data_1F1H
# 
_entry.id   1F1H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1F1H         
RCSB  RCSB011127   
WWPDB D_1000011127 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F1H 
_pdbx_database_status.recvd_initial_deposition_date   2000-05-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gill, H.S.'    1 
'Eisenberg, D.' 2 
# 
_citation.id                        primary 
_citation.title                     
;The crystal structure of phosphinothricin in the active site of glutamine synthetase illuminates the mechanism of enzymatic inhibition.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            40 
_citation.page_first                1903 
_citation.page_last                 1912 
_citation.year                      2001 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11329256 
_citation.pdbx_database_id_DOI      10.1021/bi002438h 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gill, H.S.'    1 
primary 'Eisenberg, D.' 2 
# 
_cell.entry_id           1F1H 
_cell.length_a           231.130 
_cell.length_b           132.790 
_cell.length_c           196.780 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.44 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1F1H 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (GLUTAMINE SYNTHETASE)' 51744.418 12   6.3.1.2 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'             54.938    24   ?       ? ? ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"       427.201   12   ?       ? ? ? 
4 non-polymer syn 'THALLIUM (I) ION'               204.383   24   ?       ? ? ? 
5 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL'  118.174   12   ?       ? ? ? 
6 water       nat water                            18.015    1452 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKGINESDMVLMPDASTAVIDPFF
ADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNS
STKYEGGNKGHRPGVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKY
VVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYK
RLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLP
PEEAKEIPQVAGSLEEALNALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKGINESDMVLMPDASTAVIDPFF
ADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNS
STKYEGGNKGHRPGVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKY
VVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYK
RLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLP
PEEAKEIPQVAGSLEEALNALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   GLU n 
1 4   HIS n 
1 5   VAL n 
1 6   LEU n 
1 7   THR n 
1 8   MET n 
1 9   LEU n 
1 10  ASN n 
1 11  GLU n 
1 12  HIS n 
1 13  GLU n 
1 14  VAL n 
1 15  LYS n 
1 16  PHE n 
1 17  VAL n 
1 18  ASP n 
1 19  LEU n 
1 20  ARG n 
1 21  PHE n 
1 22  THR n 
1 23  ASP n 
1 24  THR n 
1 25  LYS n 
1 26  GLY n 
1 27  LYS n 
1 28  GLU n 
1 29  GLN n 
1 30  HIS n 
1 31  VAL n 
1 32  THR n 
1 33  ILE n 
1 34  PRO n 
1 35  ALA n 
1 36  HIS n 
1 37  GLN n 
1 38  VAL n 
1 39  ASN n 
1 40  ALA n 
1 41  GLU n 
1 42  PHE n 
1 43  PHE n 
1 44  GLU n 
1 45  GLU n 
1 46  GLY n 
1 47  LYS n 
1 48  MET n 
1 49  PHE n 
1 50  ASP n 
1 51  GLY n 
1 52  SER n 
1 53  SER n 
1 54  ILE n 
1 55  GLY n 
1 56  GLY n 
1 57  TRP n 
1 58  LYS n 
1 59  GLY n 
1 60  ILE n 
1 61  ASN n 
1 62  GLU n 
1 63  SER n 
1 64  ASP n 
1 65  MET n 
1 66  VAL n 
1 67  LEU n 
1 68  MET n 
1 69  PRO n 
1 70  ASP n 
1 71  ALA n 
1 72  SER n 
1 73  THR n 
1 74  ALA n 
1 75  VAL n 
1 76  ILE n 
1 77  ASP n 
1 78  PRO n 
1 79  PHE n 
1 80  PHE n 
1 81  ALA n 
1 82  ASP n 
1 83  SER n 
1 84  THR n 
1 85  LEU n 
1 86  ILE n 
1 87  ILE n 
1 88  ARG n 
1 89  CYS n 
1 90  ASP n 
1 91  ILE n 
1 92  LEU n 
1 93  GLU n 
1 94  PRO n 
1 95  GLY n 
1 96  THR n 
1 97  LEU n 
1 98  GLN n 
1 99  GLY n 
1 100 TYR n 
1 101 ASP n 
1 102 ARG n 
1 103 ASP n 
1 104 PRO n 
1 105 ARG n 
1 106 SER n 
1 107 ILE n 
1 108 ALA n 
1 109 LYS n 
1 110 ARG n 
1 111 ALA n 
1 112 GLU n 
1 113 ASP n 
1 114 TYR n 
1 115 LEU n 
1 116 ARG n 
1 117 ALA n 
1 118 THR n 
1 119 GLY n 
1 120 ILE n 
1 121 ALA n 
1 122 ASP n 
1 123 THR n 
1 124 VAL n 
1 125 LEU n 
1 126 PHE n 
1 127 GLY n 
1 128 PRO n 
1 129 GLU n 
1 130 PRO n 
1 131 GLU n 
1 132 PHE n 
1 133 PHE n 
1 134 LEU n 
1 135 PHE n 
1 136 ASP n 
1 137 ASP n 
1 138 ILE n 
1 139 ARG n 
1 140 PHE n 
1 141 GLY n 
1 142 ALA n 
1 143 SER n 
1 144 ILE n 
1 145 SER n 
1 146 GLY n 
1 147 SER n 
1 148 HIS n 
1 149 VAL n 
1 150 ALA n 
1 151 ILE n 
1 152 ASP n 
1 153 ASP n 
1 154 ILE n 
1 155 GLU n 
1 156 GLY n 
1 157 ALA n 
1 158 TRP n 
1 159 ASN n 
1 160 SER n 
1 161 SER n 
1 162 THR n 
1 163 LYS n 
1 164 TYR n 
1 165 GLU n 
1 166 GLY n 
1 167 GLY n 
1 168 ASN n 
1 169 LYS n 
1 170 GLY n 
1 171 HIS n 
1 172 ARG n 
1 173 PRO n 
1 174 GLY n 
1 175 VAL n 
1 176 LYS n 
1 177 GLY n 
1 178 GLY n 
1 179 TYR n 
1 180 PHE n 
1 181 PRO n 
1 182 VAL n 
1 183 PRO n 
1 184 PRO n 
1 185 VAL n 
1 186 ASP n 
1 187 SER n 
1 188 ALA n 
1 189 GLN n 
1 190 ASP n 
1 191 ILE n 
1 192 ARG n 
1 193 SER n 
1 194 GLU n 
1 195 MET n 
1 196 CYS n 
1 197 LEU n 
1 198 VAL n 
1 199 MET n 
1 200 GLU n 
1 201 GLN n 
1 202 MET n 
1 203 GLY n 
1 204 LEU n 
1 205 VAL n 
1 206 VAL n 
1 207 GLU n 
1 208 ALA n 
1 209 HIS n 
1 210 HIS n 
1 211 HIS n 
1 212 GLU n 
1 213 VAL n 
1 214 ALA n 
1 215 THR n 
1 216 ALA n 
1 217 GLY n 
1 218 GLN n 
1 219 ASN n 
1 220 GLU n 
1 221 VAL n 
1 222 ALA n 
1 223 THR n 
1 224 ARG n 
1 225 PHE n 
1 226 ASN n 
1 227 THR n 
1 228 MET n 
1 229 THR n 
1 230 LYS n 
1 231 LYS n 
1 232 ALA n 
1 233 ASP n 
1 234 GLU n 
1 235 ILE n 
1 236 GLN n 
1 237 ILE n 
1 238 TYR n 
1 239 LYS n 
1 240 TYR n 
1 241 VAL n 
1 242 VAL n 
1 243 HIS n 
1 244 ASN n 
1 245 VAL n 
1 246 ALA n 
1 247 HIS n 
1 248 ARG n 
1 249 PHE n 
1 250 GLY n 
1 251 LYS n 
1 252 THR n 
1 253 ALA n 
1 254 THR n 
1 255 PHE n 
1 256 MET n 
1 257 PRO n 
1 258 LYS n 
1 259 PRO n 
1 260 MET n 
1 261 PHE n 
1 262 GLY n 
1 263 ASP n 
1 264 ASN n 
1 265 GLY n 
1 266 SER n 
1 267 GLY n 
1 268 MET n 
1 269 HIS n 
1 270 CYS n 
1 271 HIS n 
1 272 MET n 
1 273 SER n 
1 274 LEU n 
1 275 ALA n 
1 276 LYS n 
1 277 ASN n 
1 278 GLY n 
1 279 THR n 
1 280 ASN n 
1 281 LEU n 
1 282 PHE n 
1 283 SER n 
1 284 GLY n 
1 285 ASP n 
1 286 LYS n 
1 287 TYR n 
1 288 ALA n 
1 289 GLY n 
1 290 LEU n 
1 291 SER n 
1 292 GLU n 
1 293 GLN n 
1 294 ALA n 
1 295 LEU n 
1 296 TYR n 
1 297 TYR n 
1 298 ILE n 
1 299 GLY n 
1 300 GLY n 
1 301 VAL n 
1 302 ILE n 
1 303 LYS n 
1 304 HIS n 
1 305 ALA n 
1 306 LYS n 
1 307 ALA n 
1 308 ILE n 
1 309 ASN n 
1 310 ALA n 
1 311 LEU n 
1 312 ALA n 
1 313 ASN n 
1 314 PRO n 
1 315 THR n 
1 316 THR n 
1 317 ASN n 
1 318 SER n 
1 319 TYR n 
1 320 LYS n 
1 321 ARG n 
1 322 LEU n 
1 323 VAL n 
1 324 PRO n 
1 325 GLY n 
1 326 TYR n 
1 327 GLU n 
1 328 ALA n 
1 329 PRO n 
1 330 VAL n 
1 331 MET n 
1 332 LEU n 
1 333 ALA n 
1 334 TYR n 
1 335 SER n 
1 336 ALA n 
1 337 ARG n 
1 338 ASN n 
1 339 ARG n 
1 340 SER n 
1 341 ALA n 
1 342 SER n 
1 343 ILE n 
1 344 ARG n 
1 345 ILE n 
1 346 PRO n 
1 347 VAL n 
1 348 VAL n 
1 349 ALA n 
1 350 SER n 
1 351 PRO n 
1 352 LYS n 
1 353 ALA n 
1 354 ARG n 
1 355 ARG n 
1 356 ILE n 
1 357 GLU n 
1 358 VAL n 
1 359 ARG n 
1 360 PHE n 
1 361 PRO n 
1 362 ASP n 
1 363 PRO n 
1 364 ALA n 
1 365 ALA n 
1 366 ASN n 
1 367 PRO n 
1 368 TYR n 
1 369 LEU n 
1 370 CYS n 
1 371 PHE n 
1 372 ALA n 
1 373 ALA n 
1 374 LEU n 
1 375 LEU n 
1 376 MET n 
1 377 ALA n 
1 378 GLY n 
1 379 LEU n 
1 380 ASP n 
1 381 GLY n 
1 382 ILE n 
1 383 LYS n 
1 384 ASN n 
1 385 LYS n 
1 386 ILE n 
1 387 HIS n 
1 388 PRO n 
1 389 GLY n 
1 390 GLU n 
1 391 PRO n 
1 392 MET n 
1 393 ASP n 
1 394 LYS n 
1 395 ASN n 
1 396 LEU n 
1 397 TYR n 
1 398 ASP n 
1 399 LEU n 
1 400 PRO n 
1 401 PRO n 
1 402 GLU n 
1 403 GLU n 
1 404 ALA n 
1 405 LYS n 
1 406 GLU n 
1 407 ILE n 
1 408 PRO n 
1 409 GLN n 
1 410 VAL n 
1 411 ALA n 
1 412 GLY n 
1 413 SER n 
1 414 LEU n 
1 415 GLU n 
1 416 GLU n 
1 417 ALA n 
1 418 LEU n 
1 419 ASN n 
1 420 ALA n 
1 421 LEU n 
1 422 ASP n 
1 423 LEU n 
1 424 ASP n 
1 425 ARG n 
1 426 GLU n 
1 427 PHE n 
1 428 LEU n 
1 429 LYS n 
1 430 ALA n 
1 431 GLY n 
1 432 GLY n 
1 433 VAL n 
1 434 PHE n 
1 435 THR n 
1 436 ASP n 
1 437 GLU n 
1 438 ALA n 
1 439 ILE n 
1 440 ASP n 
1 441 ALA n 
1 442 TYR n 
1 443 ILE n 
1 444 ALA n 
1 445 LEU n 
1 446 ARG n 
1 447 ARG n 
1 448 GLU n 
1 449 GLU n 
1 450 ASP n 
1 451 ASP n 
1 452 ARG n 
1 453 VAL n 
1 454 ARG n 
1 455 MET n 
1 456 THR n 
1 457 PRO n 
1 458 HIS n 
1 459 PRO n 
1 460 VAL n 
1 461 GLU n 
1 462 PHE n 
1 463 GLU n 
1 464 LEU n 
1 465 TYR n 
1 466 TYR n 
1 467 SER n 
1 468 VAL n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Salmonella typhimurium' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      602 
_entity_src_nat.genus                      Salmonella 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'GRAM NEGATIVE BACTERIA' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GLNA_SALTY 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P0A1P6 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1F1H A 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
2  1 1F1H B 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
3  1 1F1H C 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
4  1 1F1H D 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
5  1 1F1H E 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
6  1 1F1H F 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
7  1 1F1H G 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
8  1 1F1H H 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
9  1 1F1H I 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
10 1 1F1H J 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
11 1 1F1H K 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
12 1 1F1H L 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"      ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                        ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                       ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                           ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                      ? 'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'            ? 'Mn 2'              54.938  
MPD non-polymer         . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2'         118.174 
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'        119.119 
TL  non-polymer         . 'THALLIUM (I) ION'              ? 'Tl 1'              204.383 
TRP 'L-peptide linking' y TRYPTOPHAN                      ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                        ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1F1H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.37 
_exptl_crystal.density_percent_sol   48.17 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    'ADP, MPD, SPERMINE, MANGANESE CHLORIDE, IMIDAZOLE BUFFER, pH 7.50' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   1997-03-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1F1H 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             32.000 
_reflns.d_resolution_high            2.670 
_reflns.number_obs                   268069 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         82.0 
_reflns.pdbx_Rmerge_I_obs            0.1300000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.8000 
_reflns.B_iso_Wilson_estimate        44.00 
_reflns.pdbx_redundancy              2.000 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.67 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   55.0 
_reflns_shell.Rmerge_I_obs           0.4300000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.80 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1F1H 
_refine.ls_number_reflns_obs                     130596 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.00 
_refine.ls_d_res_high                            2.67 
_refine.ls_percent_reflns_obs                    82.0 
_refine.ls_R_factor_obs                          0.2320000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2320000 
_refine.ls_R_factor_R_free                       0.2630000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  6529 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               46.43 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THE MODEL WAS REFINED USING STRICT 12-FOLD NCS-AVERAGING, I.E. CONSTRAINTS. THE 2- METHYL-2,4-PENTANEDIOL (MPD) MOLECULE WAS RESTRAINED TO MATCH PD
 CODE 3AL1. A BULK SOLVENT CORRECTION WAS APPLIED TO THE DATA SET. METHOD USED: J.-S. JIANG AND A.T. BRUNGER, J. MOL. BIOL. 243, 100-115 (1994).
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMEN' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1F1H 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           7.00 
_refine_analyze.Luzzati_coordinate_error_free   0.42 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        43644 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         372 
_refine_hist.number_atoms_solvent             1548 
_refine_hist.number_atoms_total               45564 
_refine_hist.d_res_high                       2.67 
_refine_hist.d_res_low                        32.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.79  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.07 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.81  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTRAINED 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.67 
_refine_ls_shell.d_res_low                        2.79 
_refine_ls_shell.number_reflns_R_work             8079 
_refine_ls_shell.R_factor_R_work                  0.3500000 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3800000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.8 
_refine_ls_shell.number_reflns_R_free             391 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1F1H 
_struct.title                     'CRYSTAL STRUCTURE OF GLUTAMINE SYNTHETASE FROM SALMONELLA TYPHIMURIUM WITH THALLIUM IONS' 
_struct.pdbx_descriptor           'CRYSTAL STRUCTURE OF GLUTAMINE SYNTHETASE FROM SALMONELLA TYPHIMURIUM WITH THALLIUM IONS' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F1H 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'GLUTAMINE SYNTHETASE, THALLIUM IONS, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 5 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 3 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 5 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 5 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 3 ? 
HA N N 4 ? 
IA N N 4 ? 
JA N N 5 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 3 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 5 ? 
QA N N 2 ? 
RA N N 2 ? 
SA N N 3 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 5 ? 
WA N N 2 ? 
XA N N 2 ? 
YA N N 3 ? 
ZA N N 4 ? 
AB N N 4 ? 
BB N N 5 ? 
CB N N 2 ? 
DB N N 2 ? 
EB N N 3 ? 
FB N N 4 ? 
GB N N 4 ? 
HB N N 5 ? 
IB N N 2 ? 
JB N N 2 ? 
KB N N 3 ? 
LB N N 4 ? 
MB N N 4 ? 
NB N N 5 ? 
OB N N 2 ? 
PB N N 2 ? 
QB N N 3 ? 
RB N N 4 ? 
SB N N 4 ? 
TB N N 5 ? 
UB N N 2 ? 
VB N N 2 ? 
WB N N 3 ? 
XB N N 4 ? 
YB N N 4 ? 
ZB N N 5 ? 
AC N N 2 ? 
BC N N 2 ? 
CC N N 3 ? 
DC N N 4 ? 
EC N N 4 ? 
FC N N 5 ? 
GC N N 6 ? 
HC N N 6 ? 
IC N N 6 ? 
JC N N 6 ? 
KC N N 6 ? 
LC N N 6 ? 
MC N N 6 ? 
NC N N 6 ? 
OC N N 6 ? 
PC N N 6 ? 
QC N N 6 ? 
RC N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 1   ? HIS A 12  ? SER A 1   HIS A 12  1 ? 12 
HELX_P HELX_P2   2   HIS A 36  ? VAL A 38  ? HIS A 36  VAL A 38  5 ? 3  
HELX_P HELX_P3   3   ASN A 39  ? GLY A 46  ? ASN A 39  GLY A 46  1 ? 8  
HELX_P HELX_P4   4   ASP A 50  ? ILE A 54  ? ASP A 50  ILE A 54  5 ? 5  
HELX_P HELX_P5   5   ALA A 71  ? ALA A 74  ? ALA A 71  ALA A 74  5 ? 4  
HELX_P HELX_P6   6   ASP A 103 ? THR A 118 ? ASP A 103 THR A 118 1 ? 16 
HELX_P HELX_P7   7   GLY A 156 ? THR A 162 ? GLY A 156 THR A 162 5 ? 7  
HELX_P HELX_P8   8   ALA A 188 ? MET A 202 ? ALA A 188 MET A 202 1 ? 15 
HELX_P HELX_P9   9   MET A 228 ? PHE A 249 ? MET A 228 PHE A 249 1 ? 22 
HELX_P HELX_P10  10  LYS A 286 ? GLY A 289 ? LYS A 286 GLY A 289 5 ? 4  
HELX_P HELX_P11  11  SER A 291 ? HIS A 304 ? SER A 291 HIS A 304 1 ? 14 
HELX_P HELX_P12  12  HIS A 304 ? ASN A 313 ? HIS A 304 ASN A 313 1 ? 10 
HELX_P HELX_P13  13  THR A 316 ? ARG A 321 ? THR A 316 ARG A 321 5 ? 6  
HELX_P HELX_P14  14  SER A 350 ? ARG A 354 ? SER A 350 ARG A 354 5 ? 5  
HELX_P HELX_P15  15  ASN A 366 ? ASN A 384 ? ASN A 366 ASN A 384 1 ? 19 
HELX_P HELX_P16  16  SER A 413 ? ASP A 424 ? SER A 413 ASP A 424 1 ? 12 
HELX_P HELX_P17  17  ARG A 425 ? ALA A 430 ? ARG A 425 ALA A 430 1 ? 6  
HELX_P HELX_P18  18  GLY A 431 ? VAL A 433 ? GLY A 431 VAL A 433 5 ? 3  
HELX_P HELX_P19  19  THR A 435 ? THR A 456 ? THR A 435 THR A 456 1 ? 22 
HELX_P HELX_P20  20  HIS A 458 ? TYR A 466 ? HIS A 458 TYR A 466 1 ? 9  
HELX_P HELX_P21  21  SER B 1   ? HIS B 12  ? SER B 1   HIS B 12  1 ? 12 
HELX_P HELX_P22  22  HIS B 36  ? VAL B 38  ? HIS B 36  VAL B 38  5 ? 3  
HELX_P HELX_P23  23  ASN B 39  ? GLY B 46  ? ASN B 39  GLY B 46  1 ? 8  
HELX_P HELX_P24  24  ASP B 50  ? ILE B 54  ? ASP B 50  ILE B 54  5 ? 5  
HELX_P HELX_P25  25  ALA B 71  ? ALA B 74  ? ALA B 71  ALA B 74  5 ? 4  
HELX_P HELX_P26  26  ASP B 103 ? THR B 118 ? ASP B 103 THR B 118 1 ? 16 
HELX_P HELX_P27  27  GLY B 156 ? THR B 162 ? GLY B 156 THR B 162 5 ? 7  
HELX_P HELX_P28  28  ALA B 188 ? MET B 202 ? ALA B 188 MET B 202 1 ? 15 
HELX_P HELX_P29  29  MET B 228 ? PHE B 249 ? MET B 228 PHE B 249 1 ? 22 
HELX_P HELX_P30  30  LYS B 286 ? GLY B 289 ? LYS B 286 GLY B 289 5 ? 4  
HELX_P HELX_P31  31  SER B 291 ? HIS B 304 ? SER B 291 HIS B 304 1 ? 14 
HELX_P HELX_P32  32  HIS B 304 ? ASN B 313 ? HIS B 304 ASN B 313 1 ? 10 
HELX_P HELX_P33  33  THR B 316 ? ARG B 321 ? THR B 316 ARG B 321 5 ? 6  
HELX_P HELX_P34  34  SER B 350 ? ARG B 354 ? SER B 350 ARG B 354 5 ? 5  
HELX_P HELX_P35  35  ASN B 366 ? ASN B 384 ? ASN B 366 ASN B 384 1 ? 19 
HELX_P HELX_P36  36  SER B 413 ? ASP B 424 ? SER B 413 ASP B 424 1 ? 12 
HELX_P HELX_P37  37  ARG B 425 ? ALA B 430 ? ARG B 425 ALA B 430 1 ? 6  
HELX_P HELX_P38  38  GLY B 431 ? VAL B 433 ? GLY B 431 VAL B 433 5 ? 3  
HELX_P HELX_P39  39  THR B 435 ? THR B 456 ? THR B 435 THR B 456 1 ? 22 
HELX_P HELX_P40  40  HIS B 458 ? TYR B 466 ? HIS B 458 TYR B 466 1 ? 9  
HELX_P HELX_P41  41  SER C 1   ? HIS C 12  ? SER C 1   HIS C 12  1 ? 12 
HELX_P HELX_P42  42  HIS C 36  ? VAL C 38  ? HIS C 36  VAL C 38  5 ? 3  
HELX_P HELX_P43  43  ASN C 39  ? GLY C 46  ? ASN C 39  GLY C 46  1 ? 8  
HELX_P HELX_P44  44  ASP C 50  ? ILE C 54  ? ASP C 50  ILE C 54  5 ? 5  
HELX_P HELX_P45  45  ALA C 71  ? ALA C 74  ? ALA C 71  ALA C 74  5 ? 4  
HELX_P HELX_P46  46  ASP C 103 ? THR C 118 ? ASP C 103 THR C 118 1 ? 16 
HELX_P HELX_P47  47  GLY C 156 ? THR C 162 ? GLY C 156 THR C 162 5 ? 7  
HELX_P HELX_P48  48  ALA C 188 ? MET C 202 ? ALA C 188 MET C 202 1 ? 15 
HELX_P HELX_P49  49  MET C 228 ? PHE C 249 ? MET C 228 PHE C 249 1 ? 22 
HELX_P HELX_P50  50  LYS C 286 ? GLY C 289 ? LYS C 286 GLY C 289 5 ? 4  
HELX_P HELX_P51  51  SER C 291 ? HIS C 304 ? SER C 291 HIS C 304 1 ? 14 
HELX_P HELX_P52  52  HIS C 304 ? ASN C 313 ? HIS C 304 ASN C 313 1 ? 10 
HELX_P HELX_P53  53  THR C 316 ? ARG C 321 ? THR C 316 ARG C 321 5 ? 6  
HELX_P HELX_P54  54  SER C 350 ? ARG C 354 ? SER C 350 ARG C 354 5 ? 5  
HELX_P HELX_P55  55  ASN C 366 ? ASN C 384 ? ASN C 366 ASN C 384 1 ? 19 
HELX_P HELX_P56  56  SER C 413 ? ASP C 424 ? SER C 413 ASP C 424 1 ? 12 
HELX_P HELX_P57  57  ARG C 425 ? ALA C 430 ? ARG C 425 ALA C 430 1 ? 6  
HELX_P HELX_P58  58  GLY C 431 ? VAL C 433 ? GLY C 431 VAL C 433 5 ? 3  
HELX_P HELX_P59  59  THR C 435 ? THR C 456 ? THR C 435 THR C 456 1 ? 22 
HELX_P HELX_P60  60  HIS C 458 ? TYR C 466 ? HIS C 458 TYR C 466 1 ? 9  
HELX_P HELX_P61  61  SER D 1   ? HIS D 12  ? SER D 1   HIS D 12  1 ? 12 
HELX_P HELX_P62  62  HIS D 36  ? VAL D 38  ? HIS D 36  VAL D 38  5 ? 3  
HELX_P HELX_P63  63  ASN D 39  ? GLY D 46  ? ASN D 39  GLY D 46  1 ? 8  
HELX_P HELX_P64  64  ASP D 50  ? ILE D 54  ? ASP D 50  ILE D 54  5 ? 5  
HELX_P HELX_P65  65  ALA D 71  ? ALA D 74  ? ALA D 71  ALA D 74  5 ? 4  
HELX_P HELX_P66  66  ASP D 103 ? THR D 118 ? ASP D 103 THR D 118 1 ? 16 
HELX_P HELX_P67  67  GLY D 156 ? THR D 162 ? GLY D 156 THR D 162 5 ? 7  
HELX_P HELX_P68  68  ALA D 188 ? MET D 202 ? ALA D 188 MET D 202 1 ? 15 
HELX_P HELX_P69  69  MET D 228 ? PHE D 249 ? MET D 228 PHE D 249 1 ? 22 
HELX_P HELX_P70  70  LYS D 286 ? GLY D 289 ? LYS D 286 GLY D 289 5 ? 4  
HELX_P HELX_P71  71  SER D 291 ? HIS D 304 ? SER D 291 HIS D 304 1 ? 14 
HELX_P HELX_P72  72  HIS D 304 ? ASN D 313 ? HIS D 304 ASN D 313 1 ? 10 
HELX_P HELX_P73  73  THR D 316 ? ARG D 321 ? THR D 316 ARG D 321 5 ? 6  
HELX_P HELX_P74  74  SER D 350 ? ARG D 354 ? SER D 350 ARG D 354 5 ? 5  
HELX_P HELX_P75  75  ASN D 366 ? ASN D 384 ? ASN D 366 ASN D 384 1 ? 19 
HELX_P HELX_P76  76  SER D 413 ? ASP D 424 ? SER D 413 ASP D 424 1 ? 12 
HELX_P HELX_P77  77  ARG D 425 ? ALA D 430 ? ARG D 425 ALA D 430 1 ? 6  
HELX_P HELX_P78  78  GLY D 431 ? VAL D 433 ? GLY D 431 VAL D 433 5 ? 3  
HELX_P HELX_P79  79  THR D 435 ? THR D 456 ? THR D 435 THR D 456 1 ? 22 
HELX_P HELX_P80  80  HIS D 458 ? TYR D 466 ? HIS D 458 TYR D 466 1 ? 9  
HELX_P HELX_P81  81  SER E 1   ? HIS E 12  ? SER E 1   HIS E 12  1 ? 12 
HELX_P HELX_P82  82  HIS E 36  ? VAL E 38  ? HIS E 36  VAL E 38  5 ? 3  
HELX_P HELX_P83  83  ASN E 39  ? GLY E 46  ? ASN E 39  GLY E 46  1 ? 8  
HELX_P HELX_P84  84  ASP E 50  ? ILE E 54  ? ASP E 50  ILE E 54  5 ? 5  
HELX_P HELX_P85  85  ALA E 71  ? ALA E 74  ? ALA E 71  ALA E 74  5 ? 4  
HELX_P HELX_P86  86  ASP E 103 ? THR E 118 ? ASP E 103 THR E 118 1 ? 16 
HELX_P HELX_P87  87  GLY E 156 ? THR E 162 ? GLY E 156 THR E 162 5 ? 7  
HELX_P HELX_P88  88  ALA E 188 ? MET E 202 ? ALA E 188 MET E 202 1 ? 15 
HELX_P HELX_P89  89  MET E 228 ? PHE E 249 ? MET E 228 PHE E 249 1 ? 22 
HELX_P HELX_P90  90  LYS E 286 ? GLY E 289 ? LYS E 286 GLY E 289 5 ? 4  
HELX_P HELX_P91  91  SER E 291 ? HIS E 304 ? SER E 291 HIS E 304 1 ? 14 
HELX_P HELX_P92  92  HIS E 304 ? ASN E 313 ? HIS E 304 ASN E 313 1 ? 10 
HELX_P HELX_P93  93  THR E 316 ? ARG E 321 ? THR E 316 ARG E 321 5 ? 6  
HELX_P HELX_P94  94  SER E 350 ? ARG E 354 ? SER E 350 ARG E 354 5 ? 5  
HELX_P HELX_P95  95  ASN E 366 ? ASN E 384 ? ASN E 366 ASN E 384 1 ? 19 
HELX_P HELX_P96  96  SER E 413 ? ASP E 424 ? SER E 413 ASP E 424 1 ? 12 
HELX_P HELX_P97  97  ARG E 425 ? ALA E 430 ? ARG E 425 ALA E 430 1 ? 6  
HELX_P HELX_P98  98  GLY E 431 ? VAL E 433 ? GLY E 431 VAL E 433 5 ? 3  
HELX_P HELX_P99  99  THR E 435 ? THR E 456 ? THR E 435 THR E 456 1 ? 22 
HELX_P HELX_P100 100 HIS E 458 ? TYR E 466 ? HIS E 458 TYR E 466 1 ? 9  
HELX_P HELX_P101 101 SER F 1   ? HIS F 12  ? SER F 1   HIS F 12  1 ? 12 
HELX_P HELX_P102 102 HIS F 36  ? VAL F 38  ? HIS F 36  VAL F 38  5 ? 3  
HELX_P HELX_P103 103 ASN F 39  ? GLY F 46  ? ASN F 39  GLY F 46  1 ? 8  
HELX_P HELX_P104 104 ASP F 50  ? ILE F 54  ? ASP F 50  ILE F 54  5 ? 5  
HELX_P HELX_P105 105 ALA F 71  ? ALA F 74  ? ALA F 71  ALA F 74  5 ? 4  
HELX_P HELX_P106 106 ASP F 103 ? THR F 118 ? ASP F 103 THR F 118 1 ? 16 
HELX_P HELX_P107 107 GLY F 156 ? THR F 162 ? GLY F 156 THR F 162 5 ? 7  
HELX_P HELX_P108 108 ALA F 188 ? MET F 202 ? ALA F 188 MET F 202 1 ? 15 
HELX_P HELX_P109 109 MET F 228 ? PHE F 249 ? MET F 228 PHE F 249 1 ? 22 
HELX_P HELX_P110 110 LYS F 286 ? GLY F 289 ? LYS F 286 GLY F 289 5 ? 4  
HELX_P HELX_P111 111 SER F 291 ? HIS F 304 ? SER F 291 HIS F 304 1 ? 14 
HELX_P HELX_P112 112 HIS F 304 ? ASN F 313 ? HIS F 304 ASN F 313 1 ? 10 
HELX_P HELX_P113 113 THR F 316 ? ARG F 321 ? THR F 316 ARG F 321 5 ? 6  
HELX_P HELX_P114 114 SER F 350 ? ARG F 354 ? SER F 350 ARG F 354 5 ? 5  
HELX_P HELX_P115 115 ASN F 366 ? ASN F 384 ? ASN F 366 ASN F 384 1 ? 19 
HELX_P HELX_P116 116 SER F 413 ? ASP F 424 ? SER F 413 ASP F 424 1 ? 12 
HELX_P HELX_P117 117 ARG F 425 ? ALA F 430 ? ARG F 425 ALA F 430 1 ? 6  
HELX_P HELX_P118 118 GLY F 431 ? VAL F 433 ? GLY F 431 VAL F 433 5 ? 3  
HELX_P HELX_P119 119 THR F 435 ? THR F 456 ? THR F 435 THR F 456 1 ? 22 
HELX_P HELX_P120 120 HIS F 458 ? TYR F 466 ? HIS F 458 TYR F 466 1 ? 9  
HELX_P HELX_P121 121 SER G 1   ? HIS G 12  ? SER G 1   HIS G 12  1 ? 12 
HELX_P HELX_P122 122 HIS G 36  ? VAL G 38  ? HIS G 36  VAL G 38  5 ? 3  
HELX_P HELX_P123 123 ASN G 39  ? GLY G 46  ? ASN G 39  GLY G 46  1 ? 8  
HELX_P HELX_P124 124 ASP G 50  ? ILE G 54  ? ASP G 50  ILE G 54  5 ? 5  
HELX_P HELX_P125 125 ALA G 71  ? ALA G 74  ? ALA G 71  ALA G 74  5 ? 4  
HELX_P HELX_P126 126 ASP G 103 ? THR G 118 ? ASP G 103 THR G 118 1 ? 16 
HELX_P HELX_P127 127 GLY G 156 ? THR G 162 ? GLY G 156 THR G 162 5 ? 7  
HELX_P HELX_P128 128 ALA G 188 ? MET G 202 ? ALA G 188 MET G 202 1 ? 15 
HELX_P HELX_P129 129 MET G 228 ? PHE G 249 ? MET G 228 PHE G 249 1 ? 22 
HELX_P HELX_P130 130 LYS G 286 ? GLY G 289 ? LYS G 286 GLY G 289 5 ? 4  
HELX_P HELX_P131 131 SER G 291 ? HIS G 304 ? SER G 291 HIS G 304 1 ? 14 
HELX_P HELX_P132 132 HIS G 304 ? ASN G 313 ? HIS G 304 ASN G 313 1 ? 10 
HELX_P HELX_P133 133 THR G 316 ? ARG G 321 ? THR G 316 ARG G 321 5 ? 6  
HELX_P HELX_P134 134 SER G 350 ? ARG G 354 ? SER G 350 ARG G 354 5 ? 5  
HELX_P HELX_P135 135 ASN G 366 ? ASN G 384 ? ASN G 366 ASN G 384 1 ? 19 
HELX_P HELX_P136 136 SER G 413 ? ASP G 424 ? SER G 413 ASP G 424 1 ? 12 
HELX_P HELX_P137 137 ARG G 425 ? ALA G 430 ? ARG G 425 ALA G 430 1 ? 6  
HELX_P HELX_P138 138 GLY G 431 ? VAL G 433 ? GLY G 431 VAL G 433 5 ? 3  
HELX_P HELX_P139 139 THR G 435 ? THR G 456 ? THR G 435 THR G 456 1 ? 22 
HELX_P HELX_P140 140 HIS G 458 ? TYR G 466 ? HIS G 458 TYR G 466 1 ? 9  
HELX_P HELX_P141 141 SER H 1   ? HIS H 12  ? SER H 1   HIS H 12  1 ? 12 
HELX_P HELX_P142 142 HIS H 36  ? VAL H 38  ? HIS H 36  VAL H 38  5 ? 3  
HELX_P HELX_P143 143 ASN H 39  ? GLY H 46  ? ASN H 39  GLY H 46  1 ? 8  
HELX_P HELX_P144 144 ASP H 50  ? ILE H 54  ? ASP H 50  ILE H 54  5 ? 5  
HELX_P HELX_P145 145 ALA H 71  ? ALA H 74  ? ALA H 71  ALA H 74  5 ? 4  
HELX_P HELX_P146 146 ASP H 103 ? THR H 118 ? ASP H 103 THR H 118 1 ? 16 
HELX_P HELX_P147 147 GLY H 156 ? THR H 162 ? GLY H 156 THR H 162 5 ? 7  
HELX_P HELX_P148 148 ALA H 188 ? MET H 202 ? ALA H 188 MET H 202 1 ? 15 
HELX_P HELX_P149 149 MET H 228 ? PHE H 249 ? MET H 228 PHE H 249 1 ? 22 
HELX_P HELX_P150 150 LYS H 286 ? GLY H 289 ? LYS H 286 GLY H 289 5 ? 4  
HELX_P HELX_P151 151 SER H 291 ? HIS H 304 ? SER H 291 HIS H 304 1 ? 14 
HELX_P HELX_P152 152 HIS H 304 ? ASN H 313 ? HIS H 304 ASN H 313 1 ? 10 
HELX_P HELX_P153 153 THR H 316 ? ARG H 321 ? THR H 316 ARG H 321 5 ? 6  
HELX_P HELX_P154 154 SER H 350 ? ARG H 354 ? SER H 350 ARG H 354 5 ? 5  
HELX_P HELX_P155 155 ASN H 366 ? ASN H 384 ? ASN H 366 ASN H 384 1 ? 19 
HELX_P HELX_P156 156 SER H 413 ? ASP H 424 ? SER H 413 ASP H 424 1 ? 12 
HELX_P HELX_P157 157 ARG H 425 ? ALA H 430 ? ARG H 425 ALA H 430 1 ? 6  
HELX_P HELX_P158 158 GLY H 431 ? VAL H 433 ? GLY H 431 VAL H 433 5 ? 3  
HELX_P HELX_P159 159 THR H 435 ? THR H 456 ? THR H 435 THR H 456 1 ? 22 
HELX_P HELX_P160 160 HIS H 458 ? TYR H 466 ? HIS H 458 TYR H 466 1 ? 9  
HELX_P HELX_P161 161 SER I 1   ? HIS I 12  ? SER I 1   HIS I 12  1 ? 12 
HELX_P HELX_P162 162 HIS I 36  ? VAL I 38  ? HIS I 36  VAL I 38  5 ? 3  
HELX_P HELX_P163 163 ASN I 39  ? GLY I 46  ? ASN I 39  GLY I 46  1 ? 8  
HELX_P HELX_P164 164 ASP I 50  ? ILE I 54  ? ASP I 50  ILE I 54  5 ? 5  
HELX_P HELX_P165 165 ALA I 71  ? ALA I 74  ? ALA I 71  ALA I 74  5 ? 4  
HELX_P HELX_P166 166 ASP I 103 ? THR I 118 ? ASP I 103 THR I 118 1 ? 16 
HELX_P HELX_P167 167 GLY I 156 ? THR I 162 ? GLY I 156 THR I 162 5 ? 7  
HELX_P HELX_P168 168 ALA I 188 ? MET I 202 ? ALA I 188 MET I 202 1 ? 15 
HELX_P HELX_P169 169 MET I 228 ? PHE I 249 ? MET I 228 PHE I 249 1 ? 22 
HELX_P HELX_P170 170 LYS I 286 ? GLY I 289 ? LYS I 286 GLY I 289 5 ? 4  
HELX_P HELX_P171 171 SER I 291 ? HIS I 304 ? SER I 291 HIS I 304 1 ? 14 
HELX_P HELX_P172 172 HIS I 304 ? ASN I 313 ? HIS I 304 ASN I 313 1 ? 10 
HELX_P HELX_P173 173 THR I 316 ? ARG I 321 ? THR I 316 ARG I 321 5 ? 6  
HELX_P HELX_P174 174 SER I 350 ? ARG I 354 ? SER I 350 ARG I 354 5 ? 5  
HELX_P HELX_P175 175 ASN I 366 ? ASN I 384 ? ASN I 366 ASN I 384 1 ? 19 
HELX_P HELX_P176 176 SER I 413 ? ASP I 424 ? SER I 413 ASP I 424 1 ? 12 
HELX_P HELX_P177 177 ARG I 425 ? ALA I 430 ? ARG I 425 ALA I 430 1 ? 6  
HELX_P HELX_P178 178 GLY I 431 ? VAL I 433 ? GLY I 431 VAL I 433 5 ? 3  
HELX_P HELX_P179 179 THR I 435 ? THR I 456 ? THR I 435 THR I 456 1 ? 22 
HELX_P HELX_P180 180 HIS I 458 ? TYR I 466 ? HIS I 458 TYR I 466 1 ? 9  
HELX_P HELX_P181 181 SER J 1   ? HIS J 12  ? SER J 1   HIS J 12  1 ? 12 
HELX_P HELX_P182 182 HIS J 36  ? VAL J 38  ? HIS J 36  VAL J 38  5 ? 3  
HELX_P HELX_P183 183 ASN J 39  ? GLY J 46  ? ASN J 39  GLY J 46  1 ? 8  
HELX_P HELX_P184 184 ASP J 50  ? ILE J 54  ? ASP J 50  ILE J 54  5 ? 5  
HELX_P HELX_P185 185 ALA J 71  ? ALA J 74  ? ALA J 71  ALA J 74  5 ? 4  
HELX_P HELX_P186 186 ASP J 103 ? THR J 118 ? ASP J 103 THR J 118 1 ? 16 
HELX_P HELX_P187 187 GLY J 156 ? THR J 162 ? GLY J 156 THR J 162 5 ? 7  
HELX_P HELX_P188 188 ALA J 188 ? MET J 202 ? ALA J 188 MET J 202 1 ? 15 
HELX_P HELX_P189 189 MET J 228 ? PHE J 249 ? MET J 228 PHE J 249 1 ? 22 
HELX_P HELX_P190 190 LYS J 286 ? GLY J 289 ? LYS J 286 GLY J 289 5 ? 4  
HELX_P HELX_P191 191 SER J 291 ? HIS J 304 ? SER J 291 HIS J 304 1 ? 14 
HELX_P HELX_P192 192 HIS J 304 ? ASN J 313 ? HIS J 304 ASN J 313 1 ? 10 
HELX_P HELX_P193 193 THR J 316 ? ARG J 321 ? THR J 316 ARG J 321 5 ? 6  
HELX_P HELX_P194 194 SER J 350 ? ARG J 354 ? SER J 350 ARG J 354 5 ? 5  
HELX_P HELX_P195 195 ASN J 366 ? ASN J 384 ? ASN J 366 ASN J 384 1 ? 19 
HELX_P HELX_P196 196 SER J 413 ? ASP J 424 ? SER J 413 ASP J 424 1 ? 12 
HELX_P HELX_P197 197 ARG J 425 ? ALA J 430 ? ARG J 425 ALA J 430 1 ? 6  
HELX_P HELX_P198 198 GLY J 431 ? VAL J 433 ? GLY J 431 VAL J 433 5 ? 3  
HELX_P HELX_P199 199 THR J 435 ? THR J 456 ? THR J 435 THR J 456 1 ? 22 
HELX_P HELX_P200 200 HIS J 458 ? TYR J 466 ? HIS J 458 TYR J 466 1 ? 9  
HELX_P HELX_P201 201 SER K 1   ? HIS K 12  ? SER K 1   HIS K 12  1 ? 12 
HELX_P HELX_P202 202 HIS K 36  ? VAL K 38  ? HIS K 36  VAL K 38  5 ? 3  
HELX_P HELX_P203 203 ASN K 39  ? GLY K 46  ? ASN K 39  GLY K 46  1 ? 8  
HELX_P HELX_P204 204 ASP K 50  ? ILE K 54  ? ASP K 50  ILE K 54  5 ? 5  
HELX_P HELX_P205 205 ALA K 71  ? ALA K 74  ? ALA K 71  ALA K 74  5 ? 4  
HELX_P HELX_P206 206 ASP K 103 ? THR K 118 ? ASP K 103 THR K 118 1 ? 16 
HELX_P HELX_P207 207 GLY K 156 ? THR K 162 ? GLY K 156 THR K 162 5 ? 7  
HELX_P HELX_P208 208 ALA K 188 ? MET K 202 ? ALA K 188 MET K 202 1 ? 15 
HELX_P HELX_P209 209 MET K 228 ? PHE K 249 ? MET K 228 PHE K 249 1 ? 22 
HELX_P HELX_P210 210 LYS K 286 ? GLY K 289 ? LYS K 286 GLY K 289 5 ? 4  
HELX_P HELX_P211 211 SER K 291 ? HIS K 304 ? SER K 291 HIS K 304 1 ? 14 
HELX_P HELX_P212 212 HIS K 304 ? ASN K 313 ? HIS K 304 ASN K 313 1 ? 10 
HELX_P HELX_P213 213 THR K 316 ? ARG K 321 ? THR K 316 ARG K 321 5 ? 6  
HELX_P HELX_P214 214 SER K 350 ? ARG K 354 ? SER K 350 ARG K 354 5 ? 5  
HELX_P HELX_P215 215 ASN K 366 ? ASN K 384 ? ASN K 366 ASN K 384 1 ? 19 
HELX_P HELX_P216 216 SER K 413 ? ASP K 424 ? SER K 413 ASP K 424 1 ? 12 
HELX_P HELX_P217 217 ARG K 425 ? ALA K 430 ? ARG K 425 ALA K 430 1 ? 6  
HELX_P HELX_P218 218 GLY K 431 ? VAL K 433 ? GLY K 431 VAL K 433 5 ? 3  
HELX_P HELX_P219 219 THR K 435 ? THR K 456 ? THR K 435 THR K 456 1 ? 22 
HELX_P HELX_P220 220 HIS K 458 ? TYR K 466 ? HIS K 458 TYR K 466 1 ? 9  
HELX_P HELX_P221 221 SER L 1   ? HIS L 12  ? SER L 1   HIS L 12  1 ? 12 
HELX_P HELX_P222 222 HIS L 36  ? VAL L 38  ? HIS L 36  VAL L 38  5 ? 3  
HELX_P HELX_P223 223 ASN L 39  ? GLY L 46  ? ASN L 39  GLY L 46  1 ? 8  
HELX_P HELX_P224 224 ASP L 50  ? ILE L 54  ? ASP L 50  ILE L 54  5 ? 5  
HELX_P HELX_P225 225 ALA L 71  ? ALA L 74  ? ALA L 71  ALA L 74  5 ? 4  
HELX_P HELX_P226 226 ASP L 103 ? THR L 118 ? ASP L 103 THR L 118 1 ? 16 
HELX_P HELX_P227 227 GLY L 156 ? THR L 162 ? GLY L 156 THR L 162 5 ? 7  
HELX_P HELX_P228 228 ALA L 188 ? MET L 202 ? ALA L 188 MET L 202 1 ? 15 
HELX_P HELX_P229 229 MET L 228 ? PHE L 249 ? MET L 228 PHE L 249 1 ? 22 
HELX_P HELX_P230 230 LYS L 286 ? GLY L 289 ? LYS L 286 GLY L 289 5 ? 4  
HELX_P HELX_P231 231 SER L 291 ? HIS L 304 ? SER L 291 HIS L 304 1 ? 14 
HELX_P HELX_P232 232 HIS L 304 ? ASN L 313 ? HIS L 304 ASN L 313 1 ? 10 
HELX_P HELX_P233 233 THR L 316 ? ARG L 321 ? THR L 316 ARG L 321 5 ? 6  
HELX_P HELX_P234 234 SER L 350 ? ARG L 354 ? SER L 350 ARG L 354 5 ? 5  
HELX_P HELX_P235 235 ASN L 366 ? ASN L 384 ? ASN L 366 ASN L 384 1 ? 19 
HELX_P HELX_P236 236 SER L 413 ? ASP L 424 ? SER L 413 ASP L 424 1 ? 12 
HELX_P HELX_P237 237 ARG L 425 ? ALA L 430 ? ARG L 425 ALA L 430 1 ? 6  
HELX_P HELX_P238 238 GLY L 431 ? VAL L 433 ? GLY L 431 VAL L 433 5 ? 3  
HELX_P HELX_P239 239 THR L 435 ? THR L 456 ? THR L 435 THR L 456 1 ? 22 
HELX_P HELX_P240 240 HIS L 458 ? TYR L 466 ? HIS L 458 TYR L 466 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? M  MN . MN ? ? ? 1_555 GC HOH .   O   ? ? A MN 469 A HOH 1550 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc2   metalc ? ? M  MN . MN ? ? ? 1_555 A  GLU 131 OE1 ? ? A MN 469 A GLU 131  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc3   metalc ? ? M  MN . MN ? ? ? 1_555 GC HOH .   O   ? ? A MN 469 A HOH 1583 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc4   metalc ? ? M  MN . MN ? ? ? 1_555 A  GLU 220 OE1 ? ? A MN 469 A GLU 220  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc5   metalc ? ? M  MN . MN ? ? ? 1_555 A  GLU 212 OE2 ? ? A MN 469 A GLU 212  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc6   metalc ? ? N  MN . MN ? ? ? 1_555 A  HIS 269 ND1 ? ? A MN 470 A HIS 269  1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc7   metalc ? ? N  MN . MN ? ? ? 1_555 A  GLU 357 OE2 ? ? A MN 470 A GLU 357  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc8   metalc ? ? N  MN . MN ? ? ? 1_555 GC HOH .   O   ? ? A MN 470 A HOH 1582 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc9   metalc ? ? N  MN . MN ? ? ? 1_555 A  GLU 129 OE1 ? ? A MN 470 A GLU 129  1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc10  metalc ? ? N  MN . MN ? ? ? 1_555 A  GLU 129 OE2 ? ? A MN 470 A GLU 129  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc11  metalc ? ? P  TL . TL ? ? ? 1_555 B  ASP 50  OD1 ? ? A TL 473 B ASP 50   1_555 ? ? ? ? ? ? ? 3.228 ? 
metalc12  metalc ? ? P  TL . TL ? ? ? 1_555 B  SER 53  OG  ? ? A TL 473 B SER 53   1_555 ? ? ? ? ? ? ? 3.133 ? 
metalc13  metalc ? ? P  TL . TL ? ? ? 1_555 A  TYR 179 OH  ? ? A TL 473 A TYR 179  1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc14  metalc ? ? P  TL . TL ? ? ? 1_555 A  GLU 212 OE2 ? ? A TL 473 A GLU 212  1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc15  metalc ? ? P  TL . TL ? ? ? 1_555 A  GLU 212 OE1 ? ? A TL 473 A GLU 212  1_555 ? ? ? ? ? ? ? 3.132 ? 
metalc16  metalc ? ? Q  TL . TL ? ? ? 1_555 A  GLU 131 OE1 ? ? A TL 474 A GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc17  metalc ? ? Q  TL . TL ? ? ? 1_555 A  GLU 131 OE2 ? ? A TL 474 A GLU 131  1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc18  metalc ? ? Q  TL . TL ? ? ? 1_555 GC HOH .   O   ? ? A TL 474 A HOH 1554 1_555 ? ? ? ? ? ? ? 3.278 ? 
metalc19  metalc ? ? Q  TL . TL ? ? ? 1_555 GC HOH .   O   ? ? A TL 474 A HOH 1584 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc20  metalc ? ? Q  TL . TL ? ? ? 1_555 A  GLY 265 O   ? ? A TL 474 A GLY 265  1_555 ? ? ? ? ? ? ? 3.055 ? 
metalc21  metalc ? ? Q  TL . TL ? ? ? 1_555 A  ASN 264 OD1 ? ? A TL 474 A ASN 264  1_555 ? ? ? ? ? ? ? 3.045 ? 
metalc22  metalc ? ? S  MN . MN ? ? ? 1_555 B  GLU 220 OE1 ? ? B MN 469 B GLU 220  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc23  metalc ? ? S  MN . MN ? ? ? 1_555 HC HOH .   O   ? ? B MN 469 B HOH 1558 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc24  metalc ? ? S  MN . MN ? ? ? 1_555 HC HOH .   O   ? ? B MN 469 B HOH 1590 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc25  metalc ? ? S  MN . MN ? ? ? 1_555 B  GLU 131 OE1 ? ? B MN 469 B GLU 131  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc26  metalc ? ? S  MN . MN ? ? ? 1_555 B  GLU 212 OE2 ? ? B MN 469 B GLU 212  1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc27  metalc ? ? T  MN . MN ? ? ? 1_555 B  GLU 129 OE2 ? ? B MN 470 B GLU 129  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc28  metalc ? ? T  MN . MN ? ? ? 1_555 B  HIS 269 ND1 ? ? B MN 470 B HIS 269  1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc29  metalc ? ? T  MN . MN ? ? ? 1_555 B  GLU 357 OE2 ? ? B MN 470 B GLU 357  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc30  metalc ? ? T  MN . MN ? ? ? 1_555 B  GLU 129 OE1 ? ? B MN 470 B GLU 129  1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc31  metalc ? ? T  MN . MN ? ? ? 1_555 HC HOH .   O   ? ? B MN 470 B HOH 1589 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc32  metalc ? ? V  TL . TL ? ? ? 1_555 B  GLU 212 OE1 ? ? B TL 473 B GLU 212  1_555 ? ? ? ? ? ? ? 3.131 ? 
metalc33  metalc ? ? V  TL . TL ? ? ? 1_555 B  GLU 212 OE2 ? ? B TL 473 B GLU 212  1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc34  metalc ? ? V  TL . TL ? ? ? 1_555 C  ASP 50  OD1 ? ? B TL 473 C ASP 50   1_555 ? ? ? ? ? ? ? 3.221 ? 
metalc35  metalc ? ? V  TL . TL ? ? ? 1_555 B  TYR 179 OH  ? ? B TL 473 B TYR 179  1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc36  metalc ? ? V  TL . TL ? ? ? 1_555 C  SER 53  OG  ? ? B TL 473 C SER 53   1_555 ? ? ? ? ? ? ? 3.264 ? 
metalc37  metalc ? ? W  TL . TL ? ? ? 1_555 B  GLY 265 O   ? ? B TL 474 B GLY 265  1_555 ? ? ? ? ? ? ? 3.056 ? 
metalc38  metalc ? ? W  TL . TL ? ? ? 1_555 B  GLU 131 OE2 ? ? B TL 474 B GLU 131  1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc39  metalc ? ? W  TL . TL ? ? ? 1_555 HC HOH .   O   ? ? B TL 474 B HOH 1562 1_555 ? ? ? ? ? ? ? 3.279 ? 
metalc40  metalc ? ? W  TL . TL ? ? ? 1_555 HC HOH .   O   ? ? B TL 474 B HOH 1591 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc41  metalc ? ? W  TL . TL ? ? ? 1_555 B  GLU 131 OE1 ? ? B TL 474 B GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc42  metalc ? ? W  TL . TL ? ? ? 1_555 B  ASN 264 OD1 ? ? B TL 474 B ASN 264  1_555 ? ? ? ? ? ? ? 3.045 ? 
metalc43  metalc ? ? Y  MN . MN ? ? ? 1_555 C  GLU 212 OE2 ? ? C MN 469 C GLU 212  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc44  metalc ? ? Y  MN . MN ? ? ? 1_555 C  GLU 220 OE1 ? ? C MN 469 C GLU 220  1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc45  metalc ? ? Y  MN . MN ? ? ? 1_555 IC HOH .   O   ? ? C MN 469 C HOH 1560 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc46  metalc ? ? Y  MN . MN ? ? ? 1_555 JC HOH .   O   ? ? C MN 469 D HOH 1494 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc47  metalc ? ? Y  MN . MN ? ? ? 1_555 C  GLU 131 OE1 ? ? C MN 469 C GLU 131  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc48  metalc ? ? Z  MN . MN ? ? ? 1_555 C  GLU 129 OE1 ? ? C MN 470 C GLU 129  1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc49  metalc ? ? Z  MN . MN ? ? ? 1_555 C  GLU 129 OE2 ? ? C MN 470 C GLU 129  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc50  metalc ? ? Z  MN . MN ? ? ? 1_555 C  HIS 269 ND1 ? ? C MN 470 C HIS 269  1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc51  metalc ? ? Z  MN . MN ? ? ? 1_555 C  GLU 357 OE2 ? ? C MN 470 C GLU 357  1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc52  metalc ? ? Z  MN . MN ? ? ? 1_555 IC HOH .   O   ? ? C MN 470 C HOH 1590 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc53  metalc ? ? BA TL . TL ? ? ? 1_555 C  GLU 212 OE2 ? ? C TL 473 C GLU 212  1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc54  metalc ? ? BA TL . TL ? ? ? 1_555 C  GLU 212 OE1 ? ? C TL 473 C GLU 212  1_555 ? ? ? ? ? ? ? 3.132 ? 
metalc55  metalc ? ? BA TL . TL ? ? ? 1_555 C  TYR 179 OH  ? ? C TL 473 C TYR 179  1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc56  metalc ? ? BA TL . TL ? ? ? 1_555 D  ASP 50  OD1 ? ? C TL 473 D ASP 50   1_555 ? ? ? ? ? ? ? 3.096 ? 
metalc57  metalc ? ? BA TL . TL ? ? ? 1_555 D  SER 53  OG  ? ? C TL 473 D SER 53   1_555 ? ? ? ? ? ? ? 3.005 ? 
metalc58  metalc ? ? CA TL . TL ? ? ? 1_555 C  GLU 131 OE1 ? ? C TL 474 C GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc59  metalc ? ? CA TL . TL ? ? ? 1_555 C  GLU 131 OE2 ? ? C TL 474 C GLU 131  1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc60  metalc ? ? CA TL . TL ? ? ? 1_555 C  ASN 264 OD1 ? ? C TL 474 C ASN 264  1_555 ? ? ? ? ? ? ? 3.046 ? 
metalc61  metalc ? ? CA TL . TL ? ? ? 1_555 C  GLY 265 O   ? ? C TL 474 C GLY 265  1_555 ? ? ? ? ? ? ? 3.055 ? 
metalc62  metalc ? ? CA TL . TL ? ? ? 1_555 IC HOH .   O   ? ? C TL 474 C HOH 1563 1_555 ? ? ? ? ? ? ? 3.277 ? 
metalc63  metalc ? ? CA TL . TL ? ? ? 1_555 IC HOH .   O   ? ? C TL 474 C HOH 1591 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc64  metalc ? ? EA MN . MN ? ? ? 1_555 D  GLU 220 OE1 ? ? D MN 469 D GLU 220  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc65  metalc ? ? EA MN . MN ? ? ? 1_555 JC HOH .   O   ? ? D MN 469 D HOH 1595 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc66  metalc ? ? EA MN . MN ? ? ? 1_555 D  GLU 131 OE1 ? ? D MN 469 D GLU 131  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc67  metalc ? ? EA MN . MN ? ? ? 1_555 D  GLU 212 OE2 ? ? D MN 469 D GLU 212  1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc68  metalc ? ? EA MN . MN ? ? ? 1_555 JC HOH .   O   ? ? D MN 469 D HOH 1562 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc69  metalc ? ? FA MN . MN ? ? ? 1_555 D  GLU 129 OE1 ? ? D MN 470 D GLU 129  1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc70  metalc ? ? FA MN . MN ? ? ? 1_555 D  GLU 129 OE2 ? ? D MN 470 D GLU 129  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc71  metalc ? ? FA MN . MN ? ? ? 1_555 JC HOH .   O   ? ? D MN 470 D HOH 1594 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc72  metalc ? ? FA MN . MN ? ? ? 1_555 D  HIS 269 ND1 ? ? D MN 470 D HIS 269  1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc73  metalc ? ? FA MN . MN ? ? ? 1_555 D  GLU 357 OE2 ? ? D MN 470 D GLU 357  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc74  metalc ? ? HA TL . TL ? ? ? 1_555 E  SER 53  OG  ? ? D TL 473 E SER 53   1_555 ? ? ? ? ? ? ? 3.090 ? 
metalc75  metalc ? ? HA TL . TL ? ? ? 1_555 D  TYR 179 OH  ? ? D TL 473 D TYR 179  1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc76  metalc ? ? HA TL . TL ? ? ? 1_555 D  GLU 212 OE1 ? ? D TL 473 D GLU 212  1_555 ? ? ? ? ? ? ? 3.131 ? 
metalc77  metalc ? ? HA TL . TL ? ? ? 1_555 D  GLU 212 OE2 ? ? D TL 473 D GLU 212  1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc78  metalc ? ? HA TL . TL ? ? ? 1_555 E  ASP 50  OD1 ? ? D TL 473 E ASP 50   1_555 ? ? ? ? ? ? ? 3.077 ? 
metalc79  metalc ? ? IA TL . TL ? ? ? 1_555 D  GLU 131 OE1 ? ? D TL 474 D GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc80  metalc ? ? IA TL . TL ? ? ? 1_555 D  ASN 264 OD1 ? ? D TL 474 D ASN 264  1_555 ? ? ? ? ? ? ? 3.044 ? 
metalc81  metalc ? ? IA TL . TL ? ? ? 1_555 D  GLU 131 OE2 ? ? D TL 474 D GLU 131  1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc82  metalc ? ? IA TL . TL ? ? ? 1_555 D  GLY 265 O   ? ? D TL 474 D GLY 265  1_555 ? ? ? ? ? ? ? 3.056 ? 
metalc83  metalc ? ? IA TL . TL ? ? ? 1_555 JC HOH .   O   ? ? D TL 474 D HOH 1566 1_555 ? ? ? ? ? ? ? 3.279 ? 
metalc84  metalc ? ? IA TL . TL ? ? ? 1_555 JC HOH .   O   ? ? D TL 474 D HOH 1596 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc85  metalc ? ? KA MN . MN ? ? ? 1_555 KC HOH .   O   ? ? E MN 469 E HOH 1560 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc86  metalc ? ? KA MN . MN ? ? ? 1_555 KC HOH .   O   ? ? E MN 469 E HOH 1592 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc87  metalc ? ? KA MN . MN ? ? ? 1_555 E  GLU 131 OE1 ? ? E MN 469 E GLU 131  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc88  metalc ? ? KA MN . MN ? ? ? 1_555 E  GLU 212 OE2 ? ? E MN 469 E GLU 212  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc89  metalc ? ? KA MN . MN ? ? ? 1_555 E  GLU 220 OE1 ? ? E MN 469 E GLU 220  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc90  metalc ? ? LA MN . MN ? ? ? 1_555 E  GLU 129 OE1 ? ? E MN 470 E GLU 129  1_555 ? ? ? ? ? ? ? 2.545 ? 
metalc91  metalc ? ? LA MN . MN ? ? ? 1_555 E  HIS 269 ND1 ? ? E MN 470 E HIS 269  1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc92  metalc ? ? LA MN . MN ? ? ? 1_555 E  GLU 357 OE2 ? ? E MN 470 E GLU 357  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc93  metalc ? ? LA MN . MN ? ? ? 1_555 KC HOH .   O   ? ? E MN 470 E HOH 1591 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc94  metalc ? ? LA MN . MN ? ? ? 1_555 E  GLU 129 OE2 ? ? E MN 470 E GLU 129  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc95  metalc ? ? NA TL . TL ? ? ? 1_555 E  GLU 212 OE2 ? ? E TL 473 E GLU 212  1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc96  metalc ? ? NA TL . TL ? ? ? 1_555 E  TYR 179 OH  ? ? E TL 473 E TYR 179  1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc97  metalc ? ? NA TL . TL ? ? ? 1_555 F  SER 53  OG  ? ? E TL 473 F SER 53   1_555 ? ? ? ? ? ? ? 3.343 ? 
metalc98  metalc ? ? NA TL . TL ? ? ? 1_555 F  ASP 50  OD1 ? ? E TL 473 F ASP 50   1_555 ? ? ? ? ? ? ? 3.286 ? 
metalc99  metalc ? ? NA TL . TL ? ? ? 1_555 E  GLU 212 OE1 ? ? E TL 473 E GLU 212  1_555 ? ? ? ? ? ? ? 3.132 ? 
metalc100 metalc ? ? OA TL . TL ? ? ? 1_555 E  GLU 131 OE2 ? ? E TL 474 E GLU 131  1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc101 metalc ? ? OA TL . TL ? ? ? 1_555 E  GLY 265 O   ? ? E TL 474 E GLY 265  1_555 ? ? ? ? ? ? ? 3.055 ? 
metalc102 metalc ? ? OA TL . TL ? ? ? 1_555 E  ASN 264 OD1 ? ? E TL 474 E ASN 264  1_555 ? ? ? ? ? ? ? 3.045 ? 
metalc103 metalc ? ? OA TL . TL ? ? ? 1_555 E  GLU 131 OE1 ? ? E TL 474 E GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc104 metalc ? ? OA TL . TL ? ? ? 1_555 KC HOH .   O   ? ? E TL 474 E HOH 1564 1_555 ? ? ? ? ? ? ? 3.279 ? 
metalc105 metalc ? ? OA TL . TL ? ? ? 1_555 KC HOH .   O   ? ? E TL 474 E HOH 1593 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc106 metalc ? ? QA MN . MN ? ? ? 1_555 LC HOH .   O   ? ? F MN 469 F HOH 1565 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc107 metalc ? ? QA MN . MN ? ? ? 1_555 LC HOH .   O   ? ? F MN 469 F HOH 1597 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc108 metalc ? ? QA MN . MN ? ? ? 1_555 F  GLU 212 OE2 ? ? F MN 469 F GLU 212  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc109 metalc ? ? QA MN . MN ? ? ? 1_555 F  GLU 131 OE1 ? ? F MN 469 F GLU 131  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc110 metalc ? ? QA MN . MN ? ? ? 1_555 F  GLU 220 OE1 ? ? F MN 469 F GLU 220  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc111 metalc ? ? RA MN . MN ? ? ? 1_555 F  GLU 357 OE2 ? ? F MN 470 F GLU 357  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc112 metalc ? ? RA MN . MN ? ? ? 1_555 LC HOH .   O   ? ? F MN 470 F HOH 1596 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc113 metalc ? ? RA MN . MN ? ? ? 1_555 F  HIS 269 ND1 ? ? F MN 470 F HIS 269  1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc114 metalc ? ? RA MN . MN ? ? ? 1_555 F  GLU 129 OE1 ? ? F MN 470 F GLU 129  1_555 ? ? ? ? ? ? ? 2.545 ? 
metalc115 metalc ? ? RA MN . MN ? ? ? 1_555 F  GLU 129 OE2 ? ? F MN 470 F GLU 129  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc116 metalc ? ? TA TL . TL ? ? ? 1_555 F  GLU 212 OE1 ? ? F TL 473 F GLU 212  1_555 ? ? ? ? ? ? ? 3.131 ? 
metalc117 metalc ? ? TA TL . TL ? ? ? 1_555 A  SER 53  OG  ? ? F TL 473 A SER 53   1_555 ? ? ? ? ? ? ? 3.049 ? 
metalc118 metalc ? ? TA TL . TL ? ? ? 1_555 F  GLU 212 OE2 ? ? F TL 473 F GLU 212  1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc119 metalc ? ? TA TL . TL ? ? ? 1_555 A  ASP 50  OD1 ? ? F TL 473 A ASP 50   1_555 ? ? ? ? ? ? ? 3.033 ? 
metalc120 metalc ? ? TA TL . TL ? ? ? 1_555 F  TYR 179 OH  ? ? F TL 473 F TYR 179  1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc121 metalc ? ? UA TL . TL ? ? ? 1_555 F  GLU 131 OE1 ? ? F TL 474 F GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc122 metalc ? ? UA TL . TL ? ? ? 1_555 F  ASN 264 OD1 ? ? F TL 474 F ASN 264  1_555 ? ? ? ? ? ? ? 3.044 ? 
metalc123 metalc ? ? UA TL . TL ? ? ? 1_555 LC HOH .   O   ? ? F TL 474 F HOH 1598 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc124 metalc ? ? UA TL . TL ? ? ? 1_555 F  GLU 131 OE2 ? ? F TL 474 F GLU 131  1_555 ? ? ? ? ? ? ? 2.682 ? 
metalc125 metalc ? ? UA TL . TL ? ? ? 1_555 F  GLY 265 O   ? ? F TL 474 F GLY 265  1_555 ? ? ? ? ? ? ? 3.056 ? 
metalc126 metalc ? ? UA TL . TL ? ? ? 1_555 LC HOH .   O   ? ? F TL 474 F HOH 1568 1_555 ? ? ? ? ? ? ? 3.278 ? 
metalc127 metalc ? ? WA MN . MN ? ? ? 1_555 G  GLU 212 OE2 ? ? G MN 469 G GLU 212  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc128 metalc ? ? WA MN . MN ? ? ? 1_555 MC HOH .   O   ? ? G MN 469 G HOH 1565 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc129 metalc ? ? WA MN . MN ? ? ? 1_555 G  GLU 131 OE1 ? ? G MN 469 G GLU 131  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc130 metalc ? ? WA MN . MN ? ? ? 1_555 G  GLU 220 OE1 ? ? G MN 469 G GLU 220  1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc131 metalc ? ? WA MN . MN ? ? ? 1_555 MC HOH .   O   ? ? G MN 469 G HOH 1597 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc132 metalc ? ? XA MN . MN ? ? ? 1_555 G  GLU 357 OE2 ? ? G MN 470 G GLU 357  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc133 metalc ? ? XA MN . MN ? ? ? 1_555 MC HOH .   O   ? ? G MN 470 G HOH 1596 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc134 metalc ? ? XA MN . MN ? ? ? 1_555 G  GLU 129 OE1 ? ? G MN 470 G GLU 129  1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc135 metalc ? ? XA MN . MN ? ? ? 1_555 G  GLU 129 OE2 ? ? G MN 470 G GLU 129  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc136 metalc ? ? XA MN . MN ? ? ? 1_555 G  HIS 269 ND1 ? ? G MN 470 G HIS 269  1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc137 metalc ? ? ZA TL . TL ? ? ? 1_555 G  GLU 212 OE2 ? ? G TL 473 G GLU 212  1_555 ? ? ? ? ? ? ? 2.984 ? 
metalc138 metalc ? ? ZA TL . TL ? ? ? 1_555 L  SER 53  OG  ? ? G TL 473 L SER 53   1_555 ? ? ? ? ? ? ? 3.121 ? 
metalc139 metalc ? ? ZA TL . TL ? ? ? 1_555 G  GLU 212 OE1 ? ? G TL 473 G GLU 212  1_555 ? ? ? ? ? ? ? 3.132 ? 
metalc140 metalc ? ? ZA TL . TL ? ? ? 1_555 L  ASP 50  OD1 ? ? G TL 473 L ASP 50   1_555 ? ? ? ? ? ? ? 3.221 ? 
metalc141 metalc ? ? ZA TL . TL ? ? ? 1_555 G  TYR 179 OH  ? ? G TL 473 G TYR 179  1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc142 metalc ? ? AB TL . TL ? ? ? 1_555 MC HOH .   O   ? ? G TL 474 G HOH 1569 1_555 ? ? ? ? ? ? ? 3.278 ? 
metalc143 metalc ? ? AB TL . TL ? ? ? 1_555 MC HOH .   O   ? ? G TL 474 G HOH 1598 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc144 metalc ? ? AB TL . TL ? ? ? 1_555 G  ASN 264 OD1 ? ? G TL 474 G ASN 264  1_555 ? ? ? ? ? ? ? 3.045 ? 
metalc145 metalc ? ? AB TL . TL ? ? ? 1_555 G  GLY 265 O   ? ? G TL 474 G GLY 265  1_555 ? ? ? ? ? ? ? 3.055 ? 
metalc146 metalc ? ? AB TL . TL ? ? ? 1_555 G  GLU 131 OE1 ? ? G TL 474 G GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc147 metalc ? ? AB TL . TL ? ? ? 1_555 G  GLU 131 OE2 ? ? G TL 474 G GLU 131  1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc148 metalc ? ? CB MN . MN ? ? ? 1_555 NC HOH .   O   ? ? H MN 469 H HOH 1597 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc149 metalc ? ? CB MN . MN ? ? ? 1_555 NC HOH .   O   ? ? H MN 469 H HOH 1565 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc150 metalc ? ? CB MN . MN ? ? ? 1_555 H  GLU 212 OE2 ? ? H MN 469 H GLU 212  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc151 metalc ? ? CB MN . MN ? ? ? 1_555 H  GLU 131 OE1 ? ? H MN 469 H GLU 131  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc152 metalc ? ? CB MN . MN ? ? ? 1_555 H  GLU 220 OE1 ? ? H MN 469 H GLU 220  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc153 metalc ? ? DB MN . MN ? ? ? 1_555 H  GLU 129 OE2 ? ? H MN 470 H GLU 129  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc154 metalc ? ? DB MN . MN ? ? ? 1_555 H  HIS 269 ND1 ? ? H MN 470 H HIS 269  1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc155 metalc ? ? DB MN . MN ? ? ? 1_555 NC HOH .   O   ? ? H MN 470 H HOH 1596 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc156 metalc ? ? DB MN . MN ? ? ? 1_555 H  GLU 129 OE1 ? ? H MN 470 H GLU 129  1_555 ? ? ? ? ? ? ? 2.543 ? 
metalc157 metalc ? ? DB MN . MN ? ? ? 1_555 H  GLU 357 OE2 ? ? H MN 470 H GLU 357  1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc158 metalc ? ? FB TL . TL ? ? ? 1_555 H  TYR 179 OH  ? ? H TL 473 H TYR 179  1_555 ? ? ? ? ? ? ? 2.850 ? 
metalc159 metalc ? ? FB TL . TL ? ? ? 1_555 H  GLU 212 OE1 ? ? H TL 473 H GLU 212  1_555 ? ? ? ? ? ? ? 3.132 ? 
metalc160 metalc ? ? FB TL . TL ? ? ? 1_555 H  GLU 212 OE2 ? ? H TL 473 H GLU 212  1_555 ? ? ? ? ? ? ? 2.984 ? 
metalc161 metalc ? ? FB TL . TL ? ? ? 1_555 G  SER 53  OG  ? ? H TL 473 G SER 53   1_555 ? ? ? ? ? ? ? 3.073 ? 
metalc162 metalc ? ? FB TL . TL ? ? ? 1_555 G  ASP 50  OD1 ? ? H TL 473 G ASP 50   1_555 ? ? ? ? ? ? ? 3.136 ? 
metalc163 metalc ? ? GB TL . TL ? ? ? 1_555 H  GLU 131 OE2 ? ? H TL 474 H GLU 131  1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc164 metalc ? ? GB TL . TL ? ? ? 1_555 H  GLY 265 O   ? ? H TL 474 H GLY 265  1_555 ? ? ? ? ? ? ? 3.055 ? 
metalc165 metalc ? ? GB TL . TL ? ? ? 1_555 H  GLU 131 OE1 ? ? H TL 474 H GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc166 metalc ? ? GB TL . TL ? ? ? 1_555 NC HOH .   O   ? ? H TL 474 H HOH 1598 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc167 metalc ? ? GB TL . TL ? ? ? 1_555 H  ASN 264 OD1 ? ? H TL 474 H ASN 264  1_555 ? ? ? ? ? ? ? 3.045 ? 
metalc168 metalc ? ? GB TL . TL ? ? ? 1_555 NC HOH .   O   ? ? H TL 474 H HOH 1568 1_555 ? ? ? ? ? ? ? 3.278 ? 
metalc169 metalc ? ? IB MN . MN ? ? ? 1_555 OC HOH .   O   ? ? I MN 469 I HOH 1599 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc170 metalc ? ? IB MN . MN ? ? ? 1_555 OC HOH .   O   ? ? I MN 469 I HOH 1567 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc171 metalc ? ? IB MN . MN ? ? ? 1_555 I  GLU 220 OE1 ? ? I MN 469 I GLU 220  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc172 metalc ? ? IB MN . MN ? ? ? 1_555 I  GLU 212 OE2 ? ? I MN 469 I GLU 212  1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc173 metalc ? ? IB MN . MN ? ? ? 1_555 I  GLU 131 OE1 ? ? I MN 469 I GLU 131  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc174 metalc ? ? JB MN . MN ? ? ? 1_555 I  GLU 357 OE2 ? ? I MN 470 I GLU 357  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc175 metalc ? ? JB MN . MN ? ? ? 1_555 I  GLU 129 OE2 ? ? I MN 470 I GLU 129  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc176 metalc ? ? JB MN . MN ? ? ? 1_555 I  HIS 269 ND1 ? ? I MN 470 I HIS 269  1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc177 metalc ? ? JB MN . MN ? ? ? 1_555 I  GLU 129 OE1 ? ? I MN 470 I GLU 129  1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc178 metalc ? ? JB MN . MN ? ? ? 1_555 OC HOH .   O   ? ? I MN 470 I HOH 1598 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc179 metalc ? ? LB TL . TL ? ? ? 1_555 I  TYR 179 OH  ? ? I TL 473 I TYR 179  1_555 ? ? ? ? ? ? ? 2.852 ? 
metalc180 metalc ? ? LB TL . TL ? ? ? 1_555 H  SER 53  OG  ? ? I TL 473 H SER 53   1_555 ? ? ? ? ? ? ? 3.177 ? 
metalc181 metalc ? ? LB TL . TL ? ? ? 1_555 I  GLU 212 OE1 ? ? I TL 473 I GLU 212  1_555 ? ? ? ? ? ? ? 3.131 ? 
metalc182 metalc ? ? LB TL . TL ? ? ? 1_555 I  GLU 212 OE2 ? ? I TL 473 I GLU 212  1_555 ? ? ? ? ? ? ? 2.984 ? 
metalc183 metalc ? ? LB TL . TL ? ? ? 1_555 H  ASP 50  OD1 ? ? I TL 473 H ASP 50   1_555 ? ? ? ? ? ? ? 3.164 ? 
metalc184 metalc ? ? MB TL . TL ? ? ? 1_555 I  GLU 131 OE1 ? ? I TL 474 I GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc185 metalc ? ? MB TL . TL ? ? ? 1_555 I  GLU 131 OE2 ? ? I TL 474 I GLU 131  1_555 ? ? ? ? ? ? ? 2.682 ? 
metalc186 metalc ? ? MB TL . TL ? ? ? 1_555 OC HOH .   O   ? ? I TL 474 I HOH 1600 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc187 metalc ? ? MB TL . TL ? ? ? 1_555 OC HOH .   O   ? ? I TL 474 I HOH 1571 1_555 ? ? ? ? ? ? ? 3.278 ? 
metalc188 metalc ? ? MB TL . TL ? ? ? 1_555 I  ASN 264 OD1 ? ? I TL 474 I ASN 264  1_555 ? ? ? ? ? ? ? 3.045 ? 
metalc189 metalc ? ? MB TL . TL ? ? ? 1_555 I  GLY 265 O   ? ? I TL 474 I GLY 265  1_555 ? ? ? ? ? ? ? 3.056 ? 
metalc190 metalc ? ? OB MN . MN ? ? ? 1_555 PC HOH .   O   ? ? J MN 469 J HOH 1598 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc191 metalc ? ? OB MN . MN ? ? ? 1_555 PC HOH .   O   ? ? J MN 469 J HOH 1567 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc192 metalc ? ? OB MN . MN ? ? ? 1_555 J  GLU 220 OE1 ? ? J MN 469 J GLU 220  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc193 metalc ? ? OB MN . MN ? ? ? 1_555 J  GLU 212 OE2 ? ? J MN 469 J GLU 212  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc194 metalc ? ? OB MN . MN ? ? ? 1_555 J  GLU 131 OE1 ? ? J MN 469 J GLU 131  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc195 metalc ? ? PB MN . MN ? ? ? 1_555 J  GLU 129 OE1 ? ? J MN 470 J GLU 129  1_555 ? ? ? ? ? ? ? 2.545 ? 
metalc196 metalc ? ? PB MN . MN ? ? ? 1_555 PC HOH .   O   ? ? J MN 470 J HOH 1597 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc197 metalc ? ? PB MN . MN ? ? ? 1_555 J  GLU 357 OE2 ? ? J MN 470 J GLU 357  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc198 metalc ? ? PB MN . MN ? ? ? 1_555 J  HIS 269 ND1 ? ? J MN 470 J HIS 269  1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc199 metalc ? ? PB MN . MN ? ? ? 1_555 J  GLU 129 OE2 ? ? J MN 470 J GLU 129  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc200 metalc ? ? RB TL . TL ? ? ? 1_555 J  GLU 212 OE2 ? ? J TL 473 J GLU 212  1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc201 metalc ? ? RB TL . TL ? ? ? 1_555 I  SER 53  OG  ? ? J TL 473 I SER 53   1_555 ? ? ? ? ? ? ? 3.052 ? 
metalc202 metalc ? ? RB TL . TL ? ? ? 1_555 I  ASP 50  OD1 ? ? J TL 473 I ASP 50   1_555 ? ? ? ? ? ? ? 3.200 ? 
metalc203 metalc ? ? RB TL . TL ? ? ? 1_555 J  TYR 179 OH  ? ? J TL 473 J TYR 179  1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc204 metalc ? ? RB TL . TL ? ? ? 1_555 J  GLU 212 OE1 ? ? J TL 473 J GLU 212  1_555 ? ? ? ? ? ? ? 3.131 ? 
metalc205 metalc ? ? SB TL . TL ? ? ? 1_555 J  ASN 264 OD1 ? ? J TL 474 J ASN 264  1_555 ? ? ? ? ? ? ? 3.044 ? 
metalc206 metalc ? ? SB TL . TL ? ? ? 1_555 J  GLY 265 O   ? ? J TL 474 J GLY 265  1_555 ? ? ? ? ? ? ? 3.055 ? 
metalc207 metalc ? ? SB TL . TL ? ? ? 1_555 PC HOH .   O   ? ? J TL 474 J HOH 1570 1_555 ? ? ? ? ? ? ? 3.278 ? 
metalc208 metalc ? ? SB TL . TL ? ? ? 1_555 PC HOH .   O   ? ? J TL 474 J HOH 1599 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc209 metalc ? ? SB TL . TL ? ? ? 1_555 J  GLU 131 OE1 ? ? J TL 474 J GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc210 metalc ? ? SB TL . TL ? ? ? 1_555 J  GLU 131 OE2 ? ? J TL 474 J GLU 131  1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc211 metalc ? ? UB MN . MN ? ? ? 1_555 K  GLU 212 OE2 ? ? K MN 469 K GLU 212  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc212 metalc ? ? UB MN . MN ? ? ? 1_555 QC HOH .   O   ? ? K MN 469 K HOH 1602 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc213 metalc ? ? UB MN . MN ? ? ? 1_555 QC HOH .   O   ? ? K MN 469 K HOH 1570 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc214 metalc ? ? UB MN . MN ? ? ? 1_555 K  GLU 220 OE1 ? ? K MN 469 K GLU 220  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc215 metalc ? ? UB MN . MN ? ? ? 1_555 K  GLU 131 OE1 ? ? K MN 469 K GLU 131  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc216 metalc ? ? VB MN . MN ? ? ? 1_555 QC HOH .   O   ? ? K MN 470 K HOH 1601 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc217 metalc ? ? VB MN . MN ? ? ? 1_555 K  GLU 357 OE2 ? ? K MN 470 K GLU 357  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc218 metalc ? ? VB MN . MN ? ? ? 1_555 K  HIS 269 ND1 ? ? K MN 470 K HIS 269  1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc219 metalc ? ? VB MN . MN ? ? ? 1_555 K  GLU 129 OE1 ? ? K MN 470 K GLU 129  1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc220 metalc ? ? VB MN . MN ? ? ? 1_555 K  GLU 129 OE2 ? ? K MN 470 K GLU 129  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc221 metalc ? ? XB TL . TL ? ? ? 1_555 K  GLU 212 OE2 ? ? K TL 473 K GLU 212  1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc222 metalc ? ? XB TL . TL ? ? ? 1_555 J  ASP 50  OD1 ? ? K TL 473 J ASP 50   1_555 ? ? ? ? ? ? ? 3.165 ? 
metalc223 metalc ? ? XB TL . TL ? ? ? 1_555 J  SER 53  OG  ? ? K TL 473 J SER 53   1_555 ? ? ? ? ? ? ? 3.156 ? 
metalc224 metalc ? ? XB TL . TL ? ? ? 1_555 K  TYR 179 OH  ? ? K TL 473 K TYR 179  1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc225 metalc ? ? XB TL . TL ? ? ? 1_555 K  GLU 212 OE1 ? ? K TL 473 K GLU 212  1_555 ? ? ? ? ? ? ? 3.132 ? 
metalc226 metalc ? ? YB TL . TL ? ? ? 1_555 K  GLY 265 O   ? ? K TL 474 K GLY 265  1_555 ? ? ? ? ? ? ? 3.056 ? 
metalc227 metalc ? ? YB TL . TL ? ? ? 1_555 QC HOH .   O   ? ? K TL 474 K HOH 1574 1_555 ? ? ? ? ? ? ? 3.279 ? 
metalc228 metalc ? ? YB TL . TL ? ? ? 1_555 QC HOH .   O   ? ? K TL 474 K HOH 1603 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc229 metalc ? ? YB TL . TL ? ? ? 1_555 K  GLU 131 OE1 ? ? K TL 474 K GLU 131  1_555 ? ? ? ? ? ? ? 3.401 ? 
metalc230 metalc ? ? YB TL . TL ? ? ? 1_555 K  ASN 264 OD1 ? ? K TL 474 K ASN 264  1_555 ? ? ? ? ? ? ? 3.045 ? 
metalc231 metalc ? ? YB TL . TL ? ? ? 1_555 K  GLU 131 OE2 ? ? K TL 474 K GLU 131  1_555 ? ? ? ? ? ? ? 2.682 ? 
metalc232 metalc ? ? AC MN . MN ? ? ? 1_555 L  GLU 212 OE2 ? ? L MN 469 L GLU 212  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc233 metalc ? ? AC MN . MN ? ? ? 1_555 RC HOH .   O   ? ? L MN 469 L HOH 1445 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc234 metalc ? ? AC MN . MN ? ? ? 1_555 L  GLU 220 OE1 ? ? L MN 469 L GLU 220  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc235 metalc ? ? AC MN . MN ? ? ? 1_555 L  GLU 131 OE1 ? ? L MN 469 L GLU 131  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc236 metalc ? ? AC MN . MN ? ? ? 1_555 RC HOH .   O   ? ? L MN 469 L HOH 1406 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc237 metalc ? ? BC MN . MN ? ? ? 1_555 L  HIS 269 ND1 ? ? L MN 470 L HIS 269  1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc238 metalc ? ? BC MN . MN ? ? ? 1_555 L  GLU 129 OE2 ? ? L MN 470 L GLU 129  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc239 metalc ? ? BC MN . MN ? ? ? 1_555 L  GLU 129 OE1 ? ? L MN 470 L GLU 129  1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc240 metalc ? ? BC MN . MN ? ? ? 1_555 RC HOH .   O   ? ? L MN 470 L HOH 1444 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc241 metalc ? ? BC MN . MN ? ? ? 1_555 L  GLU 357 OE2 ? ? L MN 470 L GLU 357  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc242 metalc ? ? DC TL . TL ? ? ? 1_555 K  ASP 50  OD1 ? ? L TL 473 K ASP 50   1_555 ? ? ? ? ? ? ? 3.069 ? 
metalc243 metalc ? ? DC TL . TL ? ? ? 1_555 L  TYR 179 OH  ? ? L TL 473 L TYR 179  1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc244 metalc ? ? DC TL . TL ? ? ? 1_555 L  GLU 212 OE1 ? ? L TL 473 L GLU 212  1_555 ? ? ? ? ? ? ? 3.132 ? 
metalc245 metalc ? ? DC TL . TL ? ? ? 1_555 L  GLU 212 OE2 ? ? L TL 473 L GLU 212  1_555 ? ? ? ? ? ? ? 2.984 ? 
metalc246 metalc ? ? DC TL . TL ? ? ? 1_555 K  SER 53  OG  ? ? L TL 473 K SER 53   1_555 ? ? ? ? ? ? ? 3.145 ? 
metalc247 metalc ? ? EC TL . TL ? ? ? 1_555 RC HOH .   O   ? ? L TL 474 L HOH 1411 1_555 ? ? ? ? ? ? ? 3.278 ? 
metalc248 metalc ? ? EC TL . TL ? ? ? 1_555 L  GLY 265 O   ? ? L TL 474 L GLY 265  1_555 ? ? ? ? ? ? ? 3.055 ? 
metalc249 metalc ? ? EC TL . TL ? ? ? 1_555 L  GLU 131 OE1 ? ? L TL 474 L GLU 131  1_555 ? ? ? ? ? ? ? 3.402 ? 
metalc250 metalc ? ? EC TL . TL ? ? ? 1_555 L  GLU 131 OE2 ? ? L TL 474 L GLU 131  1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc251 metalc ? ? EC TL . TL ? ? ? 1_555 L  ASN 264 OD1 ? ? L TL 474 L ASN 264  1_555 ? ? ? ? ? ? ? 3.046 ? 
metalc252 metalc ? ? EC TL . TL ? ? ? 1_555 RC HOH .   O   ? ? L TL 474 L HOH 1446 1_555 ? ? ? ? ? ? ? 2.862 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PRO 183 A . ? PRO 183 A PRO 184 A ? PRO 184 A 1 0.75 
2  PRO 183 B . ? PRO 183 B PRO 184 B ? PRO 184 B 1 0.74 
3  PRO 183 C . ? PRO 183 C PRO 184 C ? PRO 184 C 1 0.77 
4  PRO 183 D . ? PRO 183 D PRO 184 D ? PRO 184 D 1 0.71 
5  PRO 183 E . ? PRO 183 E PRO 184 E ? PRO 184 E 1 0.76 
6  PRO 183 F . ? PRO 183 F PRO 184 F ? PRO 184 F 1 0.74 
7  PRO 183 G . ? PRO 183 G PRO 184 G ? PRO 184 G 1 0.71 
8  PRO 183 H . ? PRO 183 H PRO 184 H ? PRO 184 H 1 0.74 
9  PRO 183 I . ? PRO 183 I PRO 184 I ? PRO 184 I 1 0.76 
10 PRO 183 J . ? PRO 183 J PRO 184 J ? PRO 184 J 1 0.77 
11 PRO 183 K . ? PRO 183 K PRO 184 K ? PRO 184 K 1 0.82 
12 PRO 183 L . ? PRO 183 L PRO 184 L ? PRO 184 L 1 0.82 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 7  ? 
B  ? 14 ? 
C  ? 4  ? 
D  ? 7  ? 
E  ? 14 ? 
F  ? 4  ? 
G  ? 7  ? 
H  ? 13 ? 
I  ? 4  ? 
J  ? 7  ? 
K  ? 13 ? 
L  ? 4  ? 
M  ? 7  ? 
N  ? 13 ? 
O  ? 4  ? 
P  ? 7  ? 
Q  ? 13 ? 
R  ? 4  ? 
S  ? 7  ? 
T  ? 13 ? 
U  ? 7  ? 
V  ? 13 ? 
W  ? 7  ? 
X  ? 13 ? 
Y  ? 7  ? 
Z  ? 13 ? 
AA ? 7  ? 
BB ? 13 ? 
CC ? 7  ? 
DD ? 13 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1  2  ? anti-parallel 
A  2  3  ? parallel      
A  3  4  ? anti-parallel 
A  4  5  ? anti-parallel 
A  5  6  ? anti-parallel 
A  6  7  ? anti-parallel 
B  1  2  ? anti-parallel 
B  2  3  ? anti-parallel 
B  3  4  ? anti-parallel 
B  4  5  ? anti-parallel 
B  5  6  ? anti-parallel 
B  6  7  ? anti-parallel 
B  7  8  ? anti-parallel 
B  8  9  ? anti-parallel 
B  9  10 ? anti-parallel 
B  10 11 ? anti-parallel 
B  11 12 ? anti-parallel 
B  12 13 ? anti-parallel 
B  13 14 ? parallel      
C  1  2  ? anti-parallel 
C  2  3  ? anti-parallel 
C  3  4  ? anti-parallel 
D  1  2  ? anti-parallel 
D  2  3  ? parallel      
D  3  4  ? anti-parallel 
D  4  5  ? anti-parallel 
D  5  6  ? anti-parallel 
D  6  7  ? anti-parallel 
E  1  2  ? parallel      
E  2  3  ? anti-parallel 
E  3  4  ? anti-parallel 
E  4  5  ? anti-parallel 
E  5  6  ? anti-parallel 
E  6  7  ? anti-parallel 
E  7  8  ? anti-parallel 
E  8  9  ? anti-parallel 
E  9  10 ? anti-parallel 
E  10 11 ? anti-parallel 
E  11 12 ? anti-parallel 
E  12 13 ? anti-parallel 
E  13 14 ? anti-parallel 
F  1  2  ? anti-parallel 
F  2  3  ? anti-parallel 
F  3  4  ? anti-parallel 
G  1  2  ? anti-parallel 
G  2  3  ? parallel      
G  3  4  ? anti-parallel 
G  4  5  ? anti-parallel 
G  5  6  ? anti-parallel 
G  6  7  ? anti-parallel 
H  1  2  ? anti-parallel 
H  2  3  ? anti-parallel 
H  3  4  ? anti-parallel 
H  4  5  ? anti-parallel 
H  5  6  ? anti-parallel 
H  6  7  ? anti-parallel 
H  7  8  ? anti-parallel 
H  8  9  ? anti-parallel 
H  9  10 ? anti-parallel 
H  10 11 ? anti-parallel 
H  11 12 ? anti-parallel 
H  12 13 ? parallel      
I  1  2  ? anti-parallel 
I  2  3  ? anti-parallel 
I  3  4  ? anti-parallel 
J  1  2  ? anti-parallel 
J  2  3  ? parallel      
J  3  4  ? anti-parallel 
J  4  5  ? anti-parallel 
J  5  6  ? anti-parallel 
J  6  7  ? anti-parallel 
K  1  2  ? anti-parallel 
K  2  3  ? anti-parallel 
K  3  4  ? anti-parallel 
K  4  5  ? anti-parallel 
K  5  6  ? anti-parallel 
K  6  7  ? anti-parallel 
K  7  8  ? anti-parallel 
K  8  9  ? anti-parallel 
K  9  10 ? anti-parallel 
K  10 11 ? anti-parallel 
K  11 12 ? anti-parallel 
K  12 13 ? parallel      
L  1  2  ? anti-parallel 
L  2  3  ? anti-parallel 
L  3  4  ? anti-parallel 
M  1  2  ? anti-parallel 
M  2  3  ? parallel      
M  3  4  ? anti-parallel 
M  4  5  ? anti-parallel 
M  5  6  ? anti-parallel 
M  6  7  ? anti-parallel 
N  1  2  ? anti-parallel 
N  2  3  ? anti-parallel 
N  3  4  ? anti-parallel 
N  4  5  ? anti-parallel 
N  5  6  ? anti-parallel 
N  6  7  ? anti-parallel 
N  7  8  ? anti-parallel 
N  8  9  ? anti-parallel 
N  9  10 ? anti-parallel 
N  10 11 ? anti-parallel 
N  11 12 ? anti-parallel 
N  12 13 ? parallel      
O  1  2  ? anti-parallel 
O  2  3  ? anti-parallel 
O  3  4  ? anti-parallel 
P  1  2  ? anti-parallel 
P  2  3  ? parallel      
P  3  4  ? anti-parallel 
P  4  5  ? anti-parallel 
P  5  6  ? anti-parallel 
P  6  7  ? anti-parallel 
Q  1  2  ? anti-parallel 
Q  2  3  ? anti-parallel 
Q  3  4  ? anti-parallel 
Q  4  5  ? anti-parallel 
Q  5  6  ? anti-parallel 
Q  6  7  ? anti-parallel 
Q  7  8  ? anti-parallel 
Q  8  9  ? anti-parallel 
Q  9  10 ? anti-parallel 
Q  10 11 ? anti-parallel 
Q  11 12 ? anti-parallel 
Q  12 13 ? parallel      
R  1  2  ? anti-parallel 
R  2  3  ? anti-parallel 
R  3  4  ? anti-parallel 
S  1  2  ? anti-parallel 
S  2  3  ? parallel      
S  3  4  ? anti-parallel 
S  4  5  ? anti-parallel 
S  5  6  ? anti-parallel 
S  6  7  ? anti-parallel 
T  1  2  ? anti-parallel 
T  2  3  ? anti-parallel 
T  3  4  ? anti-parallel 
T  4  5  ? anti-parallel 
T  5  6  ? anti-parallel 
T  6  7  ? anti-parallel 
T  7  8  ? anti-parallel 
T  8  9  ? anti-parallel 
T  9  10 ? anti-parallel 
T  10 11 ? anti-parallel 
T  11 12 ? anti-parallel 
T  12 13 ? parallel      
U  1  2  ? anti-parallel 
U  2  3  ? parallel      
U  3  4  ? anti-parallel 
U  4  5  ? anti-parallel 
U  5  6  ? anti-parallel 
U  6  7  ? anti-parallel 
V  1  2  ? anti-parallel 
V  2  3  ? anti-parallel 
V  3  4  ? anti-parallel 
V  4  5  ? anti-parallel 
V  5  6  ? anti-parallel 
V  6  7  ? anti-parallel 
V  7  8  ? anti-parallel 
V  8  9  ? anti-parallel 
V  9  10 ? anti-parallel 
V  10 11 ? anti-parallel 
V  11 12 ? anti-parallel 
V  12 13 ? parallel      
W  1  2  ? anti-parallel 
W  2  3  ? parallel      
W  3  4  ? anti-parallel 
W  4  5  ? anti-parallel 
W  5  6  ? anti-parallel 
W  6  7  ? anti-parallel 
X  1  2  ? anti-parallel 
X  2  3  ? anti-parallel 
X  3  4  ? anti-parallel 
X  4  5  ? anti-parallel 
X  5  6  ? anti-parallel 
X  6  7  ? anti-parallel 
X  7  8  ? anti-parallel 
X  8  9  ? anti-parallel 
X  9  10 ? anti-parallel 
X  10 11 ? anti-parallel 
X  11 12 ? anti-parallel 
X  12 13 ? parallel      
Y  1  2  ? anti-parallel 
Y  2  3  ? parallel      
Y  3  4  ? anti-parallel 
Y  4  5  ? anti-parallel 
Y  5  6  ? anti-parallel 
Y  6  7  ? anti-parallel 
Z  1  2  ? anti-parallel 
Z  2  3  ? anti-parallel 
Z  3  4  ? anti-parallel 
Z  4  5  ? anti-parallel 
Z  5  6  ? anti-parallel 
Z  6  7  ? anti-parallel 
Z  7  8  ? anti-parallel 
Z  8  9  ? anti-parallel 
Z  9  10 ? anti-parallel 
Z  10 11 ? anti-parallel 
Z  11 12 ? anti-parallel 
Z  12 13 ? parallel      
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AA 3  4  ? anti-parallel 
AA 4  5  ? anti-parallel 
AA 5  6  ? anti-parallel 
AA 6  7  ? anti-parallel 
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? anti-parallel 
BB 5  6  ? anti-parallel 
BB 6  7  ? anti-parallel 
BB 7  8  ? anti-parallel 
BB 8  9  ? anti-parallel 
BB 9  10 ? anti-parallel 
BB 10 11 ? anti-parallel 
BB 11 12 ? anti-parallel 
BB 12 13 ? parallel      
CC 1  2  ? anti-parallel 
CC 2  3  ? parallel      
CC 3  4  ? anti-parallel 
CC 4  5  ? anti-parallel 
CC 5  6  ? anti-parallel 
CC 6  7  ? anti-parallel 
DD 1  2  ? anti-parallel 
DD 2  3  ? anti-parallel 
DD 3  4  ? anti-parallel 
DD 4  5  ? anti-parallel 
DD 5  6  ? anti-parallel 
DD 6  7  ? anti-parallel 
DD 7  8  ? anti-parallel 
DD 8  9  ? anti-parallel 
DD 9  10 ? anti-parallel 
DD 10 11 ? anti-parallel 
DD 11 12 ? anti-parallel 
DD 12 13 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1  GLU A 28  ? PRO A 34  ? GLU A 28  PRO A 34  
A  2  PHE A 16  ? THR A 22  ? PHE A 16  THR A 22  
A  3  THR A 84  ? LEU A 92  ? THR A 84  LEU A 92  
A  4  VAL A 75  ? ILE A 76  ? VAL A 75  ILE A 76  
A  5  THR A 84  ? LEU A 92  ? THR A 84  LEU A 92  
A  6  VAL A 66  ? PRO A 69  ? VAL A 66  PRO A 69  
A  7  LYS A 47  ? MET A 48  ? LYS A 47  MET A 48  
B  1  ASN A 226 ? THR A 227 ? ASN A 226 THR A 227 
B  2  THR A 123 ? PHE A 135 ? THR A 123 PHE A 135 
B  3  THR A 252 ? THR A 254 ? THR A 252 THR A 254 
B  4  THR A 123 ? PHE A 135 ? THR A 123 PHE A 135 
B  5  GLN A 218 ? THR A 223 ? GLN A 218 THR A 223 
B  6  VAL A 206 ? HIS A 211 ? VAL A 206 HIS A 211 
B  7  GLN A 218 ? THR A 223 ? GLN A 218 THR A 223 
B  8  THR A 123 ? PHE A 135 ? THR A 123 PHE A 135 
B  9  MET A 268 ? LYS A 276 ? MET A 268 LYS A 276 
B  10 THR A 279 ? ASN A 280 ? THR A 279 ASN A 280 
B  11 MET A 268 ? LYS A 276 ? MET A 268 LYS A 276 
B  12 ILE A 356 ? VAL A 358 ? ILE A 356 VAL A 358 
B  13 ALA A 341 ? ARG A 344 ? ALA A 341 ARG A 344 
B  14 MET A 331 ? SER A 335 ? MET A 331 SER A 335 
C  1  ASP A 137 ? SER A 143 ? ASP A 137 SER A 143 
C  2  GLY A 146 ? ASP A 152 ? GLY A 146 ASP A 152 
C  3  GLY G 146 ? ASP G 152 ? GLY G 146 ASP G 152 
C  4  ASP G 137 ? SER G 143 ? ASP G 137 SER G 143 
D  1  GLU B 28  ? PRO B 34  ? GLU B 28  PRO B 34  
D  2  PHE B 16  ? THR B 22  ? PHE B 16  THR B 22  
D  3  THR B 84  ? LEU B 92  ? THR B 84  LEU B 92  
D  4  VAL B 75  ? ILE B 76  ? VAL B 75  ILE B 76  
D  5  THR B 84  ? LEU B 92  ? THR B 84  LEU B 92  
D  6  VAL B 66  ? PRO B 69  ? VAL B 66  PRO B 69  
D  7  LYS B 47  ? MET B 48  ? LYS B 47  MET B 48  
E  1  MET B 331 ? SER B 335 ? MET B 331 SER B 335 
E  2  ALA B 341 ? ARG B 344 ? ALA B 341 ARG B 344 
E  3  ILE B 356 ? VAL B 358 ? ILE B 356 VAL B 358 
E  4  MET B 268 ? LYS B 276 ? MET B 268 LYS B 276 
E  5  THR B 279 ? ASN B 280 ? THR B 279 ASN B 280 
E  6  MET B 268 ? LYS B 276 ? MET B 268 LYS B 276 
E  7  THR B 123 ? PHE B 135 ? THR B 123 PHE B 135 
E  8  GLN B 218 ? THR B 223 ? GLN B 218 THR B 223 
E  9  VAL B 206 ? HIS B 211 ? VAL B 206 HIS B 211 
E  10 GLN B 218 ? THR B 223 ? GLN B 218 THR B 223 
E  11 THR B 123 ? PHE B 135 ? THR B 123 PHE B 135 
E  12 ASN B 226 ? THR B 227 ? ASN B 226 THR B 227 
E  13 THR B 123 ? PHE B 135 ? THR B 123 PHE B 135 
E  14 THR B 252 ? THR B 254 ? THR B 252 THR B 254 
F  1  ASP B 137 ? SER B 143 ? ASP B 137 SER B 143 
F  2  GLY B 146 ? ASP B 152 ? GLY B 146 ASP B 152 
F  3  GLY H 146 ? ASP H 152 ? GLY H 146 ASP H 152 
F  4  ASP H 137 ? SER H 143 ? ASP H 137 SER H 143 
G  1  GLU C 28  ? PRO C 34  ? GLU C 28  PRO C 34  
G  2  PHE C 16  ? THR C 22  ? PHE C 16  THR C 22  
G  3  THR C 84  ? LEU C 92  ? THR C 84  LEU C 92  
G  4  VAL C 75  ? ILE C 76  ? VAL C 75  ILE C 76  
G  5  THR C 84  ? LEU C 92  ? THR C 84  LEU C 92  
G  6  VAL C 66  ? PRO C 69  ? VAL C 66  PRO C 69  
G  7  LYS C 47  ? MET C 48  ? LYS C 47  MET C 48  
H  1  VAL C 206 ? HIS C 211 ? VAL C 206 HIS C 211 
H  2  GLN C 218 ? THR C 223 ? GLN C 218 THR C 223 
H  3  THR C 123 ? PHE C 135 ? THR C 123 PHE C 135 
H  4  ASN C 226 ? THR C 227 ? ASN C 226 THR C 227 
H  5  THR C 123 ? PHE C 135 ? THR C 123 PHE C 135 
H  6  THR C 252 ? THR C 254 ? THR C 252 THR C 254 
H  7  THR C 123 ? PHE C 135 ? THR C 123 PHE C 135 
H  8  MET C 268 ? LYS C 276 ? MET C 268 LYS C 276 
H  9  THR C 279 ? ASN C 280 ? THR C 279 ASN C 280 
H  10 MET C 268 ? LYS C 276 ? MET C 268 LYS C 276 
H  11 ILE C 356 ? VAL C 358 ? ILE C 356 VAL C 358 
H  12 ALA C 341 ? ARG C 344 ? ALA C 341 ARG C 344 
H  13 MET C 331 ? SER C 335 ? MET C 331 SER C 335 
I  1  ASP C 137 ? SER C 143 ? ASP C 137 SER C 143 
I  2  GLY C 146 ? ASP C 152 ? GLY C 146 ASP C 152 
I  3  GLY I 146 ? ASP I 152 ? GLY I 146 ASP I 152 
I  4  ASP I 137 ? SER I 143 ? ASP I 137 SER I 143 
J  1  GLU D 28  ? PRO D 34  ? GLU D 28  PRO D 34  
J  2  PHE D 16  ? THR D 22  ? PHE D 16  THR D 22  
J  3  THR D 84  ? LEU D 92  ? THR D 84  LEU D 92  
J  4  VAL D 75  ? ILE D 76  ? VAL D 75  ILE D 76  
J  5  THR D 84  ? LEU D 92  ? THR D 84  LEU D 92  
J  6  VAL D 66  ? PRO D 69  ? VAL D 66  PRO D 69  
J  7  LYS D 47  ? MET D 48  ? LYS D 47  MET D 48  
K  1  VAL D 206 ? HIS D 211 ? VAL D 206 HIS D 211 
K  2  GLN D 218 ? THR D 223 ? GLN D 218 THR D 223 
K  3  THR D 123 ? PHE D 135 ? THR D 123 PHE D 135 
K  4  ASN D 226 ? THR D 227 ? ASN D 226 THR D 227 
K  5  THR D 123 ? PHE D 135 ? THR D 123 PHE D 135 
K  6  THR D 252 ? THR D 254 ? THR D 252 THR D 254 
K  7  THR D 123 ? PHE D 135 ? THR D 123 PHE D 135 
K  8  MET D 268 ? LYS D 276 ? MET D 268 LYS D 276 
K  9  THR D 279 ? ASN D 280 ? THR D 279 ASN D 280 
K  10 MET D 268 ? LYS D 276 ? MET D 268 LYS D 276 
K  11 ILE D 356 ? VAL D 358 ? ILE D 356 VAL D 358 
K  12 ALA D 341 ? ARG D 344 ? ALA D 341 ARG D 344 
K  13 MET D 331 ? SER D 335 ? MET D 331 SER D 335 
L  1  ASP D 137 ? SER D 143 ? ASP D 137 SER D 143 
L  2  GLY D 146 ? ASP D 152 ? GLY D 146 ASP D 152 
L  3  GLY J 146 ? ASP J 152 ? GLY J 146 ASP J 152 
L  4  ASP J 137 ? SER J 143 ? ASP J 137 SER J 143 
M  1  GLU E 28  ? PRO E 34  ? GLU E 28  PRO E 34  
M  2  PHE E 16  ? THR E 22  ? PHE E 16  THR E 22  
M  3  THR E 84  ? LEU E 92  ? THR E 84  LEU E 92  
M  4  VAL E 75  ? ILE E 76  ? VAL E 75  ILE E 76  
M  5  THR E 84  ? LEU E 92  ? THR E 84  LEU E 92  
M  6  VAL E 66  ? PRO E 69  ? VAL E 66  PRO E 69  
M  7  LYS E 47  ? MET E 48  ? LYS E 47  MET E 48  
N  1  VAL E 206 ? HIS E 211 ? VAL E 206 HIS E 211 
N  2  GLN E 218 ? THR E 223 ? GLN E 218 THR E 223 
N  3  THR E 123 ? PHE E 135 ? THR E 123 PHE E 135 
N  4  ASN E 226 ? THR E 227 ? ASN E 226 THR E 227 
N  5  THR E 123 ? PHE E 135 ? THR E 123 PHE E 135 
N  6  THR E 252 ? THR E 254 ? THR E 252 THR E 254 
N  7  THR E 123 ? PHE E 135 ? THR E 123 PHE E 135 
N  8  MET E 268 ? LYS E 276 ? MET E 268 LYS E 276 
N  9  THR E 279 ? ASN E 280 ? THR E 279 ASN E 280 
N  10 MET E 268 ? LYS E 276 ? MET E 268 LYS E 276 
N  11 ILE E 356 ? VAL E 358 ? ILE E 356 VAL E 358 
N  12 ALA E 341 ? ARG E 344 ? ALA E 341 ARG E 344 
N  13 MET E 331 ? SER E 335 ? MET E 331 SER E 335 
O  1  ASP E 137 ? SER E 143 ? ASP E 137 SER E 143 
O  2  GLY E 146 ? ASP E 152 ? GLY E 146 ASP E 152 
O  3  GLY K 146 ? ASP K 152 ? GLY K 146 ASP K 152 
O  4  ASP K 137 ? SER K 143 ? ASP K 137 SER K 143 
P  1  GLU F 28  ? PRO F 34  ? GLU F 28  PRO F 34  
P  2  PHE F 16  ? THR F 22  ? PHE F 16  THR F 22  
P  3  THR F 84  ? LEU F 92  ? THR F 84  LEU F 92  
P  4  VAL F 75  ? ILE F 76  ? VAL F 75  ILE F 76  
P  5  THR F 84  ? LEU F 92  ? THR F 84  LEU F 92  
P  6  VAL F 66  ? PRO F 69  ? VAL F 66  PRO F 69  
P  7  LYS F 47  ? MET F 48  ? LYS F 47  MET F 48  
Q  1  VAL F 206 ? HIS F 211 ? VAL F 206 HIS F 211 
Q  2  GLN F 218 ? THR F 223 ? GLN F 218 THR F 223 
Q  3  THR F 123 ? PHE F 135 ? THR F 123 PHE F 135 
Q  4  ASN F 226 ? THR F 227 ? ASN F 226 THR F 227 
Q  5  THR F 123 ? PHE F 135 ? THR F 123 PHE F 135 
Q  6  THR F 252 ? THR F 254 ? THR F 252 THR F 254 
Q  7  THR F 123 ? PHE F 135 ? THR F 123 PHE F 135 
Q  8  MET F 268 ? LYS F 276 ? MET F 268 LYS F 276 
Q  9  THR F 279 ? ASN F 280 ? THR F 279 ASN F 280 
Q  10 MET F 268 ? LYS F 276 ? MET F 268 LYS F 276 
Q  11 ILE F 356 ? VAL F 358 ? ILE F 356 VAL F 358 
Q  12 ALA F 341 ? ARG F 344 ? ALA F 341 ARG F 344 
Q  13 MET F 331 ? SER F 335 ? MET F 331 SER F 335 
R  1  ASP F 137 ? SER F 143 ? ASP F 137 SER F 143 
R  2  GLY F 146 ? ASP F 152 ? GLY F 146 ASP F 152 
R  3  GLY L 146 ? ASP L 152 ? GLY L 146 ASP L 152 
R  4  ASP L 137 ? SER L 143 ? ASP L 137 SER L 143 
S  1  GLU G 28  ? PRO G 34  ? GLU G 28  PRO G 34  
S  2  PHE G 16  ? THR G 22  ? PHE G 16  THR G 22  
S  3  THR G 84  ? LEU G 92  ? THR G 84  LEU G 92  
S  4  VAL G 75  ? ILE G 76  ? VAL G 75  ILE G 76  
S  5  THR G 84  ? LEU G 92  ? THR G 84  LEU G 92  
S  6  VAL G 66  ? PRO G 69  ? VAL G 66  PRO G 69  
S  7  LYS G 47  ? MET G 48  ? LYS G 47  MET G 48  
T  1  VAL G 206 ? HIS G 211 ? VAL G 206 HIS G 211 
T  2  GLN G 218 ? THR G 223 ? GLN G 218 THR G 223 
T  3  THR G 123 ? PHE G 135 ? THR G 123 PHE G 135 
T  4  ASN G 226 ? THR G 227 ? ASN G 226 THR G 227 
T  5  THR G 123 ? PHE G 135 ? THR G 123 PHE G 135 
T  6  THR G 252 ? THR G 254 ? THR G 252 THR G 254 
T  7  THR G 123 ? PHE G 135 ? THR G 123 PHE G 135 
T  8  MET G 268 ? LYS G 276 ? MET G 268 LYS G 276 
T  9  THR G 279 ? ASN G 280 ? THR G 279 ASN G 280 
T  10 MET G 268 ? LYS G 276 ? MET G 268 LYS G 276 
T  11 ILE G 356 ? VAL G 358 ? ILE G 356 VAL G 358 
T  12 ALA G 341 ? ARG G 344 ? ALA G 341 ARG G 344 
T  13 MET G 331 ? SER G 335 ? MET G 331 SER G 335 
U  1  GLU H 28  ? PRO H 34  ? GLU H 28  PRO H 34  
U  2  PHE H 16  ? THR H 22  ? PHE H 16  THR H 22  
U  3  THR H 84  ? LEU H 92  ? THR H 84  LEU H 92  
U  4  VAL H 75  ? ILE H 76  ? VAL H 75  ILE H 76  
U  5  THR H 84  ? LEU H 92  ? THR H 84  LEU H 92  
U  6  VAL H 66  ? PRO H 69  ? VAL H 66  PRO H 69  
U  7  LYS H 47  ? MET H 48  ? LYS H 47  MET H 48  
V  1  VAL H 206 ? HIS H 211 ? VAL H 206 HIS H 211 
V  2  GLN H 218 ? THR H 223 ? GLN H 218 THR H 223 
V  3  THR H 123 ? PHE H 135 ? THR H 123 PHE H 135 
V  4  ASN H 226 ? THR H 227 ? ASN H 226 THR H 227 
V  5  THR H 123 ? PHE H 135 ? THR H 123 PHE H 135 
V  6  THR H 252 ? THR H 254 ? THR H 252 THR H 254 
V  7  THR H 123 ? PHE H 135 ? THR H 123 PHE H 135 
V  8  MET H 268 ? LYS H 276 ? MET H 268 LYS H 276 
V  9  THR H 279 ? ASN H 280 ? THR H 279 ASN H 280 
V  10 MET H 268 ? LYS H 276 ? MET H 268 LYS H 276 
V  11 ILE H 356 ? VAL H 358 ? ILE H 356 VAL H 358 
V  12 ALA H 341 ? ARG H 344 ? ALA H 341 ARG H 344 
V  13 MET H 331 ? SER H 335 ? MET H 331 SER H 335 
W  1  GLU I 28  ? PRO I 34  ? GLU I 28  PRO I 34  
W  2  PHE I 16  ? THR I 22  ? PHE I 16  THR I 22  
W  3  THR I 84  ? LEU I 92  ? THR I 84  LEU I 92  
W  4  VAL I 75  ? ILE I 76  ? VAL I 75  ILE I 76  
W  5  THR I 84  ? LEU I 92  ? THR I 84  LEU I 92  
W  6  VAL I 66  ? PRO I 69  ? VAL I 66  PRO I 69  
W  7  LYS I 47  ? MET I 48  ? LYS I 47  MET I 48  
X  1  VAL I 206 ? HIS I 211 ? VAL I 206 HIS I 211 
X  2  GLN I 218 ? THR I 223 ? GLN I 218 THR I 223 
X  3  THR I 123 ? PHE I 135 ? THR I 123 PHE I 135 
X  4  ASN I 226 ? THR I 227 ? ASN I 226 THR I 227 
X  5  THR I 123 ? PHE I 135 ? THR I 123 PHE I 135 
X  6  THR I 252 ? THR I 254 ? THR I 252 THR I 254 
X  7  THR I 123 ? PHE I 135 ? THR I 123 PHE I 135 
X  8  MET I 268 ? LYS I 276 ? MET I 268 LYS I 276 
X  9  THR I 279 ? ASN I 280 ? THR I 279 ASN I 280 
X  10 MET I 268 ? LYS I 276 ? MET I 268 LYS I 276 
X  11 ILE I 356 ? VAL I 358 ? ILE I 356 VAL I 358 
X  12 ALA I 341 ? ARG I 344 ? ALA I 341 ARG I 344 
X  13 MET I 331 ? SER I 335 ? MET I 331 SER I 335 
Y  1  GLU J 28  ? PRO J 34  ? GLU J 28  PRO J 34  
Y  2  PHE J 16  ? THR J 22  ? PHE J 16  THR J 22  
Y  3  THR J 84  ? LEU J 92  ? THR J 84  LEU J 92  
Y  4  VAL J 75  ? ILE J 76  ? VAL J 75  ILE J 76  
Y  5  THR J 84  ? LEU J 92  ? THR J 84  LEU J 92  
Y  6  VAL J 66  ? PRO J 69  ? VAL J 66  PRO J 69  
Y  7  LYS J 47  ? MET J 48  ? LYS J 47  MET J 48  
Z  1  VAL J 206 ? HIS J 211 ? VAL J 206 HIS J 211 
Z  2  GLN J 218 ? THR J 223 ? GLN J 218 THR J 223 
Z  3  THR J 123 ? PHE J 135 ? THR J 123 PHE J 135 
Z  4  ASN J 226 ? THR J 227 ? ASN J 226 THR J 227 
Z  5  THR J 123 ? PHE J 135 ? THR J 123 PHE J 135 
Z  6  THR J 252 ? THR J 254 ? THR J 252 THR J 254 
Z  7  THR J 123 ? PHE J 135 ? THR J 123 PHE J 135 
Z  8  MET J 268 ? LYS J 276 ? MET J 268 LYS J 276 
Z  9  THR J 279 ? ASN J 280 ? THR J 279 ASN J 280 
Z  10 MET J 268 ? LYS J 276 ? MET J 268 LYS J 276 
Z  11 ILE J 356 ? VAL J 358 ? ILE J 356 VAL J 358 
Z  12 ALA J 341 ? ARG J 344 ? ALA J 341 ARG J 344 
Z  13 MET J 331 ? SER J 335 ? MET J 331 SER J 335 
AA 1  GLU K 28  ? PRO K 34  ? GLU K 28  PRO K 34  
AA 2  PHE K 16  ? THR K 22  ? PHE K 16  THR K 22  
AA 3  THR K 84  ? LEU K 92  ? THR K 84  LEU K 92  
AA 4  VAL K 75  ? ILE K 76  ? VAL K 75  ILE K 76  
AA 5  THR K 84  ? LEU K 92  ? THR K 84  LEU K 92  
AA 6  VAL K 66  ? PRO K 69  ? VAL K 66  PRO K 69  
AA 7  LYS K 47  ? MET K 48  ? LYS K 47  MET K 48  
BB 1  VAL K 206 ? HIS K 211 ? VAL K 206 HIS K 211 
BB 2  GLN K 218 ? THR K 223 ? GLN K 218 THR K 223 
BB 3  THR K 123 ? PHE K 135 ? THR K 123 PHE K 135 
BB 4  ASN K 226 ? THR K 227 ? ASN K 226 THR K 227 
BB 5  THR K 123 ? PHE K 135 ? THR K 123 PHE K 135 
BB 6  THR K 252 ? THR K 254 ? THR K 252 THR K 254 
BB 7  THR K 123 ? PHE K 135 ? THR K 123 PHE K 135 
BB 8  MET K 268 ? LYS K 276 ? MET K 268 LYS K 276 
BB 9  THR K 279 ? ASN K 280 ? THR K 279 ASN K 280 
BB 10 MET K 268 ? LYS K 276 ? MET K 268 LYS K 276 
BB 11 ILE K 356 ? VAL K 358 ? ILE K 356 VAL K 358 
BB 12 ALA K 341 ? ARG K 344 ? ALA K 341 ARG K 344 
BB 13 MET K 331 ? SER K 335 ? MET K 331 SER K 335 
CC 1  GLU L 28  ? PRO L 34  ? GLU L 28  PRO L 34  
CC 2  PHE L 16  ? THR L 22  ? PHE L 16  THR L 22  
CC 3  THR L 84  ? LEU L 92  ? THR L 84  LEU L 92  
CC 4  VAL L 75  ? ILE L 76  ? VAL L 75  ILE L 76  
CC 5  THR L 84  ? LEU L 92  ? THR L 84  LEU L 92  
CC 6  VAL L 66  ? PRO L 69  ? VAL L 66  PRO L 69  
CC 7  LYS L 47  ? MET L 48  ? LYS L 47  MET L 48  
DD 1  VAL L 206 ? HIS L 211 ? VAL L 206 HIS L 211 
DD 2  GLN L 218 ? THR L 223 ? GLN L 218 THR L 223 
DD 3  THR L 123 ? PHE L 135 ? THR L 123 PHE L 135 
DD 4  ASN L 226 ? THR L 227 ? ASN L 226 THR L 227 
DD 5  THR L 123 ? PHE L 135 ? THR L 123 PHE L 135 
DD 6  THR L 252 ? THR L 254 ? THR L 252 THR L 254 
DD 7  THR L 123 ? PHE L 135 ? THR L 123 PHE L 135 
DD 8  MET L 268 ? LYS L 276 ? MET L 268 LYS L 276 
DD 9  THR L 279 ? ASN L 280 ? THR L 279 ASN L 280 
DD 10 MET L 268 ? LYS L 276 ? MET L 268 LYS L 276 
DD 11 ILE L 356 ? VAL L 358 ? ILE L 356 VAL L 358 
DD 12 ALA L 341 ? ARG L 344 ? ALA L 341 ARG L 344 
DD 13 MET L 331 ? SER L 335 ? MET L 331 SER L 335 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1  2  O ILE A 33  ? O ILE A 33  N VAL A 17  ? N VAL A 17  
A  2  3  N ASP A 18  ? N ASP A 18  O LEU A 85  ? O LEU A 85  
A  3  4  N ILE A 86  ? N ILE A 86  O VAL A 75  ? O VAL A 75  
A  4  5  O VAL A 75  ? O VAL A 75  N ILE A 86  ? N ILE A 86  
A  5  6  O LEU A 92  ? O LEU A 92  N VAL A 66  ? N VAL A 66  
A  6  7  N LEU A 67  ? N LEU A 67  O LYS A 47  ? O LYS A 47  
B  1  2  O ASN A 226 ? O ASN A 226 N PHE A 126 ? N PHE A 126 
B  2  3  N PHE A 135 ? N PHE A 135 O THR A 252 ? O THR A 252 
B  3  4  O THR A 254 ? O THR A 254 N PHE A 133 ? N PHE A 133 
B  4  5  O PHE A 132 ? O PHE A 132 N ASN A 219 ? N ASN A 219 
B  5  6  O ALA A 222 ? O ALA A 222 N GLU A 207 ? N GLU A 207 
B  6  7  N HIS A 210 ? N HIS A 210 O GLU A 220 ? O GLU A 220 
B  7  8  N VAL A 221 ? N VAL A 221 O PRO A 130 ? O PRO A 130 
B  8  9  N GLU A 129 ? N GLU A 129 O HIS A 269 ? O HIS A 269 
B  9  10 N LYS A 276 ? N LYS A 276 O THR A 279 ? O THR A 279 
B  10 11 O THR A 279 ? O THR A 279 N LYS A 276 ? N LYS A 276 
B  11 12 N MET A 272 ? N MET A 272 O ILE A 356 ? O ILE A 356 
B  12 13 N GLU A 357 ? N GLU A 357 O ARG A 344 ? O ARG A 344 
B  13 14 N SER A 342 ? N SER A 342 O MET A 331 ? O MET A 331 
C  1  2  N SER A 143 ? N SER A 143 O GLY A 146 ? O GLY A 146 
C  2  3  N VAL A 149 ? N VAL A 149 O SER G 147 ? O SER G 147 
C  3  4  O ASP G 152 ? O ASP G 152 N ASP G 137 ? N ASP G 137 
D  1  2  O ILE B 33  ? O ILE B 33  N VAL B 17  ? N VAL B 17  
D  2  3  N ASP B 18  ? N ASP B 18  O LEU B 85  ? O LEU B 85  
D  3  4  N ILE B 86  ? N ILE B 86  O VAL B 75  ? O VAL B 75  
D  4  5  O VAL B 75  ? O VAL B 75  N ILE B 86  ? N ILE B 86  
D  5  6  O LEU B 92  ? O LEU B 92  N VAL B 66  ? N VAL B 66  
D  6  7  N LEU B 67  ? N LEU B 67  O LYS B 47  ? O LYS B 47  
E  1  2  O MET B 331 ? O MET B 331 N SER B 342 ? N SER B 342 
E  2  3  O ARG B 344 ? O ARG B 344 N GLU B 357 ? N GLU B 357 
E  3  4  N VAL B 358 ? N VAL B 358 O CYS B 270 ? O CYS B 270 
E  4  5  N LYS B 276 ? N LYS B 276 O THR B 279 ? O THR B 279 
E  5  6  O THR B 279 ? O THR B 279 N LYS B 276 ? N LYS B 276 
E  6  7  N ALA B 275 ? N ALA B 275 O THR B 123 ? O THR B 123 
E  7  8  O PHE B 132 ? O PHE B 132 N ASN B 219 ? N ASN B 219 
E  8  9  O ALA B 222 ? O ALA B 222 N GLU B 207 ? N GLU B 207 
E  9  10 N HIS B 210 ? N HIS B 210 O GLU B 220 ? O GLU B 220 
E  10 11 N VAL B 221 ? N VAL B 221 O PRO B 130 ? O PRO B 130 
E  11 12 N PHE B 126 ? N PHE B 126 O ASN B 226 ? O ASN B 226 
E  12 13 O ASN B 226 ? O ASN B 226 N PHE B 126 ? N PHE B 126 
E  13 14 N PHE B 135 ? N PHE B 135 O THR B 252 ? O THR B 252 
F  1  2  N SER B 143 ? N SER B 143 O GLY B 146 ? O GLY B 146 
F  2  3  N VAL B 149 ? N VAL B 149 O SER H 147 ? O SER H 147 
F  3  4  O ASP H 152 ? O ASP H 152 N ASP H 137 ? N ASP H 137 
G  1  2  O ILE C 33  ? O ILE C 33  N VAL C 17  ? N VAL C 17  
G  2  3  N ASP C 18  ? N ASP C 18  O LEU C 85  ? O LEU C 85  
G  3  4  N ILE C 86  ? N ILE C 86  O VAL C 75  ? O VAL C 75  
G  4  5  O VAL C 75  ? O VAL C 75  N ILE C 86  ? N ILE C 86  
G  5  6  O LEU C 92  ? O LEU C 92  N VAL C 66  ? N VAL C 66  
G  6  7  N LEU C 67  ? N LEU C 67  O LYS C 47  ? O LYS C 47  
H  1  2  N HIS C 210 ? N HIS C 210 O GLU C 220 ? O GLU C 220 
H  2  3  N VAL C 221 ? N VAL C 221 O PRO C 130 ? O PRO C 130 
H  3  4  N PHE C 126 ? N PHE C 126 O ASN C 226 ? O ASN C 226 
H  4  5  O ASN C 226 ? O ASN C 226 N PHE C 126 ? N PHE C 126 
H  5  6  N PHE C 135 ? N PHE C 135 O THR C 252 ? O THR C 252 
H  6  7  O THR C 254 ? O THR C 254 N PHE C 133 ? N PHE C 133 
H  7  8  N GLU C 129 ? N GLU C 129 O HIS C 269 ? O HIS C 269 
H  8  9  N LYS C 276 ? N LYS C 276 O THR C 279 ? O THR C 279 
H  9  10 O THR C 279 ? O THR C 279 N LYS C 276 ? N LYS C 276 
H  10 11 N MET C 272 ? N MET C 272 O ILE C 356 ? O ILE C 356 
H  11 12 N GLU C 357 ? N GLU C 357 O ARG C 344 ? O ARG C 344 
H  12 13 N SER C 342 ? N SER C 342 O MET C 331 ? O MET C 331 
I  1  2  N SER C 143 ? N SER C 143 O GLY C 146 ? O GLY C 146 
I  2  3  N VAL C 149 ? N VAL C 149 O SER I 147 ? O SER I 147 
I  3  4  O ASP I 152 ? O ASP I 152 N ASP I 137 ? N ASP I 137 
J  1  2  O ILE D 33  ? O ILE D 33  N VAL D 17  ? N VAL D 17  
J  2  3  N ASP D 18  ? N ASP D 18  O LEU D 85  ? O LEU D 85  
J  3  4  N ILE D 86  ? N ILE D 86  O VAL D 75  ? O VAL D 75  
J  4  5  O VAL D 75  ? O VAL D 75  N ILE D 86  ? N ILE D 86  
J  5  6  O LEU D 92  ? O LEU D 92  N VAL D 66  ? N VAL D 66  
J  6  7  N LEU D 67  ? N LEU D 67  O LYS D 47  ? O LYS D 47  
K  1  2  N HIS D 210 ? N HIS D 210 O GLU D 220 ? O GLU D 220 
K  2  3  N VAL D 221 ? N VAL D 221 O PRO D 130 ? O PRO D 130 
K  3  4  N PHE D 126 ? N PHE D 126 O ASN D 226 ? O ASN D 226 
K  4  5  O ASN D 226 ? O ASN D 226 N PHE D 126 ? N PHE D 126 
K  5  6  N PHE D 135 ? N PHE D 135 O THR D 252 ? O THR D 252 
K  6  7  O THR D 254 ? O THR D 254 N PHE D 133 ? N PHE D 133 
K  7  8  N GLU D 129 ? N GLU D 129 O HIS D 269 ? O HIS D 269 
K  8  9  N LYS D 276 ? N LYS D 276 O THR D 279 ? O THR D 279 
K  9  10 O THR D 279 ? O THR D 279 N LYS D 276 ? N LYS D 276 
K  10 11 N MET D 272 ? N MET D 272 O ILE D 356 ? O ILE D 356 
K  11 12 N GLU D 357 ? N GLU D 357 O ARG D 344 ? O ARG D 344 
K  12 13 N SER D 342 ? N SER D 342 O MET D 331 ? O MET D 331 
L  1  2  N SER D 143 ? N SER D 143 O GLY D 146 ? O GLY D 146 
L  2  3  N VAL D 149 ? N VAL D 149 O SER J 147 ? O SER J 147 
L  3  4  O ASP J 152 ? O ASP J 152 N ASP J 137 ? N ASP J 137 
M  1  2  O ILE E 33  ? O ILE E 33  N VAL E 17  ? N VAL E 17  
M  2  3  N ASP E 18  ? N ASP E 18  O LEU E 85  ? O LEU E 85  
M  3  4  N ILE E 86  ? N ILE E 86  O VAL E 75  ? O VAL E 75  
M  4  5  O VAL E 75  ? O VAL E 75  N ILE E 86  ? N ILE E 86  
M  5  6  O LEU E 92  ? O LEU E 92  N VAL E 66  ? N VAL E 66  
M  6  7  N LEU E 67  ? N LEU E 67  O LYS E 47  ? O LYS E 47  
N  1  2  N HIS E 210 ? N HIS E 210 O GLU E 220 ? O GLU E 220 
N  2  3  N VAL E 221 ? N VAL E 221 O PRO E 130 ? O PRO E 130 
N  3  4  N PHE E 126 ? N PHE E 126 O ASN E 226 ? O ASN E 226 
N  4  5  O ASN E 226 ? O ASN E 226 N PHE E 126 ? N PHE E 126 
N  5  6  N PHE E 135 ? N PHE E 135 O THR E 252 ? O THR E 252 
N  6  7  O THR E 254 ? O THR E 254 N PHE E 133 ? N PHE E 133 
N  7  8  N GLU E 129 ? N GLU E 129 O HIS E 269 ? O HIS E 269 
N  8  9  N LYS E 276 ? N LYS E 276 O THR E 279 ? O THR E 279 
N  9  10 O THR E 279 ? O THR E 279 N LYS E 276 ? N LYS E 276 
N  10 11 N MET E 272 ? N MET E 272 O ILE E 356 ? O ILE E 356 
N  11 12 N GLU E 357 ? N GLU E 357 O ARG E 344 ? O ARG E 344 
N  12 13 N SER E 342 ? N SER E 342 O MET E 331 ? O MET E 331 
O  1  2  N SER E 143 ? N SER E 143 O GLY E 146 ? O GLY E 146 
O  2  3  N VAL E 149 ? N VAL E 149 O SER K 147 ? O SER K 147 
O  3  4  O ASP K 152 ? O ASP K 152 N ASP K 137 ? N ASP K 137 
P  1  2  O ILE F 33  ? O ILE F 33  N VAL F 17  ? N VAL F 17  
P  2  3  N ASP F 18  ? N ASP F 18  O LEU F 85  ? O LEU F 85  
P  3  4  N ILE F 86  ? N ILE F 86  O VAL F 75  ? O VAL F 75  
P  4  5  O VAL F 75  ? O VAL F 75  N ILE F 86  ? N ILE F 86  
P  5  6  O LEU F 92  ? O LEU F 92  N VAL F 66  ? N VAL F 66  
P  6  7  N LEU F 67  ? N LEU F 67  O LYS F 47  ? O LYS F 47  
Q  1  2  N HIS F 210 ? N HIS F 210 O GLU F 220 ? O GLU F 220 
Q  2  3  N VAL F 221 ? N VAL F 221 O PRO F 130 ? O PRO F 130 
Q  3  4  N PHE F 126 ? N PHE F 126 O ASN F 226 ? O ASN F 226 
Q  4  5  O ASN F 226 ? O ASN F 226 N PHE F 126 ? N PHE F 126 
Q  5  6  N PHE F 135 ? N PHE F 135 O THR F 252 ? O THR F 252 
Q  6  7  O THR F 254 ? O THR F 254 N PHE F 133 ? N PHE F 133 
Q  7  8  N GLU F 129 ? N GLU F 129 O HIS F 269 ? O HIS F 269 
Q  8  9  N LYS F 276 ? N LYS F 276 O THR F 279 ? O THR F 279 
Q  9  10 O THR F 279 ? O THR F 279 N LYS F 276 ? N LYS F 276 
Q  10 11 N MET F 272 ? N MET F 272 O ILE F 356 ? O ILE F 356 
Q  11 12 N GLU F 357 ? N GLU F 357 O ARG F 344 ? O ARG F 344 
Q  12 13 N SER F 342 ? N SER F 342 O MET F 331 ? O MET F 331 
R  1  2  N SER F 143 ? N SER F 143 O GLY F 146 ? O GLY F 146 
R  2  3  N VAL F 149 ? N VAL F 149 O SER L 147 ? O SER L 147 
R  3  4  O ASP L 152 ? O ASP L 152 N ASP L 137 ? N ASP L 137 
S  1  2  O ILE G 33  ? O ILE G 33  N VAL G 17  ? N VAL G 17  
S  2  3  N ASP G 18  ? N ASP G 18  O LEU G 85  ? O LEU G 85  
S  3  4  N ILE G 86  ? N ILE G 86  O VAL G 75  ? O VAL G 75  
S  4  5  O VAL G 75  ? O VAL G 75  N ILE G 86  ? N ILE G 86  
S  5  6  O LEU G 92  ? O LEU G 92  N VAL G 66  ? N VAL G 66  
S  6  7  N LEU G 67  ? N LEU G 67  O LYS G 47  ? O LYS G 47  
T  1  2  N HIS G 210 ? N HIS G 210 O GLU G 220 ? O GLU G 220 
T  2  3  N VAL G 221 ? N VAL G 221 O PRO G 130 ? O PRO G 130 
T  3  4  N PHE G 126 ? N PHE G 126 O ASN G 226 ? O ASN G 226 
T  4  5  O ASN G 226 ? O ASN G 226 N PHE G 126 ? N PHE G 126 
T  5  6  N PHE G 135 ? N PHE G 135 O THR G 252 ? O THR G 252 
T  6  7  O THR G 254 ? O THR G 254 N PHE G 133 ? N PHE G 133 
T  7  8  N GLU G 129 ? N GLU G 129 O HIS G 269 ? O HIS G 269 
T  8  9  N LYS G 276 ? N LYS G 276 O THR G 279 ? O THR G 279 
T  9  10 O THR G 279 ? O THR G 279 N LYS G 276 ? N LYS G 276 
T  10 11 N MET G 272 ? N MET G 272 O ILE G 356 ? O ILE G 356 
T  11 12 N GLU G 357 ? N GLU G 357 O ARG G 344 ? O ARG G 344 
T  12 13 N SER G 342 ? N SER G 342 O MET G 331 ? O MET G 331 
U  1  2  O ILE H 33  ? O ILE H 33  N VAL H 17  ? N VAL H 17  
U  2  3  N ASP H 18  ? N ASP H 18  O LEU H 85  ? O LEU H 85  
U  3  4  N ILE H 86  ? N ILE H 86  O VAL H 75  ? O VAL H 75  
U  4  5  O VAL H 75  ? O VAL H 75  N ILE H 86  ? N ILE H 86  
U  5  6  O LEU H 92  ? O LEU H 92  N VAL H 66  ? N VAL H 66  
U  6  7  N LEU H 67  ? N LEU H 67  O LYS H 47  ? O LYS H 47  
V  1  2  N HIS H 210 ? N HIS H 210 O GLU H 220 ? O GLU H 220 
V  2  3  N VAL H 221 ? N VAL H 221 O PRO H 130 ? O PRO H 130 
V  3  4  N PHE H 126 ? N PHE H 126 O ASN H 226 ? O ASN H 226 
V  4  5  O ASN H 226 ? O ASN H 226 N PHE H 126 ? N PHE H 126 
V  5  6  N PHE H 135 ? N PHE H 135 O THR H 252 ? O THR H 252 
V  6  7  O THR H 254 ? O THR H 254 N PHE H 133 ? N PHE H 133 
V  7  8  N GLU H 129 ? N GLU H 129 O HIS H 269 ? O HIS H 269 
V  8  9  N LYS H 276 ? N LYS H 276 O THR H 279 ? O THR H 279 
V  9  10 O THR H 279 ? O THR H 279 N LYS H 276 ? N LYS H 276 
V  10 11 N MET H 272 ? N MET H 272 O ILE H 356 ? O ILE H 356 
V  11 12 N GLU H 357 ? N GLU H 357 O ARG H 344 ? O ARG H 344 
V  12 13 N SER H 342 ? N SER H 342 O MET H 331 ? O MET H 331 
W  1  2  O ILE I 33  ? O ILE I 33  N VAL I 17  ? N VAL I 17  
W  2  3  N ASP I 18  ? N ASP I 18  O LEU I 85  ? O LEU I 85  
W  3  4  N ILE I 86  ? N ILE I 86  O VAL I 75  ? O VAL I 75  
W  4  5  O VAL I 75  ? O VAL I 75  N ILE I 86  ? N ILE I 86  
W  5  6  O LEU I 92  ? O LEU I 92  N VAL I 66  ? N VAL I 66  
W  6  7  N LEU I 67  ? N LEU I 67  O LYS I 47  ? O LYS I 47  
X  1  2  N HIS I 210 ? N HIS I 210 O GLU I 220 ? O GLU I 220 
X  2  3  N VAL I 221 ? N VAL I 221 O PRO I 130 ? O PRO I 130 
X  3  4  N PHE I 126 ? N PHE I 126 O ASN I 226 ? O ASN I 226 
X  4  5  O ASN I 226 ? O ASN I 226 N PHE I 126 ? N PHE I 126 
X  5  6  N PHE I 135 ? N PHE I 135 O THR I 252 ? O THR I 252 
X  6  7  O THR I 254 ? O THR I 254 N PHE I 133 ? N PHE I 133 
X  7  8  N GLU I 129 ? N GLU I 129 O HIS I 269 ? O HIS I 269 
X  8  9  N LYS I 276 ? N LYS I 276 O THR I 279 ? O THR I 279 
X  9  10 O THR I 279 ? O THR I 279 N LYS I 276 ? N LYS I 276 
X  10 11 N MET I 272 ? N MET I 272 O ILE I 356 ? O ILE I 356 
X  11 12 N GLU I 357 ? N GLU I 357 O ARG I 344 ? O ARG I 344 
X  12 13 N SER I 342 ? N SER I 342 O MET I 331 ? O MET I 331 
Y  1  2  O ILE J 33  ? O ILE J 33  N VAL J 17  ? N VAL J 17  
Y  2  3  N ASP J 18  ? N ASP J 18  O LEU J 85  ? O LEU J 85  
Y  3  4  N ILE J 86  ? N ILE J 86  O VAL J 75  ? O VAL J 75  
Y  4  5  O VAL J 75  ? O VAL J 75  N ILE J 86  ? N ILE J 86  
Y  5  6  O LEU J 92  ? O LEU J 92  N VAL J 66  ? N VAL J 66  
Y  6  7  N LEU J 67  ? N LEU J 67  O LYS J 47  ? O LYS J 47  
Z  1  2  N HIS J 210 ? N HIS J 210 O GLU J 220 ? O GLU J 220 
Z  2  3  N VAL J 221 ? N VAL J 221 O PRO J 130 ? O PRO J 130 
Z  3  4  N PHE J 126 ? N PHE J 126 O ASN J 226 ? O ASN J 226 
Z  4  5  O ASN J 226 ? O ASN J 226 N PHE J 126 ? N PHE J 126 
Z  5  6  N PHE J 135 ? N PHE J 135 O THR J 252 ? O THR J 252 
Z  6  7  O THR J 254 ? O THR J 254 N PHE J 133 ? N PHE J 133 
Z  7  8  N GLU J 129 ? N GLU J 129 O HIS J 269 ? O HIS J 269 
Z  8  9  N LYS J 276 ? N LYS J 276 O THR J 279 ? O THR J 279 
Z  9  10 O THR J 279 ? O THR J 279 N LYS J 276 ? N LYS J 276 
Z  10 11 N MET J 272 ? N MET J 272 O ILE J 356 ? O ILE J 356 
Z  11 12 N GLU J 357 ? N GLU J 357 O ARG J 344 ? O ARG J 344 
Z  12 13 N SER J 342 ? N SER J 342 O MET J 331 ? O MET J 331 
AA 1  2  O ILE K 33  ? O ILE K 33  N VAL K 17  ? N VAL K 17  
AA 2  3  N ASP K 18  ? N ASP K 18  O LEU K 85  ? O LEU K 85  
AA 3  4  N ILE K 86  ? N ILE K 86  O VAL K 75  ? O VAL K 75  
AA 4  5  O VAL K 75  ? O VAL K 75  N ILE K 86  ? N ILE K 86  
AA 5  6  O LEU K 92  ? O LEU K 92  N VAL K 66  ? N VAL K 66  
AA 6  7  N LEU K 67  ? N LEU K 67  O LYS K 47  ? O LYS K 47  
BB 1  2  N HIS K 210 ? N HIS K 210 O GLU K 220 ? O GLU K 220 
BB 2  3  N VAL K 221 ? N VAL K 221 O PRO K 130 ? O PRO K 130 
BB 3  4  N PHE K 126 ? N PHE K 126 O ASN K 226 ? O ASN K 226 
BB 4  5  O ASN K 226 ? O ASN K 226 N PHE K 126 ? N PHE K 126 
BB 5  6  N PHE K 135 ? N PHE K 135 O THR K 252 ? O THR K 252 
BB 6  7  O THR K 254 ? O THR K 254 N PHE K 133 ? N PHE K 133 
BB 7  8  N GLU K 129 ? N GLU K 129 O HIS K 269 ? O HIS K 269 
BB 8  9  N LYS K 276 ? N LYS K 276 O THR K 279 ? O THR K 279 
BB 9  10 O THR K 279 ? O THR K 279 N LYS K 276 ? N LYS K 276 
BB 10 11 N MET K 272 ? N MET K 272 O ILE K 356 ? O ILE K 356 
BB 11 12 N GLU K 357 ? N GLU K 357 O ARG K 344 ? O ARG K 344 
BB 12 13 N SER K 342 ? N SER K 342 O MET K 331 ? O MET K 331 
CC 1  2  O ILE L 33  ? O ILE L 33  N VAL L 17  ? N VAL L 17  
CC 2  3  N ASP L 18  ? N ASP L 18  O LEU L 85  ? O LEU L 85  
CC 3  4  N ILE L 86  ? N ILE L 86  O VAL L 75  ? O VAL L 75  
CC 4  5  O VAL L 75  ? O VAL L 75  N ILE L 86  ? N ILE L 86  
CC 5  6  O LEU L 92  ? O LEU L 92  N VAL L 66  ? N VAL L 66  
CC 6  7  N LEU L 67  ? N LEU L 67  O LYS L 47  ? O LYS L 47  
DD 1  2  N HIS L 210 ? N HIS L 210 O GLU L 220 ? O GLU L 220 
DD 2  3  N VAL L 221 ? N VAL L 221 O PRO L 130 ? O PRO L 130 
DD 3  4  N PHE L 126 ? N PHE L 126 O ASN L 226 ? O ASN L 226 
DD 4  5  O ASN L 226 ? O ASN L 226 N PHE L 126 ? N PHE L 126 
DD 5  6  N PHE L 135 ? N PHE L 135 O THR L 252 ? O THR L 252 
DD 6  7  O THR L 254 ? O THR L 254 N PHE L 133 ? N PHE L 133 
DD 7  8  N GLU L 129 ? N GLU L 129 O HIS L 269 ? O HIS L 269 
DD 8  9  N LYS L 276 ? N LYS L 276 O THR L 279 ? O THR L 279 
DD 9  10 O THR L 279 ? O THR L 279 N LYS L 276 ? N LYS L 276 
DD 10 11 N MET L 272 ? N MET L 272 O ILE L 356 ? O ILE L 356 
DD 11 12 N GLU L 357 ? N GLU L 357 O ARG L 344 ? O ARG L 344 
DD 12 13 N SER L 342 ? N SER L 342 O MET L 331 ? O MET L 331 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 469'   
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN A 470'   
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN B 469'   
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN B 470'   
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN C 469'   
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN C 470'   
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN D 469'   
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN D 470'   
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN E 469'   
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN E 470'   
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN F 469'   
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN F 470'   
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN G 469'   
BC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN G 470'   
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN H 469'   
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN H 470'   
BC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN I 469'   
BC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN I 470'   
CC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN J 469'   
CC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN J 470'   
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN K 469'   
CC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN K 470'   
CC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN L 469'   
CC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN L 470'   
CC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP A 1471' 
CC8 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP B 1472' 
CC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP C 1473' 
DC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP D 1474' 
DC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP E 1475' 
DC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP F 1476' 
DC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP G 1477' 
DC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP H 1478' 
DC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP I 1479' 
DC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP J 1480' 
DC8 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP K 1481' 
DC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP L 1482' 
EC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL A 473'   
EC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL A 474'   
EC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL B 473'   
EC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL B 474'   
EC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL C 473'   
EC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL C 474'   
EC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL D 473'   
EC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL D 474'   
EC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL E 473'   
FC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL E 474'   
FC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL F 473'   
FC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL F 474'   
FC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL G 473'   
FC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL G 474'   
FC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL H 473'   
FC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL H 474'   
FC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL I 473'   
FC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL I 474'   
GC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL J 473'   
GC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL J 474'   
GC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL K 473'   
GC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL K 474'   
GC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL L 473'   
GC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TL L 474'   
GC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MPD A 1483' 
GC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MPD B 1484' 
GC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MPD C 1485' 
HC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MPD D 1486' 
HC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MPD E 1487' 
HC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MPD F 1488' 
HC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MPD G 1489' 
HC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE MPD H 1490' 
HC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MPD I 1491' 
HC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MPD J 1492' 
HC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MPD K 1493' 
HC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE MPD L 1494' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  GLU A  131 ? GLU A 131  . ? 1_555 ? 
