.68  ? 59  LEU A HD11 1  
ATOM 844   H HD12 . LEU A 1 59  ? 6.961   -2.834  -8.656  1.00 1.59  ? 59  LEU A HD12 1  
ATOM 845   H HD13 . LEU A 1 59  ? 7.974   -3.030  -10.086 1.00 1.49  ? 59  LEU A HD13 1  
ATOM 846   H HD21 . LEU A 1 59  ? 4.893   -4.381  -8.372  1.00 1.91  ? 59  LEU A HD21 1  
ATOM 847   H HD22 . LEU A 1 59  ? 6.140   -5.623  -8.344  1.00 1.91  ? 59  LEU A HD22 1  
ATOM 848   H HD23 . LEU A 1 59  ? 4.779   -5.773  -9.447  1.00 1.77  ? 59  LEU A HD23 1  
ATOM 849   N N    . SER A 1 60  ? 2.577   -2.462  -12.457 1.00 0.43  ? 60  SER A N    1  
ATOM 850   C CA   . SER A 1 60  ? 1.216   -1.853  -12.391 1.00 0.42  ? 60  SER A CA   1  
ATOM 851   C C    . SER A 1 60  ? 0.215   -2.911  -12.860 1.00 0.39  ? 60  SER A C    1  
ATOM 852   O O    . SER A 1 60  ? -0.869  -3.041  -12.330 1.00 0.41  ? 60  SER A O    1  
ATOM 853   C CB   . SER A 1 60  ? 1.155   -0.640  -13.318 1.00 0.47  ? 60  SER A CB   1  
ATOM 854   O OG   . SER A 1 60  ? -0.102  0.004   -13.164 1.00 1.36  ? 60  SER A OG   1  
ATOM 855   H H    . SER A 1 60  ? 3.185   -2.227  -13.191 1.00 0.45  ? 60  SER A H    1  
ATOM 856   H HA   . SER A 1 60  ? 0.997   -1.549  -11.377 1.00 0.43  ? 60  SER A HA   1  
ATOM 857   H HB2  . SER A 1 60  ? 1.941   0.051   -13.062 1.00 1.13  ? 60  SER A HB2  1  
ATOM 858   H HB3  . SER A 1 60  ? 1.283   -0.964  -14.343 1.00 1.04  ? 60  SER A HB3  1  
ATOM 859   H HG   . SER A 1 60  ? -0.380  -0.103  -12.250 1.00 1.79  ? 60  SER A HG   1  
ATOM 860   N N    . GLU A 1 61  ? 0.602   -3.694  -13.827 1.00 0.38  ? 61  GLU A N    1  
ATOM 861   C CA   . GLU A 1 61  ? -0.281  -4.789  -14.323 1.00 0.38  ? 61  GLU A CA   1  
ATOM 862   C C    . GLU A 1 61  ? -0.594  -5.749  -13.171 1.00 0.38  ? 61  GLU A C    1  
ATOM 863   O O    . GLU A 1 61  ? -1.659  -6.331  -13.126 1.00 0.41  ? 61  GLU A O    1  
ATOM 864   C CB   . GLU A 1 61  ? 0.428   -5.549  -15.446 1.00 0.39  ? 61  GLU A CB   1  
ATOM 865   C CG   . GLU A 1 61  ? -0.546  -6.545  -16.079 1.00 1.06  ? 61  GLU A CG   1  
ATOM 866   C CD   . GLU A 1 61  ? 0.119   -7.221  -17.278 1.00 1.67  ? 61  GLU A CD   1  
ATOM 867   O OE1  . GLU A 1 61  ? 0.419   -6.525  -18.235 1.00 2.25  ? 61  GLU A OE1  1  
ATOM 868   O OE2  . GLU A 1 61  ? 0.316   -8.423  -17.221 1.00 2.40  ? 61  GLU A OE2  1  
ATOM 869   H H    . GLU A 1 61  ? 1.502   -3.583  -14.203 1.00 0.41  ? 61  GLU A H    1  
ATOM 870   H HA   . GLU A 1 61  ? -1.234  -4.435  -14.682 1.00 0.41  ? 61  GLU A HA   1  
ATOM 871   H HB2  . GLU A 1 61  ? 0.766   -4.847  -16.196 1.00 0.98  ? 61  GLU A HB2  1  
ATOM 872   H HB3  . GLU A 1 61  ? 1.275   -6.082  -15.043 1.00 0.88  ? 61  GLU A HB3  1  
ATOM 873   H HG2  . GLU A 1 61  ? -0.820  -7.292  -15.349 1.00 1.80  ? 61  GLU A HG2  1  
ATOM 874   H HG3  . GLU A 1 61  ? -1.432  -6.022  -16.408 1.00 1.66  ? 61  GLU A HG3  1  
ATOM 875   N N    . CYS A 1 62  ? 0.299   -5.925  -12.239 1.00 0.37  ? 62  CYS A N    1  
ATOM 876   C CA   . CYS A 1 62  ? -0.001  -6.854  -11.109 1.00 0.39  ? 62  CYS A CA   1  
ATOM 877   C C    . CYS A 1 62  ? -1.003  -6.190  -10.151 1.00 0.38  ? 62  CYS A C    1  
ATOM 878   O O    . CYS A 1 62  ? -1.988  -6.784  -9.758  1.00 0.44  ? 62  CYS A O    1  
ATOM 879   C CB   . CYS A 1 62  ? 1.291   -7.176  -10.357 1.00 0.41  ? 62  CYS A CB   1  
ATOM 880   S SG   . CYS A 1 62  ? 2.400   -8.112  -11.438 1.00 1.62  ? 62  CYS A SG   1  
ATOM 881   H H    . CYS A 1 62  ? 1.159   -5.456  -12.282 1.00 0.36  ? 62  CYS A H    1  
ATOM 882   H HA   . CYS A 1 62  ? -0.422  -7.764  -11.510 1.00 0.40  ? 62  CYS A HA   1  
ATOM 883   H HB2  . CYS A 1 62  ? 1.771   -6.257  -10.057 1.00 0.95  ? 62  CYS A HB2  1  
ATOM 884   H HB3  . CYS A 1 62  ? 1.060   -7.765  -9.481  1.00 1.06  ? 62  CYS A HB3  1  
ATOM 885   H HG   . CYS A 1 62  ? 1.918   -8.872  -11.771 1.00 2.03  ? 62  CYS A HG   1  
ATOM 886   N N    . LEU A 1 63  ? -0.762  -4.958  -9.792  1.00 0.35  ? 63  LEU A N    1  
ATOM 887   C CA   . LEU A 1 63  ? -1.689  -4.224  -8.880  1.00 0.36  ? 63  LEU A CA   1  
ATOM 888   C C    . LEU A 1 63  ? -2.994  -3.907  -9.627  1.00 0.36  ? 63  LEU A C    1  
ATOM 889   O O    . LEU A 1 63  ? -4.044  -3.769  -9.032  1.00 0.41  ? 63  LEU A O    1  
ATOM 890   C CB   . LEU A 1 63  ? -0.987  -2.932  -8.431  1.00 0.38  ? 63  LEU A CB   1  
ATOM 891   C CG   . LEU A 1 63  ? -1.873  -2.089  -7.493  1.00 0.69  ? 63  LEU A CG   1  
ATOM 892   C CD1  . LEU A 1 63  ? -2.487  -2.957  -6.379  1.00 1.39  ? 63  LEU A CD1  1  
ATOM 893   C CD2  . LEU A 1 63  ? -1.012  -0.983  -6.851  1.00 1.11  ? 63  LEU A CD2  1  
ATOM 894   H H    . LEU A 1 63  ? 0.030   -4.495  -10.135 1.00 0.37  ? 63  LEU A H    1  
ATOM 895   H HA   . LEU A 1 63  ? -1.933  -4.811  -8.016  1.00 0.39  ? 63  LEU A HA   1  
ATOM 896   H HB2  . LEU A 1 63  ? -0.075  -3.191  -7.914  1.00 0.65  ? 63  LEU A HB2  1  
ATOM 897   H HB3  . LEU A 1 63  ? -0.740  -2.345  -9.304  1.00 0.46  ? 63  LEU A HB3  1  
ATOM 898   H HG   . LEU A 1 63  ? -2.665  -1.635  -8.068  1.00 1.38  ? 63  LEU A HG   1  
ATOM 899   H HD11 . LEU A 1 63  ? -3.340  -3.495  -6.767  1.00 1.91  ? 63  LEU A HD11 1  
ATOM 900   H HD12 . LEU A 1 63  ? -2.808  -2.326  -5.563  1.00 1.98  ? 63  LEU A HD12 1  
ATOM 901   H HD13 . LEU A 1 63  ? -1.749  -3.659  -6.019  1.00 1.77  ? 63  LEU A HD13 1  
ATOM 902   H HD21 . LEU A 1 63  ? -1.649  -0.169  -6.540  1.00 1.71  ? 63  LEU A HD21 1  
ATOM 903   H HD22 . LEU A 1 63  ? -0.287  -0.620  -7.565  1.00 1.69  ? 63  LEU A HD22 1  
ATOM 904   H HD23 . LEU A 1 63  ? -0.492  -1.380  -5.990  1.00 1.59  ? 63  LEU A HD23 1  
ATOM 905   N N    . LYS A 1 64  ? -2.932  -3.798  -10.922 1.00 0.35  ? 64  LYS A N    1  
ATOM 906   C CA   . LYS A 1 64  ? -4.162  -3.498  -11.718 1.00 0.37  ? 64  LYS A CA   1  
ATOM 907   C C    . LYS A 1 64  ? -5.017  -4.765  -11.865 1.00 0.39  ? 64  LYS A C    1  
ATOM 908   O O    . LYS A 1 64  ? -6.210  -4.748  -11.637 1.00 0.43  ? 64  LYS A O    1  
ATOM 909   C CB   . LYS A 1 64  ? -3.758  -3.007  -13.108 1.00 0.38  ? 64  LYS A CB   1  
ATOM 910   C CG   . LYS A 1 64  ? -5.015  -2.760  -13.953 1.00 0.82  ? 64  LYS A CG   1  
ATOM 911   C CD   . LYS A 1 64  ? -4.660  -1.954  -15.232 1.00 1.35  ? 64  LYS A CD   1  
ATOM 912   C CE   . LYS A 1 64  ? -5.052  -0.480  -15.065 1.00 1.38  ? 64  LYS A CE   1  
ATOM 913   N NZ   . LYS A 1 64  ? -4.628  0.286   -16.271 1.00 2.09  ? 64  LYS A NZ   1  
ATOM 914   H H    . LYS A 1 64  ? -2.065  -3.913  -11.365 1.00 0.36  ? 64  LYS A H    1  
ATOM 915   H HA   . LYS A 1 64  ? -4.752  -2.733  -11.235 1.00 0.38  ? 64  LYS A HA   1  
ATOM 916   H HB2  . LYS A 1 64  ? -3.196  -2.089  -13.018 1.00 0.83  ? 64  LYS A HB2  1  
ATOM 917   H HB3  . LYS A 1 64  ? -3.150  -3.755  -13.588 1.00 0.76  ? 64  LYS A HB3  1  
ATOM 918   H HG2  . LYS A 1 64  ? -5.441  -3.715  -14.234 1.00 1.50  ? 64  LYS A HG2  1  
ATOM 919   H HG3  . LYS A 1 64  ? -5.737  -2.212  -13.363 1.00 1.58  ? 64  LYS A HG3  1  
ATOM 920   H HD2  . LYS A 1 64  ? -3.598  -2.017  -15.428 1.00 1.98  ? 64  LYS A HD2  1  
ATOM 921   H HD3  . LYS A 1 64  ? -5.193  -2.369  -16.077 1.00 1.96  ? 64  LYS A HD3  1  
ATOM 922   H HE2  . LYS A 1 64  ? -6.123  -0.403  -14.948 1.00 1.48  ? 64  LYS A HE2  1  
ATOM 923   H HE3  . LYS A 1 64  ? -4.564  -0.075  -14.191 1.00 1.82  ? 64  LYS A HE3  1  
ATOM 924   H HZ1  . LYS A 1 64  ? -4.484  -0.368  -17.066 1.00 2.59  ? 64  LYS A HZ1  1  
ATOM 925   H HZ2  . LYS A 1 64  ? -3.738  0.787   -16.068 1.00 2.53  ? 64  LYS A HZ2  1  
ATOM 926   H HZ3  . LYS A 1 64  ? -5.365  0.975   -16.521 1.00 2.46  ? 64  LYS A HZ3  1  
ATOM 927   N N    . ARG A 1 65  ? -4.420  -5.855  -12.261 1.00 0.43  ? 65  ARG A N    1  
ATOM 928   C CA   . ARG A 1 65  ? -5.196  -7.119  -12.444 1.00 0.47  ? 65  ARG A CA   1  
ATOM 929   C C    . ARG A 1 65  ? -5.931  -7.509  -11.154 1.00 0.50  ? 65  ARG A C    1  
ATOM 930   O O    . ARG A 1 65  ? -7.009  -8.074  -11.193 1.00 0.54  ? 65  ARG A O    1  
ATOM 931   C CB   . ARG A 1 65  ? -4.233  -8.247  -12.826 1.00 0.45  ? 65  ARG A CB   1  
ATOM 932   C CG   . ARG A 1 65  ? -5.034  -9.469  -13.285 1.00 0.94  ? 65  ARG A CG   1  
ATOM 933   C CD   . ARG A 1 65  ? -4.079  -10.538 -13.819 1.00 1.55  ? 65  ARG A CD   1  
ATOM 934   N NE   . ARG A 1 65  ? -4.867  -11.647 -14.429 1.00 1.86  ? 65  ARG A NE   1  
ATOM 935   C CZ   . ARG A 1 65  ? -4.278  -12.519 -15.202 1.00 2.39  ? 65  ARG A CZ   1  
ATOM 936   N NH1  . ARG A 1 65  ? -2.999  -12.421 -15.441 1.00 2.94  ? 65  ARG A NH1  1  
ATOM 937   N NH2  . ARG A 1 65  ? -4.969  -13.488 -15.736 1.00 2.92  ? 65  ARG A NH2  1  
ATOM 938   H H    . ARG A 1 65  ? -3.460  -5.840  -12.454 1.00 0.45  ? 65  ARG A H    1  
ATOM 939   H HA   . ARG A 1 65  ? -5.913  -6.992  -13.241 1.00 0.49  ? 65  ARG A HA   1  
ATOM 940   H HB2  . ARG A 1 65  ? -3.590  -7.914  -13.628 1.00 0.88  ? 65  ARG A HB2  1  
ATOM 941   H HB3  . ARG A 1 65  ? -3.633  -8.514  -11.969 1.00 0.85  ? 65  ARG A HB3  1  
ATOM 942   H HG2  . ARG A 1 65  ? -5.592  -9.868  -12.450 1.00 1.50  ? 65  ARG A HG2  1  
ATOM 943   H HG3  . ARG A 1 65  ? -5.718  -9.178  -14.068 1.00 1.54  ? 65  ARG A HG3  1  
ATOM 944   H HD2  . ARG A 1 65  ? -3.432  -10.103 -14.566 1.00 2.13  ? 65  ARG A HD2  1  
ATOM 945   H HD3  . ARG A 1 65  ? -3.481  -10.925 -13.007 1.00 2.11  ? 65  ARG A HD3  1  
ATOM 946   H HE   . ARG A 1 65  ? -5.827  -11.722 -14.249 1.00 2.20  ? 65  ARG A HE   1  
ATOM 947   H HH11 . ARG A 1 65  ? -2.469  -11.678 -15.031 1.00 2.96  ? 65  ARG A HH11 1  
ATOM 948   H HH12 . ARG A 1 65  ? -2.548  -13.089 -16.033 1.00 3.62  ? 65  ARG A HH12 1  
ATOM 949   H HH21 . ARG A 1 65  ? -5.949  -13.564 -15.554 1.00 3.11  ? 65  ARG A HH21 1  
ATOM 950   H HH22 . ARG A 1 65  ? -4.518  -14.156 -16.329 1.00 3.43  ? 65  ARG A HH22 1  
ATOM 951   N N    . ILE A 1 66  ? -5.364  -7.227  -10.008 1.00 0.49  ? 66  ILE A N    1  
ATOM 952   C CA   . ILE A 1 66  ? -6.037  -7.605  -8.723  1.00 0.53  ? 66  ILE A CA   1  
ATOM 953   C C    . ILE A 1 66  ? -6.916  -6.452  -8.238  1.00 0.54  ? 66  ILE A C    1  
ATOM 954   O O    . ILE A 1 66  ? -7.927  -6.661  -7.599  1.00 0.60  ? 66  ILE A O    1  
ATOM 955   C CB   . ILE A 1 66  ? -4.958  -7.972  -7.699  1.00 0.52  ? 66  ILE A CB   1  
ATOM 956   C CG1  . ILE A 1 66  ? -4.121  -6.735  -7.362  1.00 1.22  ? 66  ILE A CG1  1  
ATOM 957   C CG2  . ILE A 1 66  ? -4.084  -9.043  -8.356  1.00 1.29  ? 66  ILE A CG2  1  
ATOM 958   C CD1  . ILE A 1 66  ? -2.946  -7.139  -6.471  1.00 1.25  ? 66  ILE A CD1  1  
ATOM 959   H H    . ILE A 1 66  ? -4.497  -6.769  -9.987  1.00 0.46  ? 66  ILE A H    1  
ATOM 960   H HA   . ILE A 1 66  ? -6.664  -8.472  -8.894  1.00 0.56  ? 66  ILE A HA   1  
ATOM 961   H HB   . ILE A 1 66  ? -5.419  -8.371  -6.806  1.00 1.04  ? 66  ILE A HB   1  
ATOM 962   H HG12 . ILE A 1 66  ? -3.749  -6.293  -8.273  1.00 1.73  ? 66  ILE A HG12 1  
ATOM 963   H HG13 . ILE A 1 66  ? -4.736  -6.018  -6.839  1.00 1.78  ? 66  ILE A HG13 1  
ATOM 964   H HG21 . ILE A 1 66  ? -3.392  -9.437  -7.625  1.00 1.84  ? 66  ILE A HG21 1  
ATOM 965   H HG22 . ILE A 1 66  ? -3.532  -8.605  -9.174  1.00 1.76  ? 66  ILE A HG22 1  
ATOM 966   H HG23 . ILE A 1 66  ? -4.708  -9.843  -8.728  1.00 1.93  ? 66  ILE A HG23 1  
ATOM 967   H HD11 . ILE A 1 66  ? -2.482  -6.252  -6.063  1.00 1.47  ? 66  ILE A HD11 1  
ATOM 968   H HD12 . ILE A 1 66  ? -2.222  -7.687  -7.056  1.00 1.70  ? 66  ILE A HD12 1  
ATOM 969   H HD13 . ILE A 1 66  ? -3.303  -7.762  -5.664  1.00 1.59  ? 66  ILE A HD13 1  
ATOM 970   N N    . GLY A 1 67  ? -6.563  -5.239  -8.563  1.00 0.52  ? 67  GLY A N    1  
ATOM 971   C CA   . GLY A 1 67  ? -7.412  -4.087  -8.146  1.00 0.55  ? 67  GLY A CA   1  
ATOM 972   C C    . GLY A 1 67  ? -8.802  -4.266  -8.758  1.00 0.53  ? 67  GLY A C    1  
ATOM 973   O O    . GLY A 1 67  ? -9.792  -3.815  -8.217  1.00 0.63  ? 67  GLY A O    1  
ATOM 974   H H    . GLY A 1 67  ? -5.757  -5.087  -9.099  1.00 0.50  ? 67  GLY A H    1  
ATOM 975   H HA2  . GLY A 1 67  ? -7.487  -4.048  -7.067  1.00 0.55  ? 67  GLY A HA2  1  
ATOM 976   H HA3  . GLY A 1 67  ? -6.976  -3.167  -8.504  1.00 0.59  ? 67  GLY A HA3  1  
ATOM 977   N N    . ASP A 1 68  ? -8.885  -4.919  -9.886  1.00 0.54  ? 68  ASP A N    1  
ATOM 978   C CA   . ASP A 1 68  ? -10.211 -5.126  -10.539 1.00 0.54  ? 68  ASP A CA   1  
ATOM 979   C C    . ASP A 1 68  ? -10.898 -6.353  -9.936  1.00 0.52  ? 68  ASP A C    1  
ATOM 980   O O    . ASP A 1 68  ? -12.065 -6.318  -9.599  1.00 0.56  ? 68  ASP A O    1  
ATOM 981   C CB   . ASP A 1 68  ? -10.009 -5.345  -12.040 1.00 0.60  ? 68  ASP A CB   1  
ATOM 982   C CG   . ASP A 1 68  ? -11.372 -5.466  -12.726 1.00 1.43  ? 68  ASP A CG   1  
ATOM 983   O OD1  . ASP A 1 68  ? -12.257 -4.699  -12.382 1.00 2.12  ? 68  ASP A OD1  1  
ATOM 984   O OD2  . ASP A 1 68  ? -11.507 -6.322  -13.585 1.00 2.20  ? 68  ASP A OD2  1  
ATOM 985   H H    . ASP A 1 68  ? -8.072  -5.273  -10.305 1.00 0.63  ? 68  ASP A H    1  
ATOM 986   H HA   . ASP A 1 68  ? -10.831 -4.254  -10.386 1.00 0.53  ? 68  ASP A HA   1  
ATOM 987   H HB2  . ASP A 1 68  ? -9.468  -4.508  -12.457 1.00 1.16  ? 68  ASP A HB2  1  
ATOM 988   H HB3  . ASP A 1 68  ? -9.447  -6.253  -12.199 1.00 1.06  ? 68  ASP A HB3  1  
ATOM 989   N N    . GLU A 1 69  ? -10.189 -7.441  -9.804  1.00 0.56  ? 69  GLU A N    1  
ATOM 990   C CA   . GLU A 1 69  ? -10.811 -8.669  -9.230  1.00 0.56  ? 69  GLU A CA   1  
ATOM 991   C C    . GLU A 1 69  ? -11.246 -8.405  -7.786  1.00 0.55  ? 69  GLU A C    1  
ATOM 992   O O    . GLU A 1 69  ? -12.395 -8.579  -7.431  1.00 0.73  ? 69  GLU A O    1  
ATOM 993   C CB   . GLU A 1 69  ? -9.794  -9.812  -9.255  1.00 0.61  ? 69  GLU A CB   1  
ATOM 994   C CG   . GLU A 1 69  ? -10.495 -11.132 -8.929  1.00 0.84  ? 69  GLU A CG   1  
ATOM 995   C CD   . GLU A 1 69  ? -11.375 -11.548 -10.109 1.00 1.65  ? 69  GLU A CD   1  
ATOM 996   O OE1  . GLU A 1 69  ? -10.840 -12.100 -11.056 1.00 2.23  ? 69  GLU A OE1  1  
ATOM 997   O OE2  . GLU A 1 69  ? -12.569 -11.307 -10.046 1.00 2.48  ? 69  GLU A OE2  1  
ATOM 998   H H    . GLU A 1 69  ? -9.248  -7.453  -10.089 1.00 0.65  ? 69  GLU A H    1  
ATOM 999   H HA   . GLU A 1 69  ? -11.675 -8.940  -9.818  1.00 0.57  ? 69  GLU A HA   1  
ATOM 1000  H HB2  . GLU A 1 69  ? -9.347  -9.874  -10.237 1.00 0.87  ? 69  GLU A HB2  1  
ATOM 1001  H HB3  . GLU A 1 69  ? -9.025  -9.625  -8.521  1.00 0.83  ? 69  GLU A HB3  1  
ATOM 1002  H HG2  . GLU A 1 69  ? -9.754  -11.896 -8.744  1.00 1.45  ? 69  GLU A HG2  1  
ATOM 1003  H HG3  . GLU A 1 69  ? -11.110 -11.006 -8.051  1.00 1.39  ? 69  GLU A HG3  1  
ATOM 1004  N N    . LEU A 1 70  ? -10.334 -8.001  -6.947  1.00 0.53  ? 70  LEU A N    1  
ATOM 1005  C CA   . LEU A 1 70  ? -10.689 -7.743  -5.522  1.00 0.52  ? 70  LEU A CA   1  
ATOM 1006  C C    . LEU A 1 70  ? -11.803 -6.695  -5.425  1.00 0.54  ? 70  LEU A C    1  
ATOM 1007  O O    . LEU A 1 70  ? -12.741 -6.845  -4.667  1.00 0.60  ? 70  LEU A O    1  
ATOM 1008  C CB   . LEU A 1 70  ? -9.444  -7.224  -4.771  1.00 0.61  ? 70  LEU A CB   1  
ATOM 1009  C CG   . LEU A 1 70  ? -8.544  -8.386  -4.305  1.00 0.70  ? 70  LEU A CG   1  
ATOM 1010  C CD1  . LEU A 1 70  ? -9.165  -9.112  -3.100  1.00 1.38  ? 70  LEU A CD1  1  
ATOM 1011  C CD2  . LEU A 1 70  ? -8.332  -9.380  -5.451  1.00 1.61  ? 70  LEU A CD2  1  
ATOM 1012  H H    . LEU A 1 70  ? -9.411  -7.878  -7.251  1.00 0.66  ? 70  LEU A H    1  
ATOM 1013  H HA   . LEU A 1 70  ? -11.025 -8.653  -5.063  1.00 0.56  ? 70  LEU A HA   1  
ATOM 1014  H HB2  . LEU A 1 70  ? -8.878  -6.584  -5.431  1.00 1.07  ? 70  LEU A HB2  1  
ATOM 1015  H HB3  . LEU A 1 70  ? -9.754  -6.650  -3.908  1.00 1.07  ? 70  LEU A HB3  1  
ATOM 1016  H HG   . LEU A 1 70  ? -7.586  -7.983  -4.009  1.00 1.39  ? 70  LEU A HG   1  
ATOM 1017  H HD11 . LEU A 1 70  ? -9.555  -8.389  -2.398  1.00 1.91  ? 70  LEU A HD11 1  
ATOM 1018  H HD12 . LEU A 1 70  ? -8.406  -9.705  -2.615  1.00 1.90  ? 70  LEU A HD12 1  
ATOM 1019  H HD13 . LEU A 1 70  ? -9.960  -9.761  -3.429  1.00 1.98  ? 70  LEU A HD13 1  
ATOM 1020  H HD21 . LEU A 1 70  ? -7.481  -10.006 -5.227  1.00 2.16  ? 70  LEU A HD21 1  
ATOM 1021  H HD22 . LEU A 1 70  ? -8.149  -8.840  -6.368  1.00 2.22  ? 70  LEU A HD22 1  
ATOM 1022  H HD23 . LEU A 1 70  ? -9.210  -9.998  -5.565  1.00 2.09  ? 70  LEU A HD23 1  
ATOM 1023  N N    . ASP A 1 71  ? -11.695 -5.623  -6.159  1.00 0.67  ? 71  ASP A N    1  
ATOM 1024  C CA   . ASP A 1 71  ? -12.737 -4.563  -6.070  1.00 0.91  ? 71  ASP A CA   1  
ATOM 1025  C C    . ASP A 1 71  ? -14.097 -5.096  -6.535  1.00 1.02  ? 71  ASP A C    1  
ATOM 1026  O O    . ASP A 1 71  ? -15.094 -4.423  -6.370  1.00 1.29  ? 71  ASP A O    1  
ATOM 1027  C CB   . ASP A 1 71  ? -12.329 -3.364  -6.928  1.00 1.09  ? 71  ASP A CB   1  
ATOM 1028  C CG   . ASP A 1 71  ? -13.399 -2.275  -6.827  1.00 1.66  ? 71  ASP A CG   1  
ATOM 1029  O OD1  . ASP A 1 71  ? -13.869 -2.034  -5.728  1.00 2.25  ? 71  ASP A OD1  1  
ATOM 1030  O OD2  . ASP A 1 71  ? -13.730 -1.701  -7.852  1.00 2.36  ? 71  ASP A OD2  1  
ATOM 1031  H H    . ASP A 1 71  ? -10.918 -5.502  -6.744  1.00 0.69  ? 71  ASP A H    1  
ATOM 1032  H HA   . ASP A 1 71  ? -12.820 -4.261  -5.038  1.00 0.96  ? 71  ASP A HA   1  
ATOM 1033  H HB2  . ASP A 1 71  ? -11.384 -2.975  -6.577  1.00 1.58  ? 71  ASP A HB2  1  
ATOM 1034  H HB3  . ASP A 1 71  ? -12.231 -3.674  -7.958  1.00 1.39  ? 71  ASP A HB3  1  
ATOM 1035  N N    . SER A 1 72  ? -14.172 -6.288  -7.100  1.00 0.90  ? 72  SER A N    1  
ATOM 1036  C CA   . SER A 1 72  ? -15.515 -6.816  -7.546  1.00 1.20  ? 72  SER A CA   1  
ATOM 1037  C C    . SER A 1 72  ? -16.024 -7.836  -6.521  1.00 0.98  ? 72  SER A C    1  
ATOM 1038  O O    . SER A 1 72  ? -16.994 -8.533  -6.745  1.00 1.02  ? 72  SER A O    1  
ATOM 1039  C CB   . SER A 1 72  ? -15.415 -7.445  -8.935  1.00 1.57  ? 72  SER A CB   1  
ATOM 1040  O OG   . SER A 1 72  ? -16.666 -8.023  -9.279  1.00 2.09  ? 72  SER A OG   1  
ATOM 1041  H H    . SER A 1 72  ? -13.364 -6.829  -7.220  1.00 0.70  ? 72  SER A H    1  
ATOM 1042  H HA   . SER A 1 72  ? -16.214 -5.992  -7.549  1.00 1.57  ? 72  SER A HA   1  
ATOM 1043  H HB2  . SER A 1 72  ? -15.162 -6.687  -9.658  1.00 1.99  ? 72  SER A HB2  1  
ATOM 1044  H HB3  . SER A 1 72  ? -14.644 -8.205  -8.929  1.00 2.01  ? 72  SER A HB3  1  
ATOM 1045  H HG   . SER A 1 72  ? -16.954 -7.633  -10.108 1.00 2.54  ? 72  SER A HG   1  
ATOM 1046  N N    . ASN A 1 73  ? -15.403 -7.876  -5.376  1.00 0.92  ? 73  ASN A N    1  
ATOM 1047  C CA   . ASN A 1 73  ? -15.855 -8.781  -4.283  1.00 0.83  ? 73  ASN A CA   1  
ATOM 1048  C C    . ASN A 1 73  ? -17.050 -8.122  -3.592  1.00 0.75  ? 73  ASN A C    1  
ATOM 1049  O O    . ASN A 1 73  ? -16.938 -7.058  -3.020  1.00 1.07  ? 73  ASN A O    1  
ATOM 1050  C CB   . ASN A 1 73  ? -14.712 -8.939  -3.265  1.00 0.91  ? 73  ASN A CB   1  
ATOM 1051  C CG   . ASN A 1 73  ? -13.748 -10.034 -3.734  1.00 1.43  ? 73  ASN A CG   1  
ATOM 1052  O OD1  . ASN A 1 73  ? -12.546 -9.853  -3.714  1.00 2.29  ? 73  ASN A OD1  1  
ATOM 1053  N ND2  . ASN A 1 73  ? -14.229 -11.173 -4.155  1.00 1.90  ? 73  ASN A ND2  1  
ATOM 1054  H H    . ASN A 1 73  ? -14.651 -7.266  -5.211  1.00 1.04  ? 73  ASN A H    1  
ATOM 1055  H HA   . ASN A 1 73  ? -16.155 -9.762  -4.630  1.00 0.90  ? 73  ASN A HA   1  
ATOM 1056  H HB2  . ASN A 1 73  ? -14.178 -8.004  -3.178  1.00 1.30  ? 73  ASN A HB2  1  
ATOM 1057  H HB3  . ASN A 1 73  ? -15.116 -9.213  -2.300  1.00 1.39  ? 73  ASN A HB3  1  
ATOM 1058  H HD21 . ASN A 1 73  ? -15.197 -11.320 -4.169  1.00 2.05  ? 73  ASN A HD21 1  
ATOM 1059  H HD22 . ASN A 1 73  ? -13.621 -11.880 -4.456  1.00 2.57  ? 73  ASN A HD22 1  
ATOM 1060  N N    . MET A 1 74  ? -18.200 -8.746  -3.648  1.00 0.71  ? 74  MET A N    1  
ATOM 1061  C CA   . MET A 1 74  ? -19.403 -8.146  -3.002  1.00 0.67  ? 74  MET A CA   1  
ATOM 1062  C C    . MET A 1 74  ? -19.335 -8.376  -1.493  1.00 0.67  ? 74  MET A C    1  
ATOM 1063  O O    . MET A 1 74  ? -19.912 -7.642  -0.717  1.00 0.71  ? 74  MET A O    1  
ATOM 1064  C CB   . MET A 1 74  ? -20.683 -8.762  -3.577  1.00 0.75  ? 74  MET A CB   1  
ATOM 1065  C CG   . MET A 1 74  ? -20.599 -8.801  -5.106  1.00 1.20  ? 74  MET A CG   1  
ATOM 1066  S SD   . MET A 1 74  ? -20.480 -7.114  -5.750  1.00 1.92  ? 74  MET A SD   1  
ATOM 1067  C CE   . MET A 1 74  ? -20.696 -7.524  -7.500  1.00 1.96  ? 74  MET A CE   1  
ATOM 1068  H H    . MET A 1 74  ? -18.269 -9.609  -4.108  1.00 0.95  ? 74  MET A H    1  
ATOM 1069  H HA   . MET A 1 74  ? -19.397 -7.078  -3.159  1.00 0.69  ? 74  MET A HA   1  
ATOM 1070  H HB2  . MET A 1 74  ? -20.798 -9.767  -3.198  1.00 1.13  ? 74  MET A HB2  1  
ATOM 1071  H HB3  . MET A 1 74  ? -21.533 -8.167  -3.281  1.00 1.14  ? 74  MET A HB3  1  
ATOM 1072  H HG2  . MET A 1 74  ? -19.727 -9.364  -5.406  1.00 1.74  ? 74  MET A HG2  1  
ATOM 1073  H HG3  . MET A 1 74  ? -21.485 -9.275  -5.502  1.00 1.78  ? 74  MET A HG3  1  
ATOM 1074  H HE1  . MET A 1 74  ? -20.671 -6.616  -8.087  1.00 2.47  ? 74  MET A HE1  1  
ATOM 1075  H HE2  . MET A 1 74  ? -21.645 -8.015  -7.642  1.00 2.23  ? 74  MET A HE2  1  
ATOM 1076  H HE3  . MET A 1 74  ? -19.900 -8.185  -7.815  1.00 2.17  ? 74  MET A HE3  1  
ATOM 1077  N N    . GLU A 1 75  ? -18.596 -9.361  -1.069  1.00 0.70  ? 75  GLU A N    1  
ATOM 1078  C CA   . GLU A 1 75  ? -18.445 -9.610  0.387   1.00 0.75  ? 75  GLU A CA   1  
ATOM 1079  C C    . GLU A 1 75  ? -17.427 -8.612  0.937   1.00 0.73  ? 75  GLU A C    1  
ATOM 1080  O O    . GLU A 1 75  ? -17.659 -7.960  1.935   1.00 0.78  ? 75  GLU A O    1  
ATOM 1081  C CB   . GLU A 1 75  ? -17.943 -11.035 0.613   1.00 0.87  ? 75  GLU A CB   1  
ATOM 1082  C CG   . GLU A 1 75  ? -18.065 -11.377 2.094   1.00 1.15  ? 75  GLU A CG   1  
ATOM 1083  C CD   . GLU A 1 75  ? -17.576 -12.807 2.335   1.00 1.70  ? 75  GLU A CD   1  
ATOM 1084  O OE1  . GLU A 1 75  ? -16.561 -13.168 1.762   1.00 2.29  ? 75  GLU A OE1  1  
ATOM 1085  O OE2  . GLU A 1 75  ? -18.224 -13.515 3.087   1.00 2.21  ? 75  GLU A OE2  1  
ATOM 1086  H H    . GLU A 1 75  ? -18.105 -9.919  -1.706  1.00 0.73  ? 75  GLU A H    1  
ATOM 1087  H HA   . GLU A 1 75  ? -19.377 -9.462  0.914   1.00 0.77  ? 75  GLU A HA   1  
ATOM 1088  H HB2  . GLU A 1 75  ? -18.538 -11.724 0.031   1.00 1.11  ? 75  GLU A HB2  1  
ATOM 1089  H HB3  . GLU A 1 75  ? -16.909 -11.107 0.312   1.00 0.94  ? 75  GLU A HB3  1  
ATOM 1090  H HG2  . GLU A 1 75  ? -17.466 -10.687 2.669   1.00 1.41  ? 75  GLU A HG2  1  
ATOM 1091  H HG3  . GLU A 1 75  ? -19.099 -11.294 2.394   1.00 1.33  ? 75  GLU A HG3  1  
ATOM 1092  N N    . LEU A 1 76  ? -16.313 -8.465  0.278   1.00 0.74  ? 76  LEU A N    1  
ATOM 1093  C CA   . LEU A 1 76  ? -15.293 -7.484  0.744   1.00 0.80  ? 76  LEU A CA   1  
ATOM 1094  C C    . LEU A 1 76  ? -15.857 -6.067  0.554   1.00 0.75  ? 76  LEU A C    1  
ATOM 1095  O O    . LEU A 1 76  ? -15.531 -5.156  1.286   1.00 0.81  ? 76  LEU A O    1  
ATOM 1096  C CB   . LEU A 1 76  ? -13.991 -7.684  -0.053  1.00 0.92  ? 76  LEU A CB   1  
ATOM 1097  C CG   . LEU A 1 76  ? -12.757 -7.251  0.763   1.00 1.00  ? 76  LEU A CG   1  
ATOM 1098  C CD1  . LEU A 1 76  ? -12.885 -5.775  1.164   1.00 1.57  ? 76  LEU A CD1  1  
ATOM 1099  C CD2  . LEU A 1 76  ? -12.587 -8.148  2.009   1.00 1.51  ? 76  LEU A CD2  1  
ATOM 1100  H H    . LEU A 1 76  ? -16.155 -8.986  -0.537  1.00 0.77  ? 76  LEU A H    1  
ATOM 1101  H HA   . LEU A 1 76  ? -15.123 -7.584  1.803   1.00 0.82  ? 76  LEU A HA   1  
ATOM 1102  H HB2  . LEU A 1 76  ? -13.893 -8.728  -0.311  1.00 1.40  ? 76  LEU A HB2  1  
ATOM 1103  H HB3  . LEU A 1 76  ? -14.035 -7.101  -0.962  1.00 1.28  ? 76  LEU A HB3  1  
ATOM 1104  H HG   . LEU A 1 76  ? -11.882 -7.355  0.137   1.00 1.62  ? 76  LEU A HG   1  
ATOM 1105  H HD11 . LEU A 1 76  ? -13.383 -5.224  0.378   1.00 1.93  ? 76  LEU A HD11 1  
ATOM 1106  H HD12 . LEU A 1 76  ? -11.899 -5.363  1.319   1.00 2.18  ? 76  LEU A HD12 1  
ATOM 1107  H HD13 . LEU A 1 76  ? -13.451 -5.697  2.079   1.00 2.01  ? 76  LEU A HD13 1  
ATOM 1108  H HD21 . LEU A 1 76  ? -13.035 -9.116  1.832   1.00 2.04  ? 76  LEU A HD21 1  
ATOM 1109  H HD22 . LEU A 1 76  ? -13.058 -7.687  2.866   1.00 1.83  ? 76  LEU A HD22 1  
ATOM 1110  H HD23 . LEU A 1 76  ? -11.534 -8.278  2.210   1.00 2.09  ? 76  LEU A HD23 1  
ATOM 1111  N N    . GLN A 1 77  ? -16.751 -5.879  -0.373  1.00 0.76  ? 77  GLN A N    1  
ATOM 1112  C CA   . GLN A 1 77  ? -17.361 -4.529  -0.534  1.00 0.74  ? 77  GLN A CA   1  
ATOM 1113  C C    . GLN A 1 77  ? -18.406 -4.349  0.574   1.00 0.71  ? 77  GLN A C    1  
ATOM 1114  O O    . GLN A 1 77  ? -18.710 -3.242  0.979   1.00 0.72  ? 77  GLN A O    1  
ATOM 1115  C CB   . GLN A 1 77  ? -18.017 -4.405  -1.917  1.00 0.71  ? 77  GLN A CB   1  
ATOM 1116  C CG   . GLN A 1 77  ? -18.345 -2.939  -2.224  1.00 1.26  ? 77  GLN A CG   1  
ATOM 1117  C CD   . GLN A 1 77  ? -19.539 -2.488  -1.382  1.00 1.59  ? 77  GLN A CD   1  
ATOM 1118  O OE1  . GLN A 1 77  ? -19.457 -1.511  -0.665  1.00 2.35  ? 77  GLN A OE1  1  
ATOM 1119  N NE2  . GLN A 1 77  ? -20.655 -3.162  -1.438  1.00 2.03  ? 77  GLN A NE2  1  
ATOM 1120  H H    . GLN A 1 77  ? -17.056 -6.629  -0.925  1.00 0.86  ? 77  GLN A H    1  
ATOM 1121  H HA   . GLN A 1 77  ? -16.618 -3.758  -0.394  1.00 0.78  ? 77  GLN A HA   1  
ATOM 1122  H HB2  . GLN A 1 77  ? -17.339 -4.781  -2.668  1.00 1.14  ? 77  GLN A HB2  1  
ATOM 1123  H HB3  . GLN A 1 77  ? -18.928 -4.984  -1.935  1.00 1.09  ? 77  GLN A HB3  1  
ATOM 1124  H HG2  . GLN A 1 77  ? -17.489 -2.320  -1.998  1.00 1.82  ? 77  GLN A HG2  1  
ATOM 1125  H HG3  . GLN A 1 77  ? -18.591 -2.840  -3.271  1.00 1.98  ? 77  GLN A HG3  1  
ATOM 1126  H HE21 . GLN A 1 77  ? -20.723 -3.950  -2.017  1.00 2.26  ? 77  GLN A HE21 1  
ATOM 1127  H HE22 . GLN A 1 77  ? -21.425 -2.881  -0.902  1.00 2.60  ? 77  GLN A HE22 1  
ATOM 1128  N N    . ARG A 1 78  ? -18.936 -5.425  1.097   1.00 0.72  ? 78  ARG A N    1  
ATOM 1129  C CA   . ARG A 1 78  ? -19.936 -5.294  2.199   1.00 0.73  ? 78  ARG A CA   1  
ATOM 1130  C C    . ARG A 1 78  ? -19.178 -5.042  3.506   1.00 0.75  ? 78  ARG A C    1  
ATOM 1131  O O    . ARG A 1 78  ? -19.726 -4.595  4.494   1.00 0.79  ? 78  ARG A O    1  
ATOM 1132  C CB   . ARG A 1 78  ? -20.734 -6.626  2.326   1.00 0.74  ? 78  ARG A CB   1  
ATOM 1133  C CG   . ARG A 1 78  ? -22.206 -6.469  1.866   1.00 0.94  ? 78  ARG A CG   1  
ATOM 1134  C CD   . ARG A 1 78  ? -22.323 -6.774  0.371   1.00 1.23  ? 78  ARG A CD   1  
ATOM 1135  N NE   . ARG A 1 78  ? -23.723 -6.527  -0.073  1.00 1.80  ? 78  ARG A NE   1  
ATOM 1136  C CZ   . ARG A 1 78  ? -24.002 -6.459  -1.345  1.00 2.50  ? 78  ARG A CZ   1  
ATOM 1137  N NH1  . ARG A 1 78  ? -23.054 -6.610  -2.229  1.00 2.83  ? 78  ARG A NH1  1  
ATOM 1138  N NH2  . ARG A 1 78  ? -25.229 -6.243  -1.733  1.00 3.41  ? 78  ARG A NH2  1  
ATOM 1139  H H    . ARG A 1 78  ? -18.665 -6.312  0.781   1.00 0.75  ? 78  ARG A H    1  
ATOM 1140  H HA   . ARG A 1 78  ? -20.601 -4.477  1.949   1.00 0.75  ? 78  ARG A HA   1  
ATOM 1141  H HB2  . ARG A 1 78  ? -20.250 -7.379  1.721   1.00 0.91  ? 78  ARG A HB2  1  
ATOM 1142  H HB3  . ARG A 1 78  ? -20.727 -6.960  3.358   1.00 0.83  ? 78  ARG A HB3  1  
ATOM 1143  H HG2  . ARG A 1 78  ? -22.825 -7.166  2.414   1.00 1.18  ? 78  ARG A HG2  1  
ATOM 1144  H HG3  . ARG A 1 78  ? -22.556 -5.467  2.057   1.00 1.35  ? 78  ARG A HG3  1  
ATOM 1145  H HD2  . ARG A 1 78  ? -21.650 -6.138  -0.182  1.00 1.78  ? 78  ARG A HD2  1  
ATOM 1146  H HD3  . ARG A 1 78  ? -22.063 -7.810  0.199   1.00 1.68  ? 78  ARG A HD3  1  
ATOM 1147  H HE   . ARG A 1 78  ? -24.435 -6.415  0.591   1.00 2.23  ? 78  ARG A HE   1  
ATOM 1148  H HH11 . ARG A 1 78  ? -22.114 -6.777  -1.931  1.00 2.69  ? 78  ARG A HH11 1  
ATOM 1149  H HH12 . ARG A 1 78  ? -23.268 -6.559  -3.205  1.00 3.57  ? 78  ARG A HH12 1  
ATOM 1150  H HH21 . ARG A 1 78  ? -25.955 -6.128  -1.055  1.00 3.73  ? 78  ARG A HH21 1  
ATOM 1151  H HH22 . ARG A 1 78  ? -25.443 -6.192  -2.708  1.00 4.02  ? 78  ARG A HH22 1  
ATOM 1152  N N    . MET A 1 79  ? -17.912 -5.366  3.503   1.00 0.75  ? 79  MET A N    1  
ATOM 1153  C CA   . MET A 1 79  ? -17.065 -5.207  4.714   1.00 0.77  ? 79  MET A CA   1  
ATOM 1154  C C    . MET A 1 79  ? -16.627 -3.747  4.832   1.00 0.77  ? 79  MET A C    1  
ATOM 1155  O O    . MET A 1 79  ? -16.899 -3.080  5.810   1.00 0.78  ? 79  MET A O    1  
ATOM 1156  C CB   . MET A 1 79  ? -15.837 -6.122  4.531   1.00 0.81  ? 79  MET A CB   1  
ATOM 1157  C CG   . MET A 1 79  ? -15.347 -6.692  5.865   1.00 1.08  ? 79  MET A CG   1  
ATOM 1158  S SD   . MET A 1 79  ? -16.487 -7.975  6.445   1.00 1.07  ? 79  MET A SD   1  
ATOM 1159  C CE   . MET A 1 79  ? -16.015 -7.919  8.193   1.00 0.81  ? 79  MET A CE   1  
ATOM 1160  H H    . MET A 1 79  ? -17.496 -5.724  2.691   1.00 0.77  ? 79  MET A H    1  
ATOM 1161  H HA   . MET A 1 79  ? -17.620 -5.501  5.592   1.00 0.78  ? 79  MET A HA   1  
ATOM 1162  H HB2  . MET A 1 79  ? -16.109 -6.943  3.884   1.00 1.29  ? 79  MET A HB2  1  
ATOM 1163  H HB3  . MET A 1 79  ? -15.033 -5.567  4.068   1.00 1.16  ? 79  MET A HB3  1  
ATOM 1164  H HG2  . MET A 1 79  ? -14.376 -7.131  5.695   1.00 1.48  ? 79  MET A HG2  1  
ATOM 1165  H HG3  . MET A 1 79  ? -15.277 -5.908  6.600   1.00 1.58  ? 79  MET A HG3  1  
ATOM 1166  H HE1  . MET A 1 79  ? -14.950 -8.088  8.284   1.00 1.37  ? 79  MET A HE1  1  
ATOM 1167  H HE2  . MET A 1 79  ? -16.545 -8.686  8.735   1.00 1.34  ? 79  MET A HE2  1  
ATOM 1168  H HE3  . MET A 1 79  ? -16.268 -6.951  8.603   1.00 1.20  ? 79  MET A HE3  1  
ATOM 1169  N N    . ILE A 1 80  ? -15.951 -3.248  3.833   1.00 0.77  ? 80  ILE A N    1  
ATOM 1170  C CA   . ILE A 1 80  ? -15.497 -1.834  3.880   1.00 0.80  ? 80  ILE A CA   1  
ATOM 1171  C C    . ILE A 1 80  ? -16.706 -0.939  4.139   1.00 0.80  ? 80  ILE A C    1  
ATOM 1172  O O    . ILE A 1 80  ? -16.599 0.109   4.745   1.00 0.83  ? 80  ILE A O    1  
ATOM 1173  C CB   . ILE A 1 80  ? -14.850 -1.460  2.546   1.00 0.82  ? 80  ILE A CB   1  
ATOM 1174  C CG1  . ILE A 1 80  ? -13.646 -2.372  2.296   1.00 0.84  ? 80  ILE A CG1  1  
ATOM 1175  C CG2  . ILE A 1 80  ? -14.386 -0.003  2.595   1.00 0.89  ? 80  ILE A CG2  1  
ATOM 1176  C CD1  . ILE A 1 80  ? -13.171 -2.210  0.850   1.00 1.10  ? 80  ILE A CD1  1  
ATOM 1177  H H    . ILE A 1 80  ? -15.746 -3.804  3.053   1.00 0.77  ? 80  ILE A H    1  
ATOM 1178  H HA   . ILE A 1 80  ? -14.775 -1.720  4.676   1.00 0.82  ? 80  ILE A HA   1  
ATOM 1179  H HB   . ILE A 1 80  ? -15.570 -1.582  1.750   1.00 0.80  ? 80  ILE A HB   1  
ATOM 1180  H HG12 . ILE A 1 80  ? -12.846 -2.103  2.970   1.00 0.89  ? 80  ILE A HG12 1  
ATOM 1181  H HG13 . ILE A 1 80  ? -13.931 -3.399  2.466   1.00 1.04  ? 80  ILE A HG13 1  
ATOM 1182  H HG21 . ILE A 1 80  ? -13.772 0.209   1.732   1.00 1.27  ? 80  ILE A HG21 1  
ATOM 1183  H HG22 . ILE A 1 80  ? -13.811 0.162   3.495   1.00 1.34  ? 80  ILE A HG22 1  
ATOM 1184  H HG23 . ILE A 1 80  ? -15.246 0.650   2.594   1.00 1.40  ? 80  ILE A HG23 1  
ATOM 1185  H HD11 . ILE A 1 80  ? -12.344 -2.881  0.667   1.00 1.67  ? 80  ILE A HD11 1  
ATOM 1186  H HD12 . ILE A 1 80  ? -12.853 -1.191  0.687   1.00 1.53  ? 80  ILE A HD12 1  
ATOM 1187  H HD13 . ILE A 1 80  ? -13.982 -2.447  0.177   1.00 1.46  ? 80  ILE A HD13 1  
ATOM 1188  N N    . ALA A 1 81  ? -17.864 -1.353  3.693   1.00 0.78  ? 81  ALA A N    1  
ATOM 1189  C CA   . ALA A 1 81  ? -19.082 -0.532  3.927   1.00 0.80  ? 81  ALA A CA   1  
ATOM 1190  C C    . ALA A 1 81  ? -19.501 -0.670  5.391   1.00 0.81  ? 81  ALA A C    1  
ATOM 1191  O O    . ALA A 1 81  ? -20.261 0.124   5.910   1.00 0.85  ? 81  ALA A O    1  
ATOM 1192  C CB   . ALA A 1 81  ? -20.213 -1.015  3.021   1.00 0.79  ? 81  ALA A CB   1  
ATOM 1193  H H    . ALA A 1 81  ? -17.930 -2.210  3.216   1.00 0.76  ? 81  ALA A H    1  
ATOM 1194  H HA   . ALA A 1 81  ? -18.862 0.498   3.719   1.00 0.84  ? 81  ALA A HA   1  
ATOM 1195  H HB1  . ALA A 1 81  ? -19.899 -0.955  1.990   1.00 1.32  ? 81  ALA A HB1  1  
ATOM 1196  H HB2  . ALA A 1 81  ? -21.083 -0.392  3.170   1.00 1.19  ? 81  ALA A HB2  1  
ATOM 1197  H HB3  . ALA A 1 81  ? -20.456 -2.038  3.265   1.00 1.34  ? 81  ALA A HB3  1  
ATOM 1198  N N    . ALA A 1 82  ? -19.010 -1.678  6.058   1.00 0.78  ? 82  ALA A N    1  
ATOM 1199  C CA   . ALA A 1 82  ? -19.374 -1.883  7.489   1.00 0.80  ? 82  ALA A CA   1  
ATOM 1200  C C    . ALA A 1 82  ? -18.520 -0.983  8.374   1.00 0.79  ? 82  ALA A C    1  
ATOM 1201  O O    . ALA A 1 82  ? -18.858 -0.710  9.508   1.00 0.83  ? 82  ALA A O    1  
ATOM 1202  C CB   . ALA A 1 82  ? -19.092 -3.327  7.874   1.00 0.87  ? 82  ALA A CB   1  
ATOM 1203  H H    . ALA A 1 82  ? -18.406 -2.306  5.611   1.00 0.76  ? 82  ALA A H    1  
ATOM 1204  H HA   . ALA A 1 82  ? -20.421 -1.662  7.628   1.00 0.83  ? 82  ALA A HA   1  
ATOM 1205  H HB1  . ALA A 1 82  ? -19.473 -3.514  8.866   1.00 1.37  ? 82  ALA A HB1  1  
ATOM 1206  H HB2  . ALA A 1 82  ? -18.022 -3.489  7.863   1.00 1.22  ? 82  ALA A HB2  1  
ATOM 1207  H HB3  . ALA A 1 82  ? -19.567 -3.990  7.169   1.00 1.37  ? 82  ALA A HB3  1  
ATOM 1208  N N    . VAL A 1 83  ? -17.419 -0.516  7.866   1.00 0.80  ? 83  VAL A N    1  
ATOM 1209  C CA   . VAL A 1 83  ? -16.543 0.370   8.677   1.00 0.85  ? 83  VAL A CA   1  
ATOM 1210  C C    . VAL A 1 83  ? -17.080 1.799   8.604   1.00 0.99  ? 83  VAL A C    1  
ATOM 1211  O O    . VAL A 1 83  ? -18.230 2.037   8.896   1.00 1.36  ? 83  VAL A O    1  
ATOM 1212  C CB   . VAL A 1 83  ? -15.101 0.308   8.149   1.00 0.97  ? 83  VAL A CB   1  
ATOM 1213  C CG1  . VAL A 1 83  ? -14.128 0.818   9.215   1.00 1.81  ? 83  VAL A CG1  1  
ATOM 1214  C CG2  . VAL A 1 83  ? -14.744 -1.138  7.793   1.00 1.40  ? 83  VAL A CG2  1  
ATOM 1215  H H    . VAL A 1 83  ? -17.167 -0.729  6.942   1.00 0.82  ? 83  VAL A H    1  
ATOM 1216  H HA   . VAL A 1 83  ? -16.579 0.105   9.723   1.00 0.90  ? 83  VAL A HA   1  
ATOM 1217  H HB   . VAL A 1 83  ? -15.016 0.922   7.264   1.00 1.62  ? 83  VAL A HB   1  
ATOM 1218  H HG11 . VAL A 1 83  ? -13.142 0.916   8.783   1.00 2.36  ? 83  VAL A HG11 1  
ATOM 1219  H HG12 . VAL A 1 83  ? -14.093 0.116   10.035  1.00 2.40  ? 83  VAL A HG12 1  
ATOM 1220  H HG13 . VAL A 1 83  ? -14.460 1.779   9.576   1.00 2.21  ? 83  VAL A HG13 1  
ATOM 1221  H HG21 . VAL A 1 83  ? -14.882 -1.767  8.660   1.00 2.00  ? 83  VAL A HG21 1  
ATOM 1222  H HG22 . VAL A 1 83  ? -13.712 -1.185  7.473   1.00 1.97  ? 83  VAL A HG22 1  
ATOM 1223  H HG23 . VAL A 1 83  ? -15.383 -1.480  6.993   1.00 1.85  ? 83  VAL A HG23 1  
ATOM 1224  N N    . ASP A 1 84  ? -16.247 2.735   8.249   1.00 1.46  ? 84  ASP A N    1  
ATOM 1225  C CA   . ASP A 1 84  ? -16.666 4.178   8.190   1.00 1.71  ? 84  ASP A CA   1  
ATOM 1226  C C    . ASP A 1 84  ? -15.408 5.056   8.254   1.00 1.39  ? 84  ASP A C    1  
ATOM 1227  O O    . ASP A 1 84  ? -14.328 4.589   8.561   1.00 1.80  ? 84  ASP A O    1  
ATOM 1228  C CB   . ASP A 1 84  ? -17.579 4.516   9.397   1.00 2.38  ? 84  ASP A CB   1  
ATOM 1229  C CG   . ASP A 1 84  ? -17.594 6.028   9.666   1.00 2.99  ? 84  ASP A CG   1  
ATOM 1230  O OD1  . ASP A 1 84  ? -16.613 6.528   10.190  1.00 3.57  ? 84  ASP A OD1  1  
ATOM 1231  O OD2  . ASP A 1 84  ? -18.589 6.656   9.342   1.00 3.45  ? 84  ASP A OD2  1  
ATOM 1232  H H    . ASP A 1 84  ? -15.331 2.487   8.021   1.00 1.92  ? 84  ASP A H    1  
ATOM 1233  H HA   . ASP A 1 84  ? -17.202 4.387   7.275   1.00 2.10  ? 84  ASP A HA   1  
ATOM 1234  H HB2  . ASP A 1 84  ? -18.589 4.202   9.184   1.00 2.86  ? 84  ASP A HB2  1  
ATOM 1235  H HB3  . ASP A 1 84  ? -17.219 4.002   10.275  1.00 2.68  ? 84  ASP A HB3  1  
ATOM 1236  N N    . THR A 1 85  ? -15.544 6.327   7.980   1.00 1.68  ? 85  THR A N    1  
ATOM 1237  C CA   . THR A 1 85  ? -14.366 7.246   8.036   1.00 1.97  ? 85  THR A CA   1  
ATOM 1238  C C    . THR A 1 85  ? -14.282 7.872   9.432   1.00 1.67  ? 85  THR A C    1  
ATOM 1239  O O    . THR A 1 85  ? -13.588 7.374   10.292  1.00 2.28  ? 85  THR A O    1  
ATOM 1240  C CB   . THR A 1 85  ? -14.518 8.351   6.978   1.00 3.20  ? 85  THR A CB   1  
ATOM 1241  O OG1  . THR A 1 85  ? -13.918 9.548   7.454   1.00 3.80  ? 85  THR A OG1  1  
ATOM 1242  C CG2  . THR A 1 85  ? -16.002 8.602   6.694   1.00 3.87  ? 85  THR A CG2  1  
ATOM 1243  H H    . THR A 1 85  ? -16.427 6.682   7.746   1.00 2.23  ? 85  THR A H    1  
ATOM 1244  H HA   . THR A 1 85  ? -13.455 6.689   7.856   1.00 2.24  ? 85  THR A HA   1  
ATOM 1245  H HB   . THR A 1 85  ? -14.031 8.045   6.063   1.00 3.70  ? 85  THR A HB   1  
ATOM 1246  H HG1  . THR A 1 85  ? -14.588 10.236  7.451   1.00 4.15  ? 85  THR A HG1  1  
ATOM 1247  H HG21 . THR A 1 85  ? -16.114 9.532   6.157   1.00 4.19  ? 85  THR A HG21 1  
ATOM 1248  H HG22 . THR A 1 85  ? -16.544 8.657   7.626   1.00 4.15  ? 85  THR A HG22 1  
ATOM 1249  H HG23 . THR A 1 85  ? -16.396 7.792   6.097   1.00 4.28  ? 85  THR A HG23 1  
ATOM 1250  N N    . ASP A 1 86  ? -14.983 8.958   9.652   1.00 1.51  ? 86  ASP A N    1  
ATOM 1251  C CA   . ASP A 1 86  ? -14.964 9.640   10.985  1.00 1.98  ? 86  ASP A CA   1  
ATOM 1252  C C    . ASP A 1 86  ? -13.537 10.071  11.346  1.00 1.78  ? 86  ASP A C    1  
ATOM 1253  O O    . ASP A 1 86  ? -13.223 11.244  11.389  1.00 2.48  ? 86  ASP A O    1  
ATOM 1254  C CB   . ASP A 1 86  ? -15.522 8.711   12.072  1.00 2.56  ? 86  ASP A CB   1  
ATOM 1255  C CG   . ASP A 1 86  ? -17.031 8.553   11.878  1.00 3.06  ? 86  ASP A CG   1  
ATOM 1256  O OD1  . ASP A 1 86  ? -17.487 8.729   10.760  1.00 3.57  ? 86  ASP A OD1  1  
ATOM 1257  O OD2  . ASP A 1 86  ? -17.706 8.261   12.852  1.00 3.50  ? 86  ASP A OD2  1  
ATOM 1258  H H    . ASP A 1 86  ? -15.528 9.331   8.932   1.00 1.71  ? 86  ASP A H    1  
ATOM 1259  H HA   . ASP A 1 86  ? -15.585 10.522  10.930  1.00 2.59  ? 86  ASP A HA   1  
ATOM 1260  H HB2  . ASP A 1 86  ? -15.049 7.745   12.010  1.00 2.88  ? 86  ASP A HB2  1  
ATOM 1261  H HB3  . ASP A 1 86  ? -15.332 9.142   13.043  1.00 3.03  ? 86  ASP A HB3  1  
ATOM 1262  N N    . SER A 1 87  ? -12.670 9.121   11.594  1.00 1.11  ? 87  SER A N    1  
ATOM 1263  C CA   . SER A 1 87  ? -11.249 9.439   11.944  1.00 0.93  ? 87  SER A CA   1  
ATOM 1264  C C    . SER A 1 87  ? -10.326 8.506   11.138  1.00 0.84  ? 87  SER A C    1  
ATOM 1265  O O    . SER A 1 87  ? -9.798  7.556   11.682  1.00 0.97  ? 87  SER A O    1  
ATOM 1266  C CB   . SER A 1 87  ? -11.028 9.206   13.438  1.00 0.88  ? 87  SER A CB   1  
ATOM 1267  O OG   . SER A 1 87  ? -11.229 7.830   13.733  1.00 1.63  ? 87  SER A OG   1  
ATOM 1268  H H    . SER A 1 87  ? -12.956 8.185   11.541  1.00 1.20  ? 87  SER A H    1  
ATOM 1269  H HA   . SER A 1 87  ? -11.034 10.467  11.699  1.00 1.05  ? 87  SER A HA   1  
ATOM 1270  H HB2  . SER A 1 87  ? -10.021 9.482   13.703  1.00 1.41  ? 87  SER A HB2  1  
ATOM 1271  H HB3  . SER A 1 87  ? -11.725 9.811   14.003  1.00 1.22  ? 87  SER A HB3  1  
ATOM 1272  H HG   . SER A 1 87  ? -12.078 7.569   13.368  1.00 2.08  ? 87  SER A HG   1  
ATOM 1273  N N    . PRO A 1 88  ? -10.172 8.784   9.856   1.00 0.77  ? 88  PRO A N    1  
ATOM 1274  C CA   . PRO A 1 88  ? -9.331  7.947   8.975   1.00 0.83  ? 88  PRO A CA   1  
ATOM 1275  C C    . PRO A 1 88  ? -7.873  7.936   9.457   1.00 0.73  ? 88  PRO A C    1  
ATOM 1276  O O    . PRO A 1 88  ? -7.090  7.098   9.056   1.00 0.72  ? 88  PRO A O    1  
ATOM 1277  C CB   . PRO A 1 88  ? -9.452  8.600   7.573   1.00 1.01  ? 88  PRO A CB   1  
ATOM 1278  C CG   . PRO A 1 88  ? -10.438 9.796   7.695   1.00 1.07  ? 88  PRO A CG   1  
ATOM 1279  C CD   . PRO A 1 88  ? -10.810 9.941   9.186   1.00 0.83  ? 88  PRO A CD   1  
ATOM 1280  H HA   . PRO A 1 88  ? -9.718  6.939   8.930   1.00 0.98  ? 88  PRO A HA   1  
ATOM 1281  H HB2  . PRO A 1 88  ? -8.483  8.951   7.235   1.00 1.03  ? 88  PRO A HB2  1  
ATOM 1282  H HB3  . PRO A 1 88  ? -9.841  7.882   6.862   1.00 1.17  ? 88  PRO A HB3  1  
ATOM 1283  H HG2  . PRO A 1 88  ? -9.962  10.703  7.338   1.00 1.20  ? 88  PRO A HG2  1  
ATOM 1284  H HG3  . PRO A 1 88  ? -11.332 9.608   7.115   1.00 1.29  ? 88  PRO A HG3  1  
ATOM 1285  H HD2  . PRO A 1 88  ? -10.414 10.870  9.575   1.00 0.84  ? 88  PRO A HD2  1  
ATOM 1286  H HD3  . PRO A 1 88  ? -11.882 9.903   9.321   1.00 0.89  ? 88  PRO A HD3  1  
ATOM 1287  N N    . ARG A 1 89  ? -7.493  8.860   10.300  1.00 0.75  ? 89  ARG A N    1  
ATOM 1288  C CA   . ARG A 1 89  ? -6.079  8.885   10.773  1.00 0.73  ? 89  ARG A CA   1  
ATOM 1289  C C    . ARG A 1 89  ? -5.868  7.794   11.826  1.00 0.67  ? 89  ARG A C    1  
ATOM 1290  O O    . ARG A 1 89  ? -4.929  7.026   11.756  1.00 0.68  ? 89  ARG A O    1  
ATOM 1291  C CB   . ARG A 1 89  ? -5.758  10.255  11.377  1.00 0.79  ? 89  ARG A CB   1  
ATOM 1292  C CG   . ARG A 1 89  ? -5.866  11.334  10.296  1.00 1.63  ? 89  ARG A CG   1  
ATOM 1293  C CD   . ARG A 1 89  ? -5.919  12.715  10.955  1.00 1.65  ? 89  ARG A CD   1  
ATOM 1294  N NE   . ARG A 1 89  ? -4.829  12.824  11.965  1.00 2.07  ? 89  ARG A NE   1  
ATOM 1295  C CZ   . ARG A 1 89  ? -4.499  13.992  12.448  1.00 2.47  ? 89  ARG A CZ   1  
ATOM 1296  N NH1  . ARG A 1 89  ? -5.130  15.064  12.052  1.00 2.69  ? 89  ARG A NH1  1  
ATOM 1297  N NH2  . ARG A 1 89  ? -3.540  14.087  13.328  1.00 3.10  ? 89  ARG A NH2  1  
ATOM 1298  H H    . ARG A 1 89  ? -8.127  9.538   10.613  1.00 0.82  ? 89  ARG A H    1  
ATOM 1299  H HA   . ARG A 1 89  ? -5.431  8.694   9.930   1.00 0.76  ? 89  ARG A HA   1  
ATOM 1300  H HB2  . ARG A 1 89  ? -6.458  10.469  12.171  1.00 1.38  ? 89  ARG A HB2  1  
ATOM 1301  H HB3  . ARG A 1 89  ? -4.754  10.247  11.775  1.00 1.17  ? 89  ARG A HB3  1  
ATOM 1302  H HG2  . ARG A 1 89  ? -5.006  11.278  9.644   1.00 2.22  ? 89  ARG A HG2  1  
ATOM 1303  H HG3  . ARG A 1 89  ? -6.766  11.178  9.720   1.00 2.30  ? 89  ARG A HG3  1  
ATOM 1304  H HD2  . ARG A 1 89  ? -5.789  13.478  10.203  1.00 1.89  ? 89  ARG A HD2  1  
ATOM 1305  H HD3  . ARG A 1 89  ? -6.876  12.847  11.439  1.00 1.63  ? 89  ARG A HD3  1  
ATOM 1306  H HE   . ARG A 1 89  ? -4.357  12.020  12.266  1.00 2.46  ? 89  ARG A HE   1  
ATOM 1307  H HH11 . ARG A 1 89  ? -5.866  14.991  11.379  1.00 2.55  ? 89  ARG A HH11 1  
ATOM 1308  H HH12 . ARG A 1 89  ? -4.878  15.958  12.422  1.00 3.27  ? 89  ARG A HH12 1  
ATOM 1309  H HH21 . ARG A 1 89  ? -3.058  13.266  13.633  1.00 3.36  ? 89  ARG A HH21 1  
ATOM 1310  H HH22 . ARG A 1 89  ? -3.288  14.981  13.698  1.00 3.53  ? 89  ARG A HH22 1  
ATOM 1311  N N    . GLU A 1 90  ? -6.735  7.715   12.800  1.00 0.65  ? 90  GLU A N    1  
ATOM 1312  C CA   . GLU A 1 90  ? -6.580  6.667   13.849  1.00 0.65  ? 90  GLU A CA   1  
ATOM 1313  C C    . GLU A 1 90  ? -6.794  5.293   13.212  1.00 0.64  ? 90  GLU A C    1  
ATOM 1314  O O    . GLU A 1 90  ? -6.051  4.365   13.459  1.00 0.67  ? 90  GLU A O    1  
ATOM 1315  C CB   . GLU A 1 90  ? -7.619  6.892   14.949  1.00 0.71  ? 90  GLU A CB   1  
ATOM 1316  C CG   . GLU A 1 90  ? -7.337  8.223   15.648  1.00 1.32  ? 90  GLU A CG   1  
ATOM 1317  C CD   . GLU A 1 90  ? -6.047  8.109   16.462  1.00 2.02  ? 90  GLU A CD   1  
ATOM 1318  O OE1  . GLU A 1 90  ? -6.083  7.484   17.509  1.00 2.46  ? 90  GLU A OE1  1  
ATOM 1319  O OE2  . GLU A 1 90  ? -5.043  8.648   16.024  1.00 2.78  ? 90  GLU A OE2  1  
ATOM 1320  H H    . GLU A 1 90  ? -7.489  8.340   12.837  1.00 0.67  ? 90  GLU A H    1  
ATOM 1321  H HA   . GLU A 1 90  ? -5.588  6.729   14.272  1.00 0.66  ? 90  GLU A HA   1  
ATOM 1322  H HB2  . GLU A 1 90  ? -8.606  6.915   14.512  1.00 1.12  ? 90  GLU A HB2  1  
ATOM 1323  H HB3  . GLU A 1 90  ? -7.561  6.089   15.669  1.00 1.09  ? 90  GLU A HB3  1  
ATOM 1324  H HG2  . GLU A 1 90  ? -7.229  9.002   14.908  1.00 1.90  ? 90  GLU A HG2  1  
ATOM 1325  H HG3  . GLU A 1 90  ? -8.156  8.464   16.308  1.00 1.78  ? 90  GLU A HG3  1  
ATOM 1326  N N    . VAL A 1 91  ? -7.807  5.148   12.402  1.00 0.64  ? 91  VAL A N    1  
ATOM 1327  C CA   . VAL A 1 91  ? -8.068  3.827   11.763  1.00 0.67  ? 91  VAL A CA   1  
ATOM 1328  C C    . VAL A 1 91  ? -6.903  3.466   10.838  1.00 0.66  ? 91  VAL A C    1  
ATOM 1329  O O    . VAL A 1 91  ? -6.423  2.351   10.838  1.00 0.67  ? 91  VAL A O    1  
ATOM 1330  C CB   . VAL A 1 91  ? -9.369  3.912   10.960  1.00 0.71  ? 91  VAL A CB   1  
ATOM 1331  C CG1  . VAL A 1 91  ? -9.700  2.549   10.354  1.00 0.80  ? 91  VAL A CG1  1  
ATOM 1332  C CG2  . VAL A 1 91  ? -10.508 4.345   11.886  1.00 0.75  ? 91  VAL A CG2  1  
ATOM 1333  H H    . VAL A 1 91  ? -8.402  5.902   12.208  1.00 0.65  ? 91  VAL A H    1  
ATOM 1334  H HA   . VAL A 1 91  ? -8.156  3.067   12.525  1.00 0.69  ? 91  VAL A HA   1  
ATOM 1335  H HB   . VAL A 1 91  ? -9.254  4.638   10.168  1.00 0.70  ? 91  VAL A HB   1  
ATOM 1336  H HG11 . VAL A 1 91  ? -8.909  2.252   9.683   1.00 1.38  ? 91  VAL A HG11 1  
ATOM 1337  H HG12 . VAL A 1 91  ? -10.629 2.616   9.806   1.00 1.38  ? 91  VAL A HG12 1  
ATOM 1338  H HG13 . VAL A 1 91  ? -9.800  1.819   11.142  1.00 1.12  ? 91  VAL A HG13 1  
ATOM 1339  H HG21 . VAL A 1 91  ? -10.660 3.593   12.646  1.00 1.26  ? 91  VAL A HG21 1  
ATOM 1340  H HG22 . VAL A 1 91  ? -11.415 4.464   11.311  1.00 1.29  ? 91  VAL A HG22 1  
ATOM 1341  H HG23 . VAL A 1 91  ? -10.254 5.285   12.355  1.00 1.25  ? 91  VAL A HG23 1  
ATOM 1342  N N    . PHE A 1 92  ? -6.445  4.398   10.053  1.00 0.64  ? 92  PHE A N    1  
ATOM 1343  C CA   . PHE A 1 92  ? -5.311  4.108   9.132   1.00 0.65  ? 92  PHE A CA   1  
ATOM 1344  C C    . PHE A 1 92  ? -4.105  3.590   9.925   1.00 0.62  ? 92  PHE A C    1  
ATOM 1345  O O    . PHE A 1 92  ? -3.449  2.652   9.520   1.00 0.67  ? 92  PHE A O    1  
ATOM 1346  C CB   . PHE A 1 92  ? -4.919  5.390   8.389   1.00 0.65  ? 92  PHE A CB   1  
ATOM 1347  C CG   . PHE A 1 92  ? -3.673  5.144   7.570   1.00 0.65  ? 92  PHE A CG   1  
ATOM 1348  C CD1  . PHE A 1 92  ? -3.774  4.596   6.285   1.00 1.44  ? 92  PHE A CD1  1  
ATOM 1349  C CD2  . PHE A 1 92  ? -2.415  5.460   8.099   1.00 1.31  ? 92  PHE A CD2  1  
ATOM 1350  C CE1  . PHE A 1 92  ? -2.618  4.366   5.530   1.00 1.47  ? 92  PHE A CE1  1  
ATOM 1351  C CE2  . PHE A 1 92  ? -1.260  5.230   7.343   1.00 1.31  ? 92  PHE A CE2  1  
ATOM 1352  C CZ   . PHE A 1 92  ? -1.361  4.683   6.058   1.00 0.73  ? 92  PHE A CZ   1  
ATOM 1353  H H    . PHE A 1 92  ? -6.848  5.292   10.067  1.00 0.63  ? 92  PHE A H    1  
ATOM 1354  H HA   . PHE A 1 92  ? -5.601  3.358   8.411   1.00 0.68  ? 92  PHE A HA   1  
ATOM 1355  H HB2  . PHE A 1 92  ? -5.727  5.686   7.735   1.00 0.66  ? 92  PHE A HB2  1  
ATOM 1356  H HB3  . PHE A 1 92  ? -4.729  6.176   9.105   1.00 0.67  ? 92  PHE A HB3  1  
ATOM 1357  H HD1  . PHE A 1 92  ? -4.744  4.352   5.878   1.00 2.30  ? 92  PHE A HD1  1  
ATOM 1358  H HD2  . PHE A 1 92  ? -2.337  5.882   9.090   1.00 2.16  ? 92  PHE A HD2  1  
ATOM 1359  H HE1  . PHE A 1 92  ? -2.696  3.943   4.539   1.00 2.34  ? 92  PHE A HE1  1  
ATOM 1360  H HE2  . PHE A 1 92  ? -0.290  5.474   7.750   1.00 2.16  ? 92  PHE A HE2  1  
ATOM 1361  H HZ   . PHE A 1 92  ? -0.469  4.505   5.475   1.00 0.77  ? 92  PHE A HZ   1  
ATOM 1362  N N    . PHE A 1 93  ? -3.789  4.197   11.040  1.00 0.58  ? 93  PHE A N    1  
ATOM 1363  C CA   . PHE A 1 93  ? -2.604  3.731   11.824  1.00 0.57  ? 93  PHE A CA   1  
ATOM 1364  C C    . PHE A 1 93  ? -2.978  2.501   12.658  1.00 0.59  ? 93  PHE A C    1  
ATOM 1365  O O    . PHE A 1 93  ? -2.186  1.595   12.828  1.00 0.60  ? 93  PHE A O    1  
ATOM 1366  C CB   . PHE A 1 93  ? -2.122  4.857   12.742  1.00 0.57  ? 93  PHE A CB   1  
ATOM 1367  C CG   . PHE A 1 93  ? -0.827  4.459   13.406  1.00 0.56  ? 93  PHE A CG   1  
ATOM 1368  C CD1  . PHE A 1 93  ? 0.394   4.724   12.774  1.00 1.47  ? 93  PHE A CD1  1  
ATOM 1369  C CD2  . PHE A 1 93  ? -0.846  3.831   14.657  1.00 1.15  ? 93  PHE A CD2  1  
ATOM 1370  C CE1  . PHE A 1 93  ? 1.596   4.360   13.393  1.00 1.58  ? 93  PHE A CE1  1  
ATOM 1371  C CE2  . PHE A 1 93  ? 0.356   3.466   15.276  1.00 1.07  ? 93  PHE A CE2  1  
ATOM 1372  C CZ   . PHE A 1 93  ? 1.577   3.731   14.644  1.00 0.70  ? 93  PHE A CZ   1  
ATOM 1373  H H    . PHE A 1 93  ? -4.315  4.963   11.351  1.00 0.57  ? 93  PHE A H    1  
ATOM 1374  H HA   . PHE A 1 93  ? -1.821  3.460   11.130  1.00 0.57  ? 93  PHE A HA   1  
ATOM 1375  H HB2  . PHE A 1 93  ? -1.967  5.753   12.158  1.00 0.62  ? 93  PHE A HB2  1  
ATOM 1376  H HB3  . PHE A 1 93  ? -2.869  5.047   13.498  1.00 0.56  ? 93  PHE A HB3  1  
ATOM 1377  H HD1  . PHE A 1 93  ? 0.409   5.209   11.810  1.00 2.29  ? 93  PHE A HD1  1  
ATOM 1378  H HD2  . PHE A 1 93  ? -1.787  3.627   15.145  1.00 2.04  ? 93  PHE A HD2  1  
ATOM 1379  H HE1  . PHE A 1 93  ? 2.538   4.565   12.906  1.00 2.50  ? 93  PHE A HE1  1  
ATOM 1380  H HE2  . PHE A 1 93  ? 0.342   2.981   16.241  1.00 1.86  ? 93  PHE A HE2  1  
ATOM 1381  H HZ   . PHE A 1 93  ? 2.504   3.451   15.121  1.00 0.78  ? 93  PHE A HZ   1  
ATOM 1382  N N    . ARG A 1 94  ? -4.175  2.453   13.176  1.00 0.62  ? 94  ARG A N    1  
ATOM 1383  C CA   . ARG A 1 94  ? -4.584  1.272   13.990  1.00 0.67  ? 94  ARG A CA   1  
ATOM 1384  C C    . ARG A 1 94  ? -4.722  0.051   13.075  1.00 0.66  ? 94  ARG A C    1  
ATOM 1385  O O    . ARG A 1 94  ? -4.082  -0.960  13.289  1.00 0.67  ? 94  ARG A O    1  
ATOM 1386  C CB   . ARG A 1 94  ? -5.917  1.564   14.693  1.00 0.72  ? 94  ARG A CB   1  
ATOM 1387  C CG   . ARG A 1 94  ? -6.091  0.640   15.908  1.00 0.89  ? 94  ARG A CG   1  
ATOM 1388  C CD   . ARG A 1 94  ? -6.198  -0.822  15.455  1.00 1.00  ? 94  ARG A CD   1  
ATOM 1389  N NE   . ARG A 1 94  ? -6.924  -1.606  16.495  1.00 1.95  ? 94  ARG A NE   1  
ATOM 1390  C CZ   . ARG A 1 94  ? -7.388  -2.793  16.215  1.00 2.64  ? 94  ARG A CZ   1  
ATOM 1391  N NH1  . ARG A 1 94  ? -7.211  -3.299  15.025  1.00 2.76  ? 94  ARG A NH1  1  
ATOM 1392  N NH2  . ARG A 1 94  ? -8.027  -3.476  17.125  1.00 3.65  ? 94  ARG A NH2  1  
ATOM 1393  H H    . ARG A 1 94  ? -4.804  3.190   13.028  1.00 0.62  ? 94  ARG A H    1  
ATOM 1394  H HA   . ARG A 1 94  ? -3.819  1.048   14.720  1.00 0.68  ? 94  ARG A HA   1  
ATOM 1395  H HB2  . ARG A 1 94  ? -5.925  2.592   15.024  1.00 0.81  ? 94  ARG A HB2  1  
ATOM 1396  H HB3  . ARG A 1 94  ? -6.732  1.406   14.003  1.00 0.78  ? 94  ARG A HB3  1  
ATOM 1397  H HG2  . ARG A 1 94  ? -5.242  0.751   16.566  1.00 1.50  ? 94  ARG A HG2  1  
ATOM 1398  H HG3  . ARG A 1 94  ? -6.991  0.915   16.437  1.00 1.69  ? 94  ARG A HG3  1  
ATOM 1399  H HD2  . ARG A 1 94  ? -6.739  -0.880  14.522  1.00 1.49  ? 94  ARG A HD2  1  
ATOM 1400  H HD3  . ARG A 1 94  ? -5.208  -1.232  15.324  1.00 1.47  ? 94  ARG A HD3  1  
ATOM 1401  H HE   . ARG A 1 94  ? -7.055  -1.228  17.390  1.00 2.46  ? 94  ARG A HE   1  
ATOM 1402  H HH11 . ARG A 1 94  ? -6.720  -2.777  14.327  1.00 2.42  ? 94  ARG A HH11 1  
ATOM 1403  H HH12 . ARG A 1 94  ? -7.566  -4.209  14.810  1.00 3.50  ? 94  ARG A HH12 1  
ATOM 1404  H HH21 . ARG A 1 94  ? -8.162  -3.088  18.037  1.00 4.01  ? 94  ARG A HH21 1  
ATOM 1405  H HH22 . ARG A 1 94  ? -8.383  -4.385  16.911  1.00 4.24  ? 94  ARG A HH22 1  
ATOM 1406  N N    . VAL A 1 95  ? -5.526  0.121   12.051  1.00 0.65  ? 95  VAL A N    1  
ATOM 1407  C CA   . VAL A 1 95  ? -5.668  -1.045  11.136  1.00 0.66  ? 95  VAL A CA   1  
ATOM 1408  C C    . VAL A 1 95  ? -4.303  -1.432  10.565  1.00 0.66  ? 95  VAL A C    1  
ATOM 1409  O O    . VAL A 1 95  ? -3.963  -2.595  10.471  1.00 0.67  ? 95  VAL A O    1  
ATOM 1410  C CB   . VAL A 1 95  ? -6.594  -0.649  9.984   1.00 0.64  ? 95  VAL A CB   1  
ATOM 1411  C CG1  . VAL A 1 95  ? -6.674  -1.793  8.970   1.00 1.27  ? 95  VAL A CG1  1  
ATOM 1412  C CG2  . VAL A 1 95  ? -7.991  -0.368  10.540  1.00 1.08  ? 95  VAL A CG2  1  
ATOM 1413  H H    . VAL A 1 95  ? -6.038  0.934   11.852  1.00 0.66  ? 95  VAL A H    1  
ATOM 1414  H HA   . VAL A 1 95  ? -6.112  -1.883  11.654  1.00 0.68  ? 95  VAL A HA   1  
ATOM 1415  H HB   . VAL A 1 95  ? -6.211  0.238   9.499   1.00 1.14  ? 95  VAL A HB   1  
ATOM 1416  H HG11 . VAL A 1 95  ? -7.489  -1.609  8.285   1.00 1.81  ? 95  VAL A HG11 1  
ATOM 1417  H HG12 . VAL A 1 95  ? -6.845  -2.724  9.490   1.00 1.74  ? 95  VAL A HG12 1  
ATOM 1418  H HG13 . VAL A 1 95  ? -5.747  -1.853  8.419   1.00 1.85  ? 95  VAL A HG13 1  
ATOM 1419  H HG21 . VAL A 1 95  ? -8.377  -1.261  11.009  1.00 1.72  ? 95  VAL A HG21 1  
ATOM 1420  H HG22 . VAL A 1 95  ? -8.646  -0.072  9.735   1.00 1.70  ? 95  VAL A HG22 1  
ATOM 1421  H HG23 . VAL A 1 95  ? -7.933  0.425   11.270  1.00 1.50  ? 95  VAL A HG23 1  
ATOM 1422  N N    . ALA A 1 96  ? -3.527  -0.462  10.158  1.00 0.65  ? 96  ALA A N    1  
ATOM 1423  C CA   . ALA A 1 96  ? -2.197  -0.771  9.564   1.00 0.68  ? 96  ALA A CA   1  
ATOM 1424  C C    . ALA A 1 96  ? -1.362  -1.569  10.568  1.00 0.70  ? 96  ALA A C    1  
ATOM 1425  O O    . ALA A 1 96  ? -0.995  -2.707  10.354  1.00 0.76  ? 96  ALA A O    1  
ATOM 1426  C CB   . ALA A 1 96  ? -1.483  0.545   9.252   1.00 0.69  ? 96  ALA A CB   1  
ATOM 1427  H H    . ALA A 1 96  ? -3.829  0.468   10.225  1.00 0.65  ? 96  ALA A H    1  
ATOM 1428  H HA   . ALA A 1 96  ? -2.374  -1.286  8.630   1.00 0.69  ? 96  ALA A HA   1  
ATOM 1429  H HB1  . ALA A 1 96  ? -0.465  0.341   8.958   1.00 1.19  ? 96  ALA A HB1  1  
ATOM 1430  H HB2  . ALA A 1 96  ? -1.487  1.175   10.129  1.00 1.22  ? 96  ALA A HB2  1  
ATOM 1431  H HB3  . ALA A 1 96  ? -1.996  1.049   8.445   1.00 1.14  ? 96  ALA A HB3  1  
ATOM 1432  N N    . ALA A 1 97  ? -1.084  -0.935  11.678  1.00 0.74  ? 97  ALA A N    1  
ATOM 1433  C CA   . ALA A 1 97  ? -0.285  -1.575  12.767  1.00 0.78  ? 97  ALA A CA   1  
ATOM 1434  C C    . ALA A 1 97  ? -0.731  -3.027  12.950  1.00 0.79  ? 97  ALA A C    1  
ATOM 1435  O O    . ALA A 1 97  ? 0.070   -3.905  13.202  1.00 0.83  ? 97  ALA A O    1  
ATOM 1436  C CB   . ALA A 1 97  ? -0.511  -0.812  14.074  1.00 0.77  ? 97  ALA A CB   1  
ATOM 1437  H H    . ALA A 1 97  ? -1.427  -0.023  11.774  1.00 0.80  ? 97  ALA A H    1  
ATOM 1438  H HA   . ALA A 1 97  ? 0.766   -1.553  12.520  1.00 0.81  ? 97  ALA A HA   1  
ATOM 1439  H HB1  . ALA A 1 97  ? -0.196  0.214   13.951  1.00 1.22  ? 97  ALA A HB1  1  
ATOM 1440  H HB2  . ALA A 1 97  ? 0.065   -1.273  14.864  1.00 1.21  ? 97  ALA A HB2  1  
ATOM 1441  H HB3  . ALA A 1 97  ? -1.559  -0.839  14.331  1.00 1.35  ? 97  ALA A HB3  1  
ATOM 1442  N N    . ASP A 1 98  ? -2.001  -3.286  12.826  1.00 0.78  ? 98  ASP A N    1  
ATOM 1443  C CA   . ASP A 1 98  ? -2.496  -4.679  12.994  1.00 0.82  ? 98  ASP A CA   1  
ATOM 1444  C C    . ASP A 1 98  ? -1.915  -5.575  11.898  1.00 0.83  ? 98  ASP A C    1  
ATOM 1445  O O    . ASP A 1 98  ? -1.642  -6.737  12.127  1.00 0.88  ? 98  ASP A O    1  
ATOM 1446  C CB   . ASP A 1 98  ? -4.025  -4.695  12.920  1.00 0.82  ? 98  ASP A CB   1  
ATOM 1447  C CG   . ASP A 1 98  ? -4.539  -6.090  13.279  1.00 1.47  ? 98  ASP A CG   1  
ATOM 1448  O OD1  . ASP A 1 98  ? -4.700  -6.355  14.460  1.00 2.19  ? 98  ASP A OD1  1  
ATOM 1449  O OD2  . ASP A 1 98  ? -4.765  -6.870  12.369  1.00 2.13  ? 98  ASP A OD2  1  
ATOM 1450  H H    . ASP A 1 98  ? -2.631  -2.563  12.621  1.00 0.77  ? 98  ASP A H    1  
ATOM 1451  H HA   . ASP A 1 98  ? -2.176  -5.071  13.947  1.00 0.85  ? 98  ASP A HA   1  
ATOM 1452  H HB2  . ASP A 1 98  ? -4.426  -3.972  13.615  1.00 1.13  ? 98  ASP A HB2  1  
ATOM 1453  H HB3  . ASP A 1 98  ? -4.340  -4.445  11.918  1.00 1.31  ? 98  ASP A HB3  1  
ATOM 1454  N N    . MET A 1 99  ? -1.744  -5.074  10.704  1.00 0.81  ? 99  MET A N    1  
ATOM 1455  C CA   . MET A 1 99  ? -1.207  -5.948  9.622   1.00 0.85  ? 99  MET A CA   1  
ATOM 1456  C C    . MET A 1 99  ? 0.237   -6.349  9.938   1.00 0.97  ? 99  MET A C    1  
ATOM 1457  O O    . MET A 1 99  ? 0.711   -7.371  9.484   1.00 1.14  ? 99  MET A O    1  
ATOM 1458  C CB   . MET A 1 99  ? -1.241  -5.212  8.282   1.00 0.79  ? 99  MET A CB   1  
ATOM 1459  C CG   . MET A 1 99  ? -2.687  -4.984  7.846   1.00 0.81  ? 99  MET A CG   1  
ATOM 1460  S SD   . MET A 1 99  ? -2.696  -4.312  6.166   1.00 0.97  ? 99  MET A SD   1  
ATOM 1461  C CE   . MET A 1 99  ? -4.469  -3.973  6.069   1.00 0.48  ? 99  MET A CE   1  
ATOM 1462  H H    . MET A 1 99  ? -1.989  -4.144  10.512  1.00 0.79  ? 99  MET A H    1  
ATOM 1463  H HA   . MET A 1 99  ? -1.823  -6.833  9.580   1.00 0.91  ? 99  MET A HA   1  
ATOM 1464  H HB2  . MET A 1 99  ? -0.744  -4.258  8.387   1.00 1.11  ? 99  MET A HB2  1  
ATOM 1465  H HB3  . MET A 1 99  ? -0.731  -5.801  7.536   1.00 1.06  ? 99  MET A HB3  1  
ATOM 1466  H HG2  . MET A 1 99  ? -3.222  -5.922  7.864   1.00 1.31  ? 99  MET A HG2  1  
ATOM 1467  H HG3  . MET A 1 99  ? -3.161  -4.284  8.518   1.00 1.20  ? 99  MET A HG3  1  
ATOM 1468  H HE1  . MET A 1 99  ? -4.719  -3.176  6.756   1.00 1.17  ? 99  MET A HE1  1  
ATOM 1469  H HE2  . MET A 1 99  ? -5.020  -4.862  6.332   1.00 1.11  ? 99  MET A HE2  1  
ATOM 1470  H HE3  . MET A 1 99  ? -4.722  -3.678  5.059   1.00 1.06  ? 99  MET A HE3  1  
ATOM 1471  N N    . PHE A 1 100 ? 0.938   -5.556  10.713  1.00 0.98  ? 100 PHE A N    1  
ATOM 1472  C CA   . PHE A 1 100 ? 2.358   -5.889  11.064  1.00 1.14  ? 100 PHE A CA   1  
ATOM 1473  C C    . PHE A 1 100 ? 2.461   -6.152  12.565  1.00 1.28  ? 100 PHE A C    1  
ATOM 1474  O O    . PHE A 1 100 ? 3.537   -6.164  13.130  1.00 1.67  ? 100 PHE A O    1  
ATOM 1475  C CB   . PHE A 1 100 ? 3.263   -4.703  10.717  1.00 1.19  ? 100 PHE A CB   1  
ATOM 1476  C CG   . PHE A 1 100 ? 3.051   -4.294  9.278   1.00 1.15  ? 100 PHE A CG   1  
ATOM 1477  C CD1  . PHE A 1 100 ? 1.899   -3.588  8.916   1.00 1.64  ? 100 PHE A CD1  1  
ATOM 1478  C CD2  . PHE A 1 100 ? 4.010   -4.615  8.308   1.00 1.67  ? 100 PHE A CD2  1  
ATOM 1479  C CE1  . PHE A 1 100 ? 1.704   -3.201  7.585   1.00 1.69  ? 100 PHE A CE1  1  
ATOM 1480  C CE2  . PHE A 1 100 ? 3.814   -4.229  6.977   1.00 1.79  ? 100 PHE A CE2  1  
ATOM 1481  C CZ   . PHE A 1 100 ? 2.661   -3.521  6.615   1.00 1.38  ? 100 PHE A CZ   1  
ATOM 1482  H H    . PHE A 1 100 ? 0.533   -4.739  11.071  1.00 0.94  ? 100 PHE A H    1  
ATOM 1483  H HA   . PHE A 1 100 ? 2.687   -6.762  10.517  1.00 1.20  ? 100 PHE A HA   1  
ATOM 1484  H HB2  . PHE A 1 100 ? 3.024   -3.871  11.364  1.00 1.19  ? 100 PHE A HB2  1  
ATOM 1485  H HB3  . PHE A 1 100 ? 4.295   -4.985  10.864  1.00 1.36  ? 100 PHE A HB3  1  
ATOM 1486  H HD1  . PHE A 1 100 ? 1.162   -3.341  9.664   1.00 2.37  ? 100 PHE A HD1  1  
ATOM 1487  H HD2  . PHE A 1 100 ? 4.900   -5.160  8.587   1.00 2.36  ? 100 PHE A HD2  1  
ATOM 1488  H HE1  . PHE A 1 100 ? 0.815   -2.655  7.307   1.00 2.38  ? 100 PHE A HE1  1  
ATOM 1489  H HE2  . PHE A 1 100 ? 4.553   -4.476  6.230   1.00 2.56  ? 100 PHE A HE2  1  
ATOM 1490  H HZ   . PHE A 1 100 ? 2.511   -3.223  5.589   1.00 1.54  ? 100 PHE A HZ   1  
ATOM 1491  N N    . SER A 1 101 ? 1.348   -6.310  13.229  1.00 1.34  ? 101 SER A N    1  
ATOM 1492  C CA   . SER A 1 101 ? 1.395   -6.510  14.704  1.00 1.52  ? 101 SER A CA   1  
ATOM 1493  C C    . SER A 1 101 ? 1.914   -7.904  15.066  1.00 1.61  ? 101 SER A C    1  
ATOM 1494  O O    . SER A 1 101 ? 1.897   -8.284  16.219  1.00 1.99  ? 101 SER A O    1  
ATOM 1495  C CB   . SER A 1 101 ? 0.003   -6.300  15.303  1.00 1.79  ? 101 SER A CB   1  
ATOM 1496  O OG   . SER A 1 101 ? -0.029  -6.834  16.620  1.00 2.21  ? 101 SER A OG   1  
ATOM 1497  H H    . SER A 1 101 ? 0.486   -6.260  12.767  1.00 1.50  ? 101 SER A H    1  
ATOM 1498  H HA   . SER A 1 101 ? 2.081   -5.785  15.115  1.00 1.75  ? 101 SER A HA   1  
ATOM 1499  H HB2  . SER A 1 101 ? -0.219  -5.246  15.342  1.00 2.11  ? 101 SER A HB2  1  
ATOM 1500  H HB3  . SER A 1 101 ? -0.732  -6.797  14.684  1.00 2.15  ? 101 SER A HB3  1  
ATOM 1501  H HG   . SER A 1 101 ? -0.535  -7.650  16.596  1.00 2.49  ? 101 SER A HG   1  
ATOM 1502  N N    . ASP A 1 102 ? 2.405   -8.671  14.122  1.00 1.99  ? 102 ASP A N    1  
ATOM 1503  C CA   . ASP A 1 102 ? 2.948   -10.020 14.467  1.00 2.34  ? 102 ASP A CA   1  
ATOM 1504  C C    . ASP A 1 102 ? 3.978   -10.375 13.392  1.00 2.07  ? 102 ASP A C    1  
ATOM 1505  O O    . ASP A 1 102 ? 4.109   -9.656  12.421  1.00 2.62  ? 102 ASP A O    1  
ATOM 1506  C CB   . ASP A 1 102 ? 1.819   -11.049 14.467  1.00 3.15  ? 102 ASP A CB   1  
ATOM 1507  C CG   . ASP A 1 102 ? 1.054   -10.960 13.145  1.00 3.78  ? 102 ASP A CG   1  
ATOM 1508  O OD1  . ASP A 1 102 ? 1.542   -11.498 12.164  1.00 4.10  ? 102 ASP A OD1  1  
ATOM 1509  O OD2  . ASP A 1 102 ? -0.004  -10.355 13.134  1.00 4.42  ? 102 ASP A OD2  1  
ATOM 1510  H H    . ASP A 1 102 ? 2.450   -8.388  13.185  1.00 2.41  ? 102 ASP A H    1  
ATOM 1511  H HA   . ASP A 1 102 ? 3.412   -9.965  15.443  1.00 2.78  ? 102 ASP A HA   1  
ATOM 1512  H HB2  . ASP A 1 102 ? 2.236   -12.038 14.579  1.00 3.32  ? 102 ASP A HB2  1  
ATOM 1513  H HB3  . ASP A 1 102 ? 1.145   -10.845 15.285  1.00 3.70  ? 102 ASP A HB3  1  
ATOM 1514  N N    . GLY A 1 103 ? 4.706   -11.457 13.504  1.00 2.05  ? 103 GLY A N    1  
ATOM 1515  C CA   . GLY A 1 103 ? 5.684   -11.788 12.431  1.00 2.45  ? 103 GLY A CA   1  
ATOM 1516  C C    . GLY A 1 103 ? 6.606   -10.605 12.156  1.00 2.44  ? 103 GLY A C    1  
ATOM 1517  O O    . GLY A 1 103 ? 7.043   -9.920  13.061  1.00 3.08  ? 103 GLY A O    1  
ATOM 1518  H H    . GLY A 1 103 ? 4.650   -12.080 14.259  1.00 2.36  ? 103 GLY A H    1  
ATOM 1519  H HA2  . GLY A 1 103 ? 6.276   -12.635 12.745  1.00 2.86  ? 103 GLY A HA2  1  
ATOM 1520  H HA3  . GLY A 1 103 ? 5.161   -12.055 11.525  1.00 2.87  ? 103 GLY A HA3  1  
ATOM 1521  N N    . ASN A 1 104 ? 6.920   -10.368 10.912  1.00 2.29  ? 104 ASN A N    1  
ATOM 1522  C CA   . ASN A 1 104 ? 7.829   -9.238  10.580  1.00 2.55  ? 104 ASN A CA   1  
ATOM 1523  C C    . ASN A 1 104 ? 7.711   -8.895  9.087   1.00 2.17  ? 104 ASN A C    1  
ATOM 1524  O O    . ASN A 1 104 ? 7.570   -7.745  8.724   1.00 2.54  ? 104 ASN A O    1  
ATOM 1525  C CB   . ASN A 1 104 ? 9.281   -9.632  10.924  1.00 3.20  ? 104 ASN A CB   1  
ATOM 1526  C CG   . ASN A 1 104 ? 9.453   -11.149 10.791  1.00 3.72  ? 104 ASN A CG   1  
ATOM 1527  O OD1  . ASN A 1 104 ? 9.736   -11.826 11.759  1.00 4.05  ? 104 ASN A OD1  1  
ATOM 1528  N ND2  . ASN A 1 104 ? 9.293   -11.715 9.626   1.00 4.31  ? 104 ASN A ND2  1  
ATOM 1529  H H    . ASN A 1 104 ? 6.566   -10.940 10.199  1.00 2.45  ? 104 ASN A H    1  
ATOM 1530  H HA   . ASN A 1 104 ? 7.545   -8.374  11.163  1.00 2.95  ? 104 ASN A HA   1  
ATOM 1531  H HB2  . ASN A 1 104 ? 9.968   -9.133  10.255  1.00 3.39  ? 104 ASN A HB2  1  
ATOM 1532  H HB3  . ASN A 1 104 ? 9.501   -9.341  11.941  1.00 3.67  ? 104 ASN A HB3  1  
ATOM 1533  H HD21 . ASN A 1 104 ? 9.066   -11.171 8.844   1.00 4.45  ? 104 ASN A HD21 1  
ATOM 1534  H HD22 . ASN A 1 104 ? 9.399   -12.685 9.534   1.00 4.84  ? 104 ASN A HD22 1  
ATOM 1535  N N    . PHE A 1 105 ? 7.790   -9.876  8.217   1.00 1.90  ? 105 PHE A N    1  
ATOM 1536  C CA   . PHE A 1 105 ? 7.706   -9.594  6.755   1.00 1.74  ? 105 PHE A CA   1  
ATOM 1537  C C    . PHE A 1 105 ? 6.870   -10.664 6.044   1.00 1.59  ? 105 PHE A C    1  
ATOM 1538  O O    . PHE A 1 105 ? 7.103   -11.849 6.181   1.00 1.88  ? 105 PHE A O    1  
ATOM 1539  C CB   . PHE A 1 105 ? 9.117   -9.596  6.177   1.00 2.03  ? 105 PHE A CB   1  
ATOM 1540  C CG   . PHE A 1 105 ? 9.049   -9.174  4.738   1.00 1.75  ? 105 PHE A CG   1  
ATOM 1541  C CD1  . PHE A 1 105 ? 8.953   -7.818  4.417   1.00 2.14  ? 105 PHE A CD1  1  
ATOM 1542  C CD2  . PHE A 1 105 ? 9.068   -10.136 3.726   1.00 2.28  ? 105 PHE A CD2  1  
ATOM 1543  C CE1  . PHE A 1 105 ? 8.877   -7.423  3.081   1.00 2.60  ? 105 PHE A CE1  1  
ATOM 1544  C CE2  . PHE A 1 105 ? 8.993   -9.743  2.390   1.00 2.84  ? 105 PHE A CE2  1  
ATOM 1545  C CZ   . PHE A 1 105 ? 8.897   -8.385  2.064   1.00 2.84  ? 105 PHE A CZ   1  
ATOM 1546  H H    . PHE A 1 105 ? 7.927   -10.790 8.525   1.00 2.17  ? 105 PHE A H    1  
ATOM 1547  H HA   . PHE A 1 105 ? 7.256   -8.627  6.587   1.00 1.98  ? 105 PHE A HA   1  
ATOM 1548  H HB2  . PHE A 1 105 ? 9.736   -8.904  6.731   1.00 2.66  ? 105 PHE A HB2  1  
ATOM 1549  H HB3  . PHE A 1 105 ? 9.536   -10.589 6.245   1.00 2.53  ? 105 PHE A HB3  1  
ATOM 1550  H HD1  . PHE A 1 105 ? 8.938   -7.075  5.202   1.00 2.69  ? 105 PHE A HD1  1  
ATOM 1551  H HD2  . PHE A 1 105 ? 9.142   -11.184 3.978   1.00 2.82  ? 105 PHE A HD2  1  
ATOM 1552  H HE1  . PHE A 1 105 ? 8.802   -6.377  2.835   1.00 3.27  ? 105 PHE A HE1  1  
ATOM 1553  H HE2  . PHE A 1 105 ? 9.007   -10.488 1.613   1.00 3.66  ? 105 PHE A HE2  1  
ATOM 1554  H HZ   . PHE A 1 105 ? 8.839   -8.079  1.029   1.00 3.53  ? 105 PHE A HZ   1  
ATOM 1555  N N    . ASN A 1 106 ? 5.894   -10.240 5.279   1.00 1.85  ? 106 ASN A N    1  
ATOM 1556  C CA   . ASN A 1 106 ? 5.025   -11.209 4.538   1.00 1.93  ? 106 ASN A CA   1  
ATOM 1557  C C    . ASN A 1 106 ? 4.720   -10.653 3.140   1.00 1.72  ? 106 ASN A C    1  
ATOM 1558  O O    . ASN A 1 106 ? 5.569   -10.062 2.502   1.00 2.31  ? 106 ASN A O    1  
ATOM 1559  C CB   . ASN A 1 106 ? 3.717   -11.409 5.313   1.00 2.62  ? 106 ASN A CB   1  
ATOM 1560  C CG   . ASN A 1 106 ? 3.041   -12.709 4.869   1.00 3.11  ? 106 ASN A CG   1  
ATOM 1561  O OD1  . ASN A 1 106 ? 3.339   -13.234 3.815   1.00 3.46  ? 106 ASN A OD1  1  
ATOM 1562  N ND2  . ASN A 1 106 ? 2.137   -13.253 5.637   1.00 3.79  ? 106 ASN A ND2  1  
ATOM 1563  H H    . ASN A 1 106 ? 5.739   -9.275  5.203   1.00 2.35  ? 106 ASN A H    1  
ATOM 1564  H HA   . ASN A 1 106 ? 5.540   -12.156 4.447   1.00 2.19  ? 106 ASN A HA   1  
ATOM 1565  H HB2  . ASN A 1 106 ? 3.932   -11.459 6.370   1.00 3.01  ? 106 ASN A HB2  1  
ATOM 1566  H HB3  . ASN A 1 106 ? 3.054   -10.581 5.122   1.00 3.06  ? 106 ASN A HB3  1  
ATOM 1567  H HD21 . ASN A 1 106 ? 1.898   -12.828 6.488   1.00 3.97  ? 106 ASN A HD21 1  
ATOM 1568  H HD22 . ASN A 1 106 ? 1.698   -14.085 5.364   1.00 4.42  ? 106 ASN A HD22 1  
ATOM 1569  N N    . TRP A 1 107 ? 3.516   -10.850 2.655   1.00 1.54  ? 107 TRP A N    1  
ATOM 1570  C CA   . TRP A 1 107 ? 3.153   -10.342 1.291   1.00 1.68  ? 107 TRP A CA   1  
ATOM 1571  C C    . TRP A 1 107 ? 1.748   -9.729  1.311   1.00 1.47  ? 107 TRP A C    1  
ATOM 1572  O O    . TRP A 1 107 ? 1.444   -8.825  0.558   1.00 1.49  ? 107 TRP A O    1  
ATOM 1573  C CB   . TRP A 1 107 ? 3.176   -11.505 0.296   1.00 2.30  ? 107 TRP A CB   1  
ATOM 1574  C CG   . TRP A 1 107 ? 4.426   -12.303 0.484   1.00 2.32  ? 107 TRP A CG   1  
ATOM 1575  C CD1  . TRP A 1 107 ? 4.500   -13.487 1.134   1.00 2.69  ? 107 TRP A CD1  1  
ATOM 1576  C CD2  . TRP A 1 107 ? 5.777   -11.999 0.030   1.00 2.77  ? 107 TRP A CD2  1  
ATOM 1577  N NE1  . TRP A 1 107 ? 5.811   -13.930 1.107   1.00 3.12  ? 107 TRP A NE1  1  
ATOM 1578  C CE2  . TRP A 1 107 ? 6.635   -13.047 0.439   1.00 3.35  ? 107 TRP A CE2  1  
ATOM 1579  C CE3  . TRP A 1 107 ? 6.335   -10.927 -0.689  1.00 3.24  ? 107 TRP A CE3  1  
ATOM 1580  C CZ2  . TRP A 1 107 ? 7.999   -13.033 0.144   1.00 4.31  ? 107 TRP A CZ2  1  
ATOM 1581  C CZ3  . TRP A 1 107 ? 7.708   -10.909 -0.987  1.00 4.29  ? 107 TRP A CZ3  1  
ATOM 1582  C CH2  . TRP A 1 107 ? 8.538   -11.960 -0.571  1.00 4.80  ? 107 TRP A CH2  1  
ATOM 1583  H H    . TRP A 1 107 ? 2.856   -11.344 3.184   1.00 1.87  ? 107 TRP A H    1  
ATOM 1584  H HA   . TRP A 1 107 ? 3.862   -9.589  0.974   1.00 1.91  ? 107 TRP A HA   1  
ATOM 1585  H HB2  . TRP A 1 107 ? 2.317   -12.138 0.464   1.00 2.77  ? 107 TRP A HB2  1  
ATOM 1586  H HB3  . TRP A 1 107 ? 3.145   -11.117 -0.711  1.00 2.87  ? 107 TRP A HB3  1  
ATOM 1587  H HD1  . TRP A 1 107 ? 3.672   -14.003 1.597   1.00 3.02  ? 107 TRP A HD1  1  
ATOM 1588  H HE1  . TRP A 1 107 ? 6.134   -14.764 1.508   1.00 3.54  ? 107 TRP A HE1  1  
ATOM 1589  H HE3  . TRP A 1 107 ? 5.705   -10.113 -1.014  1.00 3.02  ? 107 TRP A HE3  1  
ATOM 1590  H HZ2  . TRP A 1 107 ? 8.634   -13.844 0.467   1.00 4.84  ? 107 TRP A HZ2  1  
ATOM 1591  H HZ3  . TRP A 1 107 ? 8.126   -10.081 -1.540  1.00 4.86  ? 107 TRP A HZ3  1  
ATOM 1592  H HH2  . TRP A 1 107 ? 9.592   -11.940 -0.804  1.00 5.71  ? 107 TRP A HH2  1  
ATOM 1593  N N    . GLY A 1 108 ? 0.892   -10.207 2.173   1.00 1.41  ? 108 GLY A N    1  
ATOM 1594  C CA   . GLY A 1 108 ? -0.490  -9.643  2.245   1.00 1.47  ? 108 GLY A CA   1  
ATOM 1595  C C    . GLY A 1 108 ? -0.412  -8.195  2.731   1.00 1.05  ? 108 GLY A C    1  
ATOM 1596  O O    . GLY A 1 108 ? -0.979  -7.294  2.145   1.00 1.02  ? 108 GLY A O    1  
ATOM 1597  H H    . GLY A 1 108 ? 1.165   -10.930 2.776   1.00 1.45  ? 108 GLY A H    1  
ATOM 1598  H HA2  . GLY A 1 108 ? -0.942  -9.673  1.264   1.00 1.69  ? 108 GLY A HA2  1  
ATOM 1599  H HA3  . GLY A 1 108 ? -1.083  -10.221 2.936   1.00 1.74  ? 108 GLY A HA3  1  
ATOM 1600  N N    . ARG A 1 109 ? 0.309   -7.971  3.791   1.00 0.86  ? 109 ARG A N    1  
ATOM 1601  C CA   . ARG A 1 109 ? 0.474   -6.594  4.339   1.00 0.87  ? 109 ARG A CA   1  
ATOM 1602  C C    . ARG A 1 109 ? 0.705   -5.581  3.214   1.00 0.70  ? 109 ARG A C    1  
ATOM 1603  O O    . ARG A 1 109 ? -0.012  -4.609  3.082   1.00 0.81  ? 109 ARG A O    1  
ATOM 1604  C CB   . ARG A 1 109 ? 1.717   -6.570  5.286   1.00 1.08  ? 109 ARG A CB   1  
ATOM 1605  C CG   . ARG A 1 109 ? 2.479   -7.899  5.223   1.00 1.48  ? 109 ARG A CG   1  
ATOM 1606  C CD   . ARG A 1 109 ? 3.825   -7.754  5.945   1.00 1.96  ? 109 ARG A CD   1  
ATOM 1607  N NE   . ARG A 1 109 ? 4.814   -7.115  5.033   1.00 2.74  ? 109 ARG A NE   1  
ATOM 1608  C CZ   . ARG A 1 109 ? 5.900   -6.579  5.520   1.00 3.19  ? 109 ARG A CZ   1  
ATOM 1609  N NH1  . ARG A 1 109 ? 6.094   -6.552  6.810   1.00 3.19  ? 109 ARG A NH1  1  
ATOM 1610  N NH2  . ARG A 1 109 ? 6.785   -6.055  4.716   1.00 4.08  ? 109 ARG A NH2  1  
ATOM 1611  H H    . ARG A 1 109 ? 0.771   -8.713  4.234   1.00 0.93  ? 109 ARG A H    1  
ATOM 1612  H HA   . ARG A 1 109 ? -0.386  -6.299  4.930   1.00 1.25  ? 109 ARG A HA   1  
ATOM 1613  H HB2  . ARG A 1 109 ? 2.390   -5.770  5.007   1.00 1.43  ? 109 ARG A HB2  1  
ATOM 1614  H HB3  . ARG A 1 109 ? 1.391   -6.407  6.306   1.00 1.52  ? 109 ARG A HB3  1  
ATOM 1615  H HG2  . ARG A 1 109 ? 1.892   -8.667  5.703   1.00 2.00  ? 109 ARG A HG2  1  
ATOM 1616  H HG3  . ARG A 1 109 ? 2.655   -8.168  4.192   1.00 2.02  ? 109 ARG A HG3  1  
ATOM 1617  H HD2  . ARG A 1 109 ? 3.700   -7.145  6.832   1.00 2.34  ? 109 ARG A HD2  1  
ATOM 1618  H HD3  . ARG A 1 109 ? 4.187   -8.730  6.227   1.00 2.24  ? 109 ARG A HD3  1  
ATOM 1619  H HE   . ARG A 1 109 ? 4.657   -7.111  4.065   1.00 3.26  ? 109 ARG A HE   1  
ATOM 1620  H HH11 . ARG A 1 109 ? 5.410   -6.942  7.427   1.00 2.87  ? 109 ARG A HH11 1  
ATOM 1621  H HH12 . ARG A 1 109 ? 6.926   -6.142  7.182   1.00 3.82  ? 109 ARG A HH12 1  
ATOM 1622  H HH21 . ARG A 1 109 ? 6.631   -6.063  3.728   1.00 4.49  ? 109 ARG A HH21 1  
ATOM 1623  H HH22 . ARG A 1 109 ? 7.618   -5.644  5.089   1.00 4.54  ? 109 ARG A HH22 1  
ATOM 1624  N N    . VAL A 1 110 ? 1.743   -5.768  2.446   1.00 0.60  ? 110 VAL A N    1  
ATOM 1625  C CA   . VAL A 1 110 ? 2.059   -4.775  1.387   1.00 0.68  ? 110 VAL A CA   1  
ATOM 1626  C C    . VAL A 1 110 ? 0.867   -4.600  0.445   1.00 0.56  ? 110 VAL A C    1  
ATOM 1627  O O    . VAL A 1 110 ? 0.233   -3.563  0.421   1.00 0.60  ? 110 VAL A O    1  
ATOM 1628  C CB   . VAL A 1 110 ? 3.292   -5.231  0.605   1.00 0.88  ? 110 VAL A CB   1  
ATOM 1629  C CG1  . VAL A 1 110 ? 3.721   -4.131  -0.366  1.00 1.27  ? 110 VAL A CG1  1  
ATOM 1630  C CG2  . VAL A 1 110 ? 4.436   -5.521  1.580   1.00 1.73  ? 110 VAL A CG2  1  
ATOM 1631  H H    . VAL A 1 110 ? 2.339   -6.530  2.600   1.00 0.60  ? 110 VAL A H    1  
ATOM 1632  H HA   . VAL A 1 110 ? 2.271   -3.847  1.897   1.00 0.87  ? 110 VAL A HA   1  
ATOM 1633  H HB   . VAL A 1 110 ? 3.054   -6.127  0.050   1.00 1.28  ? 110 VAL A HB   1  
ATOM 1634  H HG11 . VAL A 1 110 ? 4.672   -4.390  -0.807  1.00 1.71  ? 110 VAL A HG11 1  
ATOM 1635  H HG12 . VAL A 1 110 ? 3.814   -3.196  0.167   1.00 1.81  ? 110 VAL A HG12 1  
ATOM 1636  H HG13 . VAL A 1 110 ? 2.980   -4.030  -1.144  1.00 1.85  ? 110 VAL A HG13 1  
ATOM 1637  H HG21 . VAL A 1 110 ? 5.311   -5.829  1.028   1.00 2.12  ? 110 VAL A HG21 1  
ATOM 1638  H HG22 . VAL A 1 110 ? 4.141   -6.310  2.256   1.00 2.28  ? 110 VAL A HG22 1  
ATOM 1639  H HG23 . VAL A 1 110 ? 4.662   -4.629  2.146   1.00 2.29  ? 110 VAL A HG23 1  
ATOM 1640  N N    . VAL A 1 111 ? 0.568   -5.592  -0.351  1.00 0.51  ? 111 VAL A N    1  
ATOM 1641  C CA   . VAL A 1 111 ? -0.565  -5.468  -1.309  1.00 0.50  ? 111 VAL A CA   1  
ATOM 1642  C C    . VAL A 1 111 ? -1.808  -4.919  -0.603  1.00 0.46  ? 111 VAL A C    1  
ATOM 1643  O O    . VAL A 1 111 ? -2.438  -3.979  -1.046  1.00 0.47  ? 111 VAL A O    1  
ATOM 1644  C CB   . VAL A 1 111 ? -0.894  -6.855  -1.869  1.00 0.58  ? 111 VAL A CB   1  
ATOM 1645  C CG1  . VAL A 1 111 ? -1.934  -6.721  -2.985  1.00 1.41  ? 111 VAL A CG1  1  
ATOM 1646  C CG2  . VAL A 1 111 ? 0.379   -7.485  -2.439  1.00 1.36  ? 111 VAL A CG2  1  
ATOM 1647  H H    . VAL A 1 111 ? 1.098   -6.417  -0.346  1.00 0.55  ? 111 VAL A H    1  
ATOM 1648  H HA   . VAL A 1 111 ? -0.243  -4.846  -2.132  1.00 0.52  ? 111 VAL A HA   1  
ATOM 1649  H HB   . VAL A 1 111 ? -1.288  -7.480  -1.080  1.00 1.33  ? 111 VAL A HB   1  
ATOM 1650  H HG11 . VAL A 1 111 ? -1.613  -5.964  -3.686  1.00 2.00  ? 111 VAL A HG11 1  
ATOM 1651  H HG12 . VAL A 1 111 ? -2.885  -6.437  -2.560  1.00 1.95  ? 111 VAL A HG12 1  
ATOM 1652  H HG13 . VAL A 1 111 ? -2.037  -7.666  -3.499  1.00 1.98  ? 111 VAL A HG13 1  
ATOM 1653  H HG21 . VAL A 1 111 ? 1.063   -7.708  -1.634  1.00 1.80  ? 111 VAL A HG21 1  
ATOM 1654  H HG22 . VAL A 1 111 ? 0.845   -6.794  -3.126  1.00 2.02  ? 111 VAL A HG22 1  
ATOM 1655  H HG23 . VAL A 1 111 ? 0.127   -8.396  -2.960  1.00 1.95  ? 111 VAL A HG23 1  
ATOM 1656  N N    . ALA A 1 112 ? -2.160  -5.534  0.501   1.00 0.45  ? 112 ALA A N    1  
ATOM 1657  C CA   . ALA A 1 112 ? -3.361  -5.108  1.277   1.00 0.47  ? 112 ALA A CA   1  
ATOM 1658  C C    . ALA A 1 112 ? -3.220  -3.659  1.747   1.00 0.46  ? 112 ALA A C    1  
ATOM 1659  O O    . ALA A 1 112 ? -4.187  -3.038  2.141   1.00 0.54  ? 112 ALA A O    1  
ATOM 1660  C CB   . ALA A 1 112 ? -3.533  -6.026  2.492   1.00 0.53  ? 112 ALA A CB   1  
ATOM 1661  H H    . ALA A 1 112 ? -1.628  -6.293  0.819   1.00 0.47  ? 112 ALA A H    1  
ATOM 1662  H HA   . ALA A 1 112 ? -4.237  -5.170  0.662   1.00 0.49  ? 112 ALA A HA   1  
ATOM 1663  H HB1  . ALA A 1 112 ? -2.684  -5.915  3.150   1.00 1.17  ? 112 ALA A HB1  1  
ATOM 1664  H HB2  . ALA A 1 112 ? -3.602  -7.053  2.162   1.00 1.01  ? 112 ALA A HB2  1  
ATOM 1665  H HB3  . ALA A 1 112 ? -4.436  -5.758  3.021   1.00 1.25  ? 112 ALA A HB3  1  
ATOM 1666  N N    . LEU A 1 113 ? -2.041  -3.101  1.709   1.00 0.43  ? 113 LEU A N    1  
ATOM 1667  C CA   . LEU A 1 113 ? -1.882  -1.683  2.158   1.00 0.43  ? 113 LEU A CA   1  
ATOM 1668  C C    . LEU A 1 113 ? -2.133  -0.748  0.968   1.00 0.42  ? 113 LEU A C    1  
ATOM 1669  O O    . LEU A 1 113 ? -2.895  0.193   1.060   1.00 0.45  ? 113 LEU A O    1  
ATOM 1670  C CB   . LEU A 1 113 ? -0.463  -1.480  2.704   1.00 0.44  ? 113 LEU A CB   1  
ATOM 1671  C CG   . LEU A 1 113 ? -0.245  -0.017  3.120   1.00 0.51  ? 113 LEU A CG   1  
ATOM 1672  C CD1  . LEU A 1 113 ? -1.300  0.406   4.155   1.00 1.45  ? 113 LEU A CD1  1  
ATOM 1673  C CD2  . LEU A 1 113 ? 1.156   0.116   3.727   1.00 1.27  ? 113 LEU A CD2  1  
ATOM 1674  H H    . LEU A 1 113 ? -1.266  -3.606  1.386   1.00 0.45  ? 113 LEU A H    1  
ATOM 1675  H HA   . LEU A 1 113 ? -2.608  -1.476  2.932   1.00 0.44  ? 113 LEU A HA   1  
ATOM 1676  H HB2  . LEU A 1 113 ? -0.317  -2.120  3.561   1.00 0.58  ? 113 LEU A HB2  1  
ATOM 1677  H HB3  . LEU A 1 113 ? 0.252   -1.742  1.938   1.00 0.53  ? 113 LEU A HB3  1  
ATOM 1678  H HG   . LEU A 1 113 ? -0.321  0.619   2.250   1.00 1.38  ? 113 LEU A HG   1  
ATOM 1679  H HD11 . LEU A 1 113 ? -0.932  1.247   4.727   1.00 2.09  ? 113 LEU A HD11 1  
ATOM 1680  H HD12 . LEU A 1 113 ? -1.506  -0.418  4.823   1.00 1.97  ? 113 LEU A HD12 1  
ATOM 1681  H HD13 . LEU A 1 113 ? -2.208  0.693   3.646   1.00 1.99  ? 113 LEU A HD13 1  
ATOM 1682  H HD21 . LEU A 1 113 ? 1.896   -0.167  2.992   1.00 1.86  ? 113 LEU A HD21 1  
ATOM 1683  H HD22 . LEU A 1 113 ? 1.239   -0.531  4.588   1.00 1.87  ? 113 LEU A HD22 1  
ATOM 1684  H HD23 . LEU A 1 113 ? 1.322   1.140   4.029   1.00 1.85  ? 113 LEU A HD23 1  
ATOM 1685  N N    . PHE A 1 114 ? -1.498  -0.994  -0.145  1.00 0.40  ? 114 PHE A N    1  
ATOM 1686  C CA   . PHE A 1 114 ? -1.706  -0.110  -1.330  1.00 0.40  ? 114 PHE A CA   1  
ATOM 1687  C C    . PHE A 1 114 ? -3.192  -0.051  -1.700  1.00 0.39  ? 114 PHE A C    1  
ATOM 1688  O O    . PHE A 1 114 ? -3.728  0.999   -1.994  1.00 0.41  ? 114 PHE A O    1  
ATOM 1689  C CB   . PHE A 1 114 ? -0.913  -0.638  -2.533  1.00 0.41  ? 114 PHE A CB   1  
ATOM 1690  C CG   . PHE A 1 114 ? 0.553   -0.892  -2.194  1.00 0.44  ? 114 PHE A CG   1  
ATOM 1691  C CD1  . PHE A 1 114 ? 1.189   -0.275  -1.094  1.00 1.29  ? 114 PHE A CD1  1  
ATOM 1692  C CD2  . PHE A 1 114 ? 1.288   -1.756  -3.018  1.00 1.27  ? 114 PHE A CD2  1  
ATOM 1693  C CE1  . PHE A 1 114 ? 2.540   -0.531  -0.835  1.00 1.38  ? 114 PHE A CE1  1  
ATOM 1694  C CE2  . PHE A 1 114 ? 2.640   -2.005  -2.753  1.00 1.27  ? 114 PHE A CE2  1  
ATOM 1695  C CZ   . PHE A 1 114 ? 3.264   -1.393  -1.663  1.00 0.68  ? 114 PHE A CZ   1  
ATOM 1696  H H    . PHE A 1 114 ? -0.880  -1.753  -0.195  1.00 0.40  ? 114 PHE A H    1  
ATOM 1697  H HA   . PHE A 1 114 ? -1.380  0.890   -1.096  1.00 0.41  ? 114 PHE A HA   1  
ATOM 1698  H HB2  . PHE A 1 114 ? -1.359  -1.563  -2.866  1.00 0.49  ? 114 PHE A HB2  1  
ATOM 1699  H HB3  . PHE A 1 114 ? -0.969  0.085   -3.333  1.00 0.43  ? 114 PHE A HB3  1  
ATOM 1700  H HD1  . PHE A 1 114 ? 0.650   0.390   -0.445  1.00 2.14  ? 114 PHE A HD1  1  
ATOM 1701  H HD2  . PHE A 1 114 ? 0.809   -2.233  -3.860  1.00 2.16  ? 114 PHE A HD2  1  
ATOM 1702  H HE1  . PHE A 1 114 ? 3.024   -0.058  0.006   1.00 2.28  ? 114 PHE A HE1  1  
ATOM 1703  H HE2  . PHE A 1 114 ? 3.201   -2.673  -3.392  1.00 2.12  ? 114 PHE A HE2  1  
ATOM 1704  H HZ   . PHE A 1 114 ? 4.308   -1.584  -1.461  1.00 0.80  ? 114 PHE A HZ   1  
ATOM 1705  N N    . TYR A 1 115 ? -3.857  -1.175  -1.704  1.00 0.40  ? 115 TYR A N    1  
ATOM 1706  C CA   . TYR A 1 115 ? -5.304  -1.188  -2.074  1.00 0.41  ? 115 TYR A CA   1  
ATOM 1707  C C    . TYR A 1 115 ? -6.148  -0.563  -0.961  1.00 0.41  ? 115 TYR A C    1  
ATOM 1708  O O    . TYR A 1 115 ? -7.113  0.132   -1.219  1.00 0.44  ? 115 TYR A O    1  
ATOM 1709  C CB   . TYR A 1 115 ? -5.762  -2.632  -2.308  1.00 0.44  ? 115 TYR A CB   1  
ATOM 1710  C CG   . TYR A 1 115 ? -7.235  -2.649  -2.649  1.00 0.47  ? 115 TYR A CG   1  
ATOM 1711  C CD1  . TYR A 1 115 ? -7.652  -2.370  -3.956  1.00 1.28  ? 115 TYR A CD1  1  
ATOM 1712  C CD2  . TYR A 1 115 ? -8.183  -2.944  -1.661  1.00 1.24  ? 115 TYR A CD2  1  
ATOM 1713  C CE1  . TYR A 1 115 ? -9.016  -2.387  -4.276  1.00 1.32  ? 115 TYR A CE1  1  
ATOM 1714  C CE2  . TYR A 1 115 ? -9.547  -2.960  -1.980  1.00 1.26  ? 115 TYR A CE2  1  
ATOM 1715  C CZ   . TYR A 1 115 ? -9.963  -2.682  -3.288  1.00 0.61  ? 115 TYR A CZ   1  
ATOM 1716  O OH   . TYR A 1 115 ? -11.307 -2.698  -3.603  1.00 0.70  ? 115 TYR A OH   1  
ATOM 1717  H H    . TYR A 1 115 ? -3.403  -2.012  -1.474  1.00 0.41  ? 115 TYR A H    1  
ATOM 1718  H HA   . TYR A 1 115 ? -5.453  -0.612  -2.973  1.00 0.42  ? 115 TYR A HA   1  
ATOM 1719  H HB2  . TYR A 1 115 ? -5.198  -3.060  -3.123  1.00 0.46  ? 115 TYR A HB2  1  
ATOM 1720  H HB3  . TYR A 1 115 ? -5.595  -3.212  -1.412  1.00 0.47  ? 115 TYR A HB3  1  
ATOM 1721  H HD1  . TYR A 1 115 ? -6.922  -2.143  -4.719  1.00 2.12  ? 115 TYR A HD1  1  
ATOM 1722  H HD2  . TYR A 1 115 ? -7.863  -3.159  -0.652  1.00 2.08  ? 115 TYR A HD2  1  
ATOM 1723  H HE1  . TYR A 1 115 ? -9.337  -2.172  -5.284  1.00 2.17  ? 115 TYR A HE1  1  
ATOM 1724  H HE2  . TYR A 1 115 ? -10.278 -3.188  -1.218  1.00 2.10  ? 115 TYR A HE2  1  
ATOM 1725  H HH   . TYR A 1 115 ? -11.394 -2.979  -4.517  1.00 1.23  ? 115 TYR A HH   1  
ATOM 1726  N N    . PHE A 1 116 ? -5.796  -0.793  0.271   1.00 0.38  ? 116 PHE A N    1  
ATOM 1727  C CA   . PHE A 1 116 ? -6.593  -0.198  1.377   1.00 0.38  ? 116 PHE A CA   1  
ATOM 1728  C C    . PHE A 1 116 ? -6.543  1.328   1.255   1.00 0.36  ? 116 PHE A C    1  
ATOM 1729  O O    . PHE A 1 116 ? -7.542  2.016   1.371   1.00 0.35  ? 116 PHE A O    1  
ATOM 1730  C CB   . PHE A 1 116 ? -5.997  -0.615  2.726   1.00 0.40  ? 116 PHE A CB   1  
ATOM 1731  C CG   . PHE A 1 116 ? -6.748  0.068   3.852   1.00 0.37  ? 116 PHE A CG   1  
ATOM 1732  C CD1  . PHE A 1 116 ? -8.044  -0.352  4.191   1.00 1.17  ? 116 PHE A CD1  1  
ATOM 1733  C CD2  . PHE A 1 116 ? -6.149  1.120   4.559   1.00 1.35  ? 116 PHE A CD2  1  
ATOM 1734  C CE1  . PHE A 1 116 ? -8.735  0.279   5.232   1.00 1.18  ? 116 PHE A CE1  1  
ATOM 1735  C CE2  . PHE A 1 116 ? -6.843  1.750   5.601   1.00 1.37  ? 116 PHE A CE2  1  
ATOM 1736  C CZ   . PHE A 1 116 ? -8.135  1.329   5.936   1.00 0.45  ? 116 PHE A CZ   1  
ATOM 1737  H H    . PHE A 1 116 ? -5.013  -1.355  0.459   1.00 0.39  ? 116 PHE A H    1  
ATOM 1738  H HA   . PHE A 1 116 ? -7.605  -0.569  1.302   1.00 0.39  ? 116 PHE A HA   1  
ATOM 1739  H HB2  . PHE A 1 116 ? -6.078  -1.687  2.839   1.00 0.47  ? 116 PHE A HB2  1  
ATOM 1740  H HB3  . PHE A 1 116 ? -4.956  -0.329  2.762   1.00 0.41  ? 116 PHE A HB3  1  
ATOM 1741  H HD1  . PHE A 1 116 ? -8.511  -1.162  3.651   1.00 2.09  ? 116 PHE A HD1  1  
ATOM 1742  H HD2  . PHE A 1 116 ? -5.153  1.446   4.302   1.00 2.26  ? 116 PHE A HD2  1  
ATOM 1743  H HE1  . PHE A 1 116 ? -9.731  -0.045  5.491   1.00 2.08  ? 116 PHE A HE1  1  
ATOM 1744  H HE2  . PHE A 1 116 ? -6.381  2.560   6.145   1.00 2.29  ? 116 PHE A HE2  1  
ATOM 1745  H HZ   . PHE A 1 116 ? -8.670  1.815   6.739   1.00 0.51  ? 116 PHE A HZ   1  
ATOM 1746  N N    . ALA A 1 117 ? -5.372  1.859   1.013   1.00 0.35  ? 117 ALA A N    1  
ATOM 1747  C CA   . ALA A 1 117 ? -5.228  3.330   0.875   1.00 0.34  ? 117 ALA A CA   1  
ATOM 1748  C C    . ALA A 1 117 ? -5.842  3.799   -0.444  1.00 0.34  ? 117 ALA A C    1  
ATOM 1749  O O    . ALA A 1 117 ? -6.374  4.885   -0.532  1.00 0.34  ? 117 ALA A O    1  
ATOM 1750  C CB   . ALA A 1 117 ? -3.746  3.706   0.907   1.00 0.37  ? 117 ALA A CB   1  
ATOM 1751  H H    . ALA A 1 117 ? -4.583  1.287   0.933   1.00 0.36  ? 117 ALA A H    1  
ATOM 1752  H HA   . ALA A 1 117 ? -5.739  3.814   1.690   1.00 0.34  ? 117 ALA A HA   1  
ATOM 1753  H HB1  . ALA A 1 117 ? -3.234  3.224   0.087   1.00 1.05  ? 117 ALA A HB1  1  
ATOM 1754  H HB2  . ALA A 1 117 ? -3.312  3.383   1.842   1.00 1.06  ? 117 ALA A HB2  1  
ATOM 1755  H HB3  . ALA A 1 117 ? -3.644  4.777   0.815   1.00 1.10  ? 117 ALA A HB3  1  
ATOM 1756  N N    . SER A 1 118 ? -5.782  2.996   -1.476  1.00 0.35  ? 118 SER A N    1  
ATOM 1757  C CA   . SER A 1 118 ? -6.368  3.420   -2.776  1.00 0.37  ? 118 SER A CA   1  
ATOM 1758  C C    . SER A 1 118 ? -7.800  3.904   -2.564  1.00 0.36  ? 118 SER A C    1  
ATOM 1759  O O    . SER A 1 118 ? -8.232  4.880   -3.142  1.00 0.36  ? 118 SER A O    1  
ATOM 1760  C CB   . SER A 1 118 ? -6.369  2.236   -3.745  1.00 0.42  ? 118 SER A CB   1  
ATOM 1761  O OG   . SER A 1 118 ? -7.358  1.299   -3.340  1.00 1.25  ? 118 SER A OG   1  
ATOM 1762  H H    . SER A 1 118 ? -5.364  2.112   -1.414  1.00 0.37  ? 118 SER A H    1  
ATOM 1763  H HA   . SER A 1 118 ? -5.776  4.222   -3.192  1.00 0.38  ? 118 SER A HA   1  
ATOM 1764  H HB2  . SER A 1 118 ? -6.596  2.583   -4.740  1.00 1.08  ? 118 SER A HB2  1  
ATOM 1765  H HB3  . SER A 1 118 ? -5.393  1.769   -3.743  1.00 1.10  ? 118 SER A HB3  1  
ATOM 1766  H HG   . SER A 1 118 ? -7.282  1.178   -2.391  1.00 1.71  ? 118 SER A HG   1  
ATOM 1767  N N    . LYS A 1 119 ? -8.529  3.238   -1.710  1.00 0.37  ? 119 LYS A N    1  
ATOM 1768  C CA   . LYS A 1 119 ? -9.927  3.665   -1.423  1.00 0.39  ? 119 LYS A CA   1  
ATOM 1769  C C    . LYS A 1 119 ? -9.886  4.988   -0.643  1.00 0.36  ? 119 LYS A C    1  
ATOM 1770  O O    . LYS A 1 119 ? -10.510 5.953   -1.037  1.00 0.38  ? 119 LYS A O    1  
ATOM 1771  C CB   . LYS A 1 119 ? -10.643 2.574   -0.604  1.00 0.46  ? 119 LYS A CB   1  
ATOM 1772  C CG   . LYS A 1 119 ? -12.162 2.613   -0.869  1.00 1.29  ? 119 LYS A CG   1  
ATOM 1773  C CD   . LYS A 1 119 ? -12.502 1.831   -2.155  1.00 1.84  ? 119 LYS A CD   1  
ATOM 1774  C CE   . LYS A 1 119 ? -12.717 0.347   -1.831  1.00 2.48  ? 119 LYS A CE   1  
ATOM 1775  N NZ   . LYS A 1 119 ? -13.997 0.182   -1.086  1.00 3.36  ? 119 LYS A NZ   1  
ATOM 1776  H H    . LYS A 1 119 ? -8.144  2.467   -1.238  1.00 0.38  ? 119 LYS A H    1  
ATOM 1777  H HA   . LYS A 1 119 ? -10.461 3.850   -2.345  1.00 0.42  ? 119 LYS A HA   1  
ATOM 1778  H HB2  . LYS A 1 119 ? -10.253 1.607   -0.887  1.00 0.98  ? 119 LYS A HB2  1  
ATOM 1779  H HB3  . LYS A 1 119 ? -10.461 2.733   0.450   1.00 0.99  ? 119 LYS A HB3  1  
ATOM 1780  H HG2  . LYS A 1 119 ? -12.682 2.175   -0.028  1.00 1.92  ? 119 LYS A HG2  1  
ATOM 1781  H HG3  . LYS A 1 119 ? -12.478 3.641   -0.983  1.00 1.81  ? 119 LYS A HG3  1  
ATOM 1782  H HD2  . LYS A 1 119 ? -13.407 2.233   -2.590  1.00 2.21  ? 119 LYS A HD2  1  
ATOM 1783  H HD3  . LYS A 1 119 ? -11.694 1.927   -2.866  1.00 2.29  ? 119 LYS A HD3  1  
ATOM 1784  H HE2  . LYS A 1 119 ? -12.761 -0.220  -2.750  1.00 2.99  ? 119 LYS A HE2  1  
ATOM 1785  H HE3  . LYS A 1 119 ? -11.899 -0.014  -1.226  1.00 2.53  ? 119 LYS A HE3  1  
ATOM 1786  H HZ1  . LYS A 1 119 ? -14.706 0.840   -1.465  1.00 3.76  ? 119 LYS A HZ1  1  
ATOM 1787  H HZ2  . LYS A 1 119 ? -13.838 0.385   -0.077  1.00 3.68  ? 119 LYS A HZ2  1  
ATOM 1788  H HZ3  . LYS A 1 119 ? -14.339 -0.794  -1.194  1.00 3.74  ? 119 LYS A HZ3  1  
ATOM 1789  N N    . LEU A 1 120 ? -9.145  5.065   0.434   1.00 0.36  ? 120 LEU A N    1  
ATOM 1790  C CA   . LEU A 1 120 ? -9.069  6.361   1.186   1.00 0.35  ? 120 LEU A CA   1  
ATOM 1791  C C    . LEU A 1 120 ? -8.810  7.499   0.186   1.00 0.33  ? 120 LEU A C    1  
ATOM 1792  O O    . LEU A 1 120 ? -9.431  8.542   0.231   1.00 0.39  ? 120 LEU A O    1  
ATOM 1793  C CB   . LEU A 1 120 ? -7.922  6.294   2.207   1.00 0.36  ? 120 LEU A CB   1  
ATOM 1794  C CG   . LEU A 1 120 ? -8.371  5.503   3.452   1.00 0.68  ? 120 LEU A CG   1  
ATOM 1795  C CD1  . LEU A 1 120 ? -7.143  5.119   4.283   1.00 1.69  ? 120 LEU A CD1  1  
ATOM 1796  C CD2  . LEU A 1 120 ? -9.328  6.345   4.322   1.00 1.28  ? 120 LEU A CD2  1  
ATOM 1797  H H    . LEU A 1 120 ? -8.625  4.284   0.734   1.00 0.41  ? 120 LEU A H    1  
ATOM 1798  H HA   . LEU A 1 120 ? -9.993  6.545   1.709   1.00 0.39  ? 120 LEU A HA   1  
ATOM 1799  H HB2  . LEU A 1 120 ? -7.075  5.797   1.756   1.00 0.60  ? 120 LEU A HB2  1  
ATOM 1800  H HB3  . LEU A 1 120 ? -7.636  7.293   2.497   1.00 0.65  ? 120 LEU A HB3  1  
ATOM 1801  H HG   . LEU A 1 120 ? -8.876  4.604   3.131   1.00 1.47  ? 120 LEU A HG   1  
ATOM 1802  H HD11 . LEU A 1 120 ? -6.589  4.347   3.775   1.00 2.18  ? 120 LEU A HD11 1  
ATOM 1803  H HD12 . LEU A 1 120 ? -7.463  4.754   5.248   1.00 2.20  ? 120 LEU A HD12 1  
ATOM 1804  H HD13 . LEU A 1 120 ? -6.514  5.987   4.418   1.00 2.31  ? 120 LEU A HD13 1  
ATOM 1805  H HD21 . LEU A 1 120 ? -9.327  5.965   5.334   1.00 1.86  ? 120 LEU A HD21 1  
ATOM 1806  H HD22 . LEU A 1 120 ? -10.331 6.283   3.928   1.00 1.90  ? 120 LEU A HD22 1  
ATOM 1807  H HD23 . LEU A 1 120 ? -9.008  7.375   4.329   1.00 1.79  ? 120 LEU A HD23 1  
ATOM 1808  N N    . VAL A 1 121 ? -7.920  7.270   -0.738  1.00 0.33  ? 121 VAL A N    1  
ATOM 1809  C CA   . VAL A 1 121 ? -7.612  8.279   -1.794  1.00 0.39  ? 121 VAL A CA   1  
ATOM 1810  C C    . VAL A 1 121 ? -8.825  8.469   -2.707  1.00 0.36  ? 121 VAL A C    1  
ATOM 1811  O O    . VAL A 1 121 ? -9.413  9.530   -2.771  1.00 0.39  ? 121 VAL A O    1  
ATOM 1812  C CB   . VAL A 1 121 ? -6.446  7.766   -2.640  1.00 0.54  ? 121 VAL A CB   1  
ATOM 1813  C CG1  . VAL A 1 121 ? -6.152  8.774   -3.754  1.00 0.95  ? 121 VAL A CG1  1  
ATOM 1814  C CG2  . VAL A 1 121 ? -5.205  7.609   -1.756  1.00 1.18  ? 121 VAL A CG2  1  
ATOM 1815  H H    . VAL A 1 121 ? -7.465  6.402   -0.759  1.00 0.34  ? 121 VAL A H    1  
ATOM 1816  H HA   . VAL A 1 121 ? -7.339  9.249   -1.400  1.00 0.51  ? 121 VAL A HA   1  
ATOM 1817  H HB   . VAL A 1 121 ? -6.707  6.812   -3.075  1.00 1.28  ? 121 VAL A HB   1  
ATOM 1818  H HG11 . VAL A 1 121 ? -5.201  8.542   -4.206  1.00 1.65  ? 121 VAL A HG11 1  
ATOM 1819  H HG12 . VAL A 1 121 ? -6.119  9.771   -3.338  1.00 1.36  ? 121 VAL A HG12 1  
ATOM 1820  H HG13 . VAL A 1 121 ? -6.929  8.722   -4.502  1.00 1.60  ? 121 VAL A HG13 1  
ATOM 1821  H HG21 . VAL A 1 121 ? -4.888  8.580   -1.405  1.00 1.78  ? 121 VAL A HG21 1  
ATOM 1822  H HG22 . VAL A 1 121 ? -4.409  7.157   -2.329  1.00 1.69  ? 121 VAL A HG22 1  
ATOM 1823  H HG23 . VAL A 1 121 ? -5.440  6.981   -0.911  1.00 1.75  ? 121 VAL A HG23 1  
ATOM 1824  N N    . LEU A 1 122 ? -9.190  7.444   -3.424  1.00 0.37  ? 122 LEU A N    1  
ATOM 1825  C CA   . LEU A 1 122 ? -10.354 7.551   -4.350  1.00 0.39  ? 122 LEU A CA   1  
ATOM 1826  C C    . LEU A 1 122 ? -11.583 8.051   -3.579  1.00 0.40  ? 122 LEU A C    1  
ATOM 1827  O O    . LEU A 1 122 ? -12.264 8.961   -4.010  1.00 0.40  ? 122 LEU A O    1  
ATOM 1828  C CB   . LEU A 1 122 ? -10.637 6.165   -4.990  1.00 0.42  ? 122 LEU A CB   1  
ATOM 1829  C CG   . LEU A 1 122 ? -10.750 6.279   -6.524  1.00 0.72  ? 122 LEU A CG   1  
ATOM 1830  C CD1  . LEU A 1 122 ? -9.351  6.372   -7.142  1.00 1.15  ? 122 LEU A CD1  1  
ATOM 1831  C CD2  . LEU A 1 122 ? -11.459 5.040   -7.081  1.00 1.24  ? 122 LEU A CD2  1  
ATOM 1832  H H    . LEU A 1 122 ? -8.689  6.605   -3.348  1.00 0.39  ? 122 LEU A H    1  
ATOM 1833  H HA   . LEU A 1 122 ? -10.135 8.278   -5.117  1.00 0.40  ? 122 LEU A HA   1  
ATOM 1834  H HB2  . LEU A 1 122 ? -9.829  5.493   -4.746  1.00 0.62  ? 122 LEU A HB2  1  
ATOM 1835  H HB3  . LEU A 1 122 ? -11.560 5.757   -4.596  1.00 0.70  ? 122 LEU A HB3  1  
ATOM 1836  H HG   . LEU A 1 122 ? -11.316 7.163   -6.781  1.00 1.46  ? 122 LEU A HG   1  
ATOM 1837  H HD11 . LEU A 1 122 ? -9.438  6.479   -8.213  1.00 1.70  ? 122 LEU A HD11 1  
ATOM 1838  H HD12 . LEU A 1 122 ? -8.797  5.474   -6.915  1.00 1.65  ? 122 LEU A HD12 1  
ATOM 1839  H HD13 . LEU A 1 122 ? -8.831  7.227   -6.736  1.00 1.70  ? 122 LEU A HD13 1  
ATOM 1840  H HD21 . LEU A 1 122 ? -10.938 4.151   -6.758  1.00 1.80  ? 122 LEU A HD21 1  
ATOM 1841  H HD22 . LEU A 1 122 ? -11.463 5.082   -8.160  1.00 1.64  ? 122 LEU A HD22 1  
ATOM 1842  H HD23 . LEU A 1 122 ? -12.476 5.013   -6.718  1.00 1.86  ? 122 LEU A HD23 1  
ATOM 1843  N N    . LYS A 1 123 ? -11.877 7.469   -2.451  1.00 0.51  ? 123 LYS A N    1  
ATOM 1844  C CA   . LYS A 1 123 ? -13.065 7.928   -1.680  1.00 0.55  ? 123 LYS A CA   1  
ATOM 1845  C C    . LYS A 1 123 ? -12.974 9.440   -1.450  1.00 0.54  ? 123 LYS A C    1  
ATOM 1846  O O    . LYS A 1 123 ? -13.969 10.129  -1.465  1.00 0.55  ? 123 LYS A O    1  
ATOM 1847  C CB   . LYS A 1 123 ? -13.132 7.202   -0.324  1.00 0.59  ? 123 LYS A CB   1  
ATOM 1848  C CG   . LYS A 1 123 ? -14.583 7.153   0.166   1.00 0.97  ? 123 LYS A CG   1  
ATOM 1849  C CD   . LYS A 1 123 ? -14.647 6.413   1.502   1.00 1.37  ? 123 LYS A CD   1  
ATOM 1850  C CE   . LYS A 1 123 ? -16.109 6.162   1.872   1.00 1.74  ? 123 LYS A CE   1  
ATOM 1851  N NZ   . LYS A 1 123 ? -16.737 5.282   0.846   1.00 2.32  ? 123 LYS A NZ   1  
ATOM 1852  H H    . LYS A 1 123 ? -11.326 6.728   -2.121  1.00 0.62  ? 123 LYS A H    1  
ATOM 1853  H HA   . LYS A 1 123 ? -13.957 7.709   -2.250  1.00 0.56  ? 123 LYS A HA   1  
ATOM 1854  H HB2  . LYS A 1 123 ? -12.761 6.196   -0.438  1.00 0.98  ? 123 LYS A HB2  1  
ATOM 1855  H HB3  . LYS A 1 123 ? -12.529 7.728   0.404   1.00 0.98  ? 123 LYS A HB3  1  
ATOM 1856  H HG2  . LYS A 1 123 ? -14.954 8.159   0.292   1.00 1.58  ? 123 LYS A HG2  1  
ATOM 1857  H HG3  . LYS A 1 123 ? -15.190 6.633   -0.560  1.00 1.56  ? 123 LYS A HG3  1  
ATOM 1858  H HD2  . LYS A 1 123 ? -14.128 5.469   1.416   1.00 1.88  ? 123 LYS A HD2  1  
ATOM 1859  H HD3  . LYS A 1 123 ? -14.181 7.012   2.269   1.00 1.93  ? 123 LYS A HD3  1  
ATOM 1860  H HE2  . LYS A 1 123 ? -16.158 5.681   2.838   1.00 2.16  ? 123 LYS A HE2  1  
ATOM 1861  H HE3  . LYS A 1 123 ? -16.636 7.103   1.910   1.00 2.15  ? 123 LYS A HE3  1  
ATOM 1862  H HZ1  . LYS A 1 123 ? -16.018 4.982   0.159   1.00 2.93  ? 123 LYS A HZ1  1  
ATOM 1863  H HZ2  . LYS A 1 123 ? -17.490 5.807   0.355   1.00 2.67  ? 123 LYS A HZ2  1  
ATOM 1864  H HZ3  . LYS A 1 123 ? -17.143 4.444   1.309   1.00 2.55  ? 123 LYS A HZ3  1  
ATOM 1865  N N    . ALA A 1 124 ? -11.789 9.960   -1.231  1.00 0.52  ? 124 ALA A N    1  
ATOM 1866  C CA   . ALA A 1 124 ? -11.657 11.429  -0.987  1.00 0.52  ? 124 ALA A CA   1  
ATOM 1867  C C    . ALA A 1 124 ? -11.849 12.190  -2.295  1.00 0.51  ? 124 ALA A C    1  
ATOM 1868  O O    . ALA A 1 124 ? -12.279 13.327  -2.314  1.00 0.54  ? 124 ALA A O    1  
ATOM 1869  C CB   . ALA A 1 124 ? -10.289 11.748  -0.394  1.00 0.51  ? 124 ALA A CB   1  
ATOM 1870  H H    . ALA A 1 124 ? -10.996 9.385   -1.227  1.00 0.51  ? 124 ALA A H    1  
ATOM 1871  H HA   . ALA A 1 124 ? -12.439 11.733  -0.312  1.00 0.54  ? 124 ALA A HA   1  
ATOM 1872  H HB1  . ALA A 1 124 ? -9.529  11.578  -1.142  1.00 1.07  ? 124 ALA A HB1  1  
ATOM 1873  H HB2  . ALA A 1 124 ? -10.108 11.110  0.457   1.00 1.08  ? 124 ALA A HB2  1  
ATOM 1874  H HB3  . ALA A 1 124 ? -10.264 12.782  -0.085  1.00 1.07  ? 124 ALA A HB3  1  
ATOM 1875  N N    . LEU A 1 125 ? -11.545 11.558  -3.394  1.00 0.47  ? 125 LEU A N    1  
ATOM 1876  C CA   . LEU A 1 125 ? -11.719 12.222  -4.711  1.00 0.47  ? 125 LEU A CA   1  
ATOM 1877  C C    . LEU A 1 125 ? -13.207 12.519  -4.916  1.00 0.48  ? 125 LEU A C    1  
ATOM 1878  O O    . LEU A 1 125 ? -13.584 13.583  -5.364  1.00 0.48  ? 125 LEU A O    1  
ATOM 1879  C CB   . LEU A 1 125 ? -11.217 11.275  -5.822  1.00 0.51  ? 125 LEU A CB   1  
ATOM 1880  C CG   . LEU A 1 125 ? -10.711 12.075  -7.034  1.00 0.49  ? 125 LEU A CG   1  
ATOM 1881  C CD1  . LEU A 1 125 ? -10.422 11.110  -8.187  1.00 1.10  ? 125 LEU A CD1  1  
ATOM 1882  C CD2  . LEU A 1 125 ? -11.773 13.090  -7.479  1.00 1.21  ? 125 LEU A CD2  1  
ATOM 1883  H H    . LEU A 1 125 ? -11.212 10.637  -3.351  1.00 0.45  ? 125 LEU A H    1  
ATOM 1884  H HA   . LEU A 1 125 ? -11.154 13.142  -4.737  1.00 0.47  ? 125 LEU A HA   1  
ATOM 1885  H HB2  . LEU A 1 125 ? -10.406 10.676  -5.433  1.00 0.65  ? 125 LEU A HB2  1  
ATOM 1886  H HB3  . LEU A 1 125 ? -12.018 10.620  -6.136  1.00 0.63  ? 125 LEU A HB3  1  
ATOM 1887  H HG   . LEU A 1 125 ? -9.802  12.595  -6.766  1.00 1.08  ? 125 LEU A HG   1  
ATOM 1888  H HD11 . LEU A 1 125 ? -11.335 10.615  -8.480  1.00 1.73  ? 125 LEU A HD11 1  
ATOM 1889  H HD12 . LEU A 1 125 ? -9.700  10.374  -7.867  1.00 1.64  ? 125 LEU A HD12 1  
ATOM 1890  H HD13 . LEU A 1 125 ? -10.025 11.662  -9.026  1.00 1.64  ? 125 LEU A HD13 1  
ATOM 1891  H HD21 . LEU A 1 125 ? -11.772 13.936  -6.810  1.00 1.87  ? 125 LEU A HD21 1  
ATOM 1892  H HD22 . LEU A 1 125 ? -12.746 12.623  -7.470  1.00 1.77  ? 125 LEU A HD22 1  
ATOM 1893  H HD23 . LEU A 1 125 ? -11.549 13.429  -8.481  1.00 1.57  ? 125 LEU A HD23 1  
ATOM 1894  N N    . CYS A 1 126 ? -14.056 11.574  -4.612  1.00 0.52  ? 126 CYS A N    1  
ATOM 1895  C CA   . CYS A 1 126 ? -15.513 11.796  -4.818  1.00 0.57  ? 126 CYS A CA   1  
ATOM 1896  C C    . CYS A 1 126 ? -16.023 12.833  -3.814  1.00 0.57  ? 126 CYS A C    1  
ATOM 1897  O O    . CYS A 1 126 ? -16.769 13.736  -4.134  1.00 0.68  ? 126 CYS A O    1  
ATOM 1898  C CB   . CYS A 1 126 ? -16.259 10.451  -4.641  1.00 0.66  ? 126 CYS A CB   1  
ATOM 1899  S SG   . CYS A 1 126 ? -16.738 10.192  -2.907  1.00 1.67  ? 126 CYS A SG   1  
ATOM 1900  H H    . CYS A 1 126 ? -13.738 10.712  -4.270  1.00 0.54  ? 126 CYS A H    1  
ATOM 1901  H HA   . CYS A 1 126 ? -15.662 12.143  -5.831  1.00 0.59  ? 126 CYS A HA   1  
ATOM 1902  H HB2  . CYS A 1 126 ? -17.148 10.459  -5.250  1.00 1.24  ? 126 CYS A HB2  1  
ATOM 1903  H HB3  . CYS A 1 126 ? -15.603 9.646   -4.942  1.00 1.23  ? 126 CYS A HB3  1  
ATOM 1904  H HG   . CYS A 1 126 ? -17.479 9.582   -2.892  1.00 2.20  ? 126 CYS A HG   1  
ATOM 1905  N N    . THR A 1 127 ? -15.630 12.660  -2.585  1.00 0.57  ? 127 THR A N    1  
ATOM 1906  C CA   . THR A 1 127 ? -16.083 13.577  -1.506  1.00 0.60  ? 127 THR A CA   1  
ATOM 1907  C C    . THR A 1 127 ? -15.806 15.033  -1.892  1.00 0.62  ? 127 THR A C    1  
ATOM 1908  O O    . THR A 1 127 ? -16.308 15.930  -1.254  1.00 0.70  ? 127 THR A O    1  
ATOM 1909  C CB   . THR A 1 127 ? -15.367 13.218  -0.182  1.00 0.60  ? 127 THR A CB   1  
ATOM 1910  O OG1  . THR A 1 127 ? -14.679 12.001  -0.356  1.00 1.14  ? 127 THR A OG1  1  
ATOM 1911  C CG2  . THR A 1 127 ? -16.376 13.040  0.953   1.00 1.19  ? 127 THR A CG2  1  
ATOM 1912  H H    . THR A 1 127 ? -15.060 11.889  -2.389  1.00 0.65  ? 127 THR A H    1  
ATOM 1913  H HA   . THR A 1 127 ? -17.151 13.464  -1.389  1.00 0.70  ? 127 THR A HA   1  
ATOM 1914  H HB   . THR A 1 127 ? -14.662 13.993  0.090   1.00 1.00  ? 127 THR A HB   1  
ATOM 1915  H HG1  . THR A 1 127 ? -14.414 11.684  0.511   1.00 1.73  ? 127 THR A HG1  1  
ATOM 1916  H HG21 . THR A 1 127 ? -17.015 12.198  0.731   1.00 1.77  ? 127 THR A HG21 1  
ATOM 1917  H HG22 . THR A 1 127 ? -16.973 13.934  1.048   1.00 1.72  ? 127 THR A HG22 1  
ATOM 1918  H HG23 . THR A 1 127 ? -15.847 12.857  1.876   1.00 1.72  ? 127 THR A HG23 1  
ATOM 1919  N N    . LYS A 1 128 ? -15.020 15.275  -2.925  1.00 0.60  ? 128 LYS A N    1  
ATOM 1920  C CA   . LYS A 1 128 ? -14.746 16.691  -3.334  1.00 0.70  ? 128 LYS A CA   1  
ATOM 1921  C C    . LYS A 1 128 ? -13.789 17.377  -2.365  1.00 0.61  ? 128 LYS A C    1  
ATOM 1922  O O    . LYS A 1 128 ? -13.934 18.556  -2.104  1.00 0.60  ? 128 LYS A O    1  
ATOM 1923  C CB   . LYS A 1 128 ? -16.054 17.510  -3.413  1.00 0.87  ? 128 LYS A CB   1  
ATOM 1924  C CG   . LYS A 1 128 ? -17.129 16.715  -4.168  1.00 1.12  ? 128 LYS A CG   1  
ATOM 1925  C CD   . LYS A 1 128 ? -18.255 17.659  -4.599  1.00 1.43  ? 128 LYS A CD   1  
ATOM 1926  C CE   . LYS A 1 128 ? -19.428 16.838  -5.138  1.00 1.83  ? 128 LYS A CE   1  
ATOM 1927  N NZ   . LYS A 1 128 ? -20.073 16.098  -4.016  1.00 2.47  ? 128 LYS A NZ   1  
ATOM 1928  H H    . LYS A 1 128 ? -14.602 14.530  -3.405  1.00 0.57  ? 128 LYS A H    1  
ATOM 1929  H HA   . LYS A 1 128 ? -14.259 16.777  -4.298  1.00 0.81  ? 128 LYS A HA   1  
ATOM 1930  H HB2  . LYS A 1 128 ? -16.403 17.757  -2.426  1.00 0.88  ? 128 LYS A HB2  1  
ATOM 1931  H HB3  . LYS A 1 128 ? -15.859 18.429  -3.950  1.00 0.94  ? 128 LYS A HB3  1  
ATOM 1932  H HG2  . LYS A 1 128 ? -16.690 16.257  -5.043  1.00 1.28  ? 128 LYS A HG2  1  
ATOM 1933  H HG3  . LYS A 1 128 ? -17.537 15.950  -3.529  1.00 1.39  ? 128 LYS A HG3  1  
ATOM 1934  H HD2  . LYS A 1 128 ? -18.581 18.240  -3.749  1.00 1.67  ? 128 LYS A HD2  1  
ATOM 1935  H HD3  . LYS A 1 128 ? -17.895 18.321  -5.373  1.00 1.69  ? 128 LYS A HD3  1  
ATOM 1936  H HE2  . LYS A 1 128 ? -20.150 17.499  -5.595  1.00 2.13  ? 128 LYS A HE2  1  
ATOM 1937  H HE3  . LYS A 1 128 ? -19.068 16.134  -5.873  1.00 2.19  ? 128 LYS A HE3  1  
ATOM 1938  H HZ1  . LYS A 1 128 ? -21.012 15.767  -4.313  1.00 2.85  ? 128 LYS A HZ1  1  
ATOM 1939  H HZ2  . LYS A 1 128 ? -20.171 16.731  -3.195  1.00 2.89  ? 128 LYS A HZ2  1  
ATOM 1940  H HZ3  . LYS A 1 128 ? -19.486 15.281  -3.757  1.00 2.86  ? 128 LYS A HZ3  1  
ATOM 1941  N N    . VAL A 1 129 ? -12.782 16.690  -1.858  1.00 0.60  ? 129 VAL A N    1  
ATOM 1942  C CA   . VAL A 1 129 ? -11.790 17.362  -0.948  1.00 0.53  ? 129 VAL A CA   1  
ATOM 1943  C C    . VAL A 1 129 ? -10.378 16.991  -1.438  1.00 0.53  ? 129 VAL A C    1  
ATOM 1944  O O    . VAL A 1 129 ? -9.724  16.170  -0.827  1.00 0.56  ? 129 VAL A O    1  
ATOM 1945  C CB   . VAL A 1 129 ? -11.978 16.852  0.480   1.00 0.57  ? 129 VAL A CB   1  
ATOM 1946  C CG1  . VAL A 1 129 ? -11.133 17.684  1.444   1.00 1.40  ? 129 VAL A CG1  1  
ATOM 1947  C CG2  . VAL A 1 129 ? -13.453 16.941  0.867   1.00 1.22  ? 129 VAL A CG2  1  
ATOM 1948  H H    . VAL A 1 129 ? -12.647 15.743  -2.072  1.00 0.66  ? 129 VAL A H    1  
ATOM 1949  H HA   . VAL A 1 129 ? -11.939 18.427  -1.009  1.00 0.54  ? 129 VAL A HA   1  
ATOM 1950  H HB   . VAL A 1 129 ? -11.657 15.822  0.531   1.00 1.05  ? 129 VAL A HB   1  
ATOM 1951  H HG11 . VAL A 1 129 ? -10.089 17.589  1.179   1.00 1.84  ? 129 VAL A HG11 1  
ATOM 1952  H HG12 . VAL A 1 129 ? -11.280 17.325  2.452   1.00 2.01  ? 129 VAL A HG12 1  
ATOM 1953  H HG13 . VAL A 1 129 ? -11.428 18.721  1.382   1.00 1.91  ? 129 VAL A HG13 1  
ATOM 1954  H HG21 . VAL A 1 129 ? -14.024 16.255  0.255   1.00 1.76  ? 129 VAL A HG21 1  
ATOM 1955  H HG22 . VAL A 1 129 ? -13.808 17.948  0.710   1.00 1.84  ? 129 VAL A HG22 1  
ATOM 1956  H HG23 . VAL A 1 129 ? -13.568 16.674  1.907   1.00 1.66  ? 129 VAL A HG23 1  
ATOM 1957  N N    . PRO A 1 130 ? -9.955  17.568  -2.548  1.00 0.62  ? 130 PRO A N    1  
ATOM 1958  C CA   . PRO A 1 130 ? -8.637  17.247  -3.128  1.00 0.73  ? 130 PRO A CA   1  
ATOM 1959  C C    . PRO A 1 130 ? -7.488  17.567  -2.156  1.00 0.65  ? 130 PRO A C    1  
ATOM 1960  O O    . PRO A 1 130 ? -6.423  16.977  -2.246  1.00 0.64  ? 130 PRO A O    1  
ATOM 1961  C CB   . PRO A 1 130 ? -8.540  18.100  -4.417  1.00 1.00  ? 130 PRO A CB   1  
ATOM 1962  C CG   . PRO A 1 130 ? -9.869  18.898  -4.549  1.00 1.00  ? 130 PRO A CG   1  
ATOM 1963  C CD   . PRO A 1 130 ? -10.735 18.572  -3.310  1.00 0.75  ? 130 PRO A CD   1  
ATOM 1964  H HA   . PRO A 1 130 ? -8.602  16.200  -3.379  1.00 0.84  ? 130 PRO A HA   1  
ATOM 1965  H HB2  . PRO A 1 130 ? -7.700  18.785  -4.354  1.00 1.10  ? 130 PRO A HB2  1  
ATOM 1966  H HB3  . PRO A 1 130 ? -8.415  17.457  -5.279  1.00 1.18  ? 130 PRO A HB3  1  
ATOM 1967  H HG2  . PRO A 1 130 ? -9.658  19.961  -4.588  1.00 1.11  ? 130 PRO A HG2  1  
ATOM 1968  H HG3  . PRO A 1 130 ? -10.392 18.601  -5.449  1.00 1.11  ? 130 PRO A HG3  1  
ATOM 1969  H HD2  . PRO A 1 130 ? -10.885 19.465  -2.718  1.00 0.76  ? 130 PRO A HD2  1  
ATOM 1970  H HD3  . PRO A 1 130 ? -11.682 18.155  -3.610  1.00 0.75  ? 130 PRO A HD3  1  
ATOM 1971  N N    . GLU A 1 131 ? -7.649  18.494  -1.240  1.00 0.73  ? 131 GLU A N    1  
ATOM 1972  C CA   . GLU A 1 131 ? -6.493  18.788  -0.339  1.00 0.82  ? 131 GLU A CA   1  
ATOM 1973  C C    . GLU A 1 131 ? -6.263  17.569  0.554   1.00 0.72  ? 131 GLU A C    1  
ATOM 1974  O O    . GLU A 1 131 ? -5.207  17.391  1.130   1.00 0.73  ? 131 GLU A O    1  
ATOM 1975  C CB   . GLU A 1 131 ? -6.755  20.040  0.504   1.00 1.09  ? 131 GLU A CB   1  
ATOM 1976  C CG   . GLU A 1 131 ? -7.136  21.209  -0.405  1.00 1.55  ? 131 GLU A CG   1  
ATOM 1977  C CD   . GLU A 1 131 ? -7.661  22.366  0.449   1.00 2.17  ? 131 GLU A CD   1  
ATOM 1978  O OE1  . GLU A 1 131 ? -8.665  22.177  1.115   1.00 2.52  ? 131 GLU A OE1  1  
ATOM 1979  O OE2  . GLU A 1 131 ? -7.049  23.421  0.423   1.00 2.86  ? 131 GLU A OE2  1  
ATOM 1980  H H    . GLU A 1 131 ? -8.491  18.990  -1.163  1.00 0.82  ? 131 GLU A H    1  
ATOM 1981  H HA   . GLU A 1 131 ? -5.645  18.918  -0.997  1.00 0.90  ? 131 GLU A HA   1  
ATOM 1982  H HB2  . GLU A 1 131 ? -7.565  19.843  1.191   1.00 1.38  ? 131 GLU A HB2  1  
ATOM 1983  H HB3  . GLU A 1 131 ? -5.865  20.292  1.060   1.00 1.55  ? 131 GLU A HB3  1  
ATOM 1984  H HG2  . GLU A 1 131 ? -6.266  21.534  -0.957  1.00 2.03  ? 131 GLU A HG2  1  
ATOM 1985  H HG3  . GLU A 1 131 ? -7.905  20.896  -1.094  1.00 1.89  ? 131 GLU A HG3  1  
ATOM 1986  N N    . LEU A 1 132 ? -7.242  16.710  0.637   1.00 0.71  ? 132 LEU A N    1  
ATOM 1987  C CA   . LEU A 1 132 ? -7.101  15.474  1.445   1.00 0.69  ? 132 LEU A CA   1  
ATOM 1988  C C    . LEU A 1 132 ? -6.416  14.403  0.585   1.00 0.58  ? 132 LEU A C    1  
ATOM 1989  O O    . LEU A 1 132 ? -5.693  13.568  1.091   1.00 0.59  ? 132 LEU A O    1  
ATOM 1990  C CB   . LEU A 1 132 ? -8.477  14.997  1.930   1.00 0.80  ? 132 LEU A CB   1  
ATOM 1991  C CG   . LEU A 1 132 ? -8.314  13.912  3.007   1.00 0.60  ? 132 LEU A CG   1  
ATOM 1992  C CD1  . LEU A 1 132 ? -7.956  14.538  4.367   1.00 1.11  ? 132 LEU A CD1  1  
ATOM 1993  C CD2  . LEU A 1 132 ? -9.626  13.133  3.151   1.00 0.77  ? 132 LEU A CD2  1  
ATOM 1994  H H    . LEU A 1 132 ? -8.068  16.863  0.139   1.00 0.77  ? 132 LEU A H    1  
ATOM 1995  H HA   . LEU A 1 132 ? -6.440  15.615  2.277   1.00 0.73  ? 132 LEU A HA   1  
ATOM 1996  H HB2  . LEU A 1 132 ? -9.022  15.835  2.337   1.00 1.25  ? 132 LEU A HB2  1  
ATOM 1997  H HB3  . LEU A 1 132 ? -9.024  14.589  1.092   1.00 1.02  ? 132 LEU A HB3  1  
ATOM 1998  H HG   . LEU A 1 132 ? -7.530  13.237  2.707   1.00 0.96  ? 132 LEU A HG   1  
ATOM 1999  H HD11 . LEU A 1 132 ? -6.925  14.851  4.367   1.00 1.71  ? 132 LEU A HD11 1  
ATOM 2000  H HD12 . LEU A 1 132 ? -8.103  13.806  5.148   1.00 1.45  ? 132 LEU A HD12 1  
ATOM 2001  H HD13 . LEU A 1 132 ? -8.591  15.391  4.555   1.00 1.58  ? 132 LEU A HD13 1  
ATOM 2002  H HD21 . LEU A 1 132 ? -10.423 13.815  3.407   1.00 1.39  ? 132 LEU A HD21 1  
ATOM 2003  H HD22 . LEU A 1 132 ? -9.522  12.394  3.932   1.00 1.46  ? 132 LEU A HD22 1  
ATOM 2004  H HD23 . LEU A 1 132 ? -9.858  12.641  2.220   1.00 1.25  ? 132 LEU A HD23 1  
ATOM 2005  N N    . ILE A 1 133 ? -6.595  14.436  -0.707  1.00 0.52  ? 133 ILE A N    1  
ATOM 2006  C CA   . ILE A 1 133 ? -5.904  13.441  -1.578  1.00 0.46  ? 133 ILE A CA   1  
ATOM 2007  C C    . ILE A 1 133 ? -4.403  13.504  -1.281  1.00 0.43  ? 133 ILE A C    1  
ATOM 2008  O O    . ILE A 1 133 ? -3.757  12.506  -1.033  1.00 0.46  ? 133 ILE A O    1  
ATOM 2009  C CB   . ILE A 1 133 ? -6.149  13.805  -3.050  1.00 0.45  ? 133 ILE A CB   1  
ATOM 2010  C CG1  . ILE A 1 133 ? -7.613  13.497  -3.397  1.00 0.42  ? 133 ILE A CG1  1  
ATOM 2011  C CG2  . ILE A 1 133 ? -5.220  12.978  -3.953  1.00 0.49  ? 133 ILE A CG2  1  
ATOM 2012  C CD1  . ILE A 1 133 ? -7.946  13.998  -4.808  1.00 1.19  ? 133 ILE A CD1  1  
ATOM 2013  H H    . ILE A 1 133 ? -7.160  15.120  -1.113  1.00 0.56  ? 133 ILE A H    1  
ATOM 2014  H HA   . ILE A 1 133 ? -6.286  12.446  -1.397  1.00 0.50  ? 133 ILE A HA   1  
ATOM 2015  H HB   . ILE A 1 133 ? -5.954  14.857  -3.197  1.00 0.52  ? 133 ILE A HB   1  
ATOM 2016  H HG12 . ILE A 1 133 ? -7.773  12.430  -3.351  1.00 1.01  ? 133 ILE A HG12 1  
ATOM 2017  H HG13 . ILE A 1 133 ? -8.260  13.986  -2.684  1.00 1.03  ? 133 ILE A HG13 1  
ATOM 2018  H HG21 . ILE A 1 133 ? -5.555  13.041  -4.977  1.00 1.14  ? 133 ILE A HG21 1  
ATOM 2019  H HG22 . ILE A 1 133 ? -5.232  11.947  -3.633  1.00 1.19  ? 133 ILE A HG22 1  
ATOM 2020  H HG23 . ILE A 1 133 ? -4.213  13.364  -3.881  1.00 1.08  ? 133 ILE A HG23 1  
ATOM 2021  H HD11 . ILE A 1 133 ? -9.014  14.136  -4.896  1.00 1.86  ? 133 ILE A HD11 1  
ATOM 2022  H HD12 . ILE A 1 133 ? -7.618  13.268  -5.534  1.00 1.78  ? 133 ILE A HD12 1  
ATOM 2023  H HD13 . ILE A 1 133 ? -7.446  14.938  -4.991  1.00 1.68  ? 133 ILE A HD13 1  
ATOM 2024  N N    . ARG A 1 134 ? -3.858  14.691  -1.289  1.00 0.42  ? 134 ARG A N    1  
ATOM 2025  C CA   . ARG A 1 134 ? -2.405  14.873  -0.993  1.00 0.43  ? 134 ARG A CA   1  
ATOM 2026  C C    . ARG A 1 134 ? -2.114  14.514  0.468   1.00 0.40  ? 134 ARG A C    1  
ATOM 2027  O O    . ARG A 1 134 ? -1.080  13.956  0.778   1.00 0.39  ? 134 ARG A O    1  
ATOM 2028  C CB   . ARG A 1 134 ? -2.018  16.334  -1.244  1.00 0.51  ? 134 ARG A CB   1  
ATOM 2029  C CG   . ARG A 1 134 ? -2.317  16.699  -2.700  1.00 1.26  ? 134 ARG A CG   1  
ATOM 2030  C CD   . ARG A 1 134 ? -2.021  18.184  -2.927  1.00 1.57  ? 134 ARG A CD   1  
ATOM 2031  N NE   . ARG A 1 134 ? -0.572  18.444  -2.696  1.00 2.30  ? 134 ARG A NE   1  
ATOM 2032  C CZ   . ARG A 1 134 ? -0.035  19.560  -3.109  1.00 2.86  ? 134 ARG A CZ   1  
ATOM 2033  N NH1  . ARG A 1 134 ? -0.766  20.449  -3.726  1.00 2.98  ? 134 ARG A NH1  1  
ATOM 2034  N NH2  . ARG A 1 134 ? 1.234   19.788  -2.906  1.00 3.71  ? 134 ARG A NH2  1  
ATOM 2035  H H    . ARG A 1 134 ? -4.416  15.482  -1.476  1.00 0.45  ? 134 ARG A H    1  
ATOM 2036  H HA   . ARG A 1 134 ? -1.782  14.235  -1.603  1.00 0.44  ? 134 ARG A HA   1  
ATOM 2037  H HB2  . ARG A 1 134 ? -2.587  16.975  -0.586  1.00 0.98  ? 134 ARG A HB2  1  
ATOM 2038  H HB3  . ARG A 1 134 ? -0.964  16.465  -1.051  1.00 1.10  ? 134 ARG A HB3  1  
ATOM 2039  H HG2  . ARG A 1 134 ? -1.698  16.104  -3.355  1.00 1.75  ? 134 ARG A HG2  1  
ATOM 2040  H HG3  . ARG A 1 134 ? -3.357  16.505  -2.914  1.00 1.79  ? 134 ARG A HG3  1  
ATOM 2041  H HD2  . ARG A 1 134 ? -2.277  18.451  -3.942  1.00 1.69  ? 134 ARG A HD2  1  
ATOM 2042  H HD3  . ARG A 1 134 ? -2.608  18.777  -2.242  1.00 1.89  ? 134 ARG A HD3  1  
ATOM 2043  H HE   . ARG A 1 134 ? -0.022  17.778  -2.234  1.00 2.71  ? 134 ARG A HE   1  
ATOM 2044  H HH11 . ARG A 1 134 ? -1.738  20.275  -3.882  1.00 2.70  ? 134 ARG A HH11 1  
ATOM 2045  H HH12 . ARG A 1 134 ? -0.353  21.303  -4.042  1.00 3.64  ? 134 ARG A HH12 1  
ATOM 2046  H HH21 . ARG A 1 134 ? 1.795   19.108  -2.434  1.00 4.02  ? 134 ARG A HH21 1  
ATOM 2047  H HH22 . ARG A 1 134 ? 1.646   20.643  -3.222  1.00 4.22  ? 134 ARG A HH22 1  
ATOM 2048  N N    . THR A 1 135 ? -2.994  14.838  1.372   1.00 0.41  ? 135 THR A N    1  
ATOM 2049  C CA   . THR A 1 135 ? -2.719  14.514  2.802   1.00 0.41  ? 135 THR A CA   1  
ATOM 2050  C C    . THR A 1 135 ? -2.660  12.998  3.006   1.00 0.39  ? 135 THR A C    1  
ATOM 2051  O O    . THR A 1 135 ? -1.913  12.497  3.823   1.00 0.52  ? 135 THR A O    1  
ATOM 2052  C CB   . THR A 1 135 ? -3.790  15.123  3.705   1.00 0.42  ? 135 THR A CB   1  
ATOM 2053  O OG1  . THR A 1 135 ? -3.805  16.530  3.511   1.00 0.89  ? 135 THR A OG1  1  
ATOM 2054  C CG2  . THR A 1 135 ? -3.456  14.825  5.167   1.00 0.88  ? 135 THR A CG2  1  
ATOM 2055  H H    . THR A 1 135 ? -3.815  15.304  1.107   1.00 0.43  ? 135 THR A H    1  
ATOM 2056  H HA   . THR A 1 135 ? -1.769  14.953  3.077   1.00 0.42  ? 135 THR A HA   1  
ATOM 2057  H HB   . THR A 1 135 ? -4.763  14.731  3.477   1.00 0.74  ? 135 THR A HB   1  
ATOM 2058  H HG1  . THR A 1 135 ? -4.468  16.729  2.845   1.00 1.41  ? 135 THR A HG1  1  
ATOM 2059  H HG21 . THR A 1 135 ? -4.181  15.307  5.806   1.00 1.52  ? 135 THR A HG21 1  
ATOM 2060  H HG22 . THR A 1 135 ? -2.470  15.200  5.394   1.00 1.47  ? 135 THR A HG22 1  
ATOM 2061  H HG23 . THR A 1 135 ? -3.483  13.760  5.334   1.00 1.37  ? 135 THR A HG23 1  
ATOM 2062  N N    . ILE A 1 136 ? -3.416  12.262  2.232   1.00 0.35  ? 136 ILE A N    1  
ATOM 2063  C CA   . ILE A 1 136 ? -3.387  10.776  2.330   1.00 0.36  ? 136 ILE A CA   1  
ATOM 2064  C C    . ILE A 1 136 ? -2.045  10.291  1.785   1.00 0.35  ? 136 ILE A C    1  
ATOM 2065  O O    . ILE A 1 136 ? -1.232  9.799   2.541   1.00 0.51  ? 136 ILE A O    1  
ATOM 2066  C CB   . ILE A 1 136 ? -4.557  10.192  1.525   1.00 0.46  ? 136 ILE A CB   1  
ATOM 2067  C CG1  . ILE A 1 136 ? -5.870  10.504  2.266   1.00 0.60  ? 136 ILE A CG1  1  
ATOM 2068  C CG2  . ILE A 1 136 ? -4.394  8.675   1.398   1.00 0.94  ? 136 ILE A CG2  1  
ATOM 2069  C CD1  . ILE A 1 136 ? -7.060  10.381  1.312   1.00 0.64  ? 136 ILE A CD1  1  
ATOM 2070  H H    . ILE A 1 136 ? -3.978  12.680  1.547   1.00 0.41  ? 136 ILE A H    1  
ATOM 2071  H HA   . ILE A 1 136 ? -3.456  10.435  3.354   1.00 0.40  ? 136 ILE A HA   1  
ATOM 2072  H HB   . ILE A 1 136 ? -4.579  10.638  0.542   1.00 0.84  ? 136 ILE A HB   1  
ATOM 2073  H HG12 . ILE A 1 136 ? -5.996  9.814   3.087   1.00 1.16  ? 136 ILE A HG12 1  
ATOM 2074  H HG13 . ILE A 1 136 ? -5.833  11.513  2.653   1.00 1.18  ? 136 ILE A HG13 1  
ATOM 2075  H HG21 . ILE A 1 136 ? -5.325  8.240   1.067   1.00 1.44  ? 136 ILE A HG21 1  
ATOM 2076  H HG22 . ILE A 1 136 ? -4.125  8.260   2.359   1.00 1.48  ? 136 ILE A HG22 1  
ATOM 2077  H HG23 . ILE A 1 136 ? -3.618  8.454   0.680   1.00 1.51  ? 136 ILE A HG23 1  
ATOM 2078  H HD11 . ILE A 1 136 ? -7.151  9.356   0.982   1.00 1.15  ? 136 ILE A HD11 1  
ATOM 2079  H HD12 . ILE A 1 136 ? -6.907  11.023  0.458   1.00 1.44  ? 136 ILE A HD12 1  
ATOM 2080  H HD13 . ILE A 1 136 ? -7.964  10.673  1.826   1.00 1.20  ? 136 ILE A HD13 1  
ATOM 2081  N N    . MET A 1 137 ? -1.798  10.402  0.496   1.00 0.35  ? 137 MET A N    1  
ATOM 2082  C CA   . MET A 1 137 ? -0.486  9.935   -0.068  1.00 0.33  ? 137 MET A CA   1  
ATOM 2083  C C    . MET A 1 137 ? 0.652   10.270  0.909   1.00 0.31  ? 137 MET A C    1  
ATOM 2084  O O    . MET A 1 137 ? 1.677   9.621   0.960   1.00 0.34  ? 137 MET A O    1  
ATOM 2085  C CB   . MET A 1 137 ? -0.233  10.632  -1.414  1.00 0.36  ? 137 MET A CB   1  
ATOM 2086  C CG   . MET A 1 137 ? -1.423  10.397  -2.383  1.00 0.67  ? 137 MET A CG   1  
ATOM 2087  S SD   . MET A 1 137 ? -0.903  9.336   -3.763  1.00 1.13  ? 137 MET A SD   1  
ATOM 2088  C CE   . MET A 1 137 ? 0.262   10.484  -4.548  1.00 0.67  ? 137 MET A CE   1  
ATOM 2089  H H    . MET A 1 137 ? -2.476  10.762  -0.115  1.00 0.52  ? 137 MET A H    1  
ATOM 2090  H HA   . MET A 1 137 ? -0.523  8.867   -0.217  1.00 0.34  ? 137 MET A HA   1  
ATOM 2091  H HB2  . MET A 1 137 ? -0.109  11.694  -1.242  1.00 0.50  ? 137 MET A HB2  1  
ATOM 2092  H HB3  . MET A 1 137 ? 0.672   10.238  -1.851  1.00 0.49  ? 137 MET A HB3  1  
ATOM 2093  H HG2  . MET A 1 137 ? -2.241  9.920   -1.861  1.00 1.13  ? 137 MET A HG2  1  
ATOM 2094  H HG3  . MET A 1 137 ? -1.765  11.346  -2.775  1.00 1.01  ? 137 MET A HG3  1  
ATOM 2095  H HE1  . MET A 1 137 ? 0.105   11.484  -4.166  1.00 1.28  ? 137 MET A HE1  1  
ATOM 2096  H HE2  . MET A 1 137 ? 0.102   10.483  -5.614  1.00 1.01  ? 137 MET A HE2  1  
ATOM 2097  H HE3  . MET A 1 137 ? 1.277   10.167  -4.337  1.00 1.26  ? 137 MET A HE3  1  
ATOM 2098  N N    . GLY A 1 138 ? 0.436   11.287  1.696   1.00 0.31  ? 138 GLY A N    1  
ATOM 2099  C CA   . GLY A 1 138 ? 1.435   11.716  2.716   1.00 0.33  ? 138 GLY A CA   1  
ATOM 2100  C C    . GLY A 1 138 ? 1.544   10.636  3.798   1.00 0.33  ? 138 GLY A C    1  
ATOM 2101  O O    . GLY A 1 138 ? 2.624   10.223  4.172   1.00 0.34  ? 138 GLY A O    1  
ATOM 2102  H H    . GLY A 1 138 ? -0.412  11.772  1.619   1.00 0.32  ? 138 GLY A H    1  
ATOM 2103  H HA2  . GLY A 1 138 ? 2.402   11.869  2.256   1.00 0.35  ? 138 GLY A HA2  1  
ATOM 2104  H HA3  . GLY A 1 138 ? 1.084   12.640  3.146   1.00 0.36  ? 138 GLY A HA3  1  
ATOM 2105  N N    . TRP A 1 139 ? 0.430   10.168  4.296   1.00 0.34  ? 139 TRP A N    1  
ATOM 2106  C CA   . TRP A 1 139 ? 0.471   9.105   5.344   1.00 0.37  ? 139 TRP A CA   1  
ATOM 2107  C C    . TRP A 1 139 ? 0.980   7.792   4.737   1.00 0.35  ? 139 TRP A C    1  
ATOM 2108  O O    . TRP A 1 139 ? 1.486   6.934   5.434   1.00 0.39  ? 139 TRP A O    1  
ATOM 2109  C CB   . TRP A 1 139 ? -0.921  8.872   5.941   1.00 0.43  ? 139 TRP A CB   1  
ATOM 2110  C CG   . TRP A 1 139 ? -1.505  10.147  6.471   1.00 0.46  ? 139 TRP A CG   1  
ATOM 2111  C CD1  . TRP A 1 139 ? -0.805  11.209  6.943   1.00 0.54  ? 139 TRP A CD1  1  
ATOM 2112  C CD2  . TRP A 1 139 ? -2.913  10.499  6.602   1.00 0.53  ? 139 TRP A CD2  1  
ATOM 2113  N NE1  . TRP A 1 139 ? -1.697  12.185  7.352   1.00 0.57  ? 139 TRP A NE1  1  
ATOM 2114  C CE2  . TRP A 1 139 ? -3.007  11.795  7.161   1.00 0.56  ? 139 TRP A CE2  1  
ATOM 2115  C CE3  . TRP A 1 139 ? -4.107  9.824   6.291   1.00 0.67  ? 139 TRP A CE3  1  
ATOM 2116  C CZ2  . TRP A 1 139 ? -4.242  12.399  7.404   1.00 0.66  ? 139 TRP A CZ2  1  
ATOM 2117  C CZ3  . TRP A 1 139 ? -5.351  10.428  6.532   1.00 0.81  ? 139 TRP A CZ3  1  
ATOM 2118  C CH2  . TRP A 1 139 ? -5.418  11.713  7.088   1.00 0.78  ? 139 TRP A CH2  1  
ATOM 2119  H H    . TRP A 1 139 ? -0.425  10.522  3.973   1.00 0.35  ? 139 TRP A H    1  
ATOM 2120  H HA   . TRP A 1 139 ? 1.165   9.378   6.123   1.00 0.39  ? 139 TRP A HA   1  
ATOM 2121  H HB2  . TRP A 1 139 ? -1.573  8.476   5.177   1.00 0.45  ? 139 TRP A HB2  1  
ATOM 2122  H HB3  . TRP A 1 139 ? -0.845  8.154   6.745   1.00 0.45  ? 139 TRP A HB3  1  
ATOM 2123  H HD1  . TRP A 1 139 ? 0.270   11.287  6.995   1.00 0.64  ? 139 TRP A HD1  1  
ATOM 2124  H HE1  . TRP A 1 139 ? -1.449  13.054  7.731   1.00 0.65  ? 139 TRP A HE1  1  
ATOM 2125  H HE3  . TRP A 1 139 ? -4.066  8.833   5.862   1.00 0.70  ? 139 TRP A HE3  1  
ATOM 2126  H HZ2  . TRP A 1 139 ? -4.288  13.389  7.832   1.00 0.69  ? 139 TRP A HZ2  1  
ATOM 2127  H HZ3  . TRP A 1 139 ? -6.261  9.900   6.289   1.00 0.96  ? 139 TRP A HZ3  1  
ATOM 2128  H HH2  . TRP A 1 139 ? -6.378  12.174  7.271   1.00 0.90  ? 139 TRP A HH2  1  
ATOM 2129  N N    . THR A 1 140 ? 0.852   7.623   3.448   1.00 0.34  ? 140 THR A N    1  
ATOM 2130  C CA   . THR A 1 140 ? 1.334   6.359   2.816   1.00 0.36  ? 140 THR A CA   1  
ATOM 2131  C C    . THR A 1 140 ? 2.865   6.357   2.783   1.00 0.34  ? 140 THR A C    1  
ATOM 2132  O O    . THR A 1 140 ? 3.506   5.514   3.378   1.00 0.39  ? 140 THR A O    1  
ATOM 2133  C CB   . THR A 1 140 ? 0.791   6.253   1.387   1.00 0.38  ? 140 THR A CB   1  
ATOM 2134  O OG1  . THR A 1 140 ? 1.279   7.338   0.613   1.00 1.20  ? 140 THR A OG1  1  
ATOM 2135  C CG2  . THR A 1 140 ? -0.738  6.290   1.414   1.00 1.17  ? 140 THR A CG2  1  
ATOM 2136  H H    . THR A 1 140 ? 0.440   8.322   2.899   1.00 0.34  ? 140 THR A H    1  
ATOM 2137  H HA   . THR A 1 140 ? 0.987   5.516   3.394   1.00 0.40  ? 140 THR A HA   1  
ATOM 2138  H HB   . THR A 1 140 ? 1.115   5.323   0.947   1.00 0.98  ? 140 THR A HB   1  
ATOM 2139  H HG1  . THR A 1 140 ? 1.351   7.045   -0.298  1.00 1.79  ? 140 THR A HG1  1  
ATOM 2140  H HG21 . THR A 1 140 ? -1.069  7.200   1.892   1.00 1.62  ? 140 THR A HG21 1  
ATOM 2141  H HG22 . THR A 1 140 ? -1.109  5.438   1.966   1.00 1.80  ? 140 THR A HG22 1  
ATOM 2142  H HG23 . THR A 1 140 ? -1.117  6.256   0.403   1.00 1.82  ? 140 THR A HG23 1  
ATOM 2143  N N    . LEU A 1 141 ? 3.455   7.295   2.094   1.00 0.33  ? 141 LEU A N    1  
ATOM 2144  C CA   . LEU A 1 141 ? 4.945   7.349   2.025   1.00 0.34  ? 141 LEU A CA   1  
ATOM 2145  C C    . LEU A 1 141 ? 5.529   7.487   3.432   1.00 0.33  ? 141 LEU A C    1  
ATOM 2146  O O    . LEU A 1 141 ? 6.642   7.073   3.691   1.00 0.33  ? 141 LEU A O    1  
ATOM 2147  C CB   . LEU A 1 141 ? 5.387   8.527   1.150   1.00 0.35  ? 141 LEU A CB   1  
ATOM 2148  C CG   . LEU A 1 141 ? 5.049   8.244   -0.330  1.00 0.41  ? 141 LEU A CG   1  
ATOM 2149  C CD1  . LEU A 1 141 ? 4.852   9.565   -1.081  1.00 0.99  ? 141 LEU A CD1  1  
ATOM 2150  C CD2  . LEU A 1 141 ? 6.193   7.463   -0.992  1.00 0.80  ? 141 LEU A CD2  1  
ATOM 2151  H H    . LEU A 1 141 ? 2.920   7.967   1.622   1.00 0.37  ? 141 LEU A H    1  
ATOM 2152  H HA   . LEU A 1 141 ? 5.334   6.426   1.626   1.00 0.36  ? 141 LEU A HA   1  
ATOM 2153  H HB2  . LEU A 1 141 ? 4.870   9.419   1.479   1.00 0.38  ? 141 LEU A HB2  1  
ATOM 2154  H HB3  . LEU A 1 141 ? 6.452   8.674   1.258   1.00 0.41  ? 141 LEU A HB3  1  
ATOM 2155  H HG   . LEU A 1 141 ? 4.136   7.665   -0.391  1.00 1.00  ? 141 LEU A HG   1  
ATOM 2156  H HD11 . LEU A 1 141 ? 4.672   9.362   -2.126  1.00 1.58  ? 141 LEU A HD11 1  
ATOM 2157  H HD12 . LEU A 1 141 ? 5.739   10.172  -0.979  1.00 1.53  ? 141 LEU A HD12 1  
ATOM 2158  H HD13 . LEU A 1 141 ? 4.005   10.092  -0.665  1.00 1.54  ? 141 LEU A HD13 1  
ATOM 2159  H HD21 . LEU A 1 141 ? 5.902   7.177   -1.990  1.00 1.31  ? 141 LEU A HD21 1  
ATOM 2160  H HD22 . LEU A 1 141 ? 6.410   6.577   -0.416  1.00 1.31  ? 141 LEU A HD22 1  
ATOM 2161  H HD23 . LEU A 1 141 ? 7.073   8.086   -1.039  1.00 1.59  ? 141 LEU A HD23 1  
ATOM 2162  N N    . ASP A 1 142 ? 4.791   8.044   4.351   1.00 0.36  ? 142 ASP A N    1  
ATOM 2163  C CA   . ASP A 1 142 ? 5.321   8.174   5.737   1.00 0.37  ? 142 ASP A CA   1  
ATOM 2164  C C    . ASP A 1 142 ? 5.555   6.769   6.292   1.00 0.37  ? 142 ASP A C    1  
ATOM 2165  O O    . ASP A 1 142 ? 6.610   6.454   6.806   1.00 0.42  ? 142 ASP A O    1  
ATOM 2166  C CB   . ASP A 1 142 ? 4.299   8.904   6.611   1.00 0.37  ? 142 ASP A CB   1  
ATOM 2167  C CG   . ASP A 1 142 ? 4.278   10.388  6.241   1.00 0.78  ? 142 ASP A CG   1  
ATOM 2168  O OD1  . ASP A 1 142 ? 4.737   10.715  5.159   1.00 1.32  ? 142 ASP A OD1  1  