2   AC1 6  GLU A  212 ? GLU A 212  . ? 1_555 ? 
3   AC1 6  GLU A  220 ? GLU A 220  . ? 1_555 ? 
4   AC1 6  ADP O  .   ? ADP A 1471 . ? 1_555 ? 
5   AC1 6  HOH GC .   ? HOH A 1550 . ? 1_555 ? 
6   AC1 6  HOH GC .   ? HOH A 1583 . ? 1_555 ? 
7   AC2 5  GLU A  129 ? GLU A 129  . ? 1_555 ? 
8   AC2 5  HIS A  269 ? HIS A 269  . ? 1_555 ? 
9   AC2 5  GLU A  357 ? GLU A 357  . ? 1_555 ? 
10  AC2 5  HOH GC .   ? HOH A 1582 . ? 1_555 ? 
11  AC2 5  HOH HC .   ? HOH B 1490 . ? 1_555 ? 
12  AC3 6  GLU B  131 ? GLU B 131  . ? 1_555 ? 
13  AC3 6  GLU B  212 ? GLU B 212  . ? 1_555 ? 
14  AC3 6  GLU B  220 ? GLU B 220  . ? 1_555 ? 
15  AC3 6  ADP U  .   ? ADP B 1472 . ? 1_555 ? 
16  AC3 6  HOH HC .   ? HOH B 1558 . ? 1_555 ? 
17  AC3 6  HOH HC .   ? HOH B 1590 . ? 1_555 ? 
18  AC4 5  GLU B  129 ? GLU B 129  . ? 1_555 ? 
19  AC4 5  HIS B  269 ? HIS B 269  . ? 1_555 ? 
20  AC4 5  GLU B  357 ? GLU B 357  . ? 1_555 ? 
21  AC4 5  HOH HC .   ? HOH B 1589 . ? 1_555 ? 
22  AC4 5  HOH IC .   ? HOH C 1492 . ? 1_555 ? 
23  AC5 6  GLU C  131 ? GLU C 131  . ? 1_555 ? 
24  AC5 6  GLU C  212 ? GLU C 212  . ? 1_555 ? 
25  AC5 6  GLU C  220 ? GLU C 220  . ? 1_555 ? 
26  AC5 6  ADP AA .   ? ADP C 1473 . ? 1_555 ? 
27  AC5 6  HOH IC .   ? HOH C 1560 . ? 1_555 ? 
28  AC5 6  HOH JC .   ? HOH D 1494 . ? 1_555 ? 
29  AC6 5  GLU C  129 ? GLU C 129  . ? 1_555 ? 
30  AC6 5  HIS C  269 ? HIS C 269  . ? 1_555 ? 
31  AC6 5  GLU C  357 ? GLU C 357  . ? 1_555 ? 
32  AC6 5  HOH IC .   ? HOH C 1590 . ? 1_555 ? 
33  AC6 5  HOH JC .   ? HOH D 1493 . ? 1_555 ? 
34  AC7 6  GLU D  131 ? GLU D 131  . ? 1_555 ? 
35  AC7 6  GLU D  212 ? GLU D 212  . ? 1_555 ? 
36  AC7 6  GLU D  220 ? GLU D 220  . ? 1_555 ? 
37  AC7 6  ADP GA .   ? ADP D 1474 . ? 1_555 ? 
38  AC7 6  HOH JC .   ? HOH D 1562 . ? 1_555 ? 
39  AC7 6  HOH JC .   ? HOH D 1595 . ? 1_555 ? 
40  AC8 5  GLU D  129 ? GLU D 129  . ? 1_555 ? 
41  AC8 5  HIS D  269 ? HIS D 269  . ? 1_555 ? 
42  AC8 5  GLU D  357 ? GLU D 357  . ? 1_555 ? 
43  AC8 5  HOH JC .   ? HOH D 1594 . ? 1_555 ? 
44  AC8 5  HOH KC .   ? HOH E 1493 . ? 1_555 ? 
45  AC9 6  GLU E  131 ? GLU E 131  . ? 1_555 ? 
46  AC9 6  GLU E  212 ? GLU E 212  . ? 1_555 ? 
47  AC9 6  GLU E  220 ? GLU E 220  . ? 1_555 ? 
48  AC9 6  ADP MA .   ? ADP E 1475 . ? 1_555 ? 
49  AC9 6  HOH KC .   ? HOH E 1560 . ? 1_555 ? 
50  AC9 6  HOH KC .   ? HOH E 1592 . ? 1_555 ? 
51  BC1 5  GLU E  129 ? GLU E 129  . ? 1_555 ? 
52  BC1 5  HIS E  269 ? HIS E 269  . ? 1_555 ? 
53  BC1 5  GLU E  357 ? GLU E 357  . ? 1_555 ? 
54  BC1 5  HOH KC .   ? HOH E 1591 . ? 1_555 ? 
55  BC1 5  HOH LC .   ? HOH F 1496 . ? 1_555 ? 
56  BC2 6  GLU F  131 ? GLU F 131  . ? 1_555 ? 
57  BC2 6  GLU F  212 ? GLU F 212  . ? 1_555 ? 
58  BC2 6  GLU F  220 ? GLU F 220  . ? 1_555 ? 
59  BC2 6  ADP SA .   ? ADP F 1476 . ? 1_555 ? 
60  BC2 6  HOH LC .   ? HOH F 1565 . ? 1_555 ? 
61  BC2 6  HOH LC .   ? HOH F 1597 . ? 1_555 ? 
62  BC3 5  HOH GC .   ? HOH A 1596 . ? 1_555 ? 
63  BC3 5  GLU F  129 ? GLU F 129  . ? 1_555 ? 
64  BC3 5  HIS F  269 ? HIS F 269  . ? 1_555 ? 
65  BC3 5  GLU F  357 ? GLU F 357  . ? 1_555 ? 
66  BC3 5  HOH LC .   ? HOH F 1596 . ? 1_555 ? 
67  BC4 6  GLU G  131 ? GLU G 131  . ? 1_555 ? 
68  BC4 6  GLU G  212 ? GLU G 212  . ? 1_555 ? 
69  BC4 6  GLU G  220 ? GLU G 220  . ? 1_555 ? 
70  BC4 6  ADP YA .   ? ADP G 1477 . ? 1_555 ? 
71  BC4 6  HOH MC .   ? HOH G 1565 . ? 1_555 ? 
72  BC4 6  HOH MC .   ? HOH G 1597 . ? 1_555 ? 
73  BC5 5  GLU G  129 ? GLU G 129  . ? 1_555 ? 
74  BC5 5  HIS G  269 ? HIS G 269  . ? 1_555 ? 
75  BC5 5  GLU G  357 ? GLU G 357  . ? 1_555 ? 
76  BC5 5  HOH MC .   ? HOH G 1596 . ? 1_555 ? 
77  BC5 5  HOH RC .   ? HOH L 838  . ? 1_555 ? 
78  BC6 6  GLU H  131 ? GLU H 131  . ? 1_555 ? 
79  BC6 6  GLU H  212 ? GLU H 212  . ? 1_555 ? 
80  BC6 6  GLU H  220 ? GLU H 220  . ? 1_555 ? 
81  BC6 6  ADP EB .   ? ADP H 1478 . ? 1_555 ? 
82  BC6 6  HOH NC .   ? HOH H 1565 . ? 1_555 ? 
83  BC6 6  HOH NC .   ? HOH H 1597 . ? 1_555 ? 
84  BC7 5  HOH MC .   ? HOH G 1609 . ? 1_555 ? 
85  BC7 5  GLU H  129 ? GLU H 129  . ? 1_555 ? 
86  BC7 5  HIS H  269 ? HIS H 269  . ? 1_555 ? 
87  BC7 5  GLU H  357 ? GLU H 357  . ? 1_555 ? 
88  BC7 5  HOH NC .   ? HOH H 1596 . ? 1_555 ? 
89  BC8 6  GLU I  131 ? GLU I 131  . ? 1_555 ? 
90  BC8 6  GLU I  212 ? GLU I 212  . ? 1_555 ? 
91  BC8 6  GLU I  220 ? GLU I 220  . ? 1_555 ? 
92  BC8 6  ADP KB .   ? ADP I 1479 . ? 1_555 ? 
93  BC8 6  HOH OC .   ? HOH I 1567 . ? 1_555 ? 
94  BC8 6  HOH OC .   ? HOH I 1599 . ? 1_555 ? 
95  BC9 5  HOH NC .   ? HOH H 1611 . ? 1_555 ? 
96  BC9 5  GLU I  129 ? GLU I 129  . ? 1_555 ? 
97  BC9 5  HIS I  269 ? HIS I 269  . ? 1_555 ? 
98  BC9 5  GLU I  357 ? GLU I 357  . ? 1_555 ? 
99  BC9 5  HOH OC .   ? HOH I 1598 . ? 1_555 ? 
100 CC1 6  GLU J  131 ? GLU J 131  . ? 1_555 ? 
101 CC1 6  GLU J  212 ? GLU J 212  . ? 1_555 ? 
102 CC1 6  GLU J  220 ? GLU J 220  . ? 1_555 ? 
103 CC1 6  ADP QB .   ? ADP J 1480 . ? 1_555 ? 
104 CC1 6  HOH PC .   ? HOH J 1567 . ? 1_555 ? 
105 CC1 6  HOH PC .   ? HOH J 1598 . ? 1_555 ? 
106 CC2 5  HOH OC .   ? HOH I 1613 . ? 1_555 ? 
107 CC2 5  GLU J  129 ? GLU J 129  . ? 1_555 ? 
108 CC2 5  HIS J  269 ? HIS J 269  . ? 1_555 ? 
109 CC2 5  GLU J  357 ? GLU J 357  . ? 1_555 ? 
110 CC2 5  HOH PC .   ? HOH J 1597 . ? 1_555 ? 
111 CC3 6  GLU K  131 ? GLU K 131  . ? 1_555 ? 
112 CC3 6  GLU K  212 ? GLU K 212  . ? 1_555 ? 
113 CC3 6  GLU K  220 ? GLU K 220  . ? 1_555 ? 
114 CC3 6  ADP WB .   ? ADP K 1481 . ? 1_555 ? 
115 CC3 6  HOH QC .   ? HOH K 1570 . ? 1_555 ? 
116 CC3 6  HOH QC .   ? HOH K 1602 . ? 1_555 ? 
117 CC4 5  HOH PC .   ? HOH J 1612 . ? 1_555 ? 
118 CC4 5  GLU K  129 ? GLU K 129  . ? 1_555 ? 
119 CC4 5  HIS K  269 ? HIS K 269  . ? 1_555 ? 
120 CC4 5  GLU K  357 ? GLU K 357  . ? 1_555 ? 
121 CC4 5  HOH QC .   ? HOH K 1601 . ? 1_555 ? 
122 CC5 6  GLU L  131 ? GLU L 131  . ? 1_555 ? 
123 CC5 6  GLU L  212 ? GLU L 212  . ? 1_555 ? 
124 CC5 6  GLU L  220 ? GLU L 220  . ? 1_555 ? 
125 CC5 6  HOH RC .   ? HOH L 1406 . ? 1_555 ? 
126 CC5 6  HOH RC .   ? HOH L 1445 . ? 1_555 ? 
127 CC5 6  ADP CC .   ? ADP L 1482 . ? 1_555 ? 
128 CC6 5  HOH QC .   ? HOH K 1616 . ? 1_555 ? 
129 CC6 5  GLU L  129 ? GLU L 129  . ? 1_555 ? 
130 CC6 5  HIS L  269 ? HIS L 269  . ? 1_555 ? 
131 CC6 5  GLU L  357 ? GLU L 357  . ? 1_555 ? 
132 CC6 5  HOH RC .   ? HOH L 1444 . ? 1_555 ? 
133 CC7 14 GLU A  129 ? GLU A 129  . ? 1_555 ? 
134 CC7 14 GLU A  207 ? GLU A 207  . ? 1_555 ? 
135 CC7 14 HIS A  210 ? HIS A 210  . ? 1_555 ? 
136 CC7 14 GLU A  220 ? GLU A 220  . ? 1_555 ? 
137 CC7 14 THR A  223 ? THR A 223  . ? 1_555 ? 
138 CC7 14 PHE A  225 ? PHE A 225  . ? 1_555 ? 
139 CC7 14 HIS A  271 ? HIS A 271  . ? 1_555 ? 
140 CC7 14 SER A  273 ? SER A 273  . ? 1_555 ? 
141 CC7 14 ARG A  355 ? ARG A 355  . ? 1_555 ? 
142 CC7 14 MN  M  .   ? MN  A 469  . ? 1_555 ? 
143 CC7 14 HOH GC .   ? HOH A 1487 . ? 1_555 ? 
144 CC7 14 HOH GC .   ? HOH A 1550 . ? 1_555 ? 
145 CC7 14 HOH GC .   ? HOH A 1583 . ? 1_555 ? 
146 CC7 14 ASP B  50  ? ASP B 50   . ? 1_555 ? 
147 CC8 14 GLU B  129 ? GLU B 129  . ? 1_555 ? 
148 CC8 14 GLU B  207 ? GLU B 207  . ? 1_555 ? 
149 CC8 14 HIS B  210 ? HIS B 210  . ? 1_555 ? 
150 CC8 14 GLU B  220 ? GLU B 220  . ? 1_555 ? 
151 CC8 14 THR B  223 ? THR B 223  . ? 1_555 ? 
152 CC8 14 PHE B  225 ? PHE B 225  . ? 1_555 ? 
153 CC8 14 HIS B  271 ? HIS B 271  . ? 1_555 ? 
154 CC8 14 SER B  273 ? SER B 273  . ? 1_555 ? 
155 CC8 14 ARG B  355 ? ARG B 355  . ? 1_555 ? 
156 CC8 14 MN  S  .   ? MN  B 469  . ? 1_555 ? 
157 CC8 14 HOH HC .   ? HOH B 1494 . ? 1_555 ? 
158 CC8 14 HOH HC .   ? HOH B 1558 . ? 1_555 ? 
159 CC8 14 HOH HC .   ? HOH B 1590 . ? 1_555 ? 
160 CC8 14 ASP C  50  ? ASP C 50   . ? 1_555 ? 
161 CC9 14 GLU C  129 ? GLU C 129  . ? 1_555 ? 
162 CC9 14 GLU C  207 ? GLU C 207  . ? 1_555 ? 
163 CC9 14 HIS C  210 ? HIS C 210  . ? 1_555 ? 
164 CC9 14 GLU C  220 ? GLU C 220  . ? 1_555 ? 
165 CC9 14 THR C  223 ? THR C 223  . ? 1_555 ? 
166 CC9 14 PHE C  225 ? PHE C 225  . ? 1_555 ? 
167 CC9 14 HIS C  271 ? HIS C 271  . ? 1_555 ? 
168 CC9 14 SER C  273 ? SER C 273  . ? 1_555 ? 
169 CC9 14 ARG C  355 ? ARG C 355  . ? 1_555 ? 
170 CC9 14 MN  Y  .   ? MN  C 469  . ? 1_555 ? 
171 CC9 14 HOH IC .   ? HOH C 1496 . ? 1_555 ? 
172 CC9 14 HOH IC .   ? HOH C 1560 . ? 1_555 ? 
173 CC9 14 ASP D  50  ? ASP D 50   . ? 1_555 ? 
174 CC9 14 HOH JC .   ? HOH D 1494 . ? 1_555 ? 
175 DC1 14 GLU D  129 ? GLU D 129  . ? 1_555 ? 
176 DC1 14 GLU D  207 ? GLU D 207  . ? 1_555 ? 
177 DC1 14 HIS D  210 ? HIS D 210  . ? 1_555 ? 
178 DC1 14 GLU D  220 ? GLU D 220  . ? 1_555 ? 
179 DC1 14 THR D  223 ? THR D 223  . ? 1_555 ? 
180 DC1 14 PHE D  225 ? PHE D 225  . ? 1_555 ? 
181 DC1 14 HIS D  271 ? HIS D 271  . ? 1_555 ? 
182 DC1 14 SER D  273 ? SER D 273  . ? 1_555 ? 
183 DC1 14 ARG D  355 ? ARG D 355  . ? 1_555 ? 
184 DC1 14 MN  EA .   ? MN  D 469  . ? 1_555 ? 
185 DC1 14 HOH JC .   ? HOH D 1498 . ? 1_555 ? 
186 DC1 14 HOH JC .   ? HOH D 1562 . ? 1_555 ? 
187 DC1 14 HOH JC .   ? HOH D 1595 . ? 1_555 ? 
188 DC1 14 ASP E  50  ? ASP E 50   . ? 1_555 ? 
189 DC2 14 GLU E  129 ? GLU E 129  . ? 1_555 ? 
190 DC2 14 GLU E  207 ? GLU E 207  . ? 1_555 ? 
191 DC2 14 HIS E  210 ? HIS E 210  . ? 1_555 ? 
192 DC2 14 GLU E  220 ? GLU E 220  . ? 1_555 ? 
193 DC2 14 THR E  223 ? THR E 223  . ? 1_555 ? 
194 DC2 14 PHE E  225 ? PHE E 225  . ? 1_555 ? 
195 DC2 14 HIS E  271 ? HIS E 271  . ? 1_555 ? 
196 DC2 14 SER E  273 ? SER E 273  . ? 1_555 ? 
197 DC2 14 ARG E  355 ? ARG E 355  . ? 1_555 ? 
198 DC2 14 MN  KA .   ? MN  E 469  . ? 1_555 ? 
199 DC2 14 HOH KC .   ? HOH E 1497 . ? 1_555 ? 
200 DC2 14 HOH KC .   ? HOH E 1560 . ? 1_555 ? 
201 DC2 14 HOH KC .   ? HOH E 1592 . ? 1_555 ? 
202 DC2 14 ASP F  50  ? ASP F 50   . ? 1_555 ? 
203 DC3 14 ASP A  50  ? ASP A 50   . ? 1_555 ? 
204 DC3 14 GLU F  129 ? GLU F 129  . ? 1_555 ? 
205 DC3 14 GLU F  207 ? GLU F 207  . ? 1_555 ? 
206 DC3 14 HIS F  210 ? HIS F 210  . ? 1_555 ? 
207 DC3 14 GLU F  220 ? GLU F 220  . ? 1_555 ? 
208 DC3 14 THR F  223 ? THR F 223  . ? 1_555 ? 
209 DC3 14 PHE F  225 ? PHE F 225  . ? 1_555 ? 
210 DC3 14 HIS F  271 ? HIS F 271  . ? 1_555 ? 
211 DC3 14 SER F  273 ? SER F 273  . ? 1_555 ? 
212 DC3 14 ARG F  355 ? ARG F 355  . ? 1_555 ? 
213 DC3 14 MN  QA .   ? MN  F 469  . ? 1_555 ? 
214 DC3 14 HOH LC .   ? HOH F 1500 . ? 1_555 ? 
215 DC3 14 HOH LC .   ? HOH F 1565 . ? 1_555 ? 
216 DC3 14 HOH LC .   ? HOH F 1597 . ? 1_555 ? 
217 DC4 14 GLU G  129 ? GLU G 129  . ? 1_555 ? 
218 DC4 14 GLU G  207 ? GLU G 207  . ? 1_555 ? 
219 DC4 14 HIS G  210 ? HIS G 210  . ? 1_555 ? 
220 DC4 14 GLU G  220 ? GLU G 220  . ? 1_555 ? 
221 DC4 14 THR G  223 ? THR G 223  . ? 1_555 ? 
222 DC4 14 PHE G  225 ? PHE G 225  . ? 1_555 ? 
223 DC4 14 HIS G  271 ? HIS G 271  . ? 1_555 ? 
224 DC4 14 SER G  273 ? SER G 273  . ? 1_555 ? 
225 DC4 14 ARG G  355 ? ARG G 355  . ? 1_555 ? 
226 DC4 14 MN  WA .   ? MN  G 469  . ? 1_555 ? 
227 DC4 14 HOH MC .   ? HOH G 1501 . ? 1_555 ? 
228 DC4 14 HOH MC .   ? HOH G 1565 . ? 1_555 ? 
229 DC4 14 HOH MC .   ? HOH G 1597 . ? 1_555 ? 
230 DC4 14 ASP L  50  ? ASP L 50   . ? 1_555 ? 
231 DC5 14 ASP G  50  ? ASP G 50   . ? 1_555 ? 
232 DC5 14 GLU H  129 ? GLU H 129  . ? 1_555 ? 
233 DC5 14 GLU H  207 ? GLU H 207  . ? 1_555 ? 
234 DC5 14 HIS H  210 ? HIS H 210  . ? 1_555 ? 
235 DC5 14 GLU H  220 ? GLU H 220  . ? 1_555 ? 
236 DC5 14 THR H  223 ? THR H 223  . ? 1_555 ? 
237 DC5 14 PHE H  225 ? PHE H 225  . ? 1_555 ? 
238 DC5 14 HIS H  271 ? HIS H 271  . ? 1_555 ? 
239 DC5 14 SER H  273 ? SER H 273  . ? 1_555 ? 
240 DC5 14 ARG H  355 ? ARG H 355  . ? 1_555 ? 
241 DC5 14 MN  CB .   ? MN  H 469  . ? 1_555 ? 
242 DC5 14 HOH NC .   ? HOH H 1500 . ? 1_555 ? 
243 DC5 14 HOH NC .   ? HOH H 1565 . ? 1_555 ? 
244 DC5 14 HOH NC .   ? HOH H 1597 . ? 1_555 ? 
245 DC6 14 ASP H  50  ? ASP H 50   . ? 1_555 ? 
246 DC6 14 GLU I  129 ? GLU I 129  . ? 1_555 ? 
247 DC6 14 GLU I  207 ? GLU I 207  . ? 1_555 ? 
248 DC6 14 HIS I  210 ? HIS I 210  . ? 1_555 ? 
249 DC6 14 GLU I  220 ? GLU I 220  . ? 1_555 ? 
250 DC6 14 THR I  223 ? THR I 223  . ? 1_555 ? 
251 DC6 14 PHE I  225 ? PHE I 225  . ? 1_555 ? 
252 DC6 14 HIS I  271 ? HIS I 271  . ? 1_555 ? 
253 DC6 14 SER I  273 ? SER I 273  . ? 1_555 ? 
254 DC6 14 ARG I  355 ? ARG I 355  . ? 1_555 ? 
255 DC6 14 MN  IB .   ? MN  I 469  . ? 1_555 ? 
256 DC6 14 HOH OC .   ? HOH I 1503 . ? 1_555 ? 
257 DC6 14 HOH OC .   ? HOH I 1567 . ? 1_555 ? 
258 DC6 14 HOH OC .   ? HOH I 1599 . ? 1_555 ? 
259 DC7 14 ASP I  50  ? ASP I 50   . ? 1_555 ? 
260 DC7 14 GLU J  129 ? GLU J 129  . ? 1_555 ? 
261 DC7 14 GLU J  207 ? GLU J 207  . ? 1_555 ? 
262 DC7 14 HIS J  210 ? HIS J 210  . ? 1_555 ? 
263 DC7 14 GLU J  220 ? GLU J 220  . ? 1_555 ? 
264 DC7 14 THR J  223 ? THR J 223  . ? 1_555 ? 
265 DC7 14 PHE J  225 ? PHE J 225  . ? 1_555 ? 
266 DC7 14 HIS J  271 ? HIS J 271  . ? 1_555 ? 
267 DC7 14 SER J  273 ? SER J 273  . ? 1_555 ? 
268 DC7 14 ARG J  355 ? ARG J 355  . ? 1_555 ? 
269 DC7 14 MN  OB .   ? MN  J 469  . ? 1_555 ? 
270 DC7 14 HOH PC .   ? HOH J 1503 . ? 1_555 ? 
271 DC7 14 HOH PC .   ? HOH J 1567 . ? 1_555 ? 
272 DC7 14 HOH PC .   ? HOH J 1598 . ? 1_555 ? 
273 DC8 14 ASP J  50  ? ASP J 50   . ? 1_555 ? 
274 DC8 14 GLU K  129 ? GLU K 129  . ? 1_555 ? 
275 DC8 14 GLU K  207 ? GLU K 207  . ? 1_555 ? 
276 DC8 14 HIS K  210 ? HIS K 210  . ? 1_555 ? 
277 DC8 14 GLU K  220 ? GLU K 220  . ? 1_555 ? 
278 DC8 14 THR K  223 ? THR K 223  . ? 1_555 ? 
279 DC8 14 PHE K  225 ? PHE K 225  . ? 1_555 ? 
280 DC8 14 HIS K  271 ? HIS K 271  . ? 1_555 ? 
281 DC8 14 SER K  273 ? SER K 273  . ? 1_555 ? 
282 DC8 14 ARG K  355 ? ARG K 355  . ? 1_555 ? 
283 DC8 14 MN  UB .   ? MN  K 469  . ? 1_555 ? 
284 DC8 14 HOH QC .   ? HOH K 1507 . ? 1_555 ? 
285 DC8 14 HOH QC .   ? HOH K 1570 . ? 1_555 ? 
286 DC8 14 HOH QC .   ? HOH K 1602 . ? 1_555 ? 
287 DC9 14 ASP K  50  ? ASP K 50   . ? 1_555 ? 
288 DC9 14 GLU L  129 ? GLU L 129  . ? 1_555 ? 
289 DC9 14 GLU L  207 ? GLU L 207  . ? 1_555 ? 
290 DC9 14 HIS L  210 ? HIS L 210  . ? 1_555 ? 
291 DC9 14 GLU L  220 ? GLU L 220  . ? 1_555 ? 
292 DC9 14 THR L  223 ? THR L 223  . ? 1_555 ? 
293 DC9 14 PHE L  225 ? PHE L 225  . ? 1_555 ? 
294 DC9 14 HIS L  271 ? HIS L 271  . ? 1_555 ? 
295 DC9 14 SER L  273 ? SER L 273  . ? 1_555 ? 
296 DC9 14 ARG L  355 ? ARG L 355  . ? 1_555 ? 
297 DC9 14 MN  AC .   ? MN  L 469  . ? 1_555 ? 
298 DC9 14 HOH RC .   ? HOH L 1336 . ? 1_555 ? 
299 DC9 14 HOH RC .   ? HOH L 1406 . ? 1_555 ? 
300 DC9 14 HOH RC .   ? HOH L 1445 . ? 1_555 ? 
301 EC1 4  TYR A  179 ? TYR A 179  . ? 1_555 ? 
302 EC1 4  GLU A  212 ? GLU A 212  . ? 1_555 ? 
303 EC1 4  ASP B  50  ? ASP B 50   . ? 1_555 ? 
304 EC1 4  SER B  53  ? SER B 53   . ? 1_555 ? 
305 EC2 4  GLU A  131 ? GLU A 131  . ? 1_555 ? 
306 EC2 4  ASN A  264 ? ASN A 264  . ? 1_555 ? 
307 EC2 4  GLY A  265 ? GLY A 265  . ? 1_555 ? 
308 EC2 4  HOH GC .   ? HOH A 1584 . ? 1_555 ? 
309 EC3 4  TYR B  179 ? TYR B 179  . ? 1_555 ? 
310 EC3 4  GLU B  212 ? GLU B 212  . ? 1_555 ? 
311 EC3 4  ASP C  50  ? ASP C 50   . ? 1_555 ? 
312 EC3 4  SER C  53  ? SER C 53   . ? 1_555 ? 
313 EC4 4  GLU B  131 ? GLU B 131  . ? 1_555 ? 
314 EC4 4  ASN B  264 ? ASN B 264  . ? 1_555 ? 
315 EC4 4  GLY B  265 ? GLY B 265  . ? 1_555 ? 
316 EC4 4  HOH HC .   ? HOH B 1591 . ? 1_555 ? 
317 EC5 4  TYR C  179 ? TYR C 179  . ? 1_555 ? 
318 EC5 4  GLU C  212 ? GLU C 212  . ? 1_555 ? 
319 EC5 4  ASP D  50  ? ASP D 50   . ? 1_555 ? 
320 EC5 4  SER D  53  ? SER D 53   . ? 1_555 ? 
321 EC6 4  GLU C  131 ? GLU C 131  . ? 1_555 ? 
322 EC6 4  ASN C  264 ? ASN C 264  . ? 1_555 ? 
323 EC6 4  GLY C  265 ? GLY C 265  . ? 1_555 ? 
324 EC6 4  HOH IC .   ? HOH C 1591 . ? 1_555 ? 
325 EC7 4  TYR D  179 ? TYR D 179  . ? 1_555 ? 
326 EC7 4  GLU D  212 ? GLU D 212  . ? 1_555 ? 
327 EC7 4  ASP E  50  ? ASP E 50   . ? 1_555 ? 
328 EC7 4  SER E  53  ? SER E 53   . ? 1_555 ? 
329 EC8 4  GLU D  131 ? GLU D 131  . ? 1_555 ? 
330 EC8 4  ASN D  264 ? ASN D 264  . ? 1_555 ? 
331 EC8 4  GLY D  265 ? GLY D 265  . ? 1_555 ? 
332 EC8 4  HOH JC .   ? HOH D 1596 . ? 1_555 ? 
333 EC9 4  TYR E  179 ? TYR E 179  . ? 1_555 ? 
334 EC9 4  GLU E  212 ? GLU E 212  . ? 1_555 ? 
335 EC9 4  ASP F  50  ? ASP F 50   . ? 1_555 ? 
336 EC9 4  SER F  53  ? SER F 53   . ? 1_555 ? 
337 FC1 4  GLU E  131 ? GLU E 131  . ? 1_555 ? 
338 FC1 4  ASN E  264 ? ASN E 264  . ? 1_555 ? 
339 FC1 4  GLY E  265 ? GLY E 265  . ? 1_555 ? 
340 FC1 4  HOH KC .   ? HOH E 1593 . ? 1_555 ? 
341 FC2 4  ASP A  50  ? ASP A 50   . ? 1_555 ? 
342 FC2 4  SER A  53  ? SER A 53   . ? 1_555 ? 
343 FC2 4  TYR F  179 ? TYR F 179  . ? 1_555 ? 
344 FC2 4  GLU F  212 ? GLU F 212  . ? 1_555 ? 
345 FC3 4  GLU F  131 ? GLU F 131  . ? 1_555 ? 
346 FC3 4  ASN F  264 ? ASN F 264  . ? 1_555 ? 
347 FC3 4  GLY F  265 ? GLY F 265  . ? 1_555 ? 
348 FC3 4  HOH LC .   ? HOH F 1598 . ? 1_555 ? 
349 FC4 4  TYR G  179 ? TYR G 179  . ? 1_555 ? 
350 FC4 4  GLU G  212 ? GLU G 212  . ? 1_555 ? 
351 FC4 4  ASP L  50  ? ASP L 50   . ? 1_555 ? 
352 FC4 4  SER L  53  ? SER L 53   . ? 1_555 ? 
353 FC5 4  GLU G  131 ? GLU G 131  . ? 1_555 ? 
354 FC5 4  ASN G  264 ? ASN G 264  . ? 1_555 ? 
355 FC5 4  GLY G  265 ? GLY G 265  . ? 1_555 ? 
356 FC5 4  HOH MC .   ? HOH G 1598 . ? 1_555 ? 
357 FC6 4  ASP G  50  ? ASP G 50   . ? 1_555 ? 
358 FC6 4  SER G  53  ? SER G 53   . ? 1_555 ? 
359 FC6 4  TYR H  179 ? TYR H 179  . ? 1_555 ? 
360 FC6 4  GLU H  212 ? GLU H 212  . ? 1_555 ? 
361 FC7 4  GLU H  131 ? GLU H 131  . ? 1_555 ? 
362 FC7 4  ASN H  264 ? ASN H 264  . ? 1_555 ? 
363 FC7 4  GLY H  265 ? GLY H 265  . ? 1_555 ? 
364 FC7 4  HOH NC .   ? HOH H 1598 . ? 1_555 ? 
365 FC8 4  ASP H  50  ? ASP H 50   . ? 1_555 ? 
366 FC8 4  SER H  53  ? SER H 53   . ? 1_555 ? 
367 FC8 4  TYR I  179 ? TYR I 179  . ? 1_555 ? 
368 FC8 4  GLU I  212 ? GLU I 212  . ? 1_555 ? 
369 FC9 4  GLU I  131 ? GLU I 131  . ? 1_555 ? 
370 FC9 4  ASN I  264 ? ASN I 264  . ? 1_555 ? 
371 FC9 4  GLY I  265 ? GLY I 265  . ? 1_555 ? 
372 FC9 4  HOH OC .   ? HOH I 1600 . ? 1_555 ? 
373 GC1 4  ASP I  50  ? ASP I 50   . ? 1_555 ? 
374 GC1 4  SER I  53  ? SER I 53   . ? 1_555 ? 
375 GC1 4  TYR J  179 ? TYR J 179  . ? 1_555 ? 
376 GC1 4  GLU J  212 ? GLU J 212  . ? 1_555 ? 
377 GC2 4  GLU J  131 ? GLU J 131  . ? 1_555 ? 
378 GC2 4  ASN J  264 ? ASN J 264  . ? 1_555 ? 
379 GC2 4  GLY J  265 ? GLY J 265  . ? 1_555 ? 
380 GC2 4  HOH PC .   ? HOH J 1599 . ? 1_555 ? 
381 GC3 4  ASP J  50  ? ASP J 50   . ? 1_555 ? 
382 GC3 4  SER J  53  ? SER J 53   . ? 1_555 ? 
383 GC3 4  TYR K  179 ? TYR K 179  . ? 1_555 ? 
384 GC3 4  GLU K  212 ? GLU K 212  . ? 1_555 ? 
385 GC4 4  GLU K  131 ? GLU K 131  . ? 1_555 ? 
386 GC4 4  ASN K  264 ? ASN K 264  . ? 1_555 ? 
387 GC4 4  GLY K  265 ? GLY K 265  . ? 1_555 ? 
388 GC4 4  HOH QC .   ? HOH K 1603 . ? 1_555 ? 
389 GC5 4  ASP K  50  ? ASP K 50   . ? 1_555 ? 
390 GC5 4  SER K  53  ? SER K 53   . ? 1_555 ? 
391 GC5 4  TYR L  179 ? TYR L 179  . ? 1_555 ? 
392 GC5 4  GLU L  212 ? GLU L 212  . ? 1_555 ? 
393 GC6 4  GLU L  131 ? GLU L 131  . ? 1_555 ? 
394 GC6 4  ASN L  264 ? ASN L 264  . ? 1_555 ? 
395 GC6 4  GLY L  265 ? GLY L 265  . ? 1_555 ? 
396 GC6 4  HOH RC .   ? HOH L 1446 . ? 1_555 ? 
397 GC7 8  PHE A  16  ? PHE A 16   . ? 1_555 ? 
398 GC7 8  PHE A  80  ? PHE A 80   . ? 1_555 ? 
399 GC7 8  ALA A  81  ? ALA A 81   . ? 1_555 ? 
400 GC7 8  ASP A  82  ? ASP A 82   . ? 1_555 ? 
401 GC7 8  THR A  84  ? THR A 84   . ? 1_555 ? 
402 GC7 8  GLN F  189 ? GLN F 189  . ? 1_555 ? 
403 GC7 8  ASP F  190 ? ASP F 190  . ? 1_555 ? 
404 GC7 8  SER F  193 ? SER F 193  . ? 1_555 ? 
405 GC8 8  GLN A  189 ? GLN A 189  . ? 1_555 ? 
406 GC8 8  ASP A  190 ? ASP A 190  . ? 1_555 ? 
407 GC8 8  SER A  193 ? SER A 193  . ? 1_555 ? 
408 GC8 8  PHE B  16  ? PHE B 16   . ? 1_555 ? 
409 GC8 8  PHE B  80  ? PHE B 80   . ? 1_555 ? 
410 GC8 8  ALA B  81  ? ALA B 81   . ? 1_555 ? 
411 GC8 8  ASP B  82  ? ASP B 82   . ? 1_555 ? 
412 GC8 8  THR B  84  ? THR B 84   . ? 1_555 ? 
413 GC9 8  GLN B  189 ? GLN B 189  . ? 1_555 ? 
414 GC9 8  ASP B  190 ? ASP B 190  . ? 1_555 ? 
415 GC9 8  SER B  193 ? SER B 193  . ? 1_555 ? 
416 GC9 8  PHE C  16  ? PHE C 16   . ? 1_555 ? 
417 GC9 8  PHE C  80  ? PHE C 80   . ? 1_555 ? 
418 GC9 8  ALA C  81  ? ALA C 81   . ? 1_555 ? 
419 GC9 8  ASP C  82  ? ASP C 82   . ? 1_555 ? 
420 GC9 8  THR C  84  ? THR C 84   . ? 1_555 ? 
421 HC1 8  GLN C  189 ? GLN C 189  . ? 1_555 ? 
422 HC1 8  ASP C  190 ? ASP C 190  . ? 1_555 ? 
423 HC1 8  SER C  193 ? SER C 193  . ? 1_555 ? 
424 HC1 8  PHE D  16  ? PHE D 16   . ? 1_555 ? 
425 HC1 8  PHE D  80  ? PHE D 80   . ? 1_555 ? 
426 HC1 8  ALA D  81  ? ALA D 81   . ? 1_555 ? 
427 HC1 8  ASP D  82  ? ASP D 82   . ? 1_555 ? 
428 HC1 8  THR D  84  ? THR D 84   . ? 1_555 ? 
429 HC2 8  GLN D  189 ? GLN D 189  . ? 1_555 ? 
430 HC2 8  ASP D  190 ? ASP D 190  . ? 1_555 ? 
431 HC2 8  SER D  193 ? SER D 193  . ? 1_555 ? 
432 HC2 8  PHE E  16  ? PHE E 16   . ? 1_555 ? 
433 HC2 8  PHE E  80  ? PHE E 80   . ? 1_555 ? 
434 HC2 8  ALA E  81  ? ALA E 81   . ? 1_555 ? 
435 HC2 8  ASP E  82  ? ASP E 82   . ? 1_555 ? 
436 HC2 8  THR E  84  ? THR E 84   . ? 1_555 ? 
437 HC3 8  GLN E  189 ? GLN E 189  . ? 1_555 ? 
438 HC3 8  ASP E  190 ? ASP E 190  . ? 1_555 ? 
439 HC3 8  SER E  193 ? SER E 193  . ? 1_555 ? 
440 HC3 8  PHE F  16  ? PHE F 16   . ? 1_555 ? 
441 HC3 8  PHE F  80  ? PHE F 80   . ? 1_555 ? 
442 HC3 8  ALA F  81  ? ALA F 81   . ? 1_555 ? 
443 HC3 8  ASP F  82  ? ASP F 82   . ? 1_555 ? 
444 HC3 8  THR F  84  ? THR F 84   . ? 1_555 ? 
445 HC4 8  PHE G  16  ? PHE G 16   . ? 1_555 ? 
446 HC4 8  PHE G  80  ? PHE G 80   . ? 1_555 ? 
447 HC4 8  ALA G  81  ? ALA G 81   . ? 1_555 ? 
448 HC4 8  ASP G  82  ? ASP G 82   . ? 1_555 ? 
449 HC4 8  THR G  84  ? THR G 84   . ? 1_555 ? 
450 HC4 8  GLN H  189 ? GLN H 189  . ? 1_555 ? 
451 HC4 8  ASP H  190 ? ASP H 190  . ? 1_555 ? 
452 HC4 8  SER H  193 ? SER H 193  . ? 1_555 ? 
453 HC5 9  PHE H  16  ? PHE H 16   . ? 1_555 ? 
454 HC5 9  PHE H  80  ? PHE H 80   . ? 1_555 ? 
455 HC5 9  ALA H  81  ? ALA H 81   . ? 1_555 ? 
456 HC5 9  ASP H  82  ? ASP H 82   . ? 1_555 ? 
457 HC5 9  THR H  84  ? THR H 84   . ? 1_555 ? 
458 HC5 9  HOH NC .   ? HOH H 1606 . ? 1_555 ? 
459 HC5 9  GLN I  189 ? GLN I 189  . ? 1_555 ? 
460 HC5 9  ASP I  190 ? ASP I 190  . ? 1_555 ? 
461 HC5 9  SER I  193 ? SER I 193  . ? 1_555 ? 
462 HC6 8  PHE I  16  ? PHE I 16   . ? 1_555 ? 
463 HC6 8  PHE I  80  ? PHE I 80   . ? 1_555 ? 
464 HC6 8  ALA I  81  ? ALA I 81   . ? 1_555 ? 
465 HC6 8  ASP I  82  ? ASP I 82   . ? 1_555 ? 
466 HC6 8  THR I  84  ? THR I 84   . ? 1_555 ? 
467 HC6 8  GLN J  189 ? GLN J 189  . ? 1_555 ? 
468 HC6 8  ASP J  190 ? ASP J 190  . ? 1_555 ? 
469 HC6 8  SER J  193 ? SER J 193  . ? 1_555 ? 
470 HC7 8  PHE J  16  ? PHE J 16   . ? 1_555 ? 
471 HC7 8  PHE J  80  ? PHE J 80   . ? 1_555 ? 
472 HC7 8  ALA J  81  ? ALA J 81   . ? 1_555 ? 
473 HC7 8  ASP J  82  ? ASP J 82   . ? 1_555 ? 
474 HC7 8  THR J  84  ? THR J 84   . ? 1_555 ? 
475 HC7 8  GLN K  189 ? GLN K 189  . ? 1_555 ? 
476 HC7 8  ASP K  190 ? ASP K 190  . ? 1_555 ? 
477 HC7 8  SER K  193 ? SER K 193  . ? 1_555 ? 
478 HC8 8  PHE K  16  ? PHE K 16   . ? 1_555 ? 
479 HC8 8  PHE K  80  ? PHE K 80   . ? 1_555 ? 
480 HC8 8  ALA K  81  ? ALA K 81   . ? 1_555 ? 
481 HC8 8  ASP K  82  ? ASP K 82   . ? 1_555 ? 
482 HC8 8  THR K  84  ? THR K 84   . ? 1_555 ? 
483 HC8 8  GLN L  189 ? GLN L 189  . ? 1_555 ? 
484 HC8 8  ASP L  190 ? ASP L 190  . ? 1_555 ? 
485 HC8 8  SER L  193 ? SER L 193  . ? 1_555 ? 
486 HC9 9  GLN G  189 ? GLN G 189  . ? 1_555 ? 
487 HC9 9  ASP G  190 ? ASP G 190  . ? 1_555 ? 
488 HC9 9  SER G  193 ? SER G 193  . ? 1_555 ? 
489 HC9 9  PHE L  16  ? PHE L 16   . ? 1_555 ? 
490 HC9 9  PHE L  80  ? PHE L 80   . ? 1_555 ? 
491 HC9 9  ALA L  81  ? ALA L 81   . ? 1_555 ? 
492 HC9 9  ASP L  82  ? ASP L 82   . ? 1_555 ? 
493 HC9 9  THR L  84  ? THR L 84   . ? 1_555 ? 
494 HC9 9  HOH RC .   ? HOH L 733  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1F1H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1F1H 
_atom_sites.fract_transf_matrix[1][1]   0.00433 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00095 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.00753 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.00520 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
TL 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1 1   ? -86.271  -11.009 -96.949  0.98 91.54  ? 1    SER A N     1 
ATOM   2     C  CA    . SER A  1 1   ? -87.012  -12.250 -96.767  0.98 95.36  ? 1    SER A CA    1 
ATOM   3     C  C     . SER A  1 1   ? -86.152  -13.437 -97.096  0.98 85.20  ? 1    SER A C     1 
ATOM   4     O  O     . SER A  1 1   ? -84.972  -13.313 -97.429  0.98 88.00  ? 1    SER A O     1 
ATOM   5     C  CB    . SER A  1 1   ? -88.282  -12.245 -97.607  0.98 93.37  ? 1    SER A CB    1 
ATOM   6     O  OG    . SER A  1 1   ? -88.180  -13.163 -98.682  0.98 90.73  ? 1    SER A OG    1 
ATOM   7     N  N     . ALA A  1 2   ? -86.754  -14.611 -96.987  0.98 80.68  ? 2    ALA A N     1 
ATOM   8     C  CA    . ALA A  1 2   ? -86.040  -15.823 -97.265  0.98 60.75  ? 2    ALA A CA    1 
ATOM   9     C  C     . ALA A  1 2   ? -85.103  -15.717 -98.464  0.98 64.48  ? 2    ALA A C     1 
ATOM   10    O  O     . ALA A  1 2   ? -83.905  -15.951 -98.324  0.98 59.63  ? 2    ALA A O     1 
ATOM   11    C  CB    . ALA A  1 2   ? -87.014  -16.965 -97.493  0.98 58.77  ? 2    ALA A CB    1 
ATOM   12    N  N     . GLU A  1 3   ? -85.619  -15.358 -99.647  0.98 87.84  ? 3    GLU A N     1 
ATOM   13    C  CA    . GLU A  1 3   ? -84.843  -15.344 -100.869 0.98 87.63  ? 3    GLU A CA    1 
ATOM   14    C  C     . GLU A  1 3   ? -83.615  -14.417 -100.681 0.98 78.47  ? 3    GLU A C     1 
ATOM   15    O  O     . GLU A  1 3   ? -82.471  -14.835 -100.897 0.98 57.02  ? 3    GLU A O     1 
ATOM   16    C  CB    . GLU A  1 3   ? -85.811  -14.908 -102.003 0.98 100.00 ? 3    GLU A CB    1 
ATOM   17    C  CG    . GLU A  1 3   ? -85.257  -14.038 -103.139 0.98 100.00 ? 3    GLU A CG    1 
ATOM   18    C  CD    . GLU A  1 3   ? -84.189  -14.734 -103.985 0.98 100.00 ? 3    GLU A CD    1 
ATOM   19    O  OE1   . GLU A  1 3   ? -83.514  -14.025 -104.775 0.98 100.00 ? 3    GLU A OE1   1 
ATOM   20    O  OE2   . GLU A  1 3   ? -84.019  -15.976 -103.857 0.98 100.00 ? 3    GLU A OE2   1 
ATOM   21    N  N     . HIS A  1 4   ? -83.866  -13.204 -100.182 0.98 78.57  ? 4    HIS A N     1 
ATOM   22    C  CA    . HIS A  1 4   ? -82.835  -12.188 -99.925  0.98 74.33  ? 4    HIS A CA    1 
ATOM   23    C  C     . HIS A  1 4   ? -81.795  -12.631 -98.894  0.98 70.90  ? 4    HIS A C     1 
ATOM   24    O  O     . HIS A  1 4   ? -80.602  -12.402 -99.072  0.98 71.84  ? 4    HIS A O     1 
ATOM   25    C  CB    . HIS A  1 4   ? -83.511  -10.883 -99.464  0.98 86.94  ? 4    HIS A CB    1 
ATOM   26    C  CG    . HIS A  1 4   ? -82.574  -9.865  -98.877  0.98 100.00 ? 4    HIS A CG    1 
ATOM   27    N  ND1   . HIS A  1 4   ? -82.766  -9.316  -97.625  0.98 100.00 ? 4    HIS A ND1   1 
ATOM   28    C  CD2   . HIS A  1 4   ? -81.469  -9.263  -99.385  0.98 92.27  ? 4    HIS A CD2   1 
ATOM   29    C  CE1   . HIS A  1 4   ? -81.825  -8.418  -97.389  0.98 100.00 ? 4    HIS A CE1   1 
ATOM   30    N  NE2   . HIS A  1 4   ? -81.026  -8.367  -98.440  0.98 96.44  ? 4    HIS A NE2   1 
ATOM   31    N  N     . VAL A  1 5   ? -82.256  -13.248 -97.810  0.98 63.23  ? 5    VAL A N     1 
ATOM   32    C  CA    . VAL A  1 5   ? -81.371  -13.711 -96.751  0.98 35.97  ? 5    VAL A CA    1 
ATOM   33    C  C     . VAL A  1 5   ? -80.284  -14.663 -97.246  0.98 60.89  ? 5    VAL A C     1 
ATOM   34    O  O     . VAL A  1 5   ? -79.120  -14.525 -96.849  0.98 61.74  ? 5    VAL A O     1 
ATOM   35    C  CB    . VAL A  1 5   ? -82.169  -14.364 -95.603  0.98 43.20  ? 5    VAL A CB    1 
ATOM   36    C  CG1   . VAL A  1 5   ? -81.246  -15.115 -94.649  0.98 25.94  ? 5    VAL A CG1   1 
ATOM   37    C  CG2   . VAL A  1 5   ? -82.951  -13.298 -94.844  0.98 31.77  ? 5    VAL A CG2   1 
ATOM   38    N  N     . LEU A  1 6   ? -80.645  -15.622 -98.104  0.98 63.75  ? 6    LEU A N     1 
ATOM   39    C  CA    . LEU A  1 6   ? -79.648  -16.561 -98.630  0.98 57.28  ? 6    LEU A CA    1 
ATOM   40    C  C     . LEU A  1 6   ? -78.562  -15.816 -99.427  0.98 60.80  ? 6    LEU A C     1 
ATOM   41    O  O     . LEU A  1 6   ? -77.421  -16.276 -99.521  0.98 66.27  ? 6    LEU A O     1 
ATOM   42    C  CB    . LEU A  1 6   ? -80.298  -17.673 -99.464  0.98 53.84  ? 6    LEU A CB    1 
ATOM   43    C  CG    . LEU A  1 6   ? -80.910  -18.939 -98.809  0.98 71.48  ? 6    LEU A CG    1 
ATOM   44    C  CD1   . LEU A  1 6   ? -79.974  -19.455 -97.736  0.98 75.37  ? 6    LEU A CD1   1 
ATOM   45    C  CD2   . LEU A  1 6   ? -82.301  -18.725 -98.221  0.98 60.22  ? 6    LEU A CD2   1 
ATOM   46    N  N     . THR A  1 7   ? -78.910  -14.634 -99.939  0.98 65.70  ? 7    THR A N     1 
ATOM   47    C  CA    . THR A  1 7   ? -77.976  -13.793 -100.692 0.98 76.39  ? 7    THR A CA    1 
ATOM   48    C  C     . THR A  1 7   ? -76.949  -13.220 -99.722  0.98 70.50  ? 7    THR A C     1 
ATOM   49    O  O     . THR A  1 7   ? -75.749  -13.420 -99.901  0.98 81.02  ? 7    THR A O     1 
ATOM   50    C  CB    . THR A  1 7   ? -78.711  -12.620 -101.423 0.98 92.18  ? 7    THR A CB    1 
ATOM   51    O  OG1   . THR A  1 7   ? -79.537  -13.151 -102.471 0.98 100.00 ? 7    THR A OG1   1 
ATOM   52    C  CG2   . THR A  1 7   ? -77.713  -11.597 -102.011 0.98 66.42  ? 7    THR A CG2   1 
ATOM   53    N  N     . MET A  1 8   ? -77.436  -12.537 -98.683  0.98 71.94  ? 8    MET A N     1 
ATOM   54    C  CA    . MET A  1 8   ? -76.583  -11.934 -97.654  0.98 60.99  ? 8    MET A CA    1 
ATOM   55    C  C     . MET A  1 8   ? -75.605  -12.924 -97.036  0.98 54.14  ? 8    MET A C     1 
ATOM   56    O  O     . MET A  1 8   ? -74.510  -12.537 -96.626  0.98 57.61  ? 8    MET A O     1 
ATOM   57    C  CB    . MET A  1 8   ? -77.422  -11.297 -96.546  0.98 38.10  ? 8    MET A CB    1 
ATOM   58    C  CG    . MET A  1 8   ? -78.152  -10.037 -96.975  0.98 61.48  ? 8    MET A CG    1 
ATOM   59    S  SD    . MET A  1 8   ? -78.852  -9.119  -95.580  0.98 71.20  ? 8    MET A SD    1 
ATOM   60    C  CE    . MET A  1 8   ? -77.635  -7.792  -95.385  0.98 76.50  ? 8    MET A CE    1 
ATOM   61    N  N     . LEU A  1 9   ? -75.987  -14.198 -96.979  0.98 50.81  ? 9    LEU A N     1 
ATOM   62    C  CA    . LEU A  1 9   ? -75.099  -15.209 -96.421  0.98 55.55  ? 9    LEU A CA    1 
ATOM   63    C  C     . LEU A  1 9   ? -73.812  -15.335 -97.237  0.98 61.74  ? 9    LEU A C     1 
ATOM   64    O  O     . LEU A  1 9   ? -72.722  -15.450 -96.672  0.98 70.99  ? 9    LEU A O     1 
ATOM   65    C  CB    . LEU A  1 9   ? -75.817  -16.558 -96.276  0.98 41.30  ? 9    LEU A CB    1 
ATOM   66    C  CG    . LEU A  1 9   ? -76.947  -16.561 -95.227  0.98 35.72  ? 9    LEU A CG    1 
ATOM   67    C  CD1   . LEU A  1 9   ? -77.586  -17.919 -95.147  0.98 35.72  ? 9    LEU A CD1   1 
ATOM   68    C  CD2   . LEU A  1 9   ? -76.431  -16.171 -93.849  0.98 29.89  ? 9    LEU A CD2   1 
ATOM   69    N  N     . ASN A  1 10  ? -73.927  -15.230 -98.559  0.98 68.65  ? 10   ASN A N     1 
ATOM   70    C  CA    . ASN A  1 10  ? -72.758  -15.328 -99.432  0.98 69.56  ? 10   ASN A CA    1 
ATOM   71    C  C     . ASN A  1 10  ? -72.041  -14.009 -99.670  0.98 58.27  ? 10   ASN A C     1 
ATOM   72    O  O     . ASN A  1 10  ? -70.814  -13.966 -99.751  0.98 66.88  ? 10   ASN A O     1 
ATOM   73    C  CB    . ASN A  1 10  ? -73.142  -15.994 -100.748 0.98 60.05  ? 10   ASN A CB    1 
ATOM   74    C  CG    . ASN A  1 10  ? -73.426  -17.466 -100.567 0.98 87.96  ? 10   ASN A CG    1 
ATOM   75    O  OD1   . ASN A  1 10  ? -74.562  -17.867 -100.294 0.98 84.58  ? 10   ASN A OD1   1 
ATOM   76    N  ND2   . ASN A  1 10  ? -72.376  -18.279 -100.638 0.98 87.11  ? 10   ASN A ND2   1 
ATOM   77    N  N     . GLU A  1 11  ? -72.818  -12.933 -99.726  1.00 62.74  ? 11   GLU A N     1 
ATOM   78    C  CA    . GLU A  1 11  ? -72.304  -11.588 -99.950  1.00 69.11  ? 11   GLU A CA    1 
ATOM   79    C  C     . GLU A  1 11  ? -71.380  -11.174 -98.812  1.00 67.44  ? 11   GLU A C     1 
ATOM   80    O  O     . GLU A  1 11  ? -70.418  -10.436 -99.021  1.00 78.51  ? 11   GLU A O     1 
ATOM   81    C  CB    . GLU A  1 11  ? -73.478  -10.610 -100.058 1.00 74.13  ? 11   GLU A CB    1 
ATOM   82    C  CG    . GLU A  1 11  ? -73.152  -9.219  -100.599 1.00 89.86  ? 11   GLU A CG    1 
ATOM   83    C  CD    . GLU A  1 11  ? -74.395  -8.334  -100.681 1.00 100.00 ? 11   GLU A CD    1 
ATOM   84    O  OE1   . GLU A  1 11  ? -75.299  -8.642  -101.497 1.00 100.00 ? 11   GLU A OE1   1 
ATOM   85    O  OE2   . GLU A  1 11  ? -74.480  -7.343  -99.915  1.00 100.00 ? 11   GLU A OE2   1 
ATOM   86    N  N     . HIS A  1 12  ? -71.664  -11.677 -97.614  1.00 70.16  ? 12   HIS A N     1 
ATOM   87    C  CA    . HIS A  1 12  ? -70.866  -11.350 -96.435  1.00 69.82  ? 12   HIS A CA    1 
ATOM   88    C  C     . HIS A  1 12  ? -70.120  -12.542 -95.845  1.00 67.84  ? 12   HIS A C     1 
ATOM   89    O  O     . HIS A  1 12  ? -69.588  -12.433 -94.739  1.00 62.08  ? 12   HIS A O     1 
ATOM   90    C  CB    . HIS A  1 12  ? -71.749  -10.747 -95.338  1.00 69.75  ? 12   HIS A CB    1 
ATOM   91    C  CG    . HIS A  1 12  ? -72.387  -9.441  -95.702  1.00 72.96  ? 12   HIS A CG    1 
ATOM   92    N  ND1   . HIS A  1 12  ? -71.753  -8.228  -95.531  1.00 68.91  ? 12   HIS A ND1   1 
ATOM   93    C  CD2   . HIS A  1 12  ? -73.624  -9.155  -96.177  1.00 63.12  ? 12   HIS A CD2   1 
ATOM   94    C  CE1   . HIS A  1 12  ? -72.575  -7.253  -95.882  1.00 69.92  ? 12   HIS A CE1   1 
ATOM   95    N  NE2   . HIS A  1 12  ? -73.715  -7.787  -96.276  1.00 69.17  ? 12   HIS A NE2   1 
ATOM   96    N  N     . GLU A  1 13  ? -70.095  -13.668 -96.564  1.00 68.05  ? 13   GLU A N     1 
ATOM   97    C  CA    . GLU A  1 13  ? -69.425  -14.889 -96.100  1.00 56.18  ? 13   GLU A CA    1 
ATOM   98    C  C     . GLU A  1 13  ? -69.764  -15.132 -94.632  1.00 55.45  ? 13   GLU A C     1 
ATOM   99    O  O     . GLU A  1 13  ? -68.886  -15.289 -93.781  1.00 47.42  ? 13   GLU A O     1 
ATOM   100   C  CB    . GLU A  1 13  ? -67.919  -14.769 -96.270  1.00 61.80  ? 13   GLU A CB    1 
ATOM   101   C  CG    . GLU A  1 13  ? -67.474  -14.521 -97.683  1.00 72.48  ? 13   GLU A CG    1 
ATOM   102   C  CD    . GLU A  1 13  ? -66.046  -14.041 -97.735  1.00 80.62  ? 13   GLU A CD    1 
ATOM   103   O  OE1   . GLU A  1 13  ? -65.836  -12.842 -98.014  1.00 88.96  ? 13   GLU A OE1   1 
ATOM   104   O  OE2   . GLU A  1 13  ? -65.136  -14.858 -97.470  1.00 90.58  ? 13   GLU A OE2   1 
ATOM   105   N  N     . VAL A  1 14  ? -71.054  -15.086 -94.343  1.00 40.74  ? 14   VAL A N     1 
ATOM   106   C  CA    . VAL A  1 14  ? -71.558  -15.277 -93.001  1.00 30.89  ? 14   VAL A CA    1 
ATOM   107   C  C     . VAL A  1 14  ? -71.258  -16.667 -92.461  1.00 37.46  ? 14   VAL A C     1 
ATOM   108   O  O     . VAL A  1 14  ? -71.466  -17.678 -93.130  1.00 43.37  ? 14   VAL A O     1 
ATOM   109   C  CB    . VAL A  1 14  ? -73.062  -14.979 -92.961  1.00 26.59  ? 14   VAL A CB    1 
ATOM   110   C  CG1   . VAL A  1 14  ? -73.654  -15.377 -91.638  1.00 31.78  ? 14   VAL A CG1   1 
ATOM   111   C  CG2   . VAL A  1 14  ? -73.279  -13.500 -93.191  1.00 20.62  ? 14   VAL A CG2   1 
ATOM   112   N  N     . LYS A  1 15  ? -70.733  -16.698 -91.243  1.00 38.67  ? 15   LYS A N     1 
ATOM   113   C  CA    . LYS A  1 15  ? -70.380  -17.946 -90.598  1.00 27.66  ? 15   LYS A CA    1 
ATOM   114   C  C     . LYS A  1 15  ? -71.470  -18.360 -89.602  1.00 30.72  ? 15   LYS A C     1 
ATOM   115   O  O     . LYS A  1 15  ? -71.689  -19.558 -89.387  1.00 31.27  ? 15   LYS A O     1 
ATOM   116   C  CB    . LYS A  1 15  ? -69.021  -17.812 -89.898  1.00 21.59  ? 15   LYS A CB    1 
ATOM   117   C  CG    . LYS A  1 15  ? -67.914  -17.125 -90.719  1.00 52.25  ? 15   LYS A CG    1 
ATOM   118   C  CD    . LYS A  1 15  ? -66.827  -18.087 -91.192  1.00 60.74  ? 15   LYS A CD    1 
ATOM   119   C  CE    . LYS A  1 15  ? -67.204  -18.819 -92.481  1.00 85.15  ? 15   LYS A CE    1 
ATOM   120   N  NZ    . LYS A  1 15  ? -67.179  -17.953 -93.707  1.00 82.52  ? 15   LYS A NZ    1 
ATOM   121   N  N     . PHE A  1 16  ? -72.153  -17.380 -89.003  1.00 28.14  ? 16   PHE A N     1 
ATOM   122   C  CA    . PHE A  1 16  ? -73.226  -17.674 -88.038  1.00 28.03  ? 16   PHE A CA    1 
ATOM   123   C  C     . PHE A  1 16  ? -74.471  -16.811 -88.223  1.00 32.11  ? 16   PHE A C     1 
ATOM   124   O  O     . PHE A  1 16  ? -74.428  -15.742 -88.831  1.00 29.20  ? 16   PHE A O     1 
ATOM   125   C  CB    . PHE A  1 16  ? -72.752  -17.479 -86.590  1.00 18.81  ? 16   PHE A CB    1 
ATOM   126   C  CG    . PHE A  1 16  ? -71.583  -18.326 -86.216  1.00 22.42  ? 16   PHE A CG    1 
ATOM   127   C  CD1   . PHE A  1 16  ? -70.281  -17.891 -86.476  1.00 8.48   ? 16   PHE A CD1   1 
ATOM   128   C  CD2   . PHE A  1 16  ? -71.774  -19.574 -85.640  1.00 11.95  ? 16   PHE A CD2   1 
ATOM   129   C  CE1   . PHE A  1 16  ? -69.185  -18.681 -86.179  1.00 17.93  ? 16   PHE A CE1   1 
ATOM   130   C  CE2   . PHE A  1 16  ? -70.678  -20.386 -85.337  1.00 13.71  ? 16   PHE A CE2   1 
ATOM   131   C  CZ    . PHE A  1 16  ? -69.376  -19.932 -85.611  1.00 21.68  ? 16   PHE A CZ    1 
ATOM   132   N  N     . VAL A  1 17  ? -75.576  -17.282 -87.659  1.00 27.78  ? 17   VAL A N     1 
ATOM   133   C  CA    . VAL A  1 17  ? -76.845  -16.571 -87.694  1.00 20.54  ? 17   VAL A CA    1 
ATOM   134   C  C     . VAL A  1 17  ? -77.294  -16.457 -86.235  1.00 32.96  ? 17   VAL A C     1 
ATOM   135   O  O     . VAL A  1 17  ? -77.352  -17.453 -85.506  1.00 28.02  ? 17   VAL A O     1 
ATOM   136   C  CB    . VAL A  1 17  ? -77.897  -17.330 -88.527  1.00 24.49  ? 17   VAL A CB    1 
ATOM   137   C  CG1   . VAL A  1 17  ? -79.269  -16.749 -88.292  1.00 16.04  ? 17   VAL A CG1   1 
ATOM   138   C  CG2   . VAL A  1 17  ? -77.557  -17.223 -90.009  1.00 20.26  ? 17   VAL A CG2   1 
ATOM   139   N  N     . ASP A  1 18  ? -77.558  -15.232 -85.801  1.00 29.03  ? 18   ASP A N     1 
ATOM   140   C  CA    . ASP A  1 18  ? -77.969  -14.996 -84.429  1.00 24.31  ? 18   ASP A CA    1 
ATOM   141   C  C     . ASP A  1 18  ? -79.472  -14.769 -84.348  1.00 28.29  ? 18   ASP A C     1 
ATOM   142   O  O     . ASP A  1 18  ? -80.004  -13.748 -84.799  1.00 30.50  ? 18   ASP A O     1 
ATOM   143   C  CB    . ASP A  1 18  ? -77.191  -13.806 -83.836  1.00 25.21  ? 18   ASP A CB    1 
ATOM   144   C  CG    . ASP A  1 18  ? -77.146  -13.830 -82.314  1.00 29.45  ? 18   ASP A CG    1 
ATOM   145   O  OD1   . ASP A  1 18  ? -77.361  -12.772 -81.687  1.00 23.38  ? 18   ASP A OD1   1 
ATOM   146   O  OD2   . ASP A  1 18  ? -76.892  -14.908 -81.741  1.00 27.58  ? 18   ASP A OD2   1 
ATOM   147   N  N     . LEU A  1 19  ? -80.158  -15.759 -83.801  1.00 29.43  ? 19   LEU A N     1 
ATOM   148   C  CA    . LEU A  1 19  ? -81.599  -15.687 -83.646  1.00 27.87  ? 19   LEU A CA    1 
ATOM   149   C  C     . LEU A  1 19  ? -81.958  -14.858 -82.425  1.00 29.84  ? 19   LEU A C     1 
ATOM   150   O  O     . LEU A  1 19  ? -81.600  -15.211 -81.300  1.00 40.84  ? 19   LEU A O     1 
ATOM   151   C  CB    . LEU A  1 19  ? -82.166  -17.099 -83.521  1.00 26.48  ? 19   LEU A CB    1 
ATOM   152   C  CG    . LEU A  1 19  ? -82.543  -17.865 -84.799  1.00 35.13  ? 19   LEU A CG    1 
ATOM   153   C  CD1   . LEU A  1 19  ? -81.989  -17.238 -86.073  1.00 23.73  ? 19   LEU A CD1   1 
ATOM   154   C  CD2   . LEU A  1 19  ? -82.083  -19.287 -84.654  1.00 19.57  ? 19   LEU A CD2   1 
ATOM   155   N  N     . ARG A  1 20  ? -82.664  -13.754 -82.652  1.00 28.84  ? 20   ARG A N     1 
ATOM   156   C  CA    . ARG A  1 20  ? -83.056  -12.880 -81.557  1.00 29.31  ? 20   ARG A CA    1 
ATOM   157   C  C     . ARG A  1 20  ? -84.549  -12.692 -81.340  1.00 29.08  ? 20   ARG A C     1 
ATOM   158   O  O     . ARG A  1 20  ? -85.343  -12.722 -82.275  1.00 41.02  ? 20   ARG A O     1 
ATOM   159   C  CB    . ARG A  1 20  ? -82.401  -11.510 -81.716  1.00 19.28  ? 20   ARG A CB    1 
ATOM   160   C  CG    . ARG A  1 20  ? -80.919  -11.601 -81.680  1.00 27.39  ? 20   ARG A CG    1 
ATOM   161   C  CD    . ARG A  1 20  ? -80.269  -10.262 -81.584  1.00 14.40  ? 20   ARG A CD    1 
ATOM   162   N  NE    . ARG A  1 20  ? -78.835  -10.473 -81.632  1.00 22.85  ? 20   ARG A NE    1 
ATOM   163   C  CZ    . ARG A  1 20  ? -77.930  -9.515  -81.713  1.00 23.69  ? 20   ARG A CZ    1 
ATOM   164   N  NH1   . ARG A  1 20  ? -76.647  -9.845  -81.764  1.00 23.91  ? 20   ARG A NH1   1 
ATOM   165   N  NH2   . ARG A  1 20  ? -78.301  -8.238  -81.722  1.00 28.19  ? 20   ARG A NH2   1 
ATOM   166   N  N     . PHE A  1 21  ? -84.904  -12.474 -80.079  1.00 31.80  ? 21   PHE A N     1 
ATOM   167   C  CA    . PHE A  1 21  ? -86.274  -12.229 -79.676  1.00 32.37  ? 21   PHE A CA    1 
ATOM   168   C  C     . PHE A  1 21  ? -86.268  -11.505 -78.333  1.00 34.14  ? 21   PHE A C     1 
ATOM   169   O  O     . PHE A  1 21  ? -85.218  -11.355 -77.718  1.00 33.65  ? 21   PHE A O     1 
ATOM   170   C  CB    . PHE A  1 21  ? -87.075  -13.526 -79.614  1.00 29.71  ? 21   PHE A CB    1 
ATOM   171   C  CG    . PHE A  1 21  ? -86.581  -14.501 -78.595  1.00 25.22  ? 21   PHE A CG    1 
ATOM   172   C  CD1   . PHE A  1 21  ? -87.136  -14.531 -77.319  1.00 40.70  ? 21   PHE A CD1   1 
ATOM   173   C  CD2   . PHE A  1 21  ? -85.597  -15.426 -78.922  1.00 34.13  ? 21   PHE A CD2   1 
ATOM   174   C  CE1   . PHE A  1 21  ? -86.724  -15.477 -76.382  1.00 26.60  ? 21   PHE A CE1   1 
ATOM   175   C  CE2   . PHE A  1 21  ? -85.174  -16.380 -77.992  1.00 31.88  ? 21   PHE A CE2   1 
ATOM   176   C  CZ    . PHE A  1 21  ? -85.739  -16.407 -76.722  1.00 24.57  ? 21   PHE A CZ    1 
ATOM   177   N  N     . THR A  1 22  ? -87.441  -11.060 -77.892  1.00 32.80  ? 22   THR A N     1 
ATOM   178   C  CA    . THR A  1 22  ? -87.586  -10.318 -76.645  1.00 26.92  ? 22   THR A CA    1 
ATOM   179   C  C     . THR A  1 22  ? -88.440  -11.033 -75.601  1.00 31.11  ? 22   THR A C     1 
ATOM   180   O  O     . THR A  1 22  ? -89.501  -11.560 -75.924  1.00 39.13  ? 22   THR A O     1 
ATOM   181   C  CB    . THR A  1 22  ? -88.208  -8.955  -76.946  1.00 22.60  ? 22   THR A CB    1 
ATOM   182   O  OG1   . THR A  1 22  ? -87.332  -8.226  -77.813  1.00 29.18  ? 22   THR A OG1   1 
ATOM   183   C  CG2   . THR A  1 22  ? -88.453  -8.171  -75.671  1.00 25.72  ? 22   THR A CG2   1 
ATOM   184   N  N     . ASP A  1 23  ? -87.978  -11.055 -74.351  1.00 30.62  ? 23   ASP A N     1 
ATOM   185   C  CA    . ASP A  1 23  ? -88.735  -11.710 -73.279  1.00 19.64  ? 23   ASP A CA    1 
ATOM   186   C  C     . ASP A  1 23  ? -89.840  -10.797 -72.750  1.00 33.48  ? 23   ASP A C     1 
ATOM   187   O  O     . ASP A  1 23  ? -89.971  -9.654  -73.204  1.00 27.81  ? 23   ASP A O     1 
ATOM   188   C  CB    . ASP A  1 23  ? -87.811  -12.201 -72.145  1.00 27.79  ? 23   ASP A CB    1 
ATOM   189   C  CG    . ASP A  1 23  ? -87.278  -11.077 -71.246  1.00 38.28  ? 23   ASP A CG    1 
ATOM   190   O  OD1   . ASP A  1 23  ? -87.473  -9.871  -71.528  1.00 44.20  ? 23   ASP A OD1   1 
ATOM   191   O  OD2   . ASP A  1 23  ? -86.638  -11.420 -70.228  1.00 59.84  ? 23   ASP A OD2   1 
ATOM   192   N  N     . THR A  1 24  ? -90.615  -11.276 -71.780  1.00 34.54  ? 24   THR A N     1 
ATOM   193   C  CA    . THR A  1 24  ? -91.705  -10.462 -71.254  1.00 29.73  ? 24   THR A CA    1 
ATOM   194   C  C     . THR A  1 24  ? -91.247  -9.120  -70.674  1.00 42.44  ? 24   THR A C     1 
ATOM   195   O  O     . THR A  1 24  ? -91.859  -8.083  -70.956  1.00 45.48  ? 24   THR A O     1 
ATOM   196   C  CB    . THR A  1 24  ? -92.577  -11.253 -70.250  1.00 30.89  ? 24   THR A CB    1 
ATOM   197   O  OG1   . THR A  1 24  ? -93.334  -12.238 -70.961  1.00 36.51  ? 24   THR A OG1   1 
ATOM   198   C  CG2   . THR A  1 24  ? -93.558  -10.338 -69.531  1.00 39.91  ? 24   THR A CG2   1 
ATOM   199   N  N     . LYS A  1 25  ? -90.147  -9.125  -69.919  1.00 46.41  ? 25   LYS A N     1 
ATOM   200   C  CA    . LYS A  1 25  ? -89.631  -7.890  -69.323  1.00 32.14  ? 25   LYS A CA    1 
ATOM   201   C  C     . LYS A  1 25  ? -89.102  -6.885  -70.349  1.00 35.61  ? 25   LYS A C     1 
ATOM   202   O  O     . LYS A  1 25  ? -88.994  -5.695  -70.052  1.00 47.19  ? 25   LYS A O     1 
ATOM   203   C  CB    . LYS A  1 25  ? -88.580  -8.199  -68.260  1.00 28.23  ? 25   LYS A CB    1 
ATOM   204   C  CG    . LYS A  1 25  ? -89.159  -8.868  -67.028  1.00 29.00  ? 25   LYS A CG    1 
ATOM   205   C  CD    . LYS A  1 25  ? -88.106  -9.137  -65.986  1.00 27.28  ? 25   LYS A CD    1 
ATOM   206   C  CE    . LYS A  1 25  ? -88.663  -9.953  -64.848  1.00 43.24  ? 25   LYS A CE    1 
ATOM   207   N  NZ    . LYS A  1 25  ? -87.558  -10.486 -63.999  1.00 40.98  ? 25   LYS A NZ    1 
ATOM   208   N  N     . GLY A  1 26  ? -88.780  -7.367  -71.551  1.00 34.55  ? 26   GLY A N     1 
ATOM   209   C  CA    . GLY A  1 26  ? -88.316  -6.489  -72.617  1.00 19.41  ? 26   GLY A CA    1 
ATOM   210   C  C     . GLY A  1 26  ? -86.857  -6.583  -73.011  1.00 35.20  ? 26   GLY A C     1 
ATOM   211   O  O     . GLY A  1 26  ? -86.355  -5.753  -73.790  1.00 36.21  ? 26   GLY A O     1 
ATOM   212   N  N     . LYS A  1 27  ? -86.186  -7.603  -72.479  1.00 28.86  ? 27   LYS A N     1 
ATOM   213   C  CA    . LYS A  1 27  ? -84.775  -7.821  -72.736  1.00 30.37  ? 27   LYS A CA    1 
ATOM   214   C  C     . LYS A  1 27  ? -84.574  -8.717  -73.948  1.00 25.53  ? 27   LYS A C     1 
ATOM   215   O  O     . LYS A  1 27  ? -85.131  -9.808  -74.023  1.00 37.83  ? 27   LYS A O     1 
ATOM   216   C  CB    . LYS A  1 27  ? -84.108  -8.440  -71.498  1.00 17.79  ? 27   LYS A CB    1 
ATOM   217   C  CG    . LYS A  1 27  ? -82.580  -8.486  -71.554  1.00 34.79  ? 27   LYS A CG    1 
ATOM   218   C  CD    . LYS A  1 27  ? -81.968  -7.102  -71.368  1.00 43.27  ? 27   LYS A CD    1 
ATOM   219   C  CE    . LYS A  1 27  ? -80.554  -7.043  -71.917  1.00 34.47  ? 27   LYS A CE    1 
ATOM   220   N  NZ    . LYS A  1 27  ? -79.965  -5.669  -71.893  1.00 35.77  ? 27   LYS A NZ    1 
ATOM   221   N  N     . GLU A  1 28  ? -83.774  -8.244  -74.898  1.00 23.25  ? 28   GLU A N     1 
ATOM   222   C  CA    . GLU A  1 28  ? -83.481  -9.007  -76.107  1.00 20.64  ? 28   GLU A CA    1 
ATOM   223   C  C     . GLU A  1 28  ? -82.701  -10.283 -75.741  1.00 36.27  ? 28   GLU A C     1 
ATOM   224   O  O     . GLU A  1 28  ? -81.779  -10.255 -74.918  1.00 40.93  ? 28   GLU A O     1 
ATOM   225   C  CB    . GLU A  1 28  ? -82.664  -8.138  -77.046  1.00 23.87  ? 28   GLU A CB    1 
ATOM   226   C  CG    . GLU A  1 28  ? -82.706  -8.486  -78.523  1.00 11.97  ? 28   GLU A CG    1 
ATOM   227   C  CD    . GLU A  1 28  ? -81.901  -7.483  -79.328  1.00 37.40  ? 28   GLU A CD    1 
ATOM   228   O  OE1   . GLU A  1 28  ? -81.728  -7.695  -80.545  1.00 46.78  ? 28   GLU A OE1   1 
ATOM   229   O  OE2   . GLU A  1 28  ? -81.418  -6.481  -78.730  1.00 59.28  ? 28   GLU A OE2   1 
ATOM   230   N  N     . GLN A  1 29  ? -83.104  -11.405 -76.331  1.00 31.67  ? 29   GLN A N     1 
ATOM   231   C  CA    . GLN A  1 29  ? -82.460  -12.694 -76.083  1.00 24.75  ? 29   GLN A CA    1 
ATOM   232   C  C     . GLN A  1 29  ? -81.884  -13.230 -77.383  1.00 30.50  ? 29   GLN A C     1 
ATOM   233   O  O     . GLN A  1 29  ? -82.221  -12.747 -78.468  1.00 36.59  ? 29   GLN A O     1 
ATOM   234   C  CB    . GLN A  1 29  ? -83.473  -13.698 -75.558  1.00 15.36  ? 29   GLN A CB    1 
ATOM   235   C  CG    . GLN A  1 29  ? -84.387  -13.145 -74.503  1.00 36.23  ? 29   GLN A CG    1 
ATOM   236   C  CD    . GLN A  1 29  ? -83.708  -13.012 -73.168  1.00 29.62  ? 29   GLN A CD    1 
ATOM   237   O  OE1   . GLN A  1 29  ? -83.103  -13.961 -72.671  1.00 33.70  ? 29   GLN A OE1   1 
ATOM   238   N  NE2   . GLN A  1 29  ? -83.814  -11.836 -72.569  1.00 42.60  ? 29   GLN A NE2   1 
ATOM   239   N  N     . HIS A  1 30  ? -81.032  -14.245 -77.284  1.00 18.45  ? 30   HIS A N     1 
ATOM   240   C  CA    . HIS A  1 30  ? -80.457  -14.801 -78.492  1.00 23.64  ? 30   HIS A CA    1 
ATOM   241   C  C     . HIS A  1 30  ? -79.881  -16.190 -78.363  1.00 21.12  ? 30   HIS A C     1 
ATOM   242   O  O     . HIS A  1 30  ? -79.562  -16.665 -77.281  1.00 32.73  ? 30   HIS A O     1 
ATOM   243   C  CB    . HIS A  1 30  ? -79.387  -13.860 -79.069  1.00 24.12  ? 30   HIS A CB    1 
ATOM   244   C  CG    . HIS A  1 30  ? -78.035  -14.012 -78.439  1.00 31.13  ? 30   HIS A CG    1 
ATOM   245   N  ND1   . HIS A  1 30  ? -77.841  -13.998 -77.077  1.00 36.22  ? 30   HIS A ND1   1 
ATOM   246   C  CD2   . HIS A  1 30  ? -76.812  -14.193 -78.990  1.00 18.59  ? 30   HIS A CD2   1 
ATOM   247   C  CE1   . HIS A  1 30  ? -76.557  -14.164 -76.816  1.00 23.77  ? 30   HIS A CE1   1 
ATOM   248   N  NE2   . HIS A  1 30  ? -75.912  -14.289 -77.960  1.00 26.02  ? 30   HIS A NE2   1 
ATOM   249   N  N     . VAL A  1 31  ? -79.793  -16.839 -79.511  1.00 30.80  ? 31   VAL A N     1 
ATOM   250   C  CA    . VAL A  1 31  ? -79.211  -18.161 -79.632  1.00 32.51  ? 31   VAL A CA    1 
ATOM   251   C  C     . VAL A  1 31  ? -78.593  -18.158 -81.034  1.00 31.57  ? 31   VAL A C     1 
ATOM   252   O  O     . VAL A  1 31  ? -79.145  -17.563 -81.968  1.00 29.18  ? 31   VAL A O     1 
ATOM   253   C  CB    . VAL A  1 31  ? -80.242  -19.274 -79.451  1.00 27.59  ? 31   VAL A CB    1 
ATOM   254   C  CG1   . VAL A  1 31  ? -81.390  -19.088 -80.411  1.00 46.69  ? 31   VAL A CG1   1 
ATOM   255   C  CG2   . VAL A  1 31  ? -79.584  -20.618 -79.671  1.00 37.26  ? 31   VAL A CG2   1 
ATOM   256   N  N     . THR A  1 32  ? -77.404  -18.739 -81.145  1.00 23.36  ? 32   THR A N     1 
ATOM   257   C  CA    . THR A  1 32  ? -76.662  -18.763 -82.391  1.00 22.51  ? 32   THR A CA    1 
ATOM   258   C  C     . THR A  1 32  ? -76.636  -20.128 -83.047  1.00 26.62  ? 32   THR A C     1 
ATOM   259   O  O     . THR A  1 32  ? -76.384  -21.159 -82.417  1.00 26.30  ? 32   THR A O     1 
ATOM   260   C  CB    . THR A  1 32  ? -75.244  -18.253 -82.154  1.00 27.40  ? 32   THR A CB    1 
ATOM   261   O  OG1   . THR A  1 32  ? -75.317  -16.995 -81.481  1.00 27.63  ? 32   THR A OG1   1 
ATOM   262   C  CG2   . THR A  1 32  ? -74.502  -18.072 -83.460  1.00 22.16  ? 32   THR A CG2   1 
ATOM   263   N  N     . ILE A  1 33  ? -76.807  -20.077 -84.358  1.00 30.18  ? 33   ILE A N     1 
ATOM   264   C  CA    . ILE A  1 33  ? -76.868  -21.229 -85.237  1.00 20.67  ? 33   ILE A CA    1 
ATOM   265   C  C     . ILE A  1 33  ? -75.845  -20.990 -86.354  1.00 22.53  ? 33   ILE A C     1 
ATOM   266   O  O     . ILE A  1 33  ? -75.617  -19.846 -86.764  1.00 34.53  ? 33   ILE A O     1 
ATOM   267   C  CB    . ILE A  1 33  ? -78.339  -21.385 -85.750  1.00 32.66  ? 33   ILE A CB    1 
ATOM   268   C  CG1   . ILE A  1 33  ? -78.932  -22.667 -85.192  1.00 45.17  ? 33   ILE A CG1   1 
ATOM   269   C  CG2   . ILE A  1 33  ? -78.567  -21.267 -87.251  1.00 23.22  ? 33   ILE A CG2   1 
ATOM   270   C  CD1   . ILE A  1 33  ? -79.195  -22.575 -83.756  1.00 91.60  ? 33   ILE A CD1   1 
ATOM   271   N  N     . PRO A  1 34  ? -75.085  -22.021 -86.724  1.00 22.90  ? 34   PRO A N     1 
ATOM   272   C  CA    . PRO A  1 34  ? -74.073  -21.921 -87.789  1.00 22.42  ? 34   PRO A CA    1 
ATOM   273   C  C     . PRO A  1 34  ? -74.803  -21.548 -89.078  1.00 36.38  ? 34   PRO A C     1 
ATOM   274   O  O     . PRO A  1 34  ? -75.953  -21.940 -89.243  1.00 29.83  ? 34   PRO A O     1 
ATOM   275   C  CB    . PRO A  1 34  ? -73.535  -23.355 -87.884  1.00 6.41   ? 34   PRO A CB    1 
ATOM   276   C  CG    . PRO A  1 34  ? -73.745  -23.902 -86.480  1.00 22.94  ? 34   PRO A CG    1 
ATOM   277   C  CD    . PRO A  1 34  ? -75.105  -23.360 -86.115  1.00 26.13  ? 34   PRO A CD    1 
ATOM   278   N  N     . ALA A  1 35  ? -74.156  -20.827 -89.995  1.00 35.07  ? 35   ALA A N     1 
ATOM   279   C  CA    . ALA A  1 35  ? -74.832  -20.439 -91.237  1.00 28.55  ? 35   ALA A CA    1 
ATOM   280   C  C     . ALA A  1 35  ? -75.350  -21.642 -92.022  1.00 35.34  ? 35   ALA A C     1 
ATOM   281   O  O     . ALA A  1 35  ? -76.445  -21.590 -92.582  1.00 36.34  ? 35   ALA A O     1 
ATOM   282   C  CB    . ALA A  1 35  ? -73.932  -19.575 -92.115  1.00 25.77  ? 35   ALA A CB    1 
ATOM   283   N  N     . HIS A  1 36  ? -74.603  -22.746 -92.008  1.00 35.91  ? 36   HIS A N     1 
ATOM   284   C  CA    . HIS A  1 36  ? -75.019  -23.951 -92.734  1.00 28.59  ? 36   HIS A CA    1 
ATOM   285   C  C     . HIS A  1 36  ? -76.323  -24.613 -92.284  1.00 33.01  ? 36   HIS A C     1 
ATOM   286   O  O     . HIS A  1 36  ? -76.818  -25.521 -92.946  1.00 52.83  ? 36   HIS A O     1 
ATOM   287   C  CB    . HIS A  1 36  ? -73.898  -24.993 -92.770  1.00 23.72  ? 36   HIS A CB    1 
ATOM   288   C  CG    . HIS A  1 36  ? -73.531  -25.555 -91.431  1.00 33.89  ? 36   HIS A CG    1 
ATOM   289   N  ND1   . HIS A  1 36  ? -74.398  -26.320 -90.680  1.00 42.74  ? 36   HIS A ND1   1 
ATOM   290   C  CD2   . HIS A  1 36  ? -72.365  -25.523 -90.742  1.00 25.70  ? 36   HIS A CD2   1 
ATOM   291   C  CE1   . HIS A  1 36  ? -73.780  -26.743 -89.591  1.00 38.92  ? 36   HIS A CE1   1 
ATOM   292   N  NE2   . HIS A  1 36  ? -72.541  -26.272 -89.606  1.00 30.08  ? 36   HIS A NE2   1 
ATOM   293   N  N     . GLN A  1 37  ? -76.867  -24.172 -91.157  1.00 37.79  ? 37   GLN A N     1 
ATOM   294   C  CA    . GLN A  1 37  ? -78.116  -24.723 -90.637  1.00 36.34  ? 37   GLN A CA    1 
ATOM   295   C  C     . GLN A  1 37  ? -79.332  -23.995 -91.217  1.00 39.09  ? 37   GLN A C     1 
ATOM   296   O  O     . GLN A  1 37  ? -80.482  -24.363 -90.943  1.00 45.61  ? 37   GLN A O     1 
ATOM   297   C  CB    . GLN A  1 37  ? -78.146  -24.626 -89.117  1.00 21.37  ? 37   GLN A CB    1 
ATOM   298   C  CG    . GLN A  1 37  ? -77.155  -25.489 -88.417  1.00 32.72  ? 37   GLN A CG    1 
ATOM   299   C  CD    . GLN A  1 37  ? -77.423  -26.946 -88.644  1.00 40.33  ? 37   GLN A CD    1 
ATOM   300   O  OE1   . GLN A  1 37  ? -76.737  -27.588 -89.428  1.00 43.92  ? 37   GLN A OE1   1 
ATOM   301   N  NE2   . GLN A  1 37  ? -78.425  -27.486 -87.955  1.00 54.64  ? 37   GLN A NE2   1 
ATOM   302   N  N     . VAL A  1 38  ? -79.072  -22.930 -91.968  1.00 37.91  ? 38   VAL A N     1 
ATOM   303   C  CA    . VAL A  1 38  ? -80.133  -22.156 -92.601  1.00 43.28  ? 38   VAL A CA    1 
ATOM   304   C  C     . VAL A  1 38  ? -80.486  -22.803 -93.937  1.00 49.63  ? 38   VAL A C     1 
ATOM   305   O  O     . VAL A  1 38  ? -79.614  -23.029 -94.777  1.00 54.34  ? 38   VAL A O     1 
ATOM   306   C  CB    . VAL A  1 38  ? -79.699  -20.708 -92.843  1.00 44.43  ? 38   VAL A CB    1 
ATOM   307   C  CG1   . VAL A  1 38  ? -80.771  -19.959 -93.605  1.00 48.39  ? 38   VAL A CG1   1 
ATOM   308   C  CG2   . VAL A  1 38  ? -79.432  -20.031 -91.523  1.00 40.83  ? 38   VAL A CG2   1 
ATOM   309   N  N     . ASN A  1 39  ? -81.771  -23.084 -94.124  1.00 55.20  ? 39   ASN A N     1 
ATOM   310   C  CA    . ASN A  1 39  ? -82.249  -23.722 -95.339  1.00 60.48  ? 39   ASN A CA    1 
ATOM   311   C  C     . ASN A  1 39  ? -83.708  -23.394 -95.605  1.00 65.72  ? 39   ASN A C     1 
ATOM   312   O  O     . ASN A  1 39  ? -84.326  -22.612 -94.873  1.00 65.57  ? 39   ASN A O     1 
ATOM   313   C  CB    . ASN A  1 39  ? -82.085  -25.234 -95.218  1.00 53.57  ? 39   ASN A CB    1 
ATOM   314   C  CG    . ASN A  1 39  ? -82.698  -25.777 -93.950  1.00 56.40  ? 39   ASN A CG    1 
ATOM   315   O  OD1   . ASN A  1 39  ? -83.721  -25.281 -93.474  1.00 62.74  ? 39   ASN A OD1   1 
ATOM   316   N  ND2   . ASN A  1 39  ? -82.065  -26.786 -93.378  1.00 64.98  ? 39   ASN A ND2   1 
ATOM   317   N  N     . ALA A  1 40  ? -84.244  -24.024 -96.649  1.00 77.57  ? 40   ALA A N     1 
ATOM   318   C  CA    . ALA A  1 40  ? -85.627  -23.853 -97.070  1.00 74.38  ? 40   ALA A CA    1 
ATOM   319   C  C     . ALA A  1 40  ? -86.530  -24.092 -95.866  1.00 75.94  ? 40   ALA A C     1 
ATOM   320   O  O     . ALA A  1 40  ? -87.302  -23.214 -95.456  1.00 64.60  ? 40   ALA A O     1 
ATOM   321   C  CB    . ALA A  1 40  ? -85.942  -24.856 -98.166  1.00 83.53  ? 40   ALA A CB    1 
ATOM   322   N  N     . GLU A  1 41  ? -86.371  -25.287 -95.302  1.00 68.04  ? 41   GLU A N     1 
ATOM   323   C  CA    . GLU A  1 41  ? -87.092  -25.777 -94.127  1.00 82.38  ? 41   GLU A CA    1 
ATOM   324   C  C     . GLU A  1 41  ? -87.243  -24.719 -93.018  1.00 81.14  ? 41   GLU A C     1 
ATOM   325   O  O     . GLU A  1 41  ? -88.352  -24.323 -92.632  1.00 79.47  ? 41   GLU A O     1 
ATOM   326   C  CB    . GLU A  1 41  ? -86.307  -26.987 -93.596  1.00 91.32  ? 41   GLU A CB    1 
ATOM   327   C  CG    . GLU A  1 41  ? -86.654  -27.439 -92.182  1.00 100.00 ? 41   GLU A CG    1 
ATOM   328   C  CD    . GLU A  1 41  ? -87.631  -28.606 -92.155  1.00 100.00 ? 41   GLU A CD    1 
ATOM   329   O  OE1   . GLU A  1 41  ? -88.270  -28.894 -93.197  1.00 100.00 ? 41   GLU A OE1   1 
ATOM   330   O  OE2   . GLU A  1 41  ? -87.756  -29.239 -91.081  1.00 100.00 ? 41   GLU A OE2   1 
ATOM   331   N  N     . PHE A  1 42  ? -86.089  -24.307 -92.511  1.00 74.57  ? 42   PHE A N     1 
ATOM   332   C  CA    . PHE A  1 42  ? -85.930  -23.316 -91.462  1.00 62.17  ? 42   PHE A CA    1 
ATOM   333   C  C     . PHE A  1 42  ? -86.869  -22.099 -91.550  1.00 58.13  ? 42   PHE A C     1 
ATOM   334   O  O     . PHE A  1 42  ? -87.448  -21.680 -90.546  1.00 59.69  ? 42   PHE A O     1 
ATOM   335   C  CB    . PHE A  1 42  ? -84.455  -22.892 -91.482  1.00 63.78  ? 42   PHE A CB    1 
ATOM   336   C  CG    . PHE A  1 42  ? -84.139  -21.686 -90.653  1.00 59.35  ? 42   PHE A CG    1 
ATOM   337   C  CD1   . PHE A  1 42  ? -83.678  -20.526 -91.262  1.00 51.75  ? 42   PHE A CD1   1 
ATOM   338   C  CD2   . PHE A  1 42  ? -84.283  -21.706 -89.268  1.00 74.03  ? 42   PHE A CD2   1 
ATOM   339   C  CE1   . PHE A  1 42  ? -83.364  -19.396 -90.513  1.00 39.50  ? 42   PHE A CE1   1 
ATOM   340   C  CE2   . PHE A  1 42  ? -83.970  -20.579 -88.507  1.00 69.89  ? 42   PHE A CE2   1 
ATOM   341   C  CZ    . PHE A  1 42  ? -83.507  -19.421 -89.135  1.00 50.16  ? 42   PHE A CZ    1 
ATOM   342   N  N     . PHE A  1 43  ? -87.037  -21.547 -92.745  1.00 48.45  ? 43   PHE A N     1 
ATOM   343   C  CA    . PHE A  1 43  ? -87.897  -20.378 -92.924  1.00 51.93  ? 43   PHE A CA    1 
ATOM   344   C  C     . PHE A  1 43  ? -89.390  -20.573 -92.848  1.00 66.23  ? 43   PHE A C     1 
ATOM   345   O  O     . PHE A  1 43  ? -90.128  -19.632 -92.504  1.00 59.98  ? 43   PHE A O     1 
ATOM   346   C  CB    . PHE A  1 43  ? -87.574  -19.698 -94.235  1.00 49.45  ? 43   PHE A CB    1 
ATOM   347   C  CG    . PHE A  1 43  ? -86.465  -18.741 -94.127  1.00 61.30  ? 43   PHE A CG    1 
ATOM   348   C  CD1   . PHE A  1 43  ? -85.204  -19.052 -94.642  1.00 57.91  ? 43   PHE A CD1   1 
ATOM   349   C  CD2   . PHE A  1 43  ? -86.656  -17.536 -93.449  1.00 61.39  ? 43   PHE A CD2   1 
ATOM   350   C  CE1   . PHE A  1 43  ? -84.135  -18.167 -94.481  1.00 55.75  ? 43   PHE A CE1   1 
ATOM   351   C  CE2   . PHE A  1 43  ? -85.599  -16.640 -93.278  1.00 54.51  ? 43   PHE A CE2   1 
ATOM   352   C  CZ    . PHE A  1 43  ? -84.333  -16.956 -93.794  1.00 53.42  ? 43   PHE A CZ    1 
ATOM   353   N  N     . GLU A  1 44  ? -89.829  -21.770 -93.243  1.00 74.09  ? 44   GLU A N     1 
ATOM   354   C  CA    . GLU A  1 44  ? -91.239  -22.119 -93.262  1.00 73.42  ? 44   GLU A CA    1 
ATOM   355   C  C     . GLU A  1 44  ? -91.734  -22.708 -91.959  1.00 64.44  ? 44   GLU A C     1 
ATOM   356   O  O     . GLU A  1 44  ? -92.920  -22.578 -91.638  1.00 72.75  ? 44   GLU A O     1 
ATOM   357   C  CB    . GLU A  1 44  ? -91.546  -23.053 -94.433  1.00 86.95  ? 44   GLU A CB    1 
ATOM   358   C  CG    . GLU A  1 44  ? -91.557  -22.355 -95.800  1.00 90.85  ? 44   GLU A CG    1 
ATOM   359   C  CD    . GLU A  1 44  ? -90.798  -23.141 -96.869  1.00 100.00 ? 44   GLU A CD    1 
ATOM   360   O  OE1   . GLU A  1 44  ? -90.244  -22.497 -97.792  1.00 100.00 ? 44   GLU A OE1   1 
ATOM   361   O  OE2   . GLU A  1 44  ? -90.742  -24.394 -96.783  1.00 99.74  ? 44   GLU A OE2   1 
ATOM   362   N  N     . GLU A  1 45  ? -90.847  -23.352 -91.202  1.00 46.08  ? 45   GLU A N     1 
ATOM   363   C  CA    . GLU A  1 45  ? -91.282  -23.902 -89.920  1.00 68.83  ? 45   GLU A CA    1 
ATOM   364   C  C     . GLU A  1 45  ? -90.396  -23.616 -88.706  1.00 71.87  ? 45   GLU A C     1 
ATOM   365   O  O     . GLU A  1 45  ? -90.664  -24.108 -87.602  1.00 69.14  ? 45   GLU A O     1 
ATOM   366   C  CB    . GLU A  1 45  ? -91.571  -25.385 -90.040  1.00 74.67  ? 45   GLU A CB    1 
ATOM   367   C  CG    . GLU A  1 45  ? -90.464  -26.171 -90.661  1.00 88.91  ? 45   GLU A CG    1 
ATOM   368   C  CD    . GLU A  1 45  ? -90.898  -27.589 -90.920  1.00 100.00 ? 45   GLU A CD    1 
ATOM   369   O  OE1   . GLU A  1 45  ? -91.495  -27.841 -91.993  1.00 100.00 ? 45   GLU A OE1   1 
ATOM   370   O  OE2   . GLU A  1 45  ? -90.666  -28.442 -90.036  1.00 100.00 ? 45   GLU A OE2   1 
ATOM   371   N  N     . GLY A  1 46  ? -89.360  -22.793 -88.931  1.00 71.94  ? 46   GLY A N     1 
ATOM   372   C  CA    . GLY A  1 46  ? -88.388  -22.371 -87.921  1.00 57.06  ? 46   GLY A CA    1 
ATOM   373   C  C     . GLY A  1 46  ? -87.651  -23.545 -87.276  1.00 55.72  ? 46   GLY A C     1 
ATOM   374   O  O     . GLY A  1 46  ? -87.667  -24.668 -87.779  1.00 72.51  ? 46   GLY A O     1 
ATOM   375   N  N     . LYS A  1 47  ? -86.992  -23.254 -86.167  1.00 54.83  ? 47   LYS A N     1 
ATOM   376   C  CA    . LYS A  1 47  ? -86.239  -24.215 -85.374  1.00 61.51  ? 47   LYS A CA    1 
ATOM   377   C  C     . LYS A  1 47  ? -86.812  -24.107 -83.943  1.00 57.81  ? 47   LYS A C     1 
ATOM   378   O  O     . LYS A  1 47  ? -87.144  -23.001 -83.547  1.00 63.20  ? 47   LYS A O     1 
ATOM   379   C  CB    . LYS A  1 47  ? -84.737  -23.900 -85.402  1.00 49.16  ? 47   LYS A CB    1 
ATOM   380   C  CG    . LYS A  1 47  ? -83.903  -24.796 -84.514  1.00 93.45  ? 47   LYS A CG    1 
ATOM   381   C  CD    . LYS A  1 47  ? -83.499  -24.113 -83.218  1.00 97.85  ? 47   LYS A CD    1 
ATOM   382   C  CE    . LYS A  1 47  ? -82.543  -24.976 -82.419  1.00 84.37  ? 47   LYS A CE    1 
ATOM   383   N  NZ    . LYS A  1 47  ? -82.263  -24.407 -81.071  1.00 40.01  ? 47   LYS A NZ    1 
ATOM   384   N  N     . MET A  1 48  ? -86.951  -25.146 -83.094  1.00 56.52  ? 48   MET A N     1 
ATOM   385   C  CA    . MET A  1 48  ? -87.558  -24.872 -81.755  1.00 62.21  ? 48   MET A CA    1 
ATOM   386   C  C     . MET A  1 48  ? -86.550  -24.944 -80.558  1.00 57.27  ? 48   MET A C     1 
ATOM   387   O  O     . MET A  1 48  ? -85.354  -25.050 -80.788  1.00 73.04  ? 48   MET A O     1 
ATOM   388   C  CB    . MET A  1 48  ? -88.721  -25.833 -81.480  1.00 73.05  ? 48   MET A CB    1 
ATOM   389   C  CG    . MET A  1 48  ? -88.767  -27.112 -82.307  1.00 71.58  ? 48   MET A CG    1 
ATOM   390   S  SD    . MET A  1 48  ? -90.267  -28.075 -82.020  1.00 100.00 ? 48   MET A SD    1 
ATOM   391   C  CE    . MET A  1 48  ? -91.439  -27.178 -83.042  1.00 86.71  ? 48   MET A CE    1 
ATOM   392   N  N     . PHE A  1 49  ? -86.968  -24.946 -79.271  1.00 74.83  ? 49   PHE A N     1 
ATOM   393   C  CA    . PHE A  1 49  ? -86.111  -24.966 -78.057  1.00 86.74  ? 49   PHE A CA    1 
ATOM   394   C  C     . PHE A  1 49  ? -86.525  -25.885 -76.880  0.39 86.69  ? 49   PHE A C     1 
ATOM   395   O  O     . PHE A  1 49  ? -87.421  -26.712 -77.037  0.39 100.00 ? 49   PHE A O     1 
ATOM   396   C  CB    . PHE A  1 49  ? -85.922  -23.564 -77.439  1.00 74.73  ? 49   PHE A CB    1 
ATOM   397   C  CG    . PHE A  1 49  ? -86.982  -22.442 -77.600  1.00 88.14  ? 49   PHE A CG    1 
ATOM   398   C  CD1   . PHE A  1 49  ? -86.858  -21.318 -76.809  1.00 90.31  ? 49   PHE A CD1   1 
ATOM   399   C  CD2   . PHE A  1 49  ? -88.036  -22.480 -78.520  1.00 92.95  ? 49   PHE A CD2   1 
ATOM   400   C  CE1   . PHE A  1 49  ? -87.700  -20.244 -76.921  1.00 39.75  ? 49   PHE A CE1   1 
ATOM   401   C  CE2   . PHE A  1 49  ? -88.897  -21.386 -78.637  1.00 92.81  ? 49   PHE A CE2   1 
ATOM   402   C  CZ    . PHE A  1 49  ? -88.714  -20.278 -77.832  1.00 51.70  ? 49   PHE A CZ    1 
ATOM   403   N  N     . ASP A  1 50  ? -85.847  -25.739 -75.707  0.39 81.07  ? 50   ASP A N     1 
ATOM   404   C  CA    . ASP A  1 50  ? -86.029  -26.385 -74.358  0.39 68.41  ? 50   ASP A CA    1 
ATOM   405   C  C     . ASP A  1 50  ? -86.377  -25.237 -73.390  0.39 50.11  ? 50   ASP A C     1 
ATOM   406   O  O     . ASP A  1 50  ? -85.966  -25.137 -72.233  0.39 41.71  ? 50   ASP A O     1 
ATOM   407   C  CB    . ASP A  1 50  ? -84.854  -27.266 -73.964  0.39 74.88  ? 50   ASP A CB    1 
ATOM   408   C  CG    . ASP A  1 50  ? -83.678  -26.578 -73.189  0.39 78.97  ? 50   ASP A CG    1 
ATOM   409   O  OD1   . ASP A  1 50  ? -83.715  -26.533 -71.954  0.39 81.17  ? 50   ASP A OD1   1 
ATOM   410   O  OD2   . ASP A  1 50  ? -82.742  -26.082 -73.867  0.39 76.71  ? 50   ASP A OD2   1 
ATOM   411   N  N     . GLY A  1 51  ? -87.196  -24.396 -73.998  0.39 28.93  ? 51   GLY A N     1 
ATOM   412   C  CA    . GLY A  1 51  ? -87.790  -23.155 -73.533  0.39 18.90  ? 51   GLY A CA    1 
ATOM   413   C  C     . GLY A  1 51  ? -88.185  -23.118 -72.053  0.39 42.89  ? 51   GLY A C     1 
ATOM   414   O  O     . GLY A  1 51  ? -87.931  -22.121 -71.363  0.39 31.40  ? 51   GLY A O     1 
ATOM   415   N  N     . SER A  1 52  ? -88.788  -24.173 -71.561  0.39 46.69  ? 52   SER A N     1 
ATOM   416   C  CA    . SER A  1 52  ? -89.135  -24.184 -70.153  0.39 39.57  ? 52   SER A CA    1 
ATOM   417   C  C     . SER A  1 52  ? -88.065  -23.412 -69.378  0.39 41.83  ? 52   SER A C     1 
ATOM   418   O  O     . SER A  1 52  ? -88.162  -23.212 -68.164  0.39 37.60  ? 52   SER A O     1 
ATOM   419   C  CB    . SER A  1 52  ? -89.207  -25.606 -69.612  0.39 51.87  ? 52   SER A CB    1 
ATOM   420   O  OG    . SER A  1 52  ? -87.976  -25.995 -69.038  0.39 64.57  ? 52   SER A OG    1 
ATOM   421   N  N     . SER A  1 53  ? -87.041  -22.984 -70.107  0.39 55.25  ? 53   SER A N     1 
ATOM   422   C  CA    . SER A  1 53  ? -85.960  -22.292 -69.442  0.39 53.12  ? 53   SER A CA    1 
ATOM   423   C  C     . SER A  1 53  ? -86.127  -20.757 -69.379  0.39 53.04  ? 53   SER A C     1 
ATOM   424   O  O     . SER A  1 53  ? -85.280  -20.079 -68.784  0.39 37.25  ? 53   SER A O     1 
ATOM   425   C  CB    . SER A  1 53  ? -84.642  -22.694 -70.097  0.39 64.19  ? 53   SER A CB    1 
ATOM   426   O  OG    . SER A  1 53  ? -84.423  -24.091 -70.003  0.39 55.60  ? 53   SER A OG    1 
ATOM   427   N  N     . ILE A  1 54  ? -87.192  -20.170 -69.972  1.00 75.73  ? 54   ILE A N     1 
ATOM   428   C  CA    . ILE A  1 54  ? -87.366  -18.678 -69.911  1.00 78.50  ? 54   ILE A CA    1 
ATOM   429   C  C     . ILE A  1 54  ? -88.385  -18.263 -68.793  1.00 83.95  ? 54   ILE A C     1 
ATOM   430   O  O     . ILE A  1 54  ? -89.139  -19.114 -68.313  1.00 100.00 ? 54   ILE A O     1 
ATOM   431   C  CB    . ILE A  1 54  ? -87.777  -18.124 -71.311  1.00 77.35  ? 54   ILE A CB    1 
ATOM   432   C  CG1   . ILE A  1 54  ? -86.810  -18.613 -72.409  1.00 98.29  ? 54   ILE A CG1   1 
ATOM   433   C  CG2   . ILE A  1 54  ? -87.836  -16.597 -71.283  1.00 34.45  ? 54   ILE A CG2   1 
ATOM   434   C  CD1   . ILE A  1 54  ? -85.532  -17.814 -72.496  1.00 99.88  ? 54   ILE A CD1   1 
ATOM   435   N  N     . GLY A  1 55  ? -88.433  -16.973 -68.395  1.00 38.24  ? 55   GLY A N     1 
ATOM   436   C  CA    . GLY A  1 55  ? -89.267  -16.338 -67.341  1.00 45.04  ? 55   GLY A CA    1 
ATOM   437   C  C     . GLY A  1 55  ? -90.628  -15.727 -67.802  1.00 54.16  ? 55   GLY A C     1 
ATOM   438   O  O     . GLY A  1 55  ? -90.692  -14.944 -68.742  1.00 58.55  ? 55   GLY A O     1 
ATOM   439   N  N     . GLY A  1 56  ? -91.704  -16.101 -67.097  1.00 53.15  ? 56   GLY A N     1 
ATOM   440   C  CA    . GLY A  1 56  ? -93.068  -15.726 -67.435  1.00 58.81  ? 56   GLY A CA    1 
ATOM   441   C  C     . GLY A  1 56  ? -93.635  -16.515 -68.600  1.00 61.90  ? 56   GLY A C     1 
ATOM   442   O  O     . GLY A  1 56  ? -94.751  -16.257 -69.059  1.00 62.17  ? 56   GLY A O     1 
ATOM   443   N  N     . TRP A  1 57  ? -92.833  -17.443 -69.111  1.00 61.19  ? 57   TRP A N     1 
ATOM   444   C  CA    . TRP A  1 57  ? -93.222  -18.302 -70.225  1.00 64.78  ? 57   TRP A CA    1 
ATOM   445   C  C     . TRP A  1 57  ? -93.202  -19.736 -69.708  1.00 76.78  ? 57   TRP A C     1 
ATOM   446   O  O     . TRP A  1 57  ? -93.587  -20.691 -70.406  1.00 88.48  ? 57   TRP A O     1 
ATOM   447   C  CB    . TRP A  1 57  ? -92.218  -18.177 -71.372  1.00 48.51  ? 57   TRP A CB    1 
ATOM   448   C  CG    . TRP A  1 57  ? -92.187  -16.829 -72.032  1.00 41.24  ? 57   TRP A CG    1 
ATOM   449   C  CD1   . TRP A  1 57  ? -92.839  -15.695 -71.633  1.00 46.59  ? 57   TRP A CD1   1 
ATOM   450   C  CD2   . TRP A  1 57  ? -91.471  -16.479 -73.226  1.00 43.34  ? 57   TRP A CD2   1 
ATOM   451   N  NE1   . TRP A  1 57  ? -92.576  -14.664 -72.505  1.00 46.66  ? 57   TRP A NE1   1 
ATOM   452   C  CE2   . TRP A  1 57  ? -91.743  -15.118 -73.491  1.00 44.32  ? 57   TRP A CE2   1 
ATOM   453   C  CE3   . TRP A  1 57  ? -90.628  -17.184 -74.094  1.00 44.07  ? 57   TRP A CE3   1 
ATOM   454   C  CZ2   . TRP A  1 57  ? -91.201  -14.449 -74.597  1.00 43.65  ? 57   TRP A CZ2   1 
ATOM   455   C  CZ3   . TRP A  1 57  ? -90.088  -16.517 -75.193  1.00 43.11  ? 57   TRP A CZ3   1 
ATOM   456   C  CH2   . TRP A  1 57  ? -90.379  -15.163 -75.434  1.00 30.35  ? 57   TRP A CH2   1 
ATOM   457   N  N     . LYS A  1 58  ? -92.727  -19.895 -68.462  0.72 96.46  ? 58   LYS A N     1 
ATOM   458   C  CA    . LYS A  1 58  ? -92.531  -21.198 -67.828  0.72 93.07  ? 58   LYS A CA    1 
ATOM   459   C  C     . LYS A  1 58  ? -93.766  -21.961 -67.376  0.72 94.91  ? 58   LYS A C     1 
ATOM   460   O  O     . LYS A  1 58  ? -94.369  -21.666 -66.349  0.72 88.79  ? 58   LYS A O     1 
ATOM   461   C  CB    . LYS A  1 58  ? -91.622  -21.073 -66.622  0.72 84.44  ? 58   LYS A CB    1 
ATOM   462   C  CG    . LYS A  1 58  ? -91.722  -22.260 -65.673  0.72 88.12  ? 58   LYS A CG    1 
ATOM   463   C  CD    . LYS A  1 58  ? -90.772  -22.107 -64.507  0.72 93.37  ? 58   LYS A CD    1 
ATOM   464   C  CE    . LYS A  1 58  ? -90.966  -23.192 -63.466  0.72 93.27  ? 58   LYS A CE    1 
ATOM   465   N  NZ    . LYS A  1 58  ? -90.543  -24.527 -63.968  0.72 100.00 ? 58   LYS A NZ    1 
ATOM   466   N  N     . GLY A  1 59  ? -94.124  -22.929 -68.189  0.72 89.58  ? 59   GLY A N     1 
ATOM   467   C  CA    . GLY A  1 59  ? -95.194  -23.856 -67.883  0.72 92.74  ? 59   GLY A CA    1 
ATOM   468   C  C     . GLY A  1 59  ? -94.529  -25.166 -67.555  0.72 98.82  ? 59   GLY A C     1 
ATOM   469   O  O     . GLY A  1 59  ? -93.714  -25.652 -68.340  0.72 96.45  ? 59   GLY A O     1 
ATOM   470   N  N     . ILE A  1 60  ? -94.842  -25.750 -66.409  0.72 98.63  ? 60   ILE A N     1 
ATOM   471   C  CA    . ILE A  1 60  ? -94.201  -26.988 -66.027  0.72 100.00 ? 60   ILE A CA    1 
ATOM   472   C  C     . ILE A  1 60  ? -94.276  -28.129 -67.041  0.72 93.34  ? 60   ILE A C     1 
ATOM   473   O  O     . ILE A  1 60  ? -93.266  -28.770 -67.317  0.72 93.61  ? 60   ILE A O     1 
ATOM   474   C  CB    . ILE A  1 60  ? -94.627  -27.365 -64.590  0.72 98.85  ? 60   ILE A CB    1 
ATOM   475   C  CG1   . ILE A  1 60  ? -93.431  -27.080 -63.665  0.72 100.00 ? 60   ILE A CG1   1 
ATOM   476   C  CG2   . ILE A  1 60  ? -95.029  -28.846 -64.471  0.72 96.54  ? 60   ILE A CG2   1 
ATOM   477   C  CD1   . ILE A  1 60  ? -92.131  -26.866 -64.399  0.72 100.00 ? 60   ILE A CD1   1 
ATOM   478   N  N     . ASN A  1 61  ? -95.468  -28.397 -67.567  0.72 81.49  ? 61   ASN A N     1 
ATOM   479   C  CA    . ASN A  1 61  ? -95.642  -29.450 -68.579  0.72 87.22  ? 61   ASN A CA    1 
ATOM   480   C  C     . ASN A  1 61  ? -95.164  -28.982 -69.967  0.72 90.99  ? 61   ASN A C     1 
ATOM   481   O  O     . ASN A  1 61  ? -94.007  -29.209 -70.345  0.72 77.29  ? 61   ASN A O     1 
ATOM   482   C  CB    . ASN A  1 61  ? -97.120  -29.856 -68.664  0.72 87.62  ? 61   ASN A CB    1 
ATOM   483   C  CG    . ASN A  1 61  ? -97.516  -30.905 -67.639  0.72 91.82  ? 61   ASN A CG    1 
ATOM   484   O  OD1   . ASN A  1 61  ? -98.670  -31.343 -67.601  0.72 88.47  ? 61   ASN A OD1   1 
ATOM   485   N  ND2   . ASN A  1 61  ? -96.568  -31.333 -66.819  0.72 100.00 ? 61   ASN A ND2   1 
ATOM   486   N  N     . GLU A  1 62  ? -96.072  -28.308 -70.691  0.72 96.34  ? 62   GLU A N     1 
ATOM   487   C  CA    . GLU A  1 62  ? -95.873  -27.771 -72.053  0.72 100.00 ? 62   GLU A CA    1 
ATOM   488   C  C     . GLU A  1 62  ? -94.738  -26.756 -72.298  0.72 100.00 ? 62   GLU A C     1 
ATOM   489   O  O     . GLU A  1 62  ? -94.980  -25.602 -72.701  0.72 100.00 ? 62   GLU A O     1 
ATOM   490   C  CB    . GLU A  1 62  ? -97.205  -27.176 -72.581  0.72 100.00 ? 62   GLU A CB    1 
ATOM   491   C  CG    . GLU A  1 62  ? -98.156  -26.371 -71.652  0.72 100.00 ? 62   GLU A CG    1 
ATOM   492   C  CD    . GLU A  1 62  ? -97.517  -25.696 -70.418  0.72 100.00 ? 62   GLU A CD    1 
ATOM   493   O  OE1   . GLU A  1 62  ? -97.644  -26.266 -69.308  0.72 100.00 ? 62   GLU A OE1   1 
ATOM   494   O  OE2   . GLU A  1 62  ? -96.932  -24.587 -70.540  0.72 100.00 ? 62   GLU A OE2   1 
ATOM   495   N  N     . SER A  1 63  ? -93.509  -27.221 -72.153  0.72 94.20  ? 63   SER A N     1 
ATOM   496   C  CA    . SER A  1 63  ? -92.340  -26.348 -72.287  0.72 94.85  ? 63   SER A CA    1 
ATOM   497   C  C     . SER A  1 63  ? -91.816  -26.023 -73.683  0.72 90.33  ? 63   SER A C     1 
ATOM   498   O  O     . SER A  1 63  ? -91.000  -25.123 -73.836  0.72 93.72  ? 63   SER A O     1 
ATOM   499   C  CB    . SER A  1 63  ? -91.200  -26.867 -71.396  0.72 91.94  ? 63   SER A CB    1 
ATOM   500   O  OG    . SER A  1 63  ? -91.635  -27.934 -70.552  0.72 92.15  ? 63   SER A OG    1 
ATOM   501   N  N     . ASP A  1 64  ? -92.298  -26.710 -74.720  0.72 74.19  ? 64   ASP A N     1 
ATOM   502   C  CA    . ASP A  1 64  ? -91.755  -26.461 -76.057  0.72 62.56  ? 64   ASP A CA    1 
ATOM   503   C  C     . ASP A  1 64  ? -92.471  -25.541 -77.030  0.72 59.40  ? 64   ASP A C     1 
ATOM   504   O  O     . ASP A  1 64  ? -93.634  -25.772 -77.373  0.72 48.35  ? 64   ASP A O     1 
ATOM   505   C  CB    . ASP A  1 64  ? -91.416  -27.780 -76.722  0.72 59.45  ? 64   ASP A CB    1 
ATOM   506   C  CG    . ASP A  1 64  ? -89.983  -28.201 -76.452  0.72 69.42  ? 64   ASP A CG    1 
ATOM   507   O  OD1   . ASP A  1 64  ? -89.648  -28.446 -75.262  0.72 59.28  ? 64   ASP A OD1   1 
ATOM   508   O  OD2   . ASP A  1 64  ? -89.201  -28.258 -77.412  0.72 66.23  ? 64   ASP A OD2   1 
ATOM   509   N  N     . MET A  1 65  ? -91.724  -24.531 -77.521  1.00 68.43  ? 65   MET A N     1 
ATOM   510   C  CA    . MET A  1 65  ? -92.190  -23.508 -78.471  1.00 67.01  ? 65   MET A CA    1 
ATOM   511   C  C     . MET A  1 65  ? -91.290  -23.396 -79.724  1.00 66.51  ? 65   MET A C     1 
ATOM   512   O  O     . MET A  1 65  ? -90.159  -23.883 -79.727  1.00 70.47  ? 65   MET A O     1 
ATOM   513   C  CB    . MET A  1 65  ? -92.265  -22.134 -77.779  1.00 71.42  ? 65   MET A CB    1 
ATOM   514   C  CG    . MET A  1 65  ? -93.670  -21.519 -77.657  1.00 70.08  ? 65   MET A CG    1 
ATOM   515   S  SD    . MET A  1 65  ? -94.655  -22.100 -76.260  1.00 93.66  ? 65   MET A SD    1 
ATOM   516   C  CE    . MET A  1 65  ? -93.640  -21.531 -74.894  1.00 92.12  ? 65   MET A CE    1 
ATOM   517   N  N     . VAL A  1 66  ? -91.780  -22.691 -80.751  1.00 57.88  ? 66   VAL A N     1 
ATOM   518   C  CA    . VAL A  1 66  ? -91.074  -22.510 -82.038  1.00 51.96  ? 66   VAL A CA    1 
ATOM   519   C  C     . VAL A  1 66  ? -90.529  -21.102 -82.349  1.00 57.09  ? 66   VAL A C     1 
ATOM   520   O  O     . VAL A  1 66  ? -91.248  -20.102 -82.246  1.00 53.53  ? 66   VAL A O     1 
ATOM   521   C  CB    . VAL A  1 66  ? -92.012  -22.870 -83.219  1.00 49.86  ? 66   VAL A CB    1 
ATOM   522   C  CG1   . VAL A  1 66  ? -91.297  -22.707 -84.559  1.00 39.35  ? 66   VAL A CG1   1 
ATOM   523   C  CG2   . VAL A  1 66  ? -92.533  -24.275 -83.062  1.00 71.33  ? 66   VAL A CG2   1 
ATOM   524   N  N     . LEU A  1 67  ? -89.278  -21.043 -82.794  1.00 50.80  ? 67   LEU A N     1 
ATOM   525   C  CA    . LEU A  1 67  ? -88.655  -19.774 -83.181  1.00 40.95  ? 67   LEU A CA    1 
ATOM   526   C  C     . LEU A  1 67  ? -88.872  -19.538 -84.679  1.00 46.70  ? 67   LEU A C     1 
ATOM   527   O  O     . LEU A  1 67  ? -88.273  -20.229 -85.516  1.00 42.99  ? 67   LEU A O     1 
ATOM   528   C  CB    . LEU A  1 67  ? -87.155  -19.811 -82.911  1.00 43.05  ? 67   LEU A CB    1 
ATOM   529   C  CG    . LEU A  1 67  ? -86.641  -19.323 -81.566  1.00 49.19  ? 67   LEU A CG    1 
ATOM   530   C  CD1   . LEU A  1 67  ? -85.191  -19.685 -81.464  1.00 26.04  ? 67   LEU A CD1   1 
ATOM   531   C  CD2   . LEU A  1 67  ? -86.823  -17.830 -81.442  1.00 33.63  ? 67   LEU A CD2   1 
ATOM   532   N  N     . MET A  1 68  ? -89.696  -18.550 -85.020  1.00 39.32  ? 68   MET A N     1 
ATOM   533   C  CA    . MET A  1 68  ? -89.979  -18.266 -86.421  1.00 34.90  ? 68   MET A CA    1 
ATOM   534   C  C     . MET A  1 68  ? -89.243  -17.057 -86.974  1.00 37.66  ? 68   MET A C     1 
ATOM   535   O  O     . MET A  1 68  ? -89.660  -15.906 -86.780  1.00 51.33  ? 68   MET A O     1 
ATOM   536   C  CB    . MET A  1 68  ? -91.487  -18.115 -86.662  1.00 48.46  ? 68   MET A CB    1 
ATOM   537   C  CG    . MET A  1 68  ? -91.884  -18.030 -88.139  1.00 48.45  ? 68   MET A CG    1 
ATOM   538   S  SD    . MET A  1 68  ? -91.301  -19.456 -89.095  1.00 51.13  ? 68   MET A SD    1 
ATOM   539   C  CE    . MET A  1 68  ? -92.197  -20.768 -88.272  1.00 41.35  ? 68   MET A CE    1 
ATOM   540   N  N     . PRO A  1 69  ? -88.172  -17.313 -87.739  1.00 28.61  ? 69   PRO A N     1 
ATOM   541   C  CA    . PRO A  1 69  ? -87.380  -16.242 -88.334  1.00 32.01  ? 69   PRO A CA    1 
ATOM   542   C  C     . PRO A  1 69  ? -88.212  -15.357 -89.236  1.00 33.26  ? 69   PRO A C     1 
ATOM   543   O  O     . PRO A  1 69  ? -89.043  -15.840 -90.013  1.00 53.98  ? 69   PRO A O     1 
ATOM   544   C  CB    . PRO A  1 69  ? -86.300  -17.003 -89.115  1.00 23.06  ? 69   PRO A CB    1 
ATOM   545   C  CG    . PRO A  1 69  ? -86.950  -18.297 -89.443  1.00 35.29  ? 69   PRO A CG    1 
ATOM   546   C  CD    . PRO A  1 69  ? -87.646  -18.628 -88.142  1.00 35.60  ? 69   PRO A CD    1 
ATOM   547   N  N     . ASP A  1 70  ? -88.044  -14.058 -89.034  1.00 38.15  ? 70   ASP A N     1 
ATOM   548   C  CA    . ASP A  1 70  ? -88.713  -13.037 -89.821  1.00 36.62  ? 70   ASP A CA    1 
ATOM   549   C  C     . ASP A  1 70  ? -87.619  -12.542 -90.776  1.00 31.15  ? 70   ASP A C     1 
ATOM   550   O  O     . ASP A  1 70  ? -86.801  -11.695 -90.421  1.00 35.28  ? 70   ASP A O     1 
ATOM   551   C  CB    . ASP A  1 70  ? -89.221  -11.923 -88.896  1.00 32.33  ? 70   ASP A CB    1 
ATOM   552   C  CG    . ASP A  1 70  ? -89.846  -10.757 -89.650  1.00 44.39  ? 70   ASP A CG    1 
ATOM   553   O  OD1   . ASP A  1 70  ? -89.448  -10.485 -90.804  1.00 39.00  ? 70   ASP A OD1   1 
ATOM   554   O  OD2   . ASP A  1 70  ? -90.734  -10.093 -89.070  1.00 42.92  ? 70   ASP A OD2   1 
ATOM   555   N  N     . ALA A  1 71  ? -87.640  -13.068 -91.998  1.00 38.54  ? 71   ALA A N     1 
ATOM   556   C  CA    . ALA A  1 71  ? -86.650  -12.751 -93.027  1.00 30.21  ? 71   ALA A CA    1 
ATOM   557   C  C     . ALA A  1 71  ? -86.469  -11.290 -93.371  1.00 34.48  ? 71   ALA A C     1 
ATOM   558   O  O     . ALA A  1 71  ? -85.472  -10.913 -93.994  1.00 44.23  ? 71   ALA A O     1 
ATOM   559   C  CB    . ALA A  1 71  ? -86.942  -13.528 -94.272  1.00 31.19  ? 71   ALA A CB    1 
ATOM   560   N  N     . SER A  1 72  ? -87.419  -10.458 -92.974  1.00 32.11  ? 72   SER A N     1 
ATOM   561   C  CA    . SER A  1 72  ? -87.307  -9.039  -93.278  1.00 41.14  ? 72   SER A CA    1 
ATOM   562   C  C     . SER A  1 72  ? -86.356  -8.309  -92.333  1.00 43.96  ? 72   SER A C     1 
ATOM   563   O  O     . SER A  1 72  ? -85.831  -7.250  -92.674  1.00 47.61  ? 72   SER A O     1 
ATOM   564   C  CB    . SER A  1 72  ? -88.683  -8.373  -93.230  1.00 33.69  ? 72   SER A CB    1 
ATOM   565   O  OG    . SER A  1 72  ? -89.141  -8.238  -91.898  1.00 36.72  ? 72   SER A OG    1 
ATOM   566   N  N     . THR A  1 73  ? -86.111  -8.899  -91.163  1.00 41.27  ? 73   THR A N     1 
ATOM   567   C  CA    . THR A  1 73  ? -85.266  -8.287  -90.142  1.00 32.28  ? 73   THR A CA    1 
ATOM   568   C  C     . THR A  1 73  ? -83.766  -8.538  -90.235  1.00 30.61  ? 73   THR A C     1 
ATOM   569   O  O     . THR A  1 73  ? -83.000  -7.987  -89.437  1.00 48.14  ? 73   THR A O     1 
ATOM   570   C  CB    . THR A  1 73  ? -85.717  -8.723  -88.744  1.00 29.27  ? 73   THR A CB    1 
ATOM   571   O  OG1   . THR A  1 73  ? -85.551  -10.136 -88.616  1.00 39.41  ? 73   THR A OG1   1 
ATOM   572   C  CG2   . THR A  1 73  ? -87.169  -8.383  -88.520  1.00 30.73  ? 73   THR A CG2   1 
ATOM   573   N  N     . ALA A  1 74  ? -83.343  -9.299  -91.240  1.00 33.12  ? 74   ALA A N     1 
ATOM   574   C  CA    . ALA A  1 74  ? -81.932  -9.655  -91.400  1.00 32.99  ? 74   ALA A CA    1 
ATOM   575   C  C     . ALA A  1 74  ? -80.953  -8.502  -91.445  1.00 41.73  ? 74   ALA A C     1 
ATOM   576   O  O     . ALA A  1 74  ? -81.063  -7.600  -92.279  1.00 49.22  ? 74   ALA A O     1 
ATOM   577   C  CB    . ALA A  1 74  ? -81.730  -10.561 -92.604  1.00 36.40  ? 74   ALA A CB    1 
ATOM   578   N  N     . VAL A  1 75  ? -79.986  -8.556  -90.535  1.00 44.83  ? 75   VAL A N     1 
ATOM   579   C  CA    . VAL A  1 75  ? -78.953  -7.539  -90.436  1.00 37.83  ? 75   VAL A CA    1 
ATOM   580   C  C     . VAL A  1 75  ? -77.678  -8.100  -89.799  1.00 36.70  ? 75   VAL A C     1 
ATOM   581   O  O     . VAL A  1 75  ? -77.726  -8.959  -88.914  1.00 38.75  ? 75   VAL A O     1 
ATOM   582   C  CB    . VAL A  1 75  ? -79.469  -6.283  -89.695  1.00 16.29  ? 75   VAL A CB    1 
ATOM   583   C  CG1   . VAL A  1 75  ? -80.018  -6.635  -88.313  1.00 37.98  ? 75   VAL A CG1   1 
ATOM   584   C  CG2   . VAL A  1 75  ? -78.392  -5.230  -89.637  1.00 51.81  ? 75   VAL A CG2   1 
ATOM   585   N  N     . ILE A  1 76  ? -76.541  -7.656  -90.329  1.00 32.12  ? 76   ILE A N     1 
ATOM   586   C  CA    . ILE A  1 76  ? -75.223  -8.081  -89.878  1.00 34.57  ? 76   ILE A CA    1 
ATOM   587   C  C     . ILE A  1 76  ? -74.888  -7.490  -88.520  1.00 34.81  ? 76   ILE A C     1 
ATOM   588   O  O     . ILE A  1 76  ? -75.157  -6.309  -88.285  1.00 37.18  ? 76   ILE A O     1 
ATOM   589   C  CB    . ILE A  1 76  ? -74.143  -7.615  -90.890  1.00 26.77  ? 76   ILE A CB    1 
ATOM   590   C  CG1   . ILE A  1 76  ? -74.279  -8.386  -92.197  1.00 28.25  ? 76   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A  1 76  ? -72.748  -7.832  -90.332  1.00 20.03  ? 76   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A  1 76  ? -73.901  -9.857  -92.073  1.00 25.92  ? 76   ILE A CD1   1 
ATOM   593   N  N     . ASP A  1 77  ? -74.296  -8.301  -87.639  1.00 30.42  ? 77   ASP A N     1 
ATOM   594   C  CA    . ASP A  1 77  ? -73.894  -7.813  -86.323  1.00 26.27  ? 77   ASP A CA    1 
ATOM   595   C  C     . ASP A  1 77  ? -72.556  -7.111  -86.515  1.00 24.00  ? 77   ASP A C     1 
ATOM   596   O  O     . ASP A  1 77  ? -71.599  -7.696  -87.032  1.00 34.67  ? 77   ASP A O     1 
ATOM   597   C  CB    . ASP A  1 77  ? -73.751  -8.943  -85.311  1.00 21.65  ? 77   ASP A CB    1 
ATOM   598   C  CG    . ASP A  1 77  ? -73.550  -8.424  -83.899  1.00 26.72  ? 77   ASP A CG    1 
ATOM   599   O  OD1   . ASP A  1 77  ? -74.518  -8.453  -83.126  1.00 30.34  ? 77   ASP A OD1   1 
ATOM   600   O  OD2   . ASP A  1 77  ? -72.438  -7.973  -83.561  1.00 33.52  ? 77   ASP A OD2   1 
ATOM   601   N  N     . PRO A  1 78  ? -72.472  -5.841  -86.092  1.00 22.75  ? 78   PRO A N     1 
ATOM   602   C  CA    . PRO A  1 78  ? -71.259  -5.024  -86.221  1.00 19.29  ? 78   PRO A CA    1 
ATOM   603   C  C     . PRO A  1 78  ? -70.219  -5.163  -85.129  1.00 26.74  ? 78   PRO A C     1 
ATOM   604   O  O     . PRO A  1 78  ? -69.196  -4.489  -85.169  1.00 39.44  ? 78   PRO A O     1 
ATOM   605   C  CB    . PRO A  1 78  ? -71.824  -3.607  -86.263  1.00 18.55  ? 78   PRO A CB    1 
ATOM   606   C  CG    . PRO A  1 78  ? -72.995  -3.680  -85.328  1.00 15.61  ? 78   PRO A CG    1 
ATOM   607   C  CD    . PRO A  1 78  ? -73.597  -5.061  -85.533  1.00 22.58  ? 78   PRO A CD    1 
ATOM   608   N  N     . PHE A  1 79  ? -70.466  -6.059  -84.179  1.00 30.98  ? 79   PHE A N     1 
ATOM   609   C  CA    . PHE A  1 79  ? -69.565  -6.254  -83.051  1.00 20.82  ? 79   PHE A CA    1 
ATOM   610   C  C     . PHE A  1 79  ? -68.881  -7.604  -83.021  1.00 23.51  ? 79   PHE A C     1 
ATOM   611   O  O     . PHE A  1 79  ? -67.691  -7.697  -82.726  1.00 39.21  ? 79   PHE A O     1 
ATOM   612   C  CB    . PHE A  1 79  ? -70.327  -6.055  -81.748  1.00 12.02  ? 79   PHE A CB    1 
ATOM   613   C  CG    . PHE A  1 79  ? -71.037  -4.739  -81.667  1.00 18.37  ? 79   PHE A CG    1 
ATOM   614   C  CD1   . PHE A  1 79  ? -70.319  -3.548  -81.648  1.00 21.57  ? 79   PHE A CD1   1 
ATOM   615   C  CD2   . PHE A  1 79  ? -72.422  -4.687  -81.639  1.00 26.19  ? 79   PHE A CD2   1 
ATOM   616   C  CE1   . PHE A  1 79  ? -70.967  -2.324  -81.610  1.00 18.05  ? 79   PHE A CE1   1 
ATOM   617   C  CE2   . PHE A  1 79  ? -73.084  -3.464  -81.601  1.00 14.56  ? 79   PHE A CE2   1 
ATOM   618   C  CZ    . PHE A  1 79  ? -72.356  -2.281  -81.585  1.00 20.35  ? 79   PHE A CZ    1 
ATOM   619   N  N     . PHE A  1 80  ? -69.655  -8.650  -83.276  1.00 20.51  ? 80   PHE A N     1 
ATOM   620   C  CA    . PHE A  1 80  ? -69.145  -10.015 -83.277  1.00 17.47  ? 80   PHE A CA    1 
ATOM   621   C  C     . PHE A  1 80  ? -67.901  -10.156 -84.178  1.00 21.07  ? 80   PHE A C     1 
ATOM   622   O  O     . PHE A  1 80  ? -67.790  -9.495  -85.214  1.00 36.96  ? 80   PHE A O     1 
ATOM   623   C  CB    . PHE A  1 80  ? -70.274  -10.969 -83.693  1.00 5.66   ? 80   PHE A CB    1 
ATOM   624   C  CG    . PHE A  1 80  ? -71.433  -11.034 -82.702  1.00 23.99  ? 80   PHE A CG    1 
ATOM   625   C  CD1   . PHE A  1 80  ? -72.619  -11.670 -83.039  1.00 27.38  ? 80   PHE A CD1   1 
ATOM   626   C  CD2   . PHE A  1 80  ? -71.336  -10.458 -81.443  1.00 37.38  ? 80   PHE A CD2   1 
ATOM   627   C  CE1   . PHE A  1 80  ? -73.685  -11.727 -82.152  1.00 33.99  ? 80   PHE A CE1   1 
ATOM   628   C  CE2   . PHE A  1 80  ? -72.403  -10.509 -80.551  1.00 37.69  ? 80   PHE A CE2   1 
ATOM   629   C  CZ    . PHE A  1 80  ? -73.577  -11.146 -80.909  1.00 33.97  ? 80   PHE A CZ    1 
ATOM   630   N  N     . ALA A  1 81  ? -66.954  -10.990 -83.758  1.00 17.66  ? 81   ALA A N     1 
ATOM   631   C  CA    . ALA A  1 81  ? -65.704  -11.180 -84.503  1.00 19.68  ? 81   ALA A CA    1 
ATOM   632   C  C     . ALA A  1 81  ? -65.794  -11.993 -85.786  1.00 27.32  ? 81   ALA A C     1 
ATOM   633   O  O     . ALA A  1 81  ? -64.978  -11.813 -86.692  1.00 33.70  ? 81   ALA A O     1 
ATOM   634   C  CB    . ALA A  1 81  ? -64.673  -11.785 -83.600  1.00 11.19  ? 81   ALA A CB    1 
ATOM   635   N  N     . ASP A  1 82  ? -66.714  -12.937 -85.811  1.00 16.79  ? 82   ASP A N     1 
ATOM   636   C  CA    . ASP A  1 82  ? -66.946  -13.809 -86.957  1.00 26.07  ? 82   ASP A CA    1 
ATOM   637   C  C     . ASP A  1 82  ? -68.196  -13.291 -87.630  1.00 32.01  ? 82   ASP A C     1 
ATOM   638   O  O     . ASP A  1 82  ? -69.150  -12.981 -86.946  1.00 22.71  ? 82   ASP A O     1 
ATOM   639   C  CB    . ASP A  1 82  ? -67.188  -15.235 -86.475  1.00 22.09  ? 82   ASP A CB    1 
ATOM   640   C  CG    . ASP A  1 82  ? -66.100  -15.718 -85.549  1.00 35.94  ? 82   ASP A CG    1 
ATOM   641   O  OD1   . ASP A  1 82  ? -64.998  -16.074 -86.036  1.00 26.27  ? 82   ASP A OD1   1 
ATOM   642   O  OD2   . ASP A  1 82  ? -66.352  -15.714 -84.330  1.00 29.36  ? 82   ASP A OD2   1 
ATOM   643   N  N     . SER A  1 83  ? -68.197  -13.218 -88.957  1.00 36.61  ? 83   SER A N     1 
ATOM   644   C  CA    . SER A  1 83  ? -69.358  -12.707 -89.675  1.00 25.78  ? 83   SER A CA    1 
ATOM   645   C  C     . SER A  1 83  ? -70.640  -13.418 -89.275  1.00 34.30  ? 83   SER A C     1 
ATOM   646   O  O     . SER A  1 83  ? -70.793  -14.629 -89.460  1.00 41.21  ? 83   SER A O     1 
ATOM   647   C  CB    . SER A  1 83  ? -69.161  -12.797 -91.183  1.00 23.58  ? 83   SER A CB    1 
ATOM   648   O  OG    . SER A  1 83  ? -69.998  -11.838 -91.801  1.00 39.26  ? 83   SER A OG    1 
ATOM   649   N  N     . THR A  1 84  ? -71.543  -12.660 -88.673  1.00 25.08  ? 84   THR A N     1 
ATOM   650   C  CA    . THR A  1 84  ? -72.793  -13.236 -88.241  1.00 28.59  ? 84   THR A CA    1 
ATOM   651   C  C     . THR A  1 84  ? -73.971  -12.327 -88.571  1.00 26.08  ? 84   THR A C     1 
ATOM   652   O  O     . THR A  1 84  ? -73.872  -11.092 -88.510  1.00 28.22  ? 84   THR A O     1 
ATOM   653   C  CB    . THR A  1 84  ? -72.736  -13.682 -86.735  1.00 28.86  ? 84   THR A CB    1 
ATOM   654   O  OG1   . THR A  1 84  ? -73.909  -13.249 -86.038  1.00 35.27  ? 84   THR A OG1   1 
ATOM   655   C  CG2   . THR A  1 84  ? -71.529  -13.064 -86.026  1.00 21.72  ? 84   THR A CG2   1 
ATOM   656   N  N     . LEU A  1 85  ? -75.043  -12.968 -89.025  1.00 22.19  ? 85   LEU A N     1 
ATOM   657   C  CA    . LEU A  1 85  ? -76.267  -12.298 -89.427  1.00 26.88  ? 85   LEU A CA    1 
ATOM   658   C  C     . LEU A  1 85  ? -77.348  -12.483 -88.380  1.00 28.72  ? 85   LEU A C     1 
ATOM   659   O  O     . LEU A  1 85  ? -77.660  -13.605 -87.978  1.00 33.27  ? 85   LEU A O     1 
ATOM   660   C  CB    . LEU A  1 85  ? -76.728  -12.864 -90.777  1.00 31.57  ? 85   LEU A CB    1 
ATOM   661   C  CG    . LEU A  1 85  ? -77.943  -12.247 -91.471  1.00 25.33  ? 85   LEU A CG    1 
ATOM   662   C  CD1   . LEU A  1 85  ? -77.586  -10.914 -92.082  1.00 29.57  ? 85   LEU A CD1   1 
ATOM   663   C  CD2   . LEU A  1 85  ? -78.420  -13.182 -92.551  1.00 22.40  ? 85   LEU A CD2   1 
ATOM   664   N  N     . ILE A  1 86  ? -77.906  -11.367 -87.938  1.00 25.77  ? 86   ILE A N     1 
ATOM   665   C  CA    . ILE A  1 86  ? -78.958  -11.371 -86.931  1.00 27.59  ? 86   ILE A CA    1 
ATOM   666   C  C     . ILE A  1 86  ? -80.301  -11.489 -87.628  1.00 30.04  ? 86   ILE A C     1 
ATOM   667   O  O     . ILE A  1 86  ? -80.527  -10.844 -88.642  1.00 34.35  ? 86   ILE A O     1 
ATOM   668   C  CB    . ILE A  1 86  ? -78.985  -10.025 -86.147  1.00 25.68  ? 86   ILE A CB    1 
ATOM   669   C  CG1   . ILE A  1 86  ? -77.642  -9.763  -85.480  1.00 25.93  ? 86   ILE A CG1   1 
ATOM   670   C  CG2   . ILE A  1 86  ? -80.109  -10.020 -85.098  1.00 18.64  ? 86   ILE A CG2   1 
ATOM   671   C  CD1   . ILE A  1 86  ? -77.443  -8.315  -85.115  1.00 18.59  ? 86   ILE A CD1   1 
ATOM   672   N  N     . ILE A  1 87  ? -81.183  -12.316 -87.082  1.00 33.39  ? 87   ILE A N     1 
ATOM   673   C  CA    . ILE A  1 87  ? -82.529  -12.463 -87.612  1.00 23.04  ? 87   ILE A CA    1 
ATOM   674   C  C     . ILE A  1 87  ? -83.486  -12.512 -86.426  1.00 31.15  ? 87   ILE A C     1 
ATOM   675   O  O     . ILE A  1 87  ? -83.388  -13.387 -85.566  1.00 35.32  ? 87   ILE A O     1 
ATOM   676   C  CB    . ILE A  1 87  ? -82.701  -13.718 -88.477  1.00 27.46  ? 87   ILE A CB    1 
ATOM   677   C  CG1   . ILE A  1 87  ? -81.788  -13.647 -89.695  1.00 25.36  ? 87   ILE A CG1   1 
ATOM   678   C  CG2   . ILE A  1 87  ? -84.130  -13.804 -88.996  1.00 37.52  ? 87   ILE A CG2   1 
ATOM   679   C  CD1   . ILE A  1 87  ? -81.817  -14.902 -90.519  1.00 34.24  ? 87   ILE A CD1   1 
ATOM   680   N  N     . ARG A  1 88  ? -84.345  -11.499 -86.347  1.00 34.33  ? 88   ARG A N     1 
ATOM   681   C  CA    . ARG A  1 88  ? -85.341  -11.370 -85.295  1.00 24.66  ? 88   ARG A CA    1 
ATOM   682   C  C     . ARG A  1 88  ? -86.375  -12.464 -85.545  1.00 25.68  ? 88   ARG A C     1 
ATOM   683   O  O     . ARG A  1 88  ? -86.635  -12.834 -86.689  1.00 35.43  ? 88   ARG A O     1 
ATOM   684   C  CB    . ARG A  1 88  ? -85.940  -9.965  -85.374  1.00 24.09  ? 88   ARG A CB    1 
ATOM   685   C  CG    . ARG A  1 88  ? -86.880  -9.569  -84.267  1.00 31.12  ? 88   ARG A CG    1 
ATOM   686   C  CD    . ARG A  1 88  ? -86.652  -8.103  -83.933  1.00 20.21  ? 88   ARG A CD    1 
ATOM   687   N  NE    . ARG A  1 88  ? -85.855  -8.062  -82.724  1.00 31.79  ? 88   ARG A NE    1 
ATOM   688   C  CZ    . ARG A  1 88  ? -84.635  -7.562  -82.626  1.00 36.77  ? 88   ARG A CZ    1 
ATOM   689   N  NH1   . ARG A  1 88  ? -84.032  -7.626  -81.452  1.00 37.68  ? 88   ARG A NH1   1 
ATOM   690   N  NH2   . ARG A  1 88  ? -84.040  -6.965  -83.661  1.00 28.40  ? 88   ARG A NH2   1 
ATOM   691   N  N     . CYS A  1 89  ? -86.918  -13.025 -84.476  1.00 28.74  ? 89   CYS A N     1 
ATOM   692   C  CA    . CYS A  1 89  ? -87.881  -14.111 -84.601  1.00 30.86  ? 89   CYS A CA    1 
ATOM   693   C  C     . CYS A  1 89  ? -89.138  -13.831 -83.829  1.00 36.37  ? 89   CYS A C     1 
ATOM   694   O  O     . CYS A  1 89  ? -89.162  -12.923 -83.000  1.00 41.31  ? 89   CYS A O     1 
ATOM   695   C  CB    . CYS A  1 89  ? -87.296  -15.399 -84.023  1.00 28.08  ? 89   CYS A CB    1 
ATOM   696   S  SG    . CYS A  1 89  ? -85.849  -16.032 -84.854  1.00 35.89  ? 89   CYS A SG    1 
ATOM   697   N  N     . ASP A  1 90  ? -90.178  -14.620 -84.117  1.00 42.70  ? 90   ASP A N     1 
ATOM   698   C  CA    . ASP A  1 90  ? -91.464  -14.552 -83.410  1.00 36.60  ? 90   ASP A CA    1 
ATOM   699   C  C     . ASP A  1 90  ? -91.538  -15.905 -82.715  1.00 37.35  ? 90   ASP A C     1 
ATOM   700   O  O     . ASP A  1 90  ? -90.943  -16.881 -83.184  1.00 36.86  ? 90   ASP A O     1 
ATOM   701   C  CB    . ASP A  1 90  ? -92.661  -14.438 -84.360  1.00 31.12  ? 90   ASP A CB    1 
ATOM   702   C  CG    . ASP A  1 90  ? -92.649  -13.167 -85.172  1.00 49.10  ? 90   ASP A CG    1 
ATOM   703   O  OD1   . ASP A  1 90  ? -92.863  -12.091 -84.580  1.00 32.37  ? 90   ASP A OD1   1 
ATOM   704   O  OD2   . ASP A  1 90  ? -92.441  -13.254 -86.405  1.00 65.40  ? 90   ASP A OD2   1 
ATOM   705   N  N     . ILE A  1 91  ? -92.216  -15.956 -81.578  1.00 34.61  ? 91   ILE A N     1 
ATOM   706   C  CA    . ILE A  1 91  ? -92.365  -17.205 -80.838  1.00 40.85  ? 91   ILE A CA    1 
ATOM   707   C  C     . ILE A  1 91  ? -93.757  -17.728 -81.150  1.00 50.30  ? 91   ILE A C     1 
ATOM   708   O  O     . ILE A  1 91  ? -94.754  -17.081 -80.821  1.00 48.19  ? 91   ILE A O     1 
ATOM   709   C  CB    . ILE A  1 91  ? -92.244  -16.980 -79.316  1.00 48.43  ? 91   ILE A CB    1 
ATOM   710   C  CG1   . ILE A  1 91  ? -91.009  -16.134 -78.997  1.00 35.13  ? 91   ILE A CG1   1 
ATOM   711   C  CG2   . ILE A  1 91  ? -92.165  -18.311 -78.596  1.00 37.81  ? 91   ILE A CG2   1 
ATOM   712   C  CD1   . ILE A  1 91  ? -89.705  -16.725 -79.517  1.00 41.58  ? 91   ILE A CD1   1 
ATOM   713   N  N     . LEU A  1 92  ? -93.828  -18.879 -81.810  1.00 52.40  ? 92   LEU A N     1 
ATOM   714   C  CA    . LEU A  1 92  ? -95.115  -19.458 -82.184  1.00 50.50  ? 92   LEU A CA    1 
ATOM   715   C  C     . LEU A  1 92  ? -95.347  -20.747 -81.428  1.00 55.01  ? 92   LEU A C     1 
ATOM   716   O  O     . LEU A  1 92  ? -94.384  -21.403 -81.021  1.00 52.48  ? 92   LEU A O     1 
ATOM   717   C  CB    . LEU A  1 92  ? -95.144  -19.735 -83.690  1.00 23.94  ? 92   LEU A CB    1 
ATOM   718   C  CG    . LEU A  1 92  ? -94.667  -18.597 -84.598  1.00 42.02  ? 92   LEU A CG    1 
ATOM   719   C  CD1   . LEU A  1 92  ? -94.600  -19.085 -86.036  1.00 37.43  ? 92   LEU A CD1   1 
ATOM   720   C  CD2   . LEU A  1 92  ? -95.565  -17.359 -84.467  1.00 33.46  ? 92   LEU A CD2   1 
ATOM   721   N  N     . GLU A  1 93  ? -96.619  -21.093 -81.214  1.00 66.36  ? 93   GLU A N     1 
ATOM   722   C  CA    . GLU A  1 93  ? -96.952  -22.336 -80.521  1.00 64.68  ? 93   GLU A CA    1 
ATOM   723   C  C     . GLU A  1 93  ? -96.778  -23.445 -81.578  1.00 62.06  ? 93   GLU A C     1 
ATOM   724   O  O     . GLU A  1 93  ? -97.155  -23.258 -82.741  1.00 60.54  ? 93   GLU A O     1 
ATOM   725   C  CB    . GLU A  1 93  ? -98.383  -22.284 -79.968  1.00 64.17  ? 93   GLU A CB    1 
ATOM   726   C  CG    . GLU A  1 93  ? -98.601  -23.163 -78.720  1.00 78.76  ? 93   GLU A CG    1 
ATOM   727   C  CD    . GLU A  1 93  ? -98.426  -22.402 -77.409  1.00 80.99  ? 93   GLU A CD    1 
ATOM   728   O  OE1   . GLU A  1 93  ? -99.021  -21.301 -77.296  1.00 71.39  ? 93   GLU A OE1   1 
ATOM   729   O  OE2   . GLU A  1 93  ? -97.719  -22.910 -76.496  1.00 62.07  ? 93   GLU A OE2   1 
ATOM   730   N  N     . PRO A  1 94  ? -96.189  -24.601 -81.197  1.00 55.48  ? 94   PRO A N     1 
ATOM   731   C  CA    . PRO A  1 94  ? -95.957  -25.722 -82.121  1.00 60.76  ? 94   PRO A CA    1 
ATOM   732   C  C     . PRO A  1 94  ? -97.224  -26.283 -82.752  1.00 73.83  ? 94   PRO A C     1 
ATOM   733   O  O     . PRO A  1 94  ? -98.284  -26.346 -82.108  1.00 75.32  ? 94   PRO A O     1 
ATOM   734   C  CB    . PRO A  1 94  ? -95.294  -26.777 -81.231  1.00 55.58  ? 94   PRO A CB    1 
ATOM   735   C  CG    . PRO A  1 94  ? -94.751  -26.001 -80.086  1.00 57.18  ? 94   PRO A CG    1 
ATOM   736   C  CD    . PRO A  1 94  ? -95.836  -25.000 -79.827  1.00 58.21  ? 94   PRO A CD    1 
ATOM   737   N  N     . GLY A  1 95  ? -97.095  -26.724 -84.001  1.00 68.65  ? 95   GLY A N     1 
ATOM   738   C  CA    . GLY A  1 95  ? -98.232  -27.281 -84.712  1.00 70.14  ? 95   GLY A CA    1 
ATOM   739   C  C     . GLY A  1 95  ? -99.133  -26.178 -85.222  1.00 70.94  ? 95   GLY A C     1 
ATOM   740   O  O     . GLY A  1 95  ? -99.201  -25.929 -86.431  1.00 61.19  ? 95   GLY A O     1 
ATOM   741   N  N     . THR A  1 96  ? -99.821  -25.511 -84.298  1.00 68.16  ? 96   THR A N     1 
ATOM   742   C  CA    . THR A  1 96  ? -100.705 -24.407 -84.656  1.00 68.74  ? 96   THR A CA    1 
ATOM   743   C  C     . THR A  1 96  ? -99.927  -23.311 -85.390  1.00 69.35  ? 96   THR A C     1 
ATOM   744   O  O     . THR A  1 96  ? -100.404 -22.793 -86.404  1.00 54.72  ? 96   THR A O     1 
ATOM   745   C  CB    . THR A  1 96  ? -101.446 -23.823 -83.404  1.00 73.76  ? 96   THR A CB    1 
ATOM   746   O  OG1   . THR A  1 96  ? -101.810 -22.457 -83.635  1.00 76.91  ? 96   THR A OG1   1 
ATOM   747   C  CG2   . THR A  1 96  ? -100.592 -23.921 -82.148  1.00 73.93  ? 96   THR A CG2   1 
ATOM   748   N  N     . LEU A  1 97  ? -98.703  -23.034 -84.922  1.00 66.04  ? 97   LEU A N     1 
ATOM   749   C  CA    . LEU A  1 97  ? -97.834  -22.001 -85.502  1.00 62.52  ? 97   LEU A CA    1 
ATOM   750   C  C     . LEU A  1 97  ? -98.566  -20.655 -85.498  1.00 70.35  ? 97   LEU A C     1 
ATOM   751   O  O     . LEU A  1 97  ? -98.318  -19.786 -86.345  1.00 54.13  ? 97   LEU A O     1 
ATOM   752   C  CB    . LEU A  1 97  ? -97.420  -22.376 -86.934  1.00 46.45  ? 97   LEU A CB    1 
ATOM   753   C  CG    . LEU A  1 97  ? -96.017  -22.949 -87.180  1.00 61.52  ? 97   LEU A CG    1 
ATOM   754   C  CD1   . LEU A  1 97  ? -95.761  -24.197 -86.329  1.00 63.28  ? 97   LEU A CD1   1 
ATOM   755   C  CD2   . LEU A  1 97  ? -95.855  -23.256 -88.673  1.00 60.52  ? 97   LEU A CD2   1 
ATOM   756   N  N     . GLN A  1 98  ? -99.426  -20.473 -84.499  1.00 75.90  ? 98   GLN A N     1 
ATOM   757   C  CA    . GLN A  1 98  ? -100.240 -19.275 -84.404  1.00 83.60  ? 98   GLN A CA    1 
ATOM   758   C  C     . GLN A  1 98  ? -99.569  -18.027 -83.816  1.00 84.35  ? 98   GLN A C     1 
ATOM   759   O  O     . GLN A  1 98  ? -99.726  -16.925 -84.358  1.00 95.96  ? 98   GLN A O     1 
ATOM   760   C  CB    . GLN A  1 98  ? -101.559 -19.625 -83.700  1.00 81.10  ? 98   GLN A CB    1 
ATOM   761   C  CG    . GLN A  1 98  ? -102.487 -18.467 -83.374  1.00 96.25  ? 98   GLN A CG    1 
ATOM   762   C  CD    . GLN A  1 98  ? -102.654 -18.266 -81.859  1.00 100.00 ? 98   GLN A CD    1 
ATOM   763   O  OE1   . GLN A  1 98  ? -101.996 -18.940 -81.047  1.00 100.00 ? 98   GLN A OE1   1 
ATOM   764   N  NE2   . GLN A  1 98  ? -103.530 -17.335 -81.476  1.00 95.94  ? 98   GLN A NE2   1 
ATOM   765   N  N     . GLY A  1 99  ? -98.788  -18.183 -82.752  1.00 52.06  ? 99   GLY A N     1 
ATOM   766   C  CA    . GLY A  1 99  ? -98.168  -17.001 -82.178  1.00 47.94  ? 99   GLY A CA    1 
ATOM   767   C  C     . GLY A  1 99  ? -98.499  -16.897 -80.707  1.00 51.27  ? 99   GLY A C     1 
ATOM   768   O  O     . GLY A  1 99  ? -99.576  -16.447 -80.335  1.00 59.37  ? 99   GLY A O     1 
ATOM   769   N  N     . TYR A  1 100 ? -97.544  -17.314 -79.882  1.00 50.71  ? 100  TYR A N     1 
ATOM   770   C  CA    . TYR A  1 100 ? -97.635  -17.344 -78.421  1.00 31.46  ? 100  TYR A CA    1 
ATOM   771   C  C     . TYR A  1 100 ? -98.318  -16.130 -77.784  1.00 41.07  ? 100  TYR A C     1 
ATOM   772   O  O     . TYR A  1 100 ? -98.007  -14.982 -78.116  1.00 40.46  ? 100  TYR A O     1 
ATOM   773   C  CB    . TYR A  1 100 ? -96.223  -17.546 -77.844  1.00 36.33  ? 100  TYR A CB    1 
ATOM   774   C  CG    . TYR A  1 100 ? -96.175  -17.941 -76.391  1.00 40.02  ? 100  TYR A CG    1 
ATOM   775   C  CD1   . TYR A  1 100 ? -97.205  -18.682 -75.824  1.00 37.82  ? 100  TYR A CD1   1 
ATOM   776   C  CD2   . TYR A  1 100 ? -95.112  -17.557 -75.574  1.00 35.44  ? 100  TYR A CD2   1 
ATOM   777   C  CE1   . TYR A  1 100 ? -97.190  -19.036 -74.477  1.00 63.57  ? 100  TYR A CE1   1 
ATOM   778   C  CE2   . TYR A  1 100 ? -95.086  -17.908 -74.210  1.00 40.50  ? 100  TYR A CE2   1 
ATOM   779   C  CZ    . TYR A  1 100 ? -96.133  -18.651 -73.673  1.00 52.44  ? 100  TYR A CZ    1 
ATOM   780   O  OH    . TYR A  1 100 ? -96.145  -19.029 -72.343  1.00 65.14  ? 100  TYR A OH    1 
ATOM   781   N  N     . ASP A  1 101 ? -99.262  -16.397 -76.882  1.00 41.86  ? 101  ASP A N     1 
ATOM   782   C  CA    . ASP A  1 101 ? -100.001 -15.341 -76.185  1.00 45.87  ? 101  ASP A CA    1 
ATOM   783   C  C     . ASP A  1 101 ? -99.087  -14.414 -75.398  1.00 48.45  ? 101  ASP A C     1 
ATOM   784   O  O     . ASP A  1 101 ? -99.367  -13.224 -75.251  1.00 51.72  ? 101  ASP A O     1 
ATOM   785   C  CB    . ASP A  1 101 ? -101.004 -15.943 -75.202  1.00 61.60  ? 101  ASP A CB    1 
ATOM   786   C  CG    . ASP A  1 101 ? -102.209 -16.539 -75.877  1.00 64.81  ? 101  ASP A CG    1 
ATOM   787   O  OD1   . ASP A  1 101 ? -102.901 -17.323 -75.194  1.00 61.95  ? 101  ASP A OD1   1 
ATOM   788   O  OD2   . ASP A  1 101 ? -102.483 -16.204 -77.054  1.00 52.26  ? 101  ASP A OD2   1 
ATOM   789   N  N     . ARG A  1 102 ? -98.033  -14.991 -74.833  1.00 43.34  ? 102  ARG A N     1 
ATOM   790   C  CA    . ARG A  1 102 ? -97.068  -14.243 -74.042  1.00 37.69  ? 102  ARG A CA    1 
ATOM   791   C  C     . ARG A  1 102 ? -95.877  -13.660 -74.814  1.00 40.47  ? 102  ARG A C     1 
ATOM   792   O  O     . ARG A  1 102 ? -94.993  -13.058 -74.205  1.00 50.44  ? 102  ARG A O     1 
ATOM   793   C  CB    . ARG A  1 102 ? -96.596  -15.087 -72.852  1.00 33.43  ? 102  ARG A CB    1 
ATOM   794   C  CG    . ARG A  1 102 ? -97.567  -15.061 -71.681  1.00 42.07  ? 102  ARG A CG    1 
ATOM   795   C  CD    . ARG A  1 102 ? -98.128  -16.429 -71.324  1.00 50.36  ? 102  ARG A CD    1 
ATOM   796   N  NE    . ARG A  1 102 ? -97.468  -17.028 -70.162  1.00 55.86  ? 102  ARG A NE    1 
ATOM   797   C  CZ    . ARG A  1 102 ? -98.087  -17.760 -69.237  1.00 53.56  ? 102  ARG A CZ    1 
ATOM   798   N  NH1   . ARG A  1 102 ? -97.397  -18.269 -68.223  1.00 56.30  ? 102  ARG A NH1   1 
ATOM   799   N  NH2   . ARG A  1 102 ? -99.397  -17.975 -69.314  1.00 47.56  ? 102  ARG A NH2   1 
ATOM   800   N  N     . ASP A  1 103 ? -95.847  -13.841 -76.139  1.00 41.16  ? 103  ASP A N     1 
ATOM   801   C  CA    . ASP A  1 103 ? -94.771  -13.293 -76.976  1.00 25.95  ? 103  ASP A CA    1 
ATOM   802   C  C     . ASP A  1 103 ? -95.077  -11.819 -77.247  1.00 39.68  ? 103  ASP A C     1 
ATOM   803   O  O     . ASP A  1 103 ? -95.995  -11.488 -78.001  1.00 50.31  ? 103  ASP A O     1 
ATOM   804   C  CB    . ASP A  1 103 ? -94.639  -14.071 -78.293  1.00 28.13  ? 103  ASP A CB    1 
ATOM   805   C  CG    . ASP A  1 103 ? -93.669  -13.414 -79.297  1.00 42.30  ? 103  ASP A CG    1 
ATOM   806   O  OD1   . ASP A  1 103 ? -92.948  -12.462 -78.933  1.00 50.23  ? 103  ASP A OD1   1 
ATOM   807   O  OD2   . ASP A  1 103 ? -93.634  -13.850 -80.475  1.00 39.64  ? 103  ASP A OD2   1 
ATOM   808   N  N     . PRO A  1 104 ? -94.263  -10.916 -76.679  1.00 44.16  ? 104  PRO A N     1 
ATOM   809   C  CA    . PRO A  1 104 ? -94.423  -9.472  -76.829  1.00 33.28  ? 104  PRO A CA    1 
ATOM   810   C  C     . PRO A  1 104 ? -94.465  -9.000  -78.272  1.00 31.12  ? 104  PRO A C     1 
ATOM   811   O  O     . PRO A  1 104 ? -95.179  -8.056  -78.594  1.00 39.86  ? 104  PRO A O     1 
ATOM   812   C  CB    . PRO A  1 104 ? -93.191  -8.922  -76.115  1.00 26.02  ? 104  PRO A CB    1 
ATOM   813   C  CG    . PRO A  1 104 ? -92.891  -9.953  -75.106  1.00 37.84  ? 104  PRO A CG    1 
ATOM   814   C  CD    . PRO A  1 104 ? -93.051  -11.212 -75.898  1.00 38.19  ? 104  PRO A CD    1 
ATOM   815   N  N     . ARG A  1 105 ? -93.693  -9.636  -79.142  1.00 35.46  ? 105  ARG A N     1 
ATOM   816   C  CA    . ARG A  1 105 ? -93.682  -9.210  -80.532  1.00 31.49  ? 105  ARG A CA    1 
ATOM   817   C  C     . ARG A  1 105 ? -94.975  -9.603  -81.209  1.00 43.68  ? 105  ARG A C     1 
ATOM   818   O  O     . ARG A  1 105 ? -95.525  -8.825  -81.991  1.00 42.70  ? 105  ARG A O     1 
ATOM   819   C  CB    . ARG A  1 105 ? -92.501  -9.798  -81.291  1.00 33.46  ? 105  ARG A CB    1 
ATOM   820   C  CG    . ARG A  1 105 ? -92.236  -9.074  -82.593  1.00 29.97  ? 105  ARG A CG    1 
ATOM   821   C  CD    . ARG A  1 105 ? -91.024  -9.624  -83.283  1.00 28.42  ? 105  ARG A CD    1 
ATOM   822   N  NE    . ARG A  1 105 ? -90.554  -8.750  -84.352  1.00 29.94  ? 105  ARG A NE    1 
ATOM   823   C  CZ    . ARG A  1 105 ? -90.512  -9.105  -85.632  1.00 34.06  ? 105  ARG A CZ    1 
ATOM   824   N  NH1   . ARG A  1 105 ? -90.057  -8.257  -86.537  1.00 28.28  ? 105  ARG A NH1   1 
ATOM   825   N  NH2   . ARG A  1 105 ? -90.948  -10.301 -86.013  1.00 30.15  ? 105  ARG A NH2   1 
ATOM   826   N  N     . SER A  1 106 ? -95.452  -10.814 -80.918  1.00 51.58  ? 106  SER A N     1 
ATOM   827   C  CA    . SER A  1 106 ? -96.706  -11.291 -81.494  1.00 46.50  ? 106  SER A CA    1 
ATOM   828   C  C     . SER A  1 106 ? -97.839  -10.362 -81.051  1.00 41.08  ? 106  SER A C     1 
ATOM   829   O  O     . SER A  1 106 ? -98.662  -9.942  -81.869  1.00 46.62  ? 106  SER A O     1 
ATOM   830   C  CB    . SER A  1 106 ? -96.971  -12.744 -81.094  1.00 35.69  ? 106  SER A CB    1 
ATOM   831   O  OG    . SER A  1 106 ? -96.144  -13.629 -81.837  1.00 46.22  ? 106  SER A OG    1 
ATOM   832   N  N     . ILE A  1 107 ? -97.817  -9.983  -79.772  1.00 32.72  ? 107  ILE A N     1 
ATOM   833   C  CA    . ILE A  1 107 ? -98.804  -9.067  -79.199  1.00 31.17  ? 107  ILE A CA    1 
ATOM   834   C  C     . ILE A  1 107 ? -98.837  -7.717  -79.930  1.00 34.00  ? 107  ILE A C     1 
ATOM   835   O  O     . ILE A  1 107 ? -99.905  -7.165  -80.181  1.00 50.40  ? 107  ILE A O     1 
ATOM   836   C  CB    . ILE A  1 107 ? -98.518  -8.796  -77.696  1.00 34.28  ? 107  ILE A CB    1 
ATOM   837   C  CG1   . ILE A  1 107 ? -98.727  -10.067 -76.874  1.00 25.35  ? 107  ILE A CG1   1 
ATOM   838   C  CG2   . ILE A  1 107 ? -99.409  -7.661  -77.163  1.00 18.03  ? 107  ILE A CG2   1 
ATOM   839   C  CD1   . ILE A  1 107 ? -98.580  -9.845  -75.382  1.00 20.61  ? 107  ILE A CD1   1 
ATOM   840   N  N     . ALA A  1 108 ? -97.667  -7.183  -80.260  1.00 32.49  ? 108  ALA A N     1 
ATOM   841   C  CA    . ALA A  1 108 ? -97.599  -5.904  -80.952  1.00 39.70  ? 108  ALA A CA    1 
ATOM   842   C  C     . ALA A  1 108 ? -98.166  -6.037  -82.353  1.00 45.36  ? 108  ALA A C     1 
ATOM   843   O  O     . ALA A  1 108 ? -98.833  -5.122  -82.841  1.00 44.44  ? 108  ALA A O     1 
ATOM   844   C  CB    . ALA A  1 108 ? -96.166  -5.395  -81.007  1.00 39.79  ? 108  ALA A CB    1 
ATOM   845   N  N     . LYS A  1 109 ? -97.896  -7.177  -82.991  1.00 34.70  ? 109  LYS A N     1 
ATOM   846   C  CA    . LYS A  1 109 ? -98.390  -7.445  -84.337  1.00 35.64  ? 109  LYS A CA    1 
ATOM   847   C  C     . LYS A  1 109 ? -99.918  -7.554  -84.321  1.00 44.43  ? 109  LYS A C     1 
ATOM   848   O  O     . LYS A  1 109 ? -100.585 -6.977  -85.183  1.00 40.99  ? 109  LYS A O     1 
ATOM   849   C  CB    . LYS A  1 109 ? -97.750  -8.712  -84.906  1.00 38.89  ? 109  LYS A CB    1 
ATOM   850   C  CG    . LYS A  1 109 ? -96.318  -8.523  -85.424  1.00 34.00  ? 109  LYS A CG    1 
ATOM   851   C  CD    . LYS A  1 109 ? -95.743  -9.848  -85.929  1.00 28.51  ? 109  LYS A CD    1 
ATOM   852   C  CE    . LYS A  1 109 ? -94.570  -9.629  -86.871  1.00 44.97  ? 109  LYS A CE    1 
ATOM   853   N  NZ    . LYS A  1 109 ? -94.121  -10.902 -87.492  1.00 45.79  ? 109  LYS A NZ    1 
ATOM   854   N  N     . ARG A  1 110 ? -100.461 -8.237  -83.306  1.00 37.86  ? 110  ARG A N     1 
ATOM   855   C  CA    . ARG A  1 110 ? -101.913 -8.402  -83.144  1.00 37.03  ? 110  ARG A CA    1 
ATOM   856   C  C     . ARG A  1 110 ? -102.591 -7.044  -82.997  1.00 41.48  ? 110  ARG A C     1 
ATOM   857   O  O     . ARG A  1 110 ? -103.713 -6.834  -83.461  1.00 55.19  ? 110  ARG A O     1 
ATOM   858   C  CB    . ARG A  1 110 ? -102.245 -9.225  -81.896  1.00 28.48  ? 110  ARG A CB    1 
ATOM   859   C  CG    . ARG A  1 110 ? -101.842 -10.681 -81.934  1.00 30.68  ? 110  ARG A CG    1 
ATOM   860   C  CD    . ARG A  1 110 ? -102.261 -11.346 -80.626  1.00 33.23  ? 110  ARG A CD    1 
ATOM   861   N  NE    . ARG A  1 110 ? -101.848 -12.750 -80.532  1.00 37.49  ? 110  ARG A NE    1 
ATOM   862   C  CZ    . ARG A  1 110 ? -102.083 -13.524 -79.471  1.00 52.85  ? 110  ARG A CZ    1 
ATOM   863   N  NH1   . ARG A  1 110 ? -101.681 -14.793 -79.466  1.00 37.45  ? 110  ARG A NH1   1 
ATOM   864   N  NH2   . ARG A  1 110 ? -102.719 -13.032 -78.409  1.00 48.15  ? 110  ARG A NH2   1 
ATOM   865   N  N     . ALA A  1 111 ? -101.923 -6.142  -82.293  1.00 39.53  ? 111  ALA A N     1 
ATOM   866   C  CA    . ALA A  1 111 ? -102.455 -4.815  -82.091  1.00 41.04  ? 111  ALA A CA    1 
ATOM   867   C  C     . ALA A  1 111 ? -102.411 -4.029  -83.401  1.00 40.84  ? 111  ALA A C     1 
ATOM   868   O  O     . ALA A  1 111 ? -103.267 -3.188  -83.639  1.00 47.56  ? 111  ALA A O     1 
ATOM   869   C  CB    . ALA A  1 111 ? -101.694 -4.102  -80.996  1.00 33.44  ? 111  ALA A CB    1 
ATOM   870   N  N     . GLU A  1 112 ? -101.421 -4.294  -84.254  1.00 45.96  ? 112  GLU A N     1 
ATOM   871   C  CA    . GLU A  1 112 ? -101.352 -3.593  -85.536  1.00 48.66  ? 112  GLU A CA    1 
ATOM   872   C  C     . GLU A  1 112 ? -102.472 -4.129  -86.424  1.00 57.52  ? 112  GLU A C     1 
ATOM   873   O  O     . GLU A  1 112 ? -103.147 -3.353  -87.100  1.00 60.25  ? 112  GLU A O     1 
ATOM   874   C  CB    . GLU A  1 112 ? -99.985  -3.759  -86.215  1.00 51.58  ? 112  GLU A CB    1 
ATOM   875   C  CG    . GLU A  1 112 ? -98.841  -3.009  -85.514  1.00 60.21  ? 112  GLU A CG    1 
ATOM   876   C  CD    . GLU A  1 112 ? -97.971  -2.194  -86.457  1.00 53.94  ? 112  GLU A CD    1 
ATOM   877   O  OE1   . GLU A  1 112 ? -98.403  -1.096  -86.871  1.00 72.98  ? 112  GLU A OE1   1 
ATOM   878   O  OE2   . GLU A  1 112 ? -96.842  -2.628  -86.765  1.00 45.65  ? 112  GLU A OE2   1 
ATOM   879   N  N     . ASP A  1 113 ? -102.703 -5.443  -86.363  1.00 55.52  ? 113  ASP A N     1 
ATOM   880   C  CA    . ASP A  1 113 ? -103.760 -6.104  -87.138  1.00 48.99  ? 113  ASP A CA    1 
ATOM   881   C  C     . ASP A  1 113 ? -105.112 -5.541  -86.749  1.00 53.16  ? 113  ASP A C     1 
ATOM   882   O  O     . ASP A  1 113 ? -105.905 -5.145  -87.602  1.00 64.79  ? 113  ASP A O     1 
ATOM   883   C  CB    . ASP A  1 113 ? -103.782 -7.609  -86.865  1.00 48.41  ? 113  ASP A CB    1 
ATOM   884   C  CG    . ASP A  1 113 ? -102.640 -8.346  -87.535  1.00 70.46  ? 113  ASP A CG    1 
ATOM   885   O  OD1   . ASP A  1 113 ? -102.071 -7.809  -88.520  1.00 64.95  ? 113  ASP A OD1   1 
ATOM   886   O  OD2   . ASP A  1 113 ? -102.324 -9.470  -87.071  1.00 64.29  ? 113  ASP A OD2   1 
ATOM   887   N  N     . TYR A  1 114 ? -105.367 -5.539  -85.446  1.00 47.46  ? 114  TYR A N     1 
ATOM   888   C  CA    . TYR A  1 114 ? -106.604 -5.026  -84.888  1.00 40.55  ? 114  TYR A CA    1 
ATOM   889   C  C     . TYR A  1 114 ? -106.875 -3.571  -85.300  1.00 43.97  ? 114  TYR A C     1 
ATOM   890   O  O     . TYR A  1 114 ? -108.027 -3.176  -85.435  1.00 58.35  ? 114  TYR A O     1 
ATOM   891   C  CB    . TYR A  1 114 ? -106.569 -5.170  -83.369  1.00 39.89  ? 114  TYR A CB    1 
ATOM   892   C  CG    . TYR A  1 114 ? -107.746 -4.565  -82.638  1.00 54.17  ? 114  TYR A CG    1 
ATOM   893   C  CD1   . TYR A  1 114 ? -107.693 -3.256  -82.163  1.00 54.00  ? 114  TYR A CD1   1 
ATOM   894   C  CD2   . TYR A  1 114 ? -108.902 -5.307  -82.391  1.00 55.23  ? 114  TYR A CD2   1 
ATOM   895   C  CE1   . TYR A  1 114 ? -108.764 -2.696  -81.454  1.00 71.13  ? 114  TYR A CE1   1 
ATOM   896   C  CE2   . TYR A  1 114 ? -109.981 -4.755  -81.679  1.00 47.96  ? 114  TYR A CE2   1 
ATOM   897   C  CZ    . TYR A  1 114 ? -109.904 -3.449  -81.214  1.00 62.30  ? 114  TYR A CZ    1 
ATOM   898   O  OH    . TYR A  1 114 ? -110.952 -2.885  -80.504  1.00 52.14  ? 114  TYR A OH    1 
ATOM   899   N  N     . LEU A  1 115 ? -105.832 -2.773  -85.512  1.00 44.17  ? 115  LEU A N     1 
ATOM   900   C  CA    . LEU A  1 115 ? -106.041 -1.381  -85.920  1.00 44.06  ? 115  LEU A CA    1 
ATOM   901   C  C     . LEU A  1 115 ? -106.729 -1.425  -87.272  1.00 50.44  ? 115  LEU A C     1 
ATOM   902   O  O     . LEU A  1 115 ? -107.747 -0.767  -87.480  1.00 64.94  ? 115  LEU A O     1 
ATOM   903   C  CB    . LEU A  1 115 ? -104.711 -0.638  -86.075  1.00 35.55  ? 115  LEU A CB    1 
ATOM   904   C  CG    . LEU A  1 115 ? -104.604 0.881   -85.836  1.00 41.13  ? 115  LEU A CG    1 
ATOM   905   C  CD1   . LEU A  1 115 ? -103.880 1.532   -86.994  1.00 44.68  ? 115  LEU A CD1   1 
ATOM   906   C  CD2   . LEU A  1 115 ? -105.939 1.542   -85.611  1.00 42.89  ? 115  LEU A CD2   1 
ATOM   907   N  N     . ARG A  1 116 ? -106.166 -2.220  -88.180  1.00 56.31  ? 116  ARG A N     1 
ATOM   908   C  CA    . ARG A  1 116 ? -106.708 -2.371  -89.525  1.00 63.31  ? 116  ARG A CA    1 
ATOM   909   C  C     . ARG A  1 116 ? -108.097 -2.993  -89.514  1.00 69.12  ? 116  ARG A C     1 
ATOM   910   O  O     . ARG A  1 116 ? -108.999 -2.505  -90.193  1.00 77.70  ? 116  ARG A O     1 
ATOM   911   C  CB    . ARG A  1 116 ? -105.751 -3.174  -90.410  1.00 45.26  ? 116  ARG A CB    1 
ATOM   912   C  CG    . ARG A  1 116 ? -104.583 -2.343  -90.928  1.00 71.58  ? 116  ARG A CG    1 
ATOM   913   C  CD    . ARG A  1 116 ? -103.655 -3.138  -91.834  1.00 84.59  ? 116  ARG A CD    1 
ATOM   914   N  NE    . ARG A  1 116 ? -103.021 -4.241  -91.118  1.00 100.00 ? 116  ARG A NE    1 
ATOM   915   C  CZ    . ARG A  1 116 ? -101.839 -4.165  -90.510  1.00 100.00 ? 116  ARG A CZ    1 
ATOM   916   N  NH1   . ARG A  1 116 ? -101.348 -5.228  -89.876  1.00 92.47  ? 116  ARG A NH1   1 
ATOM   917   N  NH2   . ARG A  1 116 ? -101.139 -3.035  -90.548  1.00 100.00 ? 116  ARG A NH2   1 
ATOM   918   N  N     . ALA A  1 117 ? -108.277 -4.030  -88.701  1.00 65.69  ? 117  ALA A N     1 
ATOM   919   C  CA    . ALA A  1 117 ? -109.566 -4.708  -88.585  1.00 60.71  ? 117  ALA A CA    1 
ATOM   920   C  C     . ALA A  1 117 ? -110.712 -3.752  -88.227  1.00 62.33  ? 117  ALA A C     1 
ATOM   921   O  O     . ALA A  1 117 ? -111.803 -3.868  -88.778  1.00 88.06  ? 117  ALA A O     1 
ATOM   922   C  CB    . ALA A  1 117 ? -109.481 -5.849  -87.564  1.00 44.52  ? 117  ALA A CB    1 
ATOM   923   N  N     . THR A  1 118 ? -110.472 -2.808  -87.321  1.00 58.46  ? 118  THR A N     1 
ATOM   924   C  CA    . THR A  1 118 ? -111.513 -1.855  -86.937  1.00 57.60  ? 118  THR A CA    1 
ATOM   925   C  C     . THR A  1 118 ? -111.682 -0.770  -87.991  1.00 58.29  ? 118  THR A C     1 
ATOM   926   O  O     . THR A  1 118 ? -112.569 0.075   -87.880  1.00 62.05  ? 118  THR A O     1 
ATOM   927   C  CB    . THR A  1 118 ? -111.201 -1.131  -85.609  1.00 68.69  ? 118  THR A CB    1 
ATOM   928   O  OG1   . THR A  1 118 ? -110.069 -0.264  -85.783  1.00 52.30  ? 118  THR A OG1   1 
ATOM   929   C  CG2   . THR A  1 118 ? -110.938 -2.127  -84.497  1.00 59.56  ? 118  THR A CG2   1 
ATOM   930   N  N     . GLY A  1 119 ? -110.788 -0.750  -88.973  1.00 53.61  ? 119  GLY A N     1 
ATOM   931   C  CA    . GLY A  1 119 ? -110.862 0.251   -90.023  1.00 53.78  ? 119  GLY A CA    1 
ATOM   932   C  C     . GLY A  1 119 ? -110.640 1.692   -89.577  1.00 60.98  ? 119  GLY A C     1 
ATOM   933   O  O     . GLY A  1 119 ? -110.809 2.616   -90.379  1.00 60.60  ? 119  GLY A O     1 
ATOM   934   N  N     . ILE A  1 120 ? -110.271 1.900   -88.312  1.00 55.89  ? 120  ILE A N     1 
ATOM   935   C  CA    . ILE A  1 120 ? -110.015 3.250   -87.809  1.00 53.29  ? 120  ILE A CA    1 
ATOM   936   C  C     . ILE A  1 120 ? -108.829 3.905   -88.537  1.00 57.08  ? 120  ILE A C     1 
ATOM   937   O  O     . ILE A  1 120 ? -108.789 5.127   -88.692  1.00 54.33  ? 120  ILE A O     1 
ATOM   938   C  CB    . ILE A  1 120 ? -109.762 3.252   -86.292  1.00 46.27  ? 120  ILE A CB    1 
ATOM   939   C  CG1   . ILE A  1 120 ? -110.926 2.567   -85.578  1.00 46.96  ? 120  ILE A CG1   1 
ATOM   940   C  CG2   . ILE A  1 120 ? -109.624 4.681   -85.787  1.00 42.64  ? 120  ILE A CG2   1 
ATOM   941   C  CD1   . ILE A  1 120 ? -110.922 2.729   -84.073  1.00 56.27  ? 120  ILE A CD1   1 
ATOM   942   N  N     . ALA A  1 121 ? -107.882 3.074   -88.983  1.00 52.10  ? 121  ALA A N     1 
ATOM   943   C  CA    . ALA A  1 121 ? -106.688 3.501   -89.731  1.00 45.07  ? 121  ALA A CA    1 
ATOM   944   C  C     . ALA A  1 121 ? -105.971 2.252   -90.230  1.00 48.42  ? 121  ALA A C     1 
ATOM   945   O  O     . ALA A  1 121 ? -106.352 1.135   -89.856  1.00 46.16  ? 121  ALA A O     1 
ATOM   946   C  CB    . ALA A  1 121 ? -105.751 4.313   -88.847  1.00 44.52  ? 121  ALA A CB    1 
ATOM   947   N  N     . ASP A  1 122 ? -104.968 2.426   -91.097  1.00 43.20  ? 122  ASP A N     1 
ATOM   948   C  CA    . ASP A  1 122 ? -104.207 1.273   -91.596  1.00 57.32  ? 122  ASP A CA    1 
ATOM   949   C  C     . ASP A  1 122 ? -102.794 1.119   -91.024  1.00 63.56  ? 122  ASP A C     1 
ATOM   950   O  O     . ASP A  1 122 ? -102.248 0.007   -91.010  1.00 70.18  ? 122  ASP A O     1 
ATOM   951   C  CB    . ASP A  1 122 ? -104.194 1.181   -93.133  1.00 57.08  ? 122  ASP A CB    1 
ATOM   952   C  CG    . ASP A  1 122 ? -103.897 2.497   -93.813  1.00 60.83  ? 122  ASP A CG    1 
ATOM   953   O  OD1   . ASP A  1 122 ? -102.856 3.132   -93.516  1.00 74.93  ? 122  ASP A OD1   1 
ATOM   954   O  OD2   . ASP A  1 122 ? -104.714 2.877   -94.678  1.00 69.32  ? 122  ASP A OD2   1 
ATOM   955   N  N     . THR A  1 123 ? -102.211 2.220   -90.542  1.00 60.35  ? 123  THR A N     1 
ATOM   956   C  CA    . THR A  1 123 ? -100.870 2.186   -89.946  1.00 65.87  ? 123  THR A CA    1 
ATOM   957   C  C     . THR A  1 123 ? -100.732 3.082   -88.708  1.00 53.18  ? 123  THR A C     1 
ATOM   958   O  O     . THR A  1 123 ? -101.363 4.136   -88.625  1.00 46.38  ? 123  THR A O     1 
ATOM   959   C  CB    . THR A  1 123 ? -99.776  2.591   -90.959  1.00 55.83  ? 123  THR A CB    1 
ATOM   960   O  OG1   . THR A  1 123 ? -100.191 3.772   -91.636  1.00 48.37  ? 123  THR A OG1   1 
ATOM   961   C  CG2   . THR A  1 123 ? -99.499  1.465   -91.984  1.00 65.47  ? 123  THR A CG2   1 
ATOM   962   N  N     . VAL A  1 124 ? -99.945  2.618   -87.732  1.00 53.85  ? 124  VAL A N     1 
ATOM   963   C  CA    . VAL A  1 124 ? -99.682  3.372   -86.501  1.00 45.47  ? 124  VAL A CA    1 
ATOM   964   C  C     . VAL A  1 124 ? -98.240  3.839   -86.540  1.00 44.98  ? 124  VAL A C     1 
ATOM   965   O  O     . VAL A  1 124 ? -97.334  3.035   -86.756  1.00 50.74  ? 124  VAL A O     1 
ATOM   966   C  CB    . VAL A  1 124 ? -99.763  2.525   -85.228  1.00 42.66  ? 124  VAL A CB    1 
ATOM   967   C  CG1   . VAL A  1 124 ? -100.378 3.340   -84.119  1.00 37.68  ? 124  VAL A CG1   1 
ATOM   968   C  CG2   . VAL A  1 124 ? -100.477 1.214   -85.466  1.00 51.82  ? 124  VAL A CG2   1 
ATOM   969   N  N     . LEU A  1 125 ? -98.019  5.121   -86.293  1.00 41.67  ? 125  LEU A N     1 
ATOM   970   C  CA    . LEU A  1 125 ? -96.668  5.660   -86.299  1.00 43.17  ? 125  LEU A CA    1 
ATOM   971   C  C     . LEU A  1 125 ? -96.139  5.962   -84.900  1.00 50.85  ? 125  LEU A C     1 
ATOM   972   O  O     . LEU A  1 125 ? -96.799  6.630   -84.098  1.00 46.60  ? 125  LEU A O     1 
ATOM   973   C  CB    . LEU A  1 125 ? -96.602  6.899   -87.185  1.00 41.49  ? 125  LEU A CB    1 
ATOM   974   C  CG    . LEU A  1 125 ? -96.179  6.667   -88.637  1.00 40.67  ? 125  LEU A CG    1 
ATOM   975   C  CD1   . LEU A  1 125 ? -96.448  5.249   -89.105  1.00 36.29  ? 125  LEU A CD1   1 
ATOM   976   C  CD2   . LEU A  1 125 ? -96.884  7.677   -89.505  1.00 36.93  ? 125  LEU A CD2   1 
ATOM   977   N  N     . PHE A  1 126 ? -94.939  5.456   -84.619  1.00 54.98  ? 126  PHE A N     1 
ATOM   978   C  CA    . PHE A  1 126 ? -94.291  5.642   -83.324  1.00 39.06  ? 126  PHE A CA    1 
ATOM   979   C  C     . PHE A  1 126 ? -92.906  6.257   -83.411  1.00 45.00  ? 126  PHE A C     1 
ATOM   980   O  O     . PHE A  1 126 ? -92.080  5.844   -84.226  1.00 51.49  ? 126  PHE A O     1 
ATOM   981   C  CB    . PHE A  1 126 ? -94.198  4.311   -82.592  1.00 28.84  ? 126  PHE A CB    1 
ATOM   982   C  CG    . PHE A  1 126 ? -95.359  4.037   -81.689  1.00 46.71  ? 126  PHE A CG    1 
ATOM   983   C  CD1   . PHE A  1 126 ? -96.540  3.505   -82.195  1.00 39.18  ? 126  PHE A CD1   1 
ATOM   984   C  CD2   . PHE A  1 126 ? -95.264  4.294   -80.320  1.00 34.90  ? 126  PHE A CD2   1 
ATOM   985   C  CE1   . PHE A  1 126 ? -97.612  3.231   -81.352  1.00 46.40  ? 126  PHE A CE1   1 
ATOM   986   C  CE2   . PHE A  1 126 ? -96.332  4.024   -79.466  1.00 39.21  ? 126  PHE A CE2   1 
ATOM   987   C  CZ    . PHE A  1 126 ? -97.508  3.491   -79.983  1.00 43.88  ? 126  PHE A CZ    1 
ATOM   988   N  N     . GLY A  1 127 ? -92.657  7.240   -82.550  1.00 41.47  ? 127  GLY A N     1 
ATOM   989   C  CA    . GLY A  1 127 ? -91.365  7.897   -82.517  1.00 37.41  ? 127  GLY A CA    1 
ATOM   990   C  C     . GLY A  1 127 ? -90.906  8.084   -81.084  1.00 40.23  ? 127  GLY A C     1 
ATOM   991   O  O     . GLY A  1 127 ? -91.126  9.152   -80.517  1.00 36.40  ? 127  GLY A O     1 
ATOM   992   N  N     . PRO A  1 128 ? -90.263  7.073   -80.466  1.00 36.81  ? 128  PRO A N     1 
ATOM   993   C  CA    . PRO A  1 128 ? -89.796  7.189   -79.082  1.00 30.92  ? 128  PRO A CA    1 
ATOM   994   C  C     . PRO A  1 128 ? -88.507  7.995   -79.030  1.00 33.38  ? 128  PRO A C     1 
ATOM   995   O  O     . PRO A  1 128 ? -87.716  7.975   -79.974  1.00 37.69  ? 128  PRO A O     1 
ATOM   996   C  CB    . PRO A  1 128 ? -89.508  5.737   -78.685  1.00 38.89  ? 128  PRO A CB    1 
ATOM   997   C  CG    . PRO A  1 128 ? -89.855  4.894   -79.913  1.00 31.31  ? 128  PRO A CG    1 
ATOM   998   C  CD    . PRO A  1 128 ? -89.782  5.818   -81.063  1.00 27.46  ? 128  PRO A CD    1 
ATOM   999   N  N     . GLU A  1 129 ? -88.302  8.709   -77.928  1.00 27.93  ? 129  GLU A N     1 
ATOM   1000  C  CA    . GLU A  1 129 ? -87.089  9.508   -77.731  1.00 29.45  ? 129  GLU A CA    1 
ATOM   1001  C  C     . GLU A  1 129 ? -86.412  8.914   -76.481  1.00 37.72  ? 129  GLU A C     1 
ATOM   1002  O  O     . GLU A  1 129 ? -86.459  9.491   -75.395  1.00 35.90  ? 129  GLU A O     1 
ATOM   1003  C  CB    . GLU A  1 129 ? -87.444  10.992  -77.488  1.00 37.24  ? 129  GLU A CB    1 
ATOM   1004  C  CG    . GLU A  1 129 ? -88.230  11.763  -78.618  1.00 19.46  ? 129  GLU A CG    1 
ATOM   1005  C  CD    . GLU A  1 129 ? -88.823  13.092  -78.116  1.00 40.30  ? 129  GLU A CD    1 
ATOM   1006  O  OE1   . GLU A  1 129 ? -88.627  14.160  -78.725  1.00 45.79  ? 129  GLU A OE1   1 
ATOM   1007  O  OE2   . GLU A  1 129 ? -89.495  13.086  -77.071  1.00 54.93  ? 129  GLU A OE2   1 
ATOM   1008  N  N     . PRO A  1 130 ? -85.791  7.733   -76.615  1.00 30.26  ? 130  PRO A N     1 
ATOM   1009  C  CA    . PRO A  1 130 ? -85.149  7.134   -75.446  1.00 30.01  ? 130  PRO A CA    1 
ATOM   1010  C  C     . PRO A  1 130 ? -83.807  7.744   -75.065  1.00 33.45  ? 130  PRO A C     1 
ATOM   1011  O  O     . PRO A  1 130 ? -82.911  7.897   -75.895  1.00 45.55  ? 130  PRO A O     1 
ATOM   1012  C  CB    . PRO A  1 130 ? -85.023  5.664   -75.849  1.00 19.51  ? 130  PRO A CB    1 
ATOM   1013  C  CG    . PRO A  1 130 ? -84.721  5.753   -77.306  1.00 34.49  ? 130  PRO A CG    1 
ATOM   1014  C  CD    . PRO A  1 130 ? -85.630  6.876   -77.805  1.00 35.14  ? 130  PRO A CD    1 
ATOM   1015  N  N     . GLU A  1 131 ? -83.690  8.085   -73.787  1.00 33.40  ? 131  GLU A N     1 
ATOM   1016  C  CA    . GLU A  1 131 ? -82.476  8.672   -73.223  1.00 26.45  ? 131  GLU A CA    1 
ATOM   1017  C  C     . GLU A  1 131 ? -81.672  7.655   -72.415  1.00 24.91  ? 131  GLU A C     1 
ATOM   1018  O  O     . GLU A  1 131 ? -82.206  6.650   -71.957  1.00 25.07  ? 131  GLU A O     1 
ATOM   1019  C  CB    . GLU A  1 131 ? -82.846  9.851   -72.334  1.00 18.98  ? 131  GLU A CB    1 
ATOM   1020  C  CG    . GLU A  1 131 ? -83.246  11.073  -73.123  1.00 24.77  ? 131  GLU A CG    1 
ATOM   1021  C  CD    . GLU A  1 131 ? -84.058  12.055  -72.315  1.00 37.31  ? 131  GLU A CD    1 
ATOM   1022  O  OE1   . GLU A  1 131 ? -84.128  13.236  -72.727  1.00 40.25  ? 131  GLU A OE1   1 
ATOM   1023  O  OE2   . GLU A  1 131 ? -84.646  11.647  -71.283  1.00 32.24  ? 131  GLU A OE2   1 
ATOM   1024  N  N     . PHE A  1 132 ? -80.389  7.924   -72.223  1.00 27.20  ? 132  PHE A N     1 
ATOM   1025  C  CA    . PHE A  1 132 ? -79.552  7.004   -71.466  1.00 24.72  ? 132  PHE A CA    1 
ATOM   1026  C  C     . PHE A  1 132 ? -78.366  7.678   -70.791  1.00 30.73  ? 132  PHE A C     1 
ATOM   1027  O  O     . PHE A  1 132 ? -78.123  8.878   -70.961  1.00 23.21  ? 132  PHE A O     1 
ATOM   1028  C  CB    . PHE A  1 132 ? -79.063  5.875   -72.370  1.00 20.51  ? 132  PHE A CB    1 
ATOM   1029  C  CG    . PHE A  1 132 ? -78.266  6.342   -73.562  1.00 24.36  ? 132  PHE A CG    1 
ATOM   1030  C  CD1   . PHE A  1 132 ? -78.900  6.670   -74.757  1.00 36.17  ? 132  PHE A CD1   1 
ATOM   1031  C  CD2   . PHE A  1 132 ? -76.882  6.444   -73.493  1.00 32.42  ? 132  PHE A CD2   1 
ATOM   1032  C  CE1   . PHE A  1 132 ? -78.161  7.093   -75.859  1.00 24.40  ? 132  PHE A CE1   1 
ATOM   1033  C  CE2   . PHE A  1 132 ? -76.132  6.866   -74.589  1.00 30.26  ? 132  PHE A CE2   1 
ATOM   1034  C  CZ    . PHE A  1 132 ? -76.771  7.190   -75.773  1.00 31.51  ? 132  PHE A CZ    1 
ATOM   1035  N  N     . PHE A  1 133 ? -77.633  6.884   -70.016  1.00 24.77  ? 133  PHE A N     1 
ATOM   1036  C  CA    . PHE A  1 133 ? -76.449  7.354   -69.295  1.00 19.47  ? 133  PHE A CA    1 
ATOM   1037  C  C     . PHE A  1 133 ? -75.225  6.516   -69.649  1.00 24.09  ? 133  PHE A C     1 
ATOM   1038  O  O     . PHE A  1 133 ? -75.317  5.289   -69.816  1.00 28.96  ? 133  PHE A O     1 
ATOM   1039  C  CB    . PHE A  1 133 ? -76.664  7.232   -67.779  1.00 18.21  ? 133  PHE A CB    1 
ATOM   1040  C  CG    . PHE A  1 133 ? -77.404  8.383   -67.165  1.00 19.46  ? 133  PHE A CG    1 
ATOM   1041  C  CD1   . PHE A  1 133 ? -78.779  8.319   -66.971  1.00 22.57  ? 133  PHE A CD1   1 
ATOM   1042  C  CD2   . PHE A  1 133 ? -76.719  9.528   -66.760  1.00 23.19  ? 133  PHE A CD2   1 
ATOM   1043  C  CE1   . PHE A  1 133 ? -79.465  9.381   -66.380  1.00 19.82  ? 133  PHE A CE1   1 
ATOM   1044  C  CE2   . PHE A  1 133 ? -77.388  10.589  -66.173  1.00 18.10  ? 133  PHE A CE2   1 
ATOM   1045  C  CZ    . PHE A  1 133 ? -78.770  10.516  -65.983  1.00 20.97  ? 133  PHE A CZ    1 
ATOM   1046  N  N     . LEU A  1 134 ? -74.075  7.176   -69.728  1.00 19.57  ? 134  LEU A N     1 
ATOM   1047  C  CA    . LEU A  1 134 ? -72.811  6.499   -69.998  1.00 18.96  ? 134  LEU A CA    1 
ATOM   1048  C  C     . LEU A  1 134 ? -71.908  6.716   -68.798  1.00 17.94  ? 134  LEU A C     1 
ATOM   1049  O  O     . LEU A  1 134 ? -71.530  7.845   -68.513  1.00 35.28  ? 134  LEU A O     1 
ATOM   1050  C  CB    . LEU A  1 134 ? -72.128  7.077   -71.234  1.00 17.00  ? 134  LEU A CB    1 
ATOM   1051  C  CG    . LEU A  1 134 ? -72.831  6.844   -72.562  1.00 18.77  ? 134  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A  1 134 ? -71.988  7.403   -73.679  1.00 25.75  ? 134  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A  1 134 ? -73.030  5.359   -72.761  1.00 22.41  ? 134  LEU A CD2   1 
ATOM   1054  N  N     . PHE A  1 135 ? -71.572  5.641   -68.095  1.00 24.94  ? 135  PHE A N     1 
ATOM   1055  C  CA    . PHE A  1 135 ? -70.696  5.718   -66.924  1.00 16.36  ? 135  PHE A CA    1 
ATOM   1056  C  C     . PHE A  1 135 ? -69.363  5.017   -67.179  1.00 24.57  ? 135  PHE A C     1 
ATOM   1057  O  O     . PHE A  1 135 ? -69.184  4.324   -68.191  1.00 29.62  ? 135  PHE A O     1 
ATOM   1058  C  CB    . PHE A  1 135 ? -71.358  5.036   -65.737  1.00 14.63  ? 135  PHE A CB    1 
ATOM   1059  C  CG    . PHE A  1 135 ? -72.658  5.637   -65.334  1.00 14.26  ? 135  PHE A CG    1 
ATOM   1060  C  CD1   . PHE A  1 135 ? -73.697  4.823   -64.903  1.00 17.99  ? 135  PHE A CD1   1 
ATOM   1061  C  CD2   . PHE A  1 135 ? -72.839  7.015   -65.330  1.00 18.11  ? 135  PHE A CD2   1 
ATOM   1062  C  CE1   . PHE A  1 135 ? -74.906  5.377   -64.459  1.00 16.71  ? 135  PHE A CE1   1 
ATOM   1063  C  CE2   . PHE A  1 135 ? -74.038  7.578   -64.890  1.00 14.58  ? 135  PHE A CE2   1 
ATOM   1064  C  CZ    . PHE A  1 135 ? -75.076  6.756   -64.452  1.00 13.73  ? 135  PHE A CZ    1 
ATOM   1065  N  N     . ASP A  1 136 ? -68.445  5.167   -66.229  1.00 32.23  ? 136  ASP A N     1 
ATOM   1066  C  CA    . ASP A  1 136 ? -67.130  4.531   -66.308  1.00 23.81  ? 136  ASP A CA    1 
ATOM   1067  C  C     . ASP A  1 136 ? -67.068  3.332   -65.360  1.00 22.94  ? 136  ASP A C     1 
ATOM   1068  O  O     . ASP A  1 136 ? -66.401  2.331   -65.633  1.00 25.82  ? 136  ASP A O     1 
ATOM   1069  C  CB    . ASP A  1 136 ? -66.033  5.521   -65.904  1.00 11.78  ? 136  ASP A CB    1 
ATOM   1070  C  CG    . ASP A  1 136 ? -65.618  6.448   -67.029  1.00 34.08  ? 136  ASP A CG    1 
ATOM   1071  O  OD1   . ASP A  1 136 ? -65.135  7.558   -66.714  1.00 36.41  ? 136  ASP A OD1   1 
ATOM   1072  O  OD2   . ASP A  1 136 ? -65.726  6.059   -68.213  1.00 27.71  ? 136  ASP A OD2   1 
ATOM   1073  N  N     . ASP A  1 137 ? -67.822  3.422   -64.270  1.00 25.31  ? 137  ASP A N     1 
ATOM   1074  C  CA    . ASP A  1 137 ? -67.829  2.396   -63.239  1.00 15.11  ? 137  ASP A CA    1 
ATOM   1075  C  C     . ASP A  1 137 ? -69.177  2.400   -62.521  1.00 15.73  ? 137  ASP A C     1 
ATOM   1076  O  O     . ASP A  1 137 ? -69.715  3.455   -62.188  1.00 22.53  ? 137  ASP A O     1 
ATOM   1077  C  CB    . ASP A  1 137 ? -66.695  2.740   -62.261  1.00 28.55  ? 137  ASP A CB    1 
ATOM   1078  C  CG    . ASP A  1 137 ? -66.637  1.839   -61.041  1.00 35.08  ? 137  ASP A CG    1 
ATOM   1079  O  OD1   . ASP A  1 137 ? -66.406  0.622   -61.200  1.00 34.82  ? 137  ASP A OD1   1 
ATOM   1080  O  OD2   . ASP A  1 137 ? -66.744  2.373   -59.910  1.00 26.87  ? 137  ASP A OD2   1 
ATOM   1081  N  N     . ILE A  1 138 ? -69.737  1.212   -62.337  1.00 18.52  ? 138  ILE A N     1 
ATOM   1082  C  CA    . ILE A  1 138 ? -71.003  1.037   -61.639  1.00 21.80  ? 138  ILE A CA    1 
ATOM   1083  C  C     . ILE A  1 138 ? -70.842  -0.180  -60.717  1.00 28.63  ? 138  ILE A C     1 
ATOM   1084  O  O     . ILE A  1 138 ? -70.460  -1.275  -61.152  1.00 25.75  ? 138  ILE A O     1 
ATOM   1085  C  CB    . ILE A  1 138 ? -72.193  0.794   -62.618  1.00 25.61  ? 138  ILE A CB    1 
ATOM   1086  C  CG1   . ILE A  1 138 ? -73.495  0.552   -61.838  1.00 13.45  ? 138  ILE A CG1   1 
ATOM   1087  C  CG2   . ILE A  1 138 ? -71.923  -0.416  -63.510  1.00 17.82  ? 138  ILE A CG2   1 
ATOM   1088  C  CD1   . ILE A  1 138 ? -74.087  1.805   -61.228  1.00 20.79  ? 138  ILE A CD1   1 
ATOM   1089  N  N     . ARG A  1 139 ? -71.066  0.037   -59.430  1.00 21.50  ? 139  ARG A N     1 
ATOM   1090  C  CA    . ARG A  1 139 ? -70.962  -1.041  -58.461  1.00 14.07  ? 139  ARG A CA    1 
ATOM   1091  C  C     . ARG A  1 139 ? -72.185  -1.022  -57.560  1.00 23.37  ? 139  ARG A C     1 
ATOM   1092  O  O     . ARG A  1 139 ? -72.729  0.037   -57.239  1.00 26.04  ? 139  ARG A O     1 
ATOM   1093  C  CB    . ARG A  1 139 ? -69.674  -0.908  -57.646  1.00 8.80   ? 139  ARG A CB    1 
ATOM   1094  C  CG    . ARG A  1 139 ? -68.396  -1.367  -58.378  1.00 27.39  ? 139  ARG A CG    1 
ATOM   1095  C  CD    . ARG A  1 139 ? -67.146  -0.560  -57.989  1.00 20.85  ? 139  ARG A CD    1 
ATOM   1096  N  NE    . ARG A  1 139 ? -67.181  -0.090  -56.606  1.00 27.08  ? 139  ARG A NE    1 
ATOM   1097  C  CZ    . ARG A  1 139 ? -67.084  1.188   -56.261  1.00 36.91  ? 139  ARG A CZ    1 
ATOM   1098  N  NH1   . ARG A  1 139 ? -67.144  1.542   -54.983  1.00 40.55  ? 139  ARG A NH1   1 
ATOM   1099  N  NH2   . ARG A  1 139 ? -66.920  2.115   -57.199  1.00 35.65  ? 139  ARG A NH2   1 
ATOM   1100  N  N     . PHE A  1 140 ? -72.657  -2.208  -57.213  1.00 14.60  ? 140  PHE A N     1 
ATOM   1101  C  CA    . PHE A  1 140 ? -73.820  -2.331  -56.356  1.00 22.29  ? 140  PHE A CA    1 
ATOM   1102  C  C     . PHE A  1 140 ? -73.946  -3.734  -55.772  1.00 26.24  ? 140  PHE A C     1 
ATOM   1103  O  O     . PHE A  1 140 ? -73.312  -4.683  -56.240  1.00 27.73  ? 140  PHE A O     1 
ATOM   1104  C  CB    . PHE A  1 140 ? -75.087  -1.941  -57.119  1.00 10.45  ? 140  PHE A CB    1 
ATOM   1105  C  CG    . PHE A  1 140 ? -75.360  -2.788  -58.329  1.00 25.75  ? 140  PHE A CG    1 
ATOM   1106  C  CD1   . PHE A  1 140 ? -75.863  -4.088  -58.192  1.00 24.11  ? 140  PHE A CD1   1 
ATOM   1107  C  CD2   . PHE A  1 140 ? -75.082  -2.303  -59.611  1.00 28.72  ? 140  PHE A CD2   1 
ATOM   1108  C  CE1   . PHE A  1 140 ? -76.081  -4.898  -59.312  1.00 16.10  ? 140  PHE A CE1   1 
ATOM   1109  C  CE2   . PHE A  1 140 ? -75.294  -3.100  -60.738  1.00 7.90   ? 140  PHE A CE2   1 
ATOM   1110  C  CZ    . PHE A  1 140 ? -75.794  -4.407  -60.583  1.00 31.38  ? 140  PHE A CZ    1 
ATOM   1111  N  N     . GLY A  1 141 ? -74.766  -3.858  -54.740  1.00 23.57  ? 141  GLY A N     1 
ATOM   1112  C  CA    . GLY A  1 141 ? -74.948  -5.147  -54.108  1.00 20.28  ? 141  GLY A CA    1 
ATOM   1113  C  C     . GLY A  1 141 ? -75.876  -5.056  -52.923  1.00 22.40  ? 141  GLY A C     1 
ATOM   1114  O  O     . GLY A  1 141 ? -76.151  -3.961  -52.421  1.00 33.68  ? 141  GLY A O     1 
ATOM   1115  N  N     . ALA A  1 142 ? -76.364  -6.212  -52.484  1.00 32.88  ? 142  ALA A N     1 
ATOM   1116  C  CA    . ALA A  1 142 ? -77.263  -6.298  -51.338  1.00 22.53  ? 142  ALA A CA    1 
ATOM   1117  C  C     . ALA A  1 142 ? -77.109  -7.671  -50.725  1.00 27.75  ? 142  ALA A C     1 
ATOM   1118  O  O     . ALA A  1 142 ? -77.144  -8.687  -51.428  1.00 36.95  ? 142  ALA A O     1 
ATOM   1119  C  CB    . ALA A  1 142 ? -78.694  -6.079  -51.760  1.00 21.61  ? 142  ALA A CB    1 
ATOM   1120  N  N     . SER A  1 143 ? -76.868  -7.677  -49.421  1.00 32.05  ? 143  SER A N     1 
ATOM   1121  C  CA    . SER A  1 143 ? -76.698  -8.899  -48.651  1.00 16.76  ? 143  SER A CA    1 
ATOM   1122  C  C     . SER A  1 143 ? -77.336  -8.633  -47.295  1.00 28.13  ? 143  SER A C     1 
ATOM   1123  O  O     . SER A  1 143 ? -77.802  -7.520  -47.027  1.00 28.43  ? 143  SER A O     1 
ATOM   1124  C  CB    . SER A  1 143 ? -75.214  -9.251  -48.507  1.00 18.03  ? 143  SER A CB    1 
ATOM   1125  O  OG    . SER A  1 143 ? -74.585  -8.537  -47.457  1.00 32.13  ? 143  SER A OG    1 
ATOM   1126  N  N     . ILE A  1 144 ? -77.351  -9.642  -46.434  1.00 21.76  ? 144  ILE A N     1 
ATOM   1127  C  CA    . ILE A  1 144 ? -77.970  -9.490  -45.123  1.00 24.84  ? 144  ILE A CA    1 
ATOM   1128  C  C     . ILE A  1 144 ? -77.403  -8.320  -44.306  1.00 25.39  ? 144  ILE A C     1 
ATOM   1129  O  O     . ILE A  1 144 ? -78.146  -7.624  -43.630  1.00 28.61  ? 144  ILE A O     1 
ATOM   1130  C  CB    . ILE A  1 144 ? -77.908  -10.816 -44.320  1.00 26.93  ? 144  ILE A CB    1 
ATOM   1131  C  CG1   . ILE A  1 144 ? -78.704  -10.690 -43.023  1.00 19.26  ? 144  ILE A CG1   1 
ATOM   1132  C  CG2   . ILE A  1 144 ? -76.466  -11.216 -44.042  1.00 18.60  ? 144  ILE A CG2   1 
ATOM   1133  C  CD1   . ILE A  1 144 ? -78.676  -11.937 -42.156  1.00 27.34  ? 144  ILE A CD1   1 
ATOM   1134  N  N     . SER A  1 145 ? -76.102  -8.068  -44.425  1.00 29.05  ? 145  SER A N     1 
ATOM   1135  C  CA    . SER A  1 145 ? -75.440  -6.987  -43.687  1.00 18.42  ? 145  SER A CA    1 
ATOM   1136  C  C     . SER A  1 145 ? -75.524  -5.575  -44.287  1.00 25.36  ? 145  SER A C     1 
ATOM   1137  O  O     . SER A  1 145 ? -75.032  -4.618  -43.680  1.00 29.83  ? 145  SER A O     1 
ATOM   1138  C  CB    . SER A  1 145 ? -73.968  -7.342  -43.420  1.00 14.40  ? 145  SER A CB    1 
ATOM   1139  O  OG    . SER A  1 145 ? -73.306  -7.785  -44.592  1.00 38.70  ? 145  SER A OG    1 
ATOM   1140  N  N     . GLY A  1 146 ? -76.128  -5.439  -45.469  1.00 20.95  ? 146  GLY A N     1 
ATOM   1141  C  CA    . GLY A  1 146 ? -76.239  -4.122  -46.087  1.00 4.05   ? 146  GLY A CA    1 
ATOM   1142  C  C     . GLY A  1 146 ? -76.530  -4.101  -47.580  1.00 19.93  ? 146  GLY A C     1 
ATOM   1143  O  O     . GLY A  1 146 ? -76.826  -5.129  -48.201  1.00 27.44  ? 146  GLY A O     1 
ATOM   1144  N  N     . SER A  1 147 ? -76.430  -2.908  -48.156  1.00 18.06  ? 147  SER A N     1 
ATOM   1145  C  CA    . SER A  1 147 ? -76.677  -2.681  -49.578  1.00 22.09  ? 147  SER A CA    1 
ATOM   1146  C  C     . SER A  1 147 ? -75.878  -1.469  -49.980  1.00 31.01  ? 147  SER A C     1 
ATOM   1147  O  O     . SER A  1 147 ? -75.470  -0.682  -49.127  1.00 30.12  ? 147  SER A O     1 
ATOM   1148  C  CB    . SER A  1 147 ? -78.170  -2.376  -49.863  1.00 13.20  ? 147  SER A CB    1 
ATOM   1149  O  OG    . SER A  1 147 ? -78.934  -2.058  -48.692  1.00 43.89  ? 147  SER A OG    1 
ATOM   1150  N  N     . HIS A  1 148 ? -75.672  -1.305  -51.281  1.00 25.90  ? 148  HIS A N     1 
ATOM   1151  C  CA    . HIS A  1 148 ? -74.962  -0.139  -51.768  1.00 22.39  ? 148  HIS A CA    1 
ATOM   1152  C  C     . HIS A  1 148 ? -74.988  -0.044  -53.275  1.00 25.11  ? 148  HIS A C     1 
ATOM   1153  O  O     . HIS A  1 148 ? -75.213  -1.033  -53.971  1.00 29.16  ? 148  HIS A O     1 
ATOM   1154  C  CB    . HIS A  1 148 ? -73.501  -0.165  -51.320  1.00 23.66  ? 148  HIS A CB    1 
ATOM   1155  C  CG    . HIS A  1 148 ? -72.648  -1.105  -52.112  1.00 32.66  ? 148  HIS A CG    1 
ATOM   1156  N  ND1   . HIS A  1 148 ? -72.626  -2.464  -51.881  1.00 34.39  ? 148  HIS A ND1   1 
ATOM   1157  C  CD2   . HIS A  1 148 ? -71.813  -0.886  -53.160  1.00 13.84  ? 148  HIS A CD2   1 
ATOM   1158  C  CE1   . HIS A  1 148 ? -71.819  -3.043  -52.754  1.00 29.17  ? 148  HIS A CE1   1 
ATOM   1159  N  NE2   . HIS A  1 148 ? -71.313  -2.109  -53.540  1.00 27.09  ? 148  HIS A NE2   1 
ATOM   1160  N  N     . VAL A  1 149 ? -74.795  1.179   -53.752  1.00 24.46  ? 149  VAL A N     1 
ATOM   1161  C  CA    . VAL A  1 149 ? -74.679  1.485   -55.167  1.00 20.84  ? 149  VAL A CA    1 
ATOM   1162  C  C     . VAL A  1 149 ? -73.718  2.659   -55.266  1.00 19.65  ? 149  VAL A C     1 
ATOM   1163  O  O     . VAL A  1 149 ? -73.829  3.630   -54.511  1.00 26.09  ? 149  VAL A O     1 
ATOM   1164  C  CB    . VAL A  1 149 ? -76.002  1.849   -55.861  1.00 21.92  ? 149  VAL A CB    1 
ATOM   1165  C  CG1   . VAL A  1 149 ? -76.701  2.984   -55.169  1.00 14.67  ? 149  VAL A CG1   1 
ATOM   1166  C  CG2   . VAL A  1 149 ? -75.705  2.263   -57.286  1.00 7.62   ? 149  VAL A CG2   1 
ATOM   1167  N  N     . ALA A  1 150 ? -72.737  2.530   -56.151  1.00 15.11  ? 150  ALA A N     1 
ATOM   1168  C  CA    . ALA A  1 150 ? -71.756  3.580   -56.366  1.00 19.30  ? 150  ALA A CA    1 
ATOM   1169  C  C     . ALA A  1 150 ? -71.583  3.804   -57.865  1.00 28.25  ? 150  ALA A C     1 
ATOM   1170  O  O     . ALA A  1 150 ? -71.195  2.893   -58.598  1.00 28.90  ? 150  ALA A O     1 
ATOM   1171  C  CB    . ALA A  1 150 ? -70.457  3.199   -55.744  1.00 18.72  ? 150  ALA A CB    1 
ATOM   1172  N  N     . ILE A  1 151 ? -71.931  5.006   -58.314  1.00 23.07  ? 151  ILE A N     1 
ATOM   1173  C  CA    . ILE A  1 151 ? -71.834  5.386   -59.723  1.00 16.34  ? 151  ILE A CA    1 
ATOM   1174  C  C     . ILE A  1 151 ? -70.618  6.260   -59.903  1.00 21.67  ? 151  ILE A C     1 
ATOM   1175  O  O     . ILE A  1 151 ? -70.291  7.077   -59.044  1.00 26.49  ? 151  ILE A O     1 
ATOM   1176  C  CB    . ILE A  1 151 ? -73.050  6.241   -60.156  1.00 18.34  ? 151  ILE A CB    1 
ATOM   1177  C  CG1   . ILE A  1 151 ? -74.312  5.410   -60.141  1.00 16.24  ? 151  ILE A CG1   1 
ATOM   1178  C  CG2   . ILE A  1 151 ? -72.864  6.797   -61.543  1.00 13.44  ? 151  ILE A CG2   1 
ATOM   1179  C  CD1   . ILE A  1 151 ? -75.516  6.240   -60.201  1.00 14.69  ? 151  ILE A CD1   1 
ATOM   1180  N  N     . ASP A  1 152 ? -69.941  6.091   -61.024  1.00 23.05  ? 152  ASP A N     1 
ATOM   1181  C  CA    . ASP A  1 152 ? -68.799  6.927   -61.289  1.00 25.19  ? 152  ASP A CA    1 
ATOM   1182  C  C     . ASP A  1 152 ? -68.536  7.115   -62.773  1.00 30.13  ? 152  ASP A C     1 
ATOM   1183  O  O     . ASP A  1 152 ? -68.673  6.188   -63.576  1.00 27.87  ? 152  ASP A O     1 
ATOM   1184  C  CB    . ASP A  1 152 ? -67.551  6.413   -60.578  1.00 14.02  ? 152  ASP A CB    1 
ATOM   1185  C  CG    . ASP A  1 152 ? -66.537  7.520   -60.309  1.00 30.72  ? 152  ASP A CG    1 
ATOM   1186  O  OD1   . ASP A  1 152 ? -66.920  8.715   -60.290  1.00 32.34  ? 152  ASP A OD1   1 
ATOM   1187  O  OD2   . ASP A  1 152 ? -65.355  7.195   -60.099  1.00 36.26  ? 152  ASP A OD2   1 
ATOM   1188  N  N     . ASP A  1 153 ? -68.263  8.365   -63.127  1.00 18.83  ? 153  ASP A N     1 
ATOM   1189  C  CA    . ASP A  1 153 ? -67.941  8.738   -64.484  1.00 28.87  ? 153  ASP A CA    1 
ATOM   1190  C  C     . ASP A  1 153 ? -67.072  9.978   -64.499  1.00 29.46  ? 153  ASP A C     1 
ATOM   1191  O  O     . ASP A  1 153 ? -67.164  10.836  -63.624  1.00 31.18  ? 153  ASP A O     1 
ATOM   1192  C  CB    . ASP A  1 153 ? -69.184  8.986   -65.323  1.00 28.91  ? 153  ASP A CB    1 
ATOM   1193  C  CG    . ASP A  1 153 ? -68.843  9.224   -66.778  1.00 29.50  ? 153  ASP A CG    1 
ATOM   1194  O  OD1   . ASP A  1 153 ? -68.357  8.275   -67.431  1.00 31.84  ? 153  ASP A OD1   1 
ATOM   1195  O  OD2   . ASP A  1 153 ? -69.012  10.365  -67.254  1.00 23.30  ? 153  ASP A OD2   1 
ATOM   1196  N  N     . ILE A  1 154 ? -66.244  10.057  -65.530  1.00 24.95  ? 154  ILE A N     1 
ATOM   1197  C  CA    . ILE A  1 154 ? -65.316  11.149  -65.750  1.00 21.86  ? 154  ILE A CA    1 
ATOM   1198  C  C     . ILE A  1 154 ? -66.042  12.505  -65.783  1.00 31.23  ? 154  ILE A C     1 
ATOM   1199  O  O     . ILE A  1 154 ? -65.460  13.529  -65.406  1.00 31.20  ? 154  ILE A O     1 
ATOM   1200  C  CB    . ILE A  1 154 ? -64.502  10.873  -67.071  1.00 30.90  ? 154  ILE A CB    1 
ATOM   1201  C  CG1   . ILE A  1 154 ? -63.291  11.795  -67.194  1.00 29.85  ? 154  ILE A CG1   1 
ATOM   1202  C  CG2   . ILE A  1 154 ? -65.398  10.935  -68.294  1.00 18.76  ? 154  ILE A CG2   1 
ATOM   1203  C  CD1   . ILE A  1 154 ? -62.085  11.330  -66.382  1.00 39.96  ? 154  ILE A CD1   1 
ATOM   1204  N  N     . GLU A  1 155 ? -67.321  12.498  -66.174  1.00 20.61  ? 155  GLU A N     1 
ATOM   1205  C  CA    . GLU A  1 155 ? -68.120  13.728  -66.244  1.00 20.09  ? 155  GLU A CA    1 
ATOM   1206  C  C     . GLU A  1 155 ? -68.816  14.089  -64.945  1.00 16.92  ? 155  GLU A C     1 
ATOM   1207  O  O     . GLU A  1 155 ? -69.300  15.204  -64.798  1.00 35.70  ? 155  GLU A O     1 
ATOM   1208  C  CB    . GLU A  1 155 ? -69.190  13.635  -67.330  1.00 21.55  ? 155  GLU A CB    1 
ATOM   1209  C  CG    . GLU A  1 155 ? -68.679  13.634  -68.765  1.00 17.34  ? 155  GLU A CG    1 
ATOM   1210  C  CD    . GLU A  1 155 ? -69.800  13.824  -69.758  1.00 37.81  ? 155  GLU A CD    1 
ATOM   1211  O  OE1   . GLU A  1 155 ? -70.952  13.964  -69.303  1.00 32.67  ? 155  GLU A OE1   1 
ATOM   1212  O  OE2   . GLU A  1 155 ? -69.540  13.834  -70.981  1.00 30.00  ? 155  GLU A OE2   1 
ATOM   1213  N  N     . GLY A  1 156 ? -68.905  13.134  -64.026  1.00 27.90  ? 156  GLY A N     1 
ATOM   1214  C  CA    . GLY A  1 156 ? -69.568  13.372  -62.755  1.00 23.57  ? 156  GLY A CA    1 
ATOM   1215  C  C     . GLY A  1 156 ? -69.040  14.603  -62.066  1.00 19.35  ? 156  GLY A C     1 
ATOM   1216  O  O     . GLY A  1 156 ? -67.850  14.704  -61.811  1.00 30.11  ? 156  GLY A O     1 
ATOM   1217  N  N     . ALA A  1 157 ? -69.928  15.539  -61.756  1.00 35.26  ? 157  ALA A N     1 
ATOM   1218  C  CA    . ALA A  1 157 ? -69.536  16.787  -61.116  1.00 31.40  ? 157  ALA A CA    1 
ATOM   1219  C  C     . ALA A  1 157 ? -68.772  16.583  -59.814  1.00 36.88  ? 157  ALA A C     1 
ATOM   1220  O  O     . ALA A  1 157 ? -67.963  17.428  -59.416  1.00 32.17  ? 157  ALA A O     1 
ATOM   1221  C  CB    . ALA A  1 157 ? -70.745  17.631  -60.885  1.00 14.23  ? 157  ALA A CB    1 
ATOM   1222  N  N     . TRP A  1 158 ? -69.031  15.450  -59.165  1.00 32.57  ? 158  TRP A N     1 
ATOM   1223  C  CA    . TRP A  1 158 ? -68.381  15.106  -57.905  1.00 23.00  ? 158  TRP A CA    1 
ATOM   1224  C  C     . TRP A  1 158 ? -66.896  14.837  -58.055  1.00 25.21  ? 158  TRP A C     1 
ATOM   1225  O  O     . TRP A  1 158 ? -66.172  14.804  -57.055  1.00 41.26  ? 158  TRP A O     1 
ATOM   1226  C  CB    . TRP A  1 158 ? -69.049  13.889  -57.258  1.00 24.26  ? 158  TRP A CB    1 
ATOM   1227  C  CG    . TRP A  1 158 ? -69.131  12.674  -58.143  1.00 26.64  ? 158  TRP A CG    1 
ATOM   1228  C  CD1   . TRP A  1 158 ? -68.173  11.712  -58.323  1.00 23.44  ? 158  TRP A CD1   1 
ATOM   1229  C  CD2   . TRP A  1 158 ? -70.245  12.288  -58.959  1.00 34.58  ? 158  TRP A CD2   1 
ATOM   1230  N  NE1   . TRP A  1 158 ? -68.623  10.748  -59.201  1.00 26.42  ? 158  TRP A NE1   1 
ATOM   1231  C  CE2   . TRP A  1 158 ? -69.893  11.076  -59.606  1.00 32.89  ? 158  TRP A CE2   1 
ATOM   1232  C  CE3   . TRP A  1 158 ? -71.510  12.847  -59.205  1.00 26.94  ? 158  TRP A CE3   1 
ATOM   1233  C  CZ2   . TRP A  1 158 ? -70.764  10.412  -60.486  1.00 25.64  ? 158  TRP A CZ2   1 
ATOM   1234  C  CZ3   . TRP A  1 158 ? -72.378  12.184  -60.082  1.00 29.00  ? 158  TRP A CZ3   1 
ATOM   1235  C  CH2   . TRP A  1 158 ? -71.996  10.979  -60.709  1.00 20.64  ? 158  TRP A CH2   1 
ATOM   1236  N  N     . ASN A  1 159 ? -66.450  14.639  -59.296  1.00 24.48  ? 159  ASN A N     1 
ATOM   1237  C  CA    . ASN A  1 159 ? -65.041  14.366  -59.584  1.00 25.31  ? 159  ASN A CA    1 
ATOM   1238  C  C     . ASN A  1 159 ? -64.181  15.614  -59.771  1.00 29.29  ? 159  ASN A C     1 
ATOM   1239  O  O     . ASN A  1 159 ? -62.980  15.523  -60.044  1.00 27.96  ? 159  ASN A O     1 
ATOM   1240  C  CB    . ASN A  1 159 ? -64.895  13.431  -60.786  1.00 28.20  ? 159  ASN A CB    1 
ATOM   1241  C  CG    . ASN A  1 159 ? -65.095  11.963  -60.419  1.00 31.96  ? 159  ASN A CG    1 
ATOM   1242  O  OD1   . ASN A  1 159 ? -64.526  11.473  -59.444  1.00 46.08  ? 159  ASN A OD1   1 
ATOM   1243  N  ND2   . ASN A  1 159 ? -65.893  11.251  -61.214  1.00 38.57  ? 159  ASN A ND2   1 
ATOM   1244  N  N     . SER A  1 160 ? -64.787  16.780  -59.577  1.00 31.60  ? 160  SER A N     1 
ATOM   1245  C  CA    . SER A  1 160 ? -64.074  18.044  -59.702  1.00 29.84  ? 160  SER A CA    1 
ATOM   1246  C  C     . SER A  1 160 ? -62.916  18.079  -58.695  1.00 30.15  ? 160  SER A C     1 
ATOM   1247  O  O     . SER A  1 160 ? -61.925  18.785  -58.882  1.00 31.73  ? 160  SER A O     1 
ATOM   1248  C  CB    . SER A  1 160 ? -65.038  19.199  -59.428  1.00 25.85  ? 160  SER A CB    1 
ATOM   1249  O  OG    . SER A  1 160 ? -65.576  19.114  -58.116  1.00 34.48  ? 160  SER A OG    1 
ATOM   1250  N  N     . SER A  1 161 ? -63.045  17.275  -57.646  1.00 23.57  ? 161  SER A N     1 
ATOM   1251  C  CA    . SER A  1 161 ? -62.055  17.186  -56.579  1.00 34.90  ? 161  SER A CA    1 
ATOM   1252  C  C     . SER A  1 161 ? -61.161  15.946  -56.631  1.00 35.34  ? 161  SER A C     1 
ATOM   1253  O  O     . SER A  1 161 ? -60.177  15.856  -55.892  1.00 33.88  ? 161  SER A O     1 
ATOM   1254  C  CB    . SER A  1 161 ? -62.770  17.219  -55.226  1.00 26.06  ? 161  SER A CB    1 
ATOM   1255  O  OG    . SER A  1 161 ? -63.751  16.197  -55.140  1.00 30.42  ? 161  SER A OG    1 
ATOM   1256  N  N     . THR A  1 162 ? -61.496  15.007  -57.508  1.00 24.37  ? 162  THR A N     1 
ATOM   1257  C  CA    . THR A  1 162 ? -60.757  13.753  -57.636  1.00 14.36  ? 162  THR A CA    1 
ATOM   1258  C  C     . THR A  1 162 ? -59.340  13.844  -58.198  1.00 24.43  ? 162  THR A C     1 
ATOM   1259  O  O     . THR A  1 162 ? -59.078  14.602  -59.134  1.00 38.17  ? 162  THR A O     1 
ATOM   1260  C  CB    . THR A  1 162 ? -61.562  12.750  -58.478  1.00 21.08  ? 162  THR A CB    1 
ATOM   1261  O  OG1   . THR A  1 162 ? -62.799  12.476  -57.816  1.00 26.37  ? 162  THR A OG1   1 
ATOM   1262  C  CG2   . THR A  1 162 ? -60.793  11.449  -58.681  1.00 13.45  ? 162  THR A CG2   1 
ATOM   1263  N  N     . LYS A  1 163 ? -58.425  13.078  -57.601  1.00 24.48  ? 163  LYS A N     1 
ATOM   1264  C  CA    . LYS A  1 163 ? -57.045  13.036  -58.064  1.00 28.07  ? 163  LYS A CA    1 
ATOM   1265  C  C     . LYS A  1 163 ? -56.985  11.971  -59.150  1.00 30.79  ? 163  LYS A C     1 
ATOM   1266  O  O     . LYS A  1 163 ? -57.517  10.872  -58.984  1.00 37.04  ? 163  LYS A O     1 
ATOM   1267  C  CB    . LYS A  1 163 ? -56.077  12.680  -56.934  1.00 23.34  ? 163  LYS A CB    1 
ATOM   1268  C  CG    . LYS A  1 163 ? -55.977  13.720  -55.846  1.00 33.93  ? 163  LYS A CG    1 
ATOM   1269  C  CD    . LYS A  1 163 ? -54.751  13.499  -54.992  1.00 48.54  ? 163  LYS A CD    1 
ATOM   1270  C  CE    . LYS A  1 163 ? -54.920  14.165  -53.634  1.00 60.77  ? 163  LYS A CE    1 
ATOM   1271  N  NZ    . LYS A  1 163 ? -53.626  14.240  -52.908  1.00 56.75  ? 163  LYS A NZ    1 
ATOM   1272  N  N     . TYR A  1 164 ? -56.443  12.326  -60.293  1.00 31.60  ? 164  TYR A N     1 
ATOM   1273  C  CA    . TYR A  1 164 ? -56.390  11.394  -61.405  1.00 32.58  ? 164  TYR A CA    1 
ATOM   1274  C  C     . TYR A  1 164 ? -54.969  11.092  -61.701  1.00 38.02  ? 164  TYR A C     1 
ATOM   1275  O  O     . TYR A  1 164 ? -54.115  11.903  -61.364  1.00 39.09  ? 164  TYR A O     1 
ATOM   1276  C  CB    . TYR A  1 164 ? -57.037  11.977  -62.658  1.00 16.33  ? 164  TYR A CB    1 
ATOM   1277  C  CG    . TYR A  1 164 ? -58.540  11.853  -62.627  1.00 27.17  ? 164  TYR A CG    1 
ATOM   1278  C  CD1   . TYR A  1 164 ? -59.164  10.768  -63.204  1.00 36.72  ? 164  TYR A CD1   1 
ATOM   1279  C  CD2   . TYR A  1 164 ? -59.279  12.844  -62.022  1.00 26.56  ? 164  TYR A CD2   1 
ATOM   1280  C  CE1   . TYR A  1 164 ? -60.520  10.667  -63.182  1.00 43.16  ? 164  TYR A CE1   1 
ATOM   1281  C  CE2   . TYR A  1 164 ? -60.641  12.752  -61.995  1.00 36.59  ? 164  TYR A CE2   1 
ATOM   1282  C  CZ    . TYR A  1 164 ? -61.268  11.661  -62.578  1.00 33.99  ? 164  TYR A CZ    1 
ATOM   1283  O  OH    . TYR A  1 164 ? -62.642  11.579  -62.560  1.00 44.25  ? 164  TYR A OH    1 
ATOM   1284  N  N     . GLU A  1 165 ? -54.634  9.982   -62.326  1.00 50.82  ? 165  GLU A N     1 
ATOM   1285  C  CA    . GLU A  1 165 ? -53.226  9.776   -62.406  1.00 56.06  ? 165  GLU A CA    1 
ATOM   1286  C  C     . GLU A  1 165 ? -52.492  10.614  -63.417  1.00 53.89  ? 165  GLU A C     1 
ATOM   1287  O  O     . GLU A  1 165 ? -51.275  10.664  -63.372  1.00 54.52  ? 165  GLU A O     1 
ATOM   1288  C  CB    . GLU A  1 165 ? -52.918  8.279   -62.505  1.00 84.70  ? 165  GLU A CB    1 
ATOM   1289  C  CG    . GLU A  1 165 ? -53.020  7.614   -63.855  1.00 99.02  ? 165  GLU A CG    1 
ATOM   1290  C  CD    . GLU A  1 165 ? -52.737  6.115   -63.788  1.00 100.00 ? 165  GLU A CD    1 
ATOM   1291  O  OE1   . GLU A  1 165 ? -52.513  5.573   -62.686  1.00 100.00 ? 165  GLU A OE1   1 
ATOM   1292  O  OE2   . GLU A  1 165 ? -52.754  5.483   -64.865  1.00 100.00 ? 165  GLU A OE2   1 
ATOM   1293  N  N     . GLY A  1 166 ? -53.146  11.285  -64.315  1.00 31.55  ? 166  GLY A N     1 
ATOM   1294  C  CA    . GLY A  1 166 ? -52.387  12.139  -65.180  1.00 29.95  ? 166  GLY A CA    1 
ATOM   1295  C  C     . GLY A  1 166 ? -52.818  13.567  -64.920  1.00 37.98  ? 166  GLY A C     1 
ATOM   1296  O  O     . GLY A  1 166 ? -52.551  14.467  -65.719  1.00 39.59  ? 166  GLY A O     1 
ATOM   1297  N  N     . GLY A  1 167 ? -53.477  13.805  -63.777  1.00 42.56  ? 167  GLY A N     1 
ATOM   1298  C  CA    . GLY A  1 167 ? -54.011  15.121  -63.498  1.00 29.12  ? 167  GLY A CA    1 
ATOM   1299  C  C     . GLY A  1 167 ? -55.485  15.212  -63.839  1.00 38.84  ? 167  GLY A C     1 
ATOM   1300  O  O     . GLY A  1 167 ? -55.962  14.578  -64.783  1.00 32.12  ? 167  GLY A O     1 
ATOM   1301  N  N     . ASN A  1 168 ? -56.215  15.976  -63.034  1.00 28.74  ? 168  ASN A N     1 
ATOM   1302  C  CA    . ASN A  1 168 ? -57.641  16.182  -63.236  1.00 31.86  ? 168  ASN A CA    1 
ATOM   1303  C  C     . ASN A  1 168 ? -57.708  17.320  -64.249  1.00 26.04  ? 168  ASN A C     1 
ATOM   1304  O  O     . ASN A  1 168 ? -57.157  18.397  -64.010  1.00 32.37  ? 168  ASN A O     1 
ATOM   1305  C  CB    . ASN A  1 168 ? -58.306  16.580  -61.903  1.00 19.63  ? 168  ASN A CB    1 
ATOM   1306  C  CG    . ASN A  1 168 ? -59.826  16.615  -61.989  1.00 33.08  ? 168  ASN A CG    1 
ATOM   1307  O  OD1   . ASN A  1 168 ? -60.409  16.982  -63.017  1.00 29.49  ? 168  ASN A OD1   1 
ATOM   1308  N  ND2   . ASN A  1 168 ? -60.476  16.227  -60.906  1.00 30.78  ? 168  ASN A ND2   1 
ATOM   1309  N  N     . LYS A  1 169 ? -58.377  17.072  -65.393  1.00 23.36  ? 169  LYS A N     1 
ATOM   1310  C  CA    . LYS A  1 169 ? -58.453  18.103  -66.423  1.00 33.28  ? 169  LYS A CA    1 
ATOM   1311  C  C     . LYS A  1 169 ? -59.535  19.124  -66.167  1.00 33.61  ? 169  LYS A C     1 
ATOM   1312  O  O     . LYS A  1 169 ? -59.503  20.256  -66.668  1.00 50.33  ? 169  LYS A O     1 
ATOM   1313  C  CB    . LYS A  1 169 ? -58.397  17.407  -67.789  1.00 18.92  ? 169  LYS A CB    1 
ATOM   1314  C  CG    . LYS A  1 169 ? -57.188  16.458  -67.946  1.00 13.21  ? 169  LYS A CG    1 