ATOM 2169  O OD2  . ASP A 1 142 ? 3.803   11.172  7.045   1.00 1.59  ? 142 ASP A OD2  1  
ATOM 2170  H H    . ASP A 1 142 ? 3.888   8.359   4.137   1.00 0.37  ? 142 ASP A H    1  
ATOM 2171  H HA   . ASP A 1 142 ? 6.250   8.727   5.724   1.00 0.38  ? 142 ASP A HA   1  
ATOM 2172  H HB2  . ASP A 1 142 ? 3.319   8.478   6.451   1.00 0.57  ? 142 ASP A HB2  1  
ATOM 2173  H HB3  . ASP A 1 142 ? 4.573   8.798   7.650   1.00 0.68  ? 142 ASP A HB3  1  
ATOM 2174  N N    . PHE A 1 143 ? 4.571   5.922   6.174   1.00 0.41  ? 143 PHE A N    1  
ATOM 2175  C CA   . PHE A 1 143 ? 4.705   4.524   6.669   1.00 0.43  ? 143 PHE A CA   1  
ATOM 2176  C C    . PHE A 1 143 ? 5.714   3.771   5.796   1.00 0.43  ? 143 PHE A C    1  
ATOM 2177  O O    . PHE A 1 143 ? 6.452   2.934   6.276   1.00 0.45  ? 143 PHE A O    1  
ATOM 2178  C CB   . PHE A 1 143 ? 3.339   3.837   6.587   1.00 0.44  ? 143 PHE A CB   1  
ATOM 2179  C CG   . PHE A 1 143 ? 3.362   2.537   7.358   1.00 0.47  ? 143 PHE A CG   1  
ATOM 2180  C CD1  . PHE A 1 143 ? 3.856   1.375   6.755   1.00 1.16  ? 143 PHE A CD1  1  
ATOM 2181  C CD2  . PHE A 1 143 ? 2.879   2.493   8.672   1.00 1.29  ? 143 PHE A CD2  1  
ATOM 2182  C CE1  . PHE A 1 143 ? 3.869   0.168   7.465   1.00 1.22  ? 143 PHE A CE1  1  
ATOM 2183  C CE2  . PHE A 1 143 ? 2.893   1.286   9.383   1.00 1.35  ? 143 PHE A CE2  1  
ATOM 2184  C CZ   . PHE A 1 143 ? 3.387   0.124   8.779   1.00 0.72  ? 143 PHE A CZ   1  
ATOM 2185  H H    . PHE A 1 143 ? 3.737   6.206   5.745   1.00 0.48  ? 143 PHE A H    1  
ATOM 2186  H HA   . PHE A 1 143 ? 5.054   4.515   7.691   1.00 0.44  ? 143 PHE A HA   1  
ATOM 2187  H HB2  . PHE A 1 143 ? 2.586   4.488   7.006   1.00 0.47  ? 143 PHE A HB2  1  
ATOM 2188  H HB3  . PHE A 1 143 ? 3.101   3.635   5.553   1.00 0.49  ? 143 PHE A HB3  1  
ATOM 2189  H HD1  . PHE A 1 143 ? 4.228   1.409   5.742   1.00 1.96  ? 143 PHE A HD1  1  
ATOM 2190  H HD2  . PHE A 1 143 ? 2.497   3.390   9.138   1.00 2.09  ? 143 PHE A HD2  1  
ATOM 2191  H HE1  . PHE A 1 143 ? 4.250   -0.728  7.000   1.00 2.02  ? 143 PHE A HE1  1  
ATOM 2192  H HE2  . PHE A 1 143 ? 2.522   1.252   10.396  1.00 2.16  ? 143 PHE A HE2  1  
ATOM 2193  H HZ   . PHE A 1 143 ? 3.397   -0.807  9.327   1.00 0.85  ? 143 PHE A HZ   1  
ATOM 2194  N N    . LEU A 1 144 ? 5.753   4.048   4.518   1.00 0.45  ? 144 LEU A N    1  
ATOM 2195  C CA   . LEU A 1 144 ? 6.718   3.327   3.634   1.00 0.47  ? 144 LEU A CA   1  
ATOM 2196  C C    . LEU A 1 144 ? 8.141   3.823   3.941   1.00 0.47  ? 144 LEU A C    1  
ATOM 2197  O O    . LEU A 1 144 ? 9.015   3.046   4.271   1.00 0.49  ? 144 LEU A O    1  
ATOM 2198  C CB   . LEU A 1 144 ? 6.344   3.588   2.164   1.00 0.49  ? 144 LEU A CB   1  
ATOM 2199  C CG   . LEU A 1 144 ? 6.870   2.481   1.248   1.00 0.64  ? 144 LEU A CG   1  
ATOM 2200  C CD1  . LEU A 1 144 ? 6.240   2.636   -0.138  1.00 1.31  ? 144 LEU A CD1  1  
ATOM 2201  C CD2  . LEU A 1 144 ? 8.396   2.573   1.122   1.00 1.01  ? 144 LEU A CD2  1  
ATOM 2202  H H    . LEU A 1 144 ? 5.145   4.714   4.136   1.00 0.46  ? 144 LEU A H    1  
ATOM 2203  H HA   . LEU A 1 144 ? 6.682   2.283   3.881   1.00 0.47  ? 144 LEU A HA   1  
ATOM 2204  H HB2  . LEU A 1 144 ? 5.268   3.632   2.079   1.00 0.76  ? 144 LEU A HB2  1  
ATOM 2205  H HB3  . LEU A 1 144 ? 6.759   4.535   1.854   1.00 0.69  ? 144 LEU A HB3  1  
ATOM 2206  H HG   . LEU A 1 144 ? 6.594   1.526   1.650   1.00 1.31  ? 144 LEU A HG   1  
ATOM 2207  H HD11 . LEU A 1 144 ? 6.416   3.637   -0.504  1.00 1.90  ? 144 LEU A HD11 1  
ATOM 2208  H HD12 . LEU A 1 144 ? 5.177   2.458   -0.072  1.00 1.80  ? 144 LEU A HD12 1  
ATOM 2209  H HD13 . LEU A 1 144 ? 6.683   1.922   -0.817  1.00 1.81  ? 144 LEU A HD13 1  
ATOM 2210  H HD21 . LEU A 1 144 ? 8.857   2.222   2.032   1.00 1.47  ? 144 LEU A HD21 1  
ATOM 2211  H HD22 . LEU A 1 144 ? 8.684   3.597   0.943   1.00 1.62  ? 144 LEU A HD22 1  
ATOM 2212  H HD23 . LEU A 1 144 ? 8.724   1.959   0.296   1.00 1.63  ? 144 LEU A HD23 1  
ATOM 2213  N N    . ARG A 1 145 ? 8.373   5.095   3.863   1.00 0.47  ? 145 ARG A N    1  
ATOM 2214  C CA   . ARG A 1 145 ? 9.728   5.639   4.179   1.00 0.48  ? 145 ARG A CA   1  
ATOM 2215  C C    . ARG A 1 145 ? 10.162  5.229   5.595   1.00 0.49  ? 145 ARG A C    1  
ATOM 2216  O O    . ARG A 1 145 ? 11.325  4.973   5.837   1.00 0.50  ? 145 ARG A O    1  
ATOM 2217  C CB   . ARG A 1 145 ? 9.678   7.167   4.097   1.00 0.49  ? 145 ARG A CB   1  
ATOM 2218  C CG   . ARG A 1 145 ? 11.049  7.745   4.464   1.00 0.69  ? 145 ARG A CG   1  
ATOM 2219  C CD   . ARG A 1 145 ? 11.090  9.239   4.124   1.00 0.68  ? 145 ARG A CD   1  
ATOM 2220  N NE   . ARG A 1 145 ? 12.197  9.886   4.884   1.00 1.56  ? 145 ARG A NE   1  
ATOM 2221  C CZ   . ARG A 1 145 ? 12.609  11.079  4.551   1.00 2.10  ? 145 ARG A CZ   1  
ATOM 2222  N NH1  . ARG A 1 145 ? 12.052  11.707  3.552   1.00 2.12  ? 145 ARG A NH1  1  
ATOM 2223  N NH2  . ARG A 1 145 ? 13.580  11.643  5.217   1.00 3.16  ? 145 ARG A NH2  1  
ATOM 2224  H H    . ARG A 1 145 ? 7.648   5.708   3.618   1.00 0.47  ? 145 ARG A H    1  
ATOM 2225  H HA   . ARG A 1 145 ? 10.493  5.281   3.506   1.00 0.49  ? 145 ARG A HA   1  
ATOM 2226  H HB2  . ARG A 1 145 ? 9.419   7.463   3.091   1.00 0.67  ? 145 ARG A HB2  1  
ATOM 2227  H HB3  . ARG A 1 145 ? 8.936   7.541   4.786   1.00 0.66  ? 145 ARG A HB3  1  
ATOM 2228  H HG2  . ARG A 1 145 ? 11.223  7.613   5.522   1.00 0.93  ? 145 ARG A HG2  1  
ATOM 2229  H HG3  . ARG A 1 145 ? 11.817  7.231   3.906   1.00 0.93  ? 145 ARG A HG3  1  
ATOM 2230  H HD2  . ARG A 1 145 ? 11.261  9.364   3.066   1.00 1.08  ? 145 ARG A HD2  1  
ATOM 2231  H HD3  . ARG A 1 145 ? 10.150  9.700   4.393   1.00 1.24  ? 145 ARG A HD3  1  
ATOM 2232  H HE   . ARG A 1 145 ? 12.616  9.415   5.635   1.00 2.23  ? 145 ARG A HE   1  
ATOM 2233  H HH11 . ARG A 1 145 ? 11.308  11.275  3.043   1.00 1.91  ? 145 ARG A HH11 1  
ATOM 2234  H HH12 . ARG A 1 145 ? 12.368  12.621  3.298   1.00 2.82  ? 145 ARG A HH12 1  
ATOM 2235  H HH21 . ARG A 1 145 ? 14.007  11.161  5.982   1.00 3.67  ? 145 ARG A HH21 1  
ATOM 2236  H HH22 . ARG A 1 145 ? 13.896  12.557  4.962   1.00 3.66  ? 145 ARG A HH22 1  
ATOM 2237  N N    . GLU A 1 146 ? 9.270   5.222   6.546   1.00 0.49  ? 146 GLU A N    1  
ATOM 2238  C CA   . GLU A 1 146 ? 9.690   4.893   7.950   1.00 0.51  ? 146 GLU A CA   1  
ATOM 2239  C C    . GLU A 1 146 ? 9.800   3.378   8.213   1.00 0.53  ? 146 GLU A C    1  
ATOM 2240  O O    . GLU A 1 146 ? 10.711  2.969   8.905   1.00 0.55  ? 146 GLU A O    1  
ATOM 2241  C CB   . GLU A 1 146 ? 8.700   5.512   8.940   1.00 0.52  ? 146 GLU A CB   1  
ATOM 2242  C CG   . GLU A 1 146 ? 8.697   7.036   8.788   1.00 0.96  ? 146 GLU A CG   1  
ATOM 2243  C CD   . GLU A 1 146 ? 9.946   7.622   9.449   1.00 1.48  ? 146 GLU A CD   1  
ATOM 2244  O OE1  . GLU A 1 146 ? 10.139  7.376   10.628  1.00 2.22  ? 146 GLU A OE1  1  
ATOM 2245  O OE2  . GLU A 1 146 ? 10.688  8.308   8.764   1.00 2.03  ? 146 GLU A OE2  1  
ATOM 2246  H H    . GLU A 1 146 ? 8.350   5.492   6.346   1.00 0.49  ? 146 GLU A H    1  
ATOM 2247  H HA   . GLU A 1 146 ? 10.674  5.302   8.120   1.00 0.53  ? 146 GLU A HA   1  
ATOM 2248  H HB2  . GLU A 1 146 ? 7.709   5.130   8.739   1.00 0.95  ? 146 GLU A HB2  1  
ATOM 2249  H HB3  . GLU A 1 146 ? 8.987   5.252   9.948   1.00 0.79  ? 146 GLU A HB3  1  
ATOM 2250  H HG2  . GLU A 1 146 ? 8.689   7.294   7.738   1.00 1.43  ? 146 GLU A HG2  1  
ATOM 2251  H HG3  . GLU A 1 146 ? 7.817   7.442   9.264   1.00 1.69  ? 146 GLU A HG3  1  
ATOM 2252  N N    . ARG A 1 147 ? 8.890   2.544   7.757   1.00 0.59  ? 147 ARG A N    1  
ATOM 2253  C CA   . ARG A 1 147 ? 8.998   1.072   8.114   1.00 0.62  ? 147 ARG A CA   1  
ATOM 2254  C C    . ARG A 1 147 ? 9.421   0.182   6.934   1.00 0.58  ? 147 ARG A C    1  
ATOM 2255  O O    . ARG A 1 147 ? 10.274  -0.673  7.064   1.00 0.62  ? 147 ARG A O    1  
ATOM 2256  C CB   . ARG A 1 147 ? 7.637   0.608   8.626   1.00 0.63  ? 147 ARG A CB   1  
ATOM 2257  C CG   . ARG A 1 147 ? 7.288   1.399   9.898   1.00 0.73  ? 147 ARG A CG   1  
ATOM 2258  C CD   . ARG A 1 147 ? 6.018   0.828   10.576  1.00 1.11  ? 147 ARG A CD   1  
ATOM 2259  N NE   . ARG A 1 147 ? 6.275   0.571   12.035  1.00 1.75  ? 147 ARG A NE   1  
ATOM 2260  C CZ   . ARG A 1 147 ? 7.270   -0.176  12.440  1.00 2.40  ? 147 ARG A CZ   1  
ATOM 2261  N NH1  . ARG A 1 147 ? 8.028   -0.793  11.575  1.00 2.71  ? 147 ARG A NH1  1  
ATOM 2262  N NH2  . ARG A 1 147 ? 7.491   -0.325  13.717  1.00 3.30  ? 147 ARG A NH2  1  
ATOM 2263  H H    . ARG A 1 147 ? 8.126   2.889   7.250   1.00 0.66  ? 147 ARG A H    1  
ATOM 2264  H HA   . ARG A 1 147 ? 9.706   0.966   8.924   1.00 0.69  ? 147 ARG A HA   1  
ATOM 2265  H HB2  . ARG A 1 147 ? 6.887   0.787   7.868   1.00 0.63  ? 147 ARG A HB2  1  
ATOM 2266  H HB3  . ARG A 1 147 ? 7.676   -0.445  8.855   1.00 0.70  ? 147 ARG A HB3  1  
ATOM 2267  H HG2  . ARG A 1 147 ? 8.120   1.357   10.583  1.00 1.25  ? 147 ARG A HG2  1  
ATOM 2268  H HG3  . ARG A 1 147 ? 7.116   2.432   9.627   1.00 1.20  ? 147 ARG A HG3  1  
ATOM 2269  H HD2  . ARG A 1 147 ? 5.225   1.551   10.516  1.00 1.77  ? 147 ARG A HD2  1  
ATOM 2270  H HD3  . ARG A 1 147 ? 5.698   -0.081  10.067  1.00 1.67  ? 147 ARG A HD3  1  
ATOM 2271  H HE   . ARG A 1 147 ? 5.695   0.994   12.702  1.00 2.24  ? 147 ARG A HE   1  
ATOM 2272  H HH11 . ARG A 1 147 ? 7.851   -0.696  10.598  1.00 2.53  ? 147 ARG A HH11 1  
ATOM 2273  H HH12 . ARG A 1 147 ? 8.787   -1.363  11.892  1.00 3.48  ? 147 ARG A HH12 1  
ATOM 2274  H HH21 . ARG A 1 147 ? 6.900   0.132   14.383  1.00 3.61  ? 147 ARG A HH21 1  
ATOM 2275  H HH22 . ARG A 1 147 ? 8.249   -0.896  14.030  1.00 3.89  ? 147 ARG A HH22 1  
ATOM 2276  N N    . LEU A 1 148 ? 8.794   0.343   5.806   1.00 0.53  ? 148 LEU A N    1  
ATOM 2277  C CA   . LEU A 1 148 ? 9.099   -0.521  4.623   1.00 0.57  ? 148 LEU A CA   1  
ATOM 2278  C C    . LEU A 1 148 ? 10.316  -0.036  3.829   1.00 0.67  ? 148 LEU A C    1  
ATOM 2279  O O    . LEU A 1 148 ? 10.336  -0.160  2.624   1.00 1.61  ? 148 LEU A O    1  
ATOM 2280  C CB   . LEU A 1 148 ? 7.891   -0.484  3.687   1.00 0.59  ? 148 LEU A CB   1  
ATOM 2281  C CG   . LEU A 1 148 ? 6.600   -0.691  4.489   1.00 0.70  ? 148 LEU A CG   1  
ATOM 2282  C CD1  . LEU A 1 148 ? 5.405   -0.703  3.531   1.00 1.29  ? 148 LEU A CD1  1  
ATOM 2283  C CD2  . LEU A 1 148 ? 6.667   -2.028  5.241   1.00 1.34  ? 148 LEU A CD2  1  
ATOM 2284  H H    . LEU A 1 148 ? 8.082   1.013   5.734   1.00 0.52  ? 148 LEU A H    1  
ATOM 2285  H HA   . LEU A 1 148 ? 9.238   -1.554  4.905   1.00 0.58  ? 148 LEU A HA   1  
ATOM 2286  H HB2  . LEU A 1 148 ? 7.859   0.464   3.190   1.00 0.75  ? 148 LEU A HB2  1  
ATOM 2287  H HB3  . LEU A 1 148 ? 7.982   -1.269  2.952   1.00 0.89  ? 148 LEU A HB3  1  
ATOM 2288  H HG   . LEU A 1 148 ? 6.482   0.118   5.196   1.00 1.45  ? 148 LEU A HG   1  
ATOM 2289  H HD11 . LEU A 1 148 ? 4.525   -1.040  4.059   1.00 1.91  ? 148 LEU A HD11 1  
ATOM 2290  H HD12 . LEU A 1 148 ? 5.610   -1.371  2.708   1.00 1.90  ? 148 LEU A HD12 1  
ATOM 2291  H HD13 . LEU A 1 148 ? 5.238   0.294   3.152   1.00 1.61  ? 148 LEU A HD13 1  
ATOM 2292  H HD21 . LEU A 1 148 ? 5.672   -2.326  5.539   1.00 1.92  ? 148 LEU A HD21 1  
ATOM 2293  H HD22 . LEU A 1 148 ? 7.283   -1.915  6.121   1.00 1.86  ? 148 LEU A HD22 1  
ATOM 2294  H HD23 . LEU A 1 148 ? 7.092   -2.786  4.598   1.00 1.88  ? 148 LEU A HD23 1  
ATOM 2295  N N    . LEU A 1 149 ? 11.326  0.511   4.462   1.00 0.67  ? 149 LEU A N    1  
ATOM 2296  C CA   . LEU A 1 149 ? 12.526  0.986   3.686   1.00 0.57  ? 149 LEU A CA   1  
ATOM 2297  C C    . LEU A 1 149 ? 13.703  0.028   3.928   1.00 0.56  ? 149 LEU A C    1  
ATOM 2298  O O    . LEU A 1 149 ? 14.323  -0.456  2.998   1.00 0.58  ? 149 LEU A O    1  
ATOM 2299  C CB   . LEU A 1 149 ? 12.887  2.424   4.124   1.00 0.54  ? 149 LEU A CB   1  
ATOM 2300  C CG   . LEU A 1 149 ? 13.372  3.244   2.917   1.00 0.59  ? 149 LEU A CG   1  
ATOM 2301  C CD1  . LEU A 1 149 ? 13.646  4.686   3.348   1.00 0.83  ? 149 LEU A CD1  1  
ATOM 2302  C CD2  . LEU A 1 149 ? 14.656  2.624   2.361   1.00 1.21  ? 149 LEU A CD2  1  
ATOM 2303  H H    . LEU A 1 149 ? 11.299  0.614   5.436   1.00 1.41  ? 149 LEU A H    1  
ATOM 2304  H HA   . LEU A 1 149 ? 12.307  0.970   2.626   1.00 0.58  ? 149 LEU A HA   1  
ATOM 2305  H HB2  . LEU A 1 149 ? 12.010  2.896   4.543   1.00 0.54  ? 149 LEU A HB2  1  
ATOM 2306  H HB3  . LEU A 1 149 ? 13.666  2.398   4.874   1.00 0.61  ? 149 LEU A HB3  1  
ATOM 2307  H HG   . LEU A 1 149 ? 12.609  3.240   2.152   1.00 1.15  ? 149 LEU A HG   1  
ATOM 2308  H HD11 . LEU A 1 149 ? 12.809  5.056   3.921   1.00 1.37  ? 149 LEU A HD11 1  
ATOM 2309  H HD12 . LEU A 1 149 ? 13.783  5.304   2.471   1.00 1.41  ? 149 LEU A HD12 1  
ATOM 2310  H HD13 . LEU A 1 149 ? 14.540  4.717   3.953   1.00 1.52  ? 149 LEU A HD13 1  
ATOM 2311  H HD21 . LEU A 1 149 ? 14.422  1.690   1.871   1.00 1.67  ? 149 LEU A HD21 1  
ATOM 2312  H HD22 . LEU A 1 149 ? 15.349  2.444   3.169   1.00 1.82  ? 149 LEU A HD22 1  
ATOM 2313  H HD23 . LEU A 1 149 ? 15.102  3.302   1.648   1.00 1.75  ? 149 LEU A HD23 1  
ATOM 2314  N N    . GLY A 1 150 ? 14.017  -0.251  5.161   1.00 0.56  ? 150 GLY A N    1  
ATOM 2315  C CA   . GLY A 1 150 ? 15.153  -1.173  5.450   1.00 0.58  ? 150 GLY A CA   1  
ATOM 2316  C C    . GLY A 1 150 ? 14.842  -2.575  4.915   1.00 0.62  ? 150 GLY A C    1  
ATOM 2317  O O    . GLY A 1 150 ? 15.712  -3.273  4.429   1.00 0.70  ? 150 GLY A O    1  
ATOM 2318  H H    . GLY A 1 150 ? 13.508  0.147   5.899   1.00 0.56  ? 150 GLY A H    1  
ATOM 2319  H HA2  . GLY A 1 150 ? 16.046  -0.796  4.973   1.00 0.57  ? 150 GLY A HA2  1  
ATOM 2320  H HA3  . GLY A 1 150 ? 15.307  -1.220  6.517   1.00 0.61  ? 150 GLY A HA3  1  
ATOM 2321  N N    . TRP A 1 151 ? 13.613  -3.003  5.020   1.00 0.63  ? 151 TRP A N    1  
ATOM 2322  C CA   . TRP A 1 151 ? 13.253  -4.369  4.540   1.00 0.69  ? 151 TRP A CA   1  
ATOM 2323  C C    . TRP A 1 151 ? 13.301  -4.432  3.008   1.00 0.70  ? 151 TRP A C    1  
ATOM 2324  O O    . TRP A 1 151 ? 13.665  -5.442  2.438   1.00 0.72  ? 151 TRP A O    1  
ATOM 2325  C CB   . TRP A 1 151 ? 11.840  -4.722  5.032   1.00 0.73  ? 151 TRP A CB   1  
ATOM 2326  C CG   . TRP A 1 151 ? 11.896  -5.161  6.464   1.00 1.25  ? 151 TRP A CG   1  
ATOM 2327  C CD1  . TRP A 1 151 ? 11.838  -6.446  6.883   1.00 2.17  ? 151 TRP A CD1  1  
ATOM 2328  C CD2  . TRP A 1 151 ? 12.024  -4.345  7.666   1.00 1.86  ? 151 TRP A CD2  1  
ATOM 2329  N NE1  . TRP A 1 151 ? 11.920  -6.471  8.264   1.00 2.65  ? 151 TRP A NE1  1  
ATOM 2330  C CE2  . TRP A 1 151 ? 12.036  -5.201  8.793   1.00 2.43  ? 151 TRP A CE2  1  
ATOM 2331  C CE3  . TRP A 1 151 ? 12.129  -2.959  7.886   1.00 2.68  ? 151 TRP A CE3  1  
ATOM 2332  C CZ2  . TRP A 1 151 ? 12.149  -4.702  10.091  1.00 3.17  ? 151 TRP A CZ2  1  
ATOM 2333  C CZ3  . TRP A 1 151 ? 12.243  -2.453  9.192   1.00 3.62  ? 151 TRP A CZ3  1  
ATOM 2334  C CH2  . TRP A 1 151 ? 12.253  -3.323  10.291  1.00 3.67  ? 151 TRP A CH2  1  
ATOM 2335  H H    . TRP A 1 151 ? 12.930  -2.432  5.428   1.00 0.64  ? 151 TRP A H    1  
ATOM 2336  H HA   . TRP A 1 151 ? 13.960  -5.081  4.940   1.00 0.73  ? 151 TRP A HA   1  
ATOM 2337  H HB2  . TRP A 1 151 ? 11.204  -3.854  4.949   1.00 0.96  ? 151 TRP A HB2  1  
ATOM 2338  H HB3  . TRP A 1 151 ? 11.435  -5.523  4.429   1.00 0.95  ? 151 TRP A HB3  1  
ATOM 2339  H HD1  . TRP A 1 151 ? 11.742  -7.311  6.244   1.00 2.79  ? 151 TRP A HD1  1  
ATOM 2340  H HE1  . TRP A 1 151 ? 11.901  -7.280  8.817   1.00 3.39  ? 151 TRP A HE1  1  
ATOM 2341  H HE3  . TRP A 1 151 ? 12.123  -2.281  7.046   1.00 2.90  ? 151 TRP A HE3  1  
ATOM 2342  H HZ2  . TRP A 1 151 ? 12.156  -5.376  10.934  1.00 3.65  ? 151 TRP A HZ2  1  
ATOM 2343  H HZ3  . TRP A 1 151 ? 12.323  -1.388  9.350   1.00 4.48  ? 151 TRP A HZ3  1  
ATOM 2344  H HH2  . TRP A 1 151 ? 12.340  -2.928  11.293  1.00 4.40  ? 151 TRP A HH2  1  
ATOM 2345  N N    . ILE A 1 152 ? 12.940  -3.376  2.330   1.00 0.73  ? 152 ILE A N    1  
ATOM 2346  C CA   . ILE A 1 152 ? 12.978  -3.418  0.839   1.00 0.76  ? 152 ILE A CA   1  
ATOM 2347  C C    . ILE A 1 152 ? 14.432  -3.495  0.373   1.00 0.79  ? 152 ILE A C    1  
ATOM 2348  O O    . ILE A 1 152 ? 14.724  -3.937  -0.720  1.00 0.89  ? 152 ILE A O    1  
ATOM 2349  C CB   . ILE A 1 152 ? 12.309  -2.170  0.259   1.00 0.78  ? 152 ILE A CB   1  
ATOM 2350  C CG1  . ILE A 1 152 ? 10.821  -2.199  0.623   1.00 0.83  ? 152 ILE A CG1  1  
ATOM 2351  C CG2  . ILE A 1 152 ? 12.466  -2.165  -1.270  1.00 0.92  ? 152 ILE A CG2  1  
ATOM 2352  C CD1  . ILE A 1 152 ? 10.134  -0.924  0.130   1.00 0.94  ? 152 ILE A CD1  1  
ATOM 2353  H H    . ILE A 1 152 ? 12.649  -2.565  2.798   1.00 0.74  ? 152 ILE A H    1  
ATOM 2354  H HA   . ILE A 1 152 ? 12.447  -4.294  0.499   1.00 0.76  ? 152 ILE A HA   1  
ATOM 2355  H HB   . ILE A 1 152 ? 12.769  -1.285  0.674   1.00 0.91  ? 152 ILE A HB   1  
ATOM 2356  H HG12 . ILE A 1 152 ? 10.357  -3.058  0.161   1.00 1.01  ? 152 ILE A HG12 1  
ATOM 2357  H HG13 . ILE A 1 152 ? 10.717  -2.271  1.695   1.00 1.14  ? 152 ILE A HG13 1  
ATOM 2358  H HG21 . ILE A 1 152 ? 13.505  -2.036  -1.530  1.00 1.31  ? 152 ILE A HG21 1  
ATOM 2359  H HG22 . ILE A 1 152 ? 11.892  -1.355  -1.694  1.00 1.41  ? 152 ILE A HG22 1  
ATOM 2360  H HG23 . ILE A 1 152 ? 12.110  -3.104  -1.670  1.00 1.51  ? 152 ILE A HG23 1  
ATOM 2361  H HD11 . ILE A 1 152 ? 10.771  -0.072  0.318   1.00 1.40  ? 152 ILE A HD11 1  
ATOM 2362  H HD12 . ILE A 1 152 ? 9.196   -0.796  0.648   1.00 1.40  ? 152 ILE A HD12 1  
ATOM 2363  H HD13 . ILE A 1 152 ? 9.951   -1.007  -0.930  1.00 1.40  ? 152 ILE A HD13 1  
ATOM 2364  N N    . GLN A 1 153 ? 15.347  -3.078  1.202   1.00 0.77  ? 153 GLN A N    1  
ATOM 2365  C CA   . GLN A 1 153 ? 16.785  -3.137  0.815   1.00 0.80  ? 153 GLN A CA   1  
ATOM 2366  C C    . GLN A 1 153 ? 17.291  -4.582  0.914   1.00 0.81  ? 153 GLN A C    1  
ATOM 2367  O O    . GLN A 1 153 ? 18.076  -5.019  0.096   1.00 0.82  ? 153 GLN A O    1  
ATOM 2368  C CB   . GLN A 1 153 ? 17.622  -2.267  1.758   1.00 0.82  ? 153 GLN A CB   1  
ATOM 2369  C CG   . GLN A 1 153 ? 17.405  -0.769  1.480   1.00 1.09  ? 153 GLN A CG   1  
ATOM 2370  C CD   . GLN A 1 153 ? 17.711  0.043   2.746   1.00 1.98  ? 153 GLN A CD   1  
ATOM 2371  O OE1  . GLN A 1 153 ? 18.050  -0.510  3.773   1.00 2.66  ? 153 GLN A OE1  1  
ATOM 2372  N NE2  . GLN A 1 153 ? 17.615  1.344   2.710   1.00 2.77  ? 153 GLN A NE2  1  
ATOM 2373  H H    . GLN A 1 153 ? 15.086  -2.736  2.085   1.00 0.77  ? 153 GLN A H    1  
ATOM 2374  H HA   . GLN A 1 153 ? 16.917  -2.817  -0.207  1.00 0.82  ? 153 GLN A HA   1  
ATOM 2375  H HB2  . GLN A 1 153 ? 17.339  -2.492  2.776   1.00 1.30  ? 153 GLN A HB2  1  
ATOM 2376  H HB3  . GLN A 1 153 ? 18.669  -2.502  1.624   1.00 1.06  ? 153 GLN A HB3  1  
ATOM 2377  H HG2  . GLN A 1 153 ? 18.076  -0.431  0.703   1.00 1.37  ? 153 GLN A HG2  1  
ATOM 2378  H HG3  . GLN A 1 153 ? 16.389  -0.568  1.176   1.00 1.72  ? 153 GLN A HG3  1  
ATOM 2379  H HE21 . GLN A 1 153 ? 17.350  1.793   1.880   1.00 2.94  ? 153 GLN A HE21 1  
ATOM 2380  H HE22 . GLN A 1 153 ? 17.812  1.872   3.512   1.00 3.53  ? 153 GLN A HE22 1  
ATOM 2381  N N    . ASP A 1 154 ? 16.907  -5.317  1.925   1.00 0.83  ? 154 ASP A N    1  
ATOM 2382  C CA   . ASP A 1 154 ? 17.453  -6.703  2.051   1.00 0.86  ? 154 ASP A CA   1  
ATOM 2383  C C    . ASP A 1 154 ? 16.994  -7.577  0.875   1.00 0.85  ? 154 ASP A C    1  
ATOM 2384  O O    . ASP A 1 154 ? 17.748  -8.384  0.368   1.00 0.94  ? 154 ASP A O    1  
ATOM 2385  C CB   . ASP A 1 154 ? 17.011  -7.327  3.376   1.00 0.90  ? 154 ASP A CB   1  
ATOM 2386  C CG   . ASP A 1 154 ? 17.484  -6.453  4.538   1.00 1.28  ? 154 ASP A CG   1  
ATOM 2387  O OD1  . ASP A 1 154 ? 16.823  -5.467  4.818   1.00 1.99  ? 154 ASP A OD1  1  
ATOM 2388  O OD2  . ASP A 1 154 ? 18.498  -6.785  5.129   1.00 1.84  ? 154 ASP A OD2  1  
ATOM 2389  H H    . ASP A 1 154 ? 16.312  -4.949  2.613   1.00 0.82  ? 154 ASP A H    1  
ATOM 2390  H HA   . ASP A 1 154 ? 18.526  -6.603  2.022   1.00 0.87  ? 154 ASP A HA   1  
ATOM 2391  H HB2  . ASP A 1 154 ? 15.934  -7.400  3.396   1.00 1.24  ? 154 ASP A HB2  1  
ATOM 2392  H HB3  . ASP A 1 154 ? 17.441  -8.313  3.471   1.00 1.20  ? 154 ASP A HB3  1  
ATOM 2393  N N    . GLN A 1 155 ? 15.779  -7.421  0.424   1.00 0.79  ? 155 GLN A N    1  
ATOM 2394  C CA   . GLN A 1 155 ? 15.292  -8.238  -0.728  1.00 0.79  ? 155 GLN A CA   1  
ATOM 2395  C C    . GLN A 1 155 ? 15.936  -7.744  -2.025  1.00 0.72  ? 155 GLN A C    1  
ATOM 2396  O O    . GLN A 1 155 ? 15.573  -8.158  -3.108  1.00 1.03  ? 155 GLN A O    1  
ATOM 2397  C CB   . GLN A 1 155 ? 13.773  -8.097  -0.844  1.00 0.90  ? 155 GLN A CB   1  
ATOM 2398  C CG   . GLN A 1 155 ? 13.399  -6.618  -0.914  1.00 1.37  ? 155 GLN A CG   1  
ATOM 2399  C CD   . GLN A 1 155 ? 11.878  -6.480  -1.000  1.00 2.01  ? 155 GLN A CD   1  
ATOM 2400  O OE1  . GLN A 1 155 ? 11.179  -6.718  -0.034  1.00 2.72  ? 155 GLN A OE1  1  
ATOM 2401  N NE2  . GLN A 1 155 ? 11.331  -6.103  -2.123  1.00 2.54  ? 155 GLN A NE2  1  
ATOM 2402  H H    . GLN A 1 155 ? 15.176  -6.760  0.821   1.00 0.78  ? 155 GLN A H    1  
ATOM 2403  H HA   . GLN A 1 155 ? 15.534  -9.284  -0.602  1.00 0.92  ? 155 GLN A HA   1  
ATOM 2404  H HB2  . GLN A 1 155 ? 13.433  -8.597  -1.740  1.00 1.39  ? 155 GLN A HB2  1  
ATOM 2405  H HB3  . GLN A 1 155 ? 13.303  -8.545  0.018   1.00 1.28  ? 155 GLN A HB3  1  
ATOM 2406  H HG2  . GLN A 1 155 ? 13.759  -6.117  -0.030  1.00 1.80  ? 155 GLN A HG2  1  
ATOM 2407  H HG3  . GLN A 1 155 ? 13.849  -6.174  -1.789  1.00 1.99  ? 155 GLN A HG3  1  
ATOM 2408  H HE21 . GLN A 1 155 ? 11.895  -5.912  -2.902  1.00 2.69  ? 155 GLN A HE21 1  
ATOM 2409  H HE22 . GLN A 1 155 ? 10.358  -6.012  -2.188  1.00 3.17  ? 155 GLN A HE22 1  
ATOM 2410  N N    . GLY A 1 156 ? 16.886  -6.855  -1.924  1.00 0.63  ? 156 GLY A N    1  
ATOM 2411  C CA   . GLY A 1 156 ? 17.554  -6.321  -3.145  1.00 0.72  ? 156 GLY A CA   1  
ATOM 2412  C C    . GLY A 1 156 ? 16.770  -5.112  -3.650  1.00 0.87  ? 156 GLY A C    1  
ATOM 2413  O O    . GLY A 1 156 ? 17.306  -4.035  -3.827  1.00 1.38  ? 156 GLY A O    1  
ATOM 2414  H H    . GLY A 1 156 ? 17.157  -6.535  -1.043  1.00 0.79  ? 156 GLY A H    1  
ATOM 2415  H HA2  . GLY A 1 156 ? 18.566  -6.026  -2.902  1.00 0.89  ? 156 GLY A HA2  1  
ATOM 2416  H HA3  . GLY A 1 156 ? 17.576  -7.080  -3.913  1.00 0.72  ? 156 GLY A HA3  1  
ATOM 2417  N N    . GLY A 1 157 ? 15.501  -5.289  -3.890  1.00 0.81  ? 157 GLY A N    1  
ATOM 2418  C CA   . GLY A 1 157 ? 14.664  -4.160  -4.393  1.00 1.10  ? 157 GLY A CA   1  
ATOM 2419  C C    . GLY A 1 157 ? 13.269  -4.680  -4.754  1.00 0.84  ? 157 GLY A C    1  
ATOM 2420  O O    . GLY A 1 157 ? 12.942  -5.828  -4.531  1.00 0.88  ? 157 GLY A O    1  
ATOM 2421  H H    . GLY A 1 157 ? 15.098  -6.170  -3.746  1.00 0.96  ? 157 GLY A H    1  
ATOM 2422  H HA2  . GLY A 1 157 ? 14.583  -3.403  -3.626  1.00 1.27  ? 157 GLY A HA2  1  
ATOM 2423  H HA3  . GLY A 1 157 ? 15.125  -3.735  -5.272  1.00 1.46  ? 157 GLY A HA3  1  
ATOM 2424  N N    . TRP A 1 158 ? 12.440  -3.828  -5.300  1.00 0.67  ? 158 TRP A N    1  
ATOM 2425  C CA   . TRP A 1 158 ? 11.055  -4.247  -5.669  1.00 0.50  ? 158 TRP A CA   1  
ATOM 2426  C C    . TRP A 1 158 ? 11.093  -5.453  -6.611  1.00 0.51  ? 158 TRP A C    1  
ATOM 2427  O O    . TRP A 1 158 ? 10.063  -6.007  -6.941  1.00 0.53  ? 158 TRP A O    1  
ATOM 2428  C CB   . TRP A 1 158 ? 10.326  -3.093  -6.361  1.00 0.51  ? 158 TRP A CB   1  
ATOM 2429  C CG   . TRP A 1 158 ? 10.184  -1.933  -5.429  1.00 0.46  ? 158 TRP A CG   1  
ATOM 2430  C CD1  . TRP A 1 158 ? 11.045  -0.892  -5.343  1.00 0.59  ? 158 TRP A CD1  1  
ATOM 2431  C CD2  . TRP A 1 158 ? 9.128   -1.670  -4.463  1.00 0.46  ? 158 TRP A CD2  1  
ATOM 2432  N NE1  . TRP A 1 158 ? 10.581  -0.007  -4.386  1.00 0.55  ? 158 TRP A NE1  1  
ATOM 2433  C CE2  . TRP A 1 158 ? 9.402   -0.444  -3.814  1.00 0.47  ? 158 TRP A CE2  1  
ATOM 2434  C CE3  . TRP A 1 158 ? 7.969   -2.373  -4.091  1.00 0.65  ? 158 TRP A CE3  1  
ATOM 2435  C CZ2  . TRP A 1 158 ? 8.555   0.069   -2.831  1.00 0.58  ? 158 TRP A CZ2  1  
ATOM 2436  C CZ3  . TRP A 1 158 ? 7.114   -1.862  -3.102  1.00 0.84  ? 158 TRP A CZ3  1  
ATOM 2437  C CH2  . TRP A 1 158 ? 7.406   -0.643  -2.473  1.00 0.78  ? 158 TRP A CH2  1  
ATOM 2438  H H    . TRP A 1 158 ? 12.728  -2.905  -5.459  1.00 0.72  ? 158 TRP A H    1  
ATOM 2439  H HA   . TRP A 1 158 ? 10.517  -4.549  -4.785  1.00 0.48  ? 158 TRP A HA   1  
ATOM 2440  H HB2  . TRP A 1 158 ? 10.890  -2.784  -7.229  1.00 0.68  ? 158 TRP A HB2  1  
ATOM 2441  H HB3  . TRP A 1 158 ? 9.346   -3.425  -6.672  1.00 0.51  ? 158 TRP A HB3  1  
ATOM 2442  H HD1  . TRP A 1 158 ? 11.945  -0.771  -5.927  1.00 0.78  ? 158 TRP A HD1  1  
ATOM 2443  H HE1  . TRP A 1 158 ? 11.021  0.831   -4.130  1.00 0.66  ? 158 TRP A HE1  1  
ATOM 2444  H HE3  . TRP A 1 158 ? 7.737   -3.312  -4.569  1.00 0.72  ? 158 TRP A HE3  1  
ATOM 2445  H HZ2  . TRP A 1 158 ? 8.785   1.008   -2.350  1.00 0.60  ? 158 TRP A HZ2  1  
ATOM 2446  H HZ3  . TRP A 1 158 ? 6.227   -2.410  -2.823  1.00 1.06  ? 158 TRP A HZ3  1  
ATOM 2447  H HH2  . TRP A 1 158 ? 6.745   -0.255  -1.712  1.00 0.95  ? 158 TRP A HH2  1  
ATOM 2448  N N    . ASP A 1 159 ? 12.240  -5.873  -7.060  1.00 0.50  ? 159 ASP A N    1  
ATOM 2449  C CA   . ASP A 1 159 ? 12.262  -7.043  -7.982  1.00 0.51  ? 159 ASP A CA   1  
ATOM 2450  C C    . ASP A 1 159 ? 11.707  -8.265  -7.245  1.00 0.51  ? 159 ASP A C    1  
ATOM 2451  O O    . ASP A 1 159 ? 11.109  -9.142  -7.837  1.00 0.51  ? 159 ASP A O    1  
ATOM 2452  C CB   . ASP A 1 159 ? 13.694  -7.314  -8.447  1.00 0.54  ? 159 ASP A CB   1  
ATOM 2453  C CG   . ASP A 1 159 ? 14.598  -7.505  -7.229  1.00 1.66  ? 159 ASP A CG   1  
ATOM 2454  O OD1  . ASP A 1 159 ? 14.995  -6.508  -6.648  1.00 2.46  ? 159 ASP A OD1  1  
ATOM 2455  O OD2  . ASP A 1 159 ? 14.879  -8.645  -6.896  1.00 2.37  ? 159 ASP A OD2  1  
ATOM 2456  H H    . ASP A 1 159 ? 13.073  -5.426  -6.800  1.00 0.50  ? 159 ASP A H    1  
ATOM 2457  H HA   . ASP A 1 159 ? 11.632  -6.816  -8.832  1.00 0.51  ? 159 ASP A HA   1  
ATOM 2458  H HB2  . ASP A 1 159 ? 13.712  -8.207  -9.054  1.00 0.94  ? 159 ASP A HB2  1  
ATOM 2459  H HB3  . ASP A 1 159 ? 14.048  -6.476  -9.028  1.00 1.23  ? 159 ASP A HB3  1  
ATOM 2460  N N    . GLY A 1 160 ? 11.892  -8.323  -5.952  1.00 0.52  ? 160 GLY A N    1  
ATOM 2461  C CA   . GLY A 1 160 ? 11.367  -9.481  -5.171  1.00 0.54  ? 160 GLY A CA   1  
ATOM 2462  C C    . GLY A 1 160 ? 9.836   -9.427  -5.161  1.00 0.53  ? 160 GLY A C    1  
ATOM 2463  O O    . GLY A 1 160 ? 9.169   -10.443 -5.163  1.00 0.54  ? 160 GLY A O    1  
ATOM 2464  H H    . GLY A 1 160 ? 12.374  -7.602  -5.496  1.00 0.53  ? 160 GLY A H    1  
ATOM 2465  H HA2  . GLY A 1 160 ? 11.696  -10.403 -5.628  1.00 0.55  ? 160 GLY A HA2  1  
ATOM 2466  H HA3  . GLY A 1 160 ? 11.733  -9.429  -4.158  1.00 0.57  ? 160 GLY A HA3  1  
ATOM 2467  N N    . LEU A 1 161 ? 9.278   -8.248  -5.158  1.00 0.54  ? 161 LEU A N    1  
ATOM 2468  C CA   . LEU A 1 161 ? 7.793   -8.117  -5.156  1.00 0.56  ? 161 LEU A CA   1  
ATOM 2469  C C    . LEU A 1 161 ? 7.219   -8.815  -6.391  1.00 0.56  ? 161 LEU A C    1  
ATOM 2470  O O    . LEU A 1 161 ? 6.359   -9.669  -6.302  1.00 0.62  ? 161 LEU A O    1  
ATOM 2471  C CB   . LEU A 1 161 ? 7.424   -6.627  -5.209  1.00 0.58  ? 161 LEU A CB   1  
ATOM 2472  C CG   . LEU A 1 161 ? 5.892   -6.447  -5.158  1.00 0.74  ? 161 LEU A CG   1  
ATOM 2473  C CD1  . LEU A 1 161 ? 5.303   -7.112  -3.897  1.00 1.63  ? 161 LEU A CD1  1  
ATOM 2474  C CD2  . LEU A 1 161 ? 5.566   -4.950  -5.138  1.00 1.56  ? 161 LEU A CD2  1  
ATOM 2475  H H    . LEU A 1 161 ? 9.839   -7.444  -5.166  1.00 0.54  ? 161 LEU A H    1  
ATOM 2476  H HA   . LEU A 1 161 ? 7.386   -8.529  -4.246  1.00 0.58  ? 161 LEU A HA   1  
ATOM 2477  H HB2  . LEU A 1 161 ? 7.871   -6.120  -4.365  1.00 0.75  ? 161 LEU A HB2  1  
ATOM 2478  H HB3  . LEU A 1 161 ? 7.803   -6.197  -6.124  1.00 0.77  ? 161 LEU A HB3  1  
ATOM 2479  H HG   . LEU A 1 161 ? 5.451   -6.896  -6.034  1.00 1.32  ? 161 LEU A HG   1  
ATOM 2480  H HD11 . LEU A 1 161 ? 5.112   -8.156  -4.099  1.00 2.13  ? 161 LEU A HD11 1  
ATOM 2481  H HD12 . LEU A 1 161 ? 4.374   -6.629  -3.626  1.00 2.24  ? 161 LEU A HD12 1  
ATOM 2482  H HD13 . LEU A 1 161 ? 6.003   -7.027  -3.079  1.00 2.11  ? 161 LEU A HD13 1  
ATOM 2483  H HD21 . LEU A 1 161 ? 6.153   -4.442  -5.889  1.00 2.07  ? 161 LEU A HD21 1  
ATOM 2484  H HD22 . LEU A 1 161 ? 5.796   -4.545  -4.164  1.00 2.01  ? 161 LEU A HD22 1  
ATOM 2485  H HD23 . LEU A 1 161 ? 4.515   -4.808  -5.346  1.00 2.20  ? 161 LEU A HD23 1  
ATOM 2486  N N    . LEU A 1 162 ? 7.675   -8.415  -7.551  1.00 0.53  ? 162 LEU A N    1  
ATOM 2487  C CA   . LEU A 1 162 ? 7.156   -8.997  -8.822  1.00 0.56  ? 162 LEU A CA   1  
ATOM 2488  C C    . LEU A 1 162 ? 7.677   -10.429 -9.003  1.00 0.55  ? 162 LEU A C    1  
ATOM 2489  O O    . LEU A 1 162 ? 7.030   -11.248 -9.625  1.00 0.57  ? 162 LEU A O    1  
ATOM 2490  C CB   . LEU A 1 162 ? 7.601   -8.091  -9.984  1.00 0.61  ? 162 LEU A CB   1  
ATOM 2491  C CG   . LEU A 1 162 ? 7.331   -8.746  -11.342 1.00 0.80  ? 162 LEU A CG   1  
ATOM 2492  C CD1  . LEU A 1 162 ? 5.835   -9.037  -11.491 1.00 1.56  ? 162 LEU A CD1  1  
ATOM 2493  C CD2  . LEU A 1 162 ? 7.775   -7.788  -12.451 1.00 1.33  ? 162 LEU A CD2  1  
ATOM 2494  H H    . LEU A 1 162 ? 8.348   -7.705  -7.584  1.00 0.52  ? 162 LEU A H    1  
ATOM 2495  H HA   . LEU A 1 162 ? 6.081   -9.041  -8.768  1.00 0.58  ? 162 LEU A HA   1  
ATOM 2496  H HB2  . LEU A 1 162 ? 7.062   -7.157  -9.930  1.00 1.09  ? 162 LEU A HB2  1  
ATOM 2497  H HB3  . LEU A 1 162 ? 8.659   -7.894  -9.891  1.00 1.00  ? 162 LEU A HB3  1  
ATOM 2498  H HG   . LEU A 1 162 ? 7.891   -9.664  -11.421 1.00 1.65  ? 162 LEU A HG   1  
ATOM 2499  H HD11 . LEU A 1 162 ? 5.268   -8.180  -11.162 1.00 2.03  ? 162 LEU A HD11 1  
ATOM 2500  H HD12 . LEU A 1 162 ? 5.573   -9.895  -10.891 1.00 2.11  ? 162 LEU A HD12 1  
ATOM 2501  H HD13 . LEU A 1 162 ? 5.609   -9.242  -12.527 1.00 2.11  ? 162 LEU A HD13 1  
ATOM 2502  H HD21 . LEU A 1 162 ? 8.843   -7.639  -12.391 1.00 1.91  ? 162 LEU A HD21 1  
ATOM 2503  H HD22 . LEU A 1 162 ? 7.273   -6.840  -12.332 1.00 1.79  ? 162 LEU A HD22 1  
ATOM 2504  H HD23 . LEU A 1 162 ? 7.525   -8.210  -13.414 1.00 1.84  ? 162 LEU A HD23 1  
ATOM 2505  N N    . SER A 1 163 ? 8.817   -10.753 -8.467  1.00 0.54  ? 163 SER A N    1  
ATOM 2506  C CA   . SER A 1 163 ? 9.324   -12.147 -8.624  1.00 0.56  ? 163 SER A CA   1  
ATOM 2507  C C    . SER A 1 163 ? 8.452   -13.088 -7.789  1.00 0.53  ? 163 SER A C    1  
ATOM 2508  O O    . SER A 1 163 ? 8.379   -14.274 -8.042  1.00 0.60  ? 163 SER A O    1  
ATOM 2509  C CB   . SER A 1 163 ? 10.773  -12.230 -8.145  1.00 0.63  ? 163 SER A CB   1  
ATOM 2510  O OG   . SER A 1 163 ? 11.558  -11.287 -8.861  1.00 1.32  ? 163 SER A OG   1  
ATOM 2511  H H    . SER A 1 163 ? 9.332   -10.092 -7.957  1.00 0.53  ? 163 SER A H    1  
ATOM 2512  H HA   . SER A 1 163 ? 9.268   -12.440 -9.663  1.00 0.62  ? 163 SER A HA   1  
ATOM 2513  H HB2  . SER A 1 163 ? 10.820  -12.005 -7.093  1.00 1.17  ? 163 SER A HB2  1  
ATOM 2514  H HB3  . SER A 1 163 ? 11.149  -13.230 -8.314  1.00 1.37  ? 163 SER A HB3  1  
ATOM 2515  H HG   . SER A 1 163 ? 11.782  -10.571 -8.263  1.00 1.90  ? 163 SER A HG   1  
ATOM 2516  N N    . TYR A 1 164 ? 7.786   -12.562 -6.799  1.00 0.59  ? 164 TYR A N    1  
ATOM 2517  C CA   . TYR A 1 164 ? 6.910   -13.413 -5.944  1.00 0.64  ? 164 TYR A CA   1  
ATOM 2518  C C    . TYR A 1 164 ? 5.696   -13.868 -6.757  1.00 0.63  ? 164 TYR A C    1  
ATOM 2519  O O    . TYR A 1 164 ? 5.342   -15.030 -6.761  1.00 0.68  ? 164 TYR A O    1  
ATOM 2520  C CB   . TYR A 1 164 ? 6.440   -12.585 -4.742  1.00 0.69  ? 164 TYR A CB   1  
ATOM 2521  C CG   . TYR A 1 164 ? 5.424   -13.365 -3.935  1.00 0.72  ? 164 TYR A CG   1  
ATOM 2522  C CD1  . TYR A 1 164 ? 5.814   -14.528 -3.261  1.00 1.50  ? 164 TYR A CD1  1  
ATOM 2523  C CD2  . TYR A 1 164 ? 4.095   -12.922 -3.854  1.00 1.34  ? 164 TYR A CD2  1  
ATOM 2524  C CE1  . TYR A 1 164 ? 4.879   -15.249 -2.508  1.00 1.57  ? 164 TYR A CE1  1  
ATOM 2525  C CE2  . TYR A 1 164 ? 3.160   -13.644 -3.101  1.00 1.35  ? 164 TYR A CE2  1  
ATOM 2526  C CZ   . TYR A 1 164 ? 3.553   -14.807 -2.428  1.00 0.87  ? 164 TYR A CZ   1  
ATOM 2527  O OH   . TYR A 1 164 ? 2.633   -15.518 -1.684  1.00 0.97  ? 164 TYR A OH   1  
ATOM 2528  H H    . TYR A 1 164 ? 7.858   -11.602 -6.619  1.00 0.69  ? 164 TYR A H    1  
ATOM 2529  H HA   . TYR A 1 164 ? 7.462   -14.274 -5.598  1.00 0.71  ? 164 TYR A HA   1  
ATOM 2530  H HB2  . TYR A 1 164 ? 7.289   -12.350 -4.116  1.00 0.77  ? 164 TYR A HB2  1  
ATOM 2531  H HB3  . TYR A 1 164 ? 5.993   -11.666 -5.094  1.00 0.69  ? 164 TYR A HB3  1  
ATOM 2532  H HD1  . TYR A 1 164 ? 6.836   -14.870 -3.323  1.00 2.34  ? 164 TYR A HD1  1  
ATOM 2533  H HD2  . TYR A 1 164 ? 3.791   -12.025 -4.373  1.00 2.19  ? 164 TYR A HD2  1  
ATOM 2534  H HE1  . TYR A 1 164 ? 5.181   -16.146 -1.988  1.00 2.44  ? 164 TYR A HE1  1  
ATOM 2535  H HE2  . TYR A 1 164 ? 2.136   -13.302 -3.038  1.00 2.17  ? 164 TYR A HE2  1  
ATOM 2536  H HH   . TYR A 1 164 ? 2.198   -14.906 -1.086  1.00 1.32  ? 164 TYR A HH   1  
ATOM 2537  N N    . PHE A 1 165 ? 5.054   -12.967 -7.443  1.00 0.64  ? 165 PHE A N    1  
ATOM 2538  C CA   . PHE A 1 165 ? 3.864   -13.358 -8.249  1.00 0.72  ? 165 PHE A CA   1  
ATOM 2539  C C    . PHE A 1 165 ? 4.269   -14.354 -9.345  1.00 0.82  ? 165 PHE A C    1  
ATOM 2540  O O    . PHE A 1 165 ? 4.772   -15.423 -9.064  1.00 1.56  ? 165 PHE A O    1  
ATOM 2541  C CB   . PHE A 1 165 ? 3.250   -12.114 -8.896  1.00 0.74  ? 165 PHE A CB   1  
ATOM 2542  C CG   . PHE A 1 165 ? 2.571   -11.277 -7.839  1.00 0.84  ? 165 PHE A CG   1  
ATOM 2543  C CD1  . PHE A 1 165 ? 1.271   -11.592 -7.426  1.00 1.65  ? 165 PHE A CD1  1  
ATOM 2544  C CD2  . PHE A 1 165 ? 3.241   -10.187 -7.272  1.00 1.42  ? 165 PHE A CD2  1  
ATOM 2545  C CE1  . PHE A 1 165 ? 0.641   -10.817 -6.446  1.00 1.96  ? 165 PHE A CE1  1  
ATOM 2546  C CE2  . PHE A 1 165 ? 2.611   -9.411  -6.291  1.00 1.71  ? 165 PHE A CE2  1  
ATOM 2547  C CZ   . PHE A 1 165 ? 1.311   -9.726  -5.879  1.00 1.66  ? 165 PHE A CZ   1  
ATOM 2548  H H    . PHE A 1 165 ? 5.351   -12.033 -7.419  1.00 0.65  ? 165 PHE A H    1  
ATOM 2549  H HA   . PHE A 1 165 ? 3.132   -13.820 -7.603  1.00 0.80  ? 165 PHE A HA   1  
ATOM 2550  H HB2  . PHE A 1 165 ? 4.027   -11.534 -9.373  1.00 0.84  ? 165 PHE A HB2  1  
ATOM 2551  H HB3  . PHE A 1 165 ? 2.521   -12.415 -9.635  1.00 0.97  ? 165 PHE A HB3  1  
ATOM 2552  H HD1  . PHE A 1 165 ? 0.755   -12.434 -7.864  1.00 2.37  ? 165 PHE A HD1  1  
ATOM 2553  H HD2  . PHE A 1 165 ? 4.245   -9.944  -7.591  1.00 2.11  ? 165 PHE A HD2  1  
ATOM 2554  H HE1  . PHE A 1 165 ? -0.362  -11.060 -6.128  1.00 2.78  ? 165 PHE A HE1  1  
ATOM 2555  H HE2  . PHE A 1 165 ? 3.127   -8.570  -5.854  1.00 2.44  ? 165 PHE A HE2  1  
ATOM 2556  H HZ   . PHE A 1 165 ? 0.824   -9.128  -5.122  1.00 2.03  ? 165 PHE A HZ   1  
ATOM 2557  N N    . GLY A 1 166 ? 4.075   -14.011 -10.587 1.00 0.94  ? 166 GLY A N    1  
ATOM 2558  C CA   . GLY A 1 166 ? 4.466   -14.937 -11.690 1.00 1.01  ? 166 GLY A CA   1  
ATOM 2559  C C    . GLY A 1 166 ? 3.933   -16.347 -11.414 1.00 1.23  ? 166 GLY A C    1  
ATOM 2560  O O    . GLY A 1 166 ? 4.307   -17.297 -12.074 1.00 1.85  ? 166 GLY A O    1  
ATOM 2561  H H    . GLY A 1 166 ? 3.683   -13.139 -10.798 1.00 1.51  ? 166 GLY A H    1  
ATOM 2562  H HA2  . GLY A 1 166 ? 4.059   -14.575 -12.623 1.00 1.22  ? 166 GLY A HA2  1  
ATOM 2563  H HA3  . GLY A 1 166 ? 5.543   -14.974 -11.760 1.00 1.28  ? 166 GLY A HA3  1  
ATOM 2564  N N    . THR A 1 167 ? 3.063   -16.500 -10.448 1.00 1.51  ? 167 THR A N    1  
ATOM 2565  C CA   . THR A 1 167 ? 2.517   -17.859 -10.145 1.00 2.01  ? 167 THR A CA   1  
ATOM 2566  C C    . THR A 1 167 ? 1.289   -18.123 -11.048 1.00 1.65  ? 167 THR A C    1  
ATOM 2567  O O    . THR A 1 167 ? 0.541   -17.204 -11.318 1.00 2.06  ? 167 THR A O    1  
ATOM 2568  C CB   . THR A 1 167 ? 2.079   -17.914 -8.674  1.00 3.10  ? 167 THR A CB   1  
ATOM 2569  O OG1  . THR A 1 167 ? 1.440   -16.694 -8.328  1.00 3.65  ? 167 THR A OG1  1  
ATOM 2570  C CG2  . THR A 1 167 ? 3.299   -18.125 -7.773  1.00 3.92  ? 167 THR A CG2  1  
ATOM 2571  H H    . THR A 1 167 ? 2.770   -15.726 -9.924  1.00 1.82  ? 167 THR A H    1  
ATOM 2572  H HA   . THR A 1 167 ? 3.288   -18.588 -10.318 1.00 2.49  ? 167 THR A HA   1  
ATOM 2573  H HB   . THR A 1 167 ? 1.390   -18.734 -8.531  1.00 3.48  ? 167 THR A HB   1  
ATOM 2574  H HG1  . THR A 1 167 ? 0.536   -16.731 -8.650  1.00 3.86  ? 167 THR A HG1  1  
ATOM 2575  H HG21 . THR A 1 167 ? 4.036   -17.365 -7.981  1.00 4.12  ? 167 THR A HG21 1  
ATOM 2576  H HG22 . THR A 1 167 ? 3.724   -19.099 -7.963  1.00 4.41  ? 167 THR A HG22 1  
ATOM 2577  H HG23 . THR A 1 167 ? 2.997   -18.060 -6.738  1.00 4.29  ? 167 THR A HG23 1  
ATOM 2578  N N    . PRO A 1 168 ? 1.089   -19.357 -11.486 1.00 1.84  ? 168 PRO A N    1  
ATOM 2579  C CA   . PRO A 1 168 ? -0.074  -19.685 -12.338 1.00 2.36  ? 168 PRO A CA   1  
ATOM 2580  C C    . PRO A 1 168 ? -1.379  -19.426 -11.568 1.00 1.79  ? 168 PRO A C    1  
ATOM 2581  O O    . PRO A 1 168 ? -2.143  -18.541 -11.899 1.00 2.00  ? 168 PRO A O    1  
ATOM 2582  C CB   . PRO A 1 168 ? 0.085   -21.189 -12.669 1.00 3.35  ? 168 PRO A CB   1  
ATOM 2583  C CG   . PRO A 1 168 ? 1.278   -21.725 -11.829 1.00 3.48  ? 168 PRO A CG   1  
ATOM 2584  C CD   . PRO A 1 168 ? 1.975   -20.506 -11.188 1.00 2.53  ? 168 PRO A CD   1  
ATOM 2585  H HA   . PRO A 1 168 ? -0.051  -19.099 -13.245 1.00 2.91  ? 168 PRO A HA   1  
ATOM 2586  H HB2  . PRO A 1 168 ? -0.821  -21.731 -12.417 1.00 3.53  ? 168 PRO A HB2  1  
ATOM 2587  H HB3  . PRO A 1 168 ? 0.299   -21.315 -13.722 1.00 4.09  ? 168 PRO A HB3  1  
ATOM 2588  H HG2  . PRO A 1 168 ? 0.914   -22.394 -11.057 1.00 3.88  ? 168 PRO A HG2  1  
ATOM 2589  H HG3  . PRO A 1 168 ? 1.976   -22.253 -12.466 1.00 4.15  ? 168 PRO A HG3  1  
ATOM 2590  H HD2  . PRO A 1 168 ? 2.075   -20.641 -10.118 1.00 2.65  ? 168 PRO A HD2  1  
ATOM 2591  H HD3  . PRO A 1 168 ? 2.943   -20.354 -11.643 1.00 2.71  ? 168 PRO A HD3  1  
ATOM 2592  N N    . THR A 1 169 ? -1.639  -20.204 -10.551 1.00 1.73  ? 169 THR A N    1  
ATOM 2593  C CA   . THR A 1 169 ? -2.894  -20.022 -9.765  1.00 1.33  ? 169 THR A CA   1  
ATOM 2594  C C    . THR A 1 169 ? -2.988  -18.583 -9.252  1.00 1.05  ? 169 THR A C    1  
ATOM 2595  O O    . THR A 1 169 ? -2.220  -18.160 -8.411  1.00 1.06  ? 169 THR A O    1  
ATOM 2596  C CB   . THR A 1 169 ? -2.899  -20.988 -8.577  1.00 1.53  ? 169 THR A CB   1  
ATOM 2597  O OG1  . THR A 1 169 ? -3.763  -20.487 -7.567  1.00 1.94  ? 169 THR A OG1  1  
ATOM 2598  C CG2  . THR A 1 169 ? -1.482  -21.124 -8.016  1.00 2.40  ? 169 THR A CG2  1  
ATOM 2599  H H    . THR A 1 169 ? -1.012  -20.917 -10.310 1.00 2.32  ? 169 THR A H    1  
ATOM 2600  H HA   . THR A 1 169 ? -3.744  -20.230 -10.398 1.00 1.48  ? 169 THR A HA   1  
ATOM 2601  H HB   . THR A 1 169 ? -3.247  -21.957 -8.900  1.00 1.70  ? 169 THR A HB   1  
ATOM 2602  H HG1  . THR A 1 169 ? -3.699  -21.069 -6.806  1.00 2.25  ? 169 THR A HG1  1  
ATOM 2603  H HG21 . THR A 1 169 ? -1.041  -20.144 -7.912  1.00 2.77  ? 169 THR A HG21 1  
ATOM 2604  H HG22 . THR A 1 169 ? -0.884  -21.719 -8.690  1.00 2.87  ? 169 THR A HG22 1  
ATOM 2605  H HG23 . THR A 1 169 ? -1.523  -21.605 -7.050  1.00 2.91  ? 169 THR A HG23 1  
ATOM 2606  N N    . TRP A 1 170 ? -3.931  -17.829 -9.753  1.00 1.04  ? 170 TRP A N    1  
ATOM 2607  C CA   . TRP A 1 170 ? -4.096  -16.414 -9.301  1.00 1.01  ? 170 TRP A CA   1  
ATOM 2608  C C    . TRP A 1 170 ? -5.134  -16.354 -8.175  1.00 0.92  ? 170 TRP A C    1  
ATOM 2609  O O    . TRP A 1 170 ? -5.395  -15.311 -7.610  1.00 0.95  ? 170 TRP A O    1  
ATOM 2610  C CB   . TRP A 1 170 ? -4.576  -15.563 -10.479 1.00 1.32  ? 170 TRP A CB   1  
ATOM 2611  C CG   . TRP A 1 170 ? -3.644  -15.743 -11.634 1.00 1.70  ? 170 TRP A CG   1  
ATOM 2612  C CD1  . TRP A 1 170 ? -3.917  -16.460 -12.749 1.00 2.30  ? 170 TRP A CD1  1  
ATOM 2613  C CD2  . TRP A 1 170 ? -2.298  -15.213 -11.808 1.00 2.52  ? 170 TRP A CD2  1  
ATOM 2614  N NE1  . TRP A 1 170 ? -2.825  -16.403 -13.596 1.00 3.04  ? 170 TRP A NE1  1  
ATOM 2615  C CE2  . TRP A 1 170 ? -1.801  -15.646 -13.060 1.00 3.15  ? 170 TRP A CE2  1  
ATOM 2616  C CE3  . TRP A 1 170 ? -1.469  -14.406 -11.008 1.00 3.32  ? 170 TRP A CE3  1  
ATOM 2617  C CZ2  . TRP A 1 170 ? -0.527  -15.291 -13.503 1.00 4.11  ? 170 TRP A CZ2  1  
ATOM 2618  C CZ3  . TRP A 1 170 ? -0.185  -14.047 -11.451 1.00 4.37  ? 170 TRP A CZ3  1  
ATOM 2619  C CH2  . TRP A 1 170 ? 0.284   -14.489 -12.696 1.00 4.64  ? 170 TRP A CH2  1  
ATOM 2620  H H    . TRP A 1 170 ? -4.540  -18.197 -10.428 1.00 1.23  ? 170 TRP A H    1  
ATOM 2621  H HA   . TRP A 1 170 ? -3.151  -16.030 -8.942  1.00 1.04  ? 170 TRP A HA   1  
ATOM 2622  H HB2  . TRP A 1 170 ? -5.570  -15.873 -10.766 1.00 1.55  ? 170 TRP A HB2  1  
ATOM 2623  H HB3  . TRP A 1 170 ? -4.593  -14.523 -10.189 1.00 1.86  ? 170 TRP A HB3  1  
ATOM 2624  H HD1  . TRP A 1 170 ? -4.838  -16.989 -12.945 1.00 2.68  ? 170 TRP A HD1  1  
ATOM 2625  H HE1  . TRP A 1 170 ? -2.765  -16.838 -14.471 1.00 3.72  ? 170 TRP A HE1  1  
ATOM 2626  H HE3  . TRP A 1 170 ? -1.821  -14.060 -10.048 1.00 3.40  ? 170 TRP A HE3  1  
ATOM 2627  H HZ2  . TRP A 1 170 ? -0.169  -15.634 -14.463 1.00 4.68  ? 170 TRP A HZ2  1  
ATOM 2628  H HZ3  . TRP A 1 170 ? 0.443   -13.427 -10.829 1.00 5.15  ? 170 TRP A HZ3  1  
ATOM 2629  H HH2  . TRP A 1 170 ? 1.272   -14.209 -13.031 1.00 5.49  ? 170 TRP A HH2  1  
ATOM 2630  N N    . GLN A 1 171 ? -5.743  -17.464 -7.857  1.00 0.88  ? 171 GLN A N    1  
ATOM 2631  C CA   . GLN A 1 171 ? -6.779  -17.471 -6.782  1.00 0.84  ? 171 GLN A CA   1  
ATOM 2632  C C    . GLN A 1 171 ? -6.121  -17.572 -5.400  1.00 0.75  ? 171 GLN A C    1  
ATOM 2633  O O    . GLN A 1 171 ? -6.772  -17.401 -4.388  1.00 0.75  ? 171 GLN A O    1  
ATOM 2634  C CB   . GLN A 1 171 ? -7.713  -18.668 -6.987  1.00 0.88  ? 171 GLN A CB   1  
ATOM 2635  C CG   . GLN A 1 171 ? -6.893  -19.959 -7.045  1.00 1.57  ? 171 GLN A CG   1  
ATOM 2636  C CD   . GLN A 1 171 ? -7.828  -21.148 -7.279  1.00 1.93  ? 171 GLN A CD   1  
ATOM 2637  O OE1  . GLN A 1 171 ? -7.544  -22.009 -8.087  1.00 2.66  ? 171 GLN A OE1  1  
ATOM 2638  N NE2  . GLN A 1 171 ? -8.939  -21.231 -6.600  1.00 2.34  ? 171 GLN A NE2  1  
ATOM 2639  H H    . GLN A 1 171 ? -5.528  -18.292 -8.335  1.00 0.92  ? 171 GLN A H    1  
ATOM 2640  H HA   . GLN A 1 171 ? -7.357  -16.560 -6.836  1.00 0.90  ? 171 GLN A HA   1  
ATOM 2641  H HB2  . GLN A 1 171 ? -8.413  -18.722 -6.166  1.00 1.24  ? 171 GLN A HB2  1  
ATOM 2642  H HB3  . GLN A 1 171 ? -8.255  -18.547 -7.913  1.00 1.30  ? 171 GLN A HB3  1  
ATOM 2643  H HG2  . GLN A 1 171 ? -6.180  -19.897 -7.854  1.00 2.31  ? 171 GLN A HG2  1  
ATOM 2644  H HG3  . GLN A 1 171 ? -6.368  -20.095 -6.111  1.00 2.11  ? 171 GLN A HG3  1  
ATOM 2645  H HE21 . GLN A 1 171 ? -9.169  -20.536 -5.948  1.00 2.50  ? 171 GLN A HE21 1  
ATOM 2646  H HE22 . GLN A 1 171 ? -9.545  -21.988 -6.743  1.00 2.93  ? 171 GLN A HE22 1  
ATOM 2647  N N    . THR A 1 172 ? -4.843  -17.845 -5.335  1.00 0.67  ? 172 THR A N    1  
ATOM 2648  C CA   . THR A 1 172 ? -4.172  -17.949 -3.997  1.00 0.60  ? 172 THR A CA   1  
ATOM 2649  C C    . THR A 1 172 ? -3.635  -16.579 -3.593  1.00 0.59  ? 172 THR A C    1  
ATOM 2650  O O    . THR A 1 172 ? -3.443  -16.307 -2.426  1.00 0.74  ? 172 THR A O    1  
ATOM 2651  C CB   . THR A 1 172 ? -3.019  -18.962 -4.049  1.00 0.59  ? 172 THR A CB   1  
ATOM 2652  O OG1  . THR A 1 172 ? -2.264  -18.870 -2.850  1.00 0.81  ? 172 THR A OG1  1  
ATOM 2653  C CG2  . THR A 1 172 ? -2.105  -18.688 -5.246  1.00 0.92  ? 172 THR A CG2  1  
ATOM 2654  H H    . THR A 1 172 ? -4.329  -17.978 -6.156  1.00 0.67  ? 172 THR A H    1  
ATOM 2655  H HA   . THR A 1 172 ? -4.893  -18.275 -3.259  1.00 0.60  ? 172 THR A HA   1  
ATOM 2656  H HB   . THR A 1 172 ? -3.426  -19.958 -4.137  1.00 0.71  ? 172 THR A HB   1  
ATOM 2657  H HG1  . THR A 1 172 ? -1.514  -18.294 -3.015  1.00 1.37  ? 172 THR A HG1  1  
ATOM 2658  H HG21 . THR A 1 172 ? -1.546  -17.780 -5.069  1.00 1.44  ? 172 THR A HG21 1  
ATOM 2659  H HG22 . THR A 1 172 ? -2.696  -18.579 -6.141  1.00 1.31  ? 172 THR A HG22 1  
ATOM 2660  H HG23 . THR A 1 172 ? -1.418  -19.512 -5.368  1.00 1.56  ? 172 THR A HG23 1  
ATOM 2661  N N    . VAL A 1 173 ? -3.430  -15.696 -4.528  1.00 0.59  ? 173 VAL A N    1  
ATOM 2662  C CA   . VAL A 1 173 ? -2.944  -14.333 -4.168  1.00 0.58  ? 173 VAL A CA   1  
ATOM 2663  C C    . VAL A 1 173 ? -4.168  -13.450 -3.903  1.00 0.57  ? 173 VAL A C    1  
ATOM 2664  O O    . VAL A 1 173 ? -4.137  -12.569 -3.064  1.00 0.60  ? 173 VAL A O    1  
ATOM 2665  C CB   . VAL A 1 173 ? -2.112  -13.758 -5.325  1.00 0.64  ? 173 VAL A CB   1  
ATOM 2666  C CG1  . VAL A 1 173 ? -0.675  -14.279 -5.240  1.00 1.13  ? 173 VAL A CG1  1  
ATOM 2667  C CG2  . VAL A 1 173 ? -2.722  -14.185 -6.660  1.00 1.01  ? 173 VAL A CG2  1  
ATOM 2668  H H    . VAL A 1 173 ? -3.631  -15.904 -5.464  1.00 0.73  ? 173 VAL A H    1  
ATOM 2669  H HA   . VAL A 1 173 ? -2.344  -14.370 -3.269  1.00 0.56  ? 173 VAL A HA   1  
ATOM 2670  H HB   . VAL A 1 173 ? -2.105  -12.684 -5.262  1.00 0.89  ? 173 VAL A HB   1  
ATOM 2671  H HG11 . VAL A 1 173 ? -0.213  -13.917 -4.333  1.00 1.56  ? 173 VAL A HG11 1  
ATOM 2672  H HG12 . VAL A 1 173 ? -0.114  -13.929 -6.094  1.00 1.64  ? 173 VAL A HG12 1  
ATOM 2673  H HG13 . VAL A 1 173 ? -0.683  -15.359 -5.233  1.00 1.50  ? 173 VAL A HG13 1  
ATOM 2674  H HG21 . VAL A 1 173 ? -2.216  -13.672 -7.466  1.00 1.60  ? 173 VAL A HG21 1  
ATOM 2675  H HG22 . VAL A 1 173 ? -3.768  -13.928 -6.673  1.00 1.51  ? 173 VAL A HG22 1  
ATOM 2676  H HG23 . VAL A 1 173 ? -2.609  -15.251 -6.785  1.00 1.54  ? 173 VAL A HG23 1  
ATOM 2677  N N    . THR A 1 174 ? -5.254  -13.695 -4.584  1.00 0.55  ? 174 THR A N    1  
ATOM 2678  C CA   . THR A 1 174 ? -6.480  -12.884 -4.336  1.00 0.56  ? 174 THR A CA   1  
ATOM 2679  C C    . THR A 1 174 ? -7.077  -13.301 -2.987  1.00 0.53  ? 174 THR A C    1  
ATOM 2680  O O    . THR A 1 174 ? -7.605  -12.486 -2.255  1.00 0.55  ? 174 THR A O    1  
ATOM 2681  C CB   . THR A 1 174 ? -7.501  -13.150 -5.446  1.00 0.59  ? 174 THR A CB   1  
ATOM 2682  O OG1  . THR A 1 174 ? -7.784  -14.542 -5.499  1.00 1.37  ? 174 THR A OG1  1  
ATOM 2683  C CG2  . THR A 1 174 ? -6.934  -12.694 -6.792  1.00 1.27  ? 174 THR A CG2  1  
ATOM 2684  H H    . THR A 1 174 ? -5.271  -14.422 -5.243  1.00 0.55  ? 174 THR A H    1  
ATOM 2685  H HA   . THR A 1 174 ? -6.226  -11.834 -4.315  1.00 0.59  ? 174 THR A HA   1  
ATOM 2686  H HB   . THR A 1 174 ? -8.409  -12.606 -5.240  1.00 1.03  ? 174 THR A HB   1  
ATOM 2687  H HG1  . THR A 1 174 ? -6.949  -15.014 -5.535  1.00 1.79  ? 174 THR A HG1  1  
ATOM 2688  H HG21 . THR A 1 174 ? -7.575  -13.042 -7.589  1.00 1.81  ? 174 THR A HG21 1  
ATOM 2689  H HG22 . THR A 1 174 ? -5.944  -13.104 -6.923  1.00 1.83  ? 174 THR A HG22 1  
ATOM 2690  H HG23 . THR A 1 174 ? -6.884  -11.616 -6.815  1.00 1.84  ? 174 THR A HG23 1  
ATOM 2691  N N    . ILE A 1 175 ? -7.003  -14.560 -2.651  1.00 0.51  ? 175 ILE A N    1  
ATOM 2692  C CA   . ILE A 1 175 ? -7.570  -15.024 -1.350  1.00 0.50  ? 175 ILE A CA   1  
ATOM 2693  C C    . ILE A 1 175 ? -6.592  -14.693 -0.214  1.00 0.49  ? 175 ILE A C    1  
ATOM 2694  O O    . ILE A 1 175 ? -6.975  -14.617 0.937   1.00 0.49  ? 175 ILE A O    1  
ATOM 2695  C CB   . ILE A 1 175 ? -7.801  -16.538 -1.420  1.00 0.52  ? 175 ILE A CB   1  
ATOM 2696  C CG1  . ILE A 1 175 ? -8.960  -16.824 -2.380  1.00 0.77  ? 175 ILE A CG1  1  
ATOM 2697  C CG2  . ILE A 1 175 ? -8.139  -17.093 -0.030  1.00 0.87  ? 175 ILE A CG2  1  
ATOM 2698  C CD1  . ILE A 1 175 ? -9.054  -18.328 -2.648  1.00 0.89  ? 175 ILE A CD1  1  
ATOM 2699  H H    . ILE A 1 175 ? -6.579  -15.203 -3.257  1.00 0.51  ? 175 ILE A H    1  
ATOM 2700  H HA   . ILE A 1 175 ? -8.512  -14.525 -1.175  1.00 0.51  ? 175 ILE A HA   1  
ATOM 2701  H HB   . ILE A 1 175 ? -6.905  -17.018 -1.786  1.00 0.69  ? 175 ILE A HB   1  
ATOM 2702  H HG12 . ILE A 1 175 ? -9.884  -16.478 -1.941  1.00 1.10  ? 175 ILE A HG12 1  
ATOM 2703  H HG13 . ILE A 1 175 ? -8.789  -16.306 -3.312  1.00 1.20  ? 175 ILE A HG13 1  
ATOM 2704  H HG21 . ILE A 1 175 ? -7.253  -17.085 0.587   1.00 1.33  ? 175 ILE A HG21 1  
ATOM 2705  H HG22 . ILE A 1 175 ? -8.502  -18.106 -0.121  1.00 1.36  ? 175 ILE A HG22 1  
ATOM 2706  H HG23 . ILE A 1 175 ? -8.901  -16.478 0.427   1.00 1.53  ? 175 ILE A HG23 1  
ATOM 2707  H HD11 . ILE A 1 175 ? -8.082  -18.708 -2.923  1.00 1.52  ? 175 ILE A HD11 1  
ATOM 2708  H HD12 . ILE A 1 175 ? -9.752  -18.507 -3.453  1.00 1.28  ? 175 ILE A HD12 1  
ATOM 2709  H HD13 . ILE A 1 175 ? -9.398  -18.832 -1.756  1.00 1.40  ? 175 ILE A HD13 1  
ATOM 2710  N N    . PHE A 1 176 ? -5.344  -14.465 -0.523  1.00 0.48  ? 176 PHE A N    1  
ATOM 2711  C CA   . PHE A 1 176 ? -4.369  -14.103 0.548   1.00 0.49  ? 176 PHE A CA   1  
ATOM 2712  C C    . PHE A 1 176 ? -4.744  -12.719 1.097   1.00 0.49  ? 176 PHE A C    1  
ATOM 2713  O O    . PHE A 1 176 ? -5.130  -12.574 2.240   1.00 0.56  ? 176 PHE A O    1  
ATOM 2714  C CB   . PHE A 1 176 ? -2.948  -14.052 -0.068  1.00 0.51  ? 176 PHE A CB   1  
ATOM 2715  C CG   . PHE A 1 176 ? -1.968  -14.795 0.822   1.00 0.51  ? 176 PHE A CG   1  
ATOM 2716  C CD1  . PHE A 1 176 ? -1.709  -14.325 2.115   1.00 1.41  ? 176 PHE A CD1  1  
ATOM 2717  C CD2  . PHE A 1 176 ? -1.331  -15.954 0.359   1.00 1.23  ? 176 PHE A CD2  1  
ATOM 2718  C CE1  . PHE A 1 176 ? -0.815  -15.011 2.944   1.00 1.52  ? 176 PHE A CE1  1  
ATOM 2719  C CE2  . PHE A 1 176 ? -0.438  -16.641 1.188   1.00 1.22  ? 176 PHE A CE2  1  
ATOM 2720  C CZ   . PHE A 1 176 ? -0.179  -16.169 2.481   1.00 0.76  ? 176 PHE A CZ   1  
ATOM 2721  H H    . PHE A 1 176 ? -5.051  -14.506 -1.460  1.00 0.49  ? 176 PHE A H    1  
ATOM 2722  H HA   . PHE A 1 176 ? -4.388  -14.849 1.333   1.00 0.49  ? 176 PHE A HA   1  
ATOM 2723  H HB2  . PHE A 1 176 ? -2.970  -14.515 -1.038  1.00 0.60  ? 176 PHE A HB2  1  
ATOM 2724  H HB3  . PHE A 1 176 ? -2.620  -13.026 -0.177  1.00 0.54  ? 176 PHE A HB3  1  
ATOM 2725  H HD1  . PHE A 1 176 ? -2.200  -13.432 2.472   1.00 2.26  ? 176 PHE A HD1  1  
ATOM 2726  H HD2  . PHE A 1 176 ? -1.530  -16.318 -0.639  1.00 2.12  ? 176 PHE A HD2  1  
ATOM 2727  H HE1  . PHE A 1 176 ? -0.616  -14.647 3.941   1.00 2.43  ? 176 PHE A HE1  1  
ATOM 2728  H HE2  . PHE A 1 176 ? 0.052   -17.535 0.829   1.00 2.05  ? 176 PHE A HE2  1  
ATOM 2729  H HZ   . PHE A 1 176 ? 0.511   -16.699 3.121   1.00 0.89  ? 176 PHE A HZ   1  
ATOM 2730  N N    . VAL A 1 177 ? -4.600  -11.702 0.293   1.00 0.46  ? 177 VAL A N    1  
ATOM 2731  C CA   . VAL A 1 177 ? -4.912  -10.321 0.763   1.00 0.48  ? 177 VAL A CA   1  
ATOM 2732  C C    . VAL A 1 177 ? -6.352  -10.252 1.282   1.00 0.44  ? 177 VAL A C    1  
ATOM 2733  O O    . VAL A 1 177 ? -6.619  -9.639  2.296   1.00 0.57  ? 177 VAL A O    1  
ATOM 2734  C CB   . VAL A 1 177 ? -4.740  -9.336  -0.402  1.00 0.56  ? 177 VAL A CB   1  
ATOM 2735  C CG1  . VAL A 1 177 ? -3.378  -9.551  -1.067  1.00 1.20  ? 177 VAL A CG1  1  
ATOM 2736  C CG2  . VAL A 1 177 ? -5.848  -9.559  -1.436  1.00 1.24  ? 177 VAL A CG2  1  
ATOM 2737  H H    . VAL A 1 177 ? -4.267  -11.844 -0.619  1.00 0.46  ? 177 VAL A H    1  
ATOM 2738  H HA   . VAL A 1 177 ? -4.232  -10.053 1.558   1.00 0.50  ? 177 VAL A HA   1  
ATOM 2739  H HB   . VAL A 1 177 ? -4.798  -8.324  -0.026  1.00 1.10  ? 177 VAL A HB   1  
ATOM 2740  H HG11 . VAL A 1 177 ? -3.303  -10.570 -1.419  1.00 1.82  ? 177 VAL A HG11 1  
ATOM 2741  H HG12 . VAL A 1 177 ? -2.594  -9.359  -0.352  1.00 1.81  ? 177 VAL A HG12 1  
ATOM 2742  H HG13 . VAL A 1 177 ? -3.275  -8.875  -1.903  1.00 1.63  ? 177 VAL A HG13 1  
ATOM 2743  H HG21 . VAL A 1 177 ? -6.777  -9.164  -1.053  1.00 1.77  ? 177 VAL A HG21 1  
ATOM 2744  H HG22 . VAL A 1 177 ? -5.957  -10.618 -1.625  1.00 1.78  ? 177 VAL A HG22 1  
ATOM 2745  H HG23 . VAL A 1 177 ? -5.593  -9.053  -2.355  1.00 1.80  ? 177 VAL A HG23 1  
ATOM 2746  N N    . ALA A 1 178 ? -7.280  -10.867 0.609   1.00 0.45  ? 178 ALA A N    1  
ATOM 2747  C CA   . ALA A 1 178 ? -8.690  -10.816 1.089   1.00 0.43  ? 178 ALA A CA   1  
ATOM 2748  C C    . ALA A 1 178 ? -8.796  -11.507 2.451   1.00 0.40  ? 178 ALA A C    1  
ATOM 2749  O O    . ALA A 1 178 ? -9.361  -10.976 3.385   1.00 0.40  ? 178 ALA A O    1  
ATOM 2750  C CB   . ALA A 1 178 ? -9.603  -11.521 0.086   1.00 0.46  ? 178 ALA A CB   1  
ATOM 2751  H H    . ALA A 1 178 ? -7.054  -11.359 -0.208  1.00 0.59  ? 178 ALA A H    1  
ATOM 2752  H HA   . ALA A 1 178 ? -8.993  -9.785  1.194   1.00 0.44  ? 178 ALA A HA   1  
ATOM 2753  H HB1  . ALA A 1 178 ? -10.626 -11.461 0.428   1.00 0.98  ? 178 ALA A HB1  1  
ATOM 2754  H HB2  . ALA A 1 178 ? -9.312  -12.557 0.000   1.00 1.10  ? 178 ALA A HB2  1  
ATOM 2755  H HB3  . ALA A 1 178 ? -9.517  -11.041 -0.877  1.00 1.22  ? 178 ALA A HB3  1  
ATOM 2756  N N    . GLY A 1 179 ? -8.259  -12.688 2.571   1.00 0.41  ? 179 GLY A N    1  
ATOM 2757  C CA   . GLY A 1 179 ? -8.334  -13.410 3.871   1.00 0.43  ? 179 GLY A CA   1  
ATOM 2758  C C    . GLY A 1 179 ? -7.612  -12.605 4.953   1.00 0.43  ? 179 GLY A C    1  
ATOM 2759  O O    . GLY A 1 179 ? -8.026  -12.571 6.096   1.00 0.48  ? 179 GLY A O    1  
ATOM 2760  H H    . GLY A 1 179 ? -7.807  -13.102 1.806   1.00 0.42  ? 179 GLY A H    1  
ATOM 2761  H HA2  . GLY A 1 179 ? -9.370  -13.541 4.150   1.00 0.45  ? 179 GLY A HA2  1  
ATOM 2762  H HA3  . GLY A 1 179 ? -7.863  -14.377 3.774   1.00 0.46  ? 179 GLY A HA3  1  
ATOM 2763  N N    . VAL A 1 180 ? -6.527  -11.967 4.607   1.00 0.42  ? 180 VAL A N    1  
ATOM 2764  C CA   . VAL A 1 180 ? -5.772  -11.184 5.622   1.00 0.45  ? 180 VAL A CA   1  
ATOM 2765  C C    . VAL A 1 180 ? -6.414  -9.814  5.841   1.00 0.45  ? 180 VAL A C    1  
ATOM 2766  O O    . VAL A 1 180 ? -6.588  -9.359  6.955   1.00 0.43  ? 180 VAL A O    1  
ATOM 2767  C CB   . VAL A 1 180 ? -4.325  -10.993 5.153   1.00 0.49  ? 180 VAL A CB   1  
ATOM 2768  C CG1  . VAL A 1 180 ? -3.573  -10.095 6.142   1.00 1.31  ? 180 VAL A CG1  1  
ATOM 2769  C CG2  . VAL A 1 180 ? -3.629  -12.354 5.077   1.00 1.41  ? 180 VAL A CG2  1  
ATOM 2770  H H    . VAL A 1 180 ? -6.201  -12.013 3.684   1.00 0.42  ? 180 VAL A H    1  
ATOM 2771  H HA   . VAL A 1 180 ? -5.771  -11.720 6.561   1.00 0.46  ? 180 VAL A HA   1  
ATOM 2772  H HB   . VAL A 1 180 ? -4.323  -10.531 4.177   1.00 1.21  ? 180 VAL A HB   1  
ATOM 2773  H HG11 . VAL A 1 180 ? -3.758  -10.435 7.151   1.00 1.78  ? 180 VAL A HG11 1  
ATOM 2774  H HG12 . VAL A 1 180 ? -3.915  -9.075  6.038   1.00 1.94  ? 180 VAL A HG12 1  
ATOM 2775  H HG13 . VAL A 1 180 ? -2.514  -10.142 5.936   1.00 1.95  ? 180 VAL A HG13 1  
ATOM 2776  H HG21 . VAL A 1 180 ? -2.639  -12.230 4.663   1.00 1.89  ? 180 VAL A HG21 1  
ATOM 2777  H HG22 . VAL A 1 180 ? -4.203  -13.016 4.445   1.00 2.13  ? 180 VAL A HG22 1  
ATOM 2778  H HG23 . VAL A 1 180 ? -3.554  -12.777 6.068   1.00 1.85  ? 180 VAL A HG23 1  
ATOM 2779  N N    . LEU A 1 181 ? -6.740  -9.142  4.765   1.00 0.49  ? 181 LEU A N    1  
ATOM 2780  C CA   . LEU A 1 181 ? -7.342  -7.785  4.874   1.00 0.50  ? 181 LEU A CA   1  
ATOM 2781  C C    . LEU A 1 181 ? -8.679  -7.873  5.614   1.00 0.49  ? 181 LEU A C    1  
ATOM 2782  O O    . LEU A 1 181 ? -8.999  -7.067  6.465   1.00 0.51  ? 181 LEU A O    1  
ATOM 2783  C CB   . LEU A 1 181 ? -7.555  -7.240  3.449   1.00 0.56  ? 181 LEU A CB   1  
ATOM 2784  C CG   . LEU A 1 181 ? -8.264  -5.867  3.457   1.00 0.64  ? 181 LEU A CG   1  
ATOM 2785  C CD1  . LEU A 1 181 ? -9.775  -6.008  3.763   1.00 1.60  ? 181 LEU A CD1  1  
ATOM 2786  C CD2  . LEU A 1 181 ? -7.600  -4.945  4.490   1.00 1.20  ? 181 LEU A CD2  1  
ATOM 2787  H H    . LEU A 1 181 ? -6.561  -9.518  3.878   1.00 0.51  ? 181 LEU A H    1  
ATOM 2788  H HA   . LEU A 1 181 ? -6.626  -7.170  5.394   1.00 0.50  ? 181 LEU A HA   1  
ATOM 2789  H HB2  . LEU A 1 181 ? -6.592  -7.131  2.973   1.00 1.01  ? 181 LEU A HB2  1  
ATOM 2790  H HB3  . LEU A 1 181 ? -8.144  -7.946  2.884   1.00 0.95  ? 181 LEU A HB3  1  
ATOM 2791  H HG   . LEU A 1 181 ? -8.156  -5.424  2.478   1.00 1.52  ? 181 LEU A HG   1  
ATOM 2792  H HD11 . LEU A 1 181 ? -10.327 -5.331  3.128   1.00 2.12  ? 181 LEU A HD11 1  
ATOM 2793  H HD12 . LEU A 1 181 ? -9.971  -5.762  4.796   1.00 2.16  ? 181 LEU A HD12 1  
ATOM 2794  H HD13 . LEU A 1 181 ? -10.105 -7.018  3.571   1.00 2.17  ? 181 LEU A HD13 1  
ATOM 2795  H HD21 . LEU A 1 181 ? -7.883  -3.922  4.291   1.00 1.66  ? 181 LEU A HD21 1  
ATOM 2796  H HD22 . LEU A 1 181 ? -6.527  -5.040  4.422   1.00 1.87  ? 181 LEU A HD22 1  
ATOM 2797  H HD23 . LEU A 1 181 ? -7.925  -5.220  5.482   1.00 1.79  ? 181 LEU A HD23 1  
ATOM 2798  N N    . THR A 1 182 ? -9.461  -8.868  5.279   1.00 0.49  ? 182 THR A N    1  
ATOM 2799  C CA   . THR A 1 182 ? -10.790 -9.042  5.930   1.00 0.51  ? 182 THR A CA   1  
ATOM 2800  C C    . THR A 1 182 ? -10.599 -9.326  7.418   1.00 0.48  ? 182 THR A C    1  
ATOM 2801  O O    . THR A 1 182 ? -11.367 -8.882  8.248   1.00 0.51  ? 182 THR A O    1  
ATOM 2802  C CB   . THR A 1 182 ? -11.535 -10.211 5.275   1.00 0.54  ? 182 THR A CB   1  
ATOM 2803  O OG1  . THR A 1 182 ? -11.489 -10.067 3.862   1.00 1.16  ? 182 THR A OG1  1  
ATOM 2804  C CG2  . THR A 1 182 ? -12.993 -10.215 5.737   1.00 1.07  ? 182 THR A CG2  1  
ATOM 2805  H H    . THR A 1 182 ? -9.155  -9.505  4.600   1.00 0.49  ? 182 THR A H    1  
ATOM 2806  H HA   . THR A 1 182 ? -11.369 -8.139  5.810   1.00 0.56  ? 182 THR A HA   1  
ATOM 2807  H HB   . THR A 1 182 ? -11.069 -11.142 5.558   1.00 1.04  ? 182 THR A HB   1  
ATOM 2808  H HG1  . THR A 1 182 ? -12.085 -10.714 3.477   1.00 1.69  ? 182 THR A HG1  1  
ATOM 2809  H HG21 . THR A 1 182 ? -13.496 -9.341  5.351   1.00 1.49  ? 182 THR A HG21 1  
ATOM 2810  H HG22 . THR A 1 182 ? -13.029 -10.205 6.816   1.00 1.80  ? 182 THR A HG22 1  
ATOM 2811  H HG23 . THR A 1 182 ? -13.485 -11.104 5.369   1.00 1.62  ? 182 THR A HG23 1  
ATOM 2812  N N    . ALA A 1 183 ? -9.586  -10.072 7.764   1.00 0.45  ? 183 ALA A N    1  
ATOM 2813  C CA   . ALA A 1 183 ? -9.361  -10.388 9.200   1.00 0.44  ? 183 ALA A CA   1  
ATOM 2814  C C    . ALA A 1 183 ? -9.334  -9.086  10.006  1.00 0.44  ? 183 ALA A C    1  
ATOM 2815  O O    . ALA A 1 183 ? -10.016 -8.939  11.001  1.00 0.50  ? 183 ALA A O    1  
ATOM 2816  C CB   . ALA A 1 183 ? -8.024  -11.115 9.357   1.00 0.46  ? 183 ALA A CB   1  
ATOM 2817  H H    . ALA A 1 183 ? -8.982  -10.432 7.080   1.00 0.44  ? 183 ALA A H    1  
ATOM 2818  H HA   . ALA A 1 183 ? -10.162 -11.032 9.534   1.00 0.45  ? 183 ALA A HA   1  
ATOM 2819  H HB1  . ALA A 1 183 ? -7.222  -10.466 9.038   1.00 1.08  ? 183 ALA A HB1  1  
ATOM 2820  H HB2  . ALA A 1 183 ? -8.027  -12.008 8.751   1.00 1.22  ? 183 ALA A HB2  1  
ATOM 2821  H HB3  . ALA A 1 183 ? -7.879  -11.384 10.393  1.00 1.06  ? 183 ALA A HB3  1  
ATOM 2822  N N    . SER A 1 184 ? -8.544  -8.139  9.572   1.00 0.47  ? 184 SER A N    1  
ATOM 2823  C CA   . SER A 1 184 ? -8.458  -6.836  10.295  1.00 0.51  ? 184 SER A CA   1  
ATOM 2824  C C    . SER A 1 184 ? -9.856  -6.228  10.428  1.00 0.54  ? 184 SER A C    1  
ATOM 2825  O O    . SER A 1 184 ? -10.225 -5.710  11.463  1.00 0.56  ? 184 SER A O    1  
ATOM 2826  C CB   . SER A 1 184 ? -7.560  -5.877  9.512   1.00 0.62  ? 184 SER A CB   1  
ATOM 2827  O OG   . SER A 1 184 ? -6.287  -6.479  9.319   1.00 1.55  ? 184 SER A OG   1  
ATOM 2828  H H    . SER A 1 184 ? -8.007  -8.287  8.763   1.00 0.51  ? 184 SER A H    1  
ATOM 2829  H HA   . SER A 1 184 ? -8.044  -6.990  11.280  1.00 0.48  ? 184 SER A HA   1  
ATOM 2830  H HB2  . SER A 1 184 ? -8.003  -5.668  8.553   1.00 1.12  ? 184 SER A HB2  1  
ATOM 2831  H HB3  . SER A 1 184 ? -7.453  -4.954  10.067  1.00 1.19  ? 184 SER A HB3  1  
ATOM 2832  H HG   . SER A 1 184 ? -6.261  -6.838  8.429   1.00 1.98  ? 184 SER A HG   1  
ATOM 2833  N N    . LEU A 1 185 ? -10.638 -6.300  9.387   1.00 0.58  ? 185 LEU A N    1  
ATOM 2834  C CA   . LEU A 1 185 ? -12.018 -5.745  9.436   1.00 0.69  ? 185 LEU A CA   1  
ATOM 2835  C C    . LEU A 1 185 ? -12.891 -6.619  10.333  1.00 0.69  ? 185 LEU A C    1  
ATOM 2836  O O    . LEU A 1 185 ? -13.821 -6.161  10.966  1.00 0.79  ? 185 LEU A O    1  
ATOM 2837  C CB   . LEU A 1 185 ? -12.612 -5.763  8.026   1.00 0.71  ? 185 LEU A CB   1  
ATOM 2838  C CG   . LEU A 1 185 ? -11.739 -4.936  7.072   1.00 0.79  ? 185 LEU A CG   1  
ATOM 2839  C CD1  . LEU A 1 185 ? -12.333 -5.011  5.662   1.00 1.62  ? 185 LEU A CD1  1  
ATOM 2840  C CD2  . LEU A 1 185 ? -11.672 -3.472  7.549   1.00 1.18  ? 185 LEU A CD2  1  
ATOM 2841  H H    . LEU A 1 185 ? -10.324 -6.738  8.567   1.00 0.58  ? 185 LEU A H    1  
ATOM 2842  H HA   . LEU A 1 185 ? -12.011 -4.723  9.783   1.00 0.77  ? 185 LEU A HA   1  
ATOM 2843  H HB2  . LEU A 1 185 ? -12.668 -6.781  7.672   1.00 1.28  ? 185 LEU A HB2  1  
ATOM 2844  H HB3  . LEU A 1 185 ? -13.601 -5.337  8.059   1.00 1.05  ? 185 LEU A HB3  1  
ATOM 2845  H HG   . LEU A 1 185 ? -10.741 -5.353  7.056   1.00 1.57  ? 185 LEU A HG   1  
ATOM 2846  H HD11 . LEU A 1 185 ? -11.803 -4.332  5.010   1.00 1.91  ? 185 LEU A HD11 1  
ATOM 2847  H HD12 . LEU A 1 185 ? -13.376 -4.733  5.697   1.00 2.16  ? 185 LEU A HD12 1  
ATOM 2848  H HD13 . LEU A 1 185 ? -12.243 -6.019  5.285   1.00 2.28  ? 185 LEU A HD13 1  
ATOM 2849  H HD21 . LEU A 1 185 ? -10.879 -3.367  8.275   1.00 1.69  ? 185 LEU A HD21 1  
ATOM 2850  H HD22 . LEU A 1 185 ? -12.612 -3.190  8.002   1.00 1.76  ? 185 LEU A HD22 1  
ATOM 2851  H HD23 . LEU A 1 185 ? -11.472 -2.822  6.708   1.00 1.75  ? 185 LEU A HD23 1  
ATOM 2852  N N    . THR A 1 186 ? -12.591 -7.888  10.374  1.00 0.62  ? 186 THR A N    1  
ATOM 2853  C CA   . THR A 1 186 ? -13.381 -8.834  11.206  1.00 0.68  ? 186 THR A CA   1  
ATOM 2854  C C    . THR A 1 186 ? -13.292 -8.447  12.681  1.00 0.62  ? 186 THR A C    1  
ATOM 2855  O O    . THR A 1 186 ? -14.281 -8.430  13.387  1.00 0.64  ? 186 THR A O    1  
ATOM 2856  C CB   . THR A 1 186 ? -12.808 -10.243 11.034  1.00 0.73  ? 186 THR A CB   1  
ATOM 2857  O OG1  . THR A 1 186 ? -12.616 -10.510 9.652   1.00 0.89  ? 186 THR A OG1  1  
ATOM 2858  C CG2  . THR A 1 186 ? -13.785 -11.264 11.621  1.00 1.00  ? 186 THR A CG2  1  
ATOM 2859  H H    . THR A 1 186 ? -11.834 -8.222  9.848   1.00 0.55  ? 186 THR A H    1  
ATOM 2860  H HA   . THR A 1 186 ? -14.413 -8.841  10.886  1.00 0.89  ? 186 THR A HA   1  
ATOM 2861  H HB   . THR A 1 186 ? -11.864 -10.316 11.550  1.00 0.76  ? 186 THR A HB   1  
ATOM 2862  H HG1  . THR A 1 186 ? -13.150 -9.887  9.153   1.00 1.30  ? 186 THR A HG1  1  
ATOM 2863  H HG21 . THR A 1 186 ? -14.740 -11.173 11.125  1.00 1.38  ? 186 THR A HG21 1  
ATOM 2864  H HG22 . THR A 1 186 ? -13.908 -11.077 12.678  1.00 1.41  ? 186 THR A HG22 1  
ATOM 2865  H HG23 . THR A 1 186 ? -13.396 -12.261 11.475  1.00 1.61  ? 186 THR A HG23 1  
ATOM 2866  N N    . ILE A 1 187 ? -12.115 -8.140  13.156  1.00 0.64  ? 187 ILE A N    1  
ATOM 2867  C CA   . ILE A 1 187 ? -11.964 -7.760  14.590  1.00 0.66  ? 187 ILE A CA   1  
ATOM 2868  C C    . ILE A 1 187 ? -12.246 -6.263  14.764  1.00 0.66  ? 187 ILE A C    1  
ATOM 2869  O O    . ILE A 1 187 ? -12.871 -5.857  15.724  1.00 0.75  ? 187 ILE A O    1  
ATOM 2870  C CB   . ILE A 1 187 ? -10.537 -8.095  15.051  1.00 0.72  ? 187 ILE A CB   1  
ATOM 2871  C CG1  . ILE A 1 187 ? -9.508  -7.351  14.186  1.00 0.88  ? 187 ILE A CG1  1  
ATOM 2872  C CG2  . ILE A 1 187 ? -10.318 -9.603  14.907  1.00 1.57  ? 187 ILE A CG2  1  
ATOM 2873  C CD1  . ILE A 1 187 ? -8.093  -7.793  14.570  1.00 0.87  ? 187 ILE A CD1  1  
ATOM 2874  H H    . ILE A 1 187 ? -11.326 -8.160  12.575  1.00 0.69  ? 187 ILE A H    1  
ATOM 2875  H HA   . ILE A 1 187 ? -12.666 -8.329  15.185  1.00 0.71  ? 187 ILE A HA   1  
ATOM 2876  H HB   . ILE A 1 187 ? -10.417 -7.811  16.087  1.00 1.19  ? 187 ILE A HB   1  
ATOM 2877  H HG12 . ILE A 1 187 ? -9.685  -7.573  13.144  1.00 1.44  ? 187 ILE A HG12 1  
ATOM 2878  H HG13 . ILE A 1 187 ? -9.599  -6.290  14.349  1.00 1.37  ? 187 ILE A HG13 1  
ATOM 2879  H HG21 . ILE A 1 187 ? -9.402  -9.885  15.405  1.00 2.03  ? 187 ILE A HG21 1  
ATOM 2880  H HG22 . ILE A 1 187 ? -10.252 -9.859  13.860  1.00 2.23  ? 187 ILE A HG22 1  
ATOM 2881  H HG23 . ILE A 1 187 ? -11.147 -10.130 15.355  1.00 1.91  ? 187 ILE A HG23 1  
ATOM 2882  H HD11 . ILE A 1 187 ? -7.374  -7.138  14.100  1.00 1.36  ? 187 ILE A HD11 1  
ATOM 2883  H HD12 . ILE A 1 187 ? -7.927  -8.806  14.237  1.00 1.37  ? 187 ILE A HD12 1  
ATOM 2884  H HD13 . ILE A 1 187 ? -7.979  -7.742  15.642  1.00 1.21  ? 187 ILE A HD13 1  
ATOM 2885  N N    . TRP A 1 188 ? -11.722 -5.439  13.890  1.00 0.64  ? 188 TRP A N    1  
ATOM 2886  C CA   . TRP A 1 188 ? -11.886 -3.957  14.029  1.00 0.70  ? 188 TRP A CA   1  
ATOM 2887  C C    . TRP A 1 188 ? -13.298 -3.591  14.501  1.00 0.81  ? 188 TRP A C    1  
ATOM 2888  O O    . TRP A 1 188 ? -13.535 -2.492  14.961  1.00 1.06  ? 188 TRP A O    1  
ATOM 2889  C CB   . TRP A 1 188 ? -11.625 -3.298  12.671  1.00 0.85  ? 188 TRP A CB   1  
ATOM 2890  C CG   . TRP A 1 188 ? -11.736 -1.812  12.800  1.00 0.92  ? 188 TRP A CG   1  
ATOM 2891  C CD1  . TRP A 1 188 ? -10.701 -0.976  13.037  1.00 1.76  ? 188 TRP A CD1  1  
ATOM 2892  C CD2  . TRP A 1 188 ? -12.925 -0.973  12.698  1.00 1.04  ? 188 TRP A CD2  1  
ATOM 2893  N NE1  . TRP A 1 188 ? -11.177 0.322   13.094  1.00 2.01  ? 188 TRP A NE1  1  
ATOM 2894  C CE2  . TRP A 1 188 ? -12.541 0.375   12.890  1.00 1.34  ? 188 TRP A CE2  1  
ATOM 2895  C CE3  . TRP A 1 188 ? -14.284 -1.248  12.461  1.00 1.79  ? 188 TRP A CE3  1  
ATOM 2896  C CZ2  . TRP A 1 188 ? -13.472 1.414   12.849  1.00 1.47  ? 188 TRP A CZ2  1  
ATOM 2897  C CZ3  . TRP A 1 188 ? -15.224 -0.205  12.419  1.00 2.17  ? 188 TRP A CZ3  1  
ATOM 2898  C CH2  . TRP A 1 188 ? -14.819 1.123   12.613  1.00 1.71  ? 188 TRP A CH2  1  
ATOM 2899  H H    . TRP A 1 188 ? -11.139 -5.785  13.182  1.00 0.65  ? 188 TRP A H    1  
ATOM 2900  H HA   . TRP A 1 188 ? -11.131 -3.638  14.730  1.00 0.79  ? 188 TRP A HA   1  
ATOM 2901  H HB2  . TRP A 1 188 ? -10.633 -3.555  12.331  1.00 1.16  ? 188 TRP A HB2  1  
ATOM 2902  H HB3  . TRP A 1 188 ? -12.352 -3.652  11.954  1.00 1.12  ? 188 TRP A HB3  1  
ATOM 2903  H HD1  . TRP A 1 188 ? -9.671  -1.274  13.164  1.00 2.36  ? 188 TRP A HD1  1  
ATOM 2904  H HE1  . TRP A 1 188 ? -10.629 1.118   13.257  1.00 2.74  ? 188 TRP A HE1  1  
ATOM 2905  H HE3  . TRP A 1 188 ? -14.607 -2.268  12.310  1.00 2.35  ? 188 TRP A HE3  1  
ATOM 2906  H HZ2  . TRP A 1 188 ? -13.155 2.435   13.000  1.00 1.90  ? 188 TRP A HZ2  1  
ATOM 2907  H HZ3  . TRP A 1 188 ? -16.265 -0.427  12.236  1.00 2.99  ? 188 TRP A HZ3  1  
ATOM 2908  H HH2  . TRP A 1 188 ? -15.546 1.921   12.580  1.00 2.02  ? 188 TRP A HH2  1  
ATOM 2909  N N    . LYS A 1 189 ? -14.235 -4.502  14.396  1.00 0.95  ? 189 LYS A N    1  
ATOM 2910  C CA   . LYS A 1 189 ? -15.633 -4.215  14.848  1.00 1.23  ? 189 LYS A CA   1  
ATOM 2911  C C    . LYS A 1 189 ? -15.605 -3.454  16.178  1.00 1.53  ? 189 LYS A C    1  
ATOM 2912  O O    . LYS A 1 189 ? -15.879 -2.272  16.233  1.00 2.02  ? 189 LYS A O    1  
ATOM 2913  C CB   . LYS A 1 189 ? -16.384 -5.535  15.039  1.00 1.90  ? 189 LYS A CB   1  
ATOM 2914  C CG   . LYS A 1 189 ? -16.588 -6.212  13.682  1.00 2.68  ? 189 LYS A CG   1  
ATOM 2915  C CD   . LYS A 1 189 ? -17.318 -7.543  13.882  1.00 3.60  ? 189 LYS A CD   1  
ATOM 2916  C CE   . LYS A 1 189 ? -17.581 -8.191  12.521  1.00 4.51  ? 189 LYS A CE   1  
ATOM 2917  N NZ   . LYS A 1 189 ? -18.369 -9.442  12.712  1.00 5.09  ? 189 LYS A NZ   1  
ATOM 2918  H H    . LYS A 1 189 ? -14.017 -5.382  14.025  1.00 1.06  ? 189 LYS A H    1  
ATOM 2919  H HA   . LYS A 1 189 ? -16.138 -3.619  14.102  1.00 1.91  ? 189 LYS A HA   1  
ATOM 2920  H HB2  . LYS A 1 189 ? -15.808 -6.185  15.682  1.00 2.38  ? 189 LYS A HB2  1  
ATOM 2921  H HB3  . LYS A 1 189 ? -17.345 -5.341  15.491  1.00 2.28  ? 189 LYS A HB3  1  
ATOM 2922  H HG2  . LYS A 1 189 ? -17.178 -5.569  13.045  1.00 3.00  ? 189 LYS A HG2  1  
ATOM 2923  H HG3  . LYS A 1 189 ? -15.629 -6.395  13.222  1.00 2.99  ? 189 LYS A HG3  1  
ATOM 2924  H HD2  . LYS A 1 189 ? -16.707 -8.201  14.483  1.00 3.82  ? 189 LYS A HD2  1  
ATOM 2925  H HD3  . LYS A 1 189 ? -18.258 -7.367  14.382  1.00 3.93  ? 189 LYS A HD3  1  
ATOM 2926  H HE2  . LYS A 1 189 ? -18.138 -7.507  11.898  1.00 4.88  ? 189 LYS A HE2  1  
ATOM 2927  H HE3  . LYS A 1 189 ? -16.640 -8.427  12.047  1.00 4.83  ? 189 LYS A HE3  1  
ATOM 2928  H HZ1  . LYS A 1 189 ? -19.076 -9.526  11.954  1.00 5.52  ? 189 LYS A HZ1  1  
ATOM 2929  H HZ2  . LYS A 1 189 ? -18.850 -9.412  13.634  1.00 5.28  ? 189 LYS A HZ2  1  
ATOM 2930  H HZ3  . LYS A 1 189 ? -17.731 -10.263 12.680  1.00 5.25  ? 189 LYS A HZ3  1  
ATOM 2931  N N    . LYS A 1 190 ? -15.262 -4.120  17.251  1.00 2.36  ? 190 LYS A N    1  
ATOM 2932  C CA   . LYS A 1 190 ? -15.202 -3.428  18.572  1.00 3.37  ? 190 LYS A CA   1  
ATOM 2933  C C    . LYS A 1 190 ? -14.211 -4.148  19.487  1.00 3.71  ? 190 LYS A C    1  
ATOM 2934  O O    . LYS A 1 190 ? -13.293 -3.545  20.004  1.00 4.35  ? 190 LYS A O    1  
ATOM 2935  C CB   . LYS A 1 190 ? -16.596 -3.401  19.218  1.00 4.30  ? 190 LYS A CB   1  
ATOM 2936  C CG   . LYS A 1 190 ? -17.080 -4.829  19.515  1.00 5.08  ? 190 LYS A CG   1  
ATOM 2937  C CD   . LYS A 1 190 ? -18.610 -4.842  19.742  1.00 5.78  ? 190 LYS A CD   1  
ATOM 2938  C CE   . LYS A 1 190 ? -19.349 -5.157  18.433  1.00 6.76  ? 190 LYS A CE   1  
ATOM 2939  N NZ   . LYS A 1 190 ? -18.929 -4.200  17.372  1.00 7.40  ? 190 LYS A NZ   1  
ATOM 2940  H H    . LYS A 1 190 ? -15.035 -5.071  17.183  1.00 2.69  ? 190 LYS A H    1  
ATOM 2941  H HA   . LYS A 1 190 ? -14.861 -2.413  18.426  1.00 3.76  ? 190 LYS A HA   1  
ATOM 2942  H HB2  . LYS A 1 190 ? -16.548 -2.842  20.142  1.00 4.62  ? 190 LYS A HB2  1  
ATOM 2943  H HB3  . LYS A 1 190 ? -17.290 -2.920  18.548  1.00 4.57  ? 190 LYS A HB3  1  
ATOM 2944  H HG2  . LYS A 1 190 ? -16.824 -5.475  18.687  1.00 5.34  ? 190 LYS A HG2  1  
ATOM 2945  H HG3  . LYS A 1 190 ? -16.592 -5.187  20.410  1.00 5.31  ? 190 LYS A HG3  1  
ATOM 2946  H HD2  . LYS A 1 190 ? -18.855 -5.600  20.474  1.00 5.90  ? 190 LYS A HD2  1  
ATOM 2947  H HD3  . LYS A 1 190 ? -18.935 -3.879  20.111  1.00 5.84  ? 190 LYS A HD3  1  
ATOM 2948  H HE2  . LYS A 1 190 ? -19.114 -6.163  18.122  1.00 7.01  ? 190 LYS A HE2  1  
ATOM 2949  H HE3  . LYS A 1 190 ? -20.414 -5.070  18.594  1.00 7.05  ? 190 LYS A HE3  1  
ATOM 2950  H HZ1  . LYS A 1 190 ? -19.193 -3.234  17.651  1.00 7.47  ? 190 LYS A HZ1  1  
ATOM 2951  H HZ2  . LYS A 1 190 ? -19.401 -4.445  16.478  1.00 7.70  ? 190 LYS A HZ2  1  
ATOM 2952  H HZ3  . LYS A 1 190 ? -17.898 -4.251  17.246  1.00 7.76  ? 190 LYS A HZ3  1  
ATOM 2953  N N    . MET A 1 191 ? -14.383 -5.426  19.689  1.00 3.81  ? 191 MET A N    1  
ATOM 2954  C CA   . MET A 1 191 ? -13.448 -6.177  20.573  1.00 4.63  ? 191 MET A CA   1  
ATOM 2955  C C    . MET A 1 191 ? -13.901 -7.640  20.664  1.00 4.97  ? 191 MET A C    1  
ATOM 2956  O O    . MET A 1 191 ? -13.287 -8.526  20.103  1.00 5.27  ? 191 MET A O    1  
ATOM 2957  C CB   . MET A 1 191 ? -13.450 -5.542  21.980  1.00 5.48  ? 191 MET A CB   1  
ATOM 2958  C CG   . MET A 1 191 ? -12.890 -6.524  23.020  1.00 5.71  ? 191 MET A CG   1  
ATOM 2959  S SD   . MET A 1 191 ? -12.269 -5.602  24.448  1.00 7.00  ? 191 MET A SD   1  
ATOM 2960  C CE   . MET A 1 191 ? -13.843 -4.855  24.938  1.00 7.52  ? 191 MET A CE   1  
ATOM 2961  H H    . MET A 1 191 ? -15.131 -5.892  19.259  1.00 3.68  ? 191 MET A H    1  
ATOM 2962  H HA   . MET A 1 191 ? -12.453 -6.131  20.159  1.00 4.86  ? 191 MET A HA   1  
ATOM 2963  H HB2  . MET A 1 191 ? -12.838 -4.653  21.974  1.00 5.74  ? 191 MET A HB2  1  
ATOM 2964  H HB3  . MET A 1 191 ? -14.462 -5.277  22.250  1.00 6.08  ? 191 MET A HB3  1  
ATOM 2965  H HG2  . MET A 1 191 ? -13.674 -7.196  23.338  1.00 5.63  ? 191 MET A HG2  1  
ATOM 2966  H HG3  . MET A 1 191 ? -12.084 -7.095  22.582  1.00 5.60  ? 191 MET A HG3  1  
ATOM 2967  H HE1  . MET A 1 191 ? -13.752 -4.449  25.937  1.00 7.54  ? 191 MET A HE1  1  
ATOM 2968  H HE2  . MET A 1 191 ? -14.618 -5.603  24.925  1.00 7.75  ? 191 MET A HE2  1  
ATOM 2969  H HE3  . MET A 1 191 ? -14.096 -4.065  24.245  1.00 7.88  ? 191 MET A HE3  1  
ATOM 2970  N N    . GLY A 1 192 ? -14.973 -7.898  21.363  1.00 5.37  ? 192 GLY A N    1  
ATOM 2971  C CA   . GLY A 1 192 ? -15.464 -9.300  21.485  1.00 6.15  ? 192 GLY A CA   1  
ATOM 2972  C C    . GLY A 1 192 ? -14.451 -10.131 22.273  1.00 6.68  ? 192 GLY A C    1  
ATOM 2973  O O    . GLY A 1 192 ? -13.361 -9.635  22.508  1.00 7.01  ? 192 GLY A O    1  
ATOM 2974  O OXT  . GLY A 1 192 ? -14.781 -11.251 22.628  1.00 7.06  ? 192 GLY A OXT  1  
ATOM 2975  H H    . GLY A 1 192 ? -15.456 -7.169  21.806  1.00 5.43  ? 192 GLY A H    1  
ATOM 2976  H HA2  . GLY A 1 192 ? -16.414 -9.304  22.000  1.00 6.42  ? 192 GLY A HA2  1  
ATOM 2977  H HA3  . GLY A 1 192 ? -15.585 -9.725  20.500  1.00 6.42  ? 192 GLY A HA3  1  
ATOM 2978  N N    . MET A 1 1   ? 33.981  3.314   -4.982  1.00 17.15 ? 1   MET A N    2  
ATOM 2979  C CA   . MET A 1 1   ? 32.617  3.584   -5.517  1.00 16.73 ? 1   MET A CA   2  
ATOM 2980  C C    . MET A 1 1   ? 32.723  4.487   -6.749  1.00 16.39 ? 1   MET A C    2  
ATOM 2981  O O    . MET A 1 1   ? 32.386  4.094   -7.848  1.00 16.40 ? 1   MET A O    2  
ATOM 2982  C CB   . MET A 1 1   ? 31.778  4.281   -4.444  1.00 16.98 ? 1   MET A CB   2  
ATOM 2983  C CG   . MET A 1 1   ? 30.338  4.430   -4.939  1.00 17.51 ? 1   MET A CG   2  
ATOM 2984  S SD   . MET A 1 1   ? 29.303  5.071   -3.599  1.00 17.69 ? 1   MET A SD   2  
ATOM 2985  C CE   . MET A 1 1   ? 27.700  4.713   -4.358  1.00 17.86 ? 1   MET A CE   2  
ATOM 2986  H H1   . MET A 1 1   ? 34.526  4.198   -4.957  1.00 17.22 ? 1   MET A H1   2  
ATOM 2987  H H2   . MET A 1 1   ? 34.463  2.625   -5.596  1.00 17.32 ? 1   MET A H2   2  
ATOM 2988  H H3   . MET A 1 1   ? 33.906  2.928   -4.020  1.00 17.33 ? 1   MET A H3   2  
ATOM 2989  H HA   . MET A 1 1   ? 32.147  2.652   -5.793  1.00 16.65 ? 1   MET A HA   2  
ATOM 2990  H HB2  . MET A 1 1   ? 31.789  3.691   -3.539  1.00 17.06 ? 1   MET A HB2  2  
ATOM 2991  H HB3  . MET A 1 1   ? 32.190  5.259   -4.243  1.00 16.85 ? 1   MET A HB3  2  
ATOM 2992  H HG2  . MET A 1 1   ? 30.312  5.116   -5.772  1.00 17.63 ? 1   MET A HG2  2  
ATOM 2993  H HG3  . MET A 1 1   ? 29.963  3.467   -5.253  1.00 17.81 ? 1   MET A HG3  2  
ATOM 2994  H HE1  . MET A 1 1   ? 27.616  3.650   -4.535  1.00 17.66 ? 1   MET A HE1  2  
ATOM 2995  H HE2  . MET A 1 1   ? 27.620  5.239   -5.296  1.00 18.24 ? 1   MET A HE2  2  
ATOM 2996  H HE3  . MET A 1 1   ? 26.909  5.038   -3.697  1.00 17.93 ? 1   MET A HE3  2  
ATOM 2997  N N    . ASP A 1 2   ? 33.188  5.693   -6.574  1.00 16.24 ? 2   ASP A N    2  
ATOM 2998  C CA   . ASP A 1 2   ? 33.316  6.619   -7.734  1.00 16.07 ? 2   ASP A CA   2  
ATOM 2999  C C    . ASP A 1 2   ? 34.528  6.218   -8.577  1.00 15.50 ? 2   ASP A C    2  
ATOM 3000  O O    . ASP A 1 2   ? 34.394  5.743   -9.688  1.00 15.56 ? 2   ASP A O    2  
ATOM 3001  C CB   . ASP A 1 2   ? 33.501  8.051   -7.225  1.00 16.42 ? 2   ASP A CB   2  
ATOM 3002  C CG   . ASP A 1 2   ? 33.611  9.006   -8.415  1.00 16.67 ? 2   ASP A CG   2  
ATOM 3003  O OD1  . ASP A 1 2   ? 34.694  9.113   -8.965  1.00 16.88 ? 2   ASP A OD1  2  
ATOM 3004  O OD2  . ASP A 1 2   ? 32.610  9.615   -8.755  1.00 16.77 ? 2   ASP A OD2  2  
ATOM 3005  H H    . ASP A 1 2   ? 33.455  5.990   -5.679  1.00 16.34 ? 2   ASP A H    2  
ATOM 3006  H HA   . ASP A 1 2   ? 32.422  6.565   -8.338  1.00 16.28 ? 2   ASP A HA   2  
ATOM 3007  H HB2  . ASP A 1 2   ? 32.652  8.328   -6.617  1.00 16.55 ? 2   ASP A HB2  2  
ATOM 3008  H HB3  . ASP A 1 2   ? 34.402  8.109   -6.635  1.00 16.53 ? 2   ASP A HB3  2  
ATOM 3009  N N    . GLY A 1 3   ? 35.711  6.405   -8.059  1.00 15.11 ? 3   GLY A N    2  
ATOM 3010  C CA   . GLY A 1 3   ? 36.931  6.034   -8.831  1.00 14.72 ? 3   GLY A CA   2  
ATOM 3011  C C    . GLY A 1 3   ? 36.880  4.547   -9.187  1.00 14.60 ? 3   GLY A C    2  
ATOM 3012  O O    . GLY A 1 3   ? 37.181  4.154   -10.297 1.00 14.88 ? 3   GLY A O    2  
ATOM 3013  H H    . GLY A 1 3   ? 35.797  6.790   -7.162  1.00 15.19 ? 3   GLY A H    2  
ATOM 3014  H HA2  . GLY A 1 3   ? 36.974  6.622   -9.738  1.00 14.73 ? 3   GLY A HA2  2  
ATOM 3015  H HA3  . GLY A 1 3   ? 37.808  6.228   -8.234  1.00 14.69 ? 3   GLY A HA3  2  
ATOM 3016  N N    . SER A 1 4   ? 36.502  3.717   -8.253  1.00 14.34 ? 4   SER A N    2  
ATOM 3017  C CA   . SER A 1 4   ? 36.429  2.252   -8.531  1.00 14.41 ? 4   SER A CA   2  
ATOM 3018  C C    . SER A 1 4   ? 37.758  1.771   -9.121  1.00 13.79 ? 4   SER A C    2  
ATOM 3019  O O    . SER A 1 4   ? 38.020  1.934   -10.296 1.00 14.02 ? 4   SER A O    2  
ATOM 3020  C CB   . SER A 1 4   ? 35.297  1.975   -9.522  1.00 14.82 ? 4   SER A CB   2  
ATOM 3021  O OG   . SER A 1 4   ? 35.501  0.704   -10.124 1.00 14.88 ? 4   SER A OG   2  
ATOM 3022  H H    . SER A 1 4   ? 36.264  4.057   -7.365  1.00 14.23 ? 4   SER A H    2  
ATOM 3023  H HA   . SER A 1 4   ? 36.235  1.723   -7.610  1.00 14.79 ? 4   SER A HA   2  
ATOM 3024  H HB2  . SER A 1 4   ? 34.353  1.973   -9.002  1.00 15.17 ? 4   SER A HB2  2  
ATOM 3025  H HB3  . SER A 1 4   ? 35.286  2.747   -10.280 1.00 14.87 ? 4   SER A HB3  2  
ATOM 3026  H HG   . SER A 1 4   ? 34.646  0.364   -10.397 1.00 14.91 ? 4   SER A HG   2  
ATOM 3027  N N    . GLY A 1 5   ? 38.598  1.177   -8.315  1.00 13.15 ? 5   GLY A N    2  
ATOM 3028  C CA   . GLY A 1 5   ? 39.909  0.682   -8.832  1.00 12.67 ? 5   GLY A CA   2  
ATOM 3029  C C    . GLY A 1 5   ? 40.420  -0.447  -7.942  1.00 12.31 ? 5   GLY A C    2  
ATOM 3030  O O    . GLY A 1 5   ? 41.589  -0.510  -7.616  1.00 12.37 ? 5   GLY A O    2  
ATOM 3031  H H    . GLY A 1 5   ? 38.366  1.056   -7.371  1.00 13.09 ? 5   GLY A H    2  
ATOM 3032  H HA2  . GLY A 1 5   ? 39.787  0.314   -9.839  1.00 12.77 ? 5   GLY A HA2  2  
ATOM 3033  H HA3  . GLY A 1 5   ? 40.625  1.487   -8.825  1.00 12.67 ? 5   GLY A HA3  2  
ATOM 3034  N N    . GLU A 1 6   ? 39.559  -1.341  -7.546  1.00 12.14 ? 6   GLU A N    2  
ATOM 3035  C CA   . GLU A 1 6   ? 40.007  -2.461  -6.676  1.00 12.01 ? 6   GLU A CA   2  
ATOM 3036  C C    . GLU A 1 6   ? 38.884  -3.494  -6.546  1.00 11.53 ? 6   GLU A C    2  
ATOM 3037  O O    . GLU A 1 6   ? 39.045  -4.647  -6.895  1.00 11.57 ? 6   GLU A O    2  
ATOM 3038  C CB   . GLU A 1 6   ? 40.360  -1.910  -5.294  1.00 12.39 ? 6   GLU A CB   2  
ATOM 3039  C CG   . GLU A 1 6   ? 41.131  -2.964  -4.505  1.00 12.94 ? 6   GLU A CG   2  
ATOM 3040  C CD   . GLU A 1 6   ? 42.547  -3.098  -5.070  1.00 13.31 ? 6   GLU A CD   2  
ATOM 3041  O OE1  . GLU A 1 6   ? 43.281  -2.125  -5.012  1.00 13.50 ? 6   GLU A OE1  2  
ATOM 3042  O OE2  . GLU A 1 6   ? 42.874  -4.172  -5.549  1.00 13.55 ? 6   GLU A OE2  2  
ATOM 3043  H H    . GLU A 1 6   ? 38.620  -1.274  -7.820  1.00 12.23 ? 6   GLU A H    2  
ATOM 3044  H HA   . GLU A 1 6   ? 40.878  -2.928  -7.111  1.00 12.19 ? 6   GLU A HA   2  
ATOM 3045  H HB2  . GLU A 1 6   ? 40.968  -1.024  -5.403  1.00 12.50 ? 6   GLU A HB2  2  
ATOM 3046  H HB3  . GLU A 1 6   ? 39.453  -1.660  -4.763  1.00 12.34 ? 6   GLU A HB3  2  
ATOM 3047  H HG2  . GLU A 1 6   ? 41.183  -2.667  -3.469  1.00 13.05 ? 6   GLU A HG2  2  
ATOM 3048  H HG3  . GLU A 1 6   ? 40.623  -3.912  -4.585  1.00 13.14 ? 6   GLU A HG3  2  
ATOM 3049  N N    . GLN A 1 7   ? 37.748  -3.089  -6.044  1.00 11.25 ? 7   GLN A N    2  
ATOM 3050  C CA   . GLN A 1 7   ? 36.610  -4.041  -5.883  1.00 10.97 ? 7   GLN A CA   2  
ATOM 3051  C C    . GLN A 1 7   ? 35.285  -3.272  -6.016  1.00 10.29 ? 7   GLN A C    2  
ATOM 3052  O O    . GLN A 1 7   ? 34.610  -3.052  -5.030  1.00 10.41 ? 7   GLN A O    2  
ATOM 3053  C CB   . GLN A 1 7   ? 36.687  -4.692  -4.497  1.00 11.52 ? 7   GLN A CB   2  
ATOM 3054  C CG   . GLN A 1 7   ? 37.067  -3.640  -3.453  1.00 12.08 ? 7   GLN A CG   2  
ATOM 3055  C CD   . GLN A 1 7   ? 36.817  -4.198  -2.050  1.00 12.56 ? 7   GLN A CD   2  
ATOM 3056  O OE1  . GLN A 1 7   ? 37.734  -4.334  -1.265  1.00 12.91 ? 7   GLN A OE1  2  
ATOM 3057  N NE2  . GLN A 1 7   ? 35.605  -4.530  -1.700  1.00 12.77 ? 7   GLN A NE2  2  
ATOM 3058  H H    . GLN A 1 7   ? 37.644  -2.154  -5.769  1.00 11.36 ? 7   GLN A H    2  
ATOM 3059  H HA   . GLN A 1 7   ? 36.665  -4.810  -6.637  1.00 11.07 ? 7   GLN A HA   2  
ATOM 3060  H HB2  . GLN A 1 7   ? 35.727  -5.121  -4.244  1.00 11.67 ? 7   GLN A HB2  2  
ATOM 3061  H HB3  . GLN A 1 7   ? 37.435  -5.470  -4.508  1.00 11.58 ? 7   GLN A HB3  2  
ATOM 3062  H HG2  . GLN A 1 7   ? 38.113  -3.389  -3.560  1.00 12.23 ? 7   GLN A HG2  2  
ATOM 3063  H HG3  . GLN A 1 7   ? 36.468  -2.754  -3.598  1.00 12.20 ? 7   GLN A HG3  2  
ATOM 3064  H HE21 . GLN A 1 7   ? 34.865  -4.421  -2.333  1.00 12.61 ? 7   GLN A HE21 2  
ATOM 3065  H HE22 . GLN A 1 7   ? 35.434  -4.889  -0.804  1.00 13.18 ? 7   GLN A HE22 2  
ATOM 3066  N N    . PRO A 1 8   ? 34.947  -2.870  -7.225  1.00 9.81  ? 8   PRO A N    2  
ATOM 3067  C CA   . PRO A 1 8   ? 33.704  -2.113  -7.464  1.00 9.37  ? 8   PRO A CA   2  
ATOM 3068  C C    . PRO A 1 8   ? 32.492  -2.940  -7.016  1.00 9.09  ? 8   PRO A C    2  
ATOM 3069  O O    . PRO A 1 8   ? 32.075  -3.862  -7.689  1.00 9.07  ? 8   PRO A O    2  
ATOM 3070  C CB   . PRO A 1 8   ? 33.682  -1.849  -8.989  1.00 9.20  ? 8   PRO A CB   2  
ATOM 3071  C CG   . PRO A 1 8   ? 34.988  -2.450  -9.587  1.00 9.57  ? 8   PRO A CG   2  
ATOM 3072  C CD   . PRO A 1 8   ? 35.759  -3.134  -8.435  1.00 9.93  ? 8   PRO A CD   2  
ATOM 3073  H HA   . PRO A 1 8   ? 33.732  -1.176  -6.927  1.00 9.66  ? 8   PRO A HA   2  
ATOM 3074  H HB2  . PRO A 1 8   ? 32.816  -2.322  -9.440  1.00 8.88  ? 8   PRO A HB2  2  
ATOM 3075  H HB3  . PRO A 1 8   ? 33.652  -0.785  -9.180  1.00 9.40  ? 8   PRO A HB3  2  
ATOM 3076  H HG2  . PRO A 1 8   ? 34.741  -3.177  -10.353 1.00 9.46  ? 8   PRO A HG2  2  
ATOM 3077  H HG3  . PRO A 1 8   ? 35.595  -1.664  -10.016 1.00 9.94  ? 8   PRO A HG3  2  
ATOM 3078  H HD2  . PRO A 1 8   ? 35.831  -4.196  -8.621  1.00 10.00 ? 8   PRO A HD2  2  
ATOM 3079  H HD3  . PRO A 1 8   ? 36.743  -2.702  -8.323  1.00 10.41 ? 8   PRO A HD3  2  
ATOM 3080  N N    . ARG A 1 9   ? 31.925  -2.614  -5.887  1.00 9.13  ? 9   ARG A N    2  
ATOM 3081  C CA   . ARG A 1 9   ? 30.744  -3.380  -5.401  1.00 9.14  ? 9   ARG A CA   2  
ATOM 3082  C C    . ARG A 1 9   ? 29.585  -3.201  -6.382  1.00 8.60  ? 9   ARG A C    2  
ATOM 3083  O O    . ARG A 1 9   ? 28.834  -4.121  -6.640  1.00 8.68  ? 9   ARG A O    2  
ATOM 3084  C CB   . ARG A 1 9   ? 30.332  -2.871  -4.017  1.00 10.09 ? 9   ARG A CB   2  
ATOM 3085  C CG   . ARG A 1 9   ? 30.019  -1.374  -4.091  1.00 10.67 ? 9   ARG A CG   2  
ATOM 3086  C CD   . ARG A 1 9   ? 29.800  -0.827  -2.678  1.00 11.51 ? 9   ARG A CD   2  
ATOM 3087  N NE   . ARG A 1 9   ? 31.107  -0.757  -1.964  1.00 12.05 ? 9   ARG A NE   2  
ATOM 3088  C CZ   . ARG A 1 9   ? 31.214  -0.063  -0.863  1.00 12.65 ? 9   ARG A CZ   2  
ATOM 3089  N NH1  . ARG A 1 9   ? 30.175  0.563   -0.382  1.00 12.79 ? 9   ARG A NH1  2  
ATOM 3090  N NH2  . ARG A 1 9   ? 32.360  0.002   -0.242  1.00 13.27 ? 9   ARG A NH2  2  
ATOM 3091  H H    . ARG A 1 9   ? 32.276  -1.867  -5.359  1.00 9.33  ? 9   ARG A H    2  
ATOM 3092  H HA   . ARG A 1 9   ? 30.998  -4.428  -5.339  1.00 9.10  ? 9   ARG A HA   2  
ATOM 3093  H HB2  . ARG A 1 9   ? 29.456  -3.407  -3.684  1.00 10.28 ? 9   ARG A HB2  2  
ATOM 3094  H HB3  . ARG A 1 9   ? 31.140  -3.033  -3.320  1.00 10.40 ? 9   ARG A HB3  2  
ATOM 3095  H HG2  . ARG A 1 9   ? 30.845  -0.856  -4.555  1.00 10.72 ? 9   ARG A HG2  2  
ATOM 3096  H HG3  . ARG A 1 9   ? 29.124  -1.222  -4.675  1.00 10.65 ? 9   ARG A HG3  2  
ATOM 3097  H HD2  . ARG A 1 9   ? 29.370  0.161   -2.737  1.00 11.82 ? 9   ARG A HD2  2  
ATOM 3098  H HD3  . ARG A 1 9   ? 29.129  -1.480  -2.139  1.00 11.59 ? 9   ARG A HD3  2  
ATOM 3099  H HE   . ARG A 1 9   ? 31.887  -1.230  -2.323  1.00 12.08 ? 9   ARG A HE   2  
ATOM 3100  H HH11 . ARG A 1 9   ? 29.296  0.513   -0.857  1.00 12.44 ? 9   ARG A HH11 2  
ATOM 3101  H HH12 . ARG A 1 9   ? 30.257  1.094   0.461   1.00 13.36 ? 9   ARG A HH12 2  
ATOM 3102  H HH21 . ARG A 1 9   ? 33.156  -0.479  -0.610  1.00 13.29 ? 9   ARG A HH21 2  
ATOM 3103  H HH22 . ARG A 1 9   ? 32.442  0.533   0.601   1.00 13.82 ? 9   ARG A HH22 2  
ATOM 3104  N N    . GLY A 1 10  ? 29.437  -2.023  -6.937  1.00 8.29  ? 10  GLY A N    2  
ATOM 3105  C CA   . GLY A 1 10  ? 28.331  -1.777  -7.913  1.00 8.00  ? 10  GLY A CA   2  
ATOM 3106  C C    . GLY A 1 10  ? 27.649  -0.442  -7.610  1.00 7.45  ? 10  GLY A C    2  
ATOM 3107  O O    . GLY A 1 10  ? 27.615  0.456   -8.426  1.00 7.68  ? 10  GLY A O    2  
ATOM 3108  H H    . GLY A 1 10  ? 30.061  -1.301  -6.717  1.00 8.43  ? 10  GLY A H    2  
ATOM 3109  H HA2  . GLY A 1 10  ? 28.740  -1.747  -8.914  1.00 8.37  ? 10  GLY A HA2  2  
ATOM 3110  H HA3  . GLY A 1 10  ? 27.596  -2.568  -7.853  1.00 8.08  ? 10  GLY A HA3  2  
ATOM 3111  N N    . GLY A 1 11  ? 27.115  -0.308  -6.424  1.00 7.01  ? 11  GLY A N    2  
ATOM 3112  C CA   . GLY A 1 11  ? 26.439  0.964   -6.039  1.00 6.74  ? 11  GLY A CA   2  
ATOM 3113  C C    . GLY A 1 11  ? 25.985  0.872   -4.579  1.00 5.83  ? 11  GLY A C    2  
ATOM 3114  O O    . GLY A 1 11  ? 26.748  0.510   -3.706  1.00 6.06  ? 11  GLY A O    2  
ATOM 3115  H H    . GLY A 1 11  ? 27.164  -1.047  -5.781  1.00 7.06  ? 11  GLY A H    2  
ATOM 3116  H HA2  . GLY A 1 11  ? 27.129  1.788   -6.153  1.00 7.27  ? 11  GLY A HA2  2  
ATOM 3117  H HA3  . GLY A 1 11  ? 25.579  1.122   -6.671  1.00 6.94  ? 11  GLY A HA3  2  
ATOM 3118  N N    . GLY A 1 12  ? 24.746  1.179   -4.309  1.00 5.12  ? 12  GLY A N    2  
ATOM 3119  C CA   . GLY A 1 12  ? 24.245  1.088   -2.908  1.00 4.52  ? 12  GLY A CA   2  
ATOM 3120  C C    . GLY A 1 12  ? 22.708  1.041   -2.894  1.00 3.52  ? 12  GLY A C    2  
ATOM 3121  O O    . GLY A 1 12  ? 22.082  1.851   -2.239  1.00 3.54  ? 12  GLY A O    2  
ATOM 3122  H H    . GLY A 1 12  ? 24.141  1.456   -5.029  1.00 5.25  ? 12  GLY A H    2  
ATOM 3123  H HA2  . GLY A 1 12  ? 24.635  0.192   -2.446  1.00 4.85  ? 12  GLY A HA2  2  
ATOM 3124  H HA3  . GLY A 1 12  ? 24.578  1.951   -2.353  1.00 4.89  ? 12  GLY A HA3  2  
ATOM 3125  N N    . PRO A 1 13  ? 22.135  0.090   -3.605  1.00 3.15  ? 13  PRO A N    2  
ATOM 3126  C CA   . PRO A 1 13  ? 20.667  -0.059  -3.654  1.00 2.77  ? 13  PRO A CA   2  
ATOM 3127  C C    . PRO A 1 13  ? 20.096  -0.219  -2.237  1.00 2.05  ? 13  PRO A C    2  
ATOM 3128  O O    . PRO A 1 13  ? 18.923  0.003   -2.009  1.00 2.37  ? 13  PRO A O    2  
ATOM 3129  C CB   . PRO A 1 13  ? 20.426  -1.340  -4.492  1.00 3.47  ? 13  PRO A CB   2  
ATOM 3130  C CG   . PRO A 1 13  ? 21.812  -1.846  -4.992  1.00 3.99  ? 13  PRO A CG   2  
ATOM 3131  C CD   . PRO A 1 13  ? 22.886  -0.900  -4.409  1.00 3.79  ? 13  PRO A CD   2  
ATOM 3132  H HA   . PRO A 1 13  ? 20.222  0.793   -4.143  1.00 3.21  ? 13  PRO A HA   2  
ATOM 3133  H HB2  . PRO A 1 13  ? 19.952  -2.104  -3.885  1.00 3.49  ? 13  PRO A HB2  2  
ATOM 3134  H HB3  . PRO A 1 13  ? 19.795  -1.112  -5.340  1.00 4.08  ? 13  PRO A HB3  2  
ATOM 3135  H HG2  . PRO A 1 13  ? 21.992  -2.854  -4.637  1.00 4.37  ? 13  PRO A HG2  2  
ATOM 3136  H HG3  . PRO A 1 13  ? 21.838  -1.797  -6.073  1.00 4.57  ? 13  PRO A HG3  2  
ATOM 3137  H HD2  . PRO A 1 13  ? 23.579  -1.448  -3.782  1.00 4.09  ? 13  PRO A HD2  2  
ATOM 3138  H HD3  . PRO A 1 13  ? 23.412  -0.408  -5.209  1.00 4.27  ? 13  PRO A HD3  2  
ATOM 3139  N N    . THR A 1 14  ? 20.905  -0.607  -1.287  1.00 1.59  ? 14  THR A N    2  
ATOM 3140  C CA   . THR A 1 14  ? 20.386  -0.782  0.103   1.00 1.24  ? 14  THR A CA   2  
ATOM 3141  C C    . THR A 1 14  ? 20.404  0.563   0.837   1.00 1.07  ? 14  THR A C    2  
ATOM 3142  O O    . THR A 1 14  ? 20.723  0.638   2.007   1.00 1.20  ? 14  THR A O    2  
ATOM 3143  C CB   . THR A 1 14  ? 21.245  -1.797  0.857   1.00 1.43  ? 14  THR A CB   2  
ATOM 3144  O OG1  . THR A 1 14  ? 22.588  -1.335  0.897   1.00 2.16  ? 14  THR A OG1  2  
ATOM 3145  C CG2  . THR A 1 14  ? 21.190  -3.148  0.143   1.00 1.78  ? 14  THR A CG2  2  
ATOM 3146  H H    . THR A 1 14  ? 21.847  -0.787  -1.487  1.00 1.96  ? 14  THR A H    2  
ATOM 3147  H HA   . THR A 1 14  ? 19.358  -1.113  0.061   1.00 1.69  ? 14  THR A HA   2  
ATOM 3148  H HB   . THR A 1 14  ? 20.872  -1.909  1.863   1.00 1.94  ? 14  THR A HB   2  
ATOM 3149  H HG1  . THR A 1 14  ? 22.588  -0.402  0.670   1.00 2.49  ? 14  THR A HG1  2  
ATOM 3150  H HG21 . THR A 1 14  ? 21.532  -3.031  -0.875  1.00 2.04  ? 14  THR A HG21 2  
ATOM 3151  H HG22 . THR A 1 14  ? 20.175  -3.514  0.142   1.00 2.29  ? 14  THR A HG22 2  
ATOM 3152  H HG23 . THR A 1 14  ? 21.827  -3.852  0.657   1.00 2.23  ? 14  THR A HG23 2  
ATOM 3153  N N    . SER A 1 15  ? 20.030  1.620   0.164   1.00 1.07  ? 15  SER A N    2  
ATOM 3154  C CA   . SER A 1 15  ? 19.985  2.962   0.821   1.00 0.91  ? 15  SER A CA   2  
ATOM 3155  C C    . SER A 1 15  ? 18.551  3.216   1.297   1.00 0.75  ? 15  SER A C    2  
ATOM 3156  O O    . SER A 1 15  ? 17.604  3.073   0.550   1.00 0.78  ? 15  SER A O    2  
ATOM 3157  C CB   . SER A 1 15  ? 20.395  4.042   -0.184  1.00 0.99  ? 15  SER A CB   2  
ATOM 3158  O OG   . SER A 1 15  ? 19.264  4.423   -0.955  1.00 1.38  ? 15  SER A OG   2  
ATOM 3159  H H    . SER A 1 15  ? 19.754  1.527   -0.771  1.00 1.34  ? 15  SER A H    2  
ATOM 3160  H HA   . SER A 1 15  ? 20.654  2.986   1.672   1.00 0.94  ? 15  SER A HA   2  
ATOM 3161  H HB2  . SER A 1 15  ? 20.770  4.904   0.342   1.00 1.46  ? 15  SER A HB2  2  
ATOM 3162  H HB3  . SER A 1 15  ? 21.171  3.653   -0.831  1.00 1.34  ? 15  SER A HB3  2  
ATOM 3163  H HG   . SER A 1 15  ? 19.264  5.380   -1.027  1.00 1.70  ? 15  SER A HG   2  
ATOM 3164  N N    . SER A 1 16  ? 18.382  3.571   2.541   1.00 0.72  ? 16  SER A N    2  
ATOM 3165  C CA   . SER A 1 16  ? 17.008  3.810   3.070   1.00 0.82  ? 16  SER A CA   2  
ATOM 3166  C C    . SER A 1 16  ? 16.295  4.882   2.242   1.00 0.81  ? 16  SER A C    2  
ATOM 3167  O O    . SER A 1 16  ? 15.124  4.761   1.935   1.00 0.92  ? 16  SER A O    2  
ATOM 3168  C CB   . SER A 1 16  ? 17.100  4.275   4.524   1.00 1.06  ? 16  SER A CB   2  
ATOM 3169  O OG   . SER A 1 16  ? 17.717  5.555   4.570   1.00 1.64  ? 16  SER A OG   2  
ATOM 3170  H H    . SER A 1 16  ? 19.157  3.666   3.132   1.00 0.74  ? 16  SER A H    2  
ATOM 3171  H HA   . SER A 1 16  ? 16.444  2.891   3.027   1.00 0.88  ? 16  SER A HA   2  
ATOM 3172  H HB2  . SER A 1 16  ? 16.111  4.344   4.946   1.00 1.49  ? 16  SER A HB2  2  
ATOM 3173  H HB3  . SER A 1 16  ? 17.683  3.563   5.093   1.00 1.64  ? 16  SER A HB3  2  
ATOM 3174  H HG   . SER A 1 16  ? 18.635  5.433   4.823   1.00 2.08  ? 16  SER A HG   2  
ATOM 3175  N N    . GLU A 1 17  ? 16.975  5.934   1.886   1.00 0.80  ? 17  GLU A N    2  
ATOM 3176  C CA   . GLU A 1 17  ? 16.317  7.009   1.090   1.00 0.94  ? 17  GLU A CA   2  
ATOM 3177  C C    . GLU A 1 17  ? 15.805  6.460   -0.246  1.00 0.85  ? 17  GLU A C    2  
ATOM 3178  O O    . GLU A 1 17  ? 14.824  6.941   -0.776  1.00 0.89  ? 17  GLU A O    2  
ATOM 3179  C CB   . GLU A 1 17  ? 17.299  8.157   0.846   1.00 1.13  ? 17  GLU A CB   2  
ATOM 3180  C CG   . GLU A 1 17  ? 18.542  7.617   0.134   1.00 1.71  ? 17  GLU A CG   2  
ATOM 3181  C CD   . GLU A 1 17  ? 19.600  8.717   0.039   1.00 2.26  ? 17  GLU A CD   2  
ATOM 3182  O OE1  . GLU A 1 17  ? 19.267  9.793   -0.429  1.00 2.68  ? 17  GLU A OE1  2  
ATOM 3183  O OE2  . GLU A 1 17  ? 20.726  8.465   0.436   1.00 2.90  ? 17  GLU A OE2  2  
ATOM 3184  H H    . GLU A 1 17  ? 17.914  6.034   2.147   1.00 0.79  ? 17  GLU A H    2  
ATOM 3185  H HA   . GLU A 1 17  ? 15.443  7.369   1.611   1.00 1.09  ? 17  GLU A HA   2  
ATOM 3186  H HB2  . GLU A 1 17  ? 16.828  8.910   0.230   1.00 1.54  ? 17  GLU A HB2  2  
ATOM 3187  H HB3  . GLU A 1 17  ? 17.588  8.592   1.790   1.00 1.46  ? 17  GLU A HB3  2  
ATOM 3188  H HG2  . GLU A 1 17  ? 18.940  6.781   0.691   1.00 2.27  ? 17  GLU A HG2  2  
ATOM 3189  H HG3  . GLU A 1 17  ? 18.275  7.291   -0.860  1.00 2.07  ? 17  GLU A HG3  2  
ATOM 3190  N N    . GLN A 1 18  ? 16.432  5.460   -0.800  1.00 0.80  ? 18  GLN A N    2  
ATOM 3191  C CA   . GLN A 1 18  ? 15.920  4.918   -2.093  1.00 0.83  ? 18  GLN A CA   2  
ATOM 3192  C C    . GLN A 1 18  ? 14.517  4.342   -1.859  1.00 0.68  ? 18  GLN A C    2  
ATOM 3193  O O    . GLN A 1 18  ? 13.688  4.326   -2.748  1.00 0.69  ? 18  GLN A O    2  
ATOM 3194  C CB   . GLN A 1 18  ? 16.868  3.817   -2.614  1.00 0.96  ? 18  GLN A CB   2  
ATOM 3195  C CG   . GLN A 1 18  ? 17.934  4.434   -3.535  1.00 1.53  ? 18  GLN A CG   2  
ATOM 3196  C CD   . GLN A 1 18  ? 17.346  4.649   -4.933  1.00 2.23  ? 18  GLN A CD   2  
ATOM 3197  O OE1  . GLN A 1 18  ? 18.074  4.789   -5.896  1.00 2.69  ? 18  GLN A OE1  2  
ATOM 3198  N NE2  . GLN A 1 18  ? 16.051  4.682   -5.084  1.00 3.07  ? 18  GLN A NE2  2  
ATOM 3199  H H    . GLN A 1 18  ? 17.227  5.069   -0.380  1.00 0.80  ? 18  GLN A H    2  
ATOM 3200  H HA   . GLN A 1 18  ? 15.863  5.724   -2.812  1.00 0.96  ? 18  GLN A HA   2  
ATOM 3201  H HB2  . GLN A 1 18  ? 17.352  3.339   -1.776  1.00 1.31  ? 18  GLN A HB2  2  
ATOM 3202  H HB3  . GLN A 1 18  ? 16.304  3.077   -3.166  1.00 1.16  ? 18  GLN A HB3  2  
ATOM 3203  H HG2  . GLN A 1 18  ? 18.254  5.385   -3.132  1.00 1.79  ? 18  GLN A HG2  2  
ATOM 3204  H HG3  . GLN A 1 18  ? 18.780  3.767   -3.602  1.00 2.17  ? 18  GLN A HG3  2  
ATOM 3205  H HE21 . GLN A 1 18  ? 15.464  4.569   -4.308  1.00 3.31  ? 18  GLN A HE21 2  
ATOM 3206  H HE22 . GLN A 1 18  ? 15.664  4.819   -5.974  1.00 3.76  ? 18  GLN A HE22 2  
ATOM 3207  N N    . ILE A 1 19  ? 14.245  3.876   -0.667  1.00 0.59  ? 19  ILE A N    2  
ATOM 3208  C CA   . ILE A 1 19  ? 12.896  3.311   -0.377  1.00 0.58  ? 19  ILE A CA   2  
ATOM 3209  C C    . ILE A 1 19  ? 11.886  4.451   -0.275  1.00 0.52  ? 19  ILE A C    2  
ATOM 3210  O O    . ILE A 1 19  ? 10.736  4.330   -0.645  1.00 0.59  ? 19  ILE A O    2  
ATOM 3211  C CB   . ILE A 1 19  ? 12.931  2.529   0.932   1.00 0.64  ? 19  ILE A CB   2  
ATOM 3212  C CG1  . ILE A 1 19  ? 13.951  1.394   0.808   1.00 0.74  ? 19  ILE A CG1  2  
ATOM 3213  C CG2  . ILE A 1 19  ? 11.545  1.944   1.213   1.00 0.73  ? 19  ILE A CG2  2  
ATOM 3214  C CD1  . ILE A 1 19  ? 14.165  0.746   2.176   1.00 0.81  ? 19  ILE A CD1  2  
ATOM 3215  H H    . ILE A 1 19  ? 14.927  3.900   0.035   1.00 0.59  ? 19  ILE A H    2  
ATOM 3216  H HA   . ILE A 1 19  ? 12.607  2.651   -1.183  1.00 0.68  ? 19  ILE A HA   2  
ATOM 3217  H HB   . ILE A 1 19  ? 13.216  3.188   1.738   1.00 0.65  ? 19  ILE A HB   2  
ATOM 3218  H HG12 . ILE A 1 19  ? 13.583  0.655   0.111   1.00 0.83  ? 19  ILE A HG12 2  
ATOM 3219  H HG13 . ILE A 1 19  ? 14.889  1.792   0.450   1.00 0.77  ? 19  ILE A HG13 2  
ATOM 3220  H HG21 . ILE A 1 19  ? 11.202  1.398   0.347   1.00 1.13  ? 19  ILE A HG21 2  
ATOM 3221  H HG22 . ILE A 1 19  ? 10.853  2.745   1.429   1.00 1.26  ? 19  ILE A HG22 2  
ATOM 3222  H HG23 . ILE A 1 19  ? 11.600  1.277   2.060   1.00 1.33  ? 19  ILE A HG23 2  
ATOM 3223  H HD11 . ILE A 1 19  ? 13.236  0.315   2.519   1.00 1.45  ? 19  ILE A HD11 2  
ATOM 3224  H HD12 . ILE A 1 19  ? 14.498  1.493   2.881   1.00 1.18  ? 19  ILE A HD12 2  
ATOM 3225  H HD13 . ILE A 1 19  ? 14.912  -0.030  2.093   1.00 1.28  ? 19  ILE A HD13 2  
ATOM 3226  N N    . MET A 1 20  ? 12.334  5.573   0.211   1.00 0.51  ? 20  MET A N    2  
ATOM 3227  C CA   . MET A 1 20  ? 11.466  6.769   0.340   1.00 0.60  ? 20  MET A CA   2  
ATOM 3228  C C    . MET A 1 20  ? 11.033  7.272   -1.037  1.00 0.55  ? 20  MET A C    2  
ATOM 3229  O O    . MET A 1 20  ? 9.867   7.452   -1.321  1.00 0.59  ? 20  MET A O    2  
ATOM 3230  C CB   . MET A 1 20  ? 12.313  7.879   1.019   1.00 0.82  ? 20  MET A CB   2  
ATOM 3231  C CG   . MET A 1 20  ? 11.390  8.877   1.753   1.00 1.07  ? 20  MET A CG   2  
ATOM 3232  S SD   . MET A 1 20  ? 10.637  8.078   3.200   1.00 1.43  ? 20  MET A SD   2  
ATOM 3233  C CE   . MET A 1 20  ? 9.022   8.898   3.121   1.00 0.93  ? 20  MET A CE   2  
ATOM 3234  H H    . MET A 1 20  ? 13.277  5.672   0.469   1.00 0.57  ? 20  MET A H    2  
ATOM 3235  H HA   . MET A 1 20  ? 10.616  6.629   0.995   1.00 0.71  ? 20  MET A HA   2  
ATOM 3236  H HB2  . MET A 1 20  ? 12.979  7.426   1.739   1.00 0.95  ? 20  MET A HB2  2  
ATOM 3237  H HB3  . MET A 1 20  ? 12.896  8.411   0.281   1.00 1.15  ? 20  MET A HB3  2  
ATOM 3238  H HG2  . MET A 1 20  ? 11.966  9.727   2.079   1.00 1.52  ? 20  MET A HG2  2  
ATOM 3239  H HG3  . MET A 1 20  ? 10.612  9.205   1.080   1.00 1.72  ? 20  MET A HG3  2  
ATOM 3240  H HE1  . MET A 1 20  ? 8.567   8.707   2.158   1.00 1.32  ? 20  MET A HE1  2  
ATOM 3241  H HE2  . MET A 1 20  ? 9.149   9.961   3.251   1.00 1.36  ? 20  MET A HE2  2  
ATOM 3242  H HE3  . MET A 1 20  ? 8.385   8.516   3.908   1.00 1.55  ? 20  MET A HE3  2  
ATOM 3243  N N    . LYS A 1 21  ? 11.999  7.499   -1.891  1.00 0.57  ? 21  LYS A N    2  
ATOM 3244  C CA   . LYS A 1 21  ? 11.715  7.992   -3.268  1.00 0.61  ? 21  LYS A CA   2  
ATOM 3245  C C    . LYS A 1 21  ? 11.007  6.919   -4.093  1.00 0.53  ? 21  LYS A C    2  
ATOM 3246  O O    . LYS A 1 21  ? 9.973   7.166   -4.680  1.00 0.51  ? 21  LYS A O    2  
ATOM 3247  C CB   . LYS A 1 21  ? 13.035  8.348   -3.957  1.00 0.72  ? 21  LYS A CB   2  
ATOM 3248  C CG   . LYS A 1 21  ? 13.619  9.620   -3.333  1.00 1.09  ? 21  LYS A CG   2  
ATOM 3249  C CD   . LYS A 1 21  ? 15.075  9.822   -3.810  1.00 1.24  ? 21  LYS A CD   2  
ATOM 3250  C CE   . LYS A 1 21  ? 16.048  9.132   -2.848  1.00 1.80  ? 21  LYS A CE   2  
ATOM 3251  N NZ   . LYS A 1 21  ? 17.433  9.242   -3.385  1.00 2.40  ? 21  LYS A NZ   2  
ATOM 3252  H H    . LYS A 1 21  ? 12.930  7.348   -1.622  1.00 0.62  ? 21  LYS A H    2  
ATOM 3253  H HA   . LYS A 1 21  ? 11.085  8.868   -3.234  1.00 0.64  ? 21  LYS A HA   2  
ATOM 3254  H HB2  . LYS A 1 21  ? 13.734  7.534   -3.837  1.00 0.99  ? 21  LYS A HB2  2  
ATOM 3255  H HB3  . LYS A 1 21  ? 12.857  8.517   -5.009  1.00 0.93  ? 21  LYS A HB3  2  
ATOM 3256  H HG2  . LYS A 1 21  ? 13.020  10.469  -3.635  1.00 1.39  ? 21  LYS A HG2  2  
ATOM 3257  H HG3  . LYS A 1 21  ? 13.597  9.534   -2.256  1.00 1.41  ? 21  LYS A HG3  2  
ATOM 3258  H HD2  . LYS A 1 21  ? 15.199  9.403   -4.800  1.00 1.54  ? 21  LYS A HD2  2  
ATOM 3259  H HD3  . LYS A 1 21  ? 15.299  10.878  -3.841  1.00 1.52  ? 21  LYS A HD3  2  
ATOM 3260  H HE2  . LYS A 1 21  ? 15.997  9.610   -1.881  1.00 2.25  ? 21  LYS A HE2  2  
ATOM 3261  H HE3  . LYS A 1 21  ? 15.780  8.091   -2.750  1.00 2.26  ? 21  LYS A HE3  2  
ATOM 3262  H HZ1  . LYS A 1 21  ? 17.508  10.092  -3.980  1.00 2.80  ? 21  LYS A HZ1  2  
ATOM 3263  H HZ2  . LYS A 1 21  ? 17.652  8.399   -3.955  1.00 2.67  ? 21  LYS A HZ2  2  
ATOM 3264  H HZ3  . LYS A 1 21  ? 18.107  9.313   -2.597  1.00 2.91  ? 21  LYS A HZ3  2  
ATOM 3265  N N    . THR A 1 22  ? 11.538  5.729   -4.153  1.00 0.53  ? 22  THR A N    2  
ATOM 3266  C CA   . THR A 1 22  ? 10.873  4.667   -4.960  1.00 0.52  ? 22  THR A CA   2  
ATOM 3267  C C    . THR A 1 22  ? 9.442   4.455   -4.470  1.00 0.45  ? 22  THR A C    2  
ATOM 3268  O O    . THR A 1 22  ? 8.526   4.351   -5.251  1.00 0.48  ? 22  THR A O    2  
ATOM 3269  C CB   . THR A 1 22  ? 11.659  3.359   -4.825  1.00 0.55  ? 22  THR A CB   2  
ATOM 3270  O OG1  . THR A 1 22  ? 13.033  3.604   -5.092  1.00 0.64  ? 22  THR A OG1  2  
ATOM 3271  C CG2  . THR A 1 22  ? 11.120  2.331   -5.822  1.00 0.62  ? 22  THR A CG2  2  
ATOM 3272  H H    . THR A 1 22  ? 12.361  5.504   -3.668  1.00 0.56  ? 22  THR A H    2  
ATOM 3273  H HA   . THR A 1 22  ? 10.853  4.968   -5.996  1.00 0.57  ? 22  THR A HA   2  
ATOM 3274  H HB   . THR A 1 22  ? 11.549  2.974   -3.823  1.00 0.52  ? 22  THR A HB   2  
ATOM 3275  H HG1  . THR A 1 22  ? 13.440  3.920   -4.282  1.00 1.05  ? 22  THR A HG1  2  
ATOM 3276  H HG21 . THR A 1 22  ? 10.081  2.129   -5.605  1.00 1.17  ? 22  THR A HG21 2  
ATOM 3277  H HG22 . THR A 1 22  ? 11.689  1.417   -5.739  1.00 1.27  ? 22  THR A HG22 2  
ATOM 3278  H HG23 . THR A 1 22  ? 11.209  2.721   -6.825  1.00 1.12  ? 22  THR A HG23 2  
ATOM 3279  N N    . GLY A 1 23  ? 9.245   4.405   -3.184  1.00 0.42  ? 23  GLY A N    2  
ATOM 3280  C CA   . GLY A 1 23  ? 7.869   4.202   -2.634  1.00 0.43  ? 23  GLY A CA   2  
ATOM 3281  C C    . GLY A 1 23  ? 6.941   5.336   -3.083  1.00 0.41  ? 23  GLY A C    2  
ATOM 3282  O O    . GLY A 1 23  ? 5.922   5.095   -3.708  1.00 0.47  ? 23  GLY A O    2  
ATOM 3283  H H    . GLY A 1 23  ? 10.001  4.511   -2.570  1.00 0.42  ? 23  GLY A H    2  
ATOM 3284  H HA2  . GLY A 1 23  ? 7.467   3.260   -2.981  1.00 0.47  ? 23  GLY A HA2  2  
ATOM 3285  H HA3  . GLY A 1 23  ? 7.931   4.157   -1.560  1.00 0.46  ? 23  GLY A HA3  2  
ATOM 3286  N N    . ALA A 1 24  ? 7.270   6.562   -2.795  1.00 0.40  ? 24  ALA A N    2  
ATOM 3287  C CA   . ALA A 1 24  ? 6.394   7.686   -3.235  1.00 0.41  ? 24  ALA A CA   2  
ATOM 3288  C C    . ALA A 1 24  ? 6.091   7.565   -4.735  1.00 0.41  ? 24  ALA A C    2  
ATOM 3289  O O    . ALA A 1 24  ? 5.101   8.068   -5.221  1.00 0.41  ? 24  ALA A O    2  
ATOM 3290  C CB   . ALA A 1 24  ? 7.129   9.008   -2.998  1.00 0.42  ? 24  ALA A CB   2  
ATOM 3291  H H    . ALA A 1 24  ? 8.090   6.760   -2.297  1.00 0.44  ? 24  ALA A H    2  
ATOM 3292  H HA   . ALA A 1 24  ? 5.489   7.700   -2.646  1.00 0.41  ? 24  ALA A HA   2  
ATOM 3293  H HB1  . ALA A 1 24  ? 7.398   9.089   -1.955  1.00 1.06  ? 24  ALA A HB1  2  
ATOM 3294  H HB2  . ALA A 1 24  ? 6.479   9.831   -3.266  1.00 1.11  ? 24  ALA A HB2  2  
ATOM 3295  H HB3  . ALA A 1 24  ? 8.021   9.041   -3.605  1.00 1.11  ? 24  ALA A HB3  2  
ATOM 3296  N N    . LEU A 1 25  ? 6.953   6.904   -5.469  1.00 0.42  ? 25  LEU A N    2  
ATOM 3297  C CA   . LEU A 1 25  ? 6.735   6.755   -6.938  1.00 0.44  ? 25  LEU A CA   2  
ATOM 3298  C C    . LEU A 1 25  ? 5.673   5.674   -7.201  1.00 0.44  ? 25  LEU A C    2  
ATOM 3299  O O    . LEU A 1 25  ? 4.783   5.856   -8.007  1.00 0.46  ? 25  LEU A O    2  
ATOM 3300  C CB   . LEU A 1 25  ? 8.075   6.382   -7.618  1.00 0.47  ? 25  LEU A CB   2  
ATOM 3301  C CG   . LEU A 1 25  ? 8.698   7.608   -8.302  1.00 0.77  ? 25  LEU A CG   2  
ATOM 3302  C CD1  . LEU A 1 25  ? 9.181   8.604   -7.247  1.00 1.58  ? 25  LEU A CD1  2  
ATOM 3303  C CD2  . LEU A 1 25  ? 9.883   7.161   -9.160  1.00 1.67  ? 25  LEU A CD2  2  
ATOM 3304  H H    . LEU A 1 25  ? 7.736   6.506   -5.040  1.00 0.43  ? 25  LEU A H    2  
ATOM 3305  H HA   . LEU A 1 25  ? 6.369   7.693   -7.332  1.00 0.43  ? 25  LEU A HA   2  
ATOM 3306  H HB2  . LEU A 1 25  ? 8.759   6.015   -6.870  1.00 0.82  ? 25  LEU A HB2  2  
ATOM 3307  H HB3  . LEU A 1 25  ? 7.912   5.611   -8.359  1.00 0.85  ? 25  LEU A HB3  2  
ATOM 3308  H HG   . LEU A 1 25  ? 7.960   8.083   -8.929  1.00 1.46  ? 25  LEU A HG   2  
ATOM 3309  H HD11 . LEU A 1 25  ? 9.415   9.546   -7.722  1.00 2.16  ? 25  LEU A HD11 2  
ATOM 3310  H HD12 . LEU A 1 25  ? 10.066  8.217   -6.766  1.00 2.10  ? 25  LEU A HD12 2  
ATOM 3311  H HD13 . LEU A 1 25  ? 8.406   8.755   -6.510  1.00 2.08  ? 25  LEU A HD13 2  
ATOM 3312  H HD21 . LEU A 1 25  ? 9.527   6.542   -9.970  1.00 2.29  ? 25  LEU A HD21 2  
ATOM 3313  H HD22 . LEU A 1 25  ? 10.574  6.596   -8.552  1.00 2.15  ? 25  LEU A HD22 2  
ATOM 3314  H HD23 . LEU A 1 25  ? 10.383  8.029   -9.563  1.00 2.16  ? 25  LEU A HD23 2  
ATOM 3315  N N    . LEU A 1 26  ? 5.784   4.537   -6.566  1.00 0.45  ? 26  LEU A N    2  
ATOM 3316  C CA   . LEU A 1 26  ? 4.798   3.447   -6.831  1.00 0.47  ? 26  LEU A CA   2  
ATOM 3317  C C    . LEU A 1 26  ? 3.374   3.997   -6.739  1.00 0.49  ? 26  LEU A C    2  
ATOM 3318  O O    . LEU A 1 26  ? 2.581   3.826   -7.644  1.00 0.52  ? 26  LEU A O    2  
ATOM 3319  C CB   . LEU A 1 26  ? 4.973   2.302   -5.826  1.00 0.51  ? 26  LEU A CB   2  
ATOM 3320  C CG   . LEU A 1 26  ? 6.453   1.935   -5.693  1.00 0.69  ? 26  LEU A CG   2  
ATOM 3321  C CD1  . LEU A 1 26  ? 6.597   0.677   -4.836  1.00 1.17  ? 26  LEU A CD1  2  
ATOM 3322  C CD2  . LEU A 1 26  ? 7.065   1.689   -7.080  1.00 1.35  ? 26  LEU A CD2  2  
ATOM 3323  H H    . LEU A 1 26  ? 6.524   4.399   -5.938  1.00 0.46  ? 26  LEU A H    2  
ATOM 3324  H HA   . LEU A 1 26  ? 4.958   3.072   -7.831  1.00 0.49  ? 26  LEU A HA   2  
ATOM 3325  H HB2  . LEU A 1 26  ? 4.594   2.611   -4.863  1.00 0.80  ? 26  LEU A HB2  2  
ATOM 3326  H HB3  . LEU A 1 26  ? 4.421   1.439   -6.168  1.00 0.81  ? 26  LEU A HB3  2  
ATOM 3327  H HG   . LEU A 1 26  ? 6.969   2.743   -5.212  1.00 1.43  ? 26  LEU A HG   2  
ATOM 3328  H HD11 . LEU A 1 26  ? 6.067   -0.139  -5.302  1.00 1.78  ? 26  LEU A HD11 2  
ATOM 3329  H HD12 . LEU A 1 26  ? 6.183   0.862   -3.855  1.00 1.70  ? 26  LEU A HD12 2  
ATOM 3330  H HD13 . LEU A 1 26  ? 7.642   0.422   -4.742  1.00 1.68  ? 26  LEU A HD13 2  
ATOM 3331  H HD21 . LEU A 1 26  ? 6.388   1.093   -7.673  1.00 1.84  ? 26  LEU A HD21 2  
ATOM 3332  H HD22 . LEU A 1 26  ? 8.005   1.164   -6.973  1.00 1.93  ? 26  LEU A HD22 2  
ATOM 3333  H HD23 . LEU A 1 26  ? 7.239   2.634   -7.572  1.00 1.89  ? 26  LEU A HD23 2  
ATOM 3334  N N    . LEU A 1 27  ? 3.024   4.637   -5.655  1.00 0.50  ? 27  LEU A N    2  
ATOM 3335  C CA   . LEU A 1 27  ? 1.629   5.156   -5.549  1.00 0.56  ? 27  LEU A CA   2  
ATOM 3336  C C    . LEU A 1 27  ? 1.379   6.165   -6.673  1.00 0.56  ? 27  LEU A C    2  
ATOM 3337  O O    . LEU A 1 27  ? 0.428   6.049   -7.420  1.00 0.60  ? 27  LEU A O    2  
ATOM 3338  C CB   . LEU A 1 27  ? 1.397   5.820   -4.190  1.00 0.64  ? 27  LEU A CB   2  
ATOM 3339  C CG   . LEU A 1 27  ? 1.938   4.930   -3.074  1.00 0.95  ? 27  LEU A CG   2  
ATOM 3340  C CD1  . LEU A 1 27  ? 1.681   5.603   -1.724  1.00 1.66  ? 27  LEU A CD1  2  
ATOM 3341  C CD2  . LEU A 1 27  ? 1.233   3.568   -3.113  1.00 1.42  ? 27  LEU A CD2  2  
ATOM 3342  H H    . LEU A 1 27  ? 3.666   4.752   -4.919  1.00 0.49  ? 27  LEU A H    2  
ATOM 3343  H HA   . LEU A 1 27  ? 0.958   4.322   -5.686  1.00 0.58  ? 27  LEU A HA   2  
ATOM 3344  H HB2  . LEU A 1 27  ? 1.907   6.773   -4.166  1.00 1.45  ? 27  LEU A HB2  2  
ATOM 3345  H HB3  . LEU A 1 27  ? 0.341   5.975   -4.040  1.00 1.04  ? 27  LEU A HB3  2  
ATOM 3346  H HG   . LEU A 1 27  ? 2.998   4.794   -3.211  1.00 1.71  ? 27  LEU A HG   2  
ATOM 3347  H HD11 . LEU A 1 27  ? 0.622   5.777   -1.605  1.00 2.02  ? 27  LEU A HD11 2  
ATOM 3348  H HD12 . LEU A 1 27  ? 2.207   6.546   -1.687  1.00 2.23  ? 27  LEU A HD12 2  
ATOM 3349  H HD13 . LEU A 1 27  ? 2.034   4.963   -0.929  1.00 2.21  ? 27  LEU A HD13 2  
ATOM 3350  H HD21 . LEU A 1 27  ? 1.650   2.970   -3.909  1.00 1.98  ? 27  LEU A HD21 2  
ATOM 3351  H HD22 . LEU A 1 27  ? 0.175   3.713   -3.287  1.00 1.93  ? 27  LEU A HD22 2  
ATOM 3352  H HD23 . LEU A 1 27  ? 1.375   3.060   -2.170  1.00 1.88  ? 27  LEU A HD23 2  
ATOM 3353  N N    . GLN A 1 28  ? 2.219   7.156   -6.798  1.00 0.55  ? 28  GLN A N    2  
ATOM 3354  C CA   . GLN A 1 28  ? 2.025   8.174   -7.873  1.00 0.58  ? 28  GLN A CA   2  
ATOM 3355  C C    . GLN A 1 28  ? 1.728   7.472   -9.201  1.00 0.54  ? 28  GLN A C    2  
ATOM 3356  O O    . GLN A 1 28  ? 0.877   7.886   -9.962  1.00 0.58  ? 28  GLN A O    2  
ATOM 3357  C CB   . GLN A 1 28  ? 3.311   8.995   -8.012  1.00 0.60  ? 28  GLN A CB   2  
ATOM 3358  C CG   . GLN A 1 28  ? 3.535   9.826   -6.738  1.00 1.00  ? 28  GLN A CG   2  
ATOM 3359  C CD   . GLN A 1 28  ? 2.756   11.143  -6.826  1.00 1.40  ? 28  GLN A CD   2  
ATOM 3360  O OE1  . GLN A 1 28  ? 1.813   11.255  -7.584  1.00 2.09  ? 28  GLN A OE1  2  
ATOM 3361  N NE2  . GLN A 1 28  ? 3.116   12.151  -6.079  1.00 1.91  ? 28  GLN A NE2  2  
ATOM 3362  H H    . GLN A 1 28  ? 2.974   7.246   -6.179  1.00 0.53  ? 28  GLN A H    2  
ATOM 3363  H HA   . GLN A 1 28  ? 1.215   8.830   -7.591  1.00 0.65  ? 28  GLN A HA   2  
ATOM 3364  H HB2  . GLN A 1 28  ? 4.147   8.324   -8.156  1.00 0.99  ? 28  GLN A HB2  2  
ATOM 3365  H HB3  . GLN A 1 28  ? 3.229   9.652   -8.865  1.00 0.92  ? 28  GLN A HB3  2  
ATOM 3366  H HG2  . GLN A 1 28  ? 3.196   9.267   -5.876  1.00 1.47  ? 28  GLN A HG2  2  
ATOM 3367  H HG3  . GLN A 1 28  ? 4.587   10.041  -6.631  1.00 1.50  ? 28  GLN A HG3  2  
ATOM 3368  H HE21 . GLN A 1 28  ? 3.877   12.061  -5.468  1.00 2.26  ? 28  GLN A HE21 2  
ATOM 3369  H HE22 . GLN A 1 28  ? 2.625   12.998  -6.128  1.00 2.37  ? 28  GLN A HE22 2  
ATOM 3370  N N    . GLY A 1 29  ? 2.446   6.418   -9.486  1.00 0.50  ? 29  GLY A N    2  
ATOM 3371  C CA   . GLY A 1 29  ? 2.235   5.684   -10.765 1.00 0.48  ? 29  GLY A CA   2  
ATOM 3372  C C    . GLY A 1 29  ? 1.021   4.760   -10.649 1.00 0.44  ? 29  GLY A C    2  
ATOM 3373  O O    . GLY A 1 29  ? 0.154   4.757   -11.501 1.00 0.50  ? 29  GLY A O    2  
ATOM 3374  H H    . GLY A 1 29  ? 3.136   6.121   -8.857  1.00 0.50  ? 29  GLY A H    2  
ATOM 3375  H HA2  . GLY A 1 29  ? 2.072   6.394   -11.563 1.00 0.49  ? 29  GLY A HA2  2  
ATOM 3376  H HA3  . GLY A 1 29  ? 3.111   5.092   -10.986 1.00 0.50  ? 29  GLY A HA3  2  
ATOM 3377  N N    . PHE A 1 30  ? 0.948   3.971   -9.611  1.00 0.44  ? 30  PHE A N    2  
ATOM 3378  C CA   . PHE A 1 30  ? -0.219  3.051   -9.472  1.00 0.43  ? 30  PHE A CA   2  
ATOM 3379  C C    . PHE A 1 30  ? -1.500  3.884   -9.362  1.00 0.40  ? 30  PHE A C    2  
ATOM 3380  O O    . PHE A 1 30  ? -2.537  3.502   -9.869  1.00 0.43  ? 30  PHE A O    2  
ATOM 3381  C CB   . PHE A 1 30  ? -0.048  2.163   -8.224  1.00 0.47  ? 30  PHE A CB   2  
ATOM 3382  C CG   . PHE A 1 30  ? -1.390  1.598   -7.795  1.00 0.47  ? 30  PHE A CG   2  
ATOM 3383  C CD1  . PHE A 1 30  ? -2.123  0.800   -8.681  1.00 1.20  ? 30  PHE A CD1  2  
ATOM 3384  C CD2  . PHE A 1 30  ? -1.905  1.883   -6.522  1.00 1.39  ? 30  PHE A CD2  2  
ATOM 3385  C CE1  . PHE A 1 30  ? -3.366  0.285   -8.297  1.00 1.21  ? 30  PHE A CE1  2  
ATOM 3386  C CE2  . PHE A 1 30  ? -3.148  1.365   -6.138  1.00 1.42  ? 30  PHE A CE2  2  
ATOM 3387  C CZ   . PHE A 1 30  ? -3.879  0.567   -7.026  1.00 0.58  ? 30  PHE A CZ   2  
ATOM 3388  H H    . PHE A 1 30  ? 1.656   3.983   -8.931  1.00 0.53  ? 30  PHE A H    2  
ATOM 3389  H HA   . PHE A 1 30  ? -0.291  2.435   -10.356 1.00 0.42  ? 30  PHE A HA   2  
ATOM 3390  H HB2  . PHE A 1 30  ? 0.623   1.347   -8.454  1.00 0.46  ? 30  PHE A HB2  2  
ATOM 3391  H HB3  . PHE A 1 30  ? 0.369   2.753   -7.420  1.00 0.54  ? 30  PHE A HB3  2  
ATOM 3392  H HD1  . PHE A 1 30  ? -1.728  0.582   -9.663  1.00 2.10  ? 30  PHE A HD1  2  
ATOM 3393  H HD2  . PHE A 1 30  ? -1.342  2.499   -5.836  1.00 2.27  ? 30  PHE A HD2  2  
ATOM 3394  H HE1  . PHE A 1 30  ? -3.930  -0.331  -8.982  1.00 2.09  ? 30  PHE A HE1  2  
ATOM 3395  H HE2  . PHE A 1 30  ? -3.544  1.583   -5.157  1.00 2.33  ? 30  PHE A HE2  2  
ATOM 3396  H HZ   . PHE A 1 30  ? -4.838  0.169   -6.730  1.00 0.65  ? 30  PHE A HZ   2  
ATOM 3397  N N    . ILE A 1 31  ? -1.447  5.014   -8.719  1.00 0.40  ? 31  ILE A N    2  
ATOM 3398  C CA   . ILE A 1 31  ? -2.674  5.846   -8.604  1.00 0.40  ? 31  ILE A CA   2  
ATOM 3399  C C    . ILE A 1 31  ? -2.934  6.550   -9.942  1.00 0.40  ? 31  ILE A C    2  
ATOM 3400  O O    . ILE A 1 31  ? -3.998  6.435   -10.519 1.00 0.43  ? 31  ILE A O    2  
ATOM 3401  C CB   . ILE A 1 31  ? -2.493  6.893   -7.495  1.00 0.41  ? 31  ILE A CB   2  
ATOM 3402  C CG1  . ILE A 1 31  ? -2.346  6.184   -6.147  1.00 0.53  ? 31  ILE A CG1  2  
ATOM 3403  C CG2  . ILE A 1 31  ? -3.726  7.799   -7.477  1.00 0.72  ? 31  ILE A CG2  2  
ATOM 3404  C CD1  . ILE A 1 31  ? -1.870  7.183   -5.091  1.00 0.48  ? 31  ILE A CD1  2  
ATOM 3405  H H    . ILE A 1 31  ? -0.608  5.320   -8.318  1.00 0.44  ? 31  ILE A H    2  
ATOM 3406  H HA   . ILE A 1 31  ? -3.517  5.215   -8.361  1.00 0.43  ? 31  ILE A HA   2  
ATOM 3407  H HB   . ILE A 1 31  ? -1.612  7.485   -7.698  1.00 0.63  ? 31  ILE A HB   2  
ATOM 3408  H HG12 . ILE A 1 31  ? -3.299  5.771   -5.850  1.00 0.77  ? 31  ILE A HG12 2  
ATOM 3409  H HG13 . ILE A 1 31  ? -1.622  5.388   -6.237  1.00 0.81  ? 31  ILE A HG13 2  
ATOM 3410  H HG21 . ILE A 1 31  ? -3.711  8.451   -8.336  1.00 1.21  ? 31  ILE A HG21 2  
ATOM 3411  H HG22 . ILE A 1 31  ? -3.714  8.393   -6.573  1.00 1.35  ? 31  ILE A HG22 2  
ATOM 3412  H HG23 . ILE A 1 31  ? -4.619  7.194   -7.496  1.00 1.33  ? 31  ILE A HG23 2  
ATOM 3413  H HD11 . ILE A 1 31  ? -0.862  7.497   -5.322  1.00 1.20  ? 31  ILE A HD11 2  
ATOM 3414  H HD12 . ILE A 1 31  ? -1.887  6.713   -4.118  1.00 0.94  ? 31  ILE A HD12 2  
ATOM 3415  H HD13 . ILE A 1 31  ? -2.524  8.042   -5.089  1.00 1.15  ? 31  ILE A HD13 2  
ATOM 3416  N N    . GLN A 1 32  ? -1.975  7.289   -10.432 1.00 0.42  ? 32  GLN A N    2  
ATOM 3417  C CA   . GLN A 1 32  ? -2.166  8.016   -11.722 1.00 0.47  ? 32  GLN A CA   2  
ATOM 3418  C C    . GLN A 1 32  ? -2.516  7.038   -12.844 1.00 0.50  ? 32  GLN A C    2  
ATOM 3419  O O    . GLN A 1 32  ? -3.427  7.260   -13.617 1.00 0.61  ? 32  GLN A O    2  
ATOM 3420  C CB   . GLN A 1 32  ? -0.874  8.758   -12.082 1.00 0.57  ? 32  GLN A CB   2  
ATOM 3421  C CG   . GLN A 1 32  ? -1.099  9.649   -13.313 1.00 1.19  ? 32  GLN A CG   2  
ATOM 3422  C CD   . GLN A 1 32  ? -1.057  8.801   -14.588 1.00 1.59  ? 32  GLN A CD   2  
ATOM 3423  O OE1  . GLN A 1 32  ? -0.099  8.093   -14.829 1.00 2.16  ? 32  GLN A OE1  2  
ATOM 3424  N NE2  . GLN A 1 32  ? -2.060  8.846   -15.422 1.00 2.21  ? 32  GLN A NE2  2  
ATOM 3425  H H    . GLN A 1 32  ? -1.131  7.382   -9.943  1.00 0.42  ? 32  GLN A H    2  
ATOM 3426  H HA   . GLN A 1 32  ? -2.966  8.732   -11.605 1.00 0.48  ? 32  GLN A HA   2  
ATOM 3427  H HB2  . GLN A 1 32  ? -0.573  9.373   -11.246 1.00 0.98  ? 32  GLN A HB2  2  
ATOM 3428  H HB3  . GLN A 1 32  ? -0.097  8.040   -12.296 1.00 1.06  ? 32  GLN A HB3  2  
ATOM 3429  H HG2  . GLN A 1 32  ? -2.060  10.137  -13.238 1.00 1.85  ? 32  GLN A HG2  2  
ATOM 3430  H HG3  . GLN A 1 32  ? -0.322  10.398  -13.359 1.00 1.72  ? 32  GLN A HG3  2  
ATOM 3431  H HE21 . GLN A 1 32  ? -2.831  9.419   -15.230 1.00 2.56  ? 32  GLN A HE21 2  
ATOM 3432  H HE22 . GLN A 1 32  ? -2.041  8.309   -16.242 1.00 2.71  ? 32  GLN A HE22 2  
ATOM 3433  N N    . ASP A 1 33  ? -1.795  5.953   -12.943 1.00 0.49  ? 33  ASP A N    2  
ATOM 3434  C CA   . ASP A 1 33  ? -2.073  4.957   -14.017 1.00 0.58  ? 33  ASP A CA   2  
ATOM 3435  C C    . ASP A 1 33  ? -3.536  4.526   -13.979 1.00 0.61  ? 33  ASP A C    2  
ATOM 3436  O O    . ASP A 1 33  ? -4.189  4.420   -14.998 1.00 0.70  ? 33  ASP A O    2  
ATOM 3437  C CB   . ASP A 1 33  ? -1.194  3.723   -13.792 1.00 0.61  ? 33  ASP A CB   2  
ATOM 3438  C CG   . ASP A 1 33  ? 0.270   4.080   -14.055 1.00 1.10  ? 33  ASP A CG   2  
ATOM 3439  O OD1  . ASP A 1 33  ? 0.595   5.254   -13.983 1.00 1.78  ? 33  ASP A OD1  2  
ATOM 3440  O OD2  . ASP A 1 33  ? 1.041   3.174   -14.325 1.00 1.89  ? 33  ASP A OD2  2  
ATOM 3441  H H    . ASP A 1 33  ? -1.065  5.776   -12.314 1.00 0.49  ? 33  ASP A H    2  
ATOM 3442  H HA   . ASP A 1 33  ? -1.837  5.376   -14.983 1.00 0.64  ? 33  ASP A HA   2  
ATOM 3443  H HB2  . ASP A 1 33  ? -1.305  3.381   -12.773 1.00 1.22  ? 33  ASP A HB2  2  
ATOM 3444  H HB3  . ASP A 1 33  ? -1.497  2.938   -14.469 1.00 1.02  ? 33  ASP A HB3  2  
ATOM 3445  N N    . ARG A 1 34  ? -4.049  4.240   -12.814 1.00 0.58  ? 34  ARG A N    2  
ATOM 3446  C CA   . ARG A 1 34  ? -5.461  3.774   -12.717 1.00 0.71  ? 34  ARG A CA   2  
ATOM 3447  C C    . ARG A 1 34  ? -6.447  4.939   -12.681 1.00 0.65  ? 34  ARG A C    2  
ATOM 3448  O O    . ARG A 1 34  ? -7.483  4.831   -13.312 1.00 0.85  ? 34  ARG A O    2  
ATOM 3449  C CB   . ARG A 1 34  ? -5.654  2.891   -11.480 1.00 0.85  ? 34  ARG A CB   2  
ATOM 3450  C CG   . ARG A 1 34  ? -7.101  2.386   -11.423 1.00 1.25  ? 34  ARG A CG   2  
ATOM 3451  C CD   . ARG A 1 34  ? -7.255  1.399   -10.265 1.00 1.31  ? 34  ARG A CD   2  
ATOM 3452  N NE   . ARG A 1 34  ? -8.691  1.025   -10.122 1.00 1.58  ? 34  ARG A NE   2  
ATOM 3453  C CZ   . ARG A 1 34  ? -9.029  -0.004  -9.394  1.00 2.09  ? 34  ARG A CZ   2  
ATOM 3454  N NH1  . ARG A 1 34  ? -8.111  -0.699  -8.782  1.00 2.58  ? 34  ARG A NH1  2  
ATOM 3455  N NH2  . ARG A 1 34  ? -10.286 -0.336  -9.277  1.00 2.75  ? 34  ARG A NH2  2  
ATOM 3456  H H    . ARG A 1 34  ? -3.499  4.305   -12.006 1.00 0.52  ? 34  ARG A H    2  
ATOM 3457  H HA   . ARG A 1 34  ? -5.738  3.230   -13.607 1.00 0.89  ? 34  ARG A HA   2  
ATOM 3458  H HB2  . ARG A 1 34  ? -4.980  2.049   -11.531 1.00 1.23  ? 34  ARG A HB2  2  
ATOM 3459  H HB3  . ARG A 1 34  ? -5.442  3.468   -10.592 1.00 1.14  ? 34  ARG A HB3  2  
ATOM 3460  H HG2  . ARG A 1 34  ? -7.771  3.221   -11.270 1.00 1.91  ? 34  ARG A HG2  2  
ATOM 3461  H HG3  . ARG A 1 34  ? -7.347  1.891   -12.350 1.00 1.90  ? 34  ARG A HG3  2  
ATOM 3462  H HD2  . ARG A 1 34  ? -6.672  0.513   -10.466 1.00 1.72  ? 34  ARG A HD2  2  
ATOM 3463  H HD3  . ARG A 1 34  ? -6.908  1.859   -9.351  1.00 2.00  ? 34  ARG A HD3  2  
ATOM 3464  H HE   . ARG A 1 34  ? -9.382  1.551   -10.577 1.00 2.02  ? 34  ARG A HE   2  
ATOM 3465  H HH11 . ARG A 1 34  ? -7.148  -0.443  -8.870  1.00 2.61  ? 34  ARG A HH11 2  
ATOM 3466  H HH12 . ARG A 1 34  ? -8.369  -1.488  -8.224  1.00 3.26  ? 34  ARG A HH12 2  
ATOM 3467  H HH21 . ARG A 1 34  ? -10.990 0.198   -9.744  1.00 3.04  ? 34  ARG A HH21 2  
ATOM 3468  H HH22 . ARG A 1 34  ? -10.545 -1.125  -8.719  1.00 3.25  ? 34  ARG A HH22 2  
ATOM 3469  N N    . ALA A 1 35  ? -6.219  6.046   -11.987 1.00 0.59  ? 35  ALA A N    2  
ATOM 3470  C CA   . ALA A 1 35  ? -7.293  7.111   -12.027 1.00 0.66  ? 35  ALA A CA   2  
ATOM 3471  C C    . ALA A 1 35  ? -7.096  7.910   -13.320 1.00 0.80  ? 35  ALA A C    2  
ATOM 3472  O O    . ALA A 1 35  ? -7.930  8.697   -13.718 1.00 0.88  ? 35  ALA A O    2  
ATOM 3473  C CB   . ALA A 1 35  ? -7.229  8.002   -10.789 1.00 0.94  ? 35  ALA A CB   2  
ATOM 3474  H H    . ALA A 1 35  ? -5.402  6.179   -11.464 1.00 0.67  ? 35  ALA A H    2  
ATOM 3475  H HA   . ALA A 1 35  ? -8.197  6.528   -12.101 1.00 0.91  ? 35  ALA A HA   2  
ATOM 3476  H HB1  . ALA A 1 35  ? -6.246  8.454   -10.728 1.00 1.48  ? 35  ALA A HB1  2  
ATOM 3477  H HB2  . ALA A 1 35  ? -7.403  7.407   -9.906  1.00 1.33  ? 35  ALA A HB2  2  
ATOM 3478  H HB3  . ALA A 1 35  ? -7.975  8.775   -10.861 1.00 1.41  ? 35  ALA A HB3  2  
ATOM 3479  N N    . GLY A 1 36  ? -5.996  7.675   -13.984 1.00 1.15  ? 36  GLY A N    2  
ATOM 3480  C CA   . GLY A 1 36  ? -5.710  8.369   -15.273 1.00 1.62  ? 36  GLY A CA   2  
ATOM 3481  C C    . GLY A 1 36  ? -6.489  7.691   -16.401 1.00 1.54  ? 36  GLY A C    2  
ATOM 3482  O O    . GLY A 1 36  ? -6.429  8.101   -17.543 1.00 2.10  ? 36  GLY A O    2  
ATOM 3483  H H    . GLY A 1 36  ? -5.356  7.022   -13.634 1.00 1.22  ? 36  GLY A H    2  
ATOM 3484  H HA2  . GLY A 1 36  ? -6.035  9.404   -15.239 1.00 2.27  ? 36  GLY A HA2  2  
ATOM 3485  H HA3  . GLY A 1 36  ? -4.653  8.322   -15.470 1.00 2.17  ? 36  GLY A HA3  2  
ATOM 3486  N N    . ARG A 1 37  ? -7.243  6.669   -16.088 1.00 2.07  ? 37  ARG A N    2  
ATOM 3487  C CA   . ARG A 1 37  ? -8.050  5.985   -17.142 1.00 2.87  ? 37  ARG A CA   2  
ATOM 3488  C C    . ARG A 1 37  ? -9.310  6.818   -17.386 1.00 3.46  ? 37  ARG A C    2  
ATOM 3489  O O    . ARG A 1 37  ? -9.964  6.694   -18.403 1.00 4.10  ? 37  ARG A O    2  
ATOM 3490  C CB   . ARG A 1 37  ? -8.438  4.580   -16.664 1.00 3.63  ? 37  ARG A CB   2  
ATOM 3491  C CG   . ARG A 1 37  ? -9.379  3.924   -17.689 1.00 4.34  ? 37  ARG A CG   2  
ATOM 3492  C CD   . ARG A 1 37  ? -9.610  2.438   -17.341 1.00 5.18  ? 37  ARG A CD   2  