ATOM   1315  C  CD    . LYS A  1 169 ? -55.825  17.121  -67.701  1.00 21.41  ? 169  LYS A CD    1 
ATOM   1316  C  CE    . LYS A  1 169 ? -54.660  16.139  -67.871  1.00 21.79  ? 169  LYS A CE    1 
ATOM   1317  N  NZ    . LYS A  1 169 ? -53.370  16.723  -67.396  1.00 25.39  ? 169  LYS A NZ    1 
ATOM   1318  N  N     . GLY A  1 170 ? -60.510  18.721  -65.361  1.00 39.30  ? 170  GLY A N     1 
ATOM   1319  C  CA    . GLY A  1 170 ? -61.526  19.612  -64.828  1.00 39.79  ? 170  GLY A CA    1 
ATOM   1320  C  C     . GLY A  1 170 ? -62.631  20.182  -65.726  1.00 45.70  ? 170  GLY A C     1 
ATOM   1321  O  O     . GLY A  1 170 ? -63.374  21.034  -65.238  1.00 64.07  ? 170  GLY A O     1 
ATOM   1322  N  N     . HIS A  1 171 ? -62.804  19.800  -66.996  1.00 35.71  ? 171  HIS A N     1 
ATOM   1323  C  CA    . HIS A  1 171 ? -63.953  20.397  -67.679  1.00 28.02  ? 171  HIS A CA    1 
ATOM   1324  C  C     . HIS A  1 171 ? -65.134  19.459  -67.696  1.00 39.58  ? 171  HIS A C     1 
ATOM   1325  O  O     . HIS A  1 171 ? -65.251  18.607  -68.587  1.00 56.70  ? 171  HIS A O     1 
ATOM   1326  C  CB    . HIS A  1 171 ? -63.599  20.828  -69.094  1.00 34.23  ? 171  HIS A CB    1 
ATOM   1327  C  CG    . HIS A  1 171 ? -62.631  22.026  -69.117  1.00 17.76  ? 171  HIS A CG    1 
ATOM   1328  N  ND1   . HIS A  1 171 ? -62.983  23.274  -68.648  1.00 31.55  ? 171  HIS A ND1   1 
ATOM   1329  C  CD2   . HIS A  1 171 ? -61.344  22.129  -69.529  1.00 29.07  ? 171  HIS A CD2   1 
ATOM   1330  C  CE1   . HIS A  1 171 ? -61.954  24.097  -68.737  1.00 27.60  ? 171  HIS A CE1   1 
ATOM   1331  N  NE2   . HIS A  1 171 ? -60.945  23.427  -69.268  1.00 30.46  ? 171  HIS A NE2   1 
ATOM   1332  N  N     . ARG A  1 172 ? -66.027  19.591  -66.725  1.00 26.96  ? 172  ARG A N     1 
ATOM   1333  C  CA    . ARG A  1 172 ? -67.167  18.711  -66.664  1.00 30.39  ? 172  ARG A CA    1 
ATOM   1334  C  C     . ARG A  1 172 ? -68.464  19.421  -66.385  1.00 36.25  ? 172  ARG A C     1 
ATOM   1335  O  O     . ARG A  1 172 ? -68.494  20.503  -65.794  1.00 43.32  ? 172  ARG A O     1 
ATOM   1336  C  CB    . ARG A  1 172 ? -66.941  17.552  -65.679  1.00 27.72  ? 172  ARG A CB    1 
ATOM   1337  C  CG    . ARG A  1 172 ? -66.241  17.888  -64.392  1.00 24.76  ? 172  ARG A CG    1 
ATOM   1338  C  CD    . ARG A  1 172 ? -66.029  16.637  -63.536  1.00 34.41  ? 172  ARG A CD    1 
ATOM   1339  N  NE    . ARG A  1 172 ? -64.931  15.721  -63.908  1.00 14.85  ? 172  ARG A NE    1 
ATOM   1340  C  CZ    . ARG A  1 172 ? -63.634  15.945  -63.675  1.00 33.24  ? 172  ARG A CZ    1 
ATOM   1341  N  NH1   . ARG A  1 172 ? -62.727  15.029  -64.001  1.00 19.71  ? 172  ARG A NH1   1 
ATOM   1342  N  NH2   . ARG A  1 172 ? -63.225  17.129  -63.228  1.00 16.30  ? 172  ARG A NH2   1 
ATOM   1343  N  N     . PRO A  1 173 ? -69.562  18.830  -66.866  1.00 32.73  ? 173  PRO A N     1 
ATOM   1344  C  CA    . PRO A  1 173 ? -70.903  19.374  -66.692  1.00 29.73  ? 173  PRO A CA    1 
ATOM   1345  C  C     . PRO A  1 173 ? -71.349  19.323  -65.235  1.00 41.10  ? 173  PRO A C     1 
ATOM   1346  O  O     . PRO A  1 173 ? -71.229  18.278  -64.576  1.00 38.99  ? 173  PRO A O     1 
ATOM   1347  C  CB    . PRO A  1 173 ? -71.748  18.445  -67.574  1.00 26.27  ? 173  PRO A CB    1 
ATOM   1348  C  CG    . PRO A  1 173 ? -71.045  17.133  -67.469  1.00 29.10  ? 173  PRO A CG    1 
ATOM   1349  C  CD    . PRO A  1 173 ? -69.602  17.553  -67.611  1.00 27.24  ? 173  PRO A CD    1 
ATOM   1350  N  N     . GLY A  1 174 ? -71.808  20.461  -64.720  1.00 39.05  ? 174  GLY A N     1 
ATOM   1351  C  CA    . GLY A  1 174 ? -72.310  20.500  -63.354  1.00 40.69  ? 174  GLY A CA    1 
ATOM   1352  C  C     . GLY A  1 174 ? -73.679  19.811  -63.280  1.00 45.08  ? 174  GLY A C     1 
ATOM   1353  O  O     . GLY A  1 174 ? -74.212  19.344  -64.295  1.00 43.03  ? 174  GLY A O     1 
ATOM   1354  N  N     . VAL A  1 175 ? -74.255  19.729  -62.084  1.00 48.60  ? 175  VAL A N     1 
ATOM   1355  C  CA    . VAL A  1 175 ? -75.562  19.093  -61.904  1.00 44.60  ? 175  VAL A CA    1 
ATOM   1356  C  C     . VAL A  1 175 ? -76.603  19.827  -62.756  1.00 49.59  ? 175  VAL A C     1 
ATOM   1357  O  O     . VAL A  1 175 ? -76.697  21.058  -62.695  1.00 55.36  ? 175  VAL A O     1 
ATOM   1358  C  CB    . VAL A  1 175 ? -75.971  19.111  -60.404  1.00 44.80  ? 175  VAL A CB    1 
ATOM   1359  C  CG1   . VAL A  1 175 ? -77.343  18.478  -60.201  1.00 31.62  ? 175  VAL A CG1   1 
ATOM   1360  C  CG2   . VAL A  1 175 ? -74.939  18.362  -59.586  1.00 36.46  ? 175  VAL A CG2   1 
ATOM   1361  N  N     . LYS A  1 176 ? -77.350  19.070  -63.565  1.00 47.13  ? 176  LYS A N     1 
ATOM   1362  C  CA    . LYS A  1 176 ? -78.377  19.624  -64.464  1.00 48.27  ? 176  LYS A CA    1 
ATOM   1363  C  C     . LYS A  1 176 ? -77.774  20.587  -65.505  1.00 47.79  ? 176  LYS A C     1 
ATOM   1364  O  O     . LYS A  1 176 ? -78.506  21.332  -66.156  1.00 40.91  ? 176  LYS A O     1 
ATOM   1365  C  CB    . LYS A  1 176 ? -79.479  20.375  -63.680  1.00 45.95  ? 176  LYS A CB    1 
ATOM   1366  C  CG    . LYS A  1 176 ? -80.573  19.534  -63.012  1.00 53.04  ? 176  LYS A CG    1 
ATOM   1367  C  CD    . LYS A  1 176 ? -81.671  20.454  -62.450  1.00 72.52  ? 176  LYS A CD    1 
ATOM   1368  C  CE    . LYS A  1 176 ? -82.873  19.698  -61.871  1.00 100.00 ? 176  LYS A CE    1 
ATOM   1369  N  NZ    . LYS A  1 176 ? -82.624  19.124  -60.514  1.00 97.77  ? 176  LYS A NZ    1 
ATOM   1370  N  N     . GLY A  1 177 ? -76.458  20.544  -65.699  1.00 40.92  ? 177  GLY A N     1 
ATOM   1371  C  CA    . GLY A  1 177 ? -75.834  21.469  -66.633  1.00 52.09  ? 177  GLY A CA    1 
ATOM   1372  C  C     . GLY A  1 177 ? -75.167  20.877  -67.853  1.00 53.17  ? 177  GLY A C     1 
ATOM   1373  O  O     . GLY A  1 177 ? -74.320  21.521  -68.496  1.00 46.65  ? 177  GLY A O     1 
ATOM   1374  N  N     . GLY A  1 178 ? -75.421  19.601  -68.165  1.00 37.96  ? 178  GLY A N     1 
ATOM   1375  C  CA    . GLY A  1 178 ? -74.687  18.960  -69.245  1.00 62.64  ? 178  GLY A CA    1 
ATOM   1376  C  C     . GLY A  1 178 ? -75.331  19.235  -70.553  1.00 59.04  ? 178  GLY A C     1 
ATOM   1377  O  O     . GLY A  1 178 ? -75.117  18.568  -71.566  1.00 66.01  ? 178  GLY A O     1 
ATOM   1378  N  N     . TYR A  1 179 ? -76.121  20.252  -70.481  0.93 56.62  ? 179  TYR A N     1 
ATOM   1379  C  CA    . TYR A  1 179 ? -76.827  20.498  -71.696  0.93 34.36  ? 179  TYR A CA    1 
ATOM   1380  C  C     . TYR A  1 179 ? -76.120  21.423  -72.606  0.39 41.24  ? 179  TYR A C     1 
ATOM   1381  O  O     . TYR A  1 179 ? -75.961  22.612  -72.382  0.93 42.02  ? 179  TYR A O     1 
ATOM   1382  C  CB    . TYR A  1 179 ? -78.225  20.908  -71.401  0.39 42.39  ? 179  TYR A CB    1 
ATOM   1383  C  CG    . TYR A  1 179 ? -79.185  20.241  -72.342  0.39 44.86  ? 179  TYR A CG    1 
ATOM   1384  C  CD1   . TYR A  1 179 ? -79.029  18.934  -72.856  0.39 60.55  ? 179  TYR A CD1   1 
ATOM   1385  C  CD2   . TYR A  1 179 ? -80.293  20.960  -72.747  0.39 52.21  ? 179  TYR A CD2   1 
ATOM   1386  C  CE1   . TYR A  1 179 ? -79.961  18.379  -73.716  0.39 78.68  ? 179  TYR A CE1   1 
ATOM   1387  C  CE2   . TYR A  1 179 ? -81.238  20.414  -73.608  0.39 64.92  ? 179  TYR A CE2   1 
ATOM   1388  C  CZ    . TYR A  1 179 ? -81.056  19.128  -74.075  0.39 68.46  ? 179  TYR A CZ    1 
ATOM   1389  O  OH    . TYR A  1 179 ? -81.977  18.592  -74.932  0.39 86.06  ? 179  TYR A OH    1 
ATOM   1390  N  N     . PHE A  1 180 ? -75.714  20.764  -73.654  1.00 55.29  ? 180  PHE A N     1 
ATOM   1391  C  CA    . PHE A  1 180 ? -75.067  21.354  -74.790  1.00 42.44  ? 180  PHE A CA    1 
ATOM   1392  C  C     . PHE A  1 180 ? -73.727  22.047  -74.521  1.00 41.55  ? 180  PHE A C     1 
ATOM   1393  O  O     . PHE A  1 180 ? -73.220  22.629  -75.470  1.00 52.43  ? 180  PHE A O     1 
ATOM   1394  C  CB    . PHE A  1 180 ? -76.038  22.274  -75.504  1.00 61.64  ? 180  PHE A CB    1 
ATOM   1395  C  CG    . PHE A  1 180 ? -77.156  21.465  -76.088  1.00 68.06  ? 180  PHE A CG    1 
ATOM   1396  C  CD1   . PHE A  1 180 ? -77.297  20.131  -75.752  1.00 63.64  ? 180  PHE A CD1   1 
ATOM   1397  C  CD2   . PHE A  1 180 ? -78.065  22.035  -76.942  1.00 76.86  ? 180  PHE A CD2   1 
ATOM   1398  C  CE1   . PHE A  1 180 ? -78.357  19.379  -76.252  1.00 80.34  ? 180  PHE A CE1   1 
ATOM   1399  C  CE2   . PHE A  1 180 ? -79.134  21.318  -77.452  1.00 77.53  ? 180  PHE A CE2   1 
ATOM   1400  C  CZ    . PHE A  1 180 ? -79.265  19.989  -77.104  1.00 81.37  ? 180  PHE A CZ    1 
ATOM   1401  N  N     . PRO A  1 181 ? -73.084  22.052  -73.339  1.00 38.25  ? 181  PRO A N     1 
ATOM   1402  C  CA    . PRO A  1 181 ? -71.701  22.613  -73.432  1.00 38.13  ? 181  PRO A CA    1 
ATOM   1403  C  C     . PRO A  1 181 ? -70.883  21.917  -74.558  1.00 30.96  ? 181  PRO A C     1 
ATOM   1404  O  O     . PRO A  1 181 ? -71.028  20.715  -74.704  1.00 45.17  ? 181  PRO A O     1 
ATOM   1405  C  CB    . PRO A  1 181 ? -71.179  22.497  -72.023  1.00 31.65  ? 181  PRO A CB    1 
ATOM   1406  C  CG    . PRO A  1 181 ? -72.402  22.858  -71.232  1.00 57.71  ? 181  PRO A CG    1 
ATOM   1407  C  CD    . PRO A  1 181 ? -73.620  22.588  -72.091  1.00 58.55  ? 181  PRO A CD    1 
ATOM   1408  N  N     . VAL A  1 182 ? -70.050  22.622  -75.348  1.00 30.94  ? 182  VAL A N     1 
ATOM   1409  C  CA    . VAL A  1 182 ? -69.262  21.917  -76.406  1.00 35.77  ? 182  VAL A CA    1 
ATOM   1410  C  C     . VAL A  1 182 ? -68.089  21.191  -75.756  1.00 35.88  ? 182  VAL A C     1 
ATOM   1411  O  O     . VAL A  1 182 ? -67.762  21.499  -74.596  1.00 37.61  ? 182  VAL A O     1 
ATOM   1412  C  CB    . VAL A  1 182 ? -68.693  22.903  -77.484  1.00 26.99  ? 182  VAL A CB    1 
ATOM   1413  C  CG1   . VAL A  1 182 ? -69.804  23.413  -78.388  1.00 32.44  ? 182  VAL A CG1   1 
ATOM   1414  C  CG2   . VAL A  1 182 ? -67.960  24.064  -76.826  1.00 27.09  ? 182  VAL A CG2   1 
ATOM   1415  N  N     . PRO A  1 183 ? -67.439  20.246  -76.433  1.00 32.70  ? 183  PRO A N     1 
ATOM   1416  C  CA    . PRO A  1 183 ? -66.303  19.551  -75.816  1.00 32.79  ? 183  PRO A CA    1 
ATOM   1417  C  C     . PRO A  1 183 ? -65.229  20.591  -75.448  1.00 35.01  ? 183  PRO A C     1 
ATOM   1418  O  O     . PRO A  1 183 ? -65.144  21.653  -76.072  1.00 46.48  ? 183  PRO A O     1 
ATOM   1419  C  CB    . PRO A  1 183 ? -65.827  18.632  -76.942  1.00 37.54  ? 183  PRO A CB    1 
ATOM   1420  C  CG    . PRO A  1 183 ? -67.097  18.258  -77.613  1.00 22.77  ? 183  PRO A CG    1 
ATOM   1421  C  CD    . PRO A  1 183 ? -67.817  19.597  -77.701  1.00 21.84  ? 183  PRO A CD    1 
ATOM   1422  N  N     . PRO A  1 184 ? -64.366  20.289  -74.468  1.00 39.78  ? 184  PRO A N     1 
ATOM   1423  C  CA    . PRO A  1 184 ? -64.231  19.086  -73.641  1.00 31.19  ? 184  PRO A CA    1 
ATOM   1424  C  C     . PRO A  1 184 ? -65.212  18.834  -72.489  1.00 27.76  ? 184  PRO A C     1 
ATOM   1425  O  O     . PRO A  1 184 ? -65.108  17.802  -71.822  1.00 44.50  ? 184  PRO A O     1 
ATOM   1426  C  CB    . PRO A  1 184 ? -62.799  19.194  -73.144  1.00 33.68  ? 184  PRO A CB    1 
ATOM   1427  C  CG    . PRO A  1 184 ? -62.641  20.649  -72.951  1.00 23.73  ? 184  PRO A CG    1 
ATOM   1428  C  CD    . PRO A  1 184 ? -63.278  21.242  -74.177  1.00 35.23  ? 184  PRO A CD    1 
ATOM   1429  N  N     . VAL A  1 185 ? -66.141  19.761  -72.241  1.00 22.71  ? 185  VAL A N     1 
ATOM   1430  C  CA    . VAL A  1 185 ? -67.140  19.587  -71.180  1.00 19.65  ? 185  VAL A CA    1 
ATOM   1431  C  C     . VAL A  1 185 ? -67.991  18.376  -71.543  1.00 25.17  ? 185  VAL A C     1 
ATOM   1432  O  O     . VAL A  1 185 ? -68.297  17.537  -70.694  1.00 36.52  ? 185  VAL A O     1 
ATOM   1433  C  CB    . VAL A  1 185 ? -68.031  20.840  -71.012  1.00 16.02  ? 185  VAL A CB    1 
ATOM   1434  C  CG1   . VAL A  1 185 ? -69.095  20.597  -69.966  1.00 7.23   ? 185  VAL A CG1   1 
ATOM   1435  C  CG2   . VAL A  1 185 ? -67.182  22.013  -70.564  1.00 13.25  ? 185  VAL A CG2   1 
ATOM   1436  N  N     . ASP A  1 186 ? -68.382  18.307  -72.811  1.00 31.72  ? 186  ASP A N     1 
ATOM   1437  C  CA    . ASP A  1 186 ? -69.145  17.176  -73.335  1.00 28.38  ? 186  ASP A CA    1 
ATOM   1438  C  C     . ASP A  1 186 ? -68.057  16.227  -73.813  1.00 34.42  ? 186  ASP A C     1 
ATOM   1439  O  O     . ASP A  1 186 ? -67.368  16.495  -74.801  1.00 33.55  ? 186  ASP A O     1 
ATOM   1440  C  CB    . ASP A  1 186 ? -70.027  17.615  -74.513  1.00 25.27  ? 186  ASP A CB    1 
ATOM   1441  C  CG    . ASP A  1 186 ? -70.614  16.445  -75.294  1.00 20.40  ? 186  ASP A CG    1 
ATOM   1442  O  OD1   . ASP A  1 186 ? -71.134  16.701  -76.396  1.00 29.51  ? 186  ASP A OD1   1 
ATOM   1443  O  OD2   . ASP A  1 186 ? -70.550  15.279  -74.839  1.00 30.37  ? 186  ASP A OD2   1 
ATOM   1444  N  N     . SER A  1 187 ? -67.916  15.106  -73.123  1.00 32.04  ? 187  SER A N     1 
ATOM   1445  C  CA    . SER A  1 187 ? -66.876  14.155  -73.467  1.00 21.93  ? 187  SER A CA    1 
ATOM   1446  C  C     . SER A  1 187 ? -67.334  13.059  -74.390  1.00 29.05  ? 187  SER A C     1 
ATOM   1447  O  O     . SER A  1 187 ? -66.544  12.166  -74.699  1.00 28.15  ? 187  SER A O     1 
ATOM   1448  C  CB    . SER A  1 187 ? -66.371  13.495  -72.197  1.00 28.29  ? 187  SER A CB    1 
ATOM   1449  O  OG    . SER A  1 187 ? -67.373  12.627  -71.692  1.00 21.00  ? 187  SER A OG    1 
ATOM   1450  N  N     . ALA A  1 188 ? -68.578  13.125  -74.855  1.00 19.22  ? 188  ALA A N     1 
ATOM   1451  C  CA    . ALA A  1 188 ? -69.088  12.044  -75.680  1.00 19.89  ? 188  ALA A CA    1 
ATOM   1452  C  C     . ALA A  1 188 ? -69.428  12.268  -77.156  1.00 24.94  ? 188  ALA A C     1 
ATOM   1453  O  O     . ALA A  1 188 ? -70.191  11.498  -77.743  1.00 30.25  ? 188  ALA A O     1 
ATOM   1454  C  CB    . ALA A  1 188 ? -70.241  11.402  -74.967  1.00 11.55  ? 188  ALA A CB    1 
ATOM   1455  N  N     . GLN A  1 189 ? -68.814  13.253  -77.790  1.00 22.79  ? 189  GLN A N     1 
ATOM   1456  C  CA    . GLN A  1 189 ? -69.123  13.488  -79.196  1.00 24.90  ? 189  GLN A CA    1 
ATOM   1457  C  C     . GLN A  1 189 ? -68.764  12.284  -80.060  1.00 21.80  ? 189  GLN A C     1 
ATOM   1458  O  O     . GLN A  1 189 ? -69.622  11.744  -80.748  1.00 30.51  ? 189  GLN A O     1 
ATOM   1459  C  CB    . GLN A  1 189 ? -68.424  14.740  -79.689  1.00 26.23  ? 189  GLN A CB    1 
ATOM   1460  C  CG    . GLN A  1 189 ? -68.730  15.104  -81.114  1.00 14.80  ? 189  GLN A CG    1 
ATOM   1461  C  CD    . GLN A  1 189 ? -70.152  15.529  -81.356  1.00 30.31  ? 189  GLN A CD    1 
ATOM   1462  O  OE1   . GLN A  1 189 ? -70.633  15.457  -82.482  1.00 37.57  ? 189  GLN A OE1   1 
ATOM   1463  N  NE2   . GLN A  1 189 ? -70.828  16.011  -80.317  1.00 20.07  ? 189  GLN A NE2   1 
ATOM   1464  N  N     . ASP A  1 190 ? -67.509  11.844  -79.994  1.00 30.46  ? 190  ASP A N     1 
ATOM   1465  C  CA    . ASP A  1 190 ? -67.070  10.697  -80.772  1.00 10.61  ? 190  ASP A CA    1 
ATOM   1466  C  C     . ASP A  1 190 ? -67.907  9.448   -80.469  1.00 26.38  ? 190  ASP A C     1 
ATOM   1467  O  O     . ASP A  1 190 ? -68.270  8.711   -81.388  1.00 25.31  ? 190  ASP A O     1 
ATOM   1468  C  CB    . ASP A  1 190 ? -65.574  10.383  -80.548  1.00 34.98  ? 190  ASP A CB    1 
ATOM   1469  C  CG    . ASP A  1 190 ? -64.631  11.468  -81.080  1.00 20.19  ? 190  ASP A CG    1 
ATOM   1470  O  OD1   . ASP A  1 190 ? -63.703  11.895  -80.357  1.00 69.33  ? 190  ASP A OD1   1 
ATOM   1471  O  OD2   . ASP A  1 190 ? -64.749  11.872  -82.244  1.00 37.68  ? 190  ASP A OD2   1 
ATOM   1472  N  N     . ILE A  1 191 ? -68.239  9.240   -79.194  1.00 34.73  ? 191  ILE A N     1 
ATOM   1473  C  CA    . ILE A  1 191 ? -69.020  8.074   -78.764  1.00 23.40  ? 191  ILE A CA    1 
ATOM   1474  C  C     . ILE A  1 191 ? -70.404  8.085   -79.385  1.00 28.63  ? 191  ILE A C     1 
ATOM   1475  O  O     . ILE A  1 191 ? -70.820  7.096   -79.980  1.00 34.01  ? 191  ILE A O     1 
ATOM   1476  C  CB    . ILE A  1 191 ? -69.145  8.001   -77.212  1.00 39.63  ? 191  ILE A CB    1 
ATOM   1477  C  CG1   . ILE A  1 191 ? -67.793  8.405   -76.583  1.00 63.36  ? 191  ILE A CG1   1 
ATOM   1478  C  CG2   . ILE A  1 191 ? -69.564  6.569   -76.766  1.00 16.31  ? 191  ILE A CG2   1 
ATOM   1479  C  CD1   . ILE A  1 191 ? -67.751  8.456   -75.054  1.00 58.84  ? 191  ILE A CD1   1 
ATOM   1480  N  N     . ARG A  1 192 ? -71.101  9.217   -79.280  1.00 36.86  ? 192  ARG A N     1 
ATOM   1481  C  CA    . ARG A  1 192 ? -72.447  9.344   -79.842  1.00 22.28  ? 192  ARG A CA    1 
ATOM   1482  C  C     . ARG A  1 192 ? -72.468  9.138   -81.360  1.00 30.93  ? 192  ARG A C     1 
ATOM   1483  O  O     . ARG A  1 192 ? -73.266  8.355   -81.883  1.00 40.45  ? 192  ARG A O     1 
ATOM   1484  C  CB    . ARG A  1 192 ? -73.095  10.681  -79.462  1.00 23.34  ? 192  ARG A CB    1 
ATOM   1485  C  CG    . ARG A  1 192 ? -73.436  10.815  -77.970  1.00 23.60  ? 192  ARG A CG    1 
ATOM   1486  C  CD    . ARG A  1 192 ? -74.372  12.000  -77.670  1.00 14.22  ? 192  ARG A CD    1 
ATOM   1487  N  NE    . ARG A  1 192 ? -73.874  13.259  -78.208  1.00 25.10  ? 192  ARG A NE    1 
ATOM   1488  C  CZ    . ARG A  1 192 ? -73.002  14.056  -77.596  1.00 26.00  ? 192  ARG A CZ    1 
ATOM   1489  N  NH1   . ARG A  1 192 ? -72.601  15.171  -78.183  1.00 33.36  ? 192  ARG A NH1   1 
ATOM   1490  N  NH2   . ARG A  1 192 ? -72.550  13.762  -76.392  1.00 35.70  ? 192  ARG A NH2   1 
ATOM   1491  N  N     . SER A  1 193 ? -71.571  9.799   -82.073  1.00 26.35  ? 193  SER A N     1 
ATOM   1492  C  CA    . SER A  1 193 ? -71.529  9.614   -83.515  1.00 16.71  ? 193  SER A CA    1 
ATOM   1493  C  C     . SER A  1 193 ? -71.261  8.194   -83.962  1.00 27.62  ? 193  SER A C     1 
ATOM   1494  O  O     . SER A  1 193 ? -71.796  7.772   -84.989  1.00 36.56  ? 193  SER A O     1 
ATOM   1495  C  CB    . SER A  1 193 ? -70.538  10.547  -84.147  1.00 26.01  ? 193  SER A CB    1 
ATOM   1496  O  OG    . SER A  1 193 ? -71.073  11.857  -84.120  1.00 27.34  ? 193  SER A OG    1 
ATOM   1497  N  N     . GLU A  1 194 ? -70.419  7.464   -83.228  1.00 24.86  ? 194  GLU A N     1 
ATOM   1498  C  CA    . GLU A  1 194 ? -70.167  6.062   -83.570  1.00 20.14  ? 194  GLU A CA    1 
ATOM   1499  C  C     . GLU A  1 194 ? -71.504  5.344   -83.435  1.00 32.34  ? 194  GLU A C     1 
ATOM   1500  O  O     . GLU A  1 194 ? -71.897  4.569   -84.311  1.00 36.34  ? 194  GLU A O     1 
ATOM   1501  C  CB    . GLU A  1 194 ? -69.175  5.403   -82.605  1.00 26.78  ? 194  GLU A CB    1 
ATOM   1502  C  CG    . GLU A  1 194 ? -67.786  5.126   -83.174  1.00 62.86  ? 194  GLU A CG    1 
ATOM   1503  C  CD    . GLU A  1 194 ? -67.810  4.112   -84.283  1.00 66.02  ? 194  GLU A CD    1 
ATOM   1504  O  OE1   . GLU A  1 194 ? -67.431  4.465   -85.425  1.00 80.89  ? 194  GLU A OE1   1 
ATOM   1505  O  OE2   . GLU A  1 194 ? -68.220  2.966   -84.006  1.00 50.58  ? 194  GLU A OE2   1 
ATOM   1506  N  N     . MET A  1 195 ? -72.219  5.627   -82.347  1.00 14.72  ? 195  MET A N     1 
ATOM   1507  C  CA    . MET A  1 195 ? -73.500  4.979   -82.129  1.00 17.34  ? 195  MET A CA    1 
ATOM   1508  C  C     . MET A  1 195 ? -74.427  5.273   -83.293  1.00 22.35  ? 195  MET A C     1 
ATOM   1509  O  O     . MET A  1 195 ? -75.143  4.388   -83.757  1.00 36.15  ? 195  MET A O     1 
ATOM   1510  C  CB    . MET A  1 195 ? -74.125  5.426   -80.812  1.00 12.95  ? 195  MET A CB    1 
ATOM   1511  C  CG    . MET A  1 195 ? -73.333  5.030   -79.578  1.00 20.91  ? 195  MET A CG    1 
ATOM   1512  S  SD    . MET A  1 195 ? -74.105  5.722   -78.118  1.00 23.94  ? 195  MET A SD    1 
ATOM   1513  C  CE    . MET A  1 195 ? -73.212  4.903   -76.819  1.00 15.46  ? 195  MET A CE    1 
ATOM   1514  N  N     . CYS A  1 196 ? -74.379  6.500   -83.803  1.00 22.87  ? 196  CYS A N     1 
ATOM   1515  C  CA    . CYS A  1 196 ? -75.231  6.869   -84.926  1.00 23.55  ? 196  CYS A CA    1 
ATOM   1516  C  C     . CYS A  1 196 ? -74.870  6.123   -86.204  1.00 28.22  ? 196  CYS A C     1 
ATOM   1517  O  O     . CYS A  1 196 ? -75.745  5.560   -86.859  1.00 33.73  ? 196  CYS A O     1 
ATOM   1518  C  CB    . CYS A  1 196 ? -75.198  8.371   -85.156  1.00 16.81  ? 196  CYS A CB    1 
ATOM   1519  S  SG    . CYS A  1 196 ? -75.959  9.301   -83.817  1.00 31.34  ? 196  CYS A SG    1 
ATOM   1520  N  N     . LEU A  1 197 ? -73.584  6.081   -86.535  1.00 17.30  ? 197  LEU A N     1 
ATOM   1521  C  CA    . LEU A  1 197 ? -73.145  5.384   -87.736  1.00 24.43  ? 197  LEU A CA    1 
ATOM   1522  C  C     . LEU A  1 197 ? -73.570  3.919   -87.715  1.00 24.77  ? 197  LEU A C     1 
ATOM   1523  O  O     . LEU A  1 197 ? -74.116  3.410   -88.703  1.00 46.69  ? 197  LEU A O     1 
ATOM   1524  C  CB    . LEU A  1 197 ? -71.628  5.487   -87.900  1.00 15.97  ? 197  LEU A CB    1 
ATOM   1525  C  CG    . LEU A  1 197 ? -71.011  6.889   -87.957  1.00 30.39  ? 197  LEU A CG    1 
ATOM   1526  C  CD1   . LEU A  1 197 ? -69.500  6.777   -88.091  1.00 21.04  ? 197  LEU A CD1   1 
ATOM   1527  C  CD2   . LEU A  1 197 ? -71.593  7.677   -89.106  1.00 13.18  ? 197  LEU A CD2   1 
ATOM   1528  N  N     . VAL A  1 198 ? -73.364  3.266   -86.574  1.00 20.58  ? 198  VAL A N     1 
ATOM   1529  C  CA    . VAL A  1 198 ? -73.718  1.854   -86.408  1.00 22.11  ? 198  VAL A CA    1 
ATOM   1530  C  C     . VAL A  1 198 ? -75.227  1.635   -86.448  1.00 28.03  ? 198  VAL A C     1 
ATOM   1531  O  O     . VAL A  1 198 ? -75.710  0.683   -87.062  1.00 42.15  ? 198  VAL A O     1 
ATOM   1532  C  CB    . VAL A  1 198 ? -73.151  1.263   -85.091  1.00 28.73  ? 198  VAL A CB    1 
ATOM   1533  C  CG1   . VAL A  1 198 ? -73.498  -0.206  -84.994  1.00 17.41  ? 198  VAL A CG1   1 
ATOM   1534  C  CG2   . VAL A  1 198 ? -71.628  1.440   -85.027  1.00 8.93   ? 198  VAL A CG2   1 
ATOM   1535  N  N     . MET A  1 199 ? -75.974  2.508   -85.780  1.00 32.10  ? 199  MET A N     1 
ATOM   1536  C  CA    . MET A  1 199 ? -77.424  2.404   -85.778  1.00 23.50  ? 199  MET A CA    1 
ATOM   1537  C  C     . MET A  1 199 ? -77.911  2.422   -87.212  1.00 28.96  ? 199  MET A C     1 
ATOM   1538  O  O     . MET A  1 199 ? -78.740  1.607   -87.606  1.00 49.53  ? 199  MET A O     1 
ATOM   1539  C  CB    . MET A  1 199 ? -78.041  3.564   -85.013  1.00 27.40  ? 199  MET A CB    1 
ATOM   1540  C  CG    . MET A  1 199 ? -77.943  3.383   -83.534  1.00 18.84  ? 199  MET A CG    1 
ATOM   1541  S  SD    . MET A  1 199 ? -78.834  4.644   -82.662  1.00 31.99  ? 199  MET A SD    1 
ATOM   1542  C  CE    . MET A  1 199 ? -78.341  4.217   -80.990  1.00 30.92  ? 199  MET A CE    1 
ATOM   1543  N  N     . GLU A  1 200 ? -77.356  3.333   -88.002  1.00 26.52  ? 200  GLU A N     1 
ATOM   1544  C  CA    . GLU A  1 200 ? -77.729  3.433   -89.398  1.00 25.75  ? 200  GLU A CA    1 
ATOM   1545  C  C     . GLU A  1 200 ? -77.325  2.207   -90.201  1.00 29.47  ? 200  GLU A C     1 
ATOM   1546  O  O     . GLU A  1 200 ? -78.088  1.749   -91.049  1.00 47.01  ? 200  GLU A O     1 
ATOM   1547  C  CB    . GLU A  1 200 ? -77.216  4.730   -90.000  1.00 12.29  ? 200  GLU A CB    1 
ATOM   1548  C  CG    . GLU A  1 200 ? -78.023  5.912   -89.466  1.00 28.62  ? 200  GLU A CG    1 
ATOM   1549  C  CD    . GLU A  1 200 ? -77.859  7.179   -90.273  1.00 35.61  ? 200  GLU A CD    1 
ATOM   1550  O  OE1   . GLU A  1 200 ? -78.786  8.018   -90.208  1.00 32.01  ? 200  GLU A OE1   1 
ATOM   1551  O  OE2   . GLU A  1 200 ? -76.814  7.335   -90.953  1.00 46.98  ? 200  GLU A OE2   1 
ATOM   1552  N  N     . GLN A  1 201 ? -76.164  1.637   -89.897  1.00 27.73  ? 201  GLN A N     1 
ATOM   1553  C  CA    . GLN A  1 201 ? -75.732  0.420   -90.581  1.00 31.00  ? 201  GLN A CA    1 
ATOM   1554  C  C     . GLN A  1 201 ? -76.677  -0.734  -90.212  1.00 30.90  ? 201  GLN A C     1 
ATOM   1555  O  O     . GLN A  1 201 ? -76.609  -1.812  -90.799  1.00 47.29  ? 201  GLN A O     1 
ATOM   1556  C  CB    . GLN A  1 201 ? -74.323  0.011   -90.150  1.00 23.72  ? 201  GLN A CB    1 
ATOM   1557  C  CG    . GLN A  1 201 ? -73.198  0.954   -90.486  1.00 64.60  ? 201  GLN A CG    1 
ATOM   1558  C  CD    . GLN A  1 201 ? -71.914  0.587   -89.733  1.00 76.56  ? 201  GLN A CD    1 
ATOM   1559  O  OE1   . GLN A  1 201 ? -71.766  -0.534  -89.221  1.00 52.75  ? 201  GLN A OE1   1 
ATOM   1560  N  NE2   . GLN A  1 201 ? -70.988  1.540   -89.645  1.00 85.15  ? 201  GLN A NE2   1 
ATOM   1561  N  N     . MET A  1 202 ? -77.487  -0.541  -89.174  1.00 37.46  ? 202  MET A N     1 
ATOM   1562  C  CA    . MET A  1 202 ? -78.414  -1.582  -88.749  1.00 29.72  ? 202  MET A CA    1 
ATOM   1563  C  C     . MET A  1 202 ? -79.859  -1.289  -89.116  1.00 33.65  ? 202  MET A C     1 
ATOM   1564  O  O     . MET A  1 202 ? -80.789  -1.910  -88.587  1.00 31.68  ? 202  MET A O     1 
ATOM   1565  C  CB    . MET A  1 202 ? -78.250  -1.888  -87.260  1.00 31.85  ? 202  MET A CB    1 
ATOM   1566  C  CG    . MET A  1 202 ? -76.925  -2.580  -86.965  1.00 34.26  ? 202  MET A CG    1 
ATOM   1567  S  SD    . MET A  1 202 ? -76.733  -3.102  -85.261  1.00 31.50  ? 202  MET A SD    1 
ATOM   1568  C  CE    . MET A  1 202 ? -77.517  -4.695  -85.280  1.00 22.85  ? 202  MET A CE    1 
ATOM   1569  N  N     . GLY A  1 203 ? -80.035  -0.343  -90.037  1.00 32.11  ? 203  GLY A N     1 
ATOM   1570  C  CA    . GLY A  1 203 ? -81.361  -0.009  -90.531  1.00 35.86  ? 203  GLY A CA    1 
ATOM   1571  C  C     . GLY A  1 203 ? -82.100  1.176   -89.964  1.00 36.04  ? 203  GLY A C     1 
ATOM   1572  O  O     . GLY A  1 203 ? -83.178  1.546   -90.454  1.00 50.31  ? 203  GLY A O     1 
ATOM   1573  N  N     . LEU A  1 204 ? -81.553  1.754   -88.909  1.00 30.29  ? 204  LEU A N     1 
ATOM   1574  C  CA    . LEU A  1 204 ? -82.194  2.898   -88.294  1.00 32.25  ? 204  LEU A CA    1 
ATOM   1575  C  C     . LEU A  1 204 ? -81.827  4.167   -89.037  1.00 30.09  ? 204  LEU A C     1 
ATOM   1576  O  O     . LEU A  1 204 ? -80.877  4.183   -89.833  1.00 30.71  ? 204  LEU A O     1 
ATOM   1577  C  CB    . LEU A  1 204 ? -81.801  3.007   -86.818  1.00 19.51  ? 204  LEU A CB    1 
ATOM   1578  C  CG    . LEU A  1 204 ? -82.561  2.120   -85.830  1.00 30.48  ? 204  LEU A CG    1 
ATOM   1579  C  CD1   . LEU A  1 204 ? -82.201  0.680   -86.041  1.00 26.36  ? 204  LEU A CD1   1 
ATOM   1580  C  CD2   . LEU A  1 204 ? -82.260  2.543   -84.398  1.00 25.67  ? 204  LEU A CD2   1 
ATOM   1581  N  N     . VAL A  1 205 ? -82.635  5.203   -88.842  1.00 21.94  ? 205  VAL A N     1 
ATOM   1582  C  CA    . VAL A  1 205 ? -82.363  6.491   -89.459  1.00 26.10  ? 205  VAL A CA    1 
ATOM   1583  C  C     . VAL A  1 205 ? -82.241  7.488   -88.336  1.00 37.72  ? 205  VAL A C     1 
ATOM   1584  O  O     . VAL A  1 205 ? -83.178  7.687   -87.553  1.00 35.77  ? 205  VAL A O     1 
ATOM   1585  C  CB    . VAL A  1 205 ? -83.462  6.915   -90.439  1.00 32.97  ? 205  VAL A CB    1 
ATOM   1586  C  CG1   . VAL A  1 205 ? -83.224  8.347   -90.923  1.00 15.39  ? 205  VAL A CG1   1 
ATOM   1587  C  CG2   . VAL A  1 205 ? -83.449  5.984   -91.624  1.00 14.21  ? 205  VAL A CG2   1 
ATOM   1588  N  N     . VAL A  1 206 ? -81.056  8.075   -88.238  1.00 37.14  ? 206  VAL A N     1 
ATOM   1589  C  CA    . VAL A  1 206 ? -80.769  9.030   -87.187  1.00 32.61  ? 206  VAL A CA    1 
ATOM   1590  C  C     . VAL A  1 206 ? -81.137  10.448  -87.560  1.00 32.25  ? 206  VAL A C     1 
ATOM   1591  O  O     . VAL A  1 206 ? -80.828  10.915  -88.651  1.00 46.55  ? 206  VAL A O     1 
ATOM   1592  C  CB    . VAL A  1 206 ? -79.287  8.971   -86.790  1.00 29.64  ? 206  VAL A CB    1 
ATOM   1593  C  CG1   . VAL A  1 206 ? -78.980  10.033  -85.753  1.00 27.77  ? 206  VAL A CG1   1 
ATOM   1594  C  CG2   . VAL A  1 206 ? -78.957  7.596   -86.238  1.00 22.54  ? 206  VAL A CG2   1 
ATOM   1595  N  N     . GLU A  1 207 ? -81.804  11.123  -86.636  1.00 34.20  ? 207  GLU A N     1 
ATOM   1596  C  CA    . GLU A  1 207 ? -82.217  12.502  -86.833  1.00 33.28  ? 207  GLU A CA    1 
ATOM   1597  C  C     . GLU A  1 207 ? -81.297  13.495  -86.120  1.00 34.10  ? 207  GLU A C     1 
ATOM   1598  O  O     . GLU A  1 207 ? -81.050  14.588  -86.633  1.00 39.72  ? 207  GLU A O     1 
ATOM   1599  C  CB    . GLU A  1 207 ? -83.672  12.683  -86.387  1.00 30.09  ? 207  GLU A CB    1 
ATOM   1600  C  CG    . GLU A  1 207 ? -84.623  12.887  -87.555  1.00 49.36  ? 207  GLU A CG    1 
ATOM   1601  C  CD    . GLU A  1 207 ? -86.010  12.326  -87.326  1.00 54.22  ? 207  GLU A CD    1 
ATOM   1602  O  OE1   . GLU A  1 207 ? -86.418  12.152  -86.155  1.00 75.85  ? 207  GLU A OE1   1 
ATOM   1603  O  OE2   . GLU A  1 207 ? -86.698  12.061  -88.338  1.00 67.29  ? 207  GLU A OE2   1 
ATOM   1604  N  N     . ALA A  1 208 ? -80.764  13.101  -84.962  1.00 38.91  ? 208  ALA A N     1 
ATOM   1605  C  CA    . ALA A  1 208 ? -79.866  13.963  -84.182  1.00 36.51  ? 208  ALA A CA    1 
ATOM   1606  C  C     . ALA A  1 208 ? -79.229  13.256  -82.997  1.00 31.60  ? 208  ALA A C     1 
ATOM   1607  O  O     . ALA A  1 208 ? -79.672  12.179  -82.593  1.00 33.44  ? 208  ALA A O     1 
ATOM   1608  C  CB    . ALA A  1 208 ? -80.634  15.159  -83.653  1.00 19.52  ? 208  ALA A CB    1 
ATOM   1609  N  N     . HIS A  1 209 ? -78.175  13.867  -82.453  1.00 28.07  ? 209  HIS A N     1 
ATOM   1610  C  CA    . HIS A  1 209 ? -77.514  13.353  -81.252  1.00 19.78  ? 209  HIS A CA    1 
ATOM   1611  C  C     . HIS A  1 209 ? -76.986  14.496  -80.413  1.00 22.51  ? 209  HIS A C     1 
ATOM   1612  O  O     . HIS A  1 209 ? -76.553  15.523  -80.931  1.00 20.13  ? 209  HIS A O     1 
ATOM   1613  C  CB    . HIS A  1 209 ? -76.459  12.257  -81.535  1.00 21.87  ? 209  HIS A CB    1 
ATOM   1614  C  CG    . HIS A  1 209 ? -75.077  12.751  -81.839  1.00 27.93  ? 209  HIS A CG    1 
ATOM   1615  N  ND1   . HIS A  1 209 ? -74.363  13.563  -80.985  1.00 27.74  ? 209  HIS A ND1   1 
ATOM   1616  C  CD2   . HIS A  1 209 ? -74.240  12.458  -82.866  1.00 26.67  ? 209  HIS A CD2   1 
ATOM   1617  C  CE1   . HIS A  1 209 ? -73.146  13.747  -81.470  1.00 35.58  ? 209  HIS A CE1   1 
ATOM   1618  N  NE2   . HIS A  1 209 ? -73.046  13.087  -82.610  1.00 19.48  ? 209  HIS A NE2   1 
ATOM   1619  N  N     . HIS A  1 210 ? -77.085  14.339  -79.105  1.00 25.63  ? 210  HIS A N     1 
ATOM   1620  C  CA    . HIS A  1 210 ? -76.641  15.384  -78.210  1.00 29.21  ? 210  HIS A CA    1 
ATOM   1621  C  C     . HIS A  1 210 ? -76.528  14.879  -76.792  1.00 27.65  ? 210  HIS A C     1 
ATOM   1622  O  O     . HIS A  1 210 ? -77.079  13.829  -76.450  1.00 27.97  ? 210  HIS A O     1 
ATOM   1623  C  CB    . HIS A  1 210 ? -77.663  16.517  -78.234  1.00 17.14  ? 210  HIS A CB    1 
ATOM   1624  C  CG    . HIS A  1 210 ? -79.057  16.088  -77.867  1.00 21.45  ? 210  HIS A CG    1 
ATOM   1625  N  ND1   . HIS A  1 210 ? -79.531  16.111  -76.574  1.00 25.99  ? 210  HIS A ND1   1 
ATOM   1626  C  CD2   . HIS A  1 210 ? -80.080  15.630  -78.631  1.00 29.56  ? 210  HIS A CD2   1 
ATOM   1627  C  CE1   . HIS A  1 210 ? -80.785  15.687  -76.554  1.00 23.85  ? 210  HIS A CE1   1 
ATOM   1628  N  NE2   . HIS A  1 210 ? -81.141  15.389  -77.792  1.00 23.65  ? 210  HIS A NE2   1 
ATOM   1629  N  N     . HIS A  1 211 ? -75.815  15.644  -75.972  1.00 20.12  ? 211  HIS A N     1 
ATOM   1630  C  CA    . HIS A  1 211 ? -75.672  15.327  -74.561  1.00 25.28  ? 211  HIS A CA    1 
ATOM   1631  C  C     . HIS A  1 211 ? -76.993  15.751  -73.924  1.00 25.23  ? 211  HIS A C     1 
ATOM   1632  O  O     . HIS A  1 211 ? -77.674  16.624  -74.444  1.00 24.94  ? 211  HIS A O     1 
ATOM   1633  C  CB    . HIS A  1 211 ? -74.546  16.149  -73.946  1.00 25.04  ? 211  HIS A CB    1 
ATOM   1634  C  CG    . HIS A  1 211 ? -74.165  15.717  -72.563  1.00 30.78  ? 211  HIS A CG    1 
ATOM   1635  N  ND1   . HIS A  1 211 ? -72.920  15.210  -72.258  1.00 28.34  ? 211  HIS A ND1   1 
ATOM   1636  C  CD2   . HIS A  1 211 ? -74.870  15.701  -71.407  1.00 21.00  ? 211  HIS A CD2   1 
ATOM   1637  C  CE1   . HIS A  1 211 ? -72.877  14.896  -70.975  1.00 21.09  ? 211  HIS A CE1   1 
ATOM   1638  N  NE2   . HIS A  1 211 ? -74.046  15.183  -70.435  1.00 30.07  ? 211  HIS A NE2   1 
ATOM   1639  N  N     . GLU A  1 212 ? -77.371  15.129  -72.818  1.00 20.52  ? 212  GLU A N     1 
ATOM   1640  C  CA    . GLU A  1 212 ? -78.615  15.499  -72.164  1.00 17.97  ? 212  GLU A CA    1 
ATOM   1641  C  C     . GLU A  1 212 ? -78.353  16.354  -70.937  1.00 25.00  ? 212  GLU A C     1 
ATOM   1642  O  O     . GLU A  1 212 ? -77.221  16.719  -70.671  1.00 35.23  ? 212  GLU A O     1 
ATOM   1643  C  CB    . GLU A  1 212 ? -79.435  14.266  -71.809  1.00 27.79  ? 212  GLU A CB    1 
ATOM   1644  C  CG    . GLU A  1 212 ? -80.621  14.023  -72.732  1.00 26.49  ? 212  GLU A CG    1 
ATOM   1645  C  CD    . GLU A  1 212 ? -81.698  15.102  -72.633  1.00 39.65  ? 212  GLU A CD    1 
ATOM   1646  O  OE1   . GLU A  1 212 ? -81.897  15.677  -71.534  1.00 40.28  ? 212  GLU A OE1   1 
ATOM   1647  O  OE2   . GLU A  1 212 ? -82.371  15.347  -73.657  1.00 36.49  ? 212  GLU A OE2   1 
ATOM   1648  N  N     . VAL A  1 213 ? -79.398  16.641  -70.174  1.00 27.67  ? 213  VAL A N     1 
ATOM   1649  C  CA    . VAL A  1 213 ? -79.298  17.500  -68.995  1.00 37.92  ? 213  VAL A CA    1 
ATOM   1650  C  C     . VAL A  1 213 ? -78.426  17.070  -67.808  1.00 30.24  ? 213  VAL A C     1 
ATOM   1651  O  O     . VAL A  1 213 ? -77.674  17.868  -67.241  1.00 34.80  ? 213  VAL A O     1 
ATOM   1652  C  CB    . VAL A  1 213 ? -80.703  17.819  -68.466  1.00 33.02  ? 213  VAL A CB    1 
ATOM   1653  C  CG1   . VAL A  1 213 ? -80.635  18.684  -67.232  1.00 38.72  ? 213  VAL A CG1   1 
ATOM   1654  C  CG2   . VAL A  1 213 ? -81.488  18.495  -69.521  1.00 27.99  ? 213  VAL A CG2   1 
ATOM   1655  N  N     . ALA A  1 214 ? -78.528  15.818  -67.412  1.00 25.64  ? 214  ALA A N     1 
ATOM   1656  C  CA    . ALA A  1 214 ? -77.775  15.377  -66.259  1.00 32.66  ? 214  ALA A CA    1 
ATOM   1657  C  C     . ALA A  1 214 ? -76.259  15.330  -66.422  1.00 36.49  ? 214  ALA A C     1 
ATOM   1658  O  O     . ALA A  1 214 ? -75.731  15.232  -67.535  1.00 35.24  ? 214  ALA A O     1 
ATOM   1659  C  CB    . ALA A  1 214 ? -78.305  14.027  -65.785  1.00 35.27  ? 214  ALA A CB    1 
ATOM   1660  N  N     . THR A  1 215 ? -75.570  15.466  -65.293  1.00 36.82  ? 215  THR A N     1 
ATOM   1661  C  CA    . THR A  1 215 ? -74.119  15.368  -65.245  1.00 26.09  ? 215  THR A CA    1 
ATOM   1662  C  C     . THR A  1 215 ? -73.841  13.855  -65.343  1.00 32.61  ? 215  THR A C     1 
ATOM   1663  O  O     . THR A  1 215 ? -74.763  13.050  -65.506  1.00 44.23  ? 215  THR A O     1 
ATOM   1664  C  CB    . THR A  1 215 ? -73.565  15.919  -63.891  1.00 33.46  ? 215  THR A CB    1 
ATOM   1665  O  OG1   . THR A  1 215 ? -72.133  15.829  -63.872  1.00 49.55  ? 215  THR A OG1   1 
ATOM   1666  C  CG2   . THR A  1 215 ? -74.119  15.138  -62.700  1.00 15.00  ? 215  THR A CG2   1 
ATOM   1667  N  N     . ALA A  1 216 ? -72.580  13.465  -65.286  1.00 35.30  ? 216  ALA A N     1 
ATOM   1668  C  CA    . ALA A  1 216 ? -72.220  12.057  -65.315  1.00 35.46  ? 216  ALA A CA    1 
ATOM   1669  C  C     . ALA A  1 216 ? -72.718  11.288  -66.531  1.00 39.28  ? 216  ALA A C     1 
ATOM   1670  O  O     . ALA A  1 216 ? -73.078  10.132  -66.405  1.00 36.36  ? 216  ALA A O     1 
ATOM   1671  C  CB    . ALA A  1 216 ? -72.723  11.405  -64.035  1.00 29.94  ? 216  ALA A CB    1 
ATOM   1672  N  N     . GLY A  1 217 ? -72.740  11.935  -67.692  1.00 35.96  ? 217  GLY A N     1 
ATOM   1673  C  CA    . GLY A  1 217 ? -72.994  11.260  -68.960  1.00 21.78  ? 217  GLY A CA    1 
ATOM   1674  C  C     . GLY A  1 217 ? -74.414  10.982  -69.462  1.00 22.99  ? 217  GLY A C     1 
ATOM   1675  O  O     . GLY A  1 217 ? -74.629  9.938   -70.083  1.00 28.06  ? 217  GLY A O     1 
ATOM   1676  N  N     . GLN A  1 218 ? -75.396  11.850  -69.218  1.00 18.26  ? 218  GLN A N     1 
ATOM   1677  C  CA    . GLN A  1 218 ? -76.688  11.552  -69.846  1.00 14.89  ? 218  GLN A CA    1 
ATOM   1678  C  C     . GLN A  1 218 ? -76.549  11.944  -71.314  1.00 21.58  ? 218  GLN A C     1 
ATOM   1679  O  O     . GLN A  1 218 ? -76.037  13.014  -71.637  1.00 30.83  ? 218  GLN A O     1 
ATOM   1680  C  CB    . GLN A  1 218 ? -77.855  12.268  -69.188  1.00 14.94  ? 218  GLN A CB    1 
ATOM   1681  C  CG    . GLN A  1 218 ? -79.173  11.609  -69.586  1.00 18.19  ? 218  GLN A CG    1 
ATOM   1682  C  CD    . GLN A  1 218 ? -80.399  12.215  -68.922  1.00 15.27  ? 218  GLN A CD    1 
ATOM   1683  O  OE1   . GLN A  1 218 ? -81.269  11.478  -68.457  1.00 38.93  ? 218  GLN A OE1   1 
ATOM   1684  N  NE2   . GLN A  1 218 ? -80.657  13.500  -68.778  1.00 15.68  ? 218  GLN A NE2   1 
ATOM   1685  N  N     . ASN A  1 219 ? -77.010  11.077  -72.206  1.00 31.02  ? 219  ASN A N     1 
ATOM   1686  C  CA    . ASN A  1 219 ? -76.916  11.332  -73.638  1.00 22.50  ? 219  ASN A CA    1 
ATOM   1687  C  C     . ASN A  1 219 ? -78.168  10.879  -74.367  1.00 28.68  ? 219  ASN A C     1 
ATOM   1688  O  O     . ASN A  1 219 ? -79.006  10.170  -73.797  1.00 26.63  ? 219  ASN A O     1 
ATOM   1689  C  CB    . ASN A  1 219 ? -75.706  10.607  -74.212  1.00 17.44  ? 219  ASN A CB    1 
ATOM   1690  C  CG    . ASN A  1 219 ? -74.405  11.196  -73.735  1.00 26.00  ? 219  ASN A CG    1 
ATOM   1691  O  OD1   . ASN A  1 219 ? -73.806  10.721  -72.771  1.00 36.06  ? 219  ASN A OD1   1 
ATOM   1692  N  ND2   . ASN A  1 219 ? -73.956  12.240  -74.409  1.00 25.44  ? 219  ASN A ND2   1 
ATOM   1693  N  N     . GLU A  1 220 ? -78.276  11.269  -75.635  1.00 21.85  ? 220  GLU A N     1 
ATOM   1694  C  CA    . GLU A  1 220 ? -79.428  10.890  -76.435  1.00 25.37  ? 220  GLU A CA    1 
ATOM   1695  C  C     . GLU A  1 220 ? -79.160  10.854  -77.924  1.00 29.74  ? 220  GLU A C     1 
ATOM   1696  O  O     . GLU A  1 220 ? -78.444  11.701  -78.459  1.00 33.41  ? 220  GLU A O     1 
ATOM   1697  C  CB    . GLU A  1 220 ? -80.579  11.857  -76.195  1.00 25.46  ? 220  GLU A CB    1 
ATOM   1698  C  CG    . GLU A  1 220 ? -81.896  11.319  -76.703  1.00 30.89  ? 220  GLU A CG    1 
ATOM   1699  C  CD    . GLU A  1 220 ? -83.066  12.281  -76.538  1.00 37.48  ? 220  GLU A CD    1 
ATOM   1700  O  OE1   . GLU A  1 220 ? -83.077  13.144  -75.625  1.00 20.94  ? 220  GLU A OE1   1 
ATOM   1701  O  OE2   . GLU A  1 220 ? -83.997  12.157  -77.344  1.00 31.52  ? 220  GLU A OE2   1 
ATOM   1702  N  N     . VAL A  1 221 ? -79.707  9.832   -78.577  1.00 32.11  ? 221  VAL A N     1 
ATOM   1703  C  CA    . VAL A  1 221 ? -79.618  9.701   -80.024  1.00 30.41  ? 221  VAL A CA    1 
ATOM   1704  C  C     . VAL A  1 221 ? -81.051  9.612   -80.522  1.00 36.42  ? 221  VAL A C     1 
ATOM   1705  O  O     . VAL A  1 221 ? -81.758  8.651   -80.219  1.00 43.78  ? 221  VAL A O     1 
ATOM   1706  C  CB    . VAL A  1 221 ? -78.877  8.448   -80.476  1.00 23.02  ? 221  VAL A CB    1 
ATOM   1707  C  CG1   . VAL A  1 221 ? -79.049  8.275   -81.991  1.00 21.49  ? 221  VAL A CG1   1 
ATOM   1708  C  CG2   . VAL A  1 221 ? -77.412  8.573   -80.153  1.00 13.87  ? 221  VAL A CG2   1 
ATOM   1709  N  N     . ALA A  1 222 ? -81.492  10.645  -81.231  1.00 35.17  ? 222  ALA A N     1 
ATOM   1710  C  CA    . ALA A  1 222 ? -82.844  10.692  -81.774  1.00 29.25  ? 222  ALA A CA    1 
ATOM   1711  C  C     . ALA A  1 222 ? -82.915  10.000  -83.141  1.00 31.15  ? 222  ALA A C     1 
ATOM   1712  O  O     . ALA A  1 222 ? -82.184  10.346  -84.069  1.00 42.36  ? 222  ALA A O     1 
ATOM   1713  C  CB    . ALA A  1 222 ? -83.302  12.128  -81.889  1.00 30.92  ? 222  ALA A CB    1 
ATOM   1714  N  N     . THR A  1 223 ? -83.767  8.986   -83.232  1.00 23.74  ? 223  THR A N     1 
ATOM   1715  C  CA    . THR A  1 223 ? -83.960  8.229   -84.460  1.00 27.82  ? 223  THR A CA    1 
ATOM   1716  C  C     . THR A  1 223 ? -85.344  8.548   -85.012  1.00 38.82  ? 223  THR A C     1 
ATOM   1717  O  O     . THR A  1 223 ? -86.224  9.005   -84.272  1.00 26.61  ? 223  THR A O     1 
ATOM   1718  C  CB    . THR A  1 223 ? -83.832  6.726   -84.211  1.00 17.44  ? 223  THR A CB    1 
ATOM   1719  O  OG1   . THR A  1 223 ? -84.633  6.354   -83.082  1.00 41.02  ? 223  THR A OG1   1 
ATOM   1720  C  CG2   . THR A  1 223 ? -82.394  6.381   -83.923  1.00 30.41  ? 223  THR A CG2   1 
ATOM   1721  N  N     . ARG A  1 224 ? -85.508  8.343   -86.319  1.00 37.66  ? 224  ARG A N     1 
ATOM   1722  C  CA    . ARG A  1 224 ? -86.760  8.617   -87.017  1.00 28.17  ? 224  ARG A CA    1 
ATOM   1723  C  C     . ARG A  1 224 ? -87.838  7.611   -86.667  1.00 37.49  ? 224  ARG A C     1 
ATOM   1724  O  O     . ARG A  1 224 ? -87.549  6.435   -86.426  1.00 36.22  ? 224  ARG A O     1 
ATOM   1725  C  CB    . ARG A  1 224 ? -86.520  8.615   -88.531  1.00 44.13  ? 224  ARG A CB    1 
ATOM   1726  C  CG    . ARG A  1 224 ? -87.750  8.931   -89.383  1.00 43.37  ? 224  ARG A CG    1 
ATOM   1727  C  CD    . ARG A  1 224 ? -87.369  9.540   -90.747  1.00 55.57  ? 224  ARG A CD    1 
ATOM   1728  N  NE    . ARG A  1 224 ? -87.114  8.629   -91.877  1.00 57.19  ? 224  ARG A NE    1 
ATOM   1729  C  CZ    . ARG A  1 224 ? -87.178  7.292   -91.884  1.00 80.87  ? 224  ARG A CZ    1 
ATOM   1730  N  NH1   . ARG A  1 224 ? -86.917  6.656   -93.020  1.00 61.84  ? 224  ARG A NH1   1 
ATOM   1731  N  NH2   . ARG A  1 224 ? -87.464  6.576   -90.792  1.00 79.82  ? 224  ARG A NH2   1 
ATOM   1732  N  N     . PHE A  1 225 ? -89.082  8.080   -86.658  1.00 32.82  ? 225  PHE A N     1 
ATOM   1733  C  CA    . PHE A  1 225 ? -90.241  7.235   -86.359  1.00 30.72  ? 225  PHE A CA    1 
ATOM   1734  C  C     . PHE A  1 225 ? -90.357  6.075   -87.358  1.00 31.21  ? 225  PHE A C     1 
ATOM   1735  O  O     . PHE A  1 225 ? -89.592  5.984   -88.330  1.00 44.23  ? 225  PHE A O     1 
ATOM   1736  C  CB    . PHE A  1 225 ? -91.515  8.064   -86.457  1.00 37.45  ? 225  PHE A CB    1 
ATOM   1737  C  CG    . PHE A  1 225 ? -91.850  8.455   -87.860  1.00 45.24  ? 225  PHE A CG    1 
ATOM   1738  C  CD1   . PHE A  1 225 ? -91.276  9.582   -88.432  1.00 56.86  ? 225  PHE A CD1   1 
ATOM   1739  C  CD2   . PHE A  1 225 ? -92.666  7.647   -88.642  1.00 50.64  ? 225  PHE A CD2   1 
ATOM   1740  C  CE1   . PHE A  1 225 ? -91.501  9.896   -89.762  1.00 43.03  ? 225  PHE A CE1   1 
ATOM   1741  C  CE2   . PHE A  1 225 ? -92.897  7.950   -89.975  1.00 43.05  ? 225  PHE A CE2   1 
ATOM   1742  C  CZ    . PHE A  1 225 ? -92.314  9.074   -90.537  1.00 42.51  ? 225  PHE A CZ    1 
ATOM   1743  N  N     . ASN A  1 226 ? -91.374  5.241   -87.151  1.00 33.78  ? 226  ASN A N     1 
ATOM   1744  C  CA    . ASN A  1 226 ? -91.629  4.089   -88.009  1.00 30.27  ? 226  ASN A CA    1 
ATOM   1745  C  C     . ASN A  1 226 ? -92.910  3.412   -87.536  1.00 36.37  ? 226  ASN A C     1 
ATOM   1746  O  O     . ASN A  1 226 ? -93.475  3.800   -86.509  1.00 30.37  ? 226  ASN A O     1 
ATOM   1747  C  CB    . ASN A  1 226 ? -90.462  3.114   -87.934  1.00 27.77  ? 226  ASN A CB    1 
ATOM   1748  C  CG    . ASN A  1 226 ? -90.341  2.252   -89.167  1.00 36.41  ? 226  ASN A CG    1 
ATOM   1749  O  OD1   . ASN A  1 226 ? -91.315  2.014   -89.884  1.00 55.51  ? 226  ASN A OD1   1 
ATOM   1750  N  ND2   . ASN A  1 226 ? -89.136  1.767   -89.418  1.00 38.40  ? 226  ASN A ND2   1 
ATOM   1751  N  N     . THR A  1 227 ? -93.379  2.409   -88.275  1.00 34.44  ? 227  THR A N     1 
ATOM   1752  C  CA    . THR A  1 227 ? -94.612  1.726   -87.891  1.00 40.75  ? 227  THR A CA    1 
ATOM   1753  C  C     . THR A  1 227 ? -94.378  1.095   -86.507  1.00 39.99  ? 227  THR A C     1 
ATOM   1754  O  O     . THR A  1 227 ? -93.261  0.671   -86.175  1.00 46.23  ? 227  THR A O     1 
ATOM   1755  C  CB    . THR A  1 227 ? -95.054  0.664   -88.938  1.00 34.87  ? 227  THR A CB    1 
ATOM   1756  O  OG1   . THR A  1 227 ? -94.084  -0.370  -88.996  1.00 35.08  ? 227  THR A OG1   1 
ATOM   1757  C  CG2   . THR A  1 227 ? -95.092  1.237   -90.318  1.00 21.88  ? 227  THR A CG2   1 
ATOM   1758  N  N     . MET A  1 228 ? -95.443  0.998   -85.723  1.00 35.48  ? 228  MET A N     1 
ATOM   1759  C  CA    . MET A  1 228 ? -95.331  0.490   -84.371  1.00 33.55  ? 228  MET A CA    1 
ATOM   1760  C  C     . MET A  1 228 ? -94.419  -0.689  -84.095  1.00 31.97  ? 228  MET A C     1 
ATOM   1761  O  O     . MET A  1 228 ? -93.436  -0.537  -83.382  1.00 51.56  ? 228  MET A O     1 
ATOM   1762  C  CB    . MET A  1 228 ? -96.690  0.243   -83.745  1.00 34.07  ? 228  MET A CB    1 
ATOM   1763  C  CG    . MET A  1 228 ? -96.552  -0.001  -82.264  1.00 32.29  ? 228  MET A CG    1 
ATOM   1764  S  SD    . MET A  1 228 ? -98.088  -0.305  -81.439  1.00 38.66  ? 228  MET A SD    1 
ATOM   1765  C  CE    . MET A  1 228 ? -98.278  -2.021  -81.852  1.00 18.83  ? 228  MET A CE    1 
ATOM   1766  N  N     . THR A  1 229 ? -94.719  -1.852  -84.652  1.00 41.30  ? 229  THR A N     1 
ATOM   1767  C  CA    . THR A  1 229 ? -93.887  -3.016  -84.384  1.00 36.11  ? 229  THR A CA    1 
ATOM   1768  C  C     . THR A  1 229 ? -92.448  -2.868  -84.879  1.00 37.42  ? 229  THR A C     1 
ATOM   1769  O  O     . THR A  1 229 ? -91.509  -3.209  -84.166  1.00 38.27  ? 229  THR A O     1 
ATOM   1770  C  CB    . THR A  1 229 ? -94.524  -4.295  -84.928  1.00 34.58  ? 229  THR A CB    1 
ATOM   1771  O  OG1   . THR A  1 229 ? -95.864  -4.398  -84.431  1.00 38.50  ? 229  THR A OG1   1 
ATOM   1772  C  CG2   . THR A  1 229 ? -93.744  -5.506  -84.473  1.00 30.13  ? 229  THR A CG2   1 
ATOM   1773  N  N     . LYS A  1 230 ? -92.269  -2.319  -86.074  1.00 36.58  ? 230  LYS A N     1 
ATOM   1774  C  CA    . LYS A  1 230 ? -90.928  -2.136  -86.598  1.00 33.60  ? 230  LYS A CA    1 
ATOM   1775  C  C     . LYS A  1 230 ? -90.144  -1.203  -85.669  1.00 33.70  ? 230  LYS A C     1 
ATOM   1776  O  O     . LYS A  1 230 ? -88.969  -1.439  -85.389  1.00 37.48  ? 230  LYS A O     1 
ATOM   1777  C  CB    . LYS A  1 230 ? -90.956  -1.599  -88.042  1.00 35.59  ? 230  LYS A CB    1 
ATOM   1778  C  CG    . LYS A  1 230 ? -89.575  -1.561  -88.709  1.00 65.71  ? 230  LYS A CG    1 
ATOM   1779  C  CD    . LYS A  1 230 ? -89.667  -1.546  -90.221  1.00 89.00  ? 230  LYS A CD    1 
ATOM   1780  C  CE    . LYS A  1 230 ? -90.420  -2.770  -90.734  1.00 100.00 ? 230  LYS A CE    1 
ATOM   1781  N  NZ    . LYS A  1 230 ? -90.543  -2.763  -92.217  1.00 90.42  ? 230  LYS A NZ    1 
ATOM   1782  N  N     . LYS A  1 231 ? -90.813  -0.190  -85.130  1.00 36.63  ? 231  LYS A N     1 
ATOM   1783  C  CA    . LYS A  1 231 ? -90.143  0.739   -84.232  1.00 39.23  ? 231  LYS A CA    1 
ATOM   1784  C  C     . LYS A  1 231 ? -89.693  0.084   -82.927  1.00 39.32  ? 231  LYS A C     1 
ATOM   1785  O  O     . LYS A  1 231 ? -88.616  0.392   -82.420  1.00 45.03  ? 231  LYS A O     1 
ATOM   1786  C  CB    . LYS A  1 231 ? -91.007  1.964   -83.942  1.00 31.71  ? 231  LYS A CB    1 
ATOM   1787  C  CG    . LYS A  1 231 ? -90.208  3.105   -83.331  1.00 34.47  ? 231  LYS A CG    1 
ATOM   1788  C  CD    . LYS A  1 231 ? -88.929  3.319   -84.128  1.00 36.93  ? 231  LYS A CD    1 
ATOM   1789  C  CE    . LYS A  1 231 ? -88.068  4.426   -83.575  1.00 26.18  ? 231  LYS A CE    1 
ATOM   1790  N  NZ    . LYS A  1 231 ? -86.828  4.596   -84.396  1.00 29.88  ? 231  LYS A NZ    1 
ATOM   1791  N  N     . ALA A  1 232 ? -90.501  -0.828  -82.395  1.00 31.51  ? 232  ALA A N     1 
ATOM   1792  C  CA    . ALA A  1 232 ? -90.135  -1.519  -81.167  1.00 25.32  ? 232  ALA A CA    1 
ATOM   1793  C  C     . ALA A  1 232 ? -88.908  -2.404  -81.452  1.00 35.31  ? 232  ALA A C     1 
ATOM   1794  O  O     . ALA A  1 232 ? -88.059  -2.608  -80.579  1.00 45.73  ? 232  ALA A O     1 
ATOM   1795  C  CB    . ALA A  1 232 ? -91.301  -2.328  -80.648  1.00 27.29  ? 232  ALA A CB    1 
ATOM   1796  N  N     . ASP A  1 233 ? -88.809  -2.905  -82.685  1.00 36.79  ? 233  ASP A N     1 
ATOM   1797  C  CA    . ASP A  1 233 ? -87.658  -3.708  -83.110  1.00 22.99  ? 233  ASP A CA    1 
ATOM   1798  C  C     . ASP A  1 233 ? -86.447  -2.771  -83.063  1.00 33.39  ? 233  ASP A C     1 
ATOM   1799  O  O     . ASP A  1 233 ? -85.397  -3.100  -82.503  1.00 43.20  ? 233  ASP A O     1 
ATOM   1800  C  CB    . ASP A  1 233 ? -87.810  -4.168  -84.565  1.00 31.58  ? 233  ASP A CB    1 
ATOM   1801  C  CG    . ASP A  1 233 ? -88.795  -5.308  -84.742  1.00 44.00  ? 233  ASP A CG    1 
ATOM   1802  O  OD1   . ASP A  1 233 ? -89.228  -5.914  -83.745  1.00 35.27  ? 233  ASP A OD1   1 
ATOM   1803  O  OD2   . ASP A  1 233 ? -89.121  -5.612  -85.911  1.00 39.84  ? 233  ASP A OD2   1 
ATOM   1804  N  N     . GLU A  1 234 ? -86.613  -1.602  -83.675  1.00 22.81  ? 234  GLU A N     1 
ATOM   1805  C  CA    . GLU A  1 234 ? -85.570  -0.589  -83.725  1.00 28.03  ? 234  GLU A CA    1 
ATOM   1806  C  C     . GLU A  1 234 ? -85.094  -0.193  -82.332  1.00 34.86  ? 234  GLU A C     1 
ATOM   1807  O  O     . GLU A  1 234 ? -83.898  0.020   -82.140  1.00 32.77  ? 234  GLU A O     1 
ATOM   1808  C  CB    . GLU A  1 234 ? -86.036  0.632   -84.532  1.00 27.73  ? 234  GLU A CB    1 
ATOM   1809  C  CG    . GLU A  1 234 ? -86.332  0.293   -86.010  1.00 36.39  ? 234  GLU A CG    1 
ATOM   1810  C  CD    . GLU A  1 234 ? -86.465  1.507   -86.923  1.00 40.29  ? 234  GLU A CD    1 
ATOM   1811  O  OE1   . GLU A  1 234 ? -86.580  2.640   -86.410  1.00 37.86  ? 234  GLU A OE1   1 
ATOM   1812  O  OE2   . GLU A  1 234 ? -86.442  1.328   -88.164  1.00 42.68  ? 234  GLU A OE2   1 
ATOM   1813  N  N     . ILE A  1 235 ? -86.013  -0.138  -81.361  1.00 21.78  ? 235  ILE A N     1 
ATOM   1814  C  CA    . ILE A  1 235 ? -85.651  0.203   -79.988  1.00 22.16  ? 235  ILE A CA    1 
ATOM   1815  C  C     . ILE A  1 235 ? -84.708  -0.860  -79.431  1.00 34.10  ? 235  ILE A C     1 
ATOM   1816  O  O     . ILE A  1 235 ? -83.728  -0.544  -78.750  1.00 34.77  ? 235  ILE A O     1 
ATOM   1817  C  CB    . ILE A  1 235 ? -86.888  0.340   -79.069  1.00 31.07  ? 235  ILE A CB    1 
ATOM   1818  C  CG1   . ILE A  1 235 ? -87.549  1.706   -79.278  1.00 31.24  ? 235  ILE A CG1   1 
ATOM   1819  C  CG2   . ILE A  1 235 ? -86.508  0.152   -77.599  1.00 18.87  ? 235  ILE A CG2   1 
ATOM   1820  C  CD1   . ILE A  1 235 ? -86.712  2.895   -78.863  1.00 30.44  ? 235  ILE A CD1   1 
ATOM   1821  N  N     . GLN A  1 236 ? -85.000  -2.119  -79.721  1.00 25.03  ? 236  GLN A N     1 
ATOM   1822  C  CA    . GLN A  1 236 ? -84.137  -3.193  -79.262  1.00 26.56  ? 236  GLN A CA    1 
ATOM   1823  C  C     . GLN A  1 236 ? -82.754  -3.090  -79.920  1.00 24.94  ? 236  GLN A C     1 
ATOM   1824  O  O     . GLN A  1 236 ? -81.741  -3.294  -79.254  1.00 47.13  ? 236  GLN A O     1 
ATOM   1825  C  CB    . GLN A  1 236 ? -84.781  -4.546  -79.534  1.00 9.21   ? 236  GLN A CB    1 
ATOM   1826  C  CG    . GLN A  1 236 ? -86.067  -4.737  -78.768  1.00 20.63  ? 236  GLN A CG    1 
ATOM   1827  C  CD    . GLN A  1 236 ? -85.862  -4.849  -77.273  1.00 27.40  ? 236  GLN A CD    1 
ATOM   1828  O  OE1   . GLN A  1 236 ? -85.791  -3.843  -76.550  1.00 34.36  ? 236  GLN A OE1   1 
ATOM   1829  N  NE2   . GLN A  1 236 ? -85.803  -6.084  -76.790  1.00 33.17  ? 236  GLN A NE2   1 
ATOM   1830  N  N     . ILE A  1 237 ? -82.717  -2.747  -81.208  1.00 30.15  ? 237  ILE A N     1 
ATOM   1831  C  CA    . ILE A  1 237 ? -81.456  -2.582  -81.948  1.00 20.03  ? 237  ILE A CA    1 
ATOM   1832  C  C     . ILE A  1 237 ? -80.725  -1.358  -81.387  1.00 29.99  ? 237  ILE A C     1 
ATOM   1833  O  O     . ILE A  1 237 ? -79.511  -1.380  -81.202  1.00 28.83  ? 237  ILE A O     1 
ATOM   1834  C  CB    . ILE A  1 237 ? -81.720  -2.392  -83.475  1.00 30.42  ? 237  ILE A CB    1 
ATOM   1835  C  CG1   . ILE A  1 237 ? -82.181  -3.711  -84.100  1.00 27.83  ? 237  ILE A CG1   1 
ATOM   1836  C  CG2   . ILE A  1 237 ? -80.475  -1.883  -84.199  1.00 25.88  ? 237  ILE A CG2   1 
ATOM   1837  C  CD1   . ILE A  1 237 ? -82.719  -3.563  -85.498  1.00 48.12  ? 237  ILE A CD1   1 
ATOM   1838  N  N     . TYR A  1 238 ? -81.485  -0.302  -81.102  1.00 28.97  ? 238  TYR A N     1 
ATOM   1839  C  CA    . TYR A  1 238 ? -80.963  0.937   -80.522  1.00 25.55  ? 238  TYR A CA    1 
ATOM   1840  C  C     . TYR A  1 238 ? -80.257  0.605   -79.201  1.00 33.65  ? 238  TYR A C     1 
ATOM   1841  O  O     . TYR A  1 238 ? -79.079  0.913   -79.026  1.00 35.07  ? 238  TYR A O     1 
ATOM   1842  C  CB    . TYR A  1 238 ? -82.132  1.900   -80.270  1.00 23.11  ? 238  TYR A CB    1 
ATOM   1843  C  CG    . TYR A  1 238 ? -81.792  3.250   -79.669  1.00 25.22  ? 238  TYR A CG    1 
ATOM   1844  C  CD1   . TYR A  1 238 ? -81.555  3.392   -78.299  1.00 33.76  ? 238  TYR A CD1   1 
ATOM   1845  C  CD2   . TYR A  1 238 ? -81.787  4.404   -80.459  1.00 26.26  ? 238  TYR A CD2   1 
ATOM   1846  C  CE1   . TYR A  1 238 ? -81.321  4.650   -77.726  1.00 21.45  ? 238  TYR A CE1   1 
ATOM   1847  C  CE2   . TYR A  1 238 ? -81.555  5.665   -79.900  1.00 32.35  ? 238  TYR A CE2   1 
ATOM   1848  C  CZ    . TYR A  1 238 ? -81.326  5.779   -78.530  1.00 33.30  ? 238  TYR A CZ    1 
ATOM   1849  O  OH    . TYR A  1 238 ? -81.107  7.017   -77.968  1.00 34.17  ? 238  TYR A OH    1 
ATOM   1850  N  N     . LYS A  1 239 ? -80.974  -0.029  -78.275  1.00 29.44  ? 239  LYS A N     1 
ATOM   1851  C  CA    . LYS A  1 239 ? -80.380  -0.395  -76.995  1.00 22.97  ? 239  LYS A CA    1 
ATOM   1852  C  C     . LYS A  1 239 ? -79.125  -1.263  -77.200  1.00 33.41  ? 239  LYS A C     1 
ATOM   1853  O  O     . LYS A  1 239 ? -78.122  -1.085  -76.506  1.00 36.43  ? 239  LYS A O     1 
ATOM   1854  C  CB    . LYS A  1 239 ? -81.385  -1.148  -76.109  1.00 15.83  ? 239  LYS A CB    1 
ATOM   1855  C  CG    . LYS A  1 239 ? -82.521  -0.335  -75.435  1.00 15.17  ? 239  LYS A CG    1 
ATOM   1856  C  CD    . LYS A  1 239 ? -83.333  -1.300  -74.564  1.00 30.60  ? 239  LYS A CD    1 
ATOM   1857  C  CE    . LYS A  1 239 ? -84.478  -0.685  -73.783  1.00 16.02  ? 239  LYS A CE    1 
ATOM   1858  N  NZ    . LYS A  1 239 ? -85.367  -1.829  -73.376  1.00 49.18  ? 239  LYS A NZ    1 
ATOM   1859  N  N     . TYR A  1 240 ? -79.170  -2.178  -78.168  1.00 33.90  ? 240  TYR A N     1 
ATOM   1860  C  CA    . TYR A  1 240 ? -78.034  -3.066  -78.438  1.00 18.40  ? 240  TYR A CA    1 
ATOM   1861  C  C     . TYR A  1 240 ? -76.800  -2.270  -78.853  1.00 28.94  ? 240  TYR A C     1 
ATOM   1862  O  O     . TYR A  1 240 ? -75.710  -2.473  -78.308  1.00 30.82  ? 240  TYR A O     1 
ATOM   1863  C  CB    . TYR A  1 240 ? -78.392  -4.100  -79.513  1.00 26.81  ? 240  TYR A CB    1 
ATOM   1864  C  CG    . TYR A  1 240 ? -77.299  -5.108  -79.828  1.00 22.57  ? 240  TYR A CG    1 
ATOM   1865  C  CD1   . TYR A  1 240 ? -76.942  -6.093  -78.904  1.00 23.66  ? 240  TYR A CD1   1 
ATOM   1866  C  CD2   . TYR A  1 240 ? -76.607  -5.065  -81.047  1.00 15.82  ? 240  TYR A CD2   1 
ATOM   1867  C  CE1   . TYR A  1 240 ? -75.914  -7.013  -79.179  1.00 20.01  ? 240  TYR A CE1   1 
ATOM   1868  C  CE2   . TYR A  1 240 ? -75.579  -5.977  -81.332  1.00 24.77  ? 240  TYR A CE2   1 
ATOM   1869  C  CZ    . TYR A  1 240 ? -75.236  -6.945  -80.394  1.00 31.63  ? 240  TYR A CZ    1 
ATOM   1870  O  OH    . TYR A  1 240 ? -74.189  -7.809  -80.645  1.00 34.35  ? 240  TYR A OH    1 
ATOM   1871  N  N     . VAL A  1 241 ? -76.970  -1.373  -79.818  1.00 25.06  ? 241  VAL A N     1 
ATOM   1872  C  CA    . VAL A  1 241 ? -75.867  -0.540  -80.281  1.00 22.61  ? 241  VAL A CA    1 
ATOM   1873  C  C     . VAL A  1 241 ? -75.331  0.337   -79.152  1.00 23.46  ? 241  VAL A C     1 
ATOM   1874  O  O     . VAL A  1 241 ? -74.121  0.418   -78.955  1.00 34.09  ? 241  VAL A O     1 
ATOM   1875  C  CB    . VAL A  1 241 ? -76.284  0.339   -81.473  1.00 24.32  ? 241  VAL A CB    1 
ATOM   1876  C  CG1   . VAL A  1 241 ? -75.180  1.329   -81.820  1.00 21.66  ? 241  VAL A CG1   1 
ATOM   1877  C  CG2   . VAL A  1 241 ? -76.571  -0.540  -82.667  1.00 25.12  ? 241  VAL A CG2   1 
ATOM   1878  N  N     . VAL A  1 242 ? -76.222  0.972   -78.394  1.00 24.97  ? 242  VAL A N     1 
ATOM   1879  C  CA    . VAL A  1 242 ? -75.794  1.827   -77.286  1.00 30.91  ? 242  VAL A CA    1 
ATOM   1880  C  C     . VAL A  1 242 ? -74.976  1.032   -76.270  1.00 23.30  ? 242  VAL A C     1 
ATOM   1881  O  O     . VAL A  1 242 ? -73.835  1.389   -75.964  1.00 29.24  ? 242  VAL A O     1 
ATOM   1882  C  CB    . VAL A  1 242 ? -76.990  2.491   -76.580  1.00 26.39  ? 242  VAL A CB    1 
ATOM   1883  C  CG1   . VAL A  1 242 ? -76.526  3.179   -75.313  1.00 27.52  ? 242  VAL A CG1   1 
ATOM   1884  C  CG2   . VAL A  1 242 ? -77.647  3.507   -77.510  1.00 18.54  ? 242  VAL A CG2   1 
ATOM   1885  N  N     . HIS A  1 243 ? -75.545  -0.070  -75.791  1.00 24.52  ? 243  HIS A N     1 
ATOM   1886  C  CA    . HIS A  1 243 ? -74.869  -0.931  -74.824  1.00 23.27  ? 243  HIS A CA    1 
ATOM   1887  C  C     . HIS A  1 243 ? -73.494  -1.390  -75.318  1.00 24.75  ? 243  HIS A C     1 
ATOM   1888  O  O     . HIS A  1 243 ? -72.486  -1.218  -74.633  1.00 32.81  ? 243  HIS A O     1 
ATOM   1889  C  CB    . HIS A  1 243 ? -75.740  -2.146  -74.507  1.00 16.14  ? 243  HIS A CB    1 
ATOM   1890  C  CG    . HIS A  1 243 ? -76.793  -1.888  -73.475  1.00 18.22  ? 243  HIS A CG    1 
ATOM   1891  N  ND1   . HIS A  1 243 ? -78.070  -2.406  -73.569  1.00 35.11  ? 243  HIS A ND1   1 
ATOM   1892  C  CD2   . HIS A  1 243 ? -76.749  -1.220  -72.299  1.00 15.64  ? 243  HIS A CD2   1 
ATOM   1893  C  CE1   . HIS A  1 243 ? -78.760  -2.071  -72.493  1.00 22.56  ? 243  HIS A CE1   1 
ATOM   1894  N  NE2   . HIS A  1 243 ? -77.980  -1.351  -71.708  1.00 24.94  ? 243  HIS A NE2   1 
ATOM   1895  N  N     . ASN A  1 244 ? -73.441  -1.895  -76.544  1.00 29.56  ? 244  ASN A N     1 
ATOM   1896  C  CA    . ASN A  1 244 ? -72.188  -2.385  -77.101  1.00 19.40  ? 244  ASN A CA    1 
ATOM   1897  C  C     . ASN A  1 244 ? -71.143  -1.385  -77.586  1.00 25.94  ? 244  ASN A C     1 
ATOM   1898  O  O     . ASN A  1 244 ? -69.946  -1.684  -77.563  1.00 32.37  ? 244  ASN A O     1 
ATOM   1899  C  CB    . ASN A  1 244 ? -72.466  -3.442  -78.147  1.00 11.91  ? 244  ASN A CB    1 
ATOM   1900  C  CG    . ASN A  1 244 ? -72.901  -4.742  -77.526  1.00 36.87  ? 244  ASN A CG    1 
ATOM   1901  O  OD1   . ASN A  1 244 ? -74.099  -4.990  -77.347  1.00 25.70  ? 244  ASN A OD1   1 
ATOM   1902  N  ND2   . ASN A  1 244 ? -71.924  -5.561  -77.132  1.00 21.79  ? 244  ASN A ND2   1 
ATOM   1903  N  N     . VAL A  1 245 ? -71.566  -0.223  -78.068  1.00 31.73  ? 245  VAL A N     1 
ATOM   1904  C  CA    . VAL A  1 245 ? -70.584  0.773   -78.486  1.00 24.48  ? 245  VAL A CA    1 
ATOM   1905  C  C     . VAL A  1 245 ? -69.976  1.330   -77.205  1.00 28.54  ? 245  VAL A C     1 
ATOM   1906  O  O     . VAL A  1 245 ? -68.763  1.516   -77.111  1.00 26.03  ? 245  VAL A O     1 
ATOM   1907  C  CB    . VAL A  1 245 ? -71.217  1.888   -79.309  1.00 19.81  ? 245  VAL A CB    1 
ATOM   1908  C  CG1   . VAL A  1 245 ? -70.242  3.031   -79.475  1.00 25.53  ? 245  VAL A CG1   1 
ATOM   1909  C  CG2   . VAL A  1 245 ? -71.624  1.341   -80.661  1.00 29.72  ? 245  VAL A CG2   1 
ATOM   1910  N  N     . ALA A  1 246 ? -70.824  1.513   -76.192  1.00 19.42  ? 246  ALA A N     1 
ATOM   1911  C  CA    . ALA A  1 246 ? -70.375  2.007   -74.901  1.00 26.73  ? 246  ALA A CA    1 
ATOM   1912  C  C     . ALA A  1 246 ? -69.307  1.059   -74.381  1.00 22.93  ? 246  ALA A C     1 
ATOM   1913  O  O     . ALA A  1 246 ? -68.208  1.472   -74.031  1.00 30.77  ? 246  ALA A O     1 
ATOM   1914  C  CB    . ALA A  1 246 ? -71.546  2.060   -73.921  1.00 15.84  ? 246  ALA A CB    1 
ATOM   1915  N  N     . HIS A  1 247 ? -69.631  -0.228  -74.396  1.00 27.58  ? 247  HIS A N     1 
ATOM   1916  C  CA    . HIS A  1 247 ? -68.729  -1.257  -73.919  1.00 22.14  ? 247  HIS A CA    1 
ATOM   1917  C  C     . HIS A  1 247 ? -67.409  -1.212  -74.657  1.00 23.54  ? 247  HIS A C     1 
ATOM   1918  O  O     . HIS A  1 247 ? -66.351  -1.192  -74.047  1.00 35.52  ? 247  HIS A O     1 
ATOM   1919  C  CB    . HIS A  1 247 ? -69.371  -2.623  -74.104  1.00 24.47  ? 247  HIS A CB    1 
ATOM   1920  C  CG    . HIS A  1 247 ? -68.613  -3.727  -73.452  1.00 30.90  ? 247  HIS A CG    1 
ATOM   1921  N  ND1   . HIS A  1 247 ? -68.654  -3.951  -72.091  1.00 54.48  ? 247  HIS A ND1   1 
ATOM   1922  C  CD2   . HIS A  1 247 ? -67.778  -4.660  -73.963  1.00 37.06  ? 247  HIS A CD2   1 
ATOM   1923  C  CE1   . HIS A  1 247 ? -67.877  -4.975  -71.793  1.00 28.35  ? 247  HIS A CE1   1 
ATOM   1924  N  NE2   . HIS A  1 247 ? -67.334  -5.423  -72.909  1.00 38.37  ? 247  HIS A NE2   1 
ATOM   1925  N  N     . ARG A  1 248 ? -67.497  -1.158  -75.979  1.00 38.46  ? 248  ARG A N     1 
ATOM   1926  C  CA    . ARG A  1 248 ? -66.344  -1.121  -76.860  1.00 30.04  ? 248  ARG A CA    1 
ATOM   1927  C  C     . ARG A  1 248 ? -65.466  0.134   -76.593  1.00 24.66  ? 248  ARG A C     1 
ATOM   1928  O  O     . ARG A  1 248 ? -64.295  0.141   -76.924  1.00 33.79  ? 248  ARG A O     1 
ATOM   1929  C  CB    . ARG A  1 248 ? -66.847  -1.192  -78.311  1.00 30.61  ? 248  ARG A CB    1 
ATOM   1930  C  CG    . ARG A  1 248 ? -65.905  -1.803  -79.326  1.00 73.64  ? 248  ARG A CG    1 
ATOM   1931  C  CD    . ARG A  1 248 ? -65.811  -0.925  -80.592  1.00 89.01  ? 248  ARG A CD    1 
ATOM   1932  N  NE    . ARG A  1 248 ? -66.752  -1.288  -81.659  1.00 95.86  ? 248  ARG A NE    1 
ATOM   1933  C  CZ    . ARG A  1 248 ? -67.248  -0.425  -82.549  1.00 94.09  ? 248  ARG A CZ    1 
ATOM   1934  N  NH1   . ARG A  1 248 ? -68.087  -0.841  -83.500  1.00 59.94  ? 248  ARG A NH1   1 
ATOM   1935  N  NH2   . ARG A  1 248 ? -66.934  0.866   -82.468  1.00 95.43  ? 248  ARG A NH2   1 
ATOM   1936  N  N     . PHE A  1 249 ? -66.014  1.167   -75.951  1.00 27.42  ? 249  PHE A N     1 
ATOM   1937  C  CA    . PHE A  1 249 ? -65.251  2.396   -75.636  1.00 27.07  ? 249  PHE A CA    1 
ATOM   1938  C  C     . PHE A  1 249 ? -64.818  2.465   -74.174  1.00 29.79  ? 249  PHE A C     1 
ATOM   1939  O  O     . PHE A  1 249 ? -64.411  3.532   -73.703  1.00 31.87  ? 249  PHE A O     1 
ATOM   1940  C  CB    . PHE A  1 249 ? -66.089  3.660   -75.871  1.00 21.77  ? 249  PHE A CB    1 
ATOM   1941  C  CG    . PHE A  1 249 ? -66.047  4.183   -77.271  1.00 36.58  ? 249  PHE A CG    1 
ATOM   1942  C  CD1   . PHE A  1 249 ? -65.654  5.491   -77.511  1.00 24.95  ? 249  PHE A CD1   1 
ATOM   1943  C  CD2   . PHE A  1 249 ? -66.445  3.394   -78.347  1.00 50.07  ? 249  PHE A CD2   1 
ATOM   1944  C  CE1   . PHE A  1 249 ? -65.660  6.011   -78.800  1.00 24.69  ? 249  PHE A CE1   1 
ATOM   1945  C  CE2   . PHE A  1 249 ? -66.453  3.905   -79.644  1.00 41.62  ? 249  PHE A CE2   1 
ATOM   1946  C  CZ    . PHE A  1 249 ? -66.061  5.218   -79.867  1.00 29.28  ? 249  PHE A CZ    1 
ATOM   1947  N  N     . GLY A  1 250 ? -64.994  1.374   -73.435  1.00 29.70  ? 250  GLY A N     1 
ATOM   1948  C  CA    . GLY A  1 250 ? -64.619  1.367   -72.030  1.00 22.64  ? 250  GLY A CA    1 
ATOM   1949  C  C     . GLY A  1 250 ? -65.635  2.016   -71.106  1.00 25.67  ? 250  GLY A C     1 
ATOM   1950  O  O     . GLY A  1 250 ? -65.292  2.478   -70.021  1.00 31.66  ? 250  GLY A O     1 
ATOM   1951  N  N     . LYS A  1 251 ? -66.880  2.089   -71.562  1.00 33.75  ? 251  LYS A N     1 
ATOM   1952  C  CA    . LYS A  1 251 ? -67.965  2.661   -70.773  1.00 17.65  ? 251  LYS A CA    1 
ATOM   1953  C  C     . LYS A  1 251 ? -68.997  1.567   -70.512  1.00 32.42  ? 251  LYS A C     1 
ATOM   1954  O  O     . LYS A  1 251 ? -68.858  0.402   -70.932  1.00 31.17  ? 251  LYS A O     1 
ATOM   1955  C  CB    . LYS A  1 251 ? -68.672  3.791   -71.520  1.00 29.71  ? 251  LYS A CB    1 
ATOM   1956  C  CG    . LYS A  1 251 ? -67.779  4.810   -72.178  1.00 21.27  ? 251  LYS A CG    1 
ATOM   1957  C  CD    . LYS A  1 251 ? -67.173  5.754   -71.194  1.00 19.74  ? 251  LYS A CD    1 
ATOM   1958  C  CE    . LYS A  1 251 ? -68.132  6.845   -70.827  1.00 26.18  ? 251  LYS A CE    1 
ATOM   1959  N  NZ    . LYS A  1 251 ? -67.419  7.768   -69.906  1.00 27.74  ? 251  LYS A NZ    1 
ATOM   1960  N  N     . THR A  1 252 ? -70.049  1.965   -69.820  1.00 19.47  ? 252  THR A N     1 
ATOM   1961  C  CA    . THR A  1 252 ? -71.135  1.066   -69.494  1.00 22.50  ? 252  THR A CA    1 
ATOM   1962  C  C     . THR A  1 252 ? -72.379  1.937   -69.563  1.00 18.41  ? 252  THR A C     1 
ATOM   1963  O  O     . THR A  1 252 ? -72.425  3.022   -68.982  1.00 31.98  ? 252  THR A O     1 
ATOM   1964  C  CB    . THR A  1 252 ? -70.934  0.439   -68.097  1.00 19.02  ? 252  THR A CB    1 
ATOM   1965  O  OG1   . THR A  1 252 ? -72.109  -0.279  -67.719  1.00 23.47  ? 252  THR A OG1   1 
ATOM   1966  C  CG2   . THR A  1 252 ? -70.625  1.505   -67.068  1.00 10.97  ? 252  THR A CG2   1 
ATOM   1967  N  N     . ALA A  1 253 ? -73.341  1.515   -70.371  1.00 26.26  ? 253  ALA A N     1 
ATOM   1968  C  CA    . ALA A  1 253 ? -74.569  2.281   -70.550  1.00 23.62  ? 253  ALA A CA    1 
ATOM   1969  C  C     . ALA A  1 253 ? -75.750  1.699   -69.824  1.00 17.89  ? 253  ALA A C     1 
ATOM   1970  O  O     . ALA A  1 253 ? -75.869  0.474   -69.681  1.00 28.87  ? 253  ALA A O     1 
ATOM   1971  C  CB    . ALA A  1 253 ? -74.902  2.385   -72.030  1.00 21.80  ? 253  ALA A CB    1 
ATOM   1972  N  N     . THR A  1 254 ? -76.632  2.579   -69.361  1.00 12.23  ? 254  THR A N     1 
ATOM   1973  C  CA    . THR A  1 254 ? -77.841  2.116   -68.692  1.00 18.27  ? 254  THR A CA    1 
ATOM   1974  C  C     . THR A  1 254 ? -79.051  2.892   -69.156  1.00 19.05  ? 254  THR A C     1 
ATOM   1975  O  O     . THR A  1 254 ? -78.967  4.079   -69.484  1.00 24.42  ? 254  THR A O     1 
ATOM   1976  C  CB    . THR A  1 254 ? -77.760  2.185   -67.145  1.00 20.84  ? 254  THR A CB    1 
ATOM   1977  O  OG1   . THR A  1 254 ? -78.973  1.668   -66.580  1.00 22.68  ? 254  THR A OG1   1 
ATOM   1978  C  CG2   . THR A  1 254 ? -77.587  3.603   -66.677  1.00 10.78  ? 254  THR A CG2   1 
ATOM   1979  N  N     . PHE A  1 255 ? -80.162  2.179   -69.250  1.00 23.39  ? 255  PHE A N     1 
ATOM   1980  C  CA    . PHE A  1 255 ? -81.411  2.780   -69.635  1.00 18.98  ? 255  PHE A CA    1 
ATOM   1981  C  C     . PHE A  1 255 ? -82.333  2.929   -68.433  1.00 17.98  ? 255  PHE A C     1 
ATOM   1982  O  O     . PHE A  1 255 ? -83.513  3.186   -68.601  1.00 31.33  ? 255  PHE A O     1 
ATOM   1983  C  CB    . PHE A  1 255 ? -82.056  1.976   -70.748  1.00 10.38  ? 255  PHE A CB    1 
ATOM   1984  C  CG    . PHE A  1 255 ? -81.402  2.183   -72.074  1.00 20.97  ? 255  PHE A CG    1 
ATOM   1985  C  CD1   . PHE A  1 255 ? -81.736  3.283   -72.855  1.00 16.97  ? 255  PHE A CD1   1 
ATOM   1986  C  CD2   . PHE A  1 255 ? -80.430  1.302   -72.531  1.00 21.07  ? 255  PHE A CD2   1 
ATOM   1987  C  CE1   . PHE A  1 255 ? -81.110  3.505   -74.080  1.00 23.57  ? 255  PHE A CE1   1 
ATOM   1988  C  CE2   . PHE A  1 255 ? -79.796  1.514   -73.756  1.00 17.20  ? 255  PHE A CE2   1 
ATOM   1989  C  CZ    . PHE A  1 255 ? -80.136  2.617   -74.530  1.00 15.55  ? 255  PHE A CZ    1 
ATOM   1990  N  N     . MET A  1 256 ? -81.793  2.752   -67.225  1.00 22.87  ? 256  MET A N     1 
ATOM   1991  C  CA    . MET A  1 256 ? -82.567  2.921   -65.994  1.00 16.46  ? 256  MET A CA    1 
ATOM   1992  C  C     . MET A  1 256 ? -83.185  4.305   -66.031  1.00 27.70  ? 256  MET A C     1 
ATOM   1993  O  O     . MET A  1 256 ? -82.520  5.293   -66.377  1.00 30.44  ? 256  MET A O     1 
ATOM   1994  C  CB    . MET A  1 256 ? -81.677  2.963   -64.763  1.00 21.09  ? 256  MET A CB    1 
ATOM   1995  C  CG    . MET A  1 256 ? -81.107  1.700   -64.273  1.00 40.97  ? 256  MET A CG    1 
ATOM   1996  S  SD    . MET A  1 256 ? -80.138  2.215   -62.871  1.00 29.69  ? 256  MET A SD    1 
ATOM   1997  C  CE    . MET A  1 256 ? -81.386  2.140   -61.598  1.00 9.72   ? 256  MET A CE    1 
ATOM   1998  N  N     . PRO A  1 257 ? -84.418  4.421   -65.545  1.00 19.02  ? 257  PRO A N     1 
ATOM   1999  C  CA    . PRO A  1 257 ? -85.119  5.703   -65.525  1.00 20.88  ? 257  PRO A CA    1 
ATOM   2000  C  C     . PRO A  1 257 ? -84.491  6.758   -64.596  1.00 31.41  ? 257  PRO A C     1 
ATOM   2001  O  O     . PRO A  1 257 ? -84.394  7.932   -64.966  1.00 29.79  ? 257  PRO A O     1 
ATOM   2002  C  CB    . PRO A  1 257 ? -86.521  5.313   -65.048  1.00 18.11  ? 257  PRO A CB    1 
ATOM   2003  C  CG    . PRO A  1 257 ? -86.631  3.857   -65.407  1.00 36.77  ? 257  PRO A CG    1 
ATOM   2004  C  CD    . PRO A  1 257 ? -85.285  3.331   -65.075  1.00 16.27  ? 257  PRO A CD    1 
ATOM   2005  N  N     . LYS A  1 258 ? -84.018  6.338   -63.420  1.00 25.41  ? 258  LYS A N     1 
ATOM   2006  C  CA    . LYS A  1 258 ? -83.470  7.284   -62.449  1.00 16.01  ? 258  LYS A CA    1 
ATOM   2007  C  C     . LYS A  1 258 ? -82.266  6.754   -61.665  1.00 28.34  ? 258  LYS A C     1 
ATOM   2008  O  O     . LYS A  1 258 ? -82.393  6.306   -60.525  1.00 21.46  ? 258  LYS A O     1 
ATOM   2009  C  CB    . LYS A  1 258 ? -84.581  7.666   -61.471  1.00 16.55  ? 258  LYS A CB    1 
ATOM   2010  C  CG    . LYS A  1 258 ? -84.288  8.831   -60.544  1.00 18.13  ? 258  LYS A CG    1 
ATOM   2011  C  CD    . LYS A  1 258 ? -84.372  10.174  -61.257  1.00 32.53  ? 258  LYS A CD    1 
ATOM   2012  C  CE    . LYS A  1 258 ? -84.430  11.311  -60.238  1.00 19.73  ? 258  LYS A CE    1 
ATOM   2013  N  NZ    . LYS A  1 258 ? -84.401  12.665  -60.852  1.00 23.41  ? 258  LYS A NZ    1 
ATOM   2014  N  N     . PRO A  1 259 ? -81.073  6.809   -62.264  1.00 27.27  ? 259  PRO A N     1 
ATOM   2015  C  CA    . PRO A  1 259 ? -79.898  6.313   -61.543  1.00 25.15  ? 259  PRO A CA    1 
ATOM   2016  C  C     . PRO A  1 259 ? -79.443  7.203   -60.381  1.00 18.96  ? 259  PRO A C     1 
ATOM   2017  O  O     . PRO A  1 259 ? -78.892  6.711   -59.391  1.00 28.69  ? 259  PRO A O     1 
ATOM   2018  C  CB    . PRO A  1 259 ? -78.836  6.227   -62.648  1.00 18.71  ? 259  PRO A CB    1 
ATOM   2019  C  CG    . PRO A  1 259 ? -79.253  7.284   -63.618  1.00 17.77  ? 259  PRO A CG    1 
ATOM   2020  C  CD    . PRO A  1 259 ? -80.749  7.121   -63.669  1.00 16.24  ? 259  PRO A CD    1 
ATOM   2021  N  N     . MET A  1 260 ? -79.712  8.502   -60.489  1.00 24.13  ? 260  MET A N     1 
ATOM   2022  C  CA    . MET A  1 260 ? -79.295  9.468   -59.469  1.00 18.36  ? 260  MET A CA    1 
ATOM   2023  C  C     . MET A  1 260 ? -80.375  10.393  -58.936  1.00 20.20  ? 260  MET A C     1 
ATOM   2024  O  O     . MET A  1 260 ? -81.161  10.956  -59.693  1.00 26.31  ? 260  MET A O     1 
ATOM   2025  C  CB    . MET A  1 260 ? -78.183  10.368  -60.011  1.00 11.81  ? 260  MET A CB    1 
ATOM   2026  C  CG    . MET A  1 260 ? -76.901  9.666   -60.384  1.00 19.51  ? 260  MET A CG    1 
ATOM   2027  S  SD    . MET A  1 260 ? -75.763  10.771  -61.233  1.00 27.28  ? 260  MET A SD    1 
ATOM   2028  C  CE    . MET A  1 260 ? -76.551  10.847  -62.837  1.00 12.09  ? 260  MET A CE    1 
ATOM   2029  N  N     . PHE A  1 261 ? -80.374  10.584  -57.624  1.00 20.56  ? 261  PHE A N     1 
ATOM   2030  C  CA    . PHE A  1 261 ? -81.301  11.503  -57.007  1.00 14.87  ? 261  PHE A CA    1 
ATOM   2031  C  C     . PHE A  1 261 ? -80.675  12.894  -57.145  1.00 26.89  ? 261  PHE A C     1 
ATOM   2032  O  O     . PHE A  1 261 ? -79.489  13.087  -56.854  1.00 36.61  ? 261  PHE A O     1 
ATOM   2033  C  CB    . PHE A  1 261 ? -81.486  11.193  -55.517  1.00 24.99  ? 261  PHE A CB    1 
ATOM   2034  C  CG    . PHE A  1 261 ? -82.220  12.277  -54.773  1.00 36.44  ? 261  PHE A CG    1 
ATOM   2035  C  CD1   . PHE A  1 261 ? -83.596  12.425  -54.913  1.00 36.67  ? 261  PHE A CD1   1 
ATOM   2036  C  CD2   . PHE A  1 261 ? -81.526  13.210  -54.009  1.00 47.51  ? 261  PHE A CD2   1 
ATOM   2037  C  CE1   . PHE A  1 261 ? -84.274  13.491  -54.312  1.00 37.79  ? 261  PHE A CE1   1 
ATOM   2038  C  CE2   . PHE A  1 261 ? -82.197  14.279  -53.406  1.00 45.70  ? 261  PHE A CE2   1 
ATOM   2039  C  CZ    . PHE A  1 261 ? -83.573  14.416  -53.562  1.00 41.03  ? 261  PHE A CZ    1 
ATOM   2040  N  N     . GLY A  1 262 ? -81.459  13.865  -57.598  1.00 30.50  ? 262  GLY A N     1 
ATOM   2041  C  CA    . GLY A  1 262 ? -80.924  15.207  -57.700  1.00 27.19  ? 262  GLY A CA    1 
ATOM   2042  C  C     . GLY A  1 262 ? -80.568  15.665  -59.087  1.00 36.32  ? 262  GLY A C     1 
ATOM   2043  O  O     . GLY A  1 262 ? -80.099  16.785  -59.261  1.00 42.12  ? 262  GLY A O     1 
ATOM   2044  N  N     . ASP A  1 263 ? -80.676  14.771  -60.056  1.00 32.51  ? 263  ASP A N     1 
ATOM   2045  C  CA    . ASP A  1 263 ? -80.411  15.149  -61.426  1.00 22.62  ? 263  ASP A CA    1 
ATOM   2046  C  C     . ASP A  1 263 ? -81.437  14.449  -62.284  1.00 29.45  ? 263  ASP A C     1 
ATOM   2047  O  O     . ASP A  1 263 ? -82.194  13.609  -61.805  1.00 35.83  ? 263  ASP A O     1 
ATOM   2048  C  CB    . ASP A  1 263 ? -78.981  14.823  -61.875  1.00 27.00  ? 263  ASP A CB    1 
ATOM   2049  C  CG    . ASP A  1 263 ? -78.433  15.847  -62.888  1.00 39.84  ? 263  ASP A CG    1 
ATOM   2050  O  OD1   . ASP A  1 263 ? -77.203  16.040  -62.961  1.00 46.07  ? 263  ASP A OD1   1 
ATOM   2051  O  OD2   . ASP A  1 263 ? -79.226  16.483  -63.610  1.00 33.71  ? 263  ASP A OD2   1 
ATOM   2052  N  N     . ASN A  1 264 ? -81.509  14.883  -63.533  1.00 31.14  ? 264  ASN A N     1 
ATOM   2053  C  CA    . ASN A  1 264 ? -82.427  14.363  -64.531  1.00 26.67  ? 264  ASN A CA    1 
ATOM   2054  C  C     . ASN A  1 264 ? -82.505  12.845  -64.612  1.00 31.51  ? 264  ASN A C     1 
ATOM   2055  O  O     . ASN A  1 264 ? -81.495  12.148  -64.454  1.00 35.64  ? 264  ASN A O     1 
ATOM   2056  C  CB    . ASN A  1 264 ? -81.964  14.854  -65.896  1.00 49.03  ? 264  ASN A CB    1 
ATOM   2057  C  CG    . ASN A  1 264 ? -83.010  15.640  -66.626  1.00 53.49  ? 264  ASN A CG    1 
ATOM   2058  O  OD1   . ASN A  1 264 ? -83.167  15.484  -67.845  1.00 65.67  ? 264  ASN A OD1   1 
ATOM   2059  N  ND2   . ASN A  1 264 ? -83.701  16.531  -65.907  1.00 31.95  ? 264  ASN A ND2   1 
ATOM   2060  N  N     . GLY A  1 265 ? -83.709  12.341  -64.870  1.00 28.73  ? 265  GLY A N     1 
ATOM   2061  C  CA    . GLY A  1 265 ? -83.889  10.912  -65.061  1.00 18.04  ? 265  GLY A CA    1 
ATOM   2062  C  C     . GLY A  1 265 ? -83.895  10.719  -66.575  1.00 25.40  ? 265  GLY A C     1 
ATOM   2063  O  O     . GLY A  1 265 ? -83.763  11.687  -67.330  1.00 36.41  ? 265  GLY A O     1 
ATOM   2064  N  N     . SER A  1 266 ? -84.005  9.484   -67.040  1.00 25.67  ? 266  SER A N     1 
ATOM   2065  C  CA    . SER A  1 266 ? -84.058  9.250   -68.474  1.00 26.01  ? 266  SER A CA    1 
ATOM   2066  C  C     . SER A  1 266 ? -85.490  8.872   -68.841  1.00 33.37  ? 266  SER A C     1 
ATOM   2067  O  O     . SER A  1 266 ? -86.088  7.995   -68.222  1.00 33.54  ? 266  SER A O     1 
ATOM   2068  C  CB    . SER A  1 266 ? -83.101  8.132   -68.882  1.00 15.15  ? 266  SER A CB    1 
ATOM   2069  O  OG    . SER A  1 266 ? -81.760  8.541   -68.731  1.00 27.89  ? 266  SER A OG    1 
ATOM   2070  N  N     . GLY A  1 267 ? -86.054  9.561   -69.821  1.00 35.84  ? 267  GLY A N     1 
ATOM   2071  C  CA    . GLY A  1 267 ? -87.401  9.238   -70.231  1.00 23.45  ? 267  GLY A CA    1 
ATOM   2072  C  C     . GLY A  1 267 ? -87.432  8.730   -71.652  1.00 30.85  ? 267  GLY A C     1 
ATOM   2073  O  O     . GLY A  1 267 ? -86.403  8.653   -72.322  1.00 31.09  ? 267  GLY A O     1 
ATOM   2074  N  N     . MET A  1 268 ? -88.610  8.309   -72.090  1.00 33.53  ? 268  MET A N     1 
ATOM   2075  C  CA    . MET A  1 268 ? -88.777  7.852   -73.457  1.00 31.90  ? 268  MET A CA    1 
ATOM   2076  C  C     . MET A  1 268 ? -90.089  8.388   -73.984  1.00 30.92  ? 268  MET A C     1 
ATOM   2077  O  O     . MET A  1 268 ? -91.079  7.655   -74.064  1.00 36.90  ? 268  MET A O     1 
ATOM   2078  C  CB    . MET A  1 268 ? -88.764  6.331   -73.555  1.00 28.75  ? 268  MET A CB    1 
ATOM   2079  C  CG    . MET A  1 268 ? -88.868  5.873   -74.986  1.00 17.34  ? 268  MET A CG    1 
ATOM   2080  S  SD    . MET A  1 268 ? -88.449  4.161   -75.219  1.00 28.70  ? 268  MET A SD    1 
ATOM   2081  C  CE    . MET A  1 268 ? -89.875  3.375   -74.500  1.00 19.26  ? 268  MET A CE    1 
ATOM   2082  N  N     . HIS A  1 269 ? -90.111  9.684   -74.292  1.00 34.51  ? 269  HIS A N     1 
ATOM   2083  C  CA    . HIS A  1 269 ? -91.314  10.312  -74.826  1.00 30.54  ? 269  HIS A CA    1 
ATOM   2084  C  C     . HIS A  1 269 ? -91.740  9.504   -76.050  1.00 35.94  ? 269  HIS A C     1 
ATOM   2085  O  O     . HIS A  1 269 ? -90.902  8.969   -76.786  1.00 30.69  ? 269  HIS A O     1 
ATOM   2086  C  CB    . HIS A  1 269 ? -91.049  11.749  -75.292  1.00 30.38  ? 269  HIS A CB    1 
ATOM   2087  C  CG    . HIS A  1 269 ? -90.552  12.682  -74.227  1.00 44.81  ? 269  HIS A CG    1 
ATOM   2088  N  ND1   . HIS A  1 269 ? -89.930  13.879  -74.531  1.00 29.89  ? 269  HIS A ND1   1 
ATOM   2089  C  CD2   . HIS A  1 269 ? -90.586  12.613  -72.876  1.00 25.07  ? 269  HIS A CD2   1 
ATOM   2090  C  CE1   . HIS A  1 269 ? -89.602  14.498  -73.414  1.00 43.47  ? 269  HIS A CE1   1 
ATOM   2091  N  NE2   . HIS A  1 269 ? -89.991  13.750  -72.392  1.00 37.85  ? 269  HIS A NE2   1 
ATOM   2092  N  N     . CYS A  1 270 ? -93.043  9.385   -76.249  1.00 37.07  ? 270  CYS A N     1 
ATOM   2093  C  CA    . CYS A  1 270 ? -93.538  8.658   -77.399  1.00 32.75  ? 270  CYS A CA    1 
ATOM   2094  C  C     . CYS A  1 270 ? -94.438  9.514   -78.278  1.00 42.17  ? 270  CYS A C     1 
ATOM   2095  O  O     . CYS A  1 270 ? -95.550  9.879   -77.879  1.00 33.17  ? 270  CYS A O     1 
ATOM   2096  C  CB    . CYS A  1 270 ? -94.286  7.414   -76.955  1.00 28.09  ? 270  CYS A CB    1 
ATOM   2097  S  SG    . CYS A  1 270 ? -93.231  6.179   -76.293  1.00 30.29  ? 270  CYS A SG    1 
ATOM   2098  N  N     . HIS A  1 271 ? -93.914  9.887   -79.443  1.00 44.03  ? 271  HIS A N     1 
ATOM   2099  C  CA    . HIS A  1 271 ? -94.663  10.666  -80.423  1.00 43.89  ? 271  HIS A CA    1 
ATOM   2100  C  C     . HIS A  1 271 ? -95.491  9.642   -81.198  1.00 44.30  ? 271  HIS A C     1 
ATOM   2101  O  O     . HIS A  1 271 ? -94.984  8.587   -81.578  1.00 49.50  ? 271  HIS A O     1 
ATOM   2102  C  CB    . HIS A  1 271 ? -93.720  11.388  -81.393  1.00 39.61  ? 271  HIS A CB    1 
ATOM   2103  C  CG    . HIS A  1 271 ? -92.961  12.531  -80.789  1.00 37.82  ? 271  HIS A CG    1 
ATOM   2104  N  ND1   . HIS A  1 271 ? -93.455  13.818  -80.755  1.00 45.57  ? 271  HIS A ND1   1 
ATOM   2105  C  CD2   . HIS A  1 271 ? -91.723  12.593  -80.246  1.00 55.88  ? 271  HIS A CD2   1 
ATOM   2106  C  CE1   . HIS A  1 271 ? -92.552  14.621  -80.222  1.00 41.16  ? 271  HIS A CE1   1 
ATOM   2107  N  NE2   . HIS A  1 271 ? -91.493  13.905  -79.904  1.00 50.80  ? 271  HIS A NE2   1 
ATOM   2108  N  N     . MET A  1 272 ? -96.763  9.949   -81.421  1.00 57.76  ? 272  MET A N     1 
ATOM   2109  C  CA    . MET A  1 272 ? -97.655  9.037   -82.135  1.00 55.82  ? 272  MET A CA    1 
ATOM   2110  C  C     . MET A  1 272 ? -98.675  9.735   -83.026  1.00 57.72  ? 272  MET A C     1 
ATOM   2111  O  O     . MET A  1 272 ? -99.081  10.873  -82.765  1.00 52.84  ? 272  MET A O     1 
ATOM   2112  C  CB    . MET A  1 272 ? -98.453  8.203   -81.142  1.00 35.96  ? 272  MET A CB    1 
ATOM   2113  C  CG    . MET A  1 272 ? -97.660  7.338   -80.230  1.00 43.57  ? 272  MET A CG    1 
ATOM   2114  S  SD    . MET A  1 272 ? -98.786  6.615   -79.044  1.00 46.44  ? 272  MET A SD    1 
ATOM   2115  C  CE    . MET A  1 272 ? -98.883  7.951   -77.889  1.00 21.71  ? 272  MET A CE    1 
ATOM   2116  N  N     . SER A  1 273 ? -99.133  8.999   -84.036  1.00 58.76  ? 273  SER A N     1 
ATOM   2117  C  CA    . SER A  1 273 ? -100.153 9.460   -84.977  1.00 57.63  ? 273  SER A CA    1 
ATOM   2118  C  C     . SER A  1 273 ? -100.669 8.254   -85.755  1.00 54.04  ? 273  SER A C     1 
ATOM   2119  O  O     . SER A  1 273 ? -99.989  7.228   -85.848  1.00 55.90  ? 273  SER A O     1 
ATOM   2120  C  CB    . SER A  1 273 ? -99.602  10.514  -85.948  1.00 38.95  ? 273  SER A CB    1 
ATOM   2121  O  OG    . SER A  1 273 ? -98.927  9.917   -87.037  1.00 73.28  ? 273  SER A OG    1 
ATOM   2122  N  N     . LEU A  1 274 ? -101.894 8.363   -86.264  1.00 56.39  ? 274  LEU A N     1 
ATOM   2123  C  CA    . LEU A  1 274 ? -102.492 7.295   -87.058  1.00 46.15  ? 274  LEU A CA    1 
ATOM   2124  C  C     . LEU A  1 274 ? -102.626 7.752   -88.506  1.00 42.66  ? 274  LEU A C     1 
ATOM   2125  O  O     . LEU A  1 274 ? -102.640 8.954   -88.791  1.00 52.75  ? 274  LEU A O     1 
ATOM   2126  C  CB    . LEU A  1 274 ? -103.854 6.914   -86.496  1.00 41.30  ? 274  LEU A CB    1 
ATOM   2127  C  CG    . LEU A  1 274 ? -103.790 6.240   -85.133  1.00 40.67  ? 274  LEU A CG    1 
ATOM   2128  C  CD1   . LEU A  1 274 ? -105.183 6.080   -84.573  1.00 45.52  ? 274  LEU A CD1   1 
ATOM   2129  C  CD2   . LEU A  1 274 ? -103.106 4.894   -85.276  1.00 48.68  ? 274  LEU A CD2   1 
ATOM   2130  N  N     . ALA A  1 275 ? -102.707 6.800   -89.426  1.00 43.90  ? 275  ALA A N     1 
ATOM   2131  C  CA    . ALA A  1 275 ? -102.836 7.161   -90.829  1.00 55.63  ? 275  ALA A CA    1 
ATOM   2132  C  C     . ALA A  1 275 ? -103.660 6.175   -91.644  1.00 63.98  ? 275  ALA A C     1 
ATOM   2133  O  O     . ALA A  1 275 ? -103.794 5.002   -91.280  1.00 63.60  ? 275  ALA A O     1 
ATOM   2134  C  CB    . ALA A  1 275 ? -101.465 7.342   -91.444  1.00 44.77  ? 275  ALA A CB    1 
ATOM   2135  N  N     . LYS A  1 276 ? -104.230 6.678   -92.737  1.00 70.17  ? 276  LYS A N     1 
ATOM   2136  C  CA    . LYS A  1 276 ? -105.053 5.880   -93.644  1.00 67.70  ? 276  LYS A CA    1 
ATOM   2137  C  C     . LYS A  1 276 ? -104.825 6.411   -95.054  1.00 70.81  ? 276  LYS A C     1 
ATOM   2138  O  O     . LYS A  1 276 ? -104.975 7.614   -95.304  1.00 62.55  ? 276  LYS A O     1 
ATOM   2139  C  CB    . LYS A  1 276 ? -106.534 5.995   -93.265  1.00 58.79  ? 276  LYS A CB    1 
ATOM   2140  C  CG    . LYS A  1 276 ? -107.445 4.867   -93.762  1.00 65.24  ? 276  LYS A CG    1 
ATOM   2141  C  CD    . LYS A  1 276 ? -108.882 5.095   -93.254  1.00 78.63  ? 276  LYS A CD    1 
ATOM   2142  C  CE    . LYS A  1 276 ? -109.863 4.014   -93.695  1.00 73.99  ? 276  LYS A CE    1 
ATOM   2143  N  NZ    . LYS A  1 276 ? -109.596 2.701   -93.046  1.00 76.75  ? 276  LYS A NZ    1 
ATOM   2144  N  N     . ASN A  1 277 ? -104.394 5.515   -95.944  1.00 81.57  ? 277  ASN A N     1 
ATOM   2145  C  CA    . ASN A  1 277 ? -104.116 5.831   -97.347  1.00 81.07  ? 277  ASN A CA    1 
ATOM   2146  C  C     . ASN A  1 277 ? -103.247 7.069   -97.457  1.00 83.14  ? 277  ASN A C     1 
ATOM   2147  O  O     . ASN A  1 277 ? -103.590 8.015   -98.169  1.00 93.86  ? 277  ASN A O     1 
ATOM   2148  C  CB    . ASN A  1 277 ? -105.419 6.052   -98.124  1.00 80.90  ? 277  ASN A CB    1 
ATOM   2149  C  CG    . ASN A  1 277 ? -106.424 4.944   -97.902  1.00 88.92  ? 277  ASN A CG    1 
ATOM   2150  O  OD1   . ASN A  1 277 ? -106.140 3.773   -98.162  1.00 92.88  ? 277  ASN A OD1   1 
ATOM   2151  N  ND2   . ASN A  1 277 ? -107.603 5.305   -97.396  1.00 71.76  ? 277  ASN A ND2   1 
ATOM   2152  N  N     . GLY A  1 278 ? -102.162 7.088   -96.688  1.00 77.22  ? 278  GLY A N     1 
ATOM   2153  C  CA    . GLY A  1 278 ? -101.252 8.219   -96.717  1.00 76.41  ? 278  GLY A CA    1 
ATOM   2154  C  C     . GLY A  1 278 ? -101.768 9.543   -96.165  1.00 77.80  ? 278  GLY A C     1 
ATOM   2155  O  O     . GLY A  1 278 ? -101.179 10.594  -96.439  1.00 80.91  ? 278  GLY A O     1 
ATOM   2156  N  N     . THR A  1 279 ? -102.868 9.514   -95.418  1.00 69.95  ? 279  THR A N     1 
ATOM   2157  C  CA    . THR A  1 279 ? -103.400 10.742  -94.837  1.00 71.65  ? 279  THR A CA    1 
ATOM   2158  C  C     . THR A  1 279 ? -103.248 10.689  -93.319  1.00 69.41  ? 279  THR A C     1 
ATOM   2159  O  O     . THR A  1 279 ? -103.528 9.664   -92.691  1.00 61.37  ? 279  THR A O     1 
ATOM   2160  C  CB    . THR A  1 279 ? -104.884 10.964  -95.186  1.00 71.32  ? 279  THR A CB    1 
ATOM   2161  O  OG1   . THR A  1 279 ? -105.097 10.695  -96.578  1.00 77.70  ? 279  THR A OG1   1 
ATOM   2162  C  CG2   . THR A  1 279 ? -105.269 12.411  -94.899  1.00 58.24  ? 279  THR A CG2   1 
ATOM   2163  N  N     . ASN A  1 280 ? -102.795 11.792  -92.734  1.00 58.24  ? 280  ASN A N     1 
ATOM   2164  C  CA    . ASN A  1 280 ? -102.609 11.850  -91.290  1.00 57.08  ? 280  ASN A CA    1 
ATOM   2165  C  C     . ASN A  1 280 ? -103.934 12.104  -90.573  1.00 58.55  ? 280  ASN A C     1 
ATOM   2166  O  O     . ASN A  1 280 ? -104.407 13.243  -90.486  1.00 67.23  ? 280  ASN A O     1 
ATOM   2167  C  CB    . ASN A  1 280 ? -101.584 12.931  -90.936  1.00 59.16  ? 280  ASN A CB    1 
ATOM   2168  C  CG    . ASN A  1 280 ? -101.182 12.906  -89.471  1.00 62.96  ? 280  ASN A CG    1 
ATOM   2169  O  OD1   . ASN A  1 280 ? -101.794 12.221  -88.647  1.00 56.64  ? 280  ASN A OD1   1 
ATOM   2170  N  ND2   . ASN A  1 280 ? -100.142 13.662  -89.141  1.00 79.93  ? 280  ASN A ND2   1 
ATOM   2171  N  N     . LEU A  1 281 ? -104.514 11.038  -90.033  1.00 42.78  ? 281  LEU A N     1 
ATOM   2172  C  CA    . LEU A  1 281 ? -105.786 11.126  -89.318  1.00 53.38  ? 281  LEU A CA    1 
ATOM   2173  C  C     . LEU A  1 281 ? -105.789 12.004  -88.067  1.00 52.21  ? 281  LEU A C     1 
ATOM   2174  O  O     . LEU A  1 281 ? -106.814 12.114  -87.395  1.00 61.89  ? 281  LEU A O     1 
ATOM   2175  C  CB    . LEU A  1 281 ? -106.273 9.723   -88.946  1.00 44.76  ? 281  LEU A CB    1 
ATOM   2176  C  CG    . LEU A  1 281 ? -107.015 8.950   -90.040  1.00 58.26  ? 281  LEU A CG    1 
ATOM   2177  C  CD1   . LEU A  1 281 ? -106.314 9.103   -91.377  1.00 69.79  ? 281  LEU A CD1   1 
ATOM   2178  C  CD2   . LEU A  1 281 ? -107.137 7.487   -89.653  1.00 51.20  ? 281  LEU A CD2   1 
ATOM   2179  N  N     . PHE A  1 282 ? -104.653 12.627  -87.756  1.00 60.83  ? 282  PHE A N     1 
ATOM   2180  C  CA    . PHE A  1 282 ? -104.541 13.472  -86.567  1.00 56.77  ? 282  PHE A CA    1 
ATOM   2181  C  C     . PHE A  1 282 ? -104.572 14.969  -86.829  1.00 61.36  ? 282  PHE A C     1 
ATOM   2182  O  O     . PHE A  1 282 ? -104.582 15.755  -85.884  1.00 65.63  ? 282  PHE A O     1 
ATOM   2183  C  CB    . PHE A  1 282 ? -103.297 13.098  -85.749  1.00 62.66  ? 282  PHE A CB    1 
ATOM   2184  C  CG    . PHE A  1 282 ? -103.488 11.894  -84.861  1.00 53.72  ? 282  PHE A CG    1 
ATOM   2185  C  CD1   . PHE A  1 282 ? -104.305 10.833  -85.255  1.00 68.49  ? 282  PHE A CD1   1 
ATOM   2186  C  CD2   . PHE A  1 282 ? -102.862 11.824  -83.623  1.00 49.63  ? 282  PHE A CD2   1 
ATOM   2187  C  CE1   . PHE A  1 282 ? -104.502 9.722   -84.426  1.00 59.20  ? 282  PHE A CE1   1 
ATOM   2188  C  CE2   . PHE A  1 282 ? -103.052 10.717  -82.785  1.00 40.04  ? 282  PHE A CE2   1 
ATOM   2189  C  CZ    . PHE A  1 282 ? -103.873 9.665   -83.192  1.00 48.73  ? 282  PHE A CZ    1 
ATOM   2190  N  N     . SER A  1 283 ? -104.538 15.370  -88.099  1.00 66.49  ? 283  SER A N     1 
ATOM   2191  C  CA    . SER A  1 283 ? -104.617 16.791  -88.432  1.00 66.53  ? 283  SER A CA    1 
ATOM   2192  C  C     . SER A  1 283 ? -106.093 17.119  -88.644  1.00 68.04  ? 283  SER A C     1 
ATOM   2193  O  O     . SER A  1 283 ? -106.830 16.343  -89.262  1.00 64.10  ? 283  SER A O     1 
ATOM   2194  C  CB    . SER A  1 283 ? -103.834 17.123  -89.701  1.00 60.85  ? 283  SER A CB    1 
ATOM   2195  O  OG    . SER A  1 283 ? -104.525 16.686  -90.854  1.00 63.48  ? 283  SER A OG    1 
ATOM   2196  N  N     . GLY A  1 284 ? -106.520 18.260  -88.113  1.00 66.57  ? 284  GLY A N     1 
ATOM   2197  C  CA    . GLY A  1 284 ? -107.903 18.670  -88.245  1.00 65.75  ? 284  GLY A CA    1 
ATOM   2198  C  C     . GLY A  1 284 ? -108.080 20.139  -87.932  1.00 71.47  ? 284  GLY A C     1 
ATOM   2199  O  O     . GLY A  1 284 ? -107.112 20.904  -87.923  1.00 72.41  ? 284  GLY A O     1 
ATOM   2200  N  N     . ASP A  1 285 ? -109.320 20.527  -87.652  1.00 78.44  ? 285  ASP A N     1 
ATOM   2201  C  CA    . ASP A  1 285 ? -109.661 21.916  -87.347  1.00 84.14  ? 285  ASP A CA    1 
ATOM   2202  C  C     . ASP A  1 285 ? -109.660 22.243  -85.849  1.00 85.84  ? 285  ASP A C     1 
ATOM   2203  O  O     . ASP A  1 285 ? -109.608 23.418  -85.477  1.00 91.40  ? 285  ASP A O     1 
ATOM   2204  C  CB    . ASP A  1 285 ? -111.027 22.260  -87.964  1.00 80.13  ? 285  ASP A CB    1 
ATOM   2205  C  CG    . ASP A  1 285 ? -112.137 21.312  -87.505  1.00 100.00 ? 285  ASP A CG    1 
ATOM   2206  O  OD1   . ASP A  1 285 ? -112.454 21.297  -86.294  1.00 100.00 ? 285  ASP A OD1   1 
ATOM   2207  O  OD2   . ASP A  1 285 ? -112.689 20.571  -88.351  1.00 100.00 ? 285  ASP A OD2   1 
ATOM   2208  N  N     . LYS A  1 286 ? -109.694 21.206  -85.005  1.00 76.86  ? 286  LYS A N     1 
ATOM   2209  C  CA    . LYS A  1 286 ? -109.714 21.363  -83.542  1.00 67.78  ? 286  LYS A CA    1 
ATOM   2210  C  C     . LYS A  1 286 ? -108.404 21.930  -82.972  1.00 66.61  ? 286  LYS A C     1 
ATOM   2211  O  O     . LYS A  1 286 ? -107.531 22.369  -83.729  1.00 62.39  ? 286  LYS A O     1 
ATOM   2212  C  CB    . LYS A  1 286 ? -110.031 20.028  -82.851  1.00 61.86  ? 286  LYS A CB    1 
ATOM   2213  C  CG    . LYS A  1 286 ? -111.136 19.178  -83.491  1.00 84.33  ? 286  LYS A CG    1 
ATOM   2214  C  CD    . LYS A  1 286 ? -112.514 19.839  -83.489  1.00 94.83  ? 286  LYS A CD    1 
ATOM   2215  C  CE    . LYS A  1 286 ? -113.561 18.874  -84.036  1.00 87.59  ? 286  LYS A CE    1 
ATOM   2216  N  NZ    . LYS A  1 286 ? -114.273 19.411  -85.224  1.00 81.92  ? 286  LYS A NZ    1 
ATOM   2217  N  N     . TYR A  1 287 ? -108.274 21.891  -81.641  1.00 62.51  ? 287  TYR A N     1 
ATOM   2218  C  CA    . TYR A  1 287 ? -107.096 22.401  -80.915  1.00 59.83  ? 287  TYR A CA    1 
ATOM   2219  C  C     . TYR A  1 287 ? -105.726 22.146  -81.547  1.00 57.90  ? 287  TYR A C     1 
ATOM   2220  O  O     . TYR A  1 287 ? -105.358 21.010  -81.847  1.00 65.01  ? 287  TYR A O     1 
ATOM   2221  C  CB    . TYR A  1 287 ? -107.081 21.860  -79.483  1.00 56.00  ? 287  TYR A CB    1 
ATOM   2222  C  CG    . TYR A  1 287 ? -105.932 22.374  -78.637  1.00 59.02  ? 287  TYR A CG    1 
ATOM   2223  C  CD1   . TYR A  1 287 ? -106.095 23.486  -77.822  1.00 69.46  ? 287  TYR A CD1   1 
ATOM   2224  C  CD2   . TYR A  1 287 ? -104.693 21.732  -78.626  1.00 62.71  ? 287  TYR A CD2   1 
ATOM   2225  C  CE1   . TYR A  1 287 ? -105.058 23.953  -77.010  1.00 70.53  ? 287  TYR A CE1   1 
ATOM   2226  C  CE2   . TYR A  1 287 ? -103.647 22.193  -77.816  1.00 59.61  ? 287  TYR A CE2   1 
ATOM   2227  C  CZ    . TYR A  1 287 ? -103.842 23.305  -77.011  1.00 60.83  ? 287  TYR A CZ    1 
ATOM   2228  O  OH    . TYR A  1 287 ? -102.829 23.784  -76.209  1.00 53.11  ? 287  TYR A OH    1 
ATOM   2229  N  N     . ALA A  1 288 ? -104.961 23.218  -81.710  1.00 49.86  ? 288  ALA A N     1 
ATOM   2230  C  CA    . ALA A  1 288 ? -103.621 23.144  -82.286  1.00 55.00  ? 288  ALA A CA    1 
ATOM   2231  C  C     . ALA A  1 288 ? -103.457 22.338  -83.590  1.00 57.99  ? 288  ALA A C     1 
ATOM   2232  O  O     . ALA A  1 288 ? -102.381 21.805  -83.872  1.00 73.71  ? 288  ALA A O     1 
ATOM   2233  C  CB    . ALA A  1 288 ? -102.640 22.663  -81.236  1.00 49.01  ? 288  ALA A CB    1 
ATOM   2234  N  N     . GLY A  1 289 ? -104.516 22.262  -84.389  1.00 52.91  ? 289  GLY A N     1 
ATOM   2235  C  CA    . GLY A  1 289 ? -104.438 21.547  -85.654  1.00 57.25  ? 289  GLY A CA    1 
ATOM   2236  C  C     . GLY A  1 289 ? -104.833 20.087  -85.591  1.00 57.83  ? 289  GLY A C     1 
ATOM   2237  O  O     . GLY A  1 289 ? -104.766 19.374  -86.596  1.00 60.01  ? 289  GLY A O     1 
ATOM   2238  N  N     . LEU A  1 290 ? -105.252 19.655  -84.408  1.00 50.06  ? 290  LEU A N     1 
ATOM   2239  C  CA    . LEU A  1 290 ? -105.661 18.282  -84.153  1.00 51.19  ? 290  LEU A CA    1 
ATOM   2240  C  C     . LEU A  1 290 ? -107.019 17.939  -84.738  1.00 48.70  ? 290  LEU A C     1 
ATOM   2241  O  O     . LEU A  1 290 ? -107.885 18.800  -84.854  1.00 69.85  ? 290  LEU A O     1 
ATOM   2242  C  CB    . LEU A  1 290 ? -105.727 18.064  -82.637  1.00 57.04  ? 290  LEU A CB    1 
ATOM   2243  C  CG    . LEU A  1 290 ? -104.686 17.266  -81.838  1.00 57.50  ? 290  LEU A CG    1 
ATOM   2244  C  CD1   . LEU A  1 290 ? -103.332 17.265  -82.501  1.00 37.53  ? 290  LEU A CD1   1 
ATOM   2245  C  CD2   . LEU A  1 290 ? -104.599 17.843  -80.433  1.00 51.95  ? 290  LEU A CD2   1 
ATOM   2246  N  N     . SER A  1 291 ? -107.195 16.676  -85.118  1.00 50.42  ? 291  SER A N     1 
ATOM   2247  C  CA    . SER A  1 291 ? -108.478 16.199  -85.618  1.00 57.74  ? 291  SER A CA    1 
ATOM   2248  C  C     . SER A  1 291 ? -109.236 15.785  -84.350  1.00 60.46  ? 291  SER A C     1 
ATOM   2249  O  O     . SER A  1 291 ? -108.648 15.744  -83.266  1.00 57.56  ? 291  SER A O     1 
ATOM   2250  C  CB    . SER A  1 291 ? -108.293 14.986  -86.535  1.00 55.99  ? 291  SER A CB    1 
ATOM   2251  O  OG    . SER A  1 291 ? -107.953 13.825  -85.798  1.00 63.45  ? 291  SER A OG    1 
ATOM   2252  N  N     . GLU A  1 292 ? -110.532 15.514  -84.454  1.00 75.69  ? 292  GLU A N     1 
ATOM   2253  C  CA    . GLU A  1 292 ? -111.258 15.107  -83.257  1.00 78.19  ? 292  GLU A CA    1 
ATOM   2254  C  C     . GLU A  1 292 ? -110.862 13.675  -82.926  1.00 76.23  ? 292  GLU A C     1 
ATOM   2255  O  O     . GLU A  1 292 ? -110.956 13.238  -81.778  1.00 72.14  ? 292  GLU A O     1 
ATOM   2256  C  CB    . GLU A  1 292 ? -112.775 15.243  -83.425  1.00 92.16  ? 292  GLU A CB    1 
ATOM   2257  C  CG    . GLU A  1 292 ? -113.438 14.255  -84.374  1.00 99.57  ? 292  GLU A CG    1 
ATOM   2258  C  CD    . GLU A  1 292 ? -114.957 14.280  -84.253  1.00 100.00 ? 292  GLU A CD    1 
ATOM   2259  O  OE1   . GLU A  1 292 ? -115.562 13.191  -84.129  1.00 90.57  ? 292  GLU A OE1   1 
ATOM   2260  O  OE2   . GLU A  1 292 ? -115.542 15.388  -84.268  1.00 100.00 ? 292  GLU A OE2   1 
ATOM   2261  N  N     . GLN A  1 293 ? -110.366 12.974  -83.941  1.00 77.14  ? 293  GLN A N     1 
ATOM   2262  C  CA    . GLN A  1 293 ? -109.919 11.597  -83.798  1.00 71.14  ? 293  GLN A CA    1 
ATOM   2263  C  C     . GLN A  1 293 ? -108.716 11.543  -82.856  1.00 63.10  ? 293  GLN A C     1 
ATOM   2264  O  O     . GLN A  1 293 ? -108.587 10.627  -82.043  1.00 58.83  ? 293  GLN A O     1 
ATOM   2265  C  CB    . GLN A  1 293 ? -109.549 11.044  -85.167  1.00 76.24  ? 293  GLN A CB    1 
ATOM   2266  C  CG    . GLN A  1 293 ? -109.268 9.566   -85.163  1.00 98.82  ? 293  GLN A CG    1 
ATOM   2267  C  CD    . GLN A  1 293 ? -109.592 8.915   -86.493  1.00 100.00 ? 293  GLN A CD    1 
ATOM   2268  O  OE1   . GLN A  1 293 ? -108.691 8.571   -87.264  1.00 100.00 ? 293  GLN A OE1   1 
ATOM   2269  N  NE2   . GLN A  1 293 ? -110.888 8.739   -86.771  1.00 100.00 ? 293  GLN A NE2   1 
ATOM   2270  N  N     . ALA A  1 294 ? -107.853 12.549  -82.970  1.00 56.79  ? 294  ALA A N     1 
ATOM   2271  C  CA    . ALA A  1 294 ? -106.667 12.674  -82.137  1.00 43.55  ? 294  ALA A CA    1 
ATOM   2272  C  C     . ALA A  1 294 ? -107.070 12.910  -80.680  1.00 52.58  ? 294  ALA A C     1 
ATOM   2273  O  O     . ALA A  1 294 ? -106.482 12.330  -79.767  1.00 60.23  ? 294  ALA A O     1 
ATOM   2274  C  CB    . ALA A  1 294 ? -105.785 13.828  -82.637  1.00 27.42  ? 294  ALA A CB    1 
ATOM   2275  N  N     . LEU A  1 295 ? -108.079 13.754  -80.466  1.00 58.60  ? 295  LEU A N     1 
ATOM   2276  C  CA    . LEU A  1 295 ? -108.552 14.053  -79.117  1.00 53.69  ? 295  LEU A CA    1 
ATOM   2277  C  C     . LEU A  1 295 ? -109.118 12.821  -78.419  1.00 53.43  ? 295  LEU A C     1 
ATOM   2278  O  O     . LEU A  1 295 ? -108.909 12.644  -77.224  1.00 55.03  ? 295  LEU A O     1 
ATOM   2279  C  CB    . LEU A  1 295 ? -109.599 15.154  -79.150  1.00 51.96  ? 295  LEU A CB    1 
ATOM   2280  C  CG    . LEU A  1 295 ? -109.140 16.479  -79.753  1.00 55.21  ? 295  LEU A CG    1 
ATOM   2281  C  CD1   . LEU A  1 295 ? -110.331 17.417  -79.831  1.00 82.04  ? 295  LEU A CD1   1 
ATOM   2282  C  CD2   . LEU A  1 295 ? -108.035 17.093  -78.919  1.00 48.55  ? 295  LEU A CD2   1 
ATOM   2283  N  N     . TYR A  1 296 ? -109.832 11.971  -79.159  1.00 49.23  ? 296  TYR A N     1 
ATOM   2284  C  CA    . TYR A  1 296 ? -110.396 10.753  -78.575  1.00 69.43  ? 296  TYR A CA    1 
ATOM   2285  C  C     . TYR A  1 296 ? -109.269 9.790   -78.230  1.00 66.33  ? 296  TYR A C     1 
ATOM   2286  O  O     . TYR A  1 296 ? -109.330 9.056   -77.240  1.00 59.73  ? 296  TYR A O     1 
ATOM   2287  C  CB    . TYR A  1 296 ? -111.418 10.099  -79.520  1.00 81.15  ? 296  TYR A CB    1 
ATOM   2288  C  CG    . TYR A  1 296 ? -112.699 10.901  -79.676  1.00 94.90  ? 296  TYR A CG    1 
ATOM   2289  C  CD1   . TYR A  1 296 ? -113.072 11.848  -78.718  1.00 96.61  ? 296  TYR A CD1   1 
ATOM   2290  C  CD2   . TYR A  1 296 ? -113.512 10.748  -80.798  1.00 97.47  ? 296  TYR A CD2   1 
ATOM   2291  C  CE1   . TYR A  1 296 ? -114.214 12.628  -78.876  1.00 100.00 ? 296  TYR A CE1   1 
ATOM   2292  C  CE2   . TYR A  1 296 ? -114.660 11.526  -80.966  1.00 100.00 ? 296  TYR A CE2   1 
ATOM   2293  C  CZ    . TYR A  1 296 ? -115.002 12.465  -80.002  1.00 100.00 ? 296  TYR A CZ    1 
ATOM   2294  O  OH    . TYR A  1 296 ? -116.113 13.259  -80.171  1.00 100.00 ? 296  TYR A OH    1 
ATOM   2295  N  N     . TYR A  1 297 ? -108.217 9.836   -79.038  1.00 61.44  ? 297  TYR A N     1 
ATOM   2296  C  CA    . TYR A  1 297 ? -107.047 9.004   -78.817  1.00 53.19  ? 297  TYR A CA    1 
ATOM   2297  C  C     . TYR A  1 297 ? -106.476 9.426   -77.466  1.00 47.86  ? 297  TYR A C     1 
ATOM   2298  O  O     . TYR A  1 297 ? -106.245 8.593   -76.593  1.00 51.00  ? 297  TYR A O     1 
ATOM   2299  C  CB    . TYR A  1 297 ? -106.024 9.246   -79.923  1.00 50.52  ? 297  TYR A CB    1 
ATOM   2300  C  CG    . TYR A  1 297 ? -104.947 8.199   -79.992  1.00 56.85  ? 297  TYR A CG    1 
ATOM   2301  C  CD1   . TYR A  1 297 ? -105.019 7.164   -80.917  1.00 54.84  ? 297  TYR A CD1   1 
ATOM   2302  C  CD2   . TYR A  1 297 ? -103.858 8.233   -79.126  1.00 58.83  ? 297  TYR A CD2   1 
ATOM   2303  C  CE1   . TYR A  1 297 ? -104.033 6.187   -80.979  1.00 61.94  ? 297  TYR A CE1   1 
ATOM   2304  C  CE2   . TYR A  1 297 ? -102.865 7.262   -79.180  1.00 54.44  ? 297  TYR A CE2   1 
ATOM   2305  C  CZ    . TYR A  1 297 ? -102.957 6.241   -80.108  1.00 57.65  ? 297  TYR A CZ    1 
ATOM   2306  O  OH    . TYR A  1 297 ? -101.978 5.272   -80.159  1.00 48.02  ? 297  TYR A OH    1 
ATOM   2307  N  N     . ILE A  1 298 ? -106.310 10.735  -77.294  1.00 40.28  ? 298  ILE A N     1 
ATOM   2308  C  CA    . ILE A  1 298 ? -105.798 11.311  -76.055  1.00 35.22  ? 298  ILE A CA    1 
ATOM   2309  C  C     . ILE A  1 298 ? -106.674 10.914  -74.881  1.00 47.95  ? 298  ILE A C     1 
ATOM   2310  O  O     . ILE A  1 298 ? -106.182 10.507  -73.829  1.00 52.89  ? 298  ILE A O     1 
ATOM   2311  C  CB    . ILE A  1 298 ? -105.796 12.850  -76.115  1.00 34.49  ? 298  ILE A CB    1 
ATOM   2312  C  CG1   . ILE A  1 298 ? -104.855 13.324  -77.224  1.00 38.48  ? 298  ILE A CG1   1 
ATOM   2313  C  CG2   . ILE A  1 298 ? -105.438 13.442  -74.745  1.00 30.45  ? 298  ILE A CG2   1 
ATOM   2314  C  CD1   . ILE A  1 298 ? -104.602 14.819  -77.234  1.00 32.94  ? 298  ILE A CD1   1 
ATOM   2315  N  N     . GLY A  1 299 ? -107.980 11.064  -75.068  1.00 52.69  ? 299  GLY A N     1 
ATOM   2316  C  CA    . GLY A  1 299 ? -108.921 10.726  -74.020  1.00 50.87  ? 299  GLY A CA    1 
ATOM   2317  C  C     . GLY A  1 299 ? -108.689 9.320   -73.534  1.00 46.63  ? 299  GLY A C     1 
ATOM   2318  O  O     . GLY A  1 299 ? -108.665 9.078   -72.326  1.00 53.22  ? 299  GLY A O     1 
ATOM   2319  N  N     . GLY A  1 300 ? -108.471 8.409   -74.484  1.00 42.83  ? 300  GLY A N     1 
ATOM   2320  C  CA    . GLY A  1 300 ? -108.226 7.013   -74.159  1.00 47.12  ? 300  GLY A CA    1 
ATOM   2321  C  C     . GLY A  1 300 ? -106.981 6.823   -73.316  1.00 55.80  ? 300  GLY A C     1 
ATOM   2322  O  O     . GLY A  1 300 ? -107.002 6.106   -72.307  1.00 52.87  ? 300  GLY A O     1 
ATOM   2323  N  N     . VAL A  1 301 ? -105.902 7.496   -73.714  1.00 47.00  ? 301  VAL A N     1 
ATOM   2324  C  CA    . VAL A  1 301 ? -104.633 7.419   -72.998  1.00 40.94  ? 301  VAL A CA    1 
ATOM   2325  C  C     . VAL A  1 301 ? -104.791 7.957   -71.576  1.00 43.29  ? 301  VAL A C     1 
ATOM   2326  O  O     . VAL A  1 301 ? -104.265 7.381   -70.623  1.00 48.89  ? 301  VAL A O     1 
ATOM   2327  C  CB    . VAL A  1 301 ? -103.510 8.198   -73.729  1.00 40.94  ? 301  VAL A CB    1 
ATOM   2328  C  CG1   . VAL A  1 301 ? -102.248 8.163   -72.919  1.00 44.43  ? 301  VAL A CG1   1 
ATOM   2329  C  CG2   . VAL A  1 301 ? -103.230 7.595   -75.103  1.00 29.42  ? 301  VAL A CG2   1 
ATOM   2330  N  N     . ILE A  1 302 ? -105.541 9.041   -71.427  1.00 37.95  ? 302  ILE A N     1 
ATOM   2331  C  CA    . ILE A  1 302 ? -105.747 9.607   -70.105  1.00 38.69  ? 302  ILE A CA    1 
ATOM   2332  C  C     . ILE A  1 302 ? -106.607 8.697   -69.235  1.00 41.11  ? 302  ILE A C     1 
ATOM   2333  O  O     . ILE A  1 302 ? -106.348 8.534   -68.047  1.00 48.71  ? 302  ILE A O     1 
ATOM   2334  C  CB    . ILE A  1 302 ? -106.365 11.004  -70.184  1.00 36.09  ? 302  ILE A CB    1 
ATOM   2335  C  CG1   . ILE A  1 302 ? -105.470 11.908  -71.039  1.00 34.97  ? 302  ILE A CG1   1 
ATOM   2336  C  CG2   . ILE A  1 302 ? -106.506 11.589  -68.794  1.00 27.77  ? 302  ILE A CG2   1 
ATOM   2337  C  CD1   . ILE A  1 302 ? -105.788 13.382  -70.935  1.00 40.96  ? 302  ILE A CD1   1 
ATOM   2338  N  N     . LYS A  1 303 ? -107.597 8.058   -69.841  1.00 42.44  ? 303  LYS A N     1 
ATOM   2339  C  CA    . LYS A  1 303 ? -108.466 7.176   -69.087  1.00 48.36  ? 303  LYS A CA    1 
ATOM   2340  C  C     . LYS A  1 303 ? -107.711 5.955   -68.576  1.00 53.41  ? 303  LYS A C     1 
ATOM   2341  O  O     . LYS A  1 303 ? -107.844 5.578   -67.408  1.00 51.20  ? 303  LYS A O     1 
ATOM   2342  C  CB    . LYS A  1 303 ? -109.672 6.742   -69.936  1.00 51.83  ? 303  LYS A CB    1 
ATOM   2343  C  CG    . LYS A  1 303 ? -110.704 5.892   -69.174  1.00 50.72  ? 303  LYS A CG    1 
ATOM   2344  C  CD    . LYS A  1 303 ? -111.979 5.706   -69.973  1.00 60.04  ? 303  LYS A CD    1 
ATOM   2345  C  CE    . LYS A  1 303 ? -112.901 4.679   -69.332  1.00 69.88  ? 303  LYS A CE    1 
ATOM   2346  N  NZ    . LYS A  1 303 ? -113.907 4.186   -70.319  1.00 56.80  ? 303  LYS A NZ    1 
ATOM   2347  N  N     . HIS A  1 304 ? -106.866 5.387   -69.432  1.00 50.41  ? 304  HIS A N     1 
ATOM   2348  C  CA    . HIS A  1 304 ? -106.115 4.184   -69.080  1.00 52.58  ? 304  HIS A CA    1 
ATOM   2349  C  C     . HIS A  1 304 ? -104.644 4.394   -68.706  1.00 48.46  ? 304  HIS A C     1 
ATOM   2350  O  O     . HIS A  1 304 ? -103.866 3.439   -68.647  1.00 43.53  ? 304  HIS A O     1 
ATOM   2351  C  CB    . HIS A  1 304 ? -106.207 3.195   -70.230  1.00 49.81  ? 304  HIS A CB    1 
ATOM   2352  C  CG    . HIS A  1 304 ? -107.604 2.929   -70.684  1.00 48.86  ? 304  HIS A CG    1 
ATOM   2353  N  ND1   . HIS A  1 304 ? -108.558 2.369   -69.864  1.00 50.12  ? 304  HIS A ND1   1 
ATOM   2354  C  CD2   . HIS A  1 304 ? -108.200 3.107   -71.886  1.00 47.42  ? 304  HIS A CD2   1 
ATOM   2355  C  CE1   . HIS A  1 304 ? -109.679 2.205   -70.543  1.00 53.03  ? 304  HIS A CE1   1 
ATOM   2356  N  NE2   . HIS A  1 304 ? -109.488 2.644   -71.774  1.00 44.37  ? 304  HIS A NE2   1 
ATOM   2357  N  N     . ALA A  1 305 ? -104.281 5.635   -68.409  1.00 47.07  ? 305  ALA A N     1 
ATOM   2358  C  CA    . ALA A  1 305 ? -102.912 5.976   -68.056  1.00 37.03  ? 305  ALA A CA    1 
ATOM   2359  C  C     . ALA A  1 305 ? -102.276 5.079   -66.990  1.00 40.38  ? 305  ALA A C     1 
ATOM   2360  O  O     . ALA A  1 305 ? -101.247 4.452   -67.253  1.00 41.89  ? 305  ALA A O     1 
ATOM   2361  C  CB    . ALA A  1 305 ? -102.828 7.442   -67.651  1.00 25.76  ? 305  ALA A CB    1 
ATOM   2362  N  N     . LYS A  1 306 ? -102.890 4.982   -65.809  1.00 32.19  ? 306  LYS A N     1 
ATOM   2363  C  CA    . LYS A  1 306 ? -102.323 4.147   -64.747  1.00 36.70  ? 306  LYS A CA    1 
ATOM   2364  C  C     . LYS A  1 306 ? -102.062 2.700   -65.184  1.00 40.29  ? 306  LYS A C     1 
ATOM   2365  O  O     . LYS A  1 306 ? -101.098 2.078   -64.745  1.00 44.13  ? 306  LYS A O     1 
ATOM   2366  C  CB    . LYS A  1 306 ? -103.197 4.168   -63.493  1.00 30.48  ? 306  LYS A CB    1 
ATOM   2367  C  CG    . LYS A  1 306 ? -103.330 5.516   -62.825  1.00 29.89  ? 306  LYS A CG    1 
ATOM   2368  C  CD    . LYS A  1 306 ? -104.138 5.366   -61.544  1.00 47.56  ? 306  LYS A CD    1 
ATOM   2369  C  CE    . LYS A  1 306 ? -104.668 6.699   -61.035  1.00 62.34  ? 306  LYS A CE    1 
ATOM   2370  N  NZ    . LYS A  1 306 ? -103.637 7.505   -60.335  1.00 65.37  ? 306  LYS A NZ    1 
ATOM   2371  N  N     . ALA A  1 307 ? -102.925 2.153   -66.034  1.00 46.04  ? 307  ALA A N     1 
ATOM   2372  C  CA    . ALA A  1 307 ? -102.720 0.794   -66.508  1.00 37.39  ? 307  ALA A CA    1 
ATOM   2373  C  C     . ALA A  1 307 ? -101.560 0.809   -67.500  1.00 39.73  ? 307  ALA A C     1 
ATOM   2374  O  O     . ALA A  1 307 ? -100.713 -0.086  -67.484  1.00 52.60  ? 307  ALA A O     1 
ATOM   2375  C  CB    . ALA A  1 307 ? -103.971 0.262   -67.159  1.00 37.76  ? 307  ALA A CB    1 
ATOM   2376  N  N     . ILE A  1 308 ? -101.504 1.840   -68.346  1.00 29.98  ? 308  ILE A N     1 
ATOM   2377  C  CA    . ILE A  1 308 ? -100.421 1.950   -69.323  1.00 41.96  ? 308  ILE A CA    1 
ATOM   2378  C  C     . ILE A  1 308 ? -99.076  2.066   -68.600  1.00 44.13  ? 308  ILE A C     1 
ATOM   2379  O  O     . ILE A  1 308 ? -98.059  1.559   -69.079  1.00 44.26  ? 308  ILE A O     1 
ATOM   2380  C  CB    . ILE A  1 308 ? -100.610 3.160   -70.257  1.00 39.88  ? 308  ILE A CB    1 
ATOM   2381  C  CG1   . ILE A  1 308 ? -101.906 3.007   -71.046  1.00 26.61  ? 308  ILE A CG1   1 
ATOM   2382  C  CG2   . ILE A  1 308 ? -99.430  3.268   -71.227  1.00 27.30  ? 308  ILE A CG2   1 
ATOM   2383  C  CD1   . ILE A  1 308 ? -102.253 4.222   -71.872  1.00 28.57  ? 308  ILE A CD1   1 
ATOM   2384  N  N     . ASN A  1 309 ? -99.095  2.710   -67.431  1.00 34.85  ? 309  ASN A N     1 
ATOM   2385  C  CA    . ASN A  1 309 ? -97.902  2.886   -66.603  1.00 25.41  ? 309  ASN A CA    1 
ATOM   2386  C  C     . ASN A  1 309 ? -97.222  1.550   -66.300  1.00 31.76  ? 309  ASN A C     1 
ATOM   2387  O  O     . ASN A  1 309 ? -95.996  1.458   -66.311  1.00 35.81  ? 309  ASN A O     1 
ATOM   2388  C  CB    . ASN A  1 309 ? -98.256  3.554   -65.269  1.00 26.20  ? 309  ASN A CB    1 
ATOM   2389  C  CG    . ASN A  1 309 ? -98.430  5.058   -65.379  1.00 39.19  ? 309  ASN A CG    1 
ATOM   2390  O  OD1   . ASN A  1 309 ? -99.199  5.655   -64.622  1.00 36.38  ? 309  ASN A OD1   1 
ATOM   2391  N  ND2   . ASN A  1 309 ? -97.685  5.685   -66.287  1.00 32.54  ? 309  ASN A ND2   1 
ATOM   2392  N  N     . ALA A  1 310 ? -98.023  0.529   -66.006  1.00 29.79  ? 310  ALA A N     1 
ATOM   2393  C  CA    . ALA A  1 310 ? -97.507  -0.797  -65.706  1.00 18.61  ? 310  ALA A CA    1 
ATOM   2394  C  C     . ALA A  1 310 ? -96.624  -1.308  -66.840  1.00 24.02  ? 310  ALA A C     1 
ATOM   2395  O  O     . ALA A  1 310 ? -95.791  -2.182  -66.626  1.00 26.98  ? 310  ALA A O     1 
ATOM   2396  C  CB    . ALA A  1 310 ? -98.655  -1.767  -65.448  1.00 14.88  ? 310  ALA A CB    1 
ATOM   2397  N  N     . LEU A  1 311 ? -96.784  -0.743  -68.036  1.00 30.47  ? 311  LEU A N     1 
ATOM   2398  C  CA    . LEU A  1 311 ? -95.980  -1.156  -69.192  1.00 35.73  ? 311  LEU A CA    1 
ATOM   2399  C  C     . LEU A  1 311 ? -94.956  -0.134  -69.658  1.00 35.89  ? 311  LEU A C     1 
ATOM   2400  O  O     . LEU A  1 311 ? -93.884  -0.503  -70.124  1.00 45.14  ? 311  LEU A O     1 
ATOM   2401  C  CB    . LEU A  1 311 ? -96.881  -1.537  -70.352  1.00 26.18  ? 311  LEU A CB    1 
ATOM   2402  C  CG    . LEU A  1 311 ? -97.797  -2.648  -69.859  1.00 32.81  ? 311  LEU A CG    1 
ATOM   2403  C  CD1   . LEU A  1 311 ? -99.226  -2.329  -70.192  1.00 40.18  ? 311  LEU A CD1   1 
ATOM   2404  C  CD2   . LEU A  1 311 ? -97.361  -3.959  -70.428  1.00 22.84  ? 311  LEU A CD2   1 
ATOM   2405  N  N     . ALA A  1 312 ? -95.291  1.146   -69.536  1.00 30.29  ? 312  ALA A N     1 
ATOM   2406  C  CA    . ALA A  1 312 ? -94.396  2.225   -69.937  1.00 22.60  ? 312  ALA A CA    1 
ATOM   2407  C  C     . ALA A  1 312 ? -93.420  2.637   -68.836  1.00 33.66  ? 312  ALA A C     1 
ATOM   2408  O  O     . ALA A  1 312 ? -92.418  3.291   -69.103  1.00 46.56  ? 312  ALA A O     1 
ATOM   2409  C  CB    . ALA A  1 312 ? -95.206  3.425   -70.378  1.00 26.60  ? 312  ALA A CB    1 
ATOM   2410  N  N     . ASN A  1 313 ? -93.748  2.294   -67.595  1.00 29.58  ? 313  ASN A N     1 
ATOM   2411  C  CA    . ASN A  1 313 ? -92.930  2.612   -66.425  1.00 26.66  ? 313  ASN A CA    1 
ATOM   2412  C  C     . ASN A  1 313 ? -93.024  1.352   -65.575  1.00 29.66  ? 313  ASN A C     1 
ATOM   2413  O  O     . ASN A  1 313 ? -93.534  1.391   -64.461  1.00 37.48  ? 313  ASN A O     1 
ATOM   2414  C  CB    . ASN A  1 313 ? -93.569  3.789   -65.690  1.00 21.54  ? 313  ASN A CB    1 
ATOM   2415  C  CG    . ASN A  1 313 ? -93.798  4.980   -66.604  1.00 27.42  ? 313  ASN A CG    1 
ATOM   2416  O  OD1   . ASN A  1 313 ? -92.986  5.902   -66.665  1.00 53.55  ? 313  ASN A OD1   1 
ATOM   2417  N  ND2   . ASN A  1 313 ? -94.890  4.949   -67.346  1.00 48.13  ? 313  ASN A ND2   1 
ATOM   2418  N  N     . PRO A  1 314 ? -92.431  0.241   -66.058  1.00 26.49  ? 314  PRO A N     1 
ATOM   2419  C  CA    . PRO A  1 314 ? -92.426  -1.081  -65.430  1.00 19.03  ? 314  PRO A CA    1 
ATOM   2420  C  C     . PRO A  1 314 ? -91.504  -1.374  -64.277  1.00 25.43  ? 314  PRO A C     1 
ATOM   2421  O  O     . PRO A  1 314 ? -91.451  -2.516  -63.821  1.00 36.74  ? 314  PRO A O     1 
ATOM   2422  C  CB    . PRO A  1 314 ? -92.108  -1.991  -66.612  1.00 23.04  ? 314  PRO A CB    1 
ATOM   2423  C  CG    . PRO A  1 314 ? -91.037  -1.196  -67.320  1.00 17.50  ? 314  PRO A CG    1 
ATOM   2424  C  CD    . PRO A  1 314 ? -91.520  0.255   -67.224  1.00 24.45  ? 314  PRO A CD    1 
ATOM   2425  N  N     . THR A  1 315 ? -90.790  -0.367  -63.793  1.00 33.60  ? 315  THR A N     1 
ATOM   2426  C  CA    . THR A  1 315 ? -89.847  -0.574  -62.692  1.00 28.42  ? 315  THR A CA    1 
ATOM   2427  C  C     . THR A  1 315 ? -90.177  0.317   -61.510  1.00 26.90  ? 315  THR A C     1 
ATOM   2428  O  O     . THR A  1 315 ? -90.788  1.372   -61.682  1.00 43.09  ? 315  THR A O     1 
ATOM   2429  C  CB    . THR A  1 315 ? -88.402  -0.230  -63.139  1.00 25.40  ? 315  THR A CB    1 
ATOM   2430  O  OG1   . THR A  1 315 ? -88.247  1.193   -63.240  1.00 23.44  ? 315  THR A OG1   1 
ATOM   2431  C  CG2   . THR A  1 315 ? -88.109  -0.831  -64.492  1.00 16.46  ? 315  THR A CG2   1 
ATOM   2432  N  N     . THR A  1 316 ? -89.743  -0.080  -60.319  1.00 23.55  ? 316  THR A N     1 
ATOM   2433  C  CA    . THR A  1 316 ? -89.985  0.750   -59.140  1.00 31.10  ? 316  THR A CA    1 
ATOM   2434  C  C     . THR A  1 316 ? -89.185  2.041   -59.289  1.00 33.26  ? 316  THR A C     1 
ATOM   2435  O  O     . THR A  1 316 ? -89.580  3.098   -58.783  1.00 36.66  ? 316  THR A O     1 
ATOM   2436  C  CB    . THR A  1 316 ? -89.541  0.061   -57.839  1.00 23.56  ? 316  THR A CB    1 
ATOM   2437  O  OG1   . THR A  1 316 ? -88.139  -0.224  -57.892  1.00 39.16  ? 316  THR A OG1   1 
ATOM   2438  C  CG2   . THR A  1 316 ? -90.283  -1.217  -57.652  1.00 28.12  ? 316  THR A CG2   1 
ATOM   2439  N  N     . ASN A  1 317 ? -88.073  1.939   -60.019  1.00 26.32  ? 317  ASN A N     1 
ATOM   2440  C  CA    . ASN A  1 317 ? -87.164  3.062   -60.268  1.00 32.73  ? 317  ASN A CA    1 
ATOM   2441  C  C     . ASN A  1 317 ? -87.853  4.119   -61.125  1.00 28.35  ? 317  ASN A C     1 
ATOM   2442  O  O     . ASN A  1 317 ? -87.616  5.316   -60.953  1.00 37.02  ? 317  ASN A O     1 
ATOM   2443  C  CB    . ASN A  1 317 ? -85.881  2.546   -60.954  1.00 23.19  ? 317  ASN A CB    1 
ATOM   2444  C  CG    . ASN A  1 317 ? -84.768  3.592   -61.035  1.00 29.02  ? 317  ASN A CG    1 
ATOM   2445  O  OD1   . ASN A  1 317 ? -84.344  3.983   -62.125  1.00 31.92  ? 317  ASN A OD1   1 
ATOM   2446  N  ND2   . ASN A  1 317 ? -84.258  4.003   -59.884  1.00 24.88  ? 317  ASN A ND2   1 
ATOM   2447  N  N     . SER A  1 318 ? -88.742  3.668   -62.009  1.00 29.67  ? 318  SER A N     1 
ATOM   2448  C  CA    . SER A  1 318 ? -89.475  4.561   -62.903  1.00 30.61  ? 318  SER A CA    1 
ATOM   2449  C  C     . SER A  1 318 ? -90.203  5.639   -62.127  1.00 34.96  ? 318  SER A C     1 
ATOM   2450  O  O     . SER A  1 318 ? -90.310  6.786   -62.580  1.00 30.86  ? 318  SER A O     1 
ATOM   2451  C  CB    . SER A  1 318 ? -90.515  3.780   -63.692  1.00 24.93  ? 318  SER A CB    1 
ATOM   2452  O  OG    . SER A  1 318 ? -89.921  2.784   -64.489  1.00 23.34  ? 318  SER A OG    1 
ATOM   2453  N  N     . TYR A  1 319 ? -90.720  5.255   -60.950  1.00 32.52  ? 319  TYR A N     1 
ATOM   2454  C  CA    . TYR A  1 319 ? -91.490  6.149   -60.097  1.00 31.96  ? 319  TYR A CA    1 
ATOM   2455  C  C     . TYR A  1 319 ? -90.654  7.165   -59.314  1.00 29.01  ? 319  TYR A C     1 
ATOM   2456  O  O     . TYR A  1 319 ? -91.191  8.023   -58.598  1.00 54.26  ? 319  TYR A O     1 
ATOM   2457  C  CB    . TYR A  1 319 ? -92.413  5.301   -59.214  1.00 27.22  ? 319  TYR A CB    1 
ATOM   2458  C  CG    . TYR A  1 319 ? -93.301  4.546   -60.176  1.00 36.39  ? 319  TYR A CG    1 
ATOM   2459  C  CD1   . TYR A  1 319 ? -94.314  5.211   -60.810  1.00 36.19  ? 319  TYR A CD1   1 
ATOM   2460  C  CD2   . TYR A  1 319 ? -93.068  3.213   -60.474  1.00 33.92  ? 319  TYR A CD2   1 
ATOM   2461  C  CE1   . TYR A  1 319 ? -95.103  4.549   -61.767  1.00 35.58  ? 319  TYR A CE1   1 
ATOM   2462  C  CE2   . TYR A  1 319 ? -93.835  2.557   -61.405  1.00 36.11  ? 319  TYR A CE2   1 
ATOM   2463  C  CZ    . TYR A  1 319 ? -94.843  3.238   -62.065  1.00 29.57  ? 319  TYR A CZ    1 
ATOM   2464  O  OH    . TYR A  1 319 ? -95.572  2.596   -62.975  1.00 33.74  ? 319  TYR A OH    1 
ATOM   2465  N  N     . LYS A  1 320 ? -89.333  7.085   -59.443  1.00 38.75  ? 320  LYS A N     1 
ATOM   2466  C  CA    . LYS A  1 320 ? -88.437  8.032   -58.788  1.00 32.68  ? 320  LYS A CA    1 
ATOM   2467  C  C     . LYS A  1 320 ? -88.129  9.166   -59.760  1.00 33.70  ? 320  LYS A C     1 
ATOM   2468  O  O     . LYS A  1 320 ? -87.550  10.176  -59.381  1.00 33.10  ? 320  LYS A O     1 
ATOM   2469  C  CB    . LYS A  1 320 ? -87.173  7.328   -58.281  1.00 11.98  ? 320  LYS A CB    1 
ATOM   2470  C  CG    . LYS A  1 320 ? -87.519  6.356   -57.152  1.00 22.63  ? 320  LYS A CG    1 
ATOM   2471  C  CD    . LYS A  1 320 ? -86.340  5.631   -56.585  1.00 23.18  ? 320  LYS A CD    1 
ATOM   2472  C  CE    . LYS A  1 320 ? -86.741  4.861   -55.332  1.00 21.39  ? 320  LYS A CE    1 
ATOM   2473  N  NZ    . LYS A  1 320 ? -87.792  3.857   -55.594  1.00 21.97  ? 320  LYS A NZ    1 
ATOM   2474  N  N     . ARG A  1 321 ? -88.542  8.974   -61.016  1.00 35.02  ? 321  ARG A N     1 
ATOM   2475  C  CA    . ARG A  1 321 ? -88.403  9.953   -62.091  1.00 24.44  ? 321  ARG A CA    1 
ATOM   2476  C  C     . ARG A  1 321 ? -89.731  10.729  -62.171  1.00 38.15  ? 321  ARG A C     1 
ATOM   2477  O  O     . ARG A  1 321 ? -89.743  11.956  -62.323  1.00 50.54  ? 321  ARG A O     1 
ATOM   2478  C  CB    . ARG A  1 321 ? -88.183  9.237   -63.425  1.00 29.98  ? 321  ARG A CB    1 
ATOM   2479  C  CG    . ARG A  1 321 ? -88.351  10.154  -64.631  1.00 30.85  ? 321  ARG A CG    1 
ATOM   2480  C  CD    . ARG A  1 321 ? -88.060  9.446   -65.930  1.00 26.99  ? 321  ARG A CD    1 
ATOM   2481  N  NE    . ARG A  1 321 ? -88.486  10.263  -67.058  1.00 31.94  ? 321  ARG A NE    1 
ATOM   2482  C  CZ    . ARG A  1 321 ? -89.614  10.075  -67.728  1.00 35.09  ? 321  ARG A CZ    1 
ATOM   2483  N  NH1   . ARG A  1 321 ? -89.914  10.887  -68.730  1.00 30.18  ? 321  ARG A NH1   1 
ATOM   2484  N  NH2   . ARG A  1 321 ? -90.420  9.060   -67.420  1.00 30.05  ? 321  ARG A NH2   1 
ATOM   2485  N  N     . LEU A  1 322 ? -90.830  9.977   -62.142  1.00 46.69  ? 322  LEU A N     1 
ATOM   2486  C  CA    . LEU A  1 322 ? -92.177  10.522  -62.175  1.00 39.60  ? 322  LEU A CA    1 
ATOM   2487  C  C     . LEU A  1 322 ? -92.500  10.927  -60.736  1.00 54.01  ? 322  LEU A C     1 
ATOM   2488  O  O     . LEU A  1 322 ? -93.292  10.285  -60.028  1.00 55.54  ? 322  LEU A O     1 
ATOM   2489  C  CB    . LEU A  1 322 ? -93.185  9.440   -62.592  1.00 36.06  ? 322  LEU A CB    1 
ATOM   2490  C  CG    . LEU A  1 322 ? -93.024  8.813   -63.958  1.00 28.42  ? 322  LEU A CG    1 
ATOM   2491  C  CD1   . LEU A  1 322 ? -94.062  7.719   -64.115  1.00 40.15  ? 322  LEU A CD1   1 
ATOM   2492  C  CD2   . LEU A  1 322 ? -93.182  9.869   -65.006  1.00 28.80  ? 322  LEU A CD2   1 
ATOM   2493  N  N     . VAL A  1 323 ? -91.831  12.008  -60.322  1.00 56.74  ? 323  VAL A N     1 
ATOM   2494  C  CA    . VAL A  1 323 ? -91.986  12.531  -58.985  1.00 66.57  ? 323  VAL A CA    1 
ATOM   2495  C  C     . VAL A  1 323 ? -92.334  14.019  -59.086  1.00 86.62  ? 323  VAL A C     1 
ATOM   2496  O  O     . VAL A  1 323 ? -91.787  14.734  -59.926  1.00 78.84  ? 323  VAL A O     1 
ATOM   2497  C  CB    . VAL A  1 323 ? -90.715  12.223  -58.171  1.00 62.24  ? 323  VAL A CB    1 
ATOM   2498  C  CG1   . VAL A  1 323 ? -89.799  13.429  -58.168  1.00 65.67  ? 323  VAL A CG1   1 
ATOM   2499  C  CG2   . VAL A  1 323 ? -91.073  11.816  -56.751  1.00 59.94  ? 323  VAL A CG2   1 
ATOM   2500  N  N     . PRO A  1 324 ? -93.233  14.441  -58.212  1.00 100.00 ? 324  PRO A N     1 
ATOM   2501  C  CA    . PRO A  1 324 ? -93.635  15.823  -58.311  1.00 96.20  ? 324  PRO A CA    1 
ATOM   2502  C  C     . PRO A  1 324 ? -92.516  16.802  -58.450  1.00 82.58  ? 324  PRO A C     1 
ATOM   2503  O  O     . PRO A  1 324 ? -92.107  17.457  -57.507  1.00 85.94  ? 324  PRO A O     1 
ATOM   2504  C  CB    . PRO A  1 324 ? -94.685  16.031  -57.230  1.00 97.91  ? 324  PRO A CB    1 
ATOM   2505  C  CG    . PRO A  1 324 ? -95.290  14.637  -57.142  1.00 100.00 ? 324  PRO A CG    1 
ATOM   2506  C  CD    . PRO A  1 324 ? -94.365  13.628  -57.781  1.00 100.00 ? 324  PRO A CD    1 
ATOM   2507  N  N     . GLY A  1 325 ? -92.014  16.912  -59.712  0.73 72.58  ? 325  GLY A N     1 
ATOM   2508  C  CA    . GLY A  1 325 ? -91.077  17.876  -60.129  0.73 70.28  ? 325  GLY A CA    1 
ATOM   2509  C  C     . GLY A  1 325 ? -91.877  18.882  -60.836  0.73 85.96  ? 325  GLY A C     1 
ATOM   2510  O  O     . GLY A  1 325 ? -93.094  18.763  -60.826  0.73 87.71  ? 325  GLY A O     1 
ATOM   2511  N  N     . TYR A  1 326 ? -91.286  19.874  -61.471  0.73 96.17  ? 326  TYR A N     1 
ATOM   2512  C  CA    . TYR A  1 326 ? -92.113  20.833  -62.187  0.73 91.00  ? 326  TYR A CA    1 
ATOM   2513  C  C     . TYR A  1 326 ? -92.113  20.479  -63.673  0.73 87.15  ? 326  TYR A C     1 
ATOM   2514  O  O     . TYR A  1 326 ? -93.065  20.741  -64.416  0.73 88.12  ? 326  TYR A O     1 
ATOM   2515  C  CB    . TYR A  1 326 ? -91.646  22.275  -61.877  0.73 100.00 ? 326  TYR A CB    1 
ATOM   2516  C  CG    . TYR A  1 326 ? -91.138  22.515  -60.461  0.73 100.00 ? 326  TYR A CG    1 
ATOM   2517  C  CD1   . TYR A  1 326 ? -90.329  23.622  -60.155  0.73 100.00 ? 326  TYR A CD1   1 
ATOM   2518  C  CD2   . TYR A  1 326 ? -91.435  21.640  -59.408  0.73 100.00 ? 326  TYR A CD2   1 
ATOM   2519  C  CE1   . TYR A  1 326 ? -89.824  23.815  -58.865  0.73 100.00 ? 326  TYR A CE1   1 
ATOM   2520  C  CE2   . TYR A  1 326 ? -90.942  21.819  -58.133  0.73 100.00 ? 326  TYR A CE2   1 
ATOM   2521  C  CZ    . TYR A  1 326 ? -90.132  22.913  -57.851  0.73 100.00 ? 326  TYR A CZ    1 
ATOM   2522  O  OH    . TYR A  1 326 ? -89.647  23.103  -56.570  0.73 100.00 ? 326  TYR A OH    1 
ATOM   2523  N  N     . GLU A  1 327 ? -91.002  19.868  -64.072  0.73 86.16  ? 327  GLU A N     1 
ATOM   2524  C  CA    . GLU A  1 327 ? -90.774  19.428  -65.441  0.73 88.60  ? 327  GLU A CA    1 
ATOM   2525  C  C     . GLU A  1 327 ? -91.286  17.995  -65.581  0.73 85.66  ? 327  GLU A C     1 
ATOM   2526  O  O     . GLU A  1 327 ? -91.593  17.545  -66.694  0.73 89.98  ? 327  GLU A O     1 
ATOM   2527  C  CB    . GLU A  1 327 ? -89.270  19.490  -65.776  0.73 99.20  ? 327  GLU A CB    1 
ATOM   2528  C  CG    . GLU A  1 327 ? -88.607  20.886  -65.598  0.73 96.80  ? 327  GLU A CG    1 
ATOM   2529  C  CD    . GLU A  1 327 ? -88.936  21.930  -66.709  0.73 100.00 ? 327  GLU A CD    1 
ATOM   2530  O  OE1   . GLU A  1 327 ? -88.119  22.872  -66.862  0.73 100.00 ? 327  GLU A OE1   1 
ATOM   2531  O  OE2   . GLU A  1 327 ? -89.983  21.840  -67.414  0.73 100.00 ? 327  GLU A OE2   1 
ATOM   2532  N  N     . ALA A  1 328 ? -91.374  17.294  -64.445  0.73 85.89  ? 328  ALA A N     1 
ATOM   2533  C  CA    . ALA A  1 328 ? -91.845  15.908  -64.393  0.73 87.08  ? 328  ALA A CA    1 
ATOM   2534  C  C     . ALA A  1 328 ? -93.276  15.808  -64.933  0.73 79.24  ? 328  ALA A C     1 
ATOM   2535  O  O     . ALA A  1 328 ? -94.228  16.344  -64.349  0.73 69.40  ? 328  ALA A O     1 
ATOM   2536  C  CB    . ALA A  1 328 ? -91.755  15.363  -62.969  0.73 87.06  ? 328  ALA A CB    1 
ATOM   2537  N  N     . PRO A  1 329 ? -93.429  15.132  -66.082  1.00 66.56  ? 329  PRO A N     1 
ATOM   2538  C  CA    . PRO A  1 329 ? -94.691  14.916  -66.791  1.00 63.71  ? 329  PRO A CA    1 
ATOM   2539  C  C     . PRO A  1 329 ? -95.632  13.951  -66.081  1.00 64.97  ? 329  PRO A C     1 
ATOM   2540  O  O     . PRO A  1 329 ? -95.852  12.838  -66.559  1.00 66.13  ? 329  PRO A O     1 
ATOM   2541  C  CB    . PRO A  1 329 ? -94.216  14.351  -68.125  1.00 62.29  ? 329  PRO A CB    1 
ATOM   2542  C  CG    . PRO A  1 329 ? -93.057  13.511  -67.709  1.00 63.99  ? 329  PRO A CG    1 
ATOM   2543  C  CD    . PRO A  1 329 ? -92.324  14.418  -66.753  1.00 69.38  ? 329  PRO A CD    1 
ATOM   2544  N  N     . VAL A  1 330 ? -96.239  14.399  -64.982  1.00 60.80  ? 330  VAL A N     1 
ATOM   2545  C  CA    . VAL A  1 330 ? -97.144  13.541  -64.210  1.00 56.14  ? 330  VAL A CA    1 
ATOM   2546  C  C     . VAL A  1 330 ? -98.639  13.858  -64.287  1.00 54.32  ? 330  VAL A C     1 
ATOM   2547  O  O     . VAL A  1 330 ? -99.469  13.050  -63.869  1.00 44.01  ? 330  VAL A O     1 
ATOM   2548  C  CB    . VAL A  1 330 ? -96.739  13.494  -62.715  1.00 52.76  ? 330  VAL A CB    1 
ATOM   2549  C  CG1   . VAL A  1 330 ? -95.309  13.043  -62.588  1.00 50.55  ? 330  VAL A CG1   1 
ATOM   2550  C  CG2   . VAL A  1 330 ? -96.928  14.851  -62.050  1.00 45.11  ? 330  VAL A CG2   1 
ATOM   2551  N  N     . MET A  1 331 ? -98.980  15.028  -64.815  1.00 56.53  ? 331  MET A N     1 
ATOM   2552  C  CA    . MET A  1 331 ? -100.371 15.441  -64.911  1.00 47.78  ? 331  MET A CA    1 
ATOM   2553  C  C     . MET A  1 331 ? -101.009 14.908  -66.177  1.00 52.41  ? 331  MET A C     1 
ATOM   2554  O  O     . MET A  1 331 ? -100.514 15.160  -67.274  1.00 55.61  ? 331  MET A O     1 
ATOM   2555  C  CB    . MET A  1 331 ? -100.468 16.968  -64.895  1.00 76.42  ? 331  MET A CB    1 
ATOM   2556  C  CG    . MET A  1 331 ? -99.666  17.642  -63.778  1.00 100.00 ? 331  MET A CG    1 
ATOM   2557  S  SD    . MET A  1 331 ? -100.478 17.737  -62.157  1.00 100.00 ? 331  MET A SD    1 
ATOM   2558  C  CE    . MET A  1 331 ? -101.428 19.246  -62.420  1.00 100.00 ? 331  MET A CE    1 
ATOM   2559  N  N     . LEU A  1 332 ? -102.113 14.181  -66.008  1.00 47.45  ? 332  LEU A N     1 
ATOM   2560  C  CA    . LEU A  1 332 ? -102.876 13.595  -67.111  1.00 54.67  ? 332  LEU A CA    1 
ATOM   2561  C  C     . LEU A  1 332 ? -103.723 14.641  -67.846  1.00 63.39  ? 332  LEU A C     1 
ATOM   2562  O  O     . LEU A  1 332 ? -104.954 14.682  -67.711  1.00 70.42  ? 332  LEU A O     1 
ATOM   2563  C  CB    . LEU A  1 332 ? -103.776 12.475  -66.576  1.00 62.06  ? 332  LEU A CB    1 
ATOM   2564  C  CG    . LEU A  1 332 ? -103.337 11.012  -66.685  1.00 56.37  ? 332  LEU A CG    1 
ATOM   2565  C  CD1   . LEU A  1 332 ? -101.832 10.879  -66.610  1.00 44.40  ? 332  LEU A CD1   1 
ATOM   2566  C  CD2   . LEU A  1 332 ? -104.038 10.181  -65.604  1.00 59.25  ? 332  LEU A CD2   1 
ATOM   2567  N  N     . ALA A  1 333 ? -103.048 15.464  -68.643  1.00 65.02  ? 333  ALA A N     1 
ATOM   2568  C  CA    . ALA A  1 333 ? -103.688 16.520  -69.416  1.00 71.64  ? 333  ALA A CA    1 
ATOM   2569  C  C     . ALA A  1 333 ? -102.878 16.779  -70.679  1.00 68.77  ? 333  ALA A C     1 
ATOM   2570  O  O     . ALA A  1 333 ? -101.721 16.364  -70.778  1.00 75.88  ? 333  ALA A O     1 
ATOM   2571  C  CB    . ALA A  1 333 ? -103.767 17.788  -68.586  1.00 69.73  ? 333  ALA A CB    1 
ATOM   2572  N  N     . TYR A  1 334 ? -103.485 17.450  -71.652  1.00 60.67  ? 334  TYR A N     1 
ATOM   2573  C  CA    . TYR A  1 334 ? -102.779 17.762  -72.890  1.00 53.44  ? 334  TYR A CA    1 
ATOM   2574  C  C     . TYR A  1 334 ? -102.576 19.266  -73.054  1.00 51.34  ? 334  TYR A C     1 
ATOM   2575  O  O     . TYR A  1 334 ? -103.362 20.057  -72.538  1.00 70.15  ? 334  TYR A O     1 
ATOM   2576  C  CB    . TYR A  1 334 ? -103.499 17.163  -74.100  1.00 54.01  ? 334  TYR A CB    1 
ATOM   2577  C  CG    . TYR A  1 334 ? -104.895 17.686  -74.369  1.00 67.86  ? 334  TYR A CG    1 
ATOM   2578  C  CD1   . TYR A  1 334 ? -105.980 17.289  -73.580  1.00 78.04  ? 334  TYR A CD1   1 
ATOM   2579  C  CD2   . TYR A  1 334 ? -105.147 18.517  -75.467  1.00 70.78  ? 334  TYR A CD2   1 
ATOM   2580  C  CE1   . TYR A  1 334 ? -107.277 17.701  -73.883  1.00 79.18  ? 334  TYR A CE1   1 
ATOM   2581  C  CE2   . TYR A  1 334 ? -106.440 18.933  -75.781  1.00 69.40  ? 334  TYR A CE2   1 
ATOM   2582  C  CZ    . TYR A  1 334 ? -107.499 18.519  -74.987  1.00 77.43  ? 334  TYR A CZ    1 
ATOM   2583  O  OH    . TYR A  1 334 ? -108.773 18.912  -75.309  1.00 76.84  ? 334  TYR A OH    1 
ATOM   2584  N  N     . SER A  1 335 ? -101.492 19.653  -73.727  1.00 42.26  ? 335  SER A N     1 
ATOM   2585  C  CA    . SER A  1 335 ? -101.157 21.065  -73.962  1.00 54.94  ? 335  SER A CA    1 
ATOM   2586  C  C     . SER A  1 335 ? -100.026 21.211  -74.976  1.00 59.73  ? 335  SER A C     1 
ATOM   2587  O  O     . SER A  1 335 ? -99.186  20.326  -75.112  1.00 72.80  ? 335  SER A O     1 
ATOM   2588  C  CB    . SER A  1 335 ? -100.754 21.771  -72.659  1.00 45.07  ? 335  SER A CB    1 
ATOM   2589  O  OG    . SER A  1 335 ? -100.228 23.072  -72.916  1.00 61.31  ? 335  SER A OG    1 
ATOM   2590  N  N     . ALA A  1 336 ? -99.995  22.345  -75.666  1.00 62.97  ? 336  ALA A N     1 
ATOM   2591  C  CA    . ALA A  1 336 ? -98.966  22.597  -76.663  1.00 65.41  ? 336  ALA A CA    1 
ATOM   2592  C  C     . ALA A  1 336 ? -97.757  23.275  -76.042  1.00 66.17  ? 336  ALA A C     1 
ATOM   2593  O  O     . ALA A  1 336 ? -96.646  23.214  -76.583  1.00 72.97  ? 336  ALA A O     1 
ATOM   2594  C  CB    . ALA A  1 336 ? -99.526  23.452  -77.773  1.00 61.70  ? 336  ALA A CB    1 
ATOM   2595  N  N     . ARG A  1 337 ? -97.975  23.871  -74.875  1.00 63.10  ? 337  ARG A N     1 
ATOM   2596  C  CA    . ARG A  1 337 ? -96.919  24.587  -74.187  1.00 82.05  ? 337  ARG A CA    1 
ATOM   2597  C  C     . ARG A  1 337 ? -96.602  24.081  -72.787  1.00 90.84  ? 337  ARG A C     1 
ATOM   2598  O  O     . ARG A  1 337 ? -95.436  23.808  -72.479  1.00 100.00 ? 337  ARG A O     1 
ATOM   2599  C  CB    . ARG A  1 337 ? -97.263  26.070  -74.124  1.00 87.39  ? 337  ARG A CB    1 
ATOM   2600  C  CG    . ARG A  1 337 ? -98.577  26.353  -73.422  1.00 100.00 ? 337  ARG A CG    1 
ATOM   2601  C  CD    . ARG A  1 337 ? -99.563  26.974  -74.385  1.00 100.00 ? 337  ARG A CD    1 
ATOM   2602  N  NE    . ARG A  1 337 ? -99.874  28.358  -74.024  1.00 100.00 ? 337  ARG A NE    1 
ATOM   2603  C  CZ    . ARG A  1 337 ? -100.705 29.151  -74.703  1.00 100.00 ? 337  ARG A CZ    1 
ATOM   2604  N  NH1   . ARG A  1 337 ? -101.322 28.708  -75.800  1.00 100.00 ? 337  ARG A NH1   1 
ATOM   2605  N  NH2   . ARG A  1 337 ? -100.942 30.384  -74.264  1.00 100.00 ? 337  ARG A NH2   1 
ATOM   2606  N  N     . ASN A  1 338 ? -97.624  23.963  -71.941  1.00 72.97  ? 338  ASN A N     1 
ATOM   2607  C  CA    . ASN A  1 338 ? -97.420  23.517  -70.569  1.00 76.68  ? 338  ASN A CA    1 
ATOM   2608  C  C     . ASN A  1 338 ? -96.592  22.241  -70.467  1.00 80.91  ? 338  ASN A C     1 
ATOM   2609  O  O     . ASN A  1 338 ? -96.900  21.235  -71.109  1.00 78.38  ? 338  ASN A O     1 
ATOM   2610  C  CB    . ASN A  1 338 ? -98.749  23.334  -69.858  1.00 83.67  ? 338  ASN A CB    1 
ATOM   2611  C  CG    . ASN A  1 338 ? -98.590  23.287  -68.359  1.00 100.00 ? 338  ASN A CG    1 
ATOM   2612  O  OD1   . ASN A  1 338 ? -97.806  24.060  -67.785  1.00 100.00 ? 338  ASN A OD1   1 
ATOM   2613  N  ND2   . ASN A  1 338 ? -99.318  22.375  -67.707  1.00 96.96  ? 338  ASN A ND2   1 
ATOM   2614  N  N     . ARG A  1 339 ? -95.542  22.296  -69.650  1.00 89.28  ? 339  ARG A N     1 
ATOM   2615  C  CA    . ARG A  1 339 ? -94.641  21.162  -69.487  1.00 96.75  ? 339  ARG A CA    1 
ATOM   2616  C  C     . ARG A  1 339 ? -94.997  20.218  -68.350  1.00 93.23  ? 339  ARG A C     1 
ATOM   2617  O  O     . ARG A  1 339 ? -94.393  19.152  -68.201  1.00 99.58  ? 339  ARG A O     1 
ATOM   2618  C  CB    . ARG A  1 339 ? -93.186  21.642  -69.389  1.00 100.00 ? 339  ARG A CB    1 
ATOM   2619  C  CG    . ARG A  1 339 ? -92.207  20.771  -70.201  1.00 100.00 ? 339  ARG A CG    1 
ATOM   2620  C  CD    . ARG A  1 339 ? -92.815  20.330  -71.556  1.00 100.00 ? 339  ARG A CD    1 
ATOM   2621  N  NE    . ARG A  1 339 ? -93.023  21.427  -72.509  1.00 100.00 ? 339  ARG A NE    1 
ATOM   2622  C  CZ    . ARG A  1 339 ? -92.054  21.973  -73.244  1.00 100.00 ? 339  ARG A CZ    1 
ATOM   2623  N  NH1   . ARG A  1 339 ? -90.801  21.534  -73.127  1.00 100.00 ? 339  ARG A NH1   1 
ATOM   2624  N  NH2   . ARG A  1 339 ? -92.344  22.899  -74.157  1.00 100.00 ? 339  ARG A NH2   1 
ATOM   2625  N  N     . SER A  1 340 ? -95.993  20.606  -67.565  1.00 91.90  ? 340  SER A N     1 
ATOM   2626  C  CA    . SER A  1 340 ? -96.476  19.781  -66.460  1.00 96.86  ? 340  SER A CA    1 
ATOM   2627  C  C     . SER A  1 340 ? -97.324  18.685  -67.094  1.00 97.05  ? 340  SER A C     1 
ATOM   2628  O  O     . SER A  1 340 ? -97.509  17.603  -66.528  1.00 97.66  ? 340  SER A O     1 
ATOM   2629  C  CB    . SER A  1 340 ? -97.367  20.609  -65.544  1.00 90.42  ? 340  SER A CB    1 
ATOM   2630  O  OG    . SER A  1 340 ? -97.247  21.981  -65.864  1.00 100.00 ? 340  SER A OG    1 
ATOM   2631  N  N     . ALA A  1 341 ? -97.834  19.002  -68.283  1.00 95.93  ? 341  ALA A N     1 
ATOM   2632  C  CA    . ALA A  1 341 ? -98.685  18.119  -69.070  1.00 77.47  ? 341  ALA A CA    1 
ATOM   2633  C  C     . ALA A  1 341 ? -97.934  16.912  -69.592  1.00 69.33  ? 341  ALA A C     1 
ATOM   2634  O  O     . ALA A  1 341 ? -96.920  17.047  -70.282  1.00 69.23  ? 341  ALA A O     1 
ATOM   2635  C  CB    . ALA A  1 341 ? -99.289  18.890  -70.227  1.00 82.40  ? 341  ALA A CB    1 
ATOM   2636  N  N     . SER A  1 342 ? -98.444  15.729  -69.274  1.00 48.36  ? 342  SER A N     1 
ATOM   2637  C  CA    . SER A  1 342 ? -97.807  14.507  -69.731  1.00 45.71  ? 342  SER A CA    1 
ATOM   2638  C  C     . SER A  1 342 ? -98.049  14.217  -71.213  1.00 50.98  ? 342  SER A C     1 
ATOM   2639  O  O     . SER A  1 342 ? -97.540  13.235  -71.755  1.00 58.83  ? 342  SER A O     1 
ATOM   2640  C  CB    . SER A  1 342 ? -98.176  13.320  -68.842  1.00 35.07  ? 342  SER A CB    1 
ATOM   2641  O  OG    . SER A  1 342 ? -99.560  13.252  -68.615  1.00 52.95  ? 342  SER A OG    1 
ATOM   2642  N  N     . ILE A  1 343 ? -98.803  15.092  -71.876  1.00 51.01  ? 343  ILE A N     1 
ATOM   2643  C  CA    . ILE A  1 343 ? -99.050  14.944  -73.306  1.00 39.07  ? 343  ILE A CA    1 
ATOM   2644  C  C     . ILE A  1 343 ? -98.855  16.286  -73.983  1.00 38.49  ? 343  ILE A C     1 
ATOM   2645  O  O     . ILE A  1 343 ? -99.676  17.182  -73.833  1.00 47.48  ? 343  ILE A O     1 
ATOM   2646  C  CB    . ILE A  1 343 ? -100.453 14.452  -73.605  1.00 36.79  ? 343  ILE A CB    1 
ATOM   2647  C  CG1   . ILE A  1 343 ? -100.792 13.284  -72.682  1.00 31.80  ? 343  ILE A CG1   1 
ATOM   2648  C  CG2   . ILE A  1 343 ? -100.545 14.042  -75.066  1.00 35.80  ? 343  ILE A CG2   1 
ATOM   2649  C  CD1   . ILE A  1 343 ? -101.899 12.424  -73.181  1.00 22.70  ? 343  ILE A CD1   1 
ATOM   2650  N  N     . ARG A  1 344 ? -97.730  16.434  -74.671  1.00 41.27  ? 344  ARG A N     1 
ATOM   2651  C  CA    . ARG A  1 344 ? -97.405  17.667  -75.377  1.00 43.81  ? 344  ARG A CA    1 
ATOM   2652  C  C     . ARG A  1 344 ? -97.920  17.549  -76.804  1.00 53.97  ? 344  ARG A C     1 
ATOM   2653  O  O     . ARG A  1 344 ? -97.937  16.460  -77.386  1.00 49.54  ? 344  ARG A O     1 
ATOM   2654  C  CB    . ARG A  1 344 ? -95.882  17.906  -75.399  1.00 42.30  ? 344  ARG A CB    1 
ATOM   2655  C  CG    . ARG A  1 344 ? -95.421  19.279  -74.873  1.00 83.26  ? 344  ARG A CG    1 
ATOM   2656  C  CD    . ARG A  1 344 ? -95.086  20.274  -76.003  1.00 100.00 ? 344  ARG A CD    1 
ATOM   2657  N  NE    . ARG A  1 344 ? -93.646  20.466  -76.218  1.00 100.00 ? 344  ARG A NE    1 
ATOM   2658  C  CZ    . ARG A  1 344 ? -92.856  19.657  -76.931  1.00 100.00 ? 344  ARG A CZ    1 
ATOM   2659  N  NH1   . ARG A  1 344 ? -93.345  18.566  -77.519  1.00 85.26  ? 344  ARG A NH1   1 
ATOM   2660  N  NH2   . ARG A  1 344 ? -91.568  19.960  -77.086  1.00 100.00 ? 344  ARG A NH2   1 
ATOM   2661  N  N     . ILE A  1 345 ? -98.419  18.661  -77.330  1.00 58.91  ? 345  ILE A N     1 
ATOM   2662  C  CA    . ILE A  1 345 ? -98.897  18.700  -78.697  1.00 48.85  ? 345  ILE A CA    1 
ATOM   2663  C  C     . ILE A  1 345 ? -97.870  19.540  -79.439  1.00 56.84  ? 345  ILE A C     1 
ATOM   2664  O  O     . ILE A  1 345 ? -97.729  20.750  -79.205  1.00 58.40  ? 345  ILE A O     1 
ATOM   2665  C  CB    . ILE A  1 345 ? -100.280 19.344  -78.825  1.00 50.40  ? 345  ILE A CB    1 
ATOM   2666  C  CG1   . ILE A  1 345 ? -101.268 18.699  -77.846  1.00 45.47  ? 345  ILE A CG1   1 
ATOM   2667  C  CG2   . ILE A  1 345 ? -100.777 19.197  -80.257  1.00 45.87  ? 345  ILE A CG2   1 
ATOM   2668  C  CD1   . ILE A  1 345 ? -101.531 17.232  -78.083  1.00 52.97  ? 345  ILE A CD1   1 
ATOM   2669  N  N     . PRO A  1 346 ? -97.057  18.877  -80.265  1.00 59.92  ? 346  PRO A N     1 
ATOM   2670  C  CA    . PRO A  1 346 ? -96.022  19.552  -81.044  1.00 64.33  ? 346  PRO A CA    1 
ATOM   2671  C  C     . PRO A  1 346 ? -96.654  20.610  -81.926  1.00 79.69  ? 346  PRO A C     1 
ATOM   2672  O  O     . PRO A  1 346 ? -97.556  20.326  -82.722  1.00 83.00  ? 346  PRO A O     1 
ATOM   2673  C  CB    . PRO A  1 346 ? -95.443  18.421  -81.888  1.00 61.06  ? 346  PRO A CB    1 
ATOM   2674  C  CG    . PRO A  1 346 ? -95.652  17.215  -81.032  1.00 51.66  ? 346  PRO A CG    1 
ATOM   2675  C  CD    . PRO A  1 346 ? -97.036  17.424  -80.497  1.00 54.47  ? 346  PRO A CD    1 
ATOM   2676  N  N     . VAL A  1 347 ? -96.255  21.851  -81.717  1.00 83.83  ? 347  VAL A N     1 
ATOM   2677  C  CA    . VAL A  1 347 ? -96.781  22.914  -82.548  1.00 77.93  ? 347  VAL A CA    1 
ATOM   2678  C  C     . VAL A  1 347 ? -95.974  22.805  -83.842  1.00 77.38  ? 347  VAL A C     1 
ATOM   2679  O  O     . VAL A  1 347 ? -94.755  23.023  -83.855  1.00 79.61  ? 347  VAL A O     1 
ATOM   2680  C  CB    . VAL A  1 347 ? -96.603  24.259  -81.856  1.00 84.55  ? 347  VAL A CB    1 
ATOM   2681  C  CG1   . VAL A  1 347 ? -97.049  25.382  -82.767  1.00 82.27  ? 347  VAL A CG1   1 
ATOM   2682  C  CG2   . VAL A  1 347 ? -97.409  24.263  -80.565  1.00 67.23  ? 347  VAL A CG2   1 
ATOM   2683  N  N     . VAL A  1 348 ? -96.640  22.400  -84.918  1.00 65.19  ? 348  VAL A N     1 
ATOM   2684  C  CA    . VAL A  1 348 ? -95.924  22.210  -86.169  1.00 80.21  ? 348  VAL A CA    1 
ATOM   2685  C  C     . VAL A  1 348 ? -96.590  22.763  -87.432  1.00 89.00  ? 348  VAL A C     1 
ATOM   2686  O  O     . VAL A  1 348 ? -97.822  22.777  -87.557  1.00 73.13  ? 348  VAL A O     1 
ATOM   2687  C  CB    . VAL A  1 348 ? -95.570  20.715  -86.351  1.00 73.68  ? 348  VAL A CB    1 
ATOM   2688  C  CG1   . VAL A  1 348 ? -96.842  19.893  -86.575  1.00 48.69  ? 348  VAL A CG1   1 
ATOM   2689  C  CG2   . VAL A  1 348 ? -94.558  20.537  -87.480  1.00 82.03  ? 348  VAL A CG2   1 
ATOM   2690  N  N     . ALA A  1 349 ? -95.735  23.188  -88.367  1.00 98.27  ? 349  ALA A N     1 
ATOM   2691  C  CA    . ALA A  1 349 ? -96.116  23.772  -89.654  1.00 93.33  ? 349  ALA A CA    1 
ATOM   2692  C  C     . ALA A  1 349 ? -97.057  22.911  -90.501  1.00 88.66  ? 349  ALA A C     1 
ATOM   2693  O  O     . ALA A  1 349 ? -98.260  23.187  -90.592  1.00 70.89  ? 349  ALA A O     1 
ATOM   2694  C  CB    . ALA A  1 349 ? -94.843  24.109  -90.461  1.00 95.06  ? 349  ALA A CB    1 
ATOM   2695  N  N     . SER A  1 350 ? -96.493  21.874  -91.116  1.00 78.27  ? 350  SER A N     1 
ATOM   2696  C  CA    . SER A  1 350 ? -97.235  20.967  -91.983  1.00 70.98  ? 350  SER A CA    1 
ATOM   2697  C  C     . SER A  1 350 ? -98.259  20.062  -91.299  1.00 68.73  ? 350  SER A C     1 
ATOM   2698  O  O     . SER A  1 350 ? -97.976  19.463  -90.268  1.00 68.83  ? 350  SER A O     1 
ATOM   2699  C  CB    . SER A  1 350 ? -96.248  20.102  -92.769  1.00 69.91  ? 350  SER A CB    1 
ATOM   2700  O  OG    . SER A  1 350 ? -96.912  19.058  -93.464  1.00 78.99  ? 350  SER A OG    1 
ATOM   2701  N  N     . PRO A  1 351 ? -99.479  19.973  -91.856  1.00 75.76  ? 351  PRO A N     1 
ATOM   2702  C  CA    . PRO A  1 351 ? -100.512 19.113  -91.269  1.00 77.51  ? 351  PRO A CA    1 
ATOM   2703  C  C     . PRO A  1 351 ? -100.069 17.652  -91.362  1.00 72.93  ? 351  PRO A C     1 
ATOM   2704  O  O     . PRO A  1 351 ? -100.504 16.810  -90.580  1.00 69.07  ? 351  PRO A O     1 
ATOM   2705  C  CB    . PRO A  1 351 ? -101.722 19.378  -92.167  1.00 66.02  ? 351  PRO A CB    1 
ATOM   2706  C  CG    . PRO A  1 351 ? -101.539 20.800  -92.534  1.00 81.22  ? 351  PRO A CG    1 
ATOM   2707  C  CD    . PRO A  1 351 ? -100.067 20.845  -92.887  1.00 84.67  ? 351  PRO A CD    1 
ATOM   2708  N  N     . LYS A  1 352 ? -99.192  17.368  -92.321  1.00 69.95  ? 352  LYS A N     1 
ATOM   2709  C  CA    . LYS A  1 352 ? -98.673  16.021  -92.530  1.00 77.66  ? 352  LYS A CA    1 
ATOM   2710  C  C     . LYS A  1 352 ? -97.946  15.474  -91.290  1.00 72.29  ? 352  LYS A C     1 
ATOM   2711  O  O     . LYS A  1 352 ? -97.962  14.267  -91.033  1.00 64.99  ? 352  LYS A O     1 
ATOM   2712  C  CB    . LYS A  1 352 ? -97.748  16.003  -93.764  1.00 77.09  ? 352  LYS A CB    1 
ATOM   2713  C  CG    . LYS A  1 352 ? -98.400  15.427  -95.029  1.00 93.89  ? 352  LYS A CG    1 
ATOM   2714  C  CD    . LYS A  1 352 ? -98.542  13.893  -94.926  1.00 100.00 ? 352  LYS A CD    1 
ATOM   2715  C  CE    . LYS A  1 352 ? -99.792  13.347  -95.645  1.00 100.00 ? 352  LYS A CE    1 
ATOM   2716  N  NZ    . LYS A  1 352 ? -101.089 13.560  -94.904  1.00 89.85  ? 352  LYS A NZ    1 
ATOM   2717  N  N     . ALA A  1 353 ? -97.403  16.382  -90.482  1.00 64.65  ? 353  ALA A N     1 
ATOM   2718  C  CA    . ALA A  1 353 ? -96.648  16.026  -89.284  1.00 57.09  ? 353  ALA A CA    1 
ATOM   2719  C  C     . ALA A  1 353 ? -97.343  16.253  -87.948  1.00 57.14  ? 353  ALA A C     1 
ATOM   2720  O  O     . ALA A  1 353 ? -96.685  16.336  -86.915  1.00 68.61  ? 353  ALA A O     1 
ATOM   2721  C  CB    . ALA A  1 353 ? -95.325  16.763  -89.287  1.00 60.90  ? 353  ALA A CB    1 
ATOM   2722  N  N     . ARG A  1 354 ? -98.662  16.359  -87.954  1.00 58.54  ? 354  ARG A N     1 
ATOM   2723  C  CA    . ARG A  1 354 ? -99.373  16.579  -86.709  1.00 55.80  ? 354  ARG A CA    1 
ATOM   2724  C  C     . ARG A  1 354 ? -99.462  15.273  -85.916  1.00 57.78  ? 354  ARG A C     1 
ATOM   2725  O  O     . ARG A  1 354 ? -99.706  14.207  -86.489  1.00 56.13  ? 354  ARG A O     1 
ATOM   2726  C  CB    . ARG A  1 354 ? -100.755 17.168  -86.987  1.00 58.25  ? 354  ARG A CB    1 
ATOM   2727  C  CG    . ARG A  1 354 ? -101.272 17.968  -85.821  1.00 82.34  ? 354  ARG A CG    1 
ATOM   2728  C  CD    . ARG A  1 354 ? -101.881 19.285  -86.245  1.00 85.95  ? 354  ARG A CD    1 
ATOM   2729  N  NE    . ARG A  1 354 ? -100.956 20.195  -86.908  1.00 83.39  ? 354  ARG A NE    1 
ATOM   2730  C  CZ    . ARG A  1 354 ? -101.274 20.892  -87.996  1.00 89.32  ? 354  ARG A CZ    1 
ATOM   2731  N  NH1   . ARG A  1 354 ? -102.486 20.766  -88.530  1.00 80.61  ? 354  ARG A NH1   1 
ATOM   2732  N  NH2   . ARG A  1 354 ? -100.391 21.718  -88.543  1.00 86.25  ? 354  ARG A NH2   1 
ATOM   2733  N  N     . ARG A  1 355 ? -99.276  15.368  -84.598  1.00 61.65  ? 355  ARG A N     1 
ATOM   2734  C  CA    . ARG A  1 355 ? -99.287  14.191  -83.717  1.00 46.85  ? 355  ARG A CA    1 
ATOM   2735  C  C     . ARG A  1 355 ? -99.346  14.595  -82.243  1.00 44.06  ? 355  ARG A C     1 
ATOM   2736  O  O     . ARG A  1 355 ? -99.456  15.774  -81.916  1.00 49.13  ? 355  ARG A O     1 
ATOM   2737  C  CB    . ARG A  1 355 ? -97.972  13.451  -83.919  1.00 54.08  ? 355  ARG A CB    1 
ATOM   2738  C  CG    . ARG A  1 355 ? -96.777  14.321  -83.501  1.00 48.50  ? 355  ARG A CG    1 
ATOM   2739  C  CD    . ARG A  1 355 ? -95.506  13.899  -84.182  1.00 43.80  ? 355  ARG A CD    1 
ATOM   2740  N  NE    . ARG A  1 355 ? -94.848  15.025  -84.840  1.00 63.45  ? 355  ARG A NE    1 
ATOM   2741  C  CZ    . ARG A  1 355 ? -93.715  15.582  -84.426  1.00 52.85  ? 355  ARG A CZ    1 
ATOM   2742  N  NH1   . ARG A  1 355 ? -93.100  15.129  -83.343  1.00 67.31  ? 355  ARG A NH1   1 
ATOM   2743  N  NH2   . ARG A  1 355 ? -93.168  16.562  -85.128  1.00 60.89  ? 355  ARG A NH2   1 
ATOM   2744  N  N     . ILE A  1 356 ? -99.232  13.608  -81.360  1.00 41.51  ? 356  ILE A N     1 
ATOM   2745  C  CA    . ILE A  1 356 ? -99.200  13.858  -79.917  1.00 47.22  ? 356  ILE A CA    1 
ATOM   2746  C  C     . ILE A  1 356 ? -97.933  13.218  -79.329  1.00 49.04  ? 356  ILE A C     1 
ATOM   2747  O  O     . ILE A  1 356 ? -97.395  12.272  -79.903  1.00 50.90  ? 356  ILE A O     1 
ATOM   2748  C  CB    . ILE A  1 356 ? -100.414 13.263  -79.206  1.00 36.38  ? 356  ILE A CB    1 
ATOM   2749  C  CG1   . ILE A  1 356 ? -100.398 11.743  -79.323  1.00 37.30  ? 356  ILE A CG1   1 
ATOM   2750  C  CG2   . ILE A  1 356 ? -101.683 13.815  -79.800  1.00 42.32  ? 356  ILE A CG2   1 
ATOM   2751  C  CD1   . ILE A  1 356 ? -101.445 11.087  -78.469  1.00 36.45  ? 356  ILE A CD1   1 
ATOM   2752  N  N     . GLU A  1 357 ? -97.443  13.748  -78.208  1.00 47.95  ? 357  GLU A N     1 
ATOM   2753  C  CA    . GLU A  1 357 ? -96.251  13.202  -77.551  1.00 37.80  ? 357  GLU A CA    1 
ATOM   2754  C  C     . GLU A  1 357 ? -96.586  12.810  -76.120  1.00 34.13  ? 357  GLU A C     1 
ATOM   2755  O  O     . GLU A  1 357 ? -96.844  13.674  -75.286  1.00 30.77  ? 357  GLU A O     1 
ATOM   2756  C  CB    . GLU A  1 357 ? -95.119  14.232  -77.522  1.00 27.91  ? 357  GLU A CB    1 
ATOM   2757  C  CG    . GLU A  1 357 ? -93.778  13.654  -77.120  1.00 26.11  ? 357  GLU A CG    1 
ATOM   2758  C  CD    . GLU A  1 357 ? -92.757  14.711  -76.700  1.00 40.64  ? 357  GLU A CD    1 
ATOM   2759  O  OE1   . GLU A  1 357 ? -93.141  15.692  -76.042  1.00 46.02  ? 357  GLU A OE1   1 
ATOM   2760  O  OE2   . GLU A  1 357 ? -91.557  14.561  -77.005  1.00 43.36  ? 357  GLU A OE2   1 
ATOM   2761  N  N     . VAL A  1 358 ? -96.667  11.509  -75.853  1.00 42.12  ? 358  VAL A N     1 
ATOM   2762  C  CA    . VAL A  1 358 ? -96.954  11.041  -74.498  1.00 41.17  ? 358  VAL A CA    1 
ATOM   2763  C  C     . VAL A  1 358 ? -95.601  10.981  -73.800  1.00 48.02  ? 358  VAL A C     1 
ATOM   2764  O  O     . VAL A  1 358 ? -94.774  10.112  -74.084  1.00 49.25  ? 358  VAL A O     1 
ATOM   2765  C  CB    . VAL A  1 358 ? -97.635  9.670   -74.495  1.00 33.52  ? 358  VAL A CB    1 
ATOM   2766  C  CG1   . VAL A  1 358 ? -97.968  9.257   -73.084  1.00 35.16  ? 358  VAL A CG1   1 
ATOM   2767  C  CG2   . VAL A  1 358 ? -98.906  9.733   -75.286  1.00 44.48  ? 358  VAL A CG2   1 
ATOM   2768  N  N     . ARG A  1 359 ? -95.389  11.898  -72.865  1.00 45.25  ? 359  ARG A N     1 
ATOM   2769  C  CA    . ARG A  1 359 ? -94.090  12.075  -72.225  1.00 48.79  ? 359  ARG A CA    1 
ATOM   2770  C  C     . ARG A  1 359 ? -93.754  11.181  -71.006  1.00 39.38  ? 359  ARG A C     1 
ATOM   2771  O  O     . ARG A  1 359 ? -92.609  11.199  -70.548  1.00 56.24  ? 359  ARG A O     1 
ATOM   2772  C  CB    . ARG A  1 359 ? -93.941  13.547  -71.793  1.00 41.50  ? 359  ARG A CB    1 
ATOM   2773  C  CG    . ARG A  1 359 ? -93.822  14.520  -72.957  1.00 29.89  ? 359  ARG A CG    1 
ATOM   2774  C  CD    . ARG A  1 359 ? -93.844  15.971  -72.488  1.00 37.65  ? 359  ARG A CD    1 
ATOM   2775  N  NE    . ARG A  1 359 ? -92.661  16.324  -71.712  1.00 85.10  ? 359  ARG A NE    1 
ATOM   2776  C  CZ    . ARG A  1 359 ? -91.605  16.962  -72.212  1.00 99.20  ? 359  ARG A CZ    1 
ATOM   2777  N  NH1   . ARG A  1 359 ? -91.584  17.320  -73.494  1.00 99.69  ? 359  ARG A NH1   1 
ATOM   2778  N  NH2   . ARG A  1 359 ? -90.570  17.247  -71.429  1.00 100.00 ? 359  ARG A NH2   1 
ATOM   2779  N  N     . PHE A  1 360 ? -94.712  10.409  -70.453  1.00 31.61  ? 360  PHE A N     1 
ATOM   2780  C  CA    . PHE A  1 360 ? -94.346  9.703   -69.213  1.00 31.17  ? 360  PHE A CA    1 
ATOM   2781  C  C     . PHE A  1 360 ? -93.550  8.392   -69.315  1.00 37.79  ? 360  PHE A C     1 
ATOM   2782  O  O     . PHE A  1 360 ? -92.912  7.990   -68.344  1.00 40.39  ? 360  PHE A O     1 
ATOM   2783  C  CB    . PHE A  1 360 ? -95.603  9.520   -68.340  1.00 33.08  ? 360  PHE A CB    1 
ATOM   2784  C  CG    . PHE A  1 360 ? -96.728  8.715   -68.928  1.00 35.80  ? 360  PHE A CG    1 
ATOM   2785  C  CD1   . PHE A  1 360 ? -97.881  9.342   -69.393  1.00 38.18  ? 360  PHE A CD1   1 
ATOM   2786  C  CD2   . PHE A  1 360 ? -96.648  7.330   -69.016  1.00 35.41  ? 360  PHE A CD2   1 
ATOM   2787  C  CE1   . PHE A  1 360 ? -98.935  8.599   -69.938  1.00 26.79  ? 360  PHE A CE1   1 
ATOM   2788  C  CE2   . PHE A  1 360 ? -97.697  6.580   -69.559  1.00 40.08  ? 360  PHE A CE2   1 
ATOM   2789  C  CZ    . PHE A  1 360 ? -98.841  7.216   -70.019  1.00 29.34  ? 360  PHE A CZ    1 
ATOM   2790  N  N     . PRO A  1 361 ? -93.586  7.716   -70.475  1.00 33.91  ? 361  PRO A N     1 
ATOM   2791  C  CA    . PRO A  1 361 ? -92.786  6.460   -70.634  1.00 32.67  ? 361  PRO A CA    1 
ATOM   2792  C  C     . PRO A  1 361 ? -91.293  6.616   -70.375  1.00 34.12  ? 361  PRO A C     1 
ATOM   2793  O  O     . PRO A  1 361 ? -90.724  7.682   -70.582  1.00 29.01  ? 361  PRO A O     1 
ATOM   2794  C  CB    . PRO A  1 361 ? -93.183  5.957   -71.999  1.00 33.98  ? 361  PRO A CB    1 
ATOM   2795  C  CG    . PRO A  1 361 ? -94.641  6.321   -72.034  1.00 36.93  ? 361  PRO A CG    1 
ATOM   2796  C  CD    . PRO A  1 361 ? -94.890  7.445   -71.073  1.00 47.21  ? 361  PRO A CD    1 
ATOM   2797  N  N     . ASP A  1 362 ? -90.637  5.549   -69.934  1.00 31.33  ? 362  ASP A N     1 
ATOM   2798  C  CA    . ASP A  1 362 ? -89.190  5.565   -69.787  1.00 28.39  ? 362  ASP A CA    1 
ATOM   2799  C  C     . ASP A  1 362 ? -88.597  4.384   -70.564  1.00 26.68  ? 362  ASP A C     1 
ATOM   2800  O  O     . ASP A  1 362 ? -89.307  3.467   -70.956  1.00 24.87  ? 362  ASP A O     1 
ATOM   2801  C  CB    . ASP A  1 362 ? -88.760  5.610   -68.305  1.00 24.08  ? 362  ASP A CB    1 
ATOM   2802  C  CG    . ASP A  1 362 ? -89.205  4.406   -67.520  1.00 35.13  ? 362  ASP A CG    1 
ATOM   2803  O  OD1   . ASP A  1 362 ? -88.814  3.281   -67.894  1.00 20.32  ? 362  ASP A OD1   1 
ATOM   2804  O  OD2   . ASP A  1 362 ? -89.917  4.591   -66.507  1.00 21.19  ? 362  ASP A OD2   1 
ATOM   2805  N  N     . PRO A  1 363 ? -87.284  4.387   -70.787  1.00 29.74  ? 363  PRO A N     1 
ATOM   2806  C  CA    . PRO A  1 363 ? -86.616  3.318   -71.534  1.00 17.25  ? 363  PRO A CA    1 
ATOM   2807  C  C     . PRO A  1 363 ? -86.650  1.885   -70.978  1.00 29.19  ? 363  PRO A C     1 
ATOM   2808  O  O     . PRO A  1 363 ? -86.263  0.941   -71.683  1.00 27.12  ? 363  PRO A O     1 
ATOM   2809  C  CB    . PRO A  1 363 ? -85.178  3.837   -71.646  1.00 25.98  ? 363  PRO A CB    1 
ATOM   2810  C  CG    . PRO A  1 363 ? -85.316  5.322   -71.489  1.00 29.53  ? 363  PRO A CG    1 
ATOM   2811  C  CD    . PRO A  1 363 ? -86.318  5.425   -70.394  1.00 27.78  ? 363  PRO A CD    1 
ATOM   2812  N  N     . ALA A  1 364 ? -87.074  1.712   -69.726  1.00 22.32  ? 364  ALA A N     1 
ATOM   2813  C  CA    . ALA A  1 364 ? -87.123  0.375   -69.116  1.00 19.27  ? 364  ALA A CA    1 
ATOM   2814  C  C     . ALA A  1 364 ? -88.309  -0.419  -69.628  1.00 25.06  ? 364  ALA A C     1 
ATOM   2815  O  O     . ALA A  1 364 ? -88.415  -1.633  -69.432  1.00 38.75  ? 364  ALA A O     1 
ATOM   2816  C  CB    . ALA A  1 364 ? -87.188  0.485   -67.603  1.00 17.37  ? 364  ALA A CB    1 
ATOM   2817  N  N     . ALA A  1 365 ? -89.214  0.304   -70.262  1.00 28.69  ? 365  ALA A N     1 
ATOM   2818  C  CA    . ALA A  1 365 ? -90.421  -0.252  -70.817  1.00 24.71  ? 365  ALA A CA    1 
ATOM   2819  C  C     . ALA A  1 365 ? -90.141  -1.206  -71.957  1.00 31.03  ? 365  ALA A C     1 
ATOM   2820  O  O     . ALA A  1 365 ? -89.261  -0.965  -72.784  1.00 28.25  ? 365  ALA A O     1 
ATOM   2821  C  CB    . ALA A  1 365 ? -91.294  0.876   -71.321  1.00 18.95  ? 365  ALA A CB    1 
ATOM   2822  N  N     . ASN A  1 366 ? -90.898  -2.293  -71.992  1.00 32.32  ? 366  ASN A N     1 
ATOM   2823  C  CA    . ASN A  1 366 ? -90.792  -3.256  -73.079  1.00 30.56  ? 366  ASN A CA    1 
ATOM   2824  C  C     . ASN A  1 366 ? -91.416  -2.475  -74.232  1.00 29.58  ? 366  ASN A C     1 
ATOM   2825  O  O     . ASN A  1 366 ? -92.615  -2.194  -74.208  1.00 35.32  ? 366  ASN A O     1 
ATOM   2826  C  CB    . ASN A  1 366 ? -91.640  -4.480  -72.756  1.00 27.73  ? 366  ASN A CB    1 
ATOM   2827  C  CG    . ASN A  1 366 ? -91.599  -5.506  -73.839  1.00 29.42  ? 366  ASN A CG    1 
ATOM   2828  O  OD1   . ASN A  1 366 ? -91.526  -5.171  -75.024  1.00 30.19  ? 366  ASN A OD1   1 
ATOM   2829  N  ND2   . ASN A  1 366 ? -91.633  -6.775  -73.447  1.00 25.88  ? 366  ASN A ND2   1 
ATOM   2830  N  N     . PRO A  1 367 ? -90.620  -2.113  -75.251  1.00 25.67  ? 367  PRO A N     1 
ATOM   2831  C  CA    . PRO A  1 367 ? -91.191  -1.344  -76.365  1.00 28.84  ? 367  PRO A CA    1 
ATOM   2832  C  C     . PRO A  1 367 ? -92.463  -1.932  -76.982  1.00 33.94  ? 367  PRO A C     1 
ATOM   2833  O  O     . PRO A  1 367 ? -93.423  -1.209  -77.224  1.00 44.37  ? 367  PRO A O     1 
ATOM   2834  C  CB    . PRO A  1 367 ? -90.026  -1.246  -77.354  1.00 21.90  ? 367  PRO A CB    1 
ATOM   2835  C  CG    . PRO A  1 367 ? -89.245  -2.497  -77.087  1.00 30.71  ? 367  PRO A CG    1 
ATOM   2836  C  CD    . PRO A  1 367 ? -89.257  -2.563  -75.572  1.00 28.59  ? 367  PRO A CD    1 
ATOM   2837  N  N     . TYR A  1 368 ? -92.506  -3.246  -77.152  1.00 30.27  ? 368  TYR A N     1 
ATOM   2838  C  CA    . TYR A  1 368 ? -93.679  -3.886  -77.731  1.00 27.95  ? 368  TYR A CA    1 
ATOM   2839  C  C     . TYR A  1 368 ? -94.920  -3.712  -76.876  1.00 31.36  ? 368  TYR A C     1 
ATOM   2840  O  O     . TYR A  1 368 ? -95.905  -3.131  -77.316  1.00 36.28  ? 368  TYR A O     1 
ATOM   2841  C  CB    . TYR A  1 368 ? -93.418  -5.362  -77.954  1.00 25.54  ? 368  TYR A CB    1 
ATOM   2842  C  CG    . TYR A  1 368 ? -92.225  -5.629  -78.833  1.00 35.45  ? 368  TYR A CG    1 
ATOM   2843  C  CD1   . TYR A  1 368 ? -91.039  -6.115  -78.291  1.00 24.27  ? 368  TYR A CD1   1 
ATOM   2844  C  CD2   . TYR A  1 368 ? -92.284  -5.417  -80.211  1.00 35.33  ? 368  TYR A CD2   1 
ATOM   2845  C  CE1   . TYR A  1 368 ? -89.934  -6.387  -79.096  1.00 25.52  ? 368  TYR A CE1   1 
ATOM   2846  C  CE2   . TYR A  1 368 ? -91.180  -5.684  -81.031  1.00 41.35  ? 368  TYR A CE2   1 
ATOM   2847  C  CZ    . TYR A  1 368 ? -90.009  -6.172  -80.461  1.00 30.25  ? 368  TYR A CZ    1 
ATOM   2848  O  OH    . TYR A  1 368 ? -88.907  -6.446  -81.237  1.00 29.97  ? 368  TYR A OH    1 
ATOM   2849  N  N     . LEU A  1 369 ? -94.866  -4.197  -75.643  1.00 37.12  ? 369  LEU A N     1 
ATOM   2850  C  CA    . LEU A  1 369 ? -96.006  -4.080  -74.743  1.00 26.90  ? 369  LEU A CA    1 
ATOM   2851  C  C     . LEU A  1 369 ? -96.398  -2.624  -74.437  1.00 27.39  ? 369  LEU A C     1 
ATOM   2852  O  O     . LEU A  1 369 ? -97.574  -2.300  -74.323  1.00 39.99  ? 369  LEU A O     1 
ATOM   2853  C  CB    . LEU A  1 369 ? -95.719  -4.818  -73.440  1.00 22.60  ? 369  LEU A CB    1 
ATOM   2854  C  CG    . LEU A  1 369 ? -95.210  -6.257  -73.516  1.00 33.81  ? 369  LEU A CG    1 
ATOM   2855  C  CD1   . LEU A  1 369 ? -95.213  -6.851  -72.114  1.00 22.62  ? 369  LEU A CD1   1 
ATOM   2856  C  CD2   . LEU A  1 369 ? -96.075  -7.093  -74.436  1.00 31.63  ? 369  LEU A CD2   1 
ATOM   2857  N  N     . CYS A  1 370 ? -95.412  -1.753  -74.292  1.00 29.07  ? 370  CYS A N     1 
ATOM   2858  C  CA    . CYS A  1 370 ? -95.679  -0.352  -74.001  1.00 24.95  ? 370  CYS A CA    1 
ATOM   2859  C  C     . CYS A  1 370 ? -96.364  0.311   -75.190  1.00 30.73  ? 370  CYS A C     1 
ATOM   2860  O  O     . CYS A  1 370 ? -97.389  0.963   -75.025  1.00 38.56  ? 370  CYS A O     1 
ATOM   2861  C  CB    . CYS A  1 370 ? -94.376  0.367   -73.674  1.00 34.08  ? 370  CYS A CB    1 
ATOM   2862  S  SG    . CYS A  1 370 ? -94.526  2.150   -73.539  1.00 30.85  ? 370  CYS A SG    1 
ATOM   2863  N  N     . PHE A  1 371 ? -95.800  0.138   -76.385  1.00 29.50  ? 371  PHE A N     1 
ATOM   2864  C  CA    . PHE A  1 371 ? -96.383  0.713   -77.603  1.00 34.99  ? 371  PHE A CA    1 
ATOM   2865  C  C     . PHE A  1 371 ? -97.787  0.197   -77.858  1.00 33.42  ? 371  PHE A C     1 
ATOM   2866  O  O     . PHE A  1 371 ? -98.697  0.968   -78.129  1.00 40.65  ? 371  PHE A O     1 
ATOM   2867  C  CB    . PHE A  1 371 ? -95.529  0.399   -78.823  1.00 24.38  ? 371  PHE A CB    1 
ATOM   2868  C  CG    . PHE A  1 371 ? -94.201  1.073   -78.815  1.00 35.67  ? 371  PHE A CG    1 
ATOM   2869  C  CD1   . PHE A  1 371 ? -93.309  0.868   -79.859  1.00 35.09  ? 371  PHE A CD1   1 
ATOM   2870  C  CD2   . PHE A  1 371 ? -93.831  1.903   -77.755  1.00 34.22  ? 371  PHE A CD2   1 
ATOM   2871  C  CE1   . PHE A  1 371 ? -92.063  1.481   -79.856  1.00 45.08  ? 371  PHE A CE1   1 
ATOM   2872  C  CE2   . PHE A  1 371 ? -92.595  2.520   -77.740  1.00 23.57  ? 371  PHE A CE2   1 