ATOM 3493  N NE   . ARG A 1 37  ? -9.732  1.638   -18.601 1.00 5.74  ? 37  ARG A NE   2  
ATOM 3494  C CZ   . ARG A 1 37  ? -10.508 2.027   -19.579 1.00 6.53  ? 37  ARG A CZ   2  
ATOM 3495  N NH1  . ARG A 1 37  ? -11.313 3.042   -19.423 1.00 6.88  ? 37  ARG A NH1  2  
ATOM 3496  N NH2  . ARG A 1 37  ? -10.515 1.364   -20.703 1.00 7.21  ? 37  ARG A NH2  2  
ATOM 3497  H H    . ARG A 1 37  ? -7.294  6.364   -15.158 1.00 2.46  ? 37  ARG A H    2  
ATOM 3498  H HA   . ARG A 1 37  ? -7.475  5.917   -18.054 1.00 3.07  ? 37  ARG A HA   2  
ATOM 3499  H HB2  . ARG A 1 37  ? -7.544  3.984   -16.556 1.00 3.83  ? 37  ARG A HB2  2  
ATOM 3500  H HB3  . ARG A 1 37  ? -8.941  4.651   -15.711 1.00 3.99  ? 37  ARG A HB3  2  
ATOM 3501  H HG2  . ARG A 1 37  ? -10.321 4.449   -17.681 1.00 4.58  ? 37  ARG A HG2  2  
ATOM 3502  H HG3  . ARG A 1 37  ? -8.939  3.994   -18.674 1.00 4.48  ? 37  ARG A HG3  2  
ATOM 3503  H HD2  . ARG A 1 37  ? -8.772  2.052   -16.786 1.00 5.49  ? 37  ARG A HD2  2  
ATOM 3504  H HD3  . ARG A 1 37  ? -10.507 2.343   -16.737 1.00 5.44  ? 37  ARG A HD3  2  
ATOM 3505  H HE   . ARG A 1 37  ? -9.190  0.828   -18.710 1.00 5.74  ? 37  ARG A HE   2  
ATOM 3506  H HH11 . ARG A 1 37  ? -11.345 3.524   -18.554 1.00 6.59  ? 37  ARG A HH11 2  
ATOM 3507  H HH12 . ARG A 1 37  ? -11.898 3.336   -20.178 1.00 7.60  ? 37  ARG A HH12 2  
ATOM 3508  H HH21 . ARG A 1 37  ? -9.928  0.562   -20.814 1.00 7.21  ? 37  ARG A HH21 2  
ATOM 3509  H HH22 . ARG A 1 37  ? -11.107 1.658   -21.453 1.00 7.88  ? 37  ARG A HH22 2  
ATOM 3510  N N    . MET A 1 38  ? -9.644  7.674   -16.461 1.00 3.74  ? 38  MET A N    2  
ATOM 3511  C CA   . MET A 1 38  ? -10.850 8.533   -16.627 1.00 4.68  ? 38  MET A CA   2  
ATOM 3512  C C    . MET A 1 38  ? -10.796 9.242   -17.982 1.00 4.70  ? 38  MET A C    2  
ATOM 3513  O O    . MET A 1 38  ? -11.664 9.076   -18.816 1.00 5.17  ? 38  MET A O    2  
ATOM 3514  C CB   . MET A 1 38  ? -10.875 9.582   -15.512 1.00 5.62  ? 38  MET A CB   2  
ATOM 3515  C CG   . MET A 1 38  ? -11.102 8.890   -14.166 1.00 5.93  ? 38  MET A CG   2  
ATOM 3516  S SD   . MET A 1 38  ? -12.818 8.305   -14.072 1.00 6.79  ? 38  MET A SD   2  
ATOM 3517  C CE   . MET A 1 38  ? -12.475 6.551   -13.774 1.00 7.04  ? 38  MET A CE   2  
ATOM 3518  H H    . MET A 1 38  ? -9.094  7.759   -15.655 1.00 3.65  ? 38  MET A H    2  
ATOM 3519  H HA   . MET A 1 38  ? -11.748 7.935   -16.563 1.00 5.03  ? 38  MET A HA   2  
ATOM 3520  H HB2  . MET A 1 38  ? -9.932  10.109  -15.492 1.00 5.87  ? 38  MET A HB2  2  
ATOM 3521  H HB3  . MET A 1 38  ? -11.676 10.283  -15.693 1.00 6.19  ? 38  MET A HB3  2  
ATOM 3522  H HG2  . MET A 1 38  ? -10.422 8.057   -14.072 1.00 6.03  ? 38  MET A HG2  2  
ATOM 3523  H HG3  . MET A 1 38  ? -10.919 9.593   -13.366 1.00 5.95  ? 38  MET A HG3  2  
ATOM 3524  H HE1  . MET A 1 38  ? -13.408 6.020   -13.639 1.00 7.30  ? 38  MET A HE1  2  
ATOM 3525  H HE2  . MET A 1 38  ? -11.873 6.446   -12.887 1.00 7.32  ? 38  MET A HE2  2  
ATOM 3526  H HE3  . MET A 1 38  ? -11.941 6.141   -14.620 1.00 6.96  ? 38  MET A HE3  2  
ATOM 3527  N N    . GLY A 1 39  ? -9.781  10.032  -18.206 1.00 4.57  ? 39  GLY A N    2  
ATOM 3528  C CA   . GLY A 1 39  ? -9.668  10.754  -19.506 1.00 4.85  ? 39  GLY A CA   2  
ATOM 3529  C C    . GLY A 1 39  ? -8.402  11.612  -19.506 1.00 4.67  ? 39  GLY A C    2  
ATOM 3530  O O    . GLY A 1 39  ? -7.683  11.668  -20.484 1.00 4.95  ? 39  GLY A O    2  
ATOM 3531  H H    . GLY A 1 39  ? -9.093  10.152  -17.519 1.00 4.53  ? 39  GLY A H    2  
ATOM 3532  H HA2  . GLY A 1 39  ? -9.622  10.037  -20.313 1.00 5.27  ? 39  GLY A HA2  2  
ATOM 3533  H HA3  . GLY A 1 39  ? -10.529 11.392  -19.638 1.00 5.09  ? 39  GLY A HA3  2  
ATOM 3534  N N    . GLY A 1 40  ? -8.115  12.275  -18.420 1.00 4.58  ? 40  GLY A N    2  
ATOM 3535  C CA   . GLY A 1 40  ? -6.887  13.120  -18.368 1.00 4.69  ? 40  GLY A CA   2  
ATOM 3536  C C    . GLY A 1 40  ? -6.809  13.831  -17.017 1.00 4.20  ? 40  GLY A C    2  
ATOM 3537  O O    . GLY A 1 40  ? -7.030  15.022  -16.918 1.00 4.34  ? 40  GLY A O    2  
ATOM 3538  H H    . GLY A 1 40  ? -8.703  12.215  -17.638 1.00 4.70  ? 40  GLY A H    2  
ATOM 3539  H HA2  . GLY A 1 40  ? -6.015  12.495  -18.499 1.00 5.07  ? 40  GLY A HA2  2  
ATOM 3540  H HA3  . GLY A 1 40  ? -6.924  13.856  -19.157 1.00 5.10  ? 40  GLY A HA3  2  
ATOM 3541  N N    . GLU A 1 41  ? -6.496  13.111  -15.971 1.00 4.01  ? 41  GLU A N    2  
ATOM 3542  C CA   . GLU A 1 41  ? -6.404  13.745  -14.623 1.00 3.88  ? 41  GLU A CA   2  
ATOM 3543  C C    . GLU A 1 41  ? -4.989  14.302  -14.418 1.00 3.63  ? 41  GLU A C    2  
ATOM 3544  O O    . GLU A 1 41  ? -4.590  14.613  -13.314 1.00 4.16  ? 41  GLU A O    2  
ATOM 3545  C CB   . GLU A 1 41  ? -6.718  12.693  -13.547 1.00 4.26  ? 41  GLU A CB   2  
ATOM 3546  C CG   . GLU A 1 41  ? -7.182  13.382  -12.259 1.00 4.51  ? 41  GLU A CG   2  
ATOM 3547  C CD   . GLU A 1 41  ? -8.587  13.955  -12.461 1.00 4.90  ? 41  GLU A CD   2  
ATOM 3548  O OE1  . GLU A 1 41  ? -9.503  13.173  -12.657 1.00 5.28  ? 41  GLU A OE1  2  
ATOM 3549  O OE2  . GLU A 1 41  ? -8.723  15.166  -12.414 1.00 5.19  ? 41  GLU A OE2  2  
ATOM 3550  H H    . GLU A 1 41  ? -6.322  12.152  -16.072 1.00 4.25  ? 41  GLU A H    2  
ATOM 3551  H HA   . GLU A 1 41  ? -7.119  14.554  -14.556 1.00 4.04  ? 41  GLU A HA   2  
ATOM 3552  H HB2  . GLU A 1 41  ? -7.502  12.041  -13.906 1.00 4.56  ? 41  GLU A HB2  2  
ATOM 3553  H HB3  . GLU A 1 41  ? -5.834  12.107  -13.341 1.00 4.55  ? 41  GLU A HB3  2  
ATOM 3554  H HG2  . GLU A 1 41  ? -7.200  12.662  -11.454 1.00 4.73  ? 41  GLU A HG2  2  
ATOM 3555  H HG3  . GLU A 1 41  ? -6.502  14.182  -12.012 1.00 4.68  ? 41  GLU A HG3  2  
ATOM 3556  N N    . ALA A 1 42  ? -4.228  14.418  -15.479 1.00 3.19  ? 42  ALA A N    2  
ATOM 3557  C CA   . ALA A 1 42  ? -2.834  14.946  -15.361 1.00 3.24  ? 42  ALA A CA   2  
ATOM 3558  C C    . ALA A 1 42  ? -2.787  16.149  -14.387 1.00 2.77  ? 42  ALA A C    2  
ATOM 3559  O O    . ALA A 1 42  ? -2.021  16.117  -13.445 1.00 3.06  ? 42  ALA A O    2  
ATOM 3560  C CB   . ALA A 1 42  ? -2.313  15.365  -16.756 1.00 4.08  ? 42  ALA A CB   2  
ATOM 3561  H H    . ALA A 1 42  ? -4.567  14.140  -16.355 1.00 3.13  ? 42  ALA A H    2  
ATOM 3562  H HA   . ALA A 1 42  ? -2.205  14.167  -14.963 1.00 3.53  ? 42  ALA A HA   2  
ATOM 3563  H HB1  . ALA A 1 42  ? -3.123  15.328  -17.467 1.00 4.56  ? 42  ALA A HB1  2  
ATOM 3564  H HB2  . ALA A 1 42  ? -1.540  14.675  -17.072 1.00 4.42  ? 42  ALA A HB2  2  
ATOM 3565  H HB3  . ALA A 1 42  ? -1.899  16.363  -16.725 1.00 4.35  ? 42  ALA A HB3  2  
ATOM 3566  N N    . PRO A 1 43  ? -3.580  17.184  -14.626 1.00 2.70  ? 43  PRO A N    2  
ATOM 3567  C CA   . PRO A 1 43  ? -3.568  18.360  -13.734 1.00 3.03  ? 43  PRO A CA   2  
ATOM 3568  C C    . PRO A 1 43  ? -3.929  17.944  -12.295 1.00 2.67  ? 43  PRO A C    2  
ATOM 3569  O O    . PRO A 1 43  ? -5.021  18.182  -11.818 1.00 2.87  ? 43  PRO A O    2  
ATOM 3570  C CB   . PRO A 1 43  ? -4.612  19.332  -14.334 1.00 3.84  ? 43  PRO A CB   2  
ATOM 3571  C CG   . PRO A 1 43  ? -5.250  18.633  -15.567 1.00 3.86  ? 43  PRO A CG   2  
ATOM 3572  C CD   . PRO A 1 43  ? -4.531  17.283  -15.764 1.00 3.12  ? 43  PRO A CD   2  
ATOM 3573  H HA   . PRO A 1 43  ? -2.589  18.819  -13.747 1.00 3.46  ? 43  PRO A HA   2  
ATOM 3574  H HB2  . PRO A 1 43  ? -5.377  19.567  -13.606 1.00 4.15  ? 43  PRO A HB2  2  
ATOM 3575  H HB3  . PRO A 1 43  ? -4.125  20.243  -14.650 1.00 4.45  ? 43  PRO A HB3  2  
ATOM 3576  H HG2  . PRO A 1 43  ? -6.308  18.469  -15.391 1.00 4.34  ? 43  PRO A HG2  2  
ATOM 3577  H HG3  . PRO A 1 43  ? -5.123  19.248  -16.449 1.00 4.30  ? 43  PRO A HG3  2  
ATOM 3578  H HD2  . PRO A 1 43  ? -5.247  16.479  -15.744 1.00 3.37  ? 43  PRO A HD2  2  
ATOM 3579  H HD3  . PRO A 1 43  ? -3.999  17.288  -16.698 1.00 3.16  ? 43  PRO A HD3  2  
ATOM 3580  N N    . GLU A 1 44  ? -3.011  17.331  -11.600 1.00 2.45  ? 44  GLU A N    2  
ATOM 3581  C CA   . GLU A 1 44  ? -3.290  16.911  -10.200 1.00 2.23  ? 44  GLU A CA   2  
ATOM 3582  C C    . GLU A 1 44  ? -1.994  16.401  -9.569  1.00 1.75  ? 44  GLU A C    2  
ATOM 3583  O O    . GLU A 1 44  ? -1.451  17.008  -8.666  1.00 2.00  ? 44  GLU A O    2  
ATOM 3584  C CB   . GLU A 1 44  ? -4.345  15.795  -10.197 1.00 2.55  ? 44  GLU A CB   2  
ATOM 3585  C CG   . GLU A 1 44  ? -4.560  15.270  -8.772  1.00 2.70  ? 44  GLU A CG   2  
ATOM 3586  C CD   . GLU A 1 44  ? -4.954  16.422  -7.845  1.00 3.17  ? 44  GLU A CD   2  
ATOM 3587  O OE1  . GLU A 1 44  ? -5.593  17.347  -8.318  1.00 3.42  ? 44  GLU A OE1  2  
ATOM 3588  O OE2  . GLU A 1 44  ? -4.609  16.359  -6.676  1.00 3.77  ? 44  GLU A OE2  2  
ATOM 3589  H H    . GLU A 1 44  ? -2.136  17.151  -11.997 1.00 2.65  ? 44  GLU A H    2  
ATOM 3590  H HA   . GLU A 1 44  ? -3.655  17.759  -9.640  1.00 2.52  ? 44  GLU A HA   2  
ATOM 3591  H HB2  . GLU A 1 44  ? -5.277  16.183  -10.579 1.00 3.09  ? 44  GLU A HB2  2  
ATOM 3592  H HB3  . GLU A 1 44  ? -4.010  14.985  -10.826 1.00 2.66  ? 44  GLU A HB3  2  
ATOM 3593  H HG2  . GLU A 1 44  ? -5.349  14.533  -8.782  1.00 2.90  ? 44  GLU A HG2  2  
ATOM 3594  H HG3  . GLU A 1 44  ? -3.651  14.815  -8.413  1.00 2.84  ? 44  GLU A HG3  2  
ATOM 3595  N N    . LEU A 1 45  ? -1.494  15.289  -10.035 1.00 1.80  ? 45  LEU A N    2  
ATOM 3596  C CA   . LEU A 1 45  ? -0.235  14.741  -9.458  1.00 1.80  ? 45  LEU A CA   2  
ATOM 3597  C C    . LEU A 1 45  ? 0.967   15.505  -10.017 1.00 2.29  ? 45  LEU A C    2  
ATOM 3598  O O    . LEU A 1 45  ? 1.957   14.923  -10.412 1.00 3.01  ? 45  LEU A O    2  
ATOM 3599  C CB   . LEU A 1 45  ? -0.112  13.253  -9.810  1.00 2.23  ? 45  LEU A CB   2  
ATOM 3600  C CG   . LEU A 1 45  ? -1.393  12.492  -9.363  1.00 2.52  ? 45  LEU A CG   2  
ATOM 3601  C CD1  . LEU A 1 45  ? -2.275  12.181  -10.579 1.00 3.22  ? 45  LEU A CD1  2  
ATOM 3602  C CD2  . LEU A 1 45  ? -1.010  11.174  -8.675  1.00 3.00  ? 45  LEU A CD2  2  
ATOM 3603  H H    . LEU A 1 45  ? -1.948  14.814  -10.762 1.00 2.30  ? 45  LEU A H    2  
ATOM 3604  H HA   . LEU A 1 45  ? -0.258  14.850  -8.383  1.00 1.80  ? 45  LEU A HA   2  
ATOM 3605  H HB2  . LEU A 1 45  ? 0.028   13.153  -10.879 1.00 2.70  ? 45  LEU A HB2  2  
ATOM 3606  H HB3  . LEU A 1 45  ? 0.751   12.845  -9.303  1.00 2.51  ? 45  LEU A HB3  2  
ATOM 3607  H HG   . LEU A 1 45  ? -1.959  13.100  -8.668  1.00 2.66  ? 45  LEU A HG   2  
ATOM 3608  H HD11 . LEU A 1 45  ? -3.208  11.752  -10.246 1.00 3.55  ? 45  LEU A HD11 2  
ATOM 3609  H HD12 . LEU A 1 45  ? -1.765  11.480  -11.223 1.00 3.48  ? 45  LEU A HD12 2  
ATOM 3610  H HD13 . LEU A 1 45  ? -2.471  13.093  -11.123 1.00 3.69  ? 45  LEU A HD13 2  
ATOM 3611  H HD21 . LEU A 1 45  ? -0.571  11.388  -7.711  1.00 3.29  ? 45  LEU A HD21 2  
ATOM 3612  H HD22 . LEU A 1 45  ? -0.295  10.643  -9.286  1.00 3.34  ? 45  LEU A HD22 2  
ATOM 3613  H HD23 . LEU A 1 45  ? -1.892  10.567  -8.542  1.00 3.35  ? 45  LEU A HD23 2  
ATOM 3614  N N    . ALA A 1 46  ? 0.894   16.807  -10.029 1.00 2.46  ? 46  ALA A N    2  
ATOM 3615  C CA   . ALA A 1 46  ? 2.036   17.620  -10.536 1.00 3.15  ? 46  ALA A CA   2  
ATOM 3616  C C    . ALA A 1 46  ? 3.198   17.490  -9.547  1.00 2.91  ? 46  ALA A C    2  
ATOM 3617  O O    . ALA A 1 46  ? 3.456   18.389  -8.771  1.00 3.07  ? 46  ALA A O    2  
ATOM 3618  C CB   . ALA A 1 46  ? 1.626   19.092  -10.585 1.00 4.05  ? 46  ALA A CB   2  
ATOM 3619  H H    . ALA A 1 46  ? 0.093   17.255  -9.683  1.00 2.52  ? 46  ALA A H    2  
ATOM 3620  H HA   . ALA A 1 46  ? 2.336   17.281  -11.515 1.00 3.67  ? 46  ALA A HA   2  
ATOM 3621  H HB1  . ALA A 1 46  ? 0.798   19.210  -11.270 1.00 4.47  ? 46  ALA A HB1  2  
ATOM 3622  H HB2  . ALA A 1 46  ? 2.460   19.687  -10.925 1.00 4.32  ? 46  ALA A HB2  2  
ATOM 3623  H HB3  . ALA A 1 46  ? 1.327   19.418  -9.601  1.00 4.43  ? 46  ALA A HB3  2  
ATOM 3624  N N    . LEU A 1 47  ? 3.890   16.385  -9.538  1.00 3.18  ? 47  LEU A N    2  
ATOM 3625  C CA   . LEU A 1 47  ? 5.005   16.239  -8.560  1.00 3.43  ? 47  LEU A CA   2  
ATOM 3626  C C    . LEU A 1 47  ? 5.871   15.020  -8.905  1.00 3.14  ? 47  LEU A C    2  
ATOM 3627  O O    . LEU A 1 47  ? 6.363   14.343  -8.024  1.00 3.51  ? 47  LEU A O    2  
ATOM 3628  C CB   . LEU A 1 47  ? 4.390   16.057  -7.149  1.00 4.05  ? 47  LEU A CB   2  
ATOM 3629  C CG   . LEU A 1 47  ? 5.212   16.825  -6.098  1.00 4.77  ? 47  LEU A CG   2  
ATOM 3630  C CD1  . LEU A 1 47  ? 4.513   16.746  -4.742  1.00 5.26  ? 47  LEU A CD1  2  
ATOM 3631  C CD2  . LEU A 1 47  ? 6.608   16.207  -5.990  1.00 5.35  ? 47  LEU A CD2  2  
ATOM 3632  H H    . LEU A 1 47  ? 3.669   15.654  -10.152 1.00 3.59  ? 47  LEU A H    2  
ATOM 3633  H HA   . LEU A 1 47  ? 5.606   17.138  -8.557  1.00 3.88  ? 47  LEU A HA   2  
ATOM 3634  H HB2  . LEU A 1 47  ? 3.380   16.440  -7.153  1.00 4.17  ? 47  LEU A HB2  2  
ATOM 3635  H HB3  . LEU A 1 47  ? 4.368   15.009  -6.884  1.00 4.35  ? 47  LEU A HB3  2  
ATOM 3636  H HG   . LEU A 1 47  ? 5.297   17.862  -6.393  1.00 5.01  ? 47  LEU A HG   2  
ATOM 3637  H HD11 . LEU A 1 47  ? 3.537   17.203  -4.814  1.00 5.48  ? 47  LEU A HD11 2  
ATOM 3638  H HD12 . LEU A 1 47  ? 5.101   17.269  -4.003  1.00 5.52  ? 47  LEU A HD12 2  
ATOM 3639  H HD13 . LEU A 1 47  ? 4.406   15.711  -4.452  1.00 5.56  ? 47  LEU A HD13 2  
ATOM 3640  H HD21 . LEU A 1 47  ? 7.131   16.331  -6.927  1.00 5.82  ? 47  LEU A HD21 2  
ATOM 3641  H HD22 . LEU A 1 47  ? 6.519   15.155  -5.764  1.00 5.59  ? 47  LEU A HD22 2  
ATOM 3642  H HD23 . LEU A 1 47  ? 7.159   16.699  -5.202  1.00 5.48  ? 47  LEU A HD23 2  
ATOM 3643  N N    . ASP A 1 48  ? 6.059   14.718  -10.163 1.00 3.02  ? 48  ASP A N    2  
ATOM 3644  C CA   . ASP A 1 48  ? 6.892   13.527  -10.505 1.00 3.07  ? 48  ASP A CA   2  
ATOM 3645  C C    . ASP A 1 48  ? 7.498   13.665  -11.927 1.00 2.77  ? 48  ASP A C    2  
ATOM 3646  O O    . ASP A 1 48  ? 7.073   13.006  -12.851 1.00 2.85  ? 48  ASP A O    2  
ATOM 3647  C CB   . ASP A 1 48  ? 6.025   12.251  -10.381 1.00 3.61  ? 48  ASP A CB   2  
ATOM 3648  C CG   . ASP A 1 48  ? 5.208   11.994  -11.653 1.00 4.22  ? 48  ASP A CG   2  
ATOM 3649  O OD1  . ASP A 1 48  ? 4.410   12.848  -12.002 1.00 4.68  ? 48  ASP A OD1  2  
ATOM 3650  O OD2  . ASP A 1 48  ? 5.402   10.953  -12.259 1.00 4.69  ? 48  ASP A OD2  2  
ATOM 3651  H H    . ASP A 1 48  ? 5.655   15.262  -10.870 1.00 3.25  ? 48  ASP A H    2  
ATOM 3652  H HA   . ASP A 1 48  ? 7.701   13.453  -9.792  1.00 3.56  ? 48  ASP A HA   2  
ATOM 3653  H HB2  . ASP A 1 48  ? 6.668   11.408  -10.178 1.00 4.01  ? 48  ASP A HB2  2  
ATOM 3654  H HB3  . ASP A 1 48  ? 5.341   12.358  -9.551  1.00 3.81  ? 48  ASP A HB3  2  
ATOM 3655  N N    . PRO A 1 49  ? 8.496   14.513  -12.069 1.00 3.11  ? 49  PRO A N    2  
ATOM 3656  C CA   . PRO A 1 49  ? 9.161   14.702  -13.379 1.00 3.40  ? 49  PRO A CA   2  
ATOM 3657  C C    . PRO A 1 49  ? 9.900   13.398  -13.740 1.00 3.08  ? 49  PRO A C    2  
ATOM 3658  O O    . PRO A 1 49  ? 11.067  13.384  -14.076 1.00 3.32  ? 49  PRO A O    2  
ATOM 3659  C CB   . PRO A 1 49  ? 10.150  15.875  -13.145 1.00 4.36  ? 49  PRO A CB   2  
ATOM 3660  C CG   . PRO A 1 49  ? 10.058  16.278  -11.642 1.00 4.66  ? 49  PRO A CG   2  
ATOM 3661  C CD   . PRO A 1 49  ? 9.031   15.343  -10.968 1.00 3.86  ? 49  PRO A CD   2  
ATOM 3662  H HA   . PRO A 1 49  ? 8.439   14.960  -14.136 1.00 3.68  ? 49  PRO A HA   2  
ATOM 3663  H HB2  . PRO A 1 49  ? 11.162  15.572  -13.383 1.00 4.57  ? 49  PRO A HB2  2  
ATOM 3664  H HB3  . PRO A 1 49  ? 9.873   16.717  -13.762 1.00 4.94  ? 49  PRO A HB3  2  
ATOM 3665  H HG2  . PRO A 1 49  ? 11.028  16.166  -11.170 1.00 5.13  ? 49  PRO A HG2  2  
ATOM 3666  H HG3  . PRO A 1 49  ? 9.730   17.305  -11.553 1.00 5.26  ? 49  PRO A HG3  2  
ATOM 3667  H HD2  . PRO A 1 49  ? 9.523   14.723  -10.229 1.00 4.06  ? 49  PRO A HD2  2  
ATOM 3668  H HD3  . PRO A 1 49  ? 8.234   15.913  -10.511 1.00 4.03  ? 49  PRO A HD3  2  
ATOM 3669  N N    . VAL A 1 50  ? 9.186   12.310  -13.711 1.00 3.08  ? 50  VAL A N    2  
ATOM 3670  C CA   . VAL A 1 50  ? 9.762   10.987  -14.071 1.00 3.10  ? 50  VAL A CA   2  
ATOM 3671  C C    . VAL A 1 50  ? 8.648   10.144  -14.756 1.00 2.75  ? 50  VAL A C    2  
ATOM 3672  O O    . VAL A 1 50  ? 7.658   9.835   -14.124 1.00 2.91  ? 50  VAL A O    2  
ATOM 3673  C CB   . VAL A 1 50  ? 10.246  10.269  -12.804 1.00 3.88  ? 50  VAL A CB   2  
ATOM 3674  C CG1  . VAL A 1 50  ? 11.646  10.768  -12.440 1.00 4.44  ? 50  VAL A CG1  2  
ATOM 3675  C CG2  . VAL A 1 50  ? 9.291   10.562  -11.645 1.00 4.50  ? 50  VAL A CG2  2  
ATOM 3676  H H    . VAL A 1 50  ? 8.238   12.366  -13.463 1.00 3.41  ? 50  VAL A H    2  
ATOM 3677  H HA   . VAL A 1 50  ? 10.576  11.077  -14.754 1.00 3.39  ? 50  VAL A HA   2  
ATOM 3678  H HB   . VAL A 1 50  ? 10.283  9.202   -12.983 1.00 4.18  ? 50  VAL A HB   2  
ATOM 3679  H HG11 . VAL A 1 50  ? 11.974  10.291  -11.530 1.00 4.70  ? 50  VAL A HG11 2  
ATOM 3680  H HG12 . VAL A 1 50  ? 11.619  11.838  -12.297 1.00 4.81  ? 50  VAL A HG12 2  
ATOM 3681  H HG13 . VAL A 1 50  ? 12.332  10.530  -13.240 1.00 4.69  ? 50  VAL A HG13 2  
ATOM 3682  H HG21 . VAL A 1 50  ? 8.281   10.319  -11.935 1.00 4.87  ? 50  VAL A HG21 2  
ATOM 3683  H HG22 . VAL A 1 50  ? 9.350   11.608  -11.387 1.00 4.87  ? 50  VAL A HG22 2  
ATOM 3684  H HG23 . VAL A 1 50  ? 9.573   9.964   -10.790 1.00 4.69  ? 50  VAL A HG23 2  
ATOM 3685  N N    . PRO A 1 51  ? 8.810   9.801   -16.037 1.00 2.91  ? 51  PRO A N    2  
ATOM 3686  C CA   . PRO A 1 51  ? 7.780   9.020   -16.753 1.00 3.22  ? 51  PRO A CA   2  
ATOM 3687  C C    . PRO A 1 51  ? 7.577   7.648   -16.097 1.00 2.93  ? 51  PRO A C    2  
ATOM 3688  O O    . PRO A 1 51  ? 6.566   7.395   -15.476 1.00 3.37  ? 51  PRO A O    2  
ATOM 3689  C CB   . PRO A 1 51  ? 8.315   8.866   -18.198 1.00 4.09  ? 51  PRO A CB   2  
ATOM 3690  C CG   . PRO A 1 51  ? 9.711   9.545   -18.256 1.00 4.27  ? 51  PRO A CG   2  
ATOM 3691  C CD   . PRO A 1 51  ? 9.993   10.148  -16.868 1.00 3.50  ? 51  PRO A CD   2  
ATOM 3692  H HA   . PRO A 1 51  ? 6.847   9.563   -16.764 1.00 3.54  ? 51  PRO A HA   2  
ATOM 3693  H HB2  . PRO A 1 51  ? 8.404   7.816   -18.458 1.00 4.31  ? 51  PRO A HB2  2  
ATOM 3694  H HB3  . PRO A 1 51  ? 7.647   9.354   -18.894 1.00 4.69  ? 51  PRO A HB3  2  
ATOM 3695  H HG2  . PRO A 1 51  ? 10.469  8.809   -18.502 1.00 4.68  ? 51  PRO A HG2  2  
ATOM 3696  H HG3  . PRO A 1 51  ? 9.713   10.328  -19.002 1.00 4.85  ? 51  PRO A HG3  2  
ATOM 3697  H HD2  . PRO A 1 51  ? 10.892  9.708   -16.450 1.00 3.62  ? 51  PRO A HD2  2  
ATOM 3698  H HD3  . PRO A 1 51  ? 10.094  11.224  -16.940 1.00 3.69  ? 51  PRO A HD3  2  
ATOM 3699  N N    . GLN A 1 52  ? 8.537   6.768   -16.229 1.00 2.70  ? 52  GLN A N    2  
ATOM 3700  C CA   . GLN A 1 52  ? 8.392   5.419   -15.615 1.00 2.85  ? 52  GLN A CA   2  
ATOM 3701  C C    . GLN A 1 52  ? 9.692   4.620   -15.767 1.00 2.14  ? 52  GLN A C    2  
ATOM 3702  O O    . GLN A 1 52  ? 10.281  4.558   -16.828 1.00 2.38  ? 52  GLN A O    2  
ATOM 3703  C CB   . GLN A 1 52  ? 7.256   4.663   -16.314 1.00 3.67  ? 52  GLN A CB   2  
ATOM 3704  C CG   . GLN A 1 52  ? 7.084   3.289   -15.667 1.00 4.37  ? 52  GLN A CG   2  
ATOM 3705  C CD   . GLN A 1 52  ? 5.827   2.615   -16.223 1.00 5.22  ? 52  GLN A CD   2  
ATOM 3706  O OE1  . GLN A 1 52  ? 4.994   2.147   -15.473 1.00 5.74  ? 52  GLN A OE1  2  
ATOM 3707  N NE2  . GLN A 1 52  ? 5.654   2.546   -17.515 1.00 5.74  ? 52  GLN A NE2  2  
ATOM 3708  H H    . GLN A 1 52  ? 9.352   7.012   -16.715 1.00 2.82  ? 52  GLN A H    2  
ATOM 3709  H HA   . GLN A 1 52  ? 8.157   5.526   -14.567 1.00 3.35  ? 52  GLN A HA   2  
ATOM 3710  H HB2  . GLN A 1 52  ? 6.336   5.220   -16.220 1.00 4.06  ? 52  GLN A HB2  2  
ATOM 3711  H HB3  . GLN A 1 52  ? 7.496   4.538   -17.359 1.00 3.91  ? 52  GLN A HB3  2  
ATOM 3712  H HG2  . GLN A 1 52  ? 7.948   2.683   -15.887 1.00 4.50  ? 52  GLN A HG2  2  
ATOM 3713  H HG3  . GLN A 1 52  ? 6.986   3.403   -14.598 1.00 4.63  ? 52  GLN A HG3  2  
ATOM 3714  H HE21 . GLN A 1 52  ? 6.326   2.924   -18.120 1.00 5.63  ? 52  GLN A HE21 2  
ATOM 3715  H HE22 . GLN A 1 52  ? 4.852   2.117   -17.880 1.00 6.45  ? 52  GLN A HE22 2  
ATOM 3716  N N    . ASP A 1 53  ? 10.121  3.990   -14.709 1.00 1.78  ? 53  ASP A N    2  
ATOM 3717  C CA   . ASP A 1 53  ? 11.362  3.158   -14.751 1.00 1.30  ? 53  ASP A CA   2  
ATOM 3718  C C    . ASP A 1 53  ? 10.972  1.691   -14.959 1.00 1.07  ? 53  ASP A C    2  
ATOM 3719  O O    . ASP A 1 53  ? 9.917   1.246   -14.554 1.00 1.19  ? 53  ASP A O    2  
ATOM 3720  C CB   . ASP A 1 53  ? 12.127  3.302   -13.434 1.00 1.65  ? 53  ASP A CB   2  
ATOM 3721  C CG   . ASP A 1 53  ? 12.311  4.784   -13.108 1.00 2.27  ? 53  ASP A CG   2  
ATOM 3722  O OD1  . ASP A 1 53  ? 11.355  5.395   -12.659 1.00 2.91  ? 53  ASP A OD1  2  
ATOM 3723  O OD2  . ASP A 1 53  ? 13.405  5.284   -13.313 1.00 2.80  ? 53  ASP A OD2  2  
ATOM 3724  H H    . ASP A 1 53  ? 9.610   4.048   -13.875 1.00 2.24  ? 53  ASP A H    2  
ATOM 3725  H HA   . ASP A 1 53  ? 12.002  3.416   -15.582 1.00 1.41  ? 53  ASP A HA   2  
ATOM 3726  H HB2  . ASP A 1 53  ? 11.569  2.825   -12.641 1.00 2.08  ? 53  ASP A HB2  2  
ATOM 3727  H HB3  . ASP A 1 53  ? 13.094  2.832   -13.526 1.00 2.01  ? 53  ASP A HB3  2  
ATOM 3728  N N    . ALA A 1 54  ? 11.822  0.947   -15.624 1.00 0.91  ? 54  ALA A N    2  
ATOM 3729  C CA   . ALA A 1 54  ? 11.522  -0.487  -15.907 1.00 0.84  ? 54  ALA A CA   2  
ATOM 3730  C C    . ALA A 1 54  ? 11.350  -1.264  -14.603 1.00 0.76  ? 54  ALA A C    2  
ATOM 3731  O O    . ALA A 1 54  ? 10.517  -2.142  -14.502 1.00 0.75  ? 54  ALA A O    2  
ATOM 3732  C CB   . ALA A 1 54  ? 12.673  -1.096  -16.711 1.00 0.95  ? 54  ALA A CB   2  
ATOM 3733  H H    . ALA A 1 54  ? 12.656  1.342   -15.955 1.00 0.99  ? 54  ALA A H    2  
ATOM 3734  H HA   . ALA A 1 54  ? 10.611  -0.544  -16.485 1.00 0.99  ? 54  ALA A HA   2  
ATOM 3735  H HB1  . ALA A 1 54  ? 13.585  -1.034  -16.135 1.00 1.41  ? 54  ALA A HB1  2  
ATOM 3736  H HB2  . ALA A 1 54  ? 12.794  -0.553  -17.636 1.00 1.35  ? 54  ALA A HB2  2  
ATOM 3737  H HB3  . ALA A 1 54  ? 12.453  -2.131  -16.927 1.00 1.49  ? 54  ALA A HB3  2  
ATOM 3738  N N    . SER A 1 55  ? 12.113  -0.943  -13.596 1.00 0.75  ? 55  SER A N    2  
ATOM 3739  C CA   . SER A 1 55  ? 11.969  -1.663  -12.300 1.00 0.71  ? 55  SER A CA   2  
ATOM 3740  C C    . SER A 1 55  ? 10.580  -1.382  -11.733 1.00 0.66  ? 55  SER A C    2  
ATOM 3741  O O    . SER A 1 55  ? 9.894   -2.267  -11.260 1.00 0.66  ? 55  SER A O    2  
ATOM 3742  C CB   . SER A 1 55  ? 13.027  -1.158  -11.318 1.00 0.76  ? 55  SER A CB   2  
ATOM 3743  O OG   . SER A 1 55  ? 14.321  -1.451  -11.829 1.00 1.37  ? 55  SER A OG   2  
ATOM 3744  H H    . SER A 1 55  ? 12.766  -0.216  -13.675 1.00 0.79  ? 55  SER A H    2  
ATOM 3745  H HA   . SER A 1 55  ? 12.094  -2.726  -12.448 1.00 0.71  ? 55  SER A HA   2  
ATOM 3746  H HB2  . SER A 1 55  ? 12.928  -0.092  -11.195 1.00 0.95  ? 55  SER A HB2  2  
ATOM 3747  H HB3  . SER A 1 55  ? 12.888  -1.642  -10.360 1.00 1.26  ? 55  SER A HB3  2  
ATOM 3748  H HG   . SER A 1 55  ? 14.341  -1.194  -12.754 1.00 1.82  ? 55  SER A HG   2  
ATOM 3749  N N    . THR A 1 56  ? 10.168  -0.147  -11.771 1.00 0.65  ? 56  THR A N    2  
ATOM 3750  C CA   . THR A 1 56  ? 8.833   0.215   -11.228 1.00 0.62  ? 56  THR A CA   2  
ATOM 3751  C C    . THR A 1 56  ? 7.732   -0.181  -12.217 1.00 0.59  ? 56  THR A C    2  
ATOM 3752  O O    . THR A 1 56  ? 6.581   -0.306  -11.850 1.00 0.57  ? 56  THR A O    2  
ATOM 3753  C CB   . THR A 1 56  ? 8.767   1.731   -11.015 1.00 0.67  ? 56  THR A CB   2  
ATOM 3754  O OG1  . THR A 1 56  ? 9.239   2.388   -12.182 1.00 1.09  ? 56  THR A OG1  2  
ATOM 3755  C CG2  . THR A 1 56  ? 9.626   2.146   -9.819  1.00 1.06  ? 56  THR A CG2  2  
ATOM 3756  H H    . THR A 1 56  ? 10.745  0.549   -12.150 1.00 0.67  ? 56  THR A H    2  
ATOM 3757  H HA   . THR A 1 56  ? 8.676   -0.289  -10.287 1.00 0.61  ? 56  THR A HA   2  
ATOM 3758  H HB   . THR A 1 56  ? 7.744   2.023   -10.831 1.00 1.01  ? 56  THR A HB   2  
ATOM 3759  H HG1  . THR A 1 56  ? 9.096   3.331   -12.071 1.00 1.69  ? 56  THR A HG1  2  
ATOM 3760  H HG21 . THR A 1 56  ? 9.295   1.617   -8.937  1.00 1.65  ? 56  THR A HG21 2  
ATOM 3761  H HG22 . THR A 1 56  ? 9.530   3.209   -9.658  1.00 1.60  ? 56  THR A HG22 2  
ATOM 3762  H HG23 . THR A 1 56  ? 10.659  1.903   -10.017 1.00 1.42  ? 56  THR A HG23 2  
ATOM 3763  N N    . LYS A 1 57  ? 8.058   -0.350  -13.473 1.00 0.61  ? 57  LYS A N    2  
ATOM 3764  C CA   . LYS A 1 57  ? 6.994   -0.698  -14.459 1.00 0.59  ? 57  LYS A CA   2  
ATOM 3765  C C    . LYS A 1 57  ? 6.455   -2.100  -14.169 1.00 0.54  ? 57  LYS A C    2  
ATOM 3766  O O    . LYS A 1 57  ? 5.263   -2.334  -14.208 1.00 0.52  ? 57  LYS A O    2  
ATOM 3767  C CB   . LYS A 1 57  ? 7.561   -0.624  -15.882 1.00 0.65  ? 57  LYS A CB   2  
ATOM 3768  C CG   . LYS A 1 57  ? 6.500   -1.058  -16.911 1.00 1.20  ? 57  LYS A CG   2  
ATOM 3769  C CD   . LYS A 1 57  ? 6.401   -2.608  -17.006 1.00 1.33  ? 57  LYS A CD   2  
ATOM 3770  C CE   . LYS A 1 57  ? 6.316   -3.041  -18.475 1.00 1.94  ? 57  LYS A CE   2  
ATOM 3771  N NZ   . LYS A 1 57  ? 6.101   -4.512  -18.548 1.00 2.73  ? 57  LYS A NZ   2  
ATOM 3772  H H    . LYS A 1 57  ? 8.985   -0.224  -13.766 1.00 0.68  ? 57  LYS A H    2  
ATOM 3773  H HA   . LYS A 1 57  ? 6.203   0.024   -14.329 1.00 0.59  ? 57  LYS A HA   2  
ATOM 3774  H HB2  . LYS A 1 57  ? 7.860   0.390   -16.088 1.00 0.96  ? 57  LYS A HB2  2  
ATOM 3775  H HB3  . LYS A 1 57  ? 8.426   -1.265  -15.957 1.00 1.25  ? 57  LYS A HB3  2  
ATOM 3776  H HG2  . LYS A 1 57  ? 5.539   -0.654  -16.619 1.00 1.84  ? 57  LYS A HG2  2  
ATOM 3777  H HG3  . LYS A 1 57  ? 6.769   -0.651  -17.877 1.00 1.68  ? 57  LYS A HG3  2  
ATOM 3778  H HD2  . LYS A 1 57  ? 7.266   -3.072  -16.555 1.00 1.66  ? 57  LYS A HD2  2  
ATOM 3779  H HD3  . LYS A 1 57  ? 5.513   -2.944  -16.489 1.00 1.74  ? 57  LYS A HD3  2  
ATOM 3780  H HE2  . LYS A 1 57  ? 5.492   -2.532  -18.954 1.00 2.29  ? 57  LYS A HE2  2  
ATOM 3781  H HE3  . LYS A 1 57  ? 7.237   -2.786  -18.978 1.00 2.31  ? 57  LYS A HE3  2  
ATOM 3782  H HZ1  . LYS A 1 57  ? 6.807   -4.935  -19.184 1.00 3.19  ? 57  LYS A HZ1  2  
ATOM 3783  H HZ2  . LYS A 1 57  ? 5.145   -4.705  -18.912 1.00 3.07  ? 57  LYS A HZ2  2  
ATOM 3784  H HZ3  . LYS A 1 57  ? 6.201   -4.925  -17.600 1.00 3.14  ? 57  LYS A HZ3  2  
ATOM 3785  N N    . LYS A 1 58  ? 7.313   -3.034  -13.869 1.00 0.55  ? 58  LYS A N    2  
ATOM 3786  C CA   . LYS A 1 58  ? 6.825   -4.410  -13.570 1.00 0.53  ? 58  LYS A CA   2  
ATOM 3787  C C    . LYS A 1 58  ? 6.156   -4.394  -12.188 1.00 0.48  ? 58  LYS A C    2  
ATOM 3788  O O    . LYS A 1 58  ? 5.128   -5.012  -11.978 1.00 0.46  ? 58  LYS A O    2  
ATOM 3789  C CB   . LYS A 1 58  ? 8.015   -5.389  -13.591 1.00 0.56  ? 58  LYS A CB   2  
ATOM 3790  C CG   . LYS A 1 58  ? 7.567   -6.768  -14.095 1.00 0.78  ? 58  LYS A CG   2  
ATOM 3791  C CD   . LYS A 1 58  ? 6.460   -7.319  -13.190 1.00 0.96  ? 58  LYS A CD   2  
ATOM 3792  C CE   . LYS A 1 58  ? 6.311   -8.826  -13.420 1.00 0.85  ? 58  LYS A CE   2  
ATOM 3793  N NZ   . LYS A 1 58  ? 6.243   -9.102  -14.883 1.00 1.75  ? 58  LYS A NZ   2  
ATOM 3794  H H    . LYS A 1 58  ? 8.271   -2.831  -13.834 1.00 0.59  ? 58  LYS A H    2  
ATOM 3795  H HA   . LYS A 1 58  ? 6.093   -4.688  -14.315 1.00 0.53  ? 58  LYS A HA   2  
ATOM 3796  H HB2  . LYS A 1 58  ? 8.778   -5.002  -14.252 1.00 0.79  ? 58  LYS A HB2  2  
ATOM 3797  H HB3  . LYS A 1 58  ? 8.428   -5.489  -12.597 1.00 0.71  ? 58  LYS A HB3  2  
ATOM 3798  H HG2  . LYS A 1 58  ? 7.194   -6.675  -15.105 1.00 1.49  ? 58  LYS A HG2  2  
ATOM 3799  H HG3  . LYS A 1 58  ? 8.410   -7.443  -14.084 1.00 1.56  ? 58  LYS A HG3  2  
ATOM 3800  H HD2  . LYS A 1 58  ? 6.714   -7.136  -12.156 1.00 1.72  ? 58  LYS A HD2  2  
ATOM 3801  H HD3  . LYS A 1 58  ? 5.528   -6.829  -13.424 1.00 1.67  ? 58  LYS A HD3  2  
ATOM 3802  H HE2  . LYS A 1 58  ? 7.159   -9.341  -12.995 1.00 1.27  ? 58  LYS A HE2  2  
ATOM 3803  H HE3  . LYS A 1 58  ? 5.404   -9.174  -12.946 1.00 1.24  ? 58  LYS A HE3  2  
ATOM 3804  H HZ1  . LYS A 1 58  ? 7.193   -9.015  -15.297 1.00 2.20  ? 58  LYS A HZ1  2  
ATOM 3805  H HZ2  . LYS A 1 58  ? 5.603   -8.417  -15.335 1.00 2.19  ? 58  LYS A HZ2  2  
ATOM 3806  H HZ3  . LYS A 1 58  ? 5.887   -10.066 -15.038 1.00 2.31  ? 58  LYS A HZ3  2  
ATOM 3807  N N    . LEU A 1 59  ? 6.732   -3.704  -11.242 1.00 0.50  ? 59  LEU A N    2  
ATOM 3808  C CA   . LEU A 1 59  ? 6.121   -3.674  -9.883  1.00 0.47  ? 59  LEU A CA   2  
ATOM 3809  C C    . LEU A 1 59  ? 4.782   -2.919  -9.954  1.00 0.43  ? 59  LEU A C    2  
ATOM 3810  O O    . LEU A 1 59  ? 3.884   -3.146  -9.167  1.00 0.42  ? 59  LEU A O    2  
ATOM 3811  C CB   . LEU A 1 59  ? 7.092   -2.974  -8.901  1.00 0.53  ? 59  LEU A CB   2  
ATOM 3812  C CG   . LEU A 1 59  ? 7.455   -3.888  -7.722  1.00 0.71  ? 59  LEU A CG   2  
ATOM 3813  C CD1  . LEU A 1 59  ? 8.608   -3.247  -6.945  1.00 1.07  ? 59  LEU A CD1  2  
ATOM 3814  C CD2  . LEU A 1 59  ? 6.250   -4.020  -6.787  1.00 1.34  ? 59  LEU A CD2  2  
ATOM 3815  H H    . LEU A 1 59  ? 7.564   -3.216  -11.421 1.00 0.54  ? 59  LEU A H    2  
ATOM 3816  H HA   . LEU A 1 59  ? 5.931   -4.694  -9.586  1.00 0.47  ? 59  LEU A HA   2  
ATOM 3817  H HB2  . LEU A 1 59  ? 7.995   -2.712  -9.432  1.00 0.91  ? 59  LEU A HB2  2  
ATOM 3818  H HB3  . LEU A 1 59  ? 6.640   -2.068  -8.516  1.00 0.65  ? 59  LEU A HB3  2  
ATOM 3819  H HG   . LEU A 1 59  ? 7.751   -4.860  -8.087  1.00 1.29  ? 59  LEU A HG   2  
ATOM 3820  H HD11 . LEU A 1 59  ? 8.307   -2.273  -6.590  1.00 1.68  ? 59  LEU A HD11 2  
ATOM 3821  H HD12 . LEU A 1 59  ? 9.466   -3.145  -7.593  1.00 1.59  ? 59  LEU A HD12 2  
ATOM 3822  H HD13 . LEU A 1 59  ? 8.866   -3.873  -6.104  1.00 1.49  ? 59  LEU A HD13 2  
ATOM 3823  H HD21 . LEU A 1 59  ? 5.442   -4.514  -7.305  1.00 1.91  ? 59  LEU A HD21 2  
ATOM 3824  H HD22 . LEU A 1 59  ? 5.929   -3.038  -6.472  1.00 1.91  ? 59  LEU A HD22 2  
ATOM 3825  H HD23 . LEU A 1 59  ? 6.531   -4.601  -5.920  1.00 1.77  ? 59  LEU A HD23 2  
ATOM 3826  N N    . SER A 1 60  ? 4.639   -2.045  -10.915 1.00 0.43  ? 60  SER A N    2  
ATOM 3827  C CA   . SER A 1 60  ? 3.356   -1.300  -11.062 1.00 0.42  ? 60  SER A CA   2  
ATOM 3828  C C    . SER A 1 60  ? 2.301   -2.260  -11.610 1.00 0.39  ? 60  SER A C    2  
ATOM 3829  O O    . SER A 1 60  ? 1.126   -2.128  -11.326 1.00 0.41  ? 60  SER A O    2  
ATOM 3830  C CB   . SER A 1 60  ? 3.546   -0.145  -12.048 1.00 0.47  ? 60  SER A CB   2  
ATOM 3831  O OG   . SER A 1 60  ? 3.823   -0.666  -13.340 1.00 1.36  ? 60  SER A OG   2  
ATOM 3832  H H    . SER A 1 60  ? 5.368   -1.900  -11.555 1.00 0.45  ? 60  SER A H    2  
ATOM 3833  H HA   . SER A 1 60  ? 3.047   -0.901  -10.107 1.00 0.43  ? 60  SER A HA   2  
ATOM 3834  H HB2  . SER A 1 60  ? 2.645   0.444   -12.090 1.00 1.13  ? 60  SER A HB2  2  
ATOM 3835  H HB3  . SER A 1 60  ? 4.365   0.480   -11.716 1.00 1.04  ? 60  SER A HB3  2  
ATOM 3836  H HG   . SER A 1 60  ? 3.083   -0.447  -13.912 1.00 1.79  ? 60  SER A HG   2  
ATOM 3837  N N    . GLU A 1 61  ? 2.704   -3.223  -12.394 1.00 0.38  ? 61  GLU A N    2  
ATOM 3838  C CA   . GLU A 1 61  ? 1.712   -4.184  -12.954 1.00 0.38  ? 61  GLU A CA   2  
ATOM 3839  C C    . GLU A 1 61  ? 1.206   -5.086  -11.827 1.00 0.38  ? 61  GLU A C    2  
ATOM 3840  O O    . GLU A 1 61  ? 0.097   -5.580  -11.869 1.00 0.41  ? 61  GLU A O    2  
ATOM 3841  C CB   . GLU A 1 61  ? 2.363   -5.022  -14.056 1.00 0.39  ? 61  GLU A CB   2  
ATOM 3842  C CG   . GLU A 1 61  ? 1.374   -6.072  -14.565 1.00 1.06  ? 61  GLU A CG   2  
ATOM 3843  C CD   . GLU A 1 61  ? 1.952   -6.752  -15.807 1.00 1.67  ? 61  GLU A CD   2  
ATOM 3844  O OE1  . GLU A 1 61  ? 3.135   -7.052  -15.798 1.00 2.25  ? 61  GLU A OE1  2  
ATOM 3845  O OE2  . GLU A 1 61  ? 1.203   -6.962  -16.747 1.00 2.40  ? 61  GLU A OE2  2  
ATOM 3846  H H    . GLU A 1 61  ? 3.655   -3.314  -12.608 1.00 0.41  ? 61  GLU A H    2  
ATOM 3847  H HA   . GLU A 1 61  ? 0.870   -3.628  -13.339 1.00 0.41  ? 61  GLU A HA   2  
ATOM 3848  H HB2  . GLU A 1 61  ? 2.656   -4.377  -14.871 1.00 0.98  ? 61  GLU A HB2  2  
ATOM 3849  H HB3  . GLU A 1 61  ? 3.236   -5.518  -13.658 1.00 0.88  ? 61  GLU A HB3  2  
ATOM 3850  H HG2  . GLU A 1 61  ? 1.204   -6.810  -13.795 1.00 1.80  ? 61  GLU A HG2  2  
ATOM 3851  H HG3  . GLU A 1 61  ? 0.440   -5.594  -14.820 1.00 1.66  ? 61  GLU A HG3  2  
ATOM 3852  N N    . CYS A 1 62  ? 1.989   -5.275  -10.801 1.00 0.37  ? 62  CYS A N    2  
ATOM 3853  C CA   . CYS A 1 62  ? 1.517   -6.113  -9.664  1.00 0.39  ? 62  CYS A CA   2  
ATOM 3854  C C    . CYS A 1 62  ? 0.388   -5.359  -8.956  1.00 0.38  ? 62  CYS A C    2  
ATOM 3855  O O    . CYS A 1 62  ? -0.638  -5.919  -8.623  1.00 0.44  ? 62  CYS A O    2  
ATOM 3856  C CB   . CYS A 1 62  ? 2.668   -6.352  -8.685  1.00 0.41  ? 62  CYS A CB   2  
ATOM 3857  S SG   . CYS A 1 62  ? 3.967   -7.308  -9.505  1.00 1.62  ? 62  CYS A SG   2  
ATOM 3858  H H    . CYS A 1 62  ? 2.870   -4.842  -10.767 1.00 0.36  ? 62  CYS A H    2  
ATOM 3859  H HA   . CYS A 1 62  ? 1.146   -7.058  -10.032 1.00 0.40  ? 62  CYS A HA   2  
ATOM 3860  H HB2  . CYS A 1 62  ? 3.069   -5.403  -8.361  1.00 0.95  ? 62  CYS A HB2  2  
ATOM 3861  H HB3  . CYS A 1 62  ? 2.304   -6.900  -7.828  1.00 1.06  ? 62  CYS A HB3  2  
ATOM 3862  H HG   . CYS A 1 62  ? 4.798   -7.121  -9.062  1.00 2.03  ? 62  CYS A HG   2  
ATOM 3863  N N    . LEU A 1 63  ? 0.563   -4.081  -8.758  1.00 0.35  ? 63  LEU A N    2  
ATOM 3864  C CA   . LEU A 1 63  ? -0.500  -3.260  -8.109  1.00 0.36  ? 63  LEU A CA   2  
ATOM 3865  C C    . LEU A 1 63  ? -1.699  -3.149  -9.058  1.00 0.36  ? 63  LEU A C    2  
ATOM 3866  O O    . LEU A 1 63  ? -2.828  -3.006  -8.632  1.00 0.41  ? 63  LEU A O    2  
ATOM 3867  C CB   . LEU A 1 63  ? 0.058   -1.863  -7.821  1.00 0.38  ? 63  LEU A CB   2  
ATOM 3868  C CG   . LEU A 1 63  ? 1.271   -1.971  -6.882  1.00 0.69  ? 63  LEU A CG   2  
ATOM 3869  C CD1  . LEU A 1 63  ? 1.890   -0.582  -6.697  1.00 1.39  ? 63  LEU A CD1  2  
ATOM 3870  C CD2  . LEU A 1 63  ? 0.829   -2.509  -5.507  1.00 1.11  ? 63  LEU A CD2  2  
ATOM 3871  H H    . LEU A 1 63  ? 1.391   -3.647  -9.057  1.00 0.37  ? 63  LEU A H    2  
ATOM 3872  H HA   . LEU A 1 63  ? -0.830  -3.705  -7.186  1.00 0.39  ? 63  LEU A HA   2  
ATOM 3873  H HB2  . LEU A 1 63  ? 0.363   -1.400  -8.748  1.00 0.65  ? 63  LEU A HB2  2  
ATOM 3874  H HB3  . LEU A 1 63  ? -0.705  -1.260  -7.352  1.00 0.46  ? 63  LEU A HB3  2  
ATOM 3875  H HG   . LEU A 1 63  ? 2.003   -2.637  -7.315  1.00 1.38  ? 63  LEU A HG   2  
ATOM 3876  H HD11 . LEU A 1 63  ? 2.242   -0.216  -7.650  1.00 1.91  ? 63  LEU A HD11 2  
ATOM 3877  H HD12 . LEU A 1 63  ? 2.719   -0.647  -6.008  1.00 1.98  ? 63  LEU A HD12 2  
ATOM 3878  H HD13 . LEU A 1 63  ? 1.147   0.095   -6.303  1.00 1.77  ? 63  LEU A HD13 2  
ATOM 3879  H HD21 . LEU A 1 63  ? 1.556   -2.229  -4.757  1.00 1.71  ? 63  LEU A HD21 2  
ATOM 3880  H HD22 . LEU A 1 63  ? 0.762   -3.586  -5.546  1.00 1.69  ? 63  LEU A HD22 2  
ATOM 3881  H HD23 . LEU A 1 63  ? -0.134  -2.097  -5.244  1.00 1.59  ? 63  LEU A HD23 2  
ATOM 3882  N N    . LYS A 1 64  ? -1.459  -3.200  -10.339 1.00 0.35  ? 64  LYS A N    2  
ATOM 3883  C CA   . LYS A 1 64  ? -2.582  -3.087  -11.315 1.00 0.37  ? 64  LYS A CA   2  
ATOM 3884  C C    . LYS A 1 64  ? -3.336  -4.420  -11.402 1.00 0.39  ? 64  LYS A C    2  
ATOM 3885  O O    . LYS A 1 64  ? -4.550  -4.456  -11.446 1.00 0.43  ? 64  LYS A O    2  
ATOM 3886  C CB   . LYS A 1 64  ? -2.020  -2.731  -12.698 1.00 0.38  ? 64  LYS A CB   2  
ATOM 3887  C CG   . LYS A 1 64  ? -3.164  -2.316  -13.653 1.00 0.82  ? 64  LYS A CG   2  
ATOM 3888  C CD   . LYS A 1 64  ? -3.321  -0.790  -13.661 1.00 1.35  ? 64  LYS A CD   2  
ATOM 3889  C CE   . LYS A 1 64  ? -4.478  -0.400  -14.583 1.00 1.38  ? 64  LYS A CE   2  
ATOM 3890  N NZ   . LYS A 1 64  ? -4.472  1.075   -14.791 1.00 2.09  ? 64  LYS A NZ   2  
ATOM 3891  H H    . LYS A 1 64  ? -0.535  -3.301  -10.648 1.00 0.36  ? 64  LYS A H    2  
ATOM 3892  H HA   . LYS A 1 64  ? -3.258  -2.310  -10.990 1.00 0.38  ? 64  LYS A HA   2  
ATOM 3893  H HB2  . LYS A 1 64  ? -1.311  -1.920  -12.596 1.00 0.83  ? 64  LYS A HB2  2  
ATOM 3894  H HB3  . LYS A 1 64  ? -1.512  -3.594  -13.103 1.00 0.76  ? 64  LYS A HB3  2  
ATOM 3895  H HG2  . LYS A 1 64  ? -2.935  -2.651  -14.655 1.00 1.50  ? 64  LYS A HG2  2  
ATOM 3896  H HG3  . LYS A 1 64  ? -4.094  -2.767  -13.334 1.00 1.58  ? 64  LYS A HG3  2  
ATOM 3897  H HD2  . LYS A 1 64  ? -3.525  -0.443  -12.658 1.00 1.98  ? 64  LYS A HD2  2  
ATOM 3898  H HD3  . LYS A 1 64  ? -2.409  -0.337  -14.020 1.00 1.96  ? 64  LYS A HD3  2  
ATOM 3899  H HE2  . LYS A 1 64  ? -4.364  -0.899  -15.534 1.00 1.48  ? 64  LYS A HE2  2  
ATOM 3900  H HE3  . LYS A 1 64  ? -5.413  -0.697  -14.131 1.00 1.82  ? 64  LYS A HE3  2  
ATOM 3901  H HZ1  . LYS A 1 64  ? -5.238  1.507   -14.236 1.00 2.59  ? 64  LYS A HZ1  2  
ATOM 3902  H HZ2  . LYS A 1 64  ? -4.616  1.283   -15.801 1.00 2.53  ? 64  LYS A HZ2  2  
ATOM 3903  H HZ3  . LYS A 1 64  ? -3.560  1.466   -14.482 1.00 2.46  ? 64  LYS A HZ3  2  
ATOM 3904  N N    . ARG A 1 65  ? -2.624  -5.512  -11.448 1.00 0.43  ? 65  ARG A N    2  
ATOM 3905  C CA   . ARG A 1 65  ? -3.293  -6.843  -11.555 1.00 0.47  ? 65  ARG A CA   2  
ATOM 3906  C C    . ARG A 1 65  ? -4.099  -7.150  -10.287 1.00 0.50  ? 65  ARG A C    2  
ATOM 3907  O O    . ARG A 1 65  ? -5.171  -7.717  -10.355 1.00 0.54  ? 65  ARG A O    2  
ATOM 3908  C CB   . ARG A 1 65  ? -2.227  -7.940  -11.761 1.00 0.45  ? 65  ARG A CB   2  
ATOM 3909  C CG   . ARG A 1 65  ? -1.834  -8.038  -13.246 1.00 0.94  ? 65  ARG A CG   2  
ATOM 3910  C CD   . ARG A 1 65  ? -1.156  -9.386  -13.509 1.00 1.55  ? 65  ARG A CD   2  
ATOM 3911  N NE   . ARG A 1 65  ? -0.445  -9.350  -14.829 1.00 1.86  ? 65  ARG A NE   2  
ATOM 3912  C CZ   . ARG A 1 65  ? -1.066  -9.018  -15.932 1.00 2.39  ? 65  ARG A CZ   2  
ATOM 3913  N NH1  . ARG A 1 65  ? -2.366  -8.910  -15.956 1.00 2.94  ? 65  ARG A NH1  2  
ATOM 3914  N NH2  . ARG A 1 65  ? -0.386  -8.856  -17.033 1.00 2.92  ? 65  ARG A NH2  2  
ATOM 3915  H H    . ARG A 1 65  ? -1.646  -5.455  -11.433 1.00 0.45  ? 65  ARG A H    2  
ATOM 3916  H HA   . ARG A 1 65  ? -3.968  -6.839  -12.397 1.00 0.49  ? 65  ARG A HA   2  
ATOM 3917  H HB2  . ARG A 1 65  ? -1.352  -7.697  -11.176 1.00 0.88  ? 65  ARG A HB2  2  
ATOM 3918  H HB3  . ARG A 1 65  ? -2.621  -8.893  -11.434 1.00 0.85  ? 65  ARG A HB3  2  
ATOM 3919  H HG2  . ARG A 1 65  ? -2.714  -7.951  -13.856 1.00 1.50  ? 65  ARG A HG2  2  
ATOM 3920  H HG3  . ARG A 1 65  ? -1.148  -7.240  -13.489 1.00 1.54  ? 65  ARG A HG3  2  
ATOM 3921  H HD2  . ARG A 1 65  ? -0.422  -9.572  -12.748 1.00 2.13  ? 65  ARG A HD2  2  
ATOM 3922  H HD3  . ARG A 1 65  ? -1.905  -10.175 -13.478 1.00 2.11  ? 65  ARG A HD3  2  
ATOM 3923  H HE   . ARG A 1 65  ? 0.519   -9.526  -14.857 1.00 2.20  ? 65  ARG A HE   2  
ATOM 3924  H HH11 . ARG A 1 65  ? -2.898  -9.087  -15.129 1.00 2.96  ? 65  ARG A HH11 2  
ATOM 3925  H HH12 . ARG A 1 65  ? -2.830  -8.648  -16.801 1.00 3.62  ? 65  ARG A HH12 2  
ATOM 3926  H HH21 . ARG A 1 65  ? 0.605   -8.986  -17.032 1.00 3.11  ? 65  ARG A HH21 2  
ATOM 3927  H HH22 . ARG A 1 65  ? -0.856  -8.601  -17.877 1.00 3.43  ? 65  ARG A HH22 2  
ATOM 3928  N N    . ILE A 1 66  ? -3.607  -6.789  -9.133  1.00 0.49  ? 66  ILE A N    2  
ATOM 3929  C CA   . ILE A 1 66  ? -4.376  -7.084  -7.889  1.00 0.53  ? 66  ILE A CA   2  
ATOM 3930  C C    . ILE A 1 66  ? -5.522  -6.077  -7.762  1.00 0.54  ? 66  ILE A C    2  
ATOM 3931  O O    . ILE A 1 66  ? -6.607  -6.403  -7.331  1.00 0.60  ? 66  ILE A O    2  
ATOM 3932  C CB   . ILE A 1 66  ? -3.443  -6.972  -6.672  1.00 0.52  ? 66  ILE A CB   2  
ATOM 3933  C CG1  . ILE A 1 66  ? -2.499  -8.179  -6.634  1.00 1.22  ? 66  ILE A CG1  2  
ATOM 3934  C CG2  . ILE A 1 66  ? -4.261  -6.925  -5.374  1.00 1.29  ? 66  ILE A CG2  2  
ATOM 3935  C CD1  . ILE A 1 66  ? -1.362  -7.930  -5.631  1.00 1.25  ? 66  ILE A CD1  2  
ATOM 3936  H H    . ILE A 1 66  ? -2.747  -6.322  -9.082  1.00 0.46  ? 66  ILE A H    2  
ATOM 3937  H HA   . ILE A 1 66  ? -4.775  -8.086  -7.958  1.00 0.56  ? 66  ILE A HA   2  
ATOM 3938  H HB   . ILE A 1 66  ? -2.860  -6.065  -6.755  1.00 1.04  ? 66  ILE A HB   2  
ATOM 3939  H HG12 . ILE A 1 66  ? -3.052  -9.058  -6.339  1.00 1.73  ? 66  ILE A HG12 2  
ATOM 3940  H HG13 . ILE A 1 66  ? -2.078  -8.334  -7.617  1.00 1.78  ? 66  ILE A HG13 2  
ATOM 3941  H HG21 . ILE A 1 66  ? -3.607  -7.093  -4.530  1.00 1.84  ? 66  ILE A HG21 2  
ATOM 3942  H HG22 . ILE A 1 66  ? -5.019  -7.694  -5.399  1.00 1.76  ? 66  ILE A HG22 2  
ATOM 3943  H HG23 . ILE A 1 66  ? -4.732  -5.958  -5.278  1.00 1.93  ? 66  ILE A HG23 2  
ATOM 3944  H HD11 . ILE A 1 66  ? -1.041  -8.873  -5.214  1.00 1.47  ? 66  ILE A HD11 2  
ATOM 3945  H HD12 . ILE A 1 66  ? -1.707  -7.287  -4.832  1.00 1.70  ? 66  ILE A HD12 2  
ATOM 3946  H HD13 . ILE A 1 66  ? -0.532  -7.461  -6.137  1.00 1.59  ? 66  ILE A HD13 2  
ATOM 3947  N N    . GLY A 1 67  ? -5.292  -4.864  -8.173  1.00 0.52  ? 67  GLY A N    2  
ATOM 3948  C CA   . GLY A 1 67  ? -6.364  -3.833  -8.111  1.00 0.55  ? 67  GLY A CA   2  
ATOM 3949  C C    . GLY A 1 67  ? -7.549  -4.266  -8.975  1.00 0.53  ? 67  GLY A C    2  
ATOM 3950  O O    . GLY A 1 67  ? -8.688  -4.224  -8.548  1.00 0.63  ? 67  GLY A O    2  
ATOM 3951  H H    . GLY A 1 67  ? -4.418  -4.637  -8.553  1.00 0.50  ? 67  GLY A H    2  
ATOM 3952  H HA2  . GLY A 1 67  ? -6.689  -3.690  -7.089  1.00 0.55  ? 67  GLY A HA2  2  
ATOM 3953  H HA3  . GLY A 1 67  ? -5.974  -2.896  -8.474  1.00 0.59  ? 67  GLY A HA3  2  
ATOM 3954  N N    . ASP A 1 68  ? -7.300  -4.676  -10.188 1.00 0.54  ? 68  ASP A N    2  
ATOM 3955  C CA   . ASP A 1 68  ? -8.417  -5.100  -11.079 1.00 0.54  ? 68  ASP A CA   2  
ATOM 3956  C C    . ASP A 1 68  ? -8.934  -6.482  -10.670 1.00 0.52  ? 68  ASP A C    2  
ATOM 3957  O O    . ASP A 1 68  ? -10.047 -6.850  -10.991 1.00 0.56  ? 68  ASP A O    2  
ATOM 3958  C CB   . ASP A 1 68  ? -7.909  -5.166  -12.522 1.00 0.60  ? 68  ASP A CB   2  
ATOM 3959  C CG   . ASP A 1 68  ? -7.499  -3.767  -12.986 1.00 1.43  ? 68  ASP A CG   2  
ATOM 3960  O OD1  . ASP A 1 68  ? -6.609  -3.199  -12.375 1.00 2.20  ? 68  ASP A OD1  2  
ATOM 3961  O OD2  . ASP A 1 68  ? -8.082  -3.289  -13.945 1.00 2.12  ? 68  ASP A OD2  2  
ATOM 3962  H H    . ASP A 1 68  ? -6.384  -4.706  -10.535 1.00 0.63  ? 68  ASP A H    2  
ATOM 3963  H HA   . ASP A 1 68  ? -9.221  -4.382  -11.019 1.00 0.53  ? 68  ASP A HA   2  
ATOM 3964  H HB2  . ASP A 1 68  ? -7.055  -5.827  -12.572 1.00 1.16  ? 68  ASP A HB2  2  
ATOM 3965  H HB3  . ASP A 1 68  ? -8.692  -5.541  -13.163 1.00 1.06  ? 68  ASP A HB3  2  
ATOM 3966  N N    . GLU A 1 69  ? -8.137  -7.261  -9.980  1.00 0.56  ? 69  GLU A N    2  
ATOM 3967  C CA   . GLU A 1 69  ? -8.591  -8.630  -9.571  1.00 0.56  ? 69  GLU A CA   2  
ATOM 3968  C C    . GLU A 1 69  ? -9.158  -8.583  -8.149  1.00 0.55  ? 69  GLU A C    2  
ATOM 3969  O O    . GLU A 1 69  ? -9.965  -9.414  -7.780  1.00 0.73  ? 69  GLU A O    2  
ATOM 3970  C CB   . GLU A 1 69  ? -7.405  -9.595  -9.629  1.00 0.61  ? 69  GLU A CB   2  
ATOM 3971  C CG   . GLU A 1 69  ? -7.909  -11.038 -9.556  1.00 0.84  ? 69  GLU A CG   2  
ATOM 3972  C CD   . GLU A 1 69  ? -8.587  -11.411 -10.875 1.00 1.65  ? 69  GLU A CD   2  
ATOM 3973  O OE1  . GLU A 1 69  ? -7.952  -11.268 -11.907 1.00 2.48  ? 69  GLU A OE1  2  
ATOM 3974  O OE2  . GLU A 1 69  ? -9.730  -11.836 -10.831 1.00 2.23  ? 69  GLU A OE2  2  
ATOM 3975  H H    . GLU A 1 69  ? -7.238  -6.951  -9.741  1.00 0.65  ? 69  GLU A H    2  
ATOM 3976  H HA   . GLU A 1 69  ? -9.368  -8.962  -10.245 1.00 0.57  ? 69  GLU A HA   2  
ATOM 3977  H HB2  . GLU A 1 69  ? -6.867  -9.448  -10.555 1.00 0.87  ? 69  GLU A HB2  2  
ATOM 3978  H HB3  . GLU A 1 69  ? -6.745  -9.404  -8.796  1.00 0.83  ? 69  GLU A HB3  2  
ATOM 3979  H HG2  . GLU A 1 69  ? -7.074  -11.701 -9.380  1.00 1.45  ? 69  GLU A HG2  2  
ATOM 3980  H HG3  . GLU A 1 69  ? -8.619  -11.131 -8.749  1.00 1.39  ? 69  GLU A HG3  2  
ATOM 3981  N N    . LEU A 1 70  ? -8.746  -7.649  -7.334  1.00 0.53  ? 70  LEU A N    2  
ATOM 3982  C CA   . LEU A 1 70  ? -9.282  -7.614  -5.939  1.00 0.52  ? 70  LEU A CA   2  
ATOM 3983  C C    . LEU A 1 70  ? -10.689 -7.009  -5.941  1.00 0.54  ? 70  LEU A C    2  
ATOM 3984  O O    . LEU A 1 70  ? -11.514 -7.337  -5.111  1.00 0.60  ? 70  LEU A O    2  
ATOM 3985  C CB   . LEU A 1 70  ? -8.350  -6.790  -5.039  1.00 0.61  ? 70  LEU A CB   2  
ATOM 3986  C CG   . LEU A 1 70  ? -8.686  -7.028  -3.554  1.00 0.70  ? 70  LEU A CG   2  
ATOM 3987  C CD1  . LEU A 1 70  ? -8.121  -8.378  -3.080  1.00 1.38  ? 70  LEU A CD1  2  
ATOM 3988  C CD2  . LEU A 1 70  ? -8.067  -5.907  -2.711  1.00 1.61  ? 70  LEU A CD2  2  
ATOM 3989  H H    . LEU A 1 70  ? -8.085  -6.989  -7.629  1.00 0.66  ? 70  LEU A H    2  
ATOM 3990  H HA   . LEU A 1 70  ? -9.344  -8.627  -5.575  1.00 0.56  ? 70  LEU A HA   2  
ATOM 3991  H HB2  . LEU A 1 70  ? -7.328  -7.075  -5.227  1.00 1.07  ? 70  LEU A HB2  2  
ATOM 3992  H HB3  . LEU A 1 70  ? -8.475  -5.742  -5.268  1.00 1.07  ? 70  LEU A HB3  2  
ATOM 3993  H HG   . LEU A 1 70  ? -9.758  -7.024  -3.424  1.00 1.39  ? 70  LEU A HG   2  
ATOM 3994  H HD11 . LEU A 1 70  ? -8.734  -9.182  -3.454  1.00 1.91  ? 70  LEU A HD11 2  
ATOM 3995  H HD12 . LEU A 1 70  ? -8.120  -8.407  -2.000  1.00 1.90  ? 70  LEU A HD12 2  
ATOM 3996  H HD13 . LEU A 1 70  ? -7.109  -8.498  -3.439  1.00 1.98  ? 70  LEU A HD13 2  
ATOM 3997  H HD21 . LEU A 1 70  ? -8.524  -4.964  -2.973  1.00 2.16  ? 70  LEU A HD21 2  
ATOM 3998  H HD22 . LEU A 1 70  ? -7.004  -5.857  -2.902  1.00 2.22  ? 70  LEU A HD22 2  
ATOM 3999  H HD23 . LEU A 1 70  ? -8.234  -6.109  -1.663  1.00 2.09  ? 70  LEU A HD23 2  
ATOM 4000  N N    . ASP A 1 71  ? -10.986 -6.152  -6.884  1.00 0.67  ? 71  ASP A N    2  
ATOM 4001  C CA   . ASP A 1 71  ? -12.357 -5.568  -6.940  1.00 0.91  ? 71  ASP A CA   2  
ATOM 4002  C C    . ASP A 1 71  ? -13.341 -6.684  -7.300  1.00 1.02  ? 71  ASP A C    2  
ATOM 4003  O O    . ASP A 1 71  ? -14.541 -6.499  -7.330  1.00 1.29  ? 71  ASP A O    2  
ATOM 4004  C CB   . ASP A 1 71  ? -12.414 -4.457  -7.997  1.00 1.09  ? 71  ASP A CB   2  
ATOM 4005  C CG   . ASP A 1 71  ? -12.294 -5.061  -9.398  1.00 1.66  ? 71  ASP A CG   2  
ATOM 4006  O OD1  . ASP A 1 71  ? -13.303 -5.509  -9.918  1.00 2.25  ? 71  ASP A OD1  2  
ATOM 4007  O OD2  . ASP A 1 71  ? -11.195 -5.064  -9.928  1.00 2.36  ? 71  ASP A OD2  2  
ATOM 4008  H H    . ASP A 1 71  ? -10.319 -5.911  -7.563  1.00 0.69  ? 71  ASP A H    2  
ATOM 4009  H HA   . ASP A 1 71  ? -12.615 -5.163  -5.972  1.00 0.96  ? 71  ASP A HA   2  
ATOM 4010  H HB2  . ASP A 1 71  ? -13.355 -3.931  -7.912  1.00 1.58  ? 71  ASP A HB2  2  
ATOM 4011  H HB3  . ASP A 1 71  ? -11.601 -3.766  -7.834  1.00 1.39  ? 71  ASP A HB3  2  
ATOM 4012  N N    . SER A 1 72  ? -12.817 -7.850  -7.563  1.00 0.90  ? 72  SER A N    2  
ATOM 4013  C CA   . SER A 1 72  ? -13.653 -9.012  -7.911  1.00 1.20  ? 72  SER A CA   2  
ATOM 4014  C C    . SER A 1 72  ? -14.649 -9.285  -6.787  1.00 0.98  ? 72  SER A C    2  
ATOM 4015  O O    . SER A 1 72  ? -15.612 -8.568  -6.607  1.00 1.02  ? 72  SER A O    2  
ATOM 4016  C CB   . SER A 1 72  ? -12.722 -10.223 -8.058  1.00 1.57  ? 72  SER A CB   2  
ATOM 4017  O OG   . SER A 1 72  ? -13.505 -11.399 -8.229  1.00 2.09  ? 72  SER A OG   2  
ATOM 4018  H H    . SER A 1 72  ? -11.851 -7.970  -7.515  1.00 0.70  ? 72  SER A H    2  
ATOM 4019  H HA   . SER A 1 72  ? -14.160 -8.884  -8.858  1.00 1.57  ? 72  SER A HA   2  
ATOM 4020  H HB2  . SER A 1 72  ? -12.089 -10.092 -8.920  1.00 1.99  ? 72  SER A HB2  2  
ATOM 4021  H HB3  . SER A 1 72  ? -12.107 -10.313 -7.172  1.00 2.01  ? 72  SER A HB3  2  
ATOM 4022  H HG   . SER A 1 72  ? -12.909 -12.126 -8.429  1.00 2.54  ? 72  SER A HG   2  
ATOM 4023  N N    . ASN A 1 73  ? -14.423 -10.372 -6.096  1.00 0.92  ? 73  ASN A N    2  
ATOM 4024  C CA   . ASN A 1 73  ? -15.324 -10.855 -4.990  1.00 0.83  ? 73  ASN A CA   2  
ATOM 4025  C C    . ASN A 1 73  ? -16.359 -9.794  -4.589  1.00 0.75  ? 73  ASN A C    2  
ATOM 4026  O O    . ASN A 1 73  ? -16.014 -8.744  -4.084  1.00 1.07  ? 73  ASN A O    2  
ATOM 4027  C CB   . ASN A 1 73  ? -14.472 -11.216 -3.773  1.00 0.91  ? 73  ASN A CB   2  
ATOM 4028  C CG   . ASN A 1 73  ? -15.328 -11.971 -2.757  1.00 1.43  ? 73  ASN A CG   2  
ATOM 4029  O OD1  . ASN A 1 73  ? -14.854 -12.341 -1.701  1.00 2.29  ? 73  ASN A OD1  2  
ATOM 4030  N ND2  . ASN A 1 73  ? -16.579 -12.216 -3.032  1.00 1.90  ? 73  ASN A ND2  2  
ATOM 4031  H H    . ASN A 1 73  ? -13.669 -10.924 -6.387  1.00 1.04  ? 73  ASN A H    2  
ATOM 4032  H HA   . ASN A 1 73  ? -15.798 -11.748 -5.367  1.00 0.90  ? 73  ASN A HA   2  
ATOM 4033  H HB2  . ASN A 1 73  ? -13.645 -11.839 -4.084  1.00 1.30  ? 73  ASN A HB2  2  
ATOM 4034  H HB3  . ASN A 1 73  ? -14.090 -10.313 -3.320  1.00 1.39  ? 73  ASN A HB3  2  
ATOM 4035  H HD21 . ASN A 1 73  ? -16.962 -11.918 -3.884  1.00 2.05  ? 73  ASN A HD21 2  
ATOM 4036  H HD22 . ASN A 1 73  ? -17.137 -12.699 -2.387  1.00 2.57  ? 73  ASN A HD22 2  
ATOM 4037  N N    . MET A 1 74  ? -17.617 -10.045 -4.827  1.00 0.71  ? 74  MET A N    2  
ATOM 4038  C CA   . MET A 1 74  ? -18.656 -9.033  -4.472  1.00 0.67  ? 74  MET A CA   2  
ATOM 4039  C C    . MET A 1 74  ? -18.826 -8.969  -2.951  1.00 0.67  ? 74  MET A C    2  
ATOM 4040  O O    . MET A 1 74  ? -19.460 -8.075  -2.427  1.00 0.71  ? 74  MET A O    2  
ATOM 4041  C CB   . MET A 1 74  ? -19.986 -9.400  -5.140  1.00 0.75  ? 74  MET A CB   2  
ATOM 4042  C CG   . MET A 1 74  ? -19.803 -9.532  -6.673  1.00 1.20  ? 74  MET A CG   2  
ATOM 4043  S SD   . MET A 1 74  ? -20.607 -8.143  -7.517  1.00 1.92  ? 74  MET A SD   2  
ATOM 4044  C CE   . MET A 1 74  ? -19.795 -8.350  -9.120  1.00 1.96  ? 74  MET A CE   2  
ATOM 4045  H H    . MET A 1 74  ? -17.880 -10.890 -5.248  1.00 0.95  ? 74  MET A H    2  
ATOM 4046  H HA   . MET A 1 74  ? -18.332 -8.057  -4.802  1.00 0.69  ? 74  MET A HA   2  
ATOM 4047  H HB2  . MET A 1 74  ? -20.334 -10.340 -4.733  1.00 1.13  ? 74  MET A HB2  2  
ATOM 4048  H HB3  . MET A 1 74  ? -20.715 -8.632  -4.926  1.00 1.14  ? 74  MET A HB3  2  
ATOM 4049  H HG2  . MET A 1 74  ? -18.750 -9.535  -6.925  1.00 1.74  ? 74  MET A HG2  2  
ATOM 4050  H HG3  . MET A 1 74  ? -20.247 -10.457 -7.013  1.00 1.78  ? 74  MET A HG3  2  
ATOM 4051  H HE1  . MET A 1 74  ? -18.784 -7.972  -9.061  1.00 2.47  ? 74  MET A HE1  2  
ATOM 4052  H HE2  . MET A 1 74  ? -20.338 -7.803  -9.873  1.00 2.23  ? 74  MET A HE2  2  
ATOM 4053  H HE3  . MET A 1 74  ? -19.778 -9.400  -9.381  1.00 2.17  ? 74  MET A HE3  2  
ATOM 4054  N N    . GLU A 1 75  ? -18.233 -9.883  -2.238  1.00 0.70  ? 75  GLU A N    2  
ATOM 4055  C CA   . GLU A 1 75  ? -18.324 -9.849  -0.749  1.00 0.75  ? 75  GLU A CA   2  
ATOM 4056  C C    . GLU A 1 75  ? -17.354 -8.782  -0.231  1.00 0.73  ? 75  GLU A C    2  
ATOM 4057  O O    . GLU A 1 75  ? -17.640 -8.081  0.720   1.00 0.78  ? 75  GLU A O    2  
ATOM 4058  C CB   . GLU A 1 75  ? -17.942 -11.221 -0.176  1.00 0.87  ? 75  GLU A CB   2  
ATOM 4059  C CG   . GLU A 1 75  ? -19.142 -12.170 -0.259  1.00 1.15  ? 75  GLU A CG   2  
ATOM 4060  C CD   . GLU A 1 75  ? -19.667 -12.215 -1.695  1.00 1.70  ? 75  GLU A CD   2  
ATOM 4061  O OE1  . GLU A 1 75  ? -20.517 -11.403 -2.020  1.00 2.29  ? 75  GLU A OE1  2  
ATOM 4062  O OE2  . GLU A 1 75  ? -19.211 -13.063 -2.445  1.00 2.21  ? 75  GLU A OE2  2  
ATOM 4063  H H    . GLU A 1 75  ? -17.699 -10.578 -2.677  1.00 0.73  ? 75  GLU A H    2  
ATOM 4064  H HA   . GLU A 1 75  ? -19.316 -9.580  -0.414  1.00 0.77  ? 75  GLU A HA   2  
ATOM 4065  H HB2  . GLU A 1 75  ? -17.119 -11.631 -0.742  1.00 1.11  ? 75  GLU A HB2  2  
ATOM 4066  H HB3  . GLU A 1 75  ? -17.647 -11.112 0.859   1.00 0.94  ? 75  GLU A HB3  2  
ATOM 4067  H HG2  . GLU A 1 75  ? -18.838 -13.162 0.043   1.00 1.41  ? 75  GLU A HG2  2  
ATOM 4068  H HG3  . GLU A 1 75  ? -19.924 -11.818 0.397   1.00 1.33  ? 75  GLU A HG3  2  
ATOM 4069  N N    . LEU A 1 76  ? -16.220 -8.639  -0.857  1.00 0.74  ? 76  LEU A N    2  
ATOM 4070  C CA   . LEU A 1 76  ? -15.246 -7.603  -0.408  1.00 0.80  ? 76  LEU A CA   2  
ATOM 4071  C C    . LEU A 1 76  ? -15.728 -6.222  -0.863  1.00 0.75  ? 76  LEU A C    2  
ATOM 4072  O O    . LEU A 1 76  ? -15.471 -5.227  -0.221  1.00 0.81  ? 76  LEU A O    2  
ATOM 4073  C CB   . LEU A 1 76  ? -13.861 -7.904  -0.995  1.00 0.92  ? 76  LEU A CB   2  
ATOM 4074  C CG   . LEU A 1 76  ? -12.800 -6.942  -0.418  1.00 1.00  ? 76  LEU A CG   2  
ATOM 4075  C CD1  . LEU A 1 76  ? -12.305 -7.451  0.941   1.00 1.57  ? 76  LEU A CD1  2  
ATOM 4076  C CD2  . LEU A 1 76  ? -11.612 -6.861  -1.383  1.00 1.51  ? 76  LEU A CD2  2  
ATOM 4077  H H    . LEU A 1 76  ? -16.012 -9.204  -1.629  1.00 0.77  ? 76  LEU A H    2  
ATOM 4078  H HA   . LEU A 1 76  ? -15.203 -7.572  0.669   1.00 0.82  ? 76  LEU A HA   2  
ATOM 4079  H HB2  . LEU A 1 76  ? -13.590 -8.923  -0.762  1.00 1.40  ? 76  LEU A HB2  2  
ATOM 4080  H HB3  . LEU A 1 76  ? -13.906 -7.785  -2.068  1.00 1.28  ? 76  LEU A HB3  2  
ATOM 4081  H HG   . LEU A 1 76  ? -13.227 -5.958  -0.295  1.00 1.62  ? 76  LEU A HG   2  
ATOM 4082  H HD11 . LEU A 1 76  ? -13.115 -7.432  1.653   1.00 1.93  ? 76  LEU A HD11 2  
ATOM 4083  H HD12 . LEU A 1 76  ? -11.505 -6.814  1.291   1.00 2.18  ? 76  LEU A HD12 2  
ATOM 4084  H HD13 . LEU A 1 76  ? -11.939 -8.461  0.836   1.00 2.01  ? 76  LEU A HD13 2  
ATOM 4085  H HD21 . LEU A 1 76  ? -11.933 -6.413  -2.312  1.00 2.04  ? 76  LEU A HD21 2  
ATOM 4086  H HD22 . LEU A 1 76  ? -11.236 -7.856  -1.576  1.00 1.83  ? 76  LEU A HD22 2  
ATOM 4087  H HD23 . LEU A 1 76  ? -10.830 -6.259  -0.943  1.00 2.09  ? 76  LEU A HD23 2  
ATOM 4088  N N    . GLN A 1 77  ? -16.452 -6.149  -1.946  1.00 0.76  ? 77  GLN A N    2  
ATOM 4089  C CA   . GLN A 1 77  ? -16.966 -4.824  -2.399  1.00 0.74  ? 77  GLN A CA   2  
ATOM 4090  C C    . GLN A 1 77  ? -18.223 -4.491  -1.585  1.00 0.71  ? 77  GLN A C    2  
ATOM 4091  O O    . GLN A 1 77  ? -18.478 -3.346  -1.261  1.00 0.72  ? 77  GLN A O    2  
ATOM 4092  C CB   . GLN A 1 77  ? -17.302 -4.881  -3.905  1.00 0.71  ? 77  GLN A CB   2  
ATOM 4093  C CG   . GLN A 1 77  ? -16.115 -4.374  -4.732  1.00 1.26  ? 77  GLN A CG   2  
ATOM 4094  C CD   . GLN A 1 77  ? -14.855 -5.158  -4.360  1.00 1.59  ? 77  GLN A CD   2  
ATOM 4095  O OE1  . GLN A 1 77  ? -13.872 -4.584  -3.936  1.00 2.35  ? 77  GLN A OE1  2  
ATOM 4096  N NE2  . GLN A 1 77  ? -14.843 -6.455  -4.503  1.00 2.03  ? 77  GLN A NE2  2  
ATOM 4097  H H    . GLN A 1 77  ? -16.678 -6.963  -2.444  1.00 0.86  ? 77  GLN A H    2  
ATOM 4098  H HA   . GLN A 1 77  ? -16.232 -4.054  -2.205  1.00 0.78  ? 77  GLN A HA   2  
ATOM 4099  H HB2  . GLN A 1 77  ? -17.520 -5.901  -4.182  1.00 1.14  ? 77  GLN A HB2  2  
ATOM 4100  H HB3  . GLN A 1 77  ? -18.166 -4.263  -4.113  1.00 1.09  ? 77  GLN A HB3  2  
ATOM 4101  H HG2  . GLN A 1 77  ? -16.326 -4.508  -5.783  1.00 1.82  ? 77  GLN A HG2  2  
ATOM 4102  H HG3  . GLN A 1 77  ? -15.957 -3.325  -4.528  1.00 1.98  ? 77  GLN A HG3  2  
ATOM 4103  H HE21 . GLN A 1 77  ? -15.635 -6.918  -4.846  1.00 2.26  ? 77  GLN A HE21 2  
ATOM 4104  H HE22 . GLN A 1 77  ? -14.040 -6.965  -4.269  1.00 2.60  ? 77  GLN A HE22 2  
ATOM 4105  N N    . ARG A 1 78  ? -19.003 -5.477  -1.240  1.00 0.72  ? 78  ARG A N    2  
ATOM 4106  C CA   . ARG A 1 78  ? -20.228 -5.198  -0.444  1.00 0.73  ? 78  ARG A CA   2  
ATOM 4107  C C    . ARG A 1 78  ? -19.836 -4.816  0.983   1.00 0.75  ? 78  ARG A C    2  
ATOM 4108  O O    . ARG A 1 78  ? -20.477 -3.998  1.613   1.00 0.79  ? 78  ARG A O    2  
ATOM 4109  C CB   . ARG A 1 78  ? -21.117 -6.441  -0.406  1.00 0.74  ? 78  ARG A CB   2  
ATOM 4110  C CG   . ARG A 1 78  ? -22.453 -6.081  0.248   1.00 0.94  ? 78  ARG A CG   2  
ATOM 4111  C CD   . ARG A 1 78  ? -23.387 -7.289  0.210   1.00 1.23  ? 78  ARG A CD   2  
ATOM 4112  N NE   . ARG A 1 78  ? -23.734 -7.604  -1.205  1.00 1.80  ? 78  ARG A NE   2  
ATOM 4113  C CZ   . ARG A 1 78  ? -24.275 -8.754  -1.505  1.00 2.50  ? 78  ARG A CZ   2  
ATOM 4114  N NH1  . ARG A 1 78  ? -24.515 -9.628  -0.566  1.00 2.83  ? 78  ARG A NH1  2  
ATOM 4115  N NH2  . ARG A 1 78  ? -24.577 -9.028  -2.744  1.00 3.41  ? 78  ARG A NH2  2  
ATOM 4116  H H    . ARG A 1 78  ? -18.782 -6.396  -1.501  1.00 0.75  ? 78  ARG A H    2  
ATOM 4117  H HA   . ARG A 1 78  ? -20.772 -4.387  -0.910  1.00 0.75  ? 78  ARG A HA   2  
ATOM 4118  H HB2  . ARG A 1 78  ? -21.290 -6.792  -1.414  1.00 0.91  ? 78  ARG A HB2  2  
ATOM 4119  H HB3  . ARG A 1 78  ? -20.633 -7.215  0.169   1.00 0.83  ? 78  ARG A HB3  2  
ATOM 4120  H HG2  . ARG A 1 78  ? -22.282 -5.790  1.275   1.00 1.18  ? 78  ARG A HG2  2  
ATOM 4121  H HG3  . ARG A 1 78  ? -22.906 -5.261  -0.288  1.00 1.35  ? 78  ARG A HG3  2  
ATOM 4122  H HD2  . ARG A 1 78  ? -22.895 -8.139  0.658   1.00 1.78  ? 78  ARG A HD2  2  
ATOM 4123  H HD3  . ARG A 1 78  ? -24.288 -7.062  0.760   1.00 1.68  ? 78  ARG A HD3  2  
ATOM 4124  H HE   . ARG A 1 78  ? -23.555 -6.948  -1.911  1.00 2.23  ? 78  ARG A HE   2  
ATOM 4125  H HH11 . ARG A 1 78  ? -24.284 -9.417  0.384   1.00 2.69  ? 78  ARG A HH11 2  
ATOM 4126  H HH12 . ARG A 1 78  ? -24.930 -10.508 -0.796  1.00 3.57  ? 78  ARG A HH12 2  
ATOM 4127  H HH21 . ARG A 1 78  ? -24.394 -8.358  -3.464  1.00 3.73  ? 78  ARG A HH21 2  
ATOM 4128  H HH22 . ARG A 1 78  ? -24.992 -9.909  -2.975  1.00 4.02  ? 78  ARG A HH22 2  
ATOM 4129  N N    . MET A 1 79  ? -18.783 -5.394  1.502   1.00 0.75  ? 79  MET A N    2  
ATOM 4130  C CA   . MET A 1 79  ? -18.354 -5.053  2.887   1.00 0.77  ? 79  MET A CA   2  
ATOM 4131  C C    . MET A 1 79  ? -17.819 -3.621  2.898   1.00 0.77  ? 79  MET A C    2  
ATOM 4132  O O    . MET A 1 79  ? -18.232 -2.800  3.693   1.00 0.78  ? 79  MET A O    2  
ATOM 4133  C CB   . MET A 1 79  ? -17.249 -6.022  3.337   1.00 0.81  ? 79  MET A CB   2  
ATOM 4134  C CG   . MET A 1 79  ? -17.870 -7.342  3.805   1.00 1.08  ? 79  MET A CG   2  
ATOM 4135  S SD   . MET A 1 79  ? -16.566 -8.436  4.424   1.00 1.07  ? 79  MET A SD   2  
ATOM 4136  C CE   . MET A 1 79  ? -16.577 -7.864  6.142   1.00 0.81  ? 79  MET A CE   2  
ATOM 4137  H H    . MET A 1 79  ? -18.259 -6.046  0.989   1.00 0.77  ? 79  MET A H    2  
ATOM 4138  H HA   . MET A 1 79  ? -19.199 -5.127  3.556   1.00 0.78  ? 79  MET A HA   2  
ATOM 4139  H HB2  . MET A 1 79  ? -16.583 -6.214  2.508   1.00 1.29  ? 79  MET A HB2  2  
ATOM 4140  H HB3  . MET A 1 79  ? -16.691 -5.584  4.152   1.00 1.16  ? 79  MET A HB3  2  
ATOM 4141  H HG2  . MET A 1 79  ? -18.581 -7.147  4.594   1.00 1.48  ? 79  MET A HG2  2  
ATOM 4142  H HG3  . MET A 1 79  ? -18.374 -7.817  2.976   1.00 1.58  ? 79  MET A HG3  2  
ATOM 4143  H HE1  . MET A 1 79  ? -16.480 -6.787  6.163   1.00 1.37  ? 79  MET A HE1  2  
ATOM 4144  H HE2  . MET A 1 79  ? -15.751 -8.307  6.675   1.00 1.34  ? 79  MET A HE2  2  
ATOM 4145  H HE3  . MET A 1 79  ? -17.505 -8.157  6.612   1.00 1.20  ? 79  MET A HE3  2  
ATOM 4146  N N    . ILE A 1 80  ? -16.912 -3.309  2.010   1.00 0.77  ? 80  ILE A N    2  
ATOM 4147  C CA   . ILE A 1 80  ? -16.366 -1.924  1.962   1.00 0.80  ? 80  ILE A CA   2  
ATOM 4148  C C    . ILE A 1 80  ? -17.540 -0.939  1.938   1.00 0.80  ? 80  ILE A C    2  
ATOM 4149  O O    . ILE A 1 80  ? -17.429 0.188   2.381   1.00 0.83  ? 80  ILE A O    2  
ATOM 4150  C CB   . ILE A 1 80  ? -15.496 -1.758  0.713   1.00 0.82  ? 80  ILE A CB   2  
ATOM 4151  C CG1  . ILE A 1 80  ? -14.244 -2.629  0.857   1.00 0.84  ? 80  ILE A CG1  2  
ATOM 4152  C CG2  . ILE A 1 80  ? -15.075 -0.293  0.564   1.00 0.89  ? 80  ILE A CG2  2  
ATOM 4153  C CD1  . ILE A 1 80  ? -13.528 -2.730  -0.491  1.00 1.10  ? 80  ILE A CD1  2  
ATOM 4154  H H    . ILE A 1 80  ? -16.602 -3.982  1.369   1.00 0.77  ? 80  ILE A H    2  
ATOM 4155  H HA   . ILE A 1 80  ? -15.772 -1.735  2.841   1.00 0.82  ? 80  ILE A HA   2  
ATOM 4156  H HB   . ILE A 1 80  ? -16.053 -2.065  -0.160  1.00 0.80  ? 80  ILE A HB   2  
ATOM 4157  H HG12 . ILE A 1 80  ? -13.580 -2.185  1.585   1.00 0.89  ? 80  ILE A HG12 2  
ATOM 4158  H HG13 . ILE A 1 80  ? -14.528 -3.616  1.187   1.00 1.04  ? 80  ILE A HG13 2  
ATOM 4159  H HG21 . ILE A 1 80  ? -14.314 -0.214  -0.198  1.00 1.27  ? 80  ILE A HG21 2  
ATOM 4160  H HG22 . ILE A 1 80  ? -14.681 0.067   1.504   1.00 1.34  ? 80  ILE A HG22 2  
ATOM 4161  H HG23 . ILE A 1 80  ? -15.931 0.302   0.281   1.00 1.40  ? 80  ILE A HG23 2  
ATOM 4162  H HD11 . ILE A 1 80  ? -14.172 -3.222  -1.205  1.00 1.67  ? 80  ILE A HD11 2  
ATOM 4163  H HD12 . ILE A 1 80  ? -12.619 -3.301  -0.374  1.00 1.53  ? 80  ILE A HD12 2  
ATOM 4164  H HD13 . ILE A 1 80  ? -13.287 -1.739  -0.846  1.00 1.46  ? 80  ILE A HD13 2  
ATOM 4165  N N    . ALA A 1 81  ? -18.667 -1.356  1.424   1.00 0.78  ? 81  ALA A N    2  
ATOM 4166  C CA   . ALA A 1 81  ? -19.850 -0.447  1.380   1.00 0.80  ? 81  ALA A CA   2  
ATOM 4167  C C    . ALA A 1 81  ? -20.514 -0.393  2.763   1.00 0.81  ? 81  ALA A C    2  
ATOM 4168  O O    . ALA A 1 81  ? -21.301 0.488   3.049   1.00 0.85  ? 81  ALA A O    2  
ATOM 4169  C CB   . ALA A 1 81  ? -20.858 -0.979  0.362   1.00 0.79  ? 81  ALA A CB   2  
ATOM 4170  H H    . ALA A 1 81  ? -18.735 -2.264  1.056   1.00 0.76  ? 81  ALA A H    2  
ATOM 4171  H HA   . ALA A 1 81  ? -19.534 0.543   1.096   1.00 0.84  ? 81  ALA A HA   2  
ATOM 4172  H HB1  . ALA A 1 81  ? -21.271 -1.912  0.720   1.00 1.32  ? 81  ALA A HB1  2  
ATOM 4173  H HB2  . ALA A 1 81  ? -20.364 -1.142  -0.583  1.00 1.19  ? 81  ALA A HB2  2  
ATOM 4174  H HB3  . ALA A 1 81  ? -21.653 -0.260  0.235   1.00 1.34  ? 81  ALA A HB3  2  
ATOM 4175  N N    . ALA A 1 82  ? -20.215 -1.336  3.615   1.00 0.78  ? 82  ALA A N    2  
ATOM 4176  C CA   . ALA A 1 82  ? -20.838 -1.354  4.974   1.00 0.80  ? 82  ALA A CA   2  
ATOM 4177  C C    . ALA A 1 82  ? -20.063 -0.446  5.936   1.00 0.79  ? 82  ALA A C    2  
ATOM 4178  O O    . ALA A 1 82  ? -20.546 -0.111  7.000   1.00 0.83  ? 82  ALA A O    2  
ATOM 4179  C CB   . ALA A 1 82  ? -20.822 -2.785  5.514   1.00 0.87  ? 82  ALA A CB   2  
ATOM 4180  H H    . ALA A 1 82  ? -19.588 -2.043  3.355   1.00 0.76  ? 82  ALA A H    2  
ATOM 4181  H HA   . ALA A 1 82  ? -21.860 -1.011  4.919   1.00 0.83  ? 82  ALA A HA   2  
ATOM 4182  H HB1  . ALA A 1 82  ? -21.260 -2.801  6.502   1.00 1.37  ? 82  ALA A HB1  2  
ATOM 4183  H HB2  . ALA A 1 82  ? -19.803 -3.138  5.567   1.00 1.22  ? 82  ALA A HB2  2  
ATOM 4184  H HB3  . ALA A 1 82  ? -21.391 -3.425  4.857   1.00 1.37  ? 82  ALA A HB3  2  
ATOM 4185  N N    . VAL A 1 83  ? -18.871 -0.044  5.584   1.00 0.80  ? 83  VAL A N    2  
ATOM 4186  C CA   . VAL A 1 83  ? -18.079 0.843   6.497   1.00 0.85  ? 83  VAL A CA   2  
ATOM 4187  C C    . VAL A 1 83  ? -18.376 2.309   6.156   1.00 0.99  ? 83  VAL A C    2  
ATOM 4188  O O    . VAL A 1 83  ? -17.825 2.886   5.241   1.00 1.36  ? 83  VAL A O    2  
ATOM 4189  C CB   . VAL A 1 83  ? -16.577 0.531   6.354   1.00 0.97  ? 83  VAL A CB   2  
ATOM 4190  C CG1  . VAL A 1 83  ? -16.220 0.337   4.883   1.00 1.81  ? 83  VAL A CG1  2  
ATOM 4191  C CG2  . VAL A 1 83  ? -15.733 1.670   6.942   1.00 1.40  ? 83  VAL A CG2  2  
ATOM 4192  H H    . VAL A 1 83  ? -18.499 -0.324  4.723   1.00 0.82  ? 83  VAL A H    2  
ATOM 4193  H HA   . VAL A 1 83  ? -18.381 0.666   7.521   1.00 0.90  ? 83  VAL A HA   2  
ATOM 4194  H HB   . VAL A 1 83  ? -16.359 -0.383  6.889   1.00 1.62  ? 83  VAL A HB   2  
ATOM 4195  H HG11 . VAL A 1 83  ? -16.509 1.208   4.317   1.00 2.36  ? 83  VAL A HG11 2  
ATOM 4196  H HG12 . VAL A 1 83  ? -16.743 -0.526  4.507   1.00 2.40  ? 83  VAL A HG12 2  
ATOM 4197  H HG13 . VAL A 1 83  ? -15.154 0.182   4.787   1.00 2.21  ? 83  VAL A HG13 2  
ATOM 4198  H HG21 . VAL A 1 83  ? -14.718 1.328   7.084   1.00 2.00  ? 83  VAL A HG21 2  
ATOM 4199  H HG22 . VAL A 1 83  ? -16.147 1.970   7.894   1.00 1.97  ? 83  VAL A HG22 2  
ATOM 4200  H HG23 . VAL A 1 83  ? -15.739 2.511   6.266   1.00 1.85  ? 83  VAL A HG23 2  
ATOM 4201  N N    . ASP A 1 84  ? -19.246 2.909   6.919   1.00 1.46  ? 84  ASP A N    2  
ATOM 4202  C CA   . ASP A 1 84  ? -19.602 4.339   6.700   1.00 1.71  ? 84  ASP A CA   2  
ATOM 4203  C C    . ASP A 1 84  ? -18.415 5.227   7.081   1.00 1.39  ? 84  ASP A C    2  
ATOM 4204  O O    . ASP A 1 84  ? -17.503 4.802   7.761   1.00 1.80  ? 84  ASP A O    2  
ATOM 4205  C CB   . ASP A 1 84  ? -20.797 4.699   7.586   1.00 2.38  ? 84  ASP A CB   2  
ATOM 4206  C CG   . ASP A 1 84  ? -21.285 6.107   7.238   1.00 2.99  ? 84  ASP A CG   2  
ATOM 4207  O OD1  . ASP A 1 84  ? -20.770 7.050   7.815   1.00 3.57  ? 84  ASP A OD1  2  
ATOM 4208  O OD2  . ASP A 1 84  ? -22.166 6.217   6.401   1.00 3.45  ? 84  ASP A OD2  2  
ATOM 4209  H H    . ASP A 1 84  ? -19.659 2.411   7.654   1.00 1.92  ? 84  ASP A H    2  
ATOM 4210  H HA   . ASP A 1 84  ? -19.864 4.514   5.666   1.00 2.10  ? 84  ASP A HA   2  
ATOM 4211  H HB2  . ASP A 1 84  ? -21.595 3.989   7.419   1.00 2.86  ? 84  ASP A HB2  2  
ATOM 4212  H HB3  . ASP A 1 84  ? -20.499 4.669   8.623   1.00 2.68  ? 84  ASP A HB3  2  
ATOM 4213  N N    . THR A 1 85  ? -18.422 6.461   6.649   1.00 1.68  ? 85  THR A N    2  
ATOM 4214  C CA   . THR A 1 85  ? -17.296 7.383   6.986   1.00 1.97  ? 85  THR A CA   2  
ATOM 4215  C C    . THR A 1 85  ? -17.601 8.095   8.307   1.00 1.67  ? 85  THR A C    2  
ATOM 4216  O O    . THR A 1 85  ? -18.735 8.163   8.739   1.00 2.28  ? 85  THR A O    2  
ATOM 4217  C CB   . THR A 1 85  ? -17.136 8.420   5.871   1.00 3.20  ? 85  THR A CB   2  
ATOM 4218  O OG1  . THR A 1 85  ? -16.067 9.299   6.195   1.00 3.80  ? 85  THR A OG1  2  
ATOM 4219  C CG2  . THR A 1 85  ? -18.430 9.222   5.723   1.00 3.87  ? 85  THR A CG2  2  
ATOM 4220  H H    . THR A 1 85  ? -19.169 6.783   6.103   1.00 2.23  ? 85  THR A H    2  
ATOM 4221  H HA   . THR A 1 85  ? -16.379 6.819   7.086   1.00 2.24  ? 85  THR A HA   2  
ATOM 4222  H HB   . THR A 1 85  ? -16.920 7.918   4.941   1.00 3.70  ? 85  THR A HB   2  
ATOM 4223  H HG1  . THR A 1 85  ? -15.255 8.914   5.858   1.00 4.15  ? 85  THR A HG1  2  
ATOM 4224  H HG21 . THR A 1 85  ? -18.558 9.862   6.583   1.00 4.19  ? 85  THR A HG21 2  
ATOM 4225  H HG22 . THR A 1 85  ? -19.268 8.543   5.652   1.00 4.15  ? 85  THR A HG22 2  
ATOM 4226  H HG23 . THR A 1 85  ? -18.379 9.825   4.829   1.00 4.28  ? 85  THR A HG23 2  
ATOM 4227  N N    . ASP A 1 86  ? -16.598 8.626   8.952   1.00 1.51  ? 86  ASP A N    2  
ATOM 4228  C CA   . ASP A 1 86  ? -16.829 9.331   10.244  1.00 1.98  ? 86  ASP A CA   2  
ATOM 4229  C C    . ASP A 1 86  ? -15.523 9.978   10.711  1.00 1.78  ? 86  ASP A C    2  
ATOM 4230  O O    . ASP A 1 86  ? -15.487 11.124  11.112  1.00 2.48  ? 86  ASP A O    2  
ATOM 4231  C CB   . ASP A 1 86  ? -17.309 8.324   11.293  1.00 2.56  ? 86  ASP A CB   2  
ATOM 4232  C CG   . ASP A 1 86  ? -16.457 7.057   11.213  1.00 3.06  ? 86  ASP A CG   2  
ATOM 4233  O OD1  . ASP A 1 86  ? -15.346 7.082   11.717  1.00 3.50  ? 86  ASP A OD1  2  
ATOM 4234  O OD2  . ASP A 1 86  ? -16.929 6.084   10.650  1.00 3.57  ? 86  ASP A OD2  2  
ATOM 4235  H H    . ASP A 1 86  ? -15.691 8.559   8.586   1.00 1.71  ? 86  ASP A H    2  
ATOM 4236  H HA   . ASP A 1 86  ? -17.580 10.095  10.108  1.00 2.59  ? 86  ASP A HA   2  
ATOM 4237  H HB2  . ASP A 1 86  ? -17.219 8.759   12.279  1.00 2.88  ? 86  ASP A HB2  2  
ATOM 4238  H HB3  . ASP A 1 86  ? -18.342 8.072   11.104  1.00 3.03  ? 86  ASP A HB3  2  
ATOM 4239  N N    . SER A 1 87  ? -14.446 9.242   10.650  1.00 1.11  ? 87  SER A N    2  
ATOM 4240  C CA   . SER A 1 87  ? -13.123 9.785   11.074  1.00 0.93  ? 87  SER A CA   2  
ATOM 4241  C C    . SER A 1 87  ? -12.026 8.982   10.350  1.00 0.84  ? 87  SER A C    2  
ATOM 4242  O O    . SER A 1 87  ? -11.578 7.978   10.867  1.00 0.97  ? 87  SER A O    2  
ATOM 4243  C CB   . SER A 1 87  ? -12.964 9.615   12.584  1.00 0.88  ? 87  SER A CB   2  
ATOM 4244  O OG   . SER A 1 87  ? -13.937 10.408  13.250  1.00 1.63  ? 87  SER A OG   2  
ATOM 4245  H H    . SER A 1 87  ? -14.506 8.322   10.315  1.00 1.20  ? 87  SER A H    2  
ATOM 4246  H HA   . SER A 1 87  ? -13.067 10.828  10.818  1.00 1.05  ? 87  SER A HA   2  
ATOM 4247  H HB2  . SER A 1 87  ? -13.108 8.581   12.849  1.00 1.41  ? 87  SER A HB2  2  
ATOM 4248  H HB3  . SER A 1 87  ? -11.970 9.925   12.877  1.00 1.22  ? 87  SER A HB3  2  
ATOM 4249  H HG   . SER A 1 87  ? -13.490 11.166  13.634  1.00 2.08  ? 87  SER A HG   2  
ATOM 4250  N N    . PRO A 1 88  ? -11.642 9.408   9.160   1.00 0.77  ? 88  PRO A N    2  
ATOM 4251  C CA   . PRO A 1 88  ? -10.631 8.673   8.378   1.00 0.83  ? 88  PRO A CA   2  
ATOM 4252  C C    . PRO A 1 88  ? -9.281  8.667   9.108   1.00 0.73  ? 88  PRO A C    2  
ATOM 4253  O O    . PRO A 1 88  ? -8.485  7.767   8.936   1.00 0.72  ? 88  PRO A O    2  
ATOM 4254  C CB   . PRO A 1 88  ? -10.548 9.421   7.025   1.00 1.01  ? 88  PRO A CB   2  
ATOM 4255  C CG   . PRO A 1 88  ? -11.504 10.645  7.109   1.00 1.07  ? 88  PRO A CG   2  
ATOM 4256  C CD   . PRO A 1 88  ? -12.160 10.631  8.505   1.00 0.83  ? 88  PRO A CD   2  
ATOM 4257  H HA   . PRO A 1 88  ? -10.962 7.658   8.214   1.00 0.98  ? 88  PRO A HA   2  
ATOM 4258  H HB2  . PRO A 1 88  ? -9.532  9.754   6.842   1.00 1.03  ? 88  PRO A HB2  2  
ATOM 4259  H HB3  . PRO A 1 88  ? -10.864 8.770   6.221   1.00 1.17  ? 88  PRO A HB3  2  
ATOM 4260  H HG2  . PRO A 1 88  ? -10.937 11.559  6.967   1.00 1.20  ? 88  PRO A HG2  2  
ATOM 4261  H HG3  . PRO A 1 88  ? -12.270 10.586  6.348   1.00 1.29  ? 88  PRO A HG3  2  
ATOM 4262  H HD2  . PRO A 1 88  ? -11.863 11.512  9.060   1.00 0.84  ? 88  PRO A HD2  2  
ATOM 4263  H HD3  . PRO A 1 88  ? -13.237 10.581  8.424   1.00 0.89  ? 88  PRO A HD3  2  
ATOM 4264  N N    . ARG A 1 89  ? -9.009  9.659   9.914   1.00 0.75  ? 89  ARG A N    2  
ATOM 4265  C CA   . ARG A 1 89  ? -7.700  9.679   10.630  1.00 0.73  ? 89  ARG A CA   2  
ATOM 4266  C C    . ARG A 1 89  ? -7.738  8.670   11.783  1.00 0.67  ? 89  ARG A C    2  
ATOM 4267  O O    . ARG A 1 89  ? -6.830  7.882   11.959  1.00 0.68  ? 89  ARG A O    2  
ATOM 4268  C CB   . ARG A 1 89  ? -7.424  11.084  11.173  1.00 0.79  ? 89  ARG A CB   2  
ATOM 4269  C CG   . ARG A 1 89  ? -7.086  12.029  10.015  1.00 1.63  ? 89  ARG A CG   2  
ATOM 4270  C CD   . ARG A 1 89  ? -7.146  13.484  10.494  1.00 1.65  ? 89  ARG A CD   2  
ATOM 4271  N NE   . ARG A 1 89  ? -8.474  13.767  11.136  1.00 2.07  ? 89  ARG A NE   2  
ATOM 4272  C CZ   . ARG A 1 89  ? -9.599  13.578  10.498  1.00 2.47  ? 89  ARG A CZ   2  
ATOM 4273  N NH1  . ARG A 1 89  ? -9.602  13.326  9.218   1.00 2.69  ? 89  ARG A NH1  2  
ATOM 4274  N NH2  . ARG A 1 89  ? -10.731 13.701  11.134  1.00 3.10  ? 89  ARG A NH2  2  
ATOM 4275  H H    . ARG A 1 89  ? -9.654  10.385  10.044  1.00 0.82  ? 89  ARG A H    2  
ATOM 4276  H HA   . ARG A 1 89  ? -6.930  9.388   9.931   1.00 0.76  ? 89  ARG A HA   2  
ATOM 4277  H HB2  . ARG A 1 89  ? -8.301  11.444  11.691  1.00 1.38  ? 89  ARG A HB2  2  
ATOM 4278  H HB3  . ARG A 1 89  ? -6.592  11.047  11.860  1.00 1.17  ? 89  ARG A HB3  2  
ATOM 4279  H HG2  . ARG A 1 89  ? -6.088  11.811  9.661   1.00 2.22  ? 89  ARG A HG2  2  
ATOM 4280  H HG3  . ARG A 1 89  ? -7.785  11.878  9.212   1.00 2.30  ? 89  ARG A HG3  2  
ATOM 4281  H HD2  . ARG A 1 89  ? -6.389  13.642  11.238  1.00 1.89  ? 89  ARG A HD2  2  
ATOM 4282  H HD3  . ARG A 1 89  ? -6.956  14.147  9.652   1.00 1.63  ? 89  ARG A HD3  2  
ATOM 4283  H HE   . ARG A 1 89  ? -8.499  14.051  12.074  1.00 2.46  ? 89  ARG A HE   2  
ATOM 4284  H HH11 . ARG A 1 89  ? -8.739  13.280  8.716   1.00 2.55  ? 89  ARG A HH11 2  
ATOM 4285  H HH12 . ARG A 1 89  ? -10.467 13.178  8.740   1.00 3.27  ? 89  ARG A HH12 2  
ATOM 4286  H HH21 . ARG A 1 89  ? -10.736 13.940  12.105  1.00 3.36  ? 89  ARG A HH21 2  
ATOM 4287  H HH22 . ARG A 1 89  ? -11.594 13.556  10.650  1.00 3.53  ? 89  ARG A HH22 2  
ATOM 4288  N N    . GLU A 1 90  ? -8.784  8.682   12.568  1.00 0.65  ? 90  GLU A N    2  
ATOM 4289  C CA   . GLU A 1 90  ? -8.877  7.717   13.704  1.00 0.65  ? 90  GLU A CA   2  
ATOM 4290  C C    . GLU A 1 90  ? -8.966  6.292   13.152  1.00 0.64  ? 90  GLU A C    2  
ATOM 4291  O O    . GLU A 1 90  ? -8.240  5.414   13.577  1.00 0.67  ? 90  GLU A O    2  
ATOM 4292  C CB   . GLU A 1 90  ? -10.127 8.022   14.531  1.00 0.71  ? 90  GLU A CB   2  
ATOM 4293  C CG   . GLU A 1 90  ? -10.032 9.439   15.100  1.00 1.32  ? 90  GLU A CG   2  
ATOM 4294  C CD   . GLU A 1 90  ? -11.296 9.751   15.903  1.00 2.02  ? 90  GLU A CD   2  
ATOM 4295  O OE1  . GLU A 1 90  ? -11.665 8.934   16.732  1.00 2.46  ? 90  GLU A OE1  2  
ATOM 4296  O OE2  . GLU A 1 90  ? -11.875 10.801  15.676  1.00 2.78  ? 90  GLU A OE2  2  
ATOM 4297  H H    . GLU A 1 90  ? -9.507  9.324   12.411  1.00 0.67  ? 90  GLU A H    2  
ATOM 4298  H HA   . GLU A 1 90  ? -7.999  7.803   14.326  1.00 0.66  ? 90  GLU A HA   2  
ATOM 4299  H HB2  . GLU A 1 90  ? -11.003 7.943   13.902  1.00 1.12  ? 90  GLU A HB2  2  
ATOM 4300  H HB3  . GLU A 1 90  ? -10.202 7.314   15.343  1.00 1.09  ? 90  GLU A HB3  2  
ATOM 4301  H HG2  . GLU A 1 90  ? -9.168  9.510   15.745  1.00 1.90  ? 90  GLU A HG2  2  
ATOM 4302  H HG3  . GLU A 1 90  ? -9.938  10.147  14.291  1.00 1.78  ? 90  GLU A HG3  2  
ATOM 4303  N N    . VAL A 1 91  ? -9.845  6.042   12.222  1.00 0.64  ? 91  VAL A N    2  
ATOM 4304  C CA   . VAL A 1 91  ? -9.963  4.662   11.670  1.00 0.67  ? 91  VAL A CA   2  
ATOM 4305  C C    . VAL A 1 91  ? -8.633  4.256   11.029  1.00 0.66  ? 91  VAL A C    2  
ATOM 4306  O O    . VAL A 1 91  ? -8.160  3.150   11.206  1.00 0.67  ? 91  VAL A O    2  
ATOM 4307  C CB   . VAL A 1 91  ? -11.082 4.628   10.624  1.00 0.71  ? 91  VAL A CB   2  
ATOM 4308  C CG1  . VAL A 1 91  ? -11.209 3.219   10.043  1.00 0.80  ? 91  VAL A CG1  2  
ATOM 4309  C CG2  . VAL A 1 91  ? -12.406 5.025   11.283  1.00 0.75  ? 91  VAL A CG2  2  
ATOM 4310  H H    . VAL A 1 91  ? -10.427 6.751   11.880  1.00 0.65  ? 91  VAL A H    2  
ATOM 4311  H HA   . VAL A 1 91  ? -10.190 3.972   12.470  1.00 0.69  ? 91  VAL A HA   2  
ATOM 4312  H HB   . VAL A 1 91  ? -10.851 5.324   9.830   1.00 0.70  ? 91  VAL A HB   2  
ATOM 4313  H HG11 . VAL A 1 91  ? -12.063 3.178   9.382   1.00 1.38  ? 91  VAL A HG11 2  
ATOM 4314  H HG12 . VAL A 1 91  ? -11.342 2.509   10.846  1.00 1.38  ? 91  VAL A HG12 2  
ATOM 4315  H HG13 . VAL A 1 91  ? -10.314 2.974   9.489   1.00 1.12  ? 91  VAL A HG13 2  
ATOM 4316  H HG21 . VAL A 1 91  ? -12.728 4.236   11.946  1.00 1.26  ? 91  VAL A HG21 2  
ATOM 4317  H HG22 . VAL A 1 91  ? -13.155 5.183   10.521  1.00 1.29  ? 91  VAL A HG22 2  
ATOM 4318  H HG23 . VAL A 1 91  ? -12.269 5.936   11.847  1.00 1.25  ? 91  VAL A HG23 2  
ATOM 4319  N N    . PHE A 1 92  ? -8.025  5.140   10.289  1.00 0.64  ? 92  PHE A N    2  
ATOM 4320  C CA   . PHE A 1 92  ? -6.724  4.809   9.640   1.00 0.65  ? 92  PHE A CA   2  
ATOM 4321  C C    . PHE A 1 92  ? -5.761  4.203   10.670  1.00 0.62  ? 92  PHE A C    2  
ATOM 4322  O O    . PHE A 1 92  ? -5.181  3.161   10.439  1.00 0.67  ? 92  PHE A O    2  
ATOM 4323  C CB   . PHE A 1 92  ? -6.114  6.085   9.045   1.00 0.65  ? 92  PHE A CB   2  
ATOM 4324  C CG   . PHE A 1 92  ? -4.693  5.820   8.594   1.00 0.65  ? 92  PHE A CG   2  
ATOM 4325  C CD1  . PHE A 1 92  ? -4.455  5.152   7.387   1.00 1.31  ? 92  PHE A CD1  2  
ATOM 4326  C CD2  . PHE A 1 92  ? -3.615  6.243   9.383   1.00 1.44  ? 92  PHE A CD2  2  
ATOM 4327  C CE1  . PHE A 1 92  ? -3.141  4.906   6.970   1.00 1.31  ? 92  PHE A CE1  2  
ATOM 4328  C CE2  . PHE A 1 92  ? -2.302  5.997   8.965   1.00 1.47  ? 92  PHE A CE2  2  
ATOM 4329  C CZ   . PHE A 1 92  ? -2.065  5.328   7.759   1.00 0.73  ? 92  PHE A CZ   2  
ATOM 4330  H H    . PHE A 1 92  ? -8.424  6.025   10.158  1.00 0.63  ? 92  PHE A H    2  
ATOM 4331  H HA   . PHE A 1 92  ? -6.875  4.083   8.855   1.00 0.68  ? 92  PHE A HA   2  
ATOM 4332  H HB2  . PHE A 1 92  ? -6.704  6.400   8.197   1.00 0.66  ? 92  PHE A HB2  2  
ATOM 4333  H HB3  . PHE A 1 92  ? -6.115  6.865   9.792   1.00 0.67  ? 92  PHE A HB3  2  
ATOM 4334  H HD1  . PHE A 1 92  ? -5.285  4.825   6.779   1.00 2.16  ? 92  PHE A HD1  2  
ATOM 4335  H HD2  . PHE A 1 92  ? -3.797  6.759   10.315  1.00 2.30  ? 92  PHE A HD2  2  
ATOM 4336  H HE1  . PHE A 1 92  ? -2.959  4.390   6.039   1.00 2.16  ? 92  PHE A HE1  2  
ATOM 4337  H HE2  . PHE A 1 92  ? -1.471  6.323   9.574   1.00 2.34  ? 92  PHE A HE2  2  
ATOM 4338  H HZ   . PHE A 1 92  ? -1.052  5.139   7.436   1.00 0.77  ? 92  PHE A HZ   2  
ATOM 4339  N N    . PHE A 1 93  ? -5.567  4.840   11.794  1.00 0.58  ? 93  PHE A N    2  
ATOM 4340  C CA   . PHE A 1 93  ? -4.620  4.273   12.801  1.00 0.57  ? 93  PHE A CA   2  
ATOM 4341  C C    . PHE A 1 93  ? -5.285  3.106   13.534  1.00 0.59  ? 93  PHE A C    2  
ATOM 4342  O O    . PHE A 1 93  ? -4.628  2.175   13.956  1.00 0.60  ? 93  PHE A O    2  
ATOM 4343  C CB   . PHE A 1 93  ? -4.216  5.357   13.803  1.00 0.57  ? 93  PHE A CB   2  
ATOM 4344  C CG   . PHE A 1 93  ? -3.206  4.797   14.777  1.00 0.56  ? 93  PHE A CG   2  
ATOM 4345  C CD1  . PHE A 1 93  ? -1.873  4.631   14.381  1.00 1.47  ? 93  PHE A CD1  2  
ATOM 4346  C CD2  . PHE A 1 93  ? -3.599  4.444   16.075  1.00 1.15  ? 93  PHE A CD2  2  
ATOM 4347  C CE1  . PHE A 1 93  ? -0.934  4.113   15.282  1.00 1.58  ? 93  PHE A CE1  2  
ATOM 4348  C CE2  . PHE A 1 93  ? -2.659  3.926   16.975  1.00 1.07  ? 93  PHE A CE2  2  
ATOM 4349  C CZ   . PHE A 1 93  ? -1.327  3.761   16.578  1.00 0.70  ? 93  PHE A CZ   2  
ATOM 4350  H H    . PHE A 1 93  ? -6.029  5.686   11.970  1.00 0.57  ? 93  PHE A H    2  
ATOM 4351  H HA   . PHE A 1 93  ? -3.747  3.906   12.280  1.00 0.57  ? 93  PHE A HA   2  
ATOM 4352  H HB2  . PHE A 1 93  ? -3.780  6.191   13.272  1.00 0.62  ? 93  PHE A HB2  2  
ATOM 4353  H HB3  . PHE A 1 93  ? -5.090  5.691   14.342  1.00 0.56  ? 93  PHE A HB3  2  
ATOM 4354  H HD1  . PHE A 1 93  ? -1.569  4.902   13.381  1.00 2.29  ? 93  PHE A HD1  2  
ATOM 4355  H HD2  . PHE A 1 93  ? -4.627  4.571   16.382  1.00 2.04  ? 93  PHE A HD2  2  
ATOM 4356  H HE1  . PHE A 1 93  ? 0.094   3.986   14.976  1.00 2.50  ? 93  PHE A HE1  2  
ATOM 4357  H HE2  . PHE A 1 93  ? -2.962  3.655   17.976  1.00 1.86  ? 93  PHE A HE2  2  
ATOM 4358  H HZ   . PHE A 1 93  ? -0.602  3.362   17.272  1.00 0.78  ? 93  PHE A HZ   2  
ATOM 4359  N N    . ARG A 1 94  ? -6.581  3.139   13.685  1.00 0.62  ? 94  ARG A N    2  
ATOM 4360  C CA   . ARG A 1 94  ? -7.272  2.019   14.384  1.00 0.67  ? 94  ARG A CA   2  
ATOM 4361  C C    . ARG A 1 94  ? -7.197  0.766   13.512  1.00 0.66  ? 94  ARG A C    2  
ATOM 4362  O O    . ARG A 1 94  ? -6.726  -0.267  13.948  1.00 0.67  ? 94  ARG A O    2  
ATOM 4363  C CB   . ARG A 1 94  ? -8.740  2.394   14.652  1.00 0.72  ? 94  ARG A CB   2  
ATOM 4364  C CG   . ARG A 1 94  ? -9.281  1.623   15.866  1.00 0.89  ? 94  ARG A CG   2  
ATOM 4365  C CD   . ARG A 1 94  ? -9.332  0.118   15.569  1.00 1.00  ? 94  ARG A CD   2  
ATOM 4366  N NE   . ARG A 1 94  ? -10.266 -0.536  16.529  1.00 1.95  ? 94  ARG A NE   2  
ATOM 4367  C CZ   . ARG A 1 94  ? -10.687 -1.751  16.311  1.00 2.64  ? 94  ARG A CZ   2  
ATOM 4368  N NH1  . ARG A 1 94  ? -10.280 -2.405  15.258  1.00 2.76  ? 94  ARG A NH1  2  
ATOM 4369  N NH2  . ARG A 1 94  ? -11.514 -2.315  17.149  1.00 3.65  ? 94  ARG A NH2  2  
ATOM 4370  H H    . ARG A 1 94  ? -7.098  3.895   13.336  1.00 0.62  ? 94  ARG A H    2  
ATOM 4371  H HA   . ARG A 1 94  ? -6.765  1.803   15.314  1.00 0.68  ? 94  ARG A HA   2  
ATOM 4372  H HB2  . ARG A 1 94  ? -8.801  3.454   14.850  1.00 0.81  ? 94  ARG A HB2  2  
ATOM 4373  H HB3  . ARG A 1 94  ? -9.340  2.160   13.784  1.00 0.78  ? 94  ARG A HB3  2  
ATOM 4374  H HG2  . ARG A 1 94  ? -8.641  1.799   16.717  1.00 1.50  ? 94  ARG A HG2  2  
ATOM 4375  H HG3  . ARG A 1 94  ? -10.278 1.973   16.092  1.00 1.69  ? 94  ARG A HG3  2  
ATOM 4376  H HD2  . ARG A 1 94  ? -9.683  -0.045  14.561  1.00 1.49  ? 94  ARG A HD2  2  
ATOM 4377  H HD3  . ARG A 1 94  ? -8.345  -0.308  15.679  1.00 1.47  ? 94  ARG A HD3  2  
ATOM 4378  H HE   . ARG A 1 94  ? -10.569 -0.049  17.324  1.00 2.46  ? 94  ARG A HE   2  
ATOM 4379  H HH11 . ARG A 1 94  ? -9.645  -1.975  14.616  1.00 2.42  ? 94  ARG A HH11 2  
ATOM 4380  H HH12 . ARG A 1 94  ? -10.603 -3.337  15.092  1.00 3.50  ? 94  ARG A HH12 2  
ATOM 4381  H HH21 . ARG A 1 94  ? -11.825 -1.814  17.957  1.00 4.01  ? 94  ARG A HH21 2  
ATOM 4382  H HH22 . ARG A 1 94  ? -11.838 -3.246  16.983  1.00 4.24  ? 94  ARG A HH22 2  
ATOM 4383  N N    . VAL A 1 95  ? -7.650  0.825   12.290  1.00 0.65  ? 95  VAL A N    2  
ATOM 4384  C CA   . VAL A 1 95  ? -7.590  -0.384  11.423  1.00 0.66  ? 95  VAL A CA   2  
ATOM 4385  C C    . VAL A 1 95  ? -6.128  -0.767  11.172  1.00 0.66  ? 95  VAL A C    2  
ATOM 4386  O O    . VAL A 1 95  ? -5.768  -1.927  11.226  1.00 0.67  ? 95  VAL A O    2  
ATOM 4387  C CB   . VAL A 1 95  ? -8.286  -0.074  10.086  1.00 0.64  ? 95  VAL A CB   2  
ATOM 4388  C CG1  . VAL A 1 95  ? -7.941  -1.145  9.042   1.00 1.27  ? 95  VAL A CG1  2  
ATOM 4389  C CG2  . VAL A 1 95  ? -9.803  -0.041  10.299  1.00 1.08  ? 95  VAL A CG2  2  
ATOM 4390  H H    . VAL A 1 95  ? -8.041  1.640   11.911  1.00 0.66  ? 95  VAL A H    2  
ATOM 4391  H HA   . VAL A 1 95  ? -8.096  -1.202  11.913  1.00 0.68  ? 95  VAL A HA   2  
ATOM 4392  H HB   . VAL A 1 95  ? -7.954  0.890   9.728   1.00 1.14  ? 95  VAL A HB   2  
ATOM 4393  H HG11 . VAL A 1 95  ? -8.645  -1.095  8.223   1.00 1.81  ? 95  VAL A HG11 2  
ATOM 4394  H HG12 . VAL A 1 95  ? -7.987  -2.122  9.498   1.00 1.74  ? 95  VAL A HG12 2  
ATOM 4395  H HG13 . VAL A 1 95  ? -6.943  -0.971  8.667   1.00 1.85  ? 95  VAL A HG13 2  
ATOM 4396  H HG21 . VAL A 1 95  ? -10.165 -1.045  10.463  1.00 1.72  ? 95  VAL A HG21 2  
ATOM 4397  H HG22 . VAL A 1 95  ? -10.280 0.376   9.425   1.00 1.70  ? 95  VAL A HG22 2  
ATOM 4398  H HG23 . VAL A 1 95  ? -10.032 0.569   11.160  1.00 1.50  ? 95  VAL A HG23 2  
ATOM 4399  N N    . ALA A 1 96  ? -5.286  0.183   10.869  1.00 0.65  ? 96  ALA A N    2  
ATOM 4400  C CA   . ALA A 1 96  ? -3.869  -0.168  10.591  1.00 0.68  ? 96  ALA A CA   2  
ATOM 4401  C C    . ALA A 1 96  ? -3.286  -0.949  11.763  1.00 0.70  ? 96  ALA A C    2  
ATOM 4402  O O    . ALA A 1 96  ? -2.438  -1.804  11.600  1.00 0.76  ? 96  ALA A O    2  
ATOM 4403  C CB   . ALA A 1 96  ? -3.057  1.100   10.306  1.00 0.69  ? 96  ALA A CB   2  
ATOM 4404  H H    . ALA A 1 96  ? -5.590  1.113   10.801  1.00 0.65  ? 96  ALA A H    2  
ATOM 4405  H HA   . ALA A 1 96  ? -3.868  -0.754  9.677   1.00 0.69  ? 96  ALA A HA   2  
ATOM 4406  H HB1  . ALA A 1 96  ? -3.439  1.588   9.424   1.00 1.19  ? 96  ALA A HB1  2  
ATOM 4407  H HB2  . ALA A 1 96  ? -2.020  0.840   10.159  1.00 1.22  ? 96  ALA A HB2  2  
ATOM 4408  H HB3  . ALA A 1 96  ? -3.141  1.770   11.152  1.00 1.14  ? 96  ALA A HB3  2  
ATOM 4409  N N    . ALA A 1 97  ? -3.754  -0.665  12.948  1.00 0.74  ? 97  ALA A N    2  
ATOM 4410  C CA   . ALA A 1 97  ? -3.254  -1.389  14.149  1.00 0.78  ? 97  ALA A CA   2  
ATOM 4411  C C    . ALA A 1 97  ? -4.004  -2.717  14.274  1.00 0.79  ? 97  ALA A C    2  
ATOM 4412  O O    . ALA A 1 97  ? -3.515  -3.668  14.849  1.00 0.83  ? 97  ALA A O    2  
ATOM 4413  C CB   . ALA A 1 97  ? -3.511  -0.542  15.399  1.00 0.77  ? 97  ALA A CB   2  
ATOM 4414  H H    . ALA A 1 97  ? -4.445  0.023   13.048  1.00 0.80  ? 97  ALA A H    2  
ATOM 4415  H HA   . ALA A 1 97  ? -2.195  -1.577  14.052  1.00 0.81  ? 97  ALA A HA   2  
ATOM 4416  H HB1  . ALA A 1 97  ? -2.973  0.390   15.318  1.00 1.22  ? 97  ALA A HB1  2  
ATOM 4417  H HB2  . ALA A 1 97  ? -3.173  -1.079  16.273  1.00 1.21  ? 97  ALA A HB2  2  
ATOM 4418  H HB3  . ALA A 1 97  ? -4.569  -0.341  15.486  1.00 1.35  ? 97  ALA A HB3  2  
ATOM 4419  N N    . ASP A 1 98  ? -5.188  -2.786  13.726  1.00 0.78  ? 98  ASP A N    2  
ATOM 4420  C CA   . ASP A 1 98  ? -5.974  -4.049  13.796  1.00 0.82  ? 98  ASP A CA   2  
ATOM 4421  C C    . ASP A 1 98  ? -5.369  -5.062  12.831  1.00 0.83  ? 98  ASP A C    2  
ATOM 4422  O O    . ASP A 1 98  ? -5.042  -6.173  13.198  1.00 0.88  ? 98  ASP A O    2  
ATOM 4423  C CB   . ASP A 1 98  ? -7.422  -3.761  13.392  1.00 0.82  ? 98  ASP A CB   2  
ATOM 4424  C CG   . ASP A 1 98  ? -8.284  -4.995  13.666  1.00 1.47  ? 98  ASP A CG   2  
ATOM 4425  O OD1  . ASP A 1 98  ? -8.307  -5.876  12.822  1.00 2.13  ? 98  ASP A OD1  2  
ATOM 4426  O OD2  . ASP A 1 98  ? -8.908  -5.038  14.714  1.00 2.19  ? 98  ASP A OD2  2  
ATOM 4427  H H    . ASP A 1 98  ? -5.557  -2.007  13.260  1.00 0.77  ? 98  ASP A H    2  
ATOM 4428  H HA   . ASP A 1 98  ? -5.959  -4.427  14.809  1.00 0.85  ? 98  ASP A HA   2  
ATOM 4429  H HB2  . ASP A 1 98  ? -7.796  -2.926  13.968  1.00 1.13  ? 98  ASP A HB2  2  
ATOM 4430  H HB3  . ASP A 1 98  ? -7.463  -3.521  12.341  1.00 1.31  ? 98  ASP A HB3  2  
ATOM 4431  N N    . MET A 1 99  ? -5.244  -4.688  11.584  1.00 0.81  ? 99  MET A N    2  
ATOM 4432  C CA   . MET A 1 99  ? -4.686  -5.626  10.572  1.00 0.85  ? 99  MET A CA   2  
ATOM 4433  C C    . MET A 1 99  ? -3.395  -6.242  11.112  1.00 0.97  ? 99  MET A C    2  
ATOM 4434  O O    . MET A 1 99  ? -3.149  -7.422  10.962  1.00 1.14  ? 99  MET A O    2  
ATOM 4435  C CB   . MET A 1 99  ? -4.406  -4.859  9.273   1.00 0.79  ? 99  MET A CB   2  
ATOM 4436  C CG   . MET A 1 99  ? -4.252  -5.839  8.108   1.00 0.81  ? 99  MET A CG   2  
ATOM 4437  S SD   . MET A 1 99  ? -3.469  -4.993  6.710   1.00 0.97  ? 99  MET A SD   2  
ATOM 4438  C CE   . MET A 1 99  ? -4.676  -3.653  6.540   1.00 0.48  ? 99  MET A CE   2  
ATOM 4439  H H    . MET A 1 99  ? -5.537  -3.795  11.305  1.00 0.79  ? 99  MET A H    2  
ATOM 4440  H HA   . MET A 1 99  ? -5.424  -6.394  10.397  1.00 0.91  ? 99  MET A HA   2  
ATOM 4441  H HB2  . MET A 1 99  ? -5.228  -4.188  9.070   1.00 1.11  ? 99  MET A HB2  2  
ATOM 4442  H HB3  . MET A 1 99  ? -3.496  -4.288  9.382   1.00 1.06  ? 99  MET A HB3  2  
ATOM 4443  H HG2  . MET A 1 99  ? -3.637  -6.672  8.415   1.00 1.31  ? 99  MET A HG2  2  
ATOM 4444  H HG3  . MET A 1 99  ? -5.225  -6.200  7.810   1.00 1.20  ? 99  MET A HG3  2  
ATOM 4445  H HE1  . MET A 1 99  ? -4.629  -3.252  5.537   1.00 1.17  ? 99  MET A HE1  2  
ATOM 4446  H HE2  . MET A 1 99  ? -4.450  -2.871  7.247   1.00 1.11  ? 99  MET A HE2  2  
ATOM 4447  H HE3  . MET A 1 99  ? -5.668  -4.036  6.735   1.00 1.06  ? 99  MET A HE3  2  
ATOM 4448  N N    . PHE A 1 100 ? -2.574  -5.454  11.757  1.00 0.98  ? 100 PHE A N    2  
ATOM 4449  C CA   . PHE A 1 100 ? -1.312  -6.007  12.320  1.00 1.14  ? 100 PHE A CA   2  
ATOM 4450  C C    . PHE A 1 100 ? -1.678  -7.119  13.305  1.00 1.28  ? 100 PHE A C    2  
ATOM 4451  O O    . PHE A 1 100 ? -0.991  -8.100  13.391  1.00 1.67  ? 100 PHE A O    2  
ATOM 4452  C CB   . PHE A 1 100 ? -0.521  -4.891  13.031  1.00 1.19  ? 100 PHE A CB   2  
ATOM 4453  C CG   . PHE A 1 100 ? 0.442   -4.241  12.056  1.00 1.15  ? 100 PHE A CG   2  
ATOM 4454  C CD1  . PHE A 1 100 ? -0.009  -3.845  10.791  1.00 1.64  ? 100 PHE A CD1  2  
ATOM 4455  C CD2  . PHE A 1 100 ? 1.782   -4.042  12.414  1.00 1.67  ? 100 PHE A CD2  2  
ATOM 4456  C CE1  . PHE A 1 100 ? 0.878   -3.249  9.886   1.00 1.69  ? 100 PHE A CE1  2  
ATOM 4457  C CE2  . PHE A 1 100 ? 2.668   -3.446  11.509  1.00 1.79  ? 100 PHE A CE2  2  
ATOM 4458  C CZ   . PHE A 1 100 ? 2.216   -3.050  10.245  1.00 1.38  ? 100 PHE A CZ   2  
ATOM 4459  H H    . PHE A 1 100 ? -2.795  -4.507  11.879  1.00 0.94  ? 100 PHE A H    2  
ATOM 4460  H HA   . PHE A 1 100 ? -0.722  -6.431  11.518  1.00 1.20  ? 100 PHE A HA   2  
ATOM 4461  H HB2  . PHE A 1 100 ? -1.210  -4.147  13.402  1.00 1.19  ? 100 PHE A HB2  2  
ATOM 4462  H HB3  . PHE A 1 100 ? 0.036   -5.308  13.860  1.00 1.36  ? 100 PHE A HB3  2  
ATOM 4463  H HD1  . PHE A 1 100 ? -1.041  -3.998  10.513  1.00 2.37  ? 100 PHE A HD1  2  
ATOM 4464  H HD2  . PHE A 1 100 ? 2.132   -4.349  13.389  1.00 2.36  ? 100 PHE A HD2  2  
ATOM 4465  H HE1  . PHE A 1 100 ? 0.530   -2.943  8.911   1.00 2.38  ? 100 PHE A HE1  2  
ATOM 4466  H HE2  . PHE A 1 100 ? 3.701   -3.293  11.786  1.00 2.56  ? 100 PHE A HE2  2  
ATOM 4467  H HZ   . PHE A 1 100 ? 2.900   -2.590  9.547   1.00 1.54  ? 100 PHE A HZ   2  
ATOM 4468  N N    . SER A 1 101 ? -2.809  -7.004  13.958  1.00 1.34  ? 101 SER A N    2  
ATOM 4469  C CA   . SER A 1 101 ? -3.291  -8.092  14.875  1.00 1.52  ? 101 SER A CA   2  
ATOM 4470  C C    . SER A 1 101 ? -2.147  -8.846  15.589  1.00 1.61  ? 101 SER A C    2  
ATOM 4471  O O    . SER A 1 101 ? -1.842  -8.613  16.740  1.00 1.99  ? 101 SER A O    2  
ATOM 4472  C CB   . SER A 1 101 ? -4.035  -9.098  14.001  1.00 1.79  ? 101 SER A CB   2  
ATOM 4473  O OG   . SER A 1 101 ? -4.299  -10.274 14.757  1.00 2.21  ? 101 SER A OG   2  
ATOM 4474  H H    . SER A 1 101 ? -3.388  -6.241  13.755  1.00 1.50  ? 101 SER A H    2  
ATOM 4475  H HA   . SER A 1 101 ? -4.014  -7.716  15.584  1.00 1.75  ? 101 SER A HA   2  
ATOM 4476  H HB2  . SER A 1 101 ? -4.971  -8.663  13.678  1.00 2.11  ? 101 SER A HB2  2  
ATOM 4477  H HB3  . SER A 1 101 ? -3.434  -9.338  13.135  1.00 2.15  ? 101 SER A HB3  2  
ATOM 4478  H HG   . SER A 1 101 ? -3.627  -10.924 14.539  1.00 2.49  ? 101 SER A HG   2  
ATOM 4479  N N    . ASP A 1 102 ? -1.529  -9.753  14.872  1.00 1.99  ? 102 ASP A N    2  
ATOM 4480  C CA   . ASP A 1 102 ? -0.403  -10.565 15.440  1.00 2.34  ? 102 ASP A CA   2  
ATOM 4481  C C    . ASP A 1 102 ? 0.944   -9.971  15.019  1.00 2.07  ? 102 ASP A C    2  
ATOM 4482  O O    . ASP A 1 102 ? 1.987   -10.545 15.259  1.00 2.62  ? 102 ASP A O    2  
ATOM 4483  C CB   . ASP A 1 102 ? -0.503  -12.002 14.929  1.00 3.15  ? 102 ASP A CB   2  
ATOM 4484  C CG   . ASP A 1 102 ? -1.836  -12.611 15.369  1.00 3.78  ? 102 ASP A CG   2  
ATOM 4485  O OD1  . ASP A 1 102 ? -2.071  -12.673 16.564  1.00 4.10  ? 102 ASP A OD1  2  
ATOM 4486  O OD2  . ASP A 1 102 ? -2.599  -13.005 14.502  1.00 4.42  ? 102 ASP A OD2  2  
ATOM 4487  H H    . ASP A 1 102 ? -1.830  -9.846  13.944  1.00 2.41  ? 102 ASP A H    2  
ATOM 4488  H HA   . ASP A 1 102 ? -0.469  -10.564 16.520  1.00 2.78  ? 102 ASP A HA   2  
ATOM 4489  H HB2  . ASP A 1 102 ? -0.443  -12.005 13.850  1.00 3.32  ? 102 ASP A HB2  2  
ATOM 4490  H HB3  . ASP A 1 102 ? 0.308   -12.586 15.337  1.00 3.70  ? 102 ASP A HB3  2  
ATOM 4491  N N    . GLY A 1 103 ? 0.930   -8.833  14.382  1.00 2.05  ? 103 GLY A N    2  
ATOM 4492  C CA   . GLY A 1 103 ? 2.200   -8.194  13.924  1.00 2.45  ? 103 GLY A CA   2  
ATOM 4493  C C    . GLY A 1 103 ? 2.412   -8.504  12.440  1.00 2.44  ? 103 GLY A C    2  
ATOM 4494  O O    . GLY A 1 103 ? 2.044   -7.735  11.574  1.00 3.08  ? 103 GLY A O    2  
ATOM 4495  H H    . GLY A 1 103 ? 0.074   -8.396  14.186  1.00 2.36  ? 103 GLY A H    2  
ATOM 4496  H HA2  . GLY A 1 103 ? 2.134   -7.124  14.069  1.00 2.86  ? 103 GLY A HA2  2  
ATOM 4497  H HA3  . GLY A 1 103 ? 3.035   -8.579  14.491  1.00 2.87  ? 103 GLY A HA3  2  
ATOM 4498  N N    . ASN A 1 104 ? 3.001   -9.629  12.146  1.00 2.29  ? 104 ASN A N    2  
ATOM 4499  C CA   . ASN A 1 104 ? 3.244   -10.007 10.724  1.00 2.55  ? 104 ASN A CA   2  
ATOM 4500  C C    . ASN A 1 104 ? 4.097   -8.932  10.040  1.00 2.17  ? 104 ASN A C    2  
ATOM 4501  O O    . ASN A 1 104 ? 5.299   -9.074  9.935   1.00 2.54  ? 104 ASN A O    2  
ATOM 4502  C CB   . ASN A 1 104 ? 1.908   -10.171 9.997   1.00 3.20  ? 104 ASN A CB   2  
ATOM 4503  C CG   . ASN A 1 104 ? 0.955   -10.995 10.866  1.00 3.72  ? 104 ASN A CG   2  
ATOM 4504  O OD1  . ASN A 1 104 ? 1.370   -11.606 11.831  1.00 4.05  ? 104 ASN A OD1  2  
ATOM 4505  N ND2  . ASN A 1 104 ? -0.313  -11.039 10.563  1.00 4.31  ? 104 ASN A ND2  2  
ATOM 4506  H H    . ASN A 1 104 ? 3.287   -10.231 12.864  1.00 2.45  ? 104 ASN A H    2  
ATOM 4507  H HA   . ASN A 1 104 ? 3.778   -10.947 10.698  1.00 2.95  ? 104 ASN A HA   2  
ATOM 4508  H HB2  . ASN A 1 104 ? 1.474   -9.202  9.807   1.00 3.39  ? 104 ASN A HB2  2  
ATOM 4509  H HB3  . ASN A 1 104 ? 2.070   -10.685 9.061   1.00 3.67  ? 104 ASN A HB3  2  
ATOM 4510  H HD21 . ASN A 1 104 ? -0.648  -10.547 9.785   1.00 4.45  ? 104 ASN A HD21 2  
ATOM 4511  H HD22 . ASN A 1 104 ? -0.931  -11.564 11.114  1.00 4.84  ? 104 ASN A HD22 2  
ATOM 4512  N N    . PHE A 1 105 ? 3.492   -7.891  9.517   1.00 1.90  ? 105 PHE A N    2  
ATOM 4513  C CA   . PHE A 1 105 ? 4.270   -6.834  8.792   1.00 1.74  ? 105 PHE A CA   2  
ATOM 4514  C C    . PHE A 1 105 ? 5.235   -7.485  7.801   1.00 1.59  ? 105 PHE A C    2  
ATOM 4515  O O    . PHE A 1 105 ? 6.370   -7.073  7.672   1.00 1.88  ? 105 PHE A O    2  
ATOM 4516  C CB   . PHE A 1 105 ? 5.038   -5.919  9.770   1.00 2.03  ? 105 PHE A CB   2  
ATOM 4517  C CG   . PHE A 1 105 ? 5.731   -6.717  10.851  1.00 1.75  ? 105 PHE A CG   2  
ATOM 4518  C CD1  . PHE A 1 105 ? 7.018   -7.230  10.636  1.00 2.14  ? 105 PHE A CD1  2  
ATOM 4519  C CD2  . PHE A 1 105 ? 5.088   -6.938  12.074  1.00 2.28  ? 105 PHE A CD2  2  
ATOM 4520  C CE1  . PHE A 1 105 ? 7.657   -7.963  11.642  1.00 2.60  ? 105 PHE A CE1  2  
ATOM 4521  C CE2  . PHE A 1 105 ? 5.728   -7.672  13.080  1.00 2.84  ? 105 PHE A CE2  2  
ATOM 4522  C CZ   . PHE A 1 105 ? 7.012   -8.185  12.864  1.00 2.84  ? 105 PHE A CZ   2  
ATOM 4523  H H    . PHE A 1 105 ? 2.517   -7.812  9.523   1.00 2.17  ? 105 PHE A H    2  
ATOM 4524  H HA   . PHE A 1 105 ? 3.574   -6.225  8.236   1.00 1.98  ? 105 PHE A HA   2  
ATOM 4525  H HB2  . PHE A 1 105 ? 5.777   -5.357  9.220   1.00 2.66  ? 105 PHE A HB2  2  
ATOM 4526  H HB3  . PHE A 1 105 ? 4.342   -5.231  10.228  1.00 2.53  ? 105 PHE A HB3  2  
ATOM 4527  H HD1  . PHE A 1 105 ? 7.518   -7.059  9.695   1.00 2.69  ? 105 PHE A HD1  2  
ATOM 4528  H HD2  . PHE A 1 105 ? 4.099   -6.540  12.242  1.00 2.82  ? 105 PHE A HD2  2  
ATOM 4529  H HE1  . PHE A 1 105 ? 8.649   -8.357  11.475  1.00 3.27  ? 105 PHE A HE1  2  
ATOM 4530  H HE2  . PHE A 1 105 ? 5.230   -7.844  14.023  1.00 3.66  ? 105 PHE A HE2  2  
ATOM 4531  H HZ   . PHE A 1 105 ? 7.506   -8.751  13.640  1.00 3.53  ? 105 PHE A HZ   2  
ATOM 4532  N N    . ASN A 1 106 ? 4.795   -8.512  7.101   1.00 1.85  ? 106 ASN A N    2  
ATOM 4533  C CA   . ASN A 1 106 ? 5.694   -9.210  6.121   1.00 1.93  ? 106 ASN A CA   2  
ATOM 4534  C C    . ASN A 1 106 ? 5.241   -8.957  4.674   1.00 1.72  ? 106 ASN A C    2  
ATOM 4535  O O    . ASN A 1 106 ? 6.001   -8.446  3.876   1.00 2.31  ? 106 ASN A O    2  
ATOM 4536  C CB   . ASN A 1 106 ? 5.671   -10.715 6.401   1.00 2.62  ? 106 ASN A CB   2  
ATOM 4537  C CG   . ASN A 1 106 ? 6.428   -11.007 7.697   1.00 3.11  ? 106 ASN A CG   2  
ATOM 4538  O OD1  . ASN A 1 106 ? 7.605   -10.725 7.804   1.00 3.46  ? 106 ASN A OD1  2  
ATOM 4539  N ND2  . ASN A 1 106 ? 5.798   -11.564 8.695   1.00 3.79  ? 106 ASN A ND2  2  
ATOM 4540  H H    . ASN A 1 106 ? 3.880   -8.838  7.232   1.00 2.35  ? 106 ASN A H    2  
ATOM 4541  H HA   . ASN A 1 106 ? 6.702   -8.839  6.233   1.00 2.19  ? 106 ASN A HA   2  
ATOM 4542  H HB2  . ASN A 1 106 ? 4.647   -11.046 6.498   1.00 3.01  ? 106 ASN A HB2  2  
ATOM 4543  H HB3  . ASN A 1 106 ? 6.143   -11.240 5.584   1.00 3.06  ? 106 ASN A HB3  2  
ATOM 4544  H HD21 . ASN A 1 106 ? 4.848   -11.792 8.610   1.00 3.97  ? 106 ASN A HD21 2  
ATOM 4545  H HD22 . ASN A 1 106 ? 6.274   -11.756 9.530   1.00 4.42  ? 106 ASN A HD22 2  
ATOM 4546  N N    . TRP A 1 107 ? 4.034   -9.338  4.308   1.00 1.54  ? 107 TRP A N    2  
ATOM 4547  C CA   . TRP A 1 107 ? 3.588   -9.140  2.884   1.00 1.68  ? 107 TRP A CA   2  
ATOM 4548  C C    . TRP A 1 107 ? 2.133   -8.652  2.795   1.00 1.47  ? 107 TRP A C    2  
ATOM 4549  O O    . TRP A 1 107 ? 1.841   -7.688  2.115   1.00 1.49  ? 107 TRP A O    2  
ATOM 4550  C CB   . TRP A 1 107 ? 3.708   -10.473 2.138   1.00 2.30  ? 107 TRP A CB   2  
ATOM 4551  C CG   . TRP A 1 107 ? 5.009   -11.126 2.482   1.00 2.32  ? 107 TRP A CG   2  
ATOM 4552  C CD1  . TRP A 1 107 ? 5.142   -12.241 3.237   1.00 2.69  ? 107 TRP A CD1  2  
ATOM 4553  C CD2  . TRP A 1 107 ? 6.359   -10.729 2.098   1.00 2.77  ? 107 TRP A CD2  2  
ATOM 4554  N NE1  . TRP A 1 107 ? 6.486   -12.553 3.341   1.00 3.12  ? 107 TRP A NE1  2  
ATOM 4555  C CE2  . TRP A 1 107 ? 7.275   -11.651 2.657   1.00 3.35  ? 107 TRP A CE2  2  
ATOM 4556  C CE3  . TRP A 1 107 ? 6.871   -9.669  1.328   1.00 3.24  ? 107 TRP A CE3  2  
ATOM 4557  C CZ2  . TRP A 1 107 ? 8.651   -11.527 2.458   1.00 4.31  ? 107 TRP A CZ2  2  
ATOM 4558  C CZ3  . TRP A 1 107 ? 8.255   -9.541  1.126   1.00 4.29  ? 107 TRP A CZ3  2  
ATOM 4559  C CH2  . TRP A 1 107 ? 9.143   -10.468 1.690   1.00 4.80  ? 107 TRP A CH2  2  
ATOM 4560  H H    . TRP A 1 107 ? 3.443   -9.780  4.952   1.00 1.87  ? 107 TRP A H    2  
ATOM 4561  H HA   . TRP A 1 107 ? 4.224   -8.414  2.398   1.00 1.91  ? 107 TRP A HA   2  
ATOM 4562  H HB2  . TRP A 1 107 ? 2.894   -11.122 2.427   1.00 2.77  ? 107 TRP A HB2  2  
ATOM 4563  H HB3  . TRP A 1 107 ? 3.666   -10.295 1.074   1.00 2.87  ? 107 TRP A HB3  2  
ATOM 4564  H HD1  . TRP A 1 107 ? 4.332   -12.796 3.685   1.00 3.02  ? 107 TRP A HD1  2  
ATOM 4565  H HE1  . TRP A 1 107 ? 6.852   -13.316 3.835   1.00 3.54  ? 107 TRP A HE1  2  
ATOM 4566  H HE3  . TRP A 1 107 ? 6.196   -8.950  0.889   1.00 3.02  ? 107 TRP A HE3  2  
ATOM 4567  H HZ2  . TRP A 1 107 ? 9.331   -12.244 2.894   1.00 4.84  ? 107 TRP A HZ2  2  
ATOM 4568  H HZ3  . TRP A 1 107 ? 8.638   -8.724  0.532   1.00 4.86  ? 107 TRP A HZ3  2  
ATOM 4569  H HH2  . TRP A 1 107 ? 10.206  -10.364 1.531   1.00 5.71  ? 107 TRP A HH2  2  
ATOM 4570  N N    . GLY A 1 108 ? 1.221   -9.286  3.484   1.00 1.41  ? 108 GLY A N    2  
ATOM 4571  C CA   . GLY A 1 108 ? -0.201  -8.822  3.428   1.00 1.47  ? 108 GLY A CA   2  
ATOM 4572  C C    . GLY A 1 108 ? -0.249  -7.369  3.894   1.00 1.05  ? 108 GLY A C    2  
ATOM 4573  O O    . GLY A 1 108 ? -0.623  -6.472  3.163   1.00 1.02  ? 108 GLY A O    2  
ATOM 4574  H H    . GLY A 1 108 ? 1.477   -10.042 4.054   1.00 1.45  ? 108 GLY A H    2  
ATOM 4575  H HA2  . GLY A 1 108 ? -0.566  -8.894  2.413   1.00 1.69  ? 108 GLY A HA2  2  
ATOM 4576  H HA3  . GLY A 1 108 ? -0.810  -9.428  4.080   1.00 1.74  ? 108 GLY A HA3  2  
ATOM 4577  N N    . ARG A 1 109 ? 0.184   -7.136  5.094   1.00 0.86  ? 109 ARG A N    2  
ATOM 4578  C CA   . ARG A 1 109 ? 0.250   -5.760  5.657   1.00 0.87  ? 109 ARG A CA   2  
ATOM 4579  C C    . ARG A 1 109 ? 0.775   -4.769  4.611   1.00 0.70  ? 109 ARG A C    2  
ATOM 4580  O O    . ARG A 1 109 ? 0.268   -3.674  4.466   1.00 0.81  ? 109 ARG A O    2  
ATOM 4581  C CB   . ARG A 1 109 ? 1.268   -5.819  6.814   1.00 1.08  ? 109 ARG A CB   2  
ATOM 4582  C CG   . ARG A 1 109 ? 0.574   -6.280  8.109   1.00 1.48  ? 109 ARG A CG   2  
ATOM 4583  C CD   . ARG A 1 109 ? -0.145  -7.612  7.873   1.00 1.96  ? 109 ARG A CD   2  
ATOM 4584  N NE   . ARG A 1 109 ? 0.801   -8.581  7.253   1.00 2.74  ? 109 ARG A NE   2  
ATOM 4585  C CZ   . ARG A 1 109 ? 0.487   -9.844  7.170   1.00 3.19  ? 109 ARG A CZ   2  
ATOM 4586  N NH1  . ARG A 1 109 ? -0.662  -10.264 7.626   1.00 3.19  ? 109 ARG A NH1  2  
ATOM 4587  N NH2  . ARG A 1 109 ? 1.320   -10.689 6.626   1.00 4.08  ? 109 ARG A NH2  2  
ATOM 4588  H H    . ARG A 1 109 ? 0.527   -7.865  5.646   1.00 0.93  ? 109 ARG A H    2  
ATOM 4589  H HA   . ARG A 1 109 ? -0.685  -5.417  6.079   1.00 1.25  ? 109 ARG A HA   2  
ATOM 4590  H HB2  . ARG A 1 109 ? 2.047   -6.519  6.559   1.00 1.43  ? 109 ARG A HB2  2  
ATOM 4591  H HB3  . ARG A 1 109 ? 1.702   -4.840  6.977   1.00 1.52  ? 109 ARG A HB3  2  
ATOM 4592  H HG2  . ARG A 1 109 ? 1.311   -6.402  8.889   1.00 2.00  ? 109 ARG A HG2  2  
ATOM 4593  H HG3  . ARG A 1 109 ? -0.148  -5.535  8.412   1.00 2.02  ? 109 ARG A HG3  2  
ATOM 4594  H HD2  . ARG A 1 109 ? -0.491  -8.007  8.814   1.00 2.34  ? 109 ARG A HD2  2  
ATOM 4595  H HD3  . ARG A 1 109 ? -0.993  -7.453  7.219   1.00 2.24  ? 109 ARG A HD3  2  
ATOM 4596  H HE   . ARG A 1 109 ? 1.663   -8.268  6.905   1.00 3.26  ? 109 ARG A HE   2  
ATOM 4597  H HH11 . ARG A 1 109 ? -1.303  -9.616  8.039   1.00 2.87  ? 109 ARG A HH11 2  
ATOM 4598  H HH12 . ARG A 1 109 ? -0.903  -11.232 7.560   1.00 3.82  ? 109 ARG A HH12 2  
ATOM 4599  H HH21 . ARG A 1 109 ? 2.199   -10.367 6.274   1.00 4.49  ? 109 ARG A HH21 2  
ATOM 4600  H HH22 . ARG A 1 109 ? 1.079   -11.657 6.561   1.00 4.54  ? 109 ARG A HH22 2  
ATOM 4601  N N    . VAL A 1 110 ? 1.821   -5.133  3.922   1.00 0.60  ? 110 VAL A N    2  
ATOM 4602  C CA   . VAL A 1 110 ? 2.425   -4.206  2.925   1.00 0.68  ? 110 VAL A CA   2  
ATOM 4603  C C    . VAL A 1 110 ? 1.454   -3.904  1.782   1.00 0.56  ? 110 VAL A C    2  
ATOM 4604  O O    . VAL A 1 110 ? 1.226   -2.759  1.447   1.00 0.60  ? 110 VAL A O    2  
ATOM 4605  C CB   . VAL A 1 110 ? 3.696   -4.836  2.352   1.00 0.88  ? 110 VAL A CB   2  
ATOM 4606  C CG1  . VAL A 1 110 ? 4.473   -3.787  1.553   1.00 1.27  ? 110 VAL A CG1  2  
ATOM 4607  C CG2  . VAL A 1 110 ? 4.569   -5.352  3.498   1.00 1.73  ? 110 VAL A CG2  2  
ATOM 4608  H H    . VAL A 1 110 ? 2.232   -6.007  4.086   1.00 0.60  ? 110 VAL A H    2  
ATOM 4609  H HA   . VAL A 1 110 ? 2.680   -3.283  3.424   1.00 0.87  ? 110 VAL A HA   2  
ATOM 4610  H HB   . VAL A 1 110 ? 3.428   -5.657  1.703   1.00 1.28  ? 110 VAL A HB   2  
ATOM 4611  H HG11 . VAL A 1 110 ? 4.737   -2.964  2.200   1.00 1.71  ? 110 VAL A HG11 2  
ATOM 4612  H HG12 . VAL A 1 110 ? 3.859   -3.425  0.742   1.00 1.81  ? 110 VAL A HG12 2  
ATOM 4613  H HG13 . VAL A 1 110 ? 5.371   -4.233  1.153   1.00 1.85  ? 110 VAL A HG13 2  
ATOM 4614  H HG21 . VAL A 1 110 ? 5.511   -5.703  3.103   1.00 2.12  ? 110 VAL A HG21 2  
ATOM 4615  H HG22 . VAL A 1 110 ? 4.063   -6.166  3.997   1.00 2.28  ? 110 VAL A HG22 2  
ATOM 4616  H HG23 . VAL A 1 110 ? 4.748   -4.553  4.202   1.00 2.29  ? 110 VAL A HG23 2  
ATOM 4617  N N    . VAL A 1 111 ? 0.895   -4.910  1.153   1.00 0.51  ? 111 VAL A N    2  
ATOM 4618  C CA   . VAL A 1 111 ? -0.030  -4.629  0.010   1.00 0.50  ? 111 VAL A CA   2  
ATOM 4619  C C    . VAL A 1 111 ? -1.435  -4.317  0.537   1.00 0.46  ? 111 VAL A C    2  
ATOM 4620  O O    . VAL A 1 111 ? -2.121  -3.458  0.021   1.00 0.47  ? 111 VAL A O    2  
ATOM 4621  C CB   . VAL A 1 111 ? -0.074  -5.829  -0.934  1.00 0.58  ? 111 VAL A CB   2  
ATOM 4622  C CG1  . VAL A 1 111 ? 1.340   -6.147  -1.425  1.00 1.41  ? 111 VAL A CG1  2  
ATOM 4623  C CG2  . VAL A 1 111 ? -0.641  -7.040  -0.188  1.00 1.36  ? 111 VAL A CG2  2  
ATOM 4624  H H    . VAL A 1 111 ? 1.102   -5.828  1.426   1.00 0.55  ? 111 VAL A H    2  
ATOM 4625  H HA   . VAL A 1 111 ? 0.365   -3.763  -0.503  1.00 0.52  ? 111 VAL A HA   2  
ATOM 4626  H HB   . VAL A 1 111 ? -0.704  -5.598  -1.780  1.00 1.33  ? 111 VAL A HB   2  
ATOM 4627  H HG11 . VAL A 1 111 ? 1.307   -6.991  -2.097  1.00 2.00  ? 111 VAL A HG11 2  
ATOM 4628  H HG12 . VAL A 1 111 ? 1.970   -6.384  -0.580  1.00 1.95  ? 111 VAL A HG12 2  
ATOM 4629  H HG13 . VAL A 1 111 ? 1.742   -5.289  -1.944  1.00 1.98  ? 111 VAL A HG13 2  
ATOM 4630  H HG21 . VAL A 1 111 ? -0.442  -7.936  -0.755  1.00 1.80  ? 111 VAL A HG21 2  
ATOM 4631  H HG22 . VAL A 1 111 ? -1.708  -6.919  -0.066  1.00 2.02  ? 111 VAL A HG22 2  
ATOM 4632  H HG23 . VAL A 1 111 ? -0.174  -7.118  0.783   1.00 1.95  ? 111 VAL A HG23 2  
ATOM 4633  N N    . ALA A 1 112 ? -1.861  -4.988  1.576   1.00 0.45  ? 112 ALA A N    2  
ATOM 4634  C CA   . ALA A 1 112 ? -3.213  -4.702  2.141   1.00 0.47  ? 112 ALA A CA   2  
ATOM 4635  C C    . ALA A 1 112 ? -3.248  -3.248  2.620   1.00 0.46  ? 112 ALA A C    2  
ATOM 4636  O O    . ALA A 1 112 ? -4.281  -2.609  2.619   1.00 0.54  ? 112 ALA A O    2  
ATOM 4637  C CB   . ALA A 1 112 ? -3.507  -5.651  3.306   1.00 0.53  ? 112 ALA A CB   2  
ATOM 4638  H H    . ALA A 1 112 ? -1.288  -5.663  1.995   1.00 0.47  ? 112 ALA A H    2  
ATOM 4639  H HA   . ALA A 1 112 ? -3.967  -4.810  1.379   1.00 0.49  ? 112 ALA A HA   2  
ATOM 4640  H HB1  . ALA A 1 112 ? -3.426  -6.675  2.967   1.00 1.17  ? 112 ALA A HB1  2  
ATOM 4641  H HB2  . ALA A 1 112 ? -4.506  -5.473  3.674   1.00 1.01  ? 112 ALA A HB2  2  
ATOM 4642  H HB3  . ALA A 1 112 ? -2.795  -5.478  4.100   1.00 1.25  ? 112 ALA A HB3  2  
ATOM 4643  N N    . LEU A 1 113 ? -2.123  -2.710  2.989   1.00 0.43  ? 113 LEU A N    2  
ATOM 4644  C CA   . LEU A 1 113 ? -2.078  -1.284  3.423   1.00 0.43  ? 113 LEU A CA   2  
ATOM 4645  C C    . LEU A 1 113 ? -2.122  -0.403  2.173   1.00 0.42  ? 113 LEU A C    2  
ATOM 4646  O O    . LEU A 1 113 ? -2.888  0.535   2.076   1.00 0.45  ? 113 LEU A O    2  
ATOM 4647  C CB   . LEU A 1 113 ? -0.759  -1.034  4.172   1.00 0.44  ? 113 LEU A CB   2  
ATOM 4648  C CG   . LEU A 1 113 ? -0.615  0.454   4.539   1.00 0.51  ? 113 LEU A CG   2  
ATOM 4649  C CD1  . LEU A 1 113 ? -1.813  0.916   5.385   1.00 1.45  ? 113 LEU A CD1  2  
ATOM 4650  C CD2  . LEU A 1 113 ? 0.678   0.645   5.338   1.00 1.27  ? 113 LEU A CD2  2  
ATOM 4651  H H    . LEU A 1 113 ? -1.296  -3.235  2.953   1.00 0.45  ? 113 LEU A H    2  
ATOM 4652  H HA   . LEU A 1 113 ? -2.901  -1.047  4.080   1.00 0.44  ? 113 LEU A HA   2  
ATOM 4653  H HB2  . LEU A 1 113 ? -0.747  -1.625  5.076   1.00 0.58  ? 113 LEU A HB2  2  
ATOM 4654  H HB3  . LEU A 1 113 ? 0.070   -1.327  3.544   1.00 0.53  ? 113 LEU A HB3  2  
ATOM 4655  H HG   . LEU A 1 113 ? -0.566  1.046   3.637   1.00 1.38  ? 113 LEU A HG   2  
ATOM 4656  H HD11 . LEU A 1 113 ? -2.642  1.155   4.736   1.00 2.09  ? 113 LEU A HD11 2  
ATOM 4657  H HD12 . LEU A 1 113 ? -1.541  1.796   5.952   1.00 1.97  ? 113 LEU A HD12 2  
ATOM 4658  H HD13 . LEU A 1 113 ? -2.103  0.128   6.065   1.00 1.99  ? 113 LEU A HD13 2  
ATOM 4659  H HD21 . LEU A 1 113 ? 0.656   0.016   6.215   1.00 1.86  ? 113 LEU A HD21 2  
ATOM 4660  H HD22 . LEU A 1 113 ? 0.766   1.679   5.639   1.00 1.87  ? 113 LEU A HD22 2  
ATOM 4661  H HD23 . LEU A 1 113 ? 1.525   0.377   4.723   1.00 1.85  ? 113 LEU A HD23 2  
ATOM 4662  N N    . PHE A 1 114 ? -1.286  -0.708  1.223   1.00 0.40  ? 114 PHE A N    2  
ATOM 4663  C CA   . PHE A 1 114 ? -1.225  0.083   -0.038  1.00 0.40  ? 114 PHE A CA   2  
ATOM 4664  C C    . PHE A 1 114 ? -2.607  0.147   -0.692  1.00 0.39  ? 114 PHE A C    2  
ATOM 4665  O O    . PHE A 1 114 ? -3.036  1.176   -1.171  1.00 0.41  ? 114 PHE A O    2  
ATOM 4666  C CB   . PHE A 1 114 ? -0.245  -0.594  -1.003  1.00 0.41  ? 114 PHE A CB   2  
ATOM 4667  C CG   . PHE A 1 114 ? 1.204   -0.403  -0.559  1.00 0.44  ? 114 PHE A CG   2  
ATOM 4668  C CD1  . PHE A 1 114 ? 1.540   -0.061  0.771   1.00 1.27  ? 114 PHE A CD1  2  
ATOM 4669  C CD2  . PHE A 1 114 ? 2.227   -0.588  -1.499  1.00 1.29  ? 114 PHE A CD2  2  
ATOM 4670  C CE1  . PHE A 1 114 ? 2.880   0.089   1.138   1.00 1.27  ? 114 PHE A CE1  2  
ATOM 4671  C CE2  . PHE A 1 114 ? 3.567   -0.432  -1.123  1.00 1.38  ? 114 PHE A CE2  2  
ATOM 4672  C CZ   . PHE A 1 114 ? 3.892   -0.096  0.194   1.00 0.68  ? 114 PHE A CZ   2  
ATOM 4673  H H    . PHE A 1 114 ? -0.676  -1.465  1.347   1.00 0.40  ? 114 PHE A H    2  
ATOM 4674  H HA   . PHE A 1 114 ? -0.876  1.088   0.153   1.00 0.41  ? 114 PHE A HA   2  
ATOM 4675  H HB2  . PHE A 1 114 ? -0.464  -1.649  -1.047  1.00 0.49  ? 114 PHE A HB2  2  
ATOM 4676  H HB3  . PHE A 1 114 ? -0.368  -0.168  -1.989  1.00 0.43  ? 114 PHE A HB3  2  
ATOM 4677  H HD1  . PHE A 1 114 ? 0.782   0.091   1.513   1.00 2.16  ? 114 PHE A HD1  2  
ATOM 4678  H HD2  . PHE A 1 114 ? 1.981   -0.847  -2.518  1.00 2.14  ? 114 PHE A HD2  2  
ATOM 4679  H HE1  . PHE A 1 114 ? 3.133   0.349   2.155   1.00 2.12  ? 114 PHE A HE1  2  
ATOM 4680  H HE2  . PHE A 1 114 ? 4.351   -0.574  -1.852  1.00 2.28  ? 114 PHE A HE2  2  
ATOM 4681  H HZ   . PHE A 1 114 ? 4.924   0.020   0.484   1.00 0.80  ? 114 PHE A HZ   2  
ATOM 4682  N N    . TYR A 1 115 ? -3.303  -0.960  -0.724  1.00 0.40  ? 115 TYR A N    2  
ATOM 4683  C CA   . TYR A 1 115 ? -4.651  -0.975  -1.357  1.00 0.41  ? 115 TYR A CA   2  
ATOM 4684  C C    . TYR A 1 115 ? -5.667  -0.274  -0.458  1.00 0.41  ? 115 TYR A C    2  
ATOM 4685  O O    . TYR A 1 115 ? -6.521  0.455   -0.921  1.00 0.44  ? 115 TYR A O    2  
ATOM 4686  C CB   . TYR A 1 115 ? -5.102  -2.422  -1.583  1.00 0.44  ? 115 TYR A CB   2  
ATOM 4687  C CG   . TYR A 1 115 ? -6.462  -2.422  -2.241  1.00 0.47  ? 115 TYR A CG   2  
ATOM 4688  C CD1  . TYR A 1 115 ? -7.622  -2.409  -1.456  1.00 1.28  ? 115 TYR A CD1  2  
ATOM 4689  C CD2  . TYR A 1 115 ? -6.564  -2.430  -3.638  1.00 1.24  ? 115 TYR A CD2  2  
ATOM 4690  C CE1  . TYR A 1 115 ? -8.882  -2.403  -2.067  1.00 1.32  ? 115 TYR A CE1  2  
ATOM 4691  C CE2  . TYR A 1 115 ? -7.824  -2.426  -4.248  1.00 1.26  ? 115 TYR A CE2  2  
ATOM 4692  C CZ   . TYR A 1 115 ? -8.983  -2.411  -3.463  1.00 0.61  ? 115 TYR A CZ   2  
ATOM 4693  O OH   . TYR A 1 115 ? -10.225 -2.404  -4.065  1.00 0.70  ? 115 TYR A OH   2  
ATOM 4694  H H    . TYR A 1 115 ? -2.933  -1.780  -0.334  1.00 0.41  ? 115 TYR A H    2  
ATOM 4695  H HA   . TYR A 1 115 ? -4.605  -0.465  -2.308  1.00 0.42  ? 115 TYR A HA   2  
ATOM 4696  H HB2  . TYR A 1 115 ? -4.391  -2.927  -2.220  1.00 0.46  ? 115 TYR A HB2  2  
ATOM 4697  H HB3  . TYR A 1 115 ? -5.162  -2.933  -0.634  1.00 0.47  ? 115 TYR A HB3  2  
ATOM 4698  H HD1  . TYR A 1 115 ? -7.544  -2.403  -0.378  1.00 2.12  ? 115 TYR A HD1  2  
ATOM 4699  H HD2  . TYR A 1 115 ? -5.670  -2.441  -4.244  1.00 2.08  ? 115 TYR A HD2  2  
ATOM 4700  H HE1  . TYR A 1 115 ? -9.776  -2.392  -1.461  1.00 2.17  ? 115 TYR A HE1  2  
ATOM 4701  H HE2  . TYR A 1 115 ? -7.902  -2.432  -5.326  1.00 2.10  ? 115 TYR A HE2  2  
ATOM 4702  H HH   . TYR A 1 115 ? -10.611 -3.276  -3.960  1.00 1.23  ? 115 TYR A HH   2  
ATOM 4703  N N    . PHE A 1 116 ? -5.583  -0.486  0.826   1.00 0.38  ? 116 PHE A N    2  
ATOM 4704  C CA   . PHE A 1 116 ? -6.550  0.171   1.745   1.00 0.38  ? 116 PHE A CA   2  
ATOM 4705  C C    . PHE A 1 116 ? -6.500  1.686   1.535   1.00 0.36  ? 116 PHE A C    2  
ATOM 4706  O O    . PHE A 1 116 ? -7.514  2.340   1.427   1.00 0.35  ? 116 PHE A O    2  
ATOM 4707  C CB   . PHE A 1 116 ? -6.181  -0.157  3.197   1.00 0.40  ? 116 PHE A CB   2  
ATOM 4708  C CG   . PHE A 1 116 ? -7.089  0.604   4.144   1.00 0.37  ? 116 PHE A CG   2  
ATOM 4709  C CD1  . PHE A 1 116 ? -8.469  0.351   4.151   1.00 1.35  ? 116 PHE A CD1  2  
ATOM 4710  C CD2  . PHE A 1 116 ? -6.552  1.563   5.017   1.00 1.17  ? 116 PHE A CD2  2  
ATOM 4711  C CE1  . PHE A 1 116 ? -9.306  1.053   5.027   1.00 1.37  ? 116 PHE A CE1  2  
ATOM 4712  C CE2  . PHE A 1 116 ? -7.392  2.263   5.892   1.00 1.18  ? 116 PHE A CE2  2  
ATOM 4713  C CZ   . PHE A 1 116 ? -8.768  2.008   5.897   1.00 0.45  ? 116 PHE A CZ   2  
ATOM 4714  H H    . PHE A 1 116 ? -4.889  -1.079  1.182   1.00 0.39  ? 116 PHE A H    2  
ATOM 4715  H HA   . PHE A 1 116 ? -7.540  -0.206  1.535   1.00 0.39  ? 116 PHE A HA   2  
ATOM 4716  H HB2  . PHE A 1 116 ? -6.299  -1.218  3.364   1.00 0.47  ? 116 PHE A HB2  2  
ATOM 4717  H HB3  . PHE A 1 116 ? -5.153  0.122   3.378   1.00 0.41  ? 116 PHE A HB3  2  
ATOM 4718  H HD1  . PHE A 1 116 ? -8.890  -0.386  3.481   1.00 2.26  ? 116 PHE A HD1  2  
ATOM 4719  H HD2  . PHE A 1 116 ? -5.491  1.761   5.016   1.00 2.09  ? 116 PHE A HD2  2  
ATOM 4720  H HE1  . PHE A 1 116 ? -10.368 0.856   5.032   1.00 2.29  ? 116 PHE A HE1  2  
ATOM 4721  H HE2  . PHE A 1 116 ? -6.978  3.001   6.563   1.00 2.08  ? 116 PHE A HE2  2  
ATOM 4722  H HZ   . PHE A 1 116 ? -9.415  2.549   6.572   1.00 0.51  ? 116 PHE A HZ   2  
ATOM 4723  N N    . ALA A 1 117 ? -5.331  2.258   1.465   1.00 0.35  ? 117 ALA A N    2  
ATOM 4724  C CA   . ALA A 1 117 ? -5.253  3.727   1.254   1.00 0.34  ? 117 ALA A CA   2  
ATOM 4725  C C    . ALA A 1 117 ? -5.798  4.067   -0.135  1.00 0.34  ? 117 ALA A C    2  
ATOM 4726  O O    . ALA A 1 117 ? -6.389  5.107   -0.340  1.00 0.34  ? 117 ALA A O    2  
ATOM 4727  C CB   . ALA A 1 117 ? -3.801  4.194   1.371   1.00 0.37  ? 117 ALA A CB   2  
ATOM 4728  H H    . ALA A 1 117 ? -4.514  1.731   1.556   1.00 0.36  ? 117 ALA A H    2  
ATOM 4729  H HA   . ALA A 1 117 ? -5.862  4.218   1.998   1.00 0.34  ? 117 ALA A HA   2  
ATOM 4730  H HB1  . ALA A 1 117 ? -3.748  5.257   1.188   1.00 1.05  ? 117 ALA A HB1  2  
ATOM 4731  H HB2  . ALA A 1 117 ? -3.196  3.673   0.643   1.00 1.06  ? 117 ALA A HB2  2  
ATOM 4732  H HB3  . ALA A 1 117 ? -3.433  3.980   2.363   1.00 1.10  ? 117 ALA A HB3  2  
ATOM 4733  N N    . SER A 1 118 ? -5.612  3.198   -1.093  1.00 0.35  ? 118 SER A N    2  
ATOM 4734  C CA   . SER A 1 118 ? -6.123  3.477   -2.464  1.00 0.37  ? 118 SER A CA   2  
ATOM 4735  C C    . SER A 1 118 ? -7.602  3.869   -2.416  1.00 0.36  ? 118 SER A C    2  
ATOM 4736  O O    . SER A 1 118 ? -8.029  4.801   -3.066  1.00 0.36  ? 118 SER A O    2  
ATOM 4737  C CB   . SER A 1 118 ? -5.962  2.227   -3.332  1.00 0.42  ? 118 SER A CB   2  
ATOM 4738  O OG   . SER A 1 118 ? -7.044  1.339   -3.083  1.00 1.25  ? 118 SER A OG   2  
ATOM 4739  H H    . SER A 1 118 ? -5.139  2.358   -0.922  1.00 0.37  ? 118 SER A H    2  
ATOM 4740  H HA   . SER A 1 118 ? -5.554  4.286   -2.899  1.00 0.38  ? 118 SER A HA   2  
ATOM 4741  H HB2  . SER A 1 118 ? -5.966  2.504   -4.374  1.00 1.08  ? 118 SER A HB2  2  
ATOM 4742  H HB3  . SER A 1 118 ? -5.024  1.743   -3.095  1.00 1.10  ? 118 SER A HB3  2  
ATOM 4743  H HG   . SER A 1 118 ? -7.313  0.955   -3.921  1.00 1.71  ? 118 SER A HG   2  
ATOM 4744  N N    . LYS A 1 119 ? -8.386  3.181   -1.624  1.00 0.37  ? 119 LYS A N    2  
ATOM 4745  C CA   . LYS A 1 119 ? -9.829  3.541   -1.517  1.00 0.39  ? 119 LYS A CA   2  
ATOM 4746  C C    . LYS A 1 119 ? -9.937  4.939   -0.893  1.00 0.36  ? 119 LYS A C    2  
ATOM 4747  O O    . LYS A 1 119 ? -10.722 5.754   -1.330  1.00 0.38  ? 119 LYS A O    2  
ATOM 4748  C CB   . LYS A 1 119 ? -10.579 2.480   -0.677  1.00 0.46  ? 119 LYS A CB   2  
ATOM 4749  C CG   . LYS A 1 119 ? -10.495 2.796   0.830   1.00 1.29  ? 119 LYS A CG   2  
ATOM 4750  C CD   . LYS A 1 119 ? -10.700 1.522   1.654   1.00 1.84  ? 119 LYS A CD   2  
ATOM 4751  C CE   . LYS A 1 119 ? -12.110 0.978   1.425   1.00 2.48  ? 119 LYS A CE   2  
ATOM 4752  N NZ   . LYS A 1 119 ? -12.427 -0.026  2.480   1.00 3.36  ? 119 LYS A NZ   2  
ATOM 4753  H H    . LYS A 1 119 ? -8.019  2.449   -1.084  1.00 0.38  ? 119 LYS A H    2  
ATOM 4754  H HA   . LYS A 1 119 ? -10.267 3.602   -2.502  1.00 0.42  ? 119 LYS A HA   2  
ATOM 4755  H HB2  . LYS A 1 119 ? -11.618 2.460   -0.976  1.00 0.98  ? 119 LYS A HB2  2  
ATOM 4756  H HB3  . LYS A 1 119 ? -10.139 1.511   -0.865  1.00 0.99  ? 119 LYS A HB3  2  
ATOM 4757  H HG2  . LYS A 1 119 ? -9.533  3.207   1.057   1.00 1.92  ? 119 LYS A HG2  2  
ATOM 4758  H HG3  . LYS A 1 119 ? -11.258 3.514   1.089   1.00 1.81  ? 119 LYS A HG3  2  
ATOM 4759  H HD2  . LYS A 1 119 ? -9.974  0.780   1.356   1.00 2.21  ? 119 LYS A HD2  2  
ATOM 4760  H HD3  . LYS A 1 119 ? -10.571 1.749   2.702   1.00 2.29  ? 119 LYS A HD3  2  
ATOM 4761  H HE2  . LYS A 1 119 ? -12.822 1.789   1.473   1.00 2.99  ? 119 LYS A HE2  2  
ATOM 4762  H HE3  . LYS A 1 119 ? -12.161 0.508   0.454   1.00 2.53  ? 119 LYS A HE3  2  
ATOM 4763  H HZ1  . LYS A 1 119 ? -12.321 -0.983  2.091   1.00 3.76  ? 119 LYS A HZ1  2  
ATOM 4764  H HZ2  . LYS A 1 119 ? -13.405 0.112   2.806   1.00 3.68  ? 119 LYS A HZ2  2  
ATOM 4765  H HZ3  . LYS A 1 119 ? -11.774 0.095   3.280   1.00 3.74  ? 119 LYS A HZ3  2  
ATOM 4766  N N    . LEU A 1 120 ? -9.140  5.245   0.091   1.00 0.36  ? 120 LEU A N    2  
ATOM 4767  C CA   . LEU A 1 120 ? -9.201  6.612   0.682   1.00 0.35  ? 120 LEU A CA   2  
ATOM 4768  C C    . LEU A 1 120 ? -8.862  7.616   -0.427  1.00 0.33  ? 120 LEU A C    2  
ATOM 4769  O O    . LEU A 1 120 ? -9.483  8.651   -0.562  1.00 0.39  ? 120 LEU A O    2  
ATOM 4770  C CB   . LEU A 1 120 ? -8.176  6.712   1.832   1.00 0.36  ? 120 LEU A CB   2  
ATOM 4771  C CG   . LEU A 1 120 ? -8.875  6.568   3.192   1.00 0.68  ? 120 LEU A CG   2  
ATOM 4772  C CD1  . LEU A 1 120 ? -9.554  5.197   3.298   1.00 1.69  ? 120 LEU A CD1  2  
ATOM 4773  C CD2  . LEU A 1 120 ? -7.833  6.689   4.304   1.00 1.28  ? 120 LEU A CD2  2  
ATOM 4774  H H    . LEU A 1 120 ? -8.486  4.585   0.424   1.00 0.41  ? 120 LEU A H    2  
ATOM 4775  H HA   . LEU A 1 120 ? -10.196 6.814   1.055   1.00 0.39  ? 120 LEU A HA   2  
ATOM 4776  H HB2  . LEU A 1 120 ? -7.446  5.925   1.724   1.00 0.60  ? 120 LEU A HB2  2  
ATOM 4777  H HB3  . LEU A 1 120 ? -7.673  7.670   1.797   1.00 0.65  ? 120 LEU A HB3  2  
ATOM 4778  H HG   . LEU A 1 120 ? -9.616  7.347   3.302   1.00 1.47  ? 120 LEU A HG   2  
ATOM 4779  H HD11 . LEU A 1 120 ? -10.420 5.167   2.654   1.00 2.18  ? 120 LEU A HD11 2  
ATOM 4780  H HD12 . LEU A 1 120 ? -9.862  5.026   4.318   1.00 2.20  ? 120 LEU A HD12 2  
ATOM 4781  H HD13 . LEU A 1 120 ? -8.857  4.427   2.999   1.00 2.31  ? 120 LEU A HD13 2  
ATOM 4782  H HD21 . LEU A 1 120 ? -7.117  5.886   4.217   1.00 1.86  ? 120 LEU A HD21 2  
ATOM 4783  H HD22 . LEU A 1 120 ? -8.323  6.633   5.264   1.00 1.90  ? 120 LEU A HD22 2  
ATOM 4784  H HD23 . LEU A 1 120 ? -7.323  7.638   4.216   1.00 1.79  ? 120 LEU A HD23 2  
ATOM 4785  N N    . VAL A 1 121 ? -7.891  7.288   -1.232  1.00 0.33  ? 121 VAL A N    2  
ATOM 4786  C CA   . VAL A 1 121 ? -7.497  8.174   -2.361  1.00 0.39  ? 121 VAL A CA   2  
ATOM 4787  C C    . VAL A 1 121 ? -8.582  8.153   -3.442  1.00 0.36  ? 121 VAL A C    2  
ATOM 4788  O O    . VAL A 1 121 ? -9.239  9.141   -3.699  1.00 0.39  ? 121 VAL A O    2  
ATOM 4789  C CB   . VAL A 1 121 ? -6.178  7.679   -2.956  1.00 0.54  ? 121 VAL A CB   2  
ATOM 4790  C CG1  . VAL A 1 121 ? -5.762  8.600   -4.105  1.00 0.95  ? 121 VAL A CG1  2  
ATOM 4791  C CG2  . VAL A 1 121 ? -5.093  7.700   -1.874  1.00 1.18  ? 121 VAL A CG2  2  
ATOM 4792  H H    . VAL A 1 121 ? -7.427  6.435   -1.107  1.00 0.34  ? 121 VAL A H    2  
ATOM 4793  H HA   . VAL A 1 121 ? -7.371  9.203   -2.051  1.00 0.51  ? 121 VAL A HA   2  
ATOM 4794  H HB   . VAL A 1 121 ? -6.304  6.673   -3.326  1.00 1.28  ? 121 VAL A HB   2  
ATOM 4795  H HG11 . VAL A 1 121 ? -5.807  9.629   -3.777  1.00 1.65  ? 121 VAL A HG11 2  
ATOM 4796  H HG12 . VAL A 1 121 ? -6.432  8.459   -4.940  1.00 1.36  ? 121 VAL A HG12 2  
ATOM 4797  H HG13 . VAL A 1 121 ? -4.754  8.363   -4.409  1.00 1.60  ? 121 VAL A HG13 2  
ATOM 4798  H HG21 . VAL A 1 121 ? -4.917  8.718   -1.561  1.00 1.78  ? 121 VAL A HG21 2  
ATOM 4799  H HG22 . VAL A 1 121 ? -4.180  7.282   -2.272  1.00 1.69  ? 121 VAL A HG22 2  
ATOM 4800  H HG23 . VAL A 1 121 ? -5.416  7.114   -1.027  1.00 1.75  ? 121 VAL A HG23 2  
ATOM 4801  N N    . LEU A 1 122 ? -8.760  7.032   -4.090  1.00 0.37  ? 122 LEU A N    2  
ATOM 4802  C CA   . LEU A 1 122 ? -9.786  6.943   -5.169  1.00 0.39  ? 122 LEU A CA   2  
ATOM 4803  C C    . LEU A 1 122 ? -11.141 7.451   -4.672  1.00 0.40  ? 122 LEU A C    2  
ATOM 4804  O O    . LEU A 1 122 ? -11.938 7.958   -5.436  1.00 0.40  ? 122 LEU A O    2  
ATOM 4805  C CB   . LEU A 1 122 ? -9.941  5.485   -5.616  1.00 0.42  ? 122 LEU A CB   2  
ATOM 4806  C CG   . LEU A 1 122 ? -8.601  4.938   -6.123  1.00 0.72  ? 122 LEU A CG   2  
ATOM 4807  C CD1  . LEU A 1 122 ? -8.715  3.422   -6.302  1.00 1.15  ? 122 LEU A CD1  2  
ATOM 4808  C CD2  . LEU A 1 122 ? -8.234  5.586   -7.470  1.00 1.24  ? 122 LEU A CD2  2  
ATOM 4809  H H    . LEU A 1 122 ? -8.210  6.249   -3.877  1.00 0.39  ? 122 LEU A H    2  
ATOM 4810  H HA   . LEU A 1 122 ? -9.472  7.541   -6.009  1.00 0.40  ? 122 LEU A HA   2  
ATOM 4811  H HB2  . LEU A 1 122 ? -10.273 4.892   -4.776  1.00 0.62  ? 122 LEU A HB2  2  
ATOM 4812  H HB3  . LEU A 1 122 ? -10.677 5.428   -6.404  1.00 0.70  ? 122 LEU A HB3  2  
ATOM 4813  H HG   . LEU A 1 122 ? -7.830  5.154   -5.397  1.00 1.46  ? 122 LEU A HG   2  
ATOM 4814  H HD11 . LEU A 1 122 ? -7.780  3.032   -6.675  1.00 1.70  ? 122 LEU A HD11 2  
ATOM 4815  H HD12 . LEU A 1 122 ? -9.503  3.201   -7.007  1.00 1.65  ? 122 LEU A HD12 2  
ATOM 4816  H HD13 . LEU A 1 122 ? -8.943  2.964   -5.352  1.00 1.70  ? 122 LEU A HD13 2  
ATOM 4817  H HD21 . LEU A 1 122 ? -9.114  5.664   -8.091  1.00 1.80  ? 122 LEU A HD21 2  
ATOM 4818  H HD22 . LEU A 1 122 ? -7.495  4.979   -7.973  1.00 1.64  ? 122 LEU A HD22 2  
ATOM 4819  H HD23 . LEU A 1 122 ? -7.826  6.570   -7.299  1.00 1.86  ? 122 LEU A HD23 2  
ATOM 4820  N N    . LYS A 1 123 ? -11.403 7.350   -3.396  1.00 0.51  ? 123 LYS A N    2  
ATOM 4821  C CA   . LYS A 1 123 ? -12.701 7.855   -2.868  1.00 0.55  ? 123 LYS A CA   2  
ATOM 4822  C C    . LYS A 1 123 ? -12.629 9.379   -2.758  1.00 0.54  ? 123 LYS A C    2  
ATOM 4823  O O    . LYS A 1 123 ? -13.596 10.071  -2.992  1.00 0.55  ? 123 LYS A O    2  
ATOM 4824  C CB   . LYS A 1 123 ? -12.983 7.240   -1.491  1.00 0.59  ? 123 LYS A CB   2  
ATOM 4825  C CG   . LYS A 1 123 ? -14.342 7.727   -0.965  1.00 0.97  ? 123 LYS A CG   2  
ATOM 4826  C CD   . LYS A 1 123 ? -14.551 7.236   0.474   1.00 1.37  ? 123 LYS A CD   2  
ATOM 4827  C CE   . LYS A 1 123 ? -14.640 5.705   0.516   1.00 1.74  ? 123 LYS A CE   2  
ATOM 4828  N NZ   . LYS A 1 123 ? -15.458 5.212   -0.628  1.00 2.32  ? 123 LYS A NZ   2  
ATOM 4829  H H    . LYS A 1 123 ? -10.735 6.976   -2.783  1.00 0.62  ? 123 LYS A H    2  
ATOM 4830  H HA   . LYS A 1 123 ? -13.496 7.587   -3.551  1.00 0.56  ? 123 LYS A HA   2  
ATOM 4831  H HB2  . LYS A 1 123 ? -13.002 6.165   -1.584  1.00 0.98  ? 123 LYS A HB2  2  
ATOM 4832  H HB3  . LYS A 1 123 ? -12.206 7.529   -0.801  1.00 0.98  ? 123 LYS A HB3  2  
ATOM 4833  H HG2  . LYS A 1 123 ? -14.369 8.806   -0.975  1.00 1.58  ? 123 LYS A HG2  2  
ATOM 4834  H HG3  . LYS A 1 123 ? -15.130 7.346   -1.594  1.00 1.56  ? 123 LYS A HG3  2  
ATOM 4835  H HD2  . LYS A 1 123 ? -13.722 7.562   1.085   1.00 1.88  ? 123 LYS A HD2  2  
ATOM 4836  H HD3  . LYS A 1 123 ? -15.466 7.657   0.864   1.00 1.93  ? 123 LYS A HD3  2  
ATOM 4837  H HE2  . LYS A 1 123 ? -13.649 5.283   0.459   1.00 2.16  ? 123 LYS A HE2  2  
ATOM 4838  H HE3  . LYS A 1 123 ? -15.103 5.401   1.443   1.00 2.15  ? 123 LYS A HE3  2  
ATOM 4839  H HZ1  . LYS A 1 123 ? -15.876 4.291   -0.386  1.00 2.93  ? 123 LYS A HZ1  2  
ATOM 4840  H HZ2  . LYS A 1 123 ? -14.852 5.108   -1.468  1.00 2.67  ? 123 LYS A HZ2  2  
ATOM 4841  H HZ3  . LYS A 1 123 ? -16.218 5.892   -0.830  1.00 2.55  ? 123 LYS A HZ3  2  
ATOM 4842  N N    . ALA A 1 124 ? -11.490 9.907   -2.398  1.00 0.52  ? 124 ALA A N    2  
ATOM 4843  C CA   . ALA A 1 124 ? -11.371 11.386  -2.273  1.00 0.52  ? 124 ALA A CA   2  
ATOM 4844  C C    . ALA A 1 124 ? -11.320 12.010  -3.664  1.00 0.51  ? 124 ALA A C    2  
ATOM 4845  O O    . ALA A 1 124 ? -11.735 13.130  -3.880  1.00 0.54  ? 124 ALA A O    2  
ATOM 4846  C CB   . ALA A 1 124 ? -10.108 11.744  -1.500  1.00 0.51  ? 124 ALA A CB   2  
ATOM 4847  H H    . ALA A 1 124 ? -10.718 9.333   -2.214  1.00 0.51  ? 124 ALA A H    2  
ATOM 4848  H HA   . ALA A 1 124 ? -12.246 11.763  -1.762  1.00 0.54  ? 124 ALA A HA   2  
ATOM 4849  H HB1  . ALA A 1 124 ? -9.264  11.248  -1.955  1.00 1.07  ? 124 ALA A HB1  2  
ATOM 4850  H HB2  . ALA A 1 124 ? -10.209 11.422  -0.475  1.00 1.08  ? 124 ALA A HB2  2  
ATOM 4851  H HB3  . ALA A 1 124 ? -9.958  12.812  -1.532  1.00 1.07  ? 124 ALA A HB3  2  
ATOM 4852  N N    . LEU A 1 125 ? -10.828 11.268  -4.617  1.00 0.47  ? 125 LEU A N    2  
ATOM 4853  C CA   . LEU A 1 125 ? -10.756 11.765  -6.004  1.00 0.47  ? 125 LEU A CA   2  
ATOM 4854  C C    . LEU A 1 125 ? -12.171 11.890  -6.564  1.00 0.48  ? 125 LEU A C    2  
ATOM 4855  O O    . LEU A 1 125 ? -12.520 12.876  -7.183  1.00 0.48  ? 125 LEU A O    2  
ATOM 4856  C CB   . LEU A 1 125 ? -9.967  10.751  -6.844  1.00 0.51  ? 125 LEU A CB   2  
ATOM 4857  C CG   . LEU A 1 125 ? -9.895  11.229  -8.318  1.00 0.49  ? 125 LEU A CG   2  
ATOM 4858  C CD1  . LEU A 1 125 ? -8.466  11.084  -8.857  1.00 1.10  ? 125 LEU A CD1  2  
ATOM 4859  C CD2  . LEU A 1 125 ? -10.843 10.397  -9.193  1.00 1.21  ? 125 LEU A CD2  2  
ATOM 4860  H H    . LEU A 1 125 ? -10.521 10.361  -4.429  1.00 0.45  ? 125 LEU A H    2  
ATOM 4861  H HA   . LEU A 1 125 ? -10.258 12.722  -6.061  1.00 0.47  ? 125 LEU A HA   2  
ATOM 4862  H HB2  . LEU A 1 125 ? -8.968  10.663  -6.434  1.00 0.65  ? 125 LEU A HB2  2  
ATOM 4863  H HB3  . LEU A 1 125 ? -10.455 9.788   -6.791  1.00 0.63  ? 125 LEU A HB3  2  
ATOM 4864  H HG   . LEU A 1 125 ? -10.183 12.267  -8.371  1.00 1.08  ? 125 LEU A HG   2  
ATOM 4865  H HD11 . LEU A 1 125 ? -8.123  10.072  -8.702  1.00 1.73  ? 125 LEU A HD11 2  
ATOM 4866  H HD12 . LEU A 1 125 ? -7.814  11.768  -8.335  1.00 1.64  ? 125 LEU A HD12 2  
ATOM 4867  H HD13 . LEU A 1 125 ? -8.455  11.311  -9.913  1.00 1.64  ? 125 LEU A HD13 2  
ATOM 4868  H HD21 . LEU A 1 125 ? -11.836 10.418  -8.768  1.00 1.87  ? 125 LEU A HD21 2  
ATOM 4869  H HD22 . LEU A 1 125 ? -10.491 9.376   -9.234  1.00 1.77  ? 125 LEU A HD22 2  
ATOM 4870  H HD23 . LEU A 1 125 ? -10.869 10.810  -10.190 1.00 1.57  ? 125 LEU A HD23 2  
ATOM 4871  N N    . CYS A 1 126 ? -12.977 10.879  -6.393  1.00 0.52  ? 126 CYS A N    2  
ATOM 4872  C CA   . CYS A 1 126 ? -14.359 10.922  -6.956  1.00 0.57  ? 126 CYS A CA   2  
ATOM 4873  C C    . CYS A 1 126 ? -15.225 11.941  -6.205  1.00 0.57  ? 126 CYS A C    2  
ATOM 4874  O O    . CYS A 1 126 ? -16.321 12.259  -6.622  1.00 0.68  ? 126 CYS A O    2  
ATOM 4875  C CB   . CYS A 1 126 ? -14.994 9.519   -6.844  1.00 0.66  ? 126 CYS A CB   2  
ATOM 4876  S SG   . CYS A 1 126 ? -15.826 9.321   -5.240  1.00 1.67  ? 126 CYS A SG   2  
ATOM 4877  H H    . CYS A 1 126 ? -12.670 10.065  -5.939  1.00 0.54  ? 126 CYS A H    2  
ATOM 4878  H HA   . CYS A 1 126 ? -14.292 11.182  -8.004  1.00 0.59  ? 126 CYS A HA   2  
ATOM 4879  H HB2  . CYS A 1 126 ? -15.722 9.402   -7.632  1.00 1.24  ? 126 CYS A HB2  2  
ATOM 4880  H HB3  . CYS A 1 126 ? -14.215 8.773   -6.924  1.00 1.23  ? 126 CYS A HB3  2  
ATOM 4881  H HG   . CYS A 1 126 ? -16.033 8.392   -5.125  1.00 2.20  ? 126 CYS A HG   2  
ATOM 4882  N N    . THR A 1 127 ? -14.748 12.445  -5.094  1.00 0.57  ? 127 THR A N    2  
ATOM 4883  C CA   . THR A 1 127 ? -15.555 13.431  -4.310  1.00 0.60  ? 127 THR A CA   2  
ATOM 4884  C C    . THR A 1 127 ? -15.186 14.845  -4.729  1.00 0.62  ? 127 THR A C    2  
ATOM 4885  O O    . THR A 1 127 ? -15.773 15.804  -4.278  1.00 0.70  ? 127 THR A O    2  
ATOM 4886  C CB   . THR A 1 127 ? -15.316 13.195  -2.800  1.00 0.60  ? 127 THR A CB   2  
ATOM 4887  O OG1  . THR A 1 127 ? -13.922 13.180  -2.538  1.00 1.14  ? 127 THR A OG1  2  
ATOM 4888  C CG2  . THR A 1 127 ? -15.937 11.830  -2.480  1.00 1.19  ? 127 THR A CG2  2  
ATOM 4889  H H    . THR A 1 127 ? -13.856 12.181  -4.787  1.00 0.65  ? 127 THR A H    2  
ATOM 4890  H HA   . THR A 1 127 ? -16.606 13.267  -4.520  1.00 0.70  ? 127 THR A HA   2  
ATOM 4891  H HB   . THR A 1 127 ? -15.796 13.964  -2.220  1.00 1.00  ? 127 THR A HB   2  
ATOM 4892  H HG1  . THR A 1 127 ? -13.522 12.507  -3.093  1.00 1.73  ? 127 THR A HG1  2  
ATOM 4893  H HG21 . THR A 1 127 ? -15.571 11.498  -1.517  1.00 1.77  ? 127 THR A HG21 2  
ATOM 4894  H HG22 . THR A 1 127 ? -15.671 11.109  -3.234  1.00 1.72  ? 127 THR A HG22 2  
ATOM 4895  H HG23 . THR A 1 127 ? -17.012 11.929  -2.433  1.00 1.72  ? 127 THR A HG23 2  
ATOM 4896  N N    . LYS A 1 128 ? -14.220 14.972  -5.611  1.00 0.60  ? 128 LYS A N    2  
ATOM 4897  C CA   . LYS A 1 128 ? -13.821 16.323  -6.096  1.00 0.70  ? 128 LYS A CA   2  
ATOM 4898  C C    . LYS A 1 128 ? -13.118 17.113  -5.001  1.00 0.61  ? 128 LYS A C    2  
ATOM 4899  O O    . LYS A 1 128 ? -13.339 18.302  -4.865  1.00 0.60  ? 128 LYS A O    2  
ATOM 4900  C CB   . LYS A 1 128 ? -15.051 17.103  -6.595  1.00 0.87  ? 128 LYS A CB   2  
ATOM 4901  C CG   . LYS A 1 128 ? -15.960 16.178  -7.424  1.00 1.12  ? 128 LYS A CG   2  
ATOM 4902  C CD   . LYS A 1 128 ? -16.834 17.015  -8.363  1.00 1.43  ? 128 LYS A CD   2  
ATOM 4903  C CE   . LYS A 1 128 ? -17.802 16.099  -9.116  1.00 1.83  ? 128 LYS A CE   2  
ATOM 4904  N NZ   . LYS A 1 128 ? -18.867 15.629  -8.185  1.00 2.47  ? 128 LYS A NZ   2  
ATOM 4905  H H    . LYS A 1 128 ? -13.754 14.174  -5.937  1.00 0.57  ? 128 LYS A H    2  
ATOM 4906  H HA   . LYS A 1 128 ? -13.101 16.276  -6.901  1.00 0.81  ? 128 LYS A HA   2  
ATOM 4907  H HB2  . LYS A 1 128 ? -15.601 17.497  -5.756  1.00 0.88  ? 128 LYS A HB2  2  
ATOM 4908  H HB3  . LYS A 1 128 ? -14.719 17.924  -7.215  1.00 0.94  ? 128 LYS A HB3  2  
ATOM 4909  H HG2  . LYS A 1 128 ? -15.353 15.501  -8.010  1.00 1.28  ? 128 LYS A HG2  2  
ATOM 4910  H HG3  . LYS A 1 128 ? -16.595 15.609  -6.763  1.00 1.39  ? 128 LYS A HG3  2  
ATOM 4911  H HD2  . LYS A 1 128 ? -17.395 17.735  -7.785  1.00 1.67  ? 128 LYS A HD2  2  
ATOM 4912  H HD3  . LYS A 1 128 ? -16.207 17.532  -9.073  1.00 1.69  ? 128 LYS A HD3  2  
ATOM 4913  H HE2  . LYS A 1 128 ? -18.253 16.644  -9.932  1.00 2.13  ? 128 LYS A HE2  2  
ATOM 4914  H HE3  . LYS A 1 128 ? -17.263 15.247  -9.506  1.00 2.19  ? 128 LYS A HE3  2  
ATOM 4915  H HZ1  . LYS A 1 128 ? -18.443 15.044  -7.438  1.00 2.85  ? 128 LYS A HZ1  2  
ATOM 4916  H HZ2  . LYS A 1 128 ? -19.564 15.064  -8.714  1.00 2.89  ? 128 LYS A HZ2  2  
ATOM 4917  H HZ3  . LYS A 1 128 ? -19.339 16.449  -7.755  1.00 2.86  ? 128 LYS A HZ3  2  
ATOM 4918  N N    . VAL A 1 129 ? -12.236 16.497  -4.243  1.00 0.60  ? 129 VAL A N    2  
ATOM 4919  C CA   . VAL A 1 129 ? -11.476 17.253  -3.194  1.00 0.53  ? 129 VAL A CA   2  
ATOM 4920  C C    . VAL A 1 129 ? -9.999  16.840  -3.328  1.00 0.53  ? 129 VAL A C    2  
ATOM 4921  O O    . VAL A 1 129 ? -9.509  16.073  -2.525  1.00 0.56  ? 129 VAL A O    2  
ATOM 4922  C CB   . VAL A 1 129 ? -11.992 16.869  -1.807  1.00 0.57  ? 129 VAL A CB   2  
ATOM 4923  C CG1  . VAL A 1 129 ? -11.397 17.803  -0.757  1.00 1.40  ? 129 VAL A CG1  2  
ATOM 4924  C CG2  . VAL A 1 129 ? -13.518 16.964  -1.785  1.00 1.22  ? 129 VAL A CG2  2  
ATOM 4925  H H    . VAL A 1 129 ? -12.038 15.543  -4.351  1.00 0.66  ? 129 VAL A H    2  
ATOM 4926  H HA   . VAL A 1 129 ? -11.596 18.307  -3.383  1.00 0.54  ? 129 VAL A HA   2  
ATOM 4927  H HB   . VAL A 1 129 ? -11.694 15.853  -1.588  1.00 1.05  ? 129 VAL A HB   2  
ATOM 4928  H HG11 . VAL A 1 129 ? -10.319 17.722  -0.774  1.00 1.84  ? 129 VAL A HG11 2  
ATOM 4929  H HG12 . VAL A 1 129 ? -11.762 17.524  0.220   1.00 2.01  ? 129 VAL A HG12 2  
ATOM 4930  H HG13 . VAL A 1 129 ? -11.685 18.821  -0.974  1.00 1.91  ? 129 VAL A HG13 2  
ATOM 4931  H HG21 . VAL A 1 129 ? -13.824 17.935  -2.145  1.00 1.76  ? 129 VAL A HG21 2  
ATOM 4932  H HG22 . VAL A 1 129 ? -13.872 16.825  -0.774  1.00 1.84  ? 129 VAL A HG22 2  
ATOM 4933  H HG23 . VAL A 1 129 ? -13.935 16.195  -2.420  1.00 1.66  ? 129 VAL A HG23 2  
ATOM 4934  N N    . PRO A 1 130 ? -9.337  17.312  -4.370  1.00 0.62  ? 130 PRO A N    2  
ATOM 4935  C CA   . PRO A 1 130 ? -7.937  16.930  -4.629  1.00 0.73  ? 130 PRO A CA   2  
ATOM 4936  C C    . PRO A 1 130 ? -7.009  17.336  -3.473  1.00 0.65  ? 130 PRO A C    2  
ATOM 4937  O O    . PRO A 1 130 ? -5.958  16.740  -3.285  1.00 0.64  ? 130 PRO A O    2  
ATOM 4938  C CB   . PRO A 1 130 ? -7.553  17.654  -5.942  1.00 1.00  ? 130 PRO A CB   2  
ATOM 4939  C CG   . PRO A 1 130 ? -8.788  18.486  -6.393  1.00 1.00  ? 130 PRO A CG   2  
ATOM 4940  C CD   . PRO A 1 130 ? -9.912  18.255  -5.358  1.00 0.75  ? 130 PRO A CD   2  
ATOM 4941  H HA   . PRO A 1 130 ? -7.875  15.863  -4.767  1.00 0.84  ? 130 PRO A HA   2  
ATOM 4942  H HB2  . PRO A 1 130 ? -6.705  18.310  -5.776  1.00 1.10  ? 130 PRO A HB2  2  
ATOM 4943  H HB3  . PRO A 1 130 ? -7.305  16.930  -6.706  1.00 1.18  ? 130 PRO A HB3  2  
ATOM 4944  H HG2  . PRO A 1 130 ? -8.528  19.538  -6.432  1.00 1.11  ? 130 PRO A HG2  2  
ATOM 4945  H HG3  . PRO A 1 130 ? -9.118  18.159  -7.370  1.00 1.11  ? 130 PRO A HG3  2  
ATOM 4946  H HD2  . PRO A 1 130 ? -10.174 19.191  -4.882  1.00 0.76  ? 130 PRO A HD2  2  
ATOM 4947  H HD3  . PRO A 1 130 ? -10.777 17.816  -5.829  1.00 0.75  ? 130 PRO A HD3  2  
ATOM 4948  N N    . GLU A 1 131 ? -7.339  18.351  -2.707  1.00 0.73  ? 131 GLU A N    2  
ATOM 4949  C CA   . GLU A 1 131 ? -6.390  18.745  -1.617  1.00 0.82  ? 131 GLU A CA   2  
ATOM 4950  C C    . GLU A 1 131 ? -6.353  17.601  -0.598  1.00 0.72  ? 131 GLU A C    2  
ATOM 4951  O O    . GLU A 1 131 ? -5.449  17.484  0.204   1.00 0.73  ? 131 GLU A O    2  
ATOM 4952  C CB   . GLU A 1 131 ? -6.841  20.060  -0.982  1.00 1.09  ? 131 GLU A CB   2  
ATOM 4953  C CG   . GLU A 1 131 ? -5.792  20.556  0.007   1.00 1.55  ? 131 GLU A CG   2  
ATOM 4954  C CD   . GLU A 1 131 ? -6.266  21.875  0.621   1.00 2.17  ? 131 GLU A CD   2  
ATOM 4955  O OE1  . GLU A 1 131 ? -7.398  21.922  1.075   1.00 2.86  ? 131 GLU A OE1  2  
ATOM 4956  O OE2  . GLU A 1 131 ? -5.491  22.817  0.623   1.00 2.52  ? 131 GLU A OE2  2  
ATOM 4957  H H    . GLU A 1 131 ? -8.166  18.851  -2.864  1.00 0.82  ? 131 GLU A H    2  
ATOM 4958  H HA   . GLU A 1 131 ? -5.445  18.816  -2.134  1.00 0.90  ? 131 GLU A HA   2  
ATOM 4959  H HB2  . GLU A 1 131 ? -6.991  20.800  -1.754  1.00 1.38  ? 131 GLU A HB2  2  
ATOM 4960  H HB3  . GLU A 1 131 ? -7.774  19.896  -0.459  1.00 1.55  ? 131 GLU A HB3  2  
ATOM 4961  H HG2  . GLU A 1 131 ? -5.657  19.821  0.788   1.00 2.03  ? 131 GLU A HG2  2  
ATOM 4962  H HG3  . GLU A 1 131 ? -4.858  20.714  -0.508  1.00 1.89  ? 131 GLU A HG3  2  
ATOM 4963  N N    . LEU A 1 132 ? -7.334  16.741  -0.667  1.00 0.71  ? 132 LEU A N    2  
ATOM 4964  C CA   . LEU A 1 132 ? -7.402  15.562  0.241   1.00 0.69  ? 132 LEU A CA   2  
ATOM 4965  C C    . LEU A 1 132 ? -6.583  14.418  -0.373  1.00 0.58  ? 132 LEU A C    2  
ATOM 4966  O O    . LEU A 1 132 ? -6.092  13.559  0.332   1.00 0.59  ? 132 LEU A O    2  
ATOM 4967  C CB   . LEU A 1 132 ? -8.869  15.156  0.436   1.00 0.80  ? 132 LEU A CB   2  
ATOM 4968  C CG   . LEU A 1 132 ? -8.988  13.985  1.421   1.00 0.60  ? 132 LEU A CG   2  
ATOM 4969  C CD1  . LEU A 1 132 ? -8.456  14.389  2.810   1.00 1.11  ? 132 LEU A CD1  2  
ATOM 4970  C CD2  . LEU A 1 132 ? -10.464 13.580  1.531   1.00 0.77  ? 132 LEU A CD2  2  
ATOM 4971  H H    . LEU A 1 132 ? -8.029  16.860  -1.346  1.00 0.77  ? 132 LEU A H    2  
ATOM 4972  H HA   . LEU A 1 132 ? -6.936  15.750  1.192   1.00 0.73  ? 132 LEU A HA   2  
ATOM 4973  H HB2  . LEU A 1 132 ? -9.423  15.999  0.819   1.00 1.25  ? 132 LEU A HB2  2  
ATOM 4974  H HB3  . LEU A 1 132 ? -9.284  14.861  -0.516  1.00 1.02  ? 132 LEU A HB3  2  
ATOM 4975  H HG   . LEU A 1 132 ? -8.415  13.152  1.048   1.00 0.96  ? 132 LEU A HG   2  
ATOM 4976  H HD11 . LEU A 1 132 ? -7.399  14.186  2.860   1.00 1.71  ? 132 LEU A HD11 2  
ATOM 4977  H HD12 . LEU A 1 132 ? -8.962  13.818  3.578   1.00 1.45  ? 132 LEU A HD12 2  
ATOM 4978  H HD13 . LEU A 1 132 ? -8.629  15.443  2.979   1.00 1.58  ? 132 LEU A HD13 2  
ATOM 4979  H HD21 . LEU A 1 132 ? -11.010 14.352  2.054   1.00 1.39  ? 132 LEU A HD21 2  
ATOM 4980  H HD22 . LEU A 1 132 ? -10.543 12.652  2.078   1.00 1.46  ? 132 LEU A HD22 2  
ATOM 4981  H HD23 . LEU A 1 132 ? -10.880 13.453  0.542   1.00 1.25  ? 132 LEU A HD23 2  
ATOM 4982  N N    . ILE A 1 133 ? -6.408  14.397  -1.665  1.00 0.52  ? 133 ILE A N    2  
ATOM 4983  C CA   . ILE A 1 133 ? -5.590  13.310  -2.286  1.00 0.46  ? 133 ILE A CA   2  
ATOM 4984  C C    . ILE A 1 133 ? -4.173  13.382  -1.706  1.00 0.43  ? 133 ILE A C    2  
ATOM 4985  O O    . ILE A 1 133 ? -3.617  12.397  -1.262  1.00 0.46  ? 133 ILE A O    2  
ATOM 4986  C CB   . ILE A 1 133 ? -5.543  13.514  -3.813  1.00 0.45  ? 133 ILE A CB   2  
ATOM 4987  C CG1  . ILE A 1 133 ? -6.908  13.139  -4.408  1.00 0.42  ? 133 ILE A CG1  2  
ATOM 4988  C CG2  . ILE A 1 133 ? -4.450  12.626  -4.433  1.00 0.49  ? 133 ILE A CG2  2  
ATOM 4989  C CD1  . ILE A 1 133 ? -6.953  13.491  -5.899  1.00 1.19  ? 133 ILE A CD1  2  
ATOM 4990  H H    . ILE A 1 133 ? -6.806  15.079  -2.236  1.00 0.56  ? 133 ILE A H    2  
ATOM 4991  H HA   . ILE A 1 133 ? -6.030  12.347  -2.067  1.00 0.50  ? 133 ILE A HA   2  
ATOM 4992  H HB   . ILE A 1 133 ? -5.327  14.551  -4.029  1.00 0.52  ? 133 ILE A HB   2  
ATOM 4993  H HG12 . ILE A 1 133 ? -7.071  12.078  -4.286  1.00 1.01  ? 133 ILE A HG12 2  
ATOM 4994  H HG13 . ILE A 1 133 ? -7.684  13.682  -3.890  1.00 1.03  ? 133 ILE A HG13 2  
ATOM 4995  H HG21 . ILE A 1 133 ? -4.531  11.625  -4.037  1.00 1.14  ? 133 ILE A HG21 2  
ATOM 4996  H HG22 . ILE A 1 133 ? -3.476  13.029  -4.194  1.00 1.19  ? 133 ILE A HG22 2  
ATOM 4997  H HG23 . ILE A 1 133 ? -4.569  12.598  -5.507  1.00 1.08  ? 133 ILE A HG23 2  
ATOM 4998  H HD11 . ILE A 1 133 ? -6.417  12.740  -6.462  1.00 1.86  ? 133 ILE A HD11 2  
ATOM 4999  H HD12 . ILE A 1 133 ? -6.495  14.456  -6.059  1.00 1.78  ? 133 ILE A HD12 2  
ATOM 5000  H HD13 . ILE A 1 133 ? -7.981  13.521  -6.230  1.00 1.68  ? 133 ILE A HD13 2  
ATOM 5001  N N    . ARG A 1 134 ? -3.596  14.553  -1.698  1.00 0.42  ? 134 ARG A N    2  
ATOM 5002  C CA   . ARG A 1 134 ? -2.218  14.723  -1.139  1.00 0.43  ? 134 ARG A CA   2  
ATOM 5003  C C    . ARG A 1 134 ? -2.220  14.493  0.379   1.00 0.40  ? 134 ARG A C    2  
ATOM 5004  O O    . ARG A 1 134 ? -1.353  13.828  0.908   1.00 0.39  ? 134 ARG A O    2  
ATOM 5005  C CB   . ARG A 1 134 ? -1.724  16.143  -1.431  1.00 0.51  ? 134 ARG A CB   2  
ATOM 5006  C CG   . ARG A 1 134 ? -0.234  16.246  -1.094  1.00 1.26  ? 134 ARG A CG   2  
ATOM 5007  C CD   . ARG A 1 134 ? 0.248   17.682  -1.316  1.00 1.57  ? 134 ARG A CD   2  
ATOM 5008  N NE   . ARG A 1 134 ? 0.261   17.981  -2.776  1.00 2.30  ? 134 ARG A NE   2  
ATOM 5009  C CZ   . ARG A 1 134 ? 0.370   19.214  -3.191  1.00 2.86  ? 134 ARG A CZ   2  
ATOM 5010  N NH1  . ARG A 1 134 ? 0.480   20.187  -2.328  1.00 2.98  ? 134 ARG A NH1  2  
ATOM 5011  N NH2  . ARG A 1 134 ? 0.373   19.474  -4.470  1.00 3.71  ? 134 ARG A NH2  2  
ATOM 5012  H H    . ARG A 1 134 ? -4.078  15.337  -2.056  1.00 0.45  ? 134 ARG A H    2  
ATOM 5013  H HA   . ARG A 1 134 ? -1.523  14.015  -1.571  1.00 0.44  ? 134 ARG A HA   2  
ATOM 5014  H HB2  . ARG A 1 134 ? -1.873  16.368  -2.478  1.00 0.98  ? 134 ARG A HB2  2  
ATOM 5015  H HB3  . ARG A 1 134 ? -2.277  16.848  -0.829  1.00 1.10  ? 134 ARG A HB3  2  
ATOM 5016  H HG2  . ARG A 1 134 ? -0.080  15.971  -0.060  1.00 1.75  ? 134 ARG A HG2  2  
ATOM 5017  H HG3  . ARG A 1 134 ? 0.327   15.579  -1.731  1.00 1.79  ? 134 ARG A HG3  2  
ATOM 5018  H HD2  . ARG A 1 134 ? -0.419  18.368  -0.816  1.00 1.69  ? 134 ARG A HD2  2  
ATOM 5019  H HD3  . ARG A 1 134 ? 1.245   17.793  -0.914  1.00 1.89  ? 134 ARG A HD3  2  
ATOM 5020  H HE   . ARG A 1 134 ? 0.185   17.251  -3.426  1.00 2.71  ? 134 ARG A HE   2  
ATOM 5021  H HH11 . ARG A 1 134 ? 0.480   19.988  -1.348  1.00 2.70  ? 134 ARG A HH11 2  
ATOM 5022  H HH12 . ARG A 1 134 ? 0.564   21.131  -2.646  1.00 3.64  ? 134 ARG A HH12 2  
ATOM 5023  H HH21 . ARG A 1 134 ? 0.292   18.729  -5.132  1.00 4.02  ? 134 ARG A HH21 2  
ATOM 5024  H HH22 . ARG A 1 134 ? 0.457   20.418  -4.788  1.00 4.22  ? 134 ARG A HH22 2  
ATOM 5025  N N    . THR A 1 135 ? -3.168  15.044  1.088   1.00 0.41  ? 135 THR A N    2  
ATOM 5026  C CA   . THR A 1 135 ? -3.181  14.851  2.568   1.00 0.41  ? 135 THR A CA   2  
ATOM 5027  C C    . THR A 1 135 ? -3.186  13.357  2.909   1.00 0.39  ? 135 THR A C    2  
ATOM 5028  O O    . THR A 1 135 ? -2.554  12.920  3.851   1.00 0.52  ? 135 THR A O    2  
ATOM 5029  C CB   . THR A 1 135 ? -4.409  15.526  3.177   1.00 0.42  ? 135 THR A CB   2  
ATOM 5030  O OG1  . THR A 1 135 ? -4.304  16.931  3.003   1.00 0.89  ? 135 THR A OG1  2  
ATOM 5031  C CG2  . THR A 1 135 ? -4.491  15.205  4.673   1.00 0.88  ? 135 THR A CG2  2  
ATOM 5032  H H    . THR A 1 135 ? -3.854  15.585  0.643   1.00 0.43  ? 135 THR A H    2  
ATOM 5033  H HA   . THR A 1 135 ? -2.291  15.300  2.986   1.00 0.42  ? 135 THR A HA   2  
ATOM 5034  H HB   . THR A 1 135 ? -5.299  15.174  2.690   1.00 0.74  ? 135 THR A HB   2  
ATOM 5035  H HG1  . THR A 1 135 ? -4.101  17.322  3.855   1.00 1.41  ? 135 THR A HG1  2  
ATOM 5036  H HG21 . THR A 1 135 ? -5.210  15.861  5.142   1.00 1.52  ? 135 THR A HG21 2  
ATOM 5037  H HG22 . THR A 1 135 ? -3.522  15.351  5.127   1.00 1.47  ? 135 THR A HG22 2  
ATOM 5038  H HG23 . THR A 1 135 ? -4.801  14.179  4.805   1.00 1.37  ? 135 THR A HG23 2  
ATOM 5039  N N    . ILE A 1 136 ? -3.853  12.561  2.116   1.00 0.35  ? 136 ILE A N    2  
ATOM 5040  C CA   . ILE A 1 136 ? -3.861  11.089  2.352   1.00 0.36  ? 136 ILE A CA   2  
ATOM 5041  C C    . ILE A 1 136 ? -2.447  10.559  2.117   1.00 0.35  ? 136 ILE A C    2  
ATOM 5042  O O    . ILE A 1 136 ? -1.790  10.138  3.049   1.00 0.51  ? 136 ILE A O    2  
ATOM 5043  C CB   . ILE A 1 136 ? -4.863  10.433  1.389   1.00 0.46  ? 136 ILE A CB   2  
ATOM 5044  C CG1  . ILE A 1 136 ? -6.291  10.803  1.831   1.00 0.60  ? 136 ILE A CG1  2  
ATOM 5045  C CG2  . ILE A 1 136 ? -4.697  8.910   1.419   1.00 0.94  ? 136 ILE A CG2  2  
ATOM 5046  C CD1  . ILE A 1 136 ? -7.271  10.620  0.669   1.00 0.64  ? 136 ILE A CD1  2  
ATOM 5047  H H    . ILE A 1 136 ? -4.314  12.911  1.324   1.00 0.41  ? 136 ILE A H    2  
ATOM 5048  H HA   . ILE A 1 136 ? -4.134  10.844  3.369   1.00 0.40  ? 136 ILE A HA   2  
ATOM 5049  H HB   . ILE A 1 136 ? -4.688  10.795  0.386   1.00 0.84  ? 136 ILE A HB   2  
ATOM 5050  H HG12 . ILE A 1 136 ? -6.590  10.173  2.656   1.00 1.16  ? 136 ILE A HG12 2  
ATOM 5051  H HG13 . ILE A 1 136 ? -6.313  11.837  2.147   1.00 1.18  ? 136 ILE A HG13 2  
ATOM 5052  H HG21 . ILE A 1 136 ? -5.545  8.446   0.936   1.00 1.44  ? 136 ILE A HG21 2  
ATOM 5053  H HG22 . ILE A 1 136 ? -4.641  8.573   2.444   1.00 1.48  ? 136 ILE A HG22 2  
ATOM 5054  H HG23 . ILE A 1 136 ? -3.792  8.634   0.899   1.00 1.51  ? 136 ILE A HG23 2  
ATOM 5055  H HD11 . ILE A 1 136 ? -7.184  9.615   0.281   1.00 1.15  ? 136 ILE A HD11 2  
ATOM 5056  H HD12 . ILE A 1 136 ? -7.043  11.329  -0.112  1.00 1.44  ? 136 ILE A HD12 2  
ATOM 5057  H HD13 . ILE A 1 136 ? -8.279  10.782  1.021   1.00 1.20  ? 136 ILE A HD13 2  
ATOM 5058  N N    . MET A 1 137 ? -1.970  10.555  0.895   1.00 0.35  ? 137 MET A N    2  
ATOM 5059  C CA   . MET A 1 137 ? -0.587  10.043  0.621   1.00 0.33  ? 137 MET A CA   2  
ATOM 5060  C C    . MET A 1 137 ? 0.370   10.485  1.737   1.00 0.31  ? 137 MET A C    2  
ATOM 5061  O O    . MET A 1 137 ? 1.367   9.858   2.025   1.00 0.34  ? 137 MET A O    2  
ATOM 5062  C CB   . MET A 1 137 ? -0.104  10.598  -0.722  1.00 0.36  ? 137 MET A CB   2  
ATOM 5063  C CG   . MET A 1 137 ? -0.999  10.072  -1.849  1.00 0.67  ? 137 MET A CG   2  
ATOM 5064  S SD   . MET A 1 137 ? -0.811  11.125  -3.309  1.00 1.13  ? 137 MET A SD   2  
ATOM 5065  C CE   . MET A 1 137 ? 0.852   10.584  -3.775  1.00 0.67  ? 137 MET A CE   2  
ATOM 5066  H H    . MET A 1 137 ? -2.520  10.858  0.143   1.00 0.52  ? 137 MET A H    2  
ATOM 5067  H HA   . MET A 1 137 ? -0.607  8.963   0.575   1.00 0.34  ? 137 MET A HA   2  
ATOM 5068  H HB2  . MET A 1 137 ? -0.148  11.677  -0.700  1.00 0.50  ? 137 MET A HB2  2  
ATOM 5069  H HB3  . MET A 1 137 ? 0.914   10.283  -0.896  1.00 0.49  ? 137 MET A HB3  2  
ATOM 5070  H HG2  . MET A 1 137 ? -0.712  9.061   -2.096  1.00 1.13  ? 137 MET A HG2  2  
ATOM 5071  H HG3  . MET A 1 137 ? -2.032  10.085  -1.530  1.00 1.01  ? 137 MET A HG3  2  
ATOM 5072  H HE1  . MET A 1 137 ? 1.570   10.982  -3.070  1.00 1.28  ? 137 MET A HE1  2  
ATOM 5073  H HE2  . MET A 1 137 ? 1.083   10.946  -4.763  1.00 1.01  ? 137 MET A HE2  2  
ATOM 5074  H HE3  . MET A 1 137 ? 0.894   9.504   -3.769  1.00 1.26  ? 137 MET A HE3  2  
ATOM 5075  N N    . GLY A 1 138 ? 0.033   11.576  2.370   1.00 0.31  ? 138 GLY A N    2  
ATOM 5076  C CA   . GLY A 1 138 ? 0.856   12.114  3.490   1.00 0.33  ? 138 GLY A CA   2  
ATOM 5077  C C    . GLY A 1 138 ? 0.824   11.124  4.658   1.00 0.33  ? 138 GLY A C    2  
ATOM 5078  O O    . GLY A 1 138 ? 1.841   10.786  5.227   1.00 0.34  ? 138 GLY A O    2  
ATOM 5079  H H    . GLY A 1 138 ? -0.786  12.046  2.103   1.00 0.32  ? 138 GLY A H    2  
ATOM 5080  H HA2  . GLY A 1 138 ? 1.879   12.264  3.167   1.00 0.35  ? 138 GLY A HA2  2  
ATOM 5081  H HA3  . GLY A 1 138 ? 0.423   13.056  3.782   1.00 0.36  ? 138 GLY A HA3  2  
ATOM 5082  N N    . TRP A 1 139 ? -0.342  10.653  5.011   1.00 0.34  ? 139 TRP A N    2  
ATOM 5083  C CA   . TRP A 1 139 ? -0.442  9.677   6.133   1.00 0.37  ? 139 TRP A CA   2  
ATOM 5084  C C    . TRP A 1 139 ? 0.165   8.330   5.719   1.00 0.35  ? 139 TRP A C    2  
ATOM 5085  O O    . TRP A 1 139 ? 0.523   7.523   6.553   1.00 0.39  ? 139 TRP A O    2  
ATOM 5086  C CB   . TRP A 1 139 ? -1.902  9.473   6.541   1.00 0.43  ? 139 TRP A CB   2  
ATOM 5087  C CG   . TRP A 1 139 ? -2.558  10.786  6.842   1.00 0.46  ? 139 TRP A CG   2  
ATOM 5088  C CD1  . TRP A 1 139 ? -1.925  11.918  7.242   1.00 0.54  ? 139 TRP A CD1  2  
ATOM 5089  C CD2  . TRP A 1 139 ? -3.976  11.114  6.781   1.00 0.53  ? 139 TRP A CD2  2  
ATOM 5090  N NE1  . TRP A 1 139 ? -2.867  12.914  7.427   1.00 0.57  ? 139 TRP A NE1  2  
ATOM 5091  C CE2  . TRP A 1 139 ? -4.145  12.467  7.155   1.00 0.56  ? 139 TRP A CE2  2  
ATOM 5092  C CE3  . TRP A 1 139 ? -5.120  10.372  6.439   1.00 0.67  ? 139 TRP A CE3  2  
ATOM 5093  C CZ2  . TRP A 1 139 ? -5.406  13.064  7.189   1.00 0.66  ? 139 TRP A CZ2  2  
ATOM 5094  C CZ3  . TRP A 1 139 ? -6.391  10.969  6.471   1.00 0.81  ? 139 TRP A CZ3  2  
ATOM 5095  C CH2  . TRP A 1 139 ? -6.533  12.312  6.846   1.00 0.78  ? 139 TRP A CH2  2  
ATOM 5096  H H    . TRP A 1 139 ? -1.140  10.957  4.529   1.00 0.35  ? 139 TRP A H    2  
ATOM 5097  H HA   . TRP A 1 139 ? 0.129   10.024  6.980   1.00 0.39  ? 139 TRP A HA   2  
ATOM 5098  H HB2  . TRP A 1 139 ? -2.431  8.988   5.735   1.00 0.45  ? 139 TRP A HB2  2  
ATOM 5099  H HB3  . TRP A 1 139 ? -1.941  8.845   7.420   1.00 0.45  ? 139 TRP A HB3  2  
ATOM 5100  H HD1  . TRP A 1 139 ? -0.863  12.030  7.392   1.00 0.64  ? 139 TRP A HD1  2  
ATOM 5101  H HE1  . TRP A 1 139 ? -2.672  13.830  7.715   1.00 0.65  ? 139 TRP A HE1  2  
ATOM 5102  H HE3  . TRP A 1 139 ? -5.021  9.337   6.148   1.00 0.70  ? 139 TRP A HE3  2  
ATOM 5103  H HZ2  . TRP A 1 139 ? -5.512  14.098  7.480   1.00 0.69  ? 139 TRP A HZ2  2  
ATOM 5104  H HZ3  . TRP A 1 139 ? -7.263  10.390  6.206   1.00 0.96  ? 139 TRP A HZ3  2  
ATOM 5105  H HH2  . TRP A 1 139 ? -7.513  12.766  6.869   1.00 0.90  ? 139 TRP A HH2  2  
ATOM 5106  N N    . THR A 1 140 ? 0.290   8.074   4.442   1.00 0.34  ? 140 THR A N    2  
ATOM 5107  C CA   . THR A 1 140 ? 0.881   6.774   4.005   1.00 0.36  ? 140 THR A CA   2  
ATOM 5108  C C    . THR A 1 140 ? 2.398   6.814   4.215   1.00 0.34  ? 140 THR A C    2  
ATOM 5109  O O    . THR A 1 140 ? 2.945   6.054   4.990   1.00 0.39  ? 140 THR A O    2  
ATOM 5110  C CB   . THR A 1 140 ? 0.568   6.530   2.526   1.00 0.38  ? 140 THR A CB   2  
ATOM 5111  O OG1  . THR A 1 140 ? 1.184   7.537   1.737   1.00 1.20  ? 140 THR A OG1  2  
ATOM 5112  C CG2  . THR A 1 140 ? -0.946  6.562   2.311   1.00 1.17  ? 140 THR A CG2  2  
ATOM 5113  H H    . THR A 1 140 ? -0.002  8.731   3.775   1.00 0.34  ? 140 THR A H    2  
ATOM 5114  H HA   . THR A 1 140 ? 0.460   5.975   4.597   1.00 0.40  ? 140 THR A HA   2  
ATOM 5115  H HB   . THR A 1 140 ? 0.947   5.563   2.233   1.00 0.98  ? 140 THR A HB   2  
ATOM 5116  H HG1  . THR A 1 140 ? 0.821   8.385   2.003   1.00 1.79  ? 140 THR A HG1  2  
ATOM 5117  H HG21 . THR A 1 140 ? -1.417  5.837   2.959   1.00 1.62  ? 140 THR A HG21 2  
ATOM 5118  H HG22 . THR A 1 140 ? -1.169  6.323   1.282   1.00 1.80  ? 140 THR A HG22 2  
ATOM 5119  H HG23 . THR A 1 140 ? -1.321  7.548   2.541   1.00 1.82  ? 140 THR A HG23 2  
ATOM 5120  N N    . LEU A 1 141 ? 3.081   7.700   3.541   1.00 0.33  ? 141 LEU A N    2  
ATOM 5121  C CA   . LEU A 1 141 ? 4.560   7.796   3.716   1.00 0.34  ? 141 LEU A CA   2  
ATOM 5122  C C    . LEU A 1 141 ? 4.889   8.037   5.195   1.00 0.33  ? 141 LEU A C    2  
ATOM 5123  O O    . LEU A 1 141 ? 5.951   7.683   5.665   1.00 0.33  ? 141 LEU A O    2  
ATOM 5124  C CB   . LEU A 1 141 ? 5.123   8.931   2.856   1.00 0.35  ? 141 LEU A CB   2  
ATOM 5125  C CG   . LEU A 1 141 ? 4.809   8.678   1.374   1.00 0.41  ? 141 LEU A CG   2  
ATOM 5126  C CD1  . LEU A 1 141 ? 5.154   9.930   0.564   1.00 0.99  ? 141 LEU A CD1  2  
ATOM 5127  C CD2  . LEU A 1 141 ? 5.626   7.485   0.851   1.00 0.80  ? 141 LEU A CD2  2  
ATOM 5128  H H    . LEU A 1 141 ? 2.621   8.310   2.928   1.00 0.37  ? 141 LEU A H    2  
ATOM 5129  H HA   . LEU A 1 141 ? 5.037   6.862   3.455   1.00 0.36  ? 141 LEU A HA   2  
ATOM 5130  H HB2  . LEU A 1 141 ? 4.671   9.864   3.163   1.00 0.38  ? 141 LEU A HB2  2  
ATOM 5131  H HB3  . LEU A 1 141 ? 6.192   8.992   2.994   1.00 0.41  ? 141 LEU A HB3  2  
ATOM 5132  H HG   . LEU A 1 141 ? 3.756   8.465   1.264   1.00 1.00  ? 141 LEU A HG   2  
ATOM 5133  H HD11 . LEU A 1 141 ? 4.537   10.753  0.893   1.00 1.58  ? 141 LEU A HD11 2  
ATOM 5134  H HD12 . LEU A 1 141 ? 4.974   9.741   -0.484  1.00 1.53  ? 141 LEU A HD12 2  
ATOM 5135  H HD13 . LEU A 1 141 ? 6.195   10.178  0.712   1.00 1.54  ? 141 LEU A HD13 2  
ATOM 5136  H HD21 . LEU A 1 141 ? 5.681   7.528   -0.228  1.00 1.31  ? 141 LEU A HD21 2  
ATOM 5137  H HD22 . LEU A 1 141 ? 5.144   6.565   1.144   1.00 1.31  ? 141 LEU A HD22 2  
ATOM 5138  H HD23 . LEU A 1 141 ? 6.624   7.515   1.262   1.00 1.59  ? 141 LEU A HD23 2  
ATOM 5139  N N    . ASP A 1 142 ? 3.989   8.621   5.938   1.00 0.36  ? 142 ASP A N    2  
ATOM 5140  C CA   . ASP A 1 142 ? 4.268   8.852   7.386   1.00 0.37  ? 142 ASP A CA   2  
ATOM 5141  C C    . ASP A 1 142 ? 4.339   7.495   8.090   1.00 0.37  ? 142 ASP A C    2  
ATOM 5142  O O    . ASP A 1 142 ? 5.343   7.130   8.669   1.00 0.42  ? 142 ASP A O    2  
ATOM 5143  C CB   . ASP A 1 142 ? 3.138   9.680   8.001   1.00 0.37  ? 142 ASP A CB   2  
ATOM 5144  C CG   . ASP A 1 142 ? 3.208   11.114  7.471   1.00 0.78  ? 142 ASP A CG   2  
ATOM 5145  O OD1  . ASP A 1 142 ? 4.107   11.396  6.695   1.00 1.32  ? 142 ASP A OD1  2  
ATOM 5146  O OD2  . ASP A 1 142 ? 2.362   11.907  7.851   1.00 1.59  ? 142 ASP A OD2  2  
ATOM 5147  H H    . ASP A 1 142 ? 3.131   8.895   5.550   1.00 0.37  ? 142 ASP A H    2  
ATOM 5148  H HA   . ASP A 1 142 ? 5.202   9.383   7.502   1.00 0.38  ? 142 ASP A HA   2  
ATOM 5149  H HB2  . ASP A 1 142 ? 2.188   9.242   7.738   1.00 0.57  ? 142 ASP A HB2  2  
ATOM 5150  H HB3  . ASP A 1 142 ? 3.245   9.691   9.075   1.00 0.68  ? 142 ASP A HB3  2  
ATOM 5151  N N    . PHE A 1 143 ? 3.273   6.743   8.027   1.00 0.41  ? 143 PHE A N    2  
ATOM 5152  C CA   . PHE A 1 143 ? 3.249   5.398   8.669   1.00 0.43  ? 143 PHE A CA   2  
ATOM 5153  C C    . PHE A 1 143 ? 4.371   4.528   8.097   1.00 0.43  ? 143 PHE A C    2  
ATOM 5154  O O    . PHE A 1 143 ? 5.068   3.854   8.831   1.00 0.45  ? 143 PHE A O    2  
ATOM 5155  C CB   . PHE A 1 143 ? 1.896   4.732   8.387   1.00 0.44  ? 143 PHE A CB   2  
ATOM 5156  C CG   . PHE A 1 143 ? 1.906   3.310   8.901   1.00 0.47  ? 143 PHE A CG   2  
ATOM 5157  C CD1  . PHE A 1 143 ? 2.468   2.289   8.124   1.00 1.16  ? 143 PHE A CD1  2  
ATOM 5158  C CD2  . PHE A 1 143 ? 1.351   3.012   10.152  1.00 1.29  ? 143 PHE A CD2  2  
ATOM 5159  C CE1  . PHE A 1 143 ? 2.476   0.972   8.597   1.00 1.22  ? 143 PHE A CE1  2  
ATOM 5160  C CE2  . PHE A 1 143 ? 1.360   1.693   10.625  1.00 1.35  ? 143 PHE A CE2  2  
ATOM 5161  C CZ   . PHE A 1 143 ? 1.922   0.674   9.848   1.00 0.72  ? 143 PHE A CZ   2  
ATOM 5162  H H    . PHE A 1 143 ? 2.483   7.064   7.544   1.00 0.48  ? 143 PHE A H    2  
ATOM 5163  H HA   . PHE A 1 143 ? 3.393   5.478   9.736   1.00 0.44  ? 143 PHE A HA   2  
ATOM 5164  H HB2  . PHE A 1 143 ? 1.113   5.288   8.880   1.00 0.47  ? 143 PHE A HB2  2  
ATOM 5165  H HB3  . PHE A 1 143 ? 1.716   4.726   7.322   1.00 0.49  ? 143 PHE A HB3  2  
ATOM 5166  H HD1  . PHE A 1 143 ? 2.895   2.519   7.159   1.00 1.96  ? 143 PHE A HD1  2  
ATOM 5167  H HD2  . PHE A 1 143 ? 0.917   3.798   10.752  1.00 2.09  ? 143 PHE A HD2  2  
ATOM 5168  H HE1  . PHE A 1 143 ? 2.910   0.185   7.997   1.00 2.02  ? 143 PHE A HE1  2  
ATOM 5169  H HE2  . PHE A 1 143 ? 0.933   1.463   11.590  1.00 2.16  ? 143 PHE A HE2  2  
ATOM 5170  H HZ   . PHE A 1 143 ? 1.929   -0.343  10.213  1.00 0.85  ? 143 PHE A HZ   2  
ATOM 5171  N N    . LEU A 1 144 ? 4.562   4.523   6.808   1.00 0.45  ? 144 LEU A N    2  
ATOM 5172  C CA   . LEU A 1 144 ? 5.648   3.674   6.245   1.00 0.47  ? 144 LEU A CA   2  
ATOM 5173  C C    . LEU A 1 144 ? 6.982   4.139   6.845   1.00 0.47  ? 144 LEU A C    2  
ATOM 5174  O O    . LEU A 1 144 ? 7.750   3.343   7.344   1.00 0.49  ? 144 LEU A O    2  
ATOM 5175  C CB   . LEU A 1 144 ? 5.604   3.742   4.693   1.00 0.49  ? 144 LEU A CB   2  
ATOM 5176  C CG   . LEU A 1 144 ? 7.006   3.829   4.046   1.00 0.64  ? 144 LEU A CG   2  
ATOM 5177  C CD1  . LEU A 1 144 ? 7.746   2.496   4.196   1.00 1.31  ? 144 LEU A CD1  2  
ATOM 5178  C CD2  . LEU A 1 144 ? 6.845   4.150   2.559   1.00 1.01  ? 144 LEU A CD2  2  
ATOM 5179  H H    . LEU A 1 144 ? 3.997   5.064   6.219   1.00 0.46  ? 144 LEU A H    2  
ATOM 5180  H HA   . LEU A 1 144 ? 5.498   2.679   6.602   1.00 0.47  ? 144 LEU A HA   2  
ATOM 5181  H HB2  . LEU A 1 144 ? 5.099   2.866   4.316   1.00 0.76  ? 144 LEU A HB2  2  
ATOM 5182  H HB3  . LEU A 1 144 ? 5.036   4.616   4.406   1.00 0.69  ? 144 LEU A HB3  2  
ATOM 5183  H HG   . LEU A 1 144 ? 7.581   4.616   4.509   1.00 1.31  ? 144 LEU A HG   2  
ATOM 5184  H HD11 . LEU A 1 144 ? 8.566   2.456   3.493   1.00 1.90  ? 144 LEU A HD11 2  
ATOM 5185  H HD12 . LEU A 1 144 ? 7.068   1.678   4.003   1.00 1.80  ? 144 LEU A HD12 2  
ATOM 5186  H HD13 . LEU A 1 144 ? 8.131   2.416   5.195   1.00 1.81  ? 144 LEU A HD13 2  
ATOM 5187  H HD21 . LEU A 1 144 ? 6.469   5.156   2.450   1.00 1.47  ? 144 LEU A HD21 2  
ATOM 5188  H HD22 . LEU A 1 144 ? 6.152   3.454   2.112   1.00 1.62  ? 144 LEU A HD22 2  
ATOM 5189  H HD23 . LEU A 1 144 ? 7.805   4.070   2.069   1.00 1.63  ? 144 LEU A HD23 2  
ATOM 5190  N N    . ARG A 1 145 ? 7.263   5.403   6.809   1.00 0.47  ? 145 ARG A N    2  
ATOM 5191  C CA   . ARG A 1 145 ? 8.547   5.894   7.385   1.00 0.48  ? 145 ARG A CA   2  
ATOM 5192  C C    . ARG A 1 145 ? 8.602   5.636   8.899   1.00 0.49  ? 145 ARG A C    2  
ATOM 5193  O O    . ARG A 1 145 ? 9.657   5.382   9.445   1.00 0.50  ? 145 ARG A O    2  
ATOM 5194  C CB   . ARG A 1 145 ? 8.676   7.398   7.118   1.00 0.49  ? 145 ARG A CB   2  
ATOM 5195  C CG   . ARG A 1 145 ? 9.966   7.934   7.753   1.00 0.69  ? 145 ARG A CG   2  
ATOM 5196  C CD   . ARG A 1 145 ? 10.157  9.403   7.360   1.00 0.68  ? 145 ARG A CD   2  
ATOM 5197  N NE   . ARG A 1 145 ? 11.225  10.026  8.213   1.00 1.56  ? 145 ARG A NE   2  
ATOM 5198  C CZ   . ARG A 1 145 ? 11.129  10.065  9.517   1.00 2.10  ? 145 ARG A CZ   2  
ATOM 5199  N NH1  . ARG A 1 145 ? 10.022  9.711   10.111  1.00 2.12  ? 145 ARG A NH1  2  
ATOM 5200  N NH2  . ARG A 1 145 ? 12.130  10.507  10.227  1.00 3.16  ? 145 ARG A NH2  2  
ATOM 5201  H H    . ARG A 1 145 ? 6.633   6.031   6.399   1.00 0.47  ? 145 ARG A H    2  
ATOM 5202  H HA   . ARG A 1 145 ? 9.383   5.381   6.935   1.00 0.49  ? 145 ARG A HA   2  
ATOM 5203  H HB2  . ARG A 1 145 ? 8.703   7.570   6.052   1.00 0.67  ? 145 ARG A HB2  2  
ATOM 5204  H HB3  . ARG A 1 145 ? 7.828   7.912   7.543   1.00 0.66  ? 145 ARG A HB3  2  
ATOM 5205  H HG2  . ARG A 1 145 ? 9.903   7.844   8.821   1.00 0.93  ? 145 ARG A HG2  2  
ATOM 5206  H HG3  . ARG A 1 145 ? 10.806  7.358   7.396   1.00 0.93  ? 145 ARG A HG3  2  
ATOM 5207  H HD2  . ARG A 1 145 ? 10.488  9.457   6.342   1.00 1.08  ? 145 ARG A HD2  2  
ATOM 5208  H HD3  . ARG A 1 145 ? 9.206   9.927   7.450   1.00 1.24  ? 145 ARG A HD3  2  
ATOM 5209  H HE   . ARG A 1 145 ? 12.035  10.373  7.784   1.00 2.23  ? 145 ARG A HE   2  
ATOM 5210  H HH11 . ARG A 1 145 ? 9.239   9.407   9.567   1.00 1.91  ? 145 ARG A HH11 2  
ATOM 5211  H HH12 . ARG A 1 145 ? 9.957   9.741   11.108  1.00 2.82  ? 145 ARG A HH12 2  
ATOM 5212  H HH21 . ARG A 1 145 ? 12.966  10.815  9.775   1.00 3.67  ? 145 ARG A HH21 2  
ATOM 5213  H HH22 . ARG A 1 145 ? 12.060  10.536  11.224  1.00 3.66  ? 145 ARG A HH22 2  
ATOM 5214  N N    . GLU A 1 146 ? 7.503   5.753   9.597   1.00 0.49  ? 146 GLU A N    2  
ATOM 5215  C CA   . GLU A 1 146 ? 7.551   5.567   11.084  1.00 0.51  ? 146 GLU A CA   2  
ATOM 5216  C C    . GLU A 1 146 ? 7.494   4.084   11.483  1.00 0.53  ? 146 GLU A C    2  
ATOM 5217  O O    . GLU A 1 146 ? 8.326   3.631   12.245  1.00 0.55  ? 146 GLU A O    2  
ATOM 5218  C CB   . GLU A 1 146 ? 6.387   6.319   11.732  1.00 0.52  ? 146 GLU A CB   2  
ATOM 5219  C CG   . GLU A 1 146 ? 6.582   7.825   11.546  1.00 0.96  ? 146 GLU A CG   2  
ATOM 5220  C CD   . GLU A 1 146 ? 5.357   8.570   12.081  1.00 1.48  ? 146 GLU A CD   2  
ATOM 5221  O OE1  . GLU A 1 146 ? 5.192   8.606   13.289  1.00 2.22  ? 146 GLU A OE1  2  
ATOM 5222  O OE2  . GLU A 1 146 ? 4.606   9.092   11.274  1.00 2.03  ? 146 GLU A OE2  2  
ATOM 5223  H H    . GLU A 1 146 ? 6.667   6.006   9.154   1.00 0.49  ? 146 GLU A H    2  
ATOM 5224  H HA   . GLU A 1 146 ? 8.486   5.959   11.454  1.00 0.53  ? 146 GLU A HA   2  
ATOM 5225  H HB2  . GLU A 1 146 ? 5.459   6.015   11.268  1.00 0.95  ? 146 GLU A HB2  2  
ATOM 5226  H HB3  . GLU A 1 146 ? 6.353   6.090   12.787  1.00 0.79  ? 146 GLU A HB3  2  
ATOM 5227  H HG2  . GLU A 1 146 ? 7.462   8.143   12.085  1.00 1.43  ? 146 GLU A HG2  2  
ATOM 5228  H HG3  . GLU A 1 146 ? 6.703   8.045   10.496  1.00 1.69  ? 146 GLU A HG3  2  
ATOM 5229  N N    . ARG A 1 147 ? 6.524   3.326   11.038  1.00 0.59  ? 147 ARG A N    2  
ATOM 5230  C CA   . ARG A 1 147 ? 6.451   1.890   11.480  1.00 0.62  ? 147 ARG A CA   2  
ATOM 5231  C C    . ARG A 1 147 ? 7.182   0.968   10.498  1.00 0.58  ? 147 ARG A C    2  
ATOM 5232  O O    . ARG A 1 147 ? 7.935   0.097   10.884  1.00 0.62  ? 147 ARG A O    2  
ATOM 5233  C CB   . ARG A 1 147 ? 4.979   1.475   11.568  1.00 0.63  ? 147 ARG A CB   2  
ATOM 5234  C CG   . ARG A 1 147 ? 4.253   2.331   12.621  1.00 0.73  ? 147 ARG A CG   2  
ATOM 5235  C CD   . ARG A 1 147 ? 4.520   1.787   14.032  1.00 1.11  ? 147 ARG A CD   2  
ATOM 5236  N NE   . ARG A 1 147 ? 3.674   2.522   15.014  1.00 1.75  ? 147 ARG A NE   2  
ATOM 5237  C CZ   . ARG A 1 147 ? 3.514   2.048   16.219  1.00 2.40  ? 147 ARG A CZ   2  
ATOM 5238  N NH1  . ARG A 1 147 ? 4.091   0.928   16.562  1.00 2.71  ? 147 ARG A NH1  2  
ATOM 5239  N NH2  . ARG A 1 147 ? 2.780   2.695   17.082  1.00 3.30  ? 147 ARG A NH2  2  
ATOM 5240  H H    . ARG A 1 147 ? 5.834   3.697   10.450  1.00 0.66  ? 147 ARG A H    2  
ATOM 5241  H HA   . ARG A 1 147 ? 6.897   1.803   12.459  1.00 0.69  ? 147 ARG A HA   2  
ATOM 5242  H HB2  . ARG A 1 147 ? 4.512   1.621   10.604  1.00 0.63  ? 147 ARG A HB2  2  
ATOM 5243  H HB3  . ARG A 1 147 ? 4.915   0.433   11.842  1.00 0.70  ? 147 ARG A HB3  2  
ATOM 5244  H HG2  . ARG A 1 147 ? 4.601   3.352   12.560  1.00 1.25  ? 147 ARG A HG2  2  
ATOM 5245  H HG3  . ARG A 1 147 ? 3.190   2.307   12.427  1.00 1.20  ? 147 ARG A HG3  2  
ATOM 5246  H HD2  . ARG A 1 147 ? 4.277   0.736   14.067  1.00 1.77  ? 147 ARG A HD2  2  
ATOM 5247  H HD3  . ARG A 1 147 ? 5.558   1.924   14.286  1.00 1.67  ? 147 ARG A HD3  2  
ATOM 5248  H HE   . ARG A 1 147 ? 3.241   3.362   14.756  1.00 2.24  ? 147 ARG A HE   2  
ATOM 5249  H HH11 . ARG A 1 147 ? 4.655   0.433   15.901  1.00 2.53  ? 147 ARG A HH11 2  
ATOM 5250  H HH12 . ARG A 1 147 ? 3.968   0.566   17.486  1.00 3.48  ? 147 ARG A HH12 2  
ATOM 5251  H HH21 . ARG A 1 147 ? 2.340   3.554   16.820  1.00 3.61  ? 147 ARG A HH21 2  
ATOM 5252  H HH22 . ARG A 1 147 ? 2.658   2.333   18.006  1.00 3.89  ? 147 ARG A HH22 2  
ATOM 5253  N N    . LEU A 1 148 ? 6.938   1.145   9.236   1.00 0.53  ? 148 LEU A N    2  
ATOM 5254  C CA   . LEU A 1 148 ? 7.577   0.284   8.200   1.00 0.57  ? 148 LEU A CA   2  
ATOM 5255  C C    . LEU A 1 148 ? 8.924   0.890   7.757   1.00 0.67  ? 148 LEU A C    2  
ATOM 5256  O O    . LEU A 1 148 ? 9.571   1.599   8.500   1.00 1.61  ? 148 LEU A O    2  
ATOM 5257  C CB   . LEU A 1 148 ? 6.588   0.180   7.004   1.00 0.59  ? 148 LEU A CB   2  
ATOM 5258  C CG   . LEU A 1 148 ? 6.344   -1.294  6.609   1.00 0.70  ? 148 LEU A CG   2  
ATOM 5259  C CD1  . LEU A 1 148 ? 5.536   -2.021  7.706   1.00 1.29  ? 148 LEU A CD1  2  
ATOM 5260  C CD2  . LEU A 1 148 ? 5.562   -1.336  5.293   1.00 1.34  ? 148 LEU A CD2  2  
ATOM 5261  H H    . LEU A 1 148 ? 6.310   1.845   8.958   1.00 0.52  ? 148 LEU A H    2  
ATOM 5262  H HA   . LEU A 1 148 ? 7.742   -0.718  8.564   1.00 0.58  ? 148 LEU A HA   2  
ATOM 5263  H HB2  . LEU A 1 148 ? 5.647   0.612   7.291   1.00 0.75  ? 148 LEU A HB2  2  
ATOM 5264  H HB3  . LEU A 1 148 ? 6.975   0.710   6.151   1.00 0.89  ? 148 LEU A HB3  2  
ATOM 5265  H HG   . LEU A 1 148 ? 7.295   -1.790  6.479   1.00 1.45  ? 148 LEU A HG   2  
ATOM 5266  H HD11 . LEU A 1 148 ? 6.203   -2.370  8.480   1.00 1.91  ? 148 LEU A HD11 2  
ATOM 5267  H HD12 . LEU A 1 148 ? 5.024   -2.870  7.277   1.00 1.90  ? 148 LEU A HD12 2  
ATOM 5268  H HD13 . LEU A 1 148 ? 4.810   -1.348  8.136   1.00 1.61  ? 148 LEU A HD13 2  
ATOM 5269  H HD21 . LEU A 1 148 ? 4.600   -0.866  5.432   1.00 1.92  ? 148 LEU A HD21 2  
ATOM 5270  H HD22 . LEU A 1 148 ? 5.420   -2.363  4.992   1.00 1.86  ? 148 LEU A HD22 2  
ATOM 5271  H HD23 . LEU A 1 148 ? 6.114   -0.810  4.528   1.00 1.88  ? 148 LEU A HD23 2  
ATOM 5272  N N    . LEU A 1 149 ? 9.352   0.588   6.560   1.00 0.67  ? 149 LEU A N    2  
ATOM 5273  C CA   . LEU A 1 149 ? 10.662  1.104   6.049   1.00 0.57  ? 149 LEU A CA   2  
ATOM 5274  C C    . LEU A 1 149 ? 11.802  0.270   6.647   1.00 0.56  ? 149 LEU A C    2  
ATOM 5275  O O    . LEU A 1 149 ? 12.527  -0.401  5.943   1.00 0.58  ? 149 LEU A O    2  
ATOM 5276  C CB   . LEU A 1 149 ? 10.857  2.597   6.412   1.00 0.54  ? 149 LEU A CB   2  
ATOM 5277  C CG   . LEU A 1 149 ? 11.709  3.298   5.330   1.00 0.59  ? 149 LEU A CG   2  
ATOM 5278  C CD1  . LEU A 1 149 ? 11.726  4.816   5.564   1.00 0.83  ? 149 LEU A CD1  2  
ATOM 5279  C CD2  . LEU A 1 149 ? 13.141  2.750   5.373   1.00 1.21  ? 149 LEU A CD2  2  
ATOM 5280  H H    . LEU A 1 149 ? 8.822   -0.003  5.992   1.00 1.41  ? 149 LEU A H    2  
ATOM 5281  H HA   . LEU A 1 149 ? 10.670  0.995   4.973   1.00 0.58  ? 149 LEU A HA   2  
ATOM 5282  H HB2  . LEU A 1 149 ? 9.898   3.080   6.474   1.00 0.54  ? 149 LEU A HB2  2  
ATOM 5283  H HB3  . LEU A 1 149 ? 11.356  2.681   7.367   1.00 0.61  ? 149 LEU A HB3  2  
ATOM 5284  H HG   . LEU A 1 149 ? 11.282  3.104   4.356   1.00 1.15  ? 149 LEU A HG   2  
ATOM 5285  H HD11 . LEU A 1 149 ? 11.754  5.022   6.624   1.00 1.37  ? 149 LEU A HD11 2  
ATOM 5286  H HD12 . LEU A 1 149 ? 10.837  5.255   5.135   1.00 1.41  ? 149 LEU A HD12 2  
ATOM 5287  H HD13 . LEU A 1 149 ? 12.596  5.250   5.090   1.00 1.52  ? 149 LEU A HD13 2  
ATOM 5288  H HD21 . LEU A 1 149 ? 13.491  2.733   6.395   1.00 1.67  ? 149 LEU A HD21 2  
ATOM 5289  H HD22 . LEU A 1 149 ? 13.786  3.385   4.783   1.00 1.82  ? 149 LEU A HD22 2  
ATOM 5290  H HD23 . LEU A 1 149 ? 13.157  1.748   4.969   1.00 1.75  ? 149 LEU A HD23 2  
ATOM 5291  N N    . GLY A 1 150 ? 11.963  0.311   7.947   1.00 0.56  ? 150 GLY A N    2  
ATOM 5292  C CA   . GLY A 1 150 ? 13.057  -0.475  8.590   1.00 0.58  ? 150 GLY A CA   2  
ATOM 5293  C C    . GLY A 1 150 ? 12.957  -1.943  8.171   1.00 0.62  ? 150 GLY A C    2  
ATOM 5294  O O    . GLY A 1 150 ? 13.940  -2.577  7.844   1.00 0.70  ? 150 GLY A O    2  
ATOM 5295  H H    . GLY A 1 150 ? 11.365  0.860   8.497   1.00 0.56  ? 150 GLY A H    2  
ATOM 5296  H HA2  . GLY A 1 150 ? 14.014  -0.081  8.284   1.00 0.57  ? 150 GLY A HA2  2  
ATOM 5297  H HA3  . GLY A 1 150 ? 12.974  -0.425  9.665   1.00 0.61  ? 150 GLY A HA3  2  
ATOM 5298  N N    . TRP A 1 151 ? 11.779  -2.499  8.213   1.00 0.63  ? 151 TRP A N    2  
ATOM 5299  C CA   . TRP A 1 151 ? 11.622  -3.934  7.850   1.00 0.69  ? 151 TRP A CA   2  
ATOM 5300  C C    . TRP A 1 151 ? 11.879  -4.123  6.353   1.00 0.70  ? 151 TRP A C    2  
ATOM 5301  O O    . TRP A 1 151 ? 12.310  -5.174  5.922   1.00 0.72  ? 151 TRP A O    2  
ATOM 5302  C CB   . TRP A 1 151 ? 10.198  -4.394  8.204   1.00 0.73  ? 151 TRP A CB   2  
ATOM 5303  C CG   . TRP A 1 151 ? 10.113  -4.694  9.670   1.00 1.25  ? 151 TRP A CG   2  
ATOM 5304  C CD1  . TRP A 1 151 ? 10.113  -5.936  10.208  1.00 2.17  ? 151 TRP A CD1  2  
ATOM 5305  C CD2  . TRP A 1 151 ? 10.020  -3.764  10.790  1.00 1.86  ? 151 TRP A CD2  2  
ATOM 5306  N NE1  . TRP A 1 151 ? 10.027  -5.828  11.584  1.00 2.65  ? 151 TRP A NE1  2  
ATOM 5307  C CE2  . TRP A 1 151 ? 9.968   -4.511  11.992  1.00 2.43  ? 151 TRP A CE2  2  
ATOM 5308  C CE3  . TRP A 1 151 ? 9.978   -2.361  10.881  1.00 2.68  ? 151 TRP A CE3  2  
ATOM 5309  C CZ2  . TRP A 1 151 ? 9.877   -3.888  13.237  1.00 3.17  ? 151 TRP A CZ2  2  
ATOM 5310  C CZ3  . TRP A 1 151 ? 9.886   -1.731  12.133  1.00 3.62  ? 151 TRP A CZ3  2  
ATOM 5311  C CH2  . TRP A 1 151 ? 9.836   -2.493  13.309  1.00 3.67  ? 151 TRP A CH2  2  
ATOM 5312  H H    . TRP A 1 151 ? 11.002  -1.979  8.502   1.00 0.64  ? 151 TRP A H    2  
ATOM 5313  H HA   . TRP A 1 151 ? 12.339  -4.521  8.406   1.00 0.73  ? 151 TRP A HA   2  
ATOM 5314  H HB2  . TRP A 1 151 ? 9.496   -3.612  7.957   1.00 0.96  ? 151 TRP A HB2  2  
ATOM 5315  H HB3  . TRP A 1 151 ? 9.954   -5.285  7.642   1.00 0.95  ? 151 TRP A HB3  2  
ATOM 5316  H HD1  . TRP A 1 151 ? 10.171  -6.860  9.653   1.00 2.79  ? 151 TRP A HD1  2  
ATOM 5317  H HE1  . TRP A 1 151 ? 10.010  -6.582  12.210  1.00 3.39  ? 151 TRP A HE1  2  
ATOM 5318  H HE3  . TRP A 1 151 ? 10.014  -1.763  9.983   1.00 2.90  ? 151 TRP A HE3  2  
ATOM 5319  H HZ2  . TRP A 1 151 ? 9.839   -4.480  14.140  1.00 3.65  ? 151 TRP A HZ2  2  
ATOM 5320  H HZ3  . TRP A 1 151 ? 9.854   -0.653  12.191  1.00 4.48  ? 151 TRP A HZ3  2  
ATOM 5321  H HH2  . TRP A 1 151 ? 9.765   -2.002  14.268  1.00 4.40  ? 151 TRP A HH2  2  
ATOM 5322  N N    . ILE A 1 152 ? 11.612  -3.128  5.552   1.00 0.73  ? 152 ILE A N    2  
ATOM 5323  C CA   . ILE A 1 152 ? 11.839  -3.284  4.089   1.00 0.76  ? 152 ILE A CA   2  
ATOM 5324  C C    . ILE A 1 152 ? 13.342  -3.363  3.800   1.00 0.79  ? 152 ILE A C    2  
ATOM 5325  O O    . ILE A 1 152 ? 13.812  -4.285  3.162   1.00 0.89  ? 152 ILE A O    2  
ATOM 5326  C CB   . ILE A 1 152 ? 11.230  -2.088  3.346   1.00 0.78  ? 152 ILE A CB   2  
ATOM 5327  C CG1  . ILE A 1 152 ? 9.756   -1.951  3.743   1.00 0.83  ? 152 ILE A CG1  2  
ATOM 5328  C CG2  . ILE A 1 152 ? 11.335  -2.311  1.832   1.00 0.92  ? 152 ILE A CG2  2  
ATOM 5329  C CD1  . ILE A 1 152 ? 9.117   -0.783  2.985   1.00 0.94  ? 152 ILE A CD1  2  
ATOM 5330  H H    . ILE A 1 152 ? 11.250  -2.288  5.903   1.00 0.74  ? 152 ILE A H    2  
ATOM 5331  H HA   . ILE A 1 152 ? 11.352  -4.191  3.762   1.00 0.76  ? 152 ILE A HA   2  
ATOM 5332  H HB   . ILE A 1 152 ? 11.764  -1.188  3.616   1.00 0.91  ? 152 ILE A HB   2  
ATOM 5333  H HG12 . ILE A 1 152 ? 9.233   -2.865  3.501   1.00 1.01  ? 152 ILE A HG12 2  
ATOM 5334  H HG13 . ILE A 1 152 ? 9.685   -1.768  4.805   1.00 1.14  ? 152 ILE A HG13 2  
ATOM 5335  H HG21 . ILE A 1 152 ? 12.362  -2.508  1.564   1.00 1.31  ? 152 ILE A HG21 2  
ATOM 5336  H HG22 . ILE A 1 152 ? 10.993  -1.429  1.312   1.00 1.41  ? 152 ILE A HG22 2  
ATOM 5337  H HG23 . ILE A 1 152 ? 10.723  -3.155  1.550   1.00 1.51  ? 152 ILE A HG23 2  
ATOM 5338  H HD11 . ILE A 1 152 ? 8.189   -0.508  3.465   1.00 1.40  ? 152 ILE A HD11 2  
ATOM 5339  H HD12 . ILE A 1 152 ? 8.921   -1.080  1.966   1.00 1.40  ? 152 ILE A HD12 2  
ATOM 5340  H HD13 . ILE A 1 152 ? 9.789   0.062   2.991   1.00 1.40  ? 152 ILE A HD13 2  
ATOM 5341  N N    . GLN A 1 153 ? 14.100  -2.397  4.250   1.00 0.77  ? 153 GLN A N    2  
ATOM 5342  C CA   . GLN A 1 153 ? 15.567  -2.418  3.981   1.00 0.80  ? 153 GLN A CA   2  
ATOM 5343  C C    . GLN A 1 153 ? 16.153  -3.778  4.372   1.00 0.81  ? 153 GLN A C    2  
ATOM 5344  O O    . GLN A 1 153 ? 17.015  -4.306  3.699   1.00 0.82  ? 153 GLN A O    2  
ATOM 5345  C CB   . GLN A 1 153 ? 16.269  -1.300  4.761   1.00 0.82  ? 153 GLN A CB   2  
ATOM 5346  C CG   . GLN A 1 153 ? 15.803  -1.301  6.216   1.00 1.09  ? 153 GLN A CG   2  
ATOM 5347  C CD   . GLN A 1 153 ? 16.584  -0.245  7.001   1.00 1.98  ? 153 GLN A CD   2  
ATOM 5348  O OE1  . GLN A 1 153 ? 17.601  -0.542  7.597   1.00 2.66  ? 153 GLN A OE1  2  
ATOM 5349  N NE2  . GLN A 1 153 ? 16.149  0.985   7.027   1.00 2.77  ? 153 GLN A NE2  2  
ATOM 5350  H H    . GLN A 1 153 ? 13.702  -1.654  4.750   1.00 0.77  ? 153 GLN A H    2  
ATOM 5351  H HA   . GLN A 1 153 ? 15.729  -2.263  2.923   1.00 0.82  ? 153 GLN A HA   2  
ATOM 5352  H HB2  . GLN A 1 153 ? 17.337  -1.454  4.725   1.00 1.30  ? 153 GLN A HB2  2  
ATOM 5353  H HB3  . GLN A 1 153 ? 16.030  -0.347  4.311   1.00 1.06  ? 153 GLN A HB3  2  
ATOM 5354  H HG2  . GLN A 1 153 ? 14.750  -1.071  6.255   1.00 1.37  ? 153 GLN A HG2  2  
ATOM 5355  H HG3  . GLN A 1 153 ? 15.978  -2.272  6.652   1.00 1.72  ? 153 GLN A HG3  2  
ATOM 5356  H HE21 . GLN A 1 153 ? 15.329  1.225   6.547   1.00 2.94  ? 153 GLN A HE21 2  
ATOM 5357  H HE22 . GLN A 1 153 ? 16.642  1.669   7.527   1.00 3.53  ? 153 GLN A HE22 2  
ATOM 5358  N N    . ASP A 1 154 ? 15.710  -4.346  5.465   1.00 0.83  ? 154 ASP A N    2  
ATOM 5359  C CA   . ASP A 1 154 ? 16.269  -5.663  5.892   1.00 0.86  ? 154 ASP A CA   2  
ATOM 5360  C C    . ASP A 1 154 ? 16.226  -6.629  4.705   1.00 0.85  ? 154 ASP A C    2  
ATOM 5361  O O    . ASP A 1 154 ? 17.206  -7.260  4.362   1.00 0.94  ? 154 ASP A O    2  
ATOM 5362  C CB   . ASP A 1 154 ? 15.439  -6.221  7.052   1.00 0.90  ? 154 ASP A CB   2  
ATOM 5363  C CG   . ASP A 1 154 ? 16.053  -7.534  7.540   1.00 1.28  ? 154 ASP A CG   2  
ATOM 5364  O OD1  . ASP A 1 154 ? 17.243  -7.716  7.347   1.00 1.84  ? 154 ASP A OD1  2  
ATOM 5365  O OD2  . ASP A 1 154 ? 15.322  -8.334  8.100   1.00 1.99  ? 154 ASP A OD2  2  
ATOM 5366  H H    . ASP A 1 154 ? 15.027  -3.901  6.010   1.00 0.82  ? 154 ASP A H    2  
ATOM 5367  H HA   . ASP A 1 154 ? 17.289  -5.505  6.211   1.00 0.87  ? 154 ASP A HA   2  
ATOM 5368  H HB2  . ASP A 1 154 ? 15.426  -5.505  7.861   1.00 1.24  ? 154 ASP A HB2  2  
ATOM 5369  H HB3  . ASP A 1 154 ? 14.428  -6.402  6.716   1.00 1.20  ? 154 ASP A HB3  2  
ATOM 5370  N N    . GLN A 1 155 ? 15.091  -6.731  4.071   1.00 0.79  ? 155 GLN A N    2  
ATOM 5371  C CA   . GLN A 1 155 ? 14.963  -7.633  2.895   1.00 0.79  ? 155 GLN A CA   2  
ATOM 5372  C C    . GLN A 1 155 ? 16.070  -7.311  1.890   1.00 0.72  ? 155 GLN A C    2  
ATOM 5373  O O    . GLN A 1 155 ? 16.675  -8.188  1.306   1.00 1.03  ? 155 GLN A O    2  
ATOM 5374  C CB   . GLN A 1 155 ? 13.601  -7.415  2.233   1.00 0.90  ? 155 GLN A CB   2  
ATOM 5375  C CG   . GLN A 1 155 ? 12.491  -7.632  3.263   1.00 1.37  ? 155 GLN A CG   2  
ATOM 5376  C CD   . GLN A 1 155 ? 12.501  -9.090  3.729   1.00 2.01  ? 155 GLN A CD   2  
ATOM 5377  O OE1  . GLN A 1 155 ? 12.754  -9.988  2.950   1.00 2.72  ? 155 GLN A OE1  2  
ATOM 5378  N NE2  . GLN A 1 155 ? 12.236  -9.365  4.977   1.00 2.54  ? 155 GLN A NE2  2  
ATOM 5379  H H    . GLN A 1 155 ? 14.327  -6.199  4.376   1.00 0.78  ? 155 GLN A H    2  
ATOM 5380  H HA   . GLN A 1 155 ? 15.047  -8.667  3.200   1.00 0.92  ? 155 GLN A HA   2  
ATOM 5381  H HB2  . GLN A 1 155 ? 13.546  -6.407  1.849   1.00 1.39  ? 155 GLN A HB2  2  
ATOM 5382  H HB3  . GLN A 1 155 ? 13.479  -8.117  1.422   1.00 1.28  ? 155 GLN A HB3  2  
ATOM 5383  H HG2  . GLN A 1 155 ? 12.653  -6.982  4.110   1.00 1.80  ? 155 GLN A HG2  2  
ATOM 5384  H HG3  . GLN A 1 155 ? 11.535  -7.408  2.814   1.00 1.99  ? 155 GLN A HG3  2  
ATOM 5385  H HE21 . GLN A 1 155 ? 12.032  -8.641  5.606   1.00 2.69  ? 155 GLN A HE21 2  
ATOM 5386  H HE22 . GLN A 1 155 ? 12.240  -10.295 5.286   1.00 3.17  ? 155 GLN A HE22 2  
ATOM 5387  N N    . GLY A 1 156 ? 16.338  -6.045  1.691   1.00 0.63  ? 156 GLY A N    2  
ATOM 5388  C CA   . GLY A 1 156 ? 17.404  -5.627  0.729   1.00 0.72  ? 156 GLY A CA   2  
ATOM 5389  C C    . GLY A 1 156 ? 16.909  -4.420  -0.069  1.00 0.87  ? 156 GLY A C    2  
ATOM 5390  O O    . GLY A 1 156 ? 17.614  -3.446  -0.246  1.00 1.38  ? 156 GLY A O    2  
ATOM 5391  H H    . GLY A 1 156 ? 15.834  -5.361  2.180   1.00 0.79  ? 156 GLY A H    2  
ATOM 5392  H HA2  . GLY A 1 156 ? 18.292  -5.347  1.279   1.00 0.89  ? 156 GLY A HA2  2  
ATOM 5393  H HA3  . GLY A 1 156 ? 17.632  -6.435  0.049   1.00 0.72  ? 156 GLY A HA3  2  
ATOM 5394  N N    . GLY A 1 157 ? 15.699  -4.478  -0.554  1.00 0.81  ? 157 GLY A N    2  
ATOM 5395  C CA   . GLY A 1 157 ? 15.151  -3.337  -1.345  1.00 1.10  ? 157 GLY A CA   2  
ATOM 5396  C C    . GLY A 1 157 ? 13.833  -3.765  -1.992  1.00 0.84  ? 157 GLY A C    2  
ATOM 5397  O O    . GLY A 1 157 ? 13.308  -4.825  -1.717  1.00 0.88  ? 157 GLY A O    2  
ATOM 5398  H H    . GLY A 1 157 ? 15.150  -5.276  -0.402  1.00 0.96  ? 157 GLY A H    2  
ATOM 5399  H HA2  . GLY A 1 157 ? 14.981  -2.494  -0.691  1.00 1.27  ? 157 GLY A HA2  2  
ATOM 5400  H HA3  . GLY A 1 157 ? 15.855  -3.063  -2.116  1.00 1.46  ? 157 GLY A HA3  2  
ATOM 5401  N N    . TRP A 1 158 ? 13.290  -2.939  -2.847  1.00 0.67  ? 158 TRP A N    2  
ATOM 5402  C CA   . TRP A 1 158 ? 12.002  -3.288  -3.511  1.00 0.50  ? 158 TRP A CA   2  
ATOM 5403  C C    . TRP A 1 158 ? 12.179  -4.559  -4.343  1.00 0.51  ? 158 TRP A C    2  
ATOM 5404  O O    . TRP A 1 158 ? 11.214  -5.133  -4.816  1.00 0.53  ? 158 TRP A O    2  
ATOM 5405  C CB   . TRP A 1 158 ? 11.559  -2.139  -4.419  1.00 0.51  ? 158 TRP A CB   2  
ATOM 5406  C CG   . TRP A 1 158 ? 11.087  -0.988  -3.589  1.00 0.46  ? 158 TRP A CG   2  
ATOM 5407  C CD1  . TRP A 1 158 ? 11.823  0.108   -3.292  1.00 0.59  ? 158 TRP A CD1  2  
ATOM 5408  C CD2  . TRP A 1 158 ? 9.791   -0.796  -2.955  1.00 0.46  ? 158 TRP A CD2  2  
ATOM 5409  N NE1  . TRP A 1 158 ? 11.059  0.960   -2.515  1.00 0.55  ? 158 TRP A NE1  2  
ATOM 5410  C CE2  . TRP A 1 158 ? 9.800   0.447   -2.279  1.00 0.47  ? 158 TRP A CE2  2  
ATOM 5411  C CE3  . TRP A 1 158 ? 8.620   -1.572  -2.900  1.00 0.65  ? 158 TRP A CE3  2  
ATOM 5412  C CZ2  . TRP A 1 158 ? 8.687   0.905   -1.575  1.00 0.58  ? 158 TRP A CZ2  2  
ATOM 5413  C CZ3  . TRP A 1 158 ? 7.497   -1.115  -2.191  1.00 0.84  ? 158 TRP A CZ3  2  
ATOM 5414  C CH2  . TRP A 1 158 ? 7.531   0.122   -1.531  1.00 0.78  ? 158 TRP A CH2  2  
ATOM 5415  H H    . TRP A 1 158 ? 13.730  -2.088  -3.055  1.00 0.72  ? 158 TRP A H    2  
ATOM 5416  H HA   . TRP A 1 158 ? 11.246  -3.483  -2.765  1.00 0.48  ? 158 TRP A HA   2  
ATOM 5417  H HB2  . TRP A 1 158 ? 12.392  -1.822  -5.029  1.00 0.68  ? 158 TRP A HB2  2  
ATOM 5418  H HB3  . TRP A 1 158 ? 10.755  -2.475  -5.056  1.00 0.51  ? 158 TRP A HB3  2  
ATOM 5419  H HD1  . TRP A 1 158 ? 12.839  0.289   -3.609  1.00 0.78  ? 158 TRP A HD1  2  
ATOM 5420  H HE1  . TRP A 1 158 ? 11.356  1.825   -2.165  1.00 0.66  ? 158 TRP A HE1  2  
ATOM 5421  H HE3  . TRP A 1 158 ? 8.584   -2.526  -3.405  1.00 0.72  ? 158 TRP A HE3  2  
ATOM 5422  H HZ2  . TRP A 1 158 ? 8.718   1.858   -1.068  1.00 0.60  ? 158 TRP A HZ2  2  
ATOM 5423  H HZ3  . TRP A 1 158 ? 6.602   -1.718  -2.155  1.00 1.06  ? 158 TRP A HZ3  2  
ATOM 5424  H HH2  . TRP A 1 158 ? 6.666   0.469   -0.990  1.00 0.95  ? 158 TRP A HH2  2  
ATOM 5425  N N    . ASP A 1 159 ? 13.384  -5.017  -4.534  1.00 0.50  ? 159 ASP A N    2  
ATOM 5426  C CA   . ASP A 1 159 ? 13.567  -6.254  -5.342  1.00 0.51  ? 159 ASP A CA   2  
ATOM 5427  C C    . ASP A 1 159 ? 12.968  -7.434  -4.576  1.00 0.51  ? 159 ASP A C    2  
ATOM 5428  O O    . ASP A 1 159 ? 12.431  -8.356  -5.157  1.00 0.51  ? 159 ASP A O    2  
ATOM 5429  C CB   . ASP A 1 159 ? 15.058  -6.495  -5.591  1.00 0.54  ? 159 ASP A CB   2  
ATOM 5430  C CG   . ASP A 1 159 ? 15.657  -5.288  -6.316  1.00 1.66  ? 159 ASP A CG   2  
ATOM 5431  O OD1  . ASP A 1 159 ? 16.058  -4.355  -5.640  1.00 2.37  ? 159 ASP A OD1  2  
ATOM 5432  O OD2  . ASP A 1 159 ? 15.704  -5.318  -7.535  1.00 2.46  ? 159 ASP A OD2  2  
ATOM 5433  H H    . ASP A 1 159 ? 14.163  -4.561  -4.152  1.00 0.50  ? 159 ASP A H    2  
ATOM 5434  H HA   . ASP A 1 159 ? 13.051  -6.128  -6.284  1.00 0.51  ? 159 ASP A HA   2  
ATOM 5435  H HB2  . ASP A 1 159 ? 15.562  -6.634  -4.645  1.00 0.94  ? 159 ASP A HB2  2  
ATOM 5436  H HB3  . ASP A 1 159 ? 15.184  -7.377  -6.200  1.00 1.23  ? 159 ASP A HB3  2  
ATOM 5437  N N    . GLY A 1 160 ? 13.039  -7.403  -3.271  1.00 0.52  ? 160 GLY A N    2  
ATOM 5438  C CA   . GLY A 1 160 ? 12.455  -8.513  -2.466  1.00 0.54  ? 160 GLY A CA   2  
ATOM 5439  C C    . GLY A 1 160 ? 10.943  -8.530  -2.690  1.00 0.53  ? 160 GLY A C    2  
ATOM 5440  O O    . GLY A 1 160 ? 10.311  -9.567  -2.676  1.00 0.54  ? 160 GLY A O    2  
ATOM 5441  H H    . GLY A 1 160 ? 13.465  -6.642  -2.822  1.00 0.53  ? 160 GLY A H    2  
ATOM 5442  H HA2  . GLY A 1 160 ? 12.884  -9.454  -2.781  1.00 0.55  ? 160 GLY A HA2  2  
ATOM 5443  H HA3  . GLY A 1 160 ? 12.661  -8.350  -1.420  1.00 0.57  ? 160 GLY A HA3  2  
ATOM 5444  N N    . LEU A 1 161 ? 10.366  -7.382  -2.914  1.00 0.54  ? 161 LEU A N    2  
ATOM 5445  C CA   . LEU A 1 161 ? 8.900   -7.309  -3.160  1.00 0.56  ? 161 LEU A CA   2  
ATOM 5446  C C    . LEU A 1 161 ? 8.553   -8.178  -4.372  1.00 0.56  ? 161 LEU A C    2  
ATOM 5447  O O    . LEU A 1 161 ? 7.731   -9.070  -4.308  1.00 0.62  ? 161 LEU A O    2  
ATOM 5448  C CB   . LEU A 1 161 ? 8.527   -5.840  -3.457  1.00 0.58  ? 161 LEU A CB   2  
ATOM 5449  C CG   . LEU A 1 161 ? 7.065   -5.555  -3.043  1.00 0.74  ? 161 LEU A CG   2  
ATOM 5450  C CD1  . LEU A 1 161 ? 6.130   -6.569  -3.716  1.00 1.63  ? 161 LEU A CD1  2  
ATOM 5451  C CD2  . LEU A 1 161 ? 6.905   -5.635  -1.505  1.00 1.56  ? 161 LEU A CD2  2  
ATOM 5452  H H    . LEU A 1 161 ? 10.905  -6.564  -2.935  1.00 0.54  ? 161 LEU A H    2  
ATOM 5453  H HA   . LEU A 1 161 ? 8.356   -7.620  -2.282  1.00 0.58  ? 161 LEU A HA   2  
ATOM 5454  H HB2  . LEU A 1 161 ? 9.187   -5.189  -2.903  1.00 0.75  ? 161 LEU A HB2  2  
ATOM 5455  H HB3  . LEU A 1 161 ? 8.642   -5.638  -4.513  1.00 0.77  ? 161 LEU A HB3  2  
ATOM 5456  H HG   . LEU A 1 161 ? 6.798   -4.562  -3.375  1.00 1.32  ? 161 LEU A HG   2  
ATOM 5457  H HD11 . LEU A 1 161 ? 6.392   -6.664  -4.759  1.00 2.13  ? 161 LEU A HD11 2  
ATOM 5458  H HD12 . LEU A 1 161 ? 5.109   -6.226  -3.631  1.00 2.24  ? 161 LEU A HD12 2  
ATOM 5459  H HD13 . LEU A 1 161 ? 6.227   -7.529  -3.231  1.00 2.11  ? 161 LEU A HD13 2  
ATOM 5460  H HD21 . LEU A 1 161 ? 6.177   -4.903  -1.187  1.00 2.07  ? 161 LEU A HD21 2  
ATOM 5461  H HD22 . LEU A 1 161 ? 7.848   -5.427  -1.021  1.00 2.01  ? 161 LEU A HD22 2  
ATOM 5462  H HD23 . LEU A 1 161 ? 6.566   -6.621  -1.215  1.00 2.20  ? 161 LEU A HD23 2  
ATOM 5463  N N    . LEU A 1 162 ? 9.176   -7.890  -5.486  1.00 0.53  ? 162 LEU A N    2  
ATOM 5464  C CA   . LEU A 1 162 ? 8.904   -8.654  -6.736  1.00 0.56  ? 162 LEU A CA   2  
ATOM 5465  C C    . LEU A 1 162 ? 9.476   -10.070 -6.609  1.00 0.55  ? 162 LEU A C    2  
ATOM 5466  O O    . LEU A 1 162 ? 8.939   -11.010 -7.161  1.00 0.57  ? 162 LEU A O    2  
ATOM 5467  C CB   . LEU A 1 162 ? 9.559   -7.907  -7.912  1.00 0.61  ? 162 LEU A CB   2  
ATOM 5468  C CG   . LEU A 1 162 ? 9.559   -8.760  -9.187  1.00 0.80  ? 162 LEU A CG   2  
ATOM 5469  C CD1  . LEU A 1 162 ? 8.123   -9.127  -9.571  1.00 1.56  ? 162 LEU A CD1  2  
ATOM 5470  C CD2  . LEU A 1 162 ? 10.200  -7.955  -10.323 1.00 1.33  ? 162 LEU A CD2  2  
ATOM 5471  H H    . LEU A 1 162 ? 9.826   -7.155  -5.506  1.00 0.52  ? 162 LEU A H    2  
ATOM 5472  H HA   . LEU A 1 162 ? 7.839   -8.727  -6.888  1.00 0.58  ? 162 LEU A HA   2  
ATOM 5473  H HB2  . LEU A 1 162 ? 9.015   -6.993  -8.098  1.00 1.09  ? 162 LEU A HB2  2  
ATOM 5474  H HB3  . LEU A 1 162 ? 10.579  -7.664  -7.650  1.00 1.00  ? 162 LEU A HB3  2  
ATOM 5475  H HG   . LEU A 1 162 ? 10.133  -9.659  -9.024  1.00 1.65  ? 162 LEU A HG   2  
ATOM 5476  H HD11 . LEU A 1 162 ? 7.492   -8.254  -9.484  1.00 2.03  ? 162 LEU A HD11 2  
ATOM 5477  H HD12 . LEU A 1 162 ? 7.759   -9.901  -8.913  1.00 2.11  ? 162 LEU A HD12 2  
ATOM 5478  H HD13 . LEU A 1 162 ? 8.102   -9.484  -10.591 1.00 2.11  ? 162 LEU A HD13 2  
ATOM 5479  H HD21 . LEU A 1 162 ? 10.201  -8.546  -11.227 1.00 1.91  ? 162 LEU A HD21 2  
ATOM 5480  H HD22 . LEU A 1 162 ? 11.216  -7.704  -10.056 1.00 1.79  ? 162 LEU A HD22 2  
ATOM 5481  H HD23 . LEU A 1 162 ? 9.636   -7.048  -10.485 1.00 1.84  ? 162 LEU A HD23 2  
ATOM 5482  N N    . SER A 1 163 ? 10.555  -10.238 -5.898  1.00 0.54  ? 163 SER A N    2  
ATOM 5483  C CA   . SER A 1 163 ? 11.137  -11.603 -5.760  1.00 0.56  ? 163 SER A CA   2  
ATOM 5484  C C    . SER A 1 163 ? 10.121  -12.521 -5.074  1.00 0.53  ? 163 SER A C    2  
ATOM 5485  O O    . SER A 1 163 ? 10.159  -13.726 -5.220  1.00 0.60  ? 163 SER A O    2  
ATOM 5486  C CB   . SER A 1 163 ? 12.416  -11.535 -4.924  1.00 0.63  ? 163 SER A CB   2  
ATOM 5487  O OG   . SER A 1 163 ? 13.147  -12.743 -5.085  1.00 1.32  ? 163 SER A OG   2  
ATOM 5488  H H    . SER A 1 163 ? 10.984  -9.472  -5.461  1.00 0.53  ? 163 SER A H    2  
ATOM 5489  H HA   . SER A 1 163 ? 11.369  -11.985 -6.744  1.00 0.62  ? 163 SER A HA   2  
ATOM 5490  H HB2  . SER A 1 163 ? 13.021  -10.708 -5.255  1.00 1.17  ? 163 SER A HB2  2  
ATOM 5491  H HB3  . SER A 1 163 ? 12.157  -11.394 -3.883  1.00 1.37  ? 163 SER A HB3  2  
ATOM 5492  H HG   . SER A 1 163 ? 12.841  -13.170 -5.889  1.00 1.90  ? 163 SER A HG   2  
ATOM 5493  N N    . TYR A 1 164 ? 9.214   -11.955 -4.322  1.00 0.59  ? 164 TYR A N    2  
ATOM 5494  C CA   . TYR A 1 164 ? 8.191   -12.783 -3.617  1.00 0.64  ? 164 TYR A CA   2  
ATOM 5495  C C    . TYR A 1 164 ? 7.014   -13.056 -4.557  1.00 0.63  ? 164 TYR A C    2  
ATOM 5496  O O    . TYR A 1 164 ? 6.418   -14.114 -4.531  1.00 0.68  ? 164 TYR A O    2  
ATOM 5497  C CB   . TYR A 1 164 ? 7.697   -12.027 -2.381  1.00 0.69  ? 164 TYR A CB   2  
ATOM 5498  C CG   . TYR A 1 164 ? 6.593   -12.813 -1.708  1.00 0.72  ? 164 TYR A CG   2  
ATOM 5499  C CD1  . TYR A 1 164 ? 6.874   -14.059 -1.134  1.00 1.50  ? 164 TYR A CD1  2  
ATOM 5500  C CD2  . TYR A 1 164 ? 5.289   -12.297 -1.653  1.00 1.34  ? 164 TYR A CD2  2  
ATOM 5501  C CE1  . TYR A 1 164 ? 5.856   -14.789 -0.508  1.00 1.57  ? 164 TYR A CE1  2  
ATOM 5502  C CE2  . TYR A 1 164 ? 4.272   -13.028 -1.027  1.00 1.35  ? 164 TYR A CE2  2  
ATOM 5503  C CZ   . TYR A 1 164 ? 4.556   -14.274 -0.454  1.00 0.87  ? 164 TYR A CZ   2  
ATOM 5504  O OH   . TYR A 1 164 ? 3.553   -14.994 0.163   1.00 0.97  ? 164 TYR A OH   2  
ATOM 5505  H H    . TYR A 1 164 ? 9.206   -10.980 -4.221  1.00 0.69  ? 164 TYR A H    2  
ATOM 5506  H HA   . TYR A 1 164 ? 8.632   -13.722 -3.312  1.00 0.71  ? 164 TYR A HA   2  
ATOM 5507  H HB2  . TYR A 1 164 ? 8.518   -11.899 -1.690  1.00 0.77  ? 164 TYR A HB2  2  
ATOM 5508  H HB3  . TYR A 1 164 ? 7.324   -11.058 -2.678  1.00 0.69  ? 164 TYR A HB3  2  
ATOM 5509  H HD1  . TYR A 1 164 ? 7.877   -14.458 -1.175  1.00 2.34  ? 164 TYR A HD1  2  
ATOM 5510  H HD2  . TYR A 1 164 ? 5.069   -11.337 -2.094  1.00 2.19  ? 164 TYR A HD2  2  
ATOM 5511  H HE1  . TYR A 1 164 ? 6.075   -15.750 -0.066  1.00 2.44  ? 164 TYR A HE1  2  
ATOM 5512  H HE2  . TYR A 1 164 ? 3.269   -12.631 -0.985  1.00 2.17  ? 164 TYR A HE2  2  
ATOM 5513  H HH   . TYR A 1 164 ? 3.869   -15.260 1.029   1.00 1.32  ? 164 TYR A HH   2  
ATOM 5514  N N    . PHE A 1 165 ? 6.668   -12.104 -5.380  1.00 0.64  ? 165 PHE A N    2  
ATOM 5515  C CA   . PHE A 1 165 ? 5.523   -12.302 -6.315  1.00 0.72  ? 165 PHE A CA   2  
ATOM 5516  C C    . PHE A 1 165 ? 5.871   -13.382 -7.351  1.00 0.82  ? 165 PHE A C    2  
ATOM 5517  O O    . PHE A 1 165 ? 5.200   -13.530 -8.352  1.00 1.56  ? 165 PHE A O    2  
ATOM 5518  C CB   . PHE A 1 165 ? 5.211   -10.967 -7.026  1.00 0.74  ? 165 PHE A CB   2  
ATOM 5519  C CG   . PHE A 1 165 ? 4.098   -10.239 -6.301  1.00 0.84  ? 165 PHE A CG   2  
ATOM 5520  C CD1  . PHE A 1 165 ? 4.373   -9.537  -5.121  1.00 1.65  ? 165 PHE A CD1  2  
ATOM 5521  C CD2  . PHE A 1 165 ? 2.793   -10.273 -6.807  1.00 1.42  ? 165 PHE A CD2  2  
ATOM 5522  C CE1  . PHE A 1 165 ? 3.343   -8.869  -4.449  1.00 1.96  ? 165 PHE A CE1  2  
ATOM 5523  C CE2  . PHE A 1 165 ? 1.763   -9.606  -6.135  1.00 1.71  ? 165 PHE A CE2  2  
ATOM 5524  C CZ   . PHE A 1 165 ? 2.038   -8.903  -4.956  1.00 1.66  ? 165 PHE A CZ   2  
ATOM 5525  H H    . PHE A 1 165 ? 7.156   -11.254 -5.375  1.00 0.65  ? 165 PHE A H    2  
ATOM 5526  H HA   . PHE A 1 165 ? 4.659   -12.628 -5.752  1.00 0.80  ? 165 PHE A HA   2  
ATOM 5527  H HB2  . PHE A 1 165 ? 6.097   -10.350 -7.026  1.00 0.84  ? 165 PHE A HB2  2  
ATOM 5528  H HB3  . PHE A 1 165 ? 4.907   -11.152 -8.048  1.00 0.97  ? 165 PHE A HB3  2  
ATOM 5529  H HD1  . PHE A 1 165 ? 5.379   -9.511  -4.731  1.00 2.37  ? 165 PHE A HD1  2  
ATOM 5530  H HD2  . PHE A 1 165 ? 2.581   -10.815 -7.717  1.00 2.11  ? 165 PHE A HD2  2  
ATOM 5531  H HE1  . PHE A 1 165 ? 3.554   -8.327  -3.539  1.00 2.78  ? 165 PHE A HE1  2  
ATOM 5532  H HE2  . PHE A 1 165 ? 0.757   -9.633  -6.526  1.00 2.44  ? 165 PHE A HE2  2  
ATOM 5533  H HZ   . PHE A 1 165 ? 1.243   -8.388  -4.437  1.00 2.03  ? 165 PHE A HZ   2  
ATOM 5534  N N    . GLY A 1 166 ? 6.911   -14.135 -7.119  1.00 0.94  ? 166 GLY A N    2  
ATOM 5535  C CA   . GLY A 1 166 ? 7.290   -15.197 -8.091  1.00 1.01  ? 166 GLY A CA   2  
ATOM 5536  C C    . GLY A 1 166 ? 6.337   -16.385 -7.945  1.00 1.23  ? 166 GLY A C    2  
ATOM 5537  O O    . GLY A 1 166 ? 6.502   -17.407 -8.583  1.00 1.85  ? 166 GLY A O    2  
ATOM 5538  H H    . GLY A 1 166 ? 7.442   -14.003 -6.308  1.00 1.51  ? 166 GLY A H    2  
ATOM 5539  H HA2  . GLY A 1 166 ? 7.229   -14.804 -9.096  1.00 1.22  ? 166 GLY A HA2  2  
ATOM 5540  H HA3  . GLY A 1 166 ? 8.300   -15.524 -7.892  1.00 1.28  ? 166 GLY A HA3  2  
ATOM 5541  N N    . THR A 1 167 ? 5.341   -16.262 -7.108  1.00 1.51  ? 167 THR A N    2  
ATOM 5542  C CA   . THR A 1 167 ? 4.383   -17.387 -6.922  1.00 2.01  ? 167 THR A CA   2  
ATOM 5543  C C    . THR A 1 167 ? 3.490   -17.508 -8.180  1.00 1.65  ? 167 THR A C    2  
ATOM 5544  O O    . THR A 1 167 ? 2.821   -16.552 -8.522  1.00 2.06  ? 167 THR A O    2  
ATOM 5545  C CB   . THR A 1 167 ? 3.497   -17.099 -5.709  1.00 3.10  ? 167 THR A CB   2  
ATOM 5546  O OG1  . THR A 1 167 ? 4.317   -16.765 -4.598  1.00 3.65  ? 167 THR A OG1  2  
ATOM 5547  C CG2  . THR A 1 167 ? 2.666   -18.340 -5.377  1.00 3.92  ? 167 THR A CG2  2  
ATOM 5548  H H    . THR A 1 167 ? 5.226   -15.432 -6.602  1.00 1.82  ? 167 THR A H    2  
ATOM 5549  H HA   . THR A 1 167 ? 4.938   -18.284 -6.742  1.00 2.49  ? 167 THR A HA   2  
ATOM 5550  H HB   . THR A 1 167 ? 2.835   -16.276 -5.932  1.00 3.48  ? 167 THR A HB   2  
ATOM 5551  H HG1  . THR A 1 167 ? 4.649   -17.582 -4.219  1.00 3.86  ? 167 THR A HG1  2  
ATOM 5552  H HG21 . THR A 1 167 ? 2.053   -18.602 -6.227  1.00 4.12  ? 167 THR A HG21 2  
ATOM 5553  H HG22 . THR A 1 167 ? 2.033   -18.132 -4.527  1.00 4.41  ? 167 THR A HG22 2  
ATOM 5554  H HG23 . THR A 1 167 ? 3.325   -19.163 -5.142  1.00 4.29  ? 167 THR A HG23 2  
ATOM 5555  N N    . PRO A 1 168 ? 3.483   -18.652 -8.850  1.00 1.84  ? 168 PRO A N    2  
ATOM 5556  C CA   . PRO A 1 168 ? 2.648   -18.816 -10.058 1.00 2.36  ? 168 PRO A CA   2  
ATOM 5557  C C    . PRO A 1 168 ? 1.161   -18.661 -9.703  1.00 1.79  ? 168 PRO A C    2  
ATOM 5558  O O    . PRO A 1 168 ? 0.441   -17.903 -10.322 1.00 2.00  ? 168 PRO A O    2  
ATOM 5559  C CB   . PRO A 1 168 ? 2.952   -20.245 -10.568 1.00 3.35  ? 168 PRO A CB   2  
ATOM 5560  C CG   . PRO A 1 168 ? 3.938   -20.901 -9.561  1.00 3.48  ? 168 PRO A CG   2  
ATOM 5561  C CD   . PRO A 1 168 ? 4.277   -19.850 -8.486  1.00 2.53  ? 168 PRO A CD   2  
ATOM 5562  H HA   . PRO A 1 168 ? 2.929   -18.089 -10.805 1.00 2.91  ? 168 PRO A HA   2  
ATOM 5563  H HB2  . PRO A 1 168 ? 2.039   -20.827 -10.626 1.00 3.53  ? 168 PRO A HB2  2  
ATOM 5564  H HB3  . PRO A 1 168 ? 3.412   -20.198 -11.546 1.00 4.09  ? 168 PRO A HB3  2  
ATOM 5565  H HG2  . PRO A 1 168 ? 3.474   -21.766 -9.101  1.00 3.88  ? 168 PRO A HG2  2  
ATOM 5566  H HG3  . PRO A 1 168 ? 4.843   -21.206 -10.071 1.00 4.15  ? 168 PRO A HG3  2  
ATOM 5567  H HD2  . PRO A 1 168 ? 3.991   -20.210 -7.505  1.00 2.65  ? 168 PRO A HD2  2  
ATOM 5568  H HD3  . PRO A 1 168 ? 5.333   -19.616 -8.511  1.00 2.71  ? 168 PRO A HD3  2  
ATOM 5569  N N    . THR A 1 169 ? 0.697   -19.386 -8.722  1.00 1.73  ? 169 THR A N    2  
ATOM 5570  C CA   . THR A 1 169 ? -0.741  -19.294 -8.340  1.00 1.33  ? 169 THR A CA   2  
ATOM 5571  C C    . THR A 1 169 ? -1.076  -17.868 -7.901  1.00 1.05  ? 169 THR A C    2  
ATOM 5572  O O    . THR A 1 169 ? -0.579  -17.380 -6.905  1.00 1.06  ? 169 THR A O    2  
ATOM 5573  C CB   . THR A 1 169 ? -1.025  -20.260 -7.188  1.00 1.53  ? 169 THR A CB   2  
ATOM 5574  O OG1  . THR A 1 169 ? -0.622  -21.570 -7.560  1.00 1.94  ? 169 THR A OG1  2  
ATOM 5575  C CG2  . THR A 1 169 ? -2.522  -20.254 -6.873  1.00 2.40  ? 169 THR A CG2  2  
ATOM 5576  H H    . THR A 1 169 ? 1.293   -20.000 -8.243  1.00 2.32  ? 169 THR A H    2  
ATOM 5577  H HA   . THR A 1 169 ? -1.354  -19.561 -9.188  1.00 1.48  ? 169 THR A HA   2  
ATOM 5578  H HB   . THR A 1 169 ? -0.476  -19.948 -6.312  1.00 1.70  ? 169 THR A HB   2  
ATOM 5579  H HG1  . THR A 1 169 ? -1.262  -21.910 -8.190  1.00 2.25  ? 169 THR A HG1  2  
ATOM 5580  H HG21 . THR A 1 169 ? -2.800  -19.293 -6.466  1.00 2.77  ? 169 THR A HG21 2  
ATOM 5581  H HG22 . THR A 1 169 ? -2.741  -21.027 -6.152  1.00 2.87  ? 169 THR A HG22 2  
ATOM 5582  H HG23 . THR A 1 169 ? -3.081  -20.436 -7.779  1.00 2.91  ? 169 THR A HG23 2  
ATOM 5583  N N    . TRP A 1 170 ? -1.927  -17.197 -8.634  1.00 1.04  ? 170 TRP A N    2  
ATOM 5584  C CA   . TRP A 1 170 ? -2.310  -15.803 -8.262  1.00 1.01  ? 170 TRP A CA   2  
ATOM 5585  C C    . TRP A 1 170 ? -3.566  -15.843 -7.387  1.00 0.92  ? 170 TRP A C    2  
ATOM 5586  O O    . TRP A 1 170 ? -3.994  -14.840 -6.849  1.00 0.95  ? 170 TRP A O    2  
ATOM 5587  C CB   . TRP A 1 170 ? -2.603  -14.999 -9.531  1.00 1.32  ? 170 TRP A CB   2  
ATOM 5588  C CG   . TRP A 1 170 ? -1.428  -15.075 -10.453 1.00 1.70  ? 170 TRP A CG   2  
ATOM 5589  C CD1  . TRP A 1 170 ? -0.168  -14.696 -10.139 1.00 2.30  ? 170 TRP A CD1  2  
ATOM 5590  C CD2  . TRP A 1 170 ? -1.381  -15.550 -11.830 1.00 2.52  ? 170 TRP A CD2  2  
ATOM 5591  N NE1  . TRP A 1 170 ? 0.649   -14.908 -11.234 1.00 3.04  ? 170 TRP A NE1  2  
ATOM 5592  C CE2  . TRP A 1 170 ? -0.052  -15.434 -12.301 1.00 3.15  ? 170 TRP A CE2  2  
ATOM 5593  C CE3  . TRP A 1 170 ? -2.353  -16.066 -12.706 1.00 3.32  ? 170 TRP A CE3  2  
ATOM 5594  C CZ2  . TRP A 1 170 ? 0.301   -15.816 -13.596 1.00 4.11  ? 170 TRP A CZ2  2  
ATOM 5595  C CZ3  . TRP A 1 170 ? -2.001  -16.452 -14.010 1.00 4.37  ? 170 TRP A CZ3  2  
ATOM 5596  C CH2  . TRP A 1 170 ? -0.677  -16.327 -14.454 1.00 4.64  ? 170 TRP A CH2  2  
ATOM 5597  H H    . TRP A 1 170 ? -2.319  -17.615 -9.429  1.00 1.23  ? 170 TRP A H    2  
ATOM 5598  H HA   . TRP A 1 170 ? -1.504  -15.332 -7.715  1.00 1.04  ? 170 TRP A HA   2  
ATOM 5599  H HB2  . TRP A 1 170 ? -3.473  -15.408 -10.023 1.00 1.55  ? 170 TRP A HB2  2  
ATOM 5600  H HB3  . TRP A 1 170 ? -2.789  -13.968 -9.270  1.00 1.86  ? 170 TRP A HB3  2  
ATOM 5601  H HD1  . TRP A 1 170 ? 0.148   -14.293 -9.188  1.00 2.68  ? 170 TRP A HD1  2  
ATOM 5602  H HE1  . TRP A 1 170 ? 1.609   -14.716 -11.269 1.00 3.72  ? 170 TRP A HE1  2  
ATOM 5603  H HE3  . TRP A 1 170 ? -3.376  -16.167 -12.375 1.00 3.40  ? 170 TRP A HE3  2  
ATOM 5604  H HZ2  . TRP A 1 170 ? 1.322   -15.718 -13.933 1.00 4.68  ? 170 TRP A HZ2  2  
ATOM 5605  H HZ3  . TRP A 1 170 ? -2.755  -16.847 -14.675 1.00 5.15  ? 170 TRP A HZ3  2  
ATOM 5606  H HH2  . TRP A 1 170 ? -0.413  -16.625 -15.458 1.00 5.49  ? 170 TRP A HH2  2  
ATOM 5607  N N    . GLN A 1 171 ? -4.162  -16.997 -7.243  1.00 0.88  ? 171 GLN A N    2  
ATOM 5608  C CA   . GLN A 1 171 ? -5.392  -17.105 -6.406  1.00 0.84  ? 171 GLN A CA   2  
ATOM 5609  C C    . GLN A 1 171 ? -5.011  -17.101 -4.924  1.00 0.75  ? 171 GLN A C    2  
ATOM 5610  O O    . GLN A 1 171 ? -5.811  -16.757 -4.076  1.00 0.75  ? 171 GLN A O    2  
ATOM 5611  C CB   . GLN A 1 171 ? -6.129  -18.404 -6.740  1.00 0.88  ? 171 GLN A CB   2  
ATOM 5612  C CG   . GLN A 1 171 ? -6.581  -18.375 -8.200  1.00 1.57  ? 171 GLN A CG   2  
ATOM 5613  C CD   . GLN A 1 171 ? -7.693  -17.339 -8.370  1.00 1.93  ? 171 GLN A CD   2  
ATOM 5614  O OE1  . GLN A 1 171 ? -7.612  -16.479 -9.225  1.00 2.66  ? 171 GLN A OE1  2  
ATOM 5615  N NE2  . GLN A 1 171 ? -8.736  -17.384 -7.587  1.00 2.34  ? 171 GLN A NE2  2  
ATOM 5616  H H    . GLN A 1 171 ? -3.801  -17.793 -7.686  1.00 0.92  ? 171 GLN A H    2  
ATOM 5617  H HA   . GLN A 1 171 ? -6.037  -16.261 -6.599  1.00 0.90  ? 171 GLN A HA   2  
ATOM 5618  H HB2  . GLN A 1 171 ? -5.466  -19.243 -6.583  1.00 1.24  ? 171 GLN A HB2  2  
ATOM 5619  H HB3  . GLN A 1 171 ? -6.992  -18.503 -6.099  1.00 1.30  ? 171 GLN A HB3  2  
ATOM 5620  H HG2  . GLN A 1 171 ? -5.744  -18.114 -8.831  1.00 2.31  ? 171 GLN A HG2  2  
ATOM 5621  H HG3  . GLN A 1 171 ? -6.954  -19.349 -8.481  1.00 2.11  ? 171 GLN A HG3  2  
ATOM 5622  H HE21 . GLN A 1 171 ? -8.802  -18.078 -6.898  1.00 2.50  ? 171 GLN A HE21 2  
ATOM 5623  H HE22 . GLN A 1 171 ? -9.454  -16.725 -7.688  1.00 2.93  ? 171 GLN A HE22 2  
ATOM 5624  N N    . THR A 1 172 ? -3.799  -17.450 -4.597  1.00 0.67  ? 172 THR A N    2  
ATOM 5625  C CA   . THR A 1 172 ? -3.395  -17.428 -3.164  1.00 0.60  ? 172 THR A CA   2  
ATOM 5626  C C    . THR A 1 172 ? -3.238  -15.961 -2.748  1.00 0.59  ? 172 THR A C    2  
ATOM 5627  O O    . THR A 1 172 ? -3.957  -15.476 -1.896  1.00 0.74  ? 172 THR A O    2  
ATOM 5628  C CB   . THR A 1 172 ? -2.076  -18.203 -2.993  1.00 0.59  ? 172 THR A CB   2  
ATOM 5629  O OG1  . THR A 1 172 ? -2.368  -19.591 -2.911  1.00 0.81  ? 172 THR A OG1  2  
ATOM 5630  C CG2  . THR A 1 172 ? -1.350  -17.769 -1.715  1.00 0.92  ? 172 THR A CG2  2  
ATOM 5631  H H    . THR A 1 172 ? -3.153  -17.704 -5.289  1.00 0.67  ? 172 THR A H    2  
ATOM 5632  H HA   . THR A 1 172 ? -4.167  -17.890 -2.567  1.00 0.60  ? 172 THR A HA   2  
ATOM 5633  H HB   . THR A 1 172 ? -1.439  -18.032 -3.847  1.00 0.71  ? 172 THR A HB   2  
ATOM 5634  H HG1  . THR A 1 172 ? -3.195  -19.693 -2.433  1.00 1.37  ? 172 THR A HG1  2  
ATOM 5635  H HG21 . THR A 1 172 ? -0.874  -16.813 -1.878  1.00 1.44  ? 172 THR A HG21 2  
ATOM 5636  H HG22 . THR A 1 172 ? -0.602  -18.505 -1.460  1.00 1.31  ? 172 THR A HG22 2  
ATOM 5637  H HG23 . THR A 1 172 ? -2.062  -17.685 -0.908  1.00 1.56  ? 172 THR A HG23 2  
ATOM 5638  N N    . VAL A 1 173 ? -2.300  -15.254 -3.312  1.00 0.59  ? 173 VAL A N    2  
ATOM 5639  C CA   . VAL A 1 173 ? -2.104  -13.827 -2.921  1.00 0.58  ? 173 VAL A CA   2  
ATOM 5640  C C    . VAL A 1 173 ? -3.454  -13.093 -2.929  1.00 0.57  ? 173 VAL A C    2  
ATOM 5641  O O    . VAL A 1 173 ? -3.678  -12.188 -2.149  1.00 0.60  ? 173 VAL A O    2  
ATOM 5642  C CB   . VAL A 1 173 ? -1.126  -13.170 -3.917  1.00 0.64  ? 173 VAL A CB   2  
ATOM 5643  C CG1  . VAL A 1 173 ? -1.862  -12.733 -5.192  1.00 1.13  ? 173 VAL A CG1  2  
ATOM 5644  C CG2  . VAL A 1 173 ? -0.467  -11.945 -3.272  1.00 1.01  ? 173 VAL A CG2  2  
ATOM 5645  H H    . VAL A 1 173 ? -1.698  -15.651 -3.976  1.00 0.73  ? 173 VAL A H    2  
ATOM 5646  H HA   . VAL A 1 173 ? -1.683  -13.788 -1.927  1.00 0.56  ? 173 VAL A HA   2  
ATOM 5647  H HB   . VAL A 1 173 ? -0.361  -13.886 -4.182  1.00 0.89  ? 173 VAL A HB   2  
ATOM 5648  H HG11 . VAL A 1 173 ? -1.143  -12.537 -5.974  1.00 1.56  ? 173 VAL A HG11 2  
ATOM 5649  H HG12 . VAL A 1 173 ? -2.430  -11.836 -4.993  1.00 1.64  ? 173 VAL A HG12 2  
ATOM 5650  H HG13 . VAL A 1 173 ? -2.531  -13.520 -5.508  1.00 1.50  ? 173 VAL A HG13 2  
ATOM 5651  H HG21 . VAL A 1 173 ? -1.230  -11.251 -2.953  1.00 1.60  ? 173 VAL A HG21 2  
ATOM 5652  H HG22 . VAL A 1 173 ? 0.180   -11.464 -3.990  1.00 1.51  ? 173 VAL A HG22 2  
ATOM 5653  H HG23 . VAL A 1 173 ? 0.115   -12.258 -2.417  1.00 1.54  ? 173 VAL A HG23 2  
ATOM 5654  N N    . THR A 1 174 ? -4.350  -13.468 -3.800  1.00 0.55  ? 174 THR A N    2  
ATOM 5655  C CA   . THR A 1 174 ? -5.675  -12.782 -3.845  1.00 0.56  ? 174 THR A CA   2  
ATOM 5656  C C    . THR A 1 174 ? -6.498  -13.174 -2.613  1.00 0.53  ? 174 THR A C    2  
ATOM 5657  O O    . THR A 1 174 ? -7.141  -12.343 -2.001  1.00 0.55  ? 174 THR A O    2  
ATOM 5658  C CB   . THR A 1 174 ? -6.423  -13.205 -5.113  1.00 0.59  ? 174 THR A CB   2  
ATOM 5659  O OG1  . THR A 1 174 ? -5.596  -12.979 -6.246  1.00 1.37  ? 174 THR A OG1  2  
ATOM 5660  C CG2  . THR A 1 174 ? -7.709  -12.389 -5.246  1.00 1.27  ? 174 THR A CG2  2  
ATOM 5661  H H    . THR A 1 174 ? -4.156  -14.198 -4.426  1.00 0.55  ? 174 THR A H    2  
ATOM 5662  H HA   . THR A 1 174 ? -5.527  -11.713 -3.855  1.00 0.59  ? 174 THR A HA   2  
ATOM 5663  H HB   . THR A 1 174 ? -6.672  -14.254 -5.052  1.00 1.03  ? 174 THR A HB   2  
ATOM 5664  H HG1  . THR A 1 174 ? -4.854  -13.586 -6.199  1.00 1.79  ? 174 THR A HG1  2  
ATOM 5665  H HG21 . THR A 1 174 ? -7.472  -11.336 -5.206  1.00 1.81  ? 174 THR A HG21 2  
ATOM 5666  H HG22 . THR A 1 174 ? -8.379  -12.638 -4.437  1.00 1.83  ? 174 THR A HG22 2  
ATOM 5667  H HG23 . THR A 1 174 ? -8.183  -12.615 -6.189  1.00 1.84  ? 174 THR A HG23 2  
ATOM 5668  N N    . ILE A 1 175 ? -6.484  -14.423 -2.240  1.00 0.51  ? 175 ILE A N    2  
ATOM 5669  C CA   . ILE A 1 175 ? -7.267  -14.853 -1.044  1.00 0.50  ? 175 ILE A CA   2  
ATOM 5670  C C    . ILE A 1 175 ? -6.509  -14.447 0.222   1.00 0.49  ? 175 ILE A C    2  
ATOM 5671  O O    . ILE A 1 175 ? -7.087  -14.257 1.274   1.00 0.49  ? 175 ILE A O    2  
ATOM 5672  C CB   . ILE A 1 175 ? -7.432  -16.375 -1.075  1.00 0.52  ? 175 ILE A CB   2  
ATOM 5673  C CG1  . ILE A 1 175 ? -8.247  -16.777 -2.313  1.00 0.77  ? 175 ILE A CG1  2  
ATOM 5674  C CG2  . ILE A 1 175 ? -8.158  -16.840 0.191   1.00 0.87  ? 175 ILE A CG2  2  
ATOM 5675  C CD1  . ILE A 1 175 ? -8.046  -18.267 -2.600  1.00 0.89  ? 175 ILE A CD1  2  
ATOM 5676  H H    . ILE A 1 175 ? -5.957  -15.079 -2.743  1.00 0.51  ? 175 ILE A H    2  
ATOM 5677  H HA   . ILE A 1 175 ? -8.239  -14.382 -1.062  1.00 0.51  ? 175 ILE A HA   2  
ATOM 5678  H HB   . ILE A 1 175 ? -6.456  -16.838 -1.118  1.00 0.69  ? 175 ILE A HB   2  
ATOM 5679  H HG12 . ILE A 1 175 ? -9.295  -16.583 -2.135  1.00 1.10  ? 175 ILE A HG12 2  
ATOM 5680  H HG13 . ILE A 1 175 ? -7.916  -16.203 -3.166  1.00 1.20  ? 175 ILE A HG13 2  
ATOM 5681  H HG21 . ILE A 1 175 ? -9.040  -16.236 0.343   1.00 1.33  ? 175 ILE A HG21 2  
ATOM 5682  H HG22 . ILE A 1 175 ? -7.500  -16.737 1.042   1.00 1.36  ? 175 ILE A HG22 2  
ATOM 5683  H HG23 . ILE A 1 175 ? -8.445  -17.875 0.081   1.00 1.53  ? 175 ILE A HG23 2  
ATOM 5684  H HD11 . ILE A 1 175 ? -8.661  -18.559 -3.438  1.00 1.52  ? 175 ILE A HD11 2  
ATOM 5685  H HD12 . ILE A 1 175 ? -8.326  -18.843 -1.730  1.00 1.28  ? 175 ILE A HD12 2  
ATOM 5686  H HD13 . ILE A 1 175 ? -7.007  -18.452 -2.834  1.00 1.40  ? 175 ILE A HD13 2  
ATOM 5687  N N    . PHE A 1 176 ? -5.222  -14.283 0.116   1.00 0.48  ? 176 PHE A N    2  
ATOM 5688  C CA   . PHE A 1 176 ? -4.411  -13.855 1.291   1.00 0.49  ? 176 PHE A CA   2  
ATOM 5689  C C    . PHE A 1 176 ? -4.720  -12.389 1.599   1.00 0.49  ? 176 PHE A C    2  
ATOM 5690  O O    . PHE A 1 176 ? -5.050  -12.025 2.711   1.00 0.56  ? 176 PHE A O    2  
ATOM 5691  C CB   . PHE A 1 176 ? -2.924  -13.969 0.920   1.00 0.51  ? 176 PHE A CB   2  
ATOM 5692  C CG   . PHE A 1 176 ? -2.090  -13.844 2.178   1.00 0.51  ? 176 PHE A CG   2  
ATOM 5693  C CD1  . PHE A 1 176 ? -2.142  -14.853 3.150   1.00 1.23  ? 176 PHE A CD1  2  
ATOM 5694  C CD2  . PHE A 1 176 ? -1.277  -12.721 2.381   1.00 1.41  ? 176 PHE A CD2  2  
ATOM 5695  C CE1  . PHE A 1 176 ? -1.383  -14.739 4.321   1.00 1.22  ? 176 PHE A CE1  2  
ATOM 5696  C CE2  . PHE A 1 176 ? -0.517  -12.609 3.552   1.00 1.52  ? 176 PHE A CE2  2  
ATOM 5697  C CZ   . PHE A 1 176 ? -0.571  -13.617 4.522   1.00 0.76  ? 176 PHE A CZ   2  
ATOM 5698  H H    . PHE A 1 176 ? -4.785  -14.418 -0.752  1.00 0.49  ? 176 PHE A H    2  
ATOM 5699  H HA   . PHE A 1 176 ? -4.578  -14.504 2.140   1.00 0.49  ? 176 PHE A HA   2  
ATOM 5700  H HB2  . PHE A 1 176 ? -2.743  -14.933 0.464   1.00 0.60  ? 176 PHE A HB2  2  
ATOM 5701  H HB3  . PHE A 1 176 ? -2.657  -13.186 0.226   1.00 0.54  ? 176 PHE A HB3  2  
ATOM 5702  H HD1  . PHE A 1 176 ? -2.767  -15.720 2.995   1.00 2.12  ? 176 PHE A HD1  2  
ATOM 5703  H HD2  . PHE A 1 176 ? -1.235  -11.943 1.634   1.00 2.26  ? 176 PHE A HD2  2  
ATOM 5704  H HE1  . PHE A 1 176 ? -1.425  -15.517 5.069   1.00 2.05  ? 176 PHE A HE1  2  
ATOM 5705  H HE2  . PHE A 1 176 ? 0.110   -11.743 3.708   1.00 2.43  ? 176 PHE A HE2  2  
ATOM 5706  H HZ   . PHE A 1 176 ? 0.013   -13.529 5.426   1.00 0.89  ? 176 PHE A HZ   2  
ATOM 5707  N N    . VAL A 1 177 ? -4.577  -11.546 0.615   1.00 0.46  ? 177 VAL A N    2  
ATOM 5708  C CA   . VAL A 1 177 ? -4.818  -10.087 0.805   1.00 0.48  ? 177 VAL A CA   2  
ATOM 5709  C C    . VAL A 1 177 ? -6.314  -9.805  0.960   1.00 0.44  ? 177 VAL A C    2  
ATOM 5710  O O    . VAL A 1 177 ? -6.704  -8.843  1.592   1.00 0.57  ? 177 VAL A O    2  
ATOM 5711  C CB   . VAL A 1 177 ? -4.289  -9.361  -0.434  1.00 0.56  ? 177 VAL A CB   2  
ATOM 5712  C CG1  . VAL A 1 177 ? -4.629  -7.871  -0.372  1.00 1.20  ? 177 VAL A CG1  2  
ATOM 5713  C CG2  . VAL A 1 177 ? -2.773  -9.543  -0.510  1.00 1.24  ? 177 VAL A CG2  2  
ATOM 5714  H H    . VAL A 1 177 ? -4.287  -11.875 -0.261  1.00 0.46  ? 177 VAL A H    2  
ATOM 5715  H HA   . VAL A 1 177 ? -4.287  -9.740  1.678   1.00 0.50  ? 177 VAL A HA   2  
ATOM 5716  H HB   . VAL A 1 177 ? -4.743  -9.790  -1.317  1.00 1.10  ? 177 VAL A HB   2  
ATOM 5717  H HG11 . VAL A 1 177 ? -5.688  -7.735  -0.532  1.00 1.82  ? 177 VAL A HG11 2  
ATOM 5718  H HG12 . VAL A 1 177 ? -4.078  -7.343  -1.137  1.00 1.81  ? 177 VAL A HG12 2  
ATOM 5719  H HG13 . VAL A 1 177 ? -4.359  -7.481  0.599   1.00 1.63  ? 177 VAL A HG13 2  
ATOM 5720  H HG21 . VAL A 1 177 ? -2.541  -10.596 -0.583  1.00 1.77  ? 177 VAL A HG21 2  
ATOM 5721  H HG22 . VAL A 1 177 ? -2.315  -9.134  0.378   1.00 1.78  ? 177 VAL A HG22 2  
ATOM 5722  H HG23 . VAL A 1 177 ? -2.395  -9.031  -1.382  1.00 1.80  ? 177 VAL A HG23 2  
ATOM 5723  N N    . ALA A 1 178 ? -7.155  -10.627 0.404   1.00 0.45  ? 178 ALA A N    2  
ATOM 5724  C CA   . ALA A 1 178 ? -8.621  -10.388 0.538   1.00 0.43  ? 178 ALA A CA   2  
ATOM 5725  C C    . ALA A 1 178 ? -9.106  -10.899 1.898   1.00 0.40  ? 178 ALA A C    2  
ATOM 5726  O O    . ALA A 1 178 ? -9.821  -10.221 2.609   1.00 0.40  ? 178 ALA A O    2  
ATOM 5727  C CB   . ALA A 1 178 ? -9.360  -11.132 -0.576  1.00 0.46  ? 178 ALA A CB   2  
ATOM 5728  H H    . ALA A 1 178 ? -6.827  -11.401 -0.099  1.00 0.59  ? 178 ALA A H    2  
ATOM 5729  H HA   . ALA A 1 178 ? -8.824  -9.330  0.460   1.00 0.44  ? 178 ALA A HA   2  
ATOM 5730  H HB1  . ALA A 1 178 ? -9.180  -12.192 -0.481  1.00 0.98  ? 178 ALA A HB1  2  
ATOM 5731  H HB2  . ALA A 1 178 ? -9.002  -10.790 -1.535  1.00 1.10  ? 178 ALA A HB2  2  
ATOM 5732  H HB3  . ALA A 1 178 ? -10.420 -10.938 -0.496  1.00 1.22  ? 178 ALA A HB3  2  
ATOM 5733  N N    . GLY A 1 179 ? -8.737  -12.097 2.255   1.00 0.41  ? 179 GLY A N    2  
ATOM 5734  C CA   . GLY A 1 179 ? -9.190  -12.667 3.556   1.00 0.43  ? 179 GLY A CA   2  
ATOM 5735  C C    . GLY A 1 179 ? -8.728  -11.789 4.724   1.00 0.43  ? 179 GLY A C    2  
ATOM 5736  O O    . GLY A 1 179 ? -9.410  -11.673 5.726   1.00 0.48  ? 179 GLY A O    2  
ATOM 5737  H H    . GLY A 1 179 ? -8.177  -12.633 1.656   1.00 0.42  ? 179 GLY A H    2  
ATOM 5738  H HA2  . GLY A 1 179 ? -10.268 -12.729 3.561   1.00 0.45  ? 179 GLY A HA2  2  
ATOM 5739  H HA3  . GLY A 1 179 ? -8.776  -13.657 3.673   1.00 0.46  ? 179 GLY A HA3  2  
ATOM 5740  N N    . VAL A 1 180 ? -7.575  -11.185 4.626   1.00 0.42  ? 180 VAL A N    2  
ATOM 5741  C CA   . VAL A 1 180 ? -7.088  -10.346 5.754   1.00 0.45  ? 180 VAL A CA   2  
ATOM 5742  C C    . VAL A 1 180 ? -7.772  -8.978  5.760   1.00 0.45  ? 180 VAL A C    2  
ATOM 5743  O O    . VAL A 1 180 ? -8.088  -8.427  6.801   1.00 0.43  ? 180 VAL A O    2  
ATOM 5744  C CB   . VAL A 1 180 ? -5.570  -10.162 5.653   1.00 0.49  ? 180 VAL A CB   2  
ATOM 5745  C CG1  . VAL A 1 180 ? -5.232  -9.368  4.390   1.00 1.31  ? 180 VAL A CG1  2  
ATOM 5746  C CG2  . VAL A 1 180 ? -5.063  -9.400  6.882   1.00 1.41  ? 180 VAL A CG2  2  
ATOM 5747  H H    . VAL A 1 180 ? -7.024  -11.293 3.822   1.00 0.42  ? 180 VAL A H    2  
ATOM 5748  H HA   . VAL A 1 180 ? -7.323  -10.834 6.691   1.00 0.46  ? 180 VAL A HA   2  
ATOM 5749  H HB   . VAL A 1 180 ? -5.093  -11.130 5.607   1.00 1.21  ? 180 VAL A HB   2  
ATOM 5750  H HG11 . VAL A 1 180 ? -5.544  -8.342  4.515   1.00 1.78  ? 180 VAL A HG11 2  
ATOM 5751  H HG12 . VAL A 1 180 ? -5.745  -9.801  3.545   1.00 1.94  ? 180 VAL A HG12 2  
ATOM 5752  H HG13 . VAL A 1 180 ? -4.165  -9.401  4.220   1.00 1.95  ? 180 VAL A HG13 2  
ATOM 5753  H HG21 . VAL A 1 180 ? -3.983  -9.367  6.864   1.00 1.89  ? 180 VAL A HG21 2  
ATOM 5754  H HG22 . VAL A 1 180 ? -5.392  -9.902  7.779   1.00 2.13  ? 180 VAL A HG22 2  
ATOM 5755  H HG23 . VAL A 1 180 ? -5.453  -8.393  6.869   1.00 1.85  ? 180 VAL A HG23 2  
ATOM 5756  N N    . LEU A 1 181 ? -8.011  -8.415  4.601   1.00 0.49  ? 181 LEU A N    2  
ATOM 5757  C CA   . LEU A 1 181 ? -8.669  -7.083  4.564   1.00 0.50  ? 181 LEU A CA   2  
ATOM 5758  C C    . LEU A 1 181 ? -10.042 -7.200  5.227   1.00 0.49  ? 181 LEU A C    2  
ATOM 5759  O O    . LEU A 1 181 ? -10.517 -6.297  5.885   1.00 0.51  ? 181 LEU A O    2  
ATOM 5760  C CB   . LEU A 1 181 ? -8.838  -6.619  3.105   1.00 0.56  ? 181 LEU A CB   2  
ATOM 5761  C CG   . LEU A 1 181 ? -7.528  -6.009  2.574   1.00 0.64  ? 181 LEU A CG   2  
ATOM 5762  C CD1  . LEU A 1 181 ? -7.588  -5.941  1.044   1.00 1.60  ? 181 LEU A CD1  2  
ATOM 5763  C CD2  . LEU A 1 181 ? -7.330  -4.587  3.129   1.00 1.20  ? 181 LEU A CD2  2  
ATOM 5764  H H    . LEU A 1 181 ? -7.750  -8.859  3.766   1.00 0.51  ? 181 LEU A H    2  
ATOM 5765  H HA   . LEU A 1 181 ? -8.025  -6.407  5.098   1.00 0.50  ? 181 LEU A HA   2  
ATOM 5766  H HB2  . LEU A 1 181 ? -9.105  -7.472  2.497   1.00 1.01  ? 181 LEU A HB2  2  
ATOM 5767  H HB3  . LEU A 1 181 ? -9.627  -5.884  3.048   1.00 0.95  ? 181 LEU A HB3  2  
ATOM 5768  H HG   . LEU A 1 181 ? -6.697  -6.633  2.870   1.00 1.52  ? 181 LEU A HG   2  
ATOM 5769  H HD11 . LEU A 1 181 ? -8.414  -5.311  0.744   1.00 2.12  ? 181 LEU A HD11 2  
ATOM 5770  H HD12 . LEU A 1 181 ? -7.729  -6.934  0.643   1.00 2.16  ? 181 LEU A HD12 2  
ATOM 5771  H HD13 . LEU A 1 181 ? -6.665  -5.527  0.665   1.00 2.17  ? 181 LEU A HD13 2  
ATOM 5772  H HD21 . LEU A 1 181 ? -6.997  -4.637  4.153   1.00 1.66  ? 181 LEU A HD21 2  
ATOM 5773  H HD22 . LEU A 1 181 ? -8.260  -4.042  3.080   1.00 1.87  ? 181 LEU A HD22 2  
ATOM 5774  H HD23 . LEU A 1 181 ? -6.585  -4.072  2.540   1.00 1.79  ? 181 LEU A HD23 2  
ATOM 5775  N N    . THR A 1 182 ? -10.682 -8.325  5.033   1.00 0.49  ? 182 THR A N    2  
ATOM 5776  C CA   . THR A 1 182 ? -12.031 -8.540  5.621   1.00 0.51  ? 182 THR A CA   2  
ATOM 5777  C C    . THR A 1 182 ? -11.920 -8.669  7.138   1.00 0.48  ? 182 THR A C    2  
ATOM 5778  O O    . THR A 1 182 ? -12.789 -8.242  7.870   1.00 0.51  ? 182 THR A O    2  
ATOM 5779  C CB   . THR A 1 182 ? -12.642 -9.821  5.046   1.00 0.54  ? 182 THR A CB   2  
ATOM 5780  O OG1  . THR A 1 182 ? -11.727 -10.895 5.209   1.00 1.16  ? 182 THR A OG1  2  
ATOM 5781  C CG2  . THR A 1 182 ? -12.942 -9.625  3.559   1.00 1.07  ? 182 THR A CG2  2  
ATOM 5782  H H    . THR A 1 182 ? -10.269 -9.030  4.492   1.00 0.49  ? 182 THR A H    2  
ATOM 5783  H HA   . THR A 1 182 ? -12.666 -7.701  5.378   1.00 0.56  ? 182 THR A HA   2  
ATOM 5784  H HB   . THR A 1 182 ? -13.560 -10.048 5.566   1.00 1.04  ? 182 THR A HB   2  
ATOM 5785  H HG1  . THR A 1 182 ? -11.464 -10.923 6.132   1.00 1.69  ? 182 THR A HG1  2  
ATOM 5786  H HG21 . THR A 1 182 ? -12.051 -9.281  3.054   1.00 1.49  ? 182 THR A HG21 2  
ATOM 5787  H HG22 . THR A 1 182 ? -13.727 -8.893  3.443   1.00 1.80  ? 182 THR A HG22 2  
ATOM 5788  H HG23 . THR A 1 182 ? -13.259 -10.564 3.129   1.00 1.62  ? 182 THR A HG23 2  
ATOM 5789  N N    . ALA A 1 183 ? -10.866 -9.273  7.621   1.00 0.45  ? 183 ALA A N    2  
ATOM 5790  C CA   . ALA A 1 183 ? -10.728 -9.439  9.095   1.00 0.44  ? 183 ALA A CA   2  
ATOM 5791  C C    . ALA A 1 183 ? -10.882 -8.075  9.768   1.00 0.44  ? 183 ALA A C    2  
ATOM 5792  O O    . ALA A 1 183 ? -11.498 -7.945  10.807  1.00 0.50  ? 183 ALA A O    2  
ATOM 5793  C CB   . ALA A 1 183 ? -9.353  -10.027 9.419   1.00 0.46  ? 183 ALA A CB   2  
ATOM 5794  H H    . ALA A 1 183 ? -10.178 -9.627  7.017   1.00 0.44  ? 183 ALA A H    2  
ATOM 5795  H HA   . ALA A 1 183 ? -11.502 -10.121 9.416   1.00 0.45  ? 183 ALA A HA   2  
ATOM 5796  H HB1  . ALA A 1 183 ? -9.240  -10.976 8.916   1.00 1.08  ? 183 ALA A HB1  2  
ATOM 5797  H HB2  . ALA A 1 183 ? -9.266  -10.172 10.485  1.00 1.22  ? 183 ALA A HB2  2  
ATOM 5798  H HB3  . ALA A 1 183 ? -8.583  -9.348  9.083   1.00 1.06  ? 183 ALA A HB3  2  
ATOM 5799  N N    . SER A 1 184 ? -10.317 -7.054  9.176   1.00 0.47  ? 184 SER A N    2  
ATOM 5800  C CA   . SER A 1 184 ? -10.420 -5.689  9.772   1.00 0.51  ? 184 SER A CA   2  
ATOM 5801  C C    . SER A 1 184 ? -11.849 -5.161  9.615   1.00 0.54  ? 184 SER A C    2  
ATOM 5802  O O    . SER A 1 184 ? -12.397 -4.538  10.503  1.00 0.56  ? 184 SER A O    2  
ATOM 5803  C CB   . SER A 1 184 ? -9.450  -4.746  9.058   1.00 0.62  ? 184 SER A CB   2  
ATOM 5804  O OG   . SER A 1 184 ? -9.930  -3.413  9.167   1.00 1.55  ? 184 SER A OG   2  
ATOM 5805  H H    . SER A 1 184 ? -9.820  -7.192  8.336   1.00 0.51  ? 184 SER A H    2  
ATOM 5806  H HA   . SER A 1 184 ? -10.168 -5.740  10.822  1.00 0.48  ? 184 SER A HA   2  
ATOM 5807  H HB2  . SER A 1 184 ? -8.475  -4.811  9.513   1.00 1.12  ? 184 SER A HB2  2  
ATOM 5808  H HB3  . SER A 1 184 ? -9.378  -5.029  8.017   1.00 1.19  ? 184 SER A HB3  2  
ATOM 5809  H HG   . SER A 1 184 ? -9.670  -3.073  10.027  1.00 1.98  ? 184 SER A HG   2  
ATOM 5810  N N    . LEU A 1 185 ? -12.460 -5.424  8.493   1.00 0.58  ? 185 LEU A N    2  
ATOM 5811  C CA   . LEU A 1 185 ? -13.860 -4.966  8.253   1.00 0.69  ? 185 LEU A CA   2  
ATOM 5812  C C    . LEU A 1 185 ? -14.829 -5.845  9.041   1.00 0.69  ? 185 LEU A C    2  
ATOM 5813  O O    . LEU A 1 185 ? -15.848 -5.402  9.531   1.00 0.79  ? 185 LEU A O    2  
ATOM 5814  C CB   . LEU A 1 185 ? -14.171 -5.123  6.762   1.00 0.71  ? 185 LEU A CB   2  
ATOM 5815  C CG   . LEU A 1 185 ? -13.200 -4.268  5.933   1.00 0.79  ? 185 LEU A CG   2  
ATOM 5816  C CD1  . LEU A 1 185 ? -13.389 -4.588  4.448   1.00 1.62  ? 185 LEU A CD1  2  
ATOM 5817  C CD2  . LEU A 1 185 ? -13.464 -2.769  6.174   1.00 1.18  ? 185 LEU A CD2  2  
ATOM 5818  H H    . LEU A 1 185 ? -12.013 -5.951  7.798   1.00 0.58  ? 185 LEU A H    2  
ATOM 5819  H HA   . LEU A 1 185 ? -13.986 -3.925  8.510   1.00 0.77  ? 185 LEU A HA   2  
ATOM 5820  H HB2  . LEU A 1 185 ? -14.064 -6.161  6.481   1.00 1.28  ? 185 LEU A HB2  2  
ATOM 5821  H HB3  . LEU A 1 185 ? -15.185 -4.803  6.570   1.00 1.05  ? 185 LEU A HB3  2  
ATOM 5822  H HG   . LEU A 1 185 ? -12.185 -4.505  6.221   1.00 1.57  ? 185 LEU A HG   2  
ATOM 5823  H HD11 . LEU A 1 185 ? -14.419 -4.419  4.172   1.00 1.91  ? 185 LEU A HD11 2  
ATOM 5824  H HD12 . LEU A 1 185 ? -13.133 -5.621  4.267   1.00 2.16  ? 185 LEU A HD12 2  
ATOM 5825  H HD13 . LEU A 1 185 ? -12.748 -3.950  3.858   1.00 2.28  ? 185 LEU A HD13 2  
ATOM 5826  H HD21 . LEU A 1 185 ? -12.967 -2.455  7.079   1.00 1.69  ? 185 LEU A HD21 2  
ATOM 5827  H HD22 . LEU A 1 185 ? -14.526 -2.593  6.267   1.00 1.76  ? 185 LEU A HD22 2  
ATOM 5828  H HD23 . LEU A 1 185 ? -13.080 -2.194  5.342   1.00 1.75  ? 185 LEU A HD23 2  
ATOM 5829  N N    . THR A 1 186 ? -14.498 -7.100  9.155   1.00 0.62  ? 186 THR A N    2  
ATOM 5830  C CA   . THR A 1 186 ? -15.356 -8.062  9.895   1.00 0.68  ? 186 THR A CA   2  
ATOM 5831  C C    . THR A 1 186 ? -15.398 -7.714  11.380  1.00 0.62  ? 186 THR A C    2  
ATOM 5832  O O    . THR A 1 186 ? -16.430 -7.803  12.016  1.00 0.64  ? 186 THR A O    2  
ATOM 5833  C CB   . THR A 1 186 ? -14.761 -9.465  9.748   1.00 0.73  ? 186 THR A CB   2  
ATOM 5834  O OG1  . THR A 1 186 ? -14.582 -9.758  8.369   1.00 0.89  ? 186 THR A OG1  2  
ATOM 5835  C CG2  . THR A 1 186 ? -15.713 -10.490 10.369  1.00 1.00  ? 186 THR A CG2  2  
ATOM 5836  H H    . THR A 1 186 ? -13.663 -7.414  8.750   1.00 0.55  ? 186 THR A H    2  
ATOM 5837  H HA   . THR A 1 186 ? -16.359 -8.084  9.493   1.00 0.89  ? 186 THR A HA   2  
ATOM 5838  H HB   . THR A 1 186 ? -13.810 -9.510  10.254  1.00 0.76  ? 186 THR A HB   2  
ATOM 5839  H HG1  . THR A 1 186 ? -13.995 -9.095  7.999   1.00 1.30  ? 186 THR A HG1  2  
ATOM 5840  H HG21 . THR A 1 186 ? -15.761 -10.336 11.437  1.00 1.38  ? 186 THR A HG21 2  
ATOM 5841  H HG22 . THR A 1 186 ? -15.351 -11.487 10.165  1.00 1.41  ? 186 THR A HG22 2  
ATOM 5842  H HG23 . THR A 1 186 ? -16.698 -10.371 9.943   1.00 1.61  ? 186 THR A HG23 2  
ATOM 5843  N N    . ILE A 1 187 ? -14.278 -7.356  11.957  1.00 0.64  ? 187 ILE A N    2  
ATOM 5844  C CA   . ILE A 1 187 ? -14.270 -7.053  13.419  1.00 0.66  ? 187 ILE A CA   2  
ATOM 5845  C C    . ILE A 1 187 ? -14.840 -5.651  13.667  1.00 0.66  ? 187 ILE A C    2  
ATOM 5846  O O    . ILE A 1 187 ? -15.408 -5.392  14.710  1.00 0.75  ? 187 ILE A O    2  
ATOM 5847  C CB   . ILE A 1 187 ? -12.827 -7.167  13.955  1.00 0.72  ? 187 ILE A CB   2  
ATOM 5848  C CG1  . ILE A 1 187 ? -12.859 -7.531  15.448  1.00 0.88  ? 187 ILE A CG1  2  
ATOM 5849  C CG2  . ILE A 1 187 ? -12.079 -5.831  13.785  1.00 1.57  ? 187 ILE A CG2  2  
ATOM 5850  C CD1  . ILE A 1 187 ? -11.446 -7.436  16.041  1.00 0.87  ? 187 ILE A CD1  2  
ATOM 5851  H H    . ILE A 1 187 ? -13.447 -7.316  11.441  1.00 0.69  ? 187 ILE A H    2  
ATOM 5852  H HA   . ILE A 1 187 ? -14.914 -7.782  13.890  1.00 0.71  ? 187 ILE A HA   2  
ATOM 5853  H HB   . ILE A 1 187 ? -12.304 -7.939  13.409  1.00 1.19  ? 187 ILE A HB   2  
ATOM 5854  H HG12 . ILE A 1 187 ? -13.513 -6.846  15.969  1.00 1.44  ? 187 ILE A HG12 2  
ATOM 5855  H HG13 . ILE A 1 187 ? -13.228 -8.538  15.564  1.00 1.37  ? 187 ILE A HG13 2  
ATOM 5856  H HG21 . ILE A 1 187 ? -11.017 -5.998  13.882  1.00 2.03  ? 187 ILE A HG21 2  
ATOM 5857  H HG22 . ILE A 1 187 ? -12.407 -5.132  14.538  1.00 2.23  ? 187 ILE A HG22 2  
ATOM 5858  H HG23 . ILE A 1 187 ? -12.291 -5.427  12.804  1.00 1.91  ? 187 ILE A HG23 2  
ATOM 5859  H HD11 . ILE A 1 187 ? -10.742 -7.907  15.371  1.00 1.36  ? 187 ILE A HD11 2  
ATOM 5860  H HD12 . ILE A 1 187 ? -11.423 -7.937  16.997  1.00 1.37  ? 187 ILE A HD12 2  
ATOM 5861  H HD13 . ILE A 1 187 ? -11.178 -6.395  16.172  1.00 1.21  ? 187 ILE A HD13 2  
ATOM 5862  N N    . TRP A 1 188 ? -14.636 -4.724  12.773  1.00 0.64  ? 188 TRP A N    2  
ATOM 5863  C CA   . TRP A 1 188 ? -15.116 -3.339  13.044  1.00 0.70  ? 188 TRP A CA   2  
ATOM 5864  C C    . TRP A 1 188 ? -16.587 -3.367  13.471  1.00 0.81  ? 188 TRP A C    2  
ATOM 5865  O O    . TRP A 1 188 ? -16.916 -3.046  14.597  1.00 1.06  ? 188 TRP A O    2  
ATOM 5866  C CB   . TRP A 1 188 ? -14.942 -2.486  11.781  1.00 0.85  ? 188 TRP A CB   2  
ATOM 5867  C CG   . TRP A 1 188 ? -15.557 -1.139  11.983  1.00 0.92  ? 188 TRP A CG   2  
ATOM 5868  C CD1  . TRP A 1 188 ? -16.623 -0.662  11.300  1.00 1.76  ? 188 TRP A CD1  2  
ATOM 5869  C CD2  . TRP A 1 188 ? -15.160 -0.087  12.909  1.00 1.04  ? 188 TRP A CD2  2  
ATOM 5870  N NE1  . TRP A 1 188 ? -16.907 0.615   11.749  1.00 2.01  ? 188 TRP A NE1  2  
ATOM 5871  C CE2  . TRP A 1 188 ? -16.033 1.014   12.741  1.00 1.34  ? 188 TRP A CE2  2  
ATOM 5872  C CE3  . TRP A 1 188 ? -14.138 0.016   13.869  1.00 1.79  ? 188 TRP A CE3  2  
ATOM 5873  C CZ2  . TRP A 1 188 ? -15.896 2.177   13.500  1.00 1.47  ? 188 TRP A CZ2  2  
ATOM 5874  C CZ3  . TRP A 1 188 ? -13.998 1.185   14.634  1.00 2.17  ? 188 TRP A CZ3  2  
ATOM 5875  C CH2  . TRP A 1 188 ? -14.875 2.263   14.450  1.00 1.71  ? 188 TRP A CH2  2  
ATOM 5876  H H    . TRP A 1 188 ? -14.118 -4.898  11.959  1.00 0.65  ? 188 TRP A H    2  
ATOM 5877  H HA   . TRP A 1 188 ? -14.487 -2.965  13.836  1.00 0.79  ? 188 TRP A HA   2  
ATOM 5878  H HB2  . TRP A 1 188 ? -13.890 -2.372  11.568  1.00 1.16  ? 188 TRP A HB2  2  
ATOM 5879  H HB3  . TRP A 1 188 ? -15.424 -2.979  10.949  1.00 1.12  ? 188 TRP A HB3  2  
ATOM 5880  H HD1  . TRP A 1 188 ? -17.164 -1.192  10.530  1.00 2.36  ? 188 TRP A HD1  2  
ATOM 5881  H HE1  . TRP A 1 188 ? -17.634 1.183   11.417  1.00 2.74  ? 188 TRP A HE1  2  
ATOM 5882  H HE3  . TRP A 1 188 ? -13.457 -0.808  14.019  1.00 2.35  ? 188 TRP A HE3  2  
ATOM 5883  H HZ2  . TRP A 1 188 ? -16.575 3.004   13.353  1.00 1.90  ? 188 TRP A HZ2  2  
ATOM 5884  H HZ3  . TRP A 1 188 ? -13.210 1.254   15.369  1.00 2.99  ? 188 TRP A HZ3  2  
ATOM 5885  H HH2  . TRP A 1 188 ? -14.762 3.160   15.042  1.00 2.02  ? 188 TRP A HH2  2  
ATOM 5886  N N    . LYS A 1 189 ? -17.480 -3.741  12.589  1.00 0.95  ? 189 LYS A N    2  
ATOM 5887  C CA   . LYS A 1 189 ? -18.923 -3.780  12.955  1.00 1.23  ? 189 LYS A CA   2  
ATOM 5888  C C    . LYS A 1 189 ? -19.617 -4.911  12.181  1.00 1.53  ? 189 LYS A C    2  
ATOM 5889  O O    . LYS A 1 189 ? -19.128 -6.022  12.131  1.00 2.02  ? 189 LYS A O    2  
ATOM 5890  C CB   . LYS A 1 189 ? -19.539 -2.410  12.624  1.00 1.90  ? 189 LYS A CB   2  
ATOM 5891  C CG   . LYS A 1 189 ? -20.636 -2.066  13.642  1.00 2.68  ? 189 LYS A CG   2  
ATOM 5892  C CD   . LYS A 1 189 ? -21.515 -0.921  13.116  1.00 3.60  ? 189 LYS A CD   2  
ATOM 5893  C CE   . LYS A 1 189 ? -20.803 0.420   13.314  1.00 4.51  ? 189 LYS A CE   2  
ATOM 5894  N NZ   . LYS A 1 189 ? -21.639 1.513   12.740  1.00 5.09  ? 189 LYS A NZ   2  
ATOM 5895  H H    . LYS A 1 189 ? -17.207 -3.987  11.687  1.00 1.06  ? 189 LYS A H    2  
ATOM 5896  H HA   . LYS A 1 189 ? -19.016 -3.975  14.016  1.00 1.91  ? 189 LYS A HA   2  
ATOM 5897  H HB2  . LYS A 1 189 ? -18.756 -1.667  12.667  1.00 2.38  ? 189 LYS A HB2  2  
ATOM 5898  H HB3  . LYS A 1 189 ? -19.960 -2.402  11.630  1.00 2.28  ? 189 LYS A HB3  2  
ATOM 5899  H HG2  . LYS A 1 189 ? -21.250 -2.940  13.807  1.00 3.00  ? 189 LYS A HG2  2  
ATOM 5900  H HG3  . LYS A 1 189 ? -20.178 -1.770  14.573  1.00 2.99  ? 189 LYS A HG3  2  
ATOM 5901  H HD2  . LYS A 1 189 ? -21.717 -1.068  12.067  1.00 3.82  ? 189 LYS A HD2  2  
ATOM 5902  H HD3  . LYS A 1 189 ? -22.447 -0.911  13.660  1.00 3.93  ? 189 LYS A HD3  2  
ATOM 5903  H HE2  . LYS A 1 189 ? -20.654 0.597   14.369  1.00 4.88  ? 189 LYS A HE2  2  
ATOM 5904  H HE3  . LYS A 1 189 ? -19.847 0.399   12.814  1.00 4.83  ? 189 LYS A HE3  2  
ATOM 5905  H HZ1  . LYS A 1 189 ? -21.733 2.280   13.436  1.00 5.52  ? 189 LYS A HZ1  2  
ATOM 5906  H HZ2  . LYS A 1 189 ? -22.581 1.141   12.504  1.00 5.28  ? 189 LYS A HZ2  2  
ATOM 5907  H HZ3  . LYS A 1 189 ? -21.186 1.882   11.881  1.00 5.25  ? 189 LYS A HZ3  2  
ATOM 5908  N N    . LYS A 1 190 ? -20.749 -4.650  11.587  1.00 2.36  ? 190 LYS A N    2  
ATOM 5909  C CA   . LYS A 1 190 ? -21.455 -5.721  10.838  1.00 3.37  ? 190 LYS A CA   2  
ATOM 5910  C C    . LYS A 1 190 ? -22.642 -5.112  10.087  1.00 3.71  ? 190 LYS A C    2  
ATOM 5911  O O    . LYS A 1 190 ? -23.322 -4.234  10.578  1.00 4.35  ? 190 LYS A O    2  
ATOM 5912  C CB   . LYS A 1 190 ? -21.943 -6.790  11.830  1.00 4.30  ? 190 LYS A CB   2  
ATOM 5913  C CG   . LYS A 1 190 ? -22.966 -7.716  11.158  1.00 5.08  ? 190 LYS A CG   2  
ATOM 5914  C CD   . LYS A 1 190 ? -23.159 -8.973  12.011  1.00 5.78  ? 190 LYS A CD   2  
ATOM 5915  C CE   . LYS A 1 190 ? -24.246 -9.853  11.388  1.00 6.76  ? 190 LYS A CE   2  
ATOM 5916  N NZ   . LYS A 1 190 ? -23.868 -10.193 9.987   1.00 7.40  ? 190 LYS A NZ   2  
ATOM 5917  H H    . LYS A 1 190 ? -21.137 -3.757  11.634  1.00 2.69  ? 190 LYS A H    2  
ATOM 5918  H HA   . LYS A 1 190 ? -20.776 -6.172  10.130  1.00 3.76  ? 190 LYS A HA   2  
ATOM 5919  H HB2  . LYS A 1 190 ? -21.097 -7.376  12.159  1.00 4.62  ? 190 LYS A HB2  2  
ATOM 5920  H HB3  . LYS A 1 190 ? -22.398 -6.305  12.680  1.00 4.57  ? 190 LYS A HB3  2  
ATOM 5921  H HG2  . LYS A 1 190 ? -23.909 -7.198  11.060  1.00 5.34  ? 190 LYS A HG2  2  
ATOM 5922  H HG3  . LYS A 1 190 ? -22.607 -7.999  10.180  1.00 5.31  ? 190 LYS A HG3  2  
ATOM 5923  H HD2  . LYS A 1 190 ? -22.231 -9.524  12.055  1.00 5.90  ? 190 LYS A HD2  2  
ATOM 5924  H HD3  . LYS A 1 190 ? -23.457 -8.689  13.009  1.00 5.84  ? 190 LYS A HD3  2  
ATOM 5925  H HE2  . LYS A 1 190 ? -24.347 -10.761 11.964  1.00 7.01  ? 190 LYS A HE2  2  
ATOM 5926  H HE3  . LYS A 1 190 ? -25.185 -9.320  11.389  1.00 7.05  ? 190 LYS A HE3  2  
ATOM 5927  H HZ1  . LYS A 1 190 ? -24.577 -9.806  9.333   1.00 7.47  ? 190 LYS A HZ1  2  
ATOM 5928  H HZ2  . LYS A 1 190 ? -23.826 -11.228 9.882   1.00 7.70  ? 190 LYS A HZ2  2  
ATOM 5929  H HZ3  . LYS A 1 190 ? -22.938 -9.784  9.769   1.00 7.76  ? 190 LYS A HZ3  2  
ATOM 5930  N N    . MET A 1 191 ? -22.881 -5.580  8.898   1.00 3.81  ? 191 MET A N    2  
ATOM 5931  C CA   . MET A 1 191 ? -24.015 -5.059  8.080   1.00 4.63  ? 191 MET A CA   2  
ATOM 5932  C C    . MET A 1 191 ? -25.342 -5.278  8.824   1.00 4.97  ? 191 MET A C    2  
ATOM 5933  O O    . MET A 1 191 ? -25.467 -4.966  9.990   1.00 5.27  ? 191 MET A O    2  
ATOM 5934  C CB   . MET A 1 191 ? -24.040 -5.801  6.738   1.00 5.48  ? 191 MET A CB   2  
ATOM 5935  C CG   . MET A 1 191 ? -24.009 -7.314  6.975   1.00 5.71  ? 191 MET A CG   2  
ATOM 5936  S SD   . MET A 1 191 ? -24.116 -8.170  5.381   1.00 7.00  ? 191 MET A SD   2  
ATOM 5937  C CE   . MET A 1 191 ? -25.090 -9.591  5.936   1.00 7.52  ? 191 MET A CE   2  
ATOM 5938  H H    . MET A 1 191 ? -22.307 -6.283  8.539   1.00 3.68  ? 191 MET A H    2  
ATOM 5939  H HA   . MET A 1 191 ? -23.878 -4.004  7.886   1.00 4.86  ? 191 MET A HA   2  
ATOM 5940  H HB2  . MET A 1 191 ? -24.934 -5.537  6.194   1.00 5.74  ? 191 MET A HB2  2  
ATOM 5941  H HB3  . MET A 1 191 ? -23.175 -5.516  6.158   1.00 6.08  ? 191 MET A HB3  2  
ATOM 5942  H HG2  . MET A 1 191 ? -23.084 -7.581  7.465   1.00 5.63  ? 191 MET A HG2  2  
ATOM 5943  H HG3  . MET A 1 191 ? -24.843 -7.601  7.597   1.00 5.60  ? 191 MET A HG3  2  
ATOM 5944  H HE1  . MET A 1 191 ? -24.618 -10.035 6.801   1.00 7.54  ? 191 MET A HE1  2  
ATOM 5945  H HE2  . MET A 1 191 ? -25.146 -10.322 5.144   1.00 7.75  ? 191 MET A HE2  2  
ATOM 5946  H HE3  . MET A 1 191 ? -26.089 -9.264  6.191   1.00 7.88  ? 191 MET A HE3  2  
ATOM 5947  N N    . GLY A 1 192 ? -26.335 -5.810  8.162   1.00 5.37  ? 192 GLY A N    2  
ATOM 5948  C CA   . GLY A 1 192 ? -27.644 -6.042  8.839   1.00 6.15  ? 192 GLY A CA   2  
ATOM 5949  C C    . GLY A 1 192 ? -28.439 -4.736  8.877   1.00 6.68  ? 192 GLY A C    2  
ATOM 5950  O O    . GLY A 1 192 ? -29.536 -4.748  9.412   1.00 7.01  ? 192 GLY A O    2  
ATOM 5951  O OXT  . GLY A 1 192 ? -27.938 -3.745  8.370   1.00 7.06  ? 192 GLY A OXT  2  
ATOM 5952  H H    . GLY A 1 192 ? -26.224 -6.058  7.223   1.00 5.43  ? 192 GLY A H    2  
ATOM 5953  H HA2  . GLY A 1 192 ? -28.203 -6.789  8.293   1.00 6.42  ? 192 GLY A HA2  2  
ATOM 5954  H HA3  . GLY A 1 192 ? -27.474 -6.385  9.848   1.00 6.42  ? 192 GLY A HA3  2  
ATOM 5955  N N    . MET A 1 1   ? 40.422  -5.555  -7.462  1.00 17.15 ? 1   MET A N    3  
ATOM 5956  C CA   . MET A 1 1   ? 40.799  -4.911  -6.173  1.00 16.73 ? 1   MET A CA   3  
ATOM 5957  C C    . MET A 1 1   ? 40.007  -3.613  -6.000  1.00 16.39 ? 1   MET A C    3  
ATOM 5958  O O    . MET A 1 1   ? 39.816  -2.862  -6.936  1.00 16.40 ? 1   MET A O    3  
ATOM 5959  C CB   . MET A 1 1   ? 42.297  -4.600  -6.178  1.00 16.98 ? 1   MET A CB   3  
ATOM 5960  C CG   . MET A 1 1   ? 43.090  -5.905  -6.275  1.00 17.51 ? 1   MET A CG   3  
ATOM 5961  S SD   . MET A 1 1   ? 44.862  -5.543  -6.196  1.00 17.69 ? 1   MET A SD   3  
ATOM 5962  C CE   . MET A 1 1   ? 45.431  -7.244  -5.961  1.00 17.86 ? 1   MET A CE   3  
ATOM 5963  H H1   . MET A 1 1   ? 39.441  -5.896  -7.406  1.00 17.22 ? 1   MET A H1   3  
ATOM 5964  H H2   . MET A 1 1   ? 41.059  -6.357  -7.649  1.00 17.32 ? 1   MET A H2   3  
ATOM 5965  H H3   . MET A 1 1   ? 40.501  -4.862  -8.233  1.00 17.33 ? 1   MET A H3   3  
ATOM 5966  H HA   . MET A 1 1   ? 40.574  -5.581  -5.356  1.00 16.65 ? 1   MET A HA   3  
ATOM 5967  H HB2  . MET A 1 1   ? 42.531  -3.971  -7.025  1.00 17.06 ? 1   MET A HB2  3  
ATOM 5968  H HB3  . MET A 1 1   ? 42.562  -4.087  -5.265  1.00 16.85 ? 1   MET A HB3  3  
ATOM 5969  H HG2  . MET A 1 1   ? 42.818  -6.553  -5.455  1.00 17.63 ? 1   MET A HG2  3  
ATOM 5970  H HG3  . MET A 1 1   ? 42.864  -6.394  -7.211  1.00 17.81 ? 1   MET A HG3  3  
ATOM 5971  H HE1  . MET A 1 1   ? 44.965  -7.884  -6.698  1.00 17.66 ? 1   MET A HE1  3  
ATOM 5972  H HE2  . MET A 1 1   ? 45.161  -7.583  -4.973  1.00 18.24 ? 1   MET A HE2  3  
ATOM 5973  H HE3  . MET A 1 1   ? 46.506  -7.282  -6.071  1.00 17.93 ? 1   MET A HE3  3  
ATOM 5974  N N    . ASP A 1 2   ? 39.545  -3.342  -4.809  1.00 16.24 ? 2   ASP A N    3  
ATOM 5975  C CA   . ASP A 1 2   ? 38.765  -2.093  -4.572  1.00 16.07 ? 2   ASP A CA   3  
ATOM 5976  C C    . ASP A 1 2   ? 38.866  -1.703  -3.096  1.00 15.50 ? 2   ASP A C    3  
ATOM 5977  O O    . ASP A 1 2   ? 38.957  -0.541  -2.755  1.00 15.56 ? 2   ASP A O    3  
ATOM 5978  C CB   . ASP A 1 2   ? 37.298  -2.330  -4.938  1.00 16.42 ? 2   ASP A CB   3  
ATOM 5979  C CG   . ASP A 1 2   ? 37.195  -2.713  -6.415  1.00 16.67 ? 2   ASP A CG   3  
ATOM 5980  O OD1  . ASP A 1 2   ? 37.209  -1.816  -7.242  1.00 16.88 ? 2   ASP A OD1  3  
ATOM 5981  O OD2  . ASP A 1 2   ? 37.104  -3.897  -6.695  1.00 16.77 ? 2   ASP A OD2  3  
ATOM 5982  H H    . ASP A 1 2   ? 39.711  -3.962  -4.068  1.00 16.34 ? 2   ASP A H    3  
ATOM 5983  H HA   . ASP A 1 2   ? 39.164  -1.294  -5.182  1.00 16.28 ? 2   ASP A HA   3  
ATOM 5984  H HB2  . ASP A 1 2   ? 36.901  -3.129  -4.329  1.00 16.55 ? 2   ASP A HB2  3  
ATOM 5985  H HB3  . ASP A 1 2   ? 36.732  -1.428  -4.762  1.00 16.53 ? 2   ASP A HB3  3  
ATOM 5986  N N    . GLY A 1 3   ? 38.853  -2.668  -2.218  1.00 15.11 ? 3   GLY A N    3  
ATOM 5987  C CA   . GLY A 1 3   ? 38.951  -2.354  -0.764  1.00 14.72 ? 3   GLY A CA   3  
ATOM 5988  C C    . GLY A 1 3   ? 37.634  -1.747  -0.276  1.00 14.60 ? 3   GLY A C    3  
ATOM 5989  O O    . GLY A 1 3   ? 37.616  -0.724  0.379   1.00 14.88 ? 3   GLY A O    3  
ATOM 5990  H H    . GLY A 1 3   ? 38.781  -3.599  -2.514  1.00 15.19 ? 3   GLY A H    3  
ATOM 5991  H HA2  . GLY A 1 3   ? 39.156  -3.262  -0.215  1.00 14.73 ? 3   GLY A HA2  3  
ATOM 5992  H HA3  . GLY A 1 3   ? 39.750  -1.647  -0.603  1.00 14.69 ? 3   GLY A HA3  3  
ATOM 5993  N N    . SER A 1 4   ? 36.531  -2.370  -0.591  1.00 14.34 ? 4   SER A N    3  
ATOM 5994  C CA   . SER A 1 4   ? 35.215  -1.831  -0.147  1.00 14.41 ? 4   SER A CA   3  
ATOM 5995  C C    . SER A 1 4   ? 35.049  -2.064  1.356   1.00 13.79 ? 4   SER A C    3  
ATOM 5996  O O    . SER A 1 4   ? 34.147  -1.539  1.978   1.00 14.02 ? 4   SER A O    3  
ATOM 5997  C CB   . SER A 1 4   ? 34.093  -2.547  -0.900  1.00 14.82 ? 4   SER A CB   3  
ATOM 5998  O OG   . SER A 1 4   ? 34.118  -3.931  -0.575  1.00 14.88 ? 4   SER A OG   3  
ATOM 5999  H H    . SER A 1 4   ? 36.569  -3.194  -1.122  1.00 14.23 ? 4   SER A H    3  
ATOM 6000  H HA   . SER A 1 4   ? 35.170  -0.772  -0.355  1.00 14.79 ? 4   SER A HA   3  
ATOM 6001  H HB2  . SER A 1 4   ? 33.141  -2.133  -0.611  1.00 15.17 ? 4   SER A HB2  3  
ATOM 6002  H HB3  . SER A 1 4   ? 34.233  -2.414  -1.965  1.00 14.87 ? 4   SER A HB3  3  
ATOM 6003  H HG   . SER A 1 4   ? 33.849  -4.025  0.342   1.00 14.91 ? 4   SER A HG   3  
ATOM 6004  N N    . GLY A 1 5   ? 35.913  -2.843  1.947   1.00 13.15 ? 5   GLY A N    3  
ATOM 6005  C CA   . GLY A 1 5   ? 35.802  -3.101  3.411   1.00 12.67 ? 5   GLY A CA   3  
ATOM 6006  C C    . GLY A 1 5   ? 34.620  -4.032  3.682   1.00 12.31 ? 5   GLY A C    3  
ATOM 6007  O O    . GLY A 1 5   ? 34.770  -5.090  4.260   1.00 12.37 ? 5   GLY A O    3  
ATOM 6008  H H    . GLY A 1 5   ? 36.636  -3.255  1.430   1.00 13.09 ? 5   GLY A H    3  
ATOM 6009  H HA2  . GLY A 1 5   ? 36.712  -3.561  3.765   1.00 12.77 ? 5   GLY A HA2  3  
ATOM 6010  H HA3  . GLY A 1 5   ? 35.644  -2.168  3.930   1.00 12.67 ? 5   GLY A HA3  3  
ATOM 6011  N N    . GLU A 1 6   ? 33.444  -3.645  3.273   1.00 12.14 ? 6   GLU A N    3  
ATOM 6012  C CA   . GLU A 1 6   ? 32.254  -4.507  3.513   1.00 12.01 ? 6   GLU A CA   3  
ATOM 6013  C C    . GLU A 1 6   ? 31.076  -3.988  2.682   1.00 11.53 ? 6   GLU A C    3  
ATOM 6014  O O    . GLU A 1 6   ? 30.765  -4.517  1.634   1.00 11.57 ? 6   GLU A O    3  
ATOM 6015  C CB   . GLU A 1 6   ? 31.897  -4.470  5.001   1.00 12.39 ? 6   GLU A CB   3  
ATOM 6016  C CG   . GLU A 1 6   ? 30.844  -5.535  5.301   1.00 12.94 ? 6   GLU A CG   3  
ATOM 6017  C CD   . GLU A 1 6   ? 31.490  -6.920  5.248   1.00 13.31 ? 6   GLU A CD   3  
ATOM 6018  O OE1  . GLU A 1 6   ? 31.982  -7.363  6.273   1.00 13.50 ? 6   GLU A OE1  3  
ATOM 6019  O OE2  . GLU A 1 6   ? 31.485  -7.514  4.182   1.00 13.55 ? 6   GLU A OE2  3  
ATOM 6020  H H    . GLU A 1 6   ? 33.342  -2.787  2.812   1.00 12.23 ? 6   GLU A H    3  
ATOM 6021  H HA   . GLU A 1 6   ? 32.480  -5.522  3.222   1.00 12.19 ? 6   GLU A HA   3  
ATOM 6022  H HB2  . GLU A 1 6   ? 32.784  -4.665  5.586   1.00 12.50 ? 6   GLU A HB2  3  
ATOM 6023  H HB3  . GLU A 1 6   ? 31.506  -3.497  5.255   1.00 12.34 ? 6   GLU A HB3  3  
ATOM 6024  H HG2  . GLU A 1 6   ? 30.433  -5.366  6.285   1.00 13.05 ? 6   GLU A HG2  3  
ATOM 6025  H HG3  . GLU A 1 6   ? 30.055  -5.479  4.566   1.00 13.14 ? 6   GLU A HG3  3  
ATOM 6026  N N    . GLN A 1 7   ? 30.426  -2.952  3.137   1.00 11.25 ? 7   GLN A N    3  
ATOM 6027  C CA   . GLN A 1 7   ? 29.277  -2.396  2.367   1.00 10.97 ? 7   GLN A CA   3  
ATOM 6028  C C    . GLN A 1 7   ? 28.895  -1.014  2.925   1.00 10.29 ? 7   GLN A C    3  
ATOM 6029  O O    . GLN A 1 7   ? 27.786  -0.827  3.382   1.00 10.41 ? 7   GLN A O    3  
ATOM 6030  C CB   . GLN A 1 7   ? 28.079  -3.355  2.475   1.00 11.52 ? 7   GLN A CB   3  
ATOM 6031  C CG   . GLN A 1 7   ? 27.720  -3.608  3.953   1.00 12.08 ? 7   GLN A CG   3  
ATOM 6032  C CD   . GLN A 1 7   ? 27.002  -4.955  4.093   1.00 12.56 ? 7   GLN A CD   3  
ATOM 6033  O OE1  . GLN A 1 7   ? 26.037  -5.218  3.403   1.00 12.91 ? 7   GLN A OE1  3  
ATOM 6034  N NE2  . GLN A 1 7   ? 27.436  -5.823  4.965   1.00 12.77 ? 7   GLN A NE2  3  
ATOM 6035  H H    . GLN A 1 7   ? 30.696  -2.534  3.980   1.00 11.36 ? 7   GLN A H    3  
ATOM 6036  H HA   . GLN A 1 7   ? 29.559  -2.299  1.330   1.00 11.07 ? 7   GLN A HA   3  
ATOM 6037  H HB2  . GLN A 1 7   ? 27.229  -2.921  1.969   1.00 11.67 ? 7   GLN A HB2  3  
ATOM 6038  H HB3  . GLN A 1 7   ? 28.335  -4.292  2.002   1.00 11.58 ? 7   GLN A HB3  3  
ATOM 6039  H HG2  . GLN A 1 7   ? 28.618  -3.620  4.552   1.00 12.23 ? 7   GLN A HG2  3  
ATOM 6040  H HG3  . GLN A 1 7   ? 27.066  -2.824  4.305   1.00 12.20 ? 7   GLN A HG3  3  
ATOM 6041  H HE21 . GLN A 1 7   ? 28.214  -5.611  5.522   1.00 12.61 ? 7   GLN A HE21 3  
ATOM 6042  H HE22 . GLN A 1 7   ? 26.984  -6.687  5.063   1.00 13.18 ? 7   GLN A HE22 3  
ATOM 6043  N N    . PRO A 1 8   ? 29.818  -0.073  2.875   1.00 9.81  ? 8   PRO A N    3  
ATOM 6044  C CA   . PRO A 1 8   ? 29.556  1.287   3.385   1.00 9.37  ? 8   PRO A CA   3  
ATOM 6045  C C    . PRO A 1 8   ? 28.371  1.913   2.635   1.00 9.09  ? 8   PRO A C    3  
ATOM 6046  O O    . PRO A 1 8   ? 28.368  2.002   1.423   1.00 9.07  ? 8   PRO A O    3  
ATOM 6047  C CB   . PRO A 1 8   ? 30.867  2.071   3.129   1.00 9.20  ? 8   PRO A CB   3  
ATOM 6048  C CG   . PRO A 1 8   ? 31.868  1.099   2.438   1.00 9.57  ? 8   PRO A CG   3  
ATOM 6049  C CD   . PRO A 1 8   ? 31.174  -0.276  2.313   1.00 9.93  ? 8   PRO A CD   3  
ATOM 6050  H HA   . PRO A 1 8   ? 29.347  1.252   4.444   1.00 9.66  ? 8   PRO A HA   3  
ATOM 6051  H HB2  . PRO A 1 8   ? 30.676  2.926   2.488   1.00 8.88  ? 8   PRO A HB2  3  
ATOM 6052  H HB3  . PRO A 1 8   ? 31.283  2.412   4.068   1.00 9.40  ? 8   PRO A HB3  3  
ATOM 6053  H HG2  . PRO A 1 8   ? 32.128  1.476   1.455   1.00 9.46  ? 8   PRO A HG2  3  
ATOM 6054  H HG3  . PRO A 1 8   ? 32.764  1.003   3.037   1.00 9.94  ? 8   PRO A HG3  3  
ATOM 6055  H HD2  . PRO A 1 8   ? 31.113  -0.576  1.275   1.00 10.00 ? 8   PRO A HD2  3  
ATOM 6056  H HD3  . PRO A 1 8   ? 31.707  -1.017  2.887   1.00 10.41 ? 8   PRO A HD3  3  
ATOM 6057  N N    . ARG A 1 9   ? 27.371  2.352   3.349   1.00 9.13  ? 9   ARG A N    3  
ATOM 6058  C CA   . ARG A 1 9   ? 26.195  2.975   2.679   1.00 9.14  ? 9   ARG A CA   3  
ATOM 6059  C C    . ARG A 1 9   ? 26.588  4.357   2.155   1.00 8.60  ? 9   ARG A C    3  
ATOM 6060  O O    . ARG A 1 9   ? 27.575  4.931   2.572   1.00 8.68  ? 9   ARG A O    3  
ATOM 6061  C CB   . ARG A 1 9   ? 25.049  3.119   3.685   1.00 10.09 ? 9   ARG A CB   3  
ATOM 6062  C CG   . ARG A 1 9   ? 24.547  1.732   4.090   1.00 10.67 ? 9   ARG A CG   3  
ATOM 6063  C CD   . ARG A 1 9   ? 23.329  1.878   5.005   1.00 11.51 ? 9   ARG A CD   3  
ATOM 6064  N NE   . ARG A 1 9   ? 23.665  2.783   6.139   1.00 12.05 ? 9   ARG A NE   3  
ATOM 6065  C CZ   . ARG A 1 9   ? 22.714  3.284   6.879   1.00 12.65 ? 9   ARG A CZ   3  
ATOM 6066  N NH1  . ARG A 1 9   ? 21.468  2.990   6.626   1.00 12.79 ? 9   ARG A NH1  3  
ATOM 6067  N NH2  . ARG A 1 9   ? 23.009  4.078   7.871   1.00 13.27 ? 9   ARG A NH2  3  
ATOM 6068  H H    . ARG A 1 9   ? 27.395  2.275   4.326   1.00 9.33  ? 9   ARG A H    3  
ATOM 6069  H HA   . ARG A 1 9   ? 25.877  2.353   1.855   1.00 9.10  ? 9   ARG A HA   3  
ATOM 6070  H HB2  . ARG A 1 9   ? 25.403  3.645   4.560   1.00 10.28 ? 9   ARG A HB2  3  
ATOM 6071  H HB3  . ARG A 1 9   ? 24.241  3.674   3.233   1.00 10.40 ? 9   ARG A HB3  3  
ATOM 6072  H HG2  . ARG A 1 9   ? 24.270  1.177   3.206   1.00 10.72 ? 9   ARG A HG2  3  
ATOM 6073  H HG3  . ARG A 1 9   ? 25.329  1.206   4.617   1.00 10.65 ? 9   ARG A HG3  3  
ATOM 6074  H HD2  . ARG A 1 9   ? 22.505  2.294   4.444   1.00 11.82 ? 9   ARG A HD2  3  
ATOM 6075  H HD3  . ARG A 1 9   ? 23.048  0.907   5.388   1.00 11.59 ? 9   ARG A HD3  3  
ATOM 6076  H HE   . ARG A 1 9   ? 24.601  3.002   6.330   1.00 12.08 ? 9   ARG A HE   3  
ATOM 6077  H HH11 . ARG A 1 9   ? 21.242  2.381   5.866   1.00 12.44 ? 9   ARG A HH11 3  
ATOM 6078  H HH12 . ARG A 1 9   ? 20.739  3.374   7.193   1.00 13.36 ? 9   ARG A HH12 3  
ATOM 6079  H HH21 . ARG A 1 9   ? 23.964  4.303   8.065   1.00 13.29 ? 9   ARG A HH21 3  
ATOM 6080  H HH22 . ARG A 1 9   ? 22.280  4.462   8.438   1.00 13.82 ? 9   ARG A HH22 3  
ATOM 6081  N N    . GLY A 1 10  ? 25.827  4.898   1.245   1.00 8.29  ? 10  GLY A N    3  
ATOM 6082  C CA   . GLY A 1 10  ? 26.162  6.243   0.698   1.00 8.00  ? 10  GLY A CA   3  
ATOM 6083  C C    . GLY A 1 10  ? 25.148  6.623   -0.381  1.00 7.45  ? 10  GLY A C    3  
ATOM 6084  O O    . GLY A 1 10  ? 24.768  7.769   -0.515  1.00 7.68  ? 10  GLY A O    3  
ATOM 6085  H H    . GLY A 1 10  ? 25.035  4.420   0.920   1.00 8.43  ? 10  GLY A H    3  
ATOM 6086  H HA2  . GLY A 1 10  ? 26.134  6.973   1.494   1.00 8.37  ? 10  GLY A HA2  3  
ATOM 6087  H HA3  . GLY A 1 10  ? 27.151  6.220   0.265   1.00 8.08  ? 10  GLY A HA3  3  
ATOM 6088  N N    . GLY A 1 11  ? 24.706  5.668   -1.152  1.00 7.01  ? 11  GLY A N    3  
ATOM 6089  C CA   . GLY A 1 11  ? 23.715  5.973   -2.223  1.00 6.74  ? 11  GLY A CA   3  
ATOM 6090  C C    . GLY A 1 11  ? 23.507  4.732   -3.091  1.00 5.83  ? 11  GLY A C    3  
ATOM 6091  O O    . GLY A 1 11  ? 23.014  4.812   -4.198  1.00 6.06  ? 11  GLY A O    3  
ATOM 6092  H H    . GLY A 1 11  ? 25.025  4.750   -1.028  1.00 7.06  ? 11  GLY A H    3  
ATOM 6093  H HA2  . GLY A 1 11  ? 22.777  6.262   -1.773  1.00 7.27  ? 11  GLY A HA2  3  
ATOM 6094  H HA3  . GLY A 1 11  ? 24.085  6.779   -2.837  1.00 6.94  ? 11  GLY A HA3  3  
ATOM 6095  N N    . GLY A 1 12  ? 23.881  3.582   -2.599  1.00 5.12  ? 12  GLY A N    3  
ATOM 6096  C CA   . GLY A 1 12  ? 23.705  2.339   -3.400  1.00 4.52  ? 12  GLY A CA   3  
ATOM 6097  C C    . GLY A 1 12  ? 22.208  2.018   -3.530  1.00 3.52  ? 12  GLY A C    3  
ATOM 6098  O O    . GLY A 1 12  ? 21.381  2.755   -3.031  1.00 3.54  ? 12  GLY A O    3  
ATOM 6099  H H    . GLY A 1 12  ? 24.279  3.538   -1.704  1.00 5.25  ? 12  GLY A H    3  
ATOM 6100  H HA2  . GLY A 1 12  ? 24.132  2.489   -4.381  1.00 4.85  ? 12  GLY A HA2  3  
ATOM 6101  H HA3  . GLY A 1 12  ? 24.206  1.520   -2.908  1.00 4.89  ? 12  GLY A HA3  3  
ATOM 6102  N N    . PRO A 1 13  ? 21.895  0.923   -4.193  1.00 3.15  ? 13  PRO A N    3  
ATOM 6103  C CA   . PRO A 1 13  ? 20.491  0.497   -4.387  1.00 2.77  ? 13  PRO A CA   3  
ATOM 6104  C C    . PRO A 1 13  ? 19.792  0.240   -3.037  1.00 2.05  ? 13  PRO A C    3  
ATOM 6105  O O    . PRO A 1 13  ? 18.764  -0.406  -2.981  1.00 2.37  ? 13  PRO A O    3  
ATOM 6106  C CB   . PRO A 1 13  ? 20.585  -0.806  -5.223  1.00 3.47  ? 13  PRO A CB   3  
ATOM 6107  C CG   . PRO A 1 13  ? 22.089  -1.051  -5.547  1.00 3.99  ? 13  PRO A CG   3  
ATOM 6108  C CD   . PRO A 1 13  ? 22.905  0.033   -4.808  1.00 3.79  ? 13  PRO A CD   3  
ATOM 6109  H HA   . PRO A 1 13  ? 19.952  1.249   -4.943  1.00 3.21  ? 13  PRO A HA   3  
ATOM 6110  H HB2  . PRO A 1 13  ? 20.188  -1.645  -4.660  1.00 3.49  ? 13  PRO A HB2  3  
ATOM 6111  H HB3  . PRO A 1 13  ? 20.029  -0.695  -6.144  1.00 4.08  ? 13  PRO A HB3  3  
ATOM 6112  H HG2  . PRO A 1 13  ? 22.393  -2.033  -5.201  1.00 4.37  ? 13  PRO A HG2  3  
ATOM 6113  H HG3  . PRO A 1 13  ? 22.251  -0.956  -6.613  1.00 4.57  ? 13  PRO A HG3  3  
ATOM 6114  H HD2  . PRO A 1 13  ? 23.527  -0.414  -4.043  1.00 4.09  ? 13  PRO A HD2  3  
ATOM 6115  H HD3  . PRO A 1 13  ? 23.512  0.589   -5.507  1.00 4.27  ? 13  PRO A HD3  3  
ATOM 6116  N N    . THR A 1 14  ? 20.338  0.738   -1.954  1.00 1.59  ? 14  THR A N    3  
ATOM 6117  C CA   . THR A 1 14  ? 19.707  0.525   -0.614  1.00 1.24  ? 14  THR A CA   3  
ATOM 6118  C C    . THR A 1 14  ? 19.770  1.824   0.194   1.00 1.07  ? 14  THR A C    3  
ATOM 6119  O O    . THR A 1 14  ? 20.186  1.830   1.336   1.00 1.20  ? 14  THR A O    3  
ATOM 6120  C CB   . THR A 1 14  ? 20.469  -0.573  0.131   1.00 1.43  ? 14  THR A CB   3  
ATOM 6121  O OG1  . THR A 1 14  ? 21.805  -0.145  0.360   1.00 2.16  ? 14  THR A OG1  3  
ATOM 6122  C CG2  . THR A 1 14  ? 20.478  -1.848  -0.713  1.00 1.78  ? 14  THR A CG2  3  
ATOM 6123  H H    . THR A 1 14  ? 21.169  1.245   -2.023  1.00 1.96  ? 14  THR A H    3  
ATOM 6124  H HA   . THR A 1 14  ? 18.673  0.228   -0.731  1.00 1.69  ? 14  THR A HA   3  
ATOM 6125  H HB   . THR A 1 14  ? 19.986  -0.772  1.075   1.00 1.94  ? 14  THR A HB   3  
ATOM 6126  H HG1  . THR A 1 14  ? 22.059  0.434   -0.362  1.00 2.49  ? 14  THR A HG1  3  
ATOM 6127  H HG21 . THR A 1 14  ? 19.464  -2.113  -0.974  1.00 2.04  ? 14  THR A HG21 3  
ATOM 6128  H HG22 . THR A 1 14  ? 20.926  -2.651  -0.147  1.00 2.29  ? 14  THR A HG22 3  
ATOM 6129  H HG23 . THR A 1 14  ? 21.049  -1.680  -1.614  1.00 2.23  ? 14  THR A HG23 3  
ATOM 6130  N N    . SER A 1 15  ? 19.368  2.927   -0.398  1.00 1.07  ? 15  SER A N    3  
ATOM 6131  C CA   . SER A 1 15  ? 19.409  4.244   0.323   1.00 0.91  ? 15  SER A CA   3  
ATOM 6132  C C    . SER A 1 15  ? 17.988  4.774   0.530   1.00 0.75  ? 15  SER A C    3  
ATOM 6133  O O    . SER A 1 15  ? 17.168  4.730   -0.366  1.00 0.78  ? 15  SER A O    3  
ATOM 6134  C CB   . SER A 1 15  ? 20.202  5.251   -0.510  1.00 0.99  ? 15  SER A CB   3  
ATOM 6135  O OG   . SER A 1 15  ? 19.405  5.685   -1.605  1.00 1.38  ? 15  SER A OG   3  
ATOM 6136  H H    . SER A 1 15  ? 19.050  2.881   -1.324  1.00 1.34  ? 15  SER A H    3  
ATOM 6137  H HA   . SER A 1 15  ? 19.893  4.116   1.281   1.00 0.94  ? 15  SER A HA   3  
ATOM 6138  H HB2  . SER A 1 15  ? 20.460  6.101   0.100   1.00 1.46  ? 15  SER A HB2  3  
ATOM 6139  H HB3  . SER A 1 15  ? 21.107  4.782   -0.873  1.00 1.34  ? 15  SER A HB3  3  
ATOM 6140  H HG   . SER A 1 15  ? 18.673  6.198   -1.255  1.00 1.70  ? 15  SER A HG   3  
ATOM 6141  N N    . SER A 1 16  ? 17.689  5.278   1.700   1.00 0.72  ? 16  SER A N    3  
ATOM 6142  C CA   . SER A 1 16  ? 16.318  5.817   1.960   1.00 0.82  ? 16  SER A CA   3  