ATOM   2873  C  CZ    . PHE A  1 371 ? -91.705  2.307   -78.794  1.00 26.54  ? 371  PHE A CZ    1 
ATOM   2874  N  N     . ALA A  1 372 ? -97.948  -1.117  -77.796  1.00 30.48  ? 372  ALA A N     1 
ATOM   2875  C  CA    . ALA A  1 372 ? -99.248  -1.740  -77.990  1.00 38.26  ? 372  ALA A CA    1 
ATOM   2876  C  C     . ALA A  1 372 ? -100.277 -1.170  -77.002  1.00 35.10  ? 372  ALA A C     1 
ATOM   2877  O  O     . ALA A  1 372 ? -101.369 -0.781  -77.405  1.00 55.02  ? 372  ALA A O     1 
ATOM   2878  C  CB    . ALA A  1 372 ? -99.135  -3.260  -77.820  1.00 23.95  ? 372  ALA A CB    1 
ATOM   2879  N  N     . ALA A  1 373 ? -99.908  -1.080  -75.726  1.00 36.15  ? 373  ALA A N     1 
ATOM   2880  C  CA    . ALA A  1 373 ? -100.810 -0.564  -74.694  1.00 37.19  ? 373  ALA A CA    1 
ATOM   2881  C  C     . ALA A  1 373 ? -101.236 0.872   -74.971  1.00 39.12  ? 373  ALA A C     1 
ATOM   2882  O  O     . ALA A  1 373 ? -102.381 1.250   -74.734  1.00 57.64  ? 373  ALA A O     1 
ATOM   2883  C  CB    . ALA A  1 373 ? -100.163 -0.662  -73.322  1.00 29.84  ? 373  ALA A CB    1 
ATOM   2884  N  N     . LEU A  1 374 ? -100.302 1.678   -75.455  1.00 45.55  ? 374  LEU A N     1 
ATOM   2885  C  CA    . LEU A  1 374 ? -100.595 3.062   -75.776  1.00 40.08  ? 374  LEU A CA    1 
ATOM   2886  C  C     . LEU A  1 374 ? -101.682 3.095   -76.864  1.00 43.82  ? 374  LEU A C     1 
ATOM   2887  O  O     . LEU A  1 374 ? -102.696 3.771   -76.711  1.00 48.28  ? 374  LEU A O     1 
ATOM   2888  C  CB    . LEU A  1 374 ? -99.319  3.749   -76.265  1.00 48.03  ? 374  LEU A CB    1 
ATOM   2889  C  CG    . LEU A  1 374 ? -98.641  4.860   -75.455  1.00 43.65  ? 374  LEU A CG    1 
ATOM   2890  C  CD1   . LEU A  1 374 ? -99.377  5.182   -74.185  1.00 30.80  ? 374  LEU A CD1   1 
ATOM   2891  C  CD2   . LEU A  1 374 ? -97.235  4.443   -75.166  1.00 31.97  ? 374  LEU A CD2   1 
ATOM   2892  N  N     . LEU A  1 375 ? -101.482 2.303   -77.918  1.00 46.82  ? 375  LEU A N     1 
ATOM   2893  C  CA    . LEU A  1 375 ? -102.404 2.193   -79.054  1.00 41.24  ? 375  LEU A CA    1 
ATOM   2894  C  C     . LEU A  1 375 ? -103.790 1.738   -78.625  1.00 44.70  ? 375  LEU A C     1 
ATOM   2895  O  O     . LEU A  1 375 ? -104.779 2.419   -78.879  1.00 55.61  ? 375  LEU A O     1 
ATOM   2896  C  CB    . LEU A  1 375 ? -101.882 1.166   -80.054  1.00 32.29  ? 375  LEU A CB    1 
ATOM   2897  C  CG    . LEU A  1 375 ? -102.107 1.385   -81.551  1.00 46.25  ? 375  LEU A CG    1 
ATOM   2898  C  CD1   . LEU A  1 375 ? -102.248 0.032   -82.221  1.00 19.90  ? 375  LEU A CD1   1 
ATOM   2899  C  CD2   . LEU A  1 375 ? -103.323 2.240   -81.821  1.00 33.56  ? 375  LEU A CD2   1 
ATOM   2900  N  N     . MET A  1 376 ? -103.855 0.558   -78.016  1.00 36.69  ? 376  MET A N     1 
ATOM   2901  C  CA    . MET A  1 376 ? -105.113 -0.014  -77.554  1.00 41.25  ? 376  MET A CA    1 
ATOM   2902  C  C     . MET A  1 376 ? -105.935 0.943   -76.702  1.00 46.03  ? 376  MET A C     1 
ATOM   2903  O  O     . MET A  1 376 ? -107.169 0.909   -76.736  1.00 65.29  ? 376  MET A O     1 
ATOM   2904  C  CB    . MET A  1 376 ? -104.850 -1.300  -76.788  1.00 33.19  ? 376  MET A CB    1 
ATOM   2905  C  CG    . MET A  1 376 ? -104.168 -2.381  -77.614  1.00 47.05  ? 376  MET A CG    1 
ATOM   2906  S  SD    . MET A  1 376 ? -105.121 -3.007  -79.013  1.00 39.65  ? 376  MET A SD    1 
ATOM   2907  C  CE    . MET A  1 376 ? -106.354 -3.982  -78.145  1.00 42.57  ? 376  MET A CE    1 
ATOM   2908  N  N     . ALA A  1 377 ? -105.248 1.778   -75.931  1.00 42.24  ? 377  ALA A N     1 
ATOM   2909  C  CA    . ALA A  1 377 ? -105.899 2.772   -75.083  1.00 50.05  ? 377  ALA A CA    1 
ATOM   2910  C  C     . ALA A  1 377 ? -106.445 3.887   -75.964  1.00 47.50  ? 377  ALA A C     1 
ATOM   2911  O  O     . ALA A  1 377 ? -107.555 4.364   -75.754  1.00 59.20  ? 377  ALA A O     1 
ATOM   2912  C  CB    . ALA A  1 377 ? -104.905 3.345   -74.070  1.00 44.81  ? 377  ALA A CB    1 
ATOM   2913  N  N     . GLY A  1 378 ? -105.648 4.304   -76.943  1.00 42.94  ? 378  GLY A N     1 
ATOM   2914  C  CA    . GLY A  1 378 ? -106.065 5.354   -77.853  1.00 48.03  ? 378  GLY A CA    1 
ATOM   2915  C  C     . GLY A  1 378 ? -107.260 4.920   -78.680  1.00 54.90  ? 378  GLY A C     1 
ATOM   2916  O  O     . GLY A  1 378 ? -108.183 5.701   -78.902  1.00 67.71  ? 378  GLY A O     1 
ATOM   2917  N  N     . LEU A  1 379 ? -107.250 3.665   -79.119  1.00 53.27  ? 379  LEU A N     1 
ATOM   2918  C  CA    . LEU A  1 379 ? -108.342 3.112   -79.915  1.00 52.03  ? 379  LEU A CA    1 
ATOM   2919  C  C     . LEU A  1 379 ? -109.626 3.011   -79.098  1.00 54.50  ? 379  LEU A C     1 
ATOM   2920  O  O     . LEU A  1 379 ? -110.714 3.206   -79.624  1.00 63.86  ? 379  LEU A O     1 
ATOM   2921  C  CB    . LEU A  1 379 ? -107.969 1.736   -80.477  1.00 35.43  ? 379  LEU A CB    1 
ATOM   2922  C  CG    . LEU A  1 379 ? -106.822 1.683   -81.494  1.00 48.32  ? 379  LEU A CG    1 
ATOM   2923  C  CD1   . LEU A  1 379 ? -106.740 0.282   -82.082  1.00 24.92  ? 379  LEU A CD1   1 
ATOM   2924  C  CD2   . LEU A  1 379 ? -107.008 2.731   -82.609  1.00 27.18  ? 379  LEU A CD2   1 
ATOM   2925  N  N     . ASP A  1 380 ? -109.495 2.698   -77.813  1.00 49.01  ? 380  ASP A N     1 
ATOM   2926  C  CA    . ASP A  1 380 ? -110.654 2.601   -76.941  1.00 36.92  ? 380  ASP A CA    1 
ATOM   2927  C  C     . ASP A  1 380 ? -111.195 4.009   -76.707  1.00 44.17  ? 380  ASP A C     1 
ATOM   2928  O  O     . ASP A  1 380 ? -112.341 4.188   -76.314  1.00 61.04  ? 380  ASP A O     1 
ATOM   2929  C  CB    . ASP A  1 380 ? -110.259 1.956   -75.617  1.00 46.65  ? 380  ASP A CB    1 
ATOM   2930  C  CG    . ASP A  1 380 ? -111.439 1.746   -74.694  1.00 54.00  ? 380  ASP A CG    1 
ATOM   2931  O  OD1   . ASP A  1 380 ? -112.173 0.744   -74.880  1.00 63.98  ? 380  ASP A OD1   1 
ATOM   2932  O  OD2   . ASP A  1 380 ? -111.627 2.586   -73.786  1.00 50.18  ? 380  ASP A OD2   1 
ATOM   2933  N  N     . GLY A  1 381 ? -110.351 5.007   -76.937  1.00 51.69  ? 381  GLY A N     1 
ATOM   2934  C  CA    . GLY A  1 381 ? -110.773 6.385   -76.766  1.00 50.05  ? 381  GLY A CA    1 
ATOM   2935  C  C     . GLY A  1 381 ? -111.580 6.802   -77.975  1.00 55.78  ? 381  GLY A C     1 
ATOM   2936  O  O     . GLY A  1 381 ? -112.547 7.546   -77.865  1.00 60.49  ? 381  GLY A O     1 
ATOM   2937  N  N     . ILE A  1 382 ? -111.163 6.306   -79.134  1.00 52.11  ? 382  ILE A N     1 
ATOM   2938  C  CA    . ILE A  1 382 ? -111.821 6.574   -80.403  1.00 51.90  ? 382  ILE A CA    1 
ATOM   2939  C  C     . ILE A  1 382 ? -113.128 5.783   -80.526  1.00 60.19  ? 382  ILE A C     1 
ATOM   2940  O  O     . ILE A  1 382 ? -114.191 6.368   -80.752  1.00 62.82  ? 382  ILE A O     1 
ATOM   2941  C  CB    . ILE A  1 382 ? -110.870 6.233   -81.565  1.00 47.94  ? 382  ILE A CB    1 
ATOM   2942  C  CG1   . ILE A  1 382 ? -109.853 7.359   -81.741  1.00 52.06  ? 382  ILE A CG1   1 
ATOM   2943  C  CG2   . ILE A  1 382 ? -111.637 5.956   -82.842  1.00 55.89  ? 382  ILE A CG2   1 
ATOM   2944  C  CD1   . ILE A  1 382 ? -108.716 6.997   -82.661  1.00 45.18  ? 382  ILE A CD1   1 
ATOM   2945  N  N     . LYS A  1 383 ? -113.053 4.460   -80.368  1.00 62.18  ? 383  LYS A N     1 
ATOM   2946  C  CA    . LYS A  1 383 ? -114.247 3.613   -80.447  1.00 59.78  ? 383  LYS A CA    1 
ATOM   2947  C  C     . LYS A  1 383 ? -115.344 4.176   -79.560  1.00 59.90  ? 383  LYS A C     1 
ATOM   2948  O  O     . LYS A  1 383 ? -116.513 4.160   -79.934  1.00 77.12  ? 383  LYS A O     1 
ATOM   2949  C  CB    . LYS A  1 383 ? -113.964 2.167   -79.992  1.00 58.66  ? 383  LYS A CB    1 
ATOM   2950  C  CG    . LYS A  1 383 ? -113.289 1.220   -80.996  1.00 75.61  ? 383  LYS A CG    1 
ATOM   2951  C  CD    . LYS A  1 383 ? -113.714 -0.249  -80.770  1.00 85.87  ? 383  LYS A CD    1 
ATOM   2952  C  CE    . LYS A  1 383 ? -113.754 -0.646  -79.281  1.00 98.75  ? 383  LYS A CE    1 
ATOM   2953  N  NZ    . LYS A  1 383 ? -112.424 -0.605  -78.587  1.00 95.31  ? 383  LYS A NZ    1 
ATOM   2954  N  N     . ASN A  1 384 ? -114.957 4.723   -78.408  1.00 46.53  ? 384  ASN A N     1 
ATOM   2955  C  CA    . ASN A  1 384 ? -115.919 5.269   -77.435  1.00 48.04  ? 384  ASN A CA    1 
ATOM   2956  C  C     . ASN A  1 384 ? -115.958 6.799   -77.310  1.00 56.04  ? 384  ASN A C     1 
ATOM   2957  O  O     . ASN A  1 384 ? -116.407 7.325   -76.286  1.00 52.89  ? 384  ASN A O     1 
ATOM   2958  C  CB    . ASN A  1 384 ? -115.685 4.651   -76.044  1.00 39.72  ? 384  ASN A CB    1 
ATOM   2959  C  CG    . ASN A  1 384 ? -115.838 3.138   -76.025  1.00 56.59  ? 384  ASN A CG    1 
ATOM   2960  O  OD1   . ASN A  1 384 ? -116.379 2.589   -75.068  1.00 69.93  ? 384  ASN A OD1   1 
ATOM   2961  N  ND2   . ASN A  1 384 ? -115.377 2.462   -77.066  1.00 71.20  ? 384  ASN A ND2   1 
ATOM   2962  N  N     . LYS A  1 385 ? -115.486 7.509   -78.334  1.00 58.45  ? 385  LYS A N     1 
ATOM   2963  C  CA    . LYS A  1 385 ? -115.509 8.988   -78.348  1.00 67.80  ? 385  LYS A CA    1 
ATOM   2964  C  C     . LYS A  1 385 ? -115.235 9.631   -76.969  1.00 68.05  ? 385  LYS A C     1 
ATOM   2965  O  O     . LYS A  1 385 ? -115.997 10.492  -76.536  1.00 69.65  ? 385  LYS A O     1 
ATOM   2966  C  CB    . LYS A  1 385 ? -116.873 9.477   -78.863  1.00 76.67  ? 385  LYS A CB    1 
ATOM   2967  C  CG    . LYS A  1 385 ? -117.456 8.680   -80.047  1.00 83.99  ? 385  LYS A CG    1 
ATOM   2968  C  CD    . LYS A  1 385 ? -117.404 9.462   -81.360  1.00 95.68  ? 385  LYS A CD    1 
ATOM   2969  C  CE    . LYS A  1 385 ? -117.512 8.531   -82.570  1.00 100.00 ? 385  LYS A CE    1 
ATOM   2970  N  NZ    . LYS A  1 385 ? -116.191 8.023   -83.076  1.00 100.00 ? 385  LYS A NZ    1 
ATOM   2971  N  N     . ILE A  1 386 ? -114.202 9.178   -76.281  1.00 73.01  ? 386  ILE A N     1 
ATOM   2972  C  CA    . ILE A  1 386 ? -113.878 9.720   -74.953  1.00 66.33  ? 386  ILE A CA    1 
ATOM   2973  C  C     . ILE A  1 386 ? -113.268 11.103  -75.075  1.00 65.59  ? 386  ILE A C     1 
ATOM   2974  O  O     . ILE A  1 386 ? -112.124 11.250  -75.480  1.00 57.43  ? 386  ILE A O     1 
ATOM   2975  C  CB    . ILE A  1 386 ? -112.890 8.814   -74.189  1.00 52.91  ? 386  ILE A CB    1 
ATOM   2976  C  CG1   . ILE A  1 386 ? -113.366 7.355   -74.234  1.00 46.25  ? 386  ILE A CG1   1 
ATOM   2977  C  CG2   . ILE A  1 386 ? -112.738 9.293   -72.754  1.00 41.49  ? 386  ILE A CG2   1 
ATOM   2978  C  CD1   . ILE A  1 386 ? -112.512 6.367   -73.504  1.00 50.20  ? 386  ILE A CD1   1 
ATOM   2979  N  N     . HIS A  1 387 ? -114.040 12.131  -74.702  1.00 66.77  ? 387  HIS A N     1 
ATOM   2980  C  CA    . HIS A  1 387 ? -113.524 13.470  -74.800  1.00 66.34  ? 387  HIS A CA    1 
ATOM   2981  C  C     . HIS A  1 387 ? -112.464 13.699  -73.727  1.00 64.07  ? 387  HIS A C     1 
ATOM   2982  O  O     . HIS A  1 387 ? -112.669 13.409  -72.536  1.00 59.75  ? 387  HIS A O     1 
ATOM   2983  C  CB    . HIS A  1 387 ? -114.632 14.540  -74.713  1.00 75.08  ? 387  HIS A CB    1 
ATOM   2984  C  CG    . HIS A  1 387 ? -114.244 15.838  -75.346  1.00 72.33  ? 387  HIS A CG    1 
ATOM   2985  N  ND1   . HIS A  1 387 ? -113.745 16.892  -74.615  1.00 74.14  ? 387  HIS A ND1   1 
ATOM   2986  C  CD2   . HIS A  1 387 ? -114.203 16.220  -76.644  1.00 80.53  ? 387  HIS A CD2   1 
ATOM   2987  C  CE1   . HIS A  1 387 ? -113.404 17.868  -75.439  1.00 80.97  ? 387  HIS A CE1   1 
ATOM   2988  N  NE2   . HIS A  1 387 ? -113.671 17.486  -76.675  1.00 88.55  ? 387  HIS A NE2   1 
ATOM   2989  N  N     . PRO A  1 388 ? -111.279 14.157  -74.161  1.00 53.75  ? 388  PRO A N     1 
ATOM   2990  C  CA    . PRO A  1 388 ? -110.115 14.443  -73.321  1.00 59.10  ? 388  PRO A CA    1 
ATOM   2991  C  C     . PRO A  1 388 ? -110.293 15.684  -72.470  1.00 63.62  ? 388  PRO A C     1 
ATOM   2992  O  O     . PRO A  1 388 ? -109.353 16.140  -71.815  1.00 75.00  ? 388  PRO A O     1 
ATOM   2993  C  CB    . PRO A  1 388 ? -109.009 14.653  -74.353  1.00 56.30  ? 388  PRO A CB    1 
ATOM   2994  C  CG    . PRO A  1 388 ? -109.722 15.285  -75.475  1.00 47.93  ? 388  PRO A CG    1 
ATOM   2995  C  CD    . PRO A  1 388 ? -110.964 14.418  -75.574  1.00 51.47  ? 388  PRO A CD    1 
ATOM   2996  N  N     . GLY A  1 389 ? -111.501 16.235  -72.490  1.00 67.91  ? 389  GLY A N     1 
ATOM   2997  C  CA    . GLY A  1 389 ? -111.757 17.442  -71.736  1.00 68.88  ? 389  GLY A CA    1 
ATOM   2998  C  C     . GLY A  1 389 ? -111.052 18.619  -72.384  1.00 67.88  ? 389  GLY A C     1 
ATOM   2999  O  O     . GLY A  1 389 ? -110.737 18.595  -73.573  1.00 64.86  ? 389  GLY A O     1 
ATOM   3000  N  N     . GLU A  1 390 ? -110.770 19.634  -71.584  1.00 70.47  ? 390  GLU A N     1 
ATOM   3001  C  CA    . GLU A  1 390 ? -110.121 20.835  -72.072  1.00 72.87  ? 390  GLU A CA    1 
ATOM   3002  C  C     . GLU A  1 390 ? -108.608 20.778  -71.821  1.00 80.59  ? 390  GLU A C     1 
ATOM   3003  O  O     . GLU A  1 390 ? -108.142 20.086  -70.905  1.00 94.76  ? 390  GLU A O     1 
ATOM   3004  C  CB    . GLU A  1 390 ? -110.759 22.049  -71.371  1.00 82.39  ? 390  GLU A CB    1 
ATOM   3005  C  CG    . GLU A  1 390 ? -110.977 23.285  -72.248  1.00 91.75  ? 390  GLU A CG    1 
ATOM   3006  C  CD    . GLU A  1 390 ? -111.778 23.001  -73.519  1.00 100.00 ? 390  GLU A CD    1 
ATOM   3007  O  OE1   . GLU A  1 390 ? -112.756 22.217  -73.471  1.00 95.31  ? 390  GLU A OE1   1 
ATOM   3008  O  OE2   . GLU A  1 390 ? -111.427 23.571  -74.576  1.00 100.00 ? 390  GLU A OE2   1 
ATOM   3009  N  N     . PRO A  1 391 ? -107.817 21.442  -72.682  1.00 79.74  ? 391  PRO A N     1 
ATOM   3010  C  CA    . PRO A  1 391 ? -106.354 21.476  -72.548  1.00 78.33  ? 391  PRO A CA    1 
ATOM   3011  C  C     . PRO A  1 391 ? -105.938 22.208  -71.275  1.00 74.90  ? 391  PRO A C     1 
ATOM   3012  O  O     . PRO A  1 391 ? -106.663 23.073  -70.783  1.00 75.31  ? 391  PRO A O     1 
ATOM   3013  C  CB    . PRO A  1 391 ? -105.913 22.255  -73.786  1.00 71.85  ? 391  PRO A CB    1 
ATOM   3014  C  CG    . PRO A  1 391 ? -106.979 21.942  -74.781  1.00 97.70  ? 391  PRO A CG    1 
ATOM   3015  C  CD    . PRO A  1 391 ? -108.236 22.040  -73.961  1.00 93.44  ? 391  PRO A CD    1 
ATOM   3016  N  N     . MET A  1 392 ? -104.755 21.871  -70.767  1.00 83.18  ? 392  MET A N     1 
ATOM   3017  C  CA    . MET A  1 392 ? -104.222 22.465  -69.541  1.00 81.76  ? 392  MET A CA    1 
ATOM   3018  C  C     . MET A  1 392 ? -103.109 23.461  -69.833  1.00 74.82  ? 392  MET A C     1 
ATOM   3019  O  O     . MET A  1 392 ? -101.954 23.217  -69.493  1.00 90.73  ? 392  MET A O     1 
ATOM   3020  C  CB    . MET A  1 392 ? -103.678 21.357  -68.631  1.00 95.20  ? 392  MET A CB    1 
ATOM   3021  C  CG    . MET A  1 392 ? -103.742 21.659  -67.148  1.00 100.00 ? 392  MET A CG    1 
ATOM   3022  S  SD    . MET A  1 392 ? -105.456 21.970  -66.642  1.00 100.00 ? 392  MET A SD    1 
ATOM   3023  C  CE    . MET A  1 392 ? -106.345 20.536  -67.346  1.00 99.31  ? 392  MET A CE    1 
ATOM   3024  N  N     . ASP A  1 393 ? -103.448 24.521  -70.518  0.72 60.87  ? 393  ASP A N     1 
ATOM   3025  C  CA    . ASP A  1 393 ? -102.407 25.432  -70.866  0.72 72.63  ? 393  ASP A CA    1 
ATOM   3026  C  C     . ASP A  1 393 ? -102.066 26.327  -69.732  0.72 85.67  ? 393  ASP A C     1 
ATOM   3027  O  O     . ASP A  1 393 ? -101.240 27.214  -69.914  0.72 90.09  ? 393  ASP A O     1 
ATOM   3028  C  CB    . ASP A  1 393 ? -102.826 26.363  -72.012  0.72 55.95  ? 393  ASP A CB    1 
ATOM   3029  C  CG    . ASP A  1 393 ? -102.953 25.670  -73.355  0.72 71.57  ? 393  ASP A CG    1 
ATOM   3030  O  OD1   . ASP A  1 393 ? -103.491 24.545  -73.400  0.72 84.71  ? 393  ASP A OD1   1 
ATOM   3031  O  OD2   . ASP A  1 393 ? -102.525 26.253  -74.373  0.72 72.64  ? 393  ASP A OD2   1 
ATOM   3032  N  N     . LYS A  1 394 ? -102.643 26.169  -68.579  0.72 93.43  ? 394  LYS A N     1 
ATOM   3033  C  CA    . LYS A  1 394 ? -102.317 27.217  -67.655  0.72 100.00 ? 394  LYS A CA    1 
ATOM   3034  C  C     . LYS A  1 394 ? -100.925 27.078  -67.034  0.72 100.00 ? 394  LYS A C     1 
ATOM   3035  O  O     . LYS A  1 394 ? -99.977  27.690  -67.509  0.72 100.00 ? 394  LYS A O     1 
ATOM   3036  C  CB    . LYS A  1 394 ? -103.471 27.358  -66.668  0.72 100.00 ? 394  LYS A CB    1 
ATOM   3037  C  CG    . LYS A  1 394 ? -104.763 27.741  -67.365  0.72 100.00 ? 394  LYS A CG    1 
ATOM   3038  C  CD    . LYS A  1 394 ? -104.556 28.894  -68.329  0.72 100.00 ? 394  LYS A CD    1 
ATOM   3039  C  CE    . LYS A  1 394 ? -104.086 30.131  -67.601  0.72 100.00 ? 394  LYS A CE    1 
ATOM   3040  N  NZ    . LYS A  1 394 ? -104.655 30.204  -66.228  0.72 100.00 ? 394  LYS A NZ    1 
ATOM   3041  N  N     . ASN A  1 395 ? -100.809 26.281  -65.984  0.72 100.00 ? 395  ASN A N     1 
ATOM   3042  C  CA    . ASN A  1 395 ? -99.545  26.069  -65.308  0.72 100.00 ? 395  ASN A CA    1 
ATOM   3043  C  C     . ASN A  1 395 ? -99.725  25.038  -64.220  0.72 99.08  ? 395  ASN A C     1 
ATOM   3044  O  O     . ASN A  1 395 ? -100.716 24.994  -63.479  0.72 94.19  ? 395  ASN A O     1 
ATOM   3045  C  CB    . ASN A  1 395 ? -98.950  27.388  -64.758  0.72 100.00 ? 395  ASN A CB    1 
ATOM   3046  C  CG    . ASN A  1 395 ? -97.457  27.515  -65.054  0.72 100.00 ? 395  ASN A CG    1 
ATOM   3047  O  OD1   . ASN A  1 395 ? -96.747  28.290  -64.421  0.72 100.00 ? 395  ASN A OD1   1 
ATOM   3048  N  ND2   . ASN A  1 395 ? -96.990  26.729  -66.011  0.72 100.00 ? 395  ASN A ND2   1 
ATOM   3049  N  N     . LEU A  1 396 ? -98.699  24.198  -64.151  0.72 98.84  ? 396  LEU A N     1 
ATOM   3050  C  CA    . LEU A  1 396 ? -98.536  23.084  -63.254  0.72 100.00 ? 396  LEU A CA    1 
ATOM   3051  C  C     . LEU A  1 396 ? -98.947  23.283  -61.812  0.72 100.00 ? 396  LEU A C     1 
ATOM   3052  O  O     . LEU A  1 396 ? -99.145  24.409  -61.339  0.72 100.00 ? 396  LEU A O     1 
ATOM   3053  C  CB    . LEU A  1 396 ? -97.055  22.666  -63.273  0.72 95.32  ? 396  LEU A CB    1 
ATOM   3054  C  CG    . LEU A  1 396 ? -96.083  23.688  -63.849  0.72 88.34  ? 396  LEU A CG    1 
ATOM   3055  C  CD1   . LEU A  1 396 ? -95.814  24.795  -62.854  0.72 95.88  ? 396  LEU A CD1   1 
ATOM   3056  C  CD2   . LEU A  1 396 ? -94.784  23.029  -64.280  0.72 94.94  ? 396  LEU A CD2   1 
ATOM   3057  N  N     . TYR A  1 397 ? -99.054  22.135  -61.123  0.72 97.48  ? 397  TYR A N     1 
ATOM   3058  C  CA    . TYR A  1 397 ? -99.416  22.023  -59.698  0.72 100.00 ? 397  TYR A CA    1 
ATOM   3059  C  C     . TYR A  1 397 ? -98.433  22.810  -58.849  0.72 100.00 ? 397  TYR A C     1 
ATOM   3060  O  O     . TYR A  1 397 ? -98.557  22.806  -57.587  0.72 100.00 ? 397  TYR A O     1 
ATOM   3061  C  CB    . TYR A  1 397 ? -99.477  20.541  -59.260  0.72 100.00 ? 397  TYR A CB    1 
ATOM   3062  C  CG    . TYR A  1 397 ? -100.463 20.004  -58.173  0.72 100.00 ? 397  TYR A CG    1 
ATOM   3063  C  CD1   . TYR A  1 397 ? -100.555 20.544  -56.876  0.72 100.00 ? 397  TYR A CD1   1 
ATOM   3064  C  CD2   . TYR A  1 397 ? -101.274 18.904  -58.471  0.72 100.00 ? 397  TYR A CD2   1 
ATOM   3065  C  CE1   . TYR A  1 397 ? -101.422 19.982  -55.932  0.72 100.00 ? 397  TYR A CE1   1 
ATOM   3066  C  CE2   . TYR A  1 397 ? -102.136 18.339  -57.509  0.72 100.00 ? 397  TYR A CE2   1 
ATOM   3067  C  CZ    . TYR A  1 397 ? -102.198 18.877  -56.231  0.72 100.00 ? 397  TYR A CZ    1 
ATOM   3068  O  OH    . TYR A  1 397 ? -103.027 18.316  -55.285  0.72 100.00 ? 397  TYR A OH    1 
ATOM   3069  N  N     . ASP A  1 398 ? -97.307  23.229  -59.369  0.72 100.00 ? 398  ASP A N     1 
ATOM   3070  C  CA    . ASP A  1 398 ? -96.483  24.044  -58.483  0.72 100.00 ? 398  ASP A CA    1 
ATOM   3071  C  C     . ASP A  1 398 ? -97.270  25.280  -58.308  0.72 100.00 ? 398  ASP A C     1 
ATOM   3072  O  O     . ASP A  1 398 ? -97.008  26.118  -57.448  0.72 100.00 ? 398  ASP A O     1 
ATOM   3073  C  CB    . ASP A  1 398 ? -95.140  24.309  -59.103  0.72 100.00 ? 398  ASP A CB    1 
ATOM   3074  C  CG    . ASP A  1 398 ? -94.617  22.947  -59.546  0.72 100.00 ? 398  ASP A CG    1 
ATOM   3075  O  OD1   . ASP A  1 398 ? -94.494  22.041  -58.679  0.72 100.00 ? 398  ASP A OD1   1 
ATOM   3076  O  OD2   . ASP A  1 398 ? -94.336  22.768  -60.750  0.72 100.00 ? 398  ASP A OD2   1 
ATOM   3077  N  N     . LEU A  1 399 ? -98.249  25.386  -59.131  0.72 100.00 ? 399  LEU A N     1 
ATOM   3078  C  CA    . LEU A  1 399 ? -99.293  26.338  -58.972  0.72 100.00 ? 399  LEU A CA    1 
ATOM   3079  C  C     . LEU A  1 399 ? -100.249 25.591  -58.042  0.72 99.89  ? 399  LEU A C     1 
ATOM   3080  O  O     . LEU A  1 399 ? -101.422 25.492  -58.402  0.72 91.58  ? 399  LEU A O     1 
ATOM   3081  C  CB    . LEU A  1 399 ? -99.947  26.722  -60.279  0.72 91.07  ? 399  LEU A CB    1 
ATOM   3082  C  CG    . LEU A  1 399 ? -99.017  27.451  -61.259  0.72 84.50  ? 399  LEU A CG    1 
ATOM   3083  C  CD1   . LEU A  1 399 ? -99.803  28.075  -62.403  0.72 72.61  ? 399  LEU A CD1   1 
ATOM   3084  C  CD2   . LEU A  1 399 ? -98.193  28.499  -60.521  0.72 53.23  ? 399  LEU A CD2   1 
ATOM   3085  N  N     . PRO A  1 400 ? -99.643  25.310  -56.850  0.72 100.00 ? 400  PRO A N     1 
ATOM   3086  C  CA    . PRO A  1 400 ? -100.293 24.410  -55.839  0.72 100.00 ? 400  PRO A CA    1 
ATOM   3087  C  C     . PRO A  1 400 ? -101.813 24.559  -55.637  0.72 100.00 ? 400  PRO A C     1 
ATOM   3088  O  O     . PRO A  1 400 ? -102.429 25.295  -56.412  0.72 100.00 ? 400  PRO A O     1 
ATOM   3089  C  CB    . PRO A  1 400 ? -99.595  24.640  -54.540  0.72 100.00 ? 400  PRO A CB    1 
ATOM   3090  C  CG    . PRO A  1 400 ? -98.499  25.550  -54.786  0.72 100.00 ? 400  PRO A CG    1 
ATOM   3091  C  CD    . PRO A  1 400 ? -98.770  26.187  -56.102  0.72 100.00 ? 400  PRO A CD    1 
ATOM   3092  N  N     . PRO A  1 401 ? -102.394 23.638  -54.826  0.72 100.00 ? 401  PRO A N     1 
ATOM   3093  C  CA    . PRO A  1 401 ? -103.781 23.674  -54.505  0.72 100.00 ? 401  PRO A CA    1 
ATOM   3094  C  C     . PRO A  1 401 ? -104.586 24.931  -54.752  0.72 100.00 ? 401  PRO A C     1 
ATOM   3095  O  O     . PRO A  1 401 ? -104.648 25.841  -53.910  0.72 100.00 ? 401  PRO A O     1 
ATOM   3096  C  CB    . PRO A  1 401 ? -103.926 22.985  -53.176  0.72 93.40  ? 401  PRO A CB    1 
ATOM   3097  C  CG    . PRO A  1 401 ? -102.758 21.994  -53.242  0.72 85.81  ? 401  PRO A CG    1 
ATOM   3098  C  CD    . PRO A  1 401 ? -101.682 22.583  -54.119  0.72 87.38  ? 401  PRO A CD    1 
ATOM   3099  N  N     . GLU A  1 402 ? -105.211 24.973  -55.938  0.72 100.00 ? 402  GLU A N     1 
ATOM   3100  C  CA    . GLU A  1 402 ? -106.082 26.065  -56.353  0.72 100.00 ? 402  GLU A CA    1 
ATOM   3101  C  C     . GLU A  1 402 ? -107.548 25.621  -56.182  0.72 100.00 ? 402  GLU A C     1 
ATOM   3102  O  O     . GLU A  1 402 ? -108.478 26.442  -56.144  0.72 100.00 ? 402  GLU A O     1 
ATOM   3103  C  CB    . GLU A  1 402 ? -105.758 26.490  -57.806  0.72 93.53  ? 402  GLU A CB    1 
ATOM   3104  C  CG    . GLU A  1 402 ? -104.479 27.294  -57.964  0.72 97.77  ? 402  GLU A CG    1 
ATOM   3105  C  CD    . GLU A  1 402 ? -104.081 27.567  -59.420  0.72 100.00 ? 402  GLU A CD    1 
ATOM   3106  O  OE1   . GLU A  1 402 ? -104.945 27.443  -60.321  0.72 100.00 ? 402  GLU A OE1   1 
ATOM   3107  O  OE2   . GLU A  1 402 ? -102.897 27.912  -59.664  0.72 96.40  ? 402  GLU A OE2   1 
ATOM   3108  N  N     . GLU A  1 403 ? -107.704 24.326  -56.102  0.72 100.00 ? 403  GLU A N     1 
ATOM   3109  C  CA    . GLU A  1 403 ? -108.922 23.544  -55.907  0.72 100.00 ? 403  GLU A CA    1 
ATOM   3110  C  C     . GLU A  1 403 ? -108.363 22.177  -55.487  0.72 100.00 ? 403  GLU A C     1 
ATOM   3111  O  O     . GLU A  1 403 ? -108.957 21.106  -55.681  0.72 100.00 ? 403  GLU A O     1 
ATOM   3112  C  CB    . GLU A  1 403 ? -109.775 23.459  -57.190  0.72 100.00 ? 403  GLU A CB    1 
ATOM   3113  C  CG    . GLU A  1 403 ? -109.527 22.240  -58.085  0.72 97.87  ? 403  GLU A CG    1 
ATOM   3114  C  CD    . GLU A  1 403 ? -108.773 22.553  -59.361  0.72 100.00 ? 403  GLU A CD    1 
ATOM   3115  O  OE1   . GLU A  1 403 ? -108.352 21.585  -60.027  0.72 89.33  ? 403  GLU A OE1   1 
ATOM   3116  O  OE2   . GLU A  1 403 ? -108.602 23.753  -59.682  0.72 96.29  ? 403  GLU A OE2   1 
ATOM   3117  N  N     . ALA A  1 404 ? -107.152 22.284  -54.905  0.72 93.67  ? 404  ALA A N     1 
ATOM   3118  C  CA    . ALA A  1 404 ? -106.293 21.177  -54.497  0.72 98.40  ? 404  ALA A CA    1 
ATOM   3119  C  C     . ALA A  1 404 ? -105.630 20.646  -55.743  0.72 100.00 ? 404  ALA A C     1 
ATOM   3120  O  O     . ALA A  1 404 ? -104.740 19.789  -55.676  0.72 100.00 ? 404  ALA A O     1 
ATOM   3121  C  CB    . ALA A  1 404 ? -107.096 20.081  -53.814  0.72 89.24  ? 404  ALA A CB    1 
ATOM   3122  N  N     . LYS A  1 405 ? -106.079 21.179  -56.891  1.00 100.00 ? 405  LYS A N     1 
ATOM   3123  C  CA    . LYS A  1 405 ? -105.649 20.799  -58.247  1.00 100.00 ? 405  LYS A CA    1 
ATOM   3124  C  C     . LYS A  1 405 ? -105.791 19.284  -58.463  1.00 100.00 ? 405  LYS A C     1 
ATOM   3125  O  O     . LYS A  1 405 ? -104.820 18.548  -58.704  1.00 100.00 ? 405  LYS A O     1 
ATOM   3126  C  CB    . LYS A  1 405 ? -104.250 21.336  -58.611  1.00 100.00 ? 405  LYS A CB    1 
ATOM   3127  C  CG    . LYS A  1 405 ? -104.167 22.882  -58.754  1.00 100.00 ? 405  LYS A CG    1 
ATOM   3128  C  CD    . LYS A  1 405 ? -105.278 23.488  -59.652  1.00 100.00 ? 405  LYS A CD    1 
ATOM   3129  C  CE    . LYS A  1 405 ? -104.883 23.672  -61.136  1.00 100.00 ? 405  LYS A CE    1 
ATOM   3130  N  NZ    . LYS A  1 405 ? -104.024 24.877  -61.412  1.00 100.00 ? 405  LYS A NZ    1 
ATOM   3131  N  N     . GLU A  1 406 ? -107.040 18.835  -58.355  1.00 100.00 ? 406  GLU A N     1 
ATOM   3132  C  CA    . GLU A  1 406 ? -107.387 17.439  -58.492  1.00 100.00 ? 406  GLU A CA    1 
ATOM   3133  C  C     . GLU A  1 406 ? -107.544 17.055  -59.949  1.00 100.00 ? 406  GLU A C     1 
ATOM   3134  O  O     . GLU A  1 406 ? -108.608 16.665  -60.426  1.00 93.24  ? 406  GLU A O     1 
ATOM   3135  C  CB    . GLU A  1 406 ? -108.594 17.095  -57.633  1.00 100.00 ? 406  GLU A CB    1 
ATOM   3136  C  CG    . GLU A  1 406 ? -108.183 16.894  -56.173  1.00 100.00 ? 406  GLU A CG    1 
ATOM   3137  C  CD    . GLU A  1 406 ? -106.895 16.077  -56.042  1.00 100.00 ? 406  GLU A CD    1 
ATOM   3138  O  OE1   . GLU A  1 406 ? -105.797 16.682  -55.934  1.00 90.95  ? 406  GLU A OE1   1 
ATOM   3139  O  OE2   . GLU A  1 406 ? -106.987 14.830  -56.051  1.00 100.00 ? 406  GLU A OE2   1 
ATOM   3140  N  N     . ILE A  1 407 ? -106.405 17.196  -60.622  1.00 100.00 ? 407  ILE A N     1 
ATOM   3141  C  CA    . ILE A  1 407 ? -106.211 16.816  -61.985  1.00 93.00  ? 407  ILE A CA    1 
ATOM   3142  C  C     . ILE A  1 407 ? -105.730 15.379  -61.923  1.00 84.27  ? 407  ILE A C     1 
ATOM   3143  O  O     . ILE A  1 407 ? -104.929 15.007  -61.073  1.00 75.86  ? 407  ILE A O     1 
ATOM   3144  C  CB    . ILE A  1 407 ? -105.141 17.705  -62.671  1.00 95.69  ? 407  ILE A CB    1 
ATOM   3145  C  CG1   . ILE A  1 407 ? -105.575 19.178  -62.666  1.00 100.00 ? 407  ILE A CG1   1 
ATOM   3146  C  CG2   . ILE A  1 407 ? -104.882 17.228  -64.098  1.00 89.67  ? 407  ILE A CG2   1 
ATOM   3147  C  CD1   . ILE A  1 407 ? -106.781 19.454  -63.541  1.00 100.00 ? 407  ILE A CD1   1 
ATOM   3148  N  N     . PRO A  1 408 ? -106.216 14.566  -62.830  1.00 76.55  ? 408  PRO A N     1 
ATOM   3149  C  CA    . PRO A  1 408 ? -105.771 13.132  -62.863  1.00 75.13  ? 408  PRO A CA    1 
ATOM   3150  C  C     . PRO A  1 408 ? -104.268 12.949  -62.980  1.00 73.76  ? 408  PRO A C     1 
ATOM   3151  O  O     . PRO A  1 408 ? -103.654 13.658  -63.765  1.00 66.85  ? 408  PRO A O     1 
ATOM   3152  C  CB    . PRO A  1 408 ? -106.644 12.551  -63.945  1.00 73.90  ? 408  PRO A CB    1 
ATOM   3153  C  CG    . PRO A  1 408 ? -107.940 13.295  -63.733  1.00 94.46  ? 408  PRO A CG    1 
ATOM   3154  C  CD    . PRO A  1 408 ? -107.651 14.606  -63.054  1.00 93.21  ? 408  PRO A CD    1 
ATOM   3155  N  N     . GLN A  1 409 ? -103.633 12.026  -62.236  1.00 62.99  ? 409  GLN A N     1 
ATOM   3156  C  CA    . GLN A  1 409 ? -102.203 11.849  -62.442  1.00 49.78  ? 409  GLN A CA    1 
ATOM   3157  C  C     . GLN A  1 409 ? -101.824 10.412  -62.733  1.00 48.66  ? 409  GLN A C     1 
ATOM   3158  O  O     . GLN A  1 409 ? -102.655 9.506   -62.613  1.00 63.61  ? 409  GLN A O     1 
ATOM   3159  C  CB    . GLN A  1 409 ? -101.425 12.328  -61.224  1.00 43.38  ? 409  GLN A CB    1 
ATOM   3160  C  CG    . GLN A  1 409 ? -101.343 13.826  -61.090  1.00 62.04  ? 409  GLN A CG    1 
ATOM   3161  C  CD    . GLN A  1 409 ? -100.518 14.248  -59.897  1.00 69.24  ? 409  GLN A CD    1 
ATOM   3162  O  OE1   . GLN A  1 409 ? -100.860 15.207  -59.208  1.00 80.09  ? 409  GLN A OE1   1 
ATOM   3163  N  NE2   . GLN A  1 409 ? -99.418  13.535  -59.646  1.00 74.76  ? 409  GLN A NE2   1 
ATOM   3164  N  N     . VAL A  1 410 ? -100.568 10.220  -63.136  1.00 39.72  ? 410  VAL A N     1 
ATOM   3165  C  CA    . VAL A  1 410 ? -100.027 8.893   -63.428  1.00 30.03  ? 410  VAL A CA    1 
ATOM   3166  C  C     . VAL A  1 410 ? -99.859  8.132   -62.111  1.00 34.67  ? 410  VAL A C     1 
ATOM   3167  O  O     . VAL A  1 410 ? -99.895  8.733   -61.029  1.00 43.81  ? 410  VAL A O     1 
ATOM   3168  C  CB    . VAL A  1 410 ? -98.642  8.978   -64.107  1.00 35.36  ? 410  VAL A CB    1 
ATOM   3169  C  CG1   . VAL A  1 410 ? -98.754  9.553   -65.506  1.00 21.27  ? 410  VAL A CG1   1 
ATOM   3170  C  CG2   . VAL A  1 410 ? -97.701  9.822   -63.257  1.00 20.98  ? 410  VAL A CG2   1 
ATOM   3171  N  N     . ALA A  1 411 ? -99.667  6.816   -62.204  1.00 27.30  ? 411  ALA A N     1 
ATOM   3172  C  CA    . ALA A  1 411 ? -99.492  5.979   -61.021  1.00 24.44  ? 411  ALA A CA    1 
ATOM   3173  C  C     . ALA A  1 411 ? -98.331  6.509   -60.167  1.00 35.02  ? 411  ALA A C     1 
ATOM   3174  O  O     . ALA A  1 411 ? -97.344  7.029   -60.693  1.00 47.36  ? 411  ALA A O     1 
ATOM   3175  C  CB    . ALA A  1 411 ? -99.255  4.533   -61.446  1.00 29.30  ? 411  ALA A CB    1 
ATOM   3176  N  N     . GLY A  1 412 ? -98.466  6.437   -58.850  1.00 33.35  ? 412  GLY A N     1 
ATOM   3177  C  CA    . GLY A  1 412 ? -97.405  6.943   -57.991  1.00 28.62  ? 412  GLY A CA    1 
ATOM   3178  C  C     . GLY A  1 412 ? -96.427  5.889   -57.525  1.00 38.58  ? 412  GLY A C     1 
ATOM   3179  O  O     . GLY A  1 412 ? -95.472  6.177   -56.795  1.00 51.19  ? 412  GLY A O     1 
ATOM   3180  N  N     . SER A  1 413 ? -96.670  4.661   -57.965  1.00 34.23  ? 413  SER A N     1 
ATOM   3181  C  CA    . SER A  1 413 ? -95.840  3.529   -57.609  1.00 32.51  ? 413  SER A CA    1 
ATOM   3182  C  C     . SER A  1 413 ? -96.130  2.404   -58.577  1.00 31.75  ? 413  SER A C     1 
ATOM   3183  O  O     . SER A  1 413 ? -97.128  2.428   -59.288  1.00 41.50  ? 413  SER A O     1 
ATOM   3184  C  CB    . SER A  1 413 ? -96.150  3.069   -56.182  1.00 30.58  ? 413  SER A CB    1 
ATOM   3185  O  OG    . SER A  1 413 ? -97.455  2.525   -56.084  1.00 46.18  ? 413  SER A OG    1 
ATOM   3186  N  N     . LEU A  1 414 ? -95.255  1.413   -58.599  1.00 35.78  ? 414  LEU A N     1 
ATOM   3187  C  CA    . LEU A  1 414 ? -95.434  0.275   -59.475  1.00 32.44  ? 414  LEU A CA    1 
ATOM   3188  C  C     . LEU A  1 414 ? -96.637  -0.555  -59.025  1.00 33.49  ? 414  LEU A C     1 
ATOM   3189  O  O     . LEU A  1 414 ? -97.462  -0.945  -59.846  1.00 39.93  ? 414  LEU A O     1 
ATOM   3190  C  CB    . LEU A  1 414 ? -94.168  -0.575  -59.484  1.00 21.37  ? 414  LEU A CB    1 
ATOM   3191  C  CG    . LEU A  1 414 ? -94.224  -1.802  -60.383  1.00 28.98  ? 414  LEU A CG    1 
ATOM   3192  C  CD1   . LEU A  1 414 ? -94.486  -1.394  -61.817  1.00 21.81  ? 414  LEU A CD1   1 
ATOM   3193  C  CD2   . LEU A  1 414 ? -92.927  -2.552  -60.268  1.00 12.25  ? 414  LEU A CD2   1 
ATOM   3194  N  N     . GLU A  1 415 ? -96.734  -0.793  -57.717  1.00 35.77  ? 415  GLU A N     1 
ATOM   3195  C  CA    . GLU A  1 415 ? -97.825  -1.571  -57.111  1.00 39.43  ? 415  GLU A CA    1 
ATOM   3196  C  C     . GLU A  1 415 ? -99.170  -1.054  -57.577  1.00 43.73  ? 415  GLU A C     1 
ATOM   3197  O  O     . GLU A  1 415 ? -100.095 -1.828  -57.823  1.00 58.34  ? 415  GLU A O     1 
ATOM   3198  C  CB    . GLU A  1 415 ? -97.746  -1.434  -55.604  1.00 49.08  ? 415  GLU A CB    1 
ATOM   3199  C  CG    . GLU A  1 415 ? -98.718  -2.270  -54.807  1.00 69.65  ? 415  GLU A CG    1 
ATOM   3200  C  CD    . GLU A  1 415 ? -98.657  -1.934  -53.314  1.00 75.67  ? 415  GLU A CD    1 
ATOM   3201  O  OE1   . GLU A  1 415 ? -99.684  -2.118  -52.630  1.00 66.43  ? 415  GLU A OE1   1 
ATOM   3202  O  OE2   . GLU A  1 415 ? -97.590  -1.479  -52.825  1.00 66.81  ? 415  GLU A OE2   1 
ATOM   3203  N  N     . GLU A  1 416 ? -99.257  0.270   -57.682  1.00 31.78  ? 416  GLU A N     1 
ATOM   3204  C  CA    . GLU A  1 416 ? -100.456 0.957   -58.125  1.00 30.30  ? 416  GLU A CA    1 
ATOM   3205  C  C     . GLU A  1 416 ? -100.700 0.799   -59.625  1.00 39.73  ? 416  GLU A C     1 
ATOM   3206  O  O     . GLU A  1 416 ? -101.848 0.691   -60.061  1.00 59.55  ? 416  GLU A O     1 
ATOM   3207  C  CB    . GLU A  1 416 ? -100.377 2.442   -57.766  1.00 25.39  ? 416  GLU A CB    1 
ATOM   3208  C  CG    . GLU A  1 416 ? -101.481 3.279   -58.401  1.00 50.27  ? 416  GLU A CG    1 
ATOM   3209  C  CD    . GLU A  1 416 ? -101.466 4.741   -57.984  1.00 48.12  ? 416  GLU A CD    1 
ATOM   3210  O  OE1   . GLU A  1 416 ? -102.462 5.436   -58.289  1.00 53.52  ? 416  GLU A OE1   1 
ATOM   3211  O  OE2   . GLU A  1 416 ? -100.475 5.190   -57.363  1.00 49.07  ? 416  GLU A OE2   1 
ATOM   3212  N  N     . ALA A  1 417 ? -99.631  0.846   -60.415  1.00 43.26  ? 417  ALA A N     1 
ATOM   3213  C  CA    . ALA A  1 417 ? -99.742  0.682   -61.864  1.00 41.35  ? 417  ALA A CA    1 
ATOM   3214  C  C     . ALA A  1 417 ? -100.161 -0.751  -62.151  1.00 40.69  ? 417  ALA A C     1 
ATOM   3215  O  O     . ALA A  1 417 ? -100.988 -1.007  -63.023  1.00 42.75  ? 417  ALA A O     1 
ATOM   3216  C  CB    . ALA A  1 417 ? -98.412  0.973   -62.542  1.00 35.52  ? 417  ALA A CB    1 
ATOM   3217  N  N     . LEU A  1 418 ? -99.583  -1.685  -61.408  1.00 28.17  ? 418  LEU A N     1 
ATOM   3218  C  CA    . LEU A  1 418 ? -99.908  -3.085  -61.580  1.00 34.95  ? 418  LEU A CA    1 
ATOM   3219  C  C     . LEU A  1 418 ? -101.378 -3.296  -61.237  1.00 44.76  ? 418  LEU A C     1 
ATOM   3220  O  O     . LEU A  1 418 ? -102.101 -3.983  -61.961  1.00 52.08  ? 418  LEU A O     1 
ATOM   3221  C  CB    . LEU A  1 418 ? -99.003  -3.957  -60.711  1.00 37.40  ? 418  LEU A CB    1 
ATOM   3222  C  CG    . LEU A  1 418 ? -97.513  -3.971  -61.077  1.00 33.20  ? 418  LEU A CG    1 
ATOM   3223  C  CD1   . LEU A  1 418 ? -96.783  -4.984  -60.212  1.00 31.02  ? 418  LEU A CD1   1 
ATOM   3224  C  CD2   . LEU A  1 418 ? -97.342  -4.332  -62.534  1.00 15.64  ? 418  LEU A CD2   1 
ATOM   3225  N  N     . ASN A  1 419 ? -101.824 -2.654  -60.162  1.00 46.65  ? 419  ASN A N     1 
ATOM   3226  C  CA    . ASN A  1 419 ? -103.217 -2.731  -59.735  1.00 47.85  ? 419  ASN A CA    1 
ATOM   3227  C  C     . ASN A  1 419 ? -104.138 -2.264  -60.848  1.00 48.20  ? 419  ASN A C     1 
ATOM   3228  O  O     . ASN A  1 419 ? -105.077 -2.961  -61.225  1.00 40.94  ? 419  ASN A O     1 
ATOM   3229  C  CB    . ASN A  1 419 ? -103.440 -1.819  -58.555  1.00 61.38  ? 419  ASN A CB    1 
ATOM   3230  C  CG    . ASN A  1 419 ? -104.099 -2.517  -57.442  1.00 81.34  ? 419  ASN A CG    1 
ATOM   3231  O  OD1   . ASN A  1 419 ? -103.489 -2.718  -56.388  1.00 95.59  ? 419  ASN A OD1   1 
ATOM   3232  N  ND2   . ASN A  1 419 ? -105.343 -2.957  -57.668  1.00 66.97  ? 419  ASN A ND2   1 
ATOM   3233  N  N     . ALA A  1 420 ? -103.863 -1.056  -61.338  1.00 39.22  ? 420  ALA A N     1 
ATOM   3234  C  CA    . ALA A  1 420 ? -104.619 -0.440  -62.416  1.00 29.40  ? 420  ALA A CA    1 
ATOM   3235  C  C     . ALA A  1 420 ? -104.722 -1.378  -63.605  1.00 38.32  ? 420  ALA A C     1 
ATOM   3236  O  O     . ALA A  1 420 ? -105.805 -1.585  -64.140  1.00 57.23  ? 420  ALA A O     1 
ATOM   3237  C  CB    . ALA A  1 420 ? -103.961 0.862   -62.837  1.00 33.40  ? 420  ALA A CB    1 
ATOM   3238  N  N     . LEU A  1 421 ? -103.593 -1.948  -64.008  1.00 37.72  ? 421  LEU A N     1 
ATOM   3239  C  CA    . LEU A  1 421 ? -103.562 -2.873  -65.131  1.00 41.00  ? 421  LEU A CA    1 
ATOM   3240  C  C     . LEU A  1 421 ? -104.444 -4.091  -64.857  1.00 44.36  ? 421  LEU A C     1 
ATOM   3241  O  O     . LEU A  1 421 ? -105.097 -4.605  -65.755  1.00 49.87  ? 421  LEU A O     1 
ATOM   3242  C  CB    . LEU A  1 421 ? -102.128 -3.327  -65.401  1.00 35.44  ? 421  LEU A CB    1 
ATOM   3243  C  CG    . LEU A  1 421 ? -101.978 -4.451  -66.431  1.00 43.26  ? 421  LEU A CG    1 
ATOM   3244  C  CD1   . LEU A  1 421 ? -102.393 -3.975  -67.813  1.00 35.64  ? 421  LEU A CD1   1 
ATOM   3245  C  CD2   . LEU A  1 421 ? -100.551 -4.955  -66.446  1.00 30.58  ? 421  LEU A CD2   1 
ATOM   3246  N  N     . ASP A  1 422 ? -104.441 -4.559  -63.613  1.00 44.58  ? 422  ASP A N     1 
ATOM   3247  C  CA    . ASP A  1 422 ? -105.244 -5.710  -63.209  1.00 38.44  ? 422  ASP A CA    1 
ATOM   3248  C  C     . ASP A  1 422 ? -106.726 -5.425  -63.489  1.00 50.66  ? 422  ASP A C     1 
ATOM   3249  O  O     . ASP A  1 422 ? -107.374 -6.137  -64.264  1.00 55.60  ? 422  ASP A O     1 
ATOM   3250  C  CB    . ASP A  1 422 ? -105.014 -5.969  -61.711  1.00 41.22  ? 422  ASP A CB    1 
ATOM   3251  C  CG    . ASP A  1 422 ? -105.802 -7.157  -61.168  1.00 48.93  ? 422  ASP A CG    1 
ATOM   3252  O  OD1   . ASP A  1 422 ? -106.396 -7.926  -61.953  1.00 47.78  ? 422  ASP A OD1   1 
ATOM   3253  O  OD2   . ASP A  1 422 ? -105.809 -7.324  -59.926  1.00 56.80  ? 422  ASP A OD2   1 
ATOM   3254  N  N     . LEU A  1 423 ? -107.224 -4.341  -62.899  1.00 34.19  ? 423  LEU A N     1 
ATOM   3255  C  CA    . LEU A  1 423 ? -108.615 -3.932  -63.028  1.00 36.81  ? 423  LEU A CA    1 
ATOM   3256  C  C     . LEU A  1 423 ? -108.995 -3.404  -64.404  1.00 44.12  ? 423  LEU A C     1 
ATOM   3257  O  O     . LEU A  1 423 ? -109.915 -3.915  -65.037  1.00 54.12  ? 423  LEU A O     1 
ATOM   3258  C  CB    . LEU A  1 423 ? -108.946 -2.875  -61.967  1.00 25.97  ? 423  LEU A CB    1 
ATOM   3259  C  CG    . LEU A  1 423 ? -108.475 -3.197  -60.540  1.00 48.32  ? 423  LEU A CG    1 
ATOM   3260  C  CD1   . LEU A  1 423 ? -108.890 -2.109  -59.583  1.00 38.01  ? 423  LEU A CD1   1 
ATOM   3261  C  CD2   . LEU A  1 423 ? -109.022 -4.529  -60.077  1.00 33.15  ? 423  LEU A CD2   1 
ATOM   3262  N  N     . ASP A  1 424 ? -108.273 -2.392  -64.862  1.00 39.48  ? 424  ASP A N     1 
ATOM   3263  C  CA    . ASP A  1 424 ? -108.528 -1.740  -66.147  1.00 38.39  ? 424  ASP A CA    1 
ATOM   3264  C  C     . ASP A  1 424 ? -108.011 -2.530  -67.364  1.00 42.55  ? 424  ASP A C     1 
ATOM   3265  O  O     . ASP A  1 424 ? -107.651 -1.941  -68.384  1.00 38.86  ? 424  ASP A O     1 
ATOM   3266  C  CB    . ASP A  1 424 ? -107.893 -0.340  -66.099  1.00 36.80  ? 424  ASP A CB    1 
ATOM   3267  C  CG    . ASP A  1 424 ? -108.292 0.537   -67.261  1.00 44.89  ? 424  ASP A CG    1 
ATOM   3268  O  OD1   . ASP A  1 424 ? -107.531 1.485   -67.553  1.00 64.18  ? 424  ASP A OD1   1 
ATOM   3269  O  OD2   . ASP A  1 424 ? -109.359 0.297   -67.867  1.00 41.21  ? 424  ASP A OD2   1 
ATOM   3270  N  N     . ARG A  1 425 ? -108.072 -3.857  -67.298  1.00 30.24  ? 425  ARG A N     1 
ATOM   3271  C  CA    . ARG A  1 425 ? -107.551 -4.689  -68.385  1.00 32.96  ? 425  ARG A CA    1 
ATOM   3272  C  C     . ARG A  1 425 ? -108.350 -4.880  -69.664  1.00 41.98  ? 425  ARG A C     1 
ATOM   3273  O  O     . ARG A  1 425 ? -107.790 -5.293  -70.679  1.00 54.11  ? 425  ARG A O     1 
ATOM   3274  C  CB    . ARG A  1 425 ? -107.197 -6.074  -67.853  1.00 32.82  ? 425  ARG A CB    1 
ATOM   3275  C  CG    . ARG A  1 425 ? -108.381 -6.940  -67.545  1.00 27.92  ? 425  ARG A CG    1 
ATOM   3276  C  CD    . ARG A  1 425 ? -107.934 -8.331  -67.142  1.00 41.49  ? 425  ARG A CD    1 
ATOM   3277  N  NE    . ARG A  1 425 ? -107.220 -8.327  -65.865  1.00 36.84  ? 425  ARG A NE    1 
ATOM   3278  C  CZ    . ARG A  1 425 ? -106.409 -9.300  -65.454  1.00 51.06  ? 425  ARG A CZ    1 
ATOM   3279  N  NH1   . ARG A  1 425 ? -105.811 -9.202  -64.275  1.00 39.00  ? 425  ARG A NH1   1 
ATOM   3280  N  NH2   . ARG A  1 425 ? -106.181 -10.366 -66.221  1.00 35.66  ? 425  ARG A NH2   1 
ATOM   3281  N  N     . GLU A  1 426 ? -109.643 -4.590  -69.633  1.00 54.54  ? 426  GLU A N     1 
ATOM   3282  C  CA    . GLU A  1 426 ? -110.470 -4.824  -70.812  1.00 55.82  ? 426  GLU A CA    1 
ATOM   3283  C  C     . GLU A  1 426 ? -110.028 -4.202  -72.126  1.00 46.91  ? 426  GLU A C     1 
ATOM   3284  O  O     . GLU A  1 426 ? -110.012 -4.890  -73.148  1.00 48.15  ? 426  GLU A O     1 
ATOM   3285  C  CB    . GLU A  1 426 ? -111.948 -4.522  -70.532  1.00 60.59  ? 426  GLU A CB    1 
ATOM   3286  C  CG    . GLU A  1 426 ? -112.591 -5.439  -69.477  1.00 73.40  ? 426  GLU A CG    1 
ATOM   3287  C  CD    . GLU A  1 426 ? -112.345 -6.931  -69.727  1.00 83.92  ? 426  GLU A CD    1 
ATOM   3288  O  OE1   . GLU A  1 426 ? -111.951 -7.641  -68.759  1.00 64.38  ? 426  GLU A OE1   1 
ATOM   3289  O  OE2   . GLU A  1 426 ? -112.557 -7.387  -70.881  1.00 66.91  ? 426  GLU A OE2   1 
ATOM   3290  N  N     . PHE A  1 427 ? -109.587 -2.947  -72.096  1.00 39.80  ? 427  PHE A N     1 
ATOM   3291  C  CA    . PHE A  1 427 ? -109.177 -2.271  -73.330  1.00 42.79  ? 427  PHE A CA    1 
ATOM   3292  C  C     . PHE A  1 427 ? -108.032 -2.947  -74.060  1.00 49.04  ? 427  PHE A C     1 
ATOM   3293  O  O     . PHE A  1 427 ? -107.865 -2.777  -75.271  1.00 56.48  ? 427  PHE A O     1 
ATOM   3294  C  CB    . PHE A  1 427 ? -108.858 -0.796  -73.073  1.00 49.91  ? 427  PHE A CB    1 
ATOM   3295  C  CG    . PHE A  1 427 ? -107.522 -0.553  -72.439  1.00 48.34  ? 427  PHE A CG    1 
ATOM   3296  C  CD1   . PHE A  1 427 ? -106.464 -0.062  -73.196  1.00 48.21  ? 427  PHE A CD1   1 
ATOM   3297  C  CD2   . PHE A  1 427 ? -107.328 -0.778  -71.082  1.00 51.62  ? 427  PHE A CD2   1 
ATOM   3298  C  CE1   . PHE A  1 427 ? -105.238 0.203   -72.610  1.00 49.09  ? 427  PHE A CE1   1 
ATOM   3299  C  CE2   . PHE A  1 427 ? -106.101 -0.515  -70.487  1.00 50.00  ? 427  PHE A CE2   1 
ATOM   3300  C  CZ    . PHE A  1 427 ? -105.055 -0.025  -71.250  1.00 36.15  ? 427  PHE A CZ    1 
ATOM   3301  N  N     . LEU A  1 428 ? -107.268 -3.730  -73.308  1.00 47.58  ? 428  LEU A N     1 
ATOM   3302  C  CA    . LEU A  1 428 ? -106.122 -4.463  -73.821  1.00 41.38  ? 428  LEU A CA    1 
ATOM   3303  C  C     . LEU A  1 428 ? -106.538 -5.803  -74.415  1.00 49.20  ? 428  LEU A C     1 
ATOM   3304  O  O     . LEU A  1 428 ? -105.907 -6.299  -75.358  1.00 46.99  ? 428  LEU A O     1 
ATOM   3305  C  CB    . LEU A  1 428 ? -105.141 -4.729  -72.675  1.00 45.44  ? 428  LEU A CB    1 
ATOM   3306  C  CG    . LEU A  1 428 ? -103.917 -3.867  -72.346  1.00 43.12  ? 428  LEU A CG    1 
ATOM   3307  C  CD1   . LEU A  1 428 ? -103.801 -2.648  -73.229  1.00 40.50  ? 428  LEU A CD1   1 
ATOM   3308  C  CD2   . LEU A  1 428 ? -103.958 -3.488  -70.886  1.00 26.41  ? 428  LEU A CD2   1 
ATOM   3309  N  N     . LYS A  1 429 ? -107.550 -6.419  -73.804  1.00 46.14  ? 429  LYS A N     1 
ATOM   3310  C  CA    . LYS A  1 429 ? -108.047 -7.721  -74.249  1.00 43.34  ? 429  LYS A CA    1 
ATOM   3311  C  C     . LYS A  1 429 ? -108.838 -7.629  -75.552  1.00 46.80  ? 429  LYS A C     1 
ATOM   3312  O  O     . LYS A  1 429 ? -109.106 -8.646  -76.198  1.00 41.35  ? 429  LYS A O     1 
ATOM   3313  C  CB    . LYS A  1 429 ? -108.884 -8.376  -73.154  1.00 39.89  ? 429  LYS A CB    1 
ATOM   3314  C  CG    . LYS A  1 429 ? -108.207 -8.400  -71.797  1.00 41.10  ? 429  LYS A CG    1 
ATOM   3315  C  CD    . LYS A  1 429 ? -108.644 -9.593  -70.961  1.00 43.32  ? 429  LYS A CD    1 
ATOM   3316  C  CE    . LYS A  1 429 ? -110.127 -9.580  -70.672  1.00 49.39  ? 429  LYS A CE    1 
ATOM   3317  N  NZ    . LYS A  1 429 ? -110.502 -10.620 -69.677  1.00 61.68  ? 429  LYS A NZ    1 
ATOM   3318  N  N     . ALA A  1 430 ? -109.176 -6.402  -75.946  1.00 38.74  ? 430  ALA A N     1 
ATOM   3319  C  CA    . ALA A  1 430 ? -109.905 -6.153  -77.188  1.00 43.51  ? 430  ALA A CA    1 
ATOM   3320  C  C     . ALA A  1 430 ? -109.181 -6.787  -78.365  1.00 42.35  ? 430  ALA A C     1 
ATOM   3321  O  O     . ALA A  1 430 ? -107.956 -6.747  -78.447  1.00 57.30  ? 430  ALA A O     1 
ATOM   3322  C  CB    . ALA A  1 430 ? -110.041 -4.663  -77.432  1.00 33.31  ? 430  ALA A CB    1 
ATOM   3323  N  N     . GLY A  1 431 ? -109.945 -7.373  -79.275  1.00 53.90  ? 431  GLY A N     1 
ATOM   3324  C  CA    . GLY A  1 431 ? -109.358 -8.010  -80.441  1.00 43.96  ? 431  GLY A CA    1 
ATOM   3325  C  C     . GLY A  1 431 ? -108.500 -9.204  -80.096  1.00 48.86  ? 431  GLY A C     1 
ATOM   3326  O  O     . GLY A  1 431 ? -107.718 -9.664  -80.938  1.00 61.21  ? 431  GLY A O     1 
ATOM   3327  N  N     . GLY A  1 432 ? -108.624 -9.678  -78.854  1.00 49.75  ? 432  GLY A N     1 
ATOM   3328  C  CA    . GLY A  1 432 ? -107.852 -10.823 -78.399  1.00 55.15  ? 432  GLY A CA    1 
ATOM   3329  C  C     . GLY A  1 432 ? -106.353 -10.595 -78.445  1.00 53.27  ? 432  GLY A C     1 
ATOM   3330  O  O     . GLY A  1 432 ? -105.589 -11.564 -78.546  1.00 43.29  ? 432  GLY A O     1 
ATOM   3331  N  N     . VAL A  1 433 ? -105.953 -9.316  -78.399  1.00 54.19  ? 433  VAL A N     1 
ATOM   3332  C  CA    . VAL A  1 433 ? -104.551 -8.876  -78.424  1.00 44.52  ? 433  VAL A CA    1 
ATOM   3333  C  C     . VAL A  1 433 ? -103.838 -9.372  -77.170  1.00 55.56  ? 433  VAL A C     1 
ATOM   3334  O  O     . VAL A  1 433 ? -102.890 -10.157 -77.248  1.00 49.76  ? 433  VAL A O     1 
ATOM   3335  C  CB    . VAL A  1 433 ? -104.459 -7.342  -78.464  1.00 35.40  ? 433  VAL A CB    1 
ATOM   3336  C  CG1   . VAL A  1 433 ? -103.013 -6.894  -78.342  1.00 43.54  ? 433  VAL A CG1   1 
ATOM   3337  C  CG2   . VAL A  1 433 ? -105.029 -6.821  -79.761  1.00 37.94  ? 433  VAL A CG2   1 
ATOM   3338  N  N     . PHE A  1 434 ? -104.296 -8.892  -76.018  1.00 44.13  ? 434  PHE A N     1 
ATOM   3339  C  CA    . PHE A  1 434 ? -103.747 -9.309  -74.739  1.00 27.51  ? 434  PHE A CA    1 
ATOM   3340  C  C     . PHE A  1 434 ? -104.681 -10.331 -74.107  1.00 40.45  ? 434  PHE A C     1 
ATOM   3341  O  O     . PHE A  1 434 ? -105.883 -10.086 -74.000  1.00 48.45  ? 434  PHE A O     1 
ATOM   3342  C  CB    . PHE A  1 434 ? -103.679 -8.122  -73.784  1.00 41.89  ? 434  PHE A CB    1 
ATOM   3343  C  CG    . PHE A  1 434 ? -102.490 -7.243  -73.979  1.00 46.24  ? 434  PHE A CG    1 
ATOM   3344  C  CD1   . PHE A  1 434 ? -101.350 -7.428  -73.211  1.00 41.74  ? 434  PHE A CD1   1 
ATOM   3345  C  CD2   . PHE A  1 434 ? -102.516 -6.204  -74.903  1.00 53.48  ? 434  PHE A CD2   1 
ATOM   3346  C  CE1   . PHE A  1 434 ? -100.250 -6.588  -73.357  1.00 37.13  ? 434  PHE A CE1   1 
ATOM   3347  C  CE2   . PHE A  1 434 ? -101.416 -5.354  -75.057  1.00 46.42  ? 434  PHE A CE2   1 
ATOM   3348  C  CZ    . PHE A  1 434 ? -100.283 -5.546  -74.283  1.00 44.63  ? 434  PHE A CZ    1 
ATOM   3349  N  N     . THR A  1 435 ? -104.134 -11.458 -73.663  1.00 35.18  ? 435  THR A N     1 
ATOM   3350  C  CA    . THR A  1 435 ? -104.945 -12.463 -72.992  1.00 31.81  ? 435  THR A CA    1 
ATOM   3351  C  C     . THR A  1 435 ? -104.818 -12.276 -71.479  1.00 43.22  ? 435  THR A C     1 
ATOM   3352  O  O     . THR A  1 435 ? -103.889 -11.631 -71.005  1.00 51.75  ? 435  THR A O     1 
ATOM   3353  C  CB    . THR A  1 435 ? -104.512 -13.889 -73.358  1.00 37.32  ? 435  THR A CB    1 
ATOM   3354  O  OG1   . THR A  1 435 ? -103.288 -14.218 -72.697  1.00 53.02  ? 435  THR A OG1   1 
ATOM   3355  C  CG2   . THR A  1 435 ? -104.321 -14.004 -74.842  1.00 33.15  ? 435  THR A CG2   1 
ATOM   3356  N  N     . ASP A  1 436 ? -105.752 -12.841 -70.720  1.00 53.11  ? 436  ASP A N     1 
ATOM   3357  C  CA    . ASP A  1 436 ? -105.708 -12.724 -69.266  1.00 47.16  ? 436  ASP A CA    1 
ATOM   3358  C  C     . ASP A  1 436 ? -104.411 -13.305 -68.722  1.00 47.99  ? 436  ASP A C     1 
ATOM   3359  O  O     . ASP A  1 436 ? -103.734 -12.640 -67.949  1.00 53.78  ? 436  ASP A O     1 
ATOM   3360  C  CB    . ASP A  1 436 ? -106.898 -13.441 -68.606  1.00 63.13  ? 436  ASP A CB    1 
ATOM   3361  C  CG    . ASP A  1 436 ? -108.194 -12.641 -68.678  1.00 61.43  ? 436  ASP A CG    1 
ATOM   3362  O  OD1   . ASP A  1 436 ? -109.233 -13.236 -69.029  1.00 71.67  ? 436  ASP A OD1   1 
ATOM   3363  O  OD2   . ASP A  1 436 ? -108.184 -11.432 -68.360  1.00 61.83  ? 436  ASP A OD2   1 
ATOM   3364  N  N     . GLU A  1 437 ? -104.060 -14.526 -69.143  1.00 38.27  ? 437  GLU A N     1 
ATOM   3365  C  CA    . GLU A  1 437 ? -102.838 -15.186 -68.669  1.00 51.01  ? 437  GLU A CA    1 
ATOM   3366  C  C     . GLU A  1 437 ? -101.622 -14.338 -69.010  1.00 48.64  ? 437  GLU A C     1 
ATOM   3367  O  O     . GLU A  1 437 ? -100.720 -14.200 -68.190  1.00 54.92  ? 437  GLU A O     1 
ATOM   3368  C  CB    . GLU A  1 437 ? -102.636 -16.603 -69.259  1.00 46.05  ? 437  GLU A CB    1 
ATOM   3369  C  CG    . GLU A  1 437 ? -103.862 -17.488 -69.338  1.00 71.41  ? 437  GLU A CG    1 
ATOM   3370  C  CD    . GLU A  1 437 ? -104.737 -17.134 -70.539  1.00 100.00 ? 437  GLU A CD    1 
ATOM   3371  O  OE1   . GLU A  1 437 ? -105.906 -16.709 -70.339  1.00 85.08  ? 437  GLU A OE1   1 
ATOM   3372  O  OE2   . GLU A  1 437 ? -104.237 -17.262 -71.686  1.00 100.00 ? 437  GLU A OE2   1 
ATOM   3373  N  N     . ALA A  1 438 ? -101.599 -13.761 -70.210  1.00 40.85  ? 438  ALA A N     1 
ATOM   3374  C  CA    . ALA A  1 438 ? -100.470 -12.927 -70.612  1.00 39.58  ? 438  ALA A CA    1 
ATOM   3375  C  C     . ALA A  1 438 ? -100.325 -11.777 -69.623  1.00 41.09  ? 438  ALA A C     1 
ATOM   3376  O  O     . ALA A  1 438 ? -99.237  -11.523 -69.101  1.00 58.31  ? 438  ALA A O     1 
ATOM   3377  C  CB    . ALA A  1 438 ? -100.657 -12.394 -72.030  1.00 32.91  ? 438  ALA A CB    1 
ATOM   3378  N  N     . ILE A  1 439 ? -101.442 -11.132 -69.314  1.00 27.42  ? 439  ILE A N     1 
ATOM   3379  C  CA    . ILE A  1 439 ? -101.456 -10.016 -68.379  1.00 28.91  ? 439  ILE A CA    1 
ATOM   3380  C  C     . ILE A  1 439 ? -101.115 -10.430 -66.942  1.00 34.54  ? 439  ILE A C     1 
ATOM   3381  O  O     . ILE A  1 439 ? -100.315 -9.780  -66.272  1.00 45.52  ? 439  ILE A O     1 
ATOM   3382  C  CB    . ILE A  1 439 ? -102.820 -9.302  -68.429  1.00 31.04  ? 439  ILE A CB    1 
ATOM   3383  C  CG1   . ILE A  1 439 ? -102.994 -8.642  -69.801  1.00 32.63  ? 439  ILE A CG1   1 
ATOM   3384  C  CG2   . ILE A  1 439 ? -102.951 -8.288  -67.305  1.00 31.98  ? 439  ILE A CG2   1 
ATOM   3385  C  CD1   . ILE A  1 439 ? -104.268 -7.840  -69.953  1.00 29.19  ? 439  ILE A CD1   1 
ATOM   3386  N  N     . ASP A  1 440 ? -101.707 -11.519 -66.475  1.00 38.88  ? 440  ASP A N     1 
ATOM   3387  C  CA    . ASP A  1 440 ? -101.451 -12.001 -65.125  1.00 40.76  ? 440  ASP A CA    1 
ATOM   3388  C  C     . ASP A  1 440 ? -100.000 -12.444 -64.958  1.00 40.77  ? 440  ASP A C     1 
ATOM   3389  O  O     . ASP A  1 440 ? -99.403  -12.242 -63.906  1.00 43.15  ? 440  ASP A O     1 
ATOM   3390  C  CB    . ASP A  1 440 ? -102.402 -13.155 -64.787  1.00 47.21  ? 440  ASP A CB    1 
ATOM   3391  C  CG    . ASP A  1 440 ? -103.864 -12.720 -64.737  1.00 54.88  ? 440  ASP A CG    1 
ATOM   3392  O  OD1   . ASP A  1 440 ? -104.144 -11.570 -64.318  1.00 40.39  ? 440  ASP A OD1   1 
ATOM   3393  O  OD2   . ASP A  1 440 ? -104.730 -13.538 -65.112  1.00 51.56  ? 440  ASP A OD2   1 
ATOM   3394  N  N     . ALA A  1 441 ? -99.439  -13.042 -66.005  1.00 43.07  ? 441  ALA A N     1 
ATOM   3395  C  CA    . ALA A  1 441 ? -98.053  -13.505 -65.986  1.00 37.38  ? 441  ALA A CA    1 
ATOM   3396  C  C     . ALA A  1 441 ? -97.124  -12.311 -65.810  1.00 42.58  ? 441  ALA A C     1 
ATOM   3397  O  O     . ALA A  1 441 ? -96.192  -12.354 -65.010  1.00 46.81  ? 441  ALA A O     1 
ATOM   3398  C  CB    . ALA A  1 441 ? -97.723  -14.233 -67.283  1.00 34.95  ? 441  ALA A CB    1 
ATOM   3399  N  N     . TYR A  1 442 ? -97.393  -11.251 -66.570  1.00 33.77  ? 442  TYR A N     1 
ATOM   3400  C  CA    . TYR A  1 442 ? -96.614  -10.024 -66.511  1.00 24.76  ? 442  TYR A CA    1 
ATOM   3401  C  C     . TYR A  1 442 ? -96.702  -9.409  -65.123  1.00 30.29  ? 442  TYR A C     1 
ATOM   3402  O  O     . TYR A  1 442 ? -95.687  -9.083  -64.515  1.00 49.75  ? 442  TYR A O     1 
ATOM   3403  C  CB    . TYR A  1 442 ? -97.132  -9.027  -67.542  1.00 23.94  ? 442  TYR A CB    1 
ATOM   3404  C  CG    . TYR A  1 442 ? -96.387  -7.704  -67.574  1.00 31.17  ? 442  TYR A CG    1 
ATOM   3405  C  CD1   . TYR A  1 442 ? -96.806  -6.622  -66.799  1.00 29.08  ? 442  TYR A CD1   1 
ATOM   3406  C  CD2   . TYR A  1 442 ? -95.266  -7.533  -68.387  1.00 32.95  ? 442  TYR A CD2   1 
ATOM   3407  C  CE1   . TYR A  1 442 ? -96.124  -5.403  -66.827  1.00 31.47  ? 442  TYR A CE1   1 
ATOM   3408  C  CE2   . TYR A  1 442 ? -94.579  -6.321  -68.421  1.00 38.58  ? 442  TYR A CE2   1 
ATOM   3409  C  CZ    . TYR A  1 442 ? -95.008  -5.262  -67.639  1.00 30.73  ? 442  TYR A CZ    1 
ATOM   3410  O  OH    . TYR A  1 442 ? -94.292  -4.081  -67.640  1.00 53.88  ? 442  TYR A OH    1 
ATOM   3411  N  N     . ILE A  1 443 ? -97.923  -9.251  -64.630  1.00 32.95  ? 443  ILE A N     1 
ATOM   3412  C  CA    . ILE A  1 443 ? -98.144  -8.682  -63.308  1.00 31.60  ? 443  ILE A CA    1 
ATOM   3413  C  C     . ILE A  1 443 ? -97.375  -9.443  -62.227  1.00 34.72  ? 443  ILE A C     1 
ATOM   3414  O  O     . ILE A  1 443 ? -96.836  -8.846  -61.301  1.00 38.37  ? 443  ILE A O     1 
ATOM   3415  C  CB    . ILE A  1 443 ? -99.653  -8.662  -62.966  1.00 34.60  ? 443  ILE A CB    1 
ATOM   3416  C  CG1   . ILE A  1 443 ? -100.341 -7.535  -63.736  1.00 33.66  ? 443  ILE A CG1   1 
ATOM   3417  C  CG2   . ILE A  1 443 ? -99.879  -8.521  -61.457  1.00 29.48  ? 443  ILE A CG2   1 
ATOM   3418  C  CD1   . ILE A  1 443 ? -101.846 -7.487  -63.558  1.00 32.69  ? 443  ILE A CD1   1 
ATOM   3419  N  N     . ALA A  1 444 ? -97.284  -10.755 -62.372  1.00 31.08  ? 444  ALA A N     1 
ATOM   3420  C  CA    . ALA A  1 444 ? -96.593  -11.558 -61.379  1.00 35.24  ? 444  ALA A CA    1 
ATOM   3421  C  C     . ALA A  1 444 ? -95.082  -11.356 -61.400  1.00 35.40  ? 444  ALA A C     1 
ATOM   3422  O  O     . ALA A  1 444 ? -94.451  -11.303 -60.347  1.00 42.51  ? 444  ALA A O     1 
ATOM   3423  C  CB    . ALA A  1 444 ? -96.946  -13.009 -61.556  1.00 18.36  ? 444  ALA A CB    1 
ATOM   3424  N  N     . LEU A  1 445 ? -94.501  -11.263 -62.594  1.00 34.11  ? 445  LEU A N     1 
ATOM   3425  C  CA    . LEU A  1 445 ? -93.062  -11.050 -62.726  1.00 26.42  ? 445  LEU A CA    1 
ATOM   3426  C  C     . LEU A  1 445 ? -92.681  -9.741  -62.059  1.00 32.26  ? 445  LEU A C     1 
ATOM   3427  O  O     . LEU A  1 445 ? -91.782  -9.687  -61.226  1.00 41.03  ? 445  LEU A O     1 
ATOM   3428  C  CB    . LEU A  1 445 ? -92.648  -10.955 -64.192  1.00 25.94  ? 445  LEU A CB    1 
ATOM   3429  C  CG    . LEU A  1 445 ? -92.542  -12.223 -65.019  1.00 29.40  ? 445  LEU A CG    1 
ATOM   3430  C  CD1   . LEU A  1 445 ? -92.182  -11.833 -66.434  1.00 41.89  ? 445  LEU A CD1   1 
ATOM   3431  C  CD2   . LEU A  1 445 ? -91.494  -13.156 -64.436  1.00 30.69  ? 445  LEU A CD2   1 
ATOM   3432  N  N     . ARG A  1 446 ? -93.397  -8.690  -62.420  1.00 24.71  ? 446  ARG A N     1 
ATOM   3433  C  CA    . ARG A  1 446 ? -93.124  -7.380  -61.876  1.00 34.55  ? 446  ARG A CA    1 
ATOM   3434  C  C     . ARG A  1 446 ? -93.417  -7.297  -60.394  1.00 27.87  ? 446  ARG A C     1 
ATOM   3435  O  O     . ARG A  1 446 ? -92.774  -6.549  -59.662  1.00 40.52  ? 446  ARG A O     1 
ATOM   3436  C  CB    . ARG A  1 446 ? -93.934  -6.333  -62.629  1.00 27.04  ? 446  ARG A CB    1 
ATOM   3437  C  CG    . ARG A  1 446 ? -93.649  -6.300  -64.118  1.00 18.79  ? 446  ARG A CG    1 
ATOM   3438  C  CD    . ARG A  1 446 ? -92.177  -6.127  -64.387  1.00 34.94  ? 446  ARG A CD    1 
ATOM   3439  N  NE    . ARG A  1 446 ? -91.944  -5.566  -65.708  1.00 43.23  ? 446  ARG A NE    1 
ATOM   3440  C  CZ    . ARG A  1 446 ? -90.745  -5.408  -66.246  1.00 40.52  ? 446  ARG A CZ    1 
ATOM   3441  N  NH1   . ARG A  1 446 ? -90.631  -4.882  -67.460  1.00 38.64  ? 446  ARG A NH1   1 
ATOM   3442  N  NH2   . ARG A  1 446 ? -89.666  -5.782  -65.570  1.00 35.66  ? 446  ARG A NH2   1 
ATOM   3443  N  N     . ARG A  1 447 ? -94.364  -8.104  -59.944  1.00 32.39  ? 447  ARG A N     1 
ATOM   3444  C  CA    . ARG A  1 447 ? -94.748  -8.077  -58.547  1.00 36.87  ? 447  ARG A CA    1 
ATOM   3445  C  C     . ARG A  1 447 ? -93.636  -8.610  -57.667  1.00 36.82  ? 447  ARG A C     1 
ATOM   3446  O  O     . ARG A  1 447 ? -93.450  -8.130  -56.543  1.00 36.57  ? 447  ARG A O     1 
ATOM   3447  C  CB    . ARG A  1 447 ? -96.052  -8.851  -58.333  1.00 32.63  ? 447  ARG A CB    1 
ATOM   3448  C  CG    . ARG A  1 447 ? -96.975  -8.203  -57.341  1.00 48.86  ? 447  ARG A CG    1 
ATOM   3449  C  CD    . ARG A  1 447 ? -98.382  -8.136  -57.883  1.00 36.20  ? 447  ARG A CD    1 
ATOM   3450  N  NE    . ARG A  1 447 ? -98.960  -6.825  -57.611  1.00 65.59  ? 447  ARG A NE    1 
ATOM   3451  C  CZ    . ARG A  1 447 ? -100.222 -6.502  -57.864  1.00 62.84  ? 447  ARG A CZ    1 
ATOM   3452  N  NH1   . ARG A  1 447 ? -100.659 -5.272  -57.584  1.00 52.83  ? 447  ARG A NH1   1 
ATOM   3453  N  NH2   . ARG A  1 447 ? -101.037 -7.418  -58.389  1.00 29.36  ? 447  ARG A NH2   1 
ATOM   3454  N  N     . GLU A  1 448 ? -92.868  -9.570  -58.185  1.00 26.17  ? 448  GLU A N     1 
ATOM   3455  C  CA    . GLU A  1 448 ? -91.780  -10.118 -57.393  1.00 35.21  ? 448  GLU A CA    1 
ATOM   3456  C  C     . GLU A  1 448 ? -90.585  -9.169  -57.358  1.00 33.71  ? 448  GLU A C     1 
ATOM   3457  O  O     . GLU A  1 448 ? -89.818  -9.163  -56.394  1.00 48.72  ? 448  GLU A O     1 
ATOM   3458  C  CB    . GLU A  1 448 ? -91.404  -11.530 -57.839  1.00 23.88  ? 448  GLU A CB    1 
ATOM   3459  C  CG    . GLU A  1 448 ? -90.634  -11.643 -59.120  1.00 68.51  ? 448  GLU A CG    1 
ATOM   3460  C  CD    . GLU A  1 448 ? -90.290  -13.090 -59.441  1.00 81.50  ? 448  GLU A CD    1 
ATOM   3461  O  OE1   . GLU A  1 448 ? -90.185  -13.899 -58.488  1.00 61.91  ? 448  GLU A OE1   1 
ATOM   3462  O  OE2   . GLU A  1 448 ? -90.131  -13.419 -60.639  1.00 89.55  ? 448  GLU A OE2   1 
ATOM   3463  N  N     . GLU A  1 449 ? -90.468  -8.329  -58.384  1.00 32.25  ? 449  GLU A N     1 
ATOM   3464  C  CA    . GLU A  1 449 ? -89.411  -7.327  -58.440  1.00 21.16  ? 449  GLU A CA    1 
ATOM   3465  C  C     . GLU A  1 449 ? -89.768  -6.236  -57.429  1.00 26.86  ? 449  GLU A C     1 
ATOM   3466  O  O     . GLU A  1 449 ? -88.932  -5.818  -56.630  1.00 39.15  ? 449  GLU A O     1 
ATOM   3467  C  CB    . GLU A  1 449 ? -89.301  -6.742  -59.844  1.00 16.24  ? 449  GLU A CB    1 
ATOM   3468  C  CG    . GLU A  1 449 ? -88.804  -7.764  -60.858  1.00 19.42  ? 449  GLU A CG    1 
ATOM   3469  C  CD    . GLU A  1 449 ? -88.649  -7.199  -62.251  1.00 36.15  ? 449  GLU A CD    1 
ATOM   3470  O  OE1   . GLU A  1 449 ? -89.419  -6.291  -62.623  1.00 26.54  ? 449  GLU A OE1   1 
ATOM   3471  O  OE2   . GLU A  1 449 ? -87.752  -7.671  -62.981  1.00 30.19  ? 449  GLU A OE2   1 
ATOM   3472  N  N     . ASP A  1 450 ? -91.036  -5.833  -57.422  1.00 25.78  ? 450  ASP A N     1 
ATOM   3473  C  CA    . ASP A  1 450 ? -91.514  -4.821  -56.486  1.00 32.46  ? 450  ASP A CA    1 
ATOM   3474  C  C     . ASP A  1 450 ? -91.254  -5.293  -55.041  1.00 34.38  ? 450  ASP A C     1 
ATOM   3475  O  O     . ASP A  1 450 ? -90.858  -4.505  -54.174  1.00 40.89  ? 450  ASP A O     1 
ATOM   3476  C  CB    . ASP A  1 450 ? -93.013  -4.559  -56.716  1.00 26.94  ? 450  ASP A CB    1 
ATOM   3477  C  CG    . ASP A  1 450 ? -93.532  -3.326  -55.966  1.00 32.54  ? 450  ASP A CG    1 
ATOM   3478  O  OD1   . ASP A  1 450 ? -92.932  -2.242  -56.101  1.00 49.90  ? 450  ASP A OD1   1 
ATOM   3479  O  OD2   . ASP A  1 450 ? -94.553  -3.435  -55.250  1.00 41.30  ? 450  ASP A OD2   1 
ATOM   3480  N  N     . ASP A  1 451 ? -91.417  -6.591  -54.807  1.00 29.85  ? 451  ASP A N     1 
ATOM   3481  C  CA    . ASP A  1 451 ? -91.209  -7.152  -53.477  1.00 34.46  ? 451  ASP A CA    1 
ATOM   3482  C  C     . ASP A  1 451 ? -89.800  -6.946  -52.977  1.00 33.94  ? 451  ASP A C     1 
ATOM   3483  O  O     . ASP A  1 451 ? -89.595  -6.548  -51.832  1.00 39.12  ? 451  ASP A O     1 
ATOM   3484  C  CB    . ASP A  1 451 ? -91.542  -8.645  -53.445  1.00 38.63  ? 451  ASP A CB    1 
ATOM   3485  C  CG    . ASP A  1 451 ? -93.036  -8.919  -53.329  1.00 58.72  ? 451  ASP A CG    1 
ATOM   3486  O  OD1   . ASP A  1 451 ? -93.840  -7.966  -53.145  1.00 42.69  ? 451  ASP A OD1   1 
ATOM   3487  O  OD2   . ASP A  1 451 ? -93.399  -10.113 -53.418  1.00 61.68  ? 451  ASP A OD2   1 
ATOM   3488  N  N     . ARG A  1 452 ? -88.827  -7.191  -53.844  1.00 31.76  ? 452  ARG A N     1 
ATOM   3489  C  CA    . ARG A  1 452 ? -87.440  -7.044  -53.444  1.00 25.63  ? 452  ARG A CA    1 
ATOM   3490  C  C     . ARG A  1 452 ? -87.157  -5.636  -52.964  1.00 34.66  ? 452  ARG A C     1 
ATOM   3491  O  O     . ARG A  1 452 ? -86.523  -5.430  -51.932  1.00 35.60  ? 452  ARG A O     1 
ATOM   3492  C  CB    . ARG A  1 452 ? -86.505  -7.427  -54.587  1.00 27.02  ? 452  ARG A CB    1 
ATOM   3493  C  CG    . ARG A  1 452 ? -86.490  -8.919  -54.878  1.00 48.83  ? 452  ARG A CG    1 
ATOM   3494  C  CD    . ARG A  1 452 ? -85.116  -9.373  -55.327  1.00 51.05  ? 452  ARG A CD    1 
ATOM   3495  N  NE    . ARG A  1 452 ? -84.106  -8.943  -54.366  1.00 59.81  ? 452  ARG A NE    1 
ATOM   3496  C  CZ    . ARG A  1 452 ? -82.823  -8.759  -54.655  1.00 65.68  ? 452  ARG A CZ    1 
ATOM   3497  N  NH1   . ARG A  1 452 ? -81.992  -8.354  -53.695  1.00 51.53  ? 452  ARG A NH1   1 
ATOM   3498  N  NH2   . ARG A  1 452 ? -82.370  -8.994  -55.890  1.00 48.57  ? 452  ARG A NH2   1 
ATOM   3499  N  N     . VAL A  1 453 ? -87.697  -4.665  -53.678  1.00 26.23  ? 453  VAL A N     1 
ATOM   3500  C  CA    . VAL A  1 453 ? -87.485  -3.284  -53.311  1.00 21.70  ? 453  VAL A CA    1 
ATOM   3501  C  C     . VAL A  1 453 ? -88.263  -2.911  -52.053  1.00 30.31  ? 453  VAL A C     1 
ATOM   3502  O  O     . VAL A  1 453 ? -87.744  -2.193  -51.206  1.00 37.40  ? 453  VAL A O     1 
ATOM   3503  C  CB    . VAL A  1 453 ? -87.848  -2.342  -54.480  1.00 27.47  ? 453  VAL A CB    1 
ATOM   3504  C  CG1   . VAL A  1 453 ? -87.592  -0.901  -54.103  1.00 15.00  ? 453  VAL A CG1   1 
ATOM   3505  C  CG2   . VAL A  1 453 ? -87.042  -2.716  -55.722  1.00 22.05  ? 453  VAL A CG2   1 
ATOM   3506  N  N     . ARG A  1 454 ? -89.495  -3.402  -51.915  1.00 34.22  ? 454  ARG A N     1 
ATOM   3507  C  CA    . ARG A  1 454 ? -90.301  -3.068  -50.738  1.00 29.78  ? 454  ARG A CA    1 
ATOM   3508  C  C     . ARG A  1 454 ? -89.825  -3.762  -49.472  1.00 34.41  ? 454  ARG A C     1 
ATOM   3509  O  O     . ARG A  1 454 ? -90.000  -3.241  -48.368  1.00 42.65  ? 454  ARG A O     1 
ATOM   3510  C  CB    . ARG A  1 454 ? -91.774  -3.420  -50.948  1.00 36.42  ? 454  ARG A CB    1 
ATOM   3511  C  CG    . ARG A  1 454 ? -92.618  -2.417  -51.761  1.00 86.39  ? 454  ARG A CG    1 
ATOM   3512  C  CD    . ARG A  1 454 ? -94.126  -2.758  -51.681  1.00 82.77  ? 454  ARG A CD    1 
ATOM   3513  N  NE    . ARG A  1 454 ? -94.335  -4.200  -51.543  1.00 82.72  ? 454  ARG A NE    1 
ATOM   3514  C  CZ    . ARG A  1 454 ? -94.471  -4.832  -50.375  1.00 100.00 ? 454  ARG A CZ    1 
ATOM   3515  N  NH1   . ARG A  1 454 ? -94.632  -6.154  -50.348  1.00 93.88  ? 454  ARG A NH1   1 
ATOM   3516  N  NH2   . ARG A  1 454 ? -94.471  -4.139  -49.234  1.00 96.13  ? 454  ARG A NH2   1 
ATOM   3517  N  N     . MET A  1 455 ? -89.225  -4.933  -49.636  1.00 29.39  ? 455  MET A N     1 
ATOM   3518  C  CA    . MET A  1 455 ? -88.759  -5.719  -48.503  1.00 31.76  ? 455  MET A CA    1 
ATOM   3519  C  C     . MET A  1 455 ? -87.332  -5.466  -48.007  1.00 35.53  ? 455  MET A C     1 
ATOM   3520  O  O     . MET A  1 455 ? -87.030  -5.738  -46.850  1.00 46.50  ? 455  MET A O     1 
ATOM   3521  C  CB    . MET A  1 455 ? -88.949  -7.204  -48.805  1.00 28.88  ? 455  MET A CB    1 
ATOM   3522  C  CG    . MET A  1 455 ? -90.401  -7.640  -48.887  1.00 38.64  ? 455  MET A CG    1 
ATOM   3523  S  SD    . MET A  1 455 ? -90.605  -9.325  -49.501  1.00 64.78  ? 455  MET A SD    1 
ATOM   3524  C  CE    . MET A  1 455 ? -89.743  -10.291 -48.253  1.00 66.95  ? 455  MET A CE    1 
ATOM   3525  N  N     . THR A  1 456 ? -86.469  -4.928  -48.867  1.00 38.64  ? 456  THR A N     1 
ATOM   3526  C  CA    . THR A  1 456 ? -85.061  -4.668  -48.525  1.00 25.65  ? 456  THR A CA    1 
ATOM   3527  C  C     . THR A  1 456 ? -84.796  -3.290  -47.904  1.00 23.71  ? 456  THR A C     1 
ATOM   3528  O  O     . THR A  1 456 ? -85.024  -2.271  -48.546  1.00 32.93  ? 456  THR A O     1 
ATOM   3529  C  CB    . THR A  1 456 ? -84.172  -4.790  -49.789  1.00 21.23  ? 456  THR A CB    1 
ATOM   3530  O  OG1   . THR A  1 456 ? -84.318  -6.095  -50.371  1.00 28.80  ? 456  THR A OG1   1 
ATOM   3531  C  CG2   . THR A  1 456 ? -82.720  -4.544  -49.450  1.00 22.21  ? 456  THR A CG2   1 
ATOM   3532  N  N     . PRO A  1 457 ? -84.230  -3.240  -46.683  1.00 21.41  ? 457  PRO A N     1 
ATOM   3533  C  CA    . PRO A  1 457 ? -83.958  -1.941  -46.055  1.00 17.05  ? 457  PRO A CA    1 
ATOM   3534  C  C     . PRO A  1 457 ? -83.146  -1.036  -46.982  1.00 23.54  ? 457  PRO A C     1 
ATOM   3535  O  O     . PRO A  1 457 ? -82.183  -1.478  -47.616  1.00 35.85  ? 457  PRO A O     1 
ATOM   3536  C  CB    . PRO A  1 457 ? -83.160  -2.324  -44.810  1.00 17.21  ? 457  PRO A CB    1 
ATOM   3537  C  CG    . PRO A  1 457 ? -83.691  -3.659  -44.465  1.00 14.82  ? 457  PRO A CG    1 
ATOM   3538  C  CD    . PRO A  1 457 ? -83.784  -4.338  -45.812  1.00 16.14  ? 457  PRO A CD    1 
ATOM   3539  N  N     . HIS A  1 458 ? -83.562  0.225   -47.041  1.00 21.98  ? 458  HIS A N     1 
ATOM   3540  C  CA    . HIS A  1 458 ? -82.957  1.265   -47.873  1.00 22.97  ? 458  HIS A CA    1 
ATOM   3541  C  C     . HIS A  1 458 ? -82.001  2.115   -47.056  1.00 25.80  ? 458  HIS A C     1 
ATOM   3542  O  O     . HIS A  1 458 ? -82.350  2.577   -45.979  1.00 39.66  ? 458  HIS A O     1 
ATOM   3543  C  CB    . HIS A  1 458 ? -84.076  2.167   -48.419  1.00 20.49  ? 458  HIS A CB    1 
ATOM   3544  C  CG    . HIS A  1 458 ? -83.620  3.226   -49.378  1.00 21.50  ? 458  HIS A CG    1 
ATOM   3545  N  ND1   . HIS A  1 458 ? -84.195  3.395   -50.620  1.00 23.78  ? 458  HIS A ND1   1 
ATOM   3546  C  CD2   . HIS A  1 458 ? -82.669  4.183   -49.271  1.00 22.34  ? 458  HIS A CD2   1 
ATOM   3547  C  CE1   . HIS A  1 458 ? -83.615  4.407   -51.239  1.00 18.82  ? 458  HIS A CE1   1 
ATOM   3548  N  NE2   . HIS A  1 458 ? -82.684  4.904   -50.441  1.00 28.11  ? 458  HIS A NE2   1 
ATOM   3549  N  N     . PRO A  1 459 ? -80.808  2.396   -47.601  1.00 30.86  ? 459  PRO A N     1 
ATOM   3550  C  CA    . PRO A  1 459 ? -79.754  3.203   -46.979  1.00 23.90  ? 459  PRO A CA    1 
ATOM   3551  C  C     . PRO A  1 459 ? -80.267  4.453   -46.281  1.00 22.61  ? 459  PRO A C     1 
ATOM   3552  O  O     . PRO A  1 459 ? -79.884  4.733   -45.145  1.00 32.52  ? 459  PRO A O     1 
ATOM   3553  C  CB    . PRO A  1 459 ? -78.887  3.567   -48.172  1.00 21.62  ? 459  PRO A CB    1 
ATOM   3554  C  CG    . PRO A  1 459 ? -78.913  2.300   -48.958  1.00 23.96  ? 459  PRO A CG    1 
ATOM   3555  C  CD    . PRO A  1 459 ? -80.365  1.894   -48.915  1.00 25.85  ? 459  PRO A CD    1 
ATOM   3556  N  N     . VAL A  1 460 ? -81.175  5.163   -46.954  1.00 27.85  ? 460  VAL A N     1 
ATOM   3557  C  CA    . VAL A  1 460 ? -81.779  6.400   -46.452  1.00 25.33  ? 460  VAL A CA    1 
ATOM   3558  C  C     . VAL A  1 460 ? -82.605  6.193   -45.168  1.00 24.90  ? 460  VAL A C     1 
ATOM   3559  O  O     . VAL A  1 460 ? -82.769  7.111   -44.348  1.00 28.07  ? 460  VAL A O     1 
ATOM   3560  C  CB    . VAL A  1 460 ? -82.617  7.077   -47.582  1.00 23.71  ? 460  VAL A CB    1 
ATOM   3561  C  CG1   . VAL A  1 460 ? -83.466  8.205   -47.051  1.00 19.93  ? 460  VAL A CG1   1 
ATOM   3562  C  CG2   . VAL A  1 460 ? -81.678  7.640   -48.644  1.00 20.72  ? 460  VAL A CG2   1 
ATOM   3563  N  N     . GLU A  1 461 ? -83.085  4.969   -44.976  1.00 18.28  ? 461  GLU A N     1 
ATOM   3564  C  CA    . GLU A  1 461 ? -83.868  4.630   -43.789  1.00 24.97  ? 461  GLU A CA    1 
ATOM   3565  C  C     . GLU A  1 461 ? -82.993  4.653   -42.546  1.00 25.53  ? 461  GLU A C     1 
ATOM   3566  O  O     . GLU A  1 461 ? -83.472  4.838   -41.432  1.00 29.30  ? 461  GLU A O     1 
ATOM   3567  C  CB    . GLU A  1 461 ? -84.538  3.262   -43.955  1.00 15.19  ? 461  GLU A CB    1 
ATOM   3568  C  CG    . GLU A  1 461 ? -85.641  3.262   -45.026  1.00 27.41  ? 461  GLU A CG    1 
ATOM   3569  C  CD    . GLU A  1 461 ? -86.397  1.937   -45.157  1.00 34.02  ? 461  GLU A CD    1 
ATOM   3570  O  OE1   . GLU A  1 461 ? -87.601  1.979   -45.476  1.00 28.91  ? 461  GLU A OE1   1 
ATOM   3571  O  OE2   . GLU A  1 461 ? -85.799  0.856   -44.979  1.00 26.68  ? 461  GLU A OE2   1 
ATOM   3572  N  N     . PHE A  1 462 ? -81.695  4.462   -42.752  1.00 24.08  ? 462  PHE A N     1 
ATOM   3573  C  CA    . PHE A  1 462 ? -80.757  4.515   -41.652  1.00 18.97  ? 462  PHE A CA    1 
ATOM   3574  C  C     . PHE A  1 462 ? -80.461  5.952   -41.288  1.00 28.57  ? 462  PHE A C     1 
ATOM   3575  O  O     . PHE A  1 462 ? -80.338  6.300   -40.109  1.00 37.66  ? 462  PHE A O     1 
ATOM   3576  C  CB    . PHE A  1 462 ? -79.467  3.756   -42.016  1.00 12.36  ? 462  PHE A CB    1 
ATOM   3577  C  CG    . PHE A  1 462 ? -79.746  2.279   -42.107  1.00 32.58  ? 462  PHE A CG    1 
ATOM   3578  C  CD1   . PHE A  1 462 ? -79.486  1.467   -41.000  1.00 27.63  ? 462  PHE A CD1   1 
ATOM   3579  C  CD2   . PHE A  1 462 ? -80.285  1.701   -43.249  1.00 43.24  ? 462  PHE A CD2   1 
ATOM   3580  C  CE1   . PHE A  1 462 ? -79.779  0.109   -41.037  1.00 23.83  ? 462  PHE A CE1   1 
ATOM   3581  C  CE2   . PHE A  1 462 ? -80.576  0.331   -43.284  1.00 19.79  ? 462  PHE A CE2   1 
ATOM   3582  C  CZ    . PHE A  1 462 ? -80.332  -0.457  -42.188  1.00 27.37  ? 462  PHE A CZ    1 
ATOM   3583  N  N     . GLU A  1 463 ? -80.358  6.790   -42.316  1.00 23.48  ? 463  GLU A N     1 
ATOM   3584  C  CA    . GLU A  1 463 ? -80.079  8.215   -42.169  1.00 23.33  ? 463  GLU A CA    1 
ATOM   3585  C  C     . GLU A  1 463 ? -81.206  8.813   -41.346  1.00 27.96  ? 463  GLU A C     1 
ATOM   3586  O  O     . GLU A  1 463 ? -80.982  9.560   -40.388  1.00 39.78  ? 463  GLU A O     1 
ATOM   3587  C  CB    . GLU A  1 463 ? -80.063  8.859   -43.561  1.00 26.99  ? 463  GLU A CB    1 
ATOM   3588  C  CG    . GLU A  1 463 ? -79.483  10.258  -43.663  1.00 57.20  ? 463  GLU A CG    1 
ATOM   3589  C  CD    . GLU A  1 463 ? -78.870  10.483  -45.015  1.00 78.85  ? 463  GLU A CD    1 
ATOM   3590  O  OE1   . GLU A  1 463 ? -77.632  10.335  -45.164  1.00 81.46  ? 463  GLU A OE1   1 
ATOM   3591  O  OE2   . GLU A  1 463 ? -79.642  10.789  -45.939  1.00 71.25  ? 463  GLU A OE2   1 
ATOM   3592  N  N     . LEU A  1 464 ? -82.412  8.398   -41.715  1.00 24.24  ? 464  LEU A N     1 
ATOM   3593  C  CA    . LEU A  1 464 ? -83.695  8.829   -41.120  1.00 13.84  ? 464  LEU A CA    1 
ATOM   3594  C  C     . LEU A  1 464 ? -84.068  8.148   -39.809  1.00 28.31  ? 464  LEU A C     1 
ATOM   3595  O  O     . LEU A  1 464 ? -84.613  8.795   -38.922  1.00 26.08  ? 464  LEU A O     1 
ATOM   3596  C  CB    . LEU A  1 464 ? -84.836  8.508   -42.099  1.00 18.70  ? 464  LEU A CB    1 
ATOM   3597  C  CG    . LEU A  1 464 ? -85.481  9.580   -42.994  1.00 13.06  ? 464  LEU A CG    1 
ATOM   3598  C  CD1   . LEU A  1 464 ? -84.533  10.737  -43.231  1.00 24.76  ? 464  LEU A CD1   1 
ATOM   3599  C  CD2   . LEU A  1 464 ? -85.930  8.971   -44.314  1.00 20.58  ? 464  LEU A CD2   1 
ATOM   3600  N  N     . TYR A  1 465 ? -83.808  6.849   -39.647  1.00 23.94  ? 465  TYR A N     1 
ATOM   3601  C  CA    . TYR A  1 465 ? -84.312  6.131   -38.471  1.00 20.20  ? 465  TYR A CA    1 
ATOM   3602  C  C     . TYR A  1 465 ? -83.346  5.399   -37.558  1.00 23.27  ? 465  TYR A C     1 
ATOM   3603  O  O     . TYR A  1 465 ? -83.789  4.870   -36.526  1.00 31.71  ? 465  TYR A O     1 
ATOM   3604  C  CB    . TYR A  1 465 ? -85.351  5.138   -38.945  1.00 13.84  ? 465  TYR A CB    1 
ATOM   3605  C  CG    . TYR A  1 465 ? -86.385  5.714   -39.882  1.00 24.13  ? 465  TYR A CG    1 
ATOM   3606  C  CD1   . TYR A  1 465 ? -87.194  6.790   -39.496  1.00 28.29  ? 465  TYR A CD1   1 
ATOM   3607  C  CD2   . TYR A  1 465 ? -86.568  5.176   -41.156  1.00 29.30  ? 465  TYR A CD2   1 
ATOM   3608  C  CE1   . TYR A  1 465 ? -88.162  7.310   -40.356  1.00 31.18  ? 465  TYR A CE1   1 
ATOM   3609  C  CE2   . TYR A  1 465 ? -87.531  5.688   -42.024  1.00 35.20  ? 465  TYR A CE2   1 
ATOM   3610  C  CZ    . TYR A  1 465 ? -88.325  6.746   -41.616  1.00 33.03  ? 465  TYR A CZ    1 
ATOM   3611  O  OH    . TYR A  1 465 ? -89.285  7.247   -42.476  1.00 37.50  ? 465  TYR A OH    1 
ATOM   3612  N  N     . TYR A  1 466 ? -82.070  5.342   -37.871  1.00 24.22  ? 466  TYR A N     1 
ATOM   3613  C  CA    . TYR A  1 466 ? -81.201  4.575   -36.981  1.00 19.26  ? 466  TYR A CA    1 
ATOM   3614  C  C     . TYR A  1 466 ? -81.221  5.040   -35.513  1.00 30.40  ? 466  TYR A C     1 
ATOM   3615  O  O     . TYR A  1 466 ? -81.180  4.213   -34.609  1.00 23.64  ? 466  TYR A O     1 
ATOM   3616  C  CB    . TYR A  1 466 ? -79.778  4.547   -37.538  1.00 19.52  ? 466  TYR A CB    1 
ATOM   3617  C  CG    . TYR A  1 466 ? -78.834  3.665   -36.744  1.00 22.57  ? 466  TYR A CG    1 
ATOM   3618  C  CD1   . TYR A  1 466 ? -78.794  2.287   -36.954  1.00 28.55  ? 466  TYR A CD1   1 
ATOM   3619  C  CD2   . TYR A  1 466 ? -77.981  4.209   -35.783  1.00 26.15  ? 466  TYR A CD2   1 
ATOM   3620  C  CE1   . TYR A  1 466 ? -77.925  1.471   -36.233  1.00 21.47  ? 466  TYR A CE1   1 
ATOM   3621  C  CE2   . TYR A  1 466 ? -77.108  3.402   -35.053  1.00 17.94  ? 466  TYR A CE2   1 
ATOM   3622  C  CZ    . TYR A  1 466 ? -77.082  2.037   -35.284  1.00 27.92  ? 466  TYR A CZ    1 
ATOM   3623  O  OH    . TYR A  1 466 ? -76.213  1.246   -34.569  1.00 28.23  ? 466  TYR A OH    1 
ATOM   3624  N  N     . SER A  1 467 ? -81.295  6.350   -35.280  1.00 34.57  ? 467  SER A N     1 
ATOM   3625  C  CA    . SER A  1 467 ? -81.281  6.894   -33.921  1.00 24.63  ? 467  SER A CA    1 
ATOM   3626  C  C     . SER A  1 467 ? -82.661  7.056   -33.311  1.00 31.38  ? 467  SER A C     1 
ATOM   3627  O  O     . SER A  1 467 ? -82.847  7.775   -32.330  1.00 38.67  ? 467  SER A O     1 
ATOM   3628  C  CB    . SER A  1 467 ? -80.570  8.245   -33.907  1.00 17.37  ? 467  SER A CB    1 
ATOM   3629  O  OG    . SER A  1 467 ? -79.207  8.113   -34.231  1.00 30.90  ? 467  SER A OG    1 
ATOM   3630  N  N     . VAL A  1 468 ? -83.616  6.335   -33.862  1.00 36.23  ? 468  VAL A N     1 
ATOM   3631  C  CA    . VAL A  1 468 ? -84.995  6.398   -33.413  1.00 24.91  ? 468  VAL A CA    1 
ATOM   3632  C  C     . VAL A  1 468 ? -85.206  5.958   -31.953  1.00 32.74  ? 468  VAL A C     1 
ATOM   3633  O  O     . VAL A  1 468 ? -84.423  5.125   -31.442  1.00 39.28  ? 468  VAL A O     1 
ATOM   3634  C  CB    . VAL A  1 468 ? -85.871  5.606   -34.421  1.00 16.95  ? 468  VAL A CB    1 
ATOM   3635  C  CG1   . VAL A  1 468 ? -86.307  4.282   -33.864  1.00 25.99  ? 468  VAL A CG1   1 
ATOM   3636  C  CG2   . VAL A  1 468 ? -87.002  6.451   -34.917  1.00 26.78  ? 468  VAL A CG2   1 
ATOM   3637  O  OXT   . VAL A  1 468 ? -86.136  6.498   -31.316  1.00 36.64  ? 468  VAL A OXT   1 
ATOM   3638  N  N     . SER B  1 1   ? -72.513  30.022  -97.760  0.98 91.54  ? 1    SER B N     1 
ATOM   3639  C  CA    . SER B  1 1   ? -73.968  30.024  -97.690  0.98 95.36  ? 1    SER B CA    1 
ATOM   3640  C  C     . SER B  1 1   ? -74.524  28.696  -98.118  0.98 85.20  ? 1    SER B C     1 
ATOM   3641  O  O     . SER B  1 1   ? -73.793  27.756  -98.436  0.98 88.00  ? 1    SER B O     1 
ATOM   3642  C  CB    . SER B  1 1   ? -74.545  31.155  -98.530  0.98 93.37  ? 1    SER B CB    1 
ATOM   3643  O  OG    . SER B  1 1   ? -75.198  30.647  -99.681  0.98 90.73  ? 1    SER B OG    1 
ATOM   3644  N  N     . ALA B  1 2   ? -75.846  28.615  -98.114  0.98 80.68  ? 2    ALA B N     1 
ATOM   3645  C  CA    . ALA B  1 2   ? -76.501  27.398  -98.495  0.98 60.75  ? 2    ALA B CA    1 
ATOM   3646  C  C     . ALA B  1 2   ? -75.842  26.695  -99.677  0.98 64.48  ? 2    ALA B C     1 
ATOM   3647  O  O     . ALA B  1 2   ? -75.445  25.538  -99.554  0.98 59.63  ? 2    ALA B O     1 
ATOM   3648  C  CB    . ALA B  1 2   ? -77.958  27.668  -98.825  0.98 58.77  ? 2    ALA B CB    1 
ATOM   3649  N  N     . GLU B  1 3   ? -75.705  27.370  -100.826 0.98 87.84  ? 3    GLU B N     1 
ATOM   3650  C  CA    . GLU B  1 3   ? -75.205  26.760  -102.039 0.98 87.63  ? 3    GLU B CA    1 
ATOM   3651  C  C     . GLU B  1 3   ? -73.800  26.164  -101.767 0.98 78.47  ? 3    GLU B C     1 