ATOM 6143  C C    . SER A 1 16  ? 15.875  6.677   0.770   1.00 0.81  ? 16  SER A C    3  
ATOM 6144  O O    . SER A 1 16  ? 14.777  6.539   0.269   1.00 0.92  ? 16  SER A O    3  
ATOM 6145  C CB   . SER A 1 16  ? 16.337  6.669   3.231   1.00 1.06  ? 16  SER A CB   3  
ATOM 6146  O OG   . SER A 1 16  ? 15.046  7.224   3.445   1.00 1.64  ? 16  SER A OG   3  
ATOM 6147  H H    . SER A 1 16  ? 18.369  5.295   2.406   1.00 0.74  ? 16  SER A H    3  
ATOM 6148  H HA   . SER A 1 16  ? 15.628  4.997   2.087   1.00 0.88  ? 16  SER A HA   3  
ATOM 6149  H HB2  . SER A 1 16  ? 16.602  6.054   4.075   1.00 1.49  ? 16  SER A HB2  3  
ATOM 6150  H HB3  . SER A 1 16  ? 17.067  7.461   3.122   1.00 1.64  ? 16  SER A HB3  3  
ATOM 6151  H HG   . SER A 1 16  ? 14.566  7.189   2.614   1.00 2.08  ? 16  SER A HG   3  
ATOM 6152  N N    . GLU A 1 17  ? 16.720  7.567   0.321   1.00 0.80  ? 17  GLU A N    3  
ATOM 6153  C CA   . GLU A 1 17  ? 16.357  8.445   -0.830  1.00 0.94  ? 17  GLU A CA   3  
ATOM 6154  C C    . GLU A 1 17  ? 15.661  7.639   -1.933  1.00 0.85  ? 17  GLU A C    3  
ATOM 6155  O O    . GLU A 1 17  ? 14.604  8.002   -2.410  1.00 0.89  ? 17  GLU A O    3  
ATOM 6156  C CB   . GLU A 1 17  ? 17.620  9.101   -1.394  1.00 1.13  ? 17  GLU A CB   3  
ATOM 6157  C CG   . GLU A 1 17  ? 17.229  10.210  -2.375  1.00 1.71  ? 17  GLU A CG   3  
ATOM 6158  C CD   . GLU A 1 17  ? 16.621  11.384  -1.606  1.00 2.26  ? 17  GLU A CD   3  
ATOM 6159  O OE1  . GLU A 1 17  ? 17.381  12.182  -1.082  1.00 2.68  ? 17  GLU A OE1  3  
ATOM 6160  O OE2  . GLU A 1 17  ? 15.404  11.466  -1.553  1.00 2.90  ? 17  GLU A OE2  3  
ATOM 6161  H H    . GLU A 1 17  ? 17.596  7.669   0.749   1.00 0.79  ? 17  GLU A H    3  
ATOM 6162  H HA   . GLU A 1 17  ? 15.676  9.216   -0.501  1.00 1.09  ? 17  GLU A HA   3  
ATOM 6163  H HB2  . GLU A 1 17  ? 18.198  9.523   -0.585  1.00 1.54  ? 17  GLU A HB2  3  
ATOM 6164  H HB3  . GLU A 1 17  ? 18.211  8.359   -1.910  1.00 1.46  ? 17  GLU A HB3  3  
ATOM 6165  H HG2  . GLU A 1 17  ? 18.107  10.544  -2.909  1.00 2.27  ? 17  GLU A HG2  3  
ATOM 6166  H HG3  . GLU A 1 17  ? 16.504  9.829   -3.079  1.00 2.07  ? 17  GLU A HG3  3  
ATOM 6167  N N    . GLN A 1 18  ? 16.253  6.548   -2.348  1.00 0.80  ? 18  GLN A N    3  
ATOM 6168  C CA   . GLN A 1 18  ? 15.634  5.721   -3.425  1.00 0.83  ? 18  GLN A CA   3  
ATOM 6169  C C    . GLN A 1 18  ? 14.298  5.156   -2.938  1.00 0.68  ? 18  GLN A C    3  
ATOM 6170  O O    . GLN A 1 18  ? 13.328  5.119   -3.668  1.00 0.69  ? 18  GLN A O    3  
ATOM 6171  C CB   . GLN A 1 18  ? 16.571  4.565   -3.786  1.00 0.96  ? 18  GLN A CB   3  
ATOM 6172  C CG   . GLN A 1 18  ? 17.820  5.113   -4.477  1.00 1.53  ? 18  GLN A CG   3  
ATOM 6173  C CD   . GLN A 1 18  ? 18.817  3.974   -4.707  1.00 2.23  ? 18  GLN A CD   3  
ATOM 6174  O OE1  . GLN A 1 18  ? 19.133  3.234   -3.797  1.00 2.69  ? 18  GLN A OE1  3  
ATOM 6175  N NE2  . GLN A 1 18  ? 19.330  3.801   -5.895  1.00 3.07  ? 18  GLN A NE2  3  
ATOM 6176  H H    . GLN A 1 18  ? 17.109  6.277   -1.954  1.00 0.80  ? 18  GLN A H    3  
ATOM 6177  H HA   . GLN A 1 18  ? 15.467  6.337   -4.298  1.00 0.96  ? 18  GLN A HA   3  
ATOM 6178  H HB2  . GLN A 1 18  ? 16.857  4.040   -2.886  1.00 1.31  ? 18  GLN A HB2  3  
ATOM 6179  H HB3  . GLN A 1 18  ? 16.063  3.885   -4.453  1.00 1.16  ? 18  GLN A HB3  3  
ATOM 6180  H HG2  . GLN A 1 18  ? 17.542  5.549   -5.425  1.00 1.79  ? 18  GLN A HG2  3  
ATOM 6181  H HG3  . GLN A 1 18  ? 18.275  5.866   -3.852  1.00 2.17  ? 18  GLN A HG3  3  
ATOM 6182  H HE21 . GLN A 1 18  ? 19.077  4.397   -6.630  1.00 3.31  ? 18  GLN A HE21 3  
ATOM 6183  H HE22 . GLN A 1 18  ? 19.969  3.074   -6.052  1.00 3.76  ? 18  GLN A HE22 3  
ATOM 6184  N N    . ILE A 1 19  ? 14.236  4.720   -1.710  1.00 0.59  ? 19  ILE A N    3  
ATOM 6185  C CA   . ILE A 1 19  ? 12.958  4.166   -1.183  1.00 0.58  ? 19  ILE A CA   3  
ATOM 6186  C C    . ILE A 1 19  ? 11.917  5.281   -1.110  1.00 0.52  ? 19  ILE A C    3  
ATOM 6187  O O    . ILE A 1 19  ? 10.781  5.120   -1.510  1.00 0.59  ? 19  ILE A O    3  
ATOM 6188  C CB   . ILE A 1 19  ? 13.186  3.568   0.202   1.00 0.64  ? 19  ILE A CB   3  
ATOM 6189  C CG1  . ILE A 1 19  ? 14.200  2.425   0.092   1.00 0.74  ? 19  ILE A CG1  3  
ATOM 6190  C CG2  . ILE A 1 19  ? 11.864  3.024   0.744   1.00 0.73  ? 19  ILE A CG2  3  
ATOM 6191  C CD1  . ILE A 1 19  ? 14.665  2.000   1.489   1.00 0.81  ? 19  ILE A CD1  3  
ATOM 6192  H H    . ILE A 1 19  ? 15.027  4.765   -1.133  1.00 0.59  ? 19  ILE A H    3  
ATOM 6193  H HA   . ILE A 1 19  ? 12.586  3.401   -1.847  1.00 0.68  ? 19  ILE A HA   3  
ATOM 6194  H HB   . ILE A 1 19  ? 13.566  4.330   0.867   1.00 0.65  ? 19  ILE A HB   3  
ATOM 6195  H HG12 . ILE A 1 19  ? 13.737  1.584   -0.404  1.00 0.83  ? 19  ILE A HG12 3  
ATOM 6196  H HG13 . ILE A 1 19  ? 15.052  2.755   -0.483  1.00 0.77  ? 19  ILE A HG13 3  
ATOM 6197  H HG21 . ILE A 1 19  ? 12.049  2.461   1.647   1.00 1.13  ? 19  ILE A HG21 3  
ATOM 6198  H HG22 . ILE A 1 19  ? 11.411  2.380   0.005   1.00 1.26  ? 19  ILE A HG22 3  
ATOM 6199  H HG23 . ILE A 1 19  ? 11.198  3.846   0.962   1.00 1.33  ? 19  ILE A HG23 3  
ATOM 6200  H HD11 . ILE A 1 19  ? 15.051  0.992   1.446   1.00 1.45  ? 19  ILE A HD11 3  
ATOM 6201  H HD12 . ILE A 1 19  ? 13.833  2.036   2.178   1.00 1.18  ? 19  ILE A HD12 3  
ATOM 6202  H HD13 . ILE A 1 19  ? 15.443  2.668   1.827   1.00 1.28  ? 19  ILE A HD13 3  
ATOM 6203  N N    . MET A 1 20  ? 12.309  6.420   -0.617  1.00 0.51  ? 20  MET A N    3  
ATOM 6204  C CA   . MET A 1 20  ? 11.386  7.580   -0.517  1.00 0.60  ? 20  MET A CA   3  
ATOM 6205  C C    . MET A 1 20  ? 10.864  7.987   -1.899  1.00 0.55  ? 20  MET A C    3  
ATOM 6206  O O    . MET A 1 20  ? 9.725   8.377   -2.063  1.00 0.59  ? 20  MET A O    3  
ATOM 6207  C CB   . MET A 1 20  ? 12.197  8.763   0.078   1.00 0.82  ? 20  MET A CB   3  
ATOM 6208  C CG   . MET A 1 20  ? 11.905  8.893   1.587   1.00 1.07  ? 20  MET A CG   3  
ATOM 6209  S SD   . MET A 1 20  ? 10.203  9.490   1.821   1.00 1.43  ? 20  MET A SD   3  
ATOM 6210  C CE   . MET A 1 20  ? 9.576   8.133   2.851   1.00 0.93  ? 20  MET A CE   3  
ATOM 6211  H H    . MET A 1 20  ? 13.235  6.546   -0.319  1.00 0.57  ? 20  MET A H    3  
ATOM 6212  H HA   . MET A 1 20  ? 10.565  7.399   0.166   1.00 0.71  ? 20  MET A HA   3  
ATOM 6213  H HB2  . MET A 1 20  ? 13.251  8.581   -0.065  1.00 0.95  ? 20  MET A HB2  3  
ATOM 6214  H HB3  . MET A 1 20  ? 11.925  9.690   -0.411  1.00 1.15  ? 20  MET A HB3  3  
ATOM 6215  H HG2  . MET A 1 20  ? 12.023  7.928   2.058   1.00 1.52  ? 20  MET A HG2  3  
ATOM 6216  H HG3  . MET A 1 20  ? 12.597  9.595   2.028   1.00 1.72  ? 20  MET A HG3  3  
ATOM 6217  H HE1  . MET A 1 20  ? 10.240  7.979   3.691   1.00 1.32  ? 20  MET A HE1  3  
ATOM 6218  H HE2  . MET A 1 20  ? 9.525   7.229   2.266   1.00 1.36  ? 20  MET A HE2  3  
ATOM 6219  H HE3  . MET A 1 20  ? 8.584   8.382   3.210   1.00 1.55  ? 20  MET A HE3  3  
ATOM 6220  N N    . LYS A 1 21  ? 11.716  7.911   -2.894  1.00 0.57  ? 21  LYS A N    3  
ATOM 6221  C CA   . LYS A 1 21  ? 11.315  8.304   -4.274  1.00 0.61  ? 21  LYS A CA   3  
ATOM 6222  C C    . LYS A 1 21  ? 10.385  7.256   -4.880  1.00 0.53  ? 21  LYS A C    3  
ATOM 6223  O O    . LYS A 1 21  ? 9.303   7.567   -5.326  1.00 0.51  ? 21  LYS A O    3  
ATOM 6224  C CB   . LYS A 1 21  ? 12.565  8.406   -5.155  1.00 0.72  ? 21  LYS A CB   3  
ATOM 6225  C CG   . LYS A 1 21  ? 13.328  9.685   -4.825  1.00 1.09  ? 21  LYS A CG   3  
ATOM 6226  C CD   . LYS A 1 21  ? 14.629  9.715   -5.629  1.00 1.24  ? 21  LYS A CD   3  
ATOM 6227  C CE   . LYS A 1 21  ? 15.322  11.064  -5.435  1.00 1.80  ? 21  LYS A CE   3  
ATOM 6228  N NZ   . LYS A 1 21  ? 14.688  12.079  -6.324  1.00 2.40  ? 21  LYS A NZ   3  
ATOM 6229  H H    . LYS A 1 21  ? 12.636  7.610   -2.740  1.00 0.62  ? 21  LYS A H    3  
ATOM 6230  H HA   . LYS A 1 21  ? 10.822  9.263   -4.242  1.00 0.64  ? 21  LYS A HA   3  
ATOM 6231  H HB2  . LYS A 1 21  ? 13.201  7.552   -4.975  1.00 0.99  ? 21  LYS A HB2  3  
ATOM 6232  H HB3  . LYS A 1 21  ? 12.275  8.424   -6.196  1.00 0.93  ? 21  LYS A HB3  3  
ATOM 6233  H HG2  . LYS A 1 21  ? 12.723  10.542  -5.082  1.00 1.39  ? 21  LYS A HG2  3  
ATOM 6234  H HG3  . LYS A 1 21  ? 13.557  9.707   -3.770  1.00 1.41  ? 21  LYS A HG3  3  
ATOM 6235  H HD2  . LYS A 1 21  ? 15.281  8.923   -5.288  1.00 1.54  ? 21  LYS A HD2  3  
ATOM 6236  H HD3  . LYS A 1 21  ? 14.408  9.573   -6.676  1.00 1.52  ? 21  LYS A HD3  3  
ATOM 6237  H HE2  . LYS A 1 21  ? 15.226  11.376  -4.405  1.00 2.25  ? 21  LYS A HE2  3  
ATOM 6238  H HE3  . LYS A 1 21  ? 16.368  10.969  -5.686  1.00 2.26  ? 21  LYS A HE3  3  
ATOM 6239  H HZ1  . LYS A 1 21  ? 13.881  11.651  -6.819  1.00 2.80  ? 21  LYS A HZ1  3  
ATOM 6240  H HZ2  . LYS A 1 21  ? 15.386  12.414  -7.020  1.00 2.67  ? 21  LYS A HZ2  3  
ATOM 6241  H HZ3  . LYS A 1 21  ? 14.355  12.881  -5.752  1.00 2.91  ? 21  LYS A HZ3  3  
ATOM 6242  N N    . THR A 1 22  ? 10.789  6.014   -4.898  1.00 0.53  ? 22  THR A N    3  
ATOM 6243  C CA   . THR A 1 22  ? 9.916   4.958   -5.483  1.00 0.52  ? 22  THR A CA   3  
ATOM 6244  C C    . THR A 1 22  ? 8.650   4.815   -4.646  1.00 0.45  ? 22  THR A C    3  
ATOM 6245  O O    . THR A 1 22  ? 7.566   4.656   -5.165  1.00 0.48  ? 22  THR A O    3  
ATOM 6246  C CB   . THR A 1 22  ? 10.669  3.624   -5.487  1.00 0.55  ? 22  THR A CB   3  
ATOM 6247  O OG1  . THR A 1 22  ? 11.884  3.771   -6.209  1.00 0.64  ? 22  THR A OG1  3  
ATOM 6248  C CG2  . THR A 1 22  ? 9.806   2.549   -6.150  1.00 0.62  ? 22  THR A CG2  3  
ATOM 6249  H H    . THR A 1 22  ? 11.655  5.755   -4.514  1.00 0.56  ? 22  THR A H    3  
ATOM 6250  H HA   . THR A 1 22  ? 9.657   5.219   -6.498  1.00 0.57  ? 22  THR A HA   3  
ATOM 6251  H HB   . THR A 1 22  ? 10.887  3.330   -4.472  1.00 0.52  ? 22  THR A HB   3  
ATOM 6252  H HG1  . THR A 1 22  ? 11.699  4.283   -7.000  1.00 1.05  ? 22  THR A HG1  3  
ATOM 6253  H HG21 . THR A 1 22  ? 8.955   2.331   -5.521  1.00 1.17  ? 22  THR A HG21 3  
ATOM 6254  H HG22 . THR A 1 22  ? 10.391  1.651   -6.287  1.00 1.27  ? 22  THR A HG22 3  
ATOM 6255  H HG23 . THR A 1 22  ? 9.461   2.905   -7.110  1.00 1.12  ? 22  THR A HG23 3  
ATOM 6256  N N    . GLY A 1 23  ? 8.774   4.879   -3.352  1.00 0.42  ? 23  GLY A N    3  
ATOM 6257  C CA   . GLY A 1 23  ? 7.572   4.746   -2.488  1.00 0.43  ? 23  GLY A CA   3  
ATOM 6258  C C    . GLY A 1 23  ? 6.536   5.797   -2.892  1.00 0.41  ? 23  GLY A C    3  
ATOM 6259  O O    . GLY A 1 23  ? 5.377   5.493   -3.095  1.00 0.47  ? 23  GLY A O    3  
ATOM 6260  H H    . GLY A 1 23  ? 9.655   5.025   -2.948  1.00 0.42  ? 23  GLY A H    3  
ATOM 6261  H HA2  . GLY A 1 23  ? 7.151   3.758   -2.608  1.00 0.47  ? 23  GLY A HA2  3  
ATOM 6262  H HA3  . GLY A 1 23  ? 7.849   4.900   -1.457  1.00 0.46  ? 23  GLY A HA3  3  
ATOM 6263  N N    . ALA A 1 24  ? 6.943   7.031   -3.007  1.00 0.40  ? 24  ALA A N    3  
ATOM 6264  C CA   . ALA A 1 24  ? 5.988   8.107   -3.393  1.00 0.41  ? 24  ALA A CA   3  
ATOM 6265  C C    . ALA A 1 24  ? 5.627   8.005   -4.879  1.00 0.41  ? 24  ALA A C    3  
ATOM 6266  O O    . ALA A 1 24  ? 4.575   8.444   -5.302  1.00 0.41  ? 24  ALA A O    3  
ATOM 6267  C CB   . ALA A 1 24  ? 6.656   9.462   -3.163  1.00 0.42  ? 24  ALA A CB   3  
ATOM 6268  H H    . ALA A 1 24  ? 7.877   7.266   -2.835  1.00 0.44  ? 24  ALA A H    3  
ATOM 6269  H HA   . ALA A 1 24  ? 5.109   8.058   -2.766  1.00 0.41  ? 24  ALA A HA   3  
ATOM 6270  H HB1  . ALA A 1 24  ? 6.960   9.542   -2.130  1.00 1.06  ? 24  ALA A HB1  3  
ATOM 6271  H HB2  . ALA A 1 24  ? 5.953   10.251  -3.393  1.00 1.11  ? 24  ALA A HB2  3  
ATOM 6272  H HB3  . ALA A 1 24  ? 7.521   9.551   -3.803  1.00 1.11  ? 24  ALA A HB3  3  
ATOM 6273  N N    . LEU A 1 25  ? 6.495   7.430   -5.683  1.00 0.42  ? 25  LEU A N    3  
ATOM 6274  C CA   . LEU A 1 25  ? 6.190   7.319   -7.140  1.00 0.44  ? 25  LEU A CA   3  
ATOM 6275  C C    . LEU A 1 25  ? 5.287   6.101   -7.342  1.00 0.44  ? 25  LEU A C    3  
ATOM 6276  O O    . LEU A 1 25  ? 4.180   6.205   -7.830  1.00 0.46  ? 25  LEU A O    3  
ATOM 6277  C CB   . LEU A 1 25  ? 7.501   7.184   -7.941  1.00 0.47  ? 25  LEU A CB   3  
ATOM 6278  C CG   . LEU A 1 25  ? 7.372   7.901   -9.284  1.00 0.77  ? 25  LEU A CG   3  
ATOM 6279  C CD1  . LEU A 1 25  ? 8.703   7.829   -10.035 1.00 1.58  ? 25  LEU A CD1  3  
ATOM 6280  C CD2  . LEU A 1 25  ? 6.276   7.233   -10.116 1.00 1.67  ? 25  LEU A CD2  3  
ATOM 6281  H H    . LEU A 1 25  ? 7.324   7.066   -5.316  1.00 0.43  ? 25  LEU A H    3  
ATOM 6282  H HA   . LEU A 1 25  ? 5.669   8.227   -7.421  1.00 0.43  ? 25  LEU A HA   3  
ATOM 6283  H HB2  . LEU A 1 25  ? 8.303   7.636   -7.382  1.00 0.82  ? 25  LEU A HB2  3  
ATOM 6284  H HB3  . LEU A 1 25  ? 7.727   6.142   -8.110  1.00 0.85  ? 25  LEU A HB3  3  
ATOM 6285  H HG   . LEU A 1 25  ? 7.115   8.934   -9.106  1.00 1.46  ? 25  LEU A HG   3  
ATOM 6286  H HD11 . LEU A 1 25  ? 9.473   8.311   -9.451  1.00 2.16  ? 25  LEU A HD11 3  
ATOM 6287  H HD12 . LEU A 1 25  ? 8.607   8.332   -10.987 1.00 2.10  ? 25  LEU A HD12 3  
ATOM 6288  H HD13 . LEU A 1 25  ? 8.969   6.796   -10.199 1.00 2.08  ? 25  LEU A HD13 3  
ATOM 6289  H HD21 . LEU A 1 25  ? 6.297   7.628   -11.121 1.00 2.29  ? 25  LEU A HD21 3  
ATOM 6290  H HD22 . LEU A 1 25  ? 5.314   7.433   -9.669  1.00 2.15  ? 25  LEU A HD22 3  
ATOM 6291  H HD23 . LEU A 1 25  ? 6.446   6.167   -10.144 1.00 2.16  ? 25  LEU A HD23 3  
ATOM 6292  N N    . LEU A 1 26  ? 5.774   4.937   -6.985  1.00 0.45  ? 26  LEU A N    3  
ATOM 6293  C CA   . LEU A 1 26  ? 4.987   3.685   -7.158  1.00 0.47  ? 26  LEU A CA   3  
ATOM 6294  C C    . LEU A 1 26  ? 3.523   3.914   -6.777  1.00 0.49  ? 26  LEU A C    3  
ATOM 6295  O O    . LEU A 1 26  ? 2.628   3.741   -7.579  1.00 0.52  ? 26  LEU A O    3  
ATOM 6296  C CB   . LEU A 1 26  ? 5.595   2.601   -6.245  1.00 0.51  ? 26  LEU A CB   3  
ATOM 6297  C CG   . LEU A 1 26  ? 5.369   1.206   -6.848  1.00 0.69  ? 26  LEU A CG   3  
ATOM 6298  C CD1  . LEU A 1 26  ? 6.291   0.984   -8.068  1.00 1.17  ? 26  LEU A CD1  3  
ATOM 6299  C CD2  . LEU A 1 26  ? 5.653   0.144   -5.776  1.00 1.35  ? 26  LEU A CD2  3  
ATOM 6300  H H    . LEU A 1 26  ? 6.675   4.865   -6.608  1.00 0.46  ? 26  LEU A H    3  
ATOM 6301  H HA   . LEU A 1 26  ? 5.047   3.359   -8.186  1.00 0.49  ? 26  LEU A HA   3  
ATOM 6302  H HB2  . LEU A 1 26  ? 6.653   2.777   -6.138  1.00 0.80  ? 26  LEU A HB2  3  
ATOM 6303  H HB3  . LEU A 1 26  ? 5.133   2.645   -5.268  1.00 0.81  ? 26  LEU A HB3  3  
ATOM 6304  H HG   . LEU A 1 26  ? 4.341   1.125   -7.165  1.00 1.43  ? 26  LEU A HG   3  
ATOM 6305  H HD11 . LEU A 1 26  ? 5.767   1.273   -8.967  1.00 1.78  ? 26  LEU A HD11 3  
ATOM 6306  H HD12 . LEU A 1 26  ? 6.562   -0.057  -8.136  1.00 1.70  ? 26  LEU A HD12 3  
ATOM 6307  H HD13 . LEU A 1 26  ? 7.191   1.573   -7.976  1.00 1.68  ? 26  LEU A HD13 3  
ATOM 6308  H HD21 . LEU A 1 26  ? 6.671   0.247   -5.429  1.00 1.84  ? 26  LEU A HD21 3  
ATOM 6309  H HD22 . LEU A 1 26  ? 5.515   -0.840  -6.199  1.00 1.93  ? 26  LEU A HD22 3  
ATOM 6310  H HD23 . LEU A 1 26  ? 4.974   0.279   -4.947  1.00 1.89  ? 26  LEU A HD23 3  
ATOM 6311  N N    . LEU A 1 27  ? 3.274   4.286   -5.554  1.00 0.50  ? 27  LEU A N    3  
ATOM 6312  C CA   . LEU A 1 27  ? 1.869   4.507   -5.125  1.00 0.56  ? 27  LEU A CA   3  
ATOM 6313  C C    . LEU A 1 27  ? 1.217   5.531   -6.056  1.00 0.56  ? 27  LEU A C    3  
ATOM 6314  O O    . LEU A 1 27  ? 0.093   5.360   -6.485  1.00 0.60  ? 27  LEU A O    3  
ATOM 6315  C CB   . LEU A 1 27  ? 1.857   5.006   -3.673  1.00 0.64  ? 27  LEU A CB   3  
ATOM 6316  C CG   . LEU A 1 27  ? 0.415   5.162   -3.154  1.00 0.95  ? 27  LEU A CG   3  
ATOM 6317  C CD1  . LEU A 1 27  ? -0.156  3.799   -2.747  1.00 1.66  ? 27  LEU A CD1  3  
ATOM 6318  C CD2  . LEU A 1 27  ? 0.415   6.085   -1.931  1.00 1.42  ? 27  LEU A CD2  3  
ATOM 6319  H H    . LEU A 1 27  ? 4.009   4.413   -4.916  1.00 0.49  ? 27  LEU A H    3  
ATOM 6320  H HA   . LEU A 1 27  ? 1.338   3.573   -5.210  1.00 0.58  ? 27  LEU A HA   3  
ATOM 6321  H HB2  . LEU A 1 27  ? 2.388   4.299   -3.051  1.00 1.45  ? 27  LEU A HB2  3  
ATOM 6322  H HB3  . LEU A 1 27  ? 2.359   5.962   -3.628  1.00 1.04  ? 27  LEU A HB3  3  
ATOM 6323  H HG   . LEU A 1 27  ? -0.206  5.595   -3.925  1.00 1.71  ? 27  LEU A HG   3  
ATOM 6324  H HD11 . LEU A 1 27  ? -0.303  3.189   -3.625  1.00 2.02  ? 27  LEU A HD11 3  
ATOM 6325  H HD12 . LEU A 1 27  ? -1.103  3.942   -2.249  1.00 2.23  ? 27  LEU A HD12 3  
ATOM 6326  H HD13 . LEU A 1 27  ? 0.530   3.304   -2.076  1.00 2.21  ? 27  LEU A HD13 3  
ATOM 6327  H HD21 . LEU A 1 27  ? 1.153   5.741   -1.222  1.00 1.98  ? 27  LEU A HD21 3  
ATOM 6328  H HD22 . LEU A 1 27  ? -0.561  6.073   -1.470  1.00 1.93  ? 27  LEU A HD22 3  
ATOM 6329  H HD23 . LEU A 1 27  ? 0.655   7.092   -2.240  1.00 1.88  ? 27  LEU A HD23 3  
ATOM 6330  N N    . GLN A 1 28  ? 1.901   6.595   -6.373  1.00 0.55  ? 28  GLN A N    3  
ATOM 6331  C CA   . GLN A 1 28  ? 1.297   7.616   -7.272  1.00 0.58  ? 28  GLN A CA   3  
ATOM 6332  C C    . GLN A 1 28  ? 0.962   6.980   -8.627  1.00 0.54  ? 28  GLN A C    3  
ATOM 6333  O O    . GLN A 1 28  ? 0.071   7.419   -9.328  1.00 0.58  ? 28  GLN A O    3  
ATOM 6334  C CB   . GLN A 1 28  ? 2.297   8.761   -7.469  1.00 0.60  ? 28  GLN A CB   3  
ATOM 6335  C CG   . GLN A 1 28  ? 1.755   9.770   -8.501  1.00 1.00  ? 28  GLN A CG   3  
ATOM 6336  C CD   . GLN A 1 28  ? 2.213   9.382   -9.911  1.00 1.40  ? 28  GLN A CD   3  
ATOM 6337  O OE1  . GLN A 1 28  ? 1.408   9.025   -10.747 1.00 2.09  ? 28  GLN A OE1  3  
ATOM 6338  N NE2  . GLN A 1 28  ? 3.482   9.441   -10.209 1.00 1.91  ? 28  GLN A NE2  3  
ATOM 6339  H H    . GLN A 1 28  ? 2.805   6.734   -6.015  1.00 0.53  ? 28  GLN A H    3  
ATOM 6340  H HA   . GLN A 1 28  ? 0.402   8.005   -6.809  1.00 0.65  ? 28  GLN A HA   3  
ATOM 6341  H HB2  . GLN A 1 28  ? 2.448   9.262   -6.522  1.00 0.99  ? 28  GLN A HB2  3  
ATOM 6342  H HB3  . GLN A 1 28  ? 3.240   8.360   -7.811  1.00 0.92  ? 28  GLN A HB3  3  
ATOM 6343  H HG2  . GLN A 1 28  ? 0.674   9.782   -8.468  1.00 1.47  ? 28  GLN A HG2  3  
ATOM 6344  H HG3  . GLN A 1 28  ? 2.129   10.757  -8.267  1.00 1.50  ? 28  GLN A HG3  3  
ATOM 6345  H HE21 . GLN A 1 28  ? 4.131   9.730   -9.533  1.00 2.26  ? 28  GLN A HE21 3  
ATOM 6346  H HE22 . GLN A 1 28  ? 3.787   9.197   -11.108 1.00 2.37  ? 28  GLN A HE22 3  
ATOM 6347  N N    . GLY A 1 29  ? 1.684   5.961   -9.008  1.00 0.50  ? 29  GLY A N    3  
ATOM 6348  C CA   . GLY A 1 29  ? 1.427   5.306   -10.325 1.00 0.48  ? 29  GLY A CA   3  
ATOM 6349  C C    . GLY A 1 29  ? 0.190   4.406   -10.244 1.00 0.44  ? 29  GLY A C    3  
ATOM 6350  O O    . GLY A 1 29  ? -0.650  4.415   -11.122 1.00 0.50  ? 29  GLY A O    3  
ATOM 6351  H H    . GLY A 1 29  ? 2.409   5.642   -8.431  1.00 0.50  ? 29  GLY A H    3  
ATOM 6352  H HA2  . GLY A 1 29  ? 1.266   6.067   -11.075 1.00 0.49  ? 29  GLY A HA2  3  
ATOM 6353  H HA3  . GLY A 1 29  ? 2.282   4.708   -10.600 1.00 0.50  ? 29  GLY A HA3  3  
ATOM 6354  N N    . PHE A 1 30  ? 0.073   3.621   -9.209  1.00 0.44  ? 30  PHE A N    3  
ATOM 6355  C CA   . PHE A 1 30  ? -1.108  2.716   -9.094  1.00 0.43  ? 30  PHE A CA   3  
ATOM 6356  C C    . PHE A 1 30  ? -2.371  3.548   -8.864  1.00 0.40  ? 30  PHE A C    3  
ATOM 6357  O O    . PHE A 1 30  ? -3.477  3.071   -9.028  1.00 0.43  ? 30  PHE A O    3  
ATOM 6358  C CB   . PHE A 1 30  ? -0.900  1.749   -7.921  1.00 0.47  ? 30  PHE A CB   3  
ATOM 6359  C CG   . PHE A 1 30  ? -2.132  0.887   -7.731  1.00 0.47  ? 30  PHE A CG   3  
ATOM 6360  C CD1  . PHE A 1 30  ? -2.554  0.029   -8.758  1.00 1.20  ? 30  PHE A CD1  3  
ATOM 6361  C CD2  . PHE A 1 30  ? -2.850  0.936   -6.526  1.00 1.39  ? 30  PHE A CD2  3  
ATOM 6362  C CE1  . PHE A 1 30  ? -3.687  -0.774  -8.579  1.00 1.21  ? 30  PHE A CE1  3  
ATOM 6363  C CE2  . PHE A 1 30  ? -3.983  0.133   -6.351  1.00 1.42  ? 30  PHE A CE2  3  
ATOM 6364  C CZ   . PHE A 1 30  ? -4.401  -0.722  -7.377  1.00 0.58  ? 30  PHE A CZ   3  
ATOM 6365  H H    . PHE A 1 30  ? 0.763   3.621   -8.513  1.00 0.53  ? 30  PHE A H    3  
ATOM 6366  H HA   . PHE A 1 30  ? -1.212  2.150   -10.008 1.00 0.42  ? 30  PHE A HA   3  
ATOM 6367  H HB2  . PHE A 1 30  ? -0.051  1.114   -8.129  1.00 0.46  ? 30  PHE A HB2  3  
ATOM 6368  H HB3  . PHE A 1 30  ? -0.712  2.315   -7.020  1.00 0.54  ? 30  PHE A HB3  3  
ATOM 6369  H HD1  . PHE A 1 30  ? -2.005  -0.014  -9.686  1.00 2.10  ? 30  PHE A HD1  3  
ATOM 6370  H HD2  . PHE A 1 30  ? -2.529  1.595   -5.733  1.00 2.27  ? 30  PHE A HD2  3  
ATOM 6371  H HE1  . PHE A 1 30  ? -4.010  -1.434  -9.371  1.00 2.09  ? 30  PHE A HE1  3  
ATOM 6372  H HE2  . PHE A 1 30  ? -4.534  0.172   -5.423  1.00 2.33  ? 30  PHE A HE2  3  
ATOM 6373  H HZ   . PHE A 1 30  ? -5.275  -1.343  -7.241  1.00 0.65  ? 30  PHE A HZ   3  
ATOM 6374  N N    . ILE A 1 31  ? -2.221  4.796   -8.500  1.00 0.40  ? 31  ILE A N    3  
ATOM 6375  C CA   . ILE A 1 31  ? -3.420  5.660   -8.277  1.00 0.40  ? 31  ILE A CA   3  
ATOM 6376  C C    . ILE A 1 31  ? -3.833  6.273   -9.622  1.00 0.40  ? 31  ILE A C    3  
ATOM 6377  O O    . ILE A 1 31  ? -4.965  6.146   -10.046 1.00 0.43  ? 31  ILE A O    3  
ATOM 6378  C CB   . ILE A 1 31  ? -3.076  6.759   -7.261  1.00 0.41  ? 31  ILE A CB   3  
ATOM 6379  C CG1  . ILE A 1 31  ? -2.928  6.137   -5.869  1.00 0.53  ? 31  ILE A CG1  3  
ATOM 6380  C CG2  . ILE A 1 31  ? -4.178  7.821   -7.229  1.00 0.72  ? 31  ILE A CG2  3  
ATOM 6381  C CD1  . ILE A 1 31  ? -2.302  7.156   -4.914  1.00 0.48  ? 31  ILE A CD1  3  
ATOM 6382  H H    . ILE A 1 31  ? -1.323  5.168   -8.383  1.00 0.44  ? 31  ILE A H    3  
ATOM 6383  H HA   . ILE A 1 31  ? -4.241  5.051   -7.926  1.00 0.43  ? 31  ILE A HA   3  
ATOM 6384  H HB   . ILE A 1 31  ? -2.142  7.224   -7.545  1.00 0.63  ? 31  ILE A HB   3  
ATOM 6385  H HG12 . ILE A 1 31  ? -3.901  5.847   -5.500  1.00 0.77  ? 31  ILE A HG12 3  
ATOM 6386  H HG13 . ILE A 1 31  ? -2.292  5.266   -5.930  1.00 0.81  ? 31  ILE A HG13 3  
ATOM 6387  H HG21 . ILE A 1 31  ? -5.140  7.341   -7.137  1.00 1.21  ? 31  ILE A HG21 3  
ATOM 6388  H HG22 . ILE A 1 31  ? -4.148  8.400   -8.141  1.00 1.35  ? 31  ILE A HG22 3  
ATOM 6389  H HG23 . ILE A 1 31  ? -4.019  8.476   -6.383  1.00 1.33  ? 31  ILE A HG23 3  
ATOM 6390  H HD11 . ILE A 1 31  ? -2.874  8.072   -4.938  1.00 1.20  ? 31  ILE A HD11 3  
ATOM 6391  H HD12 . ILE A 1 31  ? -1.286  7.360   -5.220  1.00 0.94  ? 31  ILE A HD12 3  
ATOM 6392  H HD13 . ILE A 1 31  ? -2.303  6.757   -3.910  1.00 1.15  ? 31  ILE A HD13 3  
ATOM 6393  N N    . GLN A 1 32  ? -2.934  6.928   -10.300 1.00 0.42  ? 32  GLN A N    3  
ATOM 6394  C CA   . GLN A 1 32  ? -3.290  7.535   -11.616 1.00 0.47  ? 32  GLN A CA   3  
ATOM 6395  C C    . GLN A 1 32  ? -3.898  6.470   -12.542 1.00 0.50  ? 32  GLN A C    3  
ATOM 6396  O O    . GLN A 1 32  ? -4.845  6.729   -13.258 1.00 0.61  ? 32  GLN A O    3  
ATOM 6397  C CB   . GLN A 1 32  ? -2.031  8.127   -12.256 1.00 0.57  ? 32  GLN A CB   3  
ATOM 6398  C CG   . GLN A 1 32  ? -2.378  8.766   -13.611 1.00 1.19  ? 32  GLN A CG   3  
ATOM 6399  C CD   . GLN A 1 32  ? -2.401  7.696   -14.707 1.00 1.59  ? 32  GLN A CD   3  
ATOM 6400  O OE1  . GLN A 1 32  ? -2.104  6.544   -14.457 1.00 2.16  ? 32  GLN A OE1  3  
ATOM 6401  N NE2  . GLN A 1 32  ? -2.741  8.032   -15.921 1.00 2.21  ? 32  GLN A NE2  3  
ATOM 6402  H H    . GLN A 1 32  ? -2.026  7.026   -9.947  1.00 0.42  ? 32  GLN A H    3  
ATOM 6403  H HA   . GLN A 1 32  ? -4.017  8.320   -11.470 1.00 0.48  ? 32  GLN A HA   3  
ATOM 6404  H HB2  . GLN A 1 32  ? -1.622  8.883   -11.599 1.00 0.98  ? 32  GLN A HB2  3  
ATOM 6405  H HB3  . GLN A 1 32  ? -1.298  7.347   -12.399 1.00 1.06  ? 32  GLN A HB3  3  
ATOM 6406  H HG2  . GLN A 1 32  ? -3.348  9.240   -13.552 1.00 1.85  ? 32  GLN A HG2  3  
ATOM 6407  H HG3  . GLN A 1 32  ? -1.633  9.509   -13.856 1.00 1.72  ? 32  GLN A HG3  3  
ATOM 6408  H HE21 . GLN A 1 32  ? -2.979  8.960   -16.124 1.00 2.56  ? 32  GLN A HE21 3  
ATOM 6409  H HE22 . GLN A 1 32  ? -2.757  7.356   -16.631 1.00 2.71  ? 32  GLN A HE22 3  
ATOM 6410  N N    . ASP A 1 33  ? -3.362  5.277   -12.538 1.00 0.49  ? 33  ASP A N    3  
ATOM 6411  C CA   . ASP A 1 33  ? -3.904  4.195   -13.420 1.00 0.58  ? 33  ASP A CA   3  
ATOM 6412  C C    . ASP A 1 33  ? -5.288  3.754   -12.930 1.00 0.61  ? 33  ASP A C    3  
ATOM 6413  O O    . ASP A 1 33  ? -6.218  3.600   -13.697 1.00 0.70  ? 33  ASP A O    3  
ATOM 6414  C CB   . ASP A 1 33  ? -2.952  2.998   -13.362 1.00 0.61  ? 33  ASP A CB   3  
ATOM 6415  C CG   . ASP A 1 33  ? -1.568  3.423   -13.858 1.00 1.10  ? 33  ASP A CG   3  
ATOM 6416  O OD1  . ASP A 1 33  ? -1.506  4.101   -14.870 1.00 1.89  ? 33  ASP A OD1  3  
ATOM 6417  O OD2  . ASP A 1 33  ? -0.594  3.066   -13.215 1.00 1.78  ? 33  ASP A OD2  3  
ATOM 6418  H H    . ASP A 1 33  ? -2.599  5.079   -11.957 1.00 0.49  ? 33  ASP A H    3  
ATOM 6419  H HA   . ASP A 1 33  ? -3.967  4.541   -14.441 1.00 0.64  ? 33  ASP A HA   3  
ATOM 6420  H HB2  . ASP A 1 33  ? -2.877  2.646   -12.343 1.00 1.22  ? 33  ASP A HB2  3  
ATOM 6421  H HB3  . ASP A 1 33  ? -3.329  2.205   -13.990 1.00 1.02  ? 33  ASP A HB3  3  
ATOM 6422  N N    . ARG A 1 34  ? -5.420  3.559   -11.650 1.00 0.58  ? 34  ARG A N    3  
ATOM 6423  C CA   . ARG A 1 34  ? -6.721  3.134   -11.056 1.00 0.71  ? 34  ARG A CA   3  
ATOM 6424  C C    . ARG A 1 34  ? -7.787  4.223   -11.239 1.00 0.65  ? 34  ARG A C    3  
ATOM 6425  O O    . ARG A 1 34  ? -8.938  3.933   -11.497 1.00 0.85  ? 34  ARG A O    3  
ATOM 6426  C CB   . ARG A 1 34  ? -6.511  2.898   -9.551  1.00 0.85  ? 34  ARG A CB   3  
ATOM 6427  C CG   . ARG A 1 34  ? -5.792  1.552   -9.316  1.00 1.25  ? 34  ARG A CG   3  
ATOM 6428  C CD   . ARG A 1 34  ? -6.813  0.407   -9.224  1.00 1.31  ? 34  ARG A CD   3  
ATOM 6429  N NE   . ARG A 1 34  ? -7.609  0.547   -7.972  1.00 1.58  ? 34  ARG A NE   3  
ATOM 6430  C CZ   . ARG A 1 34  ? -8.722  -0.120  -7.828  1.00 2.09  ? 34  ARG A CZ   3  
ATOM 6431  N NH1  . ARG A 1 34  ? -9.142  -0.906  -8.782  1.00 2.58  ? 34  ARG A NH1  3  
ATOM 6432  N NH2  . ARG A 1 34  ? -9.416  -0.001  -6.729  1.00 2.75  ? 34  ARG A NH2  3  
ATOM 6433  H H    . ARG A 1 34  ? -4.651  3.706   -11.061 1.00 0.52  ? 34  ARG A H    3  
ATOM 6434  H HA   . ARG A 1 34  ? -7.084  2.214   -11.488 1.00 0.89  ? 34  ARG A HA   3  
ATOM 6435  H HB2  . ARG A 1 34  ? -5.909  3.700   -9.148  1.00 1.23  ? 34  ARG A HB2  3  
ATOM 6436  H HB3  . ARG A 1 34  ? -7.469  2.884   -9.050  1.00 1.14  ? 34  ARG A HB3  3  
ATOM 6437  H HG2  . ARG A 1 34  ? -5.108  1.356   -10.131 1.00 1.91  ? 34  ARG A HG2  3  
ATOM 6438  H HG3  . ARG A 1 34  ? -5.235  1.602   -8.391  1.00 1.90  ? 34  ARG A HG3  3  
ATOM 6439  H HD2  . ARG A 1 34  ? -7.476  0.440   -10.075 1.00 1.72  ? 34  ARG A HD2  3  
ATOM 6440  H HD3  . ARG A 1 34  ? -6.292  -0.538  -9.212  1.00 2.00  ? 34  ARG A HD3  3  
ATOM 6441  H HE   . ARG A 1 34  ? -7.296  1.138   -7.255  1.00 2.02  ? 34  ARG A HE   3  
ATOM 6442  H HH11 . ARG A 1 34  ? -8.611  -0.997  -9.624  1.00 2.61  ? 34  ARG A HH11 3  
ATOM 6443  H HH12 . ARG A 1 34  ? -9.995  -1.416  -8.671  1.00 3.26  ? 34  ARG A HH12 3  
ATOM 6444  H HH21 . ARG A 1 34  ? -9.095  0.602   -5.998  1.00 3.04  ? 34  ARG A HH21 3  
ATOM 6445  H HH22 . ARG A 1 34  ? -10.269 -0.511  -6.618  1.00 3.25  ? 34  ARG A HH22 3  
ATOM 6446  N N    . ALA A 1 35  ? -7.429  5.466   -11.073 1.00 0.59  ? 35  ALA A N    3  
ATOM 6447  C CA   . ALA A 1 35  ? -8.454  6.544   -11.200 1.00 0.66  ? 35  ALA A CA   3  
ATOM 6448  C C    . ALA A 1 35  ? -9.118  6.496   -12.584 1.00 0.80  ? 35  ALA A C    3  
ATOM 6449  O O    . ALA A 1 35  ? -10.222 6.968   -12.767 1.00 0.88  ? 35  ALA A O    3  
ATOM 6450  C CB   . ALA A 1 35  ? -7.820  7.914   -10.963 1.00 0.94  ? 35  ALA A CB   3  
ATOM 6451  H H    . ALA A 1 35  ? -6.502  5.674   -10.836 1.00 0.67  ? 35  ALA A H    3  
ATOM 6452  H HA   . ALA A 1 35  ? -9.219  6.356   -10.462 1.00 0.91  ? 35  ALA A HA   3  
ATOM 6453  H HB1  . ALA A 1 35  ? -7.020  8.067   -11.673 1.00 1.48  ? 35  ALA A HB1  3  
ATOM 6454  H HB2  . ALA A 1 35  ? -7.425  7.959   -9.959  1.00 1.33  ? 35  ALA A HB2  3  
ATOM 6455  H HB3  . ALA A 1 35  ? -8.568  8.683   -11.092 1.00 1.41  ? 35  ALA A HB3  3  
ATOM 6456  N N    . GLY A 1 36  ? -8.472  5.868   -13.538 1.00 1.15  ? 36  GLY A N    3  
ATOM 6457  C CA   . GLY A 1 36  ? -9.067  5.711   -14.897 1.00 1.62  ? 36  GLY A CA   3  
ATOM 6458  C C    . GLY A 1 36  ? -8.119  6.225   -15.978 1.00 1.54  ? 36  GLY A C    3  
ATOM 6459  O O    . GLY A 1 36  ? -6.917  6.282   -15.814 1.00 2.10  ? 36  GLY A O    3  
ATOM 6460  H H    . GLY A 1 36  ? -7.615  5.459   -13.331 1.00 1.22  ? 36  GLY A H    3  
ATOM 6461  H HA2  . GLY A 1 36  ? -9.257  4.662   -15.062 1.00 2.27  ? 36  GLY A HA2  3  
ATOM 6462  H HA3  . GLY A 1 36  ? -10.002 6.251   -14.968 1.00 2.17  ? 36  GLY A HA3  3  
ATOM 6463  N N    . ARG A 1 37  ? -8.688  6.596   -17.084 1.00 2.07  ? 37  ARG A N    3  
ATOM 6464  C CA   . ARG A 1 37  ? -7.896  7.119   -18.235 1.00 2.87  ? 37  ARG A CA   3  
ATOM 6465  C C    . ARG A 1 37  ? -7.177  8.407   -17.836 1.00 3.46  ? 37  ARG A C    3  
ATOM 6466  O O    . ARG A 1 37  ? -5.988  8.559   -18.032 1.00 4.10  ? 37  ARG A O    3  
ATOM 6467  C CB   . ARG A 1 37  ? -8.838  7.416   -19.415 1.00 3.63  ? 37  ARG A CB   3  
ATOM 6468  C CG   . ARG A 1 37  ? -9.992  8.338   -18.981 1.00 4.34  ? 37  ARG A CG   3  
ATOM 6469  C CD   . ARG A 1 37  ? -11.125 8.293   -20.026 1.00 5.18  ? 37  ARG A CD   3  
ATOM 6470  N NE   . ARG A 1 37  ? -11.742 9.652   -20.165 1.00 5.74  ? 37  ARG A NE   3  
ATOM 6471  C CZ   . ARG A 1 37  ? -12.091 10.351  -19.116 1.00 6.53  ? 37  ARG A CZ   3  
ATOM 6472  N NH1  . ARG A 1 37  ? -12.055 9.823   -17.924 1.00 6.88  ? 37  ARG A NH1  3  
ATOM 6473  N NH2  . ARG A 1 37  ? -12.530 11.572  -19.267 1.00 7.21  ? 37  ARG A NH2  3  
ATOM 6474  H H    . ARG A 1 37  ? -9.657  6.528   -17.156 1.00 2.46  ? 37  ARG A H    3  
ATOM 6475  H HA   . ARG A 1 37  ? -7.179  6.378   -18.553 1.00 3.07  ? 37  ARG A HA   3  
ATOM 6476  H HB2  . ARG A 1 37  ? -8.278  7.896   -20.204 1.00 3.83  ? 37  ARG A HB2  3  
ATOM 6477  H HB3  . ARG A 1 37  ? -9.247  6.487   -19.784 1.00 3.99  ? 37  ARG A HB3  3  
ATOM 6478  H HG2  . ARG A 1 37  ? -10.364 8.012   -18.023 1.00 4.58  ? 37  ARG A HG2  3  
ATOM 6479  H HG3  . ARG A 1 37  ? -9.631  9.352   -18.900 1.00 4.48  ? 37  ARG A HG3  3  
ATOM 6480  H HD2  . ARG A 1 37  ? -10.726 8.012   -20.986 1.00 5.49  ? 37  ARG A HD2  3  
ATOM 6481  H HD3  . ARG A 1 37  ? -11.868 7.561   -19.724 1.00 5.44  ? 37  ARG A HD3  3  
ATOM 6482  H HE   . ARG A 1 37  ? -11.849 10.041  -21.059 1.00 5.74  ? 37  ARG A HE   3  
ATOM 6483  H HH11 . ARG A 1 37  ? -11.765 8.879   -17.805 1.00 6.59  ? 37  ARG A HH11 3  
ATOM 6484  H HH12 . ARG A 1 37  ? -12.318 10.369  -17.128 1.00 7.60  ? 37  ARG A HH12 3  
ATOM 6485  H HH21 . ARG A 1 37  ? -12.597 11.970  -20.182 1.00 7.21  ? 37  ARG A HH21 3  
ATOM 6486  H HH22 . ARG A 1 37  ? -12.799 12.109  -18.468 1.00 7.88  ? 37  ARG A HH22 3  
ATOM 6487  N N    . MET A 1 38  ? -7.903  9.340   -17.292 1.00 3.74  ? 38  MET A N    3  
ATOM 6488  C CA   . MET A 1 38  ? -7.297  10.635  -16.889 1.00 4.68  ? 38  MET A CA   3  
ATOM 6489  C C    . MET A 1 38  ? -6.460  11.193  -18.042 1.00 4.70  ? 38  MET A C    3  
ATOM 6490  O O    . MET A 1 38  ? -5.435  11.813  -17.838 1.00 5.17  ? 38  MET A O    3  
ATOM 6491  C CB   . MET A 1 38  ? -6.424  10.448  -15.649 1.00 5.62  ? 38  MET A CB   3  
ATOM 6492  C CG   . MET A 1 38  ? -7.271  9.877   -14.510 1.00 5.93  ? 38  MET A CG   3  
ATOM 6493  S SD   . MET A 1 38  ? -8.470  11.125  -13.965 1.00 6.79  ? 38  MET A SD   3  
ATOM 6494  C CE   . MET A 1 38  ? -9.979  10.299  -14.535 1.00 7.04  ? 38  MET A CE   3  
ATOM 6495  H H    . MET A 1 38  ? -8.863  9.192   -17.159 1.00 3.65  ? 38  MET A H    3  
ATOM 6496  H HA   . MET A 1 38  ? -8.093  11.333  -16.674 1.00 5.03  ? 38  MET A HA   3  
ATOM 6497  H HB2  . MET A 1 38  ? -5.616  9.768   -15.876 1.00 5.87  ? 38  MET A HB2  3  
ATOM 6498  H HB3  . MET A 1 38  ? -6.018  11.403  -15.348 1.00 6.19  ? 38  MET A HB3  3  
ATOM 6499  H HG2  . MET A 1 38  ? -7.789  8.995   -14.856 1.00 6.03  ? 38  MET A HG2  3  
ATOM 6500  H HG3  . MET A 1 38  ? -6.627  9.613   -13.684 1.00 5.95  ? 38  MET A HG3  3  
ATOM 6501  H HE1  . MET A 1 38  ? -9.910  10.117  -15.598 1.00 7.30  ? 38  MET A HE1  3  
ATOM 6502  H HE2  . MET A 1 38  ? -10.832 10.927  -14.335 1.00 7.32  ? 38  MET A HE2  3  
ATOM 6503  H HE3  . MET A 1 38  ? -10.095 9.361   -14.010 1.00 6.96  ? 38  MET A HE3  3  
ATOM 6504  N N    . GLY A 1 39  ? -6.905  10.993  -19.256 1.00 4.57  ? 39  GLY A N    3  
ATOM 6505  C CA   . GLY A 1 39  ? -6.150  11.530  -20.422 1.00 4.85  ? 39  GLY A CA   3  
ATOM 6506  C C    . GLY A 1 39  ? -6.322  13.044  -20.422 1.00 4.67  ? 39  GLY A C    3  
ATOM 6507  O O    . GLY A 1 39  ? -5.367  13.788  -20.507 1.00 4.95  ? 39  GLY A O    3  
ATOM 6508  H H    . GLY A 1 39  ? -7.747  10.512  -19.394 1.00 4.53  ? 39  GLY A H    3  
ATOM 6509  H HA2  . GLY A 1 39  ? -5.103  11.277  -20.328 1.00 5.27  ? 39  GLY A HA2  3  
ATOM 6510  H HA3  . GLY A 1 39  ? -6.547  11.121  -21.337 1.00 5.09  ? 39  GLY A HA3  3  
ATOM 6511  N N    . GLY A 1 40  ? -7.555  13.486  -20.352 1.00 4.58  ? 40  GLY A N    3  
ATOM 6512  C CA   . GLY A 1 40  ? -7.865  14.949  -20.361 1.00 4.69  ? 40  GLY A CA   3  
ATOM 6513  C C    . GLY A 1 40  ? -6.814  15.720  -19.563 1.00 4.20  ? 40  GLY A C    3  
ATOM 6514  O O    . GLY A 1 40  ? -5.752  16.029  -20.068 1.00 4.34  ? 40  GLY A O    3  
ATOM 6515  H H    . GLY A 1 40  ? -8.286  12.835  -20.318 1.00 4.70  ? 40  GLY A H    3  
ATOM 6516  H HA2  . GLY A 1 40  ? -7.868  15.303  -21.382 1.00 5.07  ? 40  GLY A HA2  3  
ATOM 6517  H HA3  . GLY A 1 40  ? -8.837  15.112  -19.922 1.00 5.10  ? 40  GLY A HA3  3  
ATOM 6518  N N    . GLU A 1 41  ? -7.080  16.054  -18.328 1.00 4.01  ? 41  GLU A N    3  
ATOM 6519  C CA   . GLU A 1 41  ? -6.071  16.812  -17.537 1.00 3.88  ? 41  GLU A CA   3  
ATOM 6520  C C    . GLU A 1 41  ? -6.345  16.601  -16.045 1.00 3.63  ? 41  GLU A C    3  
ATOM 6521  O O    . GLU A 1 41  ? -7.306  17.121  -15.513 1.00 4.16  ? 41  GLU A O    3  
ATOM 6522  C CB   . GLU A 1 41  ? -6.196  18.309  -17.837 1.00 4.26  ? 41  GLU A CB   3  
ATOM 6523  C CG   . GLU A 1 41  ? -5.711  18.611  -19.256 1.00 4.51  ? 41  GLU A CG   3  
ATOM 6524  C CD   . GLU A 1 41  ? -5.526  20.122  -19.414 1.00 4.90  ? 41  GLU A CD   3  
ATOM 6525  O OE1  . GLU A 1 41  ? -4.833  20.703  -18.595 1.00 5.19  ? 41  GLU A OE1  3  
ATOM 6526  O OE2  . GLU A 1 41  ? -6.082  20.672  -20.350 1.00 5.28  ? 41  GLU A OE2  3  
ATOM 6527  H H    . GLU A 1 41  ? -7.928  15.834  -17.888 1.00 4.25  ? 41  GLU A H    3  
ATOM 6528  H HA   . GLU A 1 41  ? -5.075  16.471  -17.778 1.00 4.04  ? 41  GLU A HA   3  
ATOM 6529  H HB2  . GLU A 1 41  ? -7.230  18.605  -17.742 1.00 4.56  ? 41  GLU A HB2  3  
ATOM 6530  H HB3  . GLU A 1 41  ? -5.598  18.866  -17.129 1.00 4.55  ? 41  GLU A HB3  3  
ATOM 6531  H HG2  . GLU A 1 41  ? -4.771  18.110  -19.433 1.00 4.73  ? 41  GLU A HG2  3  
ATOM 6532  H HG3  . GLU A 1 41  ? -6.445  18.268  -19.968 1.00 4.68  ? 41  GLU A HG3  3  
ATOM 6533  N N    . ALA A 1 42  ? -5.524  15.829  -15.369 1.00 3.19  ? 42  ALA A N    3  
ATOM 6534  C CA   . ALA A 1 42  ? -5.746  15.575  -13.901 1.00 3.24  ? 42  ALA A CA   3  
ATOM 6535  C C    . ALA A 1 42  ? -4.633  16.218  -13.049 1.00 2.77  ? 42  ALA A C    3  
ATOM 6536  O O    . ALA A 1 42  ? -3.742  15.519  -12.610 1.00 3.06  ? 42  ALA A O    3  
ATOM 6537  C CB   . ALA A 1 42  ? -5.715  14.073  -13.626 1.00 4.08  ? 42  ALA A CB   3  
ATOM 6538  H H    . ALA A 1 42  ? -4.785  15.396  -15.844 1.00 3.13  ? 42  ALA A H    3  
ATOM 6539  H HA   . ALA A 1 42  ? -6.706  15.961  -13.597 1.00 3.53  ? 42  ALA A HA   3  
ATOM 6540  H HB1  . ALA A 1 42  ? -6.495  13.585  -14.193 1.00 4.56  ? 42  ALA A HB1  3  
ATOM 6541  H HB2  . ALA A 1 42  ? -5.873  13.899  -12.572 1.00 4.42  ? 42  ALA A HB2  3  
ATOM 6542  H HB3  . ALA A 1 42  ? -4.755  13.675  -13.917 1.00 4.35  ? 42  ALA A HB3  3  
ATOM 6543  N N    . PRO A 1 43  ? -4.706  17.513  -12.806 1.00 2.70  ? 43  PRO A N    3  
ATOM 6544  C CA   . PRO A 1 43  ? -3.692  18.191  -11.975 1.00 3.03  ? 43  PRO A CA   3  
ATOM 6545  C C    . PRO A 1 43  ? -3.766  17.672  -10.525 1.00 2.67  ? 43  PRO A C    3  
ATOM 6546  O O    . PRO A 1 43  ? -3.915  18.427  -9.585  1.00 2.87  ? 43  PRO A O    3  
ATOM 6547  C CB   . PRO A 1 43  ? -4.047  19.696  -12.064 1.00 3.84  ? 43  PRO A CB   3  
ATOM 6548  C CG   . PRO A 1 43  ? -5.388  19.815  -12.838 1.00 3.86  ? 43  PRO A CG   3  
ATOM 6549  C CD   . PRO A 1 43  ? -5.765  18.403  -13.333 1.00 3.12  ? 43  PRO A CD   3  
ATOM 6550  H HA   . PRO A 1 43  ? -2.697  18.024  -12.357 1.00 3.46  ? 43  PRO A HA   3  
ATOM 6551  H HB2  . PRO A 1 43  ? -4.151  20.125  -11.077 1.00 4.15  ? 43  PRO A HB2  3  
ATOM 6552  H HB3  . PRO A 1 43  ? -3.273  20.221  -12.605 1.00 4.45  ? 43  PRO A HB3  3  
ATOM 6553  H HG2  . PRO A 1 43  ? -6.161  20.199  -12.182 1.00 4.34  ? 43  PRO A HG2  3  
ATOM 6554  H HG3  . PRO A 1 43  ? -5.270  20.480  -13.685 1.00 4.30  ? 43  PRO A HG3  3  
ATOM 6555  H HD2  . PRO A 1 43  ? -6.735  18.118  -12.948 1.00 3.37  ? 43  PRO A HD2  3  
ATOM 6556  H HD3  . PRO A 1 43  ? -5.761  18.384  -14.403 1.00 3.16  ? 43  PRO A HD3  3  
ATOM 6557  N N    . GLU A 1 44  ? -3.636  16.387  -10.334 1.00 2.45  ? 44  GLU A N    3  
ATOM 6558  C CA   . GLU A 1 44  ? -3.672  15.841  -8.950  1.00 2.23  ? 44  GLU A CA   3  
ATOM 6559  C C    . GLU A 1 44  ? -2.351  16.205  -8.262  1.00 1.75  ? 44  GLU A C    3  
ATOM 6560  O O    . GLU A 1 44  ? -2.259  17.229  -7.613  1.00 2.00  ? 44  GLU A O    3  
ATOM 6561  C CB   . GLU A 1 44  ? -3.876  14.323  -9.007  1.00 2.55  ? 44  GLU A CB   3  
ATOM 6562  C CG   . GLU A 1 44  ? -3.848  13.726  -7.595  1.00 2.70  ? 44  GLU A CG   3  
ATOM 6563  C CD   . GLU A 1 44  ? -5.054  14.235  -6.802  1.00 3.17  ? 44  GLU A CD   3  
ATOM 6564  O OE1  . GLU A 1 44  ? -6.168  13.912  -7.182  1.00 3.77  ? 44  GLU A OE1  3  
ATOM 6565  O OE2  . GLU A 1 44  ? -4.844  14.940  -5.829  1.00 3.42  ? 44  GLU A OE2  3  
ATOM 6566  H H    . GLU A 1 44  ? -3.494  15.786  -11.096 1.00 2.65  ? 44  GLU A H    3  
ATOM 6567  H HA   . GLU A 1 44  ? -4.480  16.299  -8.402  1.00 2.52  ? 44  GLU A HA   3  
ATOM 6568  H HB2  . GLU A 1 44  ? -4.833  14.114  -9.461  1.00 3.09  ? 44  GLU A HB2  3  
ATOM 6569  H HB3  . GLU A 1 44  ? -3.098  13.881  -9.603  1.00 2.66  ? 44  GLU A HB3  3  
ATOM 6570  H HG2  . GLU A 1 44  ? -3.894  12.649  -7.663  1.00 2.90  ? 44  GLU A HG2  3  
ATOM 6571  H HG3  . GLU A 1 44  ? -2.939  14.014  -7.090  1.00 2.84  ? 44  GLU A HG3  3  
ATOM 6572  N N    . LEU A 1 45  ? -1.316  15.411  -8.409  1.00 1.80  ? 45  LEU A N    3  
ATOM 6573  C CA   . LEU A 1 45  ? -0.015  15.788  -7.767  1.00 1.80  ? 45  LEU A CA   3  
ATOM 6574  C C    . LEU A 1 45  ? 0.287   17.236  -8.177  1.00 2.29  ? 45  LEU A C    3  
ATOM 6575  O O    . LEU A 1 45  ? 0.357   18.130  -7.358  1.00 3.01  ? 45  LEU A O    3  
ATOM 6576  C CB   . LEU A 1 45  ? 1.131   14.847  -8.226  1.00 2.23  ? 45  LEU A CB   3  
ATOM 6577  C CG   . LEU A 1 45  ? 0.577   13.562  -8.880  1.00 2.52  ? 45  LEU A CG   3  
ATOM 6578  C CD1  . LEU A 1 45  ? -0.470  12.874  -7.965  1.00 3.22  ? 45  LEU A CD1  3  
ATOM 6579  C CD2  . LEU A 1 45  ? -0.010  13.882  -10.283 1.00 3.00  ? 45  LEU A CD2  3  
ATOM 6580  H H    . LEU A 1 45  ? -1.387  14.599  -8.949  1.00 2.30  ? 45  LEU A H    3  
ATOM 6581  H HA   . LEU A 1 45  ? -0.127  15.744  -6.690  1.00 1.80  ? 45  LEU A HA   3  
ATOM 6582  H HB2  . LEU A 1 45  ? 1.760   15.355  -8.944  1.00 2.70  ? 45  LEU A HB2  3  
ATOM 6583  H HB3  . LEU A 1 45  ? 1.730   14.571  -7.370  1.00 2.51  ? 45  LEU A HB3  3  
ATOM 6584  H HG   . LEU A 1 45  ? 1.401   12.877  -9.009  1.00 2.66  ? 45  LEU A HG   3  
ATOM 6585  H HD11 . LEU A 1 45  ? -1.430  12.852  -8.450  1.00 3.55  ? 45  LEU A HD11 3  
ATOM 6586  H HD12 . LEU A 1 45  ? -0.559  13.398  -7.024  1.00 3.48  ? 45  LEU A HD12 3  
ATOM 6587  H HD13 . LEU A 1 45  ? -0.152  11.861  -7.770  1.00 3.69  ? 45  LEU A HD13 3  
ATOM 6588  H HD21 . LEU A 1 45  ? -0.149  14.948  -10.402 1.00 3.29  ? 45  LEU A HD21 3  
ATOM 6589  H HD22 . LEU A 1 45  ? -0.960  13.383  -10.410 1.00 3.34  ? 45  LEU A HD22 3  
ATOM 6590  H HD23 . LEU A 1 45  ? 0.676   13.529  -11.039 1.00 3.35  ? 45  LEU A HD23 3  
ATOM 6591  N N    . ALA A 1 46  ? 0.391   17.471  -9.455  1.00 2.46  ? 46  ALA A N    3  
ATOM 6592  C CA   . ALA A 1 46  ? 0.604   18.854  -9.949  1.00 3.15  ? 46  ALA A CA   3  
ATOM 6593  C C    . ALA A 1 46  ? 0.648   18.875  -11.476 1.00 2.91  ? 46  ALA A C    3  
ATOM 6594  O O    . ALA A 1 46  ? 0.600   17.844  -12.116 1.00 3.07  ? 46  ALA A O    3  
ATOM 6595  C CB   . ALA A 1 46  ? 1.875   19.505  -9.370  1.00 4.05  ? 46  ALA A CB   3  
ATOM 6596  H H    . ALA A 1 46  ? 0.273   16.736  -10.093 1.00 2.52  ? 46  ALA A H    3  
ATOM 6597  H HA   . ALA A 1 46  ? -0.212  19.458  -9.559  1.00 3.67  ? 46  ALA A HA   3  
ATOM 6598  H HB1  . ALA A 1 46  ? 2.135   20.375  -9.955  1.00 4.47  ? 46  ALA A HB1  3  
ATOM 6599  H HB2  . ALA A 1 46  ? 2.688   18.795  -9.404  1.00 4.32  ? 46  ALA A HB2  3  
ATOM 6600  H HB3  . ALA A 1 46  ? 1.702   19.800  -8.343  1.00 4.43  ? 46  ALA A HB3  3  
ATOM 6601  N N    . LEU A 1 47  ? 0.755   20.030  -12.072 1.00 3.18  ? 47  LEU A N    3  
ATOM 6602  C CA   . LEU A 1 47  ? 0.815   20.086  -13.561 1.00 3.43  ? 47  LEU A CA   3  
ATOM 6603  C C    . LEU A 1 47  ? 2.218   19.692  -14.030 1.00 3.14  ? 47  LEU A C    3  
ATOM 6604  O O    . LEU A 1 47  ? 2.950   20.495  -14.574 1.00 3.51  ? 47  LEU A O    3  
ATOM 6605  C CB   . LEU A 1 47  ? 0.504   21.506  -14.044 1.00 4.05  ? 47  LEU A CB   3  
ATOM 6606  C CG   . LEU A 1 47  ? 1.316   22.548  -13.223 1.00 4.77  ? 47  LEU A CG   3  
ATOM 6607  C CD1  . LEU A 1 47  ? 1.872   23.636  -14.150 1.00 5.26  ? 47  LEU A CD1  3  
ATOM 6608  C CD2  . LEU A 1 47  ? 0.415   23.210  -12.170 1.00 5.35  ? 47  LEU A CD2  3  
ATOM 6609  H H    . LEU A 1 47  ? 0.803   20.854  -11.545 1.00 3.59  ? 47  LEU A H    3  
ATOM 6610  H HA   . LEU A 1 47  ? 0.094   19.398  -13.976 1.00 3.88  ? 47  LEU A HA   3  
ATOM 6611  H HB2  . LEU A 1 47  ? 0.764   21.577  -15.092 1.00 4.17  ? 47  LEU A HB2  3  
ATOM 6612  H HB3  . LEU A 1 47  ? -0.554  21.692  -13.932 1.00 4.35  ? 47  LEU A HB3  3  
ATOM 6613  H HG   . LEU A 1 47  ? 2.144   22.059  -12.726 1.00 5.01  ? 47  LEU A HG   3  
ATOM 6614  H HD11 . LEU A 1 47  ? 2.570   23.193  -14.846 1.00 5.48  ? 47  LEU A HD11 3  
ATOM 6615  H HD12 . LEU A 1 47  ? 2.379   24.386  -13.561 1.00 5.52  ? 47  LEU A HD12 3  
ATOM 6616  H HD13 . LEU A 1 47  ? 1.061   24.094  -14.697 1.00 5.56  ? 47  LEU A HD13 3  
ATOM 6617  H HD21 . LEU A 1 47  ? 1.013   23.845  -11.534 1.00 5.82  ? 47  LEU A HD21 3  
ATOM 6618  H HD22 . LEU A 1 47  ? -0.063  22.448  -11.573 1.00 5.59  ? 47  LEU A HD22 3  
ATOM 6619  H HD23 . LEU A 1 47  ? -0.339  23.805  -12.665 1.00 5.48  ? 47  LEU A HD23 3  
ATOM 6620  N N    . ASP A 1 48  ? 2.602   18.465  -13.812 1.00 3.02  ? 48  ASP A N    3  
ATOM 6621  C CA   . ASP A 1 48  ? 3.962   18.016  -14.232 1.00 3.07  ? 48  ASP A CA   3  
ATOM 6622  C C    . ASP A 1 48  ? 3.963   16.485  -14.409 1.00 2.77  ? 48  ASP A C    3  
ATOM 6623  O O    . ASP A 1 48  ? 4.321   15.776  -13.489 1.00 2.85  ? 48  ASP A O    3  
ATOM 6624  C CB   . ASP A 1 48  ? 4.964   18.394  -13.136 1.00 3.61  ? 48  ASP A CB   3  
ATOM 6625  C CG   . ASP A 1 48  ? 5.106   19.917  -13.079 1.00 4.22  ? 48  ASP A CG   3  
ATOM 6626  O OD1  . ASP A 1 48  ? 5.805   20.459  -13.920 1.00 4.68  ? 48  ASP A OD1  3  
ATOM 6627  O OD2  . ASP A 1 48  ? 4.514   20.515  -12.197 1.00 4.69  ? 48  ASP A OD2  3  
ATOM 6628  H H    . ASP A 1 48  ? 1.997   17.839  -13.365 1.00 3.25  ? 48  ASP A H    3  
ATOM 6629  H HA   . ASP A 1 48  ? 4.241   18.511  -15.146 1.00 3.56  ? 48  ASP A HA   3  
ATOM 6630  H HB2  . ASP A 1 48  ? 4.609   18.029  -12.183 1.00 4.01  ? 48  ASP A HB2  3  
ATOM 6631  H HB3  . ASP A 1 48  ? 5.924   17.953  -13.357 1.00 3.81  ? 48  ASP A HB3  3  
ATOM 6632  N N    . PRO A 1 49  ? 3.552   16.000  -15.568 1.00 3.11  ? 49  PRO A N    3  
ATOM 6633  C CA   . PRO A 1 49  ? 3.504   14.543  -15.812 1.00 3.40  ? 49  PRO A CA   3  
ATOM 6634  C C    . PRO A 1 49  ? 4.903   13.933  -15.636 1.00 3.08  ? 49  PRO A C    3  
ATOM 6635  O O    . PRO A 1 49  ? 5.901   14.548  -15.954 1.00 3.32  ? 49  PRO A O    3  
ATOM 6636  C CB   . PRO A 1 49  ? 2.991   14.398  -17.265 1.00 4.36  ? 49  PRO A CB   3  
ATOM 6637  C CG   . PRO A 1 49  ? 2.669   15.826  -17.792 1.00 4.66  ? 49  PRO A CG   3  
ATOM 6638  C CD   . PRO A 1 49  ? 3.115   16.835  -16.710 1.00 3.86  ? 49  PRO A CD   3  
ATOM 6639  H HA   . PRO A 1 49  ? 2.810   14.079  -15.128 1.00 3.68  ? 49  PRO A HA   3  
ATOM 6640  H HB2  . PRO A 1 49  ? 3.751   13.935  -17.887 1.00 4.57  ? 49  PRO A HB2  3  
ATOM 6641  H HB3  . PRO A 1 49  ? 2.094   13.794  -17.283 1.00 4.94  ? 49  PRO A HB3  3  
ATOM 6642  H HG2  . PRO A 1 49  ? 3.207   16.008  -18.716 1.00 5.13  ? 49  PRO A HG2  3  
ATOM 6643  H HG3  . PRO A 1 49  ? 1.606   15.926  -17.967 1.00 5.26  ? 49  PRO A HG3  3  
ATOM 6644  H HD2  . PRO A 1 49  ? 3.938   17.431  -17.082 1.00 4.06  ? 49  PRO A HD2  3  
ATOM 6645  H HD3  . PRO A 1 49  ? 2.293   17.471  -16.414 1.00 4.03  ? 49  PRO A HD3  3  
ATOM 6646  N N    . VAL A 1 50  ? 4.978   12.727  -15.124 1.00 3.08  ? 50  VAL A N    3  
ATOM 6647  C CA   . VAL A 1 50  ? 6.309   12.071  -14.916 1.00 3.10  ? 50  VAL A CA   3  
ATOM 6648  C C    . VAL A 1 50  ? 6.590   11.094  -16.082 1.00 2.75  ? 50  VAL A C    3  
ATOM 6649  O O    . VAL A 1 50  ? 5.659   10.535  -16.626 1.00 2.91  ? 50  VAL A O    3  
ATOM 6650  C CB   . VAL A 1 50  ? 6.276   11.290  -13.598 1.00 3.88  ? 50  VAL A CB   3  
ATOM 6651  C CG1  . VAL A 1 50  ? 6.260   12.272  -12.425 1.00 4.44  ? 50  VAL A CG1  3  
ATOM 6652  C CG2  . VAL A 1 50  ? 5.016   10.421  -13.549 1.00 4.50  ? 50  VAL A CG2  3  
ATOM 6653  H H    . VAL A 1 50  ? 4.158   12.254  -14.872 1.00 3.41  ? 50  VAL A H    3  
ATOM 6654  H HA   . VAL A 1 50  ? 7.068   12.830  -14.858 1.00 3.39  ? 50  VAL A HA   3  
ATOM 6655  H HB   . VAL A 1 50  ? 7.152   10.662  -13.529 1.00 4.18  ? 50  VAL A HB   3  
ATOM 6656  H HG11 . VAL A 1 50  ? 7.145   12.890  -12.461 1.00 4.70  ? 50  VAL A HG11 3  
ATOM 6657  H HG12 . VAL A 1 50  ? 6.241   11.723  -11.495 1.00 4.81  ? 50  VAL A HG12 3  
ATOM 6658  H HG13 . VAL A 1 50  ? 5.382   12.898  -12.491 1.00 4.69  ? 50  VAL A HG13 3  
ATOM 6659  H HG21 . VAL A 1 50  ? 4.978   9.792   -14.427 1.00 4.87  ? 50  VAL A HG21 3  
ATOM 6660  H HG22 . VAL A 1 50  ? 4.142   11.054  -13.522 1.00 4.87  ? 50  VAL A HG22 3  
ATOM 6661  H HG23 . VAL A 1 50  ? 5.040   9.802   -12.664 1.00 4.69  ? 50  VAL A HG23 3  
ATOM 6662  N N    . PRO A 1 51  ? 7.854   10.901  -16.441 1.00 2.91  ? 51  PRO A N    3  
ATOM 6663  C CA   . PRO A 1 51  ? 8.215   9.973   -17.542 1.00 3.22  ? 51  PRO A CA   3  
ATOM 6664  C C    . PRO A 1 51  ? 7.664   8.552   -17.271 1.00 2.93  ? 51  PRO A C    3  
ATOM 6665  O O    . PRO A 1 51  ? 6.590   8.384   -16.730 1.00 3.37  ? 51  PRO A O    3  
ATOM 6666  C CB   . PRO A 1 51  ? 9.769   9.998   -17.584 1.00 4.09  ? 51  PRO A CB   3  
ATOM 6667  C CG   . PRO A 1 51  ? 10.257  10.977  -16.480 1.00 4.27  ? 51  PRO A CG   3  
ATOM 6668  C CD   . PRO A 1 51  ? 9.009   11.581  -15.805 1.00 3.50  ? 51  PRO A CD   3  
ATOM 6669  H HA   . PRO A 1 51  ? 7.818   10.345  -18.475 1.00 3.54  ? 51  PRO A HA   3  
ATOM 6670  H HB2  . PRO A 1 51  ? 10.175  9.014   -17.399 1.00 4.31  ? 51  PRO A HB2  3  
ATOM 6671  H HB3  . PRO A 1 51  ? 10.105  10.349  -18.551 1.00 4.69  ? 51  PRO A HB3  3  
ATOM 6672  H HG2  . PRO A 1 51  ? 10.852  10.440  -15.749 1.00 4.68  ? 51  PRO A HG2  3  
ATOM 6673  H HG3  . PRO A 1 51  ? 10.853  11.766  -16.921 1.00 4.85  ? 51  PRO A HG3  3  
ATOM 6674  H HD2  . PRO A 1 51  ? 9.021   11.391  -14.738 1.00 3.62  ? 51  PRO A HD2  3  
ATOM 6675  H HD3  . PRO A 1 51  ? 8.965   12.643  -15.999 1.00 3.69  ? 51  PRO A HD3  3  
ATOM 6676  N N    . GLN A 1 52  ? 8.404   7.533   -17.637 1.00 2.70  ? 52  GLN A N    3  
ATOM 6677  C CA   . GLN A 1 52  ? 7.945   6.133   -17.400 1.00 2.85  ? 52  GLN A CA   3  
ATOM 6678  C C    . GLN A 1 52  ? 9.160   5.203   -17.380 1.00 2.14  ? 52  GLN A C    3  
ATOM 6679  O O    . GLN A 1 52  ? 9.864   5.063   -18.361 1.00 2.38  ? 52  GLN A O    3  
ATOM 6680  C CB   . GLN A 1 52  ? 6.994   5.700   -18.520 1.00 3.67  ? 52  GLN A CB   3  
ATOM 6681  C CG   . GLN A 1 52  ? 6.431   4.314   -18.198 1.00 4.37  ? 52  GLN A CG   3  
ATOM 6682  C CD   . GLN A 1 52  ? 5.394   3.923   -19.253 1.00 5.22  ? 52  GLN A CD   3  
ATOM 6683  O OE1  . GLN A 1 52  ? 4.397   3.302   -18.941 1.00 5.74  ? 52  GLN A OE1  3  
ATOM 6684  N NE2  . GLN A 1 52  ? 5.587   4.262   -20.498 1.00 5.74  ? 52  GLN A NE2  3  
ATOM 6685  H H    . GLN A 1 52  ? 9.278   7.697   -18.044 1.00 2.82  ? 52  GLN A H    3  
ATOM 6686  H HA   . GLN A 1 52  ? 7.433   6.077   -16.451 1.00 3.35  ? 52  GLN A HA   3  
ATOM 6687  H HB2  . GLN A 1 52  ? 6.184   6.411   -18.600 1.00 4.06  ? 52  GLN A HB2  3  
ATOM 6688  H HB3  . GLN A 1 52  ? 7.533   5.660   -19.455 1.00 3.91  ? 52  GLN A HB3  3  
ATOM 6689  H HG2  . GLN A 1 52  ? 7.234   3.591   -18.198 1.00 4.50  ? 52  GLN A HG2  3  
ATOM 6690  H HG3  . GLN A 1 52  ? 5.962   4.332   -17.226 1.00 4.63  ? 52  GLN A HG3  3  
ATOM 6691  H HE21 . GLN A 1 52  ? 6.391   4.762   -20.750 1.00 5.63  ? 52  GLN A HE21 3  
ATOM 6692  H HE22 . GLN A 1 52  ? 4.929   4.016   -21.181 1.00 6.45  ? 52  GLN A HE22 3  
ATOM 6693  N N    . ASP A 1 53  ? 9.413   4.567   -16.266 1.00 1.78  ? 53  ASP A N    3  
ATOM 6694  C CA   . ASP A 1 53  ? 10.584  3.643   -16.168 1.00 1.30  ? 53  ASP A CA   3  
ATOM 6695  C C    . ASP A 1 53  ? 10.138  2.208   -16.466 1.00 1.07  ? 53  ASP A C    3  
ATOM 6696  O O    . ASP A 1 53  ? 9.008   1.831   -16.227 1.00 1.19  ? 53  ASP A O    3  
ATOM 6697  C CB   . ASP A 1 53  ? 11.167  3.715   -14.754 1.00 1.65  ? 53  ASP A CB   3  
ATOM 6698  C CG   . ASP A 1 53  ? 12.544  3.048   -14.730 1.00 2.27  ? 53  ASP A CG   3  
ATOM 6699  O OD1  . ASP A 1 53  ? 12.656  1.947   -15.242 1.00 2.91  ? 53  ASP A OD1  3  
ATOM 6700  O OD2  . ASP A 1 53  ? 13.462  3.650   -14.199 1.00 2.80  ? 53  ASP A OD2  3  
ATOM 6701  H H    . ASP A 1 53  ? 8.832   4.699   -15.489 1.00 2.24  ? 53  ASP A H    3  
ATOM 6702  H HA   . ASP A 1 53  ? 11.342  3.922   -16.887 1.00 1.41  ? 53  ASP A HA   3  
ATOM 6703  H HB2  . ASP A 1 53  ? 11.263  4.750   -14.458 1.00 2.08  ? 53  ASP A HB2  3  
ATOM 6704  H HB3  . ASP A 1 53  ? 10.510  3.204   -14.067 1.00 2.01  ? 53  ASP A HB3  3  
ATOM 6705  N N    . ALA A 1 54  ? 11.027  1.410   -16.997 1.00 0.91  ? 54  ALA A N    3  
ATOM 6706  C CA   . ALA A 1 54  ? 10.683  -0.004  -17.332 1.00 0.84  ? 54  ALA A CA   3  
ATOM 6707  C C    . ALA A 1 54  ? 10.461  -0.816  -16.053 1.00 0.76  ? 54  ALA A C    3  
ATOM 6708  O O    . ALA A 1 54  ? 9.635   -1.706  -16.010 1.00 0.75  ? 54  ALA A O    3  
ATOM 6709  C CB   . ALA A 1 54  ? 11.836  -0.624  -18.123 1.00 0.95  ? 54  ALA A CB   3  
ATOM 6710  H H    . ALA A 1 54  ? 11.929  1.746   -17.184 1.00 0.99  ? 54  ALA A H    3  
ATOM 6711  H HA   . ALA A 1 54  ? 9.786   -0.032  -17.934 1.00 0.99  ? 54  ALA A HA   3  
ATOM 6712  H HB1  . ALA A 1 54  ? 11.585  -1.641  -18.386 1.00 1.41  ? 54  ALA A HB1  3  
ATOM 6713  H HB2  . ALA A 1 54  ? 12.731  -0.620  -17.518 1.00 1.35  ? 54  ALA A HB2  3  
ATOM 6714  H HB3  . ALA A 1 54  ? 12.006  -0.051  -19.022 1.00 1.49  ? 54  ALA A HB3  3  
ATOM 6715  N N    . SER A 1 55  ? 11.177  -0.509  -15.007 1.00 0.75  ? 55  SER A N    3  
ATOM 6716  C CA   . SER A 1 55  ? 10.995  -1.254  -13.727 1.00 0.71  ? 55  SER A CA   3  
ATOM 6717  C C    . SER A 1 55  ? 9.699   -0.806  -13.064 1.00 0.66  ? 55  SER A C    3  
ATOM 6718  O O    . SER A 1 55  ? 8.898   -1.614  -12.636 1.00 0.66  ? 55  SER A O    3  
ATOM 6719  C CB   . SER A 1 55  ? 12.159  -0.941  -12.789 1.00 0.76  ? 55  SER A CB   3  
ATOM 6720  O OG   . SER A 1 55  ? 13.371  -1.394  -13.377 1.00 1.37  ? 55  SER A OG   3  
ATOM 6721  H H    . SER A 1 55  ? 11.824  0.225   -15.049 1.00 0.79  ? 55  SER A H    3  
ATOM 6722  H HA   . SER A 1 55  ? 10.956  -2.323  -13.901 1.00 0.71  ? 55  SER A HA   3  
ATOM 6723  H HB2  . SER A 1 55  ? 12.216  0.122   -12.627 1.00 0.95  ? 55  SER A HB2  3  
ATOM 6724  H HB3  . SER A 1 55  ? 11.996  -1.438  -11.841 1.00 1.26  ? 55  SER A HB3  3  
ATOM 6725  H HG   . SER A 1 55  ? 13.163  -2.132  -13.954 1.00 1.82  ? 55  SER A HG   3  
ATOM 6726  N N    . THR A 1 56  ? 9.490   0.478   -12.951 1.00 0.65  ? 56  THR A N    3  
ATOM 6727  C CA   . THR A 1 56  ? 8.251   0.957   -12.286 1.00 0.62  ? 56  THR A CA   3  
ATOM 6728  C C    . THR A 1 56  ? 7.056   0.660   -13.193 1.00 0.59  ? 56  THR A C    3  
ATOM 6729  O O    . THR A 1 56  ? 5.928   0.577   -12.747 1.00 0.57  ? 56  THR A O    3  
ATOM 6730  C CB   . THR A 1 56  ? 8.358   2.462   -12.019 1.00 0.67  ? 56  THR A CB   3  
ATOM 6731  O OG1  . THR A 1 56  ? 9.605   2.745   -11.400 1.00 1.09  ? 56  THR A OG1  3  
ATOM 6732  C CG2  . THR A 1 56  ? 7.221   2.910   -11.102 1.00 1.06  ? 56  THR A CG2  3  
ATOM 6733  H H    . THR A 1 56  ? 10.150  1.117   -13.292 1.00 0.67  ? 56  THR A H    3  
ATOM 6734  H HA   . THR A 1 56  ? 8.153   0.412   -11.360 1.00 0.61  ? 56  THR A HA   3  
ATOM 6735  H HB   . THR A 1 56  ? 8.291   2.998   -12.954 1.00 1.01  ? 56  THR A HB   3  
ATOM 6736  H HG1  . THR A 1 56  ? 9.887   1.959   -10.927 1.00 1.69  ? 56  THR A HG1  3  
ATOM 6737  H HG21 . THR A 1 56  ? 7.383   2.516   -10.111 1.00 1.65  ? 56  THR A HG21 3  
ATOM 6738  H HG22 . THR A 1 56  ? 6.281   2.543   -11.487 1.00 1.60  ? 56  THR A HG22 3  
ATOM 6739  H HG23 . THR A 1 56  ? 7.196   3.989   -11.061 1.00 1.42  ? 56  THR A HG23 3  
ATOM 6740  N N    . LYS A 1 57  ? 7.298   0.490   -14.465 1.00 0.61  ? 57  LYS A N    3  
ATOM 6741  C CA   . LYS A 1 57  ? 6.177   0.193   -15.398 1.00 0.59  ? 57  LYS A CA   3  
ATOM 6742  C C    . LYS A 1 57  ? 5.723   -1.255  -15.186 1.00 0.54  ? 57  LYS A C    3  
ATOM 6743  O O    . LYS A 1 57  ? 4.547   -1.533  -15.044 1.00 0.52  ? 57  LYS A O    3  
ATOM 6744  C CB   . LYS A 1 57  ? 6.652   0.402   -16.845 1.00 0.65  ? 57  LYS A CB   3  
ATOM 6745  C CG   . LYS A 1 57  ? 5.648   -0.205  -17.835 1.00 1.20  ? 57  LYS A CG   3  
ATOM 6746  C CD   . LYS A 1 57  ? 6.021   0.209   -19.262 1.00 1.33  ? 57  LYS A CD   3  
ATOM 6747  C CE   . LYS A 1 57  ? 5.299   -0.697  -20.263 1.00 1.94  ? 57  LYS A CE   3  
ATOM 6748  N NZ   . LYS A 1 57  ? 3.840   -0.709  -19.961 1.00 2.73  ? 57  LYS A NZ   3  
ATOM 6749  H H    . LYS A 1 57  ? 8.215   0.555   -14.804 1.00 0.68  ? 57  LYS A H    3  
ATOM 6750  H HA   . LYS A 1 57  ? 5.360   0.864   -15.176 1.00 0.59  ? 57  LYS A HA   3  
ATOM 6751  H HB2  . LYS A 1 57  ? 6.747   1.460   -17.039 1.00 0.96  ? 57  LYS A HB2  3  
ATOM 6752  H HB3  . LYS A 1 57  ? 7.613   -0.073  -16.977 1.00 1.25  ? 57  LYS A HB3  3  
ATOM 6753  H HG2  . LYS A 1 57  ? 5.671   -1.283  -17.758 1.00 1.84  ? 57  LYS A HG2  3  
ATOM 6754  H HG3  . LYS A 1 57  ? 4.655   0.152   -17.606 1.00 1.68  ? 57  LYS A HG3  3  
ATOM 6755  H HD2  . LYS A 1 57  ? 5.728   1.235   -19.428 1.00 1.66  ? 57  LYS A HD2  3  
ATOM 6756  H HD3  . LYS A 1 57  ? 7.088   0.112   -19.399 1.00 1.74  ? 57  LYS A HD3  3  
ATOM 6757  H HE2  . LYS A 1 57  ? 5.457   -0.324  -21.265 1.00 2.29  ? 57  LYS A HE2  3  
ATOM 6758  H HE3  . LYS A 1 57  ? 5.691   -1.701  -20.187 1.00 2.31  ? 57  LYS A HE3  3  
ATOM 6759  H HZ1  . LYS A 1 57  ? 3.302   -0.558  -20.837 1.00 3.19  ? 57  LYS A HZ1  3  
ATOM 6760  H HZ2  . LYS A 1 57  ? 3.621   0.050   -19.283 1.00 3.07  ? 57  LYS A HZ2  3  
ATOM 6761  H HZ3  . LYS A 1 57  ? 3.578   -1.627  -19.550 1.00 3.14  ? 57  LYS A HZ3  3  
ATOM 6762  N N    . LYS A 1 58  ? 6.642   -2.181  -15.149 1.00 0.55  ? 58  LYS A N    3  
ATOM 6763  C CA   . LYS A 1 58  ? 6.244   -3.599  -14.934 1.00 0.53  ? 58  LYS A CA   3  
ATOM 6764  C C    . LYS A 1 58  ? 5.698   -3.739  -13.512 1.00 0.48  ? 58  LYS A C    3  
ATOM 6765  O O    . LYS A 1 58  ? 4.774   -4.488  -13.265 1.00 0.46  ? 58  LYS A O    3  
ATOM 6766  C CB   . LYS A 1 58  ? 7.464   -4.509  -15.121 1.00 0.56  ? 58  LYS A CB   3  
ATOM 6767  C CG   . LYS A 1 58  ? 7.743   -4.694  -16.617 1.00 0.78  ? 58  LYS A CG   3  
ATOM 6768  C CD   . LYS A 1 58  ? 8.941   -5.635  -16.812 1.00 0.96  ? 58  LYS A CD   3  
ATOM 6769  C CE   . LYS A 1 58  ? 8.625   -7.032  -16.245 1.00 0.85  ? 58  LYS A CE   3  
ATOM 6770  N NZ   . LYS A 1 58  ? 9.127   -7.120  -14.845 1.00 1.75  ? 58  LYS A NZ   3  
ATOM 6771  H H    . LYS A 1 58  ? 7.590   -1.952  -15.248 1.00 0.59  ? 58  LYS A H    3  
ATOM 6772  H HA   . LYS A 1 58  ? 5.473   -3.864  -15.642 1.00 0.53  ? 58  LYS A HA   3  
ATOM 6773  H HB2  . LYS A 1 58  ? 8.325   -4.058  -14.648 1.00 0.79  ? 58  LYS A HB2  3  
ATOM 6774  H HB3  . LYS A 1 58  ? 7.268   -5.470  -14.671 1.00 0.71  ? 58  LYS A HB3  3  
ATOM 6775  H HG2  . LYS A 1 58  ? 6.871   -5.117  -17.095 1.00 1.49  ? 58  LYS A HG2  3  
ATOM 6776  H HG3  . LYS A 1 58  ? 7.967   -3.736  -17.062 1.00 1.56  ? 58  LYS A HG3  3  
ATOM 6777  H HD2  . LYS A 1 58  ? 9.161   -5.715  -17.868 1.00 1.72  ? 58  LYS A HD2  3  
ATOM 6778  H HD3  . LYS A 1 58  ? 9.800   -5.229  -16.300 1.00 1.67  ? 58  LYS A HD3  3  
ATOM 6779  H HE2  . LYS A 1 58  ? 7.557   -7.205  -16.254 1.00 1.27  ? 58  LYS A HE2  3  
ATOM 6780  H HE3  . LYS A 1 58  ? 9.114   -7.786  -16.845 1.00 1.24  ? 58  LYS A HE3  3  
ATOM 6781  H HZ1  . LYS A 1 58  ? 8.689   -7.935  -14.370 1.00 2.20  ? 58  LYS A HZ1  3  
ATOM 6782  H HZ2  . LYS A 1 58  ? 8.883   -6.247  -14.334 1.00 2.19  ? 58  LYS A HZ2  3  
ATOM 6783  H HZ3  . LYS A 1 58  ? 10.159  -7.241  -14.854 1.00 2.31  ? 58  LYS A HZ3  3  
ATOM 6784  N N    . LEU A 1 59  ? 6.268   -3.050  -12.564 1.00 0.50  ? 59  LEU A N    3  
ATOM 6785  C CA   . LEU A 1 59  ? 5.765   -3.196  -11.171 1.00 0.47  ? 59  LEU A CA   3  
ATOM 6786  C C    . LEU A 1 59  ? 4.337   -2.630  -11.099 1.00 0.43  ? 59  LEU A C    3  
ATOM 6787  O O    . LEU A 1 59  ? 3.568   -2.960  -10.218 1.00 0.42  ? 59  LEU A O    3  
ATOM 6788  C CB   . LEU A 1 59  ? 6.712   -2.458  -10.197 1.00 0.53  ? 59  LEU A CB   3  
ATOM 6789  C CG   . LEU A 1 59  ? 7.300   -3.420  -9.158  1.00 0.71  ? 59  LEU A CG   3  
ATOM 6790  C CD1  . LEU A 1 59  ? 8.449   -2.725  -8.424  1.00 1.07  ? 59  LEU A CD1  3  
ATOM 6791  C CD2  . LEU A 1 59  ? 6.219   -3.805  -8.144  1.00 1.34  ? 59  LEU A CD2  3  
ATOM 6792  H H    . LEU A 1 59  ? 7.027   -2.465  -12.767 1.00 0.54  ? 59  LEU A H    3  
ATOM 6793  H HA   . LEU A 1 59  ? 5.725   -4.254  -10.961 1.00 0.47  ? 59  LEU A HA   3  
ATOM 6794  H HB2  . LEU A 1 59  ? 7.519   -2.015  -10.761 1.00 0.91  ? 59  LEU A HB2  3  
ATOM 6795  H HB3  . LEU A 1 59  ? 6.172   -1.677  -9.687  1.00 0.65  ? 59  LEU A HB3  3  
ATOM 6796  H HG   . LEU A 1 59  ? 7.671   -4.304  -9.652  1.00 1.29  ? 59  LEU A HG   3  
ATOM 6797  H HD11 . LEU A 1 59  ? 8.075   -1.845  -7.921  1.00 1.68  ? 59  LEU A HD11 3  
ATOM 6798  H HD12 . LEU A 1 59  ? 9.209   -2.437  -9.135  1.00 1.59  ? 59  LEU A HD12 3  
ATOM 6799  H HD13 . LEU A 1 59  ? 8.874   -3.401  -7.697  1.00 1.49  ? 59  LEU A HD13 3  
ATOM 6800  H HD21 . LEU A 1 59  ? 5.872   -2.919  -7.635  1.00 1.91  ? 59  LEU A HD21 3  
ATOM 6801  H HD22 . LEU A 1 59  ? 6.631   -4.496  -7.424  1.00 1.91  ? 59  LEU A HD22 3  
ATOM 6802  H HD23 . LEU A 1 59  ? 5.392   -4.273  -8.656  1.00 1.77  ? 59  LEU A HD23 3  
ATOM 6803  N N    . SER A 1 60  ? 3.972   -1.812  -12.052 1.00 0.43  ? 60  SER A N    3  
ATOM 6804  C CA   . SER A 1 60  ? 2.587   -1.258  -12.079 1.00 0.42  ? 60  SER A CA   3  
ATOM 6805  C C    . SER A 1 60  ? 1.651   -2.370  -12.561 1.00 0.39  ? 60  SER A C    3  
ATOM 6806  O O    . SER A 1 60  ? 0.509   -2.462  -12.154 1.00 0.41  ? 60  SER A O    3  
ATOM 6807  C CB   . SER A 1 60  ? 2.536   -0.081  -13.056 1.00 0.47  ? 60  SER A CB   3  
ATOM 6808  O OG   . SER A 1 60  ? 3.544   0.859   -12.708 1.00 1.36  ? 60  SER A OG   3  
ATOM 6809  H H    . SER A 1 60  ? 4.602   -1.590  -12.771 1.00 0.45  ? 60  SER A H    3  
ATOM 6810  H HA   . SER A 1 60  ? 2.302   -0.920  -11.092 1.00 0.43  ? 60  SER A HA   3  
ATOM 6811  H HB2  . SER A 1 60  ? 2.710   -0.433  -14.058 1.00 1.13  ? 60  SER A HB2  3  
ATOM 6812  H HB3  . SER A 1 60  ? 1.561   0.386   -13.005 1.00 1.04  ? 60  SER A HB3  3  
ATOM 6813  H HG   . SER A 1 60  ? 3.447   1.625   -13.279 1.00 1.79  ? 60  SER A HG   3  
ATOM 6814  N N    . GLU A 1 61  ? 2.153   -3.235  -13.403 1.00 0.38  ? 61  GLU A N    3  
ATOM 6815  C CA   . GLU A 1 61  ? 1.334   -4.380  -13.904 1.00 0.38  ? 61  GLU A CA   3  
ATOM 6816  C C    . GLU A 1 61  ? 0.966   -5.294  -12.736 1.00 0.38  ? 61  GLU A C    3  
ATOM 6817  O O    . GLU A 1 61  ? -0.134  -5.799  -12.669 1.00 0.41  ? 61  GLU A O    3  
ATOM 6818  C CB   . GLU A 1 61  ? 2.135   -5.189  -14.929 1.00 0.39  ? 61  GLU A CB   3  
ATOM 6819  C CG   . GLU A 1 61  ? 2.407   -4.337  -16.180 1.00 1.06  ? 61  GLU A CG   3  
ATOM 6820  C CD   . GLU A 1 61  ? 1.221   -4.429  -17.146 1.00 1.67  ? 61  GLU A CD   3  
ATOM 6821  O OE1  . GLU A 1 61  ? 0.096   -4.457  -16.673 1.00 2.25  ? 61  GLU A OE1  3  
ATOM 6822  O OE2  . GLU A 1 61  ? 1.459   -4.469  -18.342 1.00 2.40  ? 61  GLU A OE2  3  
ATOM 6823  H H    . GLU A 1 61  ? 3.090   -3.146  -13.681 1.00 0.41  ? 61  GLU A H    3  
ATOM 6824  H HA   . GLU A 1 61  ? 0.410   -4.054  -14.350 1.00 0.41  ? 61  GLU A HA   3  
ATOM 6825  H HB2  . GLU A 1 61  ? 3.072   -5.490  -14.488 1.00 0.98  ? 61  GLU A HB2  3  
ATOM 6826  H HB3  . GLU A 1 61  ? 1.574   -6.070  -15.205 1.00 0.88  ? 61  GLU A HB3  3  
ATOM 6827  H HG2  . GLU A 1 61  ? 2.554   -3.306  -15.893 1.00 1.80  ? 61  GLU A HG2  3  
ATOM 6828  H HG3  . GLU A 1 61  ? 3.296   -4.702  -16.674 1.00 1.66  ? 61  GLU A HG3  3  
ATOM 6829  N N    . CYS A 1 62  ? 1.845   -5.502  -11.803 1.00 0.37  ? 62  CYS A N    3  
ATOM 6830  C CA   . CYS A 1 62  ? 1.477   -6.382  -10.659 1.00 0.39  ? 62  CYS A CA   3  
ATOM 6831  C C    . CYS A 1 62  ? 0.346   -5.712  -9.871  1.00 0.38  ? 62  CYS A C    3  
ATOM 6832  O O    . CYS A 1 62  ? -0.635  -6.335  -9.513  1.00 0.44  ? 62  CYS A O    3  
ATOM 6833  C CB   . CYS A 1 62  ? 2.692   -6.589  -9.755  1.00 0.41  ? 62  CYS A CB   3  
ATOM 6834  S SG   . CYS A 1 62  ? 3.995   -7.432  -10.686 1.00 1.62  ? 62  CYS A SG   3  
ATOM 6835  H H    . CYS A 1 62  ? 2.726   -5.070  -11.844 1.00 0.36  ? 62  CYS A H    3  
ATOM 6836  H HA   . CYS A 1 62  ? 1.145   -7.334  -11.047 1.00 0.40  ? 62  CYS A HA   3  
ATOM 6837  H HB2  . CYS A 1 62  ? 3.055   -5.631  -9.413  1.00 0.95  ? 62  CYS A HB2  3  
ATOM 6838  H HB3  . CYS A 1 62  ? 2.410   -7.192  -8.904  1.00 1.06  ? 62  CYS A HB3  3  
ATOM 6839  H HG   . CYS A 1 62  ? 4.836   -7.231  -10.270 1.00 2.03  ? 62  CYS A HG   3  
ATOM 6840  N N    . LEU A 1 63  ? 0.472   -4.437  -9.624  1.00 0.35  ? 63  LEU A N    3  
ATOM 6841  C CA   . LEU A 1 63  ? -0.586  -3.685  -8.887  1.00 0.36  ? 63  LEU A CA   3  
ATOM 6842  C C    . LEU A 1 63  ? -1.826  -3.522  -9.778  1.00 0.36  ? 63  LEU A C    3  
ATOM 6843  O O    . LEU A 1 63  ? -2.946  -3.625  -9.318  1.00 0.41  ? 63  LEU A O    3  
ATOM 6844  C CB   . LEU A 1 63  ? -0.033  -2.306  -8.515  1.00 0.38  ? 63  LEU A CB   3  
ATOM 6845  C CG   . LEU A 1 63  ? 1.225   -2.471  -7.644  1.00 0.69  ? 63  LEU A CG   3  
ATOM 6846  C CD1  . LEU A 1 63  ? 1.919   -1.115  -7.493  1.00 1.39  ? 63  LEU A CD1  3  
ATOM 6847  C CD2  . LEU A 1 63  ? 0.839   -2.981  -6.244  1.00 1.11  ? 63  LEU A CD2  3  
ATOM 6848  H H    . LEU A 1 63  ? 1.269   -3.958  -9.938  1.00 0.37  ? 63  LEU A H    3  
ATOM 6849  H HA   . LEU A 1 63  ? -0.880  -4.197  -7.986  1.00 0.39  ? 63  LEU A HA   3  
ATOM 6850  H HB2  . LEU A 1 63  ? 0.224   -1.769  -9.417  1.00 0.65  ? 63  LEU A HB2  3  
ATOM 6851  H HB3  . LEU A 1 63  ? -0.780  -1.752  -7.969  1.00 0.46  ? 63  LEU A HB3  3  
ATOM 6852  H HG   . LEU A 1 63  ? 1.900   -3.172  -8.113  1.00 1.38  ? 63  LEU A HG   3  
ATOM 6853  H HD11 . LEU A 1 63  ? 1.277   -0.440  -6.946  1.00 1.91  ? 63  LEU A HD11 3  
ATOM 6854  H HD12 . LEU A 1 63  ? 2.122   -0.704  -8.471  1.00 1.98  ? 63  LEU A HD12 3  
ATOM 6855  H HD13 . LEU A 1 63  ? 2.847   -1.243  -6.957  1.00 1.77  ? 63  LEU A HD13 3  
ATOM 6856  H HD21 . LEU A 1 63  ? -0.042  -2.463  -5.895  1.00 1.71  ? 63  LEU A HD21 3  
ATOM 6857  H HD22 . LEU A 1 63  ? 1.654   -2.803  -5.557  1.00 1.69  ? 63  LEU A HD22 3  
ATOM 6858  H HD23 . LEU A 1 63  ? 0.641   -4.041  -6.287  1.00 1.59  ? 63  LEU A HD23 3  
ATOM 6859  N N    . LYS A 1 64  ? -1.639  -3.265  -11.042 1.00 0.35  ? 64  LYS A N    3  
ATOM 6860  C CA   . LYS A 1 64  ? -2.808  -3.092  -11.957 1.00 0.37  ? 64  LYS A CA   3  
ATOM 6861  C C    . LYS A 1 64  ? -3.480  -4.452  -12.204 1.00 0.39  ? 64  LYS A C    3  
ATOM 6862  O O    . LYS A 1 64  ? -4.687  -4.573  -12.147 1.00 0.43  ? 64  LYS A O    3  
ATOM 6863  C CB   . LYS A 1 64  ? -2.314  -2.482  -13.281 1.00 0.38  ? 64  LYS A CB   3  
ATOM 6864  C CG   . LYS A 1 64  ? -3.304  -2.775  -14.424 1.00 0.82  ? 64  LYS A CG   3  
ATOM 6865  C CD   . LYS A 1 64  ? -3.079  -1.798  -15.594 1.00 1.35  ? 64  LYS A CD   3  
ATOM 6866  C CE   . LYS A 1 64  ? -3.881  -0.509  -15.374 1.00 1.38  ? 64  LYS A CE   3  
ATOM 6867  N NZ   . LYS A 1 64  ? -3.495  0.493   -16.407 1.00 2.09  ? 64  LYS A NZ   3  
ATOM 6868  H H    . LYS A 1 64  ? -0.728  -3.182  -11.392 1.00 0.36  ? 64  LYS A H    3  
ATOM 6869  H HA   . LYS A 1 64  ? -3.532  -2.424  -11.512 1.00 0.38  ? 64  LYS A HA   3  
ATOM 6870  H HB2  . LYS A 1 64  ? -2.209  -1.415  -13.162 1.00 0.83  ? 64  LYS A HB2  3  
ATOM 6871  H HB3  . LYS A 1 64  ? -1.358  -2.903  -13.526 1.00 0.76  ? 64  LYS A HB3  3  
ATOM 6872  H HG2  . LYS A 1 64  ? -3.147  -3.787  -14.771 1.00 1.50  ? 64  LYS A HG2  3  
ATOM 6873  H HG3  . LYS A 1 64  ? -4.315  -2.676  -14.057 1.00 1.58  ? 64  LYS A HG3  3  
ATOM 6874  H HD2  . LYS A 1 64  ? -2.028  -1.557  -15.670 1.00 1.98  ? 64  LYS A HD2  3  
ATOM 6875  H HD3  . LYS A 1 64  ? -3.403  -2.263  -16.514 1.00 1.96  ? 64  LYS A HD3  3  
ATOM 6876  H HE2  . LYS A 1 64  ? -4.936  -0.723  -15.458 1.00 1.48  ? 64  LYS A HE2  3  
ATOM 6877  H HE3  . LYS A 1 64  ? -3.672  -0.112  -14.393 1.00 1.82  ? 64  LYS A HE3  3  
ATOM 6878  H HZ1  . LYS A 1 64  ? -2.866  0.048   -17.105 1.00 2.59  ? 64  LYS A HZ1  3  
ATOM 6879  H HZ2  . LYS A 1 64  ? -3.001  1.288   -15.951 1.00 2.53  ? 64  LYS A HZ2  3  
ATOM 6880  H HZ3  . LYS A 1 64  ? -4.348  0.843   -16.887 1.00 2.46  ? 64  LYS A HZ3  3  
ATOM 6881  N N    . ARG A 1 65  ? -2.716  -5.471  -12.480 1.00 0.43  ? 65  ARG A N    3  
ATOM 6882  C CA   . ARG A 1 65  ? -3.323  -6.811  -12.730 1.00 0.47  ? 65  ARG A CA   3  
ATOM 6883  C C    . ARG A 1 65  ? -4.091  -7.273  -11.488 1.00 0.50  ? 65  ARG A C    3  
ATOM 6884  O O    . ARG A 1 65  ? -5.134  -7.888  -11.586 1.00 0.54  ? 65  ARG A O    3  
ATOM 6885  C CB   . ARG A 1 65  ? -2.215  -7.818  -13.048 1.00 0.45  ? 65  ARG A CB   3  
ATOM 6886  C CG   . ARG A 1 65  ? -1.682  -7.556  -14.461 1.00 0.94  ? 65  ARG A CG   3  
ATOM 6887  C CD   . ARG A 1 65  ? -0.556  -8.541  -14.784 1.00 1.55  ? 65  ARG A CD   3  
ATOM 6888  N NE   . ARG A 1 65  ? -1.148  -9.855  -15.161 1.00 1.86  ? 65  ARG A NE   3  
ATOM 6889  C CZ   . ARG A 1 65  ? -0.413  -10.759 -15.748 1.00 2.39  ? 65  ARG A CZ   3  
ATOM 6890  N NH1  . ARG A 1 65  ? 0.843   -10.515 -16.001 1.00 2.94  ? 65  ARG A NH1  3  
ATOM 6891  N NH2  . ARG A 1 65  ? -0.935  -11.908 -16.079 1.00 2.92  ? 65  ARG A NH2  3  
ATOM 6892  H H    . ARG A 1 65  ? -1.743  -5.361  -12.519 1.00 0.45  ? 65  ARG A H    3  
ATOM 6893  H HA   . ARG A 1 65  ? -3.999  -6.759  -13.571 1.00 0.49  ? 65  ARG A HA   3  
ATOM 6894  H HB2  . ARG A 1 65  ? -1.414  -7.714  -12.331 1.00 0.88  ? 65  ARG A HB2  3  
ATOM 6895  H HB3  . ARG A 1 65  ? -2.613  -8.820  -12.997 1.00 0.85  ? 65  ARG A HB3  3  
ATOM 6896  H HG2  . ARG A 1 65  ? -2.484  -7.682  -15.174 1.00 1.50  ? 65  ARG A HG2  3  
ATOM 6897  H HG3  . ARG A 1 65  ? -1.305  -6.547  -14.526 1.00 1.54  ? 65  ARG A HG3  3  
ATOM 6898  H HD2  . ARG A 1 65  ? 0.029   -8.160  -15.608 1.00 2.13  ? 65  ARG A HD2  3  
ATOM 6899  H HD3  . ARG A 1 65  ? 0.081   -8.667  -13.920 1.00 2.11  ? 65  ARG A HD3  3  
ATOM 6900  H HE   . ARG A 1 65  ? -2.091  -10.040 -14.969 1.00 2.20  ? 65  ARG A HE   3  
ATOM 6901  H HH11 . ARG A 1 65  ? 1.243   -9.634  -15.746 1.00 2.96  ? 65  ARG A HH11 3  
ATOM 6902  H HH12 . ARG A 1 65  ? 1.407   -11.208 -16.451 1.00 3.62  ? 65  ARG A HH12 3  
ATOM 6903  H HH21 . ARG A 1 65  ? -1.897  -12.095 -15.884 1.00 3.11  ? 65  ARG A HH21 3  
ATOM 6904  H HH22 . ARG A 1 65  ? -0.372  -12.601 -16.529 1.00 3.43  ? 65  ARG A HH22 3  
ATOM 6905  N N    . ILE A 1 66  ? -3.581  -6.986  -10.323 1.00 0.49  ? 66  ILE A N    3  
ATOM 6906  C CA   . ILE A 1 66  ? -4.277  -7.413  -9.075  1.00 0.53  ? 66  ILE A CA   3  
ATOM 6907  C C    . ILE A 1 66  ? -5.474  -6.492  -8.814  1.00 0.54  ? 66  ILE A C    3  
ATOM 6908  O O    . ILE A 1 66  ? -6.583  -6.944  -8.606  1.00 0.60  ? 66  ILE A O    3  
ATOM 6909  C CB   . ILE A 1 66  ? -3.290  -7.327  -7.899  1.00 0.52  ? 66  ILE A CB   3  
ATOM 6910  C CG1  . ILE A 1 66  ? -2.306  -8.497  -7.973  1.00 1.22  ? 66  ILE A CG1  3  
ATOM 6911  C CG2  . ILE A 1 66  ? -4.038  -7.374  -6.559  1.00 1.29  ? 66  ILE A CG2  3  
ATOM 6912  C CD1  . ILE A 1 66  ? -1.153  -8.252  -6.998  1.00 1.25  ? 66  ILE A CD1  3  
ATOM 6913  H H    . ILE A 1 66  ? -2.737  -6.492  -10.267 1.00 0.46  ? 66  ILE A H    3  
ATOM 6914  H HA   . ILE A 1 66  ? -4.620  -8.430  -9.189  1.00 0.56  ? 66  ILE A HA   3  
ATOM 6915  H HB   . ILE A 1 66  ? -2.743  -6.398  -7.965  1.00 1.04  ? 66  ILE A HB   3  
ATOM 6916  H HG12 . ILE A 1 66  ? -2.814  -9.413  -7.710  1.00 1.73  ? 66  ILE A HG12 3  
ATOM 6917  H HG13 . ILE A 1 66  ? -1.915  -8.577  -8.977  1.00 1.78  ? 66  ILE A HG13 3  
ATOM 6918  H HG21 . ILE A 1 66  ? -4.774  -8.165  -6.585  1.00 1.84  ? 66  ILE A HG21 3  
ATOM 6919  H HG22 . ILE A 1 66  ? -4.533  -6.429  -6.389  1.00 1.76  ? 66  ILE A HG22 3  
ATOM 6920  H HG23 . ILE A 1 66  ? -3.337  -7.561  -5.759  1.00 1.93  ? 66  ILE A HG23 3  
ATOM 6921  H HD11 . ILE A 1 66  ? -1.529  -8.266  -5.986  1.00 1.47  ? 66  ILE A HD11 3  
ATOM 6922  H HD12 . ILE A 1 66  ? -0.707  -7.289  -7.203  1.00 1.70  ? 66  ILE A HD12 3  
ATOM 6923  H HD13 . ILE A 1 66  ? -0.409  -9.025  -7.117  1.00 1.59  ? 66  ILE A HD13 3  
ATOM 6924  N N    . GLY A 1 67  ? -5.266  -5.205  -8.841  1.00 0.52  ? 67  GLY A N    3  
ATOM 6925  C CA   . GLY A 1 67  ? -6.392  -4.256  -8.611  1.00 0.55  ? 67  GLY A CA   3  
ATOM 6926  C C    . GLY A 1 67  ? -7.561  -4.585  -9.538  1.00 0.53  ? 67  GLY A C    3  
ATOM 6927  O O    . GLY A 1 67  ? -8.687  -4.733  -9.098  1.00 0.63  ? 67  GLY A O    3  
ATOM 6928  H H    . GLY A 1 67  ? -4.373  -4.847  -9.029  1.00 0.50  ? 67  GLY A H    3  
ATOM 6929  H HA2  . GLY A 1 67  ? -6.722  -4.299  -7.581  1.00 0.55  ? 67  GLY A HA2  3  
ATOM 6930  H HA3  . GLY A 1 67  ? -6.050  -3.251  -8.794  1.00 0.59  ? 67  GLY A HA3  3  
ATOM 6931  N N    . ASP A 1 68  ? -7.324  -4.700  -10.816 1.00 0.54  ? 68  ASP A N    3  
ATOM 6932  C CA   . ASP A 1 68  ? -8.437  -5.014  -11.754 1.00 0.54  ? 68  ASP A CA   3  
ATOM 6933  C C    . ASP A 1 68  ? -8.965  -6.425  -11.491 1.00 0.52  ? 68  ASP A C    3  
ATOM 6934  O O    . ASP A 1 68  ? -10.088 -6.748  -11.825 1.00 0.56  ? 68  ASP A O    3  
ATOM 6935  C CB   . ASP A 1 68  ? -7.914  -4.930  -13.190 1.00 0.60  ? 68  ASP A CB   3  
ATOM 6936  C CG   . ASP A 1 68  ? -9.056  -5.201  -14.170 1.00 1.43  ? 68  ASP A CG   3  
ATOM 6937  O OD1  . ASP A 1 68  ? -9.300  -6.361  -14.457 1.00 2.20  ? 68  ASP A OD1  3  
ATOM 6938  O OD2  . ASP A 1 68  ? -9.666  -4.244  -14.617 1.00 2.12  ? 68  ASP A OD2  3  
ATOM 6939  H H    . ASP A 1 68  ? -6.422  -4.583  -11.181 1.00 0.63  ? 68  ASP A H    3  
ATOM 6940  H HA   . ASP A 1 68  ? -9.237  -4.300  -11.626 1.00 0.53  ? 68  ASP A HA   3  
ATOM 6941  H HB2  . ASP A 1 68  ? -7.512  -3.943  -13.368 1.00 1.16  ? 68  ASP A HB2  3  
ATOM 6942  H HB3  . ASP A 1 68  ? -7.136  -5.665  -13.333 1.00 1.06  ? 68  ASP A HB3  3  
ATOM 6943  N N    . GLU A 1 69  ? -8.166  -7.274  -10.900 1.00 0.56  ? 69  GLU A N    3  
ATOM 6944  C CA   . GLU A 1 69  ? -8.625  -8.670  -10.622 1.00 0.56  ? 69  GLU A CA   3  
ATOM 6945  C C    . GLU A 1 69  ? -9.195  -8.748  -9.204  1.00 0.55  ? 69  GLU A C    3  
ATOM 6946  O O    . GLU A 1 69  ? -9.906  -9.677  -8.876  1.00 0.73  ? 69  GLU A O    3  
ATOM 6947  C CB   . GLU A 1 69  ? -7.437  -9.627  -10.750 1.00 0.61  ? 69  GLU A CB   3  
ATOM 6948  C CG   . GLU A 1 69  ? -7.925  -11.076 -10.640 1.00 0.84  ? 69  GLU A CG   3  
ATOM 6949  C CD   . GLU A 1 69  ? -6.833  -12.023 -11.139 1.00 1.65  ? 69  GLU A CD   3  
ATOM 6950  O OE1  . GLU A 1 69  ? -6.352  -11.813 -12.241 1.00 2.23  ? 69  GLU A OE1  3  
ATOM 6951  O OE2  . GLU A 1 69  ? -6.496  -12.943 -10.412 1.00 2.48  ? 69  GLU A OE2  3  
ATOM 6952  H H    . GLU A 1 69  ? -7.262  -6.996  -10.642 1.00 0.65  ? 69  GLU A H    3  
ATOM 6953  H HA   . GLU A 1 69  ? -9.391  -8.951  -11.332 1.00 0.57  ? 69  GLU A HA   3  
ATOM 6954  H HB2  . GLU A 1 69  ? -6.960  -9.479  -11.708 1.00 0.87  ? 69  GLU A HB2  3  
ATOM 6955  H HB3  . GLU A 1 69  ? -6.728  -9.428  -9.960  1.00 0.83  ? 69  GLU A HB3  3  
ATOM 6956  H HG2  . GLU A 1 69  ? -8.153  -11.301 -9.608  1.00 1.45  ? 69  GLU A HG2  3  
ATOM 6957  H HG3  . GLU A 1 69  ? -8.813  -11.206 -11.241 1.00 1.39  ? 69  GLU A HG3  3  
ATOM 6958  N N    . LEU A 1 70  ? -8.883  -7.813  -8.343  1.00 0.53  ? 70  LEU A N    3  
ATOM 6959  C CA   . LEU A 1 70  ? -9.417  -7.905  -6.949  1.00 0.52  ? 70  LEU A CA   3  
ATOM 6960  C C    . LEU A 1 70  ? -10.874 -7.428  -6.921  1.00 0.54  ? 70  LEU A C    3  
ATOM 6961  O O    . LEU A 1 70  ? -11.656 -7.841  -6.088  1.00 0.60  ? 70  LEU A O    3  
ATOM 6962  C CB   . LEU A 1 70  ? -8.552  -7.054  -5.996  1.00 0.61  ? 70  LEU A CB   3  
ATOM 6963  C CG   . LEU A 1 70  ? -8.486  -7.708  -4.597  1.00 0.70  ? 70  LEU A CG   3  
ATOM 6964  C CD1  . LEU A 1 70  ? -7.349  -8.734  -4.555  1.00 1.38  ? 70  LEU A CD1  3  
ATOM 6965  C CD2  . LEU A 1 70  ? -8.231  -6.634  -3.533  1.00 1.61  ? 70  LEU A CD2  3  
ATOM 6966  H H    . LEU A 1 70  ? -8.295  -7.074  -8.603  1.00 0.66  ? 70  LEU A H    3  
ATOM 6967  H HA   . LEU A 1 70  ? -9.394  -8.946  -6.655  1.00 0.56  ? 70  LEU A HA   3  
ATOM 6968  H HB2  . LEU A 1 70  ? -7.554  -6.971  -6.405  1.00 1.07  ? 70  LEU A HB2  3  
ATOM 6969  H HB3  . LEU A 1 70  ? -8.979  -6.063  -5.911  1.00 1.07  ? 70  LEU A HB3  3  
ATOM 6970  H HG   . LEU A 1 70  ? -9.422  -8.207  -4.386  1.00 1.39  ? 70  LEU A HG   3  
ATOM 6971  H HD11 . LEU A 1 70  ? -6.405  -8.229  -4.700  1.00 1.91  ? 70  LEU A HD11 3  
ATOM 6972  H HD12 . LEU A 1 70  ? -7.492  -9.463  -5.338  1.00 1.90  ? 70  LEU A HD12 3  
ATOM 6973  H HD13 . LEU A 1 70  ? -7.347  -9.230  -3.596  1.00 1.98  ? 70  LEU A HD13 3  
ATOM 6974  H HD21 . LEU A 1 70  ? -7.348  -6.070  -3.795  1.00 2.16  ? 70  LEU A HD21 3  
ATOM 6975  H HD22 . LEU A 1 70  ? -8.085  -7.106  -2.573  1.00 2.22  ? 70  LEU A HD22 3  
ATOM 6976  H HD23 . LEU A 1 70  ? -9.081  -5.969  -3.482  1.00 2.09  ? 70  LEU A HD23 3  
ATOM 6977  N N    . ASP A 1 71  ? -11.252 -6.589  -7.848  1.00 0.67  ? 71  ASP A N    3  
ATOM 6978  C CA   . ASP A 1 71  ? -12.666 -6.123  -7.889  1.00 0.91  ? 71  ASP A CA   3  
ATOM 6979  C C    . ASP A 1 71  ? -13.538 -7.304  -8.311  1.00 1.02  ? 71  ASP A C    3  
ATOM 6980  O O    . ASP A 1 71  ? -14.750 -7.234  -8.350  1.00 1.29  ? 71  ASP A O    3  
ATOM 6981  C CB   . ASP A 1 71  ? -12.807 -4.991  -8.908  1.00 1.09  ? 71  ASP A CB   3  
ATOM 6982  C CG   . ASP A 1 71  ? -14.263 -4.521  -8.949  1.00 1.66  ? 71  ASP A CG   3  
ATOM 6983  O OD1  . ASP A 1 71  ? -14.938 -4.661  -7.942  1.00 2.25  ? 71  ASP A OD1  3  
ATOM 6984  O OD2  . ASP A 1 71  ? -14.677 -4.031  -9.985  1.00 2.36  ? 71  ASP A OD2  3  
ATOM 6985  H H    . ASP A 1 71  ? -10.613 -6.290  -8.529  1.00 0.69  ? 71  ASP A H    3  
ATOM 6986  H HA   . ASP A 1 71  ? -12.967 -5.777  -6.911  1.00 0.96  ? 71  ASP A HA   3  
ATOM 6987  H HB2  . ASP A 1 71  ? -12.169 -4.167  -8.622  1.00 1.58  ? 71  ASP A HB2  3  
ATOM 6988  H HB3  . ASP A 1 71  ? -12.519 -5.348  -9.885  1.00 1.39  ? 71  ASP A HB3  3  
ATOM 6989  N N    . SER A 1 72  ? -12.893 -8.387  -8.638  1.00 0.90  ? 72  SER A N    3  
ATOM 6990  C CA   . SER A 1 72  ? -13.600 -9.618  -9.082  1.00 1.20  ? 72  SER A CA   3  
ATOM 6991  C C    . SER A 1 72  ? -14.567 -10.130 -8.017  1.00 0.98  ? 72  SER A C    3  
ATOM 6992  O O    . SER A 1 72  ? -15.463 -10.891 -8.326  1.00 1.02  ? 72  SER A O    3  
ATOM 6993  C CB   . SER A 1 72  ? -12.557 -10.707 -9.336  1.00 1.57  ? 72  SER A CB   3  
ATOM 6994  O OG   . SER A 1 72  ? -11.902 -11.024 -8.115  1.00 2.09  ? 72  SER A OG   3  
ATOM 6995  H H    . SER A 1 72  ? -11.913 -8.391  -8.595  1.00 0.70  ? 72  SER A H    3  
ATOM 6996  H HA   . SER A 1 72  ? -14.132 -9.445  -10.007 1.00 1.57  ? 72  SER A HA   3  
ATOM 6997  H HB2  . SER A 1 72  ? -13.042 -11.590 -9.717  1.00 1.99  ? 72  SER A HB2  3  
ATOM 6998  H HB3  . SER A 1 72  ? -11.836 -10.354 -10.062 1.00 2.01  ? 72  SER A HB3  3  
ATOM 6999  H HG   . SER A 1 72  ? -12.439 -11.670 -7.650  1.00 2.54  ? 72  SER A HG   3  
ATOM 7000  N N    . ASN A 1 73  ? -14.391 -9.760  -6.760  1.00 0.92  ? 73  ASN A N    3  
ATOM 7001  C CA   . ASN A 1 73  ? -15.312 -10.290 -5.693  1.00 0.83  ? 73  ASN A CA   3  
ATOM 7002  C C    . ASN A 1 73  ? -16.308 -9.208  -5.266  1.00 0.75  ? 73  ASN A C    3  
ATOM 7003  O O    . ASN A 1 73  ? -15.933 -8.206  -4.690  1.00 1.07  ? 73  ASN A O    3  
ATOM 7004  C CB   . ASN A 1 73  ? -14.476 -10.705 -4.480  1.00 0.91  ? 73  ASN A CB   3  
ATOM 7005  C CG   . ASN A 1 73  ? -13.499 -11.811 -4.885  1.00 1.43  ? 73  ASN A CG   3  
ATOM 7006  O OD1  . ASN A 1 73  ? -12.720 -12.275 -4.076  1.00 2.29  ? 73  ASN A OD1  3  
ATOM 7007  N ND2  . ASN A 1 73  ? -13.507 -12.254 -6.112  1.00 1.90  ? 73  ASN A ND2  3  
ATOM 7008  H H    . ASN A 1 73  ? -13.655 -9.161  -6.519  1.00 1.04  ? 73  ASN A H    3  
ATOM 7009  H HA   . ASN A 1 73  ? -15.799 -11.162 -6.107  1.00 0.90  ? 73  ASN A HA   3  
ATOM 7010  H HB2  . ASN A 1 73  ? -13.922 -9.851  -4.116  1.00 1.30  ? 73  ASN A HB2  3  
ATOM 7011  H HB3  . ASN A 1 73  ? -15.127 -11.070 -3.701  1.00 1.39  ? 73  ASN A HB3  3  
ATOM 7012  H HD21 . ASN A 1 73  ? -14.134 -11.878 -6.764  1.00 2.05  ? 73  ASN A HD21 3  
ATOM 7013  H HD22 . ASN A 1 73  ? -12.885 -12.962 -6.381  1.00 2.57  ? 73  ASN A HD22 3  
ATOM 7014  N N    . MET A 1 74  ? -17.568 -9.389  -5.542  1.00 0.71  ? 74  MET A N    3  
ATOM 7015  C CA   . MET A 1 74  ? -18.568 -8.355  -5.147  1.00 0.67  ? 74  MET A CA   3  
ATOM 7016  C C    . MET A 1 74  ? -18.752 -8.374  -3.626  1.00 0.67  ? 74  MET A C    3  
ATOM 7017  O O    . MET A 1 74  ? -19.373 -7.503  -3.049  1.00 0.71  ? 74  MET A O    3  
ATOM 7018  C CB   . MET A 1 74  ? -19.897 -8.643  -5.851  1.00 0.75  ? 74  MET A CB   3  
ATOM 7019  C CG   . MET A 1 74  ? -19.775 -8.312  -7.351  1.00 1.20  ? 74  MET A CG   3  
ATOM 7020  S SD   . MET A 1 74  ? -20.882 -9.389  -8.301  1.00 1.92  ? 74  MET A SD   3  
ATOM 7021  C CE   . MET A 1 74  ? -19.628 -10.532 -8.941  1.00 1.96  ? 74  MET A CE   3  
ATOM 7022  H H    . MET A 1 74  ? -17.857 -10.199 -6.013  1.00 0.95  ? 74  MET A H    3  
ATOM 7023  H HA   . MET A 1 74  ? -18.208 -7.380  -5.443  1.00 0.69  ? 74  MET A HA   3  
ATOM 7024  H HB2  . MET A 1 74  ? -20.144 -9.688  -5.731  1.00 1.13  ? 74  MET A HB2  3  
ATOM 7025  H HB3  . MET A 1 74  ? -20.676 -8.037  -5.411  1.00 1.14  ? 74  MET A HB3  3  
ATOM 7026  H HG2  . MET A 1 74  ? -20.051 -7.281  -7.516  1.00 1.74  ? 74  MET A HG2  3  
ATOM 7027  H HG3  . MET A 1 74  ? -18.755 -8.464  -7.681  1.00 1.78  ? 74  MET A HG3  3  
ATOM 7028  H HE1  . MET A 1 74  ? -19.089 -10.973 -8.114  1.00 2.47  ? 74  MET A HE1  3  
ATOM 7029  H HE2  . MET A 1 74  ? -18.936 -9.995  -9.571  1.00 2.23  ? 74  MET A HE2  3  
ATOM 7030  H HE3  . MET A 1 74  ? -20.111 -11.308 -9.518  1.00 2.17  ? 74  MET A HE3  3  
ATOM 7031  N N    . GLU A 1 75  ? -18.184 -9.350  -2.977  1.00 0.70  ? 75  GLU A N    3  
ATOM 7032  C CA   . GLU A 1 75  ? -18.272 -9.443  -1.490  1.00 0.75  ? 75  GLU A CA   3  
ATOM 7033  C C    . GLU A 1 75  ? -17.265 -8.472  -0.863  1.00 0.73  ? 75  GLU A C    3  
ATOM 7034  O O    . GLU A 1 75  ? -17.625 -7.639  -0.055  1.00 0.78  ? 75  GLU A O    3  
ATOM 7035  C CB   . GLU A 1 75  ? -17.940 -10.876 -1.055  1.00 0.87  ? 75  GLU A CB   3  
ATOM 7036  C CG   . GLU A 1 75  ? -19.164 -11.773 -1.261  1.00 1.15  ? 75  GLU A CG   3  
ATOM 7037  C CD   . GLU A 1 75  ? -19.628 -11.682 -2.716  1.00 1.70  ? 75  GLU A CD   3  
ATOM 7038  O OE1  . GLU A 1 75  ? -18.786 -11.784 -3.593  1.00 2.21  ? 75  GLU A OE1  3  
ATOM 7039  O OE2  . GLU A 1 75  ? -20.817 -11.512 -2.928  1.00 2.29  ? 75  GLU A OE2  3  
ATOM 7040  H H    . GLU A 1 75  ? -17.667 -10.022 -3.469  1.00 0.73  ? 75  GLU A H    3  
ATOM 7041  H HA   . GLU A 1 75  ? -19.249 -9.172  -1.117  1.00 0.77  ? 75  GLU A HA   3  
ATOM 7042  H HB2  . GLU A 1 75  ? -17.117 -11.250 -1.647  1.00 1.11  ? 75  GLU A HB2  3  
ATOM 7043  H HB3  . GLU A 1 75  ? -17.665 -10.885 -0.010  1.00 0.94  ? 75  GLU A HB3  3  
ATOM 7044  H HG2  . GLU A 1 75  ? -18.903 -12.796 -1.029  1.00 1.41  ? 75  GLU A HG2  3  
ATOM 7045  H HG3  . GLU A 1 75  ? -19.962 -11.449 -0.610  1.00 1.33  ? 75  GLU A HG3  3  
ATOM 7046  N N    . LEU A 1 76  ? -16.015 -8.565  -1.213  1.00 0.74  ? 76  LEU A N    3  
ATOM 7047  C CA   . LEU A 1 76  ? -15.017 -7.633  -0.613  1.00 0.80  ? 76  LEU A CA   3  
ATOM 7048  C C    . LEU A 1 76  ? -15.379 -6.186  -0.968  1.00 0.75  ? 76  LEU A C    3  
ATOM 7049  O O    . LEU A 1 76  ? -15.052 -5.262  -0.249  1.00 0.81  ? 76  LEU A O    3  
ATOM 7050  C CB   . LEU A 1 76  ? -13.612 -7.974  -1.122  1.00 0.92  ? 76  LEU A CB   3  
ATOM 7051  C CG   . LEU A 1 76  ? -12.548 -7.209  -0.312  1.00 1.00  ? 76  LEU A CG   3  
ATOM 7052  C CD1  . LEU A 1 76  ? -12.262 -7.927  1.015   1.00 1.57  ? 76  LEU A CD1  3  
ATOM 7053  C CD2  . LEU A 1 76  ? -11.249 -7.132  -1.121  1.00 1.51  ? 76  LEU A CD2  3  
ATOM 7054  H H    . LEU A 1 76  ? -15.732 -9.241  -1.864  1.00 0.77  ? 76  LEU A H    3  
ATOM 7055  H HA   . LEU A 1 76  ? -15.053 -7.712  0.460   1.00 0.82  ? 76  LEU A HA   3  
ATOM 7056  H HB2  . LEU A 1 76  ? -13.446 -9.038  -1.028  1.00 1.40  ? 76  LEU A HB2  3  
ATOM 7057  H HB3  . LEU A 1 76  ? -13.539 -7.695  -2.164  1.00 1.28  ? 76  LEU A HB3  3  
ATOM 7058  H HG   . LEU A 1 76  ? -12.901 -6.209  -0.107  1.00 1.62  ? 76  LEU A HG   3  
ATOM 7059  H HD11 . LEU A 1 76  ? -12.059 -8.971  0.827   1.00 1.93  ? 76  LEU A HD11 3  
ATOM 7060  H HD12 . LEU A 1 76  ? -13.114 -7.838  1.670   1.00 2.18  ? 76  LEU A HD12 3  
ATOM 7061  H HD13 . LEU A 1 76  ? -11.402 -7.475  1.487   1.00 2.01  ? 76  LEU A HD13 3  
ATOM 7062  H HD21 . LEU A 1 76  ? -10.928 -8.129  -1.381  1.00 2.04  ? 76  LEU A HD21 3  
ATOM 7063  H HD22 . LEU A 1 76  ? -10.485 -6.650  -0.530  1.00 1.83  ? 76  LEU A HD22 3  
ATOM 7064  H HD23 . LEU A 1 76  ? -11.420 -6.562  -2.022  1.00 2.09  ? 76  LEU A HD23 3  
ATOM 7065  N N    . GLN A 1 77  ? -16.073 -5.979  -2.054  1.00 0.76  ? 77  GLN A N    3  
ATOM 7066  C CA   . GLN A 1 77  ? -16.479 -4.592  -2.430  1.00 0.74  ? 77  GLN A CA   3  
ATOM 7067  C C    . GLN A 1 77  ? -17.759 -4.230  -1.660  1.00 0.71  ? 77  GLN A C    3  
ATOM 7068  O O    . GLN A 1 77  ? -17.985 -3.084  -1.319  1.00 0.72  ? 77  GLN A O    3  
ATOM 7069  C CB   . GLN A 1 77  ? -16.732 -4.520  -3.953  1.00 0.71  ? 77  GLN A CB   3  
ATOM 7070  C CG   . GLN A 1 77  ? -15.492 -3.979  -4.677  1.00 1.26  ? 77  GLN A CG   3  
ATOM 7071  C CD   . GLN A 1 77  ? -14.288 -4.872  -4.375  1.00 1.59  ? 77  GLN A CD   3  
ATOM 7072  O OE1  . GLN A 1 77  ? -13.282 -4.407  -3.878  1.00 2.35  ? 77  GLN A OE1  3  
ATOM 7073  N NE2  . GLN A 1 77  ? -14.348 -6.144  -4.660  1.00 2.03  ? 77  GLN A NE2  3  
ATOM 7074  H H    . GLN A 1 77  ? -16.344 -6.737  -2.613  1.00 0.86  ? 77  GLN A H    3  
ATOM 7075  H HA   . GLN A 1 77  ? -15.715 -3.883  -2.139  1.00 0.78  ? 77  GLN A HA   3  
ATOM 7076  H HB2  . GLN A 1 77  ? -16.952 -5.511  -4.322  1.00 1.14  ? 77  GLN A HB2  3  
ATOM 7077  H HB3  . GLN A 1 77  ? -17.572 -3.870  -4.160  1.00 1.09  ? 77  GLN A HB3  3  
ATOM 7078  H HG2  . GLN A 1 77  ? -15.675 -3.969  -5.742  1.00 1.82  ? 77  GLN A HG2  3  
ATOM 7079  H HG3  . GLN A 1 77  ? -15.287 -2.975  -4.338  1.00 1.98  ? 77  GLN A HG3  3  
ATOM 7080  H HE21 . GLN A 1 77  ? -15.158 -6.519  -5.063  1.00 2.26  ? 77  GLN A HE21 3  
ATOM 7081  H HE22 . GLN A 1 77  ? -13.581 -6.725  -4.471  1.00 2.60  ? 77  GLN A HE22 3  
ATOM 7082  N N    . ARG A 1 78  ? -18.591 -5.191  -1.372  1.00 0.72  ? 78  ARG A N    3  
ATOM 7083  C CA   . ARG A 1 78  ? -19.838 -4.878  -0.619  1.00 0.73  ? 78  ARG A CA   3  
ATOM 7084  C C    . ARG A 1 78  ? -19.492 -4.567  0.838   1.00 0.75  ? 78  ARG A C    3  
ATOM 7085  O O    . ARG A 1 78  ? -20.097 -3.716  1.460   1.00 0.79  ? 78  ARG A O    3  
ATOM 7086  C CB   . ARG A 1 78  ? -20.786 -6.077  -0.671  1.00 0.74  ? 78  ARG A CB   3  
ATOM 7087  C CG   . ARG A 1 78  ? -22.056 -5.753  0.121   1.00 0.94  ? 78  ARG A CG   3  
ATOM 7088  C CD   . ARG A 1 78  ? -23.144 -6.772  -0.218  1.00 1.23  ? 78  ARG A CD   3  
ATOM 7089  N NE   . ARG A 1 78  ? -24.292 -6.601  0.716   1.00 1.80  ? 78  ARG A NE   3  
ATOM 7090  C CZ   . ARG A 1 78  ? -25.445 -7.149  0.442   1.00 2.50  ? 78  ARG A CZ   3  
ATOM 7091  N NH1  . ARG A 1 78  ? -25.592 -7.847  -0.651  1.00 2.83  ? 78  ARG A NH1  3  
ATOM 7092  N NH2  . ARG A 1 78  ? -26.450 -6.999  1.260   1.00 3.41  ? 78  ARG A NH2  3  
ATOM 7093  H H    . ARG A 1 78  ? -18.396 -6.112  -1.644  1.00 0.75  ? 78  ARG A H    3  
ATOM 7094  H HA   . ARG A 1 78  ? -20.321 -4.023  -1.070  1.00 0.75  ? 78  ARG A HA   3  
ATOM 7095  H HB2  . ARG A 1 78  ? -21.044 -6.287  -1.699  1.00 0.91  ? 78  ARG A HB2  3  
ATOM 7096  H HB3  . ARG A 1 78  ? -20.303 -6.939  -0.236  1.00 0.83  ? 78  ARG A HB3  3  
ATOM 7097  H HG2  . ARG A 1 78  ? -21.841 -5.794  1.179   1.00 1.18  ? 78  ARG A HG2  3  
ATOM 7098  H HG3  . ARG A 1 78  ? -22.400 -4.763  -0.138  1.00 1.35  ? 78  ARG A HG3  3  
ATOM 7099  H HD2  . ARG A 1 78  ? -23.479 -6.614  -1.232  1.00 1.78  ? 78  ARG A HD2  3  
ATOM 7100  H HD3  . ARG A 1 78  ? -22.745 -7.770  -0.121  1.00 1.68  ? 78  ARG A HD3  3  
ATOM 7101  H HE   . ARG A 1 78  ? -24.182 -6.078  1.538   1.00 2.23  ? 78  ARG A HE   3  
ATOM 7102  H HH11 . ARG A 1 78  ? -24.822 -7.962  -1.279  1.00 2.69  ? 78  ARG A HH11 3  
ATOM 7103  H HH12 . ARG A 1 78  ? -26.475 -8.266  -0.862  1.00 3.57  ? 78  ARG A HH12 3  
ATOM 7104  H HH21 . ARG A 1 78  ? -26.337 -6.464  2.097   1.00 3.73  ? 78  ARG A HH21 3  
ATOM 7105  H HH22 . ARG A 1 78  ? -27.333 -7.418  1.049   1.00 4.02  ? 78  ARG A HH22 3  
ATOM 7106  N N    . MET A 1 79  ? -18.522 -5.247  1.392   1.00 0.75  ? 79  MET A N    3  
ATOM 7107  C CA   . MET A 1 79  ? -18.146 -4.979  2.809   1.00 0.77  ? 79  MET A CA   3  
ATOM 7108  C C    . MET A 1 79  ? -17.561 -3.570  2.913   1.00 0.77  ? 79  MET A C    3  
ATOM 7109  O O    . MET A 1 79  ? -17.922 -2.801  3.782   1.00 0.78  ? 79  MET A O    3  
ATOM 7110  C CB   . MET A 1 79  ? -17.109 -6.009  3.272   1.00 0.81  ? 79  MET A CB   3  
ATOM 7111  C CG   . MET A 1 79  ? -17.803 -7.344  3.552   1.00 1.08  ? 79  MET A CG   3  
ATOM 7112  S SD   . MET A 1 79  ? -16.596 -8.533  4.191   1.00 1.07  ? 79  MET A SD   3  
ATOM 7113  C CE   . MET A 1 79  ? -16.804 -8.155  5.949   1.00 0.81  ? 79  MET A CE   3  
ATOM 7114  H H    . MET A 1 79  ? -18.039 -5.929  0.880   1.00 0.77  ? 79  MET A H    3  
ATOM 7115  H HA   . MET A 1 79  ? -19.026 -5.047  3.432   1.00 0.78  ? 79  MET A HA   3  
ATOM 7116  H HB2  . MET A 1 79  ? -16.366 -6.144  2.499   1.00 1.29  ? 79  MET A HB2  3  
ATOM 7117  H HB3  . MET A 1 79  ? -16.630 -5.658  4.174   1.00 1.16  ? 79  MET A HB3  3  
ATOM 7118  H HG2  . MET A 1 79  ? -18.585 -7.197  4.283   1.00 1.48  ? 79  MET A HG2  3  
ATOM 7119  H HG3  . MET A 1 79  ? -18.234 -7.725  2.638   1.00 1.58  ? 79  MET A HG3  3  
ATOM 7120  H HE1  . MET A 1 79  ? -16.050 -8.680  6.521   1.00 1.37  ? 79  MET A HE1  3  
ATOM 7121  H HE2  . MET A 1 79  ? -17.782 -8.470  6.273   1.00 1.34  ? 79  MET A HE2  3  
ATOM 7122  H HE3  . MET A 1 79  ? -16.702 -7.089  6.101   1.00 1.20  ? 79  MET A HE3  3  
ATOM 7123  N N    . ILE A 1 80  ? -16.665 -3.218  2.029   1.00 0.77  ? 80  ILE A N    3  
ATOM 7124  C CA   . ILE A 1 80  ? -16.074 -1.852  2.082   1.00 0.80  ? 80  ILE A CA   3  
ATOM 7125  C C    . ILE A 1 80  ? -17.204 -0.821  2.058   1.00 0.80  ? 80  ILE A C    3  
ATOM 7126  O O    . ILE A 1 80  ? -17.093 0.249   2.623   1.00 0.83  ? 80  ILE A O    3  
ATOM 7127  C CB   . ILE A 1 80  ? -15.147 -1.643  0.882   1.00 0.82  ? 80  ILE A CB   3  
ATOM 7128  C CG1  . ILE A 1 80  ? -13.942 -2.579  1.009   1.00 0.84  ? 80  ILE A CG1  3  
ATOM 7129  C CG2  . ILE A 1 80  ? -14.659 -0.192  0.856   1.00 0.89  ? 80  ILE A CG2  3  
ATOM 7130  C CD1  . ILE A 1 80  ? -13.156 -2.583  -0.304  1.00 1.10  ? 80  ILE A CD1  3  
ATOM 7131  H H    . ILE A 1 80  ? -16.387 -3.847  1.331   1.00 0.77  ? 80  ILE A H    3  
ATOM 7132  H HA   . ILE A 1 80  ? -15.512 -1.737  2.998   1.00 0.82  ? 80  ILE A HA   3  
ATOM 7133  H HB   . ILE A 1 80  ? -15.682 -1.861  -0.030  1.00 0.80  ? 80  ILE A HB   3  
ATOM 7134  H HG12 . ILE A 1 80  ? -13.303 -2.235  1.810   1.00 0.89  ? 80  ILE A HG12 3  
ATOM 7135  H HG13 . ILE A 1 80  ? -14.284 -3.580  1.224   1.00 1.04  ? 80  ILE A HG13 3  
ATOM 7136  H HG21 . ILE A 1 80  ? -15.474 0.458   0.575   1.00 1.27  ? 80  ILE A HG21 3  
ATOM 7137  H HG22 . ILE A 1 80  ? -13.858 -0.095  0.138   1.00 1.34  ? 80  ILE A HG22 3  
ATOM 7138  H HG23 . ILE A 1 80  ? -14.299 0.085   1.836   1.00 1.40  ? 80  ILE A HG23 3  
ATOM 7139  H HD11 . ILE A 1 80  ? -13.798 -2.910  -1.107  1.00 1.67  ? 80  ILE A HD11 3  
ATOM 7140  H HD12 . ILE A 1 80  ? -12.315 -3.256  -0.217  1.00 1.53  ? 80  ILE A HD12 3  
ATOM 7141  H HD13 . ILE A 1 80  ? -12.798 -1.585  -0.512  1.00 1.46  ? 80  ILE A HD13 3  
ATOM 7142  N N    . ALA A 1 81  ? -18.301 -1.141  1.421   1.00 0.78  ? 81  ALA A N    3  
ATOM 7143  C CA   . ALA A 1 81  ? -19.441 -0.181  1.382   1.00 0.80  ? 81  ALA A CA   3  
ATOM 7144  C C    . ALA A 1 81  ? -20.091 -0.135  2.770   1.00 0.81  ? 81  ALA A C    3  
ATOM 7145  O O    . ALA A 1 81  ? -20.795 0.795   3.109   1.00 0.85  ? 81  ALA A O    3  
ATOM 7146  C CB   . ALA A 1 81  ? -20.467 -0.638  0.342   1.00 0.79  ? 81  ALA A CB   3  
ATOM 7147  H H    . ALA A 1 81  ? -18.377 -2.016  0.981   1.00 0.76  ? 81  ALA A H    3  
ATOM 7148  H HA   . ALA A 1 81  ? -19.074 0.801   1.130   1.00 0.84  ? 81  ALA A HA   3  
ATOM 7149  H HB1  . ALA A 1 81  ? -20.881 -1.591  0.639   1.00 1.32  ? 81  ALA A HB1  3  
ATOM 7150  H HB2  . ALA A 1 81  ? -19.984 -0.740  -0.619  1.00 1.19  ? 81  ALA A HB2  3  
ATOM 7151  H HB3  . ALA A 1 81  ? -21.259 0.092   0.272   1.00 1.34  ? 81  ALA A HB3  3  
ATOM 7152  N N    . ALA A 1 82  ? -19.837 -1.128  3.577   1.00 0.78  ? 82  ALA A N    3  
ATOM 7153  C CA   . ALA A 1 82  ? -20.409 -1.159  4.955   1.00 0.80  ? 82  ALA A CA   3  
ATOM 7154  C C    . ALA A 1 82  ? -19.580 -0.256  5.873   1.00 0.79  ? 82  ALA A C    3  
ATOM 7155  O O    . ALA A 1 82  ? -19.964 0.025   6.991   1.00 0.83  ? 82  ALA A O    3  
ATOM 7156  C CB   . ALA A 1 82  ? -20.367 -2.592  5.487   1.00 0.87  ? 82  ALA A CB   3  
ATOM 7157  H H    . ALA A 1 82  ? -19.253 -1.857  3.279   1.00 0.76  ? 82  ALA A H    3  
ATOM 7158  H HA   . ALA A 1 82  ? -21.431 -0.809  4.962   1.00 0.83  ? 82  ALA A HA   3  
ATOM 7159  H HB1  . ALA A 1 82  ? -19.342 -2.877  5.673   1.00 1.37  ? 82  ALA A HB1  3  
ATOM 7160  H HB2  . ALA A 1 82  ? -20.800 -3.260  4.757   1.00 1.22  ? 82  ALA A HB2  3  
ATOM 7161  H HB3  . ALA A 1 82  ? -20.929 -2.650  6.407   1.00 1.37  ? 82  ALA A HB3  3  
ATOM 7162  N N    . VAL A 1 83  ? -18.455 0.216   5.408   1.00 0.80  ? 83  VAL A N    3  
ATOM 7163  C CA   . VAL A 1 83  ? -17.613 1.118   6.251   1.00 0.85  ? 83  VAL A CA   3  
ATOM 7164  C C    . VAL A 1 83  ? -18.046 2.564   6.009   1.00 0.99  ? 83  VAL A C    3  
ATOM 7165  O O    . VAL A 1 83  ? -17.546 3.246   5.137   1.00 1.36  ? 83  VAL A O    3  
ATOM 7166  C CB   . VAL A 1 83  ? -16.137 0.951   5.880   1.00 0.97  ? 83  VAL A CB   3  
ATOM 7167  C CG1  . VAL A 1 83  ? -15.268 1.750   6.853   1.00 1.81  ? 83  VAL A CG1  3  
ATOM 7168  C CG2  . VAL A 1 83  ? -15.751 -0.528  5.952   1.00 1.40  ? 83  VAL A CG2  3  
ATOM 7169  H H    . VAL A 1 83  ? -18.169 -0.008  4.498   1.00 0.82  ? 83  VAL A H    3  
ATOM 7170  H HA   . VAL A 1 83  ? -17.762 0.907   7.300   1.00 0.90  ? 83  VAL A HA   3  
ATOM 7171  H HB   . VAL A 1 83  ? -15.977 1.317   4.876   1.00 1.62  ? 83  VAL A HB   3  
ATOM 7172  H HG11 . VAL A 1 83  ? -14.225 1.578   6.630   1.00 2.36  ? 83  VAL A HG11 3  
ATOM 7173  H HG12 . VAL A 1 83  ? -15.477 1.435   7.865   1.00 2.40  ? 83  VAL A HG12 3  
ATOM 7174  H HG13 . VAL A 1 83  ? -15.488 2.803   6.751   1.00 2.21  ? 83  VAL A HG13 3  
ATOM 7175  H HG21 . VAL A 1 83  ? -14.705 -0.640  5.704   1.00 2.00  ? 83  VAL A HG21 3  
ATOM 7176  H HG22 . VAL A 1 83  ? -16.349 -1.091  5.251   1.00 1.97  ? 83  VAL A HG22 3  
ATOM 7177  H HG23 . VAL A 1 83  ? -15.925 -0.898  6.952   1.00 1.85  ? 83  VAL A HG23 3  
ATOM 7178  N N    . ASP A 1 84  ? -18.969 3.034   6.808   1.00 1.46  ? 84  ASP A N    3  
ATOM 7179  C CA   . ASP A 1 84  ? -19.453 4.436   6.683   1.00 1.71  ? 84  ASP A CA   3  
ATOM 7180  C C    . ASP A 1 84  ? -18.299 5.399   6.964   1.00 1.39  ? 84  ASP A C    3  
ATOM 7181  O O    . ASP A 1 84  ? -17.353 5.067   7.651   1.00 1.80  ? 84  ASP A O    3  
ATOM 7182  C CB   . ASP A 1 84  ? -20.562 4.672   7.712   1.00 2.38  ? 84  ASP A CB   3  
ATOM 7183  C CG   . ASP A 1 84  ? -21.113 6.091   7.557   1.00 2.99  ? 84  ASP A CG   3  
ATOM 7184  O OD1  . ASP A 1 84  ? -20.999 6.634   6.471   1.00 3.57  ? 84  ASP A OD1  3  
ATOM 7185  O OD2  . ASP A 1 84  ? -21.640 6.610   8.527   1.00 3.45  ? 84  ASP A OD2  3  
ATOM 7186  H H    . ASP A 1 84  ? -19.341 2.460   7.510   1.00 1.92  ? 84  ASP A H    3  
ATOM 7187  H HA   . ASP A 1 84  ? -19.842 4.619   5.692   1.00 2.10  ? 84  ASP A HA   3  
ATOM 7188  H HB2  . ASP A 1 84  ? -21.357 3.958   7.554   1.00 2.86  ? 84  ASP A HB2  3  
ATOM 7189  H HB3  . ASP A 1 84  ? -20.161 4.552   8.707   1.00 2.68  ? 84  ASP A HB3  3  
ATOM 7190  N N    . THR A 1 85  ? -18.370 6.593   6.440   1.00 1.68  ? 85  THR A N    3  
ATOM 7191  C CA   . THR A 1 85  ? -17.279 7.586   6.674   1.00 1.97  ? 85  THR A CA   3  
ATOM 7192  C C    . THR A 1 85  ? -17.632 8.459   7.881   1.00 1.67  ? 85  THR A C    3  
ATOM 7193  O O    . THR A 1 85  ? -18.776 8.806   8.096   1.00 2.28  ? 85  THR A O    3  
ATOM 7194  C CB   . THR A 1 85  ? -17.122 8.471   5.434   1.00 3.20  ? 85  THR A CB   3  
ATOM 7195  O OG1  . THR A 1 85  ? -16.212 9.525   5.720   1.00 3.80  ? 85  THR A OG1  3  
ATOM 7196  C CG2  . THR A 1 85  ? -18.479 9.059   5.043   1.00 3.87  ? 85  THR A CG2  3  
ATOM 7197  H H    . THR A 1 85  ? -19.143 6.839   5.891   1.00 2.23  ? 85  THR A H    3  
ATOM 7198  H HA   . THR A 1 85  ? -16.348 7.070   6.864   1.00 2.24  ? 85  THR A HA   3  
ATOM 7199  H HB   . THR A 1 85  ? -16.742 7.880   4.615   1.00 3.70  ? 85  THR A HB   3  
ATOM 7200  H HG1  . THR A 1 85  ? -16.461 9.911   6.562   1.00 4.15  ? 85  THR A HG1  3  
ATOM 7201  H HG21 . THR A 1 85  ? -18.358 9.703   4.184   1.00 4.19  ? 85  THR A HG21 3  
ATOM 7202  H HG22 . THR A 1 85  ? -18.875 9.632   5.868   1.00 4.15  ? 85  THR A HG22 3  
ATOM 7203  H HG23 . THR A 1 85  ? -19.162 8.260   4.799   1.00 4.28  ? 85  THR A HG23 3  
ATOM 7204  N N    . ASP A 1 86  ? -16.656 8.817   8.670   1.00 1.51  ? 86  ASP A N    3  
ATOM 7205  C CA   . ASP A 1 86  ? -16.931 9.668   9.862   1.00 1.98  ? 86  ASP A CA   3  
ATOM 7206  C C    . ASP A 1 86  ? -15.608 10.177  10.435  1.00 1.78  ? 86  ASP A C    3  
ATOM 7207  O O    . ASP A 1 86  ? -15.474 11.322  10.817  1.00 2.48  ? 86  ASP A O    3  
ATOM 7208  C CB   . ASP A 1 86  ? -17.670 8.849   10.921  1.00 2.56  ? 86  ASP A CB   3  
ATOM 7209  C CG   . ASP A 1 86  ? -18.001 9.743   12.117  1.00 3.06  ? 86  ASP A CG   3  
ATOM 7210  O OD1  . ASP A 1 86  ? -18.288 10.909  11.898  1.00 3.50  ? 86  ASP A OD1  3  
ATOM 7211  O OD2  . ASP A 1 86  ? -17.962 9.248   13.231  1.00 3.57  ? 86  ASP A OD2  3  
ATOM 7212  H H    . ASP A 1 86  ? -15.740 8.527   8.478   1.00 1.71  ? 86  ASP A H    3  
ATOM 7213  H HA   . ASP A 1 86  ? -17.541 10.510  9.568   1.00 2.59  ? 86  ASP A HA   3  
ATOM 7214  H HB2  . ASP A 1 86  ? -18.585 8.457   10.499  1.00 2.88  ? 86  ASP A HB2  3  
ATOM 7215  H HB3  . ASP A 1 86  ? -17.044 8.032   11.247  1.00 3.03  ? 86  ASP A HB3  3  
ATOM 7216  N N    . SER A 1 87  ? -14.623 9.319   10.479  1.00 1.11  ? 87  SER A N    3  
ATOM 7217  C CA   . SER A 1 87  ? -13.284 9.712   11.003  1.00 0.93  ? 87  SER A CA   3  
ATOM 7218  C C    . SER A 1 87  ? -12.235 8.804   10.340  1.00 0.84  ? 87  SER A C    3  
ATOM 7219  O O    . SER A 1 87  ? -11.754 7.877   10.962  1.00 0.97  ? 87  SER A O    3  
ATOM 7220  C CB   . SER A 1 87  ? -13.247 9.520   12.521  1.00 0.88  ? 87  SER A CB   3  
ATOM 7221  O OG   . SER A 1 87  ? -13.456 8.146   12.825  1.00 1.63  ? 87  SER A OG   3  
ATOM 7222  H H    . SER A 1 87  ? -14.764 8.406   10.152  1.00 1.20  ? 87  SER A H    3  
ATOM 7223  H HA   . SER A 1 87  ? -13.093 10.743  10.754  1.00 1.05  ? 87  SER A HA   3  
ATOM 7224  H HB2  . SER A 1 87  ? -12.287 9.824   12.902  1.00 1.41  ? 87  SER A HB2  3  
ATOM 7225  H HB3  . SER A 1 87  ? -14.021 10.122  12.978  1.00 1.22  ? 87  SER A HB3  3  
ATOM 7226  H HG   . SER A 1 87  ? -12.655 7.667   12.600  1.00 2.08  ? 87  SER A HG   3  
ATOM 7227  N N    . PRO A 1 88  ? -11.929 9.066   9.081   1.00 0.77  ? 88  PRO A N    3  
ATOM 7228  C CA   . PRO A 1 88  ? -10.968 8.236   8.331   1.00 0.83  ? 88  PRO A CA   3  
ATOM 7229  C C    . PRO A 1 88  ? -9.581  8.285   8.986   1.00 0.73  ? 88  PRO A C    3  
ATOM 7230  O O    . PRO A 1 88  ? -8.724  7.476   8.692   1.00 0.72  ? 88  PRO A O    3  
ATOM 7231  C CB   . PRO A 1 88  ? -10.945 8.838   6.903   1.00 1.01  ? 88  PRO A CB   3  
ATOM 7232  C CG   . PRO A 1 88  ? -11.930 10.041  6.886   1.00 1.07  ? 88  PRO A CG   3  
ATOM 7233  C CD   . PRO A 1 88  ? -12.501 10.197  8.313   1.00 0.83  ? 88  PRO A CD   3  
ATOM 7234  H HA   . PRO A 1 88  ? -11.317 7.214   8.284   1.00 0.98  ? 88  PRO A HA   3  
ATOM 7235  H HB2  . PRO A 1 88  ? -9.944  9.173   6.652   1.00 1.03  ? 88  PRO A HB2  3  
ATOM 7236  H HB3  . PRO A 1 88  ? -11.267 8.097   6.183   1.00 1.17  ? 88  PRO A HB3  3  
ATOM 7237  H HG2  . PRO A 1 88  ? -11.404 10.942  6.591   1.00 1.20  ? 88  PRO A HG2  3  
ATOM 7238  H HG3  . PRO A 1 88  ? -12.739 9.859   6.191   1.00 1.29  ? 88  PRO A HG3  3  
ATOM 7239  H HD2  . PRO A 1 88  ? -12.183 11.141  8.735   1.00 0.84  ? 88  PRO A HD2  3  
ATOM 7240  H HD3  . PRO A 1 88  ? -13.580 10.132  8.304   1.00 0.89  ? 88  PRO A HD3  3  
ATOM 7241  N N    . ARG A 1 89  ? -9.345  9.225   9.865   1.00 0.75  ? 89  ARG A N    3  
ATOM 7242  C CA   . ARG A 1 89  ? -8.002  9.299   10.511  1.00 0.73  ? 89  ARG A CA   3  
ATOM 7243  C C    . ARG A 1 89  ? -7.925  8.244   11.620  1.00 0.67  ? 89  ARG A C    3  
ATOM 7244  O O    . ARG A 1 89  ? -6.979  7.487   11.703  1.00 0.68  ? 89  ARG A O    3  
ATOM 7245  C CB   . ARG A 1 89  ? -7.782  10.702  11.086  1.00 0.79  ? 89  ARG A CB   3  
ATOM 7246  C CG   . ARG A 1 89  ? -6.343  10.847  11.586  1.00 1.63  ? 89  ARG A CG   3  
ATOM 7247  C CD   . ARG A 1 89  ? -6.166  12.229  12.220  1.00 1.65  ? 89  ARG A CD   3  
ATOM 7248  N NE   . ARG A 1 89  ? -7.009  12.324  13.446  1.00 2.07  ? 89  ARG A NE   3  
ATOM 7249  C CZ   . ARG A 1 89  ? -6.815  13.292  14.301  1.00 2.47  ? 89  ARG A CZ   3  
ATOM 7250  N NH1  . ARG A 1 89  ? -5.891  14.186  14.076  1.00 2.69  ? 89  ARG A NH1  3  
ATOM 7251  N NH2  . ARG A 1 89  ? -7.548  13.369  15.378  1.00 3.10  ? 89  ARG A NH2  3  
ATOM 7252  H H    . ARG A 1 89  ? -10.040 9.877   10.092  1.00 0.82  ? 89  ARG A H    3  
ATOM 7253  H HA   . ARG A 1 89  ? -7.257  9.075   9.760   1.00 0.76  ? 89  ARG A HA   3  
ATOM 7254  H HB2  . ARG A 1 89  ? -7.969  11.437  10.316  1.00 1.38  ? 89  ARG A HB2  3  
ATOM 7255  H HB3  . ARG A 1 89  ? -8.463  10.864  11.908  1.00 1.17  ? 89  ARG A HB3  3  
ATOM 7256  H HG2  . ARG A 1 89  ? -6.138  10.082  12.321  1.00 2.22  ? 89  ARG A HG2  3  
ATOM 7257  H HG3  . ARG A 1 89  ? -5.660  10.744  10.756  1.00 2.30  ? 89  ARG A HG3  3  
ATOM 7258  H HD2  . ARG A 1 89  ? -5.130  12.376  12.484  1.00 1.89  ? 89  ARG A HD2  3  
ATOM 7259  H HD3  . ARG A 1 89  ? -6.468  12.990  11.514  1.00 1.63  ? 89  ARG A HD3  3  
ATOM 7260  H HE   . ARG A 1 89  ? -7.707  11.657  13.613  1.00 2.46  ? 89  ARG A HE   3  
ATOM 7261  H HH11 . ARG A 1 89  ? -5.331  14.130  13.250  1.00 2.55  ? 89  ARG A HH11 3  
ATOM 7262  H HH12 . ARG A 1 89  ? -5.744  14.928  14.731  1.00 3.27  ? 89  ARG A HH12 3  
ATOM 7263  H HH21 . ARG A 1 89  ? -8.258  12.686  15.549  1.00 3.36  ? 89  ARG A HH21 3  
ATOM 7264  H HH22 . ARG A 1 89  ? -7.400  14.110  16.032  1.00 3.53  ? 89  ARG A HH22 3  
ATOM 7265  N N    . GLU A 1 90  ? -8.919  8.180   12.467  1.00 0.65  ? 90  GLU A N    3  
ATOM 7266  C CA   . GLU A 1 90  ? -8.902  7.163   13.560  1.00 0.65  ? 90  GLU A CA   3  
ATOM 7267  C C    . GLU A 1 90  ? -9.022  5.763   12.949  1.00 0.64  ? 90  GLU A C    3  
ATOM 7268  O O    . GLU A 1 90  ? -8.283  4.865   13.300  1.00 0.67  ? 90  GLU A O    3  
ATOM 7269  C CB   . GLU A 1 90  ? -10.082 7.411   14.501  1.00 0.71  ? 90  GLU A CB   3  
ATOM 7270  C CG   . GLU A 1 90  ? -9.948  8.801   15.127  1.00 1.32  ? 90  GLU A CG   3  
ATOM 7271  C CD   . GLU A 1 90  ? -8.764  8.813   16.095  1.00 2.02  ? 90  GLU A CD   3  
ATOM 7272  O OE1  . GLU A 1 90  ? -8.831  8.110   17.090  1.00 2.78  ? 90  GLU A OE1  3  
ATOM 7273  O OE2  . GLU A 1 90  ? -7.810  9.524   15.824  1.00 2.46  ? 90  GLU A OE2  3  
ATOM 7274  H H    . GLU A 1 90  ? -9.676  8.796   12.386  1.00 0.67  ? 90  GLU A H    3  
ATOM 7275  H HA   . GLU A 1 90  ? -7.978  7.245   14.111  1.00 0.66  ? 90  GLU A HA   3  
ATOM 7276  H HB2  . GLU A 1 90  ? -11.006 7.352   13.944  1.00 1.12  ? 90  GLU A HB2  3  
ATOM 7277  H HB3  . GLU A 1 90  ? -10.082 6.666   15.282  1.00 1.09  ? 90  GLU A HB3  3  
ATOM 7278  H HG2  . GLU A 1 90  ? -9.785  9.532   14.348  1.00 1.90  ? 90  GLU A HG2  3  
ATOM 7279  H HG3  . GLU A 1 90  ? -10.853 9.042   15.664  1.00 1.78  ? 90  GLU A HG3  3  
ATOM 7280  N N    . VAL A 1 91  ? -9.945  5.558   12.048  1.00 0.64  ? 91  VAL A N    3  
ATOM 7281  C CA   . VAL A 1 91  ? -10.097 4.204   11.440  1.00 0.67  ? 91  VAL A CA   3  
ATOM 7282  C C    . VAL A 1 91  ? -8.806  3.821   10.715  1.00 0.66  ? 91  VAL A C    3  
ATOM 7283  O O    . VAL A 1 91  ? -8.327  2.711   10.829  1.00 0.67  ? 91  VAL A O    3  
ATOM 7284  C CB   . VAL A 1 91  ? -11.268 4.217   10.453  1.00 0.71  ? 91  VAL A CB   3  
ATOM 7285  C CG1  . VAL A 1 91  ? -11.494 2.810   9.896   1.00 0.80  ? 91  VAL A CG1  3  
ATOM 7286  C CG2  . VAL A 1 91  ? -12.535 4.689   11.171  1.00 0.75  ? 91  VAL A CG2  3  
ATOM 7287  H H    . VAL A 1 91  ? -10.539 6.283   11.765  1.00 0.65  ? 91  VAL A H    3  
ATOM 7288  H HA   . VAL A 1 91  ? -10.278 3.476   12.217  1.00 0.69  ? 91  VAL A HA   3  
ATOM 7289  H HB   . VAL A 1 91  ? -11.043 4.892   9.639   1.00 0.70  ? 91  VAL A HB   3  
ATOM 7290  H HG11 . VAL A 1 91  ? -10.611 2.487   9.364   1.00 1.38  ? 91  VAL A HG11 3  
ATOM 7291  H HG12 . VAL A 1 91  ? -12.337 2.822   9.221   1.00 1.38  ? 91  VAL A HG12 3  
ATOM 7292  H HG13 . VAL A 1 91  ? -11.693 2.128   10.709  1.00 1.12  ? 91  VAL A HG13 3  
ATOM 7293  H HG21 . VAL A 1 91  ? -13.342 4.775   10.459  1.00 1.26  ? 91  VAL A HG21 3  
ATOM 7294  H HG22 . VAL A 1 91  ? -12.353 5.651   11.627  1.00 1.29  ? 91  VAL A HG22 3  
ATOM 7295  H HG23 . VAL A 1 91  ? -12.804 3.974   11.935  1.00 1.25  ? 91  VAL A HG23 3  
ATOM 7296  N N    . PHE A 1 92  ? -8.235  4.727   9.977   1.00 0.64  ? 92  PHE A N    3  
ATOM 7297  C CA   . PHE A 1 92  ? -6.971  4.409   9.256   1.00 0.65  ? 92  PHE A CA   3  
ATOM 7298  C C    . PHE A 1 92  ? -5.954  3.799   10.229  1.00 0.62  ? 92  PHE A C    3  
ATOM 7299  O O    . PHE A 1 92  ? -5.354  2.781   9.943   1.00 0.67  ? 92  PHE A O    3  
ATOM 7300  C CB   . PHE A 1 92  ? -6.396  5.693   8.647   1.00 0.65  ? 92  PHE A CB   3  
ATOM 7301  C CG   . PHE A 1 92  ? -5.015  5.423   8.096   1.00 0.65  ? 92  PHE A CG   3  
ATOM 7302  C CD1  . PHE A 1 92  ? -4.858  4.996   6.772   1.00 1.44  ? 92  PHE A CD1  3  
ATOM 7303  C CD2  . PHE A 1 92  ? -3.892  5.598   8.913   1.00 1.31  ? 92  PHE A CD2  3  
ATOM 7304  C CE1  . PHE A 1 92  ? -3.577  4.744   6.265   1.00 1.47  ? 92  PHE A CE1  3  
ATOM 7305  C CE2  . PHE A 1 92  ? -2.611  5.346   8.407   1.00 1.31  ? 92  PHE A CE2  3  
ATOM 7306  C CZ   . PHE A 1 92  ? -2.454  4.920   7.083   1.00 0.73  ? 92  PHE A CZ   3  
ATOM 7307  H H    . PHE A 1 92  ? -8.633  5.619   9.898   1.00 0.63  ? 92  PHE A H    3  
ATOM 7308  H HA   . PHE A 1 92  ? -7.163  3.695   8.468   1.00 0.68  ? 92  PHE A HA   3  
ATOM 7309  H HB2  . PHE A 1 92  ? -7.042  6.032   7.851   1.00 0.66  ? 92  PHE A HB2  3  
ATOM 7310  H HB3  . PHE A 1 92  ? -6.336  6.455   9.410   1.00 0.67  ? 92  PHE A HB3  3  
ATOM 7311  H HD1  . PHE A 1 92  ? -5.724  4.861   6.141   1.00 2.30  ? 92  PHE A HD1  3  
ATOM 7312  H HD2  . PHE A 1 92  ? -4.013  5.927   9.934   1.00 2.16  ? 92  PHE A HD2  3  
ATOM 7313  H HE1  . PHE A 1 92  ? -3.455  4.414   5.244   1.00 2.34  ? 92  PHE A HE1  3  
ATOM 7314  H HE2  . PHE A 1 92  ? -1.745  5.482   9.037   1.00 2.16  ? 92  PHE A HE2  3  
ATOM 7315  H HZ   . PHE A 1 92  ? -1.466  4.725   6.692   1.00 0.77  ? 92  PHE A HZ   3  
ATOM 7316  N N    . PHE A 1 93  ? -5.736  4.406   11.365  1.00 0.58  ? 93  PHE A N    3  
ATOM 7317  C CA   . PHE A 1 93  ? -4.736  3.839   12.319  1.00 0.57  ? 93  PHE A CA   3  
ATOM 7318  C C    . PHE A 1 93  ? -5.350  2.647   13.058  1.00 0.59  ? 93  PHE A C    3  
ATOM 7319  O O    . PHE A 1 93  ? -4.666  1.702   13.399  1.00 0.60  ? 93  PHE A O    3  
ATOM 7320  C CB   . PHE A 1 93  ? -4.310  4.913   13.321  1.00 0.57  ? 93  PHE A CB   3  
ATOM 7321  C CG   . PHE A 1 93  ? -3.231  4.368   14.229  1.00 0.56  ? 93  PHE A CG   3  
ATOM 7322  C CD1  . PHE A 1 93  ? -1.904  4.316   13.785  1.00 1.15  ? 93  PHE A CD1  3  
ATOM 7323  C CD2  . PHE A 1 93  ? -3.557  3.920   15.515  1.00 1.47  ? 93  PHE A CD2  3  
ATOM 7324  C CE1  . PHE A 1 93  ? -0.904  3.816   14.626  1.00 1.07  ? 93  PHE A CE1  3  
ATOM 7325  C CE2  . PHE A 1 93  ? -2.555  3.421   16.357  1.00 1.58  ? 93  PHE A CE2  3  
ATOM 7326  C CZ   . PHE A 1 93  ? -1.229  3.369   15.913  1.00 0.70  ? 93  PHE A CZ   3  
ATOM 7327  H H    . PHE A 1 93  ? -6.215  5.233   11.584  1.00 0.57  ? 93  PHE A H    3  
ATOM 7328  H HA   . PHE A 1 93  ? -3.880  3.498   11.755  1.00 0.57  ? 93  PHE A HA   3  
ATOM 7329  H HB2  . PHE A 1 93  ? -3.929  5.771   12.786  1.00 0.62  ? 93  PHE A HB2  3  
ATOM 7330  H HB3  . PHE A 1 93  ? -5.162  5.210   13.914  1.00 0.56  ? 93  PHE A HB3  3  
ATOM 7331  H HD1  . PHE A 1 93  ? -1.653  4.661   12.793  1.00 2.04  ? 93  PHE A HD1  3  
ATOM 7332  H HD2  . PHE A 1 93  ? -4.580  3.960   15.859  1.00 2.29  ? 93  PHE A HD2  3  
ATOM 7333  H HE1  . PHE A 1 93  ? 0.120   3.776   14.284  1.00 1.86  ? 93  PHE A HE1  3  
ATOM 7334  H HE2  . PHE A 1 93  ? -2.806  3.076   17.349  1.00 2.50  ? 93  PHE A HE2  3  
ATOM 7335  H HZ   . PHE A 1 93  ? -0.456  2.984   16.562  1.00 0.78  ? 93  PHE A HZ   3  
ATOM 7336  N N    . ARG A 1 94  ? -6.632  2.673   13.301  1.00 0.62  ? 94  ARG A N    3  
ATOM 7337  C CA   . ARG A 1 94  ? -7.269  1.526   14.007  1.00 0.67  ? 94  ARG A CA   3  
ATOM 7338  C C    . ARG A 1 94  ? -7.247  0.307   13.086  1.00 0.66  ? 94  ARG A C    3  
ATOM 7339  O O    . ARG A 1 94  ? -6.767  -0.746  13.460  1.00 0.67  ? 94  ARG A O    3  
ATOM 7340  C CB   . ARG A 1 94  ? -8.714  1.884   14.391  1.00 0.72  ? 94  ARG A CB   3  
ATOM 7341  C CG   . ARG A 1 94  ? -9.193  1.020   15.572  1.00 0.89  ? 94  ARG A CG   3  
ATOM 7342  C CD   . ARG A 1 94  ? -9.410  -0.436  15.131  1.00 1.00  ? 94  ARG A CD   3  
ATOM 7343  N NE   . ARG A 1 94  ? -10.338 -1.099  16.090  1.00 1.95  ? 94  ARG A NE   3  
ATOM 7344  C CZ   . ARG A 1 94  ? -10.907 -2.230  15.775  1.00 2.64  ? 94  ARG A CZ   3  
ATOM 7345  N NH1  . ARG A 1 94  ? -10.663 -2.785  14.620  1.00 2.76  ? 94  ARG A NH1  3  
ATOM 7346  N NH2  . ARG A 1 94  ? -11.722 -2.805  16.617  1.00 3.65  ? 94  ARG A NH2  3  
ATOM 7347  H H    . ARG A 1 94  ? -7.173  3.437   13.013  1.00 0.62  ? 94  ARG A H    3  
ATOM 7348  H HA   . ARG A 1 94  ? -6.696  1.285   14.890  1.00 0.68  ? 94  ARG A HA   3  
ATOM 7349  H HB2  . ARG A 1 94  ? -8.753  2.925   14.677  1.00 0.81  ? 94  ARG A HB2  3  
ATOM 7350  H HB3  . ARG A 1 94  ? -9.365  1.727   13.543  1.00 0.78  ? 94  ARG A HB3  3  
ATOM 7351  H HG2  . ARG A 1 94  ? -8.457  1.049   16.361  1.00 1.50  ? 94  ARG A HG2  3  
ATOM 7352  H HG3  . ARG A 1 94  ? -10.125 1.418   15.945  1.00 1.69  ? 94  ARG A HG3  3  
ATOM 7353  H HD2  . ARG A 1 94  ? -9.840  -0.461  14.141  1.00 1.49  ? 94  ARG A HD2  3  
ATOM 7354  H HD3  . ARG A 1 94  ? -8.466  -0.961  15.128  1.00 1.47  ? 94  ARG A HD3  3  
ATOM 7355  H HE   . ARG A 1 94  ? -10.523 -0.684  16.959  1.00 2.46  ? 94  ARG A HE   3  
ATOM 7356  H HH11 . ARG A 1 94  ? -10.039 -2.343  13.975  1.00 2.42  ? 94  ARG A HH11 3  
ATOM 7357  H HH12 . ARG A 1 94  ? -11.100 -3.651  14.379  1.00 3.50  ? 94  ARG A HH12 3  
ATOM 7358  H HH21 . ARG A 1 94  ? -11.910 -2.379  17.502  1.00 4.01  ? 94  ARG A HH21 3  
ATOM 7359  H HH22 . ARG A 1 94  ? -12.160 -3.671  16.376  1.00 4.24  ? 94  ARG A HH22 3  
ATOM 7360  N N    . VAL A 1 95  ? -7.747  0.419   11.886  1.00 0.65  ? 95  VAL A N    3  
ATOM 7361  C CA   . VAL A 1 95  ? -7.730  -0.750  10.966  1.00 0.66  ? 95  VAL A CA   3  
ATOM 7362  C C    . VAL A 1 95  ? -6.282  -1.116  10.627  1.00 0.66  ? 95  VAL A C    3  
ATOM 7363  O O    . VAL A 1 95  ? -5.914  -2.273  10.601  1.00 0.67  ? 95  VAL A O    3  
ATOM 7364  C CB   . VAL A 1 95  ? -8.478  -0.363  9.680   1.00 0.64  ? 95  VAL A CB   3  
ATOM 7365  C CG1  . VAL A 1 95  ? -8.205  -1.386  8.570   1.00 1.27  ? 95  VAL A CG1  3  
ATOM 7366  C CG2  . VAL A 1 95  ? -9.980  -0.308  9.966   1.00 1.08  ? 95  VAL A CG2  3  
ATOM 7367  H H    . VAL A 1 95  ? -8.141  1.253   11.556  1.00 0.66  ? 95  VAL A H    3  
ATOM 7368  H HA   . VAL A 1 95  ? -8.221  -1.591  11.432  1.00 0.68  ? 95  VAL A HA   3  
ATOM 7369  H HB   . VAL A 1 95  ? -8.141  0.611   9.354   1.00 1.14  ? 95  VAL A HB   3  
ATOM 7370  H HG11 . VAL A 1 95  ? -8.929  -1.262  7.778   1.00 1.81  ? 95  VAL A HG11 3  
ATOM 7371  H HG12 . VAL A 1 95  ? -8.280  -2.384  8.974   1.00 1.74  ? 95  VAL A HG12 3  
ATOM 7372  H HG13 . VAL A 1 95  ? -7.210  -1.232  8.175   1.00 1.85  ? 95  VAL A HG13 3  
ATOM 7373  H HG21 . VAL A 1 95  ? -10.496 0.094   9.106   1.00 1.72  ? 95  VAL A HG21 3  
ATOM 7374  H HG22 . VAL A 1 95  ? -10.160 0.326   10.822  1.00 1.70  ? 95  VAL A HG22 3  
ATOM 7375  H HG23 . VAL A 1 95  ? -10.345 -1.303  10.172  1.00 1.50  ? 95  VAL A HG23 3  
ATOM 7376  N N    . ALA A 1 96  ? -5.469  -0.140  10.330  1.00 0.65  ? 96  ALA A N    3  
ATOM 7377  C CA   . ALA A 1 96  ? -4.061  -0.439  9.954   1.00 0.68  ? 96  ALA A CA   3  
ATOM 7378  C C    . ALA A 1 96  ? -3.364  -1.192  11.088  1.00 0.70  ? 96  ALA A C    3  
ATOM 7379  O O    . ALA A 1 96  ? -2.656  -2.158  10.886  1.00 0.76  ? 96  ALA A O    3  
ATOM 7380  C CB   . ALA A 1 96  ? -3.327  0.877   9.688   1.00 0.69  ? 96  ALA A CB   3  
ATOM 7381  H H    . ALA A 1 96  ? -5.793  0.784   10.324  1.00 0.65  ? 96  ALA A H    3  
ATOM 7382  H HA   . ALA A 1 96  ? -4.091  -0.985  9.020   1.00 0.69  ? 96  ALA A HA   3  
ATOM 7383  H HB1  . ALA A 1 96  ? -3.402  1.514   10.557  1.00 1.19  ? 96  ALA A HB1  3  
ATOM 7384  H HB2  . ALA A 1 96  ? -3.773  1.373   8.839   1.00 1.22  ? 96  ALA A HB2  3  
ATOM 7385  H HB3  . ALA A 1 96  ? -2.287  0.674   9.480   1.00 1.14  ? 96  ALA A HB3  3  
ATOM 7386  N N    . ALA A 1 97  ? -3.567  -0.715  12.290  1.00 0.74  ? 97  ALA A N    3  
ATOM 7387  C CA   . ALA A 1 97  ? -2.935  -1.332  13.493  1.00 0.78  ? 97  ALA A CA   3  
ATOM 7388  C C    . ALA A 1 97  ? -3.481  -2.742  13.728  1.00 0.79  ? 97  ALA A C    3  
ATOM 7389  O O    . ALA A 1 97  ? -2.758  -3.632  14.131  1.00 0.83  ? 97  ALA A O    3  
ATOM 7390  C CB   . ALA A 1 97  ? -3.247  -0.466  14.715  1.00 0.77  ? 97  ALA A CB   3  
ATOM 7391  H H    . ALA A 1 97  ? -4.141  0.073   12.392  1.00 0.80  ? 97  ALA A H    3  
ATOM 7392  H HA   . ALA A 1 97  ? -1.865  -1.380  13.357  1.00 0.81  ? 97  ALA A HA   3  
ATOM 7393  H HB1  . ALA A 1 97  ? -2.829  0.520   14.574  1.00 1.22  ? 97  ALA A HB1  3  
ATOM 7394  H HB2  . ALA A 1 97  ? -2.817  -0.917  15.597  1.00 1.21  ? 97  ALA A HB2  3  
ATOM 7395  H HB3  . ALA A 1 97  ? -4.318  -0.388  14.836  1.00 1.35  ? 97  ALA A HB3  3  
ATOM 7396  N N    . ASP A 1 98  ? -4.746  -2.959  13.499  1.00 0.78  ? 98  ASP A N    3  
ATOM 7397  C CA   . ASP A 1 98  ? -5.311  -4.317  13.735  1.00 0.82  ? 98  ASP A CA   3  
ATOM 7398  C C    . ASP A 1 98  ? -4.751  -5.284  12.693  1.00 0.83  ? 98  ASP A C    3  
ATOM 7399  O O    . ASP A 1 98  ? -4.250  -6.345  13.008  1.00 0.88  ? 98  ASP A O    3  
ATOM 7400  C CB   . ASP A 1 98  ? -6.834  -4.264  13.614  1.00 0.82  ? 98  ASP A CB   3  
ATOM 7401  C CG   . ASP A 1 98  ? -7.412  -3.505  14.809  1.00 1.47  ? 98  ASP A CG   3  
ATOM 7402  O OD1  . ASP A 1 98  ? -6.739  -2.614  15.301  1.00 2.19  ? 98  ASP A OD1  3  
ATOM 7403  O OD2  . ASP A 1 98  ? -8.517  -3.826  15.212  1.00 2.13  ? 98  ASP A OD2  3  
ATOM 7404  H H    . ASP A 1 98  ? -5.323  -2.233  13.181  1.00 0.77  ? 98  ASP A H    3  
ATOM 7405  H HA   . ASP A 1 98  ? -5.042  -4.634  14.734  1.00 0.85  ? 98  ASP A HA   3  
ATOM 7406  H HB2  . ASP A 1 98  ? -7.104  -3.760  12.698  1.00 1.13  ? 98  ASP A HB2  3  
ATOM 7407  H HB3  . ASP A 1 98  ? -7.228  -5.269  13.604  1.00 1.31  ? 98  ASP A HB3  3  
ATOM 7408  N N    . MET A 1 99  ? -4.830  -4.901  11.448  1.00 0.81  ? 99  MET A N    3  
ATOM 7409  C CA   . MET A 1 99  ? -4.301  -5.766  10.360  1.00 0.85  ? 99  MET A CA   3  
ATOM 7410  C C    . MET A 1 99  ? -2.842  -6.073  10.677  1.00 0.97  ? 99  MET A C    3  
ATOM 7411  O O    . MET A 1 99  ? -2.256  -7.003  10.157  1.00 1.14  ? 99  MET A O    3  
ATOM 7412  C CB   . MET A 1 99  ? -4.413  -5.017  9.022   1.00 0.79  ? 99  MET A CB   3  
ATOM 7413  C CG   . MET A 1 99  ? -3.866  -5.882  7.862   1.00 0.81  ? 99  MET A CG   3  
ATOM 7414  S SD   . MET A 1 99  ? -4.980  -5.770  6.434   1.00 0.97  ? 99  MET A SD   3  
ATOM 7415  C CE   . MET A 1 99  ? -4.337  -4.227  5.737   1.00 0.48  ? 99  MET A CE   3  
ATOM 7416  H H    . MET A 1 99  ? -5.223  -4.027  11.244  1.00 0.79  ? 99  MET A H    3  
ATOM 7417  H HA   . MET A 1 99  ? -4.864  -6.686  10.312  1.00 0.91  ? 99  MET A HA   3  
ATOM 7418  H HB2  . MET A 1 99  ? -5.452  -4.782  8.841   1.00 1.11  ? 99  MET A HB2  3  
ATOM 7419  H HB3  . MET A 1 99  ? -3.849  -4.096  9.083   1.00 1.06  ? 99  MET A HB3  3  
ATOM 7420  H HG2  . MET A 1 99  ? -2.886  -5.530  7.576   1.00 1.31  ? 99  MET A HG2  3  
ATOM 7421  H HG3  . MET A 1 99  ? -3.795  -6.916  8.173   1.00 1.20  ? 99  MET A HG3  3  
ATOM 7422  H HE1  . MET A 1 99  ? -4.296  -3.472  6.511   1.00 1.17  ? 99  MET A HE1  3  
ATOM 7423  H HE2  . MET A 1 99  ? -4.985  -3.890  4.944   1.00 1.11  ? 99  MET A HE2  3  
ATOM 7424  H HE3  . MET A 1 99  ? -3.345  -4.397  5.341   1.00 1.06  ? 99  MET A HE3  3  
ATOM 7425  N N    . PHE A 1 100 ? -2.258  -5.261  11.519  1.00 0.98  ? 100 PHE A N    3  
ATOM 7426  C CA   . PHE A 1 100 ? -0.824  -5.443  11.896  1.00 1.14  ? 100 PHE A CA   3  
ATOM 7427  C C    . PHE A 1 100 ? -0.670  -5.563  13.418  1.00 1.28  ? 100 PHE A C    3  
ATOM 7428  O O    . PHE A 1 100 ? -0.768  -6.631  13.983  1.00 1.67  ? 100 PHE A O    3  
ATOM 7429  C CB   . PHE A 1 100 ? -0.016  -4.237  11.383  1.00 1.19  ? 100 PHE A CB   3  
ATOM 7430  C CG   . PHE A 1 100 ? 0.338   -4.444  9.926   1.00 1.15  ? 100 PHE A CG   3  
ATOM 7431  C CD1  . PHE A 1 100 ? -0.526  -3.992  8.922   1.00 1.64  ? 100 PHE A CD1  3  
ATOM 7432  C CD2  . PHE A 1 100 ? 1.528   -5.097  9.584   1.00 1.67  ? 100 PHE A CD2  3  
ATOM 7433  C CE1  . PHE A 1 100 ? -0.200  -4.193  7.575   1.00 1.69  ? 100 PHE A CE1  3  
ATOM 7434  C CE2  . PHE A 1 100 ? 1.855   -5.297  8.237   1.00 1.79  ? 100 PHE A CE2  3  
ATOM 7435  C CZ   . PHE A 1 100 ? 0.991   -4.845  7.233   1.00 1.38  ? 100 PHE A CZ   3  
ATOM 7436  H H    . PHE A 1 100 ? -2.783  -4.509  11.864  1.00 0.94  ? 100 PHE A H    3  
ATOM 7437  H HA   . PHE A 1 100 ? -0.439  -6.347  11.438  1.00 1.20  ? 100 PHE A HA   3  
ATOM 7438  H HB2  . PHE A 1 100 ? -0.609  -3.340  11.484  1.00 1.19  ? 100 PHE A HB2  3  
ATOM 7439  H HB3  . PHE A 1 100 ? 0.893   -4.133  11.959  1.00 1.36  ? 100 PHE A HB3  3  
ATOM 7440  H HD1  . PHE A 1 100 ? -1.444  -3.488  9.186   1.00 2.37  ? 100 PHE A HD1  3  
ATOM 7441  H HD2  . PHE A 1 100 ? 2.195   -5.445  10.359  1.00 2.36  ? 100 PHE A HD2  3  
ATOM 7442  H HE1  . PHE A 1 100 ? -0.866  -3.845  6.800   1.00 2.38  ? 100 PHE A HE1  3  
ATOM 7443  H HE2  . PHE A 1 100 ? 2.774   -5.800  7.973   1.00 2.56  ? 100 PHE A HE2  3  
ATOM 7444  H HZ   . PHE A 1 100 ? 1.243   -5.001  6.194   1.00 1.54  ? 100 PHE A HZ   3  
ATOM 7445  N N    . SER A 1 101 ? -0.395  -4.453  14.050  1.00 1.34  ? 101 SER A N    3  
ATOM 7446  C CA   . SER A 1 101 ? -0.164  -4.399  15.530  1.00 1.52  ? 101 SER A CA   3  
ATOM 7447  C C    . SER A 1 101 ? 1.033   -5.298  15.837  1.00 1.61  ? 101 SER A C    3  
ATOM 7448  O O    . SER A 1 101 ? 2.096   -4.828  16.193  1.00 1.99  ? 101 SER A O    3  
ATOM 7449  C CB   . SER A 1 101 ? -1.401  -4.836  16.315  1.00 1.79  ? 101 SER A CB   3  
ATOM 7450  O OG   . SER A 1 101 ? -1.012  -5.200  17.634  1.00 2.21  ? 101 SER A OG   3  
ATOM 7451  H H    . SER A 1 101 ? -0.309  -3.628  13.529  1.00 1.50  ? 101 SER A H    3  
ATOM 7452  H HA   . SER A 1 101 ? 0.084   -3.370  15.733  1.00 1.75  ? 101 SER A HA   3  
ATOM 7453  H HB2  . SER A 1 101 ? -2.103  -4.021  16.366  1.00 2.11  ? 101 SER A HB2  3  
ATOM 7454  H HB3  . SER A 1 101 ? -1.865  -5.678  15.820  1.00 2.15  ? 101 SER A HB3  3  
ATOM 7455  H HG   . SER A 1 101 ? -0.269  -5.805  17.567  1.00 2.49  ? 101 SER A HG   3  
ATOM 7456  N N    . ASP A 1 102 ? 0.893   -6.583  15.608  1.00 1.99  ? 102 ASP A N    3  
ATOM 7457  C CA   . ASP A 1 102 ? 2.029   -7.532  15.774  1.00 2.34  ? 102 ASP A CA   3  
ATOM 7458  C C    . ASP A 1 102 ? 2.316   -7.981  14.347  1.00 2.07  ? 102 ASP A C    3  
ATOM 7459  O O    . ASP A 1 102 ? 2.489   -7.171  13.458  1.00 2.62  ? 102 ASP A O    3  
ATOM 7460  C CB   . ASP A 1 102 ? 1.609   -8.720  16.639  1.00 3.15  ? 102 ASP A CB   3  
ATOM 7461  C CG   . ASP A 1 102 ? 1.276   -8.226  18.047  1.00 3.78  ? 102 ASP A CG   3  
ATOM 7462  O OD1  . ASP A 1 102 ? 2.183   -8.164  18.861  1.00 4.42  ? 102 ASP A OD1  3  
ATOM 7463  O OD2  . ASP A 1 102 ? 0.122   -7.915  18.286  1.00 4.10  ? 102 ASP A OD2  3  
ATOM 7464  H H    . ASP A 1 102 ? 0.055   -6.940  15.248  1.00 2.41  ? 102 ASP A H    3  
ATOM 7465  H HA   . ASP A 1 102 ? 2.876   -7.012  16.206  1.00 2.78  ? 102 ASP A HA   3  
ATOM 7466  H HB2  . ASP A 1 102 ? 0.738   -9.190  16.205  1.00 3.32  ? 102 ASP A HB2  3  
ATOM 7467  H HB3  . ASP A 1 102 ? 2.417   -9.435  16.690  1.00 3.70  ? 102 ASP A HB3  3  
ATOM 7468  N N    . GLY A 1 103 ? 2.366   -9.268  14.111  1.00 2.05  ? 103 GLY A N    3  
ATOM 7469  C CA   . GLY A 1 103 ? 2.635   -9.773  12.732  1.00 2.45  ? 103 GLY A CA   3  
ATOM 7470  C C    . GLY A 1 103 ? 4.071   -10.250 12.676  1.00 2.44  ? 103 GLY A C    3  
ATOM 7471  O O    . GLY A 1 103 ? 4.926   -9.743  13.374  1.00 3.08  ? 103 GLY A O    3  
ATOM 7472  H H    . GLY A 1 103 ? 2.262   -9.914  14.842  1.00 2.36  ? 103 GLY A H    3  
ATOM 7473  H HA2  . GLY A 1 103 ? 1.975   -10.600 12.503  1.00 2.86  ? 103 GLY A HA2  3  
ATOM 7474  H HA3  . GLY A 1 103 ? 2.496   -8.986  12.005  1.00 2.87  ? 103 GLY A HA3  3  
ATOM 7475  N N    . ASN A 1 104 ? 4.358   -11.223 11.865  1.00 2.29  ? 104 ASN A N    3  
ATOM 7476  C CA   . ASN A 1 104 ? 5.756   -11.712 11.798  1.00 2.55  ? 104 ASN A CA   3  
ATOM 7477  C C    . ASN A 1 104 ? 6.592   -10.723 10.981  1.00 2.17  ? 104 ASN A C    3  
ATOM 7478  O O    . ASN A 1 104 ? 7.778   -10.904 10.838  1.00 2.54  ? 104 ASN A O    3  
ATOM 7479  C CB   . ASN A 1 104 ? 5.787   -13.121 11.163  1.00 3.20  ? 104 ASN A CB   3  
ATOM 7480  C CG   . ASN A 1 104 ? 6.788   -14.014 11.911  1.00 3.72  ? 104 ASN A CG   3  
ATOM 7481  O OD1  . ASN A 1 104 ? 7.877   -14.262 11.432  1.00 4.05  ? 104 ASN A OD1  3  
ATOM 7482  N ND2  . ASN A 1 104 ? 6.461   -14.502 13.077  1.00 4.31  ? 104 ASN A ND2  3  
ATOM 7483  H H    . ASN A 1 104 ? 3.660   -11.631 11.310  1.00 2.45  ? 104 ASN A H    3  
ATOM 7484  H HA   . ASN A 1 104 ? 6.156   -11.757 12.804  1.00 2.95  ? 104 ASN A HA   3  
ATOM 7485  H HB2  . ASN A 1 104 ? 4.803   -13.560 11.228  1.00 3.39  ? 104 ASN A HB2  3  
ATOM 7486  H HB3  . ASN A 1 104 ? 6.077   -13.054 10.123  1.00 3.67  ? 104 ASN A HB3  3  
ATOM 7487  H HD21 . ASN A 1 104 ? 5.584   -14.298 13.466  1.00 4.45  ? 104 ASN A HD21 3  
ATOM 7488  H HD22 . ASN A 1 104 ? 7.093   -15.070 13.566  1.00 4.84  ? 104 ASN A HD22 3  
ATOM 7489  N N    . PHE A 1 105 ? 5.966   -9.720  10.397  1.00 1.90  ? 105 PHE A N    3  
ATOM 7490  C CA   . PHE A 1 105 ? 6.690   -8.720  9.540   1.00 1.74  ? 105 PHE A CA   3  
ATOM 7491  C C    . PHE A 1 105 ? 6.877   -9.310  8.146   1.00 1.59  ? 105 PHE A C    3  
ATOM 7492  O O    . PHE A 1 105 ? 7.886   -9.917  7.844   1.00 1.88  ? 105 PHE A O    3  
ATOM 7493  C CB   . PHE A 1 105 ? 8.051   -8.308  10.135  1.00 2.03  ? 105 PHE A CB   3  
ATOM 7494  C CG   . PHE A 1 105 ? 7.873   -7.889  11.579  1.00 1.75  ? 105 PHE A CG   3  
ATOM 7495  C CD1  . PHE A 1 105 ? 7.247   -6.672  11.872  1.00 2.14  ? 105 PHE A CD1  3  
ATOM 7496  C CD2  . PHE A 1 105 ? 8.327   -8.710  12.623  1.00 2.28  ? 105 PHE A CD2  3  
ATOM 7497  C CE1  . PHE A 1 105 ? 7.072   -6.276  13.204  1.00 2.60  ? 105 PHE A CE1  3  
ATOM 7498  C CE2  . PHE A 1 105 ? 8.153   -8.313  13.953  1.00 2.84  ? 105 PHE A CE2  3  
ATOM 7499  C CZ   . PHE A 1 105 ? 7.524   -7.097  14.244  1.00 2.84  ? 105 PHE A CZ   3  
ATOM 7500  H H    . PHE A 1 105 ? 4.991   -9.635  10.453  1.00 2.17  ? 105 PHE A H    3  
ATOM 7501  H HA   . PHE A 1 105 ? 6.068   -7.837  9.452   1.00 1.98  ? 105 PHE A HA   3  
ATOM 7502  H HB2  . PHE A 1 105 ? 8.751   -9.119  10.068  1.00 2.66  ? 105 PHE A HB2  3  
ATOM 7503  H HB3  . PHE A 1 105 ? 8.436   -7.469  9.575   1.00 2.53  ? 105 PHE A HB3  3  
ATOM 7504  H HD1  . PHE A 1 105 ? 6.898   -6.036  11.068  1.00 2.69  ? 105 PHE A HD1  3  
ATOM 7505  H HD2  . PHE A 1 105 ? 8.819   -9.643  12.405  1.00 2.82  ? 105 PHE A HD2  3  
ATOM 7506  H HE1  . PHE A 1 105 ? 6.591   -5.336  13.429  1.00 3.27  ? 105 PHE A HE1  3  
ATOM 7507  H HE2  . PHE A 1 105 ? 8.500   -8.947  14.755  1.00 3.66  ? 105 PHE A HE2  3  
ATOM 7508  H HZ   . PHE A 1 105 ? 7.389   -6.792  15.271  1.00 3.53  ? 105 PHE A HZ   3  
ATOM 7509  N N    . ASN A 1 106 ? 5.897   -9.145  7.292   1.00 1.85  ? 106 ASN A N    3  
ATOM 7510  C CA   . ASN A 1 106 ? 5.966   -9.689  5.907   1.00 1.93  ? 106 ASN A CA   3  
ATOM 7511  C C    . ASN A 1 106 ? 5.731   -8.546  4.918   1.00 1.72  ? 106 ASN A C    3  
ATOM 7512  O O    . ASN A 1 106 ? 4.838   -7.738  5.083   1.00 2.31  ? 106 ASN A O    3  
ATOM 7513  C CB   . ASN A 1 106 ? 4.854   -10.726 5.733   1.00 2.62  ? 106 ASN A CB   3  
ATOM 7514  C CG   . ASN A 1 106 ? 5.118   -11.916 6.656   1.00 3.11  ? 106 ASN A CG   3  
ATOM 7515  O OD1  . ASN A 1 106 ? 5.585   -12.948 6.217   1.00 3.46  ? 106 ASN A OD1  3  
ATOM 7516  N ND2  . ASN A 1 106 ? 4.838   -11.815 7.926   1.00 3.79  ? 106 ASN A ND2  3  
ATOM 7517  H H    . ASN A 1 106 ? 5.078   -8.664  7.532   1.00 2.35  ? 106 ASN A H    3  
ATOM 7518  H HA   . ASN A 1 106 ? 6.918   -10.149 5.687   1.00 2.19  ? 106 ASN A HA   3  
ATOM 7519  H HB2  . ASN A 1 106 ? 3.902   -10.279 5.984   1.00 3.01  ? 106 ASN A HB2  3  
ATOM 7520  H HB3  . ASN A 1 106 ? 4.833   -11.065 4.708   1.00 3.06  ? 106 ASN A HB3  3  
ATOM 7521  H HD21 . ASN A 1 106 ? 4.461   -10.982 8.281   1.00 3.97  ? 106 ASN A HD21 3  
ATOM 7522  H HD22 . ASN A 1 106 ? 5.004   -12.572 8.526   1.00 4.42  ? 106 ASN A HD22 3  
ATOM 7523  N N    . TRP A 1 107 ? 6.539   -8.467  3.902   1.00 1.54  ? 107 TRP A N    3  
ATOM 7524  C CA   . TRP A 1 107 ? 6.388   -7.372  2.902   1.00 1.68  ? 107 TRP A CA   3  
ATOM 7525  C C    . TRP A 1 107 ? 5.139   -7.602  2.040   1.00 1.47  ? 107 TRP A C    3  
ATOM 7526  O O    . TRP A 1 107 ? 4.832   -6.829  1.160   1.00 1.49  ? 107 TRP A O    3  
ATOM 7527  C CB   . TRP A 1 107 ? 7.649   -7.307  2.010   1.00 2.30  ? 107 TRP A CB   3  
ATOM 7528  C CG   . TRP A 1 107 ? 8.331   -8.638  2.012   1.00 2.32  ? 107 TRP A CG   3  
ATOM 7529  C CD1  . TRP A 1 107 ? 9.527   -8.894  2.586   1.00 2.69  ? 107 TRP A CD1  3  
ATOM 7530  C CD2  . TRP A 1 107 ? 7.873   -9.894  1.436   1.00 2.77  ? 107 TRP A CD2  3  
ATOM 7531  N NE1  . TRP A 1 107 ? 9.835   -10.229 2.399   1.00 3.12  ? 107 TRP A NE1  3  
ATOM 7532  C CE2  . TRP A 1 107 ? 8.847   -10.887 1.695   1.00 3.35  ? 107 TRP A CE2  3  
ATOM 7533  C CE3  . TRP A 1 107 ? 6.720   -10.264 0.721   1.00 3.24  ? 107 TRP A CE3  3  
ATOM 7534  C CZ2  . TRP A 1 107 ? 8.683   -12.203 1.260   1.00 4.31  ? 107 TRP A CZ2  3  
ATOM 7535  C CZ3  . TRP A 1 107 ? 6.552   -11.588 0.281   1.00 4.29  ? 107 TRP A CZ3  3  
ATOM 7536  C CH2  . TRP A 1 107 ? 7.532   -12.555 0.551   1.00 4.80  ? 107 TRP A CH2  3  
ATOM 7537  H H    . TRP A 1 107 ? 7.260   -9.123  3.803   1.00 1.87  ? 107 TRP A H    3  
ATOM 7538  H HA   . TRP A 1 107 ? 6.277   -6.433  3.427   1.00 1.91  ? 107 TRP A HA   3  
ATOM 7539  H HB2  . TRP A 1 107 ? 7.377   -7.045  0.996   1.00 2.77  ? 107 TRP A HB2  3  
ATOM 7540  H HB3  . TRP A 1 107 ? 8.329   -6.561  2.398   1.00 2.87  ? 107 TRP A HB3  3  
ATOM 7541  H HD1  . TRP A 1 107 ? 10.141  -8.174  3.106   1.00 3.02  ? 107 TRP A HD1  3  
ATOM 7542  H HE1  . TRP A 1 107 ? 10.649  -10.671 2.719   1.00 3.54  ? 107 TRP A HE1  3  
ATOM 7543  H HE3  . TRP A 1 107 ? 5.960   -9.524  0.509   1.00 3.02  ? 107 TRP A HE3  3  
ATOM 7544  H HZ2  . TRP A 1 107 ? 9.441   -12.943 1.471   1.00 4.84  ? 107 TRP A HZ2  3  
ATOM 7545  H HZ3  . TRP A 1 107 ? 5.663   -11.863 -0.267  1.00 4.86  ? 107 TRP A HZ3  3  
ATOM 7546  H HH2  . TRP A 1 107 ? 7.397   -13.571 0.210   1.00 5.71  ? 107 TRP A HH2  3  
ATOM 7547  N N    . GLY A 1 108 ? 4.440   -8.684  2.265   1.00 1.41  ? 108 GLY A N    3  
ATOM 7548  C CA   . GLY A 1 108 ? 3.235   -8.988  1.439   1.00 1.47  ? 108 GLY A CA   3  
ATOM 7549  C C    . GLY A 1 108 ? 2.015   -8.254  1.991   1.00 1.05  ? 108 GLY A C    3  
ATOM 7550  O O    . GLY A 1 108 ? 1.212   -7.696  1.248   1.00 1.02  ? 108 GLY A O    3  
ATOM 7551  H H    . GLY A 1 108 ? 4.719   -9.310  2.966   1.00 1.45  ? 108 GLY A H    3  
ATOM 7552  H HA2  . GLY A 1 108 ? 3.409   -8.680  0.419   1.00 1.69  ? 108 GLY A HA2  3  
ATOM 7553  H HA3  . GLY A 1 108 ? 3.047   -10.052 1.463   1.00 1.74  ? 108 GLY A HA3  3  
ATOM 7554  N N    . ARG A 1 109 ? 1.841   -8.244  3.282   1.00 0.86  ? 109 ARG A N    3  
ATOM 7555  C CA   . ARG A 1 109 ? 0.652   -7.547  3.817   1.00 0.87  ? 109 ARG A CA   3  
ATOM 7556  C C    . ARG A 1 109 ? 0.738   -6.096  3.360   1.00 0.70  ? 109 ARG A C    3  
ATOM 7557  O O    . ARG A 1 109 ? -0.220  -5.349  3.401   1.00 0.81  ? 109 ARG A O    3  
ATOM 7558  C CB   . ARG A 1 109 ? 0.635   -7.622  5.345   1.00 1.08  ? 109 ARG A CB   3  
ATOM 7559  C CG   . ARG A 1 109 ? 0.333   -9.055  5.784   1.00 1.48  ? 109 ARG A CG   3  
ATOM 7560  C CD   . ARG A 1 109 ? 0.413   -9.147  7.308   1.00 1.96  ? 109 ARG A CD   3  
ATOM 7561  N NE   . ARG A 1 109 ? -0.125  -10.463 7.754   1.00 2.74  ? 109 ARG A NE   3  
ATOM 7562  C CZ   . ARG A 1 109 ? 0.105   -10.885 8.967   1.00 3.19  ? 109 ARG A CZ   3  
ATOM 7563  N NH1  . ARG A 1 109 ? 0.806   -10.155 9.791   1.00 3.19  ? 109 ARG A NH1  3  
ATOM 7564  N NH2  . ARG A 1 109 ? -0.366  -12.038 9.356   1.00 4.08  ? 109 ARG A NH2  3  
ATOM 7565  H H    . ARG A 1 109 ? 2.474   -8.692  3.881   1.00 0.93  ? 109 ARG A H    3  
ATOM 7566  H HA   . ARG A 1 109 ? -0.205  -8.056  3.401   1.00 1.25  ? 109 ARG A HA   3  
ATOM 7567  H HB2  . ARG A 1 109 ? 1.600   -7.322  5.729   1.00 1.43  ? 109 ARG A HB2  3  
ATOM 7568  H HB3  . ARG A 1 109 ? -0.127  -6.961  5.730   1.00 1.52  ? 109 ARG A HB3  3  
ATOM 7569  H HG2  . ARG A 1 109 ? -0.659  -9.330  5.457   1.00 2.00  ? 109 ARG A HG2  3  
ATOM 7570  H HG3  . ARG A 1 109 ? 1.057   -9.726  5.346   1.00 2.02  ? 109 ARG A HG3  3  
ATOM 7571  H HD2  . ARG A 1 109 ? 1.443   -9.055  7.622   1.00 2.34  ? 109 ARG A HD2  3  
ATOM 7572  H HD3  . ARG A 1 109 ? -0.170  -8.351  7.748   1.00 2.24  ? 109 ARG A HD3  3  
ATOM 7573  H HE   . ARG A 1 109 ? -0.651  -11.012 7.136   1.00 3.26  ? 109 ARG A HE   3  
ATOM 7574  H HH11 . ARG A 1 109 ? 1.167   -9.271  9.493   1.00 2.87  ? 109 ARG A HH11 3  
ATOM 7575  H HH12 . ARG A 1 109 ? 0.982   -10.479 10.720  1.00 3.82  ? 109 ARG A HH12 3  
ATOM 7576  H HH21 . ARG A 1 109 ? -0.903  -12.598 8.724   1.00 4.49  ? 109 ARG A HH21 3  
ATOM 7577  H HH22 . ARG A 1 109 ? -0.190  -12.362 10.285  1.00 4.54  ? 109 ARG A HH22 3  
ATOM 7578  N N    . VAL A 1 110 ? 1.912   -5.698  2.929   1.00 0.60  ? 110 VAL A N    3  
ATOM 7579  C CA   . VAL A 1 110 ? 2.108   -4.300  2.470   1.00 0.68  ? 110 VAL A CA   3  
ATOM 7580  C C    . VAL A 1 110 ? 1.293   -4.079  1.196   1.00 0.56  ? 110 VAL A C    3  
ATOM 7581  O O    . VAL A 1 110 ? 0.739   -3.017  0.995   1.00 0.60  ? 110 VAL A O    3  
ATOM 7582  C CB   . VAL A 1 110 ? 3.619   -4.016  2.242   1.00 0.88  ? 110 VAL A CB   3  
ATOM 7583  C CG1  . VAL A 1 110 ? 3.996   -4.154  0.757   1.00 1.27  ? 110 VAL A CG1  3  
ATOM 7584  C CG2  . VAL A 1 110 ? 3.963   -2.593  2.701   1.00 1.73  ? 110 VAL A CG2  3  
ATOM 7585  H H    . VAL A 1 110 ? 2.665   -6.326  2.916   1.00 0.60  ? 110 VAL A H    3  
ATOM 7586  H HA   . VAL A 1 110 ? 1.695   -3.644  3.215   1.00 0.87  ? 110 VAL A HA   3  
ATOM 7587  H HB   . VAL A 1 110 ? 4.201   -4.728  2.814   1.00 1.28  ? 110 VAL A HB   3  
ATOM 7588  H HG11 . VAL A 1 110 ? 3.608   -3.309  0.207   1.00 1.71  ? 110 VAL A HG11 3  
ATOM 7589  H HG12 . VAL A 1 110 ? 3.575   -5.063  0.358   1.00 1.81  ? 110 VAL A HG12 3  
ATOM 7590  H HG13 . VAL A 1 110 ? 5.071   -4.182  0.659   1.00 1.85  ? 110 VAL A HG13 3  
ATOM 7591  H HG21 . VAL A 1 110 ? 4.959   -2.340  2.367   1.00 2.12  ? 110 VAL A HG21 3  
ATOM 7592  H HG22 . VAL A 1 110 ? 3.919   -2.540  3.778   1.00 2.28  ? 110 VAL A HG22 3  
ATOM 7593  H HG23 . VAL A 1 110 ? 3.254   -1.897  2.276   1.00 2.29  ? 110 VAL A HG23 3  
ATOM 7594  N N    . VAL A 1 111 ? 1.195   -5.051  0.334   1.00 0.51  ? 111 VAL A N    3  
ATOM 7595  C CA   . VAL A 1 111 ? 0.392   -4.823  -0.887  1.00 0.50  ? 111 VAL A CA   3  
ATOM 7596  C C    . VAL A 1 111 ? -1.044  -4.567  -0.437  1.00 0.46  ? 111 VAL A C    3  
ATOM 7597  O O    . VAL A 1 111 ? -1.722  -3.688  -0.931  1.00 0.47  ? 111 VAL A O    3  
ATOM 7598  C CB   . VAL A 1 111 ? 0.469   -6.051  -1.795  1.00 0.58  ? 111 VAL A CB   3  
ATOM 7599  C CG1  . VAL A 1 111 ? -0.250  -5.769  -3.114  1.00 1.41  ? 111 VAL A CG1  3  
ATOM 7600  C CG2  . VAL A 1 111 ? 1.938   -6.381  -2.072  1.00 1.36  ? 111 VAL A CG2  3  
ATOM 7601  H H    . VAL A 1 111 ? 1.631   -5.916  0.480   1.00 0.55  ? 111 VAL A H    3  
ATOM 7602  H HA   . VAL A 1 111 ? 0.794   -3.952  -1.384  1.00 0.52  ? 111 VAL A HA   3  
ATOM 7603  H HB   . VAL A 1 111 ? -0.002  -6.890  -1.302  1.00 1.33  ? 111 VAL A HB   3  
ATOM 7604  H HG11 . VAL A 1 111 ? -1.300  -5.601  -2.924  1.00 2.00  ? 111 VAL A HG11 3  
ATOM 7605  H HG12 . VAL A 1 111 ? -0.135  -6.616  -3.774  1.00 1.95  ? 111 VAL A HG12 3  
ATOM 7606  H HG13 . VAL A 1 111 ? 0.177   -4.892  -3.577  1.00 1.98  ? 111 VAL A HG13 3  
ATOM 7607  H HG21 . VAL A 1 111 ? 2.429   -6.639  -1.145  1.00 1.80  ? 111 VAL A HG21 3  
ATOM 7608  H HG22 . VAL A 1 111 ? 2.423   -5.521  -2.509  1.00 2.02  ? 111 VAL A HG22 3  
ATOM 7609  H HG23 . VAL A 1 111 ? 1.998   -7.214  -2.755  1.00 1.95  ? 111 VAL A HG23 3  
ATOM 7610  N N    . ALA A 1 112 ? -1.500  -5.328  0.527   1.00 0.45  ? 112 ALA A N    3  
ATOM 7611  C CA   . ALA A 1 112 ? -2.889  -5.126  1.050   1.00 0.47  ? 112 ALA A CA   3  
ATOM 7612  C C    . ALA A 1 112 ? -3.010  -3.723  1.668   1.00 0.46  ? 112 ALA A C    3  
ATOM 7613  O O    . ALA A 1 112 ? -4.089  -3.172  1.759   1.00 0.54  ? 112 ALA A O    3  
ATOM 7614  C CB   . ALA A 1 112 ? -3.210  -6.192  2.100   1.00 0.53  ? 112 ALA A CB   3  
ATOM 7615  H H    . ALA A 1 112 ? -0.917  -6.028  0.916   1.00 0.47  ? 112 ALA A H    3  
ATOM 7616  H HA   . ALA A 1 112 ? -3.606  -5.172  0.244   1.00 0.49  ? 112 ALA A HA   3  
ATOM 7617  H HB1  . ALA A 1 112 ? -3.341  -7.147  1.614   1.00 1.17  ? 112 ALA A HB1  3  
ATOM 7618  H HB2  . ALA A 1 112 ? -4.117  -5.924  2.619   1.00 1.01  ? 112 ALA A HB2  3  
ATOM 7619  H HB3  . ALA A 1 112 ? -2.396  -6.257  2.807   1.00 1.25  ? 112 ALA A HB3  3  
ATOM 7620  N N    . LEU A 1 113 ? -1.918  -3.125  2.049   1.00 0.43  ? 113 LEU A N    3  
ATOM 7621  C CA   . LEU A 1 113 ? -1.972  -1.739  2.610   1.00 0.43  ? 113 LEU A CA   3  
ATOM 7622  C C    . LEU A 1 113 ? -2.239  -0.757  1.459   1.00 0.42  ? 113 LEU A C    3  
ATOM 7623  O O    . LEU A 1 113 ? -3.198  -0.011  1.470   1.00 0.45  ? 113 LEU A O    3  
ATOM 7624  C CB   . LEU A 1 113 ? -0.610  -1.414  3.267   1.00 0.44  ? 113 LEU A CB   3  
ATOM 7625  C CG   . LEU A 1 113 ? -0.813  -0.514  4.501   1.00 0.51  ? 113 LEU A CG   3  
ATOM 7626  C CD1  . LEU A 1 113 ? 0.535   -0.237  5.167   1.00 1.45  ? 113 LEU A CD1  3  
ATOM 7627  C CD2  . LEU A 1 113 ? -1.453  0.812   4.079   1.00 1.27  ? 113 LEU A CD2  3  
ATOM 7628  H H    . LEU A 1 113 ? -1.053  -3.572  1.938   1.00 0.45  ? 113 LEU A H    3  
ATOM 7629  H HA   . LEU A 1 113 ? -2.744  -1.631  3.362   1.00 0.44  ? 113 LEU A HA   3  
ATOM 7630  H HB2  . LEU A 1 113 ? -0.147  -2.334  3.580   1.00 0.58  ? 113 LEU A HB2  3  
ATOM 7631  H HB3  . LEU A 1 113 ? 0.037   -0.913  2.560   1.00 0.53  ? 113 LEU A HB3  3  
ATOM 7632  H HG   . LEU A 1 113 ? -1.459  -1.017  5.206   1.00 1.38  ? 113 LEU A HG   3  
ATOM 7633  H HD11 . LEU A 1 113 ? 0.383   0.375   6.044   1.00 2.09  ? 113 LEU A HD11 3  
ATOM 7634  H HD12 . LEU A 1 113 ? 1.181   0.281   4.474   1.00 1.97  ? 113 LEU A HD12 3  
ATOM 7635  H HD13 . LEU A 1 113 ? 0.992   -1.172  5.456   1.00 1.99  ? 113 LEU A HD13 3  
ATOM 7636  H HD21 . LEU A 1 113 ? -1.448  1.494   4.915   1.00 1.86  ? 113 LEU A HD21 3  
ATOM 7637  H HD22 . LEU A 1 113 ? -2.472  0.639   3.764   1.00 1.87  ? 113 LEU A HD22 3  
ATOM 7638  H HD23 . LEU A 1 113 ? -0.891  1.240   3.262   1.00 1.85  ? 113 LEU A HD23 3  
ATOM 7639  N N    . PHE A 1 114 ? -1.407  -0.782  0.454   1.00 0.40  ? 114 PHE A N    3  
ATOM 7640  C CA   . PHE A 1 114 ? -1.597  0.110   -0.727  1.00 0.40  ? 114 PHE A CA   3  
ATOM 7641  C C    . PHE A 1 114 ? -3.028  0.005   -1.258  1.00 0.39  ? 114 PHE A C    3  
ATOM 7642  O O    . PHE A 1 114 ? -3.650  0.992   -1.596  1.00 0.41  ? 114 PHE A O    3  
ATOM 7643  C CB   . PHE A 1 114 ? -0.622  -0.315  -1.831  1.00 0.41  ? 114 PHE A CB   3  
ATOM 7644  C CG   . PHE A 1 114 ? 0.805   -0.431  -1.303  1.00 0.44  ? 114 PHE A CG   3  
ATOM 7645  C CD1  . PHE A 1 114 ? 1.242   0.284   -0.164  1.00 1.29  ? 114 PHE A CD1  3  
ATOM 7646  C CD2  . PHE A 1 114 ? 1.707   -1.265  -1.977  1.00 1.27  ? 114 PHE A CD2  3  
ATOM 7647  C CE1  . PHE A 1 114 ? 2.564   0.155   0.279   1.00 1.38  ? 114 PHE A CE1  3  
ATOM 7648  C CE2  . PHE A 1 114 ? 3.028   -1.388  -1.528  1.00 1.27  ? 114 PHE A CE2  3  
ATOM 7649  C CZ   . PHE A 1 114 ? 3.454   -0.679  -0.401  1.00 0.68  ? 114 PHE A CZ   3  
ATOM 7650  H H    . PHE A 1 114 ? -0.658  -1.414  0.459   1.00 0.40  ? 114 PHE A H    3  
ATOM 7651  H HA   . PHE A 1 114 ? -1.411  1.148   -0.498  1.00 0.41  ? 114 PHE A HA   3  
ATOM 7652  H HB2  . PHE A 1 114 ? -0.931  -1.272  -2.225  1.00 0.49  ? 114 PHE A HB2  3  
ATOM 7653  H HB3  . PHE A 1 114 ? -0.647  0.418   -2.624  1.00 0.43  ? 114 PHE A HB3  3  
ATOM 7654  H HD1  . PHE A 1 114 ? 0.574   0.931   0.373   1.00 2.14  ? 114 PHE A HD1  3  
ATOM 7655  H HD2  . PHE A 1 114 ? 1.382   -1.815  -2.847  1.00 2.16  ? 114 PHE A HD2  3  
ATOM 7656  H HE1  . PHE A 1 114 ? 2.895   0.702   1.150   1.00 2.28  ? 114 PHE A HE1  3  
ATOM 7657  H HE2  . PHE A 1 114 ? 3.718   -2.031  -2.053  1.00 2.12  ? 114 PHE A HE2  3  
ATOM 7658  H HZ   . PHE A 1 114 ? 4.474   -0.776  -0.056  1.00 0.80  ? 114 PHE A HZ   3  
ATOM 7659  N N    . TYR A 1 115 ? -3.553  -1.188  -1.344  1.00 0.40  ? 115 TYR A N    3  
ATOM 7660  C CA   . TYR A 1 115 ? -4.939  -1.355  -1.863  1.00 0.41  ? 115 TYR A CA   3  
ATOM 7661  C C    . TYR A 1 115 ? -5.938  -0.733  -0.888  1.00 0.41  ? 115 TYR A C    3  
ATOM 7662  O O    . TYR A 1 115 ? -6.911  -0.124  -1.284  1.00 0.44  ? 115 TYR A O    3  
ATOM 7663  C CB   . TYR A 1 115 ? -5.255  -2.842  -2.032  1.00 0.44  ? 115 TYR A CB   3  
ATOM 7664  C CG   . TYR A 1 115 ? -6.614  -2.993  -2.672  1.00 0.47  ? 115 TYR A CG   3  
ATOM 7665  C CD1  . TYR A 1 115 ? -6.749  -2.873  -4.060  1.00 1.28  ? 115 TYR A CD1  3  
ATOM 7666  C CD2  . TYR A 1 115 ? -7.740  -3.248  -1.879  1.00 1.24  ? 115 TYR A CD2  3  
ATOM 7667  C CE1  . TYR A 1 115 ? -8.009  -3.007  -4.655  1.00 1.32  ? 115 TYR A CE1  3  
ATOM 7668  C CE2  . TYR A 1 115 ? -9.000  -3.384  -2.474  1.00 1.26  ? 115 TYR A CE2  3  
ATOM 7669  C CZ   . TYR A 1 115 ? -9.134  -3.263  -3.863  1.00 0.61  ? 115 TYR A CZ   3  
ATOM 7670  O OH   . TYR A 1 115 ? -10.376 -3.395  -4.450  1.00 0.70  ? 115 TYR A OH   3  
ATOM 7671  H H    . TYR A 1 115 ? -3.033  -1.972  -1.069  1.00 0.41  ? 115 TYR A H    3  
ATOM 7672  H HA   . TYR A 1 115 ? -5.032  -0.854  -2.815  1.00 0.42  ? 115 TYR A HA   3  
ATOM 7673  H HB2  . TYR A 1 115 ? -4.506  -3.301  -2.661  1.00 0.46  ? 115 TYR A HB2  3  
ATOM 7674  H HB3  . TYR A 1 115 ? -5.258  -3.322  -1.065  1.00 0.47  ? 115 TYR A HB3  3  
ATOM 7675  H HD1  . TYR A 1 115 ? -5.881  -2.676  -4.671  1.00 2.12  ? 115 TYR A HD1  3  
ATOM 7676  H HD2  . TYR A 1 115 ? -7.636  -3.341  -0.808  1.00 2.08  ? 115 TYR A HD2  3  
ATOM 7677  H HE1  . TYR A 1 115 ? -8.112  -2.914  -5.726  1.00 2.17  ? 115 TYR A HE1  3  
ATOM 7678  H HE2  . TYR A 1 115 ? -9.868  -3.581  -1.863  1.00 2.10  ? 115 TYR A HE2  3  
ATOM 7679  H HH   . TYR A 1 115 ? -10.984 -3.730  -3.787  1.00 1.23  ? 115 TYR A HH   3  
ATOM 7680  N N    . PHE A 1 116 ? -5.696  -0.866  0.384   1.00 0.38  ? 116 PHE A N    3  
ATOM 7681  C CA   . PHE A 1 116 ? -6.625  -0.266  1.377   1.00 0.38  ? 116 PHE A CA   3  
ATOM 7682  C C    . PHE A 1 116 ? -6.626  1.253   1.195   1.00 0.36  ? 116 PHE A C    3  
ATOM 7683  O O    . PHE A 1 116 ? -7.663  1.889   1.176   1.00 0.35  ? 116 PHE A O    3  
ATOM 7684  C CB   . PHE A 1 116 ? -6.151  -0.606  2.795   1.00 0.40  ? 116 PHE A CB   3  
ATOM 7685  C CG   . PHE A 1 116 ? -7.075  0.035   3.811   1.00 0.37  ? 116 PHE A CG   3  
ATOM 7686  C CD1  . PHE A 1 116 ? -8.384  -0.441  3.967   1.00 1.17  ? 116 PHE A CD1  3  
ATOM 7687  C CD2  . PHE A 1 116 ? -6.622  1.104   4.599   1.00 1.35  ? 116 PHE A CD2  3  
ATOM 7688  C CE1  . PHE A 1 116 ? -9.237  0.150   4.908   1.00 1.18  ? 116 PHE A CE1  3  
ATOM 7689  C CE2  . PHE A 1 116 ? -7.477  1.693   5.539   1.00 1.37  ? 116 PHE A CE2  3  
ATOM 7690  C CZ   . PHE A 1 116 ? -8.784  1.216   5.693   1.00 0.45  ? 116 PHE A CZ   3  
ATOM 7691  H H    . PHE A 1 116 ? -4.896  -1.351  0.679   1.00 0.39  ? 116 PHE A H    3  
ATOM 7692  H HA   . PHE A 1 116 ? -7.620  -0.656  1.223   1.00 0.39  ? 116 PHE A HA   3  
ATOM 7693  H HB2  . PHE A 1 116 ? -6.160  -1.678  2.928   1.00 0.47  ? 116 PHE A HB2  3  
ATOM 7694  H HB3  . PHE A 1 116 ? -5.146  -0.236  2.937   1.00 0.41  ? 116 PHE A HB3  3  
ATOM 7695  H HD1  . PHE A 1 116 ? -8.736  -1.263  3.363   1.00 2.09  ? 116 PHE A HD1  3  
ATOM 7696  H HD2  . PHE A 1 116 ? -5.614  1.472   4.482   1.00 2.26  ? 116 PHE A HD2  3  
ATOM 7697  H HE1  . PHE A 1 116 ? -10.246 -0.218  5.027   1.00 2.08  ? 116 PHE A HE1  3  
ATOM 7698  H HE2  . PHE A 1 116 ? -7.128  2.516   6.145   1.00 2.29  ? 116 PHE A HE2  3  
ATOM 7699  H HZ   . PHE A 1 116 ? -9.443  1.671   6.418   1.00 0.51  ? 116 PHE A HZ   3  
ATOM 7700  N N    . ALA A 1 117 ? -5.474  1.844   1.047   1.00 0.35  ? 117 ALA A N    3  
ATOM 7701  C CA   . ALA A 1 117 ? -5.426  3.314   0.855   1.00 0.34  ? 117 ALA A CA   3  
ATOM 7702  C C    . ALA A 1 117 ? -5.997  3.676   -0.518  1.00 0.34  ? 117 ALA A C    3  
ATOM 7703  O O    . ALA A 1 117 ? -6.527  4.749   -0.710  1.00 0.34  ? 117 ALA A O    3  
ATOM 7704  C CB   . ALA A 1 117 ? -3.980  3.804   0.953   1.00 0.37  ? 117 ALA A CB   3  
ATOM 7705  H H    . ALA A 1 117 ? -4.645  1.326   1.068   1.00 0.36  ? 117 ALA A H    3  
ATOM 7706  H HA   . ALA A 1 117 ? -6.021  3.786   1.615   1.00 0.34  ? 117 ALA A HA   3  
ATOM 7707  H HB1  . ALA A 1 117 ? -3.580  3.558   1.925   1.00 1.05  ? 117 ALA A HB1  3  
ATOM 7708  H HB2  . ALA A 1 117 ? -3.953  4.875   0.814   1.00 1.06  ? 117 ALA A HB2  3  
ATOM 7709  H HB3  . ALA A 1 117 ? -3.385  3.328   0.187   1.00 1.10  ? 117 ALA A HB3  3  
ATOM 7710  N N    . SER A 1 118 ? -5.893  2.796   -1.479  1.00 0.35  ? 118 SER A N    3  
ATOM 7711  C CA   . SER A 1 118 ? -6.422  3.102   -2.838  1.00 0.37  ? 118 SER A CA   3  
ATOM 7712  C C    . SER A 1 118 ? -7.916  3.438   -2.790  1.00 0.36  ? 118 SER A C    3  
ATOM 7713  O O    . SER A 1 118 ? -8.366  4.382   -3.406  1.00 0.36  ? 118 SER A O    3  
ATOM 7714  C CB   . SER A 1 118 ? -6.215  1.884   -3.739  1.00 0.42  ? 118 SER A CB   3  
ATOM 7715  O OG   . SER A 1 118 ? -7.224  0.921   -3.465  1.00 1.25  ? 118 SER A OG   3  
ATOM 7716  H H    . SER A 1 118 ? -5.467  1.927   -1.332  1.00 0.37  ? 118 SER A H    3  
ATOM 7717  H HA   . SER A 1 118 ? -5.882  3.941   -3.250  1.00 0.38  ? 118 SER A HA   3  
ATOM 7718  H HB2  . SER A 1 118 ? -6.281  2.181   -4.773  1.00 1.08  ? 118 SER A HB2  3  
ATOM 7719  H HB3  . SER A 1 118 ? -5.238  1.459   -3.551  1.00 1.10  ? 118 SER A HB3  3  
ATOM 7720  H HG   . SER A 1 118 ? -7.013  0.500   -2.628  1.00 1.71  ? 118 SER A HG   3  
ATOM 7721  N N    . LYS A 1 119 ? -8.689  2.684   -2.053  1.00 0.37  ? 119 LYS A N    3  
ATOM 7722  C CA   . LYS A 1 119 ? -10.147 2.987   -1.970  1.00 0.39  ? 119 LYS A CA   3  
ATOM 7723  C C    . LYS A 1 119 ? -10.332 4.296   -1.195  1.00 0.36  ? 119 LYS A C    3  
ATOM 7724  O O    . LYS A 1 119 ? -11.184 5.095   -1.523  1.00 0.38  ? 119 LYS A O    3  
ATOM 7725  C CB   . LYS A 1 119 ? -10.899 1.812   -1.312  1.00 0.46  ? 119 LYS A CB   3  
ATOM 7726  C CG   . LYS A 1 119 ? -10.743 1.823   0.231   1.00 1.29  ? 119 LYS A CG   3  
ATOM 7727  C CD   . LYS A 1 119 ? -11.948 2.501   0.904   1.00 1.84  ? 119 LYS A CD   3  
ATOM 7728  C CE   . LYS A 1 119 ? -11.915 2.216   2.407   1.00 2.48  ? 119 LYS A CE   3  
ATOM 7729  N NZ   . LYS A 1 119 ? -12.956 3.038   3.088   1.00 3.36  ? 119 LYS A NZ   3  
ATOM 7730  H H    . LYS A 1 119 ? -8.310  1.935   -1.547  1.00 0.38  ? 119 LYS A H    3  
ATOM 7731  H HA   . LYS A 1 119 ? -10.535 3.145   -2.967  1.00 0.42  ? 119 LYS A HA   3  
ATOM 7732  H HB2  . LYS A 1 119 ? -11.943 1.871   -1.579  1.00 0.98  ? 119 LYS A HB2  3  
ATOM 7733  H HB3  . LYS A 1 119 ? -10.495 0.887   -1.701  1.00 0.99  ? 119 LYS A HB3  3  
ATOM 7734  H HG2  . LYS A 1 119 ? -10.674 0.804   0.588   1.00 1.92  ? 119 LYS A HG2  3  
ATOM 7735  H HG3  . LYS A 1 119 ? -9.843  2.346   0.503   1.00 1.81  ? 119 LYS A HG3  3  
ATOM 7736  H HD2  . LYS A 1 119 ? -11.904 3.567   0.739   1.00 2.21  ? 119 LYS A HD2  3  
ATOM 7737  H HD3  . LYS A 1 119 ? -12.866 2.110   0.492   1.00 2.29  ? 119 LYS A HD3  3  
ATOM 7738  H HE2  . LYS A 1 119 ? -12.115 1.169   2.578   1.00 2.99  ? 119 LYS A HE2  3  
ATOM 7739  H HE3  . LYS A 1 119 ? -10.941 2.465   2.801   1.00 2.53  ? 119 LYS A HE3  3  
ATOM 7740  H HZ1  . LYS A 1 119 ? -13.841 2.495   3.149   1.00 3.76  ? 119 LYS A HZ1  3  
ATOM 7741  H HZ2  . LYS A 1 119 ? -13.119 3.910   2.544   1.00 3.68  ? 119 LYS A HZ2  3  
ATOM 7742  H HZ3  . LYS A 1 119 ? -12.635 3.281   4.046   1.00 3.74  ? 119 LYS A HZ3  3  
ATOM 7743  N N    . LEU A 1 120 ? -9.514  4.560   -0.215  1.00 0.36  ? 120 LEU A N    3  
ATOM 7744  C CA   . LEU A 1 120 ? -9.629  5.857   0.513   1.00 0.35  ? 120 LEU A CA   3  
ATOM 7745  C C    . LEU A 1 120 ? -9.327  6.987   -0.479  1.00 0.33  ? 120 LEU A C    3  
ATOM 7746  O O    . LEU A 1 120 ? -10.010 7.991   -0.534  1.00 0.39  ? 120 LEU A O    3  
ATOM 7747  C CB   . LEU A 1 120 ? -8.608  5.887   1.660   1.00 0.36  ? 120 LEU A CB   3  
ATOM 7748  C CG   . LEU A 1 120 ? -9.002  4.883   2.763   1.00 0.68  ? 120 LEU A CG   3  
ATOM 7749  C CD1  . LEU A 1 120 ? -7.954  4.929   3.882   1.00 1.69  ? 120 LEU A CD1  3  
ATOM 7750  C CD2  . LEU A 1 120 ? -10.383 5.237   3.358   1.00 1.28  ? 120 LEU A CD2  3  
ATOM 7751  H H    . LEU A 1 120 ? -8.797  3.924   0.015   1.00 0.41  ? 120 LEU A H    3  
ATOM 7752  H HA   . LEU A 1 120 ? -10.612 5.993   0.932   1.00 0.39  ? 120 LEU A HA   3  
ATOM 7753  H HB2  . LEU A 1 120 ? -7.630  5.634   1.278   1.00 0.60  ? 120 LEU A HB2  3  
ATOM 7754  H HB3  . LEU A 1 120 ? -8.582  6.877   2.081   1.00 0.65  ? 120 LEU A HB3  3  
ATOM 7755  H HG   . LEU A 1 120 ? -9.033  3.887   2.344   1.00 1.47  ? 120 LEU A HG   3  
ATOM 7756  H HD11 . LEU A 1 120 ? -7.967  5.903   4.346   1.00 2.18  ? 120 LEU A HD11 3  
ATOM 7757  H HD12 . LEU A 1 120 ? -6.976  4.741   3.472   1.00 2.20  ? 120 LEU A HD12 3  
ATOM 7758  H HD13 . LEU A 1 120 ? -8.185  4.176   4.621   1.00 2.31  ? 120 LEU A HD13 3  
ATOM 7759  H HD21 . LEU A 1 120 ? -11.160 4.776   2.768   1.00 1.86  ? 120 LEU A HD21 3  
ATOM 7760  H HD22 . LEU A 1 120 ? -10.518 6.308   3.354   1.00 1.90  ? 120 LEU A HD22 3  
ATOM 7761  H HD23 . LEU A 1 120 ? -10.450 4.873   4.375   1.00 1.79  ? 120 LEU A HD23 3  
ATOM 7762  N N    . VAL A 1 121 ? -8.323  6.795   -1.292  1.00 0.33  ? 121 VAL A N    3  
ATOM 7763  C CA   . VAL A 1 121 ? -7.956  7.798   -2.336  1.00 0.39  ? 121 VAL A CA   3  
ATOM 7764  C C    . VAL A 1 121 ? -9.027  7.825   -3.431  1.00 0.36  ? 121 VAL A C    3  
ATOM 7765  O O    . VAL A 1 121 ? -9.723  8.806   -3.604  1.00 0.39  ? 121 VAL A O    3  
ATOM 7766  C CB   . VAL A 1 121 ? -6.606  7.420   -2.951  1.00 0.54  ? 121 VAL A CB   3  
ATOM 7767  C CG1  . VAL A 1 121 ? -6.270  8.400   -4.077  1.00 0.95  ? 121 VAL A CG1  3  
ATOM 7768  C CG2  . VAL A 1 121 ? -5.518  7.504   -1.875  1.00 1.18  ? 121 VAL A CG2  3  
ATOM 7769  H H    . VAL A 1 121 ? -7.819  5.956   -1.240  1.00 0.34  ? 121 VAL A H    3  
ATOM 7770  H HA   . VAL A 1 121 ? -7.889  8.811   -1.963  1.00 0.51  ? 121 VAL A HA   3  
ATOM 7771  H HB   . VAL A 1 121 ? -6.654  6.416   -3.345  1.00 1.28  ? 121 VAL A HB   3  
ATOM 7772  H HG11 . VAL A 1 121 ? -6.427  9.412   -3.733  1.00 1.65  ? 121 VAL A HG11 3  
ATOM 7773  H HG12 . VAL A 1 121 ? -6.908  8.207   -4.927  1.00 1.36  ? 121 VAL A HG12 3  
ATOM 7774  H HG13 . VAL A 1 121 ? -5.237  8.276   -4.367  1.00 1.60  ? 121 VAL A HG13 3  
ATOM 7775  H HG21 . VAL A 1 121 ? -4.592  7.110   -2.266  1.00 1.78  ? 121 VAL A HG21 3  
ATOM 7776  H HG22 . VAL A 1 121 ? -5.817  6.929   -1.012  1.00 1.69  ? 121 VAL A HG22 3  
ATOM 7777  H HG23 . VAL A 1 121 ? -5.377  8.535   -1.586  1.00 1.75  ? 121 VAL A HG23 3  
ATOM 7778  N N    . LEU A 1 122 ? -9.163  6.764   -4.181  1.00 0.37  ? 122 LEU A N    3  
ATOM 7779  C CA   . LEU A 1 122 ? -10.186 6.750   -5.268  1.00 0.39  ? 122 LEU A CA   3  
ATOM 7780  C C    . LEU A 1 122 ? -11.538 7.214   -4.720  1.00 0.40  ? 122 LEU A C    3  
ATOM 7781  O O    . LEU A 1 122 ? -12.146 8.130   -5.243  1.00 0.40  ? 122 LEU A O    3  
ATOM 7782  C CB   . LEU A 1 122 ? -10.331 5.333   -5.836  1.00 0.42  ? 122 LEU A CB   3  
ATOM 7783  C CG   . LEU A 1 122 ? -8.971  4.812   -6.329  1.00 0.72  ? 122 LEU A CG   3  
ATOM 7784  C CD1  . LEU A 1 122 ? -9.022  3.286   -6.449  1.00 1.15  ? 122 LEU A CD1  3  
ATOM 7785  C CD2  . LEU A 1 122 ? -8.649  5.393   -7.711  1.00 1.24  ? 122 LEU A CD2  3  
ATOM 7786  H H    . LEU A 1 122 ? -8.589  5.983   -4.036  1.00 0.39  ? 122 LEU A H    3  
ATOM 7787  H HA   . LEU A 1 122 ? -9.892  7.427   -6.053  1.00 0.40  ? 122 LEU A HA   3  
ATOM 7788  H HB2  . LEU A 1 122 ? -10.707 4.679   -5.061  1.00 0.62  ? 122 LEU A HB2  3  
ATOM 7789  H HB3  . LEU A 1 122 ? -11.029 5.347   -6.659  1.00 0.70  ? 122 LEU A HB3  3  
ATOM 7790  H HG   . LEU A 1 122 ? -8.198  5.094   -5.630  1.00 1.46  ? 122 LEU A HG   3  
ATOM 7791  H HD11 . LEU A 1 122 ? -8.058  2.917   -6.768  1.00 1.70  ? 122 LEU A HD11 3  
ATOM 7792  H HD12 . LEU A 1 122 ? -9.772  3.006   -7.174  1.00 1.65  ? 122 LEU A HD12 3  
ATOM 7793  H HD13 . LEU A 1 122 ? -9.271  2.858   -5.490  1.00 1.70  ? 122 LEU A HD13 3  
ATOM 7794  H HD21 . LEU A 1 122 ? -9.444  5.146   -8.399  1.00 1.80  ? 122 LEU A HD21 3  
ATOM 7795  H HD22 . LEU A 1 122 ? -7.721  4.974   -8.068  1.00 1.64  ? 122 LEU A HD22 3  
ATOM 7796  H HD23 . LEU A 1 122 ? -8.551  6.464   -7.643  1.00 1.86  ? 122 LEU A HD23 3  
ATOM 7797  N N    . LYS A 1 123 ? -12.015 6.604   -3.671  1.00 0.51  ? 123 LYS A N    3  
ATOM 7798  C CA   . LYS A 1 123 ? -13.324 7.035   -3.107  1.00 0.55  ? 123 LYS A CA   3  
ATOM 7799  C C    . LYS A 1 123 ? -13.294 8.546   -2.875  1.00 0.54  ? 123 LYS A C    3  
ATOM 7800  O O    . LYS A 1 123 ? -14.287 9.217   -3.030  1.00 0.55  ? 123 LYS A O    3  
ATOM 7801  C CB   . LYS A 1 123 ? -13.592 6.311   -1.783  1.00 0.59  ? 123 LYS A CB   3  
ATOM 7802  C CG   . LYS A 1 123 ? -15.016 6.619   -1.287  1.00 0.97  ? 123 LYS A CG   3  
ATOM 7803  C CD   . LYS A 1 123 ? -16.066 5.967   -2.211  1.00 1.37  ? 123 LYS A CD   3  
ATOM 7804  C CE   . LYS A 1 123 ? -17.363 5.717   -1.434  1.00 1.74  ? 123 LYS A CE   3  
ATOM 7805  N NZ   . LYS A 1 123 ? -18.404 5.189   -2.362  1.00 2.32  ? 123 LYS A NZ   3  
ATOM 7806  H H    . LYS A 1 123 ? -11.515 5.871   -3.254  1.00 0.62  ? 123 LYS A H    3  
ATOM 7807  H HA   . LYS A 1 123 ? -14.110 6.809   -3.810  1.00 0.56  ? 123 LYS A HA   3  
ATOM 7808  H HB2  . LYS A 1 123 ? -13.483 5.247   -1.928  1.00 0.98  ? 123 LYS A HB2  3  
ATOM 7809  H HB3  . LYS A 1 123 ? -12.880 6.646   -1.044  1.00 0.98  ? 123 LYS A HB3  3  
ATOM 7810  H HG2  . LYS A 1 123 ? -15.127 6.234   -0.283  1.00 1.58  ? 123 LYS A HG2  3  
ATOM 7811  H HG3  . LYS A 1 123 ? -15.167 7.689   -1.275  1.00 1.56  ? 123 LYS A HG3  3  
ATOM 7812  H HD2  . LYS A 1 123 ? -16.275 6.626   -3.041  1.00 1.88  ? 123 LYS A HD2  3  
ATOM 7813  H HD3  . LYS A 1 123 ? -15.692 5.025   -2.586  1.00 1.93  ? 123 LYS A HD3  3  
ATOM 7814  H HE2  . LYS A 1 123 ? -17.181 4.995   -0.651  1.00 2.16  ? 123 LYS A HE2  3  
ATOM 7815  H HE3  . LYS A 1 123 ? -17.706 6.643   -0.998  1.00 2.15  ? 123 LYS A HE3  3  
ATOM 7816  H HZ1  . LYS A 1 123 ? -18.401 4.150   -2.333  1.00 2.93  ? 123 LYS A HZ1  3  
ATOM 7817  H HZ2  . LYS A 1 123 ? -18.198 5.510   -3.331  1.00 2.67  ? 123 LYS A HZ2  3  
ATOM 7818  H HZ3  . LYS A 1 123 ? -19.338 5.540   -2.072  1.00 2.55  ? 123 LYS A HZ3  3  
ATOM 7819  N N    . ALA A 1 124 ? -12.162 9.087   -2.506  1.00 0.52  ? 124 ALA A N    3  
ATOM 7820  C CA   . ALA A 1 124 ? -12.082 10.558  -2.265  1.00 0.52  ? 124 ALA A CA   3  
ATOM 7821  C C    . ALA A 1 124 ? -12.080 11.302  -3.603  1.00 0.51  ? 124 ALA A C    3  
ATOM 7822  O O    . ALA A 1 124 ? -12.515 12.429  -3.711  1.00 0.54  ? 124 ALA A O    3  
ATOM 7823  C CB   . ALA A 1 124 ? -10.805 10.886  -1.488  1.00 0.51  ? 124 ALA A CB   3  
ATOM 7824  H H    . ALA A 1 124 ? -11.366 8.527   -2.391  1.00 0.51  ? 124 ALA A H    3  
ATOM 7825  H HA   . ALA A 1 124 ? -12.944 10.873  -1.692  1.00 0.54  ? 124 ALA A HA   3  
ATOM 7826  H HB1  . ALA A 1 124 ? -9.945  10.586  -2.067  1.00 1.07  ? 124 ALA A HB1  3  
ATOM 7827  H HB2  . ALA A 1 124 ? -10.810 10.355  -0.547  1.00 1.08  ? 124 ALA A HB2  3  
ATOM 7828  H HB3  . ALA A 1 124 ? -10.760 11.949  -1.300  1.00 1.07  ? 124 ALA A HB3  3  
ATOM 7829  N N    . LEU A 1 125 ? -11.583 10.666  -4.627  1.00 0.47  ? 125 LEU A N    3  
ATOM 7830  C CA   . LEU A 1 125 ? -11.537 11.304  -5.961  1.00 0.47  ? 125 LEU A CA   3  
ATOM 7831  C C    . LEU A 1 125 ? -12.950 11.730  -6.380  1.00 0.48  ? 125 LEU A C    3  
ATOM 7832  O O    . LEU A 1 125 ? -13.144 12.784  -6.952  1.00 0.48  ? 125 LEU A O    3  
ATOM 7833  C CB   . LEU A 1 125 ? -10.983 10.287  -6.967  1.00 0.51  ? 125 LEU A CB   3  
ATOM 7834  C CG   . LEU A 1 125 ? -10.513 11.016  -8.239  1.00 0.49  ? 125 LEU A CG   3  
ATOM 7835  C CD1  . LEU A 1 125 ? -9.046  11.438  -8.096  1.00 1.10  ? 125 LEU A CD1  3  
ATOM 7836  C CD2  . LEU A 1 125 ? -10.653 10.095  -9.457  1.00 1.21  ? 125 LEU A CD2  3  
ATOM 7837  H H    . LEU A 1 125 ? -11.231 9.764   -4.516  1.00 0.45  ? 125 LEU A H    3  
ATOM 7838  H HA   . LEU A 1 125 ? -10.890 12.169  -5.929  1.00 0.47  ? 125 LEU A HA   3  
ATOM 7839  H HB2  . LEU A 1 125 ? -10.153 9.756   -6.518  1.00 0.65  ? 125 LEU A HB2  3  
ATOM 7840  H HB3  . LEU A 1 125 ? -11.761 9.579   -7.220  1.00 0.63  ? 125 LEU A HB3  3  
ATOM 7841  H HG   . LEU A 1 125 ? -11.120 11.894  -8.384  1.00 1.08  ? 125 LEU A HG   3  
ATOM 7842  H HD11 . LEU A 1 125 ? -8.925  12.025  -7.198  1.00 1.73  ? 125 LEU A HD11 3  
ATOM 7843  H HD12 . LEU A 1 125 ? -8.756  12.027  -8.953  1.00 1.64  ? 125 LEU A HD12 3  
ATOM 7844  H HD13 . LEU A 1 125 ? -8.423  10.557  -8.037  1.00 1.64  ? 125 LEU A HD13 3  
ATOM 7845  H HD21 . LEU A 1 125 ? -11.696 9.869   -9.620  1.00 1.87  ? 125 LEU A HD21 3  
ATOM 7846  H HD22 . LEU A 1 125 ? -10.110 9.178   -9.281  1.00 1.77  ? 125 LEU A HD22 3  
ATOM 7847  H HD23 . LEU A 1 125 ? -10.251 10.589  -10.330 1.00 1.57  ? 125 LEU A HD23 3  
ATOM 7848  N N    . CYS A 1 126 ? -13.936 10.917  -6.108  1.00 0.52  ? 126 CYS A N    3  
ATOM 7849  C CA   . CYS A 1 126 ? -15.332 11.281  -6.503  1.00 0.57  ? 126 CYS A CA   3  
ATOM 7850  C C    . CYS A 1 126 ? -15.823 12.449  -5.631  1.00 0.57  ? 126 CYS A C    3  
ATOM 7851  O O    . CYS A 1 126 ? -16.511 13.343  -6.077  1.00 0.68  ? 126 CYS A O    3  
ATOM 7852  C CB   . CYS A 1 126 ? -16.242 10.048  -6.337  1.00 0.66  ? 126 CYS A CB   3  
ATOM 7853  S SG   . CYS A 1 126 ? -16.865 9.942   -4.637  1.00 1.67  ? 126 CYS A SG   3  
ATOM 7854  H H    . CYS A 1 126 ? -13.758 10.068  -5.648  1.00 0.54  ? 126 CYS A H    3  
ATOM 7855  H HA   . CYS A 1 126 ? -15.335 11.590  -7.539  1.00 0.59  ? 126 CYS A HA   3  
ATOM 7856  H HB2  . CYS A 1 126 ? -17.076 10.127  -7.017  1.00 1.24  ? 126 CYS A HB2  3  
ATOM 7857  H HB3  . CYS A 1 126 ? -15.668 9.157   -6.555  1.00 1.23  ? 126 CYS A HB3  3  
ATOM 7858  H HG   . CYS A 1 126 ? -17.799 9.726   -4.677  1.00 2.20  ? 126 CYS A HG   3  
ATOM 7859  N N    . THR A 1 127 ? -15.446 12.421  -4.387  1.00 0.57  ? 127 THR A N    3  
ATOM 7860  C CA   . THR A 1 127 ? -15.829 13.494  -3.424  1.00 0.60  ? 127 THR A CA   3  
ATOM 7861  C C    . THR A 1 127 ? -15.175 14.809  -3.842  1.00 0.62  ? 127 THR A C    3  
ATOM 7862  O O    . THR A 1 127 ? -15.568 15.881  -3.428  1.00 0.70  ? 127 THR A O    3  
ATOM 7863  C CB   . THR A 1 127 ? -15.351 13.066  -2.025  1.00 0.60  ? 127 THR A CB   3  
ATOM 7864  O OG1  . THR A 1 127 ? -13.934 13.008  -1.977  1.00 1.14  ? 127 THR A OG1  3  
ATOM 7865  C CG2  . THR A 1 127 ? -15.952 11.683  -1.786  1.00 1.19  ? 127 THR A CG2  3  
ATOM 7866  H H    . THR A 1 127 ? -14.890 11.667  -4.097  1.00 0.65  ? 127 THR A H    3  
ATOM 7867  H HA   . THR A 1 127 ? -16.906 13.593  -3.351  1.00 0.70  ? 127 THR A HA   3  
ATOM 7868  H HB   . THR A 1 127 ? -15.720 13.752  -1.281  1.00 1.00  ? 127 THR A HB   3  
ATOM 7869  H HG1  . THR A 1 127 ? -13.674 12.851  -1.066  1.00 1.73  ? 127 THR A HG1  3  
ATOM 7870  H HG21 . THR A 1 127 ? -15.677 11.337  -0.801  1.00 1.77  ? 127 THR A HG21 3  
ATOM 7871  H HG22 . THR A 1 127 ? -15.586 10.996  -2.523  1.00 1.72  ? 127 THR A HG22 3  
ATOM 7872  H HG23 . THR A 1 127 ? -17.028 11.744  -1.856  1.00 1.72  ? 127 THR A HG23 3  
ATOM 7873  N N    . LYS A 1 128 ? -14.163 14.713  -4.670  1.00 0.60  ? 128 LYS A N    3  
ATOM 7874  C CA   . LYS A 1 128 ? -13.442 15.928  -5.146  1.00 0.70  ? 128 LYS A CA   3  
ATOM 7875  C C    . LYS A 1 128 ? -12.944 16.714  -3.941  1.00 0.61  ? 128 LYS A C    3  
ATOM 7876  O O    . LYS A 1 128 ? -13.475 17.762  -3.630  1.00 0.60  ? 128 LYS A O    3  
ATOM 7877  C CB   . LYS A 1 128 ? -14.371 16.810  -5.989  1.00 0.87  ? 128 LYS A CB   3  
ATOM 7878  C CG   . LYS A 1 128 ? -14.827 16.044  -7.238  1.00 1.12  ? 128 LYS A CG   3  
ATOM 7879  C CD   . LYS A 1 128 ? -15.881 16.863  -8.013  1.00 1.43  ? 128 LYS A CD   3  
ATOM 7880  C CE   . LYS A 1 128 ? -17.285 16.589  -7.458  1.00 1.83  ? 128 LYS A CE   3  
ATOM 7881  N NZ   . LYS A 1 128 ? -18.272 17.468  -8.148  1.00 2.47  ? 128 LYS A NZ   3  
ATOM 7882  H H    . LYS A 1 128 ? -13.864 13.826  -4.962  1.00 0.57  ? 128 LYS A H    3  
ATOM 7883  H HA   . LYS A 1 128 ? -12.583 15.634  -5.732  1.00 0.81  ? 128 LYS A HA   3  
ATOM 7884  H HB2  . LYS A 1 128 ? -15.231 17.090  -5.402  1.00 0.88  ? 128 LYS A HB2  3  
ATOM 7885  H HB3  . LYS A 1 128 ? -13.840 17.700  -6.293  1.00 0.94  ? 128 LYS A HB3  3  
ATOM 7886  H HG2  . LYS A 1 128 ? -13.972 15.867  -7.876  1.00 1.28  ? 128 LYS A HG2  3  
ATOM 7887  H HG3  . LYS A 1 128 ? -15.251 15.098  -6.943  1.00 1.39  ? 128 LYS A HG3  3  
ATOM 7888  H HD2  . LYS A 1 128 ? -15.661 17.918  -7.924  1.00 1.67  ? 128 LYS A HD2  3  
ATOM 7889  H HD3  . LYS A 1 128 ? -15.854 16.582  -9.056  1.00 1.69  ? 128 LYS A HD3  3  
ATOM 7890  H HE2  . LYS A 1 128 ? -17.545 15.555  -7.629  1.00 2.13  ? 128 LYS A HE2  3  
ATOM 7891  H HE3  . LYS A 1 128 ? -17.303 16.792  -6.398  1.00 2.19  ? 128 LYS A HE3  3  
ATOM 7892  H HZ1  . LYS A 1 128 ? -18.673 16.966  -8.965  1.00 2.85  ? 128 LYS A HZ1  3  
ATOM 7893  H HZ2  . LYS A 1 128 ? -17.796 18.335  -8.472  1.00 2.89  ? 128 LYS A HZ2  3  
ATOM 7894  H HZ3  . LYS A 1 128 ? -19.036 17.718  -7.488  1.00 2.86  ? 128 LYS A HZ3  3  
ATOM 7895  N N    . VAL A 1 129 ? -11.938 16.230  -3.248  1.00 0.60  ? 129 VAL A N    3  
ATOM 7896  C CA   . VAL A 1 129 ? -11.427 16.974  -2.053  1.00 0.53  ? 129 VAL A CA   3  
ATOM 7897  C C    . VAL A 1 129 ? -9.887  16.922  -2.044  1.00 0.53  ? 129 VAL A C    3  
ATOM 7898  O O    . VAL A 1 129 ? -9.316  16.146  -1.304  1.00 0.56  ? 129 VAL A O    3  
ATOM 7899  C CB   . VAL A 1 129 ? -11.967 16.290  -0.794  1.00 0.57  ? 129 VAL A CB   3  
ATOM 7900  C CG1  . VAL A 1 129 ? -11.608 17.113  0.439   1.00 1.40  ? 129 VAL A CG1  3  
ATOM 7901  C CG2  . VAL A 1 129 ? -13.488 16.150  -0.897  1.00 1.22  ? 129 VAL A CG2  3  
ATOM 7902  H H    . VAL A 1 129 ? -11.518 15.379  -3.491  1.00 0.66  ? 129 VAL A H    3  
ATOM 7903  H HA   . VAL A 1 129 ? -11.776 17.991  -2.106  1.00 0.54  ? 129 VAL A HA   3  
ATOM 7904  H HB   . VAL A 1 129 ? -11.524 15.308  -0.706  1.00 1.05  ? 129 VAL A HB   3  
ATOM 7905  H HG11 . VAL A 1 129 ? -12.106 16.701  1.304   1.00 1.84  ? 129 VAL A HG11 3  
ATOM 7906  H HG12 . VAL A 1 129 ? -11.921 18.136  0.295   1.00 2.01  ? 129 VAL A HG12 3  
ATOM 7907  H HG13 . VAL A 1 129 ? -10.541 17.077  0.588   1.00 1.91  ? 129 VAL A HG13 3  
ATOM 7908  H HG21 . VAL A 1 129 ? -13.880 15.785  0.041   1.00 1.76  ? 129 VAL A HG21 3  
ATOM 7909  H HG22 . VAL A 1 129 ? -13.732 15.450  -1.684  1.00 1.84  ? 129 VAL A HG22 3  
ATOM 7910  H HG23 . VAL A 1 129 ? -13.925 17.112  -1.120  1.00 1.66  ? 129 VAL A HG23 3  
ATOM 7911  N N    . PRO A 1 130 ? -9.245  17.732  -2.868  1.00 0.62  ? 130 PRO A N    3  
ATOM 7912  C CA   . PRO A 1 130 ? -7.770  17.740  -2.941  1.00 0.73  ? 130 PRO A CA   3  
ATOM 7913  C C    . PRO A 1 130 ? -7.170  18.018  -1.554  1.00 0.65  ? 130 PRO A C    3  
ATOM 7914  O O    . PRO A 1 130 ? -6.012  17.746  -1.301  1.00 0.64  ? 130 PRO A O    3  
ATOM 7915  C CB   . PRO A 1 130 ? -7.415  18.821  -3.984  1.00 1.00  ? 130 PRO A CB   3  
ATOM 7916  C CG   . PRO A 1 130 ? -8.758  19.375  -4.549  1.00 1.00  ? 130 PRO A CG   3  
ATOM 7917  C CD   . PRO A 1 130 ? -9.913  18.693  -3.775  1.00 0.75  ? 130 PRO A CD   3  
ATOM 7918  H HA   . PRO A 1 130 ? -7.399  16.778  -3.241  1.00 0.84  ? 130 PRO A HA   3  
ATOM 7919  H HB2  . PRO A 1 130 ? -6.848  19.619  -3.518  1.00 1.10  ? 130 PRO A HB2  3  
ATOM 7920  H HB3  . PRO A 1 130 ? -6.836  18.385  -4.787  1.00 1.18  ? 130 PRO A HB3  3  
ATOM 7921  H HG2  . PRO A 1 130 ? -8.800  20.450  -4.409  1.00 1.11  ? 130 PRO A HG2  3  
ATOM 7922  H HG3  . PRO A 1 130 ? -8.840  19.145  -5.603  1.00 1.11  ? 130 PRO A HG3  3  
ATOM 7923  H HD2  . PRO A 1 130 ? -10.462 19.432  -3.208  1.00 0.76  ? 130 PRO A HD2  3  
ATOM 7924  H HD3  . PRO A 1 130 ? -10.573 18.169  -4.452  1.00 0.75  ? 130 PRO A HD3  3  
ATOM 7925  N N    . GLU A 1 131 ? -7.963  18.501  -0.646  1.00 0.73  ? 131 GLU A N    3  
ATOM 7926  C CA   . GLU A 1 131 ? -7.469  18.741  0.739   1.00 0.82  ? 131 GLU A CA   3  
ATOM 7927  C C    . GLU A 1 131 ? -7.211  17.390  1.414   1.00 0.72  ? 131 GLU A C    3  
ATOM 7928  O O    . GLU A 1 131 ? -6.294  17.219  2.197   1.00 0.73  ? 131 GLU A O    3  
ATOM 7929  C CB   . GLU A 1 131 ? -8.562  19.472  1.522   1.00 1.09  ? 131 GLU A CB   3  
ATOM 7930  C CG   . GLU A 1 131 ? -8.767  20.867  0.924   1.00 1.55  ? 131 GLU A CG   3  
ATOM 7931  C CD   . GLU A 1 131 ? -9.482  20.742  -0.423  1.00 2.17  ? 131 GLU A CD   3  
ATOM 7932  O OE1  . GLU A 1 131 ? -10.692 20.588  -0.415  1.00 2.86  ? 131 GLU A OE1  3  
ATOM 7933  O OE2  . GLU A 1 131 ? -8.807  20.801  -1.437  1.00 2.52  ? 131 GLU A OE2  3  
ATOM 7934  H H    . GLU A 1 131 ? -8.903  18.673  -0.862  1.00 0.82  ? 131 GLU A H    3  
ATOM 7935  H HA   . GLU A 1 131 ? -6.587  19.366  0.752   1.00 0.90  ? 131 GLU A HA   3  
ATOM 7936  H HB2  . GLU A 1 131 ? -9.483  18.918  1.465   1.00 1.38  ? 131 GLU A HB2  3  
ATOM 7937  H HB3  . GLU A 1 131 ? -8.262  19.568  2.554   1.00 1.55  ? 131 GLU A HB3  3  
ATOM 7938  H HG2  . GLU A 1 131 ? -9.365  21.463  1.597   1.00 2.03  ? 131 GLU A HG2  3  
ATOM 7939  H HG3  . GLU A 1 131 ? -7.808  21.343  0.777   1.00 1.89  ? 131 GLU A HG3  3  
ATOM 7940  N N    . LEU A 1 132 ? -8.035  16.424  1.097   1.00 0.71  ? 132 LEU A N    3  
ATOM 7941  C CA   . LEU A 1 132 ? -7.907  15.063  1.687   1.00 0.69  ? 132 LEU A CA   3  
ATOM 7942  C C    . LEU A 1 132 ? -6.891  14.219  0.908   1.00 0.58  ? 132 LEU A C    3  
ATOM 7943  O O    . LEU A 1 132 ? -5.971  13.685  1.488   1.00 0.59  ? 132 LEU A O    3  
ATOM 7944  C CB   . LEU A 1 132 ? -9.283  14.380  1.646   1.00 0.80  ? 132 LEU A CB   3  
ATOM 7945  C CG   . LEU A 1 132 ? -9.221  12.983  2.284   1.00 0.60  ? 132 LEU A CG   3  
ATOM 7946  C CD1  . LEU A 1 132 ? -8.849  13.090  3.774   1.00 1.11  ? 132 LEU A CD1  3  
ATOM 7947  C CD2  . LEU A 1 132 ? -10.593 12.311  2.143   1.00 0.77  ? 132 LEU A CD2  3  
ATOM 7948  H H    . LEU A 1 132 ? -8.755  16.585  0.452   1.00 0.77  ? 132 LEU A H    3  
ATOM 7949  H HA   . LEU A 1 132 ? -7.569  15.112  2.706   1.00 0.73  ? 132 LEU A HA   3  
ATOM 7950  H HB2  . LEU A 1 132 ? -9.996  14.985  2.185   1.00 1.25  ? 132 LEU A HB2  3  
ATOM 7951  H HB3  . LEU A 1 132 ? -9.602  14.286  0.618   1.00 1.02  ? 132 LEU A HB3  3  
ATOM 7952  H HG   . LEU A 1 132 ? -8.481  12.388  1.773   1.00 0.96  ? 132 LEU A HG   3  
ATOM 7953  H HD11 . LEU A 1 132 ? -9.222  12.226  4.307   1.00 1.71  ? 132 LEU A HD11 3  
ATOM 7954  H HD12 . LEU A 1 132 ? -9.282  13.985  4.197   1.00 1.45  ? 132 LEU A HD12 3  
ATOM 7955  H HD13 . LEU A 1 132 ? -7.774  13.130  3.873   1.00 1.58  ? 132 LEU A HD13 3  
ATOM 7956  H HD21 . LEU A 1 132 ? -10.856 12.245  1.098   1.00 1.39  ? 132 LEU A HD21 3  
ATOM 7957  H HD22 . LEU A 1 132 ? -11.336 12.896  2.665   1.00 1.46  ? 132 LEU A HD22 3  
ATOM 7958  H HD23 . LEU A 1 132 ? -10.554 11.319  2.568   1.00 1.25  ? 132 LEU A HD23 3  
ATOM 7959  N N    . ILE A 1 133 ? -7.037  14.086  -0.387  1.00 0.52  ? 133 ILE A N    3  
ATOM 7960  C CA   . ILE A 1 133 ? -6.063  13.253  -1.169  1.00 0.46  ? 133 ILE A CA   3  
ATOM 7961  C C    . ILE A 1 133 ? -4.631  13.530  -0.702  1.00 0.43  ? 133 ILE A C    3  
ATOM 7962  O O    . ILE A 1 133 ? -3.876  12.626  -0.400  1.00 0.46  ? 133 ILE A O    3  
ATOM 7963  C CB   . ILE A 1 133 ? -6.184  13.574  -2.658  1.00 0.45  ? 133 ILE A CB   3  
ATOM 7964  C CG1  . ILE A 1 133 ? -7.638  13.373  -3.101  1.00 0.42  ? 133 ILE A CG1  3  
ATOM 7965  C CG2  . ILE A 1 133 ? -5.269  12.637  -3.451  1.00 0.49  ? 133 ILE A CG2  3  
ATOM 7966  C CD1  . ILE A 1 133 ? -7.808  13.825  -4.553  1.00 1.19  ? 133 ILE A CD1  3  
ATOM 7967  H H    . ILE A 1 133 ? -7.777  14.531  -0.849  1.00 0.56  ? 133 ILE A H    3  
ATOM 7968  H HA   . ILE A 1 133 ? -6.291  12.207  -1.021  1.00 0.50  ? 133 ILE A HA   3  
ATOM 7969  H HB   . ILE A 1 133 ? -5.884  14.594  -2.831  1.00 0.52  ? 133 ILE A HB   3  
ATOM 7970  H HG12 . ILE A 1 133 ? -7.896  12.327  -3.018  1.00 1.01  ? 133 ILE A HG12 3  
ATOM 7971  H HG13 . ILE A 1 133 ? -8.292  13.954  -2.468  1.00 1.03  ? 133 ILE A HG13 3  
ATOM 7972  H HG21 . ILE A 1 133 ? -5.417  12.795  -4.509  1.00 1.14  ? 133 ILE A HG21 3  
ATOM 7973  H HG22 . ILE A 1 133 ? -5.504  11.612  -3.203  1.00 1.19  ? 133 ILE A HG22 3  
ATOM 7974  H HG23 . ILE A 1 133 ? -4.239  12.841  -3.197  1.00 1.08  ? 133 ILE A HG23 3  
ATOM 7975  H HD11 . ILE A 1 133 ? -7.432  14.831  -4.663  1.00 1.86  ? 133 ILE A HD11 3  
ATOM 7976  H HD12 . ILE A 1 133 ? -8.855  13.801  -4.817  1.00 1.78  ? 133 ILE A HD12 3  
ATOM 7977  H HD13 . ILE A 1 133 ? -7.258  13.161  -5.203  1.00 1.68  ? 133 ILE A HD13 3  
ATOM 7978  N N    . ARG A 1 134 ? -4.262  14.777  -0.623  1.00 0.42  ? 134 ARG A N    3  
ATOM 7979  C CA   . ARG A 1 134 ? -2.893  15.128  -0.153  1.00 0.43  ? 134 ARG A CA   3  
ATOM 7980  C C    . ARG A 1 134 ? -2.721  14.664  1.298   1.00 0.40  ? 134 ARG A C    3  
ATOM 7981  O O    . ARG A 1 134 ? -1.697  14.124  1.671   1.00 0.39  ? 134 ARG A O    3  
ATOM 7982  C CB   . ARG A 1 134 ? -2.721  16.650  -0.218  1.00 0.51  ? 134 ARG A CB   3  
ATOM 7983  C CG   . ARG A 1 134 ? -2.887  17.124  -1.664  1.00 1.26  ? 134 ARG A CG   3  
ATOM 7984  C CD   . ARG A 1 134 ? -2.792  18.652  -1.720  1.00 1.57  ? 134 ARG A CD   3  
ATOM 7985  N NE   . ARG A 1 134 ? -3.025  19.111  -3.120  1.00 2.30  ? 134 ARG A NE   3  
ATOM 7986  C CZ   . ARG A 1 134 ? -3.277  20.368  -3.364  1.00 2.86  ? 134 ARG A CZ   3  
ATOM 7987  N NH1  . ARG A 1 134 ? -3.320  21.229  -2.384  1.00 2.98  ? 134 ARG A NH1  3  
ATOM 7988  N NH2  . ARG A 1 134 ? -3.484  20.766  -4.590  1.00 3.71  ? 134 ARG A NH2  3  
ATOM 7989  H H    . ARG A 1 134 ? -4.895  15.491  -0.857  1.00 0.45  ? 134 ARG A H    3  
ATOM 7990  H HA   . ARG A 1 134 ? -2.138  14.655  -0.768  1.00 0.44  ? 134 ARG A HA   3  
ATOM 7991  H HB2  . ARG A 1 134 ? -3.469  17.121  0.404   1.00 0.98  ? 134 ARG A HB2  3  
ATOM 7992  H HB3  . ARG A 1 134 ? -1.737  16.918  0.137   1.00 1.10  ? 134 ARG A HB3  3  
ATOM 7993  H HG2  . ARG A 1 134 ? -2.108  16.692  -2.275  1.00 1.75  ? 134 ARG A HG2  3  
ATOM 7994  H HG3  . ARG A 1 134 ? -3.851  16.813  -2.036  1.00 1.79  ? 134 ARG A HG3  3  
ATOM 7995  H HD2  . ARG A 1 134 ? -3.539  19.084  -1.071  1.00 1.69  ? 134 ARG A HD2  3  
ATOM 7996  H HD3  . ARG A 1 134 ? -1.810  18.964  -1.397  1.00 1.89  ? 134 ARG A HD3  3  
ATOM 7997  H HE   . ARG A 1 134 ? -2.991  18.466  -3.858  1.00 2.71  ? 134 ARG A HE   3  
ATOM 7998  H HH11 . ARG A 1 134 ? -3.160  20.925  -1.445  1.00 2.70  ? 134 ARG A HH11 3  
ATOM 7999  H HH12 . ARG A 1 134 ? -3.512  22.192  -2.572  1.00 3.64  ? 134 ARG A HH12 3  
ATOM 8000  H HH21 . ARG A 1 134 ? -3.450  20.107  -5.342  1.00 4.02  ? 134 ARG A HH21 3  
ATOM 8001  H HH22 . ARG A 1 134 ? -3.676  21.729  -4.778  1.00 4.22  ? 134 ARG A HH22 3  
ATOM 8002  N N    . THR A 1 135 ? -3.712  14.878  2.120   1.00 0.41  ? 135 THR A N    3  
ATOM 8003  C CA   . THR A 1 135 ? -3.585  14.457  3.545   1.00 0.41  ? 135 THR A CA   3  
ATOM 8004  C C    . THR A 1 135 ? -3.503  12.930  3.661   1.00 0.39  ? 135 THR A C    3  
ATOM 8005  O O    . THR A 1 135 ? -3.014  12.388  4.636   1.00 0.52  ? 135 THR A O    3  
ATOM 8006  C CB   . THR A 1 135 ? -4.779  14.961  4.355   1.00 0.42  ? 135 THR A CB   3  
ATOM 8007  O OG1  . THR A 1 135 ? -4.776  16.382  4.359   1.00 0.89  ? 135 THR A OG1  3  
ATOM 8008  C CG2  . THR A 1 135 ? -4.672  14.448  5.795   1.00 0.88  ? 135 THR A CG2  3  
ATOM 8009  H H    . THR A 1 135 ? -4.522  15.327  1.785   1.00 0.43  ? 135 THR A H    3  
ATOM 8010  H HA   . THR A 1 135 ? -2.685  14.893  3.955   1.00 0.42  ? 135 THR A HA   3  
ATOM 8011  H HB   . THR A 1 135 ? -5.695  14.608  3.919   1.00 0.74  ? 135 THR A HB   3  
ATOM 8012  H HG1  . THR A 1 135 ? -4.425  16.680  3.516   1.00 1.41  ? 135 THR A HG1  3  
ATOM 8013  H HG21 . THR A 1 135 ? -5.385  14.969  6.417   1.00 1.52  ? 135 THR A HG21 3  
ATOM 8014  H HG22 . THR A 1 135 ? -3.674  14.625  6.166   1.00 1.47  ? 135 THR A HG22 3  
ATOM 8015  H HG23 . THR A 1 135 ? -4.882  13.389  5.818   1.00 1.37  ? 135 THR A HG23 3  
ATOM 8016  N N    . ILE A 1 136 ? -3.967  12.230  2.657   1.00 0.35  ? 136 ILE A N    3  
ATOM 8017  C CA   . ILE A 1 136 ? -3.912  10.741  2.690   1.00 0.36  ? 136 ILE A CA   3  
ATOM 8018  C C    . ILE A 1 136 ? -2.468  10.298  2.466   1.00 0.35  ? 136 ILE A C    3  
ATOM 8019  O O    . ILE A 1 136 ? -1.794  9.882   3.387   1.00 0.51  ? 136 ILE A O    3  
ATOM 8020  C CB   . ILE A 1 136 ? -4.808  10.178  1.577   1.00 0.46  ? 136 ILE A CB   3  
ATOM 8021  C CG1  . ILE A 1 136 ? -6.279  10.592  1.822   1.00 0.60  ? 136 ILE A CG1  3  
ATOM 8022  C CG2  . ILE A 1 136 ? -4.681  8.648   1.530   1.00 0.94  ? 136 ILE A CG2  3  
ATOM 8023  C CD1  . ILE A 1 136 ? -6.985  9.606   2.757   1.00 0.64  ? 136 ILE A CD1  3  
ATOM 8024  H H    . ILE A 1 136 ? -4.336  12.679  1.867   1.00 0.41  ? 136 ILE A H    3  
ATOM 8025  H HA   . ILE A 1 136 ? -4.254  10.385  3.649   1.00 0.40  ? 136 ILE A HA   3  
ATOM 8026  H HB   . ILE A 1 136 ? -4.479  10.582  0.629   1.00 0.84  ? 136 ILE A HB   3  
ATOM 8027  H HG12 . ILE A 1 136 ? -6.309  11.571  2.267   1.00 1.16  ? 136 ILE A HG12 3  
ATOM 8028  H HG13 . ILE A 1 136 ? -6.803  10.618  0.877   1.00 1.18  ? 136 ILE A HG13 3  
ATOM 8029  H HG21 . ILE A 1 136 ? -4.724  8.252   2.534   1.00 1.44  ? 136 ILE A HG21 3  
ATOM 8030  H HG22 . ILE A 1 136 ? -3.740  8.378   1.075   1.00 1.48  ? 136 ILE A HG22 3  
ATOM 8031  H HG23 . ILE A 1 136 ? -5.494  8.239   0.947   1.00 1.51  ? 136 ILE A HG23 3  
ATOM 8032  H HD11 . ILE A 1 136 ? -6.328  9.342   3.570   1.00 1.15  ? 136 ILE A HD11 3  
ATOM 8033  H HD12 . ILE A 1 136 ? -7.244  8.721   2.204   1.00 1.44  ? 136 ILE A HD12 3  
ATOM 8034  H HD13 . ILE A 1 136 ? -7.882  10.062  3.150   1.00 1.20  ? 136 ILE A HD13 3  
ATOM 8035  N N    . MET A 1 137 ? -1.995  10.370  1.244   1.00 0.35  ? 137 MET A N    3  
ATOM 8036  C CA   . MET A 1 137 ? -0.592  9.945   0.937   1.00 0.33  ? 137 MET A CA   3  
ATOM 8037  C C    . MET A 1 137 ? 0.356   10.357  2.067   1.00 0.31  ? 137 MET A C    3  
ATOM 8038  O O    . MET A 1 137 ? 1.367   9.732   2.319   1.00 0.34  ? 137 MET A O    3  
ATOM 8039  C CB   . MET A 1 137 ? -0.137  10.596  -0.377  1.00 0.36  ? 137 MET A CB   3  
ATOM 8040  C CG   . MET A 1 137 ? -1.171  10.327  -1.503  1.00 0.67  ? 137 MET A CG   3  
ATOM 8041  S SD   . MET A 1 137 ? -0.353  9.556   -2.927  1.00 1.13  ? 137 MET A SD   3  
ATOM 8042  C CE   . MET A 1 137 ? 0.403   11.058  -3.593  1.00 0.67  ? 137 MET A CE   3  
ATOM 8043  H H    . MET A 1 137 ? -2.569  10.683  0.513   1.00 0.52  ? 137 MET A H    3  
ATOM 8044  H HA   . MET A 1 137 ? -0.565  8.871   0.825   1.00 0.34  ? 137 MET A HA   3  
ATOM 8045  H HB2  . MET A 1 137 ? -0.032  11.662  -0.225  1.00 0.50  ? 137 MET A HB2  3  
ATOM 8046  H HB3  . MET A 1 137 ? 0.820   10.184  -0.659  1.00 0.49  ? 137 MET A HB3  3  
ATOM 8047  H HG2  . MET A 1 137 ? -1.950  9.667   -1.147  1.00 1.13  ? 137 MET A HG2  3  
ATOM 8048  H HG3  . MET A 1 137 ? -1.617  11.262  -1.816  1.00 1.01  ? 137 MET A HG3  3  
ATOM 8049  H HE1  . MET A 1 137 ? -0.373  11.765  -3.853  1.00 1.28  ? 137 MET A HE1  3  
ATOM 8050  H HE2  . MET A 1 137 ? 0.975   10.813  -4.475  1.00 1.01  ? 137 MET A HE2  3  
ATOM 8051  H HE3  . MET A 1 137 ? 1.060   11.491  -2.850  1.00 1.26  ? 137 MET A HE3  3  
ATOM 8052  N N    . GLY A 1 138 ? 0.004   11.409  2.758   1.00 0.31  ? 138 GLY A N    3  
ATOM 8053  C CA   . GLY A 1 138 ? 0.829   11.900  3.898   1.00 0.33  ? 138 GLY A CA   3  
ATOM 8054  C C    . GLY A 1 138 ? 0.874   10.824  4.982   1.00 0.33  ? 138 GLY A C    3  
ATOM 8055  O O    . GLY A 1 138 ? 1.927   10.447  5.456   1.00 0.34  ? 138 GLY A O    3  
ATOM 8056  H H    . GLY A 1 138 ? -0.830  11.879  2.535   1.00 0.32  ? 138 GLY A H    3  
ATOM 8057  H HA2  . GLY A 1 138 ? 1.834   12.126  3.564   1.00 0.35  ? 138 GLY A HA2  3  
ATOM 8058  H HA3  . GLY A 1 138 ? 0.359   12.792  4.279   1.00 0.36  ? 138 GLY A HA3  3  
ATOM 8059  N N    . TRP A 1 139 ? -0.266  10.324  5.373   1.00 0.34  ? 139 TRP A N    3  
ATOM 8060  C CA   . TRP A 1 139 ? -0.286  9.264   6.422   1.00 0.37  ? 139 TRP A CA   3  
ATOM 8061  C C    . TRP A 1 139 ? 0.331   7.971   5.873   1.00 0.35  ? 139 TRP A C    3  
ATOM 8062  O O    . TRP A 1 139 ? 0.808   7.136   6.615   1.00 0.39  ? 139 TRP A O    3  
ATOM 8063  C CB   . TRP A 1 139 ? -1.720  8.998   6.886   1.00 0.43  ? 139 TRP A CB   3  
ATOM 8064  C CG   . TRP A 1 139 ? -2.345  10.246  7.447   1.00 0.46  ? 139 TRP A CG   3  
ATOM 8065  C CD1  . TRP A 1 139 ? -1.683  11.293  8.012   1.00 0.54  ? 139 TRP A CD1  3  
ATOM 8066  C CD2  . TRP A 1 139 ? -3.761  10.584  7.513   1.00 0.53  ? 139 TRP A CD2  3  
ATOM 8067  N NE1  . TRP A 1 139 ? -2.606  12.241  8.411   1.00 0.57  ? 139 TRP A NE1  3  
ATOM 8068  C CE2  . TRP A 1 139 ? -3.897  11.851  8.126   1.00 0.56  ? 139 TRP A CE2  3  
ATOM 8069  C CE3  . TRP A 1 139 ? -4.929  9.918   7.103   1.00 0.67  ? 139 TRP A CE3  3  
ATOM 8070  C CZ2  . TRP A 1 139 ? -5.148  12.437  8.325   1.00 0.66  ? 139 TRP A CZ2  3  
ATOM 8071  C CZ3  . TRP A 1 139 ? -6.189  10.504  7.301   1.00 0.81  ? 139 TRP A CZ3  3  
ATOM 8072  C CH2  . TRP A 1 139 ? -6.298  11.761  7.911   1.00 0.78  ? 139 TRP A CH2  3  
ATOM 8073  H H    . TRP A 1 139 ? -1.099  10.656  4.967   1.00 0.35  ? 139 TRP A H    3  
ATOM 8074  H HA   . TRP A 1 139 ? 0.314   9.576   7.260   1.00 0.39  ? 139 TRP A HA   3  
ATOM 8075  H HB2  . TRP A 1 139 ? -2.307  8.654   6.048   1.00 0.45  ? 139 TRP A HB2  3  
ATOM 8076  H HB3  . TRP A 1 139 ? -1.709  8.232   7.649   1.00 0.45  ? 139 TRP A HB3  3  
ATOM 8077  H HD1  . TRP A 1 139 ? -0.617  11.380  8.133   1.00 0.64  ? 139 TRP A HD1  3  
ATOM 8078  H HE1  . TRP A 1 139 ? -2.389  13.092  8.845   1.00 0.65  ? 139 TRP A HE1  3  
ATOM 8079  H HE3  . TRP A 1 139 ? -4.856  8.948   6.632   1.00 0.70  ? 139 TRP A HE3  3  
ATOM 8080  H HZ2  . TRP A 1 139 ? -5.226  13.406  8.796   1.00 0.69  ? 139 TRP A HZ2  3  
ATOM 8081  H HZ3  . TRP A 1 139 ? -7.080  9.984   6.982   1.00 0.96  ? 139 TRP A HZ3  3  
ATOM 8082  H HH2  . TRP A 1 139 ? -7.270  12.207  8.061   1.00 0.90  ? 139 TRP A HH2  3  
ATOM 8083  N N    . THR A 1 140 ? 0.330   7.802   4.575   1.00 0.34  ? 140 THR A N    3  
ATOM 8084  C CA   . THR A 1 140 ? 0.921   6.567   3.982   1.00 0.36  ? 140 THR A CA   3  
ATOM 8085  C C    . THR A 1 140 ? 2.442   6.601   4.165   1.00 0.34  ? 140 THR A C    3  
ATOM 8086  O O    . THR A 1 140 ? 2.994   5.881   4.973   1.00 0.39  ? 140 THR A O    3  
ATOM 8087  C CB   . THR A 1 140 ? 0.579   6.502   2.490   1.00 0.38  ? 140 THR A CB   3  
ATOM 8088  O OG1  . THR A 1 140 ? -0.812  6.735   2.317   1.00 1.20  ? 140 THR A OG1  3  
ATOM 8089  C CG2  . THR A 1 140 ? 0.938   5.122   1.936   1.00 1.17  ? 140 THR A CG2  3  
ATOM 8090  H H    . THR A 1 140 ? -0.056  8.489   3.992   1.00 0.34  ? 140 THR A H    3  
ATOM 8091  H HA   . THR A 1 140 ? 0.518   5.699   4.484   1.00 0.40  ? 140 THR A HA   3  
ATOM 8092  H HB   . THR A 1 140 ? 1.139   7.256   1.959   1.00 0.98  ? 140 THR A HB   3  
ATOM 8093  H HG1  . THR A 1 140 ? -1.205  5.935   1.959   1.00 1.79  ? 140 THR A HG1  3  
ATOM 8094  H HG21 . THR A 1 140 ? 2.012   5.009   1.921   1.00 1.62  ? 140 THR A HG21 3  
ATOM 8095  H HG22 . THR A 1 140 ? 0.552   5.026   0.932   1.00 1.80  ? 140 THR A HG22 3  
ATOM 8096  H HG23 . THR A 1 140 ? 0.504   4.357   2.563   1.00 1.82  ? 140 THR A HG23 3  
ATOM 8097  N N    . LEU A 1 141 ? 3.123   7.445   3.436   1.00 0.33  ? 141 LEU A N    3  
ATOM 8098  C CA   . LEU A 1 141 ? 4.605   7.538   3.588   1.00 0.34  ? 141 LEU A CA   3  
ATOM 8099  C C    . LEU A 1 141 ? 4.957   7.662   5.075   1.00 0.33  ? 141 LEU A C    3  
ATOM 8100  O O    . LEU A 1 141 ? 6.053   7.342   5.488   1.00 0.33  ? 141 LEU A O    3  
ATOM 8101  C CB   . LEU A 1 141 ? 5.138   8.751   2.813   1.00 0.35  ? 141 LEU A CB   3  
ATOM 8102  C CG   . LEU A 1 141 ? 4.786   8.617   1.318   1.00 0.41  ? 141 LEU A CG   3  
ATOM 8103  C CD1  . LEU A 1 141 ? 4.815   9.997   0.653   1.00 0.99  ? 141 LEU A CD1  3  
ATOM 8104  C CD2  . LEU A 1 141 ? 5.802   7.706   0.618   1.00 0.80  ? 141 LEU A CD2  3  
ATOM 8105  H H    . LEU A 1 141 ? 2.658   8.028   2.799   1.00 0.37  ? 141 LEU A H    3  
ATOM 8106  H HA   . LEU A 1 141 ? 5.093   6.637   3.252   1.00 0.36  ? 141 LEU A HA   3  
ATOM 8107  H HB2  . LEU A 1 141 ? 4.687   9.649   3.212   1.00 0.38  ? 141 LEU A HB2  3  
ATOM 8108  H HB3  . LEU A 1 141 ? 6.210   8.808   2.929   1.00 0.41  ? 141 LEU A HB3  3  
ATOM 8109  H HG   . LEU A 1 141 ? 3.796   8.196   1.215   1.00 1.00  ? 141 LEU A HG   3  
ATOM 8110  H HD11 . LEU A 1 141 ? 4.635   9.890   -0.407  1.00 1.58  ? 141 LEU A HD11 3  
ATOM 8111  H HD12 . LEU A 1 141 ? 5.781   10.453  0.810   1.00 1.53  ? 141 LEU A HD12 3  
ATOM 8112  H HD13 . LEU A 1 141 ? 4.047   10.622  1.086   1.00 1.54  ? 141 LEU A HD13 3  
ATOM 8113  H HD21 . LEU A 1 141 ? 5.601   7.694   -0.443  1.00 1.31  ? 141 LEU A HD21 3  
ATOM 8114  H HD22 . LEU A 1 141 ? 5.719   6.704   1.009   1.00 1.31  ? 141 LEU A HD22 3  
ATOM 8115  H HD23 . LEU A 1 141 ? 6.801   8.079   0.789   1.00 1.59  ? 141 LEU A HD23 3  
ATOM 8116  N N    . ASP A 1 142 ? 4.039   8.107   5.885   1.00 0.36  ? 142 ASP A N    3  
ATOM 8117  C CA   . ASP A 1 142 ? 4.333   8.226   7.344   1.00 0.37  ? 142 ASP A CA   3  
ATOM 8118  C C    . ASP A 1 142 ? 4.444   6.821   7.950   1.00 0.37  ? 142 ASP A C    3  
ATOM 8119  O O    . ASP A 1 142 ? 5.197   6.588   8.874   1.00 0.42  ? 142 ASP A O    3  
ATOM 8120  C CB   . ASP A 1 142 ? 3.203   8.993   8.033   1.00 0.37  ? 142 ASP A CB   3  
ATOM 8121  C CG   . ASP A 1 142 ? 3.572   9.237   9.498   1.00 0.78  ? 142 ASP A CG   3  
ATOM 8122  O OD1  . ASP A 1 142 ? 3.294   8.371   10.311  1.00 1.59  ? 142 ASP A OD1  3  
ATOM 8123  O OD2  . ASP A 1 142 ? 4.128   10.285  9.781   1.00 1.32  ? 142 ASP A OD2  3  
ATOM 8124  H H    . ASP A 1 142 ? 3.160   8.357   5.537   1.00 0.37  ? 142 ASP A H    3  
ATOM 8125  H HA   . ASP A 1 142 ? 5.266   8.754   7.483   1.00 0.38  ? 142 ASP A HA   3  
ATOM 8126  H HB2  . ASP A 1 142 ? 3.055   9.941   7.536   1.00 0.57  ? 142 ASP A HB2  3  
ATOM 8127  H HB3  . ASP A 1 142 ? 2.293   8.415   7.985   1.00 0.68  ? 142 ASP A HB3  3  
ATOM 8128  N N    . PHE A 1 143 ? 3.696   5.887   7.429   1.00 0.41  ? 143 PHE A N    3  
ATOM 8129  C CA   . PHE A 1 143 ? 3.740   4.489   7.955   1.00 0.43  ? 143 PHE A CA   3  
ATOM 8130  C C    . PHE A 1 143 ? 4.905   3.723   7.319   1.00 0.43  ? 143 PHE A C    3  
ATOM 8131  O O    . PHE A 1 143 ? 5.726   3.155   8.013   1.00 0.45  ? 143 PHE A O    3  
ATOM 8132  C CB   . PHE A 1 143 ? 2.425   3.786   7.606   1.00 0.44  ? 143 PHE A CB   3  
ATOM 8133  C CG   . PHE A 1 143 ? 2.320   2.486   8.368   1.00 0.47  ? 143 PHE A CG   3  
ATOM 8134  C CD1  . PHE A 1 143 ? 2.954   1.336   7.883   1.00 1.16  ? 143 PHE A CD1  3  
ATOM 8135  C CD2  . PHE A 1 143 ? 1.584   2.430   9.558   1.00 1.29  ? 143 PHE A CD2  3  
ATOM 8136  C CE1  . PHE A 1 143 ? 2.852   0.130   8.587   1.00 1.22  ? 143 PHE A CE1  3  
ATOM 8137  C CE2  . PHE A 1 143 ? 1.482   1.224   10.262  1.00 1.35  ? 143 PHE A CE2  3  
ATOM 8138  C CZ   . PHE A 1 143 ? 2.116   0.074   9.777   1.00 0.72  ? 143 PHE A CZ   3  
ATOM 8139  H H    . PHE A 1 143 ? 3.098   6.105   6.683   1.00 0.48  ? 143 PHE A H    3  
ATOM 8140  H HA   . PHE A 1 143 ? 3.873   4.487   9.027   1.00 0.44  ? 143 PHE A HA   3  
ATOM 8141  H HB2  . PHE A 1 143 ? 1.595   4.425   7.868   1.00 0.47  ? 143 PHE A HB2  3  
ATOM 8142  H HB3  . PHE A 1 143 ? 2.399   3.581   6.545   1.00 0.49  ? 143 PHE A HB3  3  
ATOM 8143  H HD1  . PHE A 1 143 ? 3.523   1.379   6.965   1.00 1.96  ? 143 PHE A HD1  3  
ATOM 8144  H HD2  . PHE A 1 143 ? 1.095   3.317   9.932   1.00 2.09  ? 143 PHE A HD2  3  
ATOM 8145  H HE1  . PHE A 1 143 ? 3.342   -0.757  8.212   1.00 2.02  ? 143 PHE A HE1  3  
ATOM 8146  H HE2  . PHE A 1 143 ? 0.913   1.182   11.180  1.00 2.16  ? 143 PHE A HE2  3  
ATOM 8147  H HZ   . PHE A 1 143 ? 2.037   -0.856  10.320  1.00 0.85  ? 143 PHE A HZ   3  
ATOM 8148  N N    . LEU A 1 144 ? 4.996   3.695   6.020   1.00 0.45  ? 144 LEU A N    3  
ATOM 8149  C CA   . LEU A 1 144 ? 6.124   2.954   5.380   1.00 0.47  ? 144 LEU A CA   3  
ATOM 8150  C C    . LEU A 1 144 ? 7.444   3.507   5.937   1.00 0.47  ? 144 LEU A C    3  
ATOM 8151  O O    . LEU A 1 144 ? 8.310   2.762   6.353   1.00 0.49  ? 144 LEU A O    3  
ATOM 8152  C CB   . LEU A 1 144 ? 6.009   3.107   3.837   1.00 0.49  ? 144 LEU A CB   3  
ATOM 8153  C CG   . LEU A 1 144 ? 7.379   3.245   3.133   1.00 0.64  ? 144 LEU A CG   3  
ATOM 8154  C CD1  . LEU A 1 144 ? 8.145   1.923   3.208   1.00 1.31  ? 144 LEU A CD1  3  
ATOM 8155  C CD2  . LEU A 1 144 ? 7.145   3.611   1.663   1.00 1.01  ? 144 LEU A CD2  3  
ATOM 8156  H H    . LEU A 1 144 ? 4.332   4.159   5.469   1.00 0.46  ? 144 LEU A H    3  
ATOM 8157  H HA   . LEU A 1 144 ? 6.062   1.917   5.672   1.00 0.47  ? 144 LEU A HA   3  
ATOM 8158  H HB2  . LEU A 1 144 ? 5.500   2.244   3.436   1.00 0.76  ? 144 LEU A HB2  3  
ATOM 8159  H HB3  . LEU A 1 144 ? 5.418   3.986   3.622   1.00 0.69  ? 144 LEU A HB3  3  
ATOM 8160  H HG   . LEU A 1 144 ? 7.962   4.027   3.594   1.00 1.31  ? 144 LEU A HG   3  
ATOM 8161  H HD11 . LEU A 1 144 ? 7.486   1.109   2.945   1.00 1.90  ? 144 LEU A HD11 3  
ATOM 8162  H HD12 . LEU A 1 144 ? 8.516   1.778   4.211   1.00 1.80  ? 144 LEU A HD12 3  
ATOM 8163  H HD13 . LEU A 1 144 ? 8.975   1.950   2.517   1.00 1.81  ? 144 LEU A HD13 3  
ATOM 8164  H HD21 . LEU A 1 144 ? 6.517   2.864   1.201   1.00 1.47  ? 144 LEU A HD21 3  
ATOM 8165  H HD22 . LEU A 1 144 ? 8.093   3.655   1.148   1.00 1.62  ? 144 LEU A HD22 3  
ATOM 8166  H HD23 . LEU A 1 144 ? 6.659   4.575   1.605   1.00 1.63  ? 144 LEU A HD23 3  
ATOM 8167  N N    . ARG A 1 145 ? 7.605   4.795   5.949   1.00 0.47  ? 145 ARG A N    3  
ATOM 8168  C CA   . ARG A 1 145 ? 8.866   5.385   6.478   1.00 0.48  ? 145 ARG A CA   3  
ATOM 8169  C C    . ARG A 1 145 ? 9.066   4.991   7.950   1.00 0.49  ? 145 ARG A C    3  
ATOM 8170  O O    . ARG A 1 145 ? 10.176  4.788   8.398   1.00 0.50  ? 145 ARG A O    3  
ATOM 8171  C CB   . ARG A 1 145 ? 8.790   6.911   6.366   1.00 0.49  ? 145 ARG A CB   3  
ATOM 8172  C CG   . ARG A 1 145 ? 10.139  7.524   6.752   1.00 0.69  ? 145 ARG A CG   3  
ATOM 8173  C CD   . ARG A 1 145 ? 10.056  9.052   6.673   1.00 0.68  ? 145 ARG A CD   3  
ATOM 8174  N NE   . ARG A 1 145 ? 11.188  9.646   7.439   1.00 1.56  ? 145 ARG A NE   3  
ATOM 8175  C CZ   . ARG A 1 145 ? 11.497  10.904  7.282   1.00 2.10  ? 145 ARG A CZ   3  
ATOM 8176  N NH1  . ARG A 1 145 ? 10.814  11.647  6.455   1.00 2.12  ? 145 ARG A NH1  3  
ATOM 8177  N NH2  . ARG A 1 145 ? 12.489  11.419  7.955   1.00 3.16  ? 145 ARG A NH2  3  
ATOM 8178  H H    . ARG A 1 145 ? 6.896   5.380   5.607   1.00 0.47  ? 145 ARG A H    3  
ATOM 8179  H HA   . ARG A 1 145 ? 9.711   5.031   5.906   1.00 0.49  ? 145 ARG A HA   3  
ATOM 8180  H HB2  . ARG A 1 145 ? 8.549   7.184   5.349   1.00 0.67  ? 145 ARG A HB2  3  
ATOM 8181  H HB3  . ARG A 1 145 ? 8.024   7.283   7.030   1.00 0.66  ? 145 ARG A HB3  3  
ATOM 8182  H HG2  . ARG A 1 145 ? 10.392  7.231   7.761   1.00 0.93  ? 145 ARG A HG2  3  
ATOM 8183  H HG3  . ARG A 1 145 ? 10.901  7.173   6.073   1.00 0.93  ? 145 ARG A HG3  3  
ATOM 8184  H HD2  . ARG A 1 145 ? 10.117  9.363   5.641   1.00 1.08  ? 145 ARG A HD2  3  
ATOM 8185  H HD3  . ARG A 1 145 ? 9.120   9.387   7.096   1.00 1.24  ? 145 ARG A HD3  3  
ATOM 8186  H HE   . ARG A 1 145 ? 11.702  9.090   8.061   1.00 2.23  ? 145 ARG A HE   3  
ATOM 8187  H HH11 . ARG A 1 145 ? 10.053  11.253  5.940   1.00 1.91  ? 145 ARG A HH11 3  
ATOM 8188  H HH12 . ARG A 1 145 ? 11.051  12.612  6.337   1.00 2.82  ? 145 ARG A HH12 3  
ATOM 8189  H HH21 . ARG A 1 145 ? 13.013  10.850  8.589   1.00 3.67  ? 145 ARG A HH21 3  
ATOM 8190  H HH22 . ARG A 1 145 ? 12.727  12.384  7.836   1.00 3.66  ? 145 ARG A HH22 3  
ATOM 8191  N N    . GLU A 1 146 ? 8.013   4.946   8.723   1.00 0.49  ? 146 GLU A N    3  
ATOM 8192  C CA   . GLU A 1 146 ? 8.173   4.634   10.182  1.00 0.51  ? 146 GLU A CA   3  
ATOM 8193  C C    . GLU A 1 146 ? 8.171   3.124   10.485  1.00 0.53  ? 146 GLU A C    3  
ATOM 8194  O O    . GLU A 1 146 ? 8.978   2.679   11.277  1.00 0.55  ? 146 GLU A O    3  
ATOM 8195  C CB   . GLU A 1 146 ? 7.046   5.305   10.967  1.00 0.52  ? 146 GLU A CB   3  
ATOM 8196  C CG   . GLU A 1 146 ? 7.191   6.824   10.871  1.00 0.96  ? 146 GLU A CG   3  
ATOM 8197  C CD   . GLU A 1 146 ? 8.357   7.281   11.749  1.00 1.48  ? 146 GLU A CD   3  
ATOM 8198  O OE1  . GLU A 1 146 ? 8.195   7.285   12.958  1.00 2.03  ? 146 GLU A OE1  3  
ATOM 8199  O OE2  . GLU A 1 146 ? 9.392   7.617   11.198  1.00 2.22  ? 146 GLU A OE2  3  
ATOM 8200  H H    . GLU A 1 146 ? 7.135   5.178   8.357   1.00 0.49  ? 146 GLU A H    3  
ATOM 8201  H HA   . GLU A 1 146 ? 9.121   5.024   10.520  1.00 0.53  ? 146 GLU A HA   3  
ATOM 8202  H HB2  . GLU A 1 146 ? 6.093   5.007   10.553  1.00 0.95  ? 146 GLU A HB2  3  
ATOM 8203  H HB3  . GLU A 1 146 ? 7.099   5.004   12.002  1.00 0.79  ? 146 GLU A HB3  3  
ATOM 8204  H HG2  . GLU A 1 146 ? 7.380   7.104   9.844   1.00 1.43  ? 146 GLU A HG2  3  
ATOM 8205  H HG3  . GLU A 1 146 ? 6.281   7.295   11.211  1.00 1.69  ? 146 GLU A HG3  3  
ATOM 8206  N N    . ARG A 1 147 ? 7.271   2.332   9.942   1.00 0.59  ? 147 ARG A N    3  
ATOM 8207  C CA   . ARG A 1 147 ? 7.258   0.868   10.321  1.00 0.62  ? 147 ARG A CA   3  
ATOM 8208  C C    . ARG A 1 147 ? 7.910   -0.011  9.246   1.00 0.58  ? 147 ARG A C    3  
ATOM 8209  O O    . ARG A 1 147 ? 8.708   -0.880  9.535   1.00 0.62  ? 147 ARG A O    3  
ATOM 8210  C CB   . ARG A 1 147 ? 5.799   0.416   10.510  1.00 0.63  ? 147 ARG A CB   3  
ATOM 8211  C CG   . ARG A 1 147 ? 5.212   0.986   11.824  1.00 0.73  ? 147 ARG A CG   3  
ATOM 8212  C CD   . ARG A 1 147 ? 4.658   2.413   11.608  1.00 1.11  ? 147 ARG A CD   3  
ATOM 8213  N NE   . ARG A 1 147 ? 5.018   3.286   12.774  1.00 1.75  ? 147 ARG A NE   3  
ATOM 8214  C CZ   . ARG A 1 147 ? 4.854   2.878   14.008  1.00 2.40  ? 147 ARG A CZ   3  
ATOM 8215  N NH1  . ARG A 1 147 ? 4.266   1.741   14.259  1.00 2.71  ? 147 ARG A NH1  3  
ATOM 8216  N NH2  . ARG A 1 147 ? 5.246   3.633   14.997  1.00 3.30  ? 147 ARG A NH2  3  
ATOM 8217  H H    . ARG A 1 147 ? 6.592   2.695   9.337   1.00 0.66  ? 147 ARG A H    3  
ATOM 8218  H HA   . ARG A 1 147 ? 7.776   0.753   11.262  1.00 0.69  ? 147 ARG A HA   3  
ATOM 8219  H HB2  . ARG A 1 147 ? 5.209   0.761   9.674   1.00 0.63  ? 147 ARG A HB2  3  
ATOM 8220  H HB3  . ARG A 1 147 ? 5.765   -0.664  10.547  1.00 0.70  ? 147 ARG A HB3  3  
ATOM 8221  H HG2  . ARG A 1 147 ? 4.413   0.337   12.153  1.00 1.25  ? 147 ARG A HG2  3  
ATOM 8222  H HG3  . ARG A 1 147 ? 5.976   1.013   12.587  1.00 1.20  ? 147 ARG A HG3  3  
ATOM 8223  H HD2  . ARG A 1 147 ? 5.090   2.848   10.724  1.00 1.77  ? 147 ARG A HD2  3  
ATOM 8224  H HD3  . ARG A 1 147 ? 3.580   2.369   11.486  1.00 1.67  ? 147 ARG A HD3  3  
ATOM 8225  H HE   . ARG A 1 147 ? 5.410   4.169   12.609  1.00 2.24  ? 147 ARG A HE   3  
ATOM 8226  H HH11 . ARG A 1 147 ? 3.932   1.176   13.512  1.00 2.53  ? 147 ARG A HH11 3  
ATOM 8227  H HH12 . ARG A 1 147 ? 4.152   1.436   15.204  1.00 3.48  ? 147 ARG A HH12 3  
ATOM 8228  H HH21 . ARG A 1 147 ? 5.670   4.520   14.813  1.00 3.61  ? 147 ARG A HH21 3  
ATOM 8229  H HH22 . ARG A 1 147 ? 5.122   3.325   15.941  1.00 3.89  ? 147 ARG A HH22 3  
ATOM 8230  N N    . LEU A 1 148 ? 7.535   0.183   8.014   1.00 0.53  ? 148 LEU A N    3  
ATOM 8231  C CA   . LEU A 1 148 ? 8.074   -0.658  6.907   1.00 0.57  ? 148 LEU A CA   3  
ATOM 8232  C C    . LEU A 1 148 ? 9.385   -0.088  6.337   1.00 0.67  ? 148 LEU A C    3  
ATOM 8233  O O    . LEU A 1 148 ? 9.659   -0.235  5.166   1.00 1.61  ? 148 LEU A O    3  
ATOM 8234  C CB   . LEU A 1 148 ? 7.000   -0.724  5.775   1.00 0.59  ? 148 LEU A CB   3  
ATOM 8235  C CG   . LEU A 1 148 ? 6.841   -2.172  5.200   1.00 0.70  ? 148 LEU A CG   3  
ATOM 8236  C CD1  . LEU A 1 148 ? 8.215   -2.771  4.838   1.00 1.29  ? 148 LEU A CD1  3  
ATOM 8237  C CD2  . LEU A 1 148 ? 6.176   -3.100  6.239   1.00 1.34  ? 148 LEU A CD2  3  
ATOM 8238  H H    . LEU A 1 148 ? 6.863   0.868   7.813   1.00 0.52  ? 148 LEU A H    3  
ATOM 8239  H HA   . LEU A 1 148 ? 8.232   -1.665  7.232   1.00 0.58  ? 148 LEU A HA   3  
ATOM 8240  H HB2  . LEU A 1 148 ? 6.051   -0.406  6.180   1.00 0.75  ? 148 LEU A HB2  3  
ATOM 8241  H HB3  . LEU A 1 148 ? 7.272   -0.056  4.970   1.00 0.89  ? 148 LEU A HB3  3  
ATOM 8242  H HG   . LEU A 1 148 ? 6.227   -2.132  4.314   1.00 1.45  ? 148 LEU A HG   3  
ATOM 8243  H HD11 . LEU A 1 148 ? 8.762   -2.077  4.224   1.00 1.91  ? 148 LEU A HD11 3  
ATOM 8244  H HD12 . LEU A 1 148 ? 8.059   -3.681  4.278   1.00 1.90  ? 148 LEU A HD12 3  
ATOM 8245  H HD13 . LEU A 1 148 ? 8.781   -3.004  5.720   1.00 1.61  ? 148 LEU A HD13 3  
ATOM 8246  H HD21 . LEU A 1 148 ? 5.766   -3.961  5.733   1.00 1.92  ? 148 LEU A HD21 3  
ATOM 8247  H HD22 . LEU A 1 148 ? 5.380   -2.570  6.739   1.00 1.86  ? 148 LEU A HD22 3  
ATOM 8248  H HD23 . LEU A 1 148 ? 6.900   -3.431  6.970   1.00 1.88  ? 148 LEU A HD23 3  
ATOM 8249  N N    . LEU A 1 149 ? 10.194  0.568   7.130   1.00 0.67  ? 149 LEU A N    3  
ATOM 8250  C CA   . LEU A 1 149 ? 11.477  1.135   6.585   1.00 0.57  ? 149 LEU A CA   3  
ATOM 8251  C C    . LEU A 1 149 ? 12.660  0.282   7.055   1.00 0.56  ? 149 LEU A C    3  
ATOM 8252  O O    . LEU A 1 149 ? 13.402  -0.251  6.257   1.00 0.58  ? 149 LEU A O    3  
ATOM 8253  C CB   . LEU A 1 149 ? 11.637  2.581   7.060   1.00 0.54  ? 149 LEU A CB   3  
ATOM 8254  C CG   . LEU A 1 149 ? 12.791  3.270   6.314   1.00 0.59  ? 149 LEU A CG   3  
ATOM 8255  C CD1  . LEU A 1 149 ? 12.427  3.494   4.832   1.00 0.83  ? 149 LEU A CD1  3  
ATOM 8256  C CD2  . LEU A 1 149 ? 13.071  4.619   6.987   1.00 1.21  ? 149 LEU A CD2  3  
ATOM 8257  H H    . LEU A 1 149 ? 9.962   0.699   8.073   1.00 1.41  ? 149 LEU A H    3  
ATOM 8258  H HA   . LEU A 1 149 ? 11.465  1.102   5.506   1.00 0.58  ? 149 LEU A HA   3  
ATOM 8259  H HB2  . LEU A 1 149 ? 10.719  3.116   6.876   1.00 0.54  ? 149 LEU A HB2  3  
ATOM 8260  H HB3  . LEU A 1 149 ? 11.846  2.586   8.120   1.00 0.61  ? 149 LEU A HB3  3  
ATOM 8261  H HG   . LEU A 1 149 ? 13.674  2.651   6.374   1.00 1.15  ? 149 LEU A HG   3  
ATOM 8262  H HD11 . LEU A 1 149 ? 12.677  2.611   4.263   1.00 1.37  ? 149 LEU A HD11 3  
ATOM 8263  H HD12 . LEU A 1 149 ? 12.985  4.334   4.442   1.00 1.41  ? 149 LEU A HD12 3  
ATOM 8264  H HD13 . LEU A 1 149 ? 11.370  3.694   4.737   1.00 1.52  ? 149 LEU A HD13 3  
ATOM 8265  H HD21 . LEU A 1 149 ? 13.358  4.456   8.015   1.00 1.67  ? 149 LEU A HD21 3  
ATOM 8266  H HD22 . LEU A 1 149 ? 12.179  5.228   6.955   1.00 1.82  ? 149 LEU A HD22 3  
ATOM 8267  H HD23 . LEU A 1 149 ? 13.870  5.123   6.464   1.00 1.75  ? 149 LEU A HD23 3  
ATOM 8268  N N    . GLY A 1 150 ? 12.855  0.151   8.332   1.00 0.56  ? 150 GLY A N    3  
ATOM 8269  C CA   . GLY A 1 150 ? 14.004  -0.663  8.828   1.00 0.58  ? 150 GLY A CA   3  
ATOM 8270  C C    . GLY A 1 150 ? 13.932  -2.093  8.270   1.00 0.62  ? 150 GLY A C    3  
ATOM 8271  O O    . GLY A 1 150 ? 14.941  -2.754  8.108   1.00 0.70  ? 150 GLY A O    3  
ATOM 8272  H H    . GLY A 1 150 ? 12.261  0.596   8.972   1.00 0.56  ? 150 GLY A H    3  
ATOM 8273  H HA2  . GLY A 1 150 ? 14.928  -0.199  8.511   1.00 0.57  ? 150 GLY A HA2  3  
ATOM 8274  H HA3  . GLY A 1 150 ? 13.967  -0.685  9.906   1.00 0.61  ? 150 GLY A HA3  3  
ATOM 8275  N N    . TRP A 1 151 ? 12.754  -2.588  7.991   1.00 0.63  ? 151 TRP A N    3  
ATOM 8276  C CA   . TRP A 1 151 ? 12.632  -3.987  7.467   1.00 0.69  ? 151 TRP A CA   3  
ATOM 8277  C C    . TRP A 1 151 ? 12.827  -4.023  5.943   1.00 0.70  ? 151 TRP A C    3  
ATOM 8278  O O    . TRP A 1 151 ? 13.338  -4.988  5.409   1.00 0.72  ? 151 TRP A O    3  
ATOM 8279  C CB   . TRP A 1 151 ? 11.238  -4.542  7.821   1.00 0.73  ? 151 TRP A CB   3  
ATOM 8280  C CG   . TRP A 1 151 ? 11.260  -5.162  9.185   1.00 1.25  ? 151 TRP A CG   3  
ATOM 8281  C CD1  . TRP A 1 151 ? 11.281  -4.477  10.350  1.00 2.17  ? 151 TRP A CD1  3  
ATOM 8282  C CD2  . TRP A 1 151 ? 11.269  -6.575  9.540   1.00 1.86  ? 151 TRP A CD2  3  
ATOM 8283  N NE1  . TRP A 1 151 ? 11.295  -5.380  11.399  1.00 2.65  ? 151 TRP A NE1  3  
ATOM 8284  C CE2  . TRP A 1 151 ? 11.290  -6.685  10.950  1.00 2.43  ? 151 TRP A CE2  3  
ATOM 8285  C CE3  . TRP A 1 151 ? 11.259  -7.760  8.781   1.00 2.68  ? 151 TRP A CE3  3  
ATOM 8286  C CZ2  . TRP A 1 151 ? 11.300  -7.928  11.586  1.00 3.17  ? 151 TRP A CZ2  3  
ATOM 8287  C CZ3  . TRP A 1 151 ? 11.270  -9.011  9.418   1.00 3.62  ? 151 TRP A CZ3  3  
ATOM 8288  C CH2  . TRP A 1 151 ? 11.291  -9.095  10.817  1.00 3.67  ? 151 TRP A CH2  3  
ATOM 8289  H H    . TRP A 1 151 ? 11.949  -2.049  8.138   1.00 0.64  ? 151 TRP A H    3  
ATOM 8290  H HA   . TRP A 1 151 ? 13.392  -4.605  7.927   1.00 0.73  ? 151 TRP A HA   3  
ATOM 8291  H HB2  . TRP A 1 151 ? 10.519  -3.737  7.808   1.00 0.96  ? 151 TRP A HB2  3  
ATOM 8292  H HB3  . TRP A 1 151 ? 10.946  -5.292  7.097   1.00 0.95  ? 151 TRP A HB3  3  
ATOM 8293  H HD1  . TRP A 1 151 ? 11.284  -3.402  10.445  1.00 2.79  ? 151 TRP A HD1  3  
ATOM 8294  H HE1  . TRP A 1 151 ? 11.309  -5.142  12.349  1.00 3.39  ? 151 TRP A HE1  3  
ATOM 8295  H HE3  . TRP A 1 151 ? 11.243  -7.706  7.703   1.00 2.90  ? 151 TRP A HE3  3  
ATOM 8296  H HZ2  . TRP A 1 151 ? 11.316  -7.987  12.664  1.00 3.65  ? 151 TRP A HZ2  3  
ATOM 8297  H HZ3  . TRP A 1 151 ? 11.263  -9.915  8.826   1.00 4.48  ? 151 TRP A HZ3  3  
ATOM 8298  H HH2  . TRP A 1 151 ? 11.299  -10.061 11.301  1.00 4.40  ? 151 TRP A HH2  3  
ATOM 8299  N N    . ILE A 1 152 ? 12.422  -3.007  5.230   1.00 0.73  ? 152 ILE A N    3  
ATOM 8300  C CA   . ILE A 1 152 ? 12.599  -3.054  3.749   1.00 0.76  ? 152 ILE A CA   3  
ATOM 8301  C C    . ILE A 1 152 ? 14.103  -3.075  3.449   1.00 0.79  ? 152 ILE A C    3  
ATOM 8302  O O    . ILE A 1 152 ? 14.558  -3.651  2.481   1.00 0.89  ? 152 ILE A O    3  
ATOM 8303  C CB   . ILE A 1 152 ? 11.913  -1.825  3.108   1.00 0.78  ? 152 ILE A CB   3  
ATOM 8304  C CG1  . ILE A 1 152 ? 11.401  -2.165  1.705   1.00 0.83  ? 152 ILE A CG1  3  
ATOM 8305  C CG2  . ILE A 1 152 ? 12.885  -0.644  3.021   1.00 0.92  ? 152 ILE A CG2  3  
ATOM 8306  C CD1  . ILE A 1 152 ? 10.621  -0.969  1.153   1.00 0.94  ? 152 ILE A CD1  3  
ATOM 8307  H H    . ILE A 1 152 ? 12.005  -2.233  5.663   1.00 0.74  ? 152 ILE A H    3  
ATOM 8308  H HA   . ILE A 1 152 ? 12.131  -3.962  3.396   1.00 0.76  ? 152 ILE A HA   3  
ATOM 8309  H HB   . ILE A 1 152 ? 11.075  -1.537  3.728   1.00 0.91  ? 152 ILE A HB   3  
ATOM 8310  H HG12 . ILE A 1 152 ? 12.237  -2.384  1.058   1.00 1.01  ? 152 ILE A HG12 3  
ATOM 8311  H HG13 . ILE A 1 152 ? 10.748  -3.023  1.757   1.00 1.14  ? 152 ILE A HG13 3  
ATOM 8312  H HG21 . ILE A 1 152 ? 13.586  -0.824  2.213   1.00 1.31  ? 152 ILE A HG21 3  
ATOM 8313  H HG22 . ILE A 1 152 ? 13.425  -0.550  3.949   1.00 1.41  ? 152 ILE A HG22 3  
ATOM 8314  H HG23 . ILE A 1 152 ? 12.336  0.264   2.826   1.00 1.51  ? 152 ILE A HG23 3  
ATOM 8315  H HD11 . ILE A 1 152 ? 11.307  -0.167  0.923   1.00 1.40  ? 152 ILE A HD11 3  
ATOM 8316  H HD12 . ILE A 1 152 ? 9.908   -0.630  1.892   1.00 1.40  ? 152 ILE A HD12 3  
ATOM 8317  H HD13 . ILE A 1 152 ? 10.097  -1.263  0.256   1.00 1.40  ? 152 ILE A HD13 3  
ATOM 8318  N N    . GLN A 1 153 ? 14.866  -2.449  4.306   1.00 0.77  ? 153 GLN A N    3  
ATOM 8319  C CA   . GLN A 1 153 ? 16.343  -2.415  4.132   1.00 0.80  ? 153 GLN A CA   3  
ATOM 8320  C C    . GLN A 1 153 ? 16.899  -3.815  4.410   1.00 0.81  ? 153 GLN A C    3  
ATOM 8321  O O    . GLN A 1 153 ? 17.738  -4.311  3.686   1.00 0.82  ? 153 GLN A O    3  
ATOM 8322  C CB   . GLN A 1 153 ? 16.953  -1.408  5.128   1.00 0.82  ? 153 GLN A CB   3  
ATOM 8323  C CG   . GLN A 1 153 ? 17.205  -0.044  4.462   1.00 1.09  ? 153 GLN A CG   3  
ATOM 8324  C CD   . GLN A 1 153 ? 17.287  1.037   5.546   1.00 1.98  ? 153 GLN A CD   3  
ATOM 8325  O OE1  . GLN A 1 153 ? 16.289  1.400   6.136   1.00 2.66  ? 153 GLN A OE1  3  
ATOM 8326  N NE2  . GLN A 1 153 ? 18.444  1.569   5.831   1.00 2.77  ? 153 GLN A NE2  3  
ATOM 8327  H H    . GLN A 1 153 ? 14.453  -2.013  5.081   1.00 0.77  ? 153 GLN A H    3  
ATOM 8328  H HA   . GLN A 1 153 ? 16.592  -2.144  3.116   1.00 0.82  ? 153 GLN A HA   3  
ATOM 8329  H HB2  . GLN A 1 153 ? 16.270  -1.281  5.955   1.00 1.30  ? 153 GLN A HB2  3  
ATOM 8330  H HB3  . GLN A 1 153 ? 17.894  -1.789  5.506   1.00 1.06  ? 153 GLN A HB3  3  
ATOM 8331  H HG2  . GLN A 1 153 ? 18.151  -0.064  3.939   1.00 1.37  ? 153 GLN A HG2  3  
ATOM 8332  H HG3  . GLN A 1 153 ? 16.405  0.210   3.782   1.00 1.72  ? 153 GLN A HG3  3  
ATOM 8333  H HE21 . GLN A 1 153 ? 19.249  1.277   5.353   1.00 2.94  ? 153 GLN A HE21 3  
ATOM 8334  H HE22 . GLN A 1 153 ? 18.509  2.260   6.522   1.00 3.53  ? 153 GLN A HE22 3  
ATOM 8335  N N    . ASP A 1 154 ? 16.462  -4.448  5.468   1.00 0.83  ? 154 ASP A N    3  
ATOM 8336  C CA   . ASP A 1 154 ? 17.010  -5.797  5.774   1.00 0.86  ? 154 ASP A CA   3  
ATOM 8337  C C    . ASP A 1 154 ? 16.697  -6.730  4.605   1.00 0.85  ? 154 ASP A C    3  
ATOM 8338  O O    . ASP A 1 154 ? 17.406  -7.681  4.345   1.00 0.94  ? 154 ASP A O    3  
ATOM 8339  C CB   . ASP A 1 154 ? 16.394  -6.333  7.069   1.00 0.90  ? 154 ASP A CB   3  
ATOM 8340  C CG   . ASP A 1 154 ? 16.985  -7.708  7.387   1.00 1.28  ? 154 ASP A CG   3  
ATOM 8341  O OD1  . ASP A 1 154 ? 18.180  -7.873  7.208   1.00 1.84  ? 154 ASP A OD1  3  
ATOM 8342  O OD2  . ASP A 1 154 ? 16.231  -8.572  7.805   1.00 1.99  ? 154 ASP A OD2  3  
ATOM 8343  H H    . ASP A 1 154 ? 15.797  -4.032  6.061   1.00 0.82  ? 154 ASP A H    3  
ATOM 8344  H HA   . ASP A 1 154 ? 18.078  -5.683  5.878   1.00 0.87  ? 154 ASP A HA   3  
ATOM 8345  H HB2  . ASP A 1 154 ? 16.608  -5.651  7.879   1.00 1.24  ? 154 ASP A HB2  3  
ATOM 8346  H HB3  . ASP A 1 154 ? 15.324  -6.422  6.948   1.00 1.20  ? 154 ASP A HB3  3  
ATOM 8347  N N    . GLN A 1 155 ? 15.644  -6.448  3.886   1.00 0.79  ? 155 GLN A N    3  
ATOM 8348  C CA   . GLN A 1 155 ? 15.281  -7.294  2.716   1.00 0.79  ? 155 GLN A CA   3  
ATOM 8349  C C    . GLN A 1 155 ? 16.128  -6.860  1.514   1.00 0.72  ? 155 GLN A C    3  
ATOM 8350  O O    . GLN A 1 155 ? 16.735  -7.666  0.837   1.00 1.03  ? 155 GLN A O    3  
ATOM 8351  C CB   . GLN A 1 155 ? 13.781  -7.106  2.408   1.00 0.90  ? 155 GLN A CB   3  
ATOM 8352  C CG   . GLN A 1 155 ? 13.195  -8.396  1.819   1.00 1.37  ? 155 GLN A CG   3  
ATOM 8353  C CD   . GLN A 1 155 ? 13.043  -9.437  2.930   1.00 2.01  ? 155 GLN A CD   3  
ATOM 8354  O OE1  . GLN A 1 155 ? 12.438  -9.171  3.949   1.00 2.72  ? 155 GLN A OE1  3  
ATOM 8355  N NE2  . GLN A 1 155 ? 13.571  -10.621 2.777   1.00 2.54  ? 155 GLN A NE2  3  
ATOM 8356  H H    . GLN A 1 155 ? 15.096  -5.666  4.106   1.00 0.78  ? 155 GLN A H    3  
ATOM 8357  H HA   . GLN A 1 155 ? 15.482  -8.335  2.931   1.00 0.92  ? 155 GLN A HA   3  
ATOM 8358  H HB2  . GLN A 1 155 ? 13.260  -6.865  3.323   1.00 1.39  ? 155 GLN A HB2  3  
ATOM 8359  H HB3  . GLN A 1 155 ? 13.648  -6.298  1.701   1.00 1.28  ? 155 GLN A HB3  3  
ATOM 8360  H HG2  . GLN A 1 155 ? 12.228  -8.187  1.385   1.00 1.80  ? 155 GLN A HG2  3  
ATOM 8361  H HG3  . GLN A 1 155 ? 13.858  -8.779  1.057   1.00 1.99  ? 155 GLN A HG3  3  
ATOM 8362  H HE21 . GLN A 1 155 ? 14.060  -10.837 1.955   1.00 2.69  ? 155 GLN A HE21 3  
ATOM 8363  H HE22 . GLN A 1 155 ? 13.480  -11.293 3.484   1.00 3.17  ? 155 GLN A HE22 3  
ATOM 8364  N N    . GLY A 1 156 ? 16.168  -5.577  1.257   1.00 0.63  ? 156 GLY A N    3  
ATOM 8365  C CA   . GLY A 1 156 ? 16.969  -5.050  0.113   1.00 0.72  ? 156 GLY A CA   3  
ATOM 8366  C C    . GLY A 1 156 ? 16.274  -3.814  -0.466  1.00 0.87  ? 156 GLY A C    3  
ATOM 8367  O O    . GLY A 1 156 ? 16.888  -2.784  -0.662  1.00 1.38  ? 156 GLY A O    3  
ATOM 8368  H H    . GLY A 1 156 ? 15.666  -4.955  1.822   1.00 0.79  ? 156 GLY A H    3  
ATOM 8369  H HA2  . GLY A 1 156 ? 17.948  -4.758  0.468   1.00 0.89  ? 156 GLY A HA2  3  
ATOM 8370  H HA3  . GLY A 1 156 ? 17.063  -5.803  -0.656  1.00 0.72  ? 156 GLY A HA3  3  
ATOM 8371  N N    . GLY A 1 157 ? 15.005  -3.909  -0.759  1.00 0.81  ? 157 GLY A N    3  
ATOM 8372  C CA   . GLY A 1 157 ? 14.281  -2.746  -1.342  1.00 1.10  ? 157 GLY A CA   3  
ATOM 8373  C C    . GLY A 1 157 ? 13.061  -3.250  -2.123  1.00 0.84  ? 157 GLY A C    3  
ATOM 8374  O O    . GLY A 1 157 ? 12.450  -4.240  -1.773  1.00 0.88  ? 157 GLY A O    3  
ATOM 8375  H H    . GLY A 1 157 ? 14.529  -4.748  -0.616  1.00 0.96  ? 157 GLY A H    3  
ATOM 8376  H HA2  . GLY A 1 157 ? 13.959  -2.086  -0.549  1.00 1.27  ? 157 GLY A HA2  3  
ATOM 8377  H HA3  . GLY A 1 157 ? 14.936  -2.211  -2.014  1.00 1.46  ? 157 GLY A HA3  3  
ATOM 8378  N N    . TRP A 1 158 ? 12.680  -2.538  -3.148  1.00 0.67  ? 158 TRP A N    3  
ATOM 8379  C CA   . TRP A 1 158 ? 11.469  -2.927  -3.933  1.00 0.50  ? 158 TRP A CA   3  
ATOM 8380  C C    . TRP A 1 158 ? 11.746  -4.140  -4.838  1.00 0.51  ? 158 TRP A C    3  
ATOM 8381  O O    . TRP A 1 158 ? 10.833  -4.702  -5.433  1.00 0.53  ? 158 TRP A O    3  
ATOM 8382  C CB   . TRP A 1 158 ? 11.027  -1.740  -4.786  1.00 0.51  ? 158 TRP A CB   3  
ATOM 8383  C CG   . TRP A 1 158 ? 10.766  -0.568  -3.893  1.00 0.46  ? 158 TRP A CG   3  
ATOM 8384  C CD1  . TRP A 1 158 ? 11.697  0.331   -3.502  1.00 0.59  ? 158 TRP A CD1  3  
ATOM 8385  C CD2  . TRP A 1 158 ? 9.513   -0.155  -3.270  1.00 0.46  ? 158 TRP A CD2  3  
ATOM 8386  N NE1  . TRP A 1 158 ? 11.096  1.268   -2.681  1.00 0.55  ? 158 TRP A NE1  3  
ATOM 8387  C CE2  . TRP A 1 158 ? 9.752   1.013   -2.509  1.00 0.47  ? 158 TRP A CE2  3  
ATOM 8388  C CE3  . TRP A 1 158 ? 8.207   -0.674  -3.293  1.00 0.65  ? 158 TRP A CE3  3  
ATOM 8389  C CZ2  . TRP A 1 158 ? 8.732   1.643   -1.795  1.00 0.58  ? 158 TRP A CZ2  3  
ATOM 8390  C CZ3  . TRP A 1 158 ? 7.177   -0.043  -2.575  1.00 0.84  ? 158 TRP A CZ3  3  
ATOM 8391  C CH2  . TRP A 1 158 ? 7.439   1.113   -1.828  1.00 0.78  ? 158 TRP A CH2  3  
ATOM 8392  H H    . TRP A 1 158 ? 13.172  -1.717  -3.361  1.00 0.72  ? 158 TRP A H    3  
ATOM 8393  H HA   . TRP A 1 158 ? 10.677  -3.165  -3.238  1.00 0.48  ? 158 TRP A HA   3  
ATOM 8394  H HB2  . TRP A 1 158 ? 11.806  -1.492  -5.491  1.00 0.68  ? 158 TRP A HB2  3  
ATOM 8395  H HB3  . TRP A 1 158 ? 10.124  -1.996  -5.319  1.00 0.51  ? 158 TRP A HB3  3  
ATOM 8396  H HD1  . TRP A 1 158 ? 12.739  0.319   -3.784  1.00 0.78  ? 158 TRP A HD1  3  
ATOM 8397  H HE1  . TRP A 1 158 ? 11.551  2.027   -2.265  1.00 0.66  ? 158 TRP A HE1  3  
ATOM 8398  H HE3  . TRP A 1 158 ? 7.996   -1.561  -3.865  1.00 0.72  ? 158 TRP A HE3  3  
ATOM 8399  H HZ2  . TRP A 1 158 ? 8.940   2.534   -1.221  1.00 0.60  ? 158 TRP A HZ2  3  
ATOM 8400  H HZ3  . TRP A 1 158 ? 6.177   -0.452  -2.599  1.00 1.06  ? 158 TRP A HZ3  3  
ATOM 8401  H HH2  . TRP A 1 158 ? 6.643   1.594   -1.278  1.00 0.95  ? 158 TRP A HH2  3  
ATOM 8402  N N    . ASP A 1 159 ? 12.968  -4.572  -4.979  1.00 0.50  ? 159 ASP A N    3  
ATOM 8403  C CA   . ASP A 1 159 ? 13.194  -5.741  -5.869  1.00 0.51  ? 159 ASP A CA   3  
ATOM 8404  C C    . ASP A 1 159 ? 12.561  -6.967  -5.209  1.00 0.51  ? 159 ASP A C    3  
ATOM 8405  O O    . ASP A 1 159 ? 12.022  -7.834  -5.868  1.00 0.51  ? 159 ASP A O    3  
ATOM 8406  C CB   . ASP A 1 159 ? 14.695  -5.956  -6.076  1.00 0.54  ? 159 ASP A CB   3  
ATOM 8407  C CG   . ASP A 1 159 ? 15.317  -4.678  -6.643  1.00 1.66  ? 159 ASP A CG   3  
ATOM 8408  O OD1  . ASP A 1 159 ? 15.051  -4.373  -7.794  1.00 2.46  ? 159 ASP A OD1  3  
ATOM 8409  O OD2  . ASP A 1 159 ? 16.047  -4.025  -5.915  1.00 2.37  ? 159 ASP A OD2  3  
ATOM 8410  H H    . ASP A 1 159 ? 13.728  -4.156  -4.521  1.00 0.50  ? 159 ASP A H    3  
ATOM 8411  H HA   . ASP A 1 159 ? 12.712  -5.536  -6.814  1.00 0.51  ? 159 ASP A HA   3  
ATOM 8412  H HB2  . ASP A 1 159 ? 15.158  -6.194  -5.129  1.00 0.94  ? 159 ASP A HB2  3  
ATOM 8413  H HB3  . ASP A 1 159 ? 14.852  -6.769  -6.769  1.00 1.23  ? 159 ASP A HB3  3  
ATOM 8414  N N    . GLY A 1 160 ? 12.612  -7.030  -3.905  1.00 0.52  ? 160 GLY A N    3  
ATOM 8415  C CA   . GLY A 1 160 ? 12.000  -8.182  -3.184  1.00 0.54  ? 160 GLY A CA   3  
ATOM 8416  C C    . GLY A 1 160 ? 10.543  -8.323  -3.623  1.00 0.53  ? 160 GLY A C    3  
ATOM 8417  O O    . GLY A 1 160 ? 9.993   -9.407  -3.638  1.00 0.54  ? 160 GLY A O    3  
ATOM 8418  H H    . GLY A 1 160 ? 13.046  -6.311  -3.400  1.00 0.53  ? 160 GLY A H    3  
ATOM 8419  H HA2  . GLY A 1 160 ? 12.543  -9.085  -3.421  1.00 0.55  ? 160 GLY A HA2  3  
ATOM 8420  H HA3  . GLY A 1 160 ? 12.037  -8.004  -2.121  1.00 0.57  ? 160 GLY A HA3  3  
ATOM 8421  N N    . LEU A 1 161 ? 9.917   -7.245  -4.005  1.00 0.54  ? 161 LEU A N    3  
ATOM 8422  C CA   . LEU A 1 161 ? 8.507   -7.336  -4.466  1.00 0.56  ? 161 LEU A CA   3  
ATOM 8423  C C    . LEU A 1 161 ? 8.475   -8.158  -5.748  1.00 0.56  ? 161 LEU A C    3  
ATOM 8424  O O    . LEU A 1 161 ? 7.822   -9.179  -5.834  1.00 0.62  ? 161 LEU A O    3  
ATOM 8425  C CB   . LEU A 1 161 ? 7.956   -5.904  -4.734  1.00 0.58  ? 161 LEU A CB   3  
ATOM 8426  C CG   . LEU A 1 161 ? 6.843   -5.564  -3.712  1.00 0.74  ? 161 LEU A CG   3  
ATOM 8427  C CD1  . LEU A 1 161 ? 7.462   -5.341  -2.327  1.00 1.63  ? 161 LEU A CD1  3  
ATOM 8428  C CD2  . LEU A 1 161 ? 6.109   -4.297  -4.144  1.00 1.56  ? 161 LEU A CD2  3  
ATOM 8429  H H    . LEU A 1 161 ? 10.381  -6.382  -4.011  1.00 0.54  ? 161 LEU A H    3  
ATOM 8430  H HA   . LEU A 1 161 ? 7.888   -7.762  -3.688  1.00 0.58  ? 161 LEU A HA   3  
ATOM 8431  H HB2  . LEU A 1 161 ? 8.753   -5.191  -4.630  1.00 0.75  ? 161 LEU A HB2  3  
ATOM 8432  H HB3  . LEU A 1 161 ? 7.547   -5.838  -5.733  1.00 0.77  ? 161 LEU A HB3  3  
ATOM 8433  H HG   . LEU A 1 161 ? 6.135   -6.381  -3.660  1.00 1.32  ? 161 LEU A HG   3  
ATOM 8434  H HD11 . LEU A 1 161 ? 7.992   -6.227  -2.014  1.00 2.13  ? 161 LEU A HD11 3  
ATOM 8435  H HD12 . LEU A 1 161 ? 6.680   -5.124  -1.615  1.00 2.24  ? 161 LEU A HD12 3  
ATOM 8436  H HD13 . LEU A 1 161 ? 8.149   -4.510  -2.370  1.00 2.11  ? 161 LEU A HD13 3  
ATOM 8437  H HD21 . LEU A 1 161 ? 6.819   -3.502  -4.287  1.00 2.07  ? 161 LEU A HD21 3  
ATOM 8438  H HD22 . LEU A 1 161 ? 5.401   -4.015  -3.377  1.00 2.01  ? 161 LEU A HD22 3  
ATOM 8439  H HD23 . LEU A 1 161 ? 5.582   -4.483  -5.068  1.00 2.20  ? 161 LEU A HD23 3  
ATOM 8440  N N    . LEU A 1 162 ? 9.198   -7.720  -6.759  1.00 0.53  ? 162 LEU A N    3  
ATOM 8441  C CA   . LEU A 1 162 ? 9.237   -8.467  -8.047  1.00 0.56  ? 162 LEU A CA   3  
ATOM 8442  C C    . LEU A 1 162 ? 9.808   -9.871  -7.802  1.00 0.55  ? 162 LEU A C    3  
ATOM 8443  O O    . LEU A 1 162 ? 9.333   -10.843 -8.355  1.00 0.57  ? 162 LEU A O    3  
ATOM 8444  C CB   . LEU A 1 162 ? 10.155  -7.672  -9.014  1.00 0.61  ? 162 LEU A CB   3  
ATOM 8445  C CG   . LEU A 1 162 ? 9.643   -7.698  -10.466 1.00 0.80  ? 162 LEU A CG   3  
ATOM 8446  C CD1  . LEU A 1 162 ? 9.450   -9.147  -10.934 1.00 1.56  ? 162 LEU A CD1  3  
ATOM 8447  C CD2  . LEU A 1 162 ? 8.329   -6.889  -10.602 1.00 1.33  ? 162 LEU A CD2  3  
ATOM 8448  H H    . LEU A 1 162 ? 9.748   -6.896  -6.715  1.00 0.52  ? 162 LEU A H    3  
ATOM 8449  H HA   . LEU A 1 162 ? 8.250   -8.582  -8.462  1.00 0.58  ? 162 LEU A HA   3  
ATOM 8450  H HB2  . LEU A 1 162 ? 10.196  -6.645  -8.684  1.00 1.09  ? 162 LEU A HB2  3  
ATOM 8451  H HB3  . LEU A 1 162 ? 11.156  -8.083  -8.987  1.00 1.00  ? 162 LEU A HB3  3  
ATOM 8452  H HG   . LEU A 1 162 ? 10.395  -7.238  -11.089 1.00 1.65  ? 162 LEU A HG   3  
ATOM 8453  H HD11 . LEU A 1 162 ? 8.522   -9.535  -10.546 1.00 2.03  ? 162 LEU A HD11 3  
ATOM 8454  H HD12 . LEU A 1 162 ? 10.272  -9.752  -10.582 1.00 2.11  ? 162 LEU A HD12 3  
ATOM 8455  H HD13 . LEU A 1 162 ? 9.425   -9.171  -12.015 1.00 2.11  ? 162 LEU A HD13 3  
ATOM 8456  H HD21 . LEU A 1 162 ? 7.576   -7.479  -11.106 1.00 1.91  ? 162 LEU A HD21 3  
ATOM 8457  H HD22 . LEU A 1 162 ? 8.524   -5.996  -11.184 1.00 1.79  ? 162 LEU A HD22 3  
ATOM 8458  H HD23 . LEU A 1 162 ? 7.963   -6.601  -9.627  1.00 1.84  ? 162 LEU A HD23 3  
ATOM 8459  N N    . SER A 1 163 ? 10.832  -9.989  -7.005  1.00 0.54  ? 163 SER A N    3  
ATOM 8460  C CA   . SER A 1 163 ? 11.421  -11.336 -6.769  1.00 0.56  ? 163 SER A CA   3  
ATOM 8461  C C    . SER A 1 163 ? 10.355  -12.272 -6.192  1.00 0.53  ? 163 SER A C    3  
ATOM 8462  O O    . SER A 1 163 ? 10.368  -13.467 -6.409  1.00 0.60  ? 163 SER A O    3  
ATOM 8463  C CB   . SER A 1 163 ? 12.572  -11.214 -5.774  1.00 0.63  ? 163 SER A CB   3  
ATOM 8464  O OG   . SER A 1 163 ? 13.481  -10.221 -6.231  1.00 1.32  ? 163 SER A OG   3  
ATOM 8465  H H    . SER A 1 163 ? 11.227  -9.197  -6.585  1.00 0.53  ? 163 SER A H    3  
ATOM 8466  H HA   . SER A 1 163 ? 11.810  -11.688 -7.713  1.00 0.62  ? 163 SER A HA   3  
ATOM 8467  H HB2  . SER A 1 163 ? 12.189  -10.930 -4.810  1.00 1.17  ? 163 SER A HB2  3  
ATOM 8468  H HB3  . SER A 1 163 ? 13.076  -12.168 -5.692  1.00 1.37  ? 163 SER A HB3  3  
ATOM 8469  H HG   . SER A 1 163 ? 14.332  -10.387 -5.820  1.00 1.90  ? 163 SER A HG   3  
ATOM 8470  N N    . TYR A 1 164 ? 9.434   -11.719 -5.442  1.00 0.59  ? 164 TYR A N    3  
ATOM 8471  C CA   . TYR A 1 164 ? 8.358   -12.544 -4.821  1.00 0.64  ? 164 TYR A CA   3  
ATOM 8472  C C    . TYR A 1 164 ? 7.271   -12.827 -5.856  1.00 0.63  ? 164 TYR A C    3  
ATOM 8473  O O    . TYR A 1 164 ? 6.696   -13.897 -5.888  1.00 0.68  ? 164 TYR A O    3  
ATOM 8474  C CB   . TYR A 1 164 ? 7.751   -11.772 -3.643  1.00 0.69  ? 164 TYR A CB   3  
ATOM 8475  C CG   . TYR A 1 164 ? 6.624   -12.573 -3.023  1.00 0.72  ? 164 TYR A CG   3  
ATOM 8476  C CD1  . TYR A 1 164 ? 6.898   -13.796 -2.399  1.00 1.34  ? 164 TYR A CD1  3  
ATOM 8477  C CD2  . TYR A 1 164 ? 5.306   -12.091 -3.065  1.00 1.50  ? 164 TYR A CD2  3  
ATOM 8478  C CE1  . TYR A 1 164 ? 5.860   -14.537 -1.820  1.00 1.35  ? 164 TYR A CE1  3  
ATOM 8479  C CE2  . TYR A 1 164 ? 4.269   -12.833 -2.485  1.00 1.57  ? 164 TYR A CE2  3  
ATOM 8480  C CZ   . TYR A 1 164 ? 4.546   -14.056 -1.863  1.00 0.87  ? 164 TYR A CZ   3  
ATOM 8481  O OH   . TYR A 1 164 ? 3.524   -14.787 -1.292  1.00 0.97  ? 164 TYR A OH   3  
ATOM 8482  H H    . TYR A 1 164 ? 9.455   -10.750 -5.289  1.00 0.69  ? 164 TYR A H    3  
ATOM 8483  H HA   . TYR A 1 164 ? 8.773   -13.475 -4.467  1.00 0.71  ? 164 TYR A HA   3  
ATOM 8484  H HB2  . TYR A 1 164 ? 8.516   -11.596 -2.900  1.00 0.77  ? 164 TYR A HB2  3  
ATOM 8485  H HB3  . TYR A 1 164 ? 7.370   -10.824 -3.995  1.00 0.69  ? 164 TYR A HB3  3  
ATOM 8486  H HD1  . TYR A 1 164 ? 7.911   -14.169 -2.365  1.00 2.19  ? 164 TYR A HD1  3  
ATOM 8487  H HD2  . TYR A 1 164 ? 5.091   -11.147 -3.545  1.00 2.34  ? 164 TYR A HD2  3  
ATOM 8488  H HE1  . TYR A 1 164 ? 6.073   -15.481 -1.340  1.00 2.17  ? 164 TYR A HE1  3  
ATOM 8489  H HE2  . TYR A 1 164 ? 3.255   -12.461 -2.516  1.00 2.44  ? 164 TYR A HE2  3  
ATOM 8490  H HH   . TYR A 1 164 ? 2.970   -14.183 -0.793  1.00 1.32  ? 164 TYR A HH   3  
ATOM 8491  N N    . PHE A 1 165 ? 6.980   -11.878 -6.701  1.00 0.64  ? 165 PHE A N    3  
ATOM 8492  C CA   . PHE A 1 165 ? 5.927   -12.100 -7.729  1.00 0.72  ? 165 PHE A CA   3  
ATOM 8493  C C    . PHE A 1 165 ? 6.498   -12.943 -8.875  1.00 0.82  ? 165 PHE A C    3  
ATOM 8494  O O    . PHE A 1 165 ? 6.603   -12.495 -9.999  1.00 1.56  ? 165 PHE A O    3  
ATOM 8495  C CB   . PHE A 1 165 ? 5.428   -10.742 -8.262  1.00 0.74  ? 165 PHE A CB   3  
ATOM 8496  C CG   . PHE A 1 165 ? 4.271   -10.253 -7.415  1.00 0.84  ? 165 PHE A CG   3  
ATOM 8497  C CD1  . PHE A 1 165 ? 3.018   -10.868 -7.531  1.00 1.65  ? 165 PHE A CD1  3  
ATOM 8498  C CD2  . PHE A 1 165 ? 4.450   -9.194  -6.517  1.00 1.42  ? 165 PHE A CD2  3  
ATOM 8499  C CE1  . PHE A 1 165 ? 1.945   -10.425 -6.750  1.00 1.96  ? 165 PHE A CE1  3  
ATOM 8500  C CE2  . PHE A 1 165 ? 3.376   -8.750  -5.736  1.00 1.71  ? 165 PHE A CE2  3  
ATOM 8501  C CZ   . PHE A 1 165 ? 2.123   -9.366  -5.853  1.00 1.66  ? 165 PHE A CZ   3  
ATOM 8502  H H    . PHE A 1 165 ? 7.452   -11.020 -6.657  1.00 0.65  ? 165 PHE A H    3  
ATOM 8503  H HA   . PHE A 1 165 ? 5.102   -12.641 -7.282  1.00 0.80  ? 165 PHE A HA   3  
ATOM 8504  H HB2  . PHE A 1 165 ? 6.234   -10.024 -8.219  1.00 0.84  ? 165 PHE A HB2  3  
ATOM 8505  H HB3  . PHE A 1 165 ? 5.096   -10.846 -9.286  1.00 0.97  ? 165 PHE A HB3  3  
ATOM 8506  H HD1  . PHE A 1 165 ? 2.880   -11.686 -8.223  1.00 2.37  ? 165 PHE A HD1  3  
ATOM 8507  H HD2  . PHE A 1 165 ? 5.415   -8.719  -6.428  1.00 2.11  ? 165 PHE A HD2  3  
ATOM 8508  H HE1  . PHE A 1 165 ? 0.979   -10.900 -6.840  1.00 2.78  ? 165 PHE A HE1  3  
ATOM 8509  H HE2  . PHE A 1 165 ? 3.513   -7.934  -5.044  1.00 2.44  ? 165 PHE A HE2  3  
ATOM 8510  H HZ   . PHE A 1 165 ? 1.295   -9.024  -5.250  1.00 2.03  ? 165 PHE A HZ   3  
ATOM 8511  N N    . GLY A 1 166 ? 6.885   -14.158 -8.592  1.00 0.94  ? 166 GLY A N    3  
ATOM 8512  C CA   . GLY A 1 166 ? 7.463   -15.031 -9.656  1.00 1.01  ? 166 GLY A CA   3  
ATOM 8513  C C    . GLY A 1 166 ? 7.080   -16.488 -9.392  1.00 1.23  ? 166 GLY A C    3  
ATOM 8514  O O    . GLY A 1 166 ? 7.888   -17.384 -9.543  1.00 1.85  ? 166 GLY A O    3  
ATOM 8515  H H    . GLY A 1 166 ? 6.804   -14.495 -7.675  1.00 1.51  ? 166 GLY A H    3  
ATOM 8516  H HA2  . GLY A 1 166 ? 7.083   -14.730 -10.624 1.00 1.22  ? 166 GLY A HA2  3  
ATOM 8517  H HA3  . GLY A 1 166 ? 8.539   -14.941 -9.649  1.00 1.28  ? 166 GLY A HA3  3  
ATOM 8518  N N    . THR A 1 167 ? 5.849   -16.732 -9.000  1.00 1.51  ? 167 THR A N    3  
ATOM 8519  C CA   . THR A 1 167 ? 5.393   -18.135 -8.723  1.00 2.01  ? 167 THR A CA   3  
ATOM 8520  C C    . THR A 1 167 ? 4.082   -18.401 -9.502  1.00 1.65  ? 167 THR A C    3  
ATOM 8521  O O    . THR A 1 167 ? 3.214   -17.551 -9.505  1.00 2.06  ? 167 THR A O    3  
ATOM 8522  C CB   . THR A 1 167 ? 5.123   -18.286 -7.224  1.00 3.10  ? 167 THR A CB   3  
ATOM 8523  O OG1  . THR A 1 167 ? 4.103   -17.378 -6.831  1.00 3.65  ? 167 THR A OG1  3  
ATOM 8524  C CG2  . THR A 1 167 ? 6.404   -17.988 -6.444  1.00 3.92  ? 167 THR A CG2  3  
ATOM 8525  H H    . THR A 1 167 ? 5.221   -15.989 -8.889  1.00 1.82  ? 167 THR A H    3  
ATOM 8526  H HA   . THR A 1 167 ? 6.162   -18.825 -9.013  1.00 2.49  ? 167 THR A HA   3  
ATOM 8527  H HB   . THR A 1 167 ? 4.806   -19.296 -7.015  1.00 3.48  ? 167 THR A HB   3  
ATOM 8528  H HG1  . THR A 1 167 ? 4.162   -16.602 -7.393  1.00 3.86  ? 167 THR A HG1  3  
ATOM 8529  H HG21 . THR A 1 167 ? 6.696   -16.962 -6.609  1.00 4.12  ? 167 THR A HG21 3  
ATOM 8530  H HG22 . THR A 1 167 ? 7.192   -18.646 -6.782  1.00 4.41  ? 167 THR A HG22 3  
ATOM 8531  H HG23 . THR A 1 167 ? 6.230   -18.148 -5.390  1.00 4.29  ? 167 THR A HG23 3  
ATOM 8532  N N    . PRO A 1 168 ? 3.947   -19.557 -10.143 1.00 1.84  ? 168 PRO A N    3  
ATOM 8533  C CA   . PRO A 1 168 ? 2.714   -19.868 -10.899 1.00 2.36  ? 168 PRO A CA   3  
ATOM 8534  C C    . PRO A 1 168 ? 1.500   -19.886 -9.956  1.00 1.79  ? 168 PRO A C    3  
ATOM 8535  O O    . PRO A 1 168 ? 1.623   -19.705 -8.761  1.00 2.00  ? 168 PRO A O    3  
ATOM 8536  C CB   . PRO A 1 168 ? 2.961   -21.267 -11.514 1.00 3.35  ? 168 PRO A CB   3  
ATOM 8537  C CG   . PRO A 1 168 ? 4.333   -21.774 -10.986 1.00 3.48  ? 168 PRO A CG   3  
ATOM 8538  C CD   . PRO A 1 168 ? 4.974   -20.627 -10.177 1.00 2.53  ? 168 PRO A CD   3  
ATOM 8539  H HA   . PRO A 1 168 ? 2.565   -19.140 -11.682 1.00 2.91  ? 168 PRO A HA   3  
ATOM 8540  H HB2  . PRO A 1 168 ? 2.173   -21.954 -11.221 1.00 3.53  ? 168 PRO A HB2  3  
ATOM 8541  H HB3  . PRO A 1 168 ? 2.992   -21.196 -12.593 1.00 4.09  ? 168 PRO A HB3  3  
ATOM 8542  H HG2  . PRO A 1 168 ? 4.186   -22.640 -10.351 1.00 3.88  ? 168 PRO A HG2  3  
ATOM 8543  H HG3  . PRO A 1 168 ? 4.975   -22.039 -11.816 1.00 4.15  ? 168 PRO A HG3  3  
ATOM 8544  H HD2  . PRO A 1 168 ? 5.212   -20.955 -9.173  1.00 2.65  ? 168 PRO A HD2  3  
ATOM 8545  H HD3  . PRO A 1 168 ? 5.862   -20.272 -10.681 1.00 2.71  ? 168 PRO A HD3  3  
ATOM 8546  N N    . THR A 1 169 ? 0.332   -20.117 -10.494 1.00 1.73  ? 169 THR A N    3  
ATOM 8547  C CA   . THR A 1 169 ? -0.894  -20.162 -9.646  1.00 1.33  ? 169 THR A CA   3  
ATOM 8548  C C    . THR A 1 169 ? -0.976  -18.903 -8.781  1.00 1.05  ? 169 THR A C    3  
ATOM 8549  O O    . THR A 1 169 ? -0.659  -18.923 -7.608  1.00 1.06  ? 169 THR A O    3  
ATOM 8550  C CB   . THR A 1 169 ? -0.841  -21.400 -8.748  1.00 1.53  ? 169 THR A CB   3  
ATOM 8551  O OG1  . THR A 1 169 ? -0.542  -22.542 -9.538  1.00 1.94  ? 169 THR A OG1  3  
ATOM 8552  C CG2  . THR A 1 169 ? -2.193  -21.593 -8.059  1.00 2.40  ? 169 THR A CG2  3  
ATOM 8553  H H    . THR A 1 169 ? 0.261   -20.268 -11.460 1.00 2.32  ? 169 THR A H    3  
ATOM 8554  H HA   . THR A 1 169 ? -1.766  -20.218 -10.281 1.00 1.48  ? 169 THR A HA   3  
ATOM 8555  H HB   . THR A 1 169 ? -0.075  -21.269 -7.999  1.00 1.70  ? 169 THR A HB   3  
ATOM 8556  H HG1  . THR A 1 169 ? -1.188  -23.222 -9.333  1.00 2.25  ? 169 THR A HG1  3  
ATOM 8557  H HG21 . THR A 1 169 ? -2.967  -21.692 -8.806  1.00 2.77  ? 169 THR A HG21 3  
ATOM 8558  H HG22 . THR A 1 169 ? -2.404  -20.738 -7.434  1.00 2.87  ? 169 THR A HG22 3  
ATOM 8559  H HG23 . THR A 1 169 ? -2.163  -22.485 -7.451  1.00 2.91  ? 169 THR A HG23 3  
ATOM 8560  N N    . TRP A 1 170 ? -1.407  -17.810 -9.348  1.00 1.04  ? 170 TRP A N    3  
ATOM 8561  C CA   . TRP A 1 170 ? -1.516  -16.552 -8.556  1.00 1.01  ? 170 TRP A CA   3  
ATOM 8562  C C    . TRP A 1 170 ? -2.791  -16.592 -7.711  1.00 0.92  ? 170 TRP A C    3  
ATOM 8563  O O    . TRP A 1 170 ? -3.045  -15.714 -6.910  1.00 0.95  ? 170 TRP A O    3  
ATOM 8564  C CB   . TRP A 1 170 ? -1.572  -15.354 -9.507  1.00 1.32  ? 170 TRP A CB   3  
ATOM 8565  C CG   . TRP A 1 170 ? -0.422  -15.421 -10.461 1.00 1.70  ? 170 TRP A CG   3  
ATOM 8566  C CD1  . TRP A 1 170 ? 0.880   -15.504 -10.104 1.00 2.30  ? 170 TRP A CD1  3  
ATOM 8567  C CD2  . TRP A 1 170 ? -0.447  -15.411 -11.918 1.00 2.52  ? 170 TRP A CD2  3  
ATOM 8568  N NE1  . TRP A 1 170 ? 1.656   -15.546 -11.248 1.00 3.04  ? 170 TRP A NE1  3  
ATOM 8569  C CE2  . TRP A 1 170 ? 0.884   -15.492 -12.392 1.00 3.15  ? 170 TRP A CE2  3  
ATOM 8570  C CE3  . TRP A 1 170 ? -1.485  -15.342 -12.865 1.00 3.32  ? 170 TRP A CE3  3  
ATOM 8571  C CZ2  . TRP A 1 170 ? 1.175   -15.502 -13.756 1.00 4.11  ? 170 TRP A CZ2  3  
ATOM 8572  C CZ3  . TRP A 1 170 ? -1.195  -15.352 -14.240 1.00 4.37  ? 170 TRP A CZ3  3  
ATOM 8573  C CH2  . TRP A 1 170 ? 0.132   -15.432 -14.684 1.00 4.64  ? 170 TRP A CH2  3  
ATOM 8574  H H    . TRP A 1 170 ? -1.662  -17.816 -10.294 1.00 1.23  ? 170 TRP A H    3  
ATOM 8575  H HA   . TRP A 1 170 ? -0.657  -16.458 -7.908  1.00 1.04  ? 170 TRP A HA   3  
ATOM 8576  H HB2  . TRP A 1 170 ? -2.500  -15.376 -10.059 1.00 1.55  ? 170 TRP A HB2  3  
ATOM 8577  H HB3  . TRP A 1 170 ? -1.514  -14.439 -8.937  1.00 1.86  ? 170 TRP A HB3  3  
ATOM 8578  H HD1  . TRP A 1 170 ? 1.253   -15.533 -9.090  1.00 2.68  ? 170 TRP A HD1  3  
ATOM 8579  H HE1  . TRP A 1 170 ? 2.634   -15.607 -11.266 1.00 3.72  ? 170 TRP A HE1  3  
ATOM 8580  H HE3  . TRP A 1 170 ? -2.511  -15.280 -12.534 1.00 3.40  ? 170 TRP A HE3  3  
ATOM 8581  H HZ2  . TRP A 1 170 ? 2.199   -15.564 -14.093 1.00 4.68  ? 170 TRP A HZ2  3  
ATOM 8582  H HZ3  . TRP A 1 170 ? -1.999  -15.298 -14.958 1.00 5.15  ? 170 TRP A HZ3  3  
ATOM 8583  H HH2  . TRP A 1 170 ? 0.349   -15.440 -15.742 1.00 5.49  ? 170 TRP A HH2  3  
ATOM 8584  N N    . GLN A 1 171 ? -3.596  -17.605 -7.883  1.00 0.88  ? 171 GLN A N    3  
ATOM 8585  C CA   . GLN A 1 171 ? -4.855  -17.702 -7.090  1.00 0.84  ? 171 GLN A CA   3  
ATOM 8586  C C    . GLN A 1 171 ? -4.517  -17.814 -5.600  1.00 0.75  ? 171 GLN A C    3  
ATOM 8587  O O    . GLN A 1 171 ? -5.328  -17.502 -4.751  1.00 0.75  ? 171 GLN A O    3  
ATOM 8588  C CB   . GLN A 1 171 ? -5.645  -18.935 -7.540  1.00 0.88  ? 171 GLN A CB   3  
ATOM 8589  C CG   . GLN A 1 171 ? -7.024  -18.936 -6.878  1.00 1.57  ? 171 GLN A CG   3  
ATOM 8590  C CD   . GLN A 1 171 ? -7.831  -20.133 -7.385  1.00 1.93  ? 171 GLN A CD   3  
ATOM 8591  O OE1  . GLN A 1 171 ? -8.102  -20.242 -8.564  1.00 2.66  ? 171 GLN A OE1  3  
ATOM 8592  N NE2  . GLN A 1 171 ? -8.227  -21.043 -6.538  1.00 2.34  ? 171 GLN A NE2  3  
ATOM 8593  H H    . GLN A 1 171 ? -3.373  -18.302 -8.534  1.00 0.92  ? 171 GLN A H    3  
ATOM 8594  H HA   . GLN A 1 171 ? -5.449  -16.814 -7.245  1.00 0.90  ? 171 GLN A HA   3  
ATOM 8595  H HB2  . GLN A 1 171 ? -5.762  -18.914 -8.614  1.00 1.24  ? 171 GLN A HB2  3  
ATOM 8596  H HB3  . GLN A 1 171 ? -5.110  -19.828 -7.254  1.00 1.30  ? 171 GLN A HB3  3  
ATOM 8597  H HG2  . GLN A 1 171 ? -6.908  -19.006 -5.806  1.00 2.31  ? 171 GLN A HG2  3  
ATOM 8598  H HG3  . GLN A 1 171 ? -7.543  -18.023 -7.126  1.00 2.11  ? 171 GLN A HG3  3  
ATOM 8599  H HE21 . GLN A 1 171 ? -8.008  -20.956 -5.587  1.00 2.50  ? 171 GLN A HE21 3  
ATOM 8600  H HE22 . GLN A 1 171 ? -8.744  -21.814 -6.853  1.00 2.93  ? 171 GLN A HE22 3  
ATOM 8601  N N    . THR A 1 172 ? -3.326  -18.236 -5.268  1.00 0.67  ? 172 THR A N    3  
ATOM 8602  C CA   . THR A 1 172 ? -2.955  -18.336 -3.824  1.00 0.60  ? 172 THR A CA   3  
ATOM 8603  C C    . THR A 1 172 ? -2.591  -16.932 -3.314  1.00 0.59  ? 172 THR A C    3  
ATOM 8604  O O    . THR A 1 172 ? -2.678  -16.655 -2.133  1.00 0.74  ? 172 THR A O    3  
ATOM 8605  C CB   . THR A 1 172 ? -1.755  -19.287 -3.662  1.00 0.59  ? 172 THR A CB   3  
ATOM 8606  O OG1  . THR A 1 172 ? -2.203  -20.631 -3.766  1.00 0.81  ? 172 THR A OG1  3  
ATOM 8607  C CG2  . THR A 1 172 ? -1.102  -19.069 -2.291  1.00 0.92  ? 172 THR A CG2  3  
ATOM 8608  H H    . THR A 1 172 ? -2.677  -18.472 -5.963  1.00 0.67  ? 172 THR A H    3  
ATOM 8609  H HA   . THR A 1 172 ? -3.796  -18.716 -3.262  1.00 0.60  ? 172 THR A HA   3  
ATOM 8610  H HB   . THR A 1 172 ? -1.032  -19.088 -4.437  1.00 0.71  ? 172 THR A HB   3  
ATOM 8611  H HG1  . THR A 1 172 ? -2.115  -20.904 -4.682  1.00 1.37  ? 172 THR A HG1  3  
ATOM 8612  H HG21 . THR A 1 172 ? -1.870  -18.983 -1.536  1.00 1.44  ? 172 THR A HG21 3  
ATOM 8613  H HG22 . THR A 1 172 ? -0.514  -18.163 -2.312  1.00 1.31  ? 172 THR A HG22 3  
ATOM 8614  H HG23 . THR A 1 172 ? -0.463  -19.908 -2.061  1.00 1.56  ? 172 THR A HG23 3  
ATOM 8615  N N    . VAL A 1 173 ? -2.215  -16.037 -4.182  1.00 0.59  ? 173 VAL A N    3  
ATOM 8616  C CA   . VAL A 1 173 ? -1.877  -14.657 -3.731  1.00 0.58  ? 173 VAL A CA   3  
ATOM 8617  C C    . VAL A 1 173 ? -3.166  -13.837 -3.648  1.00 0.57  ? 173 VAL A C    3  
ATOM 8618  O O    . VAL A 1 173 ? -3.329  -13.019 -2.764  1.00 0.60  ? 173 VAL A O    3  
ATOM 8619  C CB   . VAL A 1 173 ? -0.913  -14.023 -4.740  1.00 0.64  ? 173 VAL A CB   3  
ATOM 8620  C CG1  . VAL A 1 173 ? -0.740  -12.533 -4.437  1.00 1.13  ? 173 VAL A CG1  3  
ATOM 8621  C CG2  . VAL A 1 173 ? 0.447   -14.721 -4.646  1.00 1.01  ? 173 VAL A CG2  3  
ATOM 8622  H H    . VAL A 1 173 ? -2.180  -16.249 -5.138  1.00 0.73  ? 173 VAL A H    3  
ATOM 8623  H HA   . VAL A 1 173 ? -1.421  -14.669 -2.751  1.00 0.56  ? 173 VAL A HA   3  
ATOM 8624  H HB   . VAL A 1 173 ? -1.310  -14.142 -5.738  1.00 0.89  ? 173 VAL A HB   3  
ATOM 8625  H HG11 . VAL A 1 173 ? 0.096   -12.146 -5.001  1.00 1.56  ? 173 VAL A HG11 3  
ATOM 8626  H HG12 . VAL A 1 173 ? -0.554  -12.400 -3.381  1.00 1.64  ? 173 VAL A HG12 3  
ATOM 8627  H HG13 . VAL A 1 173 ? -1.638  -12.002 -4.714  1.00 1.50  ? 173 VAL A HG13 3  
ATOM 8628  H HG21 . VAL A 1 173 ? 1.123   -14.290 -5.369  1.00 1.60  ? 173 VAL A HG21 3  
ATOM 8629  H HG22 . VAL A 1 173 ? 0.326   -15.775 -4.849  1.00 1.51  ? 173 VAL A HG22 3  
ATOM 8630  H HG23 . VAL A 1 173 ? 0.850   -14.591 -3.652  1.00 1.54  ? 173 VAL A HG23 3  
ATOM 8631  N N    . THR A 1 174 ? -4.093  -14.057 -4.532  1.00 0.55  ? 174 THR A N    3  
ATOM 8632  C CA   . THR A 1 174 ? -5.369  -13.293 -4.456  1.00 0.56  ? 174 THR A CA   3  
ATOM 8633  C C    . THR A 1 174 ? -6.069  -13.653 -3.141  1.00 0.53  ? 174 THR A C    3  
ATOM 8634  O O    . THR A 1 174 ? -6.684  -12.818 -2.508  1.00 0.55  ? 174 THR A O    3  
ATOM 8635  C CB   . THR A 1 174 ? -6.263  -13.681 -5.636  1.00 0.59  ? 174 THR A CB   3  
ATOM 8636  O OG1  . THR A 1 174 ? -6.300  -15.097 -5.752  1.00 1.37  ? 174 THR A OG1  3  
ATOM 8637  C CG2  . THR A 1 174 ? -5.702  -13.077 -6.924  1.00 1.27  ? 174 THR A CG2  3  
ATOM 8638  H H    . THR A 1 174 ? -3.960  -14.732 -5.229  1.00 0.55  ? 174 THR A H    3  
ATOM 8639  H HA   . THR A 1 174 ? -5.163  -12.234 -4.484  1.00 0.59  ? 174 THR A HA   3  
ATOM 8640  H HB   . THR A 1 174 ? -7.261  -13.306 -5.471  1.00 1.03  ? 174 THR A HB   3  
ATOM 8641  H HG1  . THR A 1 174 ? -7.216  -15.362 -5.862  1.00 1.79  ? 174 THR A HG1  3  
ATOM 8642  H HG21 . THR A 1 174 ? -6.298  -13.401 -7.763  1.00 1.81  ? 174 THR A HG21 3  
ATOM 8643  H HG22 . THR A 1 174 ? -4.681  -13.403 -7.059  1.00 1.83  ? 174 THR A HG22 3  
ATOM 8644  H HG23 . THR A 1 174 ? -5.729  -11.999 -6.857  1.00 1.84  ? 174 THR A HG23 3  
ATOM 8645  N N    . ILE A 1 175 ? -5.981  -14.886 -2.728  1.00 0.51  ? 175 ILE A N    3  
ATOM 8646  C CA   . ILE A 1 175 ? -6.641  -15.305 -1.455  1.00 0.50  ? 175 ILE A CA   3  
ATOM 8647  C C    . ILE A 1 175 ? -5.770  -14.877 -0.268  1.00 0.49  ? 175 ILE A C    3  
ATOM 8648  O O    . ILE A 1 175 ? -6.230  -14.782 0.853   1.00 0.49  ? 175 ILE A O    3  
ATOM 8649  C CB   . ILE A 1 175 ? -6.772  -16.828 -1.468  1.00 0.52  ? 175 ILE A CB   3  
ATOM 8650  C CG1  . ILE A 1 175 ? -7.666  -17.253 -2.633  1.00 0.77  ? 175 ILE A CG1  3  
ATOM 8651  C CG2  . ILE A 1 175 ? -7.370  -17.341 -0.155  1.00 0.87  ? 175 ILE A CG2  3  
ATOM 8652  C CD1  . ILE A 1 175 ? -7.553  -18.766 -2.825  1.00 0.89  ? 175 ILE A CD1  3  
ATOM 8653  H H    . ILE A 1 175 ? -5.483  -15.543 -3.258  1.00 0.51  ? 175 ILE A H    3  
ATOM 8654  H HA   . ILE A 1 175 ? -7.621  -14.855 -1.400  1.00 0.51  ? 175 ILE A HA   3  
ATOM 8655  H HB   . ILE A 1 175 ? -5.792  -17.263 -1.599  1.00 0.69  ? 175 ILE A HB   3  
ATOM 8656  H HG12 . ILE A 1 175 ? -8.692  -16.990 -2.417  1.00 1.10  ? 175 ILE A HG12 3  
ATOM 8657  H HG13 . ILE A 1 175 ? -7.346  -16.753 -3.535  1.00 1.20  ? 175 ILE A HG13 3  
ATOM 8658  H HG21 . ILE A 1 175 ? -7.575  -18.398 -0.239  1.00 1.33  ? 175 ILE A HG21 3  
ATOM 8659  H HG22 . ILE A 1 175 ? -8.289  -16.812 0.052   1.00 1.36  ? 175 ILE A HG22 3  
ATOM 8660  H HG23 . ILE A 1 175 ? -6.670  -17.173 0.651   1.00 1.53  ? 175 ILE A HG23 3  
ATOM 8661  H HD11 . ILE A 1 175 ? -8.179  -19.074 -3.648  1.00 1.52  ? 175 ILE A HD11 3  
ATOM 8662  H HD12 . ILE A 1 175 ? -7.871  -19.267 -1.923  1.00 1.28  ? 175 ILE A HD12 3  
ATOM 8663  H HD13 . ILE A 1 175 ? -6.525  -19.026 -3.037  1.00 1.40  ? 175 ILE A HD13 3  
ATOM 8664  N N    . PHE A 1 176 ? -4.518  -14.604 -0.515  1.00 0.48  ? 176 PHE A N    3  
ATOM 8665  C CA   . PHE A 1 176 ? -3.605  -14.165 0.582   1.00 0.49  ? 176 PHE A CA   3  
ATOM 8666  C C    . PHE A 1 176 ? -3.962  -12.733 1.003   1.00 0.49  ? 176 PHE A C    3  
ATOM 8667  O O    . PHE A 1 176 ? -4.300  -12.484 2.143   1.00 0.56  ? 176 PHE A O    3  
ATOM 8668  C CB   . PHE A 1 176 ? -2.168  -14.186 0.054   1.00 0.51  ? 176 PHE A CB   3  
ATOM 8669  C CG   . PHE A 1 176 ? -1.205  -13.973 1.195   1.00 0.51  ? 176 PHE A CG   3  
ATOM 8670  C CD1  . PHE A 1 176 ? -0.727  -15.070 1.922   1.00 1.41  ? 176 PHE A CD1  3  
ATOM 8671  C CD2  . PHE A 1 176 ? -0.786  -12.679 1.523   1.00 1.23  ? 176 PHE A CD2  3  
ATOM 8672  C CE1  . PHE A 1 176 ? 0.169   -14.871 2.979   1.00 1.52  ? 176 PHE A CE1  3  
ATOM 8673  C CE2  . PHE A 1 176 ? 0.110   -12.480 2.580   1.00 1.22  ? 176 PHE A CE2  3  
ATOM 8674  C CZ   . PHE A 1 176 ? 0.587   -13.576 3.308   1.00 0.76  ? 176 PHE A CZ   3  
ATOM 8675  H H    . PHE A 1 176 ? -4.174  -14.678 -1.432  1.00 0.49  ? 176 PHE A H    3  
ATOM 8676  H HA   . PHE A 1 176 ? -3.681  -14.839 1.422   1.00 0.49  ? 176 PHE A HA   3  
ATOM 8677  H HB2  . PHE A 1 176 ? -1.971  -15.141 -0.410  1.00 0.60  ? 176 PHE A HB2  3  
ATOM 8678  H HB3  . PHE A 1 176 ? -2.041  -13.399 -0.675  1.00 0.54  ? 176 PHE A HB3  3  
ATOM 8679  H HD1  . PHE A 1 176 ? -1.050  -16.068 1.668   1.00 2.26  ? 176 PHE A HD1  3  
ATOM 8680  H HD2  . PHE A 1 176 ? -1.155  -11.833 0.962   1.00 2.12  ? 176 PHE A HD2  3  
ATOM 8681  H HE1  . PHE A 1 176 ? 0.538   -15.717 3.540   1.00 2.43  ? 176 PHE A HE1  3  
ATOM 8682  H HE2  . PHE A 1 176 ? 0.434   -11.482 2.832   1.00 2.05  ? 176 PHE A HE2  3  
ATOM 8683  H HZ   . PHE A 1 176 ? 1.279   -13.423 4.123   1.00 0.89  ? 176 PHE A HZ   3  
ATOM 8684  N N    . VAL A 1 177 ? -3.858  -11.786 0.112   1.00 0.46  ? 177 VAL A N    3  
ATOM 8685  C CA   . VAL A 1 177 ? -4.158  -10.371 0.490   1.00 0.48  ? 177 VAL A CA   3  
ATOM 8686  C C    . VAL A 1 177 ? -5.669  -10.149 0.613   1.00 0.44  ? 177 VAL A C    3  
ATOM 8687  O O    . VAL A 1 177 ? -6.117  -9.367  1.429   1.00 0.57  ? 177 VAL A O    3  
ATOM 8688  C CB   . VAL A 1 177 ? -3.601  -9.434  -0.584  1.00 0.56  ? 177 VAL A CB   3  
ATOM 8689  C CG1  . VAL A 1 177 ? -2.084  -9.608  -0.684  1.00 1.20  ? 177 VAL A CG1  3  
ATOM 8690  C CG2  . VAL A 1 177 ? -4.242  -9.772  -1.932  1.00 1.24  ? 177 VAL A CG2  3  
ATOM 8691  H H    . VAL A 1 177 ? -3.559  -11.998 -0.797  1.00 0.46  ? 177 VAL A H    3  
ATOM 8692  H HA   . VAL A 1 177 ? -3.686  -10.146 1.434   1.00 0.50  ? 177 VAL A HA   3  
ATOM 8693  H HB   . VAL A 1 177 ? -3.829  -8.411  -0.322  1.00 1.10  ? 177 VAL A HB   3  
ATOM 8694  H HG11 . VAL A 1 177 ? -1.856  -10.624 -0.972  1.00 1.82  ? 177 VAL A HG11 3  
ATOM 8695  H HG12 . VAL A 1 177 ? -1.632  -9.396  0.274   1.00 1.81  ? 177 VAL A HG12 3  
ATOM 8696  H HG13 . VAL A 1 177 ? -1.691  -8.928  -1.425  1.00 1.63  ? 177 VAL A HG13 3  
ATOM 8697  H HG21 . VAL A 1 177 ? -3.754  -9.209  -2.714  1.00 1.77  ? 177 VAL A HG21 3  
ATOM 8698  H HG22 . VAL A 1 177 ? -5.291  -9.517  -1.906  1.00 1.78  ? 177 VAL A HG22 3  
ATOM 8699  H HG23 . VAL A 1 177 ? -4.133  -10.829 -2.127  1.00 1.80  ? 177 VAL A HG23 3  
ATOM 8700  N N    . ALA A 1 178 ? -6.461  -10.816 -0.176  1.00 0.45  ? 178 ALA A N    3  
ATOM 8701  C CA   . ALA A 1 178 ? -7.936  -10.616 -0.078  1.00 0.43  ? 178 ALA A CA   3  
ATOM 8702  C C    . ALA A 1 178 ? -8.460  -11.228 1.225   1.00 0.40  ? 178 ALA A C    3  
ATOM 8703  O O    . ALA A 1 178 ? -9.124  -10.576 2.005   1.00 0.40  ? 178 ALA A O    3  
ATOM 8704  C CB   . ALA A 1 178 ? -8.624  -11.293 -1.263  1.00 0.46  ? 178 ALA A CB   3  
ATOM 8705  H H    . ALA A 1 178 ? -6.091  -11.443 -0.831  1.00 0.59  ? 178 ALA A H    3  
ATOM 8706  H HA   . ALA A 1 178 ? -8.158  -9.559  -0.093  1.00 0.44  ? 178 ALA A HA   3  
ATOM 8707  H HB1  . ALA A 1 178 ? -8.141  -10.991 -2.180  1.00 0.98  ? 178 ALA A HB1  3  
ATOM 8708  H HB2  . ALA A 1 178 ? -9.664  -11.001 -1.289  1.00 1.10  ? 178 ALA A HB2  3  
ATOM 8709  H HB3  . ALA A 1 178 ? -8.555  -12.365 -1.154  1.00 1.22  ? 178 ALA A HB3  3  
ATOM 8710  N N    . GLY A 1 179 ? -8.171  -12.477 1.461   1.00 0.41  ? 179 GLY A N    3  
ATOM 8711  C CA   . GLY A 1 179 ? -8.658  -13.132 2.708   1.00 0.43  ? 179 GLY A CA   3  
ATOM 8712  C C    . GLY A 1 179 ? -8.201  -12.333 3.928   1.00 0.43  ? 179 GLY A C    3  
ATOM 8713  O O    . GLY A 1 179 ? -8.878  -12.276 4.936   1.00 0.48  ? 179 GLY A O    3  
ATOM 8714  H H    . GLY A 1 179 ? -7.635  -12.986 0.818   1.00 0.42  ? 179 GLY A H    3  
ATOM 8715  H HA2  . GLY A 1 179 ? -9.737  -13.180 2.691   1.00 0.45  ? 179 GLY A HA2  3  
ATOM 8716  H HA3  . GLY A 1 179 ? -8.255  -14.132 2.768   1.00 0.46  ? 179 GLY A HA3  3  
ATOM 8717  N N    . VAL A 1 180 ? -7.050  -11.726 3.853   1.00 0.42  ? 180 VAL A N    3  
ATOM 8718  C CA   . VAL A 1 180 ? -6.548  -10.950 5.017   1.00 0.45  ? 180 VAL A CA   3  
ATOM 8719  C C    . VAL A 1 180 ? -7.251  -9.592  5.113   1.00 0.45  ? 180 VAL A C    3  
ATOM 8720  O O    . VAL A 1 180 ? -7.528  -9.094  6.189   1.00 0.43  ? 180 VAL A O    3  
ATOM 8721  C CB   . VAL A 1 180 ? -5.032  -10.733 4.879   1.00 0.49  ? 180 VAL A CB   3  
ATOM 8722  C CG1  . VAL A 1 180 ? -4.542  -9.737  5.940   1.00 1.31  ? 180 VAL A CG1  3  
ATOM 8723  C CG2  . VAL A 1 180 ? -4.308  -12.066 5.076   1.00 1.41  ? 180 VAL A CG2  3  
ATOM 8724  H H    . VAL A 1 180 ? -6.512  -11.792 3.037   1.00 0.42  ? 180 VAL A H    3  
ATOM 8725  H HA   . VAL A 1 180 ? -6.744  -11.501 5.925   1.00 0.46  ? 180 VAL A HA   3  
ATOM 8726  H HB   . VAL A 1 180 ? -4.813  -10.345 3.895   1.00 1.21  ? 180 VAL A HB   3  
ATOM 8727  H HG11 . VAL A 1 180 ? -4.962  -9.997  6.900   1.00 1.78  ? 180 VAL A HG11 3  
ATOM 8728  H HG12 . VAL A 1 180 ? -4.854  -8.739  5.670   1.00 1.94  ? 180 VAL A HG12 3  
ATOM 8729  H HG13 . VAL A 1 180 ? -3.464  -9.772  5.998   1.00 1.95  ? 180 VAL A HG13 3  
ATOM 8730  H HG21 . VAL A 1 180 ? -3.267  -11.952 4.814   1.00 1.89  ? 180 VAL A HG21 3  
ATOM 8731  H HG22 . VAL A 1 180 ? -4.758  -12.818 4.445   1.00 2.13  ? 180 VAL A HG22 3  
ATOM 8732  H HG23 . VAL A 1 180 ? -4.387  -12.369 6.110   1.00 1.85  ? 180 VAL A HG23 3  
ATOM 8733  N N    . LEU A 1 181 ? -7.523  -8.977  3.988   1.00 0.49  ? 181 LEU A N    3  
ATOM 8734  C CA   . LEU A 1 181 ? -8.179  -7.642  4.019   1.00 0.50  ? 181 LEU A CA   3  
ATOM 8735  C C    . LEU A 1 181 ? -9.564  -7.781  4.656   1.00 0.49  ? 181 LEU A C    3  
ATOM 8736  O O    . LEU A 1 181 ? -10.013 -6.944  5.414   1.00 0.51  ? 181 LEU A O    3  
ATOM 8737  C CB   . LEU A 1 181 ? -8.329  -7.112  2.581   1.00 0.56  ? 181 LEU A CB   3  
ATOM 8738  C CG   . LEU A 1 181 ? -7.011  -6.472  2.100   1.00 0.64  ? 181 LEU A CG   3  
ATOM 8739  C CD1  . LEU A 1 181 ? -6.957  -6.487  0.567   1.00 1.60  ? 181 LEU A CD1  3  
ATOM 8740  C CD2  . LEU A 1 181 ? -6.926  -5.017  2.581   1.00 1.20  ? 181 LEU A CD2  3  
ATOM 8741  H H    . LEU A 1 181 ? -7.273  -9.376  3.128   1.00 0.51  ? 181 LEU A H    3  
ATOM 8742  H HA   . LEU A 1 181 ? -7.527  -6.999  4.587   1.00 0.50  ? 181 LEU A HA   3  
ATOM 8743  H HB2  . LEU A 1 181 ? -8.586  -7.937  1.931   1.00 1.01  ? 181 LEU A HB2  3  
ATOM 8744  H HB3  . LEU A 1 181 ? -9.120  -6.375  2.545   1.00 0.95  ? 181 LEU A HB3  3  
ATOM 8745  H HG   . LEU A 1 181 ? -6.173  -7.032  2.491   1.00 1.52  ? 181 LEU A HG   3  
ATOM 8746  H HD11 . LEU A 1 181 ? -6.070  -5.970  0.233   1.00 2.12  ? 181 LEU A HD11 3  
ATOM 8747  H HD12 . LEU A 1 181 ? -7.832  -5.992  0.172   1.00 2.16  ? 181 LEU A HD12 3  
ATOM 8748  H HD13 . LEU A 1 181 ? -6.933  -7.508  0.217   1.00 2.17  ? 181 LEU A HD13 3  
ATOM 8749  H HD21 . LEU A 1 181 ? -7.788  -4.470  2.227   1.00 1.66  ? 181 LEU A HD21 3  
ATOM 8750  H HD22 . LEU A 1 181 ? -6.028  -4.562  2.190   1.00 1.87  ? 181 LEU A HD22 3  
ATOM 8751  H HD23 . LEU A 1 181 ? -6.900  -4.989  3.659   1.00 1.79  ? 181 LEU A HD23 3  
ATOM 8752  N N    . THR A 1 182 ? -10.239 -8.850  4.320   1.00 0.49  ? 182 THR A N    3  
ATOM 8753  C CA   . THR A 1 182 ? -11.605 -9.096  4.856   1.00 0.51  ? 182 THR A CA   3  
ATOM 8754  C C    . THR A 1 182 ? -11.535 -9.288  6.367   1.00 0.48  ? 182 THR A C    3  
ATOM 8755  O O    . THR A 1 182 ? -12.396 -8.845  7.101   1.00 0.51  ? 182 THR A O    3  
ATOM 8756  C CB   . THR A 1 182 ? -12.184 -10.359 4.205   1.00 0.54  ? 182 THR A CB   3  
ATOM 8757  O OG1  . THR A 1 182 ? -11.893 -10.347 2.815   1.00 1.16  ? 182 THR A OG1  3  
ATOM 8758  C CG2  . THR A 1 182 ? -13.700 -10.402 4.408   1.00 1.07  ? 182 THR A CG2  3  
ATOM 8759  H H    . THR A 1 182 ? -9.835  -9.496  3.704   1.00 0.49  ? 182 THR A H    3  
ATOM 8760  H HA   . THR A 1 182 ? -12.239 -8.251  4.629   1.00 0.56  ? 182 THR A HA   3  
ATOM 8761  H HB   . THR A 1 182 ? -11.741 -11.234 4.656   1.00 1.04  ? 182 THR A HB   3  
ATOM 8762  H HG1  . THR A 1 182 ? -11.095 -10.862 2.675   1.00 1.69  ? 182 THR A HG1  3  
ATOM 8763  H HG21 . THR A 1 182 ? -14.076 -11.368 4.106   1.00 1.49  ? 182 THR A HG21 3  
ATOM 8764  H HG22 . THR A 1 182 ? -14.165 -9.632  3.810   1.00 1.80  ? 182 THR A HG22 3  
ATOM 8765  H HG23 . THR A 1 182 ? -13.930 -10.236 5.450   1.00 1.62  ? 182 THR A HG23 3  
ATOM 8766  N N    . ALA A 1 183 ? -10.524 -9.963  6.840   1.00 0.45  ? 183 ALA A N    3  
ATOM 8767  C CA   . ALA A 1 183 ? -10.421 -10.195 8.303   1.00 0.44  ? 183 ALA A CA   3  
ATOM 8768  C C    . ALA A 1 183 ? -10.514 -8.854  9.033   1.00 0.44  ? 183 ALA A C    3  
ATOM 8769  O O    . ALA A 1 183 ? -11.196 -8.721  10.028  1.00 0.50  ? 183 ALA A O    3  
ATOM 8770  C CB   . ALA A 1 183 ? -9.084  -10.865 8.624   1.00 0.46  ? 183 ALA A CB   3  
ATOM 8771  H H    . ALA A 1 183 ? -9.846  -10.327 6.231   1.00 0.44  ? 183 ALA A H    3  
ATOM 8772  H HA   . ALA A 1 183 ? -11.232 -10.849 8.591   1.00 0.45  ? 183 ALA A HA   3  
ATOM 8773  H HB1  . ALA A 1 183 ? -9.007  -11.021 9.690   1.00 1.08  ? 183 ALA A HB1  3  
ATOM 8774  H HB2  . ALA A 1 183 ? -8.275  -10.232 8.293   1.00 1.22  ? 183 ALA A HB2  3  
ATOM 8775  H HB3  . ALA A 1 183 ? -9.028  -11.817 8.116   1.00 1.06  ? 183 ALA A HB3  3  
ATOM 8776  N N    . SER A 1 184 ? -9.818  -7.858  8.542   1.00 0.47  ? 184 SER A N    3  
ATOM 8777  C CA   . SER A 1 184 ? -9.848  -6.520  9.203   1.00 0.51  ? 184 SER A CA   3  
ATOM 8778  C C    . SER A 1 184 ? -11.257 -5.923  9.127   1.00 0.54  ? 184 SER A C    3  
ATOM 8779  O O    . SER A 1 184 ? -11.757 -5.358  10.080  1.00 0.56  ? 184 SER A O    3  
ATOM 8780  C CB   . SER A 1 184 ? -8.864  -5.586  8.498   1.00 0.62  ? 184 SER A CB   3  
ATOM 8781  O OG   . SER A 1 184 ? -7.586  -6.206  8.441   1.00 1.55  ? 184 SER A OG   3  
ATOM 8782  H H    . SER A 1 184 ? -9.264  -7.990  7.740   1.00 0.51  ? 184 SER A H    3  
ATOM 8783  H HA   . SER A 1 184 ? -9.559  -6.628  10.238  1.00 0.48  ? 184 SER A HA   3  
ATOM 8784  H HB2  . SER A 1 184 ? -9.207  -5.387  7.497   1.00 1.12  ? 184 SER A HB2  3  
ATOM 8785  H HB3  . SER A 1 184 ? -8.801  -4.656  9.046   1.00 1.19  ? 184 SER A HB3  3  
ATOM 8786  H HG   . SER A 1 184 ? -7.198  -6.165  9.318   1.00 1.98  ? 184 SER A HG   3  
ATOM 8787  N N    . LEU A 1 185 ? -11.904 -6.057  8.000   1.00 0.58  ? 185 LEU A N    3  
ATOM 8788  C CA   . LEU A 1 185 ? -13.286 -5.516  7.848   1.00 0.69  ? 185 LEU A CA   3  
ATOM 8789  C C    . LEU A 1 185 ? -14.245 -6.359  8.684   1.00 0.69  ? 185 LEU A C    3  
ATOM 8790  O O    . LEU A 1 185 ? -15.238 -5.885  9.200   1.00 0.79  ? 185 LEU A O    3  
ATOM 8791  C CB   . LEU A 1 185 ? -13.697 -5.618  6.377   1.00 0.71  ? 185 LEU A CB   3  
ATOM 8792  C CG   . LEU A 1 185 ? -12.692 -4.861  5.498   1.00 0.79  ? 185 LEU A CG   3  