ATOM   3652  O  O     . GLU B  1 3   ? -73.561  24.976  -102.015 0.98 57.02  ? 3    GLU B O     1 
ATOM   3653  C  CB    . GLU B  1 3   ? -75.236  27.861  -103.134 0.98 100.00 ? 3    GLU B CB    1 
ATOM   3654  C  CG    . GLU B  1 3   ? -74.120  27.872  -104.188 0.98 100.00 ? 3    GLU B CG    1 
ATOM   3655  C  CD    . GLU B  1 3   ? -74.110  26.635  -105.088 0.98 100.00 ? 3    GLU B CD    1 
ATOM   3656  O  OE1   . GLU B  1 3   ? -73.098  26.446  -105.811 0.98 100.00 ? 3    GLU B OE1   1 
ATOM   3657  O  OE2   . GLU B  1 3   ? -75.099  25.854  -105.069 0.98 100.00 ? 3    GLU B OE2   1 
ATOM   3658  N  N     . HIS B  1 4   ? -72.926  26.973  -101.165 0.98 78.57  ? 4    HIS B N     1 
ATOM   3659  C  CA    . HIS B  1 4   ? -71.550  26.589  -100.817 0.98 74.33  ? 4    HIS B CA    1 
ATOM   3660  C  C     . HIS B  1 4   ? -71.481  25.426  -99.825  0.98 70.90  ? 4    HIS B C     1 
ATOM   3661  O  O     . HIS B  1 4   ? -70.664  24.522  -99.979  0.98 71.84  ? 4    HIS B O     1 
ATOM   3662  C  CB    . HIS B  1 4   ? -70.809  27.813  -100.246 0.98 86.94  ? 4    HIS B CB    1 
ATOM   3663  C  CG    . HIS B  1 4   ? -69.505  27.497  -99.569  0.98 100.00 ? 4    HIS B CG    1 
ATOM   3664  N  ND1   . HIS B  1 4   ? -69.228  27.888  -98.274  0.98 100.00 ? 4    HIS B ND1   1 
ATOM   3665  C  CD2   . HIS B  1 4   ? -68.388  26.872  -100.019 0.98 92.27  ? 4    HIS B CD2   1 
ATOM   3666  C  CE1   . HIS B  1 4   ? -67.998  27.523  -97.958  0.98 100.00 ? 4    HIS B CE1   1 
ATOM   3667  N  NE2   . HIS B  1 4   ? -67.467  26.904  -98.998  0.98 96.44  ? 4    HIS B NE2   1 
ATOM   3668  N  N     . VAL B  1 5   ? -72.328  25.466  -98.801  0.98 63.23  ? 5    VAL B N     1 
ATOM   3669  C  CA    . VAL B  1 5   ? -72.357  24.425  -97.783  0.98 35.97  ? 5    VAL B CA    1 
ATOM   3670  C  C     . VAL B  1 5   ? -72.583  23.027  -98.356  0.98 60.89  ? 5    VAL B C     1 
ATOM   3671  O  O     . VAL B  1 5   ? -71.903  22.078  -97.945  0.98 61.74  ? 5    VAL B O     1 
ATOM   3672  C  CB    . VAL B  1 5   ? -73.410  24.734  -96.699  0.98 43.20  ? 5    VAL B CB    1 
ATOM   3673  C  CG1   . VAL B  1 5   ? -73.659  23.519  -95.812  0.98 25.94  ? 5    VAL B CG1   1 
ATOM   3674  C  CG2   . VAL B  1 5   ? -72.952  25.915  -95.853  0.98 31.77  ? 5    VAL B CG2   1 
ATOM   3675  N  N     . LEU B  1 6   ? -73.523  22.888  -99.296  0.98 63.75  ? 6    LEU B N     1 
ATOM   3676  C  CA    . LEU B  1 6   ? -73.781  21.576  -99.899  0.98 57.28  ? 6    LEU B CA    1 
ATOM   3677  C  C     . LEU B  1 6   ? -72.529  21.051  -100.624 0.98 60.80  ? 6    LEU B C     1 
ATOM   3678  O  O     . LEU B  1 6   ? -72.337  19.839  -100.754 0.98 66.27  ? 6    LEU B O     1 
ATOM   3679  C  CB    . LEU B  1 6   ? -75.001  21.607  -100.829 0.98 53.84  ? 6    LEU B CB    1 
ATOM   3680  C  CG    . LEU B  1 6   ? -76.449  21.466  -100.289 0.98 71.48  ? 6    LEU B CG    1 
ATOM   3681  C  CD1   . LEU B  1 6   ? -76.498  20.354  -99.262  0.98 75.37  ? 6    LEU B CD1   1 
ATOM   3682  C  CD2   . LEU B  1 6   ? -77.017  22.748  -99.689  0.98 60.22  ? 6    LEU B CD2   1 
ATOM   3683  N  N     . THR B  1 7   ? -71.653  21.971  -101.032 0.98 65.70  ? 7    THR B N     1 
ATOM   3684  C  CA    . THR B  1 7   ? -70.399  21.623  -101.705 0.98 76.39  ? 7    THR B CA    1 
ATOM   3685  C  C     . THR B  1 7   ? -69.460  20.989  -100.686 0.98 70.50  ? 7    THR B C     1 
ATOM   3686  O  O     . THR B  1 7   ? -69.008  19.861  -100.878 0.98 81.02  ? 7    THR B O     1 
ATOM   3687  C  CB    . THR B  1 7   ? -69.710  22.881  -102.333 0.98 92.18  ? 7    THR B CB    1 
ATOM   3688  O  OG1   . THR B  1 7   ? -70.504  23.367  -103.427 0.98 100.00 ? 7    THR B OG1   1 
ATOM   3689  C  CG2   . THR B  1 7   ? -68.280  22.564  -102.827 0.98 66.42  ? 7    THR B CG2   1 
ATOM   3690  N  N     . MET B  1 8   ? -69.201  21.711  -99.593  0.98 71.94  ? 8    MET B N     1 
ATOM   3691  C  CA    . MET B  1 8   ? -68.330  21.239  -98.512  0.98 60.99  ? 8    MET B CA    1 
ATOM   3692  C  C     . MET B  1 8   ? -68.730  19.869  -97.980  0.98 54.14  ? 8    MET B C     1 
ATOM   3693  O  O     . MET B  1 8   ? -67.873  19.105  -97.534  0.98 57.61  ? 8    MET B O     1 
ATOM   3694  C  CB    . MET B  1 8   ? -68.295  22.238  -97.355  0.98 38.10  ? 8    MET B CB    1 
ATOM   3695  C  CG    . MET B  1 8   ? -67.552  23.522  -97.675  0.98 61.48  ? 8    MET B CG    1 
ATOM   3696  S  SD    . MET B  1 8   ? -67.227  24.532  -96.207  0.98 71.20  ? 8    MET B SD    1 
ATOM   3697  C  CE    . MET B  1 8   ? -65.486  24.148  -95.893  0.98 76.50  ? 8    MET B CE    1 
ATOM   3698  N  N     . LEU B  1 9   ? -70.021  19.551  -98.036  0.98 50.81  ? 9    LEU B N     1 
ATOM   3699  C  CA    . LEU B  1 9   ? -70.480  18.251  -97.565  0.98 55.55  ? 9    LEU B CA    1 
ATOM   3700  C  C     . LEU B  1 9   ? -69.871  17.112  -98.385  0.98 61.74  ? 9    LEU B C     1 
ATOM   3701  O  O     . LEU B  1 9   ? -69.460  16.092  -97.829  0.98 70.99  ? 9    LEU B O     1 
ATOM   3702  C  CB    . LEU B  1 9   ? -72.013  18.180  -97.541  0.98 41.30  ? 9    LEU B CB    1 
ATOM   3703  C  CG    . LEU B  1 9   ? -72.671  19.108  -96.500  0.98 35.72  ? 9    LEU B CG    1 
ATOM   3704  C  CD1   . LEU B  1 9   ? -74.166  18.967  -96.541  0.98 35.72  ? 9    LEU B CD1   1 
ATOM   3705  C  CD2   . LEU B  1 9   ? -72.180  18.803  -95.091  0.98 29.89  ? 9    LEU B CD2   1 
ATOM   3706  N  N     . ASN B  1 10  ? -69.738  17.320  -99.693  0.98 68.65  ? 10   ASN B N     1 
ATOM   3707  C  CA    . ASN B  1 10  ? -69.161  16.299  -100.568 0.98 69.56  ? 10   ASN B CA    1 
ATOM   3708  C  C     . ASN B  1 10  ? -67.647  16.360  -100.687 0.98 58.27  ? 10   ASN B C     1 
ATOM   3709  O  O     . ASN B  1 10  ? -66.980  15.328  -100.760 0.98 66.88  ? 10   ASN B O     1 
ATOM   3710  C  CB    . ASN B  1 10  ? -69.826  16.348  -101.938 0.98 60.05  ? 10   ASN B CB    1 
ATOM   3711  C  CG    . ASN B  1 10  ? -71.247  15.839  -101.887 0.98 87.96  ? 10   ASN B CG    1 
ATOM   3712  O  OD1   . ASN B  1 10  ? -72.189  16.603  -101.654 0.98 84.58  ? 10   ASN B OD1   1 
ATOM   3713  N  ND2   . ASN B  1 10  ? -71.406  14.526  -102.026 0.98 87.11  ? 10   ASN B ND2   1 
ATOM   3714  N  N     . GLU B  1 11  ? -67.114  17.576  -100.651 1.00 62.74  ? 11   GLU B N     1 
ATOM   3715  C  CA    . GLU B  1 11  ? -65.682  17.824  -100.755 1.00 69.11  ? 11   GLU B CA    1 
ATOM   3716  C  C     . GLU B  1 11  ? -64.945  17.191  -99.583  1.00 67.44  ? 11   GLU B C     1 
ATOM   3717  O  O     . GLU B  1 11  ? -63.807  16.744  -99.723  1.00 78.51  ? 11   GLU B O     1 
ATOM   3718  C  CB    . GLU B  1 11  ? -65.431  19.335  -100.781 1.00 74.13  ? 11   GLU B CB    1 
ATOM   3719  C  CG    . GLU B  1 11  ? -64.031  19.781  -101.198 1.00 89.86  ? 11   GLU B CG    1 
ATOM   3720  C  CD    . GLU B  1 11  ? -63.897  21.303  -101.206 1.00 100.00 ? 11   GLU B CD    1 
ATOM   3721  O  OE1   . GLU B  1 11  ? -64.558  21.960  -102.049 1.00 100.00 ? 11   GLU B OE1   1 
ATOM   3722  O  OE2   . GLU B  1 11  ? -63.149  21.847  -100.356 1.00 100.00 ? 11   GLU B OE2   1 
ATOM   3723  N  N     . HIS B  1 12  ? -65.613  17.130  -98.434  1.00 70.16  ? 12   HIS B N     1 
ATOM   3724  C  CA    . HIS B  1 12  ? -65.018  16.560  -97.228  1.00 69.82  ? 12   HIS B CA    1 
ATOM   3725  C  C     . HIS B  1 12  ? -65.706  15.289  -96.742  1.00 67.84  ? 12   HIS B C     1 
ATOM   3726  O  O     . HIS B  1 12  ? -65.428  14.840  -95.629  1.00 62.08  ? 12   HIS B O     1 
ATOM   3727  C  CB    . HIS B  1 12  ? -65.033  17.580  -96.086  1.00 69.75  ? 12   HIS B CB    1 
ATOM   3728  C  CG    . HIS B  1 12  ? -64.209  18.806  -96.336  1.00 72.96  ? 12   HIS B CG    1 
ATOM   3729  N  ND1   . HIS B  1 12  ? -62.860  18.867  -96.058  1.00 68.91  ? 12   HIS B ND1   1 
ATOM   3730  C  CD2   . HIS B  1 12  ? -64.556  20.036  -96.788  1.00 63.12  ? 12   HIS B CD2   1 
ATOM   3731  C  CE1   . HIS B  1 12  ? -62.414  20.083  -96.325  1.00 69.92  ? 12   HIS B CE1   1 
ATOM   3732  N  NE2   . HIS B  1 12  ? -63.421  20.811  -96.768  1.00 69.17  ? 12   HIS B NE2   1 
ATOM   3733  N  N     . GLU B  1 13  ? -66.604  14.727  -97.557  1.00 68.05  ? 13   GLU B N     1 
ATOM   3734  C  CA    . GLU B  1 13  ? -67.347  13.512  -97.199  1.00 56.18  ? 13   GLU B CA    1 
ATOM   3735  C  C     . GLU B  1 13  ? -67.841  13.620  -95.759  1.00 55.45  ? 13   GLU B C     1 
ATOM   3736  O  O     . GLU B  1 13  ? -67.595  12.749  -94.922  1.00 47.42  ? 13   GLU B O     1 
ATOM   3737  C  CB    . GLU B  1 13  ? -66.466  12.283  -97.353  1.00 61.80  ? 13   GLU B CB    1 
ATOM   3738  C  CG    . GLU B  1 13  ? -65.918  12.084  -98.738  1.00 72.48  ? 13   GLU B CG    1 
ATOM   3739  C  CD    . GLU B  1 13  ? -64.777  11.100  -98.743  1.00 80.62  ? 13   GLU B CD    1 
ATOM   3740  O  OE1   . GLU B  1 13  ? -63.620  11.538  -98.915  1.00 88.96  ? 13   GLU B OE1   1 
ATOM   3741  O  OE2   . GLU B  1 13  ? -65.036  9.891   -98.547  1.00 90.58  ? 13   GLU B OE2   1 
ATOM   3742  N  N     . VAL B  1 14  ? -68.479  14.742  -95.471  1.00 40.74  ? 14   VAL B N     1 
ATOM   3743  C  CA    . VAL B  1 14  ? -69.002  15.024  -94.153  1.00 30.89  ? 14   VAL B CA    1 
ATOM   3744  C  C     . VAL B  1 14  ? -70.083  14.039  -93.735  1.00 37.46  ? 14   VAL B C     1 
ATOM   3745  O  O     . VAL B  1 14  ? -71.005  13.734  -94.491  1.00 43.37  ? 14   VAL B O     1 
ATOM   3746  C  CB    . VAL B  1 14  ? -69.514  16.469  -94.092  1.00 26.59  ? 14   VAL B CB    1 
ATOM   3747  C  CG1   . VAL B  1 14  ? -70.258  16.722  -92.811  1.00 31.78  ? 14   VAL B CG1   1 
ATOM   3748  C  CG2   . VAL B  1 14  ? -68.337  17.414  -94.192  1.00 20.62  ? 14   VAL B CG2   1 
ATOM   3749  N  N     . LYS B  1 15  ? -69.937  13.521  -92.523  1.00 38.67  ? 15   LYS B N     1 
ATOM   3750  C  CA    . LYS B  1 15  ? -70.878  12.558  -91.989  1.00 27.66  ? 15   LYS B CA    1 
ATOM   3751  C  C     . LYS B  1 15  ? -71.863  13.245  -91.036  1.00 30.72  ? 15   LYS B C     1 
ATOM   3752  O  O     . LYS B  1 15  ? -73.019  12.818  -90.927  1.00 31.27  ? 15   LYS B O     1 
ATOM   3753  C  CB    . LYS B  1 15  ? -70.126  11.426  -91.275  1.00 21.59  ? 15   LYS B CB    1 
ATOM   3754  C  CG    . LYS B  1 15  ? -68.911  10.855  -92.029  1.00 52.25  ? 15   LYS B CG    1 
ATOM   3755  C  CD    . LYS B  1 15  ? -69.148  9.451   -92.581  1.00 60.74  ? 15   LYS B CD    1 
ATOM   3756  C  CE    . LYS B  1 15  ? -69.868  9.459   -93.930  1.00 85.15  ? 15   LYS B CE    1 
ATOM   3757  N  NZ    . LYS B  1 15  ? -69.018  9.927   -95.076  1.00 82.52  ? 15   LYS B NZ    1 
ATOM   3758  N  N     . PHE B  1 16  ? -71.416  14.305  -90.356  1.00 28.14  ? 16   PHE B N     1 
ATOM   3759  C  CA    . PHE B  1 16  ? -72.287  15.040  -89.424  1.00 28.03  ? 16   PHE B CA    1 
ATOM   3760  C  C     . PHE B  1 16  ? -72.165  16.557  -89.537  1.00 32.11  ? 16   PHE B C     1 
ATOM   3761  O  O     . PHE B  1 16  ? -71.180  17.087  -90.049  1.00 29.20  ? 16   PHE B O     1 
ATOM   3762  C  CB    . PHE B  1 16  ? -71.991  14.670  -87.963  1.00 18.81  ? 16   PHE B CB    1 
ATOM   3763  C  CG    . PHE B  1 16  ? -72.152  13.219  -87.660  1.00 22.42  ? 16   PHE B CG    1 
ATOM   3764  C  CD1   . PHE B  1 16  ? -71.097  12.329  -87.877  1.00 8.48   ? 16   PHE B CD1   1 
ATOM   3765  C  CD2   . PHE B  1 16  ? -73.364  12.727  -87.196  1.00 11.95  ? 16   PHE B CD2   1 
ATOM   3766  C  CE1   . PHE B  1 16  ? -71.241  10.972  -87.647  1.00 17.93  ? 16   PHE B CE1   1 
ATOM   3767  C  CE2   . PHE B  1 16  ? -73.527  11.360  -86.962  1.00 13.71  ? 16   PHE B CE2   1 
ATOM   3768  C  CZ    . PHE B  1 16  ? -72.455  10.479  -87.191  1.00 21.68  ? 16   PHE B CZ    1 
ATOM   3769  N  N     . VAL B  1 17  ? -73.174  17.247  -89.019  1.00 27.78  ? 17   VAL B N     1 
ATOM   3770  C  CA    . VAL B  1 17  ? -73.207  18.701  -88.996  1.00 20.54  ? 17   VAL B CA    1 
ATOM   3771  C  C     . VAL B  1 17  ? -73.449  19.085  -87.534  1.00 32.96  ? 17   VAL B C     1 
ATOM   3772  O  O     . VAL B  1 17  ? -74.389  18.600  -86.895  1.00 28.02  ? 17   VAL B O     1 
ATOM   3773  C  CB    . VAL B  1 17  ? -74.328  19.258  -89.896  1.00 24.49  ? 17   VAL B CB    1 
ATOM   3774  C  CG1   . VAL B  1 17  ? -74.545  20.724  -89.615  1.00 16.04  ? 17   VAL B CG1   1 
ATOM   3775  C  CG2   . VAL B  1 17  ? -73.950  19.081  -91.362  1.00 20.26  ? 17   VAL B CG2   1 
ATOM   3776  N  N     . ASP B  1 18  ? -72.566  19.915  -86.996  1.00 29.03  ? 18   ASP B N     1 
ATOM   3777  C  CA    . ASP B  1 18  ? -72.678  20.331  -85.610  1.00 24.31  ? 18   ASP B CA    1 
ATOM   3778  C  C     . ASP B  1 18  ? -73.253  21.737  -85.514  1.00 28.29  ? 18   ASP B C     1 
ATOM   3779  O  O     . ASP B  1 18  ? -72.613  22.731  -85.876  1.00 30.50  ? 18   ASP B O     1 
ATOM   3780  C  CB    . ASP B  1 18  ? -71.307  20.239  -84.913  1.00 25.21  ? 18   ASP B CB    1 
ATOM   3781  C  CG    . ASP B  1 18  ? -71.422  20.125  -83.398  1.00 29.45  ? 18   ASP B CG    1 
ATOM   3782  O  OD1   . ASP B  1 18  ? -70.672  20.819  -82.682  1.00 23.38  ? 18   ASP B OD1   1 
ATOM   3783  O  OD2   . ASP B  1 18  ? -72.262  19.336  -82.921  1.00 27.58  ? 18   ASP B OD2   1 
ATOM   3784  N  N     . LEU B  1 19  ? -74.493  21.804  -85.058  1.00 29.43  ? 19   LEU B N     1 
ATOM   3785  C  CA    . LEU B  1 19  ? -75.175  23.075  -84.902  1.00 27.87  ? 19   LEU B CA    1 
ATOM   3786  C  C     . LEU B  1 19  ? -74.740  23.753  -83.614  1.00 29.84  ? 19   LEU B C     1 
ATOM   3787  O  O     . LEU B  1 19  ? -74.948  23.219  -82.523  1.00 40.84  ? 19   LEU B O     1 
ATOM   3788  C  CB    . LEU B  1 19  ? -76.684  22.843  -84.903  1.00 26.48  ? 19   LEU B CB    1 
ATOM   3789  C  CG    . LEU B  1 19  ? -77.435  22.833  -86.244  1.00 35.13  ? 19   LEU B CG    1 
ATOM   3790  C  CD1   . LEU B  1 19  ? -76.517  22.726  -87.456  1.00 23.73  ? 19   LEU B CD1   1 
ATOM   3791  C  CD2   . LEU B  1 19  ? -78.432  21.710  -86.222  1.00 19.57  ? 19   LEU B CD2   1 
ATOM   3792  N  N     . ARG B  1 20  ? -74.135  24.930  -83.746  1.00 28.84  ? 20   ARG B N     1 
ATOM   3793  C  CA    . ARG B  1 20  ? -73.668  25.664  -82.580  1.00 29.31  ? 20   ARG B CA    1 
ATOM   3794  C  C     . ARG B  1 20  ? -74.282  27.036  -82.353  1.00 29.08  ? 20   ARG B C     1 
ATOM   3795  O  O     . ARG B  1 20  ? -74.640  27.744  -83.289  1.00 41.02  ? 20   ARG B O     1 
ATOM   3796  C  CB    . ARG B  1 20  ? -72.148  25.801  -82.617  1.00 19.28  ? 20   ARG B CB    1 
ATOM   3797  C  CG    . ARG B  1 20  ? -71.476  24.477  -82.584  1.00 27.39  ? 20   ARG B CG    1 
ATOM   3798  C  CD    . ARG B  1 20  ? -70.004  24.591  -82.369  1.00 14.40  ? 20   ARG B CD    1 
ATOM   3799  N  NE    . ARG B  1 20  ? -69.453  23.251  -82.431  1.00 22.85  ? 20   ARG B NE    1 
ATOM   3800  C  CZ    . ARG B  1 20  ? -68.165  22.960  -82.425  1.00 23.69  ? 20   ARG B CZ    1 
ATOM   3801  N  NH1   . ARG B  1 20  ? -67.792  21.690  -82.501  1.00 23.91  ? 20   ARG B NH1   1 
ATOM   3802  N  NH2   . ARG B  1 20  ? -67.257  23.927  -82.324  1.00 28.19  ? 20   ARG B NH2   1 
ATOM   3803  N  N     . PHE B  1 21  ? -74.373  27.400  -81.078  1.00 31.80  ? 21   PHE B N     1 
ATOM   3804  C  CA    . PHE B  1 21  ? -74.890  28.687  -80.660  1.00 32.37  ? 21   PHE B CA    1 
ATOM   3805  C  C     . PHE B  1 21  ? -74.369  28.993  -79.259  1.00 34.14  ? 21   PHE B C     1 
ATOM   3806  O  O     . PHE B  1 21  ? -73.754  28.139  -78.630  1.00 33.65  ? 21   PHE B O     1 
ATOM   3807  C  CB    . PHE B  1 21  ? -76.414  28.718  -80.714  1.00 29.71  ? 21   PHE B CB    1 
ATOM   3808  C  CG    . PHE B  1 21  ? -77.078  27.756  -79.783  1.00 25.22  ? 21   PHE B CG    1 
ATOM   3809  C  CD1   . PHE B  1 21  ? -77.484  28.166  -78.516  1.00 40.70  ? 21   PHE B CD1   1 
ATOM   3810  C  CD2   . PHE B  1 21  ? -77.346  26.454  -80.186  1.00 34.13  ? 21   PHE B CD2   1 
ATOM   3811  C  CE1   . PHE B  1 21  ? -78.158  27.293  -77.664  1.00 26.60  ? 21   PHE B CE1   1 
ATOM   3812  C  CE2   . PHE B  1 21  ? -78.021  25.567  -79.342  1.00 31.88  ? 21   PHE B CE2   1 
ATOM   3813  C  CZ    . PHE B  1 21  ? -78.429  25.988  -78.081  1.00 24.57  ? 21   PHE B CZ    1 
ATOM   3814  N  N     . THR B  1 22  ? -74.617  30.210  -78.784  1.00 32.80  ? 22   THR B N     1 
ATOM   3815  C  CA    . THR B  1 22  ? -74.150  30.659  -77.478  1.00 26.92  ? 22   THR B CA    1 
ATOM   3816  C  C     . THR B  1 22  ? -75.278  30.989  -76.503  1.00 31.11  ? 22   THR B C     1 
ATOM   3817  O  O     . THR B  1 22  ? -76.244  31.649  -76.874  1.00 39.13  ? 22   THR B O     1 
ATOM   3818  C  CB    . THR B  1 22  ? -73.274  31.897  -77.661  1.00 22.60  ? 22   THR B CB    1 
ATOM   3819  O  OG1   . THR B  1 22  ? -72.136  31.548  -78.458  1.00 29.18  ? 22   THR B OG1   1 
ATOM   3820  C  CG2   . THR B  1 22  ? -72.824  32.452  -76.323  1.00 25.72  ? 22   THR B CG2   1 
ATOM   3821  N  N     . ASP B  1 23  ? -75.158  30.528  -75.258  1.00 30.62  ? 23   ASP B N     1 
ATOM   3822  C  CA    . ASP B  1 23  ? -76.187  30.803  -74.250  1.00 19.64  ? 23   ASP B CA    1 
ATOM   3823  C  C     . ASP B  1 23  ? -76.006  32.195  -73.647  1.00 33.48  ? 23   ASP B C     1 
ATOM   3824  O  O     . ASP B  1 23  ? -75.057  32.906  -74.000  1.00 27.81  ? 23   ASP B O     1 
ATOM   3825  C  CB    . ASP B  1 23  ? -76.226  29.712  -73.160  1.00 27.79  ? 23   ASP B CB    1 
ATOM   3826  C  CG    . ASP B  1 23  ? -75.060  29.784  -72.165  1.00 38.28  ? 23   ASP B CG    1 
ATOM   3827  O  OD1   . ASP B  1 23  ? -74.103  30.575  -72.341  1.00 44.20  ? 23   ASP B OD1   1 
ATOM   3828  O  OD2   . ASP B  1 23  ? -75.107  29.017  -71.179  1.00 59.84  ? 23   ASP B OD2   1 
ATOM   3829  N  N     . THR B  1 24  ? -76.885  32.580  -72.725  1.00 34.54  ? 24   THR B N     1 
ATOM   3830  C  CA    . THR B  1 24  ? -76.781  33.909  -72.133  1.00 29.73  ? 24   THR B CA    1 
ATOM   3831  C  C     . THR B  1 24  ? -75.442  34.170  -71.437  1.00 42.44  ? 24   THR B C     1 
ATOM   3832  O  O     . THR B  1 24  ? -74.841  35.234  -71.629  1.00 45.48  ? 24   THR B O     1 
ATOM   3833  C  CB    . THR B  1 24  ? -77.980  34.218  -71.205  1.00 30.89  ? 24   THR B CB    1 
ATOM   3834  O  OG1   . THR B  1 24  ? -79.155  34.400  -72.002  1.00 36.51  ? 24   THR B OG1   1 
ATOM   3835  C  CG2   . THR B  1 24  ? -77.749  35.496  -70.412  1.00 39.91  ? 24   THR B CG2   1 
ATOM   3836  N  N     . LYS B  1 25  ? -74.945  33.189  -70.682  1.00 46.41  ? 25   LYS B N     1 
ATOM   3837  C  CA    . LYS B  1 25  ? -73.669  33.345  -69.978  1.00 32.14  ? 25   LYS B CA    1 
ATOM   3838  C  C     . LYS B  1 25  ? -72.459  33.441  -70.911  1.00 35.61  ? 25   LYS B C     1 
ATOM   3839  O  O     . LYS B  1 25  ? -71.407  33.938  -70.511  1.00 47.19  ? 25   LYS B O     1 
ATOM   3840  C  CB    . LYS B  1 25  ? -73.482  32.239  -68.943  1.00 28.23  ? 25   LYS B CB    1 
ATOM   3841  C  CG    . LYS B  1 25  ? -74.445  32.347  -67.776  1.00 29.00  ? 25   LYS B CG    1 
ATOM   3842  C  CD    . LYS B  1 25  ? -74.221  31.261  -66.758  1.00 27.28  ? 25   LYS B CD    1 
ATOM   3843  C  CE    . LYS B  1 25  ? -75.291  31.280  -65.698  1.00 43.24  ? 25   LYS B CE    1 
ATOM   3844  N  NZ    . LYS B  1 25  ? -75.252  30.023  -64.895  1.00 40.98  ? 25   LYS B NZ    1 
ATOM   3845  N  N     . GLY B  1 26  ? -72.617  32.969  -72.149  1.00 34.55  ? 26   GLY B N     1 
ATOM   3846  C  CA    . GLY B  1 26  ? -71.546  33.059  -73.133  1.00 19.41  ? 26   GLY B CA    1 
ATOM   3847  C  C     . GLY B  1 26  ? -70.855  31.771  -73.529  1.00 35.20  ? 26   GLY B C     1 
ATOM   3848  O  O     . GLY B  1 26  ? -69.828  31.792  -74.231  1.00 36.21  ? 26   GLY B O     1 
ATOM   3849  N  N     . LYS B  1 27  ? -71.430  30.654  -73.086  1.00 28.86  ? 27   LYS B N     1 
ATOM   3850  C  CA    . LYS B  1 27  ? -70.880  29.340  -73.357  1.00 30.37  ? 27   LYS B CA    1 
ATOM   3851  C  C     . LYS B  1 27  ? -71.453  28.763  -74.642  1.00 25.53  ? 27   LYS B C     1 
ATOM   3852  O  O     . LYS B  1 27  ? -72.667  28.693  -74.813  1.00 37.83  ? 27   LYS B O     1 
ATOM   3853  C  CB    . LYS B  1 27  ? -71.167  28.400  -72.175  1.00 17.79  ? 27   LYS B CB    1 
ATOM   3854  C  CG    . LYS B  1 27  ? -70.426  27.063  -72.230  1.00 34.79  ? 27   LYS B CG    1 
ATOM   3855  C  CD    . LYS B  1 27  ? -68.942  27.229  -71.922  1.00 43.27  ? 27   LYS B CD    1 
ATOM   3856  C  CE    . LYS B  1 27  ? -68.131  26.064  -72.459  1.00 34.47  ? 27   LYS B CE    1 
ATOM   3857  N  NZ    . LYS B  1 27  ? -66.655  26.252  -72.313  1.00 35.77  ? 27   LYS B NZ    1 
ATOM   3858  N  N     . GLU B  1 28  ? -70.568  28.353  -75.544  1.00 23.25  ? 28   GLU B N     1 
ATOM   3859  C  CA    . GLU B  1 28  ? -70.981  27.765  -76.814  1.00 20.64  ? 28   GLU B CA    1 
ATOM   3860  C  C     . GLU B  1 28  ? -71.707  26.432  -76.558  1.00 36.27  ? 28   GLU B C     1 
ATOM   3861  O  O     . GLU B  1 28  ? -71.278  25.617  -75.733  1.00 40.93  ? 28   GLU B O     1 
ATOM   3862  C  CB    . GLU B  1 28  ? -69.748  27.540  -77.671  1.00 23.87  ? 28   GLU B CB    1 
ATOM   3863  C  CG    . GLU B  1 28  ? -69.954  27.462  -79.173  1.00 11.97  ? 28   GLU B CG    1 
ATOM   3864  C  CD    . GLU B  1 28  ? -68.623  27.310  -79.884  1.00 37.40  ? 28   GLU B CD    1 
ATOM   3865  O  OE1   . GLU B  1 28  ? -68.623  27.104  -81.115  1.00 46.78  ? 28   GLU B OE1   1 
ATOM   3866  O  OE2   . GLU B  1 28  ? -67.564  27.376  -79.200  1.00 59.28  ? 28   GLU B OE2   1 
ATOM   3867  N  N     . GLN B  1 29  ? -72.829  26.235  -77.246  1.00 31.67  ? 29   GLN B N     1 
ATOM   3868  C  CA    . GLN B  1 29  ? -73.627  25.017  -77.109  1.00 24.75  ? 29   GLN B CA    1 
ATOM   3869  C  C     . GLN B  1 29  ? -73.694  24.304  -78.449  1.00 30.50  ? 29   GLN B C     1 
ATOM   3870  O  O     . GLN B  1 29  ? -73.367  24.884  -79.489  1.00 36.59  ? 29   GLN B O     1 
ATOM   3871  C  CB    . GLN B  1 29  ? -75.043  25.359  -76.677  1.00 15.36  ? 29   GLN B CB    1 
ATOM   3872  C  CG    . GLN B  1 29  ? -75.114  26.383  -75.581  1.00 36.23  ? 29   GLN B CG    1 
ATOM   3873  C  CD    . GLN B  1 29  ? -74.758  25.810  -74.237  1.00 29.62  ? 29   GLN B CD    1 
ATOM   3874  O  OE1   . GLN B  1 29  ? -75.303  24.787  -73.823  1.00 33.70  ? 29   GLN B OE1   1 
ATOM   3875  N  NE2   . GLN B  1 29  ? -73.849  26.472  -73.538  1.00 42.60  ? 29   GLN B NE2   1 
ATOM   3876  N  N     . HIS B  1 30  ? -74.139  23.052  -78.436  1.00 18.45  ? 30   HIS B N     1 
ATOM   3877  C  CA    . HIS B  1 30  ? -74.231  22.325  -79.687  1.00 23.64  ? 30   HIS B CA    1 
ATOM   3878  C  C     . HIS B  1 30  ? -75.140  21.120  -79.678  1.00 21.12  ? 30   HIS B C     1 
ATOM   3879  O  O     . HIS B  1 30  ? -75.468  20.560  -78.640  1.00 32.73  ? 30   HIS B O     1 
ATOM   3880  C  CB    . HIS B  1 30  ? -72.836  21.904  -80.176  1.00 24.12  ? 30   HIS B CB    1 
ATOM   3881  C  CG    . HIS B  1 30  ? -72.328  20.637  -79.557  1.00 31.13  ? 30   HIS B CG    1 
ATOM   3882  N  ND1   . HIS B  1 30  ? -72.322  20.420  -78.198  1.00 36.22  ? 30   HIS B ND1   1 
ATOM   3883  C  CD2   . HIS B  1 30  ? -71.819  19.515  -80.118  1.00 18.59  ? 30   HIS B CD2   1 
ATOM   3884  C  CE1   . HIS B  1 30  ? -71.832  19.219  -77.949  1.00 23.77  ? 30   HIS B CE1   1 
ATOM   3885  N  NE2   . HIS B  1 30  ? -71.523  18.648  -79.097  1.00 26.02  ? 30   HIS B NE2   1 
ATOM   3886  N  N     . VAL B  1 31  ? -75.564  20.764  -80.878  1.00 30.80  ? 31   VAL B N     1 
ATOM   3887  C  CA    . VAL B  1 31  ? -76.393  19.598  -81.112  1.00 32.51  ? 31   VAL B CA    1 
ATOM   3888  C  C     . VAL B  1 31  ? -75.968  19.126  -82.506  1.00 31.57  ? 31   VAL B C     1 
ATOM   3889  O  O     . VAL B  1 31  ? -75.667  19.941  -83.386  1.00 29.18  ? 31   VAL B O     1 
ATOM   3890  C  CB    . VAL B  1 31  ? -77.885  19.915  -81.032  1.00 27.59  ? 31   VAL B CB    1 
ATOM   3891  C  CG1   . VAL B  1 31  ? -78.235  21.038  -81.976  1.00 46.69  ? 31   VAL B CG1   1 
ATOM   3892  C  CG2   . VAL B  1 31  ? -78.687  18.677  -81.367  1.00 37.26  ? 31   VAL B CG2   1 
ATOM   3893  N  N     . THR B  1 32  ? -75.854  17.812  -82.664  1.00 23.36  ? 32   THR B N     1 
ATOM   3894  C  CA    . THR B  1 32  ? -75.402  17.213  -83.905  1.00 22.51  ? 32   THR B CA    1 
ATOM   3895  C  C     . THR B  1 32  ? -76.509  16.526  -84.677  1.00 26.62  ? 32   THR B C     1 
ATOM   3896  O  O     . THR B  1 32  ? -77.314  15.761  -84.139  1.00 26.30  ? 32   THR B O     1 
ATOM   3897  C  CB    . THR B  1 32  ? -74.262  16.240  -83.619  1.00 27.40  ? 32   THR B CB    1 
ATOM   3898  O  OG1   . THR B  1 32  ? -73.272  16.912  -82.839  1.00 27.63  ? 32   THR B OG1   1 
ATOM   3899  C  CG2   . THR B  1 32  ? -73.629  15.747  -84.902  1.00 22.16  ? 32   THR B CG2   1 
ATOM   3900  N  N     . ILE B  1 33  ? -76.451  16.754  -85.979  1.00 30.18  ? 33   ILE B N     1 
ATOM   3901  C  CA    . ILE B  1 33  ? -77.403  16.260  -86.956  1.00 20.67  ? 33   ILE B CA    1 
ATOM   3902  C  C     . ILE B  1 33  ? -76.592  15.546  -88.044  1.00 22.53  ? 33   ILE B C     1 
ATOM   3903  O  O     . ILE B  1 33  ? -75.463  15.946  -88.352  1.00 34.53  ? 33   ILE B O     1 
ATOM   3904  C  CB    . ILE B  1 33  ? -78.245  17.469  -87.485  1.00 32.66  ? 33   ILE B CB    1 
ATOM   3905  C  CG1   . ILE B  1 33  ? -79.689  17.307  -87.043  1.00 45.17  ? 33   ILE B CG1   1 
ATOM   3906  C  CG2   . ILE B  1 33  ? -78.144  17.788  -88.971  1.00 23.22  ? 33   ILE B CG2   1 
ATOM   3907  C  CD1   . ILE B  1 33  ? -79.854  17.521  -85.606  1.00 91.60  ? 33   ILE B CD1   1 
ATOM   3908  N  N     . PRO B  1 34  ? -77.062  14.385  -88.501  1.00 22.90  ? 34   PRO B N     1 
ATOM   3909  C  CA    . PRO B  1 34  ? -76.380  13.608  -89.550  1.00 22.42  ? 34   PRO B CA    1 
ATOM   3910  C  C     . PRO B  1 34  ? -76.332  14.480  -90.803  1.00 36.38  ? 34   PRO B C     1 
ATOM   3911  O  O     . PRO B  1 34  ? -77.240  15.278  -91.006  1.00 29.83  ? 34   PRO B O     1 
ATOM   3912  C  CB    . PRO B  1 34  ? -77.330  12.423  -89.768  1.00 6.41   ? 34   PRO B CB    1 
ATOM   3913  C  CG    . PRO B  1 34  ? -78.013  12.268  -88.418  1.00 22.94  ? 34   PRO B CG    1 
ATOM   3914  C  CD    . PRO B  1 34  ? -78.268  13.699  -88.011  1.00 26.13  ? 34   PRO B CD    1 
ATOM   3915  N  N     . ALA B  1 35  ? -75.314  14.326  -91.652  1.00 35.07  ? 35   ALA B N     1 
ATOM   3916  C  CA    . ALA B  1 35  ? -75.229  15.156  -92.857  1.00 28.55  ? 35   ALA B CA    1 
ATOM   3917  C  C     . ALA B  1 35  ? -76.464  15.026  -93.746  1.00 35.34  ? 35   ALA B C     1 
ATOM   3918  O  O     . ALA B  1 35  ? -76.933  16.018  -94.303  1.00 36.34  ? 35   ALA B O     1 
ATOM   3919  C  CB    . ALA B  1 35  ? -73.963  14.855  -93.654  1.00 25.77  ? 35   ALA B CB    1 
ATOM   3920  N  N     . HIS B  1 36  ? -77.033  13.823  -93.826  1.00 35.91  ? 36   HIS B N     1 
ATOM   3921  C  CA    . HIS B  1 36  ? -78.222  13.601  -94.656  1.00 28.59  ? 36   HIS B CA    1 
ATOM   3922  C  C     . HIS B  1 36  ? -79.487  14.370  -94.270  1.00 33.01  ? 36   HIS B C     1 
ATOM   3923  O  O     . HIS B  1 36  ? -80.467  14.364  -95.010  1.00 52.83  ? 36   HIS B O     1 
ATOM   3924  C  CB    . HIS B  1 36  ? -78.543  12.109  -94.779  1.00 23.72  ? 36   HIS B CB    1 
ATOM   3925  C  CG    . HIS B  1 36  ? -78.942  11.453  -93.493  1.00 33.89  ? 36   HIS B CG    1 
ATOM   3926  N  ND1   . HIS B  1 36  ? -80.097  11.781  -92.815  1.00 42.74  ? 36   HIS B ND1   1 
ATOM   3927  C  CD2   . HIS B  1 36  ? -78.375  10.436  -92.800  1.00 25.70  ? 36   HIS B CD2   1 
ATOM   3928  C  CE1   . HIS B  1 36  ? -80.229  10.989  -91.765  1.00 38.92  ? 36   HIS B CE1   1 
ATOM   3929  N  NE2   . HIS B  1 36  ? -79.194  10.161  -91.735  1.00 30.08  ? 36   HIS B NE2   1 
ATOM   3930  N  N     . GLN B  1 37  ? -79.472  15.015  -93.110  1.00 37.79  ? 37   GLN B N     1 
ATOM   3931  C  CA    . GLN B  1 37  ? -80.619  15.790  -92.645  1.00 36.34  ? 37   GLN B CA    1 
ATOM   3932  C  C     . GLN B  1 37  ? -80.568  17.230  -93.163  1.00 39.09  ? 37   GLN B C     1 
ATOM   3933  O  O     . GLN B  1 37  ? -81.489  18.023  -92.925  1.00 45.61  ? 37   GLN B O     1 
ATOM   3934  C  CB    . GLN B  1 37  ? -80.668  15.802  -91.122  1.00 21.37  ? 37   GLN B CB    1 
ATOM   3935  C  CG    . GLN B  1 37  ? -80.959  14.482  -90.497  1.00 32.72  ? 37   GLN B CG    1 
ATOM   3936  C  CD    . GLN B  1 37  ? -82.327  13.984  -90.851  1.00 40.33  ? 37   GLN B CD    1 
ATOM   3937  O  OE1   . GLN B  1 37  ? -82.469  13.101  -91.686  1.00 43.92  ? 37   GLN B OE1   1 
ATOM   3938  N  NE2   . GLN B  1 37  ? -83.353  14.545  -90.215  1.00 54.64  ? 37   GLN B NE2   1 
ATOM   3939  N  N     . VAL B  1 38  ? -79.465  17.577  -93.817  1.00 37.91  ? 38   VAL B N     1 
ATOM   3940  C  CA    . VAL B  1 38  ? -79.291  18.909  -94.383  1.00 43.28  ? 38   VAL B CA    1 
ATOM   3941  C  C     . VAL B  1 38  ? -79.923  18.941  -95.772  1.00 49.63  ? 38   VAL B C     1 
ATOM   3942  O  O     . VAL B  1 38  ? -79.609  18.110  -96.625  1.00 54.34  ? 38   VAL B O     1 
ATOM   3943  C  CB    . VAL B  1 38  ? -77.810  19.279  -94.496  1.00 44.43  ? 38   VAL B CB    1 
ATOM   3944  C  CG1   . VAL B  1 38  ? -77.653  20.613  -95.193  1.00 48.39  ? 38   VAL B CG1   1 
ATOM   3945  C  CG2   . VAL B  1 38  ? -77.195  19.336  -93.121  1.00 40.83  ? 38   VAL B CG2   1 
ATOM   3946  N  N     . ASN B  1 39  ? -80.802  19.913  -95.987  1.00 55.20  ? 39   ASN B N     1 
ATOM   3947  C  CA    . ASN B  1 39  ? -81.499  20.052  -97.254  1.00 60.48  ? 39   ASN B CA    1 
ATOM   3948  C  C     . ASN B  1 39  ? -81.939  21.486  -97.495  1.00 65.72  ? 39   ASN B C     1 
ATOM   3949  O  O     . ASN B  1 39  ? -81.638  22.384  -96.700  1.00 65.57  ? 39   ASN B O     1 
ATOM   3950  C  CB    . ASN B  1 39  ? -82.722  19.140  -97.265  1.00 53.57  ? 39   ASN B CB    1 
ATOM   3951  C  CG    . ASN B  1 39  ? -83.597  19.340  -96.052  1.00 56.40  ? 39   ASN B CG    1 
ATOM   3952  O  OD1   . ASN B  1 39  ? -83.728  20.453  -95.537  1.00 62.74  ? 39   ASN B OD1   1 
ATOM   3953  N  ND2   . ASN B  1 39  ? -84.185  18.260  -95.568  1.00 64.98  ? 39   ASN B ND2   1 
ATOM   3954  N  N     . ALA B  1 40  ? -82.671  21.672  -98.592  1.00 77.57  ? 40   ALA B N     1 
ATOM   3955  C  CA    . ALA B  1 40  ? -83.195  22.967  -99.001  1.00 74.38  ? 40   ALA B CA    1 
ATOM   3956  C  C     . ALA B  1 40  ? -83.951  23.574  -97.825  1.00 75.94  ? 40   ALA B C     1 
ATOM   3957  O  O     . ALA B  1 40  ? -83.622  24.666  -97.343  1.00 64.60  ? 40   ALA B O     1 
ATOM   3958  C  CB    . ALA B  1 40  ? -84.131  22.776  -100.181 1.00 83.53  ? 40   ALA B CB    1 
ATOM   3959  N  N     . GLU B  1 41  ? -84.939  22.808  -97.368  1.00 68.04  ? 41   GLU B N     1 
ATOM   3960  C  CA    . GLU B  1 41  ? -85.816  23.132  -96.242  1.00 82.38  ? 41   GLU B CA    1 
ATOM   3961  C  C     . GLU B  1 41  ? -85.070  23.752  -95.045  1.00 81.14  ? 41   GLU B C     1 
ATOM   3962  O  O     . GLU B  1 41  ? -85.324  24.892  -94.630  1.00 79.47  ? 41   GLU B O     1 
ATOM   3963  C  CB    . GLU B  1 41  ? -86.496  21.821  -95.816  1.00 91.32  ? 41   GLU B CB    1 
ATOM   3964  C  CG    . GLU B  1 41  ? -87.169  21.832  -94.448  1.00 100.00 ? 41   GLU B CG    1 
ATOM   3965  C  CD    . GLU B  1 41  ? -88.668  22.082  -94.527  1.00 100.00 ? 41   GLU B CD    1 
ATOM   3966  O  OE1   . GLU B  1 41  ? -89.160  22.530  -95.592  1.00 100.00 ? 41   GLU B OE1   1 
ATOM   3967  O  OE2   . GLU B  1 41  ? -89.357  21.824  -93.512  1.00 100.00 ? 41   GLU B OE2   1 
ATOM   3968  N  N     . PHE B  1 42  ? -84.170  22.946  -94.501  1.00 74.57  ? 42   PHE B N     1 
ATOM   3969  C  CA    . PHE B  1 42  ? -83.319  23.267  -93.369  1.00 62.17  ? 42   PHE B CA    1 
ATOM   3970  C  C     . PHE B  1 42  ? -82.746  24.696  -93.353  1.00 58.13  ? 42   PHE B C     1 
ATOM   3971  O  O     . PHE B  1 42  ? -82.758  25.365  -92.318  1.00 59.69  ? 42   PHE B O     1 
ATOM   3972  C  CB    . PHE B  1 42  ? -82.205  22.212  -93.347  1.00 63.78  ? 42   PHE B CB    1 
ATOM   3973  C  CG    . PHE B  1 42  ? -81.073  22.516  -92.414  1.00 59.35  ? 42   PHE B CG    1 
ATOM   3974  C  CD1   . PHE B  1 42  ? -79.797  22.732  -92.918  1.00 51.75  ? 42   PHE B CD1   1 
ATOM   3975  C  CD2   . PHE B  1 42  ? -81.270  22.572  -91.037  1.00 74.03  ? 42   PHE B CD2   1 
ATOM   3976  C  CE1   . PHE B  1 42  ? -78.726  23.003  -92.072  1.00 39.50  ? 42   PHE B CE1   1 
ATOM   3977  C  CE2   . PHE B  1 42  ? -80.203  22.842  -90.179  1.00 69.89  ? 42   PHE B CE2   1 
ATOM   3978  C  CZ    . PHE B  1 42  ? -78.926  23.056  -90.702  1.00 50.16  ? 42   PHE B CZ    1 
ATOM   3979  N  N     . PHE B  1 43  ? -82.266  25.170  -94.496  1.00 48.45  ? 43   PHE B N     1 
ATOM   3980  C  CA    . PHE B  1 43  ? -81.686  26.510  -94.575  1.00 51.93  ? 43   PHE B CA    1 
ATOM   3981  C  C     . PHE B  1 43  ? -82.618  27.694  -94.521  1.00 66.23  ? 43   PHE B C     1 
ATOM   3982  O  O     . PHE B  1 43  ? -82.212  28.792  -94.098  1.00 59.98  ? 43   PHE B O     1 
ATOM   3983  C  CB    . PHE B  1 43  ? -80.838  26.631  -95.820  1.00 49.45  ? 43   PHE B CB    1 
ATOM   3984  C  CG    . PHE B  1 43  ? -79.462  26.156  -95.625  1.00 61.30  ? 43   PHE B CG    1 
ATOM   3985  C  CD1   . PHE B  1 43  ? -79.048  24.933  -96.161  1.00 57.91  ? 43   PHE B CD1   1 
ATOM   3986  C  CD2   . PHE B  1 43  ? -78.577  26.902  -94.845  1.00 61.39  ? 43   PHE B CD2   1 
ATOM   3987  C  CE1   . PHE B  1 43  ? -77.758  24.454  -95.920  1.00 55.75  ? 43   PHE B CE1   1 
ATOM   3988  C  CE2   . PHE B  1 43  ? -77.285  26.438  -94.593  1.00 54.51  ? 43   PHE B CE2   1 
ATOM   3989  C  CZ    . PHE B  1 43  ? -76.873  25.209  -95.131  1.00 53.42  ? 43   PHE B CZ    1 
ATOM   3990  N  N     . GLU B  1 44  ? -83.837  27.482  -95.020  1.00 74.09  ? 44   GLU B N     1 
ATOM   3991  C  CA    . GLU B  1 44  ? -84.852  28.520  -95.074  1.00 73.42  ? 44   GLU B CA    1 
ATOM   3992  C  C     . GLU B  1 44  ? -85.709  28.594  -93.829  1.00 64.44  ? 44   GLU B C     1 
ATOM   3993  O  O     . GLU B  1 44  ? -86.225  29.668  -93.502  1.00 72.75  ? 44   GLU B O     1 
ATOM   3994  C  CB    . GLU B  1 44  ? -85.719  28.361  -96.323  1.00 86.95  ? 44   GLU B CB    1 
ATOM   3995  C  CG    . GLU B  1 44  ? -85.021  28.781  -97.624  1.00 90.85  ? 44   GLU B CG    1 
ATOM   3996  C  CD    . GLU B  1 44  ? -85.227  27.773  -98.755  1.00 100.00 ? 44   GLU B CD    1 
ATOM   3997  O  OE1   . GLU B  1 44  ? -84.322  27.661  -99.617  1.00 100.00 ? 44   GLU B OE1   1 
ATOM   3998  O  OE2   . GLU B  1 44  ? -86.280  27.087  -98.779  1.00 99.74  ? 44   GLU B OE2   1 
ATOM   3999  N  N     . GLU B  1 45  ? -85.869  27.473  -93.129  1.00 46.08  ? 45   GLU B N     1 
ATOM   4000  C  CA    . GLU B  1 45  ? -86.660  27.515  -91.901  1.00 68.83  ? 45   GLU B CA    1 
ATOM   4001  C  C     . GLU B  1 45  ? -86.058  26.847  -90.664  1.00 71.87  ? 45   GLU B C     1 
ATOM   4002  O  O     . GLU B  1 45  ? -86.701  26.782  -89.608  1.00 69.14  ? 45   GLU B O     1 
ATOM   4003  C  CB    . GLU B  1 45  ? -88.070  27.018  -92.151  1.00 74.67  ? 45   GLU B CB    1 
ATOM   4004  C  CG    . GLU B  1 45  ? -88.134  25.693  -92.835  1.00 88.91  ? 45   GLU B CG    1 
ATOM   4005  C  CD    . GLU B  1 45  ? -89.551  25.359  -93.218  1.00 100.00 ? 45   GLU B CD    1 
ATOM   4006  O  OE1   . GLU B  1 45  ? -89.988  25.790  -94.311  1.00 100.00 ? 45   GLU B OE1   1 
ATOM   4007  O  OE2   . GLU B  1 45  ? -90.233  24.690  -92.411  1.00 100.00 ? 45   GLU B OE2   1 
ATOM   4008  N  N     . GLY B  1 46  ? -84.808  26.380  -90.813  1.00 71.94  ? 46   GLY B N     1 
ATOM   4009  C  CA    . GLY B  1 46  ? -84.030  25.715  -89.766  1.00 57.06  ? 46   GLY B CA    1 
ATOM   4010  C  C     . GLY B  1 46  ? -84.712  24.459  -89.224  1.00 55.72  ? 46   GLY B C     1 
ATOM   4011  O  O     . GLY B  1 46  ? -85.645  23.925  -89.823  1.00 72.51  ? 46   GLY B O     1 
ATOM   4012  N  N     . LYS B  1 47  ? -84.213  23.992  -88.092  1.00 54.83  ? 47   LYS B N     1 
ATOM   4013  C  CA    . LYS B  1 47  ? -84.716  22.824  -87.383  1.00 61.51  ? 47   LYS B CA    1 
ATOM   4014  C  C     . LYS B  1 47  ? -85.024  23.313  -85.950  1.00 57.81  ? 47   LYS B C     1 
ATOM   4015  O  O     . LYS B  1 47  ? -84.275  24.142  -85.460  1.00 63.20  ? 47   LYS B O     1 
ATOM   4016  C  CB    . LYS B  1 47  ? -83.680  21.691  -87.379  1.00 49.16  ? 47   LYS B CB    1 
ATOM   4017  C  CG    . LYS B  1 47  ? -84.093  20.482  -86.570  1.00 93.45  ? 47   LYS B CG    1 
ATOM   4018  C  CD    . LYS B  1 47  ? -83.402  20.426  -85.218  1.00 97.85  ? 47   LYS B CD    1 
ATOM   4019  C  CE    . LYS B  1 47  ? -83.718  19.132  -84.494  1.00 84.37  ? 47   LYS B CE    1 
ATOM   4020  N  NZ    . LYS B  1 47  ? -83.191  19.123  -83.101  1.00 40.01  ? 47   LYS B NZ    1 
ATOM   4021  N  N     . MET B  1 48  ? -86.051  22.871  -85.196  1.00 56.52  ? 48   MET B N     1 
ATOM   4022  C  CA    . MET B  1 48  ? -86.228  23.477  -83.840  1.00 62.21  ? 48   MET B CA    1 
ATOM   4023  C  C     . MET B  1 48  ? -85.869  22.522  -82.651  1.00 57.27  ? 48   MET B C     1 
ATOM   4024  O  O     . MET B  1 48  ? -85.335  21.448  -82.885  1.00 73.04  ? 48   MET B O     1 
ATOM   4025  C  CB    . MET B  1 48  ? -87.664  23.980  -83.654  1.00 73.05  ? 48   MET B CB    1 
ATOM   4026  C  CG    . MET B  1 48  ? -88.721  23.407  -84.589  1.00 71.58  ? 48   MET B CG    1 
ATOM   4027  S  SD    . MET B  1 48  ? -90.332  24.199  -84.393  1.00 100.00 ? 48   MET B SD    1 
ATOM   4028  C  CE    . MET B  1 48  ? -90.079  25.705  -85.336  1.00 86.71  ? 48   MET B CE    1 
ATOM   4029  N  N     . PHE B  1 49  ? -86.182  22.828  -81.370  1.00 74.83  ? 49   PHE B N     1 
ATOM   4030  C  CA    . PHE B  1 49  ? -85.857  22.029  -80.160  1.00 86.74  ? 49   PHE B CA    1 
ATOM   4031  C  C     . PHE B  1 49  ? -86.947  21.871  -79.069  0.39 86.69  ? 49   PHE B C     1 
ATOM   4032  O  O     . PHE B  1 49  ? -88.099  22.230  -79.300  0.39 100.00 ? 49   PHE B O     1 
ATOM   4033  C  CB    . PHE B  1 49  ? -84.606  22.550  -79.421  1.00 74.73  ? 49   PHE B CB    1 
ATOM   4034  C  CG    . PHE B  1 49  ? -84.170  24.038  -79.487  1.00 88.14  ? 49   PHE B CG    1 
ATOM   4035  C  CD1   . PHE B  1 49  ? -83.204  24.468  -78.600  1.00 90.31  ? 49   PHE B CD1   1 
ATOM   4036  C  CD2   . PHE B  1 49  ? -84.667  24.965  -80.410  1.00 92.95  ? 49   PHE B CD2   1 
ATOM   4037  C  CE1   . PHE B  1 49  ? -82.702  25.742  -78.621  1.00 39.75  ? 49   PHE B CE1   1 
ATOM   4038  C  CE2   . PHE B  1 49  ? -84.157  26.266  -80.434  1.00 92.81  ? 49   PHE B CE2   1 
ATOM   4039  C  CZ    . PHE B  1 49  ? -83.176  26.636  -79.534  1.00 51.70  ? 49   PHE B CZ    1 
ATOM   4040  N  N     . ASP B  1 50  ? -86.567  21.312  -77.885  0.39 81.07  ? 50   ASP B N     1 
ATOM   4041  C  CA    . ASP B  1 50  ? -87.318  21.086  -76.599  0.39 68.41  ? 50   ASP B CA    1 
ATOM   4042  C  C     . ASP B  1 50  ? -86.584  21.926  -75.535  0.39 50.11  ? 50   ASP B C     1 
ATOM   4043  O  O     . ASP B  1 50  ? -86.378  21.575  -74.372  0.39 41.71  ? 50   ASP B O     1 
ATOM   4044  C  CB    . ASP B  1 50  ? -87.507  19.611  -76.279  0.39 74.88  ? 50   ASP B CB    1 
ATOM   4045  C  CG    . ASP B  1 50  ? -86.378  18.914  -75.443  0.39 78.97  ? 50   ASP B CG    1 
ATOM   4046  O  OD1   . ASP B  1 50  ? -86.454  18.918  -74.209  0.39 81.17  ? 50   ASP B OD1   1 
ATOM   4047  O  OD2   . ASP B  1 50  ? -85.425  18.388  -76.072  0.39 76.71  ? 50   ASP B OD2   1 
ATOM   4048  N  N     . GLY B  1 51  ? -86.232  23.083  -76.070  0.39 28.93  ? 51   GLY B N     1 
ATOM   4049  C  CA    . GLY B  1 51  ? -85.505  24.204  -75.500  0.39 18.90  ? 51   GLY B CA    1 
ATOM   4050  C  C     . GLY B  1 51  ? -85.788  24.501  -74.024  0.39 42.89  ? 51   GLY B C     1 
ATOM   4051  O  O     . GLY B  1 51  ? -84.856  24.758  -73.249  0.39 31.40  ? 51   GLY B O     1 
ATOM   4052  N  N     . SER B  1 52  ? -87.037  24.466  -73.628  0.39 46.69  ? 52   SER B N     1 
ATOM   4053  C  CA    . SER B  1 52  ? -87.331  24.700  -72.227  0.39 39.57  ? 52   SER B CA    1 
ATOM   4054  C  C     . SER B  1 52  ? -86.185  24.137  -71.384  0.39 41.83  ? 52   SER B C     1 
ATOM   4055  O  O     . SER B  1 52  ? -86.156  24.272  -70.158  0.39 37.60  ? 52   SER B O     1 
ATOM   4056  C  CB    . SER B  1 52  ? -88.629  24.020  -71.813  0.39 51.87  ? 52   SER B CB    1 
ATOM   4057  O  OG    . SER B  1 52  ? -88.381  22.739  -71.271  0.39 64.57  ? 52   SER B OG    1 
ATOM   4058  N  N     . SER B  1 53  ? -85.241  23.503  -72.070  0.39 55.25  ? 53   SER B N     1 
ATOM   4059  C  CA    . SER B  1 53  ? -84.149  22.894  -71.344  0.39 53.12  ? 53   SER B CA    1 
ATOM   4060  C  C     . SER B  1 53  ? -82.922  23.813  -71.147  0.39 53.04  ? 53   SER B C     1 
ATOM   4061  O  O     . SER B  1 53  ? -81.956  23.402  -70.492  0.39 37.25  ? 53   SER B O     1 
ATOM   4062  C  CB    . SER B  1 53  ? -83.774  21.583  -72.027  0.39 64.19  ? 53   SER B CB    1 
ATOM   4063  O  OG    . SER B  1 53  ? -84.868  20.683  -72.055  0.39 55.60  ? 53   SER B OG    1 
ATOM   4064  N  N     . ILE B  1 54  ? -82.914  25.052  -71.690  1.00 75.73  ? 54   ILE B N     1 
ATOM   4065  C  CA    . ILE B  1 54  ? -81.727  25.955  -71.499  1.00 78.50  ? 54   ILE B CA    1 
ATOM   4066  C  C     . ILE B  1 54  ? -81.975  26.996  -70.353  1.00 83.95  ? 54   ILE B C     1 
ATOM   4067  O  O     . ILE B  1 54  ? -83.125  27.195  -69.951  1.00 100.00 ? 54   ILE B O     1 
ATOM   4068  C  CB    . ILE B  1 54  ? -81.353  26.648  -72.847  1.00 77.35  ? 54   ILE B CB    1 
ATOM   4069  C  CG1   . ILE B  1 54  ? -81.197  25.613  -73.980  1.00 98.29  ? 54   ILE B CG1   1 
ATOM   4070  C  CG2   . ILE B  1 54  ? -80.076  27.471  -72.686  1.00 34.45  ? 54   ILE B CG2   1 
ATOM   4071  C  CD1   . ILE B  1 54  ? -79.856  24.921  -73.993  1.00 99.88  ? 54   ILE B CD1   1 
ATOM   4072  N  N     . GLY B  1 55  ? -80.924  27.674  -69.844  1.00 38.24  ? 55   GLY B N     1 
ATOM   4073  C  CA    . GLY B  1 55  ? -80.884  28.670  -68.741  1.00 45.04  ? 55   GLY B CA    1 
ATOM   4074  C  C     . GLY B  1 55  ? -81.016  30.171  -69.151  1.00 54.16  ? 55   GLY B C     1 
ATOM   4075  O  O     . GLY B  1 55  ? -80.304  30.662  -70.019  1.00 58.55  ? 55   GLY B O     1 
ATOM   4076  N  N     . GLY B  1 56  ? -81.938  30.879  -68.485  1.00 53.15  ? 56   GLY B N     1 
ATOM   4077  C  CA    . GLY B  1 56  ? -82.283  32.258  -68.793  1.00 58.81  ? 56   GLY B CA    1 
ATOM   4078  C  C     . GLY B  1 56  ? -83.158  32.395  -70.025  1.00 61.90  ? 56   GLY B C     1 
ATOM   4079  O  O     . GLY B  1 56  ? -83.469  33.506  -70.463  1.00 62.17  ? 56   GLY B O     1 
ATOM   4080  N  N     . TRP B  1 57  ? -83.508  31.256  -70.612  1.00 61.19  ? 57   TRP B N     1 
ATOM   4081  C  CA    . TRP B  1 57  ? -84.356  31.202  -71.798  1.00 64.78  ? 57   TRP B CA    1 
ATOM   4082  C  C     . TRP B  1 57  ? -85.616  30.437  -71.408  1.00 76.78  ? 57   TRP B C     1 
ATOM   4083  O  O     . TRP B  1 57  ? -86.577  30.314  -72.189  1.00 88.48  ? 57   TRP B O     1 
ATOM   4084  C  CB    . TRP B  1 57  ? -83.651  30.449  -72.927  1.00 48.51  ? 57   TRP B CB    1 
ATOM   4085  C  CG    . TRP B  1 57  ? -82.428  31.132  -73.466  1.00 41.24  ? 57   TRP B CG    1 
ATOM   4086  C  CD1   . TRP B  1 57  ? -81.817  32.251  -72.972  1.00 46.59  ? 57   TRP B CD1   1 
ATOM   4087  C  CD2   . TRP B  1 57  ? -81.672  30.742  -74.623  1.00 43.34  ? 57   TRP B CD2   1 
ATOM   4088  N  NE1   . TRP B  1 57  ? -80.732  32.583  -73.750  1.00 46.66  ? 57   TRP B NE1   1 
ATOM   4089  C  CE2   . TRP B  1 57  ? -80.622  31.677  -74.769  1.00 44.32  ? 57   TRP B CE2   1 
ATOM   4090  C  CE3   . TRP B  1 57  ? -81.782  29.695  -75.546  1.00 44.07  ? 57   TRP B CE3   1 
ATOM   4091  C  CZ2   . TRP B  1 57  ? -79.688  31.595  -75.810  1.00 43.65  ? 57   TRP B CZ2   1 
ATOM   4092  C  CZ3   . TRP B  1 57  ? -80.851  29.614  -76.581  1.00 43.11  ? 57   TRP B CZ3   1 
ATOM   4093  C  CH2   . TRP B  1 57  ? -79.819  30.560  -76.704  1.00 30.35  ? 57   TRP B CH2   1 
ATOM   4094  N  N     . LYS B  1 58  ? -85.607  29.896  -70.180  0.72 96.46  ? 58   LYS B N     1 
ATOM   4095  C  CA    . LYS B  1 58  ? -86.674  29.041  -69.661  0.72 93.07  ? 58   LYS B CA    1 
ATOM   4096  C  C     . LYS B  1 58  ? -87.991  29.699  -69.282  0.72 94.91  ? 58   LYS B C     1 
ATOM   4097  O  O     . LYS B  1 58  ? -88.123  30.325  -68.235  0.72 88.79  ? 58   LYS B O     1 
ATOM   4098  C  CB    . LYS B  1 58  ? -86.198  28.271  -68.446  0.72 84.44  ? 58   LYS B CB    1 
ATOM   4099  C  CG    . LYS B  1 58  ? -87.340  27.716  -67.605  0.72 88.12  ? 58   LYS B CG    1 
ATOM   4100  C  CD    . LYS B  1 58  ? -86.815  26.927  -66.427  0.72 93.37  ? 58   LYS B CD    1 
ATOM   4101  C  CE    . LYS B  1 58  ? -87.925  26.501  -65.485  0.72 93.27  ? 58   LYS B CE    1 
ATOM   4102  N  NZ    . LYS B  1 58  ? -88.816  25.482  -66.101  0.72 100.00 ? 58   LYS B NZ    1 
ATOM   4103  N  N     . GLY B  1 59  ? -88.941  29.551  -70.177  0.72 89.58  ? 59   GLY B N     1 
ATOM   4104  C  CA    . GLY B  1 59  ? -90.303  29.990  -69.957  0.72 92.74  ? 59   GLY B CA    1 
ATOM   4105  C  C     . GLY B  1 59  ? -91.114  28.741  -69.743  0.72 98.82  ? 59   GLY B C     1 
ATOM   4106  O  O     . GLY B  1 59  ? -91.056  27.825  -70.564  0.72 96.45  ? 59   GLY B O     1 
ATOM   4107  N  N     . ILE B  1 60  ? -91.862  28.667  -68.653  0.72 98.63  ? 60   ILE B N     1 
ATOM   4108  C  CA    . ILE B  1 60  ? -92.628  27.472  -68.379  0.72 100.00 ? 60   ILE B CA    1 
ATOM   4109  C  C     . ILE B  1 60  ? -93.567  27.001  -69.489  0.72 93.34  ? 60   ILE B C     1 
ATOM   4110  O  O     . ILE B  1 60  ? -93.582  25.818  -69.816  0.72 93.61  ? 60   ILE B O     1 
ATOM   4111  C  CB    . ILE B  1 60  ? -93.278  27.588  -66.981  0.72 98.85  ? 60   ILE B CB    1 
ATOM   4112  C  CG1   . ILE B  1 60  ? -92.497  26.664  -66.031  0.72 100.00 ? 60   ILE B CG1   1 
ATOM   4113  C  CG2   . ILE B  1 60  ? -94.762  27.179  -66.994  0.72 96.54  ? 60   ILE B CG2   1 
ATOM   4114  C  CD1   . ILE B  1 60  ? -91.597  25.683  -66.739  0.72 100.00 ? 60   ILE B CD1   1 
ATOM   4115  N  N     . ASN B  1 61  ? -94.362  27.913  -70.040  0.72 81.49  ? 61   ASN B N     1 
ATOM   4116  C  CA    . ASN B  1 61  ? -95.276  27.572  -71.141  0.72 87.22  ? 61   ASN B CA    1 
ATOM   4117  C  C     . ASN B  1 61  ? -94.525  27.455  -72.481  0.72 90.99  ? 61   ASN B C     1 
ATOM   4118  O  O     . ASN B  1 61  ? -94.103  26.360  -72.873  0.72 77.29  ? 61   ASN B O     1 
ATOM   4119  C  CB    . ASN B  1 61  ? -96.369  28.643  -71.265  0.72 87.62  ? 61   ASN B CB    1 
ATOM   4120  C  CG    . ASN B  1 61  ? -97.549  28.410  -70.337  0.72 91.82  ? 61   ASN B CG    1 
ATOM   4121  O  OD1   . ASN B  1 61  ? -98.514  29.181  -70.341  0.72 88.47  ? 61   ASN B OD1   1 
ATOM   4122  N  ND2   . ASN B  1 61  ? -97.497  27.343  -69.555  0.72 100.00 ? 61   ASN B ND2   1 
ATOM   4123  N  N     . GLU B  1 62  ? -94.352  28.609  -73.146  0.72 96.34  ? 62   GLU B N     1 
ATOM   4124  C  CA    . GLU B  1 62  ? -93.686  28.766  -74.455  0.72 100.00 ? 62   GLU B CA    1 
ATOM   4125  C  C     . GLU B  1 62  ? -92.220  28.313  -74.607  0.72 100.00 ? 62   GLU B C     1 
ATOM   4126  O  O     . GLU B  1 62  ? -91.322  29.122  -74.908  0.72 100.00 ? 62   GLU B O     1 
ATOM   4127  C  CB    . GLU B  1 62  ? -93.812  30.237  -74.934  0.72 100.00 ? 62   GLU B CB    1 
ATOM   4128  C  CG    . GLU B  1 62  ? -93.676  31.425  -73.941  0.72 100.00 ? 62   GLU B CG    1 
ATOM   4129  C  CD    . GLU B  1 62  ? -92.867  31.165  -72.650  0.72 100.00 ? 62   GLU B CD    1 
ATOM   4130  O  OE1   . GLU B  1 62  ? -93.506  30.939  -71.595  0.72 100.00 ? 62   GLU B OE1   1 
ATOM   4131  O  OE2   . GLU B  1 62  ? -91.609  31.228  -72.673  0.72 100.00 ? 62   GLU B OE2   1 
ATOM   4132  N  N     . SER B  1 63  ? -92.005  27.013  -74.499  0.72 94.20  ? 63   SER B N     1 
ATOM   4133  C  CA    . SER B  1 63  ? -90.652  26.454  -74.553  0.72 94.85  ? 63   SER B CA    1 
ATOM   4134  C  C     . SER B  1 63  ? -89.999  26.225  -75.913  0.72 90.33  ? 63   SER B C     1 
ATOM   4135  O  O     . SER B  1 63  ? -88.801  25.984  -75.984  0.72 93.72  ? 63   SER B O     1 
ATOM   4136  C  CB    . SER B  1 63  ? -90.586  25.172  -73.707  0.72 91.94  ? 63   SER B CB    1 
ATOM   4137  O  OG    . SER B  1 63  ? -91.788  24.971  -72.961  0.72 92.15  ? 63   SER B OG    1 
ATOM   4138  N  N     . ASP B  1 64  ? -90.754  26.335  -77.008  0.72 74.19  ? 64   ASP B N     1 
ATOM   4139  C  CA    . ASP B  1 64  ? -90.162  26.050  -78.316  0.72 62.56  ? 64   ASP B CA    1 
ATOM   4140  C  C     . ASP B  1 64  ? -89.661  27.173  -79.207  0.72 59.40  ? 64   ASP B C     1 
ATOM   4141  O  O     . ASP B  1 64  ? -90.424  28.072  -79.573  0.72 48.35  ? 64   ASP B O     1 
ATOM   4142  C  CB    . ASP B  1 64  ? -91.070  25.117  -79.093  0.72 59.45  ? 64   ASP B CB    1 
ATOM   4143  C  CG    . ASP B  1 64  ? -90.724  23.659  -78.856  0.72 69.42  ? 64   ASP B CG    1 
ATOM   4144  O  OD1   . ASP B  1 64  ? -90.855  23.196  -77.691  0.72 59.28  ? 64   ASP B OD1   1 
ATOM   4145  O  OD2   . ASP B  1 64  ? -90.301  22.996  -79.815  0.72 66.23  ? 64   ASP B OD2   1 
ATOM   4146  N  N     . MET B  1 65  ? -88.378  27.061  -79.606  1.00 68.43  ? 65   MET B N     1 
ATOM   4147  C  CA    . MET B  1 65  ? -87.664  28.020  -80.464  1.00 67.01  ? 65   MET B CA    1 
ATOM   4148  C  C     . MET B  1 65  ? -87.014  27.354  -81.700  1.00 66.51  ? 65   MET B C     1 
ATOM   4149  O  O     . MET B  1 65  ? -86.857  26.133  -81.742  1.00 70.47  ? 65   MET B O     1 
ATOM   4150  C  CB    . MET B  1 65  ? -86.577  28.752  -79.655  1.00 71.42  ? 65   MET B CB    1 
ATOM   4151  C  CG    . MET B  1 65  ? -86.772  30.268  -79.484  1.00 70.08  ? 65   MET B CG    1 
ATOM   4152  S  SD    . MET B  1 65  ? -87.879  30.764  -78.147  1.00 93.66  ? 65   MET B SD    1 
ATOM   4153  C  CE    . MET B  1 65  ? -86.980  30.121  -76.733  1.00 92.12  ? 65   MET B CE    1 
ATOM   4154  N  N     . VAL B  1 66  ? -86.579  28.176  -82.663  1.00 57.88  ? 66   VAL B N     1 
ATOM   4155  C  CA    . VAL B  1 66  ? -85.966  27.713  -83.927  1.00 51.96  ? 66   VAL B CA    1 
ATOM   4156  C  C     . VAL B  1 66  ? -84.458  27.970  -84.112  1.00 57.09  ? 66   VAL B C     1 
ATOM   4157  O  O     . VAL B  1 66  ? -83.973  29.091  -83.924  1.00 53.53  ? 66   VAL B O     1 
ATOM   4158  C  CB    . VAL B  1 66  ? -86.661  28.388  -85.138  1.00 49.86  ? 66   VAL B CB    1 
ATOM   4159  C  CG1   . VAL B  1 66  ? -86.055  27.910  -86.456  1.00 39.35  ? 66   VAL B CG1   1 
ATOM   4160  C  CG2   . VAL B  1 66  ? -88.143  28.118  -85.106  1.00 71.33  ? 66   VAL B CG2   1 
ATOM   4161  N  N     . LEU B  1 67  ? -83.737  26.941  -84.546  1.00 50.80  ? 67   LEU B N     1 
ATOM   4162  C  CA    . LEU B  1 67  ? -82.302  27.063  -84.819  1.00 40.95  ? 67   LEU B CA    1 
ATOM   4163  C  C     . LEU B  1 67  ? -82.095  27.432  -86.291  1.00 46.70  ? 67   LEU B C     1 
ATOM   4164  O  O     . LEU B  1 67  ? -82.319  26.601  -87.183  1.00 42.99  ? 67   LEU B O     1 
ATOM   4165  C  CB    . LEU B  1 67  ? -81.593  25.741  -84.548  1.00 43.05  ? 67   LEU B CB    1 
ATOM   4166  C  CG    . LEU B  1 67  ? -81.016  25.489  -83.164  1.00 49.19  ? 67   LEU B CG    1 
ATOM   4167  C  CD1   . LEU B  1 67  ? -80.598  24.053  -83.089  1.00 26.04  ? 67   LEU B CD1   1 
ATOM   4168  C  CD2   . LEU B  1 67  ? -79.837  26.397  -82.910  1.00 33.63  ? 67   LEU B CD2   1 
ATOM   4169  N  N     . MET B  1 68  ? -81.640  28.656  -86.547  1.00 39.32  ? 68   MET B N     1 
ATOM   4170  C  CA    . MET B  1 68  ? -81.432  29.102  -87.919  1.00 34.90  ? 68   MET B CA    1 
ATOM   4171  C  C     . MET B  1 68  ? -79.979  29.103  -88.361  1.00 37.66  ? 68   MET B C     1 
ATOM   4172  O  O     . MET B  1 68  ? -79.218  30.037  -88.069  1.00 51.33  ? 68   MET B O     1 
ATOM   4173  C  CB    . MET B  1 68  ? -82.051  30.487  -88.150  1.00 48.46  ? 68   MET B CB    1 
ATOM   4174  C  CG    . MET B  1 68  ? -82.066  30.933  -89.616  1.00 48.45  ? 68   MET B CG    1 
ATOM   4175  S  SD    . MET B  1 68  ? -82.919  29.749  -90.691  1.00 51.13  ? 68   MET B SD    1 
ATOM   4176  C  CE    . MET B  1 68  ? -84.563  29.822  -89.988  1.00 41.35  ? 68   MET B CE    1 
ATOM   4177  N  N     . PRO B  1 69  ? -79.595  28.083  -89.142  1.00 28.61  ? 69   PRO B N     1 
ATOM   4178  C  CA    . PRO B  1 69  ? -78.228  27.968  -89.639  1.00 32.01  ? 69   PRO B CA    1 
ATOM   4179  C  C     . PRO B  1 69  ? -77.823  29.170  -90.463  1.00 33.26  ? 69   PRO B C     1 
ATOM   4180  O  O     . PRO B  1 69  ? -78.599  29.674  -91.282  1.00 53.98  ? 69   PRO B O     1 
ATOM   4181  C  CB    . PRO B  1 69  ? -78.272  26.685  -90.480  1.00 23.06  ? 69   PRO B CB    1 
ATOM   4182  C  CG    . PRO B  1 69  ? -79.687  26.603  -90.922  1.00 35.29  ? 69   PRO B CG    1 
ATOM   4183  C  CD    . PRO B  1 69  ? -80.425  26.981  -89.657  1.00 35.60  ? 69   PRO B CD    1 
ATOM   4184  N  N     . ASP B  1 70  ? -76.638  29.675  -90.148  1.00 38.15  ? 70   ASP B N     1 
ATOM   4185  C  CA    . ASP B  1 70  ? -76.042  30.801  -90.845  1.00 36.62  ? 70   ASP B CA    1 
ATOM   4186  C  C     . ASP B  1 70  ? -74.988  30.149  -91.749  1.00 31.15  ? 70   ASP B C     1 
ATOM   4187  O  O     . ASP B  1 70  ? -73.873  29.859  -91.319  1.00 35.28  ? 70   ASP B O     1 
ATOM   4188  C  CB    . ASP B  1 70  ? -75.416  31.764  -89.827  1.00 32.33  ? 70   ASP B CB    1 
ATOM   4189  C  CG    . ASP B  1 70  ? -74.675  32.924  -90.479  1.00 44.39  ? 70   ASP B CG    1 
ATOM   4190  O  OD1   . ASP B  1 70  ? -74.151  32.767  -91.603  1.00 39.00  ? 70   ASP B OD1   1 
ATOM   4191  O  OD2   . ASP B  1 70  ? -74.601  34.001  -89.846  1.00 42.92  ? 70   ASP B OD2   1 
ATOM   4192  N  N     . ALA B  1 71  ? -75.356  29.952  -93.012  1.00 38.54  ? 71   ALA B N     1 
ATOM   4193  C  CA    . ALA B  1 71  ? -74.502  29.303  -94.007  1.00 30.21  ? 71   ALA B CA    1 
ATOM   4194  C  C     . ALA B  1 71  ? -73.130  29.901  -94.221  1.00 34.48  ? 71   ALA B C     1 
ATOM   4195  O  O     . ALA B  1 71  ? -72.252  29.259  -94.806  1.00 44.23  ? 71   ALA B O     1 
ATOM   4196  C  CB    . ALA B  1 71  ? -75.221  29.212  -95.316  1.00 31.19  ? 71   ALA B CB    1 
ATOM   4197  N  N     . SER B  1 72  ? -72.930  31.124  -93.756  1.00 32.11  ? 72   SER B N     1 
ATOM   4198  C  CA    . SER B  1 72  ? -71.632  31.759  -93.934  1.00 41.14  ? 72   SER B CA    1 
ATOM   4199  C  C     . SER B  1 72  ? -70.595  31.270  -92.926  1.00 43.96  ? 72   SER B C     1 
ATOM   4200  O  O     . SER B  1 72  ? -69.394  31.368  -93.172  1.00 47.61  ? 72   SER B O     1 
ATOM   4201  C  CB    . SER B  1 72  ? -71.764  33.279  -93.833  1.00 33.69  ? 72   SER B CB    1 
ATOM   4202  O  OG    . SER B  1 72  ? -71.983  33.687  -92.496  1.00 36.72  ? 72   SER B OG    1 
ATOM   4203  N  N     . THR B  1 73  ? -71.067  30.712  -91.811  1.00 41.27  ? 73   THR B N     1 
ATOM   4204  C  CA    . THR B  1 73  ? -70.191  30.251  -90.738  1.00 32.28  ? 73   THR B CA    1 
ATOM   4205  C  C     . THR B  1 73  ? -69.637  28.836  -90.848  1.00 30.61  ? 73   THR B C     1 
ATOM   4206  O  O     . THR B  1 73  ? -68.836  28.422  -90.002  1.00 48.14  ? 73   THR B O     1 
ATOM   4207  C  CB    . THR B  1 73  ? -70.902  30.361  -89.385  1.00 29.27  ? 73   THR B CB    1 
ATOM   4208  O  OG1   . THR B  1 73  ? -72.039  29.497  -89.381  1.00 39.41  ? 73   THR B OG1   1 
ATOM   4209  C  CG2   . THR B  1 73  ? -71.365  31.774  -89.137  1.00 30.73  ? 73   THR B CG2   1 
ATOM   4210  N  N     . ALA B  1 74  ? -69.998  28.128  -91.914  1.00 33.12  ? 74   ALA B N     1 
ATOM   4211  C  CA    . ALA B  1 74  ? -69.574  26.739  -92.100  1.00 32.99  ? 74   ALA B CA    1 
ATOM   4212  C  C     . ALA B  1 74  ? -68.084  26.482  -92.041  1.00 41.73  ? 74   ALA B C     1 
ATOM   4213  O  O     . ALA B  1 74  ? -67.302  27.068  -92.793  1.00 49.22  ? 74   ALA B O     1 
ATOM   4214  C  CB    . ALA B  1 74  ? -70.156  26.157  -93.378  1.00 36.40  ? 74   ALA B CB    1 
ATOM   4215  N  N     . VAL B  1 75  ? -67.709  25.584  -91.136  1.00 44.83  ? 75   VAL B N     1 
ATOM   4216  C  CA    . VAL B  1 75  ? -66.319  25.205  -90.945  1.00 37.83  ? 75   VAL B CA    1 
ATOM   4217  C  C     . VAL B  1 75  ? -66.201  23.796  -90.356  1.00 36.70  ? 75   VAL B C     1 
ATOM   4218  O  O     . VAL B  1 75  ? -67.031  23.366  -89.549  1.00 38.75  ? 75   VAL B O     1 
ATOM   4219  C  CB    . VAL B  1 75  ? -65.561  26.255  -90.099  1.00 16.29  ? 75   VAL B CB    1 
ATOM   4220  C  CG1   . VAL B  1 75  ? -66.248  26.492  -88.755  1.00 37.98  ? 75   VAL B CG1   1 
ATOM   4221  C  CG2   . VAL B  1 75  ? -64.114  25.858  -89.946  1.00 51.81  ? 75   VAL B CG2   1 
ATOM   4222  N  N     . ILE B  1 76  ? -65.202  23.064  -90.841  1.00 32.12  ? 76   ILE B N     1 
ATOM   4223  C  CA    . ILE B  1 76  ? -64.931  21.695  -90.425  1.00 34.57  ? 76   ILE B CA    1 
ATOM   4224  C  C     . ILE B  1 76  ? -64.359  21.649  -89.019  1.00 34.81  ? 76   ILE B C     1 
ATOM   4225  O  O     . ILE B  1 76  ? -63.500  22.469  -88.683  1.00 37.18  ? 76   ILE B O     1 
ATOM   4226  C  CB    . ILE B  1 76  ? -63.905  21.043  -91.389  1.00 26.77  ? 76   ILE B CB    1 
ATOM   4227  C  CG1   . ILE B  1 76  ? -64.535  20.824  -92.759  1.00 28.25  ? 76   ILE B CG1   1 
ATOM   4228  C  CG2   . ILE B  1 76  ? -63.425  19.708  -90.847  1.00 20.03  ? 76   ILE B CG2   1 
ATOM   4229  C  CD1   . ILE B  1 76  ? -65.614  19.748  -92.762  1.00 25.92  ? 76   ILE B CD1   1 
ATOM   4230  N  N     . ASP B  1 77  ? -64.821  20.692  -88.211  1.00 30.42  ? 77   ASP B N     1 
ATOM   4231  C  CA    . ASP B  1 77  ? -64.300  20.538  -86.856  1.00 26.27  ? 77   ASP B CA    1 
ATOM   4232  C  C     . ASP B  1 77  ? -63.003  19.749  -86.981  1.00 24.00  ? 77   ASP B C     1 
ATOM   4233  O  O     . ASP B  1 77  ? -62.978  18.650  -87.544  1.00 34.67  ? 77   ASP B O     1 
ATOM   4234  C  CB    . ASP B  1 77  ? -65.274  19.800  -85.946  1.00 21.65  ? 77   ASP B CB    1 
ATOM   4235  C  CG    . ASP B  1 77  ? -64.835  19.831  -84.493  1.00 26.72  ? 77   ASP B CG    1 
ATOM   4236  O  OD1   . ASP B  1 77  ? -65.411  20.618  -83.729  1.00 30.34  ? 77   ASP B OD1   1 
ATOM   4237  O  OD2   . ASP B  1 77  ? -63.909  19.088  -84.114  1.00 33.52  ? 77   ASP B OD2   1 
ATOM   4238  N  N     . PRO B  1 78  ? -61.903  20.302  -86.449  1.00 22.75  ? 78   PRO B N     1 
ATOM   4239  C  CA    . PRO B  1 78  ? -60.576  19.677  -86.502  1.00 19.29  ? 78   PRO B CA    1 
ATOM   4240  C  C     . PRO B  1 78  ? -60.251  18.665  -85.423  1.00 26.74  ? 78   PRO B C     1 
ATOM   4241  O  O     . PRO B  1 78  ? -59.150  18.127  -85.401  1.00 39.44  ? 78   PRO B O     1 
ATOM   4242  C  CB    . PRO B  1 78  ? -59.644  20.883  -86.422  1.00 18.55  ? 78   PRO B CB    1 
ATOM   4243  C  CG    . PRO B  1 78  ? -60.374  21.815  -85.501  1.00 15.61  ? 78   PRO B CG    1 
ATOM   4244  C  CD    . PRO B  1 78  ? -61.849  21.643  -85.827  1.00 22.58  ? 78   PRO B CD    1 
ATOM   4245  N  N     . PHE B  1 79  ? -61.218  18.384  -84.556  1.00 30.98  ? 79   PHE B N     1 
ATOM   4246  C  CA    . PHE B  1 79  ? -61.014  17.463  -83.446  1.00 20.82  ? 79   PHE B CA    1 
ATOM   4247  C  C     . PHE B  1 79  ? -61.827  16.189  -83.532  1.00 23.51  ? 79   PHE B C     1 
ATOM   4248  O  O     . PHE B  1 79  ? -61.325  15.104  -83.242  1.00 39.21  ? 79   PHE B O     1 
ATOM   4249  C  CB    . PHE B  1 79  ? -61.331  18.165  -82.133  1.00 12.02  ? 79   PHE B CB    1 
ATOM   4250  C  CG    . PHE B  1 79  ? -60.569  19.440  -81.940  1.00 18.37  ? 79   PHE B CG    1 
ATOM   4251  C  CD1   . PHE B  1 79  ? -59.184  19.424  -81.814  1.00 21.57  ? 79   PHE B CD1   1 
ATOM   4252  C  CD2   . PHE B  1 79  ? -61.230  20.658  -81.912  1.00 26.19  ? 79   PHE B CD2   1 
ATOM   4253  C  CE1   . PHE B  1 79  ? -58.466  20.600  -81.672  1.00 18.05  ? 79   PHE B CE1   1 
ATOM   4254  C  CE2   . PHE B  1 79  ? -60.520  21.846  -81.769  1.00 14.56  ? 79   PHE B CE2   1 
ATOM   4255  C  CZ    . PHE B  1 79  ? -59.137  21.818  -81.648  1.00 20.35  ? 79   PHE B CZ    1 
ATOM   4256  N  N     . PHE B  1 80  ? -63.098  16.336  -83.880  1.00 20.51  ? 80   PHE B N     1 
ATOM   4257  C  CA    . PHE B  1 80  ? -64.010  15.206  -83.999  1.00 17.47  ? 80   PHE B CA    1 
ATOM   4258  C  C     . PHE B  1 80  ? -63.429  14.100  -84.904  1.00 21.07  ? 80   PHE B C     1 
ATOM   4259  O  O     . PHE B  1 80  ? -62.726  14.383  -85.878  1.00 36.96  ? 80   PHE B O     1 
ATOM   4260  C  CB    . PHE B  1 80  ? -65.370  15.712  -84.500  1.00 5.66   ? 80   PHE B CB    1 
ATOM   4261  C  CG    . PHE B  1 80  ? -66.091  16.636  -83.522  1.00 23.99  ? 80   PHE B CG    1 
ATOM   4262  C  CD1   . PHE B  1 80  ? -67.213  17.350  -83.917  1.00 27.38  ? 80   PHE B CD1   1 
ATOM   4263  C  CD2   . PHE B  1 80  ? -65.644  16.792  -82.217  1.00 37.38  ? 80   PHE B CD2   1 
ATOM   4264  C  CE1   . PHE B  1 80  ? -67.872  18.202  -83.042  1.00 33.99  ? 80   PHE B CE1   1 
ATOM   4265  C  CE2   . PHE B  1 80  ? -66.298  17.648  -81.337  1.00 37.69  ? 80   PHE B CE2   1 
ATOM   4266  C  CZ    . PHE B  1 80  ? -67.414  18.351  -81.753  1.00 33.97  ? 80   PHE B CZ    1 
ATOM   4267  N  N     . ALA B  1 81  ? -63.696  12.845  -84.556  1.00 17.66  ? 81   ALA B N     1 
ATOM   4268  C  CA    . ALA B  1 81  ? -63.166  11.703  -85.311  1.00 19.68  ? 81   ALA B CA    1 
ATOM   4269  C  C     . ALA B  1 81  ? -63.811  11.422  -86.660  1.00 27.32  ? 81   ALA B C     1 
ATOM   4270  O  O     . ALA B  1 81  ? -63.172  10.848  -87.544  1.00 33.70  ? 81   ALA B O     1 
ATOM   4271  C  CB    . ALA B  1 81  ? -63.231  10.471  -84.461  1.00 11.19  ? 81   ALA B CB    1 
ATOM   4272  N  N     . ASP B  1 82  ? -65.086  11.738  -86.770  1.00 16.79  ? 82   ASP B N     1 
ATOM   4273  C  CA    . ASP B  1 82  ? -65.864  11.544  -87.989  1.00 26.07  ? 82   ASP B CA    1 
ATOM   4274  C  C     . ASP B  1 82  ? -66.003  12.910  -88.618  1.00 32.01  ? 82   ASP B C     1 
ATOM   4275  O  O     . ASP B  1 82  ? -66.274  13.861  -87.913  1.00 22.71  ? 82   ASP B O     1 
ATOM   4276  C  CB    . ASP B  1 82  ? -67.247  11.010  -87.634  1.00 22.09  ? 82   ASP B CB    1 
ATOM   4277  C  CG    . ASP B  1 82  ? -67.180  9.789   -86.750  1.00 35.94  ? 82   ASP B CG    1 
ATOM   4278  O  OD1   . ASP B  1 82  ? -66.888  8.680   -87.263  1.00 26.27  ? 82   ASP B OD1   1 
ATOM   4279  O  OD2   . ASP B  1 82  ? -67.398  9.958   -85.537  1.00 29.36  ? 82   ASP B OD2   1 
ATOM   4280  N  N     . SER B  1 83  ? -65.839  13.004  -89.934  1.00 36.61  ? 83   SER B N     1 
ATOM   4281  C  CA    . SER B  1 83  ? -65.935  14.292  -90.608  1.00 25.78  ? 83   SER B CA    1 
ATOM   4282  C  C     . SER B  1 83  ? -67.227  15.020  -90.276  1.00 34.30  ? 83   SER B C     1 
ATOM   4283  O  O     . SER B  1 83  ? -68.330  14.546  -90.566  1.00 41.21  ? 83   SER B O     1 
ATOM   4284  C  CB    . SER B  1 83  ? -65.796  14.140  -92.117  1.00 23.58  ? 83   SER B CB    1 
ATOM   4285  O  OG    . SER B  1 83  ? -65.351  15.372  -92.652  1.00 39.26  ? 83   SER B OG    1 
ATOM   4286  N  N     . THR B  1 84  ? -67.082  16.156  -89.613  1.00 25.08  ? 84   THR B N     1 
ATOM   4287  C  CA    . THR B  1 84  ? -68.245  16.923  -89.237  1.00 28.59  ? 84   THR B CA    1 
ATOM   4288  C  C     . THR B  1 84  ? -68.038  18.412  -89.490  1.00 26.08  ? 84   THR B C     1 
ATOM   4289  O  O     . THR B  1 84  ? -66.933  18.949  -89.321  1.00 28.22  ? 84   THR B O     1 
ATOM   4290  C  CB    . THR B  1 84  ? -68.714  16.585  -87.775  1.00 28.86  ? 84   THR B CB    1 
ATOM   4291  O  OG1   . THR B  1 84  ? -68.992  17.786  -87.047  1.00 35.27  ? 84   THR B OG1   1 
ATOM   4292  C  CG2   . THR B  1 84  ? -67.625  15.829  -87.011  1.00 21.72  ? 84   THR B CG2   1 
ATOM   4293  N  N     . LEU B  1 85  ? -69.098  19.029  -90.002  1.00 22.19  ? 85   LEU B N     1 
ATOM   4294  C  CA    . LEU B  1 85  ? -69.114  20.440  -90.347  1.00 26.88  ? 85   LEU B CA    1 
ATOM   4295  C  C     . LEU B  1 85  ? -69.903  21.233  -89.324  1.00 28.72  ? 85   LEU B C     1 
ATOM   4296  O  O     . LEU B  1 85  ? -71.054  20.917  -89.023  1.00 33.27  ? 85   LEU B O     1 
ATOM   4297  C  CB    . LEU B  1 85  ? -69.730  20.606  -91.743  1.00 31.57  ? 85   LEU B CB    1 
ATOM   4298  C  CG    . LEU B  1 85  ? -69.765  21.994  -92.385  1.00 25.33  ? 85   LEU B CG    1 
ATOM   4299  C  CD1   . LEU B  1 85  ? -68.393  22.387  -92.876  1.00 29.57  ? 85   LEU B CD1   1 
ATOM   4300  C  CD2   . LEU B  1 85  ? -70.726  21.976  -93.544  1.00 22.40  ? 85   LEU B CD2   1 
ATOM   4301  N  N     . ILE B  1 86  ? -69.263  22.261  -88.788  1.00 25.77  ? 86   ILE B N     1 
ATOM   4302  C  CA    . ILE B  1 86  ? -69.878  23.123  -87.789  1.00 27.59  ? 86   ILE B CA    1 
ATOM   4303  C  C     . ILE B  1 86  ? -70.608  24.249  -88.498  1.00 30.04  ? 86   ILE B C     1 
ATOM   4304  O  O     . ILE B  1 86  ? -70.092  24.812  -89.452  1.00 34.35  ? 86   ILE B O     1 
ATOM   4305  C  CB    . ILE B  1 86  ? -68.798  23.795  -86.890  1.00 25.68  ? 86   ILE B CB    1 
ATOM   4306  C  CG1   . ILE B  1 86  ? -67.942  22.743  -86.198  1.00 25.93  ? 86   ILE B CG1   1 
ATOM   4307  C  CG2   . ILE B  1 86  ? -69.445  24.722  -85.848  1.00 18.64  ? 86   ILE B CG2   1 
ATOM   4308  C  CD1   . ILE B  1 86  ? -66.626  23.290  -85.708  1.00 18.59  ? 86   ILE B CD1   1 
ATOM   4309  N  N     . ILE B  1 87  ? -71.808  24.567  -88.029  1.00 33.39  ? 87   ILE B N     1 
ATOM   4310  C  CA    . ILE B  1 87  ? -72.577  25.674  -88.574  1.00 23.04  ? 87   ILE B CA    1 
ATOM   4311  C  C     . ILE B  1 87  ? -73.197  26.424  -87.400  1.00 31.15  ? 87   ILE B C     1 
ATOM   4312  O  O     . ILE B  1 87  ? -73.964  25.860  -86.619  1.00 35.32  ? 87   ILE B O     1 
ATOM   4313  C  CB    . ILE B  1 87  ? -73.675  25.222  -89.546  1.00 27.46  ? 87   ILE B CB    1 
ATOM   4314  C  CG1   . ILE B  1 87  ? -73.056  24.523  -90.750  1.00 25.36  ? 87   ILE B CG1   1 
ATOM   4315  C  CG2   . ILE B  1 87  ? -74.435  26.431  -90.075  1.00 37.52  ? 87   ILE B CG2   1 
ATOM   4316  C  CD1   . ILE B  1 87  ? -74.084  23.946  -91.681  1.00 34.24  ? 87   ILE B CD1   1 
ATOM   4317  N  N     . ARG B  1 88  ? -72.770  27.673  -87.235  1.00 34.33  ? 88   ARG B N     1 
ATOM   4318  C  CA    . ARG B  1 88  ? -73.247  28.553  -86.179  1.00 24.66  ? 88   ARG B CA    1 
ATOM   4319  C  C     . ARG B  1 88  ? -74.691  28.900  -86.527  1.00 25.68  ? 88   ARG B C     1 
ATOM   4320  O  O     . ARG B  1 88  ? -75.053  28.984  -87.700  1.00 35.43  ? 88   ARG B O     1 
ATOM   4321  C  CB    . ARG B  1 88  ? -72.340  29.783  -86.137  1.00 24.09  ? 88   ARG B CB    1 
ATOM   4322  C  CG    . ARG B  1 88  ? -72.563  30.747  -85.003  1.00 31.12  ? 88   ARG B CG    1 
ATOM   4323  C  CD    . ARG B  1 88  ? -71.215  31.280  -84.541  1.00 20.21  ? 88   ARG B CD    1 
ATOM   4324  N  NE    . ARG B  1 88  ? -70.868  30.564  -83.331  1.00 31.79  ? 88   ARG B NE    1 
ATOM   4325  C  CZ    . ARG B  1 88  ? -69.826  29.762  -83.186  1.00 36.77  ? 88   ARG B CZ    1 
ATOM   4326  N  NH1   . ARG B  1 88  ? -69.665  29.161  -82.020  1.00 37.68  ? 88   ARG B NH1   1 
ATOM   4327  N  NH2   . ARG B  1 88  ? -68.932  29.595  -84.163  1.00 28.40  ? 88   ARG B NH2   1 
ATOM   4328  N  N     . CYS B  1 89  ? -75.531  29.039  -85.513  1.00 28.74  ? 89   CYS B N     1 
ATOM   4329  C  CA    . CYS B  1 89  ? -76.942  29.323  -85.736  1.00 30.86  ? 89   CYS B CA    1 
ATOM   4330  C  C     . CYS B  1 89  ? -77.400  30.515  -84.946  1.00 36.37  ? 89   CYS B C     1 
ATOM   4331  O  O     . CYS B  1 89  ? -76.697  30.961  -84.041  1.00 41.31  ? 89   CYS B O     1 
ATOM   4332  C  CB    . CYS B  1 89  ? -77.794  28.143  -85.271  1.00 28.08  ? 89   CYS B CB    1 
ATOM   4333  S  SG    . CYS B  1 89  ? -77.538  26.611  -86.149  1.00 35.89  ? 89   CYS B SG    1 
ATOM   4334  N  N     . ASP B  1 90  ? -78.583  31.024  -85.305  1.00 42.70  ? 90   ASP B N     1 
ATOM   4335  C  CA    . ASP B  1 90  ? -79.232  32.136  -84.599  1.00 36.60  ? 90   ASP B CA    1 
ATOM   4336  C  C     . ASP B  1 90  ? -80.484  31.486  -84.026  1.00 37.35  ? 90   ASP B C     1 
ATOM   4337  O  O     . ASP B  1 90  ? -80.983  30.499  -84.576  1.00 36.86  ? 90   ASP B O     1 
ATOM   4338  C  CB    . ASP B  1 90  ? -79.670  33.264  -85.540  1.00 31.12  ? 90   ASP B CB    1 
ATOM   4339  C  CG    . ASP B  1 90  ? -78.511  33.932  -86.237  1.00 49.10  ? 90   ASP B CG    1 
ATOM   4340  O  OD1   . ASP B  1 90  ? -77.742  34.636  -85.554  1.00 32.37  ? 90   ASP B OD1   1 
ATOM   4341  O  OD2   . ASP B  1 90  ? -78.385  33.760  -87.473  1.00 65.40  ? 90   ASP B OD2   1 
ATOM   4342  N  N     . ILE B  1 91  ? -80.960  31.997  -82.900  1.00 34.61  ? 91   ILE B N     1 
ATOM   4343  C  CA    . ILE B  1 91  ? -82.164  31.462  -82.272  1.00 40.85  ? 91   ILE B CA    1 
ATOM   4344  C  C     . ILE B  1 91  ? -83.296  32.409  -82.633  1.00 50.30  ? 91   ILE B C     1 
ATOM   4345  O  O     . ILE B  1 91  ? -83.273  33.581  -82.252  1.00 48.19  ? 91   ILE B O     1 
ATOM   4346  C  CB    . ILE B  1 91  ? -82.026  31.408  -80.736  1.00 48.43  ? 91   ILE B CB    1 
ATOM   4347  C  CG1   . ILE B  1 91  ? -80.698  30.759  -80.340  1.00 35.13  ? 91   ILE B CG1   1 
ATOM   4348  C  CG2   . ILE B  1 91  ? -83.183  30.636  -80.135  1.00 37.81  ? 91   ILE B CG2   1 
ATOM   4349  C  CD1   . ILE B  1 91  ? -80.502  29.359  -80.906  1.00 41.58  ? 91   ILE B CD1   1 
ATOM   4350  N  N     . LEU B  1 92  ? -84.269  31.914  -83.391  1.00 52.40  ? 92   LEU B N     1 
ATOM   4351  C  CA    . LEU B  1 92  ? -85.390  32.745  -83.819  1.00 50.50  ? 92   LEU B CA    1 
ATOM   4352  C  C     . LEU B  1 92  ? -86.672  32.261  -83.179  1.00 55.01  ? 92   LEU B C     1 
ATOM   4353  O  O     . LEU B  1 92  ? -86.777  31.082  -82.828  1.00 52.48  ? 92   LEU B O     1 
ATOM   4354  C  CB    . LEU B  1 92  ? -85.527  32.693  -85.343  1.00 23.94  ? 92   LEU B CB    1 
ATOM   4355  C  CG    . LEU B  1 92  ? -84.239  32.896  -86.147  1.00 42.02  ? 92   LEU B CG    1 
ATOM   4356  C  CD1   . LEU B  1 92  ? -84.513  32.651  -87.622  1.00 37.43  ? 92   LEU B CD1   1 
ATOM   4357  C  CD2   . LEU B  1 92  ? -83.643  34.291  -85.911  1.00 33.46  ? 92   LEU B CD2   1 
ATOM   4358  N  N     . GLU B  1 93  ? -87.632  33.172  -83.000  1.00 66.36  ? 93   GLU B N     1 
ATOM   4359  C  CA    . GLU B  1 93  ? -88.921  32.800  -82.419  1.00 64.68  ? 93   GLU B CA    1 
ATOM   4360  C  C     . GLU B  1 93  ? -89.702  32.133  -83.569  1.00 62.06  ? 93   GLU B C     1 
ATOM   4361  O  O     . GLU B  1 93  ? -89.644  32.601  -84.712  1.00 60.54  ? 93   GLU B O     1 
ATOM   4362  C  CB    . GLU B  1 93  ? -89.646  34.036  -81.869  1.00 64.17  ? 93   GLU B CB    1 
ATOM   4363  C  CG    . GLU B  1 93  ? -90.606  33.727  -80.703  1.00 78.76  ? 93   GLU B CG    1 
ATOM   4364  C  CD    . GLU B  1 93  ? -89.965  33.907  -79.330  1.00 80.99  ? 93   GLU B CD    1 
ATOM   4365  O  OE1   . GLU B  1 93  ? -89.332  34.972  -79.123  1.00 71.39  ? 93   GLU B OE1   1 
ATOM   4366  O  OE2   . GLU B  1 93  ? -90.112  33.003  -78.462  1.00 62.07  ? 93   GLU B OE2   1 
ATOM   4367  N  N     . PRO B  1 94  ? -90.424  31.024  -83.288  1.00 55.48  ? 94   PRO B N     1 
ATOM   4368  C  CA    . PRO B  1 94  ? -91.197  30.295  -84.306  1.00 60.76  ? 94   PRO B CA    1 
ATOM   4369  C  C     . PRO B  1 94  ? -92.273  31.129  -84.988  1.00 73.83  ? 94   PRO B C     1 
ATOM   4370  O  O     . PRO B  1 94  ? -92.915  31.983  -84.355  1.00 75.32  ? 94   PRO B O     1 
ATOM   4371  C  CB    . PRO B  1 94  ? -91.833  29.153  -83.509  1.00 55.58  ? 94   PRO B CB    1 
ATOM   4372  C  CG    . PRO B  1 94  ? -90.980  29.031  -82.299  1.00 57.18  ? 94   PRO B CG    1 
ATOM   4373  C  CD    . PRO B  1 94  ? -90.692  30.461  -81.957  1.00 58.21  ? 94   PRO B CD    1 
ATOM   4374  N  N     . GLY B  1 95  ? -92.490  30.846  -86.270  1.00 68.65  ? 95   GLY B N     1 
ATOM   4375  C  CA    . GLY B  1 95  ? -93.491  31.573  -87.031  1.00 70.14  ? 95   GLY B CA    1 
ATOM   4376  C  C     . GLY B  1 95  ? -92.963  32.929  -87.445  1.00 70.94  ? 95   GLY B C     1 
ATOM   4377  O  O     . GLY B  1 95  ? -92.691  33.164  -88.628  1.00 61.19  ? 95   GLY B O     1 
ATOM   4378  N  N     . THR B  1 96  ? -92.812  33.821  -86.469  1.00 68.16  ? 96   THR B N     1 
ATOM   4379  C  CA    . THR B  1 96  ? -92.286  35.156  -86.732  1.00 68.74  ? 96   THR B CA    1 
ATOM   4380  C  C     . THR B  1 96  ? -90.894  35.072  -87.364  1.00 69.35  ? 96   THR B C     1 
ATOM   4381  O  O     . THR B  1 96  ? -90.614  35.787  -88.331  1.00 54.72  ? 96   THR B O     1 
ATOM   4382  C  CB    . THR B  1 96  ? -92.258  36.038  -85.436  1.00 73.76  ? 96   THR B CB    1 
ATOM   4383  O  OG1   . THR B  1 96  ? -91.253  37.053  -85.548  1.00 76.91  ? 96   THR B OG1   1 
ATOM   4384  C  CG2   . THR B  1 96  ? -92.005  35.201  -84.190  1.00 73.93  ? 96   THR B CG2   1 
ATOM   4385  N  N     . LEU B  1 97  ? -90.071  34.138  -86.870  1.00 66.04  ? 97   LEU B N     1 
ATOM   4386  C  CA    . LEU B  1 97  ? -88.698  33.937  -87.355  1.00 62.52  ? 97   LEU B CA    1 
ATOM   4387  C  C     . LEU B  1 97  ? -87.916  35.249  -87.236  1.00 70.35  ? 97   LEU B C     1 
ATOM   4388  O  O     . LEU B  1 97  ? -86.979  35.511  -88.003  1.00 54.13  ? 97   LEU B O     1 
ATOM   4389  C  CB    . LEU B  1 97  ? -88.700  33.450  -88.813  1.00 46.45  ? 97   LEU B CB    1 
ATOM   4390  C  CG    . LEU B  1 97  ? -88.459  31.962  -89.103  1.00 61.52  ? 97   LEU B CG    1 
ATOM   4391  C  CD1   . LEU B  1 97  ? -89.465  31.074  -88.364  1.00 63.28  ? 97   LEU B CD1   1 
ATOM   4392  C  CD2   . LEU B  1 97  ? -88.526  31.729  -90.617  1.00 60.52  ? 97   LEU B CD2   1 
ATOM   4393  N  N     . GLN B  1 98  ? -88.274  36.040  -86.227  1.00 75.90  ? 98   GLN B N     1 
ATOM   4394  C  CA    . GLN B  1 98  ? -87.667  37.344  -86.031  1.00 83.60  ? 98   GLN B CA    1 
ATOM   4395  C  C     . GLN B  1 98  ? -86.301  37.374  -85.334  1.00 84.35  ? 98   GLN B C     1 
ATOM   4396  O  O     . GLN B  1 98  ? -85.393  38.090  -85.778  1.00 95.96  ? 98   GLN B O     1 
ATOM   4397  C  CB    . GLN B  1 98  ? -88.692  38.274  -85.364  1.00 81.10  ? 98   GLN B CB    1 
ATOM   4398  C  CG    . GLN B  1 98  ? -88.195  39.646  -84.941  1.00 96.25  ? 98   GLN B CG    1 
ATOM   4399  C  CD    . GLN B  1 98  ? -88.224  39.828  -83.415  1.00 100.00 ? 98   GLN B CD    1 
ATOM   4400  O  OE1   . GLN B  1 98  ? -88.530  38.886  -82.663  1.00 100.00 ? 98   GLN B OE1   1 
ATOM   4401  N  NE2   . GLN B  1 98  ? -87.900  41.038  -82.955  1.00 95.94  ? 98   GLN B NE2   1 
ATOM   4402  N  N     . GLY B  1 99  ? -86.119  36.578  -84.285  1.00 52.06  ? 99   GLY B N     1 
ATOM   4403  C  CA    . GLY B  1 99  ? -84.835  36.619  -83.608  1.00 47.94  ? 99   GLY B CA    1 
ATOM   4404  C  C     . GLY B  1 99  ? -85.027  36.895  -82.134  1.00 51.27  ? 99   GLY B C     1 
ATOM   4405  O  O     . GLY B  1 99  ? -85.216  38.035  -81.728  1.00 59.37  ? 99   GLY B O     1 
ATOM   4406  N  N     . TYR B  1 100 ? -84.962  35.827  -81.346  1.00 50.71  ? 100  TYR B N     1 
ATOM   4407  C  CA    . TYR B  1 100 ? -85.147  35.829  -79.893  1.00 31.46  ? 100  TYR B CA    1 
ATOM   4408  C  C     . TYR B  1 100 ? -84.501  37.006  -79.155  1.00 41.07  ? 100  TYR B C     1 
ATOM   4409  O  O     . TYR B  1 100 ? -83.333  37.333  -79.384  1.00 40.46  ? 100  TYR B O     1 
ATOM   4410  C  CB    . TYR B  1 100 ? -84.647  34.487  -79.332  1.00 36.33  ? 100  TYR B CB    1 
ATOM   4411  C  CG    . TYR B  1 100 ? -85.073  34.185  -77.919  1.00 40.02  ? 100  TYR B CG    1 
ATOM   4412  C  CD1   . TYR B  1 100 ? -86.276  34.673  -77.422  1.00 37.82  ? 100  TYR B CD1   1 
ATOM   4413  C  CD2   . TYR B  1 100 ? -84.266  33.430  -77.068  1.00 35.44  ? 100  TYR B CD2   1 
ATOM   4414  C  CE1   . TYR B  1 100 ? -86.675  34.425  -76.111  1.00 63.57  ? 100  TYR B CE1   1 
ATOM   4415  C  CE2   . TYR B  1 100 ? -84.659  33.173  -75.740  1.00 40.50  ? 100  TYR B CE2   1 
ATOM   4416  C  CZ    . TYR B  1 100 ? -85.870  33.676  -75.273  1.00 52.44  ? 100  TYR B CZ    1 
ATOM   4417  O  OH    . TYR B  1 100 ? -86.303  33.440  -73.981  1.00 65.14  ? 100  TYR B OH    1 
ATOM   4418  N  N     . ASP B  1 101 ? -85.280  37.646  -78.283  1.00 41.86  ? 101  ASP B N     1 
ATOM   4419  C  CA    . ASP B  1 101 ? -84.803  38.788  -77.499  1.00 45.87  ? 101  ASP B CA    1 
ATOM   4420  C  C     . ASP B  1 101 ? -83.604  38.438  -76.631  1.00 48.45  ? 101  ASP B C     1 
ATOM   4421  O  O     . ASP B  1 101 ? -82.736  39.276  -76.381  1.00 51.72  ? 101  ASP B O     1 
ATOM   4422  C  CB    . ASP B  1 101 ? -85.904  39.307  -76.575  1.00 61.60  ? 101  ASP B CB    1 
ATOM   4423  C  CG    . ASP B  1 101 ? -86.976  40.071  -77.303  1.00 64.81  ? 101  ASP B CG    1 
ATOM   4424  O  OD1   . ASP B  1 101 ? -88.053  40.241  -76.694  1.00 61.95  ? 101  ASP B OD1   1 
ATOM   4425  O  OD2   . ASP B  1 101 ? -86.737  40.525  -78.448  1.00 52.26  ? 101  ASP B OD2   1 
ATOM   4426  N  N     . ARG B  1 102 ? -83.606  37.214  -76.115  1.00 43.34  ? 102  ARG B N     1 
ATOM   4427  C  CA    . ARG B  1 102 ? -82.535  36.729  -75.258  1.00 37.69  ? 102  ARG B CA    1 
ATOM   4428  C  C     . ARG B  1 102 ? -81.371  36.031  -75.973  1.00 40.47  ? 102  ARG B C     1 
ATOM   4429  O  O     . ARG B  1 102 ? -80.452  35.549  -75.310  1.00 50.44  ? 102  ARG B O     1 
ATOM   4430  C  CB    . ARG B  1 102 ? -83.111  35.846  -74.145  1.00 33.43  ? 102  ARG B CB    1 