ATOM 8793  C CD1  . LEU A 1 185 ? -13.071 -5.052  4.026   1.00 1.62  ? 185 LEU A CD1  3  
ATOM 8794  C CD2  . LEU A 1 185 ? -12.708 -3.361  5.844   1.00 1.18  ? 185 LEU A CD2  3  
ATOM 8795  H H    . LEU A 1 185 ? -11.490 -6.532  7.250   1.00 0.58  ? 185 LEU A H    3  
ATOM 8796  H HA   . LEU A 1 185 ? -13.328 -4.479  8.145   1.00 0.77  ? 185 LEU A HA   3  
ATOM 8797  H HB2  . LEU A 1 185 ? -13.721 -6.657  6.082   1.00 1.28  ? 185 LEU A HB2  3  
ATOM 8798  H HB3  . LEU A 1 185 ? -14.679 -5.187  6.248   1.00 1.05  ? 185 LEU A HB3  3  
ATOM 8799  H HG   . LEU A 1 185 ? -11.702 -5.260  5.665   1.00 1.57  ? 185 LEU A HG   3  
ATOM 8800  H HD11 . LEU A 1 185 ? -14.069 -4.674  3.859   1.00 1.91  ? 185 LEU A HD11 3  
ATOM 8801  H HD12 . LEU A 1 185 ? -13.037 -6.103  3.779   1.00 2.16  ? 185 LEU A HD12 3  
ATOM 8802  H HD13 . LEU A 1 185 ? -12.373 -4.513  3.402   1.00 2.28  ? 185 LEU A HD13 3  
ATOM 8803  H HD21 . LEU A 1 185 ? -12.331 -2.790  5.007   1.00 1.69  ? 185 LEU A HD21 3  
ATOM 8804  H HD22 . LEU A 1 185 ? -12.080 -3.183  6.704   1.00 1.76  ? 185 LEU A HD22 3  
ATOM 8805  H HD23 . LEU A 1 185 ? -13.719 -3.048  6.065   1.00 1.75  ? 185 LEU A HD23 3  
ATOM 8806  N N    . THR A 1 186 ? -13.933 -7.617  8.814   1.00 0.62  ? 186 THR A N    3  
ATOM 8807  C CA   . THR A 1 186 ? -14.781 -8.546  9.604   1.00 0.68  ? 186 THR A CA   3  
ATOM 8808  C C    . THR A 1 186 ? -14.772 -8.160  11.079  1.00 0.62  ? 186 THR A C    3  
ATOM 8809  O O    . THR A 1 186 ? -15.785 -8.221  11.749  1.00 0.64  ? 186 THR A O    3  
ATOM 8810  C CB   . THR A 1 186 ? -14.209 -9.960  9.486   1.00 0.73  ? 186 THR A CB   3  
ATOM 8811  O OG1  . THR A 1 186 ? -14.007 -10.276 8.117   1.00 0.89  ? 186 THR A OG1  3  
ATOM 8812  C CG2  . THR A 1 186 ? -15.197 -10.954 10.103  1.00 1.00  ? 186 THR A CG2  3  
ATOM 8813  H H    . THR A 1 186 ? -13.117 -7.955  8.388   1.00 0.55  ? 186 THR A H    3  
ATOM 8814  H HA   . THR A 1 186 ? -15.794 -8.567  9.229   1.00 0.89  ? 186 THR A HA   3  
ATOM 8815  H HB   . THR A 1 186 ? -13.271 -10.017 10.014  1.00 0.76  ? 186 THR A HB   3  
ATOM 8816  H HG1  . THR A 1 186 ? -13.088 -10.100 7.905   1.00 1.30  ? 186 THR A HG1  3  
ATOM 8817  H HG21 . THR A 1 186 ? -14.826 -11.959 9.975   1.00 1.38  ? 186 THR A HG21 3  
ATOM 8818  H HG22 . THR A 1 186 ? -16.155 -10.858 9.613   1.00 1.41  ? 186 THR A HG22 3  
ATOM 8819  H HG23 . THR A 1 186 ? -15.310 -10.742 11.156  1.00 1.61  ? 186 THR A HG23 3  
ATOM 8820  N N    . ILE A 1 187 ? -13.636 -7.779  11.609  1.00 0.64  ? 187 ILE A N    3  
ATOM 8821  C CA   . ILE A 1 187 ? -13.583 -7.417  13.055  1.00 0.66  ? 187 ILE A CA   3  
ATOM 8822  C C    . ILE A 1 187 ? -14.037 -5.962  13.244  1.00 0.66  ? 187 ILE A C    3  
ATOM 8823  O O    . ILE A 1 187 ? -14.764 -5.660  14.168  1.00 0.75  ? 187 ILE A O    3  
ATOM 8824  C CB   . ILE A 1 187 ? -12.138 -7.634  13.597  1.00 0.72  ? 187 ILE A CB   3  
ATOM 8825  C CG1  . ILE A 1 187 ? -12.200 -8.052  15.077  1.00 0.88  ? 187 ILE A CG1  3  
ATOM 8826  C CG2  . ILE A 1 187 ? -11.297 -6.346  13.499  1.00 1.57  ? 187 ILE A CG2  3  
ATOM 8827  C CD1  . ILE A 1 187 ? -10.782 -8.147  15.658  1.00 0.87  ? 187 ILE A CD1  3  
ATOM 8828  H H    . ILE A 1 187 ? -12.819 -7.739  11.069  1.00 0.69  ? 187 ILE A H    3  
ATOM 8829  H HA   . ILE A 1 187 ? -14.280 -8.050  13.587  1.00 0.71  ? 187 ILE A HA   3  
ATOM 8830  H HB   . ILE A 1 187 ? -11.658 -8.416  13.026  1.00 1.19  ? 187 ILE A HB   3  
ATOM 8831  H HG12 . ILE A 1 187 ? -12.764 -7.315  15.631  1.00 1.44  ? 187 ILE A HG12 3  
ATOM 8832  H HG13 . ILE A 1 187 ? -12.686 -9.012  15.160  1.00 1.37  ? 187 ILE A HG13 3  
ATOM 8833  H HG21 . ILE A 1 187 ? -11.386 -5.931  12.508  1.00 2.03  ? 187 ILE A HG21 3  
ATOM 8834  H HG22 . ILE A 1 187 ? -10.259 -6.577  13.690  1.00 2.23  ? 187 ILE A HG22 3  
ATOM 8835  H HG23 . ILE A 1 187 ? -11.645 -5.628  14.226  1.00 1.91  ? 187 ILE A HG23 3  
ATOM 8836  H HD11 . ILE A 1 187 ? -10.154 -8.709  14.983  1.00 1.36  ? 187 ILE A HD11 3  
ATOM 8837  H HD12 . ILE A 1 187 ? -10.817 -8.644  16.615  1.00 1.37  ? 187 ILE A HD12 3  
ATOM 8838  H HD13 . ILE A 1 187 ? -10.374 -7.151  15.784  1.00 1.21  ? 187 ILE A HD13 3  
ATOM 8839  N N    . TRP A 1 188 ? -13.562 -5.056  12.429  1.00 0.64  ? 188 TRP A N    3  
ATOM 8840  C CA   . TRP A 1 188 ? -13.909 -3.614  12.614  1.00 0.70  ? 188 TRP A CA   3  
ATOM 8841  C C    . TRP A 1 188 ? -15.387 -3.454  13.011  1.00 0.81  ? 188 TRP A C    3  
ATOM 8842  O O    . TRP A 1 188 ? -15.719 -2.699  13.904  1.00 1.06  ? 188 TRP A O    3  
ATOM 8843  C CB   . TRP A 1 188 ? -13.628 -2.861  11.302  1.00 0.85  ? 188 TRP A CB   3  
ATOM 8844  C CG   . TRP A 1 188 ? -14.277 -1.513  11.327  1.00 0.92  ? 188 TRP A CG   3  
ATOM 8845  C CD1  . TRP A 1 188 ? -15.267 -1.112  10.496  1.00 1.76  ? 188 TRP A CD1  3  
ATOM 8846  C CD2  . TRP A 1 188 ? -14.007 -0.393  12.214  1.00 1.04  ? 188 TRP A CD2  3  
ATOM 8847  N NE1  . TRP A 1 188 ? -15.620 0.186   10.818  1.00 2.01  ? 188 TRP A NE1  3  
ATOM 8848  C CE2  . TRP A 1 188 ? -14.871 0.673   11.870  1.00 1.34  ? 188 TRP A CE2  3  
ATOM 8849  C CE3  . TRP A 1 188 ? -13.103 -0.201  13.273  1.00 1.79  ? 188 TRP A CE3  3  
ATOM 8850  C CZ2  . TRP A 1 188 ? -14.839 1.888   12.555  1.00 1.47  ? 188 TRP A CZ2  3  
ATOM 8851  C CZ3  . TRP A 1 188 ? -13.068 1.020   13.964  1.00 2.17  ? 188 TRP A CZ3  3  
ATOM 8852  C CH2  . TRP A 1 188 ? -13.934 2.062   13.606  1.00 1.71  ? 188 TRP A CH2  3  
ATOM 8853  H H    . TRP A 1 188 ? -12.917 -5.307  11.734  1.00 0.65  ? 188 TRP A H    3  
ATOM 8854  H HA   . TRP A 1 188 ? -13.245 -3.260  13.386  1.00 0.79  ? 188 TRP A HA   3  
ATOM 8855  H HB2  . TRP A 1 188 ? -12.562 -2.741  11.180  1.00 1.16  ? 188 TRP A HB2  3  
ATOM 8856  H HB3  . TRP A 1 188 ? -14.020 -3.432  10.472  1.00 1.12  ? 188 TRP A HB3  3  
ATOM 8857  H HD1  . TRP A 1 188 ? -15.709 -1.707  9.711   1.00 2.36  ? 188 TRP A HD1  3  
ATOM 8858  H HE1  . TRP A 1 188 ? -16.313 0.712   10.366  1.00 2.74  ? 188 TRP A HE1  3  
ATOM 8859  H HE3  . TRP A 1 188 ? -12.432 -0.999  13.556  1.00 2.35  ? 188 TRP A HE3  3  
ATOM 8860  H HZ2  . TRP A 1 188 ? -15.509 2.687   12.275  1.00 1.90  ? 188 TRP A HZ2  3  
ATOM 8861  H HZ3  . TRP A 1 188 ? -12.370 1.156   14.777  1.00 2.99  ? 188 TRP A HZ3  3  
ATOM 8862  H HH2  . TRP A 1 188 ? -13.902 2.999   14.142  1.00 2.02  ? 188 TRP A HH2  3  
ATOM 8863  N N    . LYS A 1 189 ? -16.273 -4.155  12.359  1.00 0.95  ? 189 LYS A N    3  
ATOM 8864  C CA   . LYS A 1 189 ? -17.717 -4.036  12.707  1.00 1.23  ? 189 LYS A CA   3  
ATOM 8865  C C    . LYS A 1 189 ? -17.944 -4.519  14.141  1.00 1.53  ? 189 LYS A C    3  
ATOM 8866  O O    . LYS A 1 189 ? -18.331 -3.759  15.004  1.00 2.02  ? 189 LYS A O    3  
ATOM 8867  C CB   . LYS A 1 189 ? -18.547 -4.890  11.748  1.00 1.90  ? 189 LYS A CB   3  
ATOM 8868  C CG   . LYS A 1 189 ? -18.267 -4.457  10.304  1.00 2.68  ? 189 LYS A CG   3  
ATOM 8869  C CD   . LYS A 1 189 ? -19.208 -5.197  9.334   1.00 3.60  ? 189 LYS A CD   3  
ATOM 8870  C CE   . LYS A 1 189 ? -20.529 -4.431  9.187   1.00 4.51  ? 189 LYS A CE   3  
ATOM 8871  N NZ   . LYS A 1 189 ? -21.461 -5.211  8.325   1.00 5.09  ? 189 LYS A NZ   3  
ATOM 8872  H H    . LYS A 1 189 ? -15.989 -4.759  11.641  1.00 1.06  ? 189 LYS A H    3  
ATOM 8873  H HA   . LYS A 1 189 ? -18.022 -3.003  12.623  1.00 1.91  ? 189 LYS A HA   3  
ATOM 8874  H HB2  . LYS A 1 189 ? -18.281 -5.930  11.871  1.00 2.38  ? 189 LYS A HB2  3  
ATOM 8875  H HB3  . LYS A 1 189 ? -19.595 -4.758  11.966  1.00 2.28  ? 189 LYS A HB3  3  
ATOM 8876  H HG2  . LYS A 1 189 ? -18.415 -3.389  10.216  1.00 3.00  ? 189 LYS A HG2  3  
ATOM 8877  H HG3  . LYS A 1 189 ? -17.242 -4.694  10.057  1.00 2.99  ? 189 LYS A HG3  3  
ATOM 8878  H HD2  . LYS A 1 189 ? -18.734 -5.274  8.365   1.00 3.82  ? 189 LYS A HD2  3  
ATOM 8879  H HD3  . LYS A 1 189 ? -19.412 -6.190  9.708   1.00 3.93  ? 189 LYS A HD3  3  
ATOM 8880  H HE2  . LYS A 1 189 ? -20.975 -4.286  10.159  1.00 4.88  ? 189 LYS A HE2  3  
ATOM 8881  H HE3  . LYS A 1 189 ? -20.338 -3.470  8.732   1.00 4.83  ? 189 LYS A HE3  3  
ATOM 8882  H HZ1  . LYS A 1 189 ? -20.931 -5.949  7.820   1.00 5.52  ? 189 LYS A HZ1  3  
ATOM 8883  H HZ2  . LYS A 1 189 ? -21.912 -4.573  7.637   1.00 5.28  ? 189 LYS A HZ2  3  
ATOM 8884  H HZ3  . LYS A 1 189 ? -22.191 -5.655  8.917   1.00 5.25  ? 189 LYS A HZ3  3  
ATOM 8885  N N    . LYS A 1 190 ? -17.711 -5.780  14.394  1.00 2.36  ? 190 LYS A N    3  
ATOM 8886  C CA   . LYS A 1 190 ? -17.914 -6.329  15.767  1.00 3.37  ? 190 LYS A CA   3  
ATOM 8887  C C    . LYS A 1 190 ? -19.362 -6.093  16.204  1.00 3.71  ? 190 LYS A C    3  
ATOM 8888  O O    . LYS A 1 190 ? -20.189 -6.981  16.144  1.00 4.35  ? 190 LYS A O    3  
ATOM 8889  C CB   . LYS A 1 190 ? -16.957 -5.643  16.747  1.00 4.30  ? 190 LYS A CB   3  
ATOM 8890  C CG   . LYS A 1 190 ? -16.997 -6.369  18.093  1.00 5.08  ? 190 LYS A CG   3  
ATOM 8891  C CD   . LYS A 1 190 ? -16.055 -5.671  19.076  1.00 5.78  ? 190 LYS A CD   3  
ATOM 8892  C CE   . LYS A 1 190 ? -16.078 -6.406  20.417  1.00 6.76  ? 190 LYS A CE   3  
ATOM 8893  N NZ   . LYS A 1 190 ? -15.581 -7.798  20.229  1.00 7.40  ? 190 LYS A NZ   3  
ATOM 8894  H H    . LYS A 1 190 ? -17.404 -6.370  13.676  1.00 2.69  ? 190 LYS A H    3  
ATOM 8895  H HA   . LYS A 1 190 ? -17.714 -7.390  15.758  1.00 3.76  ? 190 LYS A HA   3  
ATOM 8896  H HB2  . LYS A 1 190 ? -15.953 -5.675  16.350  1.00 4.62  ? 190 LYS A HB2  3  
ATOM 8897  H HB3  . LYS A 1 190 ? -17.255 -4.616  16.888  1.00 4.57  ? 190 LYS A HB3  3  
ATOM 8898  H HG2  . LYS A 1 190 ? -18.004 -6.351  18.482  1.00 5.34  ? 190 LYS A HG2  3  
ATOM 8899  H HG3  . LYS A 1 190 ? -16.680 -7.393  17.960  1.00 5.31  ? 190 LYS A HG3  3  
ATOM 8900  H HD2  . LYS A 1 190 ? -15.051 -5.678  18.678  1.00 5.90  ? 190 LYS A HD2  3  
ATOM 8901  H HD3  . LYS A 1 190 ? -16.378 -4.651  19.221  1.00 5.84  ? 190 LYS A HD3  3  
ATOM 8902  H HE2  . LYS A 1 190 ? -15.443 -5.890  21.122  1.00 7.01  ? 190 LYS A HE2  3  
ATOM 8903  H HE3  . LYS A 1 190 ? -17.089 -6.433  20.796  1.00 7.05  ? 190 LYS A HE3  3  
ATOM 8904  H HZ1  . LYS A 1 190 ? -16.344 -8.389  19.841  1.00 7.47  ? 190 LYS A HZ1  3  
ATOM 8905  H HZ2  . LYS A 1 190 ? -15.275 -8.184  21.146  1.00 7.70  ? 190 LYS A HZ2  3  
ATOM 8906  H HZ3  . LYS A 1 190 ? -14.779 -7.794  19.568  1.00 7.76  ? 190 LYS A HZ3  3  
ATOM 8907  N N    . MET A 1 191 ? -19.676 -4.903  16.643  1.00 3.81  ? 191 MET A N    3  
ATOM 8908  C CA   . MET A 1 191 ? -21.072 -4.604  17.085  1.00 4.63  ? 191 MET A CA   3  
ATOM 8909  C C    . MET A 1 191 ? -21.838 -3.940  15.939  1.00 4.97  ? 191 MET A C    3  
ATOM 8910  O O    . MET A 1 191 ? -22.464 -2.914  16.114  1.00 5.27  ? 191 MET A O    3  
ATOM 8911  C CB   . MET A 1 191 ? -21.033 -3.647  18.279  1.00 5.48  ? 191 MET A CB   3  
ATOM 8912  C CG   . MET A 1 191 ? -20.198 -4.264  19.403  1.00 5.71  ? 191 MET A CG   3  
ATOM 8913  S SD   . MET A 1 191 ? -20.442 -3.314  20.924  1.00 7.00  ? 191 MET A SD   3  
ATOM 8914  C CE   . MET A 1 191 ? -19.781 -1.742  20.318  1.00 7.52  ? 191 MET A CE   3  
ATOM 8915  H H    . MET A 1 191 ? -18.993 -4.203  16.680  1.00 3.68  ? 191 MET A H    3  
ATOM 8916  H HA   . MET A 1 191 ? -21.574 -5.517  17.373  1.00 4.86  ? 191 MET A HA   3  
ATOM 8917  H HB2  . MET A 1 191 ? -20.591 -2.710  17.974  1.00 5.74  ? 191 MET A HB2  3  
ATOM 8918  H HB3  . MET A 1 191 ? -22.037 -3.473  18.634  1.00 6.08  ? 191 MET A HB3  3  
ATOM 8919  H HG2  . MET A 1 191 ? -20.508 -5.286  19.563  1.00 5.63  ? 191 MET A HG2  3  
ATOM 8920  H HG3  . MET A 1 191 ? -19.154 -4.243  19.128  1.00 5.60  ? 191 MET A HG3  3  
ATOM 8921  H HE1  . MET A 1 191 ? -19.428 -1.154  21.155  1.00 7.54  ? 191 MET A HE1  3  
ATOM 8922  H HE2  . MET A 1 191 ? -20.555 -1.198  19.802  1.00 7.75  ? 191 MET A HE2  3  
ATOM 8923  H HE3  . MET A 1 191 ? -18.963 -1.934  19.637  1.00 7.88  ? 191 MET A HE3  3  
ATOM 8924  N N    . GLY A 1 192 ? -21.799 -4.513  14.767  1.00 5.37  ? 192 GLY A N    3  
ATOM 8925  C CA   . GLY A 1 192 ? -22.530 -3.904  13.620  1.00 6.15  ? 192 GLY A CA   3  
ATOM 8926  C C    . GLY A 1 192 ? -24.034 -4.119  13.799  1.00 6.68  ? 192 GLY A C    3  
ATOM 8927  O O    . GLY A 1 192 ? -24.692 -4.415  12.815  1.00 7.01  ? 192 GLY A O    3  
ATOM 8928  O OXT  . GLY A 1 192 ? -24.502 -3.985  14.918  1.00 7.06  ? 192 GLY A OXT  3  
ATOM 8929  H H    . GLY A 1 192 ? -21.294 -5.342  14.635  1.00 5.43  ? 192 GLY A H    3  
ATOM 8930  H HA2  . GLY A 1 192 ? -22.318 -2.845  13.580  1.00 6.42  ? 192 GLY A HA2  3  
ATOM 8931  H HA3  . GLY A 1 192 ? -22.211 -4.370  12.700  1.00 6.42  ? 192 GLY A HA3  3  
ATOM 8932  N N    . MET A 1 1   ? 20.801  -9.722  -5.216  1.00 17.15 ? 1   MET A N    4  
ATOM 8933  C CA   . MET A 1 1   ? 20.902  -10.744 -4.136  1.00 16.73 ? 1   MET A CA   4  
ATOM 8934  C C    . MET A 1 1   ? 22.213  -11.519 -4.286  1.00 16.39 ? 1   MET A C    4  
ATOM 8935  O O    . MET A 1 1   ? 22.987  -11.279 -5.191  1.00 16.40 ? 1   MET A O    4  
ATOM 8936  C CB   . MET A 1 1   ? 19.722  -11.713 -4.238  1.00 16.98 ? 1   MET A CB   4  
ATOM 8937  C CG   . MET A 1 1   ? 19.594  -12.214 -5.679  1.00 17.51 ? 1   MET A CG   4  
ATOM 8938  S SD   . MET A 1 1   ? 18.265  -13.439 -5.775  1.00 17.69 ? 1   MET A SD   4  
ATOM 8939  C CE   . MET A 1 1   ? 18.159  -13.518 -7.580  1.00 17.86 ? 1   MET A CE   4  
ATOM 8940  H H1   . MET A 1 1   ? 19.845  -9.742  -5.625  1.00 17.22 ? 1   MET A H1   4  
ATOM 8941  H H2   . MET A 1 1   ? 21.500  -9.932  -5.958  1.00 17.32 ? 1   MET A H2   4  
ATOM 8942  H H3   . MET A 1 1   ? 20.987  -8.779  -4.820  1.00 17.33 ? 1   MET A H3   4  
ATOM 8943  H HA   . MET A 1 1   ? 20.882  -10.253 -3.174  1.00 16.65 ? 1   MET A HA   4  
ATOM 8944  H HB2  . MET A 1 1   ? 19.888  -12.552 -3.578  1.00 17.06 ? 1   MET A HB2  4  
ATOM 8945  H HB3  . MET A 1 1   ? 18.813  -11.206 -3.954  1.00 16.85 ? 1   MET A HB3  4  
ATOM 8946  H HG2  . MET A 1 1   ? 19.366  -11.383 -6.330  1.00 17.63 ? 1   MET A HG2  4  
ATOM 8947  H HG3  . MET A 1 1   ? 20.525  -12.667 -5.986  1.00 17.81 ? 1   MET A HG3  4  
ATOM 8948  H HE1  . MET A 1 1   ? 17.727  -12.600 -7.955  1.00 17.66 ? 1   MET A HE1  4  
ATOM 8949  H HE2  . MET A 1 1   ? 17.536  -14.349 -7.869  1.00 18.24 ? 1   MET A HE2  4  
ATOM 8950  H HE3  . MET A 1 1   ? 19.149  -13.651 -7.993  1.00 17.93 ? 1   MET A HE3  4  
ATOM 8951  N N    . ASP A 1 2   ? 22.466  -12.448 -3.404  1.00 16.24 ? 2   ASP A N    4  
ATOM 8952  C CA   . ASP A 1 2   ? 23.725  -13.242 -3.493  1.00 16.07 ? 2   ASP A CA   4  
ATOM 8953  C C    . ASP A 1 2   ? 24.931  -12.300 -3.407  1.00 15.50 ? 2   ASP A C    4  
ATOM 8954  O O    . ASP A 1 2   ? 24.799  -11.096 -3.496  1.00 15.56 ? 2   ASP A O    4  
ATOM 8955  C CB   . ASP A 1 2   ? 23.752  -14.005 -4.826  1.00 16.42 ? 2   ASP A CB   4  
ATOM 8956  C CG   . ASP A 1 2   ? 24.739  -15.173 -4.737  1.00 16.67 ? 2   ASP A CG   4  
ATOM 8957  O OD1  . ASP A 1 2   ? 25.919  -14.914 -4.568  1.00 16.88 ? 2   ASP A OD1  4  
ATOM 8958  O OD2  . ASP A 1 2   ? 24.297  -16.305 -4.840  1.00 16.77 ? 2   ASP A OD2  4  
ATOM 8959  H H    . ASP A 1 2   ? 21.827  -12.625 -2.683  1.00 16.34 ? 2   ASP A H    4  
ATOM 8960  H HA   . ASP A 1 2   ? 23.760  -13.945 -2.673  1.00 16.28 ? 2   ASP A HA   4  
ATOM 8961  H HB2  . ASP A 1 2   ? 22.764  -14.388 -5.038  1.00 16.55 ? 2   ASP A HB2  4  
ATOM 8962  H HB3  . ASP A 1 2   ? 24.056  -13.340 -5.620  1.00 16.53 ? 2   ASP A HB3  4  
ATOM 8963  N N    . GLY A 1 3   ? 26.106  -12.844 -3.238  1.00 15.11 ? 3   GLY A N    4  
ATOM 8964  C CA   . GLY A 1 3   ? 27.324  -11.987 -3.150  1.00 14.72 ? 3   GLY A CA   4  
ATOM 8965  C C    . GLY A 1 3   ? 27.118  -10.896 -2.095  1.00 14.60 ? 3   GLY A C    4  
ATOM 8966  O O    . GLY A 1 3   ? 26.487  -11.112 -1.079  1.00 14.88 ? 3   GLY A O    4  
ATOM 8967  H H    . GLY A 1 3   ? 26.189  -13.818 -3.172  1.00 15.19 ? 3   GLY A H    4  
ATOM 8968  H HA2  . GLY A 1 3   ? 28.173  -12.597 -2.876  1.00 14.73 ? 3   GLY A HA2  4  
ATOM 8969  H HA3  . GLY A 1 3   ? 27.508  -11.525 -4.108  1.00 14.69 ? 3   GLY A HA3  4  
ATOM 8970  N N    . SER A 1 4   ? 27.649  -9.726  -2.333  1.00 14.34 ? 4   SER A N    4  
ATOM 8971  C CA   . SER A 1 4   ? 27.491  -8.612  -1.353  1.00 14.41 ? 4   SER A CA   4  
ATOM 8972  C C    . SER A 1 4   ? 27.968  -9.062  0.031   1.00 13.79 ? 4   SER A C    4  
ATOM 8973  O O    . SER A 1 4   ? 27.178  -9.397  0.891   1.00 14.02 ? 4   SER A O    4  
ATOM 8974  C CB   . SER A 1 4   ? 26.019  -8.203  -1.275  1.00 14.82 ? 4   SER A CB   4  
ATOM 8975  O OG   . SER A 1 4   ? 25.898  -7.043  -0.462  1.00 14.88 ? 4   SER A OG   4  
ATOM 8976  H H    . SER A 1 4   ? 28.153  -9.579  -3.160  1.00 14.23 ? 4   SER A H    4  
ATOM 8977  H HA   . SER A 1 4   ? 28.080  -7.767  -1.676  1.00 14.79 ? 4   SER A HA   4  
ATOM 8978  H HB2  . SER A 1 4   ? 25.651  -7.984  -2.263  1.00 15.17 ? 4   SER A HB2  4  
ATOM 8979  H HB3  . SER A 1 4   ? 25.442  -9.014  -0.850  1.00 14.87 ? 4   SER A HB3  4  
ATOM 8980  H HG   . SER A 1 4   ? 26.334  -7.221  0.375   1.00 14.91 ? 4   SER A HG   4  
ATOM 8981  N N    . GLY A 1 5   ? 29.255  -9.071  0.253   1.00 13.15 ? 5   GLY A N    4  
ATOM 8982  C CA   . GLY A 1 5   ? 29.779  -9.497  1.583   1.00 12.67 ? 5   GLY A CA   4  
ATOM 8983  C C    . GLY A 1 5   ? 31.211  -8.989  1.760   1.00 12.31 ? 5   GLY A C    4  
ATOM 8984  O O    . GLY A 1 5   ? 31.850  -9.243  2.762   1.00 12.37 ? 5   GLY A O    4  
ATOM 8985  H H    . GLY A 1 5   ? 29.877  -8.799  -0.453  1.00 13.09 ? 5   GLY A H    4  
ATOM 8986  H HA2  . GLY A 1 5   ? 29.153  -9.089  2.364   1.00 12.77 ? 5   GLY A HA2  4  
ATOM 8987  H HA3  . GLY A 1 5   ? 29.773  -10.575 1.644   1.00 12.67 ? 5   GLY A HA3  4  
ATOM 8988  N N    . GLU A 1 6   ? 31.723  -8.274  0.796   1.00 12.14 ? 6   GLU A N    4  
ATOM 8989  C CA   . GLU A 1 6   ? 33.114  -7.753  0.913   1.00 12.01 ? 6   GLU A CA   4  
ATOM 8990  C C    . GLU A 1 6   ? 33.366  -6.718  -0.186  1.00 11.53 ? 6   GLU A C    4  
ATOM 8991  O O    . GLU A 1 6   ? 34.235  -5.876  -0.071  1.00 11.57 ? 6   GLU A O    4  
ATOM 8992  C CB   . GLU A 1 6   ? 34.105  -8.910  0.762   1.00 12.39 ? 6   GLU A CB   4  
ATOM 8993  C CG   . GLU A 1 6   ? 35.526  -8.407  1.025   1.00 12.94 ? 6   GLU A CG   4  
ATOM 8994  C CD   . GLU A 1 6   ? 36.489  -9.595  1.060   1.00 13.31 ? 6   GLU A CD   4  
ATOM 8995  O OE1  . GLU A 1 6   ? 36.248  -10.550 0.341   1.00 13.55 ? 6   GLU A OE1  4  
ATOM 8996  O OE2  . GLU A 1 6   ? 37.452  -9.530  1.807   1.00 13.50 ? 6   GLU A OE2  4  
ATOM 8997  H H    . GLU A 1 6   ? 31.192  -8.079  -0.005  1.00 12.23 ? 6   GLU A H    4  
ATOM 8998  H HA   . GLU A 1 6   ? 33.246  -7.290  1.880   1.00 12.19 ? 6   GLU A HA   4  
ATOM 8999  H HB2  . GLU A 1 6   ? 33.860  -9.687  1.471   1.00 12.50 ? 6   GLU A HB2  4  
ATOM 9000  H HB3  . GLU A 1 6   ? 34.045  -9.306  -0.241  1.00 12.34 ? 6   GLU A HB3  4  
ATOM 9001  H HG2  . GLU A 1 6   ? 35.819  -7.728  0.237   1.00 13.05 ? 6   GLU A HG2  4  
ATOM 9002  H HG3  . GLU A 1 6   ? 35.556  -7.893  1.974   1.00 13.14 ? 6   GLU A HG3  4  
ATOM 9003  N N    . GLN A 1 7   ? 32.616  -6.782  -1.257  1.00 11.25 ? 7   GLN A N    4  
ATOM 9004  C CA   . GLN A 1 7   ? 32.804  -5.813  -2.381  1.00 10.97 ? 7   GLN A CA   4  
ATOM 9005  C C    . GLN A 1 7   ? 31.431  -5.366  -2.906  1.00 10.29 ? 7   GLN A C    4  
ATOM 9006  O O    . GLN A 1 7   ? 31.042  -5.749  -3.991  1.00 10.41 ? 7   GLN A O    4  
ATOM 9007  C CB   . GLN A 1 7   ? 33.571  -6.505  -3.510  1.00 11.52 ? 7   GLN A CB   4  
ATOM 9008  C CG   . GLN A 1 7   ? 33.983  -5.471  -4.558  1.00 12.08 ? 7   GLN A CG   4  
ATOM 9009  C CD   . GLN A 1 7   ? 34.754  -6.165  -5.682  1.00 12.56 ? 7   GLN A CD   4  
ATOM 9010  O OE1  . GLN A 1 7   ? 34.493  -5.935  -6.846  1.00 12.91 ? 7   GLN A OE1  4  
ATOM 9011  N NE2  . GLN A 1 7   ? 35.699  -7.013  -5.380  1.00 12.77 ? 7   GLN A NE2  4  
ATOM 9012  H H    . GLN A 1 7   ? 31.930  -7.478  -1.328  1.00 11.36 ? 7   GLN A H    4  
ATOM 9013  H HA   . GLN A 1 7   ? 33.364  -4.953  -2.047  1.00 11.07 ? 7   GLN A HA   4  
ATOM 9014  H HB2  . GLN A 1 7   ? 34.453  -6.981  -3.106  1.00 11.67 ? 7   GLN A HB2  4  
ATOM 9015  H HB3  . GLN A 1 7   ? 32.939  -7.249  -3.971  1.00 11.58 ? 7   GLN A HB3  4  
ATOM 9016  H HG2  . GLN A 1 7   ? 33.101  -4.998  -4.964  1.00 12.23 ? 7   GLN A HG2  4  
ATOM 9017  H HG3  . GLN A 1 7   ? 34.614  -4.725  -4.099  1.00 12.20 ? 7   GLN A HG3  4  
ATOM 9018  H HE21 . GLN A 1 7   ? 35.909  -7.200  -4.441  1.00 12.61 ? 7   GLN A HE21 4  
ATOM 9019  H HE22 . GLN A 1 7   ? 36.199  -7.464  -6.093  1.00 13.18 ? 7   GLN A HE22 4  
ATOM 9020  N N    . PRO A 1 8   ? 30.727  -4.573  -2.125  1.00 9.81  ? 8   PRO A N    4  
ATOM 9021  C CA   . PRO A 1 8   ? 29.391  -4.088  -2.524  1.00 9.37  ? 8   PRO A CA   4  
ATOM 9022  C C    . PRO A 1 8   ? 29.500  -3.240  -3.800  1.00 9.09  ? 8   PRO A C    4  
ATOM 9023  O O    . PRO A 1 8   ? 29.912  -2.098  -3.764  1.00 9.07  ? 8   PRO A O    4  
ATOM 9024  C CB   . PRO A 1 8   ? 28.896  -3.247  -1.322  1.00 9.20  ? 8   PRO A CB   4  
ATOM 9025  C CG   . PRO A 1 8   ? 30.013  -3.278  -0.238  1.00 9.57  ? 8   PRO A CG   4  
ATOM 9026  C CD   . PRO A 1 8   ? 31.192  -4.101  -0.802  1.00 9.93  ? 8   PRO A CD   4  
ATOM 9027  H HA   . PRO A 1 8   ? 28.727  -4.924  -2.689  1.00 9.66  ? 8   PRO A HA   4  
ATOM 9028  H HB2  . PRO A 1 8   ? 28.706  -2.225  -1.631  1.00 8.88  ? 8   PRO A HB2  4  
ATOM 9029  H HB3  . PRO A 1 8   ? 27.989  -3.676  -0.919  1.00 9.40  ? 8   PRO A HB3  4  
ATOM 9030  H HG2  . PRO A 1 8   ? 30.338  -2.267  -0.016  1.00 9.46  ? 8   PRO A HG2  4  
ATOM 9031  H HG3  . PRO A 1 8   ? 29.641  -3.744  0.665   1.00 9.94  ? 8   PRO A HG3  4  
ATOM 9032  H HD2  . PRO A 1 8   ? 32.066  -3.473  -0.910  1.00 10.00 ? 8   PRO A HD2  4  
ATOM 9033  H HD3  . PRO A 1 8   ? 31.411  -4.945  -0.164  1.00 10.41 ? 8   PRO A HD3  4  
ATOM 9034  N N    . ARG A 1 9   ? 29.128  -3.794  -4.924  1.00 9.13  ? 9   ARG A N    4  
ATOM 9035  C CA   . ARG A 1 9   ? 29.204  -3.028  -6.205  1.00 9.14  ? 9   ARG A CA   4  
ATOM 9036  C C    . ARG A 1 9   ? 28.075  -3.482  -7.131  1.00 8.60  ? 9   ARG A C    4  
ATOM 9037  O O    . ARG A 1 9   ? 28.285  -4.243  -8.055  1.00 8.68  ? 9   ARG A O    4  
ATOM 9038  C CB   . ARG A 1 9   ? 30.551  -3.291  -6.881  1.00 10.09 ? 9   ARG A CB   4  
ATOM 9039  C CG   . ARG A 1 9   ? 31.661  -2.578  -6.107  1.00 10.67 ? 9   ARG A CG   4  
ATOM 9040  C CD   . ARG A 1 9   ? 32.984  -2.730  -6.858  1.00 11.51 ? 9   ARG A CD   4  
ATOM 9041  N NE   . ARG A 1 9   ? 32.911  -1.990  -8.148  1.00 12.05 ? 9   ARG A NE   4  
ATOM 9042  C CZ   . ARG A 1 9   ? 34.002  -1.733  -8.815  1.00 12.65 ? 9   ARG A CZ   4  
ATOM 9043  N NH1  . ARG A 1 9   ? 35.156  -2.127  -8.352  1.00 12.79 ? 9   ARG A NH1  4  
ATOM 9044  N NH2  . ARG A 1 9   ? 33.939  -1.084  -9.945  1.00 13.27 ? 9   ARG A NH2  4  
ATOM 9045  H H    . ARG A 1 9   ? 28.797  -4.716  -4.927  1.00 9.33  ? 9   ARG A H    4  
ATOM 9046  H HA   . ARG A 1 9   ? 29.100  -1.970  -6.007  1.00 9.10  ? 9   ARG A HA   4  
ATOM 9047  H HB2  . ARG A 1 9   ? 30.745  -4.354  -6.895  1.00 10.28 ? 9   ARG A HB2  4  
ATOM 9048  H HB3  . ARG A 1 9   ? 30.524  -2.917  -7.894  1.00 10.40 ? 9   ARG A HB3  4  
ATOM 9049  H HG2  . ARG A 1 9   ? 31.418  -1.530  -6.013  1.00 10.72 ? 9   ARG A HG2  4  
ATOM 9050  H HG3  . ARG A 1 9   ? 31.754  -3.017  -5.125  1.00 10.65 ? 9   ARG A HG3  4  
ATOM 9051  H HD2  . ARG A 1 9   ? 33.787  -2.328  -6.258  1.00 11.82 ? 9   ARG A HD2  4  
ATOM 9052  H HD3  . ARG A 1 9   ? 33.170  -3.776  -7.052  1.00 11.59 ? 9   ARG A HD3  4  
ATOM 9053  H HE   . ARG A 1 9   ? 32.043  -1.695  -8.496  1.00 12.08 ? 9   ARG A HE   4  
ATOM 9054  H HH11 . ARG A 1 9   ? 35.204  -2.626  -7.486  1.00 12.44 ? 9   ARG A HH11 4  
ATOM 9055  H HH12 . ARG A 1 9   ? 35.994  -1.932  -8.862  1.00 13.36 ? 9   ARG A HH12 4  
ATOM 9056  H HH21 . ARG A 1 9   ? 33.054  -0.782  -10.300 1.00 13.29 ? 9   ARG A HH21 4  
ATOM 9057  H HH22 . ARG A 1 9   ? 34.776  -0.887  -10.456 1.00 13.82 ? 9   ARG A HH22 4  
ATOM 9058  N N    . GLY A 1 10  ? 26.878  -3.025  -6.891  1.00 8.29  ? 10  GLY A N    4  
ATOM 9059  C CA   . GLY A 1 10  ? 25.740  -3.434  -7.759  1.00 8.00  ? 10  GLY A CA   4  
ATOM 9060  C C    . GLY A 1 10  ? 24.440  -2.851  -7.207  1.00 7.45  ? 10  GLY A C    4  
ATOM 9061  O O    . GLY A 1 10  ? 23.580  -2.410  -7.943  1.00 7.68  ? 10  GLY A O    4  
ATOM 9062  H H    . GLY A 1 10  ? 26.728  -2.413  -6.141  1.00 8.43  ? 10  GLY A H    4  
ATOM 9063  H HA2  . GLY A 1 10  ? 25.903  -3.068  -8.763  1.00 8.37  ? 10  GLY A HA2  4  
ATOM 9064  H HA3  . GLY A 1 10  ? 25.669  -4.511  -7.775  1.00 8.08  ? 10  GLY A HA3  4  
ATOM 9065  N N    . GLY A 1 11  ? 24.296  -2.844  -5.911  1.00 7.01  ? 11  GLY A N    4  
ATOM 9066  C CA   . GLY A 1 11  ? 23.059  -2.289  -5.298  1.00 6.74  ? 11  GLY A CA   4  
ATOM 9067  C C    . GLY A 1 11  ? 23.033  -0.771  -5.479  1.00 5.83  ? 11  GLY A C    4  
ATOM 9068  O O    . GLY A 1 11  ? 23.606  -0.241  -6.410  1.00 6.06  ? 11  GLY A O    4  
ATOM 9069  H H    . GLY A 1 11  ? 25.006  -3.202  -5.338  1.00 7.06  ? 11  GLY A H    4  
ATOM 9070  H HA2  . GLY A 1 11  ? 22.192  -2.723  -5.776  1.00 7.27  ? 11  GLY A HA2  4  
ATOM 9071  H HA3  . GLY A 1 11  ? 23.046  -2.523  -4.245  1.00 6.94  ? 11  GLY A HA3  4  
ATOM 9072  N N    . GLY A 1 12  ? 22.357  -0.067  -4.617  1.00 5.12  ? 12  GLY A N    4  
ATOM 9073  C CA   . GLY A 1 12  ? 22.280  1.411   -4.769  1.00 4.52  ? 12  GLY A CA   4  
ATOM 9074  C C    . GLY A 1 12  ? 21.262  1.998   -3.781  1.00 3.52  ? 12  GLY A C    4  
ATOM 9075  O O    . GLY A 1 12  ? 21.607  2.863   -3.000  1.00 3.54  ? 12  GLY A O    4  
ATOM 9076  H H    . GLY A 1 12  ? 21.885  -0.510  -3.882  1.00 5.25  ? 12  GLY A H    4  
ATOM 9077  H HA2  . GLY A 1 12  ? 23.254  1.841   -4.579  1.00 4.85  ? 12  GLY A HA2  4  
ATOM 9078  H HA3  . GLY A 1 12  ? 21.975  1.652   -5.777  1.00 4.89  ? 12  GLY A HA3  4  
ATOM 9079  N N    . PRO A 1 13  ? 20.030  1.530   -3.839  1.00 3.15  ? 13  PRO A N    4  
ATOM 9080  C CA   . PRO A 1 13  ? 18.977  2.040   -2.940  1.00 2.77  ? 13  PRO A CA   4  
ATOM 9081  C C    . PRO A 1 13  ? 19.419  1.876   -1.480  1.00 2.05  ? 13  PRO A C    4  
ATOM 9082  O O    . PRO A 1 13  ? 19.375  0.788   -0.941  1.00 2.37  ? 13  PRO A O    4  
ATOM 9083  C CB   . PRO A 1 13  ? 17.736  1.169   -3.255  1.00 3.47  ? 13  PRO A CB   4  
ATOM 9084  C CG   . PRO A 1 13  ? 18.088  0.278   -4.480  1.00 3.99  ? 13  PRO A CG   4  
ATOM 9085  C CD   . PRO A 1 13  ? 19.589  0.475   -4.781  1.00 3.79  ? 13  PRO A CD   4  
ATOM 9086  H HA   . PRO A 1 13  ? 18.762  3.069   -3.194  1.00 3.21  ? 13  PRO A HA   4  
ATOM 9087  H HB2  . PRO A 1 13  ? 17.489  0.545   -2.403  1.00 3.49  ? 13  PRO A HB2  4  
ATOM 9088  H HB3  . PRO A 1 13  ? 16.891  1.800   -3.497  1.00 4.08  ? 13  PRO A HB3  4  
ATOM 9089  H HG2  . PRO A 1 13  ? 17.887  -0.762  -4.249  1.00 4.37  ? 13  PRO A HG2  4  
ATOM 9090  H HG3  . PRO A 1 13  ? 17.501  0.578   -5.338  1.00 4.57  ? 13  PRO A HG3  4  
ATOM 9091  H HD2  . PRO A 1 13  ? 20.121  -0.446  -4.600  1.00 4.09  ? 13  PRO A HD2  4  
ATOM 9092  H HD3  . PRO A 1 13  ? 19.737  0.801   -5.801  1.00 4.27  ? 13  PRO A HD3  4  
ATOM 9093  N N    . THR A 1 14  ? 19.857  2.924   -0.834  1.00 1.59  ? 14  THR A N    4  
ATOM 9094  C CA   . THR A 1 14  ? 20.307  2.773   0.585   1.00 1.24  ? 14  THR A CA   4  
ATOM 9095  C C    . THR A 1 14  ? 20.078  4.069   1.364   1.00 1.07  ? 14  THR A C    4  
ATOM 9096  O O    . THR A 1 14  ? 20.340  4.131   2.549   1.00 1.20  ? 14  THR A O    4  
ATOM 9097  C CB   . THR A 1 14  ? 21.804  2.430   0.613   1.00 1.43  ? 14  THR A CB   4  
ATOM 9098  O OG1  . THR A 1 14  ? 22.495  3.274   -0.298  1.00 2.16  ? 14  THR A OG1  4  
ATOM 9099  C CG2  . THR A 1 14  ? 22.015  0.968   0.213   1.00 1.78  ? 14  THR A CG2  4  
ATOM 9100  H H    . THR A 1 14  ? 19.900  3.796   -1.277  1.00 1.96  ? 14  THR A H    4  
ATOM 9101  H HA   . THR A 1 14  ? 19.752  1.977   1.061   1.00 1.69  ? 14  THR A HA   4  
ATOM 9102  H HB   . THR A 1 14  ? 22.188  2.588   1.609   1.00 1.94  ? 14  THR A HB   4  
ATOM 9103  H HG1  . THR A 1 14  ? 23.437  3.138   -0.171  1.00 2.49  ? 14  THR A HG1  4  
ATOM 9104  H HG21 . THR A 1 14  ? 23.054  0.706   0.346   1.00 2.04  ? 14  THR A HG21 4  
ATOM 9105  H HG22 . THR A 1 14  ? 21.741  0.835   -0.824  1.00 2.29  ? 14  THR A HG22 4  
ATOM 9106  H HG23 . THR A 1 14  ? 21.401  0.331   0.832   1.00 2.23  ? 14  THR A HG23 4  
ATOM 9107  N N    . SER A 1 15  ? 19.592  5.107   0.734   1.00 1.07  ? 15  SER A N    4  
ATOM 9108  C CA   . SER A 1 15  ? 19.361  6.380   1.482   1.00 0.91  ? 15  SER A CA   4  
ATOM 9109  C C    . SER A 1 15  ? 17.949  6.346   2.081   1.00 0.75  ? 15  SER A C    4  
ATOM 9110  O O    . SER A 1 15  ? 16.972  6.163   1.382   1.00 0.78  ? 15  SER A O    4  
ATOM 9111  C CB   . SER A 1 15  ? 19.500  7.559   0.514   1.00 0.99  ? 15  SER A CB   4  
ATOM 9112  O OG   . SER A 1 15  ? 20.875  7.915   0.433   1.00 1.38  ? 15  SER A OG   4  
ATOM 9113  H H    . SER A 1 15  ? 19.373  5.062   -0.220  1.00 1.34  ? 15  SER A H    4  
ATOM 9114  H HA   . SER A 1 15  ? 20.097  6.458   2.271   1.00 0.94  ? 15  SER A HA   4  
ATOM 9115  H HB2  . SER A 1 15  ? 19.176  7.235   -0.458  1.00 1.46  ? 15  SER A HB2  4  
ATOM 9116  H HB3  . SER A 1 15  ? 18.930  8.398   0.896   1.00 1.34  ? 15  SER A HB3  4  
ATOM 9117  H HG   . SER A 1 15  ? 21.329  7.235   -0.071  1.00 1.70  ? 15  SER A HG   4  
ATOM 9118  N N    . SER A 1 16  ? 17.838  6.509   3.369   1.00 0.72  ? 16  SER A N    4  
ATOM 9119  C CA   . SER A 1 16  ? 16.494  6.474   4.014   1.00 0.82  ? 16  SER A CA   4  
ATOM 9120  C C    . SER A 1 16  ? 15.604  7.579   3.440   1.00 0.81  ? 16  SER A C    4  
ATOM 9121  O O    . SER A 1 16  ? 14.450  7.358   3.130   1.00 0.92  ? 16  SER A O    4  
ATOM 9122  C CB   . SER A 1 16  ? 16.653  6.689   5.520   1.00 1.06  ? 16  SER A CB   4  
ATOM 9123  O OG   . SER A 1 16  ? 17.557  5.724   6.040   1.00 1.64  ? 16  SER A OG   4  
ATOM 9124  H H    . SER A 1 16  ? 18.639  6.647   3.916   1.00 0.74  ? 16  SER A H    4  
ATOM 9125  H HA   . SER A 1 16  ? 16.035  5.514   3.837   1.00 0.88  ? 16  SER A HA   4  
ATOM 9126  H HB2  . SER A 1 16  ? 17.042  7.676   5.705   1.00 1.49  ? 16  SER A HB2  4  
ATOM 9127  H HB3  . SER A 1 16  ? 15.688  6.589   6.000   1.00 1.64  ? 16  SER A HB3  4  
ATOM 9128  H HG   . SER A 1 16  ? 18.364  6.179   6.292   1.00 2.08  ? 16  SER A HG   4  
ATOM 9129  N N    . GLU A 1 17  ? 16.123  8.767   3.302   1.00 0.80  ? 17  GLU A N    4  
ATOM 9130  C CA   . GLU A 1 17  ? 15.295  9.879   2.756   1.00 0.94  ? 17  GLU A CA   4  
ATOM 9131  C C    . GLU A 1 17  ? 14.879  9.565   1.316   1.00 0.85  ? 17  GLU A C    4  
ATOM 9132  O O    . GLU A 1 17  ? 13.833  9.982   0.859   1.00 0.89  ? 17  GLU A O    4  
ATOM 9133  C CB   . GLU A 1 17  ? 16.103  11.180  2.781   1.00 1.13  ? 17  GLU A CB   4  
ATOM 9134  C CG   . GLU A 1 17  ? 15.190  12.364  2.447   1.00 1.71  ? 17  GLU A CG   4  
ATOM 9135  C CD   . GLU A 1 17  ? 14.213  12.599  3.600   1.00 2.26  ? 17  GLU A CD   4  
ATOM 9136  O OE1  . GLU A 1 17  ? 14.623  13.189  4.587   1.00 2.90  ? 17  GLU A OE1  4  
ATOM 9137  O OE2  . GLU A 1 17  ? 13.072  12.187  3.477   1.00 2.68  ? 17  GLU A OE2  4  
ATOM 9138  H H    . GLU A 1 17  ? 17.053  8.930   3.562   1.00 0.79  ? 17  GLU A H    4  
ATOM 9139  H HA   . GLU A 1 17  ? 14.408  9.994   3.361   1.00 1.09  ? 17  GLU A HA   4  
ATOM 9140  H HB2  . GLU A 1 17  ? 16.527  11.319  3.765   1.00 1.54  ? 17  GLU A HB2  4  
ATOM 9141  H HB3  . GLU A 1 17  ? 16.897  11.124  2.052   1.00 1.46  ? 17  GLU A HB3  4  
ATOM 9142  H HG2  . GLU A 1 17  ? 15.791  13.249  2.298   1.00 2.27  ? 17  GLU A HG2  4  
ATOM 9143  H HG3  . GLU A 1 17  ? 14.635  12.151  1.546   1.00 2.07  ? 17  GLU A HG3  4  
ATOM 9144  N N    . GLN A 1 18  ? 15.689  8.841   0.592   1.00 0.80  ? 18  GLN A N    4  
ATOM 9145  C CA   . GLN A 1 18  ? 15.332  8.517   -0.819  1.00 0.83  ? 18  GLN A CA   4  
ATOM 9146  C C    . GLN A 1 18  ? 14.248  7.436   -0.839  1.00 0.68  ? 18  GLN A C    4  
ATOM 9147  O O    . GLN A 1 18  ? 13.396  7.416   -1.705  1.00 0.69  ? 18  GLN A O    4  
ATOM 9148  C CB   . GLN A 1 18  ? 16.582  8.019   -1.561  1.00 0.96  ? 18  GLN A CB   4  
ATOM 9149  C CG   . GLN A 1 18  ? 16.409  8.211   -3.073  1.00 1.53  ? 18  GLN A CG   4  
ATOM 9150  C CD   . GLN A 1 18  ? 15.225  7.379   -3.570  1.00 2.23  ? 18  GLN A CD   4  
ATOM 9151  O OE1  . GLN A 1 18  ? 15.087  6.225   -3.218  1.00 2.69  ? 18  GLN A OE1  4  
ATOM 9152  N NE2  . GLN A 1 18  ? 14.359  7.922   -4.381  1.00 3.07  ? 18  GLN A NE2  4  
ATOM 9153  H H    . GLN A 1 18  ? 16.534  8.518   0.970   1.00 0.80  ? 18  GLN A H    4  
ATOM 9154  H HA   . GLN A 1 18  ? 14.958  9.409   -1.299  1.00 0.96  ? 18  GLN A HA   4  
ATOM 9155  H HB2  . GLN A 1 18  ? 17.439  8.584   -1.228  1.00 1.31  ? 18  GLN A HB2  4  
ATOM 9156  H HB3  . GLN A 1 18  ? 16.739  6.971   -1.349  1.00 1.16  ? 18  GLN A HB3  4  
ATOM 9157  H HG2  . GLN A 1 18  ? 16.229  9.255   -3.282  1.00 1.79  ? 18  GLN A HG2  4  
ATOM 9158  H HG3  . GLN A 1 18  ? 17.307  7.892   -3.581  1.00 2.17  ? 18  GLN A HG3  4  
ATOM 9159  H HE21 . GLN A 1 18  ? 14.470  8.853   -4.666  1.00 3.31  ? 18  GLN A HE21 4  
ATOM 9160  H HE22 . GLN A 1 18  ? 13.597  7.399   -4.707  1.00 3.76  ? 18  GLN A HE22 4  
ATOM 9161  N N    . ILE A 1 19  ? 14.260  6.542   0.113   1.00 0.59  ? 19  ILE A N    4  
ATOM 9162  C CA   . ILE A 1 19  ? 13.213  5.486   0.128   1.00 0.58  ? 19  ILE A CA   4  
ATOM 9163  C C    . ILE A 1 19  ? 11.853  6.163   0.309   1.00 0.52  ? 19  ILE A C    4  
ATOM 9164  O O    . ILE A 1 19  ? 10.896  5.845   -0.367  1.00 0.59  ? 19  ILE A O    4  
ATOM 9165  C CB   . ILE A 1 19  ? 13.488  4.474   1.253   1.00 0.64  ? 19  ILE A CB   4  
ATOM 9166  C CG1  . ILE A 1 19  ? 14.684  3.597   0.869   1.00 0.74  ? 19  ILE A CG1  4  
ATOM 9167  C CG2  . ILE A 1 19  ? 12.261  3.583   1.486   1.00 0.73  ? 19  ILE A CG2  4  
ATOM 9168  C CD1  . ILE A 1 19  ? 15.140  2.788   2.087   1.00 0.81  ? 19  ILE A CD1  4  
ATOM 9169  H H    . ILE A 1 19  ? 14.942  6.576   0.815   1.00 0.59  ? 19  ILE A H    4  
ATOM 9170  H HA   . ILE A 1 19  ? 13.193  5.006   -0.834  1.00 0.68  ? 19  ILE A HA   4  
ATOM 9171  H HB   . ILE A 1 19  ? 13.715  5.009   2.163   1.00 0.65  ? 19  ILE A HB   4  
ATOM 9172  H HG12 . ILE A 1 19  ? 14.395  2.922   0.076   1.00 0.83  ? 19  ILE A HG12 4  
ATOM 9173  H HG13 . ILE A 1 19  ? 15.495  4.223   0.532   1.00 0.77  ? 19  ILE A HG13 4  
ATOM 9174  H HG21 . ILE A 1 19  ? 11.477  4.162   1.951   1.00 1.13  ? 19  ILE A HG21 4  
ATOM 9175  H HG22 . ILE A 1 19  ? 12.530  2.761   2.133   1.00 1.26  ? 19  ILE A HG22 4  
ATOM 9176  H HG23 . ILE A 1 19  ? 11.912  3.197   0.543   1.00 1.33  ? 19  ILE A HG23 4  
ATOM 9177  H HD11 . ILE A 1 19  ? 14.355  2.107   2.382   1.00 1.45  ? 19  ILE A HD11 4  
ATOM 9178  H HD12 . ILE A 1 19  ? 15.360  3.459   2.904   1.00 1.18  ? 19  ILE A HD12 4  
ATOM 9179  H HD13 . ILE A 1 19  ? 16.027  2.226   1.835   1.00 1.28  ? 19  ILE A HD13 4  
ATOM 9180  N N    . MET A 1 20  ? 11.751  7.070   1.242   1.00 0.51  ? 20  MET A N    4  
ATOM 9181  C CA   . MET A 1 20  ? 10.430  7.723   1.474   1.00 0.60  ? 20  MET A CA   4  
ATOM 9182  C C    . MET A 1 20  ? 10.033  8.541   0.234   1.00 0.55  ? 20  MET A C    4  
ATOM 9183  O O    . MET A 1 20  ? 8.870   8.633   -0.103  1.00 0.59  ? 20  MET A O    4  
ATOM 9184  C CB   . MET A 1 20  ? 10.483  8.589   2.733   1.00 0.82  ? 20  MET A CB   4  
ATOM 9185  C CG   . MET A 1 20  ? 9.269   9.522   2.794   1.00 1.07  ? 20  MET A CG   4  
ATOM 9186  S SD   . MET A 1 20  ? 7.766   8.597   2.395   1.00 1.43  ? 20  MET A SD   4  
ATOM 9187  C CE   . MET A 1 20  ? 7.759   7.492   3.831   1.00 0.93  ? 20  MET A CE   4  
ATOM 9188  H H    . MET A 1 20  ? 12.534  7.261   1.798   1.00 0.57  ? 20  MET A H    4  
ATOM 9189  H HA   . MET A 1 20  ? 9.716   6.918   1.542   1.00 0.71  ? 20  MET A HA   4  
ATOM 9190  H HB2  . MET A 1 20  ? 10.508  7.955   3.601   1.00 0.95  ? 20  MET A HB2  4  
ATOM 9191  H HB3  . MET A 1 20  ? 11.384  9.186   2.708   1.00 1.15  ? 20  MET A HB3  4  
ATOM 9192  H HG2  . MET A 1 20  ? 9.183   9.937   3.787   1.00 1.52  ? 20  MET A HG2  4  
ATOM 9193  H HG3  . MET A 1 20  ? 9.397   10.323  2.080   1.00 1.72  ? 20  MET A HG3  4  
ATOM 9194  H HE1  . MET A 1 20  ? 6.786   7.520   4.292   1.00 1.32  ? 20  MET A HE1  4  
ATOM 9195  H HE2  . MET A 1 20  ? 8.495   7.809   4.548   1.00 1.36  ? 20  MET A HE2  4  
ATOM 9196  H HE3  . MET A 1 20  ? 7.984   6.485   3.510   1.00 1.55  ? 20  MET A HE3  4  
ATOM 9197  N N    . LYS A 1 21  ? 10.973  9.090   -0.476  1.00 0.57  ? 21  LYS A N    4  
ATOM 9198  C CA   . LYS A 1 21  ? 10.617  9.842   -1.714  1.00 0.61  ? 21  LYS A CA   4  
ATOM 9199  C C    . LYS A 1 21  ? 10.193  8.846   -2.802  1.00 0.53  ? 21  LYS A C    4  
ATOM 9200  O O    . LYS A 1 21  ? 9.327   9.129   -3.613  1.00 0.51  ? 21  LYS A O    4  
ATOM 9201  C CB   . LYS A 1 21  ? 11.819  10.656  -2.196  1.00 0.72  ? 21  LYS A CB   4  
ATOM 9202  C CG   . LYS A 1 21  ? 11.369  11.634  -3.284  1.00 1.09  ? 21  LYS A CG   4  
ATOM 9203  C CD   . LYS A 1 21  ? 12.595  12.258  -3.959  1.00 1.24  ? 21  LYS A CD   4  
ATOM 9204  C CE   . LYS A 1 21  ? 13.452  12.991  -2.918  1.00 1.80  ? 21  LYS A CE   4  
ATOM 9205  N NZ   . LYS A 1 21  ? 14.338  12.012  -2.226  1.00 2.40  ? 21  LYS A NZ   4  
ATOM 9206  H H    . LYS A 1 21  ? 11.913  8.982   -0.220  1.00 0.62  ? 21  LYS A H    4  
ATOM 9207  H HA   . LYS A 1 21  ? 9.773   10.499  -1.556  1.00 0.64  ? 21  LYS A HA   4  
ATOM 9208  H HB2  . LYS A 1 21  ? 12.235  11.207  -1.365  1.00 0.99  ? 21  LYS A HB2  4  
ATOM 9209  H HB3  . LYS A 1 21  ? 12.567  9.990   -2.600  1.00 0.93  ? 21  LYS A HB3  4  
ATOM 9210  H HG2  . LYS A 1 21  ? 10.783  11.105  -4.022  1.00 1.39  ? 21  LYS A HG2  4  
ATOM 9211  H HG3  . LYS A 1 21  ? 10.769  12.414  -2.841  1.00 1.41  ? 21  LYS A HG3  4  
ATOM 9212  H HD2  . LYS A 1 21  ? 13.183  11.479  -4.423  1.00 1.54  ? 21  LYS A HD2  4  
ATOM 9213  H HD3  . LYS A 1 21  ? 12.270  12.960  -4.712  1.00 1.52  ? 21  LYS A HD3  4  
ATOM 9214  H HE2  . LYS A 1 21  ? 14.060  13.735  -3.412  1.00 2.25  ? 21  LYS A HE2  4  
ATOM 9215  H HE3  . LYS A 1 21  ? 12.814  13.475  -2.192  1.00 2.26  ? 21  LYS A HE3  4  
ATOM 9216  H HZ1  . LYS A 1 21  ? 15.317  12.360  -2.239  1.00 2.80  ? 21  LYS A HZ1  4  
ATOM 9217  H HZ2  . LYS A 1 21  ? 14.288  11.095  -2.715  1.00 2.67  ? 21  LYS A HZ2  4  
ATOM 9218  H HZ3  . LYS A 1 21  ? 14.026  11.898  -1.241  1.00 2.91  ? 21  LYS A HZ3  4  
ATOM 9219  N N    . THR A 1 22  ? 10.772  7.677   -2.827  1.00 0.53  ? 22  THR A N    4  
ATOM 9220  C CA   . THR A 1 22  ? 10.384  6.673   -3.860  1.00 0.52  ? 22  THR A CA   4  
ATOM 9221  C C    . THR A 1 22  ? 8.949   6.200   -3.615  1.00 0.45  ? 22  THR A C    4  
ATOM 9222  O O    . THR A 1 22  ? 8.149   6.107   -4.523  1.00 0.48  ? 22  THR A O    4  
ATOM 9223  C CB   . THR A 1 22  ? 11.330  5.473   -3.762  1.00 0.55  ? 22  THR A CB   4  
ATOM 9224  O OG1  . THR A 1 22  ? 12.674  5.925   -3.843  1.00 0.64  ? 22  THR A OG1  4  
ATOM 9225  C CG2  . THR A 1 22  ? 11.046  4.500   -4.907  1.00 0.62  ? 22  THR A CG2  4  
ATOM 9226  H H    . THR A 1 22  ? 11.458  7.435   -2.169  1.00 0.56  ? 22  THR A H    4  
ATOM 9227  H HA   . THR A 1 22  ? 10.465  7.107   -4.845  1.00 0.57  ? 22  THR A HA   4  
ATOM 9228  H HB   . THR A 1 22  ? 11.176  4.969   -2.820  1.00 0.52  ? 22  THR A HB   4  
ATOM 9229  H HG1  . THR A 1 22  ? 12.879  6.395   -3.031  1.00 1.05  ? 22  THR A HG1  4  
ATOM 9230  H HG21 . THR A 1 22  ? 11.778  3.705   -4.893  1.00 1.17  ? 22  THR A HG21 4  
ATOM 9231  H HG22 . THR A 1 22  ? 11.104  5.025   -5.849  1.00 1.27  ? 22  THR A HG22 4  
ATOM 9232  H HG23 . THR A 1 22  ? 10.058  4.082   -4.787  1.00 1.12  ? 22  THR A HG23 4  
ATOM 9233  N N    . GLY A 1 23  ? 8.622   5.893   -2.392  1.00 0.42  ? 23  GLY A N    4  
ATOM 9234  C CA   . GLY A 1 23  ? 7.243   5.418   -2.073  1.00 0.43  ? 23  GLY A CA   4  
ATOM 9235  C C    . GLY A 1 23  ? 6.214   6.499   -2.404  1.00 0.41  ? 23  GLY A C    4  
ATOM 9236  O O    . GLY A 1 23  ? 5.134   6.203   -2.881  1.00 0.47  ? 23  GLY A O    4  
ATOM 9237  H H    . GLY A 1 23  ? 9.286   5.973   -1.675  1.00 0.42  ? 23  GLY A H    4  
ATOM 9238  H HA2  . GLY A 1 23  ? 7.015   4.535   -2.659  1.00 0.47  ? 23  GLY A HA2  4  
ATOM 9239  H HA3  . GLY A 1 23  ? 7.202   5.133   -1.036  1.00 0.46  ? 23  GLY A HA3  4  
ATOM 9240  N N    . ALA A 1 24  ? 6.532   7.746   -2.201  1.00 0.40  ? 24  ALA A N    4  
ATOM 9241  C CA   . ALA A 1 24  ? 5.567   8.826   -2.554  1.00 0.41  ? 24  ALA A CA   4  
ATOM 9242  C C    . ALA A 1 24  ? 5.293   8.798   -4.061  1.00 0.41  ? 24  ALA A C    4  
ATOM 9243  O O    . ALA A 1 24  ? 4.243   9.197   -4.524  1.00 0.41  ? 24  ALA A O    4  
ATOM 9244  C CB   . ALA A 1 24  ? 6.197   10.176  -2.209  1.00 0.42  ? 24  ALA A CB   4  
ATOM 9245  H H    . ALA A 1 24  ? 7.404   7.997   -1.835  1.00 0.44  ? 24  ALA A H    4  
ATOM 9246  H HA   . ALA A 1 24  ? 4.660   8.724   -1.978  1.00 0.41  ? 24  ALA A HA   4  
ATOM 9247  H HB1  . ALA A 1 24  ? 6.487   10.183  -1.169  1.00 1.06  ? 24  ALA A HB1  4  
ATOM 9248  H HB2  . ALA A 1 24  ? 5.476   10.963  -2.388  1.00 1.11  ? 24  ALA A HB2  4  
ATOM 9249  H HB3  . ALA A 1 24  ? 7.067   10.337  -2.828  1.00 1.11  ? 24  ALA A HB3  4  
ATOM 9250  N N    . LEU A 1 25  ? 6.248   8.328   -4.826  1.00 0.42  ? 25  LEU A N    4  
ATOM 9251  C CA   . LEU A 1 25  ? 6.069   8.267   -6.307  1.00 0.44  ? 25  LEU A CA   4  
ATOM 9252  C C    . LEU A 1 25  ? 5.113   7.117   -6.655  1.00 0.44  ? 25  LEU A C    4  
ATOM 9253  O O    . LEU A 1 25  ? 4.187   7.281   -7.423  1.00 0.46  ? 25  LEU A O    4  
ATOM 9254  C CB   . LEU A 1 25  ? 7.445   8.055   -6.976  1.00 0.47  ? 25  LEU A CB   4  
ATOM 9255  C CG   . LEU A 1 25  ? 7.966   9.373   -7.586  1.00 0.77  ? 25  LEU A CG   4  
ATOM 9256  C CD1  . LEU A 1 25  ? 7.094   9.789   -8.798  1.00 1.58  ? 25  LEU A CD1  4  
ATOM 9257  C CD2  . LEU A 1 25  ? 7.974   10.486  -6.513  1.00 1.67  ? 25  LEU A CD2  4  
ATOM 9258  H H    . LEU A 1 25  ? 7.079   8.003   -4.409  1.00 0.43  ? 25  LEU A H    4  
ATOM 9259  H HA   . LEU A 1 25  ? 5.629   9.193   -6.647  1.00 0.43  ? 25  LEU A HA   4  
ATOM 9260  H HB2  . LEU A 1 25  ? 8.149   7.712   -6.235  1.00 0.82  ? 25  LEU A HB2  4  
ATOM 9261  H HB3  . LEU A 1 25  ? 7.367   7.314   -7.760  1.00 0.85  ? 25  LEU A HB3  4  
ATOM 9262  H HG   . LEU A 1 25  ? 8.976   9.212   -7.928  1.00 1.46  ? 25  LEU A HG   4  
ATOM 9263  H HD11 . LEU A 1 25  ? 7.699   9.761   -9.693  1.00 2.16  ? 25  LEU A HD11 4  
ATOM 9264  H HD12 . LEU A 1 25  ? 6.713   10.791  -8.661  1.00 2.10  ? 25  LEU A HD12 4  
ATOM 9265  H HD13 . LEU A 1 25  ? 6.261   9.107   -8.914  1.00 2.08  ? 25  LEU A HD13 4  
ATOM 9266  H HD21 . LEU A 1 25  ? 8.139   10.055  -5.536  1.00 2.29  ? 25  LEU A HD21 4  
ATOM 9267  H HD22 . LEU A 1 25  ? 7.031   11.013  -6.519  1.00 2.15  ? 25  LEU A HD22 4  
ATOM 9268  H HD23 . LEU A 1 25  ? 8.770   11.183  -6.732  1.00 2.16  ? 25  LEU A HD23 4  
ATOM 9269  N N    . LEU A 1 26  ? 5.355   5.948   -6.125  1.00 0.45  ? 26  LEU A N    4  
ATOM 9270  C CA   . LEU A 1 26  ? 4.480   4.786   -6.459  1.00 0.47  ? 26  LEU A CA   4  
ATOM 9271  C C    . LEU A 1 26  ? 3.010   5.193   -6.346  1.00 0.49  ? 26  LEU A C    4  
ATOM 9272  O O    . LEU A 1 26  ? 2.243   5.021   -7.272  1.00 0.52  ? 26  LEU A O    4  
ATOM 9273  C CB   . LEU A 1 26  ? 4.771   3.615   -5.515  1.00 0.51  ? 26  LEU A CB   4  
ATOM 9274  C CG   . LEU A 1 26  ? 6.284   3.403   -5.407  1.00 0.69  ? 26  LEU A CG   4  
ATOM 9275  C CD1  . LEU A 1 26  ? 6.571   2.178   -4.534  1.00 1.17  ? 26  LEU A CD1  4  
ATOM 9276  C CD2  . LEU A 1 26  ? 6.882   3.201   -6.806  1.00 1.35  ? 26  LEU A CD2  4  
ATOM 9277  H H    . LEU A 1 26  ? 6.121   5.838   -5.525  1.00 0.46  ? 26  LEU A H    4  
ATOM 9278  H HA   . LEU A 1 26  ? 4.675   4.486   -7.478  1.00 0.49  ? 26  LEU A HA   4  
ATOM 9279  H HB2  . LEU A 1 26  ? 4.366   3.834   -4.537  1.00 0.80  ? 26  LEU A HB2  4  
ATOM 9280  H HB3  . LEU A 1 26  ? 4.310   2.719   -5.902  1.00 0.81  ? 26  LEU A HB3  4  
ATOM 9281  H HG   . LEU A 1 26  ? 6.731   4.272   -4.951  1.00 1.43  ? 26  LEU A HG   4  
ATOM 9282  H HD11 . LEU A 1 26  ? 6.202   2.354   -3.534  1.00 1.78  ? 26  LEU A HD11 4  
ATOM 9283  H HD12 . LEU A 1 26  ? 7.636   2.003   -4.499  1.00 1.70  ? 26  LEU A HD12 4  
ATOM 9284  H HD13 . LEU A 1 26  ? 6.078   1.313   -4.953  1.00 1.68  ? 26  LEU A HD13 4  
ATOM 9285  H HD21 . LEU A 1 26  ? 6.237   2.558   -7.387  1.00 1.84  ? 26  LEU A HD21 4  
ATOM 9286  H HD22 . LEU A 1 26  ? 7.859   2.746   -6.719  1.00 1.93  ? 26  LEU A HD22 4  
ATOM 9287  H HD23 . LEU A 1 26  ? 6.977   4.157   -7.298  1.00 1.89  ? 26  LEU A HD23 4  
ATOM 9288  N N    . LEU A 1 27  ? 2.597   5.717   -5.225  1.00 0.50  ? 27  LEU A N    4  
ATOM 9289  C CA   . LEU A 1 27  ? 1.164   6.103   -5.100  1.00 0.56  ? 27  LEU A CA   4  
ATOM 9290  C C    . LEU A 1 27  ? 0.827   7.154   -6.160  1.00 0.56  ? 27  LEU A C    4  
ATOM 9291  O O    . LEU A 1 27  ? -0.097  6.992   -6.928  1.00 0.60  ? 27  LEU A O    4  
ATOM 9292  C CB   . LEU A 1 27  ? 0.869   6.662   -3.704  1.00 0.64  ? 27  LEU A CB   4  
ATOM 9293  C CG   . LEU A 1 27  ? 1.547   5.804   -2.643  1.00 0.95  ? 27  LEU A CG   4  
ATOM 9294  C CD1  . LEU A 1 27  ? 1.173   6.335   -1.258  1.00 1.66  ? 27  LEU A CD1  4  
ATOM 9295  C CD2  . LEU A 1 27  ? 1.074   4.353   -2.784  1.00 1.42  ? 27  LEU A CD2  4  
ATOM 9296  H H    . LEU A 1 27  ? 3.220   5.836   -4.477  1.00 0.49  ? 27  LEU A H    4  
ATOM 9297  H HA   . LEU A 1 27  ? 0.567   5.224   -5.289  1.00 0.58  ? 27  LEU A HA   4  
ATOM 9298  H HB2  . LEU A 1 27  ? 1.238   7.675   -3.635  1.00 1.45  ? 27  LEU A HB2  4  
ATOM 9299  H HB3  . LEU A 1 27  ? -0.194  6.655   -3.533  1.00 1.04  ? 27  LEU A HB3  4  
ATOM 9300  H HG   . LEU A 1 27  ? 2.616   5.856   -2.772  1.00 1.71  ? 27  LEU A HG   4  
ATOM 9301  H HD11 . LEU A 1 27  ? 0.098   6.335   -1.152  1.00 2.02  ? 27  LEU A HD11 4  
ATOM 9302  H HD12 . LEU A 1 27  ? 1.546   7.343   -1.147  1.00 2.23  ? 27  LEU A HD12 4  
ATOM 9303  H HD13 . LEU A 1 27  ? 1.610   5.703   -0.499  1.00 2.21  ? 27  LEU A HD13 4  
ATOM 9304  H HD21 . LEU A 1 27  ? 1.560   3.896   -3.632  1.00 1.98  ? 27  LEU A HD21 4  
ATOM 9305  H HD22 . LEU A 1 27  ? 0.002   4.335   -2.931  1.00 1.93  ? 27  LEU A HD22 4  
ATOM 9306  H HD23 . LEU A 1 27  ? 1.322   3.803   -1.888  1.00 1.88  ? 27  LEU A HD23 4  
ATOM 9307  N N    . GLN A 1 28  ? 1.566   8.230   -6.208  1.00 0.55  ? 28  GLN A N    4  
ATOM 9308  C CA   . GLN A 1 28  ? 1.279   9.294   -7.217  1.00 0.58  ? 28  GLN A CA   4  
ATOM 9309  C C    . GLN A 1 28  ? 1.042   8.665   -8.596  1.00 0.54  ? 28  GLN A C    4  
ATOM 9310  O O    . GLN A 1 28  ? 0.146   9.050   -9.321  1.00 0.58  ? 28  GLN A O    4  
ATOM 9311  C CB   . GLN A 1 28  ? 2.476   10.245  -7.300  1.00 0.60  ? 28  GLN A CB   4  
ATOM 9312  C CG   . GLN A 1 28  ? 2.161   11.379  -8.278  1.00 1.00  ? 28  GLN A CG   4  
ATOM 9313  C CD   . GLN A 1 28  ? 3.261   12.440  -8.203  1.00 1.40  ? 28  GLN A CD   4  
ATOM 9314  O OE1  . GLN A 1 28  ? 4.013   12.485  -7.250  1.00 2.09  ? 28  GLN A OE1  4  
ATOM 9315  N NE2  . GLN A 1 28  ? 3.386   13.302  -9.175  1.00 1.91  ? 28  GLN A NE2  4  
ATOM 9316  H H    . GLN A 1 28  ? 2.307   8.344   -5.577  1.00 0.53  ? 28  GLN A H    4  
ATOM 9317  H HA   . GLN A 1 28  ? 0.410   9.851   -6.899  1.00 0.65  ? 28  GLN A HA   4  
ATOM 9318  H HB2  . GLN A 1 28  ? 2.676   10.658  -6.321  1.00 0.99  ? 28  GLN A HB2  4  
ATOM 9319  H HB3  . GLN A 1 28  ? 3.344   9.704   -7.646  1.00 0.92  ? 28  GLN A HB3  4  
ATOM 9320  H HG2  . GLN A 1 28  ? 2.109   10.983  -9.282  1.00 1.47  ? 28  GLN A HG2  4  
ATOM 9321  H HG3  . GLN A 1 28  ? 1.214   11.826  -8.018  1.00 1.50  ? 28  GLN A HG3  4  
ATOM 9322  H HE21 . GLN A 1 28  ? 2.779   13.267  -9.943  1.00 2.26  ? 28  GLN A HE21 4  
ATOM 9323  H HE22 . GLN A 1 28  ? 4.088   13.986  -9.136  1.00 2.37  ? 28  GLN A HE22 4  
ATOM 9324  N N    . GLY A 1 29  ? 1.857   7.713   -8.968  1.00 0.50  ? 29  GLY A N    4  
ATOM 9325  C CA   . GLY A 1 29  ? 1.705   7.068   -10.305 1.00 0.48  ? 29  GLY A CA   4  
ATOM 9326  C C    . GLY A 1 29  ? 0.547   6.065   -10.289 1.00 0.44  ? 29  GLY A C    4  
ATOM 9327  O O    . GLY A 1 29  ? -0.461  6.261   -10.937 1.00 0.50  ? 29  GLY A O    4  
ATOM 9328  H H    . GLY A 1 29  ? 2.583   7.438   -8.370  1.00 0.50  ? 29  GLY A H    4  
ATOM 9329  H HA2  . GLY A 1 29  ? 1.508   7.828   -11.047 1.00 0.49  ? 29  GLY A HA2  4  
ATOM 9330  H HA3  . GLY A 1 29  ? 2.618   6.551   -10.557 1.00 0.50  ? 29  GLY A HA3  4  
ATOM 9331  N N    . PHE A 1 30  ? 0.689   4.985   -9.566  1.00 0.44  ? 30  PHE A N    4  
ATOM 9332  C CA   . PHE A 1 30  ? -0.399  3.961   -9.523  1.00 0.43  ? 30  PHE A CA   4  
ATOM 9333  C C    . PHE A 1 30  ? -1.753  4.651   -9.321  1.00 0.40  ? 30  PHE A C    4  
ATOM 9334  O O    . PHE A 1 30  ? -2.761  4.209   -9.835  1.00 0.43  ? 30  PHE A O    4  
ATOM 9335  C CB   . PHE A 1 30  ? -0.134  2.981   -8.363  1.00 0.47  ? 30  PHE A CB   4  
ATOM 9336  C CG   . PHE A 1 30  ? -1.416  2.262   -7.977  1.00 0.47  ? 30  PHE A CG   4  
ATOM 9337  C CD1  . PHE A 1 30  ? -2.040  1.406   -8.893  1.00 1.20  ? 30  PHE A CD1  4  
ATOM 9338  C CD2  . PHE A 1 30  ? -1.985  2.466   -6.712  1.00 1.39  ? 30  PHE A CD2  4  
ATOM 9339  C CE1  . PHE A 1 30  ? -3.230  0.754   -8.546  1.00 1.21  ? 30  PHE A CE1  4  
ATOM 9340  C CE2  . PHE A 1 30  ? -3.173  1.812   -6.365  1.00 1.42  ? 30  PHE A CE2  4  
ATOM 9341  C CZ   . PHE A 1 30  ? -3.796  0.957   -7.282  1.00 0.58  ? 30  PHE A CZ   4  
ATOM 9342  H H    . PHE A 1 30  ? 1.516   4.841   -9.060  1.00 0.53  ? 30  PHE A H    4  
ATOM 9343  H HA   . PHE A 1 30  ? -0.407  3.410   -10.452 1.00 0.42  ? 30  PHE A HA   4  
ATOM 9344  H HB2  . PHE A 1 30  ? 0.601   2.252   -8.675  1.00 0.46  ? 30  PHE A HB2  4  
ATOM 9345  H HB3  . PHE A 1 30  ? 0.245   3.527   -7.513  1.00 0.54  ? 30  PHE A HB3  4  
ATOM 9346  H HD1  . PHE A 1 30  ? -1.604  1.248   -9.869  1.00 2.10  ? 30  PHE A HD1  4  
ATOM 9347  H HD2  . PHE A 1 30  ? -1.506  3.125   -6.004  1.00 2.27  ? 30  PHE A HD2  4  
ATOM 9348  H HE1  . PHE A 1 30  ? -3.711  0.095   -9.253  1.00 2.09  ? 30  PHE A HE1  4  
ATOM 9349  H HE2  . PHE A 1 30  ? -3.610  1.969   -5.391  1.00 2.33  ? 30  PHE A HE2  4  
ATOM 9350  H HZ   . PHE A 1 30  ? -4.714  0.455   -7.014  1.00 0.65  ? 30  PHE A HZ   4  
ATOM 9351  N N    . ILE A 1 31  ? -1.793  5.714   -8.569  1.00 0.40  ? 31  ILE A N    4  
ATOM 9352  C CA   . ILE A 1 31  ? -3.097  6.392   -8.342  1.00 0.40  ? 31  ILE A CA   4  
ATOM 9353  C C    . ILE A 1 31  ? -3.531  7.133   -9.610  1.00 0.40  ? 31  ILE A C    4  
ATOM 9354  O O    . ILE A 1 31  ? -4.646  6.979   -10.069 1.00 0.43  ? 31  ILE A O    4  
ATOM 9355  C CB   . ILE A 1 31  ? -2.987  7.393   -7.176  1.00 0.41  ? 31  ILE A CB   4  
ATOM 9356  C CG1  . ILE A 1 31  ? -2.833  6.629   -5.861  1.00 0.53  ? 31  ILE A CG1  4  
ATOM 9357  C CG2  . ILE A 1 31  ? -4.258  8.249   -7.131  1.00 0.72  ? 31  ILE A CG2  4  
ATOM 9358  C CD1  . ILE A 1 31  ? -2.440  7.604   -4.752  1.00 0.48  ? 31  ILE A CD1  4  
ATOM 9359  H H    . ILE A 1 31  ? -0.977  6.058   -8.149  1.00 0.44  ? 31  ILE A H    4  
ATOM 9360  H HA   . ILE A 1 31  ? -3.841  5.647   -8.105  1.00 0.43  ? 31  ILE A HA   4  
ATOM 9361  H HB   . ILE A 1 31  ? -2.133  8.034   -7.331  1.00 0.63  ? 31  ILE A HB   4  
ATOM 9362  H HG12 . ILE A 1 31  ? -3.770  6.152   -5.610  1.00 0.77  ? 31  ILE A HG12 4  
ATOM 9363  H HG13 . ILE A 1 31  ? -2.064  5.879   -5.968  1.00 0.81  ? 31  ILE A HG13 4  
ATOM 9364  H HG21 . ILE A 1 31  ? -5.125  7.613   -7.223  1.00 1.21  ? 31  ILE A HG21 4  
ATOM 9365  H HG22 . ILE A 1 31  ? -4.244  8.965   -7.938  1.00 1.35  ? 31  ILE A HG22 4  
ATOM 9366  H HG23 . ILE A 1 31  ? -4.296  8.774   -6.188  1.00 1.33  ? 31  ILE A HG23 4  
ATOM 9367  H HD11 . ILE A 1 31  ? -1.442  7.971   -4.935  1.00 1.20  ? 31  ILE A HD11 4  
ATOM 9368  H HD12 . ILE A 1 31  ? -2.474  7.096   -3.797  1.00 0.94  ? 31  ILE A HD12 4  
ATOM 9369  H HD13 . ILE A 1 31  ? -3.129  8.433   -4.743  1.00 1.15  ? 31  ILE A HD13 4  
ATOM 9370  N N    . GLN A 1 32  ? -2.692  7.969   -10.158 1.00 0.42  ? 32  GLN A N    4  
ATOM 9371  C CA   . GLN A 1 32  ? -3.119  8.740   -11.360 1.00 0.47  ? 32  GLN A CA   4  
ATOM 9372  C C    . GLN A 1 32  ? -3.160  7.839   -12.594 1.00 0.50  ? 32  GLN A C    4  
ATOM 9373  O O    . GLN A 1 32  ? -3.898  8.075   -13.529 1.00 0.61  ? 32  GLN A O    4  
ATOM 9374  C CB   . GLN A 1 32  ? -2.139  9.888   -11.610 1.00 0.57  ? 32  GLN A CB   4  
ATOM 9375  C CG   . GLN A 1 32  ? -2.233  10.916  -10.473 1.00 1.19  ? 32  GLN A CG   4  
ATOM 9376  C CD   . GLN A 1 32  ? -1.595  12.234  -10.917 1.00 1.59  ? 32  GLN A CD   4  
ATOM 9377  O OE1  . GLN A 1 32  ? -1.968  12.791  -11.932 1.00 2.16  ? 32  GLN A OE1  4  
ATOM 9378  N NE2  . GLN A 1 32  ? -0.646  12.762  -10.195 1.00 2.21  ? 32  GLN A NE2  4  
ATOM 9379  H H    . GLN A 1 32  ? -1.807  8.117   -9.763  1.00 0.42  ? 32  GLN A H    4  
ATOM 9380  H HA   . GLN A 1 32  ? -4.091  9.156   -11.135 1.00 0.48  ? 32  GLN A HA   4  
ATOM 9381  H HB2  . GLN A 1 32  ? -1.134  9.496   -11.659 1.00 0.98  ? 32  GLN A HB2  4  
ATOM 9382  H HB3  . GLN A 1 32  ? -2.385  10.366  -12.547 1.00 1.06  ? 32  GLN A HB3  4  
ATOM 9383  H HG2  . GLN A 1 32  ? -3.269  11.090  -10.220 1.00 1.85  ? 32  GLN A HG2  4  
ATOM 9384  H HG3  . GLN A 1 32  ? -1.709  10.542  -9.606  1.00 1.72  ? 32  GLN A HG3  4  
ATOM 9385  H HE21 . GLN A 1 32  ? -0.347  12.314  -9.377  1.00 2.56  ? 32  GLN A HE21 4  
ATOM 9386  H HE22 . GLN A 1 32  ? -0.233  13.607  -10.471 1.00 2.71  ? 32  GLN A HE22 4  
ATOM 9387  N N    . ASP A 1 33  ? -2.353  6.808   -12.605 1.00 0.49  ? 33  ASP A N    4  
ATOM 9388  C CA   . ASP A 1 33  ? -2.300  5.875   -13.767 1.00 0.58  ? 33  ASP A CA   4  
ATOM 9389  C C    . ASP A 1 33  ? -3.620  5.133   -13.935 1.00 0.61  ? 33  ASP A C    4  
ATOM 9390  O O    . ASP A 1 33  ? -4.201  5.111   -15.002 1.00 0.70  ? 33  ASP A O    4  
ATOM 9391  C CB   . ASP A 1 33  ? -1.207  4.838   -13.493 1.00 0.61  ? 33  ASP A CB   4  
ATOM 9392  C CG   . ASP A 1 33  ? 0.159   5.526   -13.476 1.00 1.10  ? 33  ASP A CG   4  
ATOM 9393  O OD1  . ASP A 1 33  ? 0.314   6.509   -14.182 1.00 1.78  ? 33  ASP A OD1  4  
ATOM 9394  O OD2  . ASP A 1 33  ? 1.026   5.059   -12.757 1.00 1.89  ? 33  ASP A OD2  4  
ATOM 9395  H H    . ASP A 1 33  ? -1.755  6.614   -11.853 1.00 0.49  ? 33  ASP A H    4  
ATOM 9396  H HA   . ASP A 1 33  ? -2.046  6.399   -14.675 1.00 0.64  ? 33  ASP A HA   4  
ATOM 9397  H HB2  . ASP A 1 33  ? -1.387  4.371   -12.535 1.00 1.22  ? 33  ASP A HB2  4  
ATOM 9398  H HB3  . ASP A 1 33  ? -1.221  4.086   -14.268 1.00 1.02  ? 33  ASP A HB3  4  
ATOM 9399  N N    . ARG A 1 34  ? -4.087  4.497   -12.895 1.00 0.58  ? 34  ARG A N    4  
ATOM 9400  C CA   . ARG A 1 34  ? -5.356  3.728   -13.007 1.00 0.71  ? 34  ARG A CA   4  
ATOM 9401  C C    . ARG A 1 34  ? -6.553  4.635   -12.756 1.00 0.65  ? 34  ARG A C    4  
ATOM 9402  O O    . ARG A 1 34  ? -7.610  4.405   -13.311 1.00 0.85  ? 34  ARG A O    4  
ATOM 9403  C CB   . ARG A 1 34  ? -5.371  2.577   -11.991 1.00 0.85  ? 34  ARG A CB   4  
ATOM 9404  C CG   . ARG A 1 34  ? -6.668  1.763   -12.151 1.00 1.25  ? 34  ARG A CG   4  
ATOM 9405  C CD   . ARG A 1 34  ? -6.682  0.579   -11.168 1.00 1.31  ? 34  ARG A CD   4  
ATOM 9406  N NE   . ARG A 1 34  ? -7.420  -0.578  -11.773 1.00 1.58  ? 34  ARG A NE   4  
ATOM 9407  C CZ   . ARG A 1 34  ? -8.590  -0.421  -12.341 1.00 2.09  ? 34  ARG A CZ   4  
ATOM 9408  N NH1  . ARG A 1 34  ? -9.227  0.714   -12.253 1.00 2.58  ? 34  ARG A NH1  4  
ATOM 9409  N NH2  . ARG A 1 34  ? -9.151  -1.428  -12.953 1.00 2.75  ? 34  ARG A NH2  4  
ATOM 9410  H H    . ARG A 1 34  ? -3.598  4.518   -12.046 1.00 0.52  ? 34  ARG A H    4  
ATOM 9411  H HA   . ARG A 1 34  ? -5.444  3.322   -14.005 1.00 0.89  ? 34  ARG A HA   4  
ATOM 9412  H HB2  . ARG A 1 34  ? -4.519  1.935   -12.164 1.00 1.23  ? 34  ARG A HB2  4  
ATOM 9413  H HB3  . ARG A 1 34  ? -5.322  2.979   -10.991 1.00 1.14  ? 34  ARG A HB3  4  
ATOM 9414  H HG2  . ARG A 1 34  ? -7.512  2.404   -11.954 1.00 1.91  ? 34  ARG A HG2  4  
ATOM 9415  H HG3  . ARG A 1 34  ? -6.732  1.388   -13.162 1.00 1.90  ? 34  ARG A HG3  4  
ATOM 9416  H HD2  . ARG A 1 34  ? -5.673  0.260   -10.967 1.00 1.72  ? 34  ARG A HD2  4  
ATOM 9417  H HD3  . ARG A 1 34  ? -7.148  0.887   -10.237 1.00 2.00  ? 34  ARG A HD3  4  
ATOM 9418  H HE   . ARG A 1 34  ? -6.999  -1.463  -11.781 1.00 2.02  ? 34  ARG A HE   4  
ATOM 9419  H HH11 . ARG A 1 34  ? -8.831  1.472   -11.745 1.00 2.61  ? 34  ARG A HH11 4  
ATOM 9420  H HH12 . ARG A 1 34  ? -10.116 0.823   -12.699 1.00 3.26  ? 34  ARG A HH12 4  
ATOM 9421  H HH21 . ARG A 1 34  ? -8.688  -2.314  -12.986 1.00 3.04  ? 34  ARG A HH21 4  
ATOM 9422  H HH22 . ARG A 1 34  ? -10.044 -1.315  -13.387 1.00 3.25  ? 34  ARG A HH22 4  
ATOM 9423  N N    . ALA A 1 35  ? -6.434  5.657   -11.928 1.00 0.59  ? 35  ALA A N    4  
ATOM 9424  C CA   . ALA A 1 35  ? -7.629  6.534   -11.677 1.00 0.66  ? 35  ALA A CA   4  
ATOM 9425  C C    . ALA A 1 35  ? -7.521  7.795   -12.536 1.00 0.80  ? 35  ALA A C    4  
ATOM 9426  O O    . ALA A 1 35  ? -8.479  8.225   -13.147 1.00 0.88  ? 35  ALA A O    4  
ATOM 9427  C CB   . ALA A 1 35  ? -7.694  6.906   -10.193 1.00 0.94  ? 35  ALA A CB   4  
ATOM 9428  H H    . ALA A 1 35  ? -5.584  5.846   -11.476 1.00 0.67  ? 35  ALA A H    4  
ATOM 9429  H HA   . ALA A 1 35  ? -8.493  5.950   -11.958 1.00 0.91  ? 35  ALA A HA   4  
ATOM 9430  H HB1  . ALA A 1 35  ? -7.413  6.051   -9.595  1.00 1.48  ? 35  ALA A HB1  4  
ATOM 9431  H HB2  . ALA A 1 35  ? -8.698  7.206   -9.942  1.00 1.33  ? 35  ALA A HB2  4  
ATOM 9432  H HB3  . ALA A 1 35  ? -7.012  7.722   -9.993  1.00 1.41  ? 35  ALA A HB3  4  
ATOM 9433  N N    . GLY A 1 36  ? -6.360  8.395   -12.588 1.00 1.15  ? 36  GLY A N    4  
ATOM 9434  C CA   . GLY A 1 36  ? -6.187  9.629   -13.403 1.00 1.62  ? 36  GLY A CA   4  
ATOM 9435  C C    . GLY A 1 36  ? -6.197  9.284   -14.893 1.00 1.54  ? 36  GLY A C    4  
ATOM 9436  O O    . GLY A 1 36  ? -6.283  10.144  -15.746 1.00 2.10  ? 36  GLY A O    4  
ATOM 9437  H H    . GLY A 1 36  ? -5.589  8.046   -12.093 1.00 1.22  ? 36  GLY A H    4  
ATOM 9438  H HA2  . GLY A 1 36  ? -6.998  10.316  -13.201 1.00 2.27  ? 36  GLY A HA2  4  
ATOM 9439  H HA3  . GLY A 1 36  ? -5.244  10.092  -13.154 1.00 2.17  ? 36  GLY A HA3  4  
ATOM 9440  N N    . ARG A 1 37  ? -6.096  8.018   -15.204 1.00 2.07  ? 37  ARG A N    4  
ATOM 9441  C CA   . ARG A 1 37  ? -6.089  7.589   -16.631 1.00 2.87  ? 37  ARG A CA   4  
ATOM 9442  C C    . ARG A 1 37  ? -4.825  8.126   -17.316 1.00 3.46  ? 37  ARG A C    4  
ATOM 9443  O O    . ARG A 1 37  ? -3.757  8.143   -16.736 1.00 4.10  ? 37  ARG A O    4  
ATOM 9444  C CB   . ARG A 1 37  ? -7.347  8.129   -17.332 1.00 3.63  ? 37  ARG A CB   4  
ATOM 9445  C CG   . ARG A 1 37  ? -7.726  7.217   -18.506 1.00 4.34  ? 37  ARG A CG   4  
ATOM 9446  C CD   . ARG A 1 37  ? -8.713  7.940   -19.424 1.00 5.18  ? 37  ARG A CD   4  
ATOM 9447  N NE   . ARG A 1 37  ? -9.792  8.557   -18.605 1.00 5.74  ? 37  ARG A NE   4  
ATOM 9448  C CZ   . ARG A 1 37  ? -10.566 9.468   -19.128 1.00 6.53  ? 37  ARG A CZ   4  
ATOM 9449  N NH1  . ARG A 1 37  ? -10.390 9.838   -20.367 1.00 6.88  ? 37  ARG A NH1  4  
ATOM 9450  N NH2  . ARG A 1 37  ? -11.514 10.008  -18.413 1.00 7.21  ? 37  ARG A NH2  4  
ATOM 9451  H H    . ARG A 1 37  ? -6.021  7.347   -14.494 1.00 2.46  ? 37  ARG A H    4  
ATOM 9452  H HA   . ARG A 1 37  ? -6.084  6.508   -16.673 1.00 3.07  ? 37  ARG A HA   4  
ATOM 9453  H HB2  . ARG A 1 37  ? -8.163  8.156   -16.624 1.00 3.83  ? 37  ARG A HB2  4  
ATOM 9454  H HB3  . ARG A 1 37  ? -7.161  9.129   -17.699 1.00 3.99  ? 37  ARG A HB3  4  
ATOM 9455  H HG2  . ARG A 1 37  ? -6.838  6.960   -19.063 1.00 4.58  ? 37  ARG A HG2  4  
ATOM 9456  H HG3  . ARG A 1 37  ? -8.186  6.316   -18.127 1.00 4.48  ? 37  ARG A HG3  4  
ATOM 9457  H HD2  . ARG A 1 37  ? -8.193  8.711   -19.974 1.00 5.49  ? 37  ARG A HD2  4  
ATOM 9458  H HD3  . ARG A 1 37  ? -9.146  7.234   -20.116 1.00 5.44  ? 37  ARG A HD3  4  
ATOM 9459  H HE   . ARG A 1 37  ? -9.922  8.279   -17.674 1.00 5.74  ? 37  ARG A HE   4  
ATOM 9460  H HH11 . ARG A 1 37  ? -9.662  9.423   -20.913 1.00 6.59  ? 37  ARG A HH11 4  
ATOM 9461  H HH12 . ARG A 1 37  ? -10.982 10.535  -20.769 1.00 7.60  ? 37  ARG A HH12 4  
ATOM 9462  H HH21 . ARG A 1 37  ? -11.648 9.724   -17.463 1.00 7.21  ? 37  ARG A HH21 4  
ATOM 9463  H HH22 . ARG A 1 37  ? -12.107 10.706  -18.815 1.00 7.88  ? 37  ARG A HH22 4  
ATOM 9464  N N    . MET A 1 38  ? -4.939  8.567   -18.544 1.00 3.74  ? 38  MET A N    4  
ATOM 9465  C CA   . MET A 1 38  ? -3.747  9.108   -19.270 1.00 4.68  ? 38  MET A CA   4  
ATOM 9466  C C    . MET A 1 38  ? -4.170  10.320  -20.104 1.00 4.70  ? 38  MET A C    4  
ATOM 9467  O O    . MET A 1 38  ? -5.311  10.443  -20.504 1.00 5.17  ? 38  MET A O    4  
ATOM 9468  C CB   . MET A 1 38  ? -3.170  8.029   -20.194 1.00 5.62  ? 38  MET A CB   4  
ATOM 9469  C CG   . MET A 1 38  ? -4.275  7.465   -21.092 1.00 5.93  ? 38  MET A CG   4  
ATOM 9470  S SD   . MET A 1 38  ? -3.543  6.350   -22.317 1.00 6.79  ? 38  MET A SD   4  
ATOM 9471  C CE   . MET A 1 38  ? -3.668  4.827   -21.348 1.00 7.04  ? 38  MET A CE   4  
ATOM 9472  H H    . MET A 1 38  ? -5.812  8.545   -18.989 1.00 3.65  ? 38  MET A H    4  
ATOM 9473  H HA   . MET A 1 38  ? -2.990  9.414   -18.560 1.00 5.03  ? 38  MET A HA   4  
ATOM 9474  H HB2  . MET A 1 38  ? -2.394  8.461   -20.808 1.00 5.87  ? 38  MET A HB2  4  
ATOM 9475  H HB3  . MET A 1 38  ? -2.754  7.231   -19.597 1.00 6.19  ? 38  MET A HB3  4  
ATOM 9476  H HG2  . MET A 1 38  ? -4.985  6.920   -20.490 1.00 6.03  ? 38  MET A HG2  4  
ATOM 9477  H HG3  . MET A 1 38  ? -4.778  8.274   -21.599 1.00 5.95  ? 38  MET A HG3  4  
ATOM 9478  H HE1  . MET A 1 38  ? -3.171  4.024   -21.874 1.00 7.30  ? 38  MET A HE1  4  
ATOM 9479  H HE2  . MET A 1 38  ? -4.706  4.573   -21.206 1.00 7.32  ? 38  MET A HE2  4  
ATOM 9480  H HE3  . MET A 1 38  ? -3.201  4.976   -20.384 1.00 6.96  ? 38  MET A HE3  4  
ATOM 9481  N N    . GLY A 1 39  ? -3.259  11.217  -20.370 1.00 4.57  ? 39  GLY A N    4  
ATOM 9482  C CA   . GLY A 1 39  ? -3.613  12.419  -21.177 1.00 4.85  ? 39  GLY A CA   4  
ATOM 9483  C C    . GLY A 1 39  ? -2.393  13.335  -21.301 1.00 4.67  ? 39  GLY A C    4  
ATOM 9484  O O    . GLY A 1 39  ? -1.504  13.091  -22.093 1.00 4.95  ? 39  GLY A O    4  
ATOM 9485  H H    . GLY A 1 39  ? -2.345  11.101  -20.038 1.00 4.53  ? 39  GLY A H    4  
ATOM 9486  H HA2  . GLY A 1 39  ? -3.934  12.109  -22.161 1.00 5.27  ? 39  GLY A HA2  4  
ATOM 9487  H HA3  . GLY A 1 39  ? -4.413  12.956  -20.690 1.00 5.09  ? 39  GLY A HA3  4  
ATOM 9488  N N    . GLY A 1 40  ? -2.339  14.387  -20.531 1.00 4.58  ? 40  GLY A N    4  
ATOM 9489  C CA   . GLY A 1 40  ? -1.171  15.310  -20.616 1.00 4.69  ? 40  GLY A CA   4  
ATOM 9490  C C    . GLY A 1 40  ? -1.295  16.397  -19.547 1.00 4.20  ? 40  GLY A C    4  
ATOM 9491  O O    . GLY A 1 40  ? -0.519  17.331  -19.504 1.00 4.34  ? 40  GLY A O    4  
ATOM 9492  H H    . GLY A 1 40  ? -3.065  14.570  -19.898 1.00 4.70  ? 40  GLY A H    4  
ATOM 9493  H HA2  . GLY A 1 40  ? -0.259  14.751  -20.459 1.00 5.07  ? 40  GLY A HA2  4  
ATOM 9494  H HA3  . GLY A 1 40  ? -1.147  15.771  -21.592 1.00 5.10  ? 40  GLY A HA3  4  
ATOM 9495  N N    . GLU A 1 41  ? -2.265  16.279  -18.683 1.00 4.01  ? 41  GLU A N    4  
ATOM 9496  C CA   . GLU A 1 41  ? -2.447  17.299  -17.610 1.00 3.88  ? 41  GLU A CA   4  
ATOM 9497  C C    . GLU A 1 41  ? -3.186  16.648  -16.436 1.00 3.63  ? 41  GLU A C    4  
ATOM 9498  O O    . GLU A 1 41  ? -3.756  15.583  -16.567 1.00 4.16  ? 41  GLU A O    4  
ATOM 9499  C CB   . GLU A 1 41  ? -3.253  18.489  -18.159 1.00 4.26  ? 41  GLU A CB   4  
ATOM 9500  C CG   . GLU A 1 41  ? -4.270  17.998  -19.194 1.00 4.51  ? 41  GLU A CG   4  
ATOM 9501  C CD   . GLU A 1 41  ? -5.158  16.920  -18.571 1.00 4.90  ? 41  GLU A CD   4  
ATOM 9502  O OE1  . GLU A 1 41  ? -6.113  17.281  -17.903 1.00 5.28  ? 41  GLU A OE1  4  
ATOM 9503  O OE2  . GLU A 1 41  ? -4.868  15.753  -18.773 1.00 5.19  ? 41  GLU A OE2  4  
ATOM 9504  H H    . GLU A 1 41  ? -2.876  15.515  -18.738 1.00 4.25  ? 41  GLU A H    4  
ATOM 9505  H HA   . GLU A 1 41  ? -1.478  17.643  -17.272 1.00 4.04  ? 41  GLU A HA   4  
ATOM 9506  H HB2  . GLU A 1 41  ? -3.773  18.984  -17.350 1.00 4.56  ? 41  GLU A HB2  4  
ATOM 9507  H HB3  . GLU A 1 41  ? -2.580  19.191  -18.630 1.00 4.55  ? 41  GLU A HB3  4  
ATOM 9508  H HG2  . GLU A 1 41  ? -4.883  18.828  -19.515 1.00 4.73  ? 41  GLU A HG2  4  
ATOM 9509  H HG3  . GLU A 1 41  ? -3.750  17.587  -20.046 1.00 4.68  ? 41  GLU A HG3  4  
ATOM 9510  N N    . ALA A 1 42  ? -3.177  17.269  -15.288 1.00 3.19  ? 42  ALA A N    4  
ATOM 9511  C CA   . ALA A 1 42  ? -3.870  16.679  -14.107 1.00 3.24  ? 42  ALA A CA   4  
ATOM 9512  C C    . ALA A 1 42  ? -3.907  17.733  -12.986 1.00 2.77  ? 42  ALA A C    4  
ATOM 9513  O O    . ALA A 1 42  ? -3.024  17.751  -12.152 1.00 3.06  ? 42  ALA A O    4  
ATOM 9514  C CB   . ALA A 1 42  ? -3.080  15.467  -13.613 1.00 4.08  ? 42  ALA A CB   4  
ATOM 9515  H H    . ALA A 1 42  ? -2.715  18.127  -15.179 1.00 3.13  ? 42  ALA A H    4  
ATOM 9516  H HA   . ALA A 1 42  ? -4.864  16.369  -14.379 1.00 3.53  ? 42  ALA A HA   4  
ATOM 9517  H HB1  . ALA A 1 42  ? -3.063  14.709  -14.382 1.00 4.56  ? 42  ALA A HB1  4  
ATOM 9518  H HB2  . ALA A 1 42  ? -3.550  15.071  -12.725 1.00 4.42  ? 42  ALA A HB2  4  
ATOM 9519  H HB3  . ALA A 1 42  ? -2.069  15.768  -13.380 1.00 4.35  ? 42  ALA A HB3  4  
ATOM 9520  N N    . PRO A 1 43  ? -4.894  18.606  -12.999 1.00 2.70  ? 43  PRO A N    4  
ATOM 9521  C CA   . PRO A 1 43  ? -4.977  19.672  -11.983 1.00 3.03  ? 43  PRO A CA   4  
ATOM 9522  C C    . PRO A 1 43  ? -5.083  19.075  -10.570 1.00 2.67  ? 43  PRO A C    4  
ATOM 9523  O O    . PRO A 1 43  ? -5.099  19.794  -9.591  1.00 2.87  ? 43  PRO A O    4  
ATOM 9524  C CB   . PRO A 1 43  ? -6.237  20.484  -12.356 1.00 3.84  ? 43  PRO A CB   4  
ATOM 9525  C CG   . PRO A 1 43  ? -6.829  19.863  -13.654 1.00 3.86  ? 43  PRO A CG   4  
ATOM 9526  C CD   . PRO A 1 43  ? -5.987  18.614  -13.998 1.00 3.12  ? 43  PRO A CD   4  
ATOM 9527  H HA   . PRO A 1 43  ? -4.100  20.298  -12.052 1.00 3.46  ? 43  PRO A HA   4  
ATOM 9528  H HB2  . PRO A 1 43  ? -6.966  20.432  -11.556 1.00 4.15  ? 43  PRO A HB2  4  
ATOM 9529  H HB3  . PRO A 1 43  ? -5.972  21.516  -12.537 1.00 4.45  ? 43  PRO A HB3  4  
ATOM 9530  H HG2  . PRO A 1 43  ? -7.863  19.582  -13.490 1.00 4.34  ? 43  PRO A HG2  4  
ATOM 9531  H HG3  . PRO A 1 43  ? -6.772  20.575  -14.466 1.00 4.30  ? 43  PRO A HG3  4  
ATOM 9532  H HD2  . PRO A 1 43  ? -6.594  17.723  -13.901 1.00 3.37  ? 43  PRO A HD2  4  
ATOM 9533  H HD3  . PRO A 1 43  ? -5.580  18.687  -14.996 1.00 3.16  ? 43  PRO A HD3  4  
ATOM 9534  N N    . GLU A 1 44  ? -5.156  17.777  -10.449 1.00 2.45  ? 44  GLU A N    4  
ATOM 9535  C CA   . GLU A 1 44  ? -5.261  17.175  -9.089  1.00 2.23  ? 44  GLU A CA   4  
ATOM 9536  C C    . GLU A 1 44  ? -3.915  17.304  -8.371  1.00 1.75  ? 44  GLU A C    4  
ATOM 9537  O O    . GLU A 1 44  ? -3.405  18.391  -8.188  1.00 2.00  ? 44  GLU A O    4  
ATOM 9538  C CB   . GLU A 1 44  ? -5.676  15.693  -9.196  1.00 2.55  ? 44  GLU A CB   4  
ATOM 9539  C CG   . GLU A 1 44  ? -7.189  15.594  -9.189  1.00 2.70  ? 44  GLU A CG   4  
ATOM 9540  C CD   . GLU A 1 44  ? -7.778  16.432  -10.325 1.00 3.17  ? 44  GLU A CD   4  
ATOM 9541  O OE1  . GLU A 1 44  ? -7.819  15.937  -11.439 1.00 3.77  ? 44  GLU A OE1  4  
ATOM 9542  O OE2  . GLU A 1 44  ? -8.181  17.553  -10.061 1.00 3.42  ? 44  GLU A OE2  4  
ATOM 9543  H H    . GLU A 1 44  ? -5.143  17.204  -11.245 1.00 2.65  ? 44  GLU A H    4  
ATOM 9544  H HA   . GLU A 1 44  ? -6.004  17.720  -8.522  1.00 2.52  ? 44  GLU A HA   4  
ATOM 9545  H HB2  . GLU A 1 44  ? -5.291  15.258  -10.104 1.00 3.09  ? 44  GLU A HB2  4  
ATOM 9546  H HB3  . GLU A 1 44  ? -5.311  15.141  -8.346  1.00 2.66  ? 44  GLU A HB3  4  
ATOM 9547  H HG2  . GLU A 1 44  ? -7.473  14.564  -9.307  1.00 2.90  ? 44  GLU A HG2  4  
ATOM 9548  H HG3  . GLU A 1 44  ? -7.547  15.965  -8.243  1.00 2.84  ? 44  GLU A HG3  4  
ATOM 9549  N N    . LEU A 1 45  ? -3.337  16.211  -7.952  1.00 1.80  ? 45  LEU A N    4  
ATOM 9550  C CA   . LEU A 1 45  ? -2.044  16.287  -7.244  1.00 1.80  ? 45  LEU A CA   4  
ATOM 9551  C C    . LEU A 1 45  ? -1.084  17.133  -8.076  1.00 2.29  ? 45  LEU A C    4  
ATOM 9552  O O    . LEU A 1 45  ? -0.191  17.778  -7.561  1.00 3.01  ? 45  LEU A O    4  
ATOM 9553  C CB   . LEU A 1 45  ? -1.475  14.871  -7.050  1.00 2.23  ? 45  LEU A CB   4  
ATOM 9554  C CG   . LEU A 1 45  ? -2.613  13.884  -6.668  1.00 2.52  ? 45  LEU A CG   4  
ATOM 9555  C CD1  . LEU A 1 45  ? -3.086  13.108  -7.906  1.00 3.22  ? 45  LEU A CD1  4  
ATOM 9556  C CD2  . LEU A 1 45  ? -2.109  12.881  -5.622  1.00 3.00  ? 45  LEU A CD2  4  
ATOM 9557  H H    . LEU A 1 45  ? -3.757  15.345  -8.098  1.00 2.30  ? 45  LEU A H    4  
ATOM 9558  H HA   . LEU A 1 45  ? -2.204  16.746  -6.282  1.00 1.80  ? 45  LEU A HA   4  
ATOM 9559  H HB2  . LEU A 1 45  ? -0.999  14.547  -7.967  1.00 2.70  ? 45  LEU A HB2  4  
ATOM 9560  H HB3  . LEU A 1 45  ? -0.738  14.898  -6.260  1.00 2.51  ? 45  LEU A HB3  4  
ATOM 9561  H HG   . LEU A 1 45  ? -3.450  14.433  -6.256  1.00 2.66  ? 45  LEU A HG   4  
ATOM 9562  H HD11 . LEU A 1 45  ? -3.228  13.790  -8.731  1.00 3.55  ? 45  LEU A HD11 4  
ATOM 9563  H HD12 . LEU A 1 45  ? -4.019  12.613  -7.684  1.00 3.48  ? 45  LEU A HD12 4  
ATOM 9564  H HD13 . LEU A 1 45  ? -2.343  12.370  -8.174  1.00 3.69  ? 45  LEU A HD13 4  
ATOM 9565  H HD21 . LEU A 1 45  ? -1.796  13.413  -4.735  1.00 3.29  ? 45  LEU A HD21 4  
ATOM 9566  H HD22 . LEU A 1 45  ? -1.272  12.331  -6.025  1.00 3.34  ? 45  LEU A HD22 4  
ATOM 9567  H HD23 . LEU A 1 45  ? -2.904  12.196  -5.370  1.00 3.35  ? 45  LEU A HD23 4  
ATOM 9568  N N    . ALA A 1 46  ? -1.268  17.125  -9.368  1.00 2.46  ? 46  ALA A N    4  
ATOM 9569  C CA   . ALA A 1 46  ? -0.369  17.919  -10.255 1.00 3.15  ? 46  ALA A CA   4  
ATOM 9570  C C    . ALA A 1 46  ? 1.091   17.586  -9.930  1.00 2.91  ? 46  ALA A C    4  
ATOM 9571  O O    . ALA A 1 46  ? 1.623   16.587  -10.371 1.00 3.07  ? 46  ALA A O    4  
ATOM 9572  C CB   . ALA A 1 46  ? -0.613  19.413  -10.028 1.00 4.05  ? 46  ALA A CB   4  
ATOM 9573  H H    . ALA A 1 46  ? -1.995  16.580  -9.757  1.00 2.52  ? 46  ALA A H    4  
ATOM 9574  H HA   . ALA A 1 46  ? -0.572  17.674  -11.287 1.00 3.67  ? 46  ALA A HA   4  
ATOM 9575  H HB1  . ALA A 1 46  ? -0.482  19.645  -8.981  1.00 4.47  ? 46  ALA A HB1  4  
ATOM 9576  H HB2  . ALA A 1 46  ? -1.619  19.664  -10.329 1.00 4.32  ? 46  ALA A HB2  4  
ATOM 9577  H HB3  . ALA A 1 46  ? 0.091   19.986  -10.614 1.00 4.43  ? 46  ALA A HB3  4  
ATOM 9578  N N    . LEU A 1 47  ? 1.741   18.417  -9.159  1.00 3.18  ? 47  LEU A N    4  
ATOM 9579  C CA   . LEU A 1 47  ? 3.165   18.151  -8.802  1.00 3.43  ? 47  LEU A CA   4  
ATOM 9580  C C    . LEU A 1 47  ? 4.007   18.082  -10.082 1.00 3.14  ? 47  LEU A C    4  
ATOM 9581  O O    . LEU A 1 47  ? 5.026   17.424  -10.132 1.00 3.51  ? 47  LEU A O    4  
ATOM 9582  C CB   . LEU A 1 47  ? 3.257   16.817  -8.035  1.00 4.05  ? 47  LEU A CB   4  
ATOM 9583  C CG   . LEU A 1 47  ? 4.518   16.794  -7.142  1.00 4.77  ? 47  LEU A CG   4  
ATOM 9584  C CD1  . LEU A 1 47  ? 4.225   17.464  -5.794  1.00 5.26  ? 47  LEU A CD1  4  
ATOM 9585  C CD2  . LEU A 1 47  ? 4.946   15.344  -6.889  1.00 5.35  ? 47  LEU A CD2  4  
ATOM 9586  H H    . LEU A 1 47  ? 1.291   19.216  -8.814  1.00 3.59  ? 47  LEU A H    4  
ATOM 9587  H HA   . LEU A 1 47  ? 3.529   18.954  -8.181  1.00 3.88  ? 47  LEU A HA   4  
ATOM 9588  H HB2  . LEU A 1 47  ? 2.376   16.702  -7.418  1.00 4.17  ? 47  LEU A HB2  4  
ATOM 9589  H HB3  . LEU A 1 47  ? 3.301   16.000  -8.742  1.00 4.35  ? 47  LEU A HB3  4  
ATOM 9590  H HG   . LEU A 1 47  ? 5.322   17.323  -7.637  1.00 5.01  ? 47  LEU A HG   4  
ATOM 9591  H HD11 . LEU A 1 47  ? 3.429   16.933  -5.294  1.00 5.48  ? 47  LEU A HD11 4  
ATOM 9592  H HD12 . LEU A 1 47  ? 3.929   18.489  -5.952  1.00 5.52  ? 47  LEU A HD12 4  
ATOM 9593  H HD13 . LEU A 1 47  ? 5.113   17.438  -5.180  1.00 5.56  ? 47  LEU A HD13 4  
ATOM 9594  H HD21 . LEU A 1 47  ? 4.122   14.796  -6.456  1.00 5.82  ? 47  LEU A HD21 4  
ATOM 9595  H HD22 . LEU A 1 47  ? 5.785   15.329  -6.210  1.00 5.59  ? 47  LEU A HD22 4  
ATOM 9596  H HD23 . LEU A 1 47  ? 5.232   14.884  -7.824  1.00 5.48  ? 47  LEU A HD23 4  
ATOM 9597  N N    . ASP A 1 48  ? 3.579   18.765  -11.112 1.00 3.02  ? 48  ASP A N    4  
ATOM 9598  C CA   . ASP A 1 48  ? 4.332   18.764  -12.403 1.00 3.07  ? 48  ASP A CA   4  
ATOM 9599  C C    . ASP A 1 48  ? 4.416   17.323  -12.960 1.00 2.77  ? 48  ASP A C    4  
ATOM 9600  O O    . ASP A 1 48  ? 4.519   16.389  -12.190 1.00 2.85  ? 48  ASP A O    4  
ATOM 9601  C CB   . ASP A 1 48  ? 5.749   19.304  -12.173 1.00 3.61  ? 48  ASP A CB   4  
ATOM 9602  C CG   . ASP A 1 48  ? 5.686   20.538  -11.271 1.00 4.22  ? 48  ASP A CG   4  
ATOM 9603  O OD1  . ASP A 1 48  ? 5.383   21.605  -11.781 1.00 4.69  ? 48  ASP A OD1  4  
ATOM 9604  O OD2  . ASP A 1 48  ? 5.942   20.396  -10.087 1.00 4.68  ? 48  ASP A OD2  4  
ATOM 9605  H H    . ASP A 1 48  ? 2.754   19.287  -11.036 1.00 3.25  ? 48  ASP A H    4  
ATOM 9606  H HA   . ASP A 1 48  ? 3.817   19.407  -13.090 1.00 3.56  ? 48  ASP A HA   4  
ATOM 9607  H HB2  . ASP A 1 48  ? 6.356   18.544  -11.702 1.00 4.01  ? 48  ASP A HB2  4  
ATOM 9608  H HB3  . ASP A 1 48  ? 6.187   19.577  -13.121 1.00 3.81  ? 48  ASP A HB3  4  
ATOM 9609  N N    . PRO A 1 49  ? 4.386   17.163  -14.275 1.00 3.11  ? 49  PRO A N    4  
ATOM 9610  C CA   . PRO A 1 49  ? 4.480   15.818  -14.882 1.00 3.40  ? 49  PRO A CA   4  
ATOM 9611  C C    . PRO A 1 49  ? 5.813   15.164  -14.488 1.00 3.08  ? 49  PRO A C    4  
ATOM 9612  O O    . PRO A 1 49  ? 6.864   15.552  -14.959 1.00 3.32  ? 49  PRO A O    4  
ATOM 9613  C CB   . PRO A 1 49  ? 4.408   16.060  -16.409 1.00 4.36  ? 49  PRO A CB   4  
ATOM 9614  C CG   . PRO A 1 49  ? 4.365   17.598  -16.637 1.00 4.66  ? 49  PRO A CG   4  
ATOM 9615  C CD   . PRO A 1 49  ? 4.258   18.270  -15.251 1.00 3.86  ? 49  PRO A CD   4  
ATOM 9616  H HA   . PRO A 1 49  ? 3.652   15.203  -14.561 1.00 3.68  ? 49  PRO A HA   4  
ATOM 9617  H HB2  . PRO A 1 49  ? 5.277   15.636  -16.900 1.00 4.57  ? 49  PRO A HB2  4  
ATOM 9618  H HB3  . PRO A 1 49  ? 3.511   15.609  -16.812 1.00 4.94  ? 49  PRO A HB3  4  
ATOM 9619  H HG2  . PRO A 1 49  ? 5.270   17.921  -17.138 1.00 5.13  ? 49  PRO A HG2  4  
ATOM 9620  H HG3  . PRO A 1 49  ? 3.504   17.860  -17.238 1.00 5.26  ? 49  PRO A HG3  4  
ATOM 9621  H HD2  . PRO A 1 49  ? 5.053   18.992  -15.114 1.00 4.06  ? 49  PRO A HD2  4  
ATOM 9622  H HD3  . PRO A 1 49  ? 3.293   18.746  -15.147 1.00 4.03  ? 49  PRO A HD3  4  
ATOM 9623  N N    . VAL A 1 50  ? 5.781   14.178  -13.631 1.00 3.08  ? 50  VAL A N    4  
ATOM 9624  C CA   . VAL A 1 50  ? 7.050   13.511  -13.216 1.00 3.10  ? 50  VAL A CA   4  
ATOM 9625  C C    . VAL A 1 50  ? 7.411   12.423  -14.254 1.00 2.75  ? 50  VAL A C    4  
ATOM 9626  O O    . VAL A 1 50  ? 6.554   11.633  -14.598 1.00 2.91  ? 50  VAL A O    4  
ATOM 9627  C CB   . VAL A 1 50  ? 6.837   12.852  -11.852 1.00 3.88  ? 50  VAL A CB   4  
ATOM 9628  C CG1  . VAL A 1 50  ? 8.190   12.437  -11.271 1.00 4.44  ? 50  VAL A CG1  4  
ATOM 9629  C CG2  . VAL A 1 50  ? 6.166   13.853  -10.907 1.00 4.50  ? 50  VAL A CG2  4  
ATOM 9630  H H    . VAL A 1 50  ? 4.925   13.878  -13.261 1.00 3.41  ? 50  VAL A H    4  
ATOM 9631  H HA   . VAL A 1 50  ? 7.814   14.262  -13.122 1.00 3.39  ? 50  VAL A HA   4  
ATOM 9632  H HB   . VAL A 1 50  ? 6.208   11.981  -11.964 1.00 4.18  ? 50  VAL A HB   4  
ATOM 9633  H HG11 . VAL A 1 50  ? 8.831   13.303  -11.198 1.00 4.70  ? 50  VAL A HG11 4  
ATOM 9634  H HG12 . VAL A 1 50  ? 8.648   11.703  -11.917 1.00 4.81  ? 50  VAL A HG12 4  
ATOM 9635  H HG13 . VAL A 1 50  ? 8.045   12.012  -10.289 1.00 4.69  ? 50  VAL A HG13 4  
ATOM 9636  H HG21 . VAL A 1 50  ? 6.123   13.436  -9.911  1.00 4.87  ? 50  VAL A HG21 4  
ATOM 9637  H HG22 . VAL A 1 50  ? 5.165   14.061  -11.254 1.00 4.87  ? 50  VAL A HG22 4  
ATOM 9638  H HG23 . VAL A 1 50  ? 6.738   14.769  -10.888 1.00 4.69  ? 50  VAL A HG23 4  
ATOM 9639  N N    . PRO A 1 51  ? 8.643   12.379  -14.735 1.00 2.91  ? 51  PRO A N    4  
ATOM 9640  C CA   . PRO A 1 51  ? 9.029   11.350  -15.724 1.00 3.22  ? 51  PRO A CA   4  
ATOM 9641  C C    . PRO A 1 51  ? 8.770   9.946   -15.153 1.00 2.93  ? 51  PRO A C    4  
ATOM 9642  O O    . PRO A 1 51  ? 9.013   9.683   -13.992 1.00 3.37  ? 51  PRO A O    4  
ATOM 9643  C CB   . PRO A 1 51  ? 10.534  11.588  -15.986 1.00 4.09  ? 51  PRO A CB   4  
ATOM 9644  C CG   . PRO A 1 51  ? 10.970  12.816  -15.136 1.00 4.27  ? 51  PRO A CG   4  
ATOM 9645  C CD   . PRO A 1 51  ? 9.730   13.312  -14.359 1.00 3.50  ? 51  PRO A CD   4  
ATOM 9646  H HA   . PRO A 1 51  ? 8.468   11.487  -16.637 1.00 3.54  ? 51  PRO A HA   4  
ATOM 9647  H HB2  . PRO A 1 51  ? 11.109  10.714  -15.697 1.00 4.31  ? 51  PRO A HB2  4  
ATOM 9648  H HB3  . PRO A 1 51  ? 10.699  11.796  -17.035 1.00 4.69  ? 51  PRO A HB3  4  
ATOM 9649  H HG2  . PRO A 1 51  ? 11.752  12.526  -14.444 1.00 4.68  ? 51  PRO A HG2  4  
ATOM 9650  H HG3  . PRO A 1 51  ? 11.334  13.603  -15.783 1.00 4.85  ? 51  PRO A HG3  4  
ATOM 9651  H HD2  . PRO A 1 51  ? 9.911   13.271  -13.292 1.00 3.62  ? 51  PRO A HD2  4  
ATOM 9652  H HD3  . PRO A 1 51  ? 9.477   14.318  -14.661 1.00 3.69  ? 51  PRO A HD3  4  
ATOM 9653  N N    . GLN A 1 52  ? 8.277   9.044   -15.964 1.00 2.70  ? 52  GLN A N    4  
ATOM 9654  C CA   . GLN A 1 52  ? 8.000   7.660   -15.475 1.00 2.85  ? 52  GLN A CA   4  
ATOM 9655  C C    . GLN A 1 52  ? 9.263   6.804   -15.596 1.00 2.14  ? 52  GLN A C    4  
ATOM 9656  O O    . GLN A 1 52  ? 9.508   6.181   -16.610 1.00 2.38  ? 52  GLN A O    4  
ATOM 9657  C CB   . GLN A 1 52  ? 6.886   7.033   -16.318 1.00 3.67  ? 52  GLN A CB   4  
ATOM 9658  C CG   . GLN A 1 52  ? 5.591   7.826   -16.133 1.00 4.37  ? 52  GLN A CG   4  
ATOM 9659  C CD   . GLN A 1 52  ? 5.037   7.578   -14.728 1.00 5.22  ? 52  GLN A CD   4  
ATOM 9660  O OE1  . GLN A 1 52  ? 5.359   8.294   -13.801 1.00 5.74  ? 52  GLN A OE1  4  
ATOM 9661  N NE2  . GLN A 1 52  ? 4.210   6.588   -14.530 1.00 5.74  ? 52  GLN A NE2  4  
ATOM 9662  H H    . GLN A 1 52  ? 8.089   9.278   -16.896 1.00 2.82  ? 52  GLN A H    4  
ATOM 9663  H HA   . GLN A 1 52  ? 7.688   7.696   -14.441 1.00 3.35  ? 52  GLN A HA   4  
ATOM 9664  H HB2  . GLN A 1 52  ? 7.172   7.047   -17.359 1.00 4.06  ? 52  GLN A HB2  4  
ATOM 9665  H HB3  . GLN A 1 52  ? 6.728   6.012   -16.002 1.00 3.91  ? 52  GLN A HB3  4  
ATOM 9666  H HG2  . GLN A 1 52  ? 5.792   8.880   -16.260 1.00 4.50  ? 52  GLN A HG2  4  
ATOM 9667  H HG3  . GLN A 1 52  ? 4.866   7.504   -16.865 1.00 4.63  ? 52  GLN A HG3  4  
ATOM 9668  H HE21 . GLN A 1 52  ? 3.950   6.010   -15.277 1.00 5.63  ? 52  GLN A HE21 4  
ATOM 9669  H HE22 . GLN A 1 52  ? 3.850   6.422   -13.634 1.00 6.45  ? 52  GLN A HE22 4  
ATOM 9670  N N    . ASP A 1 53  ? 10.061  6.761   -14.565 1.00 1.78  ? 53  ASP A N    4  
ATOM 9671  C CA   . ASP A 1 53  ? 11.303  5.937   -14.610 1.00 1.30  ? 53  ASP A CA   4  
ATOM 9672  C C    . ASP A 1 53  ? 10.947  4.477   -14.906 1.00 1.07  ? 53  ASP A C    4  
ATOM 9673  O O    . ASP A 1 53  ? 9.841   4.031   -14.674 1.00 1.19  ? 53  ASP A O    4  
ATOM 9674  C CB   . ASP A 1 53  ? 12.027  6.023   -13.265 1.00 1.65  ? 53  ASP A CB   4  
ATOM 9675  C CG   . ASP A 1 53  ? 12.334  7.487   -12.942 1.00 2.27  ? 53  ASP A CG   4  
ATOM 9676  O OD1  . ASP A 1 53  ? 13.324  7.990   -13.447 1.00 2.91  ? 53  ASP A OD1  4  
ATOM 9677  O OD2  . ASP A 1 53  ? 11.573  8.079   -12.194 1.00 2.80  ? 53  ASP A OD2  4  
ATOM 9678  H H    . ASP A 1 53  ? 9.838   7.266   -13.756 1.00 2.24  ? 53  ASP A H    4  
ATOM 9679  H HA   . ASP A 1 53  ? 11.958  6.282   -15.397 1.00 1.41  ? 53  ASP A HA   4  
ATOM 9680  H HB2  . ASP A 1 53  ? 11.399  5.607   -12.492 1.00 2.08  ? 53  ASP A HB2  4  
ATOM 9681  H HB3  . ASP A 1 53  ? 12.951  5.467   -13.317 1.00 2.01  ? 53  ASP A HB3  4  
ATOM 9682  N N    . ALA A 1 54  ? 11.887  3.738   -15.433 1.00 0.91  ? 54  ALA A N    4  
ATOM 9683  C CA   . ALA A 1 54  ? 11.636  2.307   -15.772 1.00 0.84  ? 54  ALA A CA   4  
ATOM 9684  C C    . ALA A 1 54  ? 11.487  1.476   -14.496 1.00 0.76  ? 54  ALA A C    4  
ATOM 9685  O O    . ALA A 1 54  ? 10.791  0.479   -14.476 1.00 0.75  ? 54  ALA A O    4  
ATOM 9686  C CB   . ALA A 1 54  ? 12.819  1.772   -16.583 1.00 0.95  ? 54  ALA A CB   4  
ATOM 9687  H H    . ALA A 1 54  ? 12.767  4.131   -15.616 1.00 0.99  ? 54  ALA A H    4  
ATOM 9688  H HA   . ALA A 1 54  ? 10.736  2.222   -16.362 1.00 0.99  ? 54  ALA A HA   4  
ATOM 9689  H HB1  . ALA A 1 54  ? 13.720  1.838   -15.991 1.00 1.41  ? 54  ALA A HB1  4  
ATOM 9690  H HB2  . ALA A 1 54  ? 12.935  2.361   -17.481 1.00 1.35  ? 54  ALA A HB2  4  
ATOM 9691  H HB3  . ALA A 1 54  ? 12.637  0.742   -16.848 1.00 1.49  ? 54  ALA A HB3  4  
ATOM 9692  N N    . SER A 1 55  ? 12.128  1.870   -13.432 1.00 0.75  ? 55  SER A N    4  
ATOM 9693  C CA   . SER A 1 55  ? 12.012  1.091   -12.165 1.00 0.71  ? 55  SER A CA   4  
ATOM 9694  C C    . SER A 1 55  ? 10.615  1.286   -11.576 1.00 0.66  ? 55  SER A C    4  
ATOM 9695  O O    . SER A 1 55  ? 9.953   0.342   -11.193 1.00 0.66  ? 55  SER A O    4  
ATOM 9696  C CB   . SER A 1 55  ? 13.059  1.585   -11.168 1.00 0.76  ? 55  SER A CB   4  
ATOM 9697  O OG   . SER A 1 55  ? 14.356  1.389   -11.715 1.00 1.37  ? 55  SER A OG   4  
ATOM 9698  H H    . SER A 1 55  ? 12.681  2.678   -13.458 1.00 0.79  ? 55  SER A H    4  
ATOM 9699  H HA   . SER A 1 55  ? 12.174  0.042   -12.366 1.00 0.71  ? 55  SER A HA   4  
ATOM 9700  H HB2  . SER A 1 55  ? 12.910  2.635   -10.977 1.00 0.95  ? 55  SER A HB2  4  
ATOM 9701  H HB3  . SER A 1 55  ? 12.960  1.035   -10.242 1.00 1.26  ? 55  SER A HB3  4  
ATOM 9702  H HG   . SER A 1 55  ? 14.995  1.770   -11.108 1.00 1.82  ? 55  SER A HG   4  
ATOM 9703  N N    . THR A 1 56  ? 10.166  2.507   -11.493 1.00 0.65  ? 56  THR A N    4  
ATOM 9704  C CA   . THR A 1 56  ? 8.817   2.771   -10.921 1.00 0.62  ? 56  THR A CA   4  
ATOM 9705  C C    . THR A 1 56  ? 7.740   2.373   -11.932 1.00 0.59  ? 56  THR A C    4  
ATOM 9706  O O    . THR A 1 56  ? 6.647   1.990   -11.567 1.00 0.57  ? 56  THR A O    4  
ATOM 9707  C CB   . THR A 1 56  ? 8.677   4.267   -10.617 1.00 0.67  ? 56  THR A CB   4  
ATOM 9708  O OG1  . THR A 1 56  ? 9.222   5.017   -11.694 1.00 1.09  ? 56  THR A OG1  4  
ATOM 9709  C CG2  . THR A 1 56  ? 9.418   4.619   -9.328  1.00 1.06  ? 56  THR A CG2  4  
ATOM 9710  H H    . THR A 1 56  ? 10.720  3.253   -11.805 1.00 0.67  ? 56  THR A H    4  
ATOM 9711  H HA   . THR A 1 56  ? 8.690   2.201   -10.012 1.00 0.61  ? 56  THR A HA   4  
ATOM 9712  H HB   . THR A 1 56  ? 7.632   4.517   -10.501 1.00 1.01  ? 56  THR A HB   4  
ATOM 9713  H HG1  . THR A 1 56  ? 9.266   5.937   -11.423 1.00 1.69  ? 56  THR A HG1  4  
ATOM 9714  H HG21 . THR A 1 56  ? 9.305   5.673   -9.124  1.00 1.65  ? 56  THR A HG21 4  
ATOM 9715  H HG22 . THR A 1 56  ? 10.466  4.383   -9.440  1.00 1.60  ? 56  THR A HG22 4  
ATOM 9716  H HG23 . THR A 1 56  ? 9.005   4.047   -8.510  1.00 1.42  ? 56  THR A HG23 4  
ATOM 9717  N N    . LYS A 1 57  ? 8.028   2.481   -13.200 1.00 0.61  ? 57  LYS A N    4  
ATOM 9718  C CA   . LYS A 1 57  ? 6.999   2.129   -14.215 1.00 0.59  ? 57  LYS A CA   4  
ATOM 9719  C C    . LYS A 1 57  ? 6.620   0.653   -14.078 1.00 0.54  ? 57  LYS A C    4  
ATOM 9720  O O    . LYS A 1 57  ? 5.480   0.278   -14.273 1.00 0.52  ? 57  LYS A O    4  
ATOM 9721  C CB   . LYS A 1 57  ? 7.539   2.410   -15.621 1.00 0.65  ? 57  LYS A CB   4  
ATOM 9722  C CG   . LYS A 1 57  ? 6.528   1.932   -16.672 1.00 1.20  ? 57  LYS A CG   4  
ATOM 9723  C CD   . LYS A 1 57  ? 6.808   2.619   -18.013 1.00 1.33  ? 57  LYS A CD   4  
ATOM 9724  C CE   . LYS A 1 57  ? 8.235   2.303   -18.466 1.00 1.94  ? 57  LYS A CE   4  
ATOM 9725  N NZ   . LYS A 1 57  ? 8.402   2.702   -19.892 1.00 2.73  ? 57  LYS A NZ   4  
ATOM 9726  H H    . LYS A 1 57  ? 8.908   2.807   -13.481 1.00 0.68  ? 57  LYS A H    4  
ATOM 9727  H HA   . LYS A 1 57  ? 6.126   2.738   -14.032 1.00 0.59  ? 57  LYS A HA   4  
ATOM 9728  H HB2  . LYS A 1 57  ? 7.704   3.473   -15.733 1.00 0.96  ? 57  LYS A HB2  4  
ATOM 9729  H HB3  . LYS A 1 57  ? 8.473   1.886   -15.758 1.00 1.25  ? 57  LYS A HB3  4  
ATOM 9730  H HG2  . LYS A 1 57  ? 6.615   0.862   -16.793 1.00 1.84  ? 57  LYS A HG2  4  
ATOM 9731  H HG3  . LYS A 1 57  ? 5.526   2.176   -16.350 1.00 1.68  ? 57  LYS A HG3  4  
ATOM 9732  H HD2  . LYS A 1 57  ? 6.107   2.261   -18.754 1.00 1.66  ? 57  LYS A HD2  4  
ATOM 9733  H HD3  . LYS A 1 57  ? 6.697   3.687   -17.900 1.00 1.74  ? 57  LYS A HD3  4  
ATOM 9734  H HE2  . LYS A 1 57  ? 8.936   2.852   -17.855 1.00 2.29  ? 57  LYS A HE2  4  
ATOM 9735  H HE3  . LYS A 1 57  ? 8.419   1.244   -18.364 1.00 2.31  ? 57  LYS A HE3  4  
ATOM 9736  H HZ1  . LYS A 1 57  ? 9.358   2.450   -20.213 1.00 3.19  ? 57  LYS A HZ1  4  
ATOM 9737  H HZ2  . LYS A 1 57  ? 8.264   3.729   -19.983 1.00 3.07  ? 57  LYS A HZ2  4  
ATOM 9738  H HZ3  . LYS A 1 57  ? 7.700   2.204   -20.476 1.00 3.14  ? 57  LYS A HZ3  4  
ATOM 9739  N N    . LYS A 1 58  ? 7.554   -0.199  -13.745 1.00 0.55  ? 58  LYS A N    4  
ATOM 9740  C CA   . LYS A 1 58  ? 7.210   -1.646  -13.604 1.00 0.53  ? 58  LYS A CA   4  
ATOM 9741  C C    . LYS A 1 58  ? 6.483   -1.839  -12.266 1.00 0.48  ? 58  LYS A C    4  
ATOM 9742  O O    . LYS A 1 58  ? 5.491   -2.537  -12.190 1.00 0.46  ? 58  LYS A O    4  
ATOM 9743  C CB   . LYS A 1 58  ? 8.503   -2.479  -13.675 1.00 0.56  ? 58  LYS A CB   4  
ATOM 9744  C CG   . LYS A 1 58  ? 8.292   -3.906  -13.143 1.00 0.78  ? 58  LYS A CG   4  
ATOM 9745  C CD   . LYS A 1 58  ? 7.210   -4.620  -13.955 1.00 0.96  ? 58  LYS A CD   4  
ATOM 9746  C CE   . LYS A 1 58  ? 7.096   -6.068  -13.480 1.00 0.85  ? 58  LYS A CE   4  
ATOM 9747  N NZ   . LYS A 1 58  ? 6.630   -6.084  -12.065 1.00 1.75  ? 58  LYS A NZ   4  
ATOM 9748  H H    . LYS A 1 58  ? 8.474   0.102   -13.589 1.00 0.59  ? 58  LYS A H    4  
ATOM 9749  H HA   . LYS A 1 58  ? 6.540   -1.909  -14.410 1.00 0.53  ? 58  LYS A HA   4  
ATOM 9750  H HB2  . LYS A 1 58  ? 8.832   -2.533  -14.703 1.00 0.79  ? 58  LYS A HB2  4  
ATOM 9751  H HB3  . LYS A 1 58  ? 9.268   -1.993  -13.087 1.00 0.71  ? 58  LYS A HB3  4  
ATOM 9752  H HG2  . LYS A 1 58  ? 9.219   -4.455  -13.232 1.00 1.49  ? 58  LYS A HG2  4  
ATOM 9753  H HG3  . LYS A 1 58  ? 8.001   -3.873  -12.105 1.00 1.56  ? 58  LYS A HG3  4  
ATOM 9754  H HD2  . LYS A 1 58  ? 6.263   -4.122  -13.815 1.00 1.72  ? 58  LYS A HD2  4  
ATOM 9755  H HD3  . LYS A 1 58  ? 7.476   -4.606  -15.002 1.00 1.67  ? 58  LYS A HD3  4  
ATOM 9756  H HE2  . LYS A 1 58  ? 6.388   -6.597  -14.100 1.00 1.27  ? 58  LYS A HE2  4  
ATOM 9757  H HE3  . LYS A 1 58  ? 8.062   -6.547  -13.546 1.00 1.24  ? 58  LYS A HE3  4  
ATOM 9758  H HZ1  . LYS A 1 58  ? 5.719   -6.581  -12.005 1.00 2.20  ? 58  LYS A HZ1  4  
ATOM 9759  H HZ2  . LYS A 1 58  ? 6.515   -5.106  -11.728 1.00 2.19  ? 58  LYS A HZ2  4  
ATOM 9760  H HZ3  . LYS A 1 58  ? 7.329   -6.576  -11.474 1.00 2.31  ? 58  LYS A HZ3  4  
ATOM 9761  N N    . LEU A 1 59  ? 6.964   -1.238  -11.211 1.00 0.50  ? 59  LEU A N    4  
ATOM 9762  C CA   . LEU A 1 59  ? 6.287   -1.410  -9.891  1.00 0.47  ? 59  LEU A CA   4  
ATOM 9763  C C    . LEU A 1 59  ? 4.865   -0.832  -9.978  1.00 0.43  ? 59  LEU A C    4  
ATOM 9764  O O    . LEU A 1 59  ? 3.985   -1.186  -9.216  1.00 0.42  ? 59  LEU A O    4  
ATOM 9765  C CB   . LEU A 1 59  ? 7.108   -0.681  -8.795  1.00 0.53  ? 59  LEU A CB   4  
ATOM 9766  C CG   . LEU A 1 59  ? 7.640   -1.677  -7.752  1.00 0.71  ? 59  LEU A CG   4  
ATOM 9767  C CD1  . LEU A 1 59  ? 8.780   -2.501  -8.353  1.00 1.07  ? 59  LEU A CD1  4  
ATOM 9768  C CD2  . LEU A 1 59  ? 8.165   -0.907  -6.537  1.00 1.34  ? 59  LEU A CD2  4  
ATOM 9769  H H    . LEU A 1 59  ? 7.770   -0.686  -11.286 1.00 0.54  ? 59  LEU A H    4  
ATOM 9770  H HA   . LEU A 1 59  ? 6.219   -2.466  -9.678  1.00 0.47  ? 59  LEU A HA   4  
ATOM 9771  H HB2  . LEU A 1 59  ? 7.944   -0.180  -9.259  1.00 0.91  ? 59  LEU A HB2  4  
ATOM 9772  H HB3  . LEU A 1 59  ? 6.491   0.055   -8.297  1.00 0.65  ? 59  LEU A HB3  4  
ATOM 9773  H HG   . LEU A 1 59  ? 6.843   -2.335  -7.442  1.00 1.29  ? 59  LEU A HG   4  
ATOM 9774  H HD11 . LEU A 1 59  ? 9.213   -3.124  -7.585  1.00 1.68  ? 59  LEU A HD11 4  
ATOM 9775  H HD12 . LEU A 1 59  ? 9.536   -1.838  -8.748  1.00 1.59  ? 59  LEU A HD12 4  
ATOM 9776  H HD13 . LEU A 1 59  ? 8.397   -3.124  -9.148  1.00 1.49  ? 59  LEU A HD13 4  
ATOM 9777  H HD21 . LEU A 1 59  ? 7.356   -0.353  -6.085  1.00 1.91  ? 59  LEU A HD21 4  
ATOM 9778  H HD22 . LEU A 1 59  ? 8.940   -0.223  -6.851  1.00 1.91  ? 59  LEU A HD22 4  
ATOM 9779  H HD23 . LEU A 1 59  ? 8.571   -1.604  -5.818  1.00 1.77  ? 59  LEU A HD23 4  
ATOM 9780  N N    . SER A 1 60  ? 4.637   0.031   -10.929 1.00 0.43  ? 60  SER A N    4  
ATOM 9781  C CA   . SER A 1 60  ? 3.279   0.619   -11.107 1.00 0.42  ? 60  SER A CA   4  
ATOM 9782  C C    . SER A 1 60  ? 2.369   -0.421  -11.769 1.00 0.39  ? 60  SER A C    4  
ATOM 9783  O O    . SER A 1 60  ? 1.191   -0.501  -11.481 1.00 0.41  ? 60  SER A O    4  
ATOM 9784  C CB   . SER A 1 60  ? 3.382   1.840   -12.023 1.00 0.47  ? 60  SER A CB   4  
ATOM 9785  O OG   . SER A 1 60  ? 3.633   1.410   -13.352 1.00 1.36  ? 60  SER A OG   4  
ATOM 9786  H H    . SER A 1 60  ? 5.360   0.275   -11.546 1.00 0.45  ? 60  SER A H    4  
ATOM 9787  H HA   . SER A 1 60  ? 2.880   0.934   -10.153 1.00 0.43  ? 60  SER A HA   4  
ATOM 9788  H HB2  . SER A 1 60  ? 2.457   2.390   -11.997 1.00 1.13  ? 60  SER A HB2  4  
ATOM 9789  H HB3  . SER A 1 60  ? 4.187   2.477   -11.681 1.00 1.04  ? 60  SER A HB3  4  
ATOM 9790  H HG   . SER A 1 60  ? 4.434   0.880   -13.346 1.00 1.79  ? 60  SER A HG   4  
ATOM 9791  N N    . GLU A 1 61  ? 2.905   -1.210  -12.664 1.00 0.38  ? 61  GLU A N    4  
ATOM 9792  C CA   . GLU A 1 61  ? 2.066   -2.236  -13.356 1.00 0.38  ? 61  GLU A CA   4  
ATOM 9793  C C    . GLU A 1 61  ? 1.639   -3.315  -12.350 1.00 0.38  ? 61  GLU A C    4  
ATOM 9794  O O    . GLU A 1 61  ? 0.554   -3.856  -12.436 1.00 0.41  ? 61  GLU A O    4  
ATOM 9795  C CB   . GLU A 1 61  ? 2.860   -2.850  -14.511 1.00 0.39  ? 61  GLU A CB   4  
ATOM 9796  C CG   . GLU A 1 61  ? 2.023   -3.917  -15.214 1.00 1.06  ? 61  GLU A CG   4  
ATOM 9797  C CD   . GLU A 1 61  ? 2.771   -4.405  -16.456 1.00 1.67  ? 61  GLU A CD   4  
ATOM 9798  O OE1  . GLU A 1 61  ? 3.991   -4.423  -16.419 1.00 2.40  ? 61  GLU A OE1  4  
ATOM 9799  O OE2  . GLU A 1 61  ? 2.113   -4.750  -17.423 1.00 2.25  ? 61  GLU A OE2  4  
ATOM 9800  H H    . GLU A 1 61  ? 3.858   -1.122  -12.881 1.00 0.41  ? 61  GLU A H    4  
ATOM 9801  H HA   . GLU A 1 61  ? 1.172   -1.756  -13.724 1.00 0.41  ? 61  GLU A HA   4  
ATOM 9802  H HB2  . GLU A 1 61  ? 3.120   -2.074  -15.217 1.00 0.98  ? 61  GLU A HB2  4  
ATOM 9803  H HB3  . GLU A 1 61  ? 3.763   -3.300  -14.125 1.00 0.88  ? 61  GLU A HB3  4  
ATOM 9804  H HG2  . GLU A 1 61  ? 1.858   -4.747  -14.542 1.00 1.80  ? 61  GLU A HG2  4  
ATOM 9805  H HG3  . GLU A 1 61  ? 1.074   -3.495  -15.510 1.00 1.66  ? 61  GLU A HG3  4  
ATOM 9806  N N    . CYS A 1 62  ? 2.452   -3.593  -11.372 1.00 0.37  ? 62  CYS A N    4  
ATOM 9807  C CA   . CYS A 1 62  ? 2.060   -4.590  -10.332 1.00 0.39  ? 62  CYS A CA   4  
ATOM 9808  C C    . CYS A 1 62  ? 0.813   -4.063  -9.612  1.00 0.38  ? 62  CYS A C    4  
ATOM 9809  O O    . CYS A 1 62  ? -0.210  -4.718  -9.568  1.00 0.44  ? 62  CYS A O    4  
ATOM 9810  C CB   . CYS A 1 62  ? 3.204   -4.750  -9.328  1.00 0.41  ? 62  CYS A CB   4  
ATOM 9811  S SG   . CYS A 1 62  ? 2.870   -6.167  -8.252  1.00 1.62  ? 62  CYS A SG   4  
ATOM 9812  H H    . CYS A 1 62  ? 3.303   -3.112  -11.293 1.00 0.36  ? 62  CYS A H    4  
ATOM 9813  H HA   . CYS A 1 62  ? 1.813   -5.553  -10.755 1.00 0.40  ? 62  CYS A HA   4  
ATOM 9814  H HB2  . CYS A 1 62  ? 4.128   -4.915  -9.862  1.00 0.95  ? 62  CYS A HB2  4  
ATOM 9815  H HB3  . CYS A 1 62  ? 3.289   -3.855  -8.730  1.00 1.06  ? 62  CYS A HB3  4  
ATOM 9816  H HG   . CYS A 1 62  ? 3.713   -6.536  -7.979  1.00 2.03  ? 62  CYS A HG   4  
ATOM 9817  N N    . LEU A 1 63  ? 0.871   -2.874  -9.093  1.00 0.35  ? 63  LEU A N    4  
ATOM 9818  C CA   . LEU A 1 63  ? -0.322  -2.275  -8.426  1.00 0.36  ? 63  LEU A CA   4  
ATOM 9819  C C    . LEU A 1 63  ? -1.475  -2.149  -9.434  1.00 0.36  ? 63  LEU A C    4  
ATOM 9820  O O    . LEU A 1 63  ? -2.621  -2.007  -9.056  1.00 0.41  ? 63  LEU A O    4  
ATOM 9821  C CB   . LEU A 1 63  ? 0.063   -0.889  -7.902  1.00 0.38  ? 63  LEU A CB   4  
ATOM 9822  C CG   . LEU A 1 63  ? 1.312   -1.011  -7.016  1.00 0.69  ? 63  LEU A CG   4  
ATOM 9823  C CD1  . LEU A 1 63  ? 1.673   0.364   -6.451  1.00 1.39  ? 63  LEU A CD1  4  
ATOM 9824  C CD2  . LEU A 1 63  ? 1.044   -1.987  -5.856  1.00 1.11  ? 63  LEU A CD2  4  
ATOM 9825  H H    . LEU A 1 63  ? 1.694   -2.341  -9.168  1.00 0.37  ? 63  LEU A H    4  
ATOM 9826  H HA   . LEU A 1 63  ? -0.687  -2.860  -7.595  1.00 0.39  ? 63  LEU A HA   4  
ATOM 9827  H HB2  . LEU A 1 63  ? 0.272   -0.234  -8.735  1.00 0.65  ? 63  LEU A HB2  4  
ATOM 9828  H HB3  . LEU A 1 63  ? -0.751  -0.484  -7.320  1.00 0.46  ? 63  LEU A HB3  4  
ATOM 9829  H HG   . LEU A 1 63  ? 2.135   -1.379  -7.612  1.00 1.38  ? 63  LEU A HG   4  
ATOM 9830  H HD11 . LEU A 1 63  ? 0.810   0.790   -5.961  1.00 1.91  ? 63  LEU A HD11 4  
ATOM 9831  H HD12 . LEU A 1 63  ? 1.989   1.011   -7.254  1.00 1.98  ? 63  LEU A HD12 4  
ATOM 9832  H HD13 . LEU A 1 63  ? 2.477   0.258   -5.737  1.00 1.77  ? 63  LEU A HD13 4  
ATOM 9833  H HD21 . LEU A 1 63  ? 0.039   -1.845  -5.485  1.00 1.71  ? 63  LEU A HD21 4  
ATOM 9834  H HD22 . LEU A 1 63  ? 1.749   -1.805  -5.057  1.00 1.69  ? 63  LEU A HD22 4  
ATOM 9835  H HD23 . LEU A 1 63  ? 1.159   -3.002  -6.205  1.00 1.59  ? 63  LEU A HD23 4  
ATOM 9836  N N    . LYS A 1 64  ? -1.192  -2.196  -10.710 1.00 0.35  ? 64  LYS A N    4  
ATOM 9837  C CA   . LYS A 1 64  ? -2.289  -2.075  -11.720 1.00 0.37  ? 64  LYS A CA   4  
ATOM 9838  C C    . LYS A 1 64  ? -2.905  -3.455  -11.998 1.00 0.39  ? 64  LYS A C    4  
ATOM 9839  O O    . LYS A 1 64  ? -4.109  -3.611  -12.041 1.00 0.43  ? 64  LYS A O    4  
ATOM 9840  C CB   . LYS A 1 64  ? -1.727  -1.496  -13.019 1.00 0.38  ? 64  LYS A CB   4  
ATOM 9841  C CG   . LYS A 1 64  ? -2.882  -1.071  -13.925 1.00 0.82  ? 64  LYS A CG   4  
ATOM 9842  C CD   . LYS A 1 64  ? -2.328  -0.392  -15.177 1.00 1.35  ? 64  LYS A CD   4  
ATOM 9843  C CE   . LYS A 1 64  ? -3.489  0.125   -16.025 1.00 1.38  ? 64  LYS A CE   4  
ATOM 9844  N NZ   . LYS A 1 64  ? -2.956  0.833   -17.223 1.00 2.09  ? 64  LYS A NZ   4  
ATOM 9845  H H    . LYS A 1 64  ? -0.260  -2.302  -10.989 1.00 0.36  ? 64  LYS A H    4  
ATOM 9846  H HA   . LYS A 1 64  ? -3.054  -1.413  -11.336 1.00 0.38  ? 64  LYS A HA   4  
ATOM 9847  H HB2  . LYS A 1 64  ? -1.110  -0.638  -12.793 1.00 0.83  ? 64  LYS A HB2  4  
ATOM 9848  H HB3  . LYS A 1 64  ? -1.134  -2.245  -13.521 1.00 0.76  ? 64  LYS A HB3  4  
ATOM 9849  H HG2  . LYS A 1 64  ? -3.455  -1.942  -14.211 1.00 1.50  ? 64  LYS A HG2  4  
ATOM 9850  H HG3  . LYS A 1 64  ? -3.520  -0.379  -13.396 1.00 1.58  ? 64  LYS A HG3  4  
ATOM 9851  H HD2  . LYS A 1 64  ? -1.694  0.434   -14.888 1.00 1.98  ? 64  LYS A HD2  4  
ATOM 9852  H HD3  . LYS A 1 64  ? -1.754  -1.104  -15.751 1.00 1.96  ? 64  LYS A HD3  4  
ATOM 9853  H HE2  . LYS A 1 64  ? -4.101  -0.707  -16.339 1.00 1.48  ? 64  LYS A HE2  4  
ATOM 9854  H HE3  . LYS A 1 64  ? -4.084  0.808   -15.437 1.00 1.82  ? 64  LYS A HE3  4  
ATOM 9855  H HZ1  . LYS A 1 64  ? -3.553  0.619   -18.046 1.00 2.59  ? 64  LYS A HZ1  4  
ATOM 9856  H HZ2  . LYS A 1 64  ? -1.982  0.515   -17.408 1.00 2.53  ? 64  LYS A HZ2  4  
ATOM 9857  H HZ3  . LYS A 1 64  ? -2.960  1.858   -17.051 1.00 2.46  ? 64  LYS A HZ3  4  
ATOM 9858  N N    . ARG A 1 65  ? -2.085  -4.452  -12.194 1.00 0.43  ? 65  ARG A N    4  
ATOM 9859  C CA   . ARG A 1 65  ? -2.604  -5.827  -12.478 1.00 0.47  ? 65  ARG A CA   4  
ATOM 9860  C C    . ARG A 1 65  ? -3.379  -6.372  -11.271 1.00 0.50  ? 65  ARG A C    4  
ATOM 9861  O O    . ARG A 1 65  ? -4.408  -7.002  -11.418 1.00 0.54  ? 65  ARG A O    4  
ATOM 9862  C CB   . ARG A 1 65  ? -1.411  -6.753  -12.775 1.00 0.45  ? 65  ARG A CB   4  
ATOM 9863  C CG   . ARG A 1 65  ? -1.010  -6.633  -14.252 1.00 0.94  ? 65  ARG A CG   4  
ATOM 9864  C CD   . ARG A 1 65  ? 0.154   -7.582  -14.556 1.00 1.55  ? 65  ARG A CD   4  
ATOM 9865  N NE   . ARG A 1 65  ? 0.193   -7.858  -16.019 1.00 1.86  ? 65  ARG A NE   4  
ATOM 9866  C CZ   . ARG A 1 65  ? 1.255   -8.394  -16.552 1.00 2.39  ? 65  ARG A CZ   4  
ATOM 9867  N NH1  . ARG A 1 65  ? 2.283   -8.684  -15.803 1.00 2.94  ? 65  ARG A NH1  4  
ATOM 9868  N NH2  . ARG A 1 65  ? 1.288   -8.641  -17.832 1.00 2.92  ? 65  ARG A NH2  4  
ATOM 9869  H H    . ARG A 1 65  ? -1.118  -4.298  -12.158 1.00 0.45  ? 65  ARG A H    4  
ATOM 9870  H HA   . ARG A 1 65  ? -3.256  -5.812  -13.341 1.00 0.49  ? 65  ARG A HA   4  
ATOM 9871  H HB2  . ARG A 1 65  ? -0.575  -6.469  -12.153 1.00 0.88  ? 65  ARG A HB2  4  
ATOM 9872  H HB3  . ARG A 1 65  ? -1.682  -7.779  -12.565 1.00 0.85  ? 65  ARG A HB3  4  
ATOM 9873  H HG2  . ARG A 1 65  ? -1.854  -6.891  -14.875 1.00 1.50  ? 65  ARG A HG2  4  
ATOM 9874  H HG3  . ARG A 1 65  ? -0.707  -5.617  -14.461 1.00 1.54  ? 65  ARG A HG3  4  
ATOM 9875  H HD2  . ARG A 1 65  ? 1.083   -7.125  -14.251 1.00 2.13  ? 65  ARG A HD2  4  
ATOM 9876  H HD3  . ARG A 1 65  ? 0.017   -8.511  -14.020 1.00 2.11  ? 65  ARG A HD3  4  
ATOM 9877  H HE   . ARG A 1 65  ? -0.580  -7.638  -16.580 1.00 2.20  ? 65  ARG A HE   4  
ATOM 9878  H HH11 . ARG A 1 65  ? 2.255   -8.494  -14.821 1.00 2.96  ? 65  ARG A HH11 4  
ATOM 9879  H HH12 . ARG A 1 65  ? 3.098   -9.095  -16.209 1.00 3.62  ? 65  ARG A HH12 4  
ATOM 9880  H HH21 . ARG A 1 65  ? 0.499   -8.419  -18.405 1.00 3.11  ? 65  ARG A HH21 4  
ATOM 9881  H HH22 . ARG A 1 65  ? 2.103   -9.053  -18.241 1.00 3.43  ? 65  ARG A HH22 4  
ATOM 9882  N N    . ILE A 1 66  ? -2.896  -6.140  -10.084 1.00 0.49  ? 66  ILE A N    4  
ATOM 9883  C CA   . ILE A 1 66  ? -3.605  -6.650  -8.875  1.00 0.53  ? 66  ILE A CA   4  
ATOM 9884  C C    . ILE A 1 66  ? -4.883  -5.833  -8.660  1.00 0.54  ? 66  ILE A C    4  
ATOM 9885  O O    . ILE A 1 66  ? -5.964  -6.375  -8.538  1.00 0.60  ? 66  ILE A O    4  
ATOM 9886  C CB   . ILE A 1 66  ? -2.673  -6.515  -7.659  1.00 0.52  ? 66  ILE A CB   4  
ATOM 9887  C CG1  . ILE A 1 66  ? -1.625  -7.637  -7.693  1.00 1.22  ? 66  ILE A CG1  4  
ATOM 9888  C CG2  . ILE A 1 66  ? -3.472  -6.611  -6.352  1.00 1.29  ? 66  ILE A CG2  4  
ATOM 9889  C CD1  . ILE A 1 66  ? -0.499  -7.336  -6.695  1.00 1.25  ? 66  ILE A CD1  4  
ATOM 9890  H H    . ILE A 1 66  ? -2.070  -5.624  -9.982  1.00 0.46  ? 66  ILE A H    4  
ATOM 9891  H HA   . ILE A 1 66  ? -3.866  -7.690  -9.012  1.00 0.56  ? 66  ILE A HA   4  
ATOM 9892  H HB   . ILE A 1 66  ? -2.173  -5.558  -7.699  1.00 1.04  ? 66  ILE A HB   4  
ATOM 9893  H HG12 . ILE A 1 66  ? -2.095  -8.574  -7.432  1.00 1.73  ? 66  ILE A HG12 4  
ATOM 9894  H HG13 . ILE A 1 66  ? -1.210  -7.709  -8.687  1.00 1.78  ? 66  ILE A HG13 4  
ATOM 9895  H HG21 . ILE A 1 66  ? -4.169  -7.434  -6.416  1.00 1.84  ? 66  ILE A HG21 4  
ATOM 9896  H HG22 . ILE A 1 66  ? -4.016  -5.691  -6.194  1.00 1.76  ? 66  ILE A HG22 4  
ATOM 9897  H HG23 . ILE A 1 66  ? -2.796  -6.775  -5.526  1.00 1.93  ? 66  ILE A HG23 4  
ATOM 9898  H HD11 . ILE A 1 66  ? -0.063  -8.265  -6.357  1.00 1.47  ? 66  ILE A HD11 4  
ATOM 9899  H HD12 . ILE A 1 66  ? -0.892  -6.796  -5.845  1.00 1.70  ? 66  ILE A HD12 4  
ATOM 9900  H HD13 . ILE A 1 66  ? 0.261   -6.741  -7.180  1.00 1.59  ? 66  ILE A HD13 4  
ATOM 9901  N N    . GLY A 1 67  ? -4.771  -4.538  -8.637  1.00 0.52  ? 67  GLY A N    4  
ATOM 9902  C CA   . GLY A 1 67  ? -5.978  -3.681  -8.457  1.00 0.55  ? 67  GLY A CA   4  
ATOM 9903  C C    . GLY A 1 67  ? -7.080  -4.105  -9.427  1.00 0.53  ? 67  GLY A C    4  
ATOM 9904  O O    . GLY A 1 67  ? -8.210  -4.333  -9.032  1.00 0.63  ? 67  GLY A O    4  
ATOM 9905  H H    . GLY A 1 67  ? -3.898  -4.110  -8.757  1.00 0.50  ? 67  GLY A H    4  
ATOM 9906  H HA2  . GLY A 1 67  ? -6.344  -3.730  -7.440  1.00 0.55  ? 67  GLY A HA2  4  
ATOM 9907  H HA3  . GLY A 1 67  ? -5.705  -2.653  -8.630  1.00 0.59  ? 67  GLY A HA3  4  
ATOM 9908  N N    . ASP A 1 68  ? -6.777  -4.219  -10.690 1.00 0.54  ? 68  ASP A N    4  
ATOM 9909  C CA   . ASP A 1 68  ? -7.820  -4.629  -11.671 1.00 0.54  ? 68  ASP A CA   4  
ATOM 9910  C C    . ASP A 1 68  ? -8.236  -6.079  -11.416 1.00 0.52  ? 68  ASP A C    4  
ATOM 9911  O O    . ASP A 1 68  ? -9.323  -6.491  -11.769 1.00 0.56  ? 68  ASP A O    4  
ATOM 9912  C CB   . ASP A 1 68  ? -7.250  -4.506  -13.087 1.00 0.60  ? 68  ASP A CB   4  
ATOM 9913  C CG   . ASP A 1 68  ? -8.386  -4.597  -14.108 1.00 1.43  ? 68  ASP A CG   4  
ATOM 9914  O OD1  . ASP A 1 68  ? -9.351  -5.291  -13.831 1.00 2.20  ? 68  ASP A OD1  4  
ATOM 9915  O OD2  . ASP A 1 68  ? -8.271  -3.972  -15.149 1.00 2.12  ? 68  ASP A OD2  4  
ATOM 9916  H H    . ASP A 1 68  ? -5.868  -4.041  -11.012 1.00 0.63  ? 68  ASP A H    4  
ATOM 9917  H HA   . ASP A 1 68  ? -8.682  -3.985  -11.576 1.00 0.53  ? 68  ASP A HA   4  
ATOM 9918  H HB2  . ASP A 1 68  ? -6.748  -3.555  -13.191 1.00 1.16  ? 68  ASP A HB2  4  
ATOM 9919  H HB3  . ASP A 1 68  ? -6.546  -5.306  -13.263 1.00 1.06  ? 68  ASP A HB3  4  
ATOM 9920  N N    . GLU A 1 69  ? -7.378  -6.864  -10.813 1.00 0.56  ? 69  GLU A N    4  
ATOM 9921  C CA   . GLU A 1 69  ? -7.726  -8.295  -10.546 1.00 0.56  ? 69  GLU A CA   4  
ATOM 9922  C C    . GLU A 1 69  ? -8.315  -8.428  -9.140  1.00 0.55  ? 69  GLU A C    4  
ATOM 9923  O O    . GLU A 1 69  ? -8.930  -9.427  -8.825  1.00 0.73  ? 69  GLU A O    4  
ATOM 9924  C CB   . GLU A 1 69  ? -6.463  -9.154  -10.659 1.00 0.61  ? 69  GLU A CB   4  
ATOM 9925  C CG   . GLU A 1 69  ? -6.835  -10.639 -10.582 1.00 0.84  ? 69  GLU A CG   4  
ATOM 9926  C CD   . GLU A 1 69  ? -5.647  -11.488 -11.043 1.00 1.65  ? 69  GLU A CD   4  
ATOM 9927  O OE1  . GLU A 1 69  ? -4.740  -11.681 -10.251 1.00 2.23  ? 69  GLU A OE1  4  
ATOM 9928  O OE2  . GLU A 1 69  ? -5.666  -11.929 -12.180 1.00 2.48  ? 69  GLU A OE2  4  
ATOM 9929  H H    . GLU A 1 69  ? -6.504  -6.514  -10.541 1.00 0.65  ? 69  GLU A H    4  
ATOM 9930  H HA   . GLU A 1 69  ? -8.458  -8.627  -11.269 1.00 0.57  ? 69  GLU A HA   4  
ATOM 9931  H HB2  . GLU A 1 69  ? -5.977  -8.953  -11.603 1.00 0.87  ? 69  GLU A HB2  4  
ATOM 9932  H HB3  . GLU A 1 69  ? -5.791  -8.911  -9.850  1.00 0.83  ? 69  GLU A HB3  4  
ATOM 9933  H HG2  . GLU A 1 69  ? -7.085  -10.896 -9.562  1.00 1.45  ? 69  GLU A HG2  4  
ATOM 9934  H HG3  . GLU A 1 69  ? -7.683  -10.834 -11.221 1.00 1.39  ? 69  GLU A HG3  4  
ATOM 9935  N N    . LEU A 1 70  ? -8.128  -7.463  -8.274  1.00 0.53  ? 70  LEU A N    4  
ATOM 9936  C CA   . LEU A 1 70  ? -8.687  -7.612  -6.893  1.00 0.52  ? 70  LEU A CA   4  
ATOM 9937  C C    . LEU A 1 70  ? -10.182 -7.261  -6.914  1.00 0.54  ? 70  LEU A C    4  
ATOM 9938  O O    . LEU A 1 70  ? -10.950 -7.728  -6.098  1.00 0.60  ? 70  LEU A O    4  
ATOM 9939  C CB   . LEU A 1 70  ? -7.913  -6.705  -5.911  1.00 0.61  ? 70  LEU A CB   4  
ATOM 9940  C CG   . LEU A 1 70  ? -7.565  -7.466  -4.624  1.00 0.70  ? 70  LEU A CG   4  
ATOM 9941  C CD1  . LEU A 1 70  ? -6.664  -6.591  -3.751  1.00 1.38  ? 70  LEU A CD1  4  
ATOM 9942  C CD2  . LEU A 1 70  ? -8.848  -7.796  -3.856  1.00 1.61  ? 70  LEU A CD2  4  
ATOM 9943  H H    . LEU A 1 70  ? -7.619  -6.664  -8.521  1.00 0.66  ? 70  LEU A H    4  
ATOM 9944  H HA   . LEU A 1 70  ? -8.592  -8.655  -6.617  1.00 0.56  ? 70  LEU A HA   4  
ATOM 9945  H HB2  . LEU A 1 70  ? -6.999  -6.377  -6.383  1.00 1.07  ? 70  LEU A HB2  4  
ATOM 9946  H HB3  . LEU A 1 70  ? -8.510  -5.839  -5.660  1.00 1.07  ? 70  LEU A HB3  4  
ATOM 9947  H HG   . LEU A 1 70  ? -7.045  -8.380  -4.874  1.00 1.39  ? 70  LEU A HG   4  
ATOM 9948  H HD11 . LEU A 1 70  ? -6.396  -7.131  -2.854  1.00 1.91  ? 70  LEU A HD11 4  
ATOM 9949  H HD12 . LEU A 1 70  ? -7.190  -5.687  -3.483  1.00 1.90  ? 70  LEU A HD12 4  
ATOM 9950  H HD13 . LEU A 1 70  ? -5.769  -6.337  -4.299  1.00 1.98  ? 70  LEU A HD13 4  
ATOM 9951  H HD21 . LEU A 1 70  ? -8.594  -8.240  -2.905  1.00 2.16  ? 70  LEU A HD21 4  
ATOM 9952  H HD22 . LEU A 1 70  ? -9.443  -8.491  -4.430  1.00 2.22  ? 70  LEU A HD22 4  
ATOM 9953  H HD23 . LEU A 1 70  ? -9.412  -6.890  -3.690  1.00 2.09  ? 70  LEU A HD23 4  
ATOM 9954  N N    . ASP A 1 71  ? -10.604 -6.476  -7.870  1.00 0.67  ? 71  ASP A N    4  
ATOM 9955  C CA   . ASP A 1 71  ? -12.054 -6.144  -7.967  1.00 0.91  ? 71  ASP A CA   4  
ATOM 9956  C C    . ASP A 1 71  ? -12.788 -7.405  -8.422  1.00 1.02  ? 71  ASP A C    4  
ATOM 9957  O O    . ASP A 1 71  ? -13.998 -7.453  -8.527  1.00 1.29  ? 71  ASP A O    4  
ATOM 9958  C CB   . ASP A 1 71  ? -12.263 -5.031  -8.995  1.00 1.09  ? 71  ASP A CB   4  
ATOM 9959  C CG   . ASP A 1 71  ? -11.522 -5.384  -10.285 1.00 1.66  ? 71  ASP A CG   4  
ATOM 9960  O OD1  . ASP A 1 71  ? -11.415 -6.563  -10.580 1.00 2.36  ? 71  ASP A OD1  4  
ATOM 9961  O OD2  . ASP A 1 71  ? -11.075 -4.469  -10.957 1.00 2.25  ? 71  ASP A OD2  4  
ATOM 9962  H H    . ASP A 1 71  ? -9.973  -6.137  -8.542  1.00 0.69  ? 71  ASP A H    4  
ATOM 9963  H HA   . ASP A 1 71  ? -12.424 -5.824  -7.003  1.00 0.96  ? 71  ASP A HA   4  
ATOM 9964  H HB2  . ASP A 1 71  ? -13.318 -4.926  -9.201  1.00 1.58  ? 71  ASP A HB2  4  
ATOM 9965  H HB3  . ASP A 1 71  ? -11.878 -4.102  -8.603  1.00 1.39  ? 71  ASP A HB3  4  
ATOM 9966  N N    . SER A 1 72  ? -12.024 -8.426  -8.694  1.00 0.90  ? 72  SER A N    4  
ATOM 9967  C CA   . SER A 1 72  ? -12.574 -9.730  -9.155  1.00 1.20  ? 72  SER A CA   4  
ATOM 9968  C C    . SER A 1 72  ? -13.424 -10.394 -8.075  1.00 0.98  ? 72  SER A C    4  
ATOM 9969  O O    . SER A 1 72  ? -14.257 -11.226 -8.377  1.00 1.02  ? 72  SER A O    4  
ATOM 9970  C CB   . SER A 1 72  ? -11.397 -10.659 -9.456  1.00 1.57  ? 72  SER A CB   4  
ATOM 9971  O OG   . SER A 1 72  ? -10.571 -10.065 -10.449 1.00 2.09  ? 72  SER A OG   4  
ATOM 9972  H H    . SER A 1 72  ? -11.054 -8.338  -8.586  1.00 0.70  ? 72  SER A H    4  
ATOM 9973  H HA   . SER A 1 72  ? -13.149 -9.629  -10.065 1.00 1.57  ? 72  SER A HA   4  
ATOM 9974  H HB2  . SER A 1 72  ? -10.820 -10.814 -8.560  1.00 1.99  ? 72  SER A HB2  4  
ATOM 9975  H HB3  . SER A 1 72  ? -11.772 -11.611 -9.808  1.00 2.01  ? 72  SER A HB3  4  
ATOM 9976  H HG   . SER A 1 72  ? -10.043 -9.383  -10.028 1.00 2.54  ? 72  SER A HG   4  
ATOM 9977  N N    . ASN A 1 73  ? -13.213 -10.071 -6.816  1.00 0.92  ? 73  ASN A N    4  
ATOM 9978  C CA   . ASN A 1 73  ? -14.011 -10.740 -5.734  1.00 0.83  ? 73  ASN A CA   4  
ATOM 9979  C C    . ASN A 1 73  ? -15.143 -9.819  -5.274  1.00 0.75  ? 73  ASN A C    4  
ATOM 9980  O O    . ASN A 1 73  ? -14.904 -8.771  -4.706  1.00 1.07  ? 73  ASN A O    4  
ATOM 9981  C CB   . ASN A 1 73  ? -13.088 -11.043 -4.551  1.00 0.91  ? 73  ASN A CB   4  
ATOM 9982  C CG   . ASN A 1 73  ? -11.943 -11.946 -5.015  1.00 1.43  ? 73  ASN A CG   4  
ATOM 9983  O OD1  . ASN A 1 73  ? -11.120 -11.543 -5.813  1.00 2.29  ? 73  ASN A OD1  4  
ATOM 9984  N ND2  . ASN A 1 73  ? -11.854 -13.160 -4.545  1.00 1.90  ? 73  ASN A ND2  4  
ATOM 9985  H H    . ASN A 1 73  ? -12.528 -9.410  -6.581  1.00 1.04  ? 73  ASN A H    4  
ATOM 9986  H HA   . ASN A 1 73  ? -14.389 -11.667 -6.142  1.00 0.90  ? 73  ASN A HA   4  
ATOM 9987  H HB2  . ASN A 1 73  ? -12.683 -10.118 -4.165  1.00 1.30  ? 73  ASN A HB2  4  
ATOM 9988  H HB3  . ASN A 1 73  ? -13.647 -11.543 -3.776  1.00 1.39  ? 73  ASN A HB3  4  
ATOM 9989  H HD21 . ASN A 1 73  ? -12.518 -13.485 -3.901  1.00 2.05  ? 73  ASN A HD21 4  
ATOM 9990  H HD22 . ASN A 1 73  ? -11.125 -13.746 -4.835  1.00 2.57  ? 73  ASN A HD22 4  
ATOM 9991  N N    . MET A 1 74  ? -16.369 -10.188 -5.516  1.00 0.71  ? 74  MET A N    4  
ATOM 9992  C CA   . MET A 1 74  ? -17.500 -9.315  -5.091  1.00 0.67  ? 74  MET A CA   4  
ATOM 9993  C C    . MET A 1 74  ? -17.679 -9.406  -3.572  1.00 0.67  ? 74  MET A C    4  
ATOM 9994  O O    . MET A 1 74  ? -18.413 -8.647  -2.972  1.00 0.71  ? 74  MET A O    4  
ATOM 9995  C CB   . MET A 1 74  ? -18.777 -9.748  -5.815  1.00 0.75  ? 74  MET A CB   4  
ATOM 9996  C CG   . MET A 1 74  ? -18.603 -9.537  -7.327  1.00 1.20  ? 74  MET A CG   4  
ATOM 9997  S SD   . MET A 1 74  ? -19.739 -10.628 -8.223  1.00 1.92  ? 74  MET A SD   4  
ATOM 9998  C CE   . MET A 1 74  ? -18.579 -11.206 -9.491  1.00 1.96  ? 74  MET A CE   4  
ATOM 9999  H H    . MET A 1 74  ? -16.547 -11.033 -5.980  1.00 0.95  ? 74  MET A H    4  
ATOM 10000 H HA   . MET A 1 74  ? -17.271 -8.289  -5.342  1.00 0.69  ? 74  MET A HA   4  
ATOM 10001 H HB2  . MET A 1 74  ? -18.965 -10.793 -5.616  1.00 1.13  ? 74  MET A HB2  4  
ATOM 10002 H HB3  . MET A 1 74  ? -19.610 -9.157  -5.463  1.00 1.14  ? 74  MET A HB3  4  
ATOM 10003 H HG2  . MET A 1 74  ? -18.823 -8.508  -7.574  1.00 1.74  ? 74  MET A HG2  4  
ATOM 10004 H HG3  . MET A 1 74  ? -17.584 -9.763  -7.611  1.00 1.78  ? 74  MET A HG3  4  
ATOM 10005 H HE1  . MET A 1 74  ? -17.823 -11.827 -9.030  1.00 2.47  ? 74  MET A HE1  4  
ATOM 10006 H HE2  . MET A 1 74  ? -18.105 -10.359 -9.962  1.00 2.23  ? 74  MET A HE2  4  
ATOM 10007 H HE3  . MET A 1 74  ? -19.117 -11.776 -10.236 1.00 2.17  ? 74  MET A HE3  4  
ATOM 10008 N N    . GLU A 1 75  ? -16.970 -10.305 -2.948  1.00 0.70  ? 75  GLU A N    4  
ATOM 10009 C CA   . GLU A 1 75  ? -17.034 -10.440 -1.466  1.00 0.75  ? 75  GLU A CA   4  
ATOM 10010 C C    . GLU A 1 75  ? -16.340 -9.235  -0.828  1.00 0.73  ? 75  GLU A C    4  
ATOM 10011 O O    . GLU A 1 75  ? -16.970 -8.434  -0.166  1.00 0.78  ? 75  GLU A O    4  
ATOM 10012 C CB   . GLU A 1 75  ? -16.310 -11.721 -1.046  1.00 0.87  ? 75  GLU A CB   4  
ATOM 10013 C CG   . GLU A 1 75  ? -16.598 -12.009 0.427   1.00 1.15  ? 75  GLU A CG   4  
ATOM 10014 C CD   . GLU A 1 75  ? -15.881 -13.293 0.849   1.00 1.70  ? 75  GLU A CD   4  
ATOM 10015 O OE1  . GLU A 1 75  ? -16.395 -14.359 0.553   1.00 2.29  ? 75  GLU A OE1  4  
ATOM 10016 O OE2  . GLU A 1 75  ? -14.831 -13.188 1.461   1.00 2.21  ? 75  GLU A OE2  4  
ATOM 10017 H H    . GLU A 1 75  ? -16.358 -10.878 -3.452  1.00 0.73  ? 75  GLU A H    4  
ATOM 10018 H HA   . GLU A 1 75  ? -18.045 -10.457 -1.087  1.00 0.77  ? 75  GLU A HA   4  
ATOM 10019 H HB2  . GLU A 1 75  ? -16.660 -12.545 -1.650  1.00 1.11  ? 75  GLU A HB2  4  
ATOM 10020 H HB3  . GLU A 1 75  ? -15.247 -11.597 -1.186  1.00 0.94  ? 75  GLU A HB3  4  
ATOM 10021 H HG2  . GLU A 1 75  ? -16.245 -11.184 1.028   1.00 1.41  ? 75  GLU A HG2  4  
ATOM 10022 H HG3  . GLU A 1 75  ? -17.661 -12.129 0.567   1.00 1.33  ? 75  GLU A HG3  4  
ATOM 10023 N N    . LEU A 1 76  ? -15.061 -9.083  -1.017  1.00 0.74  ? 76  LEU A N    4  
ATOM 10024 C CA   . LEU A 1 76  ? -14.372 -7.908  -0.414  1.00 0.80  ? 76  LEU A CA   4  
ATOM 10025 C C    . LEU A 1 76  ? -15.131 -6.634  -0.806  1.00 0.75  ? 76  LEU A C    4  
ATOM 10026 O O    . LEU A 1 76  ? -15.557 -5.876  0.041   1.00 0.81  ? 76  LEU A O    4  
ATOM 10027 C CB   . LEU A 1 76  ? -12.914 -7.854  -0.898  1.00 0.92  ? 76  LEU A CB   4  
ATOM 10028 C CG   . LEU A 1 76  ? -12.150 -6.697  -0.225  1.00 1.00  ? 76  LEU A CG   4  
ATOM 10029 C CD1  . LEU A 1 76  ? -11.777 -7.063  1.217   1.00 1.57  ? 76  LEU A CD1  4  
ATOM 10030 C CD2  . LEU A 1 76  ? -10.863 -6.422  -1.010  1.00 1.51  ? 76  LEU A CD2  4  
ATOM 10031 H H    . LEU A 1 76  ? -14.560 -9.728  -1.558  1.00 0.77  ? 76  LEU A H    4  
ATOM 10032 H HA   . LEU A 1 76  ? -14.407 -7.972  0.661   1.00 0.82  ? 76  LEU A HA   4  
ATOM 10033 H HB2  . LEU A 1 76  ? -12.427 -8.789  -0.659  1.00 1.40  ? 76  LEU A HB2  4  
ATOM 10034 H HB3  . LEU A 1 76  ? -12.903 -7.713  -1.969  1.00 1.28  ? 76  LEU A HB3  4  
ATOM 10035 H HG   . LEU A 1 76  ? -12.762 -5.808  -0.222  1.00 1.62  ? 76  LEU A HG   4  
ATOM 10036 H HD11 . LEU A 1 76  ? -11.108 -6.313  1.611   1.00 1.93  ? 76  LEU A HD11 4  
ATOM 10037 H HD12 . LEU A 1 76  ? -11.286 -8.024  1.232   1.00 2.18  ? 76  LEU A HD12 4  
ATOM 10038 H HD13 . LEU A 1 76  ? -12.665 -7.102  1.827   1.00 2.01  ? 76  LEU A HD13 4  
ATOM 10039 H HD21 . LEU A 1 76  ? -11.112 -6.116  -2.015  1.00 2.04  ? 76  LEU A HD21 4  
ATOM 10040 H HD22 . LEU A 1 76  ? -10.265 -7.321  -1.045  1.00 1.83  ? 76  LEU A HD22 4  
ATOM 10041 H HD23 . LEU A 1 76  ? -10.304 -5.637  -0.522  1.00 2.09  ? 76  LEU A HD23 4  
ATOM 10042 N N    . GLN A 1 77  ? -15.305 -6.390  -2.077  1.00 0.76  ? 77  GLN A N    4  
ATOM 10043 C CA   . GLN A 1 77  ? -16.042 -5.161  -2.500  1.00 0.74  ? 77  GLN A CA   4  
ATOM 10044 C C    . GLN A 1 77  ? -17.339 -5.030  -1.689  1.00 0.71  ? 77  GLN A C    4  
ATOM 10045 O O    . GLN A 1 77  ? -17.724 -3.946  -1.294  1.00 0.72  ? 77  GLN A O    4  
ATOM 10046 C CB   . GLN A 1 77  ? -16.385 -5.239  -3.989  1.00 0.71  ? 77  GLN A CB   4  
ATOM 10047 C CG   . GLN A 1 77  ? -17.083 -3.944  -4.411  1.00 1.26  ? 77  GLN A CG   4  
ATOM 10048 C CD   . GLN A 1 77  ? -17.172 -3.879  -5.936  1.00 1.59  ? 77  GLN A CD   4  
ATOM 10049 O OE1  . GLN A 1 77  ? -17.879 -4.654  -6.549  1.00 2.35  ? 77  GLN A OE1  4  
ATOM 10050 N NE2  . GLN A 1 77  ? -16.480 -2.978  -6.579  1.00 2.03  ? 77  GLN A NE2  4  
ATOM 10051 H H    . GLN A 1 77  ? -14.933 -7.006  -2.743  1.00 0.86  ? 77  GLN A H    4  
ATOM 10052 H HA   . GLN A 1 77  ? -15.425 -4.294  -2.318  1.00 0.78  ? 77  GLN A HA   4  
ATOM 10053 H HB2  . GLN A 1 77  ? -15.478 -5.366  -4.563  1.00 1.14  ? 77  GLN A HB2  4  
ATOM 10054 H HB3  . GLN A 1 77  ? -17.045 -6.075  -4.165  1.00 1.09  ? 77  GLN A HB3  4  
ATOM 10055 H HG2  . GLN A 1 77  ? -18.078 -3.918  -3.991  1.00 1.82  ? 77  GLN A HG2  4  
ATOM 10056 H HG3  . GLN A 1 77  ? -16.519 -3.097  -4.050  1.00 1.98  ? 77  GLN A HG3  4  
ATOM 10057 H HE21 . GLN A 1 77  ? -15.912 -2.352  -6.084  1.00 2.26  ? 77  GLN A HE21 4  
ATOM 10058 H HE22 . GLN A 1 77  ? -16.531 -2.927  -7.556  1.00 2.60  ? 77  GLN A HE22 4  
ATOM 10059 N N    . ARG A 1 78  ? -18.017 -6.119  -1.435  1.00 0.72  ? 78  ARG A N    4  
ATOM 10060 C CA   . ARG A 1 78  ? -19.283 -6.036  -0.650  1.00 0.73  ? 78  ARG A CA   4  
ATOM 10061 C C    . ARG A 1 78  ? -18.961 -5.709  0.807   1.00 0.75  ? 78  ARG A C    4  
ATOM 10062 O O    . ARG A 1 78  ? -19.669 -4.964  1.455   1.00 0.79  ? 78  ARG A O    4  
ATOM 10063 C CB   . ARG A 1 78  ? -20.030 -7.377  -0.726  1.00 0.74  ? 78  ARG A CB   4  
ATOM 10064 C CG   . ARG A 1 78  ? -21.303 -7.343  0.167   1.00 0.94  ? 78  ARG A CG   4  
ATOM 10065 C CD   . ARG A 1 78  ? -21.031 -7.946  1.560   1.00 1.23  ? 78  ARG A CD   4  
ATOM 10066 N NE   . ARG A 1 78  ? -22.316 -8.445  2.155   1.00 1.80  ? 78  ARG A NE   4  
ATOM 10067 C CZ   . ARG A 1 78  ? -23.372 -7.677  2.249   1.00 2.50  ? 78  ARG A CZ   4  
ATOM 10068 N NH1  . ARG A 1 78  ? -23.288 -6.398  2.006   1.00 2.83  ? 78  ARG A NH1  4  
ATOM 10069 N NH2  . ARG A 1 78  ? -24.507 -8.184  2.650   1.00 3.41  ? 78  ARG A NH2  4  
ATOM 10070 H H    . ARG A 1 78  ? -17.695 -6.985  -1.759  1.00 0.75  ? 78  ARG A H    4  
ATOM 10071 H HA   . ARG A 1 78  ? -19.907 -5.257  -1.066  1.00 0.75  ? 78  ARG A HA   4  
ATOM 10072 H HB2  . ARG A 1 78  ? -20.320 -7.554  -1.754  1.00 0.91  ? 78  ARG A HB2  4  
ATOM 10073 H HB3  . ARG A 1 78  ? -19.372 -8.169  -0.406  1.00 0.83  ? 78  ARG A HB3  4  
ATOM 10074 H HG2  . ARG A 1 78  ? -21.633 -6.322  0.278   1.00 1.18  ? 78  ARG A HG2  4  
ATOM 10075 H HG3  . ARG A 1 78  ? -22.088 -7.912  -0.313  1.00 1.35  ? 78  ARG A HG3  4  
ATOM 10076 H HD2  . ARG A 1 78  ? -20.372 -8.788  1.474   1.00 1.78  ? 78  ARG A HD2  4  
ATOM 10077 H HD3  . ARG A 1 78  ? -20.569 -7.197  2.196   1.00 1.68  ? 78  ARG A HD3  4  
ATOM 10078 H HE   . ARG A 1 78  ? -22.381 -9.382  2.434   1.00 2.23  ? 78  ARG A HE   4  
ATOM 10079 H HH11 . ARG A 1 78  ? -22.413 -5.993  1.753   1.00 2.69  ? 78  ARG A HH11 4  
ATOM 10080 H HH12 . ARG A 1 78  ? -24.103 -5.822  2.075   1.00 3.57  ? 78  ARG A HH12 4  
ATOM 10081 H HH21 . ARG A 1 78  ? -24.567 -9.155  2.883   1.00 3.73  ? 78  ARG A HH21 4  
ATOM 10082 H HH22 . ARG A 1 78  ? -25.317 -7.601  2.724   1.00 4.02  ? 78  ARG A HH22 4  
ATOM 10083 N N    . MET A 1 79  ? -17.894 -6.251  1.330   1.00 0.75  ? 79  MET A N    4  
ATOM 10084 C CA   . MET A 1 79  ? -17.532 -5.956  2.744   1.00 0.77  ? 79  MET A CA   4  
ATOM 10085 C C    . MET A 1 79  ? -17.118 -4.491  2.850   1.00 0.77  ? 79  MET A C    4  
ATOM 10086 O O    . MET A 1 79  ? -17.587 -3.762  3.701   1.00 0.78  ? 79  MET A O    4  
ATOM 10087 C CB   . MET A 1 79  ? -16.364 -6.848  3.172   1.00 0.81  ? 79  MET A CB   4  
ATOM 10088 C CG   . MET A 1 79  ? -16.829 -8.303  3.276   1.00 1.08  ? 79  MET A CG   4  
ATOM 10089 S SD   . MET A 1 79  ? -15.602 -9.259  4.201   1.00 1.07  ? 79  MET A SD   4  
ATOM 10090 C CE   . MET A 1 79  ? -16.231 -8.899  5.860   1.00 0.81  ? 79  MET A CE   4  
ATOM 10091 H H    . MET A 1 79  ? -17.321 -6.843  0.799   1.00 0.77  ? 79  MET A H    4  
ATOM 10092 H HA   . MET A 1 79  ? -18.384 -6.137  3.383   1.00 0.78  ? 79  MET A HA   4  
ATOM 10093 H HB2  . MET A 1 79  ? -15.572 -6.776  2.441   1.00 1.29  ? 79  MET A HB2  4  
ATOM 10094 H HB3  . MET A 1 79  ? -15.995 -6.521  4.133   1.00 1.16  ? 79  MET A HB3  4  
ATOM 10095 H HG2  . MET A 1 79  ? -17.778 -8.346  3.790   1.00 1.48  ? 79  MET A HG2  4  
ATOM 10096 H HG3  . MET A 1 79  ? -16.937 -8.719  2.285   1.00 1.58  ? 79  MET A HG3  4  
ATOM 10097 H HE1  . MET A 1 79  ? -16.729 -7.939  5.858   1.00 1.37  ? 79  MET A HE1  4  
ATOM 10098 H HE2  . MET A 1 79  ? -15.410 -8.874  6.559   1.00 1.34  ? 79  MET A HE2  4  
ATOM 10099 H HE3  . MET A 1 79  ? -16.928 -9.671  6.155   1.00 1.20  ? 79  MET A HE3  4  
ATOM 10100 N N    . ILE A 1 80  ? -16.250 -4.050  1.981   1.00 0.77  ? 80  ILE A N    4  
ATOM 10101 C CA   . ILE A 1 80  ? -15.819 -2.627  2.024   1.00 0.80  ? 80  ILE A CA   4  
ATOM 10102 C C    . ILE A 1 80  ? -17.066 -1.736  2.035   1.00 0.80  ? 80  ILE A C    4  
ATOM 10103 O O    . ILE A 1 80  ? -17.053 -0.636  2.550   1.00 0.83  ? 80  ILE A O    4  
ATOM 10104 C CB   . ILE A 1 80  ? -14.956 -2.317  0.800   1.00 0.82  ? 80  ILE A CB   4  
ATOM 10105 C CG1  . ILE A 1 80  ? -13.673 -3.151  0.873   1.00 0.84  ? 80  ILE A CG1  4  
ATOM 10106 C CG2  . ILE A 1 80  ? -14.594 -0.832  0.793   1.00 0.89  ? 80  ILE A CG2  4  
ATOM 10107 C CD1  . ILE A 1 80  ? -12.907 -3.037  -0.446  1.00 1.10  ? 80  ILE A CD1  4  
ATOM 10108 H H    . ILE A 1 80  ? -15.891 -4.651  1.296   1.00 0.77  ? 80  ILE A H    4  
ATOM 10109 H HA   . ILE A 1 80  ? -15.248 -2.445  2.920   1.00 0.82  ? 80  ILE A HA   4  
ATOM 10110 H HB   . ILE A 1 80  ? -15.500 -2.563  -0.100  1.00 0.80  ? 80  ILE A HB   4  
ATOM 10111 H HG12 . ILE A 1 80  ? -13.055 -2.787  1.681   1.00 0.89  ? 80  ILE A HG12 4  
ATOM 10112 H HG13 . ILE A 1 80  ? -13.926 -4.185  1.052   1.00 1.04  ? 80  ILE A HG13 4  
ATOM 10113 H HG21 . ILE A 1 80  ? -14.199 -0.552  1.759   1.00 1.27  ? 80  ILE A HG21 4  
ATOM 10114 H HG22 . ILE A 1 80  ? -15.476 -0.246  0.581   1.00 1.34  ? 80  ILE A HG22 4  
ATOM 10115 H HG23 . ILE A 1 80  ? -13.850 -0.649  0.035   1.00 1.40  ? 80  ILE A HG23 4  
ATOM 10116 H HD11 . ILE A 1 80  ? -11.967 -3.564  -0.362  1.00 1.67  ? 80  ILE A HD11 4  
ATOM 10117 H HD12 . ILE A 1 80  ? -12.717 -1.996  -0.664  1.00 1.53  ? 80  ILE A HD12 4  
ATOM 10118 H HD13 . ILE A 1 80  ? -13.493 -3.471  -1.242  1.00 1.46  ? 80  ILE A HD13 4  
ATOM 10119 N N    . ALA A 1 81  ? -18.145 -2.204  1.468   1.00 0.78  ? 81  ALA A N    4  
ATOM 10120 C CA   . ALA A 1 81  ? -19.396 -1.391  1.446   1.00 0.80  ? 81  ALA A CA   4  
ATOM 10121 C C    . ALA A 1 81  ? -20.111 -1.498  2.799   1.00 0.81  ? 81  ALA A C    4  
ATOM 10122 O O    . ALA A 1 81  ? -20.951 -0.686  3.136   1.00 0.85  ? 81  ALA A O    4  
ATOM 10123 C CB   . ALA A 1 81  ? -20.320 -1.923  0.353   1.00 0.79  ? 81  ALA A CB   4  
ATOM 10124 H H    . ALA A 1 81  ? -18.132 -3.087  1.043   1.00 0.76  ? 81  ALA A H    4  
ATOM 10125 H HA   . ALA A 1 81  ? -19.155 -0.361  1.237   1.00 0.84  ? 81  ALA A HA   4  
ATOM 10126 H HB1  . ALA A 1 81  ? -20.622 -2.929  0.599   1.00 1.32  ? 81  ALA A HB1  4  
ATOM 10127 H HB2  . ALA A 1 81  ? -19.797 -1.923  -0.591  1.00 1.19  ? 81  ALA A HB2  4  
ATOM 10128 H HB3  . ALA A 1 81  ? -21.193 -1.291  0.282   1.00 1.34  ? 81  ALA A HB3  4  
ATOM 10129 N N    . ALA A 1 82  ? -19.790 -2.501  3.571   1.00 0.78  ? 82  ALA A N    4  
ATOM 10130 C CA   . ALA A 1 82  ? -20.449 -2.681  4.899   1.00 0.80  ? 82  ALA A CA   4  
ATOM 10131 C C    . ALA A 1 82  ? -19.782 -1.790  5.949   1.00 0.79  ? 82  ALA A C    4  
ATOM 10132 O O    . ALA A 1 82  ? -20.343 -1.531  6.996   1.00 0.83  ? 82  ALA A O    4  
ATOM 10133 C CB   . ALA A 1 82  ? -20.322 -4.144  5.329   1.00 0.87  ? 82  ALA A CB   4  
ATOM 10134 H H    . ALA A 1 82  ? -19.112 -3.144  3.276   1.00 0.76  ? 82  ALA A H    4  
ATOM 10135 H HA   . ALA A 1 82  ? -21.496 -2.421  4.844   1.00 0.83  ? 82  ALA A HA   4  
ATOM 10136 H HB1  . ALA A 1 82  ? -19.277 -4.405  5.414   1.00 1.37  ? 82  ALA A HB1  4  
ATOM 10137 H HB2  . ALA A 1 82  ? -20.792 -4.777  4.591   1.00 1.22  ? 82  ALA A HB2  4  
ATOM 10138 H HB3  . ALA A 1 82  ? -20.806 -4.282  6.284   1.00 1.37  ? 82  ALA A HB3  4  
ATOM 10139 N N    . VAL A 1 83  ? -18.599 -1.307  5.687   1.00 0.80  ? 83  VAL A N    4  
ATOM 10140 C CA   . VAL A 1 83  ? -17.922 -0.423  6.687   1.00 0.85  ? 83  VAL A CA   4  
ATOM 10141 C C    . VAL A 1 83  ? -18.384 1.024   6.465   1.00 0.99  ? 83  VAL A C    4  
ATOM 10142 O O    . VAL A 1 83  ? -17.811 1.788   5.714   1.00 1.36  ? 83  VAL A O    4  
ATOM 10143 C CB   . VAL A 1 83  ? -16.392 -0.564  6.569   1.00 0.97  ? 83  VAL A CB   4  
ATOM 10144 C CG1  . VAL A 1 83  ? -15.984 -0.591  5.099   1.00 1.81  ? 83  VAL A CG1  4  
ATOM 10145 C CG2  . VAL A 1 83  ? -15.682 0.597   7.280   1.00 1.40  ? 83  VAL A CG2  4  
ATOM 10146 H H    . VAL A 1 83  ? -18.163 -1.515  4.834   1.00 0.82  ? 83  VAL A H    4  
ATOM 10147 H HA   . VAL A 1 83  ? -18.233 -0.694  7.687   1.00 0.90  ? 83  VAL A HA   4  
ATOM 10148 H HB   . VAL A 1 83  ? -16.094 -1.495  7.029   1.00 1.62  ? 83  VAL A HB   4  
ATOM 10149 H HG11 . VAL A 1 83  ? -14.905 -0.619  5.023   1.00 2.36  ? 83  VAL A HG11 4  
ATOM 10150 H HG12 . VAL A 1 83  ? -16.357 0.292   4.602   1.00 2.40  ? 83  VAL A HG12 4  
ATOM 10151 H HG13 . VAL A 1 83  ? -16.399 -1.471  4.636   1.00 2.21  ? 83  VAL A HG13 4  
ATOM 10152 H HG21 . VAL A 1 83  ? -15.695 1.475   6.652   1.00 2.00  ? 83  VAL A HG21 4  
ATOM 10153 H HG22 . VAL A 1 83  ? -14.657 0.319   7.482   1.00 1.97  ? 83  VAL A HG22 4  
ATOM 10154 H HG23 . VAL A 1 83  ? -16.185 0.811   8.211   1.00 1.85  ? 83  VAL A HG23 4  
ATOM 10155 N N    . ASP A 1 84  ? -19.430 1.383   7.167   1.00 1.46  ? 84  ASP A N    4  
ATOM 10156 C CA   . ASP A 1 84  ? -20.000 2.760   7.107   1.00 1.71  ? 84  ASP A CA   4  
ATOM 10157 C C    . ASP A 1 84  ? -19.348 3.598   8.207   1.00 1.39  ? 84  ASP A C    4  
ATOM 10158 O O    . ASP A 1 84  ? -18.677 3.085   9.079   1.00 1.80  ? 84  ASP A O    4  
ATOM 10159 C CB   . ASP A 1 84  ? -21.508 2.684   7.360   1.00 2.38  ? 84  ASP A CB   4  
ATOM 10160 C CG   . ASP A 1 84  ? -21.772 2.027   8.715   1.00 2.99  ? 84  ASP A CG   4  
ATOM 10161 O OD1  . ASP A 1 84  ? -21.313 0.914   8.912   1.00 3.45  ? 84  ASP A OD1  4  
ATOM 10162 O OD2  . ASP A 1 84  ? -22.432 2.647   9.533   1.00 3.57  ? 84  ASP A OD2  4  
ATOM 10163 H H    . ASP A 1 84  ? -19.841 0.729   7.770   1.00 1.92  ? 84  ASP A H    4  
ATOM 10164 H HA   . ASP A 1 84  ? -19.831 3.236   6.151   1.00 2.10  ? 84  ASP A HA   4  
ATOM 10165 H HB2  . ASP A 1 84  ? -21.924 3.682   7.356   1.00 2.86  ? 84  ASP A HB2  4  
ATOM 10166 H HB3  . ASP A 1 84  ? -21.974 2.098   6.581   1.00 2.68  ? 84  ASP A HB3  4  
ATOM 10167 N N    . THR A 1 85  ? -19.549 4.892   8.171   1.00 1.68  ? 85  THR A N    4  
ATOM 10168 C CA   . THR A 1 85  ? -18.951 5.787   9.209   1.00 1.97  ? 85  THR A CA   4  
ATOM 10169 C C    . THR A 1 85  ? -17.488 5.391   9.426   1.00 1.67  ? 85  THR A C    4  
ATOM 10170 O O    . THR A 1 85  ? -16.708 5.314   8.500   1.00 2.28  ? 85  THR A O    4  
ATOM 10171 C CB   . THR A 1 85  ? -19.742 5.663   10.510  1.00 3.20  ? 85  THR A CB   4  
ATOM 10172 O OG1  . THR A 1 85  ? -19.636 4.336   11.005  1.00 3.80  ? 85  THR A OG1  4  
ATOM 10173 C CG2  . THR A 1 85  ? -21.211 5.995   10.240  1.00 3.87  ? 85  THR A CG2  4  
ATOM 10174 H H    . THR A 1 85  ? -20.097 5.277   7.455   1.00 2.23  ? 85  THR A H    4  
ATOM 10175 H HA   . THR A 1 85  ? -18.998 6.804   8.847   1.00 2.24  ? 85  THR A HA   4  
ATOM 10176 H HB   . THR A 1 85  ? -19.349 6.355   11.239  1.00 3.70  ? 85  THR A HB   4  
ATOM 10177 H HG1  . THR A 1 85  ? -18.968 3.879   10.488  1.00 4.15  ? 85  THR A HG1  4  
ATOM 10178 H HG21 . THR A 1 85  ? -21.613 5.293   9.524   1.00 4.19  ? 85  THR A HG21 4  
ATOM 10179 H HG22 . THR A 1 85  ? -21.286 6.996   9.842   1.00 4.15  ? 85  THR A HG22 4  
ATOM 10180 H HG23 . THR A 1 85  ? -21.771 5.930   11.161  1.00 4.28  ? 85  THR A HG23 4  
ATOM 10181 N N    . ASP A 1 86  ? -17.124 5.117   10.656  1.00 1.51  ? 86  ASP A N    4  
ATOM 10182 C CA   . ASP A 1 86  ? -15.725 4.702   10.950  1.00 1.98  ? 86  ASP A CA   4  
ATOM 10183 C C    . ASP A 1 86  ? -14.744 5.739   10.399  1.00 1.78  ? 86  ASP A C    4  
ATOM 10184 O O    . ASP A 1 86  ? -14.517 5.819   9.208   1.00 2.48  ? 86  ASP A O    4  
ATOM 10185 C CB   . ASP A 1 86  ? -15.460 3.345   10.297  1.00 2.56  ? 86  ASP A CB   4  
ATOM 10186 C CG   . ASP A 1 86  ? -16.561 2.360   10.700  1.00 3.06  ? 86  ASP A CG   4  
ATOM 10187 O OD1  . ASP A 1 86  ? -17.591 2.810   11.173  1.00 3.57  ? 86  ASP A OD1  4  
ATOM 10188 O OD2  . ASP A 1 86  ? -16.352 1.169   10.535  1.00 3.50  ? 86  ASP A OD2  4  
ATOM 10189 H H    . ASP A 1 86  ? -17.780 5.172   11.383  1.00 1.71  ? 86  ASP A H    4  
ATOM 10190 H HA   . ASP A 1 86  ? -15.583 4.598   12.017  1.00 2.59  ? 86  ASP A HA   4  
ATOM 10191 H HB2  . ASP A 1 86  ? -15.444 3.454   9.223   1.00 2.88  ? 86  ASP A HB2  4  
ATOM 10192 H HB3  . ASP A 1 86  ? -14.511 2.969   10.637  1.00 3.03  ? 86  ASP A HB3  4  
ATOM 10193 N N    . SER A 1 87  ? -14.164 6.541   11.248  1.00 1.11  ? 87  SER A N    4  
ATOM 10194 C CA   . SER A 1 87  ? -13.210 7.573   10.754  1.00 0.93  ? 87  SER A CA   4  
ATOM 10195 C C    . SER A 1 87  ? -12.117 6.893   9.900   1.00 0.84  ? 87  SER A C    4  
ATOM 10196 O O    . SER A 1 87  ? -11.720 5.790   10.207  1.00 0.97  ? 87  SER A O    4  
ATOM 10197 C CB   . SER A 1 87  ? -12.557 8.268   11.949  1.00 0.88  ? 87  SER A CB   4  
ATOM 10198 O OG   . SER A 1 87  ? -13.561 8.900   12.732  1.00 1.63  ? 87  SER A OG   4  
ATOM 10199 H H    . SER A 1 87  ? -14.359 6.468   12.206  1.00 1.20  ? 87  SER A H    4  
ATOM 10200 H HA   . SER A 1 87  ? -13.758 8.293   10.178  1.00 1.05  ? 87  SER A HA   4  
ATOM 10201 H HB2  . SER A 1 87  ? -12.041 7.541   12.554  1.00 1.41  ? 87  SER A HB2  4  
ATOM 10202 H HB3  . SER A 1 87  ? -11.848 9.004   11.593  1.00 1.22  ? 87  SER A HB3  4  
ATOM 10203 H HG   . SER A 1 87  ? -13.996 9.556   12.183  1.00 2.08  ? 87  SER A HG   4  
ATOM 10204 N N    . PRO A 1 88  ? -11.635 7.548   8.860   1.00 0.77  ? 88  PRO A N    4  
ATOM 10205 C CA   . PRO A 1 88  ? -10.572 6.956   8.025   1.00 0.83  ? 88  PRO A CA   4  
ATOM 10206 C C    . PRO A 1 88  ? -9.281  6.803   8.847   1.00 0.73  ? 88  PRO A C    4  
ATOM 10207 O O    . PRO A 1 88  ? -8.517  5.879   8.646   1.00 0.72  ? 88  PRO A O    4  
ATOM 10208 C CB   . PRO A 1 88  ? -10.367 7.963   6.868   1.00 1.01  ? 88  PRO A CB   4  
ATOM 10209 C CG   . PRO A 1 88  ? -11.231 9.216   7.182   1.00 1.07  ? 88  PRO A CG   4  
ATOM 10210 C CD   . PRO A 1 88  ? -12.096 8.886   8.419   1.00 0.83  ? 88  PRO A CD   4  
ATOM 10211 H HA   . PRO A 1 88  ? -10.887 6.000   7.636   1.00 0.98  ? 88  PRO A HA   4  
ATOM 10212 H HB2  . PRO A 1 88  ? -9.322  8.242   6.790   1.00 1.03  ? 88  PRO A HB2  4  
ATOM 10213 H HB3  . PRO A 1 88  ? -10.693 7.523   5.935   1.00 1.17  ? 88  PRO A HB3  4  
ATOM 10214 H HG2  . PRO A 1 88  ? -10.589 10.063  7.393   1.00 1.20  ? 88  PRO A HG2  4  
ATOM 10215 H HG3  . PRO A 1 88  ? -11.870 9.447   6.340   1.00 1.29  ? 88  PRO A HG3  4  
ATOM 10216 H HD2  . PRO A 1 88  ? -11.942 9.618   9.201   1.00 0.84  ? 88  PRO A HD2  4  
ATOM 10217 H HD3  . PRO A 1 88  ? -13.138 8.845   8.137   1.00 0.89  ? 88  PRO A HD3  4  
ATOM 10218 N N    . ARG A 1 89  ? -9.014  7.717   9.745   1.00 0.75  ? 89  ARG A N    4  
ATOM 10219 C CA   . ARG A 1 89  ? -7.750  7.626   10.537  1.00 0.73  ? 89  ARG A CA   4  
ATOM 10220 C C    . ARG A 1 89  ? -7.827  6.490   11.561  1.00 0.67  ? 89  ARG A C    4  
ATOM 10221 O O    . ARG A 1 89  ? -6.886  5.739   11.727  1.00 0.68  ? 89  ARG A O    4  
ATOM 10222 C CB   . ARG A 1 89  ? -7.487  8.944   11.269  1.00 0.79  ? 89  ARG A CB   4  
ATOM 10223 C CG   . ARG A 1 89  ? -7.129  10.041  10.264  1.00 1.63  ? 89  ARG A CG   4  
ATOM 10224 C CD   . ARG A 1 89  ? -7.028  11.389  10.990  1.00 1.65  ? 89  ARG A CD   4  
ATOM 10225 N NE   . ARG A 1 89  ? -8.395  11.941  11.206  1.00 2.07  ? 89  ARG A NE   4  
ATOM 10226 C CZ   . ARG A 1 89  ? -8.579  12.912  12.058  1.00 2.47  ? 89  ARG A CZ   4  
ATOM 10227 N NH1  . ARG A 1 89  ? -7.570  13.388  12.735  1.00 2.69  ? 89  ARG A NH1  4  
ATOM 10228 N NH2  . ARG A 1 89  ? -9.774  13.405  12.237  1.00 3.10  ? 89  ARG A NH2  4  
ATOM 10229 H H    . ARG A 1 89  ? -9.627  8.471   9.869   1.00 0.82  ? 89  ARG A H    4  
ATOM 10230 H HA   . ARG A 1 89  ? -6.945  7.418   9.849   1.00 0.76  ? 89  ARG A HA   4  
ATOM 10231 H HB2  . ARG A 1 89  ? -8.373  9.233   11.815  1.00 1.38  ? 89  ARG A HB2  4  
ATOM 10232 H HB3  . ARG A 1 89  ? -6.668  8.812   11.960  1.00 1.17  ? 89  ARG A HB3  4  
ATOM 10233 H HG2  . ARG A 1 89  ? -6.181  9.808   9.801   1.00 2.22  ? 89  ARG A HG2  4  
ATOM 10234 H HG3  . ARG A 1 89  ? -7.896  10.099  9.507   1.00 2.30  ? 89  ARG A HG3  4  
ATOM 10235 H HD2  . ARG A 1 89  ? -6.538  11.253  11.945  1.00 1.89  ? 89  ARG A HD2  4  
ATOM 10236 H HD3  . ARG A 1 89  ? -6.455  12.078  10.389  1.00 1.63  ? 89  ARG A HD3  4  
ATOM 10237 H HE   . ARG A 1 89  ? -9.155  11.579  10.705  1.00 2.46  ? 89  ARG A HE   4  
ATOM 10238 H HH11 . ARG A 1 89  ? -6.654  13.009  12.600  1.00 2.55  ? 89  ARG A HH11 4  
ATOM 10239 H HH12 . ARG A 1 89  ? -7.711  14.133  13.388  1.00 3.27  ? 89  ARG A HH12 4  
ATOM 10240 H HH21 . ARG A 1 89  ? -10.549 13.039  11.721  1.00 3.36  ? 89  ARG A HH21 4  
ATOM 10241 H HH22 . ARG A 1 89  ? -9.916  14.150  12.890  1.00 3.53  ? 89  ARG A HH22 4  
ATOM 10242 N N    . GLU A 1 90  ? -8.919  6.354   12.264  1.00 0.65  ? 90  GLU A N    4  
ATOM 10243 C CA   . GLU A 1 90  ? -8.992  5.261   13.273  1.00 0.65  ? 90  GLU A CA   4  
ATOM 10244 C C    . GLU A 1 90  ? -8.955  3.909   12.550  1.00 0.64  ? 90  GLU A C    4  
ATOM 10245 O O    . GLU A 1 90  ? -8.541  2.916   13.103  1.00 0.67  ? 90  GLU A O    4  
ATOM 10246 C CB   . GLU A 1 90  ? -10.274 5.404   14.119  1.00 0.71  ? 90  GLU A CB   4  
ATOM 10247 C CG   . GLU A 1 90  ? -11.486 4.809   13.394  1.00 1.32  ? 90  GLU A CG   4  
ATOM 10248 C CD   . GLU A 1 90  ? -12.770 5.249   14.100  1.00 2.02  ? 90  GLU A CD   4  
ATOM 10249 O OE1  . GLU A 1 90  ? -12.829 6.392   14.522  1.00 2.78  ? 90  GLU A OE1  4  
ATOM 10250 O OE2  . GLU A 1 90  ? -13.674 4.436   14.205  1.00 2.46  ? 90  GLU A OE2  4  
ATOM 10251 H H    . GLU A 1 90  ? -9.674  6.966   12.135  1.00 0.67  ? 90  GLU A H    4  
ATOM 10252 H HA   . GLU A 1 90  ? -8.136  5.361   13.927  1.00 0.66  ? 90  GLU A HA   4  
ATOM 10253 H HB2  . GLU A 1 90  ? -10.138 4.890   15.059  1.00 1.12  ? 90  GLU A HB2  4  
ATOM 10254 H HB3  . GLU A 1 90  ? -10.455 6.452   14.311  1.00 1.09  ? 90  GLU A HB3  4  
ATOM 10255 H HG2  . GLU A 1 90  ? -11.498 5.155   12.378  1.00 1.90  ? 90  GLU A HG2  4  
ATOM 10256 H HG3  . GLU A 1 90  ? -11.422 3.731   13.409  1.00 1.78  ? 90  GLU A HG3  4  
ATOM 10257 N N    . VAL A 1 91  ? -9.401  3.860   11.322  1.00 0.64  ? 91  VAL A N    4  
ATOM 10258 C CA   . VAL A 1 91  ? -9.408  2.565   10.571  1.00 0.67  ? 91  VAL A CA   4  
ATOM 10259 C C    . VAL A 1 91  ? -8.054  2.345   9.893   1.00 0.66  ? 91  VAL A C    4  
ATOM 10260 O O    . VAL A 1 91  ? -7.470  1.283   9.984   1.00 0.67  ? 91  VAL A O    4  
ATOM 10261 C CB   . VAL A 1 91  ? -10.507 2.616   9.499   1.00 0.71  ? 91  VAL A CB   4  
ATOM 10262 C CG1  . VAL A 1 91  ? -10.405 1.410   8.559   1.00 0.80  ? 91  VAL A CG1  4  
ATOM 10263 C CG2  . VAL A 1 91  ? -11.877 2.604   10.168  1.00 0.75  ? 91  VAL A CG2  4  
ATOM 10264 H H    . VAL A 1 91  ? -9.746  4.668   10.888  1.00 0.65  ? 91  VAL A H    4  
ATOM 10265 H HA   . VAL A 1 91  ? -9.594  1.750   11.254  1.00 0.69  ? 91  VAL A HA   4  
ATOM 10266 H HB   . VAL A 1 91  ? -10.399 3.525   8.923   1.00 0.70  ? 91  VAL A HB   4  
ATOM 10267 H HG11 . VAL A 1 91  ? -9.529  1.507   7.935   1.00 1.38  ? 91  VAL A HG11 4  
ATOM 10268 H HG12 . VAL A 1 91  ? -11.286 1.367   7.935   1.00 1.38  ? 91  VAL A HG12 4  
ATOM 10269 H HG13 . VAL A 1 91  ? -10.336 0.506   9.142   1.00 1.12  ? 91  VAL A HG13 4  
ATOM 10270 H HG21 . VAL A 1 91  ? -12.639 2.610   9.404   1.00 1.26  ? 91  VAL A HG21 4  
ATOM 10271 H HG22 . VAL A 1 91  ? -11.983 3.478   10.794  1.00 1.29  ? 91  VAL A HG22 4  
ATOM 10272 H HG23 . VAL A 1 91  ? -11.978 1.713   10.770  1.00 1.25  ? 91  VAL A HG23 4  
ATOM 10273 N N    . PHE A 1 92  ? -7.562  3.325   9.194   1.00 0.64  ? 92  PHE A N    4  
ATOM 10274 C CA   . PHE A 1 92  ? -6.264  3.151   8.490   1.00 0.65  ? 92  PHE A CA   4  
ATOM 10275 C C    . PHE A 1 92  ? -5.170  2.737   9.478   1.00 0.62  ? 92  PHE A C    4  
ATOM 10276 O O    . PHE A 1 92  ? -4.285  1.975   9.142   1.00 0.67  ? 92  PHE A O    4  
ATOM 10277 C CB   . PHE A 1 92  ? -5.871  4.465   7.812   1.00 0.65  ? 92  PHE A CB   4  
ATOM 10278 C CG   . PHE A 1 92  ? -4.518  4.309   7.152   1.00 0.65  ? 92  PHE A CG   4  
ATOM 10279 C CD1  . PHE A 1 92  ? -4.380  3.481   6.030   1.00 1.31  ? 92  PHE A CD1  4  
ATOM 10280 C CD2  . PHE A 1 92  ? -3.401  4.989   7.658   1.00 1.44  ? 92  PHE A CD2  4  
ATOM 10281 C CE1  . PHE A 1 92  ? -3.130  3.333   5.416   1.00 1.31  ? 92  PHE A CE1  4  
ATOM 10282 C CE2  . PHE A 1 92  ? -2.152  4.841   7.044   1.00 1.47  ? 92  PHE A CE2  4  
ATOM 10283 C CZ   . PHE A 1 92  ? -2.016  4.013   5.923   1.00 0.73  ? 92  PHE A CZ   4  
ATOM 10284 H H    . PHE A 1 92  ? -8.054  4.169   9.118   1.00 0.63  ? 92  PHE A H    4  
ATOM 10285 H HA   . PHE A 1 92  ? -6.375  2.384   7.738   1.00 0.68  ? 92  PHE A HA   4  
ATOM 10286 H HB2  . PHE A 1 92  ? -6.609  4.717   7.064   1.00 0.66  ? 92  PHE A HB2  4  
ATOM 10287 H HB3  . PHE A 1 92  ? -5.825  5.252   8.551   1.00 0.67  ? 92  PHE A HB3  4  
ATOM 10288 H HD1  . PHE A 1 92  ? -5.239  2.956   5.638   1.00 2.16  ? 92  PHE A HD1  4  
ATOM 10289 H HD2  . PHE A 1 92  ? -3.505  5.627   8.523   1.00 2.30  ? 92  PHE A HD2  4  
ATOM 10290 H HE1  . PHE A 1 92  ? -3.025  2.695   4.551   1.00 2.16  ? 92  PHE A HE1  4  
ATOM 10291 H HE2  . PHE A 1 92  ? -1.293  5.365   7.435   1.00 2.34  ? 92  PHE A HE2  4  
ATOM 10292 H HZ   . PHE A 1 92  ? -1.052  3.900   5.449   1.00 0.77  ? 92  PHE A HZ   4  
ATOM 10293 N N    . PHE A 1 93  ? -5.201  3.240   10.690  1.00 0.58  ? 93  PHE A N    4  
ATOM 10294 C CA   . PHE A 1 93  ? -4.130  2.876   11.674  1.00 0.57  ? 93  PHE A CA   4  
ATOM 10295 C C    . PHE A 1 93  ? -4.536  1.619   12.454  1.00 0.59  ? 93  PHE A C    4  
ATOM 10296 O O    . PHE A 1 93  ? -3.706  0.793   12.777  1.00 0.60  ? 93  PHE A O    4  
ATOM 10297 C CB   . PHE A 1 93  ? -3.901  4.048   12.631  1.00 0.57  ? 93  PHE A CB   4  
ATOM 10298 C CG   . PHE A 1 93  ? -2.870  3.677   13.668  1.00 0.56  ? 93  PHE A CG   4  
ATOM 10299 C CD1  . PHE A 1 93  ? -3.263  3.035   14.849  1.00 1.47  ? 93  PHE A CD1  4  
ATOM 10300 C CD2  . PHE A 1 93  ? -1.522  3.985   13.454  1.00 1.15  ? 93  PHE A CD2  4  
ATOM 10301 C CE1  . PHE A 1 93  ? -2.307  2.700   15.815  1.00 1.58  ? 93  PHE A CE1  4  
ATOM 10302 C CE2  . PHE A 1 93  ? -0.565  3.649   14.419  1.00 1.07  ? 93  PHE A CE2  4  
ATOM 10303 C CZ   . PHE A 1 93  ? -0.958  3.007   15.600  1.00 0.70  ? 93  PHE A CZ   4  
ATOM 10304 H H    . PHE A 1 93  ? -5.912  3.865   10.946  1.00 0.57  ? 93  PHE A H    4  
ATOM 10305 H HA   . PHE A 1 93  ? -3.228  2.661   11.120  1.00 0.57  ? 93  PHE A HA   4  
ATOM 10306 H HB2  . PHE A 1 93  ? -3.555  4.904   12.071  1.00 0.62  ? 93  PHE A HB2  4  
ATOM 10307 H HB3  . PHE A 1 93  ? -4.831  4.294   13.123  1.00 0.56  ? 93  PHE A HB3  4  
ATOM 10308 H HD1  . PHE A 1 93  ? -4.304  2.797   15.014  1.00 2.29  ? 93  PHE A HD1  4  
ATOM 10309 H HD2  . PHE A 1 93  ? -1.219  4.480   12.543  1.00 2.04  ? 93  PHE A HD2  4  
ATOM 10310 H HE1  . PHE A 1 93  ? -2.610  2.205   16.726  1.00 2.50  ? 93  PHE A HE1  4  
ATOM 10311 H HE2  . PHE A 1 93  ? 0.475   3.886   14.254  1.00 1.86  ? 93  PHE A HE2  4  
ATOM 10312 H HZ   . PHE A 1 93  ? -0.220  2.749   16.346  1.00 0.78  ? 93  PHE A HZ   4  
ATOM 10313 N N    . ARG A 1 94  ? -5.796  1.452   12.752  1.00 0.62  ? 94  ARG A N    4  
ATOM 10314 C CA   . ARG A 1 94  ? -6.217  0.228   13.498  1.00 0.67  ? 94  ARG A CA   4  
ATOM 10315 C C    . ARG A 1 94  ? -6.056  -0.989  12.587  1.00 0.66  ? 94  ARG A C    4  
ATOM 10316 O O    . ARG A 1 94  ? -5.472  -1.981  12.974  1.00 0.67  ? 94  ARG A O    4  
ATOM 10317 C CB   . ARG A 1 94  ? -7.676  0.352   13.948  1.00 0.72  ? 94  ARG A CB   4  
ATOM 10318 C CG   . ARG A 1 94  ? -8.069  -0.848  14.824  1.00 0.89  ? 94  ARG A CG   4  
ATOM 10319 C CD   . ARG A 1 94  ? -7.224  -0.891  16.114  1.00 1.00  ? 94  ARG A CD   4  
ATOM 10320 N NE   . ARG A 1 94  ? -6.866  0.491   16.549  1.00 1.95  ? 94  ARG A NE   4  
ATOM 10321 C CZ   . ARG A 1 94  ? -6.443  0.707   17.764  1.00 2.64  ? 94  ARG A CZ   4  
ATOM 10322 N NH1  . ARG A 1 94  ? -6.318  -0.286  18.601  1.00 2.76  ? 94  ARG A NH1  4  
ATOM 10323 N NH2  . ARG A 1 94  ? -6.141  1.920   18.140  1.00 3.65  ? 94  ARG A NH2  4  
ATOM 10324 H H    . ARG A 1 94  ? -6.462  2.117   12.478  1.00 0.62  ? 94  ARG A H    4  
ATOM 10325 H HA   . ARG A 1 94  ? -5.573  0.078   14.350  1.00 0.68  ? 94  ARG A HA   4  
ATOM 10326 H HB2  . ARG A 1 94  ? -7.806  1.263   14.505  1.00 0.81  ? 94  ARG A HB2  4  
ATOM 10327 H HB3  . ARG A 1 94  ? -8.314  0.376   13.077  1.00 0.78  ? 94  ARG A HB3  4  
ATOM 10328 H HG2  . ARG A 1 94  ? -9.115  -0.766  15.085  1.00 1.50  ? 94  ARG A HG2  4  
ATOM 10329 H HG3  . ARG A 1 94  ? -7.915  -1.761  14.266  1.00 1.69  ? 94  ARG A HG3  4  
ATOM 10330 H HD2  . ARG A 1 94  ? -7.793  -1.375  16.897  1.00 1.49  ? 94  ARG A HD2  4  
ATOM 10331 H HD3  . ARG A 1 94  ? -6.320  -1.454  15.935  1.00 1.47  ? 94  ARG A HD3  4  
ATOM 10332 H HE   . ARG A 1 94  ? -6.948  1.239   15.926  1.00 2.46  ? 94  ARG A HE   4  
ATOM 10333 H HH11 . ARG A 1 94  ? -6.548  -1.215  18.311  1.00 2.42  ? 94  ARG A HH11 4  
ATOM 10334 H HH12 . ARG A 1 94  ? -5.993  -0.118  19.531  1.00 3.50  ? 94  ARG A HH12 4  
ATOM 10335 H HH21 . ARG A 1 94  ? -6.235  2.681   17.498  1.00 4.01  ? 94  ARG A HH21 4  
ATOM 10336 H HH22 . ARG A 1 94  ? -5.816  2.089   19.071  1.00 4.24  ? 94  ARG A HH22 4  
ATOM 10337 N N    . VAL A 1 95  ? -6.544  -0.936  11.380  1.00 0.65  ? 95  VAL A N    4  
ATOM 10338 C CA   . VAL A 1 95  ? -6.381  -2.102  10.469  1.00 0.66  ? 95  VAL A CA   4  
ATOM 10339 C C    . VAL A 1 95  ? -4.895  -2.333  10.206  1.00 0.66  ? 95  VAL A C    4  
ATOM 10340 O O    . VAL A 1 95  ? -4.419  -3.451  10.193  1.00 0.67  ? 95  VAL A O    4  
ATOM 10341 C CB   . VAL A 1 95  ? -7.077  -1.795  9.142   1.00 0.64  ? 95  VAL A CB   4  
ATOM 10342 C CG1  . VAL A 1 95  ? -6.849  -2.948  8.161   1.00 1.27  ? 95  VAL A CG1  4  
ATOM 10343 C CG2  . VAL A 1 95  ? -8.575  -1.629  9.389   1.00 1.08  ? 95  VAL A CG2  4  
ATOM 10344 H H    . VAL A 1 95  ? -7.008  -0.141  11.044  1.00 0.66  ? 95  VAL A H    4  
ATOM 10345 H HA   . VAL A 1 95  ? -6.827  -2.986  10.900  1.00 0.68  ? 95  VAL A HA   4  
ATOM 10346 H HB   . VAL A 1 95  ? -6.674  -0.883  8.726   1.00 1.14  ? 95  VAL A HB   4  
ATOM 10347 H HG11 . VAL A 1 95  ? -7.062  -3.886  8.652   1.00 1.81  ? 95  VAL A HG11 4  
ATOM 10348 H HG12 . VAL A 1 95  ? -5.821  -2.941  7.829   1.00 1.74  ? 95  VAL A HG12 4  
ATOM 10349 H HG13 . VAL A 1 95  ? -7.503  -2.830  7.310   1.00 1.85  ? 95  VAL A HG13 4  
ATOM 10350 H HG21 . VAL A 1 95  ? -8.987  -2.562  9.744   1.00 1.72  ? 95  VAL A HG21 4  
ATOM 10351 H HG22 . VAL A 1 95  ? -9.063  -1.347  8.468   1.00 1.70  ? 95  VAL A HG22 4  
ATOM 10352 H HG23 . VAL A 1 95  ? -8.732  -0.861  10.132  1.00 1.50  ? 95  VAL A HG23 4  
ATOM 10353 N N    . ALA A 1 96  ? -4.162  -1.278  9.976   1.00 0.65  ? 96  ALA A N    4  
ATOM 10354 C CA   . ALA A 1 96  ? -2.711  -1.428  9.691   1.00 0.68  ? 96  ALA A CA   4  
ATOM 10355 C C    . ALA A 1 96  ? -2.019  -2.105  10.869  1.00 0.70  ? 96  ALA A C    4  
ATOM 10356 O O    . ALA A 1 96  ? -1.314  -3.085  10.733  1.00 0.76  ? 96  ALA A O    4  
ATOM 10357 C CB   . ALA A 1 96  ? -2.111  -0.036  9.475   1.00 0.69  ? 96  ALA A CB   4  
ATOM 10358 H H    . ALA A 1 96  ? -4.573  -0.387  9.971   1.00 0.65  ? 96  ALA A H    4  
ATOM 10359 H HA   . ALA A 1 96  ? -2.613  -1.955  8.750   1.00 0.69  ? 96  ALA A HA   4  
ATOM 10360 H HB1  . ALA A 1 96  ? -2.566  0.423   8.611   1.00 1.19  ? 96  ALA A HB1  4  
ATOM 10361 H HB2  . ALA A 1 96  ? -1.047  -0.125  9.318   1.00 1.22  ? 96  ALA A HB2  4  
ATOM 10362 H HB3  . ALA A 1 96  ? -2.296  0.574   10.348  1.00 1.14  ? 96  ALA A HB3  4  
ATOM 10363 N N    . ALA A 1 97  ? -2.232  -1.550  12.036  1.00 0.74  ? 97  ALA A N    4  
ATOM 10364 C CA   . ALA A 1 97  ? -1.621  -2.084  13.285  1.00 0.78  ? 97  ALA A CA   4  
ATOM 10365 C C    . ALA A 1 97  ? -2.070  -3.523  13.533  1.00 0.79  ? 97  ALA A C    4  
ATOM 10366 O O    . ALA A 1 97  ? -1.280  -4.364  13.905  1.00 0.83  ? 97  ALA A O    4  
ATOM 10367 C CB   . ALA A 1 97  ? -2.070  -1.216  14.463  1.00 0.77  ? 97  ALA A CB   4  
ATOM 10368 H H    . ALA A 1 97  ? -2.806  -0.757  12.085  1.00 0.80  ? 97  ALA A H    4  
ATOM 10369 H HA   . ALA A 1 97  ? -0.544  -2.053  13.214  1.00 0.81  ? 97  ALA A HA   4  
ATOM 10370 H HB1  . ALA A 1 97  ? -1.608  -1.572  15.371  1.00 1.22  ? 97  ALA A HB1  4  
ATOM 10371 H HB2  . ALA A 1 97  ? -3.145  -1.271  14.560  1.00 1.21  ? 97  ALA A HB2  4  
ATOM 10372 H HB3  . ALA A 1 97  ? -1.778  -0.191  14.287  1.00 1.35  ? 97  ALA A HB3  4  
ATOM 10373 N N    . ASP A 1 98  ? -3.324  -3.823  13.331  1.00 0.78  ? 98  ASP A N    4  
ATOM 10374 C CA   . ASP A 1 98  ? -3.791  -5.218  13.567  1.00 0.82  ? 98  ASP A CA   4  
ATOM 10375 C C    . ASP A 1 98  ? -3.112  -6.142  12.559  1.00 0.83  ? 98  ASP A C    4  
ATOM 10376 O O    . ASP A 1 98  ? -2.657  -7.221  12.883  1.00 0.88  ? 98  ASP A O    4  
ATOM 10377 C CB   . ASP A 1 98  ? -5.308  -5.289  13.385  1.00 0.82  ? 98  ASP A CB   4  
ATOM 10378 C CG   . ASP A 1 98  ? -5.787  -6.716  13.661  1.00 1.47  ? 98  ASP A CG   4  
ATOM 10379 O OD1  . ASP A 1 98  ? -6.059  -7.017  14.812  1.00 2.13  ? 98  ASP A OD1  4  
ATOM 10380 O OD2  . ASP A 1 98  ? -5.872  -7.484  12.717  1.00 2.19  ? 98  ASP A OD2  4  
ATOM 10381 H H    . ASP A 1 98  ? -3.952  -3.142  13.010  1.00 0.77  ? 98  ASP A H    4  
ATOM 10382 H HA   . ASP A 1 98  ? -3.536  -5.509  14.576  1.00 0.85  ? 98  ASP A HA   4  
ATOM 10383 H HB2  . ASP A 1 98  ? -5.786  -4.608  14.075  1.00 1.13  ? 98  ASP A HB2  4  
ATOM 10384 H HB3  . ASP A 1 98  ? -5.564  -5.015  12.373  1.00 1.31  ? 98  ASP A HB3  4  
ATOM 10385 N N    . MET A 1 99  ? -3.062  -5.715  11.329  1.00 0.81  ? 99  MET A N    4  
ATOM 10386 C CA   . MET A 1 99  ? -2.439  -6.535  10.255  1.00 0.85  ? 99  MET A CA   4  
ATOM 10387 C C    . MET A 1 99  ? -0.953  -6.758  10.534  1.00 0.97  ? 99  MET A C    4  
ATOM 10388 O O    . MET A 1 99  ? -0.408  -7.795  10.214  1.00 1.14  ? 99  MET A O    4  
ATOM 10389 C CB   . MET A 1 99  ? -2.580  -5.789  8.922   1.00 0.79  ? 99  MET A CB   4  
ATOM 10390 C CG   . MET A 1 99  ? -2.114  -6.684  7.746   1.00 0.81  ? 99  MET A CG   4  
ATOM 10391 S SD   . MET A 1 99  ? -3.503  -7.008  6.627   1.00 0.97  ? 99  MET A SD   4  
ATOM 10392 C CE   . MET A 1 99  ? -3.537  -5.379  5.840   1.00 0.48  ? 99  MET A CE   4  
ATOM 10393 H H    . MET A 1 99  ? -3.450  -4.843  11.106  1.00 0.79  ? 99  MET A H    4  
ATOM 10394 H HA   . MET A 1 99  ? -2.939  -7.488  10.179  1.00 0.91  ? 99  MET A HA   4  
ATOM 10395 H HB2  . MET A 1 99  ? -3.615  -5.509  8.784   1.00 1.11  ? 99  MET A HB2  4  
ATOM 10396 H HB3  . MET A 1 99  ? -1.974  -4.894  8.956   1.00 1.06  ? 99  MET A HB3  4  
ATOM 10397 H HG2  . MET A 1 99  ? -1.331  -6.182  7.195   1.00 1.31  ? 99  MET A HG2  4  
ATOM 10398 H HG3  . MET A 1 99  ? -1.733  -7.626  8.120   1.00 1.20  ? 99  MET A HG3  4  
ATOM 10399 H HE1  . MET A 1 99  ? -4.481  -5.246  5.330   1.00 1.17  ? 99  MET A HE1  4  
ATOM 10400 H HE2  . MET A 1 99  ? -2.733  -5.307  5.125   1.00 1.11  ? 99  MET A HE2  4  
ATOM 10401 H HE3  . MET A 1 99  ? -3.416  -4.611  6.594   1.00 1.06  ? 99  MET A HE3  4  
ATOM 10402 N N    . PHE A 1 100 ? -0.286  -5.784  11.101  1.00 0.98  ? 100 PHE A N    4  
ATOM 10403 C CA   . PHE A 1 100 ? 1.180   -5.924  11.372  1.00 1.14  ? 100 PHE A CA   4  
ATOM 10404 C C    . PHE A 1 100 ? 1.462   -5.959  12.871  1.00 1.28  ? 100 PHE A C    4  
ATOM 10405 O O    . PHE A 1 100 ? 2.597   -5.850  13.287  1.00 1.67  ? 100 PHE A O    4  
ATOM 10406 C CB   . PHE A 1 100 ? 1.924   -4.743  10.739  1.00 1.19  ? 100 PHE A CB   4  
ATOM 10407 C CG   . PHE A 1 100 ? 1.982   -4.934  9.241   1.00 1.15  ? 100 PHE A CG   4  
ATOM 10408 C CD1  . PHE A 1 100 ? 2.706   -6.006  8.711   1.00 1.67  ? 100 PHE A CD1  4  
ATOM 10409 C CD2  . PHE A 1 100 ? 1.314   -4.049  8.385   1.00 1.64  ? 100 PHE A CD2  4  
ATOM 10410 C CE1  . PHE A 1 100 ? 2.767   -6.198  7.328   1.00 1.79  ? 100 PHE A CE1  4  
ATOM 10411 C CE2  . PHE A 1 100 ? 1.374   -4.240  6.999   1.00 1.69  ? 100 PHE A CE2  4  
ATOM 10412 C CZ   . PHE A 1 100 ? 2.101   -5.314  6.470   1.00 1.38  ? 100 PHE A CZ   4  
ATOM 10413 H H    . PHE A 1 100 ? -0.744  -4.949  11.332  1.00 0.94  ? 100 PHE A H    4  
ATOM 10414 H HA   . PHE A 1 100 ? 1.559   -6.846  10.960  1.00 1.20  ? 100 PHE A HA   4  
ATOM 10415 H HB2  . PHE A 1 100 ? 1.403   -3.824  10.971  1.00 1.19  ? 100 PHE A HB2  4  
ATOM 10416 H HB3  . PHE A 1 100 ? 2.929   -4.695  11.133  1.00 1.36  ? 100 PHE A HB3  4  
ATOM 10417 H HD1  . PHE A 1 100 ? 3.218   -6.686  9.372   1.00 2.36  ? 100 PHE A HD1  4  
ATOM 10418 H HD2  . PHE A 1 100 ? 0.754   -3.221  8.792   1.00 2.37  ? 100 PHE A HD2  4  
ATOM 10419 H HE1  . PHE A 1 100 ? 3.330   -7.027  6.923   1.00 2.56  ? 100 PHE A HE1  4  
ATOM 10420 H HE2  . PHE A 1 100 ? 0.859   -3.559  6.338   1.00 2.38  ? 100 PHE A HE2  4  
ATOM 10421 H HZ   . PHE A 1 100 ? 2.146   -5.462  5.401   1.00 1.54  ? 100 PHE A HZ   4  
ATOM 10422 N N    . SER A 1 101 ? 0.462   -6.097  13.695  1.00 1.34  ? 101 SER A N    4  
ATOM 10423 C CA   . SER A 1 101 ? 0.742   -6.121  15.156  1.00 1.52  ? 101 SER A CA   4  
ATOM 10424 C C    . SER A 1 101 ? 1.783   -7.208  15.449  1.00 1.61  ? 101 SER A C    4  
ATOM 10425 O O    . SER A 1 101 ? 1.437   -8.330  15.739  1.00 1.99  ? 101 SER A O    4  
ATOM 10426 C CB   . SER A 1 101 ? -0.537  -6.411  15.948  1.00 1.79  ? 101 SER A CB   4  
ATOM 10427 O OG   . SER A 1 101 ? -0.206  -6.602  17.316  1.00 2.21  ? 101 SER A OG   4  
ATOM 10428 H H    . SER A 1 101 ? -0.456  -6.160  13.358  1.00 1.50  ? 101 SER A H    4  
ATOM 10429 H HA   . SER A 1 101 ? 1.148   -5.160  15.433  1.00 1.75  ? 101 SER A HA   4  
ATOM 10430 H HB2  . SER A 1 101 ? -1.218  -5.584  15.862  1.00 2.11  ? 101 SER A HB2  4  
ATOM 10431 H HB3  . SER A 1 101 ? -1.006  -7.304  15.554  1.00 2.15  ? 101 SER A HB3  4  
ATOM 10432 H HG   . SER A 1 101 ? -0.994  -6.903  17.773  1.00 2.49  ? 101 SER A HG   4  
ATOM 10433 N N    . ASP A 1 102 ? 3.047   -6.843  15.421  1.00 1.99  ? 102 ASP A N    4  
ATOM 10434 C CA   . ASP A 1 102 ? 4.174   -7.788  15.741  1.00 2.34  ? 102 ASP A CA   4  
ATOM 10435 C C    . ASP A 1 102 ? 5.455   -7.229  15.098  1.00 2.07  ? 102 ASP A C    4  
ATOM 10436 O O    . ASP A 1 102 ? 5.422   -6.232  14.405  1.00 2.62  ? 102 ASP A O    4  
ATOM 10437 C CB   . ASP A 1 102 ? 3.912   -9.218  15.226  1.00 3.15  ? 102 ASP A CB   4  
ATOM 10438 C CG   . ASP A 1 102 ? 5.164   -10.076 15.430  1.00 3.78  ? 102 ASP A CG   4  
ATOM 10439 O OD1  . ASP A 1 102 ? 5.397   -10.486 16.555  1.00 4.10  ? 102 ASP A OD1  4  
ATOM 10440 O OD2  . ASP A 1 102 ? 5.866   -10.308 14.460  1.00 4.42  ? 102 ASP A OD2  4  
ATOM 10441 H H    . ASP A 1 102 ? 3.264   -5.903  15.244  1.00 2.41  ? 102 ASP A H    4  
ATOM 10442 H HA   . ASP A 1 102 ? 4.281   -7.776  16.816  1.00 2.78  ? 102 ASP A HA   4  
ATOM 10443 H HB2  . ASP A 1 102 ? 3.101   -9.665  15.773  1.00 3.32  ? 102 ASP A HB2  4  
ATOM 10444 H HB3  . ASP A 1 102 ? 3.670   -9.185  14.175  1.00 3.70  ? 102 ASP A HB3  4  
ATOM 10445 N N    . GLY A 1 103 ? 6.583   -7.845  15.334  1.00 2.05  ? 103 GLY A N    4  
ATOM 10446 C CA   . GLY A 1 103 ? 7.861   -7.328  14.752  1.00 2.45  ? 103 GLY A CA   4  
ATOM 10447 C C    . GLY A 1 103 ? 7.914   -7.561  13.234  1.00 2.44  ? 103 GLY A C    4  
ATOM 10448 O O    . GLY A 1 103 ? 6.984   -7.259  12.513  1.00 3.08  ? 103 GLY A O    4  
ATOM 10449 H H    . GLY A 1 103 ? 6.597   -8.638  15.910  1.00 2.36  ? 103 GLY A H    4  
ATOM 10450 H HA2  . GLY A 1 103 ? 7.935   -6.267  14.947  1.00 2.86  ? 103 GLY A HA2  4  
ATOM 10451 H HA3  . GLY A 1 103 ? 8.693   -7.834  15.218  1.00 2.87  ? 103 GLY A HA3  4  
ATOM 10452 N N    . ASN A 1 104 ? 9.018   -8.077  12.748  1.00 2.29  ? 104 ASN A N    4  
ATOM 10453 C CA   . ASN A 1 104 ? 9.175   -8.319  11.277  1.00 2.55  ? 104 ASN A CA   4  
ATOM 10454 C C    . ASN A 1 104 ? 7.964   -9.065  10.724  1.00 2.17  ? 104 ASN A C    4  
ATOM 10455 O O    . ASN A 1 104 ? 7.416   -9.937  11.370  1.00 2.54  ? 104 ASN A O    4  
ATOM 10456 C CB   . ASN A 1 104 ? 10.424  -9.168  11.037  1.00 3.20  ? 104 ASN A CB   4  
ATOM 10457 C CG   . ASN A 1 104 ? 11.673  -8.358  11.383  1.00 3.72  ? 104 ASN A CG   4  
ATOM 10458 O OD1  . ASN A 1 104 ? 12.366  -7.886  10.504  1.00 4.05  ? 104 ASN A OD1  4  
ATOM 10459 N ND2  . ASN A 1 104 ? 11.993  -8.179  12.635  1.00 4.31  ? 104 ASN A ND2  4  
ATOM 10460 H H    . ASN A 1 104 ? 9.757   -8.294  13.354  1.00 2.45  ? 104 ASN A H    4  
ATOM 10461 H HA   . ASN A 1 104 ? 9.281   -7.374  10.766  1.00 2.95  ? 104 ASN A HA   4  
ATOM 10462 H HB2  . ASN A 1 104 ? 10.381  -10.049 11.661  1.00 3.39  ? 104 ASN A HB2  4  
ATOM 10463 H HB3  . ASN A 1 104 ? 10.463  -9.464  10.000  1.00 3.67  ? 104 ASN A HB3  4  
ATOM 10464 H HD21 . ASN A 1 104 ? 11.434  -8.562  13.343  1.00 4.45  ? 104 ASN A HD21 4  
ATOM 10465 H HD22 . ASN A 1 104 ? 12.793  -7.664  12.867  1.00 4.84  ? 104 ASN A HD22 4  
ATOM 10466 N N    . PHE A 1 105 ? 7.520   -8.719  9.538   1.00 1.90  ? 105 PHE A N    4  
ATOM 10467 C CA   . PHE A 1 105 ? 6.323   -9.387  8.936   1.00 1.74  ? 105 PHE A CA   4  
ATOM 10468 C C    . PHE A 1 105 ? 6.612   -9.713  7.461   1.00 1.59  ? 105 PHE A C    4  
ATOM 10469 O O    . PHE A 1 105 ? 7.672   -9.416  6.947   1.00 1.88  ? 105 PHE A O    4  
ATOM 10470 C CB   . PHE A 1 105 ? 5.154   -8.402  9.008   1.00 2.03  ? 105 PHE A CB   4  
ATOM 10471 C CG   . PHE A 1 105 ? 5.674   -7.009  8.709   1.00 1.75  ? 105 PHE A CG   4  
ATOM 10472 C CD1  . PHE A 1 105 ? 5.985   -6.643  7.393   1.00 2.28  ? 105 PHE A CD1  4  
ATOM 10473 C CD2  . PHE A 1 105 ? 5.851   -6.089  9.751   1.00 2.14  ? 105 PHE A CD2  4  
ATOM 10474 C CE1  . PHE A 1 105 ? 6.470   -5.358  7.120   1.00 2.84  ? 105 PHE A CE1  4  
ATOM 10475 C CE2  . PHE A 1 105 ? 6.336   -4.804  9.476   1.00 2.60  ? 105 PHE A CE2  4  
ATOM 10476 C CZ   . PHE A 1 105 ? 6.646   -4.439  8.161   1.00 2.84  ? 105 PHE A CZ   4  
ATOM 10477 H H    . PHE A 1 105 ? 7.927   -7.994  9.020   1.00 2.17  ? 105 PHE A H    4  
ATOM 10478 H HA   . PHE A 1 105 ? 6.076   -10.290 9.472   1.00 1.98  ? 105 PHE A HA   4  
ATOM 10479 H HB2  . PHE A 1 105 ? 4.399   -8.673  8.283   1.00 2.66  ? 105 PHE A HB2  4  
ATOM 10480 H HB3  . PHE A 1 105 ? 4.727   -8.423  9.999   1.00 2.53  ? 105 PHE A HB3  4  
ATOM 10481 H HD1  . PHE A 1 105 ? 5.850   -7.351  6.589   1.00 2.82  ? 105 PHE A HD1  4  
ATOM 10482 H HD2  . PHE A 1 105 ? 5.613   -6.370  10.766  1.00 2.69  ? 105 PHE A HD2  4  
ATOM 10483 H HE1  . PHE A 1 105 ? 6.709   -5.075  6.105   1.00 3.66  ? 105 PHE A HE1  4  
ATOM 10484 H HE2  . PHE A 1 105 ? 6.473   -4.096  10.280  1.00 3.27  ? 105 PHE A HE2  4  
ATOM 10485 H HZ   . PHE A 1 105 ? 7.020   -3.448  7.950   1.00 3.53  ? 105 PHE A HZ   4  
ATOM 10486 N N    . ASN A 1 106 ? 5.672   -10.312 6.776   1.00 1.85  ? 106 ASN A N    4  
ATOM 10487 C CA   . ASN A 1 106 ? 5.875   -10.650 5.334   1.00 1.93  ? 106 ASN A CA   4  
ATOM 10488 C C    . ASN A 1 106 ? 5.745   -9.385  4.476   1.00 1.72  ? 106 ASN A C    4  
ATOM 10489 O O    . ASN A 1 106 ? 4.794   -8.638  4.591   1.00 2.31  ? 106 ASN A O    4  
ATOM 10490 C CB   . ASN A 1 106 ? 4.802   -11.655 4.906   1.00 2.62  ? 106 ASN A CB   4  
ATOM 10491 C CG   . ASN A 1 106 ? 4.891   -12.901 5.788   1.00 3.11  ? 106 ASN A CG   4  
ATOM 10492 O OD1  . ASN A 1 106 ? 5.956   -13.459 5.966   1.00 3.46  ? 106 ASN A OD1  4  
ATOM 10493 N ND2  . ASN A 1 106 ? 3.811   -13.364 6.355   1.00 3.79  ? 106 ASN A ND2  4  
ATOM 10494 H H    . ASN A 1 106 ? 4.818   -10.547 7.197   1.00 2.35  ? 106 ASN A H    4  
ATOM 10495 H HA   . ASN A 1 106 ? 6.849   -11.089 5.174   1.00 2.19  ? 106 ASN A HA   4  
ATOM 10496 H HB2  . ASN A 1 106 ? 3.825   -11.205 5.013   1.00 3.01  ? 106 ASN A HB2  4  
ATOM 10497 H HB3  . ASN A 1 106 ? 4.959   -11.934 3.875   1.00 3.06  ? 106 ASN A HB3  4  
ATOM 10498 H HD21 . ASN A 1 106 ? 2.952   -12.913 6.213   1.00 3.97  ? 106 ASN A HD21 4  
ATOM 10499 H HD22 . ASN A 1 106 ? 3.858   -14.161 6.922   1.00 4.42  ? 106 ASN A HD22 4  
ATOM 10500 N N    . TRP A 1 107 ? 6.705   -9.139  3.623   1.00 1.54  ? 107 TRP A N    4  
ATOM 10501 C CA   . TRP A 1 107 ? 6.657   -7.921  2.760   1.00 1.68  ? 107 TRP A CA   4  
ATOM 10502 C C    . TRP A 1 107 ? 5.443   -7.970  1.824   1.00 1.47  ? 107 TRP A C    4  
ATOM 10503 O O    . TRP A 1 107 ? 5.133   -7.015  1.141   1.00 1.49  ? 107 TRP A O    4  
ATOM 10504 C CB   . TRP A 1 107 ? 7.937   -7.845  1.921   1.00 2.30  ? 107 TRP A CB   4  
ATOM 10505 C CG   . TRP A 1 107 ? 9.106   -8.245  2.760   1.00 2.32  ? 107 TRP A CG   4  
ATOM 10506 C CD1  . TRP A 1 107 ? 9.896   -9.319  2.530   1.00 2.69  ? 107 TRP A CD1  4  
ATOM 10507 C CD2  . TRP A 1 107 ? 9.631   -7.598  3.954   1.00 2.77  ? 107 TRP A CD2  4  
ATOM 10508 N NE1  . TRP A 1 107 ? 10.873  -9.372  3.507   1.00 3.12  ? 107 TRP A NE1  4  
ATOM 10509 C CE2  . TRP A 1 107 ? 10.751  -8.333  4.408   1.00 3.35  ? 107 TRP A CE2  4  
ATOM 10510 C CE3  . TRP A 1 107 ? 9.247   -6.457  4.680   1.00 3.24  ? 107 TRP A CE3  4  
ATOM 10511 C CZ2  . TRP A 1 107 ? 11.467  -7.948  5.542   1.00 4.31  ? 107 TRP A CZ2  4  
ATOM 10512 C CZ3  . TRP A 1 107 ? 9.964   -6.067  5.823   1.00 4.29  ? 107 TRP A CZ3  4  
ATOM 10513 C CH2  . TRP A 1 107 ? 11.072  -6.811  6.253   1.00 4.80  ? 107 TRP A CH2  4  
ATOM 10514 H H    . TRP A 1 107 ? 7.467   -9.752  3.562   1.00 1.87  ? 107 TRP A H    4  
ATOM 10515 H HA   . TRP A 1 107 ? 6.589   -7.043  3.385   1.00 1.91  ? 107 TRP A HA   4  
ATOM 10516 H HB2  . TRP A 1 107 ? 7.859   -8.515  1.076   1.00 2.77  ? 107 TRP A HB2  4  
ATOM 10517 H HB3  . TRP A 1 107 ? 8.077   -6.834  1.568   1.00 2.87  ? 107 TRP A HB3  4  
ATOM 10518 H HD1  . TRP A 1 107 ? 9.782   -10.020 1.716   1.00 3.02  ? 107 TRP A HD1  4  
ATOM 10519 H HE1  . TRP A 1 107 ? 11.573  -10.054 3.569   1.00 3.54  ? 107 TRP A HE1  4  
ATOM 10520 H HE3  . TRP A 1 107 ? 8.395   -5.876  4.358   1.00 3.02  ? 107 TRP A HE3  4  
ATOM 10521 H HZ2  . TRP A 1 107 ? 12.319  -8.525  5.869   1.00 4.84  ? 107 TRP A HZ2  4  
ATOM 10522 H HZ3  . TRP A 1 107 ? 9.661   -5.189  6.373   1.00 4.86  ? 107 TRP A HZ3  4  
ATOM 10523 H HH2  . TRP A 1 107 ? 11.619  -6.506  7.132   1.00 5.71  ? 107 TRP A HH2  4  
ATOM 10524 N N    . GLY A 1 108 ? 4.769   -9.087  1.775   1.00 1.41  ? 108 GLY A N    4  
ATOM 10525 C CA   . GLY A 1 108 ? 3.592   -9.213  0.869   1.00 1.47  ? 108 GLY A CA   4  
ATOM 10526 C C    . GLY A 1 108 ? 2.342   -8.643  1.538   1.00 1.05  ? 108 GLY A C    4  
ATOM 10527 O O    . GLY A 1 108 ? 1.459   -8.104  0.882   1.00 1.02  ? 108 GLY A O    4  
ATOM 10528 H H    . GLY A 1 108 ? 5.050   -9.843  2.329   1.00 1.45  ? 108 GLY A H    4  
ATOM 10529 H HA2  . GLY A 1 108 ? 3.784   -8.677  -0.050  1.00 1.69  ? 108 GLY A HA2  4  
ATOM 10530 H HA3  . GLY A 1 108 ? 3.428   -10.257 0.644   1.00 1.74  ? 108 GLY A HA3  4  
ATOM 10531 N N    . ARG A 1 109 ? 2.229   -8.762  2.832   1.00 0.86  ? 109 ARG A N    4  
ATOM 10532 C CA   . ARG A 1 109 ? 1.003   -8.234  3.475   1.00 0.87  ? 109 ARG A CA   4  
ATOM 10533 C C    . ARG A 1 109 ? 0.931   -6.739  3.178   1.00 0.70  ? 109 ARG A C    4  
ATOM 10534 O O    . ARG A 1 109 ? -0.124  -6.140  3.138   1.00 0.81  ? 109 ARG A O    4  
ATOM 10535 C CB   . ARG A 1 109 ? 1.050   -8.480  4.987   1.00 1.08  ? 109 ARG A CB   4  
ATOM 10536 C CG   . ARG A 1 109 ? 0.741   -9.952  5.278   1.00 1.48  ? 109 ARG A CG   4  
ATOM 10537 C CD   . ARG A 1 109 ? 0.875   -10.220 6.777   1.00 1.96  ? 109 ARG A CD   4  
ATOM 10538 N NE   . ARG A 1 109 ? 0.380   -11.593 7.078   1.00 2.74  ? 109 ARG A NE   4  
ATOM 10539 C CZ   . ARG A 1 109 ? 0.663   -12.153 8.221   1.00 3.19  ? 109 ARG A CZ   4  
ATOM 10540 N NH1  . ARG A 1 109 ? 1.376   -11.510 9.104   1.00 3.19  ? 109 ARG A NH1  4  
ATOM 10541 N NH2  . ARG A 1 109 ? 0.233   -13.358 8.482   1.00 4.08  ? 109 ARG A NH2  4  
ATOM 10542 H H    . ARG A 1 109 ? 2.926   -9.205  3.360   1.00 0.93  ? 109 ARG A H    4  
ATOM 10543 H HA   . ARG A 1 109 ? 0.190   -8.791  3.028   1.00 1.25  ? 109 ARG A HA   4  
ATOM 10544 H HB2  . ARG A 1 109 ? 2.035   -8.238  5.360   1.00 1.43  ? 109 ARG A HB2  4  
ATOM 10545 H HB3  . ARG A 1 109 ? 0.317   -7.857  5.475   1.00 1.52  ? 109 ARG A HB3  4  
ATOM 10546 H HG2  . ARG A 1 109 ? -0.267  -10.176 4.961   1.00 2.00  ? 109 ARG A HG2  4  
ATOM 10547 H HG3  . ARG A 1 109 ? 1.436   -10.578 4.739   1.00 2.02  ? 109 ARG A HG3  4  
ATOM 10548 H HD2  . ARG A 1 109 ? 1.912   -10.139 7.067   1.00 2.34  ? 109 ARG A HD2  4  
ATOM 10549 H HD3  . ARG A 1 109 ? 0.289   -9.498  7.327   1.00 2.24  ? 109 ARG A HD3  4  
ATOM 10550 H HE   . ARG A 1 109 ? -0.156  -12.076 6.415   1.00 3.26  ? 109 ARG A HE   4  
ATOM 10551 H HH11 . ARG A 1 109 ? 1.705   -10.587 8.904   1.00 2.87  ? 109 ARG A HH11 4  
ATOM 10552 H HH12 . ARG A 1 109 ? 1.593   -11.939 9.981   1.00 3.82  ? 109 ARG A HH12 4  
ATOM 10553 H HH21 . ARG A 1 109 ? -0.314  -13.851 7.804   1.00 4.49  ? 109 ARG A HH21 4  
ATOM 10554 H HH22 . ARG A 1 109 ? 0.449   -13.788 9.358   1.00 4.54  ? 109 ARG A HH22 4  
ATOM 10555 N N    . VAL A 1 110 ? 2.081   -6.138  2.981   1.00 0.60  ? 110 VAL A N    4  
ATOM 10556 C CA   . VAL A 1 110 ? 2.142   -4.678  2.696   1.00 0.68  ? 110 VAL A CA   4  
ATOM 10557 C C    . VAL A 1 110 ? 1.393   -4.390  1.398   1.00 0.56  ? 110 VAL A C    4  
ATOM 10558 O O    . VAL A 1 110 ? 0.707   -3.395  1.279   1.00 0.60  ? 110 VAL A O    4  
ATOM 10559 C CB   . VAL A 1 110 ? 3.605   -4.243  2.561   1.00 0.88  ? 110 VAL A CB   4  
ATOM 10560 C CG1  . VAL A 1 110 ? 3.683   -2.730  2.353   1.00 1.27  ? 110 VAL A CG1  4  
ATOM 10561 C CG2  . VAL A 1 110 ? 4.376   -4.626  3.827   1.00 1.73  ? 110 VAL A CG2  4  
ATOM 10562 H H    . VAL A 1 110 ? 2.912   -6.656  3.031   1.00 0.60  ? 110 VAL A H    4  
ATOM 10563 H HA   . VAL A 1 110 ? 1.657   -4.148  3.501   1.00 0.87  ? 110 VAL A HA   4  
ATOM 10564 H HB   . VAL A 1 110 ? 4.046   -4.742  1.710   1.00 1.28  ? 110 VAL A HB   4  
ATOM 10565 H HG11 . VAL A 1 110 ? 3.198   -2.470  1.424   1.00 1.71  ? 110 VAL A HG11 4  
ATOM 10566 H HG12 . VAL A 1 110 ? 4.719   -2.427  2.314   1.00 1.81  ? 110 VAL A HG12 4  
ATOM 10567 H HG13 . VAL A 1 110 ? 3.191   -2.227  3.171   1.00 1.85  ? 110 VAL A HG13 4  
ATOM 10568 H HG21 . VAL A 1 110 ? 4.307   -5.693  3.982   1.00 2.12  ? 110 VAL A HG21 4  
ATOM 10569 H HG22 . VAL A 1 110 ? 3.953   -4.111  4.677   1.00 2.28  ? 110 VAL A HG22 4  
ATOM 10570 H HG23 . VAL A 1 110 ? 5.413   -4.346  3.715   1.00 2.29  ? 110 VAL A HG23 4  
ATOM 10571 N N    . VAL A 1 111 ? 1.497   -5.256  0.427   1.00 0.51  ? 111 VAL A N    4  
ATOM 10572 C CA   . VAL A 1 111 ? 0.757   -5.008  -0.838  1.00 0.50  ? 111 VAL A CA   4  
ATOM 10573 C C    . VAL A 1 111 ? -0.721  -4.853  -0.481  1.00 0.46  ? 111 VAL A C    4  
ATOM 10574 O O    . VAL A 1 111 ? -1.416  -4.003  -0.998  1.00 0.47  ? 111 VAL A O    4  
ATOM 10575 C CB   . VAL A 1 111 ? 0.953   -6.176  -1.803  1.00 0.58  ? 111 VAL A CB   4  
ATOM 10576 C CG1  . VAL A 1 111 ? 0.247   -5.865  -3.123  1.00 1.41  ? 111 VAL A CG1  4  
ATOM 10577 C CG2  . VAL A 1 111 ? 2.449   -6.376  -2.059  1.00 1.36  ? 111 VAL A CG2  4  
ATOM 10578 H H    . VAL A 1 111 ? 2.042   -6.061  0.546   1.00 0.55  ? 111 VAL A H    4  
ATOM 10579 H HA   . VAL A 1 111 ? 1.123   -4.093  -1.283  1.00 0.52  ? 111 VAL A HA   4  
ATOM 10580 H HB   . VAL A 1 111 ? 0.534   -7.074  -1.372  1.00 1.33  ? 111 VAL A HB   4  
ATOM 10581 H HG11 . VAL A 1 111 ? 0.415   -6.671  -3.820  1.00 2.00  ? 111 VAL A HG11 4  
ATOM 10582 H HG12 . VAL A 1 111 ? 0.641   -4.946  -3.533  1.00 1.95  ? 111 VAL A HG12 4  
ATOM 10583 H HG13 . VAL A 1 111 ? -0.813  -5.755  -2.948  1.00 1.98  ? 111 VAL A HG13 4  
ATOM 10584 H HG21 . VAL A 1 111 ? 2.946   -6.603  -1.128  1.00 1.80  ? 111 VAL A HG21 4  
ATOM 10585 H HG22 . VAL A 1 111 ? 2.866   -5.471  -2.478  1.00 2.02  ? 111 VAL A HG22 4  
ATOM 10586 H HG23 . VAL A 1 111 ? 2.590   -7.192  -2.752  1.00 1.95  ? 111 VAL A HG23 4  
ATOM 10587 N N    . ALA A 1 112 ? -1.195  -5.657  0.432   1.00 0.45  ? 112 ALA A N    4  
ATOM 10588 C CA   . ALA A 1 112 ? -2.622  -5.536  0.863   1.00 0.47  ? 112 ALA A CA   4  
ATOM 10589 C C    . ALA A 1 112 ? -2.846  -4.138  1.467   1.00 0.46  ? 112 ALA A C    4  
ATOM 10590 O O    . ALA A 1 112 ? -3.800  -3.464  1.135   1.00 0.54  ? 112 ALA A O    4  
ATOM 10591 C CB   . ALA A 1 112 ? -2.943  -6.618  1.895   1.00 0.53  ? 112 ALA A CB   4  
ATOM 10592 H H    . ALA A 1 112 ? -0.603  -6.330  0.848   1.00 0.47  ? 112 ALA A H    4  
ATOM 10593 H HA   . ALA A 1 112 ? -3.289  -5.610  0.017   1.00 0.49  ? 112 ALA A HA   4  
ATOM 10594 H HB1  . ALA A 1 112 ? -2.451  -6.384  2.827   1.00 1.17  ? 112 ALA A HB1  4  
ATOM 10595 H HB2  . ALA A 1 112 ? -2.596  -7.575  1.535   1.00 1.01  ? 112 ALA A HB2  4  
ATOM 10596 H HB3  . ALA A 1 112 ? -4.006  -6.658  2.051   1.00 1.25  ? 112 ALA A HB3  4  
ATOM 10597 N N    . LEU A 1 113 ? -1.967  -3.678  2.309   1.00 0.43  ? 113 LEU A N    4  
ATOM 10598 C CA   . LEU A 1 113 ? -2.120  -2.303  2.880   1.00 0.43  ? 113 LEU A CA   4  
ATOM 10599 C C    . LEU A 1 113 ? -2.277  -1.288  1.742   1.00 0.42  ? 113 LEU A C    4  
ATOM 10600 O O    . LEU A 1 113 ? -3.210  -0.510  1.702   1.00 0.45  ? 113 LEU A O    4  
ATOM 10601 C CB   . LEU A 1 113 ? -0.843  -1.947  3.657   1.00 0.44  ? 113 LEU A CB   4  
ATOM 10602 C CG   . LEU A 1 113 ? -1.004  -0.577  4.353   1.00 0.51  ? 113 LEU A CG   4  
ATOM 10603 C CD1  . LEU A 1 113 ? -2.171  -0.603  5.363   1.00 1.45  ? 113 LEU A CD1  4  
ATOM 10604 C CD2  . LEU A 1 113 ? 0.297   -0.237  5.088   1.00 1.27  ? 113 LEU A CD2  4  
ATOM 10605 H H    . LEU A 1 113 ? -1.184  -4.220  2.543   1.00 0.45  ? 113 LEU A H    4  
ATOM 10606 H HA   . LEU A 1 113 ? -2.948  -2.222  3.565   1.00 0.44  ? 113 LEU A HA   4  
ATOM 10607 H HB2  . LEU A 1 113 ? -0.654  -2.706  4.402   1.00 0.58  ? 113 LEU A HB2  4  
ATOM 10608 H HB3  . LEU A 1 113 ? -0.010  -1.901  2.973   1.00 0.53  ? 113 LEU A HB3  4  
ATOM 10609 H HG   . LEU A 1 113 ? -1.199  0.180   3.608   1.00 1.38  ? 113 LEU A HG   4  
ATOM 10610 H HD11 . LEU A 1 113 ? -1.983  0.102   6.162   1.00 2.09  ? 113 LEU A HD11 4  
ATOM 10611 H HD12 . LEU A 1 113 ? -2.273  -1.595  5.780   1.00 1.97  ? 113 LEU A HD12 4  
ATOM 10612 H HD13 . LEU A 1 113 ? -3.087  -0.329  4.860   1.00 1.99  ? 113 LEU A HD13 4  
ATOM 10613 H HD21 . LEU A 1 113 ? 1.113   -0.205  4.381   1.00 1.86  ? 113 LEU A HD21 4  
ATOM 10614 H HD22 . LEU A 1 113 ? 0.496   -0.991  5.835   1.00 1.87  ? 113 LEU A HD22 4  
ATOM 10615 H HD23 . LEU A 1 113 ? 0.197   0.726   5.567   1.00 1.85  ? 113 LEU A HD23 4  
ATOM 10616 N N    . PHE A 1 114 ? -1.356  -1.301  0.824   1.00 0.40  ? 114 PHE A N    4  
ATOM 10617 C CA   . PHE A 1 114 ? -1.385  -0.363  -0.337  1.00 0.40  ? 114 PHE A CA   4  
ATOM 10618 C C    . PHE A 1 114 ? -2.783  -0.311  -0.969  1.00 0.39  ? 114 PHE A C    4  
ATOM 10619 O O    . PHE A 1 114 ? -3.225  0.718   -1.441  1.00 0.41  ? 114 PHE A O    4  
ATOM 10620 C CB   . PHE A 1 114 ? -0.376  -0.870  -1.382  1.00 0.41  ? 114 PHE A CB   4  
ATOM 10621 C CG   . PHE A 1 114 ? 1.052   -0.499  -0.992  1.00 0.44  ? 114 PHE A CG   4  
ATOM 10622 C CD1  . PHE A 1 114 ? 1.426   -0.317  0.358   1.00 1.29  ? 114 PHE A CD1  4  
ATOM 10623 C CD2  . PHE A 1 114 ? 2.014   -0.342  -1.998  1.00 1.27  ? 114 PHE A CD2  4  
ATOM 10624 C CE1  . PHE A 1 114 ? 2.746   0.016   0.680   1.00 1.38  ? 114 PHE A CE1  4  
ATOM 10625 C CE2  . PHE A 1 114 ? 3.334   -0.009  -1.668  1.00 1.27  ? 114 PHE A CE2  4  
ATOM 10626 C CZ   . PHE A 1 114 ? 3.699   0.170   -0.330  1.00 0.68  ? 114 PHE A CZ   4  
ATOM 10627 H H    . PHE A 1 114 ? -0.622  -1.947  0.890   1.00 0.40  ? 114 PHE A H    4  
ATOM 10628 H HA   . PHE A 1 114 ? -1.085  0.638   -0.059  1.00 0.41  ? 114 PHE A HA   4  
ATOM 10629 H HB2  . PHE A 1 114 ? -0.452  -1.941  -1.461  1.00 0.49  ? 114 PHE A HB2  4  
ATOM 10630 H HB3  . PHE A 1 114 ? -0.602  -0.428  -2.343  1.00 0.43  ? 114 PHE A HB3  4  
ATOM 10631 H HD1  . PHE A 1 114 ? 0.708   -0.431  1.148   1.00 2.14  ? 114 PHE A HD1  4  
ATOM 10632 H HD2  . PHE A 1 114 ? 1.737   -0.478  -3.033  1.00 2.16  ? 114 PHE A HD2  4  
ATOM 10633 H HE1  . PHE A 1 114 ? 3.029   0.154   1.714   1.00 2.28  ? 114 PHE A HE1  4  
ATOM 10634 H HE2  . PHE A 1 114 ? 4.072   0.110   -2.448  1.00 2.12  ? 114 PHE A HE2  4  
ATOM 10635 H HZ   . PHE A 1 114 ? 4.717   0.426   -0.077  1.00 0.80  ? 114 PHE A HZ   4  
ATOM 10636 N N    . TYR A 1 115 ? -3.466  -1.421  -1.009  1.00 0.40  ? 115 TYR A N    4  
ATOM 10637 C CA   . TYR A 1 115 ? -4.819  -1.452  -1.640  1.00 0.41  ? 115 TYR A CA   4  
ATOM 10638 C C    . TYR A 1 115 ? -5.876  -0.835  -0.719  1.00 0.41  ? 115 TYR A C    4  
ATOM 10639 O O    . TYR A 1 115 ? -6.771  -0.149  -1.169  1.00 0.44  ? 115 TYR A O    4  
ATOM 10640 C CB   . TYR A 1 115 ? -5.202  -2.903  -1.940  1.00 0.44  ? 115 TYR A CB   4  
ATOM 10641 C CG   . TYR A 1 115 ? -6.489  -2.935  -2.732  1.00 0.47  ? 115 TYR A CG   4  
ATOM 10642 C CD1  . TYR A 1 115 ? -6.470  -2.656  -4.104  1.00 1.28  ? 115 TYR A CD1  4  
ATOM 10643 C CD2  . TYR A 1 115 ? -7.700  -3.244  -2.098  1.00 1.24  ? 115 TYR A CD2  4  
ATOM 10644 C CE1  . TYR A 1 115 ? -7.659  -2.686  -4.842  1.00 1.32  ? 115 TYR A CE1  4  
ATOM 10645 C CE2  . TYR A 1 115 ? -8.889  -3.274  -2.836  1.00 1.26  ? 115 TYR A CE2  4  
ATOM 10646 C CZ   . TYR A 1 115 ? -8.869  -2.995  -4.208  1.00 0.61  ? 115 TYR A CZ   4  
ATOM 10647 O OH   . TYR A 1 115 ? -10.041 -3.024  -4.936  1.00 0.70  ? 115 TYR A OH   4  
ATOM 10648 H H    . TYR A 1 115 ? -3.081  -2.244  -0.642  1.00 0.41  ? 115 TYR A H    4  
ATOM 10649 H HA   . TYR A 1 115 ? -4.803  -0.889  -2.560  1.00 0.42  ? 115 TYR A HA   4  
ATOM 10650 H HB2  . TYR A 1 115 ? -4.415  -3.371  -2.512  1.00 0.46  ? 115 TYR A HB2  4  
ATOM 10651 H HB3  . TYR A 1 115 ? -5.338  -3.438  -1.011  1.00 0.47  ? 115 TYR A HB3  4  
ATOM 10652 H HD1  . TYR A 1 115 ? -5.537  -2.418  -4.593  1.00 2.12  ? 115 TYR A HD1  4  
ATOM 10653 H HD2  . TYR A 1 115 ? -7.716  -3.459  -1.040  1.00 2.08  ? 115 TYR A HD2  4  
ATOM 10654 H HE1  . TYR A 1 115 ? -7.644  -2.471  -5.900  1.00 2.17  ? 115 TYR A HE1  4  
ATOM 10655 H HE2  . TYR A 1 115 ? -9.823  -3.512  -2.348  1.00 2.10  ? 115 TYR A HE2  4  
ATOM 10656 H HH   . TYR A 1 115 ? -9.829  -2.814  -5.848  1.00 1.23  ? 115 TYR A HH   4  
ATOM 10657 N N    . PHE A 1 116 ? -5.795  -1.075  0.558   1.00 0.38  ? 116 PHE A N    4  
ATOM 10658 C CA   . PHE A 1 116 ? -6.820  -0.497  1.470   1.00 0.38  ? 116 PHE A CA   4  
ATOM 10659 C C    . PHE A 1 116 ? -6.845  1.028   1.304   1.00 0.36  ? 116 PHE A C    4  
ATOM 10660 O O    . PHE A 1 116 ? -7.895  1.640   1.222   1.00 0.35  ? 116 PHE A O    4  
ATOM 10661 C CB   . PHE A 1 116 ? -6.475  -0.862  2.930   1.00 0.40  ? 116 PHE A CB   4  
ATOM 10662 C CG   . PHE A 1 116 ? -7.745  -0.984  3.759   1.00 0.37  ? 116 PHE A CG   4  
ATOM 10663 C CD1  . PHE A 1 116 ? -8.540  0.146   4.006   1.00 1.17  ? 116 PHE A CD1  4  
ATOM 10664 C CD2  . PHE A 1 116 ? -8.125  -2.228  4.284   1.00 1.35  ? 116 PHE A CD2  4  
ATOM 10665 C CE1  . PHE A 1 116 ? -9.705  0.030   4.774   1.00 1.18  ? 116 PHE A CE1  4  
ATOM 10666 C CE2  . PHE A 1 116 ? -9.291  -2.341  5.050   1.00 1.37  ? 116 PHE A CE2  4  
ATOM 10667 C CZ   . PHE A 1 116 ? -10.080 -1.213  5.295   1.00 0.45  ? 116 PHE A CZ   4  
ATOM 10668 H H    . PHE A 1 116 ? -5.074  -1.641  0.905   1.00 0.39  ? 116 PHE A H    4  
ATOM 10669 H HA   . PHE A 1 116 ? -7.780  -0.920  1.209   1.00 0.39  ? 116 PHE A HA   4  
ATOM 10670 H HB2  . PHE A 1 116 ? -5.946  -1.804  2.942   1.00 0.47  ? 116 PHE A HB2  4  
ATOM 10671 H HB3  . PHE A 1 116 ? -5.841  -0.097  3.359   1.00 0.41  ? 116 PHE A HB3  4  
ATOM 10672 H HD1  . PHE A 1 116 ? -8.258  1.105   3.604   1.00 2.09  ? 116 PHE A HD1  4  
ATOM 10673 H HD2  . PHE A 1 116 ? -7.520  -3.101  4.096   1.00 2.26  ? 116 PHE A HD2  4  
ATOM 10674 H HE1  . PHE A 1 116 ? -10.314 0.901   4.964   1.00 2.08  ? 116 PHE A HE1  4  
ATOM 10675 H HE2  . PHE A 1 116 ? -9.581  -3.300  5.453   1.00 2.29  ? 116 PHE A HE2  4  
ATOM 10676 H HZ   . PHE A 1 116 ? -10.979 -1.301  5.887   1.00 0.51  ? 116 PHE A HZ   4  
ATOM 10677 N N    . ALA A 1 117 ? -5.695  1.649   1.252   1.00 0.35  ? 117 ALA A N    4  
ATOM 10678 C CA   . ALA A 1 117 ? -5.663  3.128   1.093   1.00 0.34  ? 117 ALA A CA   4  
ATOM 10679 C C    . ALA A 1 117 ? -6.165  3.512   -0.300  1.00 0.34  ? 117 ALA A C    4  
ATOM 10680 O O    . ALA A 1 117 ? -6.906  4.460   -0.451  1.00 0.34  ? 117 ALA A O    4  
ATOM 10681 C CB   . ALA A 1 117 ? -4.239  3.651   1.290   1.00 0.37  ? 117 ALA A CB   4  
ATOM 10682 H H    . ALA A 1 117 ? -4.859  1.148   1.328   1.00 0.36  ? 117 ALA A H    4  
ATOM 10683 H HA   . ALA A 1 117 ? -6.322  3.565   1.826   1.00 0.34  ? 117 ALA A HA   4  
ATOM 10684 H HB1  . ALA A 1 117 ? -3.900  3.409   2.287   1.00 1.05  ? 117 ALA A HB1  4  
ATOM 10685 H HB2  . ALA A 1 117 ? -4.227  4.723   1.156   1.00 1.06  ? 117 ALA A HB2  4  
ATOM 10686 H HB3  . ALA A 1 117 ? -3.583  3.191   0.565   1.00 1.10  ? 117 ALA A HB3  4  
ATOM 10687 N N    . SER A 1 118 ? -5.781  2.788   -1.323  1.00 0.35  ? 118 SER A N    4  
ATOM 10688 C CA   . SER A 1 118 ? -6.249  3.124   -2.701  1.00 0.37  ? 118 SER A CA   4  
ATOM 10689 C C    . SER A 1 118 ? -7.750  3.427   -2.695  1.00 0.36  ? 118 SER A C    4  
ATOM 10690 O O    . SER A 1 118 ? -8.212  4.358   -3.323  1.00 0.36  ? 118 SER A O    4  
ATOM 10691 C CB   . SER A 1 118 ? -5.974  1.934   -3.626  1.00 0.42  ? 118 SER A CB   4  
ATOM 10692 O OG   . SER A 1 118 ? -4.676  1.422   -3.356  1.00 1.25  ? 118 SER A OG   4  
ATOM 10693 H H    . SER A 1 118 ? -5.192  2.014   -1.208  1.00 0.37  ? 118 SER A H    4  
ATOM 10694 H HA   . SER A 1 118 ? -5.710  3.987   -3.063  1.00 0.38  ? 118 SER A HA   4  
ATOM 10695 H HB2  . SER A 1 118 ? -6.703  1.160   -3.451  1.00 1.08  ? 118 SER A HB2  4  
ATOM 10696 H HB3  . SER A 1 118 ? -6.037  2.258   -4.657  1.00 1.10  ? 118 SER A HB3  4  
ATOM 10697 H HG   . SER A 1 118 ? -4.489  0.733   -3.998  1.00 1.71  ? 118 SER A HG   4  
ATOM 10698 N N    . LYS A 1 119 ? -8.505  2.662   -1.956  1.00 0.37  ? 119 LYS A N    4  
ATOM 10699 C CA   . LYS A 1 119 ? -9.970  2.912   -1.866  1.00 0.39  ? 119 LYS A CA   4  
ATOM 10700 C C    . LYS A 1 119 ? -10.192 4.259   -1.171  1.00 0.36  ? 119 LYS A C    4  
ATOM 10701 O O    . LYS A 1 119 ? -10.883 5.113   -1.689  1.00 0.38  ? 119 LYS A O    4  
ATOM 10702 C CB   . LYS A 1 119 ? -10.640 1.779   -1.066  1.00 0.46  ? 119 LYS A CB   4  
ATOM 10703 C CG   . LYS A 1 119 ? -12.112 1.612   -1.496  1.00 1.29  ? 119 LYS A CG   4  
ATOM 10704 C CD   . LYS A 1 119 ? -12.206 0.621   -2.663  1.00 1.84  ? 119 LYS A CD   4  
ATOM 10705 C CE   . LYS A 1 119 ? -13.662 0.495   -3.112  1.00 2.48  ? 119 LYS A CE   4  
ATOM 10706 N NZ   . LYS A 1 119 ? -13.742 -0.430  -4.277  1.00 3.36  ? 119 LYS A NZ   4  
ATOM 10707 H H    . LYS A 1 119 ? -8.102  1.934   -1.438  1.00 0.38  ? 119 LYS A H    4  
ATOM 10708 H HA   . LYS A 1 119 ? -10.410 2.992   -2.850  1.00 0.42  ? 119 LYS A HA   4  
ATOM 10709 H HB2  . LYS A 1 119 ? -10.101 0.857   -1.241  1.00 0.98  ? 119 LYS A HB2  4  
ATOM 10710 H HB3  . LYS A 1 119 ? -10.600 2.011   -0.010  1.00 0.99  ? 119 LYS A HB3  4  
ATOM 10711 H HG2  . LYS A 1 119 ? -12.687 1.237   -0.663  1.00 1.92  ? 119 LYS A HG2  4  
ATOM 10712 H HG3  . LYS A 1 119 ? -12.514 2.566   -1.805  1.00 1.81  ? 119 LYS A HG3  4  
ATOM 10713 H HD2  . LYS A 1 119 ? -11.604 0.977   -3.486  1.00 2.21  ? 119 LYS A HD2  4  
ATOM 10714 H HD3  . LYS A 1 119 ? -11.846 -0.345  -2.343  1.00 2.29  ? 119 LYS A HD3  4  
ATOM 10715 H HE2  . LYS A 1 119 ? -14.257 0.104   -2.300  1.00 2.99  ? 119 LYS A HE2  4  
ATOM 10716 H HE3  . LYS A 1 119 ? -14.037 1.467   -3.397  1.00 2.53  ? 119 LYS A HE3  4  
ATOM 10717 H HZ1  . LYS A 1 119 ? -14.711 -0.796  -4.364  1.00 3.76  ? 119 LYS A HZ1  4  
ATOM 10718 H HZ2  . LYS A 1 119 ? -13.082 -1.222  -4.136  1.00 3.68  ? 119 LYS A HZ2  4  
ATOM 10719 H HZ3  . LYS A 1 119 ? -13.489 0.083   -5.145  1.00 3.74  ? 119 LYS A HZ3  4  
ATOM 10720 N N    . LEU A 1 120 ? -9.598  4.485   -0.029  1.00 0.36  ? 120 LEU A N    4  
ATOM 10721 C CA   . LEU A 1 120 ? -9.780  5.812   0.636   1.00 0.35  ? 120 LEU A CA   4  
ATOM 10722 C C    . LEU A 1 120 ? -9.494  6.910   -0.393  1.00 0.33  ? 120 LEU A C    4  
ATOM 10723 O O    . LEU A 1 120 ? -10.184 7.907   -0.473  1.00 0.39  ? 120 LEU A O    4  
ATOM 10724 C CB   . LEU A 1 120 ? -8.802  5.939   1.804   1.00 0.36  ? 120 LEU A CB   4  
ATOM 10725 C CG   . LEU A 1 120 ? -8.917  4.707   2.706   1.00 0.68  ? 120 LEU A CG   4  
ATOM 10726 C CD1  . LEU A 1 120 ? -8.005  4.884   3.922   1.00 1.69  ? 120 LEU A CD1  4  
ATOM 10727 C CD2  . LEU A 1 120 ? -10.371 4.529   3.173   1.00 1.28  ? 120 LEU A CD2  4  
ATOM 10728 H H    . LEU A 1 120 ? -9.020  3.799   0.375   1.00 0.41  ? 120 LEU A H    4  
ATOM 10729 H HA   . LEU A 1 120 ? -10.791 5.913   1.003   1.00 0.39  ? 120 LEU A HA   4  
ATOM 10730 H HB2  . LEU A 1 120 ? -7.794  6.013   1.422   1.00 0.60  ? 120 LEU A HB2  4  
ATOM 10731 H HB3  . LEU A 1 120 ? -9.037  6.824   2.376   1.00 0.65  ? 120 LEU A HB3  4  
ATOM 10732 H HG   . LEU A 1 120 ? -8.609  3.834   2.152   1.00 1.47  ? 120 LEU A HG   4  
ATOM 10733 H HD11 . LEU A 1 120 ? -8.065  4.006   4.548   1.00 2.18  ? 120 LEU A HD11 4  
ATOM 10734 H HD12 . LEU A 1 120 ? -8.321  5.750   4.486   1.00 2.20  ? 120 LEU A HD12 4  
ATOM 10735 H HD13 . LEU A 1 120 ? -6.987  5.022   3.592   1.00 2.31  ? 120 LEU A HD13 4  
ATOM 10736 H HD21 . LEU A 1 120 ? -10.944 4.056   2.389   1.00 1.86  ? 120 LEU A HD21 4  
ATOM 10737 H HD22 . LEU A 1 120 ? -10.801 5.493   3.401   1.00 1.90  ? 120 LEU A HD22 4  
ATOM 10738 H HD23 . LEU A 1 120 ? -10.395 3.907   4.057   1.00 1.79  ? 120 LEU A HD23 4  
ATOM 10739 N N    . VAL A 1 121 ? -8.491  6.703   -1.198  1.00 0.33  ? 121 VAL A N    4  
ATOM 10740 C CA   . VAL A 1 121 ? -8.144  7.687   -2.257  1.00 0.39  ? 121 VAL A CA   4  
ATOM 10741 C C    . VAL A 1 121 ? -9.181  7.619   -3.386  1.00 0.36  ? 121 VAL A C    4  
ATOM 10742 O O    . VAL A 1 121 ? -9.963  8.528   -3.578  1.00 0.39  ? 121 VAL A O    4  
ATOM 10743 C CB   . VAL A 1 121 ? -6.758  7.370   -2.816  1.00 0.54  ? 121 VAL A CB   4  
ATOM 10744 C CG1  . VAL A 1 121 ? -6.338  8.479   -3.780  1.00 0.95  ? 121 VAL A CG1  4  
ATOM 10745 C CG2  . VAL A 1 121 ? -5.747  7.300   -1.668  1.00 1.18  ? 121 VAL A CG2  4  
ATOM 10746 H H    . VAL A 1 121 ? -7.969  5.877   -1.117  1.00 0.34  ? 121 VAL A H    4  
ATOM 10747 H HA   . VAL A 1 121 ? -8.144  8.703   -1.881  1.00 0.51  ? 121 VAL A HA   4  
ATOM 10748 H HB   . VAL A 1 121 ? -6.783  6.425   -3.339  1.00 1.28  ? 121 VAL A HB   4  
ATOM 10749 H HG11 . VAL A 1 121 ? -7.059  8.558   -4.579  1.00 1.65  ? 121 VAL A HG11 4  
ATOM 10750 H HG12 . VAL A 1 121 ? -5.371  8.245   -4.190  1.00 1.36  ? 121 VAL A HG12 4  
ATOM 10751 H HG13 . VAL A 1 121 ? -6.286  9.416   -3.246  1.00 1.60  ? 121 VAL A HG13 4  
ATOM 10752 H HG21 . VAL A 1 121 ? -5.704  8.257   -1.168  1.00 1.78  ? 121 VAL A HG21 4  
ATOM 10753 H HG22 . VAL A 1 121 ? -4.771  7.056   -2.061  1.00 1.69  ? 121 VAL A HG22 4  
ATOM 10754 H HG23 . VAL A 1 121 ? -6.050  6.542   -0.965  1.00 1.75  ? 121 VAL A HG23 4  
ATOM 10755 N N    . LEU A 1 122 ? -9.187  6.549   -4.143  1.00 0.37  ? 122 LEU A N    4  
ATOM 10756 C CA   . LEU A 1 122 ? -10.167 6.427   -5.265  1.00 0.39  ? 122 LEU A CA   4  
ATOM 10757 C C    . LEU A 1 122 ? -11.566 6.818   -4.774  1.00 0.40  ? 122 LEU A C    4  
ATOM 10758 O O    . LEU A 1 122 ? -12.195 7.706   -5.313  1.00 0.40  ? 122 LEU A O    4  
ATOM 10759 C CB   . LEU A 1 122 ? -10.179 4.974   -5.789  1.00 0.42  ? 122 LEU A CB   4  
ATOM 10760 C CG   . LEU A 1 122 ? -9.160  4.809   -6.925  1.00 0.72  ? 122 LEU A CG   4  
ATOM 10761 C CD1  . LEU A 1 122 ? -7.748  5.050   -6.390  1.00 1.15  ? 122 LEU A CD1  4  
ATOM 10762 C CD2  . LEU A 1 122 ? -9.254  3.390   -7.491  1.00 1.24  ? 122 LEU A CD2  4  
ATOM 10763 H H    . LEU A 1 122 ? -8.543  5.827   -3.983  1.00 0.39  ? 122 LEU A H    4  
ATOM 10764 H HA   . LEU A 1 122 ? -9.881  7.100   -6.061  1.00 0.40  ? 122 LEU A HA   4  
ATOM 10765 H HB2  . LEU A 1 122 ? -9.922  4.304   -4.982  1.00 0.62  ? 122 LEU A HB2  4  
ATOM 10766 H HB3  . LEU A 1 122 ? -11.163 4.725   -6.160  1.00 0.70  ? 122 LEU A HB3  4  
ATOM 10767 H HG   . LEU A 1 122 ? -9.373  5.523   -7.708  1.00 1.46  ? 122 LEU A HG   4  
ATOM 10768 H HD11 . LEU A 1 122 ? -7.032  4.907   -7.186  1.00 1.70  ? 122 LEU A HD11 4  
ATOM 10769 H HD12 . LEU A 1 122 ? -7.542  4.352   -5.591  1.00 1.65  ? 122 LEU A HD12 4  
ATOM 10770 H HD13 . LEU A 1 122 ? -7.672  6.059   -6.014  1.00 1.70  ? 122 LEU A HD13 4  
ATOM 10771 H HD21 . LEU A 1 122 ? -10.257 3.212   -7.852  1.00 1.80  ? 122 LEU A HD21 4  
ATOM 10772 H HD22 . LEU A 1 122 ? -9.018  2.676   -6.716  1.00 1.64  ? 122 LEU A HD22 4  
ATOM 10773 H HD23 . LEU A 1 122 ? -8.554  3.281   -8.307  1.00 1.86  ? 122 LEU A HD23 4  
ATOM 10774 N N    . LYS A 1 123 ? -12.054 6.178   -3.745  1.00 0.51  ? 123 LYS A N    4  
ATOM 10775 C CA   . LYS A 1 123 ? -13.403 6.542   -3.223  1.00 0.55  ? 123 LYS A CA   4  
ATOM 10776 C C    . LYS A 1 123 ? -13.470 8.061   -3.039  1.00 0.54  ? 123 LYS A C    4  
ATOM 10777 O O    . LYS A 1 123 ? -14.507 8.662   -3.214  1.00 0.55  ? 123 LYS A O    4  
ATOM 10778 C CB   . LYS A 1 123 ? -13.654 5.842   -1.875  1.00 0.59  ? 123 LYS A CB   4  
ATOM 10779 C CG   . LYS A 1 123 ? -15.167 5.730   -1.597  1.00 0.97  ? 123 LYS A CG   4  
ATOM 10780 C CD   . LYS A 1 123 ? -15.733 4.456   -2.238  1.00 1.37  ? 123 LYS A CD   4  
ATOM 10781 C CE   . LYS A 1 123 ? -17.246 4.403   -2.018  1.00 1.74  ? 123 LYS A CE   4  
ATOM 10782 N NZ   . LYS A 1 123 ? -17.902 5.469   -2.826  1.00 2.32  ? 123 LYS A NZ   4  
ATOM 10783 H H    . LYS A 1 123 ? -11.532 5.472   -3.311  1.00 0.62  ? 123 LYS A H    4  
ATOM 10784 H HA   . LYS A 1 123 ? -14.166 6.258   -3.933  1.00 0.56  ? 123 LYS A HA   4  
ATOM 10785 H HB2  . LYS A 1 123 ? -13.216 4.856   -1.900  1.00 0.98  ? 123 LYS A HB2  4  
ATOM 10786 H HB3  . LYS A 1 123 ? -13.191 6.416   -1.083  1.00 0.98  ? 123 LYS A HB3  4  
ATOM 10787 H HG2  . LYS A 1 123 ? -15.332 5.690   -0.529  1.00 1.58  ? 123 LYS A HG2  4  
ATOM 10788 H HG3  . LYS A 1 123 ? -15.678 6.591   -2.003  1.00 1.56  ? 123 LYS A HG3  4  
ATOM 10789 H HD2  . LYS A 1 123 ? -15.522 4.460   -3.298  1.00 1.88  ? 123 LYS A HD2  4  
ATOM 10790 H HD3  . LYS A 1 123 ? -15.275 3.590   -1.783  1.00 1.93  ? 123 LYS A HD3  4  
ATOM 10791 H HE2  . LYS A 1 123 ? -17.621 3.438   -2.323  1.00 2.16  ? 123 LYS A HE2  4  
ATOM 10792 H HE3  . LYS A 1 123 ? -17.463 4.560   -0.971  1.00 2.15  ? 123 LYS A HE3  4  
ATOM 10793 H HZ1  . LYS A 1 123 ? -17.320 6.330   -2.803  1.00 2.93  ? 123 LYS A HZ1  4  
ATOM 10794 H HZ2  . LYS A 1 123 ? -18.842 5.675   -2.430  1.00 2.67  ? 123 LYS A HZ2  4  
ATOM 10795 H HZ3  . LYS A 1 123 ? -18.002 5.147   -3.809  1.00 2.55  ? 123 LYS A HZ3  4  
ATOM 10796 N N    . ALA A 1 124 ? -12.377 8.687   -2.681  1.00 0.52  ? 124 ALA A N    4  
ATOM 10797 C CA   . ALA A 1 124 ? -12.407 10.166  -2.485  1.00 0.52  ? 124 ALA A CA   4  
ATOM 10798 C C    . ALA A 1 124 ? -12.406 10.877  -3.839  1.00 0.51  ? 124 ALA A C    4  
ATOM 10799 O O    . ALA A 1 124 ? -12.964 11.941  -3.999  1.00 0.54  ? 124 ALA A O    4  
ATOM 10800 C CB   . ALA A 1 124 ? -11.199 10.621  -1.682  1.00 0.51  ? 124 ALA A CB   4  
ATOM 10801 H H    . ALA A 1 124 ? -11.546 8.188   -2.533  1.00 0.51  ? 124 ALA A H    4  
ATOM 10802 H HA   . ALA A 1 124 ? -13.309 10.427  -1.958  1.00 0.54  ? 124 ALA A HA   4  
ATOM 10803 H HB1  . ALA A 1 124 ? -11.303 11.672  -1.460  1.00 1.07  ? 124 ALA A HB1  4  
ATOM 10804 H HB2  . ALA A 1 124 ? -10.304 10.459  -2.262  1.00 1.08  ? 124 ALA A HB2  4  
ATOM 10805 H HB3  . ALA A 1 124 ? -11.144 10.060  -0.762  1.00 1.07  ? 124 ALA A HB3  4  
ATOM 10806 N N    . LEU A 1 125 ? -11.800 10.279  -4.827  1.00 0.47  ? 125 LEU A N    4  
ATOM 10807 C CA   . LEU A 1 125 ? -11.772 10.887  -6.177  1.00 0.47  ? 125 LEU A CA   4  
ATOM 10808 C C    . LEU A 1 125 ? -13.197 10.940  -6.729  1.00 0.48  ? 125 LEU A C    4  
ATOM 10809 O O    . LEU A 1 125 ? -13.642 11.953  -7.232  1.00 0.48  ? 125 LEU A O    4  
ATOM 10810 C CB   . LEU A 1 125 ? -10.900 9.998   -7.079  1.00 0.51  ? 125 LEU A CB   4  
ATOM 10811 C CG   . LEU A 1 125 ? -10.933 10.493  -8.530  1.00 0.49  ? 125 LEU A CG   4  
ATOM 10812 C CD1  . LEU A 1 125 ? -10.363 11.915  -8.625  1.00 1.10  ? 125 LEU A CD1  4  
ATOM 10813 C CD2  . LEU A 1 125 ? -10.098 9.546   -9.398  1.00 1.21  ? 125 LEU A CD2  4  
ATOM 10814 H H    . LEU A 1 125 ? -11.380 9.405   -4.700  1.00 0.45  ? 125 LEU A H    4  
ATOM 10815 H HA   . LEU A 1 125 ? -11.350 11.881  -6.161  1.00 0.47  ? 125 LEU A HA   4  
ATOM 10816 H HB2  . LEU A 1 125 ? -9.881  10.020  -6.720  1.00 0.65  ? 125 LEU A HB2  4  
ATOM 10817 H HB3  . LEU A 1 125 ? -11.267 8.984   -7.043  1.00 0.63  ? 125 LEU A HB3  4  
ATOM 10818 H HG   . LEU A 1 125 ? -11.949 10.491  -8.881  1.00 1.08  ? 125 LEU A HG   4  
ATOM 10819 H HD11 . LEU A 1 125 ? -9.509  12.009  -7.969  1.00 1.73  ? 125 LEU A HD11 4  
ATOM 10820 H HD12 . LEU A 1 125 ? -11.121 12.628  -8.335  1.00 1.64  ? 125 LEU A HD12 4  
ATOM 10821 H HD13 . LEU A 1 125 ? -10.058 12.117  -9.642  1.00 1.64  ? 125 LEU A HD13 4  
ATOM 10822 H HD21 . LEU A 1 125 ? -9.082  9.524   -9.033  1.00 1.87  ? 125 LEU A HD21 4  
ATOM 10823 H HD22 . LEU A 1 125 ? -10.107 9.894   -10.421 1.00 1.77  ? 125 LEU A HD22 4  
ATOM 10824 H HD23 . LEU A 1 125 ? -10.519 8.553   -9.352  1.00 1.57  ? 125 LEU A HD23 4  
ATOM 10825 N N    . CYS A 1 126 ? -13.904 9.845   -6.669  1.00 0.52  ? 126 CYS A N    4  
ATOM 10826 C CA   . CYS A 1 126 ? -15.291 9.818   -7.224  1.00 0.57  ? 126 CYS A CA   4  
ATOM 10827 C C    . CYS A 1 126 ? -16.200 10.758  -6.432  1.00 0.57  ? 126 CYS A C    4  
ATOM 10828 O O    . CYS A 1 126 ? -17.311 11.047  -6.828  1.00 0.68  ? 126 CYS A O    4  
ATOM 10829 C CB   . CYS A 1 126 ? -15.844 8.381   -7.157  1.00 0.66  ? 126 CYS A CB   4  
ATOM 10830 S SG   . CYS A 1 126 ? -16.623 8.079   -5.543  1.00 1.67  ? 126 CYS A SG   4  
ATOM 10831 H H    . CYS A 1 126 ? -13.514 9.029   -6.288  1.00 0.54  ? 126 CYS A H    4  
ATOM 10832 H HA   . CYS A 1 126 ? -15.256 10.132  -8.258  1.00 0.59  ? 126 CYS A HA   4  
ATOM 10833 H HB2  . CYS A 1 126 ? -16.584 8.260   -7.932  1.00 1.24  ? 126 CYS A HB2  4  
ATOM 10834 H HB3  . CYS A 1 126 ? -15.028 7.684   -7.282  1.00 1.23  ? 126 CYS A HB3  4  
ATOM 10835 H HG   . CYS A 1 126 ? -16.144 8.587   -4.883  1.00 2.20  ? 126 CYS A HG   4  
ATOM 10836 N N    . THR A 1 127 ? -15.731 11.236  -5.315  1.00 0.57  ? 127 THR A N    4  
ATOM 10837 C CA   . THR A 1 127 ? -16.553 12.160  -4.485  1.00 0.60  ? 127 THR A CA   4  
ATOM 10838 C C    . THR A 1 127 ? -16.134 13.595  -4.830  1.00 0.62  ? 127 THR A C    4  
ATOM 10839 O O    . THR A 1 127 ? -16.729 14.562  -4.398  1.00 0.70  ? 127 THR A O    4  
ATOM 10840 C CB   . THR A 1 127 ? -16.239 11.864  -3.000  1.00 0.60  ? 127 THR A CB   4  
ATOM 10841 O OG1  . THR A 1 127 ? -15.284 10.832  -2.921  1.00 1.14  ? 127 THR A OG1  4  
ATOM 10842 C CG2  . THR A 1 127 ? -17.490 11.459  -2.204  1.00 1.19  ? 127 THR A CG2  4  
ATOM 10843 H H    . THR A 1 127 ? -14.823 10.998  -5.034  1.00 0.65  ? 127 THR A H    4  
ATOM 10844 H HA   . THR A 1 127 ? -17.604 11.973  -4.675  1.00 0.70  ? 127 THR A HA   4  
ATOM 10845 H HB   . THR A 1 127 ? -15.823 12.751  -2.533  1.00 1.00  ? 127 THR A HB   4  
ATOM 10846 H HG1  . THR A 1 127 ? -15.564 10.122  -3.497  1.00 1.73  ? 127 THR A HG1  4  
ATOM 10847 H HG21 . THR A 1 127 ? -18.246 12.221  -2.288  1.00 1.77  ? 127 THR A HG21 4  
ATOM 10848 H HG22 . THR A 1 127 ? -17.229 11.310  -1.168  1.00 1.72  ? 127 THR A HG22 4  
ATOM 10849 H HG23 . THR A 1 127 ? -17.872 10.527  -2.609  1.00 1.72  ? 127 THR A HG23 4  
ATOM 10850 N N    . LYS A 1 128 ? -15.077 13.708  -5.602  1.00 0.60  ? 128 LYS A N    4  
ATOM 10851 C CA   . LYS A 1 128 ? -14.536 15.040  -6.006  1.00 0.70  ? 128 LYS A CA   4  
ATOM 10852 C C    . LYS A 1 128 ? -14.122 15.841  -4.769  1.00 0.61  ? 128 LYS A C    4  
ATOM 10853 O O    . LYS A 1 128 ? -14.715 16.860  -4.470  1.00 0.60  ? 128 LYS A O    4  
ATOM 10854 C CB   . LYS A 1 128 ? -15.577 15.829  -6.820  1.00 0.87  ? 128 LYS A CB   4  
ATOM 10855 C CG   . LYS A 1 128 ? -15.944 15.065  -8.121  1.00 1.12  ? 128 LYS A CG   4  
ATOM 10856 C CD   . LYS A 1 128 ? -17.337 14.433  -7.999  1.00 1.43  ? 128 LYS A CD   4  
ATOM 10857 C CE   . LYS A 1 128 ? -17.682 13.702  -9.298  1.00 1.83  ? 128 LYS A CE   4  
ATOM 10858 N NZ   . LYS A 1 128 ? -17.711 14.678  -10.425 1.00 2.47  ? 128 LYS A NZ   4  
ATOM 10859 H H    . LYS A 1 128 ? -14.623 12.896  -5.911  1.00 0.57  ? 128 LYS A H    4  
ATOM 10860 H HA   . LYS A 1 128 ? -13.649 14.897  -6.606  1.00 0.81  ? 128 LYS A HA   4  
ATOM 10861 H HB2  . LYS A 1 128 ? -16.460 15.984  -6.218  1.00 0.88  ? 128 LYS A HB2  4  
ATOM 10862 H HB3  . LYS A 1 128 ? -15.157 16.791  -7.079  1.00 0.94  ? 128 LYS A HB3  4  
ATOM 10863 H HG2  . LYS A 1 128 ? -15.945 15.754  -8.955  1.00 1.28  ? 128 LYS A HG2  4  
ATOM 10864 H HG3  . LYS A 1 128 ? -15.218 14.285  -8.311  1.00 1.39  ? 128 LYS A HG3  4  
ATOM 10865 H HD2  . LYS A 1 128 ? -17.344 13.732  -7.176  1.00 1.67  ? 128 LYS A HD2  4  
ATOM 10866 H HD3  . LYS A 1 128 ? -18.069 15.207  -7.819  1.00 1.69  ? 128 LYS A HD3  4  
ATOM 10867 H HE2  . LYS A 1 128 ? -16.936 12.947  -9.496  1.00 2.13  ? 128 LYS A HE2  4  
ATOM 10868 H HE3  . LYS A 1 128 ? -18.651 13.234  -9.202  1.00 2.19  ? 128 LYS A HE3  4  
ATOM 10869 H HZ1  . LYS A 1 128 ? -17.055 14.369  -11.169 1.00 2.85  ? 128 LYS A HZ1  4  
ATOM 10870 H HZ2  . LYS A 1 128 ? -17.426 15.617  -10.078 1.00 2.89  ? 128 LYS A HZ2  4  
ATOM 10871 H HZ3  . LYS A 1 128 ? -18.674 14.729  -10.815 1.00 2.86  ? 128 LYS A HZ3  4  
ATOM 10872 N N    . VAL A 1 129 ? -13.104 15.413  -4.045  1.00 0.60  ? 129 VAL A N    4  
ATOM 10873 C CA   . VAL A 1 129 ? -12.656 16.182  -2.834  1.00 0.53  ? 129 VAL A CA   4  
ATOM 10874 C C    . VAL A 1 129 ? -11.102 16.230  -2.816  1.00 0.53  ? 129 VAL A C    4  
ATOM 10875 O O    . VAL A 1 129 ? -10.468 15.538  -2.051  1.00 0.56  ? 129 VAL A O    4  
ATOM 10876 C CB   . VAL A 1 129 ? -13.218 15.490  -1.566  1.00 0.57  ? 129 VAL A CB   4  
ATOM 10877 C CG1  . VAL A 1 129 ? -12.771 14.027  -1.476  1.00 1.40  ? 129 VAL A CG1  4  
ATOM 10878 C CG2  . VAL A 1 129 ? -12.793 16.260  -0.307  1.00 1.22  ? 129 VAL A CG2  4  
ATOM 10879 H H    . VAL A 1 129 ? -12.620 14.593  -4.278  1.00 0.66  ? 129 VAL A H    4  
ATOM 10880 H HA   . VAL A 1 129 ? -13.047 17.185  -2.902  1.00 0.54  ? 129 VAL A HA   4  
ATOM 10881 H HB   . VAL A 1 129 ? -14.290 15.487  -1.621  1.00 1.05  ? 129 VAL A HB   4  
ATOM 10882 H HG11 . VAL A 1 129 ? -13.102 13.611  -0.538  1.00 1.84  ? 129 VAL A HG11 4  
ATOM 10883 H HG12 . VAL A 1 129 ? -11.706 13.953  -1.539  1.00 2.01  ? 129 VAL A HG12 4  
ATOM 10884 H HG13 . VAL A 1 129 ? -13.216 13.472  -2.284  1.00 1.91  ? 129 VAL A HG13 4  
ATOM 10885 H HG21 . VAL A 1 129 ? -11.734 16.456  -0.330  1.00 1.76  ? 129 VAL A HG21 4  
ATOM 10886 H HG22 . VAL A 1 129 ? -13.032 15.675  0.568   1.00 1.84  ? 129 VAL A HG22 4  
ATOM 10887 H HG23 . VAL A 1 129 ? -13.330 17.197  -0.265  1.00 1.66  ? 129 VAL A HG23 4  
ATOM 10888 N N    . PRO A 1 130 ? -10.508 17.036  -3.675  1.00 0.62  ? 130 PRO A N    4  
ATOM 10889 C CA   . PRO A 1 130 ? -9.035  17.119  -3.746  1.00 0.73  ? 130 PRO A CA   4  
ATOM 10890 C C    . PRO A 1 130 ? -8.447  17.468  -2.368  1.00 0.65  ? 130 PRO A C    4  
ATOM 10891 O O    . PRO A 1 130 ? -7.281  17.243  -2.108  1.00 0.64  ? 130 PRO A O    4  
ATOM 10892 C CB   . PRO A 1 130 ? -8.733  18.180  -4.822  1.00 1.00  ? 130 PRO A CB   4  
ATOM 10893 C CG   . PRO A 1 130 ? -10.102 18.649  -5.403  1.00 1.00  ? 130 PRO A CG   4  
ATOM 10894 C CD   . PRO A 1 130 ? -11.223 17.924  -4.617  1.00 0.75  ? 130 PRO A CD   4  
ATOM 10895 H HA   . PRO A 1 130 ? -8.622  16.163  -4.021  1.00 0.84  ? 130 PRO A HA   4  
ATOM 10896 H HB2  . PRO A 1 130 ? -8.205  19.019  -4.383  1.00 1.10  ? 130 PRO A HB2  4  
ATOM 10897 H HB3  . PRO A 1 130 ? -8.134  17.747  -5.611  1.00 1.18  ? 130 PRO A HB3  4  
ATOM 10898 H HG2  . PRO A 1 130 ? -10.201 19.723  -5.287  1.00 1.11  ? 130 PRO A HG2  4  
ATOM 10899 H HG3  . PRO A 1 130 ? -10.167 18.392  -6.452  1.00 1.11  ? 130 PRO A HG3  4  
ATOM 10900 H HD2  . PRO A 1 130 ? -11.821 18.647  -4.079  1.00 0.76  ? 130 PRO A HD2  4  
ATOM 10901 H HD3  . PRO A 1 130 ? -11.843 17.341  -5.283  1.00 0.75  ? 130 PRO A HD3  4  
ATOM 10902 N N    . GLU A 1 131 ? -9.253  17.956  -1.472  1.00 0.73  ? 131 GLU A N    4  
ATOM 10903 C CA   . GLU A 1 131 ? -8.753  18.252  -0.102  1.00 0.82  ? 131 GLU A CA   4  
ATOM 10904 C C    . GLU A 1 131 ? -8.379  16.935  0.586   1.00 0.72  ? 131 GLU A C    4  
ATOM 10905 O O    . GLU A 1 131 ? -7.478  16.863  1.398   1.00 0.73  ? 131 GLU A O    4  
ATOM 10906 C CB   . GLU A 1 131 ? -9.884  18.904  0.713   1.00 1.09  ? 131 GLU A CB   4  
ATOM 10907 C CG   . GLU A 1 131 ? -9.299  19.491  2.009   1.00 1.55  ? 131 GLU A CG   4  
ATOM 10908 C CD   . GLU A 1 131 ? -10.365 20.305  2.743   1.00 2.17  ? 131 GLU A CD   4  
ATOM 10909 O OE1  . GLU A 1 131 ? -11.284 19.702  3.271   1.00 2.86  ? 131 GLU A OE1  4  
ATOM 10910 O OE2  . GLU A 1 131 ? -10.239 21.519  2.770   1.00 2.52  ? 131 GLU A OE2  4  
ATOM 10911 H H    . GLU A 1 131 ? -10.200 18.090  -1.687  1.00 0.82  ? 131 GLU A H    4  
ATOM 10912 H HA   . GLU A 1 131 ? -7.925  18.949  -0.108  1.00 0.90  ? 131 GLU A HA   4  
ATOM 10913 H HB2  . GLU A 1 131 ? -10.335 19.695  0.130   1.00 1.38  ? 131 GLU A HB2  4  
ATOM 10914 H HB3  . GLU A 1 131 ? -10.632 18.166  0.959   1.00 1.55  ? 131 GLU A HB3  4  
ATOM 10915 H HG2  . GLU A 1 131 ? -8.959  18.688  2.645   1.00 2.03  ? 131 GLU A HG2  4  
ATOM 10916 H HG3  . GLU A 1 131 ? -8.465  20.136  1.771   1.00 1.89  ? 131 GLU A HG3  4  
ATOM 10917 N N    . LEU A 1 132 ? -9.111  15.898  0.267   1.00 0.71  ? 132 LEU A N    4  
ATOM 10918 C CA   . LEU A 1 132 ? -8.888  14.559  0.875   1.00 0.69  ? 132 LEU A CA   4  
ATOM 10919 C C    . LEU A 1 132 ? -7.789  13.790  0.133   1.00 0.58  ? 132 LEU A C    4  
ATOM 10920 O O    . LEU A 1 132 ? -6.957  13.159  0.754   1.00 0.59  ? 132 LEU A O    4  
ATOM 10921 C CB   . LEU A 1 132 ? -10.221 13.783  0.819   1.00 0.80  ? 132 LEU A CB   4  
ATOM 10922 C CG   . LEU A 1 132 ? -10.490 13.025  2.126   1.00 0.60  ? 132 LEU A CG   4  
ATOM 10923 C CD1  . LEU A 1 132 ? -10.587 14.004  3.321   1.00 1.11  ? 132 LEU A CD1  4  
ATOM 10924 C CD2  . LEU A 1 132 ? -11.808 12.253  1.972   1.00 0.77  ? 132 LEU A CD2  4  
ATOM 10925 H H    . LEU A 1 132 ? -9.839  15.999  -0.377  1.00 0.77  ? 132 LEU A H    4  
ATOM 10926 H HA   . LEU A 1 132 ? -8.562  14.649  1.888   1.00 0.73  ? 132 LEU A HA   4  
ATOM 10927 H HB2  . LEU A 1 132 ? -11.025 14.479  0.652   1.00 1.25  ? 132 LEU A HB2  4  
ATOM 10928 H HB3  . LEU A 1 132 ? -10.197 13.076  0.004   1.00 1.02  ? 132 LEU A HB3  4  
ATOM 10929 H HG   . LEU A 1 132 ? -9.685  12.331  2.296   1.00 0.96  ? 132 LEU A HG   4  
ATOM 10930 H HD11 . LEU A 1 132 ? -9.630  14.051  3.824   1.00 1.71  ? 132 LEU A HD11 4  
ATOM 10931 H HD12 . LEU A 1 132 ? -11.336 13.660  4.021   1.00 1.45  ? 132 LEU A HD12 4  
ATOM 10932 H HD13 . LEU A 1 132 ? -10.855 14.991  2.969   1.00 1.58  ? 132 LEU A HD13 4  
ATOM 10933 H HD21 . LEU A 1 132 ? -11.678 11.459  1.253   1.00 1.39  ? 132 LEU A HD21 4  
ATOM 10934 H HD22 . LEU A 1 132 ? -12.581 12.928  1.628   1.00 1.46  ? 132 LEU A HD22 4  
ATOM 10935 H HD23 . LEU A 1 132 ? -12.094 11.834  2.925   1.00 1.25  ? 132 LEU A HD23 4  
ATOM 10936 N N    . ILE A 1 133 ? -7.762  13.815  -1.171  1.00 0.52  ? 133 ILE A N    4  
ATOM 10937 C CA   . ILE A 1 133 ? -6.690  13.062  -1.887  1.00 0.46  ? 133 ILE A CA   4  
ATOM 10938 C C    . ILE A 1 133 ? -5.336  13.428  -1.273  1.00 0.43  ? 133 ILE A C    4  
ATOM 10939 O O    . ILE A 1 133 ? -4.510  12.578  -1.005  1.00 0.46  ? 133 ILE A O    4  
ATOM 10940 C CB   . ILE A 1 133 ? -6.715  13.419  -3.378  1.00 0.45  ? 133 ILE A CB   4  
ATOM 10941 C CG1  . ILE A 1 133 ? -8.100  13.084  -3.943  1.00 0.42  ? 133 ILE A CG1  4  
ATOM 10942 C CG2  . ILE A 1 133 ? -5.647  12.615  -4.130  1.00 0.49  ? 133 ILE A CG2  4  
ATOM 10943 C CD1  . ILE A 1 133 ? -8.167  13.463  -5.424  1.00 1.19  ? 133 ILE A CD1  4  
ATOM 10944 H H    . ILE A 1 133 ? -8.432  14.319  -1.678  1.00 0.56  ? 133 ILE A H    4  
ATOM 10945 H HA   . ILE A 1 133 ? -6.859  12.002  -1.763  1.00 0.50  ? 133 ILE A HA   4  
ATOM 10946 H HB   . ILE A 1 133 ? -6.519  14.473  -3.498  1.00 0.52  ? 133 ILE A HB   4  
ATOM 10947 H HG12 . ILE A 1 133 ? -8.283  12.024  -3.835  1.00 1.01  ? 133 ILE A HG12 4  
ATOM 10948 H HG13 . ILE A 1 133 ? -8.852  13.635  -3.399  1.00 1.03  ? 133 ILE A HG13 4  
ATOM 10949 H HG21 . ILE A 1 133 ? -5.628  12.922  -5.165  1.00 1.14  ? 133 ILE A HG21 4  
ATOM 10950 H HG22 . ILE A 1 133 ? -5.881  11.564  -4.073  1.00 1.19  ? 133 ILE A HG22 4  
ATOM 10951 H HG23 . ILE A 1 133 ? -4.677  12.791  -3.688  1.00 1.08  ? 133 ILE A HG23 4  
ATOM 10952 H HD11 . ILE A 1 133 ? -9.189  13.389  -5.769  1.00 1.86  ? 133 ILE A HD11 4  
ATOM 10953 H HD12 . ILE A 1 133 ? -7.545  12.791  -5.997  1.00 1.78  ? 133 ILE A HD12 4  
ATOM 10954 H HD13 . ILE A 1 133 ? -7.817  14.476  -5.553  1.00 1.68  ? 133 ILE A HD13 4  
ATOM 10955 N N    . ARG A 1 134 ? -5.106  14.692  -1.053  1.00 0.42  ? 134 ARG A N    4  
ATOM 10956 C CA   . ARG A 1 134 ? -3.809  15.121  -0.462  1.00 0.43  ? 134 ARG A CA   4  
ATOM 10957 C C    . ARG A 1 134 ? -3.756  14.747  1.030   1.00 0.40  ? 134 ARG A C    4  
ATOM 10958 O O    . ARG A 1 134 ? -2.730  14.336  1.535   1.00 0.39  ? 134 ARG A O    4  
ATOM 10959 C CB   . ARG A 1 134 ? -3.663  16.637  -0.626  1.00 0.51  ? 134 ARG A CB   4  
ATOM 10960 C CG   . ARG A 1 134 ? -3.746  16.993  -2.113  1.00 1.26  ? 134 ARG A CG   4  
ATOM 10961 C CD   . ARG A 1 134 ? -3.814  18.513  -2.282  1.00 1.57  ? 134 ARG A CD   4  
ATOM 10962 N NE   . ARG A 1 134 ? -3.936  18.841  -3.732  1.00 2.30  ? 134 ARG A NE   4  
ATOM 10963 C CZ   . ARG A 1 134 ? -4.300  20.039  -4.104  1.00 2.86  ? 134 ARG A CZ   4  
ATOM 10964 N NH1  . ARG A 1 134 ? -4.553  20.952  -3.207  1.00 2.98  ? 134 ARG A NH1  4  
ATOM 10965 N NH2  . ARG A 1 134 ? -4.409  20.322  -5.373  1.00 3.71  ? 134 ARG A NH2  4  
ATOM 10966 H H    . ARG A 1 134 ? -5.786  15.358  -1.297  1.00 0.45  ? 134 ARG A H    4  
ATOM 10967 H HA   . ARG A 1 134 ? -3.008  14.624  -0.992  1.00 0.44  ? 134 ARG A HA   4  
ATOM 10968 H HB2  . ARG A 1 134 ? -4.458  17.135  -0.089  1.00 0.98  ? 134 ARG A HB2  4  
ATOM 10969 H HB3  . ARG A 1 134 ? -2.708  16.953  -0.234  1.00 1.10  ? 134 ARG A HB3  4  
ATOM 10970 H HG2  . ARG A 1 134 ? -2.872  16.614  -2.622  1.00 1.75  ? 134 ARG A HG2  4  
ATOM 10971 H HG3  . ARG A 1 134 ? -4.631  16.547  -2.540  1.00 1.79  ? 134 ARG A HG3  4  
ATOM 10972 H HD2  . ARG A 1 134 ? -4.673  18.897  -1.752  1.00 1.69  ? 134 ARG A HD2  4  
ATOM 10973 H HD3  . ARG A 1 134 ? -2.915  18.961  -1.886  1.00 1.89  ? 134 ARG A HD3  4  
ATOM 10974 H HE   . ARG A 1 134 ? -3.745  18.157  -4.406  1.00 2.71  ? 134 ARG A HE   4  
ATOM 10975 H HH11 . ARG A 1 134 ? -4.469  20.735  -2.235  1.00 2.70  ? 134 ARG A HH11 4  
ATOM 10976 H HH12 . ARG A 1 134 ? -4.832  21.869  -3.493  1.00 3.64  ? 134 ARG A HH12 4  
ATOM 10977 H HH21 . ARG A 1 134 ? -4.215  19.623  -6.061  1.00 4.02  ? 134 ARG A HH21 4  
ATOM 10978 H HH22 . ARG A 1 134 ? -4.688  21.240  -5.658  1.00 4.22  ? 134 ARG A HH22 4  
ATOM 10979 N N    . THR A 1 135 ? -4.843  14.912  1.746   1.00 0.41  ? 135 THR A N    4  
ATOM 10980 C CA   . THR A 1 135 ? -4.825  14.590  3.208   1.00 0.41  ? 135 THR A CA   4  
ATOM 10981 C C    . THR A 1 135 ? -4.688  13.083  3.439   1.00 0.39  ? 135 THR A C    4  
ATOM 10982 O O    . THR A 1 135 ? -4.014  12.649  4.351   1.00 0.52  ? 135 THR A O    4  
ATOM 10983 C CB   . THR A 1 135 ? -6.088  15.111  3.895   1.00 0.42  ? 135 THR A CB   4  
ATOM 10984 O OG1  . THR A 1 135 ? -6.116  16.528  3.804   1.00 0.89  ? 135 THR A OG1  4  
ATOM 10985 C CG2  . THR A 1 135 ? -6.081  14.699  5.370   1.00 0.88  ? 135 THR A CG2  4  
ATOM 10986 H H    . THR A 1 135 ? -5.649  15.272  1.320   1.00 0.43  ? 135 THR A H    4  
ATOM 10987 H HA   . THR A 1 135 ? -3.972  15.075  3.651   1.00 0.42  ? 135 THR A HA   4  
ATOM 10988 H HB   . THR A 1 135 ? -6.961  14.710  3.422   1.00 0.74  ? 135 THR A HB   4  
ATOM 10989 H HG1  . THR A 1 135 ? -6.336  16.877  4.671   1.00 1.41  ? 135 THR A HG1  4  
ATOM 10990 H HG21 . THR A 1 135 ? -6.244  13.635  5.450   1.00 1.52  ? 135 THR A HG21 4  
ATOM 10991 H HG22 . THR A 1 135 ? -6.867  15.223  5.893   1.00 1.47  ? 135 THR A HG22 4  
ATOM 10992 H HG23 . THR A 1 135 ? -5.127  14.951  5.810   1.00 1.37  ? 135 THR A HG23 4  
ATOM 10993 N N    . ILE A 1 136 ? -5.275  12.276  2.599   1.00 0.35  ? 136 ILE A N    4  
ATOM 10994 C CA   . ILE A 1 136 ? -5.120  10.804  2.759   1.00 0.36  ? 136 ILE A CA   4  
ATOM 10995 C C    . ILE A 1 136 ? -3.643  10.471  2.543   1.00 0.35  ? 136 ILE A C    4  
ATOM 10996 O O    . ILE A 1 136 ? -2.960  10.078  3.468   1.00 0.51  ? 136 ILE A O    4  
ATOM 10997 C CB   . ILE A 1 136 ? -6.012  10.086  1.730   1.00 0.46  ? 136 ILE A CB   4  
ATOM 10998 C CG1  . ILE A 1 136 ? -7.483  10.207  2.177   1.00 0.60  ? 136 ILE A CG1  4  
ATOM 10999 C CG2  . ILE A 1 136 ? -5.625  8.604   1.644   1.00 0.94  ? 136 ILE A CG2  4  
ATOM 11000 C CD1  . ILE A 1 136 ? -8.423  10.028  0.981   1.00 0.64  ? 136 ILE A CD1  4  
ATOM 11001 H H    . ILE A 1 136 ? -5.777  12.621  1.832   1.00 0.41  ? 136 ILE A H    4  
ATOM 11002 H HA   . ILE A 1 136 ? -5.389  10.475  3.753   1.00 0.40  ? 136 ILE A HA   4  
ATOM 11003 H HB   . ILE A 1 136 ? -5.886  10.548  0.762   1.00 0.84  ? 136 ILE A HB   4  
ATOM 11004 H HG12 . ILE A 1 136 ? -7.702  9.453   2.919   1.00 1.16  ? 136 ILE A HG12 4  
ATOM 11005 H HG13 . ILE A 1 136 ? -7.650  11.186  2.608   1.00 1.18  ? 136 ILE A HG13 4  
ATOM 11006 H HG21 . ILE A 1 136 ? -5.524  8.200   2.641   1.00 1.44  ? 136 ILE A HG21 4  
ATOM 11007 H HG22 . ILE A 1 136 ? -4.688  8.505   1.118   1.00 1.48  ? 136 ILE A HG22 4  
ATOM 11008 H HG23 . ILE A 1 136 ? -6.395  8.062   1.113   1.00 1.51  ? 136 ILE A HG23 4  
ATOM 11009 H HD11 . ILE A 1 136 ? -9.447  10.126  1.311   1.00 1.15  ? 136 ILE A HD11 4  
ATOM 11010 H HD12 . ILE A 1 136 ? -8.277  9.047   0.552   1.00 1.44  ? 136 ILE A HD12 4  
ATOM 11011 H HD13 . ILE A 1 136 ? -8.211  10.782  0.238   1.00 1.20  ? 136 ILE A HD13 4  
ATOM 11012 N N    . MET A 1 137 ? -3.139  10.622  1.343   1.00 0.35  ? 137 MET A N    4  
ATOM 11013 C CA   . MET A 1 137 ? -1.695  10.318  1.081   1.00 0.33  ? 137 MET A CA   4  
ATOM 11014 C C    . MET A 1 137 ? -0.824  10.787  2.256   1.00 0.31  ? 137 MET A C    4  
ATOM 11015 O O    . MET A 1 137 ? 0.220   10.237  2.542   1.00 0.34  ? 137 MET A O    4  
ATOM 11016 C CB   . MET A 1 137 ? -1.252  11.034  -0.199  1.00 0.36  ? 137 MET A CB   4  
ATOM 11017 C CG   . MET A 1 137 ? -1.873  10.347  -1.421  1.00 0.67  ? 137 MET A CG   4  
ATOM 11018 S SD   . MET A 1 137 ? -1.899  11.503  -2.813  1.00 1.13  ? 137 MET A SD   4  
ATOM 11019 C CE   . MET A 1 137 ? -0.127  11.474  -3.175  1.00 0.67  ? 137 MET A CE   4  
ATOM 11020 H H    . MET A 1 137 ? -3.707  10.916  0.601   1.00 0.52  ? 137 MET A H    4  
ATOM 11021 H HA   . MET A 1 137 ? -1.571  9.252   0.956   1.00 0.34  ? 137 MET A HA   4  
ATOM 11022 H HB2  . MET A 1 137 ? -1.576  12.064  -0.163  1.00 0.50  ? 137 MET A HB2  4  
ATOM 11023 H HB3  . MET A 1 137 ? -0.176  10.999  -0.277  1.00 0.49  ? 137 MET A HB3  4  
ATOM 11024 H HG2  . MET A 1 137 ? -1.285  9.480   -1.685  1.00 1.13  ? 137 MET A HG2  4  
ATOM 11025 H HG3  . MET A 1 137 ? -2.884  10.040  -1.193  1.00 1.01  ? 137 MET A HG3  4  
ATOM 11026 H HE1  . MET A 1 137 ? 0.410   11.981  -2.385  1.00 1.28  ? 137 MET A HE1  4  
ATOM 11027 H HE2  . MET A 1 137 ? 0.056   11.977  -4.111  1.00 1.01  ? 137 MET A HE2  4  
ATOM 11028 H HE3  . MET A 1 137 ? 0.211   10.447  -3.246  1.00 1.26  ? 137 MET A HE3  4  
ATOM 11029 N N    . GLY A 1 138 ? -1.276  11.807  2.939   1.00 0.31  ? 138 GLY A N    4  
ATOM 11030 C CA   . GLY A 1 138 ? -0.528  12.350  4.111   1.00 0.33  ? 138 GLY A CA   4  
ATOM 11031 C C    . GLY A 1 138 ? -0.483  11.298  5.222   1.00 0.33  ? 138 GLY A C    4  
ATOM 11032 O O    . GLY A 1 138 ? 0.568   10.961  5.729   1.00 0.34  ? 138 GLY A O    4  
ATOM 11033 H H    . GLY A 1 138 ? -2.127  12.219  2.679   1.00 0.32  ? 138 GLY A H    4  
ATOM 11034 H HA2  . GLY A 1 138 ? 0.480   12.614  3.819   1.00 0.35  ? 138 GLY A HA2  4  
ATOM 11035 H HA3  . GLY A 1 138 ? -1.049  13.229  4.457   1.00 0.36  ? 138 GLY A HA3  4  
ATOM 11036 N N    . TRP A 1 139 ? -1.617  10.771  5.594   1.00 0.34  ? 139 TRP A N    4  
ATOM 11037 C CA   . TRP A 1 139 ? -1.634  9.732   6.661   1.00 0.37  ? 139 TRP A CA   4  
ATOM 11038 C C    . TRP A 1 139 ? -0.926  8.472   6.156   1.00 0.35  ? 139 TRP A C    4  
ATOM 11039 O O    . TRP A 1 139 ? -0.490  7.641   6.928   1.00 0.39  ? 139 TRP A O    4  
ATOM 11040 C CB   . TRP A 1 139 ? -3.071  9.386   7.062   1.00 0.43  ? 139 TRP A CB   4  
ATOM 11041 C CG   . TRP A 1 139 ? -3.804  10.610  7.527   1.00 0.46  ? 139 TRP A CG   4  
ATOM 11042 C CD1  . TRP A 1 139 ? -3.278  11.619  8.266   1.00 0.54  ? 139 TRP A CD1  4  
ATOM 11043 C CD2  . TRP A 1 139 ? -5.201  10.956  7.306   1.00 0.53  ? 139 TRP A CD2  4  
ATOM 11044 N NE1  . TRP A 1 139 ? -4.264  12.560  8.502   1.00 0.57  ? 139 TRP A NE1  4  
ATOM 11045 C CE2  . TRP A 1 139 ? -5.466  12.197  7.931   1.00 0.56  ? 139 TRP A CE2  4  
ATOM 11046 C CE3  . TRP A 1 139 ? -6.254  10.318  6.626   1.00 0.67  ? 139 TRP A CE3  4  
ATOM 11047 C CZ2  . TRP A 1 139 ? -6.731  12.784  7.884   1.00 0.66  ? 139 TRP A CZ2  4  
ATOM 11048 C CZ3  . TRP A 1 139 ? -7.529  10.906  6.577   1.00 0.81  ? 139 TRP A CZ3  4  
ATOM 11049 C CH2  . TRP A 1 139 ? -7.766  12.137  7.204   1.00 0.78  ? 139 TRP A CH2  4  
ATOM 11050 H H    . TRP A 1 139 ? -2.444  11.064  5.158   1.00 0.35  ? 139 TRP A H    4  
ATOM 11051 H HA   . TRP A 1 139 ? -1.085  10.079  7.522   1.00 0.39  ? 139 TRP A HA   4  
ATOM 11052 H HB2  . TRP A 1 139 ? -3.586  8.967   6.211   1.00 0.45  ? 139 TRP A HB2  4  
ATOM 11053 H HB3  . TRP A 1 139 ? -3.052  8.658   7.859   1.00 0.45  ? 139 TRP A HB3  4  
ATOM 11054 H HD1  . TRP A 1 139 ? -2.259  11.684  8.615   1.00 0.64  ? 139 TRP A HD1  4  
ATOM 11055 H HE1  . TRP A 1 139 ? -4.143  13.389  9.010   1.00 0.65  ? 139 TRP A HE1  4  
ATOM 11056 H HE3  . TRP A 1 139 ? -6.082  9.370   6.139   1.00 0.70  ? 139 TRP A HE3  4  
ATOM 11057 H HZ2  . TRP A 1 139 ? -6.909  13.732  8.370   1.00 0.69  ? 139 TRP A HZ2  4  
ATOM 11058 H HZ3  . TRP A 1 139 ? -8.330  10.407  6.052   1.00 0.96  ? 139 TRP A HZ3  4  
ATOM 11059 H HH2  . TRP A 1 139 ? -8.748  12.584  7.163   1.00 0.90  ? 139 TRP A HH2  4  
ATOM 11060 N N    . THR A 1 140 ? -0.800  8.325   4.864   1.00 0.34  ? 140 THR A N    4  
ATOM 11061 C CA   . THR A 1 140 ? -0.113  7.123   4.315   1.00 0.36  ? 140 THR A CA   4  
ATOM 11062 C C    . THR A 1 140 ? 1.397   7.268   4.523   1.00 0.34  ? 140 THR A C    4  
ATOM 11063 O O    . THR A 1 140 ? 2.024   6.468   5.188   1.00 0.39  ? 140 THR A O    4  
ATOM 11064 C CB   . THR A 1 140 ? -0.414  7.002   2.820   1.00 0.38  ? 140 THR A CB   4  
ATOM 11065 O OG1  . THR A 1 140 ? -1.815  7.117   2.611   1.00 1.20  ? 140 THR A OG1  4  
ATOM 11066 C CG2  . THR A 1 140 ? 0.071   5.646   2.307   1.00 1.17  ? 140 THR A CG2  4  
ATOM 11067 H H    . THR A 1 140 ? -1.155  9.007   4.255   1.00 0.34  ? 140 THR A H    4  
ATOM 11068 H HA   . THR A 1 140 ? -0.465  6.240   4.828   1.00 0.40  ? 140 THR A HA   4  
ATOM 11069 H HB   . THR A 1 140 ? 0.096   7.788   2.285   1.00 0.98  ? 140 THR A HB   4  
ATOM 11070 H HG1  . THR A 1 140 ? -2.037  8.051   2.599   1.00 1.79  ? 140 THR A HG1  4  
ATOM 11071 H HG21 . THR A 1 140 ? -0.141  5.563   1.251   1.00 1.62  ? 140 THR A HG21 4  
ATOM 11072 H HG22 . THR A 1 140 ? -0.439  4.857   2.840   1.00 1.80  ? 140 THR A HG22 4  
ATOM 11073 H HG23 . THR A 1 140 ? 1.135   5.560   2.468   1.00 1.82  ? 140 THR A HG23 4  
ATOM 11074 N N    . LEU A 1 141 ? 1.983   8.290   3.960   1.00 0.33  ? 141 LEU A N    4  
ATOM 11075 C CA   . LEU A 1 141 ? 3.450   8.502   4.124   1.00 0.34  ? 141 LEU A CA   4  
ATOM 11076 C C    . LEU A 1 141 ? 3.785   8.716   5.603   1.00 0.33  ? 141 LEU A C    4  
ATOM 11077 O O    . LEU A 1 141 ? 4.862   8.378   6.053   1.00 0.33  ? 141 LEU A O    4  
ATOM 11078 C CB   . LEU A 1 141 ? 3.895   9.716   3.300   1.00 0.35  ? 141 LEU A CB   4  
ATOM 11079 C CG   . LEU A 1 141 ? 3.643   9.457   1.797   1.00 0.41  ? 141 LEU A CG   4  
ATOM 11080 C CD1  . LEU A 1 141 ? 3.430   10.789  1.066   1.00 0.99  ? 141 LEU A CD1  4  
ATOM 11081 C CD2  . LEU A 1 141 ? 4.844   8.723   1.180   1.00 0.80  ? 141 LEU A CD2  4  
ATOM 11082 H H    . LEU A 1 141 ? 1.455   8.925   3.432   1.00 0.37  ? 141 LEU A H    4  
ATOM 11083 H HA   . LEU A 1 141 ? 3.996   7.623   3.816   1.00 0.36  ? 141 LEU A HA   4  
ATOM 11084 H HB2  . LEU A 1 141 ? 3.331   10.582  3.620   1.00 0.38  ? 141 LEU A HB2  4  
ATOM 11085 H HB3  . LEU A 1 141 ? 4.948   9.896   3.466   1.00 0.41  ? 141 LEU A HB3  4  
ATOM 11086 H HG   . LEU A 1 141 ? 2.759   8.848   1.677   1.00 1.00  ? 141 LEU A HG   4  
ATOM 11087 H HD11 . LEU A 1 141 ? 3.313   10.605  0.008   1.00 1.58  ? 141 LEU A HD11 4  
ATOM 11088 H HD12 . LEU A 1 141 ? 4.283   11.430  1.228   1.00 1.53  ? 141 LEU A HD12 4  
ATOM 11089 H HD13 . LEU A 1 141 ? 2.540   11.270  1.448   1.00 1.54  ? 141 LEU A HD13 4  
ATOM 11090 H HD21 . LEU A 1 141 ? 5.209   7.980   1.871   1.00 1.31  ? 141 LEU A HD21 4  
ATOM 11091 H HD22 . LEU A 1 141 ? 5.632   9.430   0.963   1.00 1.31  ? 141 LEU A HD22 4  
ATOM 11092 H HD23 . LEU A 1 141 ? 4.534   8.240   0.268   1.00 1.59  ? 141 LEU A HD23 4  
ATOM 11093 N N    . ASP A 1 142 ? 2.881   9.257   6.371   1.00 0.36  ? 142 ASP A N    4  
ATOM 11094 C CA   . ASP A 1 142 ? 3.181   9.459   7.817   1.00 0.37  ? 142 ASP A CA   4  
ATOM 11095 C C    . ASP A 1 142 ? 3.434   8.092   8.457   1.00 0.37  ? 142 ASP A C    4  
ATOM 11096 O O    . ASP A 1 142 ? 4.478   7.845   9.027   1.00 0.42  ? 142 ASP A O    4  
ATOM 11097 C CB   . ASP A 1 142 ? 1.995   10.138  8.502   1.00 0.37  ? 142 ASP A CB   4  
ATOM 11098 C CG   . ASP A 1 142 ? 1.871   11.578  8.001   1.00 0.78  ? 142 ASP A CG   4  
ATOM 11099 O OD1  . ASP A 1 142 ? 2.438   11.873  6.961   1.00 1.32  ? 142 ASP A OD1  4  
ATOM 11100 O OD2  . ASP A 1 142 ? 1.213   12.361  8.665   1.00 1.59  ? 142 ASP A OD2  4  
ATOM 11101 H H    . ASP A 1 142 ? 2.011   9.518   6.004   1.00 0.37  ? 142 ASP A H    4  
ATOM 11102 H HA   . ASP A 1 142 ? 4.064   10.073  7.919   1.00 0.38  ? 142 ASP A HA   4  
ATOM 11103 H HB2  . ASP A 1 142 ? 1.089   9.596   8.273   1.00 0.57  ? 142 ASP A HB2  4  
ATOM 11104 H HB3  . ASP A 1 142 ? 2.151   10.143  9.570   1.00 0.68  ? 142 ASP A HB3  4  
ATOM 11105 N N    . PHE A 1 143 ? 2.489   7.198   8.354   1.00 0.41  ? 143 PHE A N    4  
ATOM 11106 C CA   . PHE A 1 143 ? 2.672   5.840   8.940   1.00 0.43  ? 143 PHE A CA   4  
ATOM 11107 C C    . PHE A 1 143 ? 3.849   5.143   8.250   1.00 0.43  ? 143 PHE A C    4  
ATOM 11108 O O    . PHE A 1 143 ? 4.660   4.505   8.891   1.00 0.45  ? 143 PHE A O    4  
ATOM 11109 C CB   . PHE A 1 143 ? 1.389   5.022   8.737   1.00 0.44  ? 143 PHE A CB   4  
ATOM 11110 C CG   . PHE A 1 143 ? 1.652   3.562   9.038   1.00 0.47  ? 143 PHE A CG   4  
ATOM 11111 C CD1  . PHE A 1 143 ? 1.509   3.075   10.343  1.00 1.29  ? 143 PHE A CD1  4  
ATOM 11112 C CD2  . PHE A 1 143 ? 2.046   2.699   8.008   1.00 1.16  ? 143 PHE A CD2  4  
ATOM 11113 C CE1  . PHE A 1 143 ? 1.758   1.724   10.616  1.00 1.35  ? 143 PHE A CE1  4  
ATOM 11114 C CE2  . PHE A 1 143 ? 2.296   1.350   8.282   1.00 1.22  ? 143 PHE A CE2  4  
ATOM 11115 C CZ   . PHE A 1 143 ? 2.152   0.862   9.586   1.00 0.72  ? 143 PHE A CZ   4  
ATOM 11116 H H    . PHE A 1 143 ? 1.659   7.418   7.880   1.00 0.48  ? 143 PHE A H    4  
ATOM 11117 H HA   . PHE A 1 143 ? 2.888   5.914   9.996   1.00 0.44  ? 143 PHE A HA   4  
ATOM 11118 H HB2  . PHE A 1 143 ? 0.620   5.391   9.400   1.00 0.47  ? 143 PHE A HB2  4  
ATOM 11119 H HB3  . PHE A 1 143 ? 1.058   5.122   7.714   1.00 0.49  ? 143 PHE A HB3  4  
ATOM 11120 H HD1  . PHE A 1 143 ? 1.205   3.740   11.137  1.00 2.09  ? 143 PHE A HD1  4  
ATOM 11121 H HD2  . PHE A 1 143 ? 2.156   3.075   7.002   1.00 1.96  ? 143 PHE A HD2  4  
ATOM 11122 H HE1  . PHE A 1 143 ? 1.647   1.348   11.622  1.00 2.16  ? 143 PHE A HE1  4  
ATOM 11123 H HE2  . PHE A 1 143 ? 2.600   0.684   7.487   1.00 2.02  ? 143 PHE A HE2  4  
ATOM 11124 H HZ   . PHE A 1 143 ? 2.345   -0.180  9.797   1.00 0.85  ? 143 PHE A HZ   4  
ATOM 11125 N N    . LEU A 1 144 ? 3.955   5.250   6.955   1.00 0.45  ? 144 LEU A N    4  
ATOM 11126 C CA   . LEU A 1 144 ? 5.087   4.579   6.256   1.00 0.47  ? 144 LEU A CA   4  
ATOM 11127 C C    . LEU A 1 144 ? 6.398   5.183   6.792   1.00 0.47  ? 144 LEU A C    4  
ATOM 11128 O O    . LEU A 1 144 ? 7.274   4.473   7.247   1.00 0.49  ? 144 LEU A O    4  
ATOM 11129 C CB   . LEU A 1 144 ? 4.922   4.787   4.733   1.00 0.49  ? 144 LEU A CB   4  
ATOM 11130 C CG   . LEU A 1 144 ? 5.299   3.525   3.937   1.00 0.64  ? 144 LEU A CG   4  
ATOM 11131 C CD1  . LEU A 1 144 ? 4.684   3.607   2.533   1.00 1.31  ? 144 LEU A CD1  4  
ATOM 11132 C CD2  . LEU A 1 144 ? 6.825   3.430   3.813   1.00 1.01  ? 144 LEU A CD2  4  
ATOM 11133 H H    . LEU A 1 144 ? 3.296   5.764   6.444   1.00 0.46  ? 144 LEU A H    4  
ATOM 11134 H HA   . LEU A 1 144 ? 5.080   3.539   6.528   1.00 0.47  ? 144 LEU A HA   4  
ATOM 11135 H HB2  . LEU A 1 144 ? 3.889   5.033   4.532   1.00 0.76  ? 144 LEU A HB2  4  
ATOM 11136 H HB3  . LEU A 1 144 ? 5.541   5.607   4.411   1.00 0.69  ? 144 LEU A HB3  4  
ATOM 11137 H HG   . LEU A 1 144 ? 4.916   2.649   4.435   1.00 1.31  ? 144 LEU A HG   4  
ATOM 11138 H HD11 . LEU A 1 144 ? 4.994   2.750   1.953   1.00 1.90  ? 144 LEU A HD11 4  
ATOM 11139 H HD12 . LEU A 1 144 ? 5.018   4.512   2.044   1.00 1.80  ? 144 LEU A HD12 4  
ATOM 11140 H HD13 . LEU A 1 144 ? 3.607   3.618   2.612   1.00 1.81  ? 144 LEU A HD13 4  
ATOM 11141 H HD21 . LEU A 1 144 ? 7.280   3.653   4.766   1.00 1.47  ? 144 LEU A HD21 4  
ATOM 11142 H HD22 . LEU A 1 144 ? 7.173   4.139   3.075   1.00 1.62  ? 144 LEU A HD22 4  
ATOM 11143 H HD23 . LEU A 1 144 ? 7.099   2.431   3.508   1.00 1.63  ? 144 LEU A HD23 4  
ATOM 11144 N N    . ARG A 1 145 ? 6.529   6.477   6.772   1.00 0.47  ? 145 ARG A N    4  
ATOM 11145 C CA   . ARG A 1 145 ? 7.767   7.116   7.312   1.00 0.48  ? 145 ARG A CA   4  
ATOM 11146 C C    . ARG A 1 145 ? 7.946   6.779   8.801   1.00 0.49  ? 145 ARG A C    4  
ATOM 11147 O O    . ARG A 1 145 ? 9.050   6.559   9.259   1.00 0.50  ? 145 ARG A O    4  
ATOM 11148 C CB   . ARG A 1 145 ? 7.666   8.641   7.169   1.00 0.49  ? 145 ARG A CB   4  
ATOM 11149 C CG   . ARG A 1 145 ? 9.053   9.259   7.404   1.00 0.69  ? 145 ARG A CG   4  
ATOM 11150 C CD   . ARG A 1 145 ? 8.957   10.793  7.439   1.00 0.68  ? 145 ARG A CD   4  
ATOM 11151 N NE   . ARG A 1 145 ? 10.237  11.392  6.938   1.00 1.56  ? 145 ARG A NE   4  
ATOM 11152 C CZ   . ARG A 1 145 ? 11.402  10.993  7.386   1.00 2.10  ? 145 ARG A CZ   4  
ATOM 11153 N NH1  . ARG A 1 145 ? 11.482  10.180  8.404   1.00 2.12  ? 145 ARG A NH1  4  
ATOM 11154 N NH2  . ARG A 1 145 ? 12.496  11.458  6.846   1.00 3.16  ? 145 ARG A NH2  4  
ATOM 11155 H H    . ARG A 1 145 ? 5.807   7.033   6.412   1.00 0.47  ? 145 ARG A H    4  
ATOM 11156 H HA   . ARG A 1 145 ? 8.654   6.774   6.799   1.00 0.49  ? 145 ARG A HA   4  
ATOM 11157 H HB2  . ARG A 1 145 ? 7.317   8.892   6.180   1.00 0.67  ? 145 ARG A HB2  4  
ATOM 11158 H HB3  . ARG A 1 145 ? 6.975   9.028   7.902   1.00 0.66  ? 145 ARG A HB3  4  
ATOM 11159 H HG2  . ARG A 1 145 ? 9.438   8.896   8.344   1.00 0.93  ? 145 ARG A HG2  4  
ATOM 11160 H HG3  . ARG A 1 145 ? 9.717   8.960   6.607   1.00 0.93  ? 145 ARG A HG3  4  
ATOM 11161 H HD2  . ARG A 1 145 ? 8.162   11.122  6.791   1.00 1.08  ? 145 ARG A HD2  4  
ATOM 11162 H HD3  . ARG A 1 145 ? 8.747   11.120  8.452   1.00 1.24  ? 145 ARG A HD3  4  
ATOM 11163 H HE   . ARG A 1 145 ? 10.204  12.067  6.228   1.00 2.23  ? 145 ARG A HE   4  
ATOM 11164 H HH11 . ARG A 1 145 ? 10.654  9.861   8.855   1.00 1.91  ? 145 ARG A HH11 4  
ATOM 11165 H HH12 . ARG A 1 145 ? 12.377  9.876   8.730   1.00 2.82  ? 145 ARG A HH12 4  
ATOM 11166 H HH21 . ARG A 1 145 ? 12.442  12.115  6.095   1.00 3.67  ? 145 ARG A HH21 4  
ATOM 11167 H HH22 . ARG A 1 145 ? 13.387  11.157  7.185   1.00 3.66  ? 145 ARG A HH22 4  
ATOM 11168 N N    . GLU A 1 146 ? 6.896   6.796   9.575   1.00 0.49  ? 146 GLU A N    4  
ATOM 11169 C CA   . GLU A 1 146 ? 7.054   6.539   11.042  1.00 0.51  ? 146 GLU A CA   4  
ATOM 11170 C C    . GLU A 1 146 ? 7.153   5.039   11.375  1.00 0.53  ? 146 GLU A C    4  
ATOM 11171 O O    . GLU A 1 146 ? 7.871   4.684   12.289  1.00 0.55  ? 146 GLU A O    4  
ATOM 11172 C CB   . GLU A 1 146 ? 5.876   7.158   11.800  1.00 0.52  ? 146 GLU A CB   4  
ATOM 11173 C CG   . GLU A 1 146 ? 5.922   8.682   11.666  1.00 0.96  ? 146 GLU A CG   4  
ATOM 11174 C CD   . GLU A 1 146 ? 4.696   9.292   12.347  1.00 1.48  ? 146 GLU A CD   4  
ATOM 11175 O OE1  . GLU A 1 146 ? 3.786   8.544   12.665  1.00 2.03  ? 146 GLU A OE1  4  
ATOM 11176 O OE2  . GLU A 1 146 ? 4.687   10.497  12.539  1.00 2.22  ? 146 GLU A OE2  4  
ATOM 11177 H H    . GLU A 1 146 ? 6.021   7.030   9.200   1.00 0.49  ? 146 GLU A H    4  
ATOM 11178 H HA   . GLU A 1 146 ? 7.973   6.996   11.376  1.00 0.53  ? 146 GLU A HA   4  
ATOM 11179 H HB2  . GLU A 1 146 ? 4.949   6.788   11.385  1.00 0.95  ? 146 GLU A HB2  4  
ATOM 11180 H HB3  . GLU A 1 146 ? 5.936   6.888   12.843  1.00 0.79  ? 146 GLU A HB3  4  
ATOM 11181 H HG2  . GLU A 1 146 ? 6.820   9.057   12.135  1.00 1.43  ? 146 GLU A HG2  4  
ATOM 11182 H HG3  . GLU A 1 146 ? 5.922   8.952   10.620  1.00 1.69  ? 146 GLU A HG3  4  
ATOM 11183 N N    . ARG A 1 147 ? 6.423   4.158   10.721  1.00 0.59  ? 147 ARG A N    4  
ATOM 11184 C CA   . ARG A 1 147 ? 6.493   2.700   11.127  1.00 0.62  ? 147 ARG A CA   4  
ATOM 11185 C C    . ARG A 1 147 ? 7.178   1.815   10.074  1.00 0.58  ? 147 ARG A C    4  
ATOM 11186 O O    . ARG A 1 147 ? 7.992   0.971   10.390  1.00 0.62  ? 147 ARG A O    4  
ATOM 11187 C CB   . ARG A 1 147 ? 5.063   2.198   11.345  1.00 0.63  ? 147 ARG A CB   4  
ATOM 11188 C CG   . ARG A 1 147 ? 4.470   2.873   12.594  1.00 0.73  ? 147 ARG A CG   4  
ATOM 11189 C CD   . ARG A 1 147 ? 5.201   2.400   13.870  1.00 1.11  ? 147 ARG A CD   4  
ATOM 11190 N NE   . ARG A 1 147 ? 4.215   2.216   14.980  1.00 1.75  ? 147 ARG A NE   4  
ATOM 11191 C CZ   . ARG A 1 147 ? 3.320   3.129   15.248  1.00 2.40  ? 147 ARG A CZ   4  
ATOM 11192 N NH1  . ARG A 1 147 ? 3.353   4.287   14.649  1.00 2.71  ? 147 ARG A NH1  4  
ATOM 11193 N NH2  . ARG A 1 147 ? 2.414   2.899   16.158  1.00 3.30  ? 147 ARG A NH2  4  
ATOM 11194 H H    . ARG A 1 147 ? 5.805   4.463   10.025  1.00 0.66  ? 147 ARG A H    4  
ATOM 11195 H HA   . ARG A 1 147 ? 7.017   2.636   12.068  1.00 0.69  ? 147 ARG A HA   4  
ATOM 11196 H HB2  . ARG A 1 147 ? 4.461   2.446   10.483  1.00 0.63  ? 147 ARG A HB2  4  
ATOM 11197 H HB3  . ARG A 1 147 ? 5.070   1.127   11.482  1.00 0.70  ? 147 ARG A HB3  4  
ATOM 11198 H HG2  . ARG A 1 147 ? 4.574   3.943   12.491  1.00 1.25  ? 147 ARG A HG2  4  
ATOM 11199 H HG3  . ARG A 1 147 ? 3.422   2.624   12.671  1.00 1.20  ? 147 ARG A HG3  4  
ATOM 11200 H HD2  . ARG A 1 147 ? 5.679   1.451   13.693  1.00 1.77  ? 147 ARG A HD2  4  
ATOM 11201 H HD3  . ARG A 1 147 ? 5.957   3.129   14.147  1.00 1.67  ? 147 ARG A HD3  4  
ATOM 11202 H HE   . ARG A 1 147 ? 4.217   1.380   15.491  1.00 2.24  ? 147 ARG A HE   4  
ATOM 11203 H HH11 . ARG A 1 147 ? 4.068   4.485   13.984  1.00 2.53  ? 147 ARG A HH11 4  
ATOM 11204 H HH12 . ARG A 1 147 ? 2.661   4.978   14.857  1.00 3.48  ? 147 ARG A HH12 4  
ATOM 11205 H HH21 . ARG A 1 147 ? 2.406   2.026   16.647  1.00 3.61  ? 147 ARG A HH21 4  
ATOM 11206 H HH22 . ARG A 1 147 ? 1.727   3.595   16.368  1.00 3.89  ? 147 ARG A HH22 4  
ATOM 11207 N N    . LEU A 1 148 ? 6.801   1.964   8.838   1.00 0.53  ? 148 LEU A N    4  
ATOM 11208 C CA   . LEU A 1 148 ? 7.350   1.106   7.743   1.00 0.57  ? 148 LEU A CA   4  
ATOM 11209 C C    . LEU A 1 148 ? 8.648   1.668   7.141   1.00 0.67  ? 148 LEU A C    4  
ATOM 11210 O O    . LEU A 1 148 ? 8.895   1.493   5.964   1.00 1.61  ? 148 LEU A O    4  
ATOM 11211 C CB   . LEU A 1 148 ? 6.264   1.038   6.638   1.00 0.59  ? 148 LEU A CB   4  
ATOM 11212 C CG   . LEU A 1 148 ? 6.176   -0.383  6.036   1.00 0.70  ? 148 LEU A CG   4  
ATOM 11213 C CD1  . LEU A 1 148 ? 5.351   -1.299  6.954   1.00 1.29  ? 148 LEU A CD1  4  
ATOM 11214 C CD2  . LEU A 1 148 ? 5.493   -0.321  4.667   1.00 1.34  ? 148 LEU A CD2  4  
ATOM 11215 H H    . LEU A 1 148 ? 6.107   2.619   8.613   1.00 0.52  ? 148 LEU A H    4  
ATOM 11216 H HA   . LEU A 1 148 ? 7.526   0.095   8.072   1.00 0.58  ? 148 LEU A HA   4  
ATOM 11217 H HB2  . LEU A 1 148 ? 5.308   1.295   7.071   1.00 0.75  ? 148 LEU A HB2  4  
ATOM 11218 H HB3  . LEU A 1 148 ? 6.496   1.743   5.855   1.00 0.89  ? 148 LEU A HB3  4  
ATOM 11219 H HG   . LEU A 1 148 ? 7.171   -0.789  5.925   1.00 1.45  ? 148 LEU A HG   4  
ATOM 11220 H HD11 . LEU A 1 148 ? 5.832   -1.389  7.915   1.00 1.91  ? 148 LEU A HD11 4  
ATOM 11221 H HD12 . LEU A 1 148 ? 5.270   -2.277  6.503   1.00 1.90  ? 148 LEU A HD12 4  
ATOM 11222 H HD13 . LEU A 1 148 ? 4.364   -0.881  7.084   1.00 1.61  ? 148 LEU A HD13 4  
ATOM 11223 H HD21 . LEU A 1 148 ? 5.406   -1.319  4.264   1.00 1.92  ? 148 LEU A HD21 4  
ATOM 11224 H HD22 . LEU A 1 148 ? 6.081   0.288   3.997   1.00 1.86  ? 148 LEU A HD22 4  
ATOM 11225 H HD23 . LEU A 1 148 ? 4.508   0.110   4.775   1.00 1.88  ? 148 LEU A HD23 4  
ATOM 11226 N N    . LEU A 1 149 ? 9.483   2.325   7.910   1.00 0.67  ? 149 LEU A N    4  
ATOM 11227 C CA   . LEU A 1 149 ? 10.761  2.872   7.333   1.00 0.57  ? 149 LEU A CA   4  
ATOM 11228 C C    . LEU A 1 149 ? 11.949  2.035   7.830   1.00 0.56  ? 149 LEU A C    4  
ATOM 11229 O O    . LEU A 1 149 ? 12.754  1.560   7.054   1.00 0.58  ? 149 LEU A O    4  
ATOM 11230 C CB   . LEU A 1 149 ? 10.933  4.347   7.758   1.00 0.54  ? 149 LEU A CB   4  
ATOM 11231 C CG   . LEU A 1 149 ? 11.592  5.162   6.630   1.00 0.59  ? 149 LEU A CG   4  
ATOM 11232 C CD1  . LEU A 1 149 ? 11.814  6.598   7.108   1.00 0.83  ? 149 LEU A CD1  4  
ATOM 11233 C CD2  . LEU A 1 149 ? 12.944  4.542   6.248   1.00 1.21  ? 149 LEU A CD2  4  
ATOM 11234 H H    . LEU A 1 149 ? 9.277   2.458   8.859   1.00 1.41  ? 149 LEU A H    4  
ATOM 11235 H HA   . LEU A 1 149 ? 10.728  2.806   6.253   1.00 0.58  ? 149 LEU A HA   4  
ATOM 11236 H HB2  . LEU A 1 149 ? 9.961   4.766   7.973   1.00 0.54  ? 149 LEU A HB2  4  
ATOM 11237 H HB3  . LEU A 1 149 ? 11.547  4.406   8.646   1.00 0.61  ? 149 LEU A HB3  4  
ATOM 11238 H HG   . LEU A 1 149 ? 10.941  5.169   5.767   1.00 1.15  ? 149 LEU A HG   4  
ATOM 11239 H HD11 . LEU A 1 149 ? 12.571  6.609   7.877   1.00 1.37  ? 149 LEU A HD11 4  
ATOM 11240 H HD12 . LEU A 1 149 ? 10.890  6.992   7.506   1.00 1.41  ? 149 LEU A HD12 4  
ATOM 11241 H HD13 . LEU A 1 149 ? 12.136  7.208   6.276   1.00 1.52  ? 149 LEU A HD13 4  
ATOM 11242 H HD21 . LEU A 1 149 ? 12.783  3.654   5.656   1.00 1.67  ? 149 LEU A HD21 4  
ATOM 11243 H HD22 . LEU A 1 149 ? 13.489  4.284   7.143   1.00 1.82  ? 149 LEU A HD22 4  
ATOM 11244 H HD23 . LEU A 1 149 ? 13.517  5.255   5.670   1.00 1.75  ? 149 LEU A HD23 4  
ATOM 11245 N N    . GLY A 1 150 ? 12.073  1.870   9.119   1.00 0.56  ? 150 GLY A N    4  
ATOM 11246 C CA   . GLY A 1 150 ? 13.216  1.085   9.672   1.00 0.58  ? 150 GLY A CA   4  
ATOM 11247 C C    . GLY A 1 150 ? 13.204  -0.350  9.136   1.00 0.62  ? 150 GLY A C    4  
ATOM 11248 O O    . GLY A 1 150 ? 14.229  -0.889  8.768   1.00 0.70  ? 150 GLY A O    4  
ATOM 11249 H H    . GLY A 1 150 ? 11.423  2.276   9.729   1.00 0.56  ? 150 GLY A H    4  
ATOM 11250 H HA2  . GLY A 1 150 ? 14.143  1.563   9.390   1.00 0.57  ? 150 GLY A HA2  4  
ATOM 11251 H HA3  . GLY A 1 150 ? 13.140  1.066   10.749  1.00 0.61  ? 150 GLY A HA3  4  
ATOM 11252 N N    . TRP A 1 151 ? 12.065  -0.989  9.116   1.00 0.63  ? 151 TRP A N    4  
ATOM 11253 C CA   . TRP A 1 151 ? 12.017  -2.401  8.634   1.00 0.69  ? 151 TRP A CA   4  
ATOM 11254 C C    . TRP A 1 151 ? 12.360  -2.483  7.144   1.00 0.70  ? 151 TRP A C    4  
ATOM 11255 O O    . TRP A 1 151 ? 12.861  -3.487  6.679   1.00 0.72  ? 151 TRP A O    4  
ATOM 11256 C CB   . TRP A 1 151 ? 10.617  -2.980  8.852   1.00 0.73  ? 151 TRP A CB   4  
ATOM 11257 C CG   . TRP A 1 151 ? 10.340  -3.120  10.317  1.00 1.25  ? 151 TRP A CG   4  
ATOM 11258 C CD1  . TRP A 1 151 ? 11.120  -3.785  11.203  1.00 2.17  ? 151 TRP A CD1  4  
ATOM 11259 C CD2  . TRP A 1 151 ? 9.210   -2.602  11.076  1.00 1.86  ? 151 TRP A CD2  4  
ATOM 11260 N NE1  . TRP A 1 151 ? 10.541  -3.699  12.457  1.00 2.65  ? 151 TRP A NE1  4  
ATOM 11261 C CE2  . TRP A 1 151 ? 9.363   -2.981  12.430  1.00 2.43  ? 151 TRP A CE2  4  
ATOM 11262 C CE3  . TRP A 1 151 ? 8.080   -1.845  10.722  1.00 2.68  ? 151 TRP A CE3  4  
ATOM 11263 C CZ2  . TRP A 1 151 ? 8.427   -2.621  13.399  1.00 3.17  ? 151 TRP A CZ2  4  
ATOM 11264 C CZ3  . TRP A 1 151 ? 7.135   -1.482  11.695  1.00 3.62  ? 151 TRP A CZ3  4  
ATOM 11265 C CH2  . TRP A 1 151 ? 7.308   -1.868  13.031  1.00 3.67  ? 151 TRP A CH2  4  
ATOM 11266 H H    . TRP A 1 151 ? 11.250  -0.551  9.437   1.00 0.64  ? 151 TRP A H    4  
ATOM 11267 H HA   . TRP A 1 151 ? 12.732  -2.986  9.190   1.00 0.73  ? 151 TRP A HA   4  
ATOM 11268 H HB2  . TRP A 1 151 ? 9.884   -2.321  8.411   1.00 0.96  ? 151 TRP A HB2  4  
ATOM 11269 H HB3  . TRP A 1 151 ? 10.554  -3.950  8.382   1.00 0.95  ? 151 TRP A HB3  4  
ATOM 11270 H HD1  . TRP A 1 151 ? 12.042  -4.297  10.973  1.00 2.79  ? 151 TRP A HD1  4  
ATOM 11271 H HE1  . TRP A 1 151 ? 10.907  -4.094  13.276  1.00 3.39  ? 151 TRP A HE1  4  
ATOM 11272 H HE3  . TRP A 1 151 ? 7.937   -1.543  9.696   1.00 2.90  ? 151 TRP A HE3  4  
ATOM 11273 H HZ2  . TRP A 1 151 ? 8.565   -2.921  14.427  1.00 3.65  ? 151 TRP A HZ2  4  
ATOM 11274 H HZ3  . TRP A 1 151 ? 6.270   -0.900  11.411  1.00 4.48  ? 151 TRP A HZ3  4  
ATOM 11275 H HH2  . TRP A 1 151 ? 6.578   -1.585  13.774  1.00 4.40  ? 151 TRP A HH2  4  
ATOM 11276 N N    . ILE A 1 152 ? 12.092  -1.458  6.380   1.00 0.73  ? 152 ILE A N    4  
ATOM 11277 C CA   . ILE A 1 152 ? 12.410  -1.542  4.924   1.00 0.76  ? 152 ILE A CA   4  
ATOM 11278 C C    . ILE A 1 152 ? 13.926  -1.448  4.743   1.00 0.79  ? 152 ILE A C    4  
ATOM 11279 O O    . ILE A 1 152 ? 14.525  -2.203  4.004   1.00 0.89  ? 152 ILE A O    4  
ATOM 11280 C CB   . ILE A 1 152 ? 11.706  -0.407  4.170   1.00 0.78  ? 152 ILE A CB   4  
ATOM 11281 C CG1  . ILE A 1 152 ? 10.190  -0.590  4.317   1.00 0.83  ? 152 ILE A CG1  4  
ATOM 11282 C CG2  . ILE A 1 152 ? 12.090  -0.451  2.682   1.00 0.92  ? 152 ILE A CG2  4  
ATOM 11283 C CD1  . ILE A 1 152 ? 9.451   0.524   3.573   1.00 0.94  ? 152 ILE A CD1  4  
ATOM 11284 H H    . ILE A 1 152 ? 11.680  -0.652  6.757   1.00 0.74  ? 152 ILE A H    4  
ATOM 11285 H HA   . ILE A 1 152 ? 12.047  -2.495  4.566   1.00 0.76  ? 152 ILE A HA   4  
ATOM 11286 H HB   . ILE A 1 152 ? 11.999  0.544   4.591   1.00 0.91  ? 152 ILE A HB   4  
ATOM 11287 H HG12 . ILE A 1 152 ? 9.904   -1.547  3.906   1.00 1.01  ? 152 ILE A HG12 4  
ATOM 11288 H HG13 . ILE A 1 152 ? 9.926   -0.556  5.363   1.00 1.14  ? 152 ILE A HG13 4  
ATOM 11289 H HG21 . ILE A 1 152 ? 13.156  -0.316  2.576   1.00 1.31  ? 152 ILE A HG21 4  
ATOM 11290 H HG22 . ILE A 1 152 ? 11.581  0.339   2.151   1.00 1.41  ? 152 ILE A HG22 4  
ATOM 11291 H HG23 . ILE A 1 152 ? 11.806  -1.406  2.265   1.00 1.51  ? 152 ILE A HG23 4  
ATOM 11292 H HD11 . ILE A 1 152 ? 9.894   1.478   3.819   1.00 1.40  ? 152 ILE A HD11 4  
ATOM 11293 H HD12 . ILE A 1 152 ? 8.413   0.523   3.865   1.00 1.40  ? 152 ILE A HD12 4  
ATOM 11294 H HD13 . ILE A 1 152 ? 9.526   0.356   2.508   1.00 1.40  ? 152 ILE A HD13 4  
ATOM 11295 N N    . GLN A 1 153 ? 14.549  -0.526  5.427   1.00 0.77  ? 153 GLN A N    4  
ATOM 11296 C CA   . GLN A 1 153 ? 16.027  -0.376  5.316   1.00 0.80  ? 153 GLN A CA   4  
ATOM 11297 C C    . GLN A 1 153 ? 16.695  -1.723  5.606   1.00 0.81  ? 153 GLN A C    4  
ATOM 11298 O O    . GLN A 1 153 ? 17.592  -2.138  4.899   1.00 0.82  ? 153 GLN A O    4  
ATOM 11299 C CB   . GLN A 1 153 ? 16.507  0.679   6.317   1.00 0.82  ? 153 GLN A CB   4  
ATOM 11300 C CG   . GLN A 1 153 ? 17.917  1.153   5.957   1.00 1.09  ? 153 GLN A CG   4  
ATOM 11301 C CD   . GLN A 1 153 ? 18.317  2.283   6.909   1.00 1.98  ? 153 GLN A CD   4  
ATOM 11302 O OE1  . GLN A 1 153 ? 19.298  2.176   7.620   1.00 2.66  ? 153 GLN A OE1  4  
ATOM 11303 N NE2  . GLN A 1 153 ? 17.595  3.369   6.957   1.00 2.77  ? 153 GLN A NE2  4  
ATOM 11304 H H    . GLN A 1 153 ? 14.043  0.065   6.022   1.00 0.77  ? 153 GLN A H    4  
ATOM 11305 H HA   . GLN A 1 153 ? 16.297  -0.092  4.310   1.00 0.82  ? 153 GLN A HA   4  
ATOM 11306 H HB2  . GLN A 1 153 ? 15.832  1.522   6.296   1.00 1.30  ? 153 GLN A HB2  4  
ATOM 11307 H HB3  . GLN A 1 153 ? 16.516  0.254   7.310   1.00 1.06  ? 153 GLN A HB3  4  
ATOM 11308 H HG2  . GLN A 1 153 ? 18.618  0.339   6.074   1.00 1.37  ? 153 GLN A HG2  4  
ATOM 11309 H HG3  . GLN A 1 153 ? 17.924  1.528   4.946   1.00 1.72  ? 153 GLN A HG3  4  
ATOM 11310 H HE21 . GLN A 1 153 ? 16.804  3.456   6.386   1.00 2.94  ? 153 GLN A HE21 4  
ATOM 11311 H HE22 . GLN A 1 153 ? 17.844  4.097   7.564   1.00 3.53  ? 153 GLN A HE22 4  
ATOM 11312 N N    . ASP A 1 154 ? 16.281  -2.411  6.633   1.00 0.83  ? 154 ASP A N    4  
ATOM 11313 C CA   . ASP A 1 154 ? 16.924  -3.722  6.933   1.00 0.86  ? 154 ASP A CA   4  
ATOM 11314 C C    . ASP A 1 154 ? 16.698  -4.672  5.753   1.00 0.85  ? 154 ASP A C    4  
ATOM 11315 O O    . ASP A 1 154 ? 17.447  -5.605  5.541   1.00 0.94  ? 154 ASP A O    4  
ATOM 11316 C CB   . ASP A 1 154 ? 16.320  -4.318  8.205   1.00 0.90  ? 154 ASP A CB   4  
ATOM 11317 C CG   . ASP A 1 154 ? 16.610  -3.395  9.391   1.00 1.28  ? 154 ASP A CG   4  
ATOM 11318 O OD1  . ASP A 1 154 ? 16.548  -2.191  9.208   1.00 1.84  ? 154 ASP A OD1  4  
ATOM 11319 O OD2  . ASP A 1 154 ? 16.887  -3.909  10.462  1.00 1.99  ? 154 ASP A OD2  4  
ATOM 11320 H H    . ASP A 1 154 ? 15.562  -2.068  7.204   1.00 0.82  ? 154 ASP A H    4  
ATOM 11321 H HA   . ASP A 1 154 ? 17.983  -3.559  7.067   1.00 0.87  ? 154 ASP A HA   4  
ATOM 11322 H HB2  . ASP A 1 154 ? 15.252  -4.423  8.081   1.00 1.24  ? 154 ASP A HB2  4  
ATOM 11323 H HB3  . ASP A 1 154 ? 16.758  -5.287  8.391   1.00 1.20  ? 154 ASP A HB3  4  
ATOM 11324 N N    . GLN A 1 155 ? 15.674  -4.433  4.977   1.00 0.79  ? 155 GLN A N    4  
ATOM 11325 C CA   . GLN A 1 155 ? 15.394  -5.307  3.800   1.00 0.79  ? 155 GLN A CA   4  
ATOM 11326 C C    . GLN A 1 155 ? 16.465  -5.078  2.726   1.00 0.72  ? 155 GLN A C    4  
ATOM 11327 O O    . GLN A 1 155 ? 17.047  -6.011  2.210   1.00 1.03  ? 155 GLN A O    4  
ATOM 11328 C CB   . GLN A 1 155 ? 14.004  -4.960  3.236   1.00 0.90  ? 155 GLN A CB   4  
ATOM 11329 C CG   . GLN A 1 155 ? 13.400  -6.181  2.531   1.00 1.37  ? 155 GLN A CG   4  
ATOM 11330 C CD   . GLN A 1 155 ? 14.358  -6.674  1.444   1.00 2.01  ? 155 GLN A CD   4  
ATOM 11331 O OE1  . GLN A 1 155 ? 14.697  -7.840  1.400   1.00 2.72  ? 155 GLN A OE1  4  
ATOM 11332 N NE2  . GLN A 1 155 ? 14.811  -5.829  0.559   1.00 2.54  ? 155 GLN A NE2  4  
ATOM 11333 H H    . GLN A 1 155 ? 15.088  -3.669  5.161   1.00 0.78  ? 155 GLN A H    4  
ATOM 11334 H HA   . GLN A 1 155 ? 15.410  -6.349  4.091   1.00 0.92  ? 155 GLN A HA   4  
ATOM 11335 H HB2  . GLN A 1 155 ? 13.356  -4.663  4.048   1.00 1.39  ? 155 GLN A HB2  4  
ATOM 11336 H HB3  . GLN A 1 155 ? 14.086  -4.144  2.531   1.00 1.28  ? 155 GLN A HB3  4  
ATOM 11337 H HG2  . GLN A 1 155 ? 13.240  -6.969  3.253   1.00 1.80  ? 155 GLN A HG2  4  
ATOM 11338 H HG3  . GLN A 1 155 ? 12.458  -5.908  2.081   1.00 1.99  ? 155 GLN A HG3  4  
ATOM 11339 H HE21 . GLN A 1 155 ? 14.537  -4.889  0.594   1.00 2.69  ? 155 GLN A HE21 4  
ATOM 11340 H HE22 . GLN A 1 155 ? 15.424  -6.136  -0.141  1.00 3.17  ? 155 GLN A HE22 4  
ATOM 11341 N N    . GLY A 1 156 ? 16.737  -3.836  2.402   1.00 0.63  ? 156 GLY A N    4  
ATOM 11342 C CA   . GLY A 1 156 ? 17.783  -3.518  1.376   1.00 0.72  ? 156 GLY A CA   4  
ATOM 11343 C C    . GLY A 1 156 ? 17.207  -2.606  0.286   1.00 0.87  ? 156 GLY A C    4  
ATOM 11344 O O    . GLY A 1 156 ? 17.877  -2.302  -0.681  1.00 1.38  ? 156 GLY A O    4  
ATOM 11345 H H    . GLY A 1 156 ? 16.261  -3.105  2.849   1.00 0.79  ? 156 GLY A H    4  
ATOM 11346 H HA2  . GLY A 1 156 ? 18.599  -3.003  1.862   1.00 0.89  ? 156 GLY A HA2  4  
ATOM 11347 H HA3  . GLY A 1 156 ? 18.148  -4.424  0.911   1.00 0.72  ? 156 GLY A HA3  4  
ATOM 11348 N N    . GLY A 1 157 ? 15.982  -2.153  0.435   1.00 0.81  ? 157 GLY A N    4  
ATOM 11349 C CA   . GLY A 1 157 ? 15.373  -1.240  -0.595  1.00 1.10  ? 157 GLY A CA   4  
ATOM 11350 C C    . GLY A 1 157 ? 14.108  -1.871  -1.189  1.00 0.84  ? 157 GLY A C    4  
ATOM 11351 O O    . GLY A 1 157 ? 13.803  -3.025  -0.965  1.00 0.88  ? 157 GLY A O    4  
ATOM 11352 H H    . GLY A 1 157 ? 15.465  -2.399  1.230   1.00 0.96  ? 157 GLY A H    4  
ATOM 11353 H HA2  . GLY A 1 157 ? 15.113  -0.304  -0.124  1.00 1.27  ? 157 GLY A HA2  4  
ATOM 11354 H HA3  . GLY A 1 157 ? 16.078  -1.051  -1.391  1.00 1.46  ? 157 GLY A HA3  4  
ATOM 11355 N N    . TRP A 1 158 ? 13.366  -1.094  -1.939  1.00 0.67  ? 158 TRP A N    4  
ATOM 11356 C CA   . TRP A 1 158 ? 12.102  -1.598  -2.556  1.00 0.50  ? 158 TRP A CA   4  
ATOM 11357 C C    . TRP A 1 158 ? 12.381  -2.813  -3.444  1.00 0.51  ? 158 TRP A C    4  
ATOM 11358 O O    . TRP A 1 158 ? 11.465  -3.503  -3.861  1.00 0.53  ? 158 TRP A O    4  
ATOM 11359 C CB   . TRP A 1 158 ? 11.469  -0.493  -3.405  1.00 0.51  ? 158 TRP A CB   4  
ATOM 11360 C CG   . TRP A 1 158 ? 11.088  0.667   -2.541  1.00 0.46  ? 158 TRP A CG   4  
ATOM 11361 C CD1  . TRP A 1 158 ? 11.698  1.874   -2.548  1.00 0.59  ? 158 TRP A CD1  4  
ATOM 11362 C CD2  . TRP A 1 158 ? 10.019  0.755   -1.556  1.00 0.46  ? 158 TRP A CD2  4  
ATOM 11363 N NE1  . TRP A 1 158 ? 11.070  2.697   -1.632  1.00 0.55  ? 158 TRP A NE1  4  
ATOM 11364 C CE2  . TRP A 1 158 ? 10.030  2.052   -0.992  1.00 0.47  ? 158 TRP A CE2  4  
ATOM 11365 C CE3  . TRP A 1 158 ? 9.051   -0.157  -1.100  1.00 0.65  ? 158 TRP A CE3  4  
ATOM 11366 C CZ2  . TRP A 1 158 ? 9.112   2.432   -0.012  1.00 0.58  ? 158 TRP A CZ2  4  
ATOM 11367 C CZ3  . TRP A 1 158 ? 8.126   0.221   -0.114  1.00 0.84  ? 158 TRP A CZ3  4  
ATOM 11368 C CH2  . TRP A 1 158 ? 8.156   1.513   0.429   1.00 0.78  ? 158 TRP A CH2  4  
ATOM 11369 H H    . TRP A 1 158 ? 13.639  -0.165  -2.084  1.00 0.72  ? 158 TRP A H    4  
ATOM 11370 H HA   . TRP A 1 158 ? 11.416  -1.903  -1.781  1.00 0.48  ? 158 TRP A HA   4  
ATOM 11371 H HB2  . TRP A 1 158 ? 12.179  -0.164  -4.149  1.00 0.68  ? 158 TRP A HB2  4  
ATOM 11372 H HB3  . TRP A 1 158 ? 10.588  -0.879  -3.896  1.00 0.51  ? 158 TRP A HB3  4  
ATOM 11373 H HD1  . TRP A 1 158 ? 12.536  2.151   -3.170  1.00 0.78  ? 158 TRP A HD1  4  
ATOM 11374 H HE1  . TRP A 1 158 ? 11.319  3.626   -1.443  1.00 0.66  ? 158 TRP A HE1  4  
ATOM 11375 H HE3  . TRP A 1 158 ? 9.020   -1.154  -1.511  1.00 0.72  ? 158 TRP A HE3  4  
ATOM 11376 H HZ2  . TRP A 1 158 ? 9.140   3.429   0.403   1.00 0.60  ? 158 TRP A HZ2  4  
ATOM 11377 H HZ3  . TRP A 1 158 ? 7.386   -0.488  0.228   1.00 1.06  ? 158 TRP A HZ3  4  
ATOM 11378 H HH2  . TRP A 1 158 ? 7.442   1.798   1.187   1.00 0.95  ? 158 TRP A HH2  4  
ATOM 11379 N N    . ASP A 1 159 ? 13.612  -3.099  -3.754  1.00 0.50  ? 159 ASP A N    4  
ATOM 11380 C CA   . ASP A 1 159 ? 13.871  -4.279  -4.621  1.00 0.51  ? 159 ASP A CA   4  
ATOM 11381 C C    . ASP A 1 159 ? 13.305  -5.520  -3.932  1.00 0.51  ? 159 ASP A C    4  
ATOM 11382 O O    . ASP A 1 159 ? 12.848  -6.445  -4.573  1.00 0.51  ? 159 ASP A O    4  
ATOM 11383 C CB   . ASP A 1 159 ? 15.377  -4.438  -4.840  1.00 0.54  ? 159 ASP A CB   4  
ATOM 11384 C CG   . ASP A 1 159 ? 15.927  -3.192  -5.537  1.00 1.66  ? 159 ASP A CG   4  
ATOM 11385 O OD1  . ASP A 1 159 ? 15.598  -2.101  -5.101  1.00 2.46  ? 159 ASP A OD1  4  
ATOM 11386 O OD2  . ASP A 1 159 ? 16.667  -3.350  -6.494  1.00 2.37  ? 159 ASP A OD2  4  
ATOM 11387 H H    . ASP A 1 159 ? 14.362  -2.558  -3.428  1.00 0.50  ? 159 ASP A H    4  
ATOM 11388 H HA   . ASP A 1 159 ? 13.372  -4.126  -5.570  1.00 0.51  ? 159 ASP A HA   4  
ATOM 11389 H HB2  . ASP A 1 159 ? 15.867  -4.563  -3.885  1.00 0.94  ? 159 ASP A HB2  4  
ATOM 11390 H HB3  . ASP A 1 159 ? 15.562  -5.305  -5.457  1.00 1.23  ? 159 ASP A HB3  4  
ATOM 11391 N N    . GLY A 1 160 ? 13.314  -5.536  -2.625  1.00 0.52  ? 160 GLY A N    4  
ATOM 11392 C CA   . GLY A 1 160 ? 12.758  -6.707  -1.891  1.00 0.54  ? 160 GLY A CA   4  
ATOM 11393 C C    . GLY A 1 160 ? 11.281  -6.852  -2.257  1.00 0.53  ? 160 GLY A C    4  
ATOM 11394 O O    . GLY A 1 160 ? 10.750  -7.944  -2.315  1.00 0.54  ? 160 GLY A O    4  
ATOM 11395 H H    . GLY A 1 160 ? 13.676  -4.772  -2.129  1.00 0.53  ? 160 GLY A H    4  
ATOM 11396 H HA2  . GLY A 1 160 ? 13.295  -7.600  -2.175  1.00 0.55  ? 160 GLY A HA2  4  
ATOM 11397 H HA3  . GLY A 1 160 ? 12.850  -6.547  -0.828  1.00 0.57  ? 160 GLY A HA3  4  
ATOM 11398 N N    . LEU A 1 161 ? 10.618  -5.761  -2.526  1.00 0.54  ? 161 LEU A N    4  
ATOM 11399 C CA   . LEU A 1 161 ? 9.184   -5.842  -2.911  1.00 0.56  ? 161 LEU A CA   4  
ATOM 11400 C C    . LEU A 1 161 ? 9.076   -6.694  -4.177  1.00 0.56  ? 161 LEU A C    4  
ATOM 11401 O O    . LEU A 1 161 ? 8.265   -7.593  -4.279  1.00 0.62  ? 161 LEU A O    4  
ATOM 11402 C CB   . LEU A 1 161 ? 8.649   -4.418  -3.196  1.00 0.58  ? 161 LEU A CB   4  
ATOM 11403 C CG   . LEU A 1 161 ? 7.169   -4.323  -2.776  1.00 0.74  ? 161 LEU A CG   4  
ATOM 11404 C CD1  . LEU A 1 161 ? 6.637   -2.917  -3.049  1.00 1.63  ? 161 LEU A CD1  4  
ATOM 11405 C CD2  . LEU A 1 161 ? 6.340   -5.339  -3.569  1.00 1.56  ? 161 LEU A CD2  4  
ATOM 11406 H H    . LEU A 1 161 ? 11.069  -4.891  -2.493  1.00 0.54  ? 161 LEU A H    4  
ATOM 11407 H HA   . LEU A 1 161 ? 8.607   -6.261  -2.097  1.00 0.58  ? 161 LEU A HA   4  
ATOM 11408 H HB2  . LEU A 1 161 ? 9.226   -3.703  -2.628  1.00 0.75  ? 161 LEU A HB2  4  
ATOM 11409 H HB3  . LEU A 1 161 ? 8.737   -4.189  -4.249  1.00 0.77  ? 161 LEU A HB3  4  
ATOM 11410 H HG   . LEU A 1 161 ? 7.083   -4.536  -1.720  1.00 1.32  ? 161 LEU A HG   4  
ATOM 11411 H HD11 . LEU A 1 161 ? 5.575   -2.891  -2.854  1.00 2.13  ? 161 LEU A HD11 4  
ATOM 11412 H HD12 . LEU A 1 161 ? 6.821   -2.655  -4.080  1.00 2.24  ? 161 LEU A HD12 4  
ATOM 11413 H HD13 . LEU A 1 161 ? 7.137   -2.212  -2.403  1.00 2.11  ? 161 LEU A HD13 4  
ATOM 11414 H HD21 . LEU A 1 161 ? 6.563   -6.337  -3.223  1.00 2.07  ? 161 LEU A HD21 4  
ATOM 11415 H HD22 . LEU A 1 161 ? 6.580   -5.260  -4.619  1.00 2.01  ? 161 LEU A HD22 4  
ATOM 11416 H HD23 . LEU A 1 161 ? 5.289   -5.135  -3.424  1.00 2.20  ? 161 LEU A HD23 4  
ATOM 11417 N N    . LEU A 1 162 ? 9.909   -6.399  -5.144  1.00 0.53  ? 162 LEU A N    4  
ATOM 11418 C CA   . LEU A 1 162 ? 9.897   -7.164  -6.427  1.00 0.56  ? 162 LEU A CA   4  
ATOM 11419 C C    . LEU A 1 162 ? 10.517  -8.551  -6.194  1.00 0.55  ? 162 LEU A C    4  
ATOM 11420 O O    . LEU A 1 162 ? 10.097  -9.528  -6.782  1.00 0.57  ? 162 LEU A O    4  
ATOM 11421 C CB   . LEU A 1 162 ? 10.716  -6.385  -7.493  1.00 0.61  ? 162 LEU A CB   4  
ATOM 11422 C CG   . LEU A 1 162 ? 9.834   -5.937  -8.668  1.00 0.80  ? 162 LEU A CG   4  
ATOM 11423 C CD1  . LEU A 1 162 ? 10.600  -4.913  -9.514  1.00 1.56  ? 162 LEU A CD1  4  
ATOM 11424 C CD2  . LEU A 1 162 ? 9.486   -7.142  -9.550  1.00 1.33  ? 162 LEU A CD2  4  
ATOM 11425 H H    . LEU A 1 162 ? 10.560  -5.669  -5.031  1.00 0.52  ? 162 LEU A H    4  
ATOM 11426 H HA   . LEU A 1 162 ? 8.885   -7.324  -6.753  1.00 0.58  ? 162 LEU A HA   4  
ATOM 11427 H HB2  . LEU A 1 162 ? 11.146  -5.511  -7.029  1.00 1.09  ? 162 LEU A HB2  4  
ATOM 11428 H HB3  . LEU A 1 162 ? 11.517  -7.006  -7.874  1.00 1.00  ? 162 LEU A HB3  4  
ATOM 11429 H HG   . LEU A 1 162 ? 8.931   -5.486  -8.287  1.00 1.65  ? 162 LEU A HG   4  
ATOM 11430 H HD11 . LEU A 1 162 ? 9.967   -4.561  -10.316 1.00 2.03  ? 162 LEU A HD11 4  
ATOM 11431 H HD12 . LEU A 1 162 ? 11.481  -5.378  -9.931  1.00 2.11  ? 162 LEU A HD12 4  
ATOM 11432 H HD13 . LEU A 1 162 ? 10.894  -4.079  -8.896  1.00 2.11  ? 162 LEU A HD13 4  
ATOM 11433 H HD21 . LEU A 1 162 ? 8.940   -6.804  -10.419 1.00 1.91  ? 162 LEU A HD21 4  
ATOM 11434 H HD22 . LEU A 1 162 ? 8.879   -7.839  -8.995  1.00 1.79  ? 162 LEU A HD22 4  
ATOM 11435 H HD23 . LEU A 1 162 ? 10.396  -7.629  -9.867  1.00 1.84  ? 162 LEU A HD23 4  
ATOM 11436 N N    . SER A 1 163 ? 11.515  -8.650  -5.365  1.00 0.54  ? 163 SER A N    4  
ATOM 11437 C CA   . SER A 1 163 ? 12.146  -9.980  -5.136  1.00 0.56  ? 163 SER A CA   4  
ATOM 11438 C C    . SER A 1 163 ? 11.088  -10.993 -4.683  1.00 0.53  ? 163 SER A C    4  
ATOM 11439 O O    . SER A 1 163 ? 11.221  -12.182 -4.896  1.00 0.60  ? 163 SER A O    4  
ATOM 11440 C CB   . SER A 1 163 ? 13.217  -9.852  -4.054  1.00 0.63  ? 163 SER A CB   4  
ATOM 11441 O OG   . SER A 1 163 ? 13.994  -11.041 -4.024  1.00 1.32  ? 163 SER A OG   4  
ATOM 11442 H H    . SER A 1 163 ? 11.86