ATOM   4431  C  CG    . ARG B  1 102 ? -83.672  36.646  -72.979  1.00 42.07  ? 102  ARG B CG    1 
ATOM   4432  C  CD    . ARG B  1 102 ? -85.158  36.422  -72.745  1.00 50.36  ? 102  ARG B CD    1 
ATOM   4433  N  NE    . ARG B  1 102 ? -85.426  35.502  -71.638  1.00 55.86  ? 102  ARG B NE    1 
ATOM   4434  C  CZ    . ARG B  1 102 ? -86.440  35.626  -70.782  1.00 53.56  ? 102  ARG B CZ    1 
ATOM   4435  N  NH1   . ARG B  1 102 ? -86.604  34.731  -69.814  1.00 56.30  ? 102  ARG B NH1   1 
ATOM   4436  N  NH2   . ARG B  1 102 ? -87.284  36.648  -70.882  1.00 47.56  ? 102  ARG B NH2   1 
ATOM   4437  N  N     . ASP B  1 103 ? -81.409  35.968  -77.308  1.00 41.16  ? 103  ASP B N     1 
ATOM   4438  C  CA    . ASP B  1 103 ? -80.328  35.354  -78.091  1.00 25.95  ? 103  ASP B CA    1 
ATOM   4439  C  C     . ASP B  1 103 ? -79.198  36.375  -78.233  1.00 39.68  ? 103  ASP B C     1 
ATOM   4440  O  O     . ASP B  1 103 ? -79.322  37.365  -78.958  1.00 50.31  ? 103  ASP B O     1 
ATOM   4441  C  CB    . ASP B  1 103 ? -80.827  34.901  -79.470  1.00 28.13  ? 103  ASP B CB    1 
ATOM   4442  C  CG    . ASP B  1 103 ? -79.693  34.440  -80.410  1.00 42.30  ? 103  ASP B CG    1 
ATOM   4443  O  OD1   . ASP B  1 103 ? -78.538  34.286  -79.962  1.00 50.23  ? 103  ASP B OD1   1 
ATOM   4444  O  OD2   . ASP B  1 103 ? -79.959  34.238  -81.621  1.00 39.64  ? 103  ASP B OD2   1 
ATOM   4445  N  N     . PRO B  1 104 ? -78.053  36.108  -77.585  1.00 44.16  ? 104  PRO B N     1 
ATOM   4446  C  CA    . PRO B  1 104 ? -76.884  36.983  -77.609  1.00 33.28  ? 104  PRO B CA    1 
ATOM   4447  C  C     . PRO B  1 104 ? -76.390  37.319  -79.006  1.00 31.12  ? 104  PRO B C     1 
ATOM   4448  O  O     . PRO B  1 104 ? -75.918  38.425  -79.246  1.00 39.86  ? 104  PRO B O     1 
ATOM   4449  C  CB    . PRO B  1 104 ? -75.841  36.171  -76.846  1.00 26.02  ? 104  PRO B CB    1 
ATOM   4450  C  CG    . PRO B  1 104 ? -76.651  35.349  -75.930  1.00 37.84  ? 104  PRO B CG    1 
ATOM   4451  C  CD    . PRO B  1 104 ? -77.751  34.882  -76.829  1.00 38.19  ? 104  PRO B CD    1 
ATOM   4452  N  N     . ARG B  1 105 ? -76.476  36.368  -79.925  1.00 35.46  ? 105  ARG B N     1 
ATOM   4453  C  CA    . ARG B  1 105 ? -75.998  36.632  -81.273  1.00 31.49  ? 105  ARG B CA    1 
ATOM   4454  C  C     . ARG B  1 105 ? -76.940  37.575  -81.986  1.00 43.68  ? 105  ARG B C     1 
ATOM   4455  O  O     . ARG B  1 105 ? -76.492  38.475  -82.698  1.00 42.70  ? 105  ARG B O     1 
ATOM   4456  C  CB    . ARG B  1 105 ? -75.844  35.349  -82.076  1.00 33.46  ? 105  ARG B CB    1 
ATOM   4457  C  CG    . ARG B  1 105 ? -74.988  35.541  -83.309  1.00 29.97  ? 105  ARG B CG    1 
ATOM   4458  C  CD    . ARG B  1 105 ? -74.791  34.248  -84.041  1.00 28.42  ? 105  ARG B CD    1 
ATOM   4459  N  NE    . ARG B  1 105 ? -73.720  34.330  -85.028  1.00 29.94  ? 105  ARG B NE    1 
ATOM   4460  C  CZ    . ARG B  1 105 ? -73.905  34.167  -86.334  1.00 34.06  ? 105  ARG B CZ    1 
ATOM   4461  N  NH1   . ARG B  1 105 ? -72.877  34.243  -87.160  1.00 28.28  ? 105  ARG B NH1   1 
ATOM   4462  N  NH2   . ARG B  1 105 ? -75.123  33.953  -86.819  1.00 30.15  ? 105  ARG B NH2   1 
ATOM   4463  N  N     . SER B  1 106 ? -78.244  37.360  -81.803  1.00 51.58  ? 106  SER B N     1 
ATOM   4464  C  CA    . SER B  1 106 ? -79.246  38.223  -82.423  1.00 46.50  ? 106  SER B CA    1 
ATOM   4465  C  C     . SER B  1 106 ? -79.059  39.651  -81.904  1.00 41.08  ? 106  SER B C     1 
ATOM   4466  O  O     . SER B  1 106 ? -79.054  40.606  -82.685  1.00 46.62  ? 106  SER B O     1 
ATOM   4467  C  CB    . SER B  1 106 ? -80.658  37.698  -82.152  1.00 35.69  ? 106  SER B CB    1 
ATOM   4468  O  OG    . SER B  1 106 ? -80.940  36.569  -82.967  1.00 46.22  ? 106  SER B OG    1 
ATOM   4469  N  N     . ILE B  1 107 ? -78.821  39.770  -80.597  1.00 32.72  ? 107  ILE B N     1 
ATOM   4470  C  CA    . ILE B  1 107 ? -78.581  41.060  -79.949  1.00 31.17  ? 107  ILE B CA    1 
ATOM   4471  C  C     . ILE B  1 107 ? -77.383  41.803  -80.559  1.00 34.00  ? 107  ILE B C     1 
ATOM   4472  O  O     . ILE B  1 107 ? -77.433  43.013  -80.764  1.00 50.40  ? 107  ILE B O     1 
ATOM   4473  C  CB    . ILE B  1 107 ? -78.318  40.889  -78.427  1.00 34.28  ? 107  ILE B CB    1 
ATOM   4474  C  CG1   . ILE B  1 107 ? -79.578  40.391  -77.720  1.00 25.35  ? 107  ILE B CG1   1 
ATOM   4475  C  CG2   . ILE B  1 107 ? -77.839  42.209  -77.800  1.00 18.03  ? 107  ILE B CG2   1 
ATOM   4476  C  CD1   . ILE B  1 107 ? -79.428  40.315  -76.214  1.00 20.61  ? 107  ILE B CD1   1 
ATOM   4477  N  N     . ALA B  1 108 ? -76.305  41.079  -80.837  1.00 32.49  ? 108  ALA B N     1 
ATOM   4478  C  CA    . ALA B  1 108 ? -75.120  41.697  -81.415  1.00 39.70  ? 108  ALA B CA    1 
ATOM   4479  C  C     . ALA B  1 108 ? -75.415  42.177  -82.824  1.00 45.36  ? 108  ALA B C     1 
ATOM   4480  O  O     . ALA B  1 108 ? -74.931  43.235  -83.232  1.00 44.44  ? 108  ALA B O     1 
ATOM   4481  C  CB    . ALA B  1 108 ? -73.951  40.723  -81.421  1.00 39.79  ? 108  ALA B CB    1 
ATOM   4482  N  N     . LYS B  1 109 ? -76.206  41.393  -83.558  1.00 34.70  ? 109  LYS B N     1 
ATOM   4483  C  CA    . LYS B  1 109 ? -76.584  41.739  -84.924  1.00 35.64  ? 109  LYS B CA    1 
ATOM   4484  C  C     . LYS B  1 109 ? -77.455  42.999  -84.923  1.00 44.43  ? 109  LYS B C     1 
ATOM   4485  O  O     . LYS B  1 109 ? -77.233  43.902  -85.733  1.00 40.99  ? 109  LYS B O     1 
ATOM   4486  C  CB    . LYS B  1 109 ? -77.302  40.570  -85.600  1.00 38.89  ? 109  LYS B CB    1 
ATOM   4487  C  CG    . LYS B  1 109 ? -76.372  39.454  -86.094  1.00 34.00  ? 109  LYS B CG    1 
ATOM   4488  C  CD    . LYS B  1 109 ? -77.178  38.309  -86.711  1.00 28.51  ? 109  LYS B CD    1 
ATOM   4489  C  CE    . LYS B  1 109 ? -76.321  37.449  -87.627  1.00 44.97  ? 109  LYS B CE    1 
ATOM   4490  N  NZ    . LYS B  1 109 ? -77.138  36.443  -88.355  1.00 45.79  ? 109  LYS B NZ    1 
ATOM   4491  N  N     . ARG B  1 110 ? -78.395  43.079  -83.973  1.00 37.86  ? 110  ARG B N     1 
ATOM   4492  C  CA    . ARG B  1 110 ? -79.287  44.239  -83.831  1.00 37.03  ? 110  ARG B CA    1 
ATOM   4493  C  C     . ARG B  1 110 ? -78.478  45.505  -83.568  1.00 41.48  ? 110  ARG B C     1 
ATOM   4494  O  O     . ARG B  1 110 ? -78.832  46.597  -84.015  1.00 55.19  ? 110  ARG B O     1 
ATOM   4495  C  CB    . ARG B  1 110 ? -80.257  44.056  -82.660  1.00 28.48  ? 110  ARG B CB    1 
ATOM   4496  C  CG    . ARG B  1 110 ? -81.299  42.973  -82.824  1.00 30.68  ? 110  ARG B CG    1 
ATOM   4497  C  CD    . ARG B  1 110 ? -82.183  42.943  -81.581  1.00 33.23  ? 110  ARG B CD    1 
ATOM   4498  N  NE    . ARG B  1 110 ? -83.184  41.872  -81.608  1.00 37.49  ? 110  ARG B NE    1 
ATOM   4499  C  CZ    . ARG B  1 110 ? -84.049  41.639  -80.620  1.00 52.85  ? 110  ARG B CZ    1 
ATOM   4500  N  NH1   . ARG B  1 110 ? -84.934  40.650  -80.724  1.00 37.45  ? 110  ARG B NH1   1 
ATOM   4501  N  NH2   . ARG B  1 110 ? -84.032  42.391  -79.521  1.00 48.15  ? 110  ARG B NH2   1 
ATOM   4502  N  N     . ALA B  1 111 ? -77.418  45.357  -82.785  1.00 39.53  ? 111  ALA B N     1 
ATOM   4503  C  CA    . ALA B  1 111 ? -76.566  46.479  -82.470  1.00 41.04  ? 111  ALA B CA    1 
ATOM   4504  C  C     . ALA B  1 111 ? -75.769  46.893  -83.706  1.00 40.84  ? 111  ALA B C     1 
ATOM   4505  O  O     . ALA B  1 111 ? -75.464  48.066  -83.872  1.00 47.56  ? 111  ALA B O     1 
ATOM   4506  C  CB    . ALA B  1 111 ? -75.652  46.139  -81.314  1.00 33.44  ? 111  ALA B CB    1 
ATOM   4507  N  N     . GLU B  1 112 ? -75.427  45.942  -84.576  1.00 45.96  ? 112  GLU B N     1 
ATOM   4508  C  CA    . GLU B  1 112 ? -74.692  46.291  -85.791  1.00 48.66  ? 112  GLU B CA    1 
ATOM   4509  C  C     . GLU B  1 112 ? -75.653  47.021  -86.726  1.00 57.52  ? 112  GLU B C     1 
ATOM   4510  O  O     . GLU B  1 112 ? -75.278  48.024  -87.334  1.00 60.25  ? 112  GLU B O     1 
ATOM   4511  C  CB    . GLU B  1 112 ? -74.088  45.058  -86.478  1.00 51.58  ? 112  GLU B CB    1 
ATOM   4512  C  CG    . GLU B  1 112 ? -72.917  44.423  -85.710  1.00 60.21  ? 112  GLU B CG    1 
ATOM   4513  C  CD    . GLU B  1 112 ? -71.703  44.126  -86.576  1.00 53.94  ? 112  GLU B CD    1 
ATOM   4514  O  OE1   . GLU B  1 112 ? -70.949  45.071  -86.894  1.00 72.98  ? 112  GLU B OE1   1 
ATOM   4515  O  OE2   . GLU B  1 112 ? -71.478  42.947  -86.917  1.00 45.65  ? 112  GLU B OE2   1 
ATOM   4516  N  N     . ASP B  1 113 ? -76.902  46.552  -86.781  1.00 55.52  ? 113  ASP B N     1 
ATOM   4517  C  CA    . ASP B  1 113 ? -77.947  47.160  -87.614  1.00 48.99  ? 113  ASP B CA    1 
ATOM   4518  C  C     . ASP B  1 113 ? -78.181  48.593  -87.182  1.00 53.16  ? 113  ASP B C     1 
ATOM   4519  O  O     . ASP B  1 113 ? -78.178  49.512  -88.000  1.00 64.79  ? 113  ASP B O     1 
ATOM   4520  C  CB    . ASP B  1 113 ? -79.270  46.405  -87.474  1.00 48.41  ? 113  ASP B CB    1 
ATOM   4521  C  CG    . ASP B  1 113 ? -79.270  45.077  -88.202  1.00 70.46  ? 113  ASP B CG    1 
ATOM   4522  O  OD1   . ASP B  1 113 ? -78.445  44.899  -89.135  1.00 64.95  ? 113  ASP B OD1   1 
ATOM   4523  O  OD2   . ASP B  1 113 ? -80.110  44.216  -87.837  1.00 64.29  ? 113  ASP B OD2   1 
ATOM   4524  N  N     . TYR B  1 114 ? -78.409  48.760  -85.885  1.00 47.46  ? 114  TYR B N     1 
ATOM   4525  C  CA    . TYR B  1 114 ? -78.640  50.062  -85.288  1.00 40.55  ? 114  TYR B CA    1 
ATOM   4526  C  C     . TYR B  1 114 ? -77.498  51.049  -85.572  1.00 43.97  ? 114  TYR B C     1 
ATOM   4527  O  O     . TYR B  1 114 ? -77.734  52.247  -85.676  1.00 58.35  ? 114  TYR B O     1 
ATOM   4528  C  CB    . TYR B  1 114 ? -78.863  49.895  -83.787  1.00 39.89  ? 114  TYR B CB    1 
ATOM   4529  C  CG    . TYR B  1 114 ? -78.998  51.185  -83.010  1.00 54.17  ? 114  TYR B CG    1 
ATOM   4530  C  CD1   . TYR B  1 114 ? -77.885  51.783  -82.422  1.00 54.00  ? 114  TYR B CD1   1 
ATOM   4531  C  CD2   . TYR B  1 114 ? -80.241  51.795  -82.833  1.00 55.23  ? 114  TYR B CD2   1 
ATOM   4532  C  CE1   . TYR B  1 114 ? -78.003  52.959  -81.671  1.00 71.13  ? 114  TYR B CE1   1 
ATOM   4533  C  CE2   . TYR B  1 114 ? -80.370  52.974  -82.079  1.00 47.96  ? 114  TYR B CE2   1 
ATOM   4534  C  CZ    . TYR B  1 114 ? -79.247  53.550  -81.501  1.00 62.30  ? 114  TYR B CZ    1 
ATOM   4535  O  OH    . TYR B  1 114 ? -79.350  54.708  -80.748  1.00 52.14  ? 114  TYR B OH    1 
ATOM   4536  N  N     . LEU B  1 115 ? -76.267  50.564  -85.710  1.00 44.17  ? 115  LEU B N     1 
ATOM   4537  C  CA    . LEU B  1 115 ? -75.148  51.466  -85.996  1.00 44.06  ? 115  LEU B CA    1 
ATOM   4538  C  C     . LEU B  1 115 ? -75.431  52.092  -87.349  1.00 50.44  ? 115  LEU B C     1 
ATOM   4539  O  O     . LEU B  1 115 ? -75.368  53.311  -87.502  1.00 64.94  ? 115  LEU B O     1 
ATOM   4540  C  CB    . LEU B  1 115 ? -73.823  50.703  -86.081  1.00 35.55  ? 115  LEU B CB    1 
ATOM   4541  C  CG    . LEU B  1 115 ? -72.484  51.370  -85.710  1.00 41.13  ? 115  LEU B CG    1 
ATOM   4542  C  CD1   . LEU B  1 115 ? -71.468  51.125  -86.804  1.00 44.68  ? 115  LEU B CD1   1 
ATOM   4543  C  CD2   . LEU B  1 115 ? -72.612  52.845  -85.432  1.00 42.89  ? 115  LEU B CD2   1 
ATOM   4544  N  N     . ARG B  1 116 ? -75.757  51.243  -88.321  1.00 56.31  ? 116  ARG B N     1 
ATOM   4545  C  CA    . ARG B  1 116 ? -76.059  51.689  -89.676  1.00 63.31  ? 116  ARG B CA    1 
ATOM   4546  C  C     . ARG B  1 116 ? -77.299  52.570  -89.723  1.00 69.12  ? 116  ARG B C     1 
ATOM   4547  O  O     . ARG B  1 116 ? -77.287  53.622  -90.360  1.00 77.70  ? 116  ARG B O     1 
ATOM   4548  C  CB    . ARG B  1 116 ? -76.193  50.495  -90.624  1.00 45.26  ? 116  ARG B CB    1 
ATOM   4549  C  CG    . ARG B  1 116 ? -74.847  49.931  -91.064  1.00 71.58  ? 116  ARG B CG    1 
ATOM   4550  C  CD    . ARG B  1 116 ? -74.988  48.767  -92.033  1.00 84.59  ? 116  ARG B CD    1 
ATOM   4551  N  NE    . ARG B  1 116 ? -75.667  47.633  -91.414  1.00 100.00 ? 116  ARG B NE    1 
ATOM   4552  C  CZ    . ARG B  1 116 ? -75.048  46.628  -90.798  1.00 100.00 ? 116  ARG B CZ    1 
ATOM   4553  N  NH1   . ARG B  1 116 ? -75.759  45.640  -90.258  1.00 92.47  ? 116  ARG B NH1   1 
ATOM   4554  N  NH2   . ARG B  1 116 ? -73.720  46.599  -90.735  1.00 100.00 ? 116  ARG B NH2   1 
ATOM   4555  N  N     . ALA B  1 117 ? -78.343  52.166  -89.005  1.00 65.69  ? 117  ALA B N     1 
ATOM   4556  C  CA    . ALA B  1 117 ? -79.588  52.928  -88.953  1.00 60.71  ? 117  ALA B CA    1 
ATOM   4557  C  C     . ALA B  1 117 ? -79.378  54.384  -88.516  1.00 62.33  ? 117  ALA B C     1 
ATOM   4558  O  O     . ALA B  1 117 ? -79.989  55.288  -89.079  1.00 88.06  ? 117  ALA B O     1 
ATOM   4559  C  CB    . ALA B  1 117 ? -80.602  52.234  -88.035  1.00 44.52  ? 117  ALA B CB    1 
ATOM   4560  N  N     . THR B  1 118 ? -78.516  54.618  -87.530  1.00 58.46  ? 118  THR B N     1 
ATOM   4561  C  CA    . THR B  1 118 ? -78.257  55.981  -87.068  1.00 57.60  ? 118  THR B CA    1 
ATOM   4562  C  C     . THR B  1 118 ? -77.331  56.720  -88.024  1.00 58.29  ? 118  THR B C     1 
ATOM   4563  O  O     . THR B  1 118 ? -77.065  57.907  -87.842  1.00 62.05  ? 118  THR B O     1 
ATOM   4564  C  CB    . THR B  1 118 ? -77.579  56.024  -85.681  1.00 68.69  ? 118  THR B CB    1 
ATOM   4565  O  OG1   . THR B  1 118 ? -76.247  55.495  -85.775  1.00 52.30  ? 118  THR B OG1   1 
ATOM   4566  C  CG2   . THR B  1 118 ? -78.386  55.246  -84.659  1.00 59.56  ? 118  THR B CG2   1 
ATOM   4567  N  N     . GLY B  1 119 ? -76.784  56.001  -88.997  1.00 53.61  ? 119  GLY B N     1 
ATOM   4568  C  CA    . GLY B  1 119 ? -75.882  56.615  -89.956  1.00 53.78  ? 119  GLY B CA    1 
ATOM   4569  C  C     . GLY B  1 119 ? -74.567  57.135  -89.385  1.00 60.98  ? 119  GLY B C     1 
ATOM   4570  O  O     . GLY B  1 119 ? -73.799  57.782  -90.104  1.00 60.60  ? 119  GLY B O     1 
ATOM   4571  N  N     . ILE B  1 120 ? -74.299  56.870  -88.106  1.00 55.89  ? 120  ILE B N     1 
ATOM   4572  C  CA    . ILE B  1 120 ? -73.049  57.312  -87.486  1.00 53.29  ? 120  ILE B CA    1 
ATOM   4573  C  C     . ILE B  1 120 ? -71.829  56.653  -88.150  1.00 57.08  ? 120  ILE B C     1 
ATOM   4574  O  O     . ILE B  1 120 ? -70.748  57.244  -88.197  1.00 54.33  ? 120  ILE B O     1 
ATOM   4575  C  CB    . ILE B  1 120 ? -73.036  57.032  -85.973  1.00 46.27  ? 120  ILE B CB    1 
ATOM   4576  C  CG1   . ILE B  1 120 ? -74.270  57.658  -85.326  1.00 46.96  ? 120  ILE B CG1   1 
ATOM   4577  C  CG2   . ILE B  1 120 ? -71.779  57.616  -85.345  1.00 42.64  ? 120  ILE B CG2   1 
ATOM   4578  C  CD1   . ILE B  1 120 ? -74.244  57.674  -83.812  1.00 56.27  ? 120  ILE B CD1   1 
ATOM   4579  N  N     . ALA B  1 121 ? -72.026  55.435  -88.664  1.00 52.10  ? 121  ALA B N     1 
ATOM   4580  C  CA    . ALA B  1 121 ? -70.996  54.654  -89.368  1.00 45.07  ? 121  ALA B CA    1 
ATOM   4581  C  C     . ALA B  1 121 ? -71.664  53.425  -89.972  1.00 48.42  ? 121  ALA B C     1 
ATOM   4582  O  O     . ALA B  1 121 ? -72.845  53.172  -89.698  1.00 46.16  ? 121  ALA B O     1 
ATOM   4583  C  CB    . ALA B  1 121 ? -69.891  54.222  -88.413  1.00 44.52  ? 121  ALA B CB    1 
ATOM   4584  N  N     . ASP B  1 122 ? -70.939  52.685  -90.817  1.00 43.20  ? 122  ASP B N     1 
ATOM   4585  C  CA    . ASP B  1 122 ? -71.503  51.467  -91.412  1.00 57.32  ? 122  ASP B CA    1 
ATOM   4586  C  C     . ASP B  1 122 ? -70.961  50.148  -90.851  1.00 63.56  ? 122  ASP B C     1 
ATOM   4587  O  O     . ASP B  1 122 ? -71.638  49.114  -90.933  1.00 70.18  ? 122  ASP B O     1 
ATOM   4588  C  CB    . ASP B  1 122 ? -71.457  51.473  -92.951  1.00 57.08  ? 122  ASP B CB    1 
ATOM   4589  C  CG    . ASP B  1 122 ? -70.125  51.912  -93.513  1.00 60.83  ? 122  ASP B CG    1 
ATOM   4590  O  OD1   . ASP B  1 122 ? -69.074  51.324  -93.158  1.00 74.93  ? 122  ASP B OD1   1 
ATOM   4591  O  OD2   . ASP B  1 122 ? -70.147  52.844  -94.344  1.00 69.32  ? 122  ASP B OD2   1 
ATOM   4592  N  N     . THR B  1 123 ? -69.757  50.183  -90.273  1.00 60.35  ? 123  THR B N     1 
ATOM   4593  C  CA    . THR B  1 123 ? -69.151  48.986  -89.678  1.00 65.87  ? 123  THR B CA    1 
ATOM   4594  C  C     . THR B  1 123 ? -68.407  49.270  -88.366  1.00 53.18  ? 123  THR B C     1 
ATOM   4595  O  O     . THR B  1 123 ? -67.830  50.343  -88.193  1.00 46.38  ? 123  THR B O     1 
ATOM   4596  C  CB    . THR B  1 123 ? -68.170  48.291  -90.648  1.00 55.83  ? 123  THR B CB    1 
ATOM   4597  O  OG1   . THR B  1 123 ? -67.315  49.275  -91.221  1.00 48.37  ? 123  THR B OG1   1 
ATOM   4598  C  CG2   . THR B  1 123 ? -68.916  47.525  -91.767  1.00 65.47  ? 123  THR B CG2   1 
ATOM   4599  N  N     . VAL B  1 124 ? -68.480  48.316  -87.432  1.00 53.85  ? 124  VAL B N     1 
ATOM   4600  C  CA    . VAL B  1 124 ? -67.795  48.420  -86.139  1.00 45.47  ? 124  VAL B CA    1 
ATOM   4601  C  C     . VAL B  1 124 ? -66.658  47.416  -86.132  1.00 44.98  ? 124  VAL B C     1 
ATOM   4602  O  O     . VAL B  1 124 ? -66.871  46.238  -86.415  1.00 50.74  ? 124  VAL B O     1 
ATOM   4603  C  CB    . VAL B  1 124 ? -68.660  48.008  -84.945  1.00 42.66  ? 124  VAL B CB    1 
ATOM   4604  C  CG1   . VAL B  1 124 ? -68.359  48.904  -83.771  1.00 37.68  ? 124  VAL B CG1   1 
ATOM   4605  C  CG2   . VAL B  1 124 ? -70.129  47.969  -85.299  1.00 51.82  ? 124  VAL B CG2   1 
ATOM   4606  N  N     . LEU B  1 125 ? -65.465  47.865  -85.773  1.00 41.67  ? 125  LEU B N     1 
ATOM   4607  C  CA    . LEU B  1 125 ? -64.316  46.975  -85.728  1.00 43.17  ? 125  LEU B CA    1 
ATOM   4608  C  C     . LEU B  1 125 ? -63.896  46.614  -84.306  1.00 50.85  ? 125  LEU B C     1 
ATOM   4609  O  O     . LEU B  1 125 ? -63.720  47.487  -83.451  1.00 46.60  ? 125  LEU B O     1 
ATOM   4610  C  CB    . LEU B  1 125 ? -63.151  47.582  -86.502  1.00 41.49  ? 125  LEU B CB    1 
ATOM   4611  C  CG    . LEU B  1 125 ? -63.024  47.161  -87.967  1.00 40.67  ? 125  LEU B CG    1 
ATOM   4612  C  CD1   . LEU B  1 125 ? -64.341  46.694  -88.558  1.00 36.29  ? 125  LEU B CD1   1 
ATOM   4613  C  CD2   . LEU B  1 125 ? -62.449  48.316  -88.746  1.00 36.93  ? 125  LEU B CD2   1 
ATOM   4614  N  N     . PHE B  1 126 ? -63.742  45.312  -84.067  1.00 54.98  ? 126  PHE B N     1 
ATOM   4615  C  CA    . PHE B  1 126 ? -63.352  44.794  -82.758  1.00 39.06  ? 126  PHE B CA    1 
ATOM   4616  C  C     . PHE B  1 126 ? -62.114  43.917  -82.787  1.00 45.00  ? 126  PHE B C     1 
ATOM   4617  O  O     . PHE B  1 126 ? -61.986  43.030  -83.632  1.00 51.49  ? 126  PHE B O     1 
ATOM   4618  C  CB    . PHE B  1 126 ? -64.503  44.010  -82.145  1.00 28.84  ? 126  PHE B CB    1 
ATOM   4619  C  CG    . PHE B  1 126 ? -65.398  44.833  -81.273  1.00 46.71  ? 126  PHE B CG    1 
ATOM   4620  C  CD1   . PHE B  1 126 ? -66.415  45.602  -81.827  1.00 39.18  ? 126  PHE B CD1   1 
ATOM   4621  C  CD2   . PHE B  1 126 ? -65.234  44.825  -79.887  1.00 34.90  ? 126  PHE B CD2   1 
ATOM   4622  C  CE1   . PHE B  1 126 ? -67.260  46.352  -81.015  1.00 46.40  ? 126  PHE B CE1   1 
ATOM   4623  C  CE2   . PHE B  1 126 ? -66.074  45.572  -79.063  1.00 39.21  ? 126  PHE B CE2   1 
ATOM   4624  C  CZ    . PHE B  1 126 ? -67.089  46.337  -79.628  1.00 43.88  ? 126  PHE B CZ    1 
ATOM   4625  N  N     . GLY B  1 127 ? -61.211  44.164  -81.842  1.00 41.47  ? 127  GLY B N     1 
ATOM   4626  C  CA    . GLY B  1 127 ? -59.993  43.383  -81.748  1.00 37.41  ? 127  GLY B CA    1 
ATOM   4627  C  C     . GLY B  1 127 ? -59.710  43.022  -80.302  1.00 40.23  ? 127  GLY B C     1 
ATOM   4628  O  O     . GLY B  1 127 ? -58.949  43.729  -79.645  1.00 36.40  ? 127  GLY B O     1 
ATOM   4629  N  N     . PRO B  1 128 ? -60.298  41.931  -79.773  1.00 36.81  ? 128  PRO B N     1 
ATOM   4630  C  CA    . PRO B  1 128 ? -60.067  41.530  -78.383  1.00 30.92  ? 128  PRO B CA    1 
ATOM   4631  C  C     . PRO B  1 128 ? -58.725  40.826  -78.256  1.00 33.38  ? 128  PRO B C     1 
ATOM   4632  O  O     . PRO B  1 128 ? -58.268  40.174  -79.196  1.00 37.69  ? 128  PRO B O     1 
ATOM   4633  C  CB    . PRO B  1 128 ? -61.197  40.530  -78.113  1.00 38.89  ? 128  PRO B CB    1 
ATOM   4634  C  CG    . PRO B  1 128 ? -62.002  40.453  -79.411  1.00 31.31  ? 128  PRO B CG    1 
ATOM   4635  C  CD    . PRO B  1 128 ? -61.084  40.906  -80.476  1.00 27.46  ? 128  PRO B CD    1 
ATOM   4636  N  N     . GLU B  1 129 ? -58.093  40.965  -77.096  1.00 27.93  ? 129  GLU B N     1 
ATOM   4637  C  CA    . GLU B  1 129 ? -56.806  40.317  -76.826  1.00 29.45  ? 129  GLU B CA    1 
ATOM   4638  C  C     . GLU B  1 129 ? -57.068  39.381  -75.630  1.00 37.72  ? 129  GLU B C     1 
ATOM   4639  O  O     . GLU B  1 129 ? -56.680  39.668  -74.498  1.00 35.90  ? 129  GLU B O     1 
ATOM   4640  C  CB    . GLU B  1 129 ? -55.732  41.364  -76.455  1.00 37.24  ? 129  GLU B CB    1 
ATOM   4641  C  CG    . GLU B  1 129 ? -55.384  42.478  -77.516  1.00 19.46  ? 129  GLU B CG    1 
ATOM   4642  C  CD    . GLU B  1 129 ? -54.583  43.641  -76.901  1.00 40.30  ? 129  GLU B CD    1 
ATOM   4643  O  OE1   . GLU B  1 129 ? -53.521  44.038  -77.414  1.00 45.79  ? 129  GLU B OE1   1 
ATOM   4644  O  OE2   . GLU B  1 129 ? -55.010  44.173  -75.863  1.00 54.93  ? 129  GLU B OE2   1 
ATOM   4645  N  N     . PRO B  1 130 ? -57.755  38.253  -75.865  1.00 30.26  ? 130  PRO B N     1 
ATOM   4646  C  CA    . PRO B  1 130 ? -58.033  37.348  -74.751  1.00 30.01  ? 130  PRO B CA    1 
ATOM   4647  C  C     . PRO B  1 130 ? -56.857  36.485  -74.313  1.00 33.45  ? 130  PRO B C     1 
ATOM   4648  O  O     . PRO B  1 130 ? -56.207  35.826  -75.124  1.00 45.55  ? 130  PRO B O     1 
ATOM   4649  C  CB    . PRO B  1 130 ? -59.199  36.512  -75.280  1.00 19.51  ? 130  PRO B CB    1 
ATOM   4650  C  CG    . PRO B  1 130 ? -58.857  36.358  -76.723  1.00 34.49  ? 130  PRO B CG    1 
ATOM   4651  C  CD    . PRO B  1 130 ? -58.317  37.730  -77.125  1.00 35.14  ? 130  PRO B CD    1 
ATOM   4652  N  N     . GLU B  1 131 ? -56.603  36.504  -73.010  1.00 33.40  ? 131  GLU B N     1 
ATOM   4653  C  CA    . GLU B  1 131 ? -55.526  35.732  -72.393  1.00 26.45  ? 131  GLU B CA    1 
ATOM   4654  C  C     . GLU B  1 131 ? -56.052  34.491  -71.674  1.00 24.91  ? 131  GLU B C     1 
ATOM   4655  O  O     . GLU B  1 131 ? -57.221  34.423  -71.308  1.00 25.07  ? 131  GLU B O     1 
ATOM   4656  C  CB    . GLU B  1 131 ? -54.771  36.611  -71.406  1.00 18.98  ? 131  GLU B CB    1 
ATOM   4657  C  CG    . GLU B  1 131 ? -53.865  37.607  -72.086  1.00 24.77  ? 131  GLU B CG    1 
ATOM   4658  C  CD    . GLU B  1 131 ? -53.498  38.770  -71.198  1.00 37.31  ? 131  GLU B CD    1 
ATOM   4659  O  OE1   . GLU B  1 131 ? -52.489  39.446  -71.505  1.00 40.25  ? 131  GLU B OE1   1 
ATOM   4660  O  OE2   . GLU B  1 131 ? -54.226  39.027  -70.207  1.00 32.24  ? 131  GLU B OE2   1 
ATOM   4661  N  N     . PHE B  1 132 ? -55.184  33.514  -71.456  1.00 27.20  ? 132  PHE B N     1 
ATOM   4662  C  CA    . PHE B  1 132 ? -55.606  32.296  -70.779  1.00 24.72  ? 132  PHE B CA    1 
ATOM   4663  C  C     . PHE B  1 132 ? -54.477  31.588  -70.044  1.00 30.73  ? 132  PHE B C     1 
ATOM   4664  O  O     . PHE B  1 132 ? -53.311  31.993  -70.108  1.00 23.21  ? 132  PHE B O     1 
ATOM   4665  C  CB    . PHE B  1 132 ? -56.257  31.341  -71.777  1.00 20.51  ? 132  PHE B CB    1 
ATOM   4666  C  CG    . PHE B  1 132 ? -55.360  30.941  -72.921  1.00 24.36  ? 132  PHE B CG    1 
ATOM   4667  C  CD1   . PHE B  1 132 ? -55.309  31.702  -74.085  1.00 36.17  ? 132  PHE B CD1   1 
ATOM   4668  C  CD2   . PHE B  1 132 ? -54.574  29.797  -72.839  1.00 32.42  ? 132  PHE B CD2   1 
ATOM   4669  C  CE1   . PHE B  1 132 ? -54.485  31.326  -75.143  1.00 24.40  ? 132  PHE B CE1   1 
ATOM   4670  C  CE2   . PHE B  1 132 ? -53.747  29.411  -73.891  1.00 30.26  ? 132  PHE B CE2   1 
ATOM   4671  C  CZ    . PHE B  1 132 ? -53.703  30.174  -75.044  1.00 31.51  ? 132  PHE B CZ    1 
ATOM   4672  N  N     . PHE B  1 133 ? -54.846  30.522  -69.339  1.00 24.77  ? 133  PHE B N     1 
ATOM   4673  C  CA    . PHE B  1 133 ? -53.896  29.710  -68.576  1.00 19.47  ? 133  PHE B CA    1 
ATOM   4674  C  C     . PHE B  1 133 ? -53.966  28.247  -68.998  1.00 24.09  ? 133  PHE B C     1 
ATOM   4675  O  O     . PHE B  1 133 ? -55.052  27.711  -69.272  1.00 28.96  ? 133  PHE B O     1 
ATOM   4676  C  CB    . PHE B  1 133 ? -54.227  29.771  -67.077  1.00 18.21  ? 133  PHE B CB    1 
ATOM   4677  C  CG    . PHE B  1 133 ? -53.663  30.965  -66.367  1.00 19.46  ? 133  PHE B CG    1 
ATOM   4678  C  CD1   . PHE B  1 133 ? -54.431  32.109  -66.184  1.00 22.57  ? 133  PHE B CD1   1 
ATOM   4679  C  CD2   . PHE B  1 133 ? -52.364  30.938  -65.861  1.00 23.19  ? 133  PHE B CD2   1 
ATOM   4680  C  CE1   . PHE B  1 133 ? -53.914  33.213  -65.505  1.00 19.82  ? 133  PHE B CE1   1 
ATOM   4681  C  CE2   . PHE B  1 133 ? -51.838  32.028  -65.186  1.00 18.10  ? 133  PHE B CE2   1 
ATOM   4682  C  CZ    . PHE B  1 133 ? -52.618  33.173  -65.008  1.00 20.97  ? 133  PHE B CZ    1 
ATOM   4683  N  N     . LEU B  1 134 ? -52.809  27.594  -69.015  1.00 19.57  ? 134  LEU B N     1 
ATOM   4684  C  CA    . LEU B  1 134 ? -52.727  26.173  -69.339  1.00 18.96  ? 134  LEU B CA    1 
ATOM   4685  C  C     . LEU B  1 134 ? -52.174  25.456  -68.122  1.00 17.94  ? 134  LEU B C     1 
ATOM   4686  O  O     . LEU B  1 134 ? -51.036  25.690  -67.738  1.00 35.28  ? 134  LEU B O     1 
ATOM   4687  C  CB    . LEU B  1 134 ? -51.789  25.929  -70.518  1.00 17.00  ? 134  LEU B CB    1 
ATOM   4688  C  CG    . LEU B  1 134 ? -52.244  26.472  -71.863  1.00 18.77  ? 134  LEU B CG    1 
ATOM   4689  C  CD1   . LEU B  1 134 ? -51.250  26.076  -72.924  1.00 25.75  ? 134  LEU B CD1   1 
ATOM   4690  C  CD2   . LEU B  1 134 ? -53.604  25.900  -72.192  1.00 22.41  ? 134  LEU B CD2   1 
ATOM   4691  N  N     . PHE B  1 135 ? -52.980  24.593  -67.514  1.00 24.94  ? 135  PHE B N     1 
ATOM   4692  C  CA    . PHE B  1 135 ? -52.559  23.828  -66.338  1.00 16.36  ? 135  PHE B CA    1 
ATOM   4693  C  C     . PHE B  1 135 ? -52.463  22.336  -66.649  1.00 24.57  ? 135  PHE B C     1 
ATOM   4694  O  O     . PHE B  1 135 ? -52.889  21.873  -67.717  1.00 29.62  ? 135  PHE B O     1 
ATOM   4695  C  CB    . PHE B  1 135 ? -53.571  24.004  -65.218  1.00 14.63  ? 135  PHE B CB    1 
ATOM   4696  C  CG    . PHE B  1 135 ? -53.747  25.411  -64.768  1.00 14.26  ? 135  PHE B CG    1 
ATOM   4697  C  CD1   . PHE B  1 135 ? -55.007  25.876  -64.413  1.00 17.99  ? 135  PHE B CD1   1 
ATOM   4698  C  CD2   . PHE B  1 135 ? -52.658  26.264  -64.644  1.00 18.11  ? 135  PHE B CD2   1 
ATOM   4699  C  CE1   . PHE B  1 135 ? -55.180  27.179  -63.926  1.00 16.71  ? 135  PHE B CE1   1 
ATOM   4700  C  CE2   . PHE B  1 135 ? -52.818  27.564  -64.160  1.00 14.58  ? 135  PHE B CE2   1 
ATOM   4701  C  CZ    . PHE B  1 135 ? -54.084  28.023  -63.799  1.00 13.73  ? 135  PHE B CZ    1 
ATOM   4702  N  N     . ASP B  1 136 ? -51.941  21.582  -65.687  1.00 32.23  ? 136  ASP B N     1 
ATOM   4703  C  CA    . ASP B  1 136 ? -51.812  20.130  -65.817  1.00 23.81  ? 136  ASP B CA    1 
ATOM   4704  C  C     . ASP B  1 136 ? -52.882  19.430  -64.977  1.00 22.94  ? 136  ASP B C     1 
ATOM   4705  O  O     . ASP B  1 136 ? -53.381  18.360  -65.334  1.00 25.82  ? 136  ASP B O     1 
ATOM   4706  C  CB    . ASP B  1 136 ? -50.437  19.670  -65.324  1.00 11.78  ? 136  ASP B CB    1 
ATOM   4707  C  CG    . ASP B  1 136 ? -49.344  19.829  -66.363  1.00 34.08  ? 136  ASP B CG    1 
ATOM   4708  O  OD1   . ASP B  1 136 ? -48.171  19.962  -65.950  1.00 36.41  ? 136  ASP B OD1   1 
ATOM   4709  O  OD2   . ASP B  1 136 ? -49.642  19.774  -67.577  1.00 27.71  ? 136  ASP B OD2   1 
ATOM   4710  N  N     . ASP B  1 137 ? -53.272  20.080  -63.886  1.00 25.31  ? 137  ASP B N     1 
ATOM   4711  C  CA    . ASP B  1 137 ? -54.235  19.523  -62.949  1.00 15.11  ? 137  ASP B CA    1 
ATOM   4712  C  C     . ASP B  1 137 ? -54.972  20.656  -62.237  1.00 15.73  ? 137  ASP B C     1 
ATOM   4713  O  O     . ASP B  1 137 ? -54.366  21.640  -61.815  1.00 22.53  ? 137  ASP B O     1 
ATOM   4714  C  CB    . ASP B  1 137 ? -53.439  18.680  -61.941  1.00 28.55  ? 137  ASP B CB    1 
ATOM   4715  C  CG    . ASP B  1 137 ? -54.276  18.123  -60.804  1.00 35.08  ? 137  ASP B CG    1 
ATOM   4716  O  OD1   . ASP B  1 137 ? -55.191  17.314  -61.068  1.00 34.82  ? 137  ASP B OD1   1 
ATOM   4717  O  OD2   . ASP B  1 137 ? -53.959  18.438  -59.631  1.00 26.87  ? 137  ASP B OD2   1 
ATOM   4718  N  N     . ILE B  1 138 ? -56.290  20.529  -62.160  1.00 18.52  ? 138  ILE B N     1 
ATOM   4719  C  CA    . ILE B  1 138 ? -57.137  21.502  -61.484  1.00 21.80  ? 138  ILE B CA    1 
ATOM   4720  C  C     . ILE B  1 138 ? -58.170  20.709  -60.671  1.00 28.63  ? 138  ILE B C     1 
ATOM   4721  O  O     . ILE B  1 138 ? -58.882  19.843  -61.199  1.00 25.75  ? 138  ILE B O     1 
ATOM   4722  C  CB    . ILE B  1 138 ? -57.875  22.445  -62.484  1.00 25.61  ? 138  ILE B CB    1 
ATOM   4723  C  CG1   . ILE B  1 138 ? -58.804  23.411  -61.732  1.00 13.45  ? 138  ILE B CG1   1 
ATOM   4724  C  CG2   . ILE B  1 138 ? -58.707  21.636  -63.477  1.00 17.82  ? 138  ILE B CG2   1 
ATOM   4725  C  CD1   . ILE B  1 138 ? -58.077  24.530  -61.017  1.00 20.79  ? 138  ILE B CD1   1 
ATOM   4726  N  N     . ARG B  1 139 ? -58.196  20.958  -59.371  1.00 21.50  ? 139  ARG B N     1 
ATOM   4727  C  CA    . ARG B  1 139 ? -59.143  20.282  -58.499  1.00 14.07  ? 139  ARG B CA    1 
ATOM   4728  C  C     . ARG B  1 139 ? -59.817  21.307  -57.604  1.00 23.37  ? 139  ARG B C     1 
ATOM   4729  O  O     . ARG B  1 139 ? -59.210  22.299  -57.193  1.00 26.04  ? 139  ARG B O     1 
ATOM   4730  C  CB    . ARG B  1 139 ? -58.437  19.206  -57.672  1.00 8.80   ? 139  ARG B CB    1 
ATOM   4731  C  CG    . ARG B  1 139 ? -58.125  17.903  -58.437  1.00 27.39  ? 139  ARG B CG    1 
ATOM   4732  C  CD    . ARG B  1 139 ? -56.827  17.219  -57.975  1.00 20.85  ? 139  ARG B CD    1 
ATOM   4733  N  NE    . ARG B  1 139 ? -56.548  17.430  -56.556  1.00 27.08  ? 139  ARG B NE    1 
ATOM   4734  C  CZ    . ARG B  1 139 ? -55.429  17.979  -56.100  1.00 36.91  ? 139  ARG B CZ    1 
ATOM   4735  N  NH1   . ARG B  1 139 ? -55.254  18.157  -54.797  1.00 40.55  ? 139  ARG B NH1   1 
ATOM   4736  N  NH2   . ARG B  1 139 ? -54.479  18.347  -56.953  1.00 35.65  ? 139  ARG B NH2   1 
ATOM   4737  N  N     . PHE B  1 140 ? -61.101  21.099  -57.363  1.00 14.60  ? 140  PHE B N     1 
ATOM   4738  C  CA    . PHE B  1 140 ? -61.864  22.003  -56.524  1.00 22.29  ? 140  PHE B CA    1 
ATOM   4739  C  C     . PHE B  1 140 ? -63.176  21.376  -56.066  1.00 26.24  ? 140  PHE B C     1 
ATOM   4740  O  O     . PHE B  1 140 ? -63.632  20.369  -56.613  1.00 27.73  ? 140  PHE B O     1 
ATOM   4741  C  CB    . PHE B  1 140 ? -62.114  23.323  -57.254  1.00 10.45  ? 140  PHE B CB    1 
ATOM   4742  C  CG    . PHE B  1 140 ? -62.886  23.180  -58.535  1.00 25.75  ? 140  PHE B CG    1 
ATOM   4743  C  CD1   . PHE B  1 140 ? -64.268  22.949  -58.513  1.00 24.11  ? 140  PHE B CD1   1 
ATOM   4744  C  CD2   . PHE B  1 140 ? -62.230  23.239  -59.768  1.00 28.72  ? 140  PHE B CD2   1 
ATOM   4745  C  CE1   . PHE B  1 140 ? -64.987  22.773  -59.701  1.00 16.10  ? 140  PHE B CE1   1 
ATOM   4746  C  CE2   . PHE B  1 140 ? -62.935  23.065  -60.961  1.00 7.90   ? 140  PHE B CE2   1 
ATOM   4747  C  CZ    . PHE B  1 140 ? -64.322  22.827  -60.923  1.00 31.38  ? 140  PHE B CZ    1 
ATOM   4748  N  N     . GLY B  1 141 ? -63.778  21.977  -55.051  1.00 23.57  ? 141  GLY B N     1 
ATOM   4749  C  CA    . GLY B  1 141 ? -65.025  21.454  -54.535  1.00 20.28  ? 141  GLY B CA    1 
ATOM   4750  C  C     . GLY B  1 141 ? -65.510  22.250  -53.349  1.00 22.40  ? 141  GLY B C     1 
ATOM   4751  O  O     . GLY B  1 141 ? -64.749  23.021  -52.754  1.00 33.68  ? 141  GLY B O     1 
ATOM   4752  N  N     . ALA B  1 142 ? -66.783  22.067  -53.014  1.00 32.88  ? 142  ALA B N     1 
ATOM   4753  C  CA    . ALA B  1 142 ? -67.402  22.750  -51.883  1.00 22.53  ? 142  ALA B CA    1 
ATOM   4754  C  C     . ALA B  1 142 ? -68.549  21.896  -51.392  1.00 27.75  ? 142  ALA B C     1 
ATOM   4755  O  O     . ALA B  1 142 ? -69.384  21.441  -52.181  1.00 36.95  ? 142  ALA B O     1 
ATOM   4756  C  CB    . ALA B  1 142 ? -67.909  24.111  -52.289  1.00 21.61  ? 142  ALA B CB    1 
ATOM   4757  N  N     . SER B  1 143 ? -68.532  21.632  -50.093  1.00 32.05  ? 143  SER B N     1 
ATOM   4758  C  CA    . SER B  1 143 ? -69.553  20.834  -49.432  1.00 16.76  ? 143  SER B CA    1 
ATOM   4759  C  C     . SER B  1 143 ? -69.753  21.462  -48.060  1.00 28.13  ? 143  SER B C     1 
ATOM   4760  O  O     . SER B  1 143 ? -69.056  22.416  -47.697  1.00 28.43  ? 143  SER B O     1 
ATOM   4761  C  CB    . SER B  1 143 ? -69.112  19.372  -49.315  1.00 18.03  ? 143  SER B CB    1 
ATOM   4762  O  OG    . SER B  1 143 ? -68.260  19.148  -48.204  1.00 32.13  ? 143  SER B OG    1 
ATOM   4763  N  N     . ILE B  1 144 ? -70.692  20.928  -47.291  1.00 21.76  ? 144  ILE B N     1 
ATOM   4764  C  CA    . ILE B  1 144 ? -70.977  21.484  -45.973  1.00 24.84  ? 144  ILE B CA    1 
ATOM   4765  C  C     . ILE B  1 144 ? -69.748  21.554  -45.055  1.00 25.39  ? 144  ILE B C     1 
ATOM   4766  O  O     . ILE B  1 144 ? -69.581  22.518  -44.323  1.00 28.61  ? 144  ILE B O     1 
ATOM   4767  C  CB    . ILE B  1 144 ? -72.145  20.725  -45.289  1.00 26.93  ? 144  ILE B CB    1 
ATOM   4768  C  CG1   . ILE B  1 144 ? -72.541  21.421  -43.989  1.00 19.26  ? 144  ILE B CG1   1 
ATOM   4769  C  CG2   . ILE B  1 144 ? -71.777  19.269  -45.042  1.00 18.60  ? 144  ILE B CG2   1 
ATOM   4770  C  CD1   . ILE B  1 144 ? -73.663  20.729  -43.234  1.00 27.34  ? 144  ILE B CD1   1 
ATOM   4771  N  N     . SER B  1 145 ? -68.862  20.566  -45.148  1.00 29.05  ? 145  SER B N     1 
ATOM   4772  C  CA    . SER B  1 145 ? -67.655  20.512  -44.316  1.00 18.42  ? 145  SER B CA    1 
ATOM   4773  C  C     . SER B  1 145 ? -66.440  21.325  -44.790  1.00 25.36  ? 145  SER B C     1 
ATOM   4774  O  O     . SER B  1 145 ? -65.416  21.360  -44.101  1.00 29.83  ? 145  SER B O     1 
ATOM   4775  C  CB    . SER B  1 145 ? -67.232  19.054  -44.076  1.00 14.40  ? 145  SER B CB    1 
ATOM   4776  O  OG    . SER B  1 145 ? -67.186  18.308  -45.280  1.00 38.70  ? 145  SER B OG    1 
ATOM   4777  N  N     . GLY B  1 146 ? -66.540  21.963  -45.958  1.00 20.95  ? 146  GLY B N     1 
ATOM   4778  C  CA    . GLY B  1 146 ? -65.419  22.751  -46.459  1.00 4.05   ? 146  GLY B CA    1 
ATOM   4779  C  C     . GLY B  1 146 ? -65.434  23.075  -47.945  1.00 19.93  ? 146  GLY B C     1 
ATOM   4780  O  O     . GLY B  1 146 ? -66.418  22.835  -48.655  1.00 27.44  ? 146  GLY B O     1 
ATOM   4781  N  N     . SER B  1 147 ? -64.315  23.617  -48.415  1.00 18.06  ? 147  SER B N     1 
ATOM   4782  C  CA    . SER B  1 147 ? -64.137  24.004  -49.812  1.00 22.09  ? 147  SER B CA    1 
ATOM   4783  C  C     . SER B  1 147 ? -62.660  23.946  -50.104  1.00 31.01  ? 147  SER B C     1 
ATOM   4784  O  O     . SER B  1 147 ? -61.843  23.958  -49.184  1.00 30.12  ? 147  SER B O     1 
ATOM   4785  C  CB    . SER B  1 147 ? -64.612  25.456  -50.074  1.00 13.20  ? 147  SER B CB    1 
ATOM   4786  O  OG    . SER B  1 147 ? -64.817  26.226  -48.882  1.00 43.89  ? 147  SER B OG    1 
ATOM   4787  N  N     . HIS B  1 148 ? -62.315  23.906  -51.385  1.00 25.90  ? 148  HIS B N     1 
ATOM   4788  C  CA    . HIS B  1 148 ? -60.916  23.905  -51.766  1.00 22.39  ? 148  HIS B CA    1 
ATOM   4789  C  C     . HIS B  1 148 ? -60.732  24.038  -53.259  1.00 25.11  ? 148  HIS B C     1 
ATOM   4790  O  O     . HIS B  1 148 ? -61.641  23.760  -54.039  1.00 29.16  ? 148  HIS B O     1 
ATOM   4791  C  CB    . HIS B  1 148 ? -60.231  22.615  -51.317  1.00 23.66  ? 148  HIS B CB    1 
ATOM   4792  C  CG    . HIS B  1 148 ? -60.543  21.437  -52.186  1.00 32.66  ? 148  HIS B CG    1 
ATOM   4793  N  ND1   . HIS B  1 148 ? -61.715  20.721  -52.074  1.00 34.39  ? 148  HIS B ND1   1 
ATOM   4794  C  CD2   . HIS B  1 148 ? -59.850  20.873  -53.208  1.00 13.84  ? 148  HIS B CD2   1 
ATOM   4795  C  CE1   . HIS B  1 148 ? -61.735  19.769  -52.992  1.00 29.17  ? 148  HIS B CE1   1 
ATOM   4796  N  NE2   . HIS B  1 148 ? -60.616  19.839  -53.692  1.00 27.09  ? 148  HIS B NE2   1 
ATOM   4797  N  N     . VAL B  1 149 ? -59.548  24.511  -53.627  1.00 24.46  ? 149  VAL B N     1 
ATOM   4798  C  CA    . VAL B  1 149 ? -59.118  24.625  -55.009  1.00 20.84  ? 149  VAL B CA    1 
ATOM   4799  C  C     . VAL B  1 149 ? -57.615  24.396  -55.002  1.00 19.65  ? 149  VAL B C     1 
ATOM   4800  O  O     . VAL B  1 149 ? -56.896  24.952  -54.165  1.00 26.09  ? 149  VAL B O     1 
ATOM   4801  C  CB    . VAL B  1 149 ? -59.425  25.978  -55.673  1.00 21.92  ? 149  VAL B CB    1 
ATOM   4802  C  CG1   . VAL B  1 149 ? -58.859  27.126  -54.887  1.00 14.67  ? 149  VAL B CG1   1 
ATOM   4803  C  CG2   . VAL B  1 149 ? -58.809  25.991  -57.055  1.00 7.62   ? 149  VAL B CG2   1 
ATOM   4804  N  N     . ALA B  1 150 ? -57.159  23.523  -55.892  1.00 15.11  ? 150  ALA B N     1 
ATOM   4805  C  CA    . ALA B  1 150 ? -55.743  23.219  -56.011  1.00 19.30  ? 150  ALA B CA    1 
ATOM   4806  C  C     . ALA B  1 150 ? -55.348  23.246  -57.484  1.00 28.25  ? 150  ALA B C     1 
ATOM   4807  O  O     . ALA B  1 150 ? -55.876  22.481  -58.293  1.00 28.90  ? 150  ALA B O     1 
ATOM   4808  C  CB    . ALA B  1 150 ? -55.458  21.881  -55.421  1.00 18.72  ? 150  ALA B CB    1 
ATOM   4809  N  N     . ILE B  1 151 ? -54.459  24.173  -57.828  1.00 23.07  ? 151  ILE B N     1 
ATOM   4810  C  CA    . ILE B  1 151 ? -53.976  24.340  -59.198  1.00 16.34  ? 151  ILE B CA    1 
ATOM   4811  C  C     . ILE B  1 151 ? -52.594  23.743  -59.297  1.00 21.67  ? 151  ILE B C     1 
ATOM   4812  O  O     . ILE B  1 151 ? -51.793  23.840  -58.368  1.00 26.49  ? 151  ILE B O     1 
ATOM   4813  C  CB    . ILE B  1 151 ? -53.827  25.839  -59.558  1.00 18.34  ? 151  ILE B CB    1 
ATOM   4814  C  CG1   . ILE B  1 151 ? -55.182  26.504  -59.620  1.00 16.24  ? 151  ILE B CG1   1 
ATOM   4815  C  CG2   . ILE B  1 151 ? -53.149  26.018  -60.891  1.00 13.44  ? 151  ILE B CG2   1 
ATOM   4816  C  CD1   . ILE B  1 151 ? -55.077  27.964  -59.611  1.00 14.69  ? 151  ILE B CD1   1 
ATOM   4817  N  N     . ASP B  1 152 ? -52.309  23.121  -60.426  1.00 23.05  ? 152  ASP B N     1 
ATOM   4818  C  CA    . ASP B  1 152 ? -50.991  22.572  -60.613  1.00 25.19  ? 152  ASP B CA    1 
ATOM   4819  C  C     . ASP B  1 152 ? -50.582  22.503  -62.074  1.00 30.13  ? 152  ASP B C     1 
ATOM   4820  O  O     . ASP B  1 152 ? -51.385  22.185  -62.956  1.00 27.87  ? 152  ASP B O     1 
ATOM   4821  C  CB    . ASP B  1 152 ? -50.852  21.207  -59.946  1.00 14.02  ? 152  ASP B CB    1 
ATOM   4822  C  CG    . ASP B  1 152 ? -49.408  20.883  -59.578  1.00 30.72  ? 152  ASP B CG    1 
ATOM   4823  O  OD1   . ASP B  1 152 ? -48.579  21.818  -59.456  1.00 32.34  ? 152  ASP B OD1   1 
ATOM   4824  O  OD2   . ASP B  1 152 ? -49.103  19.692  -59.393  1.00 36.26  ? 152  ASP B OD2   1 
ATOM   4825  N  N     . ASP B  1 153 ? -49.344  22.915  -62.317  1.00 18.83  ? 153  ASP B N     1 
ATOM   4826  C  CA    . ASP B  1 153 ? -48.756  22.883  -63.635  1.00 28.87  ? 153  ASP B CA    1 
ATOM   4827  C  C     . ASP B  1 153 ? -47.249  22.763  -63.539  1.00 29.46  ? 153  ASP B C     1 
ATOM   4828  O  O     . ASP B  1 153 ? -46.627  23.241  -62.592  1.00 31.18  ? 153  ASP B O     1 
ATOM   4829  C  CB    . ASP B  1 153 ? -49.110  24.114  -64.453  1.00 28.91  ? 153  ASP B CB    1 
ATOM   4830  C  CG    . ASP B  1 153 ? -48.621  24.002  -65.881  1.00 29.50  ? 153  ASP B CG    1 
ATOM   4831  O  OD1   . ASP B  1 153 ? -49.138  23.130  -66.612  1.00 31.84  ? 153  ASP B OD1   1 
ATOM   4832  O  OD2   . ASP B  1 153 ? -47.691  24.745  -66.256  1.00 23.30  ? 153  ASP B OD2   1 
ATOM   4833  N  N     . ILE B  1 154 ? -46.682  22.133  -64.556  1.00 24.95  ? 154  ILE B N     1 
ATOM   4834  C  CA    . ILE B  1 154 ? -45.256  21.896  -64.677  1.00 21.86  ? 154  ILE B CA    1 
ATOM   4835  C  C     . ILE B  1 154 ? -44.460  23.210  -64.594  1.00 31.23  ? 154  ILE B C     1 
ATOM   4836  O  O     . ILE B  1 154 ? -43.314  23.211  -64.127  1.00 31.20  ? 154  ILE B O     1 
ATOM   4837  C  CB    . ILE B  1 154 ? -44.978  21.110  -66.014  1.00 30.90  ? 154  ILE B CB    1 
ATOM   4838  C  CG1   . ILE B  1 154 ? -43.562  20.539  -66.052  1.00 29.85  ? 154  ILE B CG1   1 
ATOM   4839  C  CG2   . ILE B  1 154 ? -45.286  21.964  -67.230  1.00 18.76  ? 154  ILE B CG2   1 
ATOM   4840  C  CD1   . ILE B  1 154 ? -43.411  19.231  -65.280  1.00 39.96  ? 154  ILE B CD1   1 
ATOM   4841  N  N     . GLU B  1 155 ? -45.085  24.324  -64.988  1.00 20.61  ? 155  GLU B N     1 
ATOM   4842  C  CA    . GLU B  1 155 ? -44.431  25.638  -64.953  1.00 20.09  ? 155  GLU B CA    1 
ATOM   4843  C  C     . GLU B  1 155 ? -44.575  26.366  -63.629  1.00 16.92  ? 155  GLU B C     1 
ATOM   4844  O  O     . GLU B  1 155 ? -43.875  27.341  -63.387  1.00 35.70  ? 155  GLU B O     1 
ATOM   4845  C  CB    . GLU B  1 155 ? -44.971  26.558  -66.046  1.00 21.55  ? 155  GLU B CB    1 
ATOM   4846  C  CG    . GLU B  1 155 ? -44.602  26.177  -67.474  1.00 17.34  ? 155  GLU B CG    1 
ATOM   4847  C  CD    . GLU B  1 155 ? -44.932  27.280  -68.450  1.00 37.81  ? 155  GLU B CD    1 
ATOM   4848  O  OE1   . GLU B  1 155 ? -45.432  28.324  -67.988  1.00 32.67  ? 155  GLU B OE1   1 
ATOM   4849  O  OE2   . GLU B  1 155 ? -44.697  27.112  -69.667  1.00 30.00  ? 155  GLU B OE2   1 
ATOM   4850  N  N     . GLY B  1 156 ? -45.510  25.921  -62.798  1.00 27.90  ? 156  GLY B N     1 
ATOM   4851  C  CA    . GLY B  1 156 ? -45.740  26.559  -61.513  1.00 23.57  ? 156  GLY B CA    1 
ATOM   4852  C  C     . GLY B  1 156 ? -44.469  26.699  -60.717  1.00 19.35  ? 156  GLY B C     1 
ATOM   4853  O  O     . GLY B  1 156 ? -43.797  25.715  -60.451  1.00 30.11  ? 156  GLY B O     1 
ATOM   4854  N  N     . ALA B  1 157 ? -44.141  27.925  -60.329  1.00 35.26  ? 157  ALA B N     1 
ATOM   4855  C  CA    . ALA B  1 157 ? -42.921  28.193  -59.582  1.00 31.40  ? 157  ALA B CA    1 
ATOM   4856  C  C     . ALA B  1 157 ? -42.807  27.378  -58.300  1.00 36.88  ? 157  ALA B C     1 
ATOM   4857  O  O     . ALA B  1 157 ? -41.702  27.092  -57.827  1.00 32.17  ? 157  ALA B O     1 
ATOM   4858  C  CB    . ALA B  1 157 ? -42.829  29.652  -59.282  1.00 14.23  ? 157  ALA B CB    1 
ATOM   4859  N  N     . TRP B  1 158 ? -43.961  27.000  -57.753  1.00 32.57  ? 158  TRP B N     1 
ATOM   4860  C  CA    . TRP B  1 158 ? -44.023  26.213  -56.526  1.00 23.00  ? 158  TRP B CA    1 
ATOM   4861  C  C     . TRP B  1 158 ? -43.487  24.804  -56.694  1.00 25.21  ? 158  TRP B C     1 
ATOM   4862  O  O     . TRP B  1 158 ? -43.225  24.122  -55.699  1.00 41.26  ? 158  TRP B O     1 
ATOM   4863  C  CB    . TRP B  1 158 ? -45.456  26.145  -55.990  1.00 24.26  ? 158  TRP B CB    1 
ATOM   4864  C  CG    . TRP B  1 158 ? -46.472  25.638  -56.978  1.00 26.64  ? 158  TRP B CG    1 
ATOM   4865  C  CD1   . TRP B  1 158 ? -46.796  24.333  -57.238  1.00 23.44  ? 158  TRP B CD1   1 
ATOM   4866  C  CD2   . TRP B  1 158 ? -47.306  26.435  -57.828  1.00 34.58  ? 158  TRP B CD2   1 
ATOM   4867  N  NE1   . TRP B  1 158 ? -47.784  24.269  -58.199  1.00 26.42  ? 158  TRP B NE1   1 
ATOM   4868  C  CE2   . TRP B  1 158 ? -48.117  25.545  -58.578  1.00 32.89  ? 158  TRP B CE2   1 
ATOM   4869  C  CE3   . TRP B  1 158 ? -47.450  27.818  -58.029  1.00 26.94  ? 158  TRP B CE3   1 
ATOM   4870  C  CZ2   . TRP B  1 158 ? -49.062  25.996  -59.515  1.00 25.64  ? 158  TRP B CZ2   1 
ATOM   4871  C  CZ3   . TRP B  1 158 ? -48.393  28.267  -58.963  1.00 29.00  ? 158  TRP B CZ3   1 
ATOM   4872  C  CH2   . TRP B  1 158 ? -49.184  27.354  -59.692  1.00 20.64  ? 158  TRP B CH2   1 
ATOM   4873  N  N     . ASN B  1 159 ? -43.335  24.372  -57.946  1.00 24.48  ? 159  ASN B N     1 
ATOM   4874  C  CA    . ASN B  1 159 ? -42.831  23.032  -58.253  1.00 25.31  ? 159  ASN B CA    1 
ATOM   4875  C  C     . ASN B  1 159 ? -41.309  22.931  -58.327  1.00 29.29  ? 159  ASN B C     1 
ATOM   4876  O  O     . ASN B  1 159 ? -40.756  21.862  -58.603  1.00 27.96  ? 159  ASN B O     1 
ATOM   4877  C  CB    . ASN B  1 159 ? -43.467  22.483  -59.531  1.00 28.20  ? 159  ASN B CB    1 
ATOM   4878  C  CG    . ASN B  1 159 ? -44.856  21.896  -59.295  1.00 31.96  ? 159  ASN B CG    1 
ATOM   4879  O  OD1   . ASN B  1 159 ? -45.062  21.117  -58.364  1.00 46.08  ? 159  ASN B OD1   1 
ATOM   4880  N  ND2   . ASN B  1 159 ? -45.811  22.256  -60.151  1.00 38.57  ? 159  ASN B ND2   1 
ATOM   4881  N  N     . SER B  1 160 ? -40.632  24.035  -58.034  1.00 31.60  ? 160  SER B N     1 
ATOM   4882  C  CA    . SER B  1 160 ? -39.176  24.067  -58.046  1.00 29.84  ? 160  SER B CA    1 
ATOM   4883  C  C     . SER B  1 160 ? -38.635  23.045  -57.036  1.00 30.15  ? 160  SER B C     1 
ATOM   4884  O  O     . SER B  1 160 ? -37.511  22.557  -57.157  1.00 31.73  ? 160  SER B O     1 
ATOM   4885  C  CB    . SER B  1 160 ? -38.696  25.470  -57.675  1.00 25.85  ? 160  SER B CB    1 
ATOM   4886  O  OG    . SER B  1 160 ? -39.143  25.836  -56.377  1.00 34.48  ? 160  SER B OG    1 
ATOM   4887  N  N     . SER B  1 161 ? -39.470  22.705  -56.061  1.00 23.57  ? 161  SER B N     1 
ATOM   4888  C  CA    . SER B  1 161 ? -39.126  21.763  -55.003  1.00 34.90  ? 161  SER B CA    1 
ATOM   4889  C  C     . SER B  1 161 ? -39.731  20.367  -55.160  1.00 35.34  ? 161  SER B C     1 
ATOM   4890  O  O     . SER B  1 161 ? -39.365  19.443  -54.429  1.00 33.88  ? 161  SER B O     1 
ATOM   4891  C  CB    . SER B  1 161 ? -39.565  22.339  -53.655  1.00 26.06  ? 161  SER B CB    1 
ATOM   4892  O  OG    . SER B  1 161 ? -40.947  22.663  -53.661  1.00 30.42  ? 161  SER B OG    1 
ATOM   4893  N  N     . THR B  1 162 ? -40.640  20.217  -56.117  1.00 24.37  ? 162  THR B N     1 
ATOM   4894  C  CA    . THR B  1 162 ? -41.330  18.951  -56.352  1.00 14.36  ? 162  THR B CA    1 
ATOM   4895  C  C     . THR B  1 162 ? -40.489  17.800  -56.899  1.00 24.43  ? 162  THR B C     1 
ATOM   4896  O  O     . THR B  1 162 ? -39.633  17.997  -57.764  1.00 38.17  ? 162  THR B O     1 
ATOM   4897  C  CB    . THR B  1 162 ? -42.535  19.171  -57.281  1.00 21.08  ? 162  THR B CB    1 
ATOM   4898  O  OG1   . THR B  1 162 ? -43.449  20.070  -56.649  1.00 26.37  ? 162  THR B OG1   1 
ATOM   4899  C  CG2   . THR B  1 162 ? -43.244  17.858  -57.594  1.00 13.45  ? 162  THR B CG2   1 
ATOM   4900  N  N     . LYS B  1 163 ? -40.727  16.599  -56.368  1.00 24.48  ? 163  LYS B N     1 
ATOM   4901  C  CA    . LYS B  1 163 ? -40.026  15.408  -56.829  1.00 28.07  ? 163  LYS B CA    1 
ATOM   4902  C  C     . LYS B  1 163 ? -40.825  14.862  -58.004  1.00 30.79  ? 163  LYS B C     1 
ATOM   4903  O  O     . LYS B  1 163 ? -42.051  14.757  -57.936  1.00 37.04  ? 163  LYS B O     1 
ATOM   4904  C  CB    . LYS B  1 163 ? -39.926  14.347  -55.731  1.00 23.34  ? 163  LYS B CB    1 
ATOM   4905  C  CG    . LYS B  1 163 ? -39.067  14.742  -54.556  1.00 33.93  ? 163  LYS B CG    1 
ATOM   4906  C  CD    . LYS B  1 163 ? -38.699  13.539  -53.721  1.00 48.54  ? 163  LYS B CD    1 
ATOM   4907  C  CE    . LYS B  1 163 ? -38.318  13.965  -52.310  1.00 60.77  ? 163  LYS B CE    1 
ATOM   4908  N  NZ    . LYS B  1 163 ? -37.652  12.859  -51.576  1.00 56.75  ? 163  LYS B NZ    1 
ATOM   4909  N  N     . TYR B  1 164 ? -40.158  14.623  -59.109  1.00 31.60  ? 164  TYR B N     1 
ATOM   4910  C  CA    . TYR B  1 164 ? -40.845  14.152  -60.298  1.00 32.58  ? 164  TYR B CA    1 
ATOM   4911  C  C     . TYR B  1 164 ? -40.359  12.787  -60.615  1.00 38.02  ? 164  TYR B C     1 
ATOM   4912  O  O     . TYR B  1 164 ? -39.255  12.448  -60.206  1.00 39.09  ? 164  TYR B O     1 
ATOM   4913  C  CB    . TYR B  1 164 ? -40.577  15.056  -61.498  1.00 16.33  ? 164  TYR B CB    1 
ATOM   4914  C  CG    . TYR B  1 164 ? -41.449  16.287  -61.483  1.00 27.17  ? 164  TYR B CG    1 
ATOM   4915  C  CD1   . TYR B  1 164 ? -42.653  16.299  -62.154  1.00 36.72  ? 164  TYR B CD1   1 
ATOM   4916  C  CD2   . TYR B  1 164 ? -41.021  17.400  -60.796  1.00 26.56  ? 164  TYR B CD2   1 
ATOM   4917  C  CE1   . TYR B  1 164 ? -43.430  17.415  -62.145  1.00 43.16  ? 164  TYR B CE1   1 
ATOM   4918  C  CE2   . TYR B  1 164 ? -41.794  18.525  -60.781  1.00 36.59  ? 164  TYR B CE2   1 
ATOM   4919  C  CZ    . TYR B  1 164 ? -43.004  18.537  -61.459  1.00 33.99  ? 164  TYR B CZ    1 
ATOM   4920  O  OH    . TYR B  1 164 ? -43.774  19.678  -61.453  1.00 44.25  ? 164  TYR B OH    1 
ATOM   4921  N  N     . GLU B  1 165 ? -41.093  11.963  -61.334  1.00 50.82  ? 165  GLU B N     1 
ATOM   4922  C  CA    . GLU B  1 165 ? -40.548  10.649  -61.427  1.00 56.06  ? 165  GLU B CA    1 
ATOM   4923  C  C     . GLU B  1 165 ? -39.378  10.483  -62.358  1.00 53.89  ? 165  GLU B C     1 
ATOM   4924  O  O     . GLU B  1 165 ? -38.721  9.458   -62.305  1.00 54.52  ? 165  GLU B O     1 
ATOM   4925  C  CB    . GLU B  1 165 ? -41.668  9.630   -61.655  1.00 84.70  ? 165  GLU B CB    1 
ATOM   4926  C  CG    . GLU B  1 165 ? -42.187  9.437   -63.058  1.00 99.02  ? 165  GLU B CG    1 
ATOM   4927  C  CD    . GLU B  1 165 ? -43.334  8.431   -63.122  1.00 100.00 ? 165  GLU B CD    1 
ATOM   4928  O  OE1   . GLU B  1 165 ? -43.770  7.918   -62.071  1.00 100.00 ? 165  GLU B OE1   1 
ATOM   4929  O  OE2   . GLU B  1 165 ? -43.802  8.171   -64.250  1.00 100.00 ? 165  GLU B OE2   1 
ATOM   4930  N  N     . GLY B  1 166 ? -39.066  11.424  -63.196  1.00 31.55  ? 166  GLY B N     1 
ATOM   4931  C  CA    . GLY B  1 166 ? -37.881  11.238  -63.981  1.00 29.95  ? 166  GLY B CA    1 
ATOM   4932  C  C     . GLY B  1 166 ? -36.895  12.322  -63.599  1.00 37.98  ? 166  GLY B C     1 
ATOM   4933  O  O     . GLY B  1 166 ? -35.926  12.581  -64.315  1.00 39.59  ? 166  GLY B O     1 
ATOM   4934  N  N     . GLY B  1 167 ? -37.114  12.963  -62.441  1.00 42.56  ? 167  GLY B N     1 
ATOM   4935  C  CA    . GLY B  1 167 ? -36.278  14.077  -62.050  1.00 29.12  ? 167  GLY B CA    1 
ATOM   4936  C  C     . GLY B  1 167 ? -36.922  15.407  -62.387  1.00 38.84  ? 167  GLY B C     1 
ATOM   4937  O  O     . GLY B  1 167 ? -37.636  15.536  -63.384  1.00 32.12  ? 167  GLY B O     1 
ATOM   4938  N  N     . ASN B  1 168 ? -36.700  16.389  -61.520  1.00 28.74  ? 168  ASN B N     1 
ATOM   4939  C  CA    . ASN B  1 168 ? -37.232  17.730  -61.708  1.00 31.86  ? 168  ASN B CA    1 
ATOM   4940  C  C     . ASN B  1 168 ? -36.212  18.406  -62.618  1.00 26.04  ? 168  ASN B C     1 
ATOM   4941  O  O     . ASN B  1 168 ? -35.027  18.467  -62.284  1.00 32.37  ? 168  ASN B O     1 
ATOM   4942  C  CB    . ASN B  1 168 ? -37.331  18.449  -60.348  1.00 19.63  ? 168  ASN B CB    1 
ATOM   4943  C  CG    . ASN B  1 168 ? -38.067  19.779  -60.435  1.00 33.08  ? 168  ASN B CG    1 
ATOM   4944  O  OD1   . ASN B  1 168 ? -37.969  20.510  -61.429  1.00 29.49  ? 168  ASN B OD1   1 
ATOM   4945  N  ND2   . ASN B  1 168 ? -38.813  20.098  -59.392  1.00 30.78  ? 168  ASN B ND2   1 
ATOM   4946  N  N     . LYS B  1 169 ? -36.677  18.905  -63.781  1.00 23.36  ? 169  LYS B N     1 
ATOM   4947  C  CA    . LYS B  1 169 ? -35.752  19.535  -64.718  1.00 33.28  ? 169  LYS B CA    1 
ATOM   4948  C  C     . LYS B  1 169 ? -35.446  20.973  -64.377  1.00 33.61  ? 169  LYS B C     1 
ATOM   4949  O  O     . LYS B  1 169 ? -34.420  21.540  -64.777  1.00 50.33  ? 169  LYS B O     1 
ATOM   4950  C  CB    . LYS B  1 169 ? -36.215  19.191  -66.139  1.00 18.92  ? 169  LYS B CB    1 
ATOM   4951  C  CG    . LYS B  1 169 ? -36.403  17.676  -66.374  1.00 13.21  ? 169  LYS B CG    1 
ATOM   4952  C  CD    . LYS B  1 169 ? -35.161  16.828  -66.068  1.00 21.41  ? 169  LYS B CD    1 
ATOM   4953  C  CE    . LYS B  1 169 ? -35.398  15.334  -66.319  1.00 21.79  ? 169  LYS B CE    1 
ATOM   4954  N  NZ    . LYS B  1 169 ? -34.278  14.499  -65.791  1.00 25.39  ? 169  LYS B NZ    1 
ATOM   4955  N  N     . GLY B  1 170 ? -36.349  21.575  -63.612  1.00 39.30  ? 170  GLY B N     1 
ATOM   4956  C  CA    . GLY B  1 170 ? -36.142  22.880  -63.007  1.00 39.79  ? 170  GLY B CA    1 
ATOM   4957  C  C     . GLY B  1 170 ? -36.145  24.157  -63.855  1.00 45.70  ? 170  GLY B C     1 
ATOM   4958  O  O     . GLY B  1 170 ? -35.829  25.208  -63.297  1.00 64.07  ? 170  GLY B O     1 
ATOM   4959  N  N     . HIS B  1 171 ? -36.463  24.166  -65.154  1.00 35.71  ? 171  HIS B N     1 
ATOM   4960  C  CA    . HIS B  1 171 ? -36.482  25.486  -65.786  1.00 28.02  ? 171  HIS B CA    1 
ATOM   4961  C  C     . HIS B  1 171 ? -37.886  26.029  -65.889  1.00 39.58  ? 171  HIS B C     1 
ATOM   4962  O  O     . HIS B  1 171 ? -38.607  25.735  -66.851  1.00 56.70  ? 171  HIS B O     1 
ATOM   4963  C  CB    . HIS B  1 171 ? -35.824  25.458  -67.157  1.00 34.23  ? 171  HIS B CB    1 
ATOM   4964  C  CG    . HIS B  1 171 ? -34.302  25.232  -67.072  1.00 17.76  ? 171  HIS B CG    1 
ATOM   4965  N  ND1   . HIS B  1 171 ? -33.447  26.148  -66.497  1.00 31.55  ? 171  HIS B ND1   1 
ATOM   4966  C  CD2   . HIS B  1 171 ? -33.528  24.193  -67.469  1.00 29.07  ? 171  HIS B CD2   1 
ATOM   4967  C  CE1   . HIS B  1 171 ? -32.211  25.682  -66.510  1.00 27.60  ? 171  HIS B CE1   1 
ATOM   4968  N  NE2   . HIS B  1 171 ? -32.232  24.496  -67.094  1.00 30.46  ? 171  HIS B NE2   1 
ATOM   4969  N  N     . ARG B  1 172 ? -38.301  26.825  -64.913  1.00 26.96  ? 172  ARG B N     1 
ATOM   4970  C  CA    . ARG B  1 172 ? -39.640  27.358  -64.933  1.00 30.39  ? 172  ARG B CA    1 
ATOM   4971  C  C     . ARG B  1 172 ? -39.711  28.823  -64.597  1.00 36.25  ? 172  ARG B C     1 
ATOM   4972  O  O     . ARG B  1 172 ? -38.844  29.372  -63.914  1.00 43.32  ? 172  ARG B O     1 
ATOM   4973  C  CB    . ARG B  1 172 ? -40.595  26.536  -64.052  1.00 27.72  ? 172  ARG B CB    1 
ATOM   4974  C  CG    . ARG B  1 172 ? -40.050  26.049  -62.738  1.00 24.76  ? 172  ARG B CG    1 
ATOM   4975  C  CD    . ARG B  1 172 ? -41.081  25.197  -61.994  1.00 34.41  ? 172  ARG B CD    1 
ATOM   4976  N  NE    . ARG B  1 172 ? -41.280  23.803  -62.441  1.00 14.85  ? 172  ARG B NE    1 
ATOM   4977  C  CZ    . ARG B  1 172 ? -40.447  22.790  -62.185  1.00 33.24  ? 172  ARG B CZ    1 
ATOM   4978  N  NH1   . ARG B  1 172 ? -40.747  21.559  -62.587  1.00 19.71  ? 172  ARG B NH1   1 
ATOM   4979  N  NH2   . ARG B  1 172 ? -39.258  23.019  -61.635  1.00 16.30  ? 172  ARG B NH2   1 
ATOM   4980  N  N     . PRO B  1 173 ? -40.739  29.490  -65.131  1.00 32.73  ? 173  PRO B N     1 
ATOM   4981  C  CA    . PRO B  1 173 ? -40.967  30.913  -64.915  1.00 29.73  ? 173  PRO B CA    1 
ATOM   4982  C  C     . PRO B  1 173 ? -41.350  31.210  -63.469  1.00 41.10  ? 173  PRO B C     1 
ATOM   4983  O  O     . PRO B  1 173 ? -42.236  30.550  -62.904  1.00 38.99  ? 173  PRO B O     1 
ATOM   4984  C  CB    . PRO B  1 173 ? -42.126  31.207  -65.877  1.00 26.27  ? 173  PRO B CB    1 
ATOM   4985  C  CG    . PRO B  1 173 ? -42.902  29.933  -65.885  1.00 29.10  ? 173  PRO B CG    1 
ATOM   4986  C  CD    . PRO B  1 173 ? -41.798  28.908  -65.985  1.00 27.24  ? 173  PRO B CD    1 
ATOM   4987  N  N     . GLY B  1 174 ? -40.646  32.161  -62.858  1.00 39.05  ? 174  GLY B N     1 
ATOM   4988  C  CA    . GLY B  1 174 ? -40.973  32.556  -61.496  1.00 40.69  ? 174  GLY B CA    1 
ATOM   4989  C  C     . GLY B  1 174 ? -42.265  33.383  -61.486  1.00 45.08  ? 174  GLY B C     1 
ATOM   4990  O  O     . GLY B  1 174 ? -42.859  33.648  -62.540  1.00 43.03  ? 174  GLY B O     1 
ATOM   4991  N  N     . VAL B  1 175 ? -42.720  33.788  -60.304  1.00 48.60  ? 175  VAL B N     1 
ATOM   4992  C  CA    . VAL B  1 175 ? -43.944  34.584  -60.184  1.00 44.60  ? 175  VAL B CA    1 
ATOM   4993  C  C     . VAL B  1 175 ? -43.778  35.888  -60.972  1.00 49.59  ? 175  VAL B C     1 
ATOM   4994  O  O     . VAL B  1 175 ? -42.774  36.589  -60.804  1.00 55.36  ? 175  VAL B O     1 
ATOM   4995  C  CB    . VAL B  1 175 ? -44.252  34.883  -58.690  1.00 44.80  ? 175  VAL B CB    1 
ATOM   4996  C  CG1   . VAL B  1 175 ? -45.507  35.735  -58.547  1.00 31.62  ? 175  VAL B CG1   1 
ATOM   4997  C  CG2   . VAL B  1 175 ? -44.433  33.581  -57.937  1.00 36.46  ? 175  VAL B CG2   1 
ATOM   4998  N  N     . LYS B  1 176 ? -44.744  36.181  -61.847  1.00 47.13  ? 176  LYS B N     1 
ATOM   4999  C  CA    . LYS B  1 176 ? -44.722  37.384  -62.697  1.00 48.27  ? 176  LYS B CA    1 
ATOM   5000  C  C     . LYS B  1 176 ? -43.509  37.395  -63.648  1.00 47.79  ? 176  LYS B C     1 
ATOM   5001  O  O     . LYS B  1 176 ? -43.192  38.430  -64.234  1.00 40.91  ? 176  LYS B O     1 
ATOM   5002  C  CB    . LYS B  1 176 ? -44.698  38.681  -61.854  1.00 45.95  ? 176  LYS B CB    1 
ATOM   5003  C  CG    . LYS B  1 176 ? -46.027  39.169  -61.266  1.00 53.04  ? 176  LYS B CG    1 
ATOM   5004  C  CD    . LYS B  1 176 ? -45.838  40.557  -60.629  1.00 72.52  ? 176  LYS B CD    1 
ATOM   5005  C  CE    . LYS B  1 176 ? -47.142  41.186  -60.122  1.00 100.00 ? 176  LYS B CE    1 
ATOM   5006  N  NZ    . LYS B  1 176 ? -47.613  40.624  -58.820  1.00 97.77  ? 176  LYS B NZ    1 
ATOM   5007  N  N     . GLY B  1 177 ? -42.863  36.248  -63.841  1.00 40.92  ? 177  GLY B N     1 
ATOM   5008  C  CA    . GLY B  1 177 ? -41.680  36.218  -64.689  1.00 52.09  ? 177  GLY B CA    1 
ATOM   5009  C  C     . GLY B  1 177 ? -41.755  35.395  -65.954  1.00 53.17  ? 177  GLY B C     1 
ATOM   5010  O  O     . GLY B  1 177 ? -40.723  35.018  -66.535  1.00 46.65  ? 177  GLY B O     1 
ATOM   5011  N  N     . GLY B  1 178 ? -42.955  34.980  -66.377  1.00 37.96  ? 178  GLY B N     1 
ATOM   5012  C  CA    . GLY B  1 178 ? -43.049  34.069  -67.506  1.00 62.64  ? 178  GLY B CA    1 
ATOM   5013  C  C     . GLY B  1 178 ? -43.040  34.817  -68.787  1.00 59.04  ? 178  GLY B C     1 
ATOM   5014  O  O     . GLY B  1 178 ? -43.425  34.337  -69.854  1.00 66.01  ? 178  GLY B O     1 
ATOM   5015  N  N     . TYR B  1 179 ? -42.574  36.009  -68.629  0.93 56.62  ? 179  TYR B N     1 
ATOM   5016  C  CA    . TYR B  1 179 ? -42.628  36.793  -69.820  0.93 34.36  ? 179  TYR B CA    1 
ATOM   5017  C  C     . TYR B  1 179 ? -41.406  36.690  -70.644  0.39 41.24  ? 179  TYR B C     1 
ATOM   5018  O  O     . TYR B  1 179 ? -40.322  37.146  -70.316  0.93 42.02  ? 179  TYR B O     1 
ATOM   5019  C  CB    . TYR B  1 179 ? -43.010  38.192  -69.495  0.39 42.39  ? 179  TYR B CB    1 
ATOM   5020  C  CG    . TYR B  1 179 ? -43.997  38.720  -70.494  0.39 44.86  ? 179  TYR B CG    1 
ATOM   5021  C  CD1   . TYR B  1 179 ? -45.000  37.945  -71.120  0.39 60.55  ? 179  TYR B CD1   1 
ATOM   5022  C  CD2   . TYR B  1 179 ? -43.912  40.055  -70.838  0.39 52.21  ? 179  TYR B CD2   1 
ATOM   5023  C  CE1   . TYR B  1 179 ? -45.883  38.503  -72.028  0.39 78.68  ? 179  TYR B CE1   1 
ATOM   5024  C  CE2   . TYR B  1 179 ? -44.795  40.629  -71.746  0.39 64.92  ? 179  TYR B CE2   1 
ATOM   5025  C  CZ    . TYR B  1 179 ? -45.770  39.840  -72.323  0.39 68.46  ? 179  TYR B CZ    1 
ATOM   5026  O  OH    . TYR B  1 179 ? -46.631  40.398  -73.227  0.39 86.06  ? 179  TYR B OH    1 
ATOM   5027  N  N     . PHE B  1 180 ? -41.684  36.050  -71.744  1.00 55.29  ? 180  PHE B N     1 
ATOM   5028  C  CA    . PHE B  1 180 ? -40.762  35.839  -72.822  1.00 42.44  ? 180  PHE B CA    1 
ATOM   5029  C  C     . PHE B  1 180 ? -39.507  35.025  -72.489  1.00 41.55  ? 180  PHE B C     1 
ATOM   5030  O  O     . PHE B  1 180 ? -38.677  34.922  -73.382  1.00 52.43  ? 180  PHE B O     1 
ATOM   5031  C  CB    . PHE B  1 180 ? -40.411  37.171  -73.456  1.00 61.64  ? 180  PHE B CB    1 
ATOM   5032  C  CG    . PHE B  1 180 ? -41.628  37.749  -74.112  1.00 68.06  ? 180  PHE B CG    1 
ATOM   5033  C  CD1   . PHE B  1 180 ? -42.870  37.180  -73.894  1.00 63.64  ? 180  PHE B CD1   1 
ATOM   5034  C  CD2   . PHE B  1 180 ? -41.536  38.856  -74.916  1.00 76.86  ? 180  PHE B CD2   1 
ATOM   5035  C  CE1   . PHE B  1 180 ? -44.015  37.733  -74.462  1.00 80.34  ? 180  PHE B CE1   1 
ATOM   5036  C  CE2   . PHE B  1 180 ? -42.655  39.435  -75.490  1.00 77.53  ? 180  PHE B CE2   1 
ATOM   5037  C  CZ    . PHE B  1 180 ? -43.888  38.860  -75.260  1.00 81.37  ? 180  PHE B CZ    1 
ATOM   5038  N  N     . PRO B  1 181 ? -39.267  34.424  -71.309  1.00 38.25  ? 181  PRO B N     1 
ATOM   5039  C  CA    . PRO B  1 181 ? -38.076  33.521  -71.348  1.00 38.13  ? 181  PRO B CA    1 
ATOM   5040  C  C     . PRO B  1 181 ? -38.171  32.511  -72.528  1.00 30.96  ? 181  PRO B C     1 
ATOM   5041  O  O     . PRO B  1 181 ? -39.264  32.033  -72.779  1.00 45.17  ? 181  PRO B O     1 
ATOM   5042  C  CB    . PRO B  1 181 ? -38.018  32.954  -69.953  1.00 31.65  ? 181  PRO B CB    1 
ATOM   5043  C  CG    . PRO B  1 181 ? -38.391  34.157  -69.138  1.00 57.71  ? 181  PRO B CG    1 
ATOM   5044  C  CD    . PRO B  1 181 ? -39.176  35.105  -70.021  1.00 58.55  ? 181  PRO B CD    1 
ATOM   5045  N  N     . VAL B  1 182 ? -37.082  32.183  -73.251  1.00 30.94  ? 182  VAL B N     1 
ATOM   5046  C  CA    . VAL B  1 182 ? -37.205  31.192  -74.364  1.00 35.77  ? 182  VAL B CA    1 
ATOM   5047  C  C     . VAL B  1 182 ? -37.282  29.787  -73.776  1.00 35.88  ? 182  VAL B C     1 
ATOM   5048  O  O     . VAL B  1 182 ? -36.940  29.613  -72.592  1.00 37.61  ? 182  VAL B O     1 
ATOM   5049  C  CB    . VAL B  1 182 ? -35.987  31.246  -75.350  1.00 26.99  ? 182  VAL B CB    1 
ATOM   5050  C  CG1   . VAL B  1 182 ? -36.045  32.499  -76.209  1.00 32.44  ? 182  VAL B CG1   1 
ATOM   5051  C  CG2   . VAL B  1 182 ? -34.669  31.175  -74.590  1.00 27.09  ? 182  VAL B CG2   1 
ATOM   5052  N  N     . PRO B  1 183 ? -37.710  28.777  -74.531  1.00 32.70  ? 183  PRO B N     1 
ATOM   5053  C  CA    . PRO B  1 183 ? -37.776  27.421  -73.973  1.00 32.79  ? 183  PRO B CA    1 
ATOM   5054  C  C     . PRO B  1 183 ? -36.367  27.007  -73.512  1.00 35.01  ? 183  PRO B C     1 
ATOM   5055  O  O     . PRO B  1 183 ? -35.365  27.497  -74.041  1.00 46.48  ? 183  PRO B O     1 
ATOM   5056  C  CB    . PRO B  1 183 ? -38.236  26.592  -75.174  1.00 37.54  ? 183  PRO B CB    1 
ATOM   5057  C  CG    . PRO B  1 183 ? -39.151  27.524  -75.879  1.00 22.77  ? 183  PRO B CG    1 
ATOM   5058  C  CD    . PRO B  1 183 ? -38.361  28.826  -75.852  1.00 21.84  ? 183  PRO B CD    1 
ATOM   5059  N  N     . PRO B  1 184 ? -36.263  26.070  -72.560  1.00 39.78  ? 184  PRO B N     1 
ATOM   5060  C  CA    . PRO B  1 184 ? -37.290  25.310  -71.841  1.00 31.19  ? 184  PRO B CA    1 
ATOM   5061  C  C     . PRO B  1 184 ? -38.093  25.979  -70.718  1.00 27.76  ? 184  PRO B C     1 
ATOM   5062  O  O     . PRO B  1 184 ? -38.977  25.339  -70.144  1.00 44.50  ? 184  PRO B O     1 
ATOM   5063  C  CB    . PRO B  1 184 ? -36.508  24.111  -71.331  1.00 33.68  ? 184  PRO B CB    1 
ATOM   5064  C  CG    . PRO B  1 184 ? -35.194  24.703  -71.012  1.00 23.73  ? 184  PRO B CG    1 
ATOM   5065  C  CD    . PRO B  1 184 ? -34.915  25.603  -72.183  1.00 35.23  ? 184  PRO B CD    1 
ATOM   5066  N  N     . VAL B  1 185 ? -37.789  27.238  -70.393  1.00 22.71  ? 185  VAL B N     1 
ATOM   5067  C  CA    . VAL B  1 185 ? -38.527  27.967  -69.355  1.00 19.65  ? 185  VAL B CA    1 
ATOM   5068  C  C     . VAL B  1 185 ? -39.971  28.101  -69.825  1.00 25.17  ? 185  VAL B C     1 
ATOM   5069  O  O     . VAL B  1 185 ? -40.911  27.905  -69.053  1.00 36.52  ? 185  VAL B O     1 
ATOM   5070  C  CB    . VAL B  1 185 ? -37.918  29.362  -69.081  1.00 16.02  ? 185  VAL B CB    1 
ATOM   5071  C  CG1   . VAL B  1 185 ? -38.748  30.111  -68.063  1.00 7.23   ? 185  VAL B CG1   1 
ATOM   5072  C  CG2   . VAL B  1 185 ? -36.515  29.206  -68.529  1.00 13.25  ? 185  VAL B CG2   1 
ATOM   5073  N  N     . ASP B  1 186 ? -40.131  28.456  -71.095  1.00 31.72  ? 186  ASP B N     1 
ATOM   5074  C  CA    . ASP B  1 186 ? -41.449  28.562  -71.719  1.00 28.38  ? 186  ASP B CA    1 
ATOM   5075  C  C     . ASP B  1 186 ? -41.673  27.164  -72.274  1.00 34.42  ? 186  ASP B C     1 
ATOM   5076  O  O     . ASP B  1 186 ? -41.017  26.748  -73.233  1.00 33.55  ? 186  ASP B O     1 
ATOM   5077  C  CB    . ASP B  1 186 ? -41.430  29.593  -72.857  1.00 25.27  ? 186  ASP B CB    1 
ATOM   5078  C  CG    . ASP B  1 186 ? -42.671  29.539  -73.739  1.00 20.40  ? 186  ASP B CG    1 
ATOM   5079  O  OD1   . ASP B  1 186 ? -42.631  30.162  -74.816  1.00 29.51  ? 186  ASP B OD1   1 
ATOM   5080  O  OD2   . ASP B  1 186 ? -43.674  28.874  -73.387  1.00 30.37  ? 186  ASP B OD2   1 
ATOM   5081  N  N     . SER B  1 187 ? -42.616  26.447  -71.684  1.00 32.04  ? 187  SER B N     1 
ATOM   5082  C  CA    . SER B  1 187 ? -42.877  25.083  -72.107  1.00 21.93  ? 187  SER B CA    1 
ATOM   5083  C  C     . SER B  1 187 ? -43.979  24.961  -73.123  1.00 29.05  ? 187  SER B C     1 
ATOM   5084  O  O     . SER B  1 187 ? -44.320  23.842  -73.507  1.00 28.15  ? 187  SER B O     1 
ATOM   5085  C  CB    . SER B  1 187 ? -43.284  24.261  -70.898  1.00 28.29  ? 187  SER B CB    1 
ATOM   5086  O  OG    . SER B  1 187 ? -44.577  24.664  -70.474  1.00 21.00  ? 187  SER B OG    1 
ATOM   5087  N  N     . ALA B  1 188 ? -44.519  26.086  -73.585  1.00 19.22  ? 188  ALA B N     1 
ATOM   5088  C  CA    . ALA B  1 188 ? -45.642  26.012  -74.503  1.00 19.89  ? 188  ALA B CA    1 
ATOM   5089  C  C     . ALA B  1 188 ? -45.509  26.479  -75.955  1.00 24.94  ? 188  ALA B C     1 
ATOM   5090  O  O     . ALA B  1 188 ? -46.512  26.771  -76.609  1.00 30.25  ? 188  ALA B O     1 
ATOM   5091  C  CB    . ALA B  1 188 ? -46.833  26.650  -73.852  1.00 11.55  ? 188  ALA B CB    1 
ATOM   5092  N  N     . GLN B  1 189 ? -44.303  26.476  -76.498  1.00 22.79  ? 189  GLN B N     1 
ATOM   5093  C  CA    . GLN B  1 189 ? -44.150  26.920  -77.879  1.00 24.90  ? 189  GLN B CA    1 
ATOM   5094  C  C     . GLN B  1 189 ? -44.934  26.037  -78.844  1.00 21.80  ? 189  GLN B C     1 
ATOM   5095  O  O     . GLN B  1 189 ? -45.781  26.531  -79.579  1.00 30.51  ? 189  GLN B O     1 
ATOM   5096  C  CB    . GLN B  1 189 ? -42.683  26.972  -78.259  1.00 26.23  ? 189  GLN B CB    1 
ATOM   5097  C  CG    . GLN B  1 189 ? -42.417  27.479  -79.647  1.00 14.80  ? 189  GLN B CG    1 
ATOM   5098  C  CD    . GLN B  1 189 ? -42.756  28.929  -79.856  1.00 30.31  ? 189  GLN B CD    1 
ATOM   5099  O  OE1   . GLN B  1 189 ? -42.976  29.354  -80.986  1.00 37.57  ? 189  GLN B OE1   1 
ATOM   5100  N  NE2   . GLN B  1 189 ? -42.766  29.712  -78.781  1.00 20.07  ? 189  GLN B NE2   1 
ATOM   5101  N  N     . ASP B  1 190 ? -44.679  24.730  -78.813  1.00 30.46  ? 190  ASP B N     1 
ATOM   5102  C  CA    . ASP B  1 190 ? -45.380  23.804  -79.687  1.00 10.61  ? 190  ASP B CA    1 
ATOM   5103  C  C     . ASP B  1 190 ? -46.900  23.879  -79.497  1.00 26.38  ? 190  ASP B C     1 
ATOM   5104  O  O     . ASP B  1 190 ? -47.646  23.857  -80.478  1.00 25.31  ? 190  ASP B O     1 
ATOM   5105  C  CB    . ASP B  1 190 ? -44.907  22.347  -79.486  1.00 34.98  ? 190  ASP B CB    1 
ATOM   5106  C  CG    . ASP B  1 190 ? -43.456  22.106  -79.918  1.00 20.19  ? 190  ASP B CG    1 
ATOM   5107  O  OD1   . ASP B  1 190 ? -42.674  21.493  -79.158  1.00 69.33  ? 190  ASP B OD1   1 
ATOM   5108  O  OD2   . ASP B  1 190 ? -43.080  22.461  -81.043  1.00 37.68  ? 190  ASP B OD2   1 
ATOM   5109  N  N     . ILE B  1 191 ? -47.345  24.007  -78.246  1.00 34.73  ? 191  ILE B N     1 
ATOM   5110  C  CA    . ILE B  1 191 ? -48.776  24.071  -77.922  1.00 23.40  ? 191  ILE B CA    1 
ATOM   5111  C  C     . ILE B  1 191 ? -49.422  25.294  -78.544  1.00 28.63  ? 191  ILE B C     1 
ATOM   5112  O  O     . ILE B  1 191 ? -50.436  25.177  -79.224  1.00 34.01  ? 191  ILE B O     1 
ATOM   5113  C  CB    . ILE B  1 191 ? -49.021  24.077  -76.382  1.00 39.63  ? 191  ILE B CB    1 
ATOM   5114  C  CG1   . ILE B  1 191 ? -48.036  23.091  -75.716  1.00 63.36  ? 191  ILE B CG1   1 
ATOM   5115  C  CG2   . ILE B  1 191 ? -50.497  23.694  -76.065  1.00 16.31  ? 191  ILE B CG2   1 
ATOM   5116  C  CD1   . ILE B  1 191 ? -48.088  23.017  -74.188  1.00 58.84  ? 191  ILE B CD1   1 
ATOM   5117  N  N     . ARG B  1 192 ? -48.813  26.464  -78.343  1.00 36.86  ? 192  ARG B N     1 
ATOM   5118  C  CA    . ARG B  1 192 ? -49.345  27.711  -78.896  1.00 22.28  ? 192  ARG B CA    1 
ATOM   5119  C  C     . ARG B  1 192 ? -49.415  27.688  -80.426  1.00 30.93  ? 192  ARG B C     1 
ATOM   5120  O  O     . ARG B  1 192 ? -50.452  28.000  -81.018  1.00 40.45  ? 192  ARG B O     1 
ATOM   5121  C  CB    . ARG B  1 192 ? -48.556  28.930  -78.402  1.00 23.34  ? 192  ARG B CB    1 
ATOM   5122  C  CG    . ARG B  1 192 ? -48.729  29.229  -76.905  1.00 23.60  ? 192  ARG B CG    1 
ATOM   5123  C  CD    . ARG B  1 192 ? -48.211  30.623  -76.506  1.00 14.22  ? 192  ARG B CD    1 
ATOM   5124  N  NE    . ARG B  1 192 ? -46.837  30.854  -76.930  1.00 25.10  ? 192  ARG B NE    1 
ATOM   5125  C  CZ    . ARG B  1 192 ? -45.757  30.481  -76.248  1.00 26.00  ? 192  ARG B CZ    1 
ATOM   5126  N  NH1   . ARG B  1 192 ? -44.552  30.725  -76.734  1.00 33.36  ? 192  ARG B NH1   1 
ATOM   5127  N  NH2   . ARG B  1 192 ? -45.872  29.893  -75.073  1.00 35.70  ? 192  ARG B NH2   1 
ATOM   5128  N  N     . SER B  1 193 ? -48.338  27.279  -81.076  1.00 26.35  ? 193  SER B N     1 
ATOM   5129  C  CA    . SER B  1 193 ? -48.364  27.210  -82.528  1.00 16.71  ? 193  SER B CA    1 
ATOM   5130  C  C     . SER B  1 193 ? -49.412  26.278  -83.097  1.00 27.62  ? 193  SER B C     1 
ATOM   5131  O  O     . SER B  1 193 ? -49.967  26.568  -84.158  1.00 36.56  ? 193  SER B O     1 
ATOM   5132  C  CB    . SER B  1 193 ? -47.012  26.855  -83.073  1.00 26.01  ? 193  SER B CB    1 
ATOM   5133  O  OG    . SER B  1 193 ? -46.162  27.978  -82.933  1.00 27.34  ? 193  SER B OG    1 
ATOM   5134  N  N     . GLU B  1 194 ? -49.667  25.153  -82.426  1.00 24.86  ? 194  GLU B N     1 
ATOM   5135  C  CA    . GLU B  1 194 ? -50.715  24.240  -82.889  1.00 20.14  ? 194  GLU B CA    1 
ATOM   5136  C  C     . GLU B  1 194 ? -52.021  25.022  -82.821  1.00 32.34  ? 194  GLU B C     1 
ATOM   5137  O  O     . GLU B  1 194 ? -52.818  25.005  -83.763  1.00 36.34  ? 194  GLU B O     1 
ATOM   5138  C  CB    . GLU B  1 194 ? -50.850  23.012  -81.982  1.00 26.78  ? 194  GLU B CB    1 
ATOM   5139  C  CG    . GLU B  1 194 ? -50.338  21.699  -82.568  1.00 62.86  ? 194  GLU B CG    1 
ATOM   5140  C  CD    . GLU B  1 194 ? -51.135  21.252  -83.762  1.00 66.02  ? 194  GLU B CD    1 
ATOM   5141  O  OE1   . GLU B  1 194 ? -50.552  21.152  -84.867  1.00 80.89  ? 194  GLU B OE1   1 
ATOM   5142  O  OE2   . GLU B  1 194 ? -52.348  21.013  -83.587  1.00 50.58  ? 194  GLU B OE2   1 
ATOM   5143  N  N     . MET B  1 195 ? -52.225  25.736  -81.715  1.00 14.72  ? 195  MET B N     1 
ATOM   5144  C  CA    . MET B  1 195 ? -53.448  26.502  -81.559  1.00 17.34  ? 195  MET B CA    1 
ATOM   5145  C  C     . MET B  1 195 ? -53.578  27.498  -82.696  1.00 22.35  ? 195  MET B C     1 
ATOM   5146  O  O     . MET B  1 195 ? -54.665  27.686  -83.237  1.00 36.15  ? 195  MET B O     1 
ATOM   5147  C  CB    . MET B  1 195 ? -53.484  27.212  -80.210  1.00 12.95  ? 195  MET B CB    1 
ATOM   5148  C  CG    . MET B  1 195 ? -53.516  26.278  -79.012  1.00 20.91  ? 195  MET B CG    1 
ATOM   5149  S  SD    . MET B  1 195 ? -53.427  27.233  -77.500  1.00 23.94  ? 195  MET B SD    1 
ATOM   5150  C  CE    . MET B  1 195 ? -53.776  25.995  -76.275  1.00 15.46  ? 195  MET B CE    1 
ATOM   5151  N  N     . CYS B  1 196 ? -52.462  28.099  -83.096  1.00 22.87  ? 196  CYS B N     1 
ATOM   5152  C  CA    . CYS B  1 196 ? -52.492  29.067  -84.185  1.00 23.55  ? 196  CYS B CA    1 
ATOM   5153  C  C     . CYS B  1 196 ? -52.850  28.431  -85.523  1.00 28.22  ? 196  CYS B C     1 
ATOM   5154  O  O     . CYS B  1 196 ? -53.727  28.927  -86.227  1.00 33.73  ? 196  CYS B O     1 
ATOM   5155  C  CB    . CYS B  1 196 ? -51.169  29.809  -84.283  1.00 16.81  ? 196  CYS B CB    1 
ATOM   5156  S  SG    . CYS B  1 196 ? -50.860  30.879  -82.870  1.00 31.34  ? 196  CYS B SG    1 
ATOM   5157  N  N     . LEU B  1 197 ? -52.207  27.316  -85.852  1.00 17.30  ? 197  LEU B N     1 
ATOM   5158  C  CA    . LEU B  1 197 ? -52.489  26.635  -87.108  1.00 24.43  ? 197  LEU B CA    1 
ATOM   5159  C  C     . LEU B  1 197 ? -53.964  26.258  -87.216  1.00 24.77  ? 197  LEU B C     1 
ATOM   5160  O  O     . LEU B  1 197 ? -54.602  26.512  -88.247  1.00 46.69  ? 197  LEU B O     1 
ATOM   5161  C  CB    . LEU B  1 197 ? -51.618  25.387  -87.257  1.00 15.97  ? 197  LEU B CB    1 
ATOM   5162  C  CG    . LEU B  1 197 ? -50.097  25.568  -87.189  1.00 30.39  ? 197  LEU B CG    1 
ATOM   5163  C  CD1   . LEU B  1 197 ? -49.415  24.216  -87.328  1.00 21.04  ? 197  LEU B CD1   1 
ATOM   5164  C  CD2   . LEU B  1 197 ? -49.628  26.517  -88.267  1.00 13.18  ? 197  LEU B CD2   1 
ATOM   5165  N  N     . VAL B  1 198 ? -54.507  25.703  -86.136  1.00 20.58  ? 198  VAL B N     1 
ATOM   5166  C  CA    . VAL B  1 198 ? -55.911  25.286  -86.095  1.00 22.11  ? 198  VAL B CA    1 
ATOM   5167  C  C     . VAL B  1 198 ? -56.862  26.476  -86.159  1.00 28.03  ? 198  VAL B C     1 
ATOM   5168  O  O     . VAL B  1 198 ? -57.877  26.435  -86.855  1.00 42.15  ? 198  VAL B O     1 
ATOM   5169  C  CB    . VAL B  1 198 ? -56.231  24.443  -84.833  1.00 28.73  ? 198  VAL B CB    1 
ATOM   5170  C  CG1   . VAL B  1 198 ? -57.675  23.994  -84.866  1.00 17.41  ? 198  VAL B CG1   1 
ATOM   5171  C  CG2   . VAL B  1 198 ? -55.310  23.218  -84.749  1.00 8.93   ? 198  VAL B CG2   1 
ATOM   5172  N  N     . MET B  1 199 ? -56.544  27.534  -85.420  1.00 32.10  ? 199  MET B N     1 
ATOM   5173  C  CA    . MET B  1 199 ? -57.371  28.730  -85.431  1.00 23.50  ? 199  MET B CA    1 
ATOM   5174  C  C     . MET B  1 199 ? -57.492  29.218  -86.860  1.00 28.96  ? 199  MET B C     1 
ATOM   5175  O  O     . MET B  1 199 ? -58.582  29.536  -87.326  1.00 49.53  ? 199  MET B O     1 
ATOM   5176  C  CB    . MET B  1 199 ? -56.748  29.817  -84.570  1.00 27.40  ? 199  MET B CB    1 
ATOM   5177  C  CG    . MET B  1 199 ? -56.967  29.579  -83.112  1.00 18.84  ? 199  MET B CG    1 
ATOM   5178  S  SD    . MET B  1 199 ? -56.405  30.949  -82.136  1.00 31.99  ? 199  MET B SD    1 
ATOM   5179  C  CE    . MET B  1 199 ? -56.649  30.238  -80.506  1.00 30.92  ? 199  MET B CE    1 
ATOM   5180  N  N     . GLU B  1 200 ? -56.368  29.234  -87.565  1.00 26.52  ? 200  GLU B N     1 
ATOM   5181  C  CA    . GLU B  1 200 ? -56.365  29.664  -88.949  1.00 25.75  ? 200  GLU B CA    1 
ATOM   5182  C  C     . GLU B  1 200 ? -57.149  28.729  -89.854  1.00 29.47  ? 200  GLU B C     1 
ATOM   5183  O  O     . GLU B  1 200 ? -57.865  29.189  -90.742  1.00 47.01  ? 200  GLU B O     1 
ATOM   5184  C  CB    . GLU B  1 200 ? -54.945  29.904  -89.433  1.00 12.29  ? 200  GLU B CB    1 
ATOM   5185  C  CG    . GLU B  1 200 ? -54.382  31.176  -88.801  1.00 28.62  ? 200  GLU B CG    1 
ATOM   5186  C  CD    . GLU B  1 200 ? -53.150  31.710  -89.493  1.00 35.61  ? 200  GLU B CD    1 
ATOM   5187  O  OE1   . GLU B  1 200 ? -52.906  32.930  -89.358  1.00 32.01  ? 200  GLU B OE1   1 
ATOM   5188  O  OE2   . GLU B  1 200 ? -52.433  30.917  -90.154  1.00 46.98  ? 200  GLU B OE2   1 
ATOM   5189  N  N     . GLN B  1 201 ? -57.072  27.428  -89.598  1.00 27.73  ? 201  GLN B N     1 
ATOM   5190  C  CA    . GLN B  1 201 ? -57.843  26.468  -90.384  1.00 31.00  ? 201  GLN B CA    1 
ATOM   5191  C  C     . GLN B  1 201 ? -59.342  26.682  -90.120  1.00 30.90  ? 201  GLN B C     1 
ATOM   5192  O  O     . GLN B  1 201 ? -60.187  26.102  -90.799  1.00 47.29  ? 201  GLN B O     1 
ATOM   5193  C  CB    . GLN B  1 201 ? -57.512  25.029  -89.986  1.00 23.72  ? 201  GLN B CB    1 
ATOM   5194  C  CG    . GLN B  1 201 ? -56.105  24.552  -90.234  1.00 64.60  ? 201  GLN B CG    1 
ATOM   5195  C  CD    . GLN B  1 201 ? -55.825  23.229  -89.512  1.00 76.56  ? 201  GLN B CD    1 
ATOM   5196  O  OE1   . GLN B  1 201 ? -56.751  22.512  -89.100  1.00 52.75  ? 201  GLN B OE1   1 
ATOM   5197  N  NE2   . GLN B  1 201 ? -54.544  22.910  -89.338  1.00 85.15  ? 201  GLN B NE2   1 
ATOM   5198  N  N     . MET B  1 202 ? -59.668  27.434  -89.072  1.00 37.46  ? 202  MET B N     1 
ATOM   5199  C  CA    . MET B  1 202 ? -61.065  27.687  -88.743  1.00 29.72  ? 202  MET B CA    1 
ATOM   5200  C  C     . MET B  1 202 ? -61.519  29.096  -89.087  1.00 33.65  ? 202  MET B C     1 
ATOM   5201  O  O     . MET B  1 202 ? -62.565  29.560  -88.617  1.00 31.68  ? 202  MET B O     1 
ATOM   5202  C  CB    . MET B  1 202 ? -61.358  27.329  -87.285  1.00 31.85  ? 202  MET B CB    1 
ATOM   5203  C  CG    . MET B  1 202 ? -61.301  25.825  -87.048  1.00 34.26  ? 202  MET B CG    1 
ATOM   5204  S  SD    . MET B  1 202 ? -61.783  25.325  -85.395  1.00 31.50  ? 202  MET B SD    1 
ATOM   5205  C  CE    . MET B  1 202 ? -63.546  25.194  -85.556  1.00 22.85  ? 202  MET B CE    1 
ATOM   5206  N  N     . GLY B  1 203 ? -60.726  29.765  -89.923  1.00 32.11  ? 203  GLY B N     1 
ATOM   5207  C  CA    . GLY B  1 203 ? -61.076  31.096  -90.390  1.00 35.86  ? 203  GLY B CA    1 
ATOM   5208  C  C     . GLY B  1 203 ? -60.478  32.309  -89.724  1.00 36.04  ? 203  GLY B C     1 
ATOM   5209  O  O     . GLY B  1 203 ? -60.671  33.446  -90.183  1.00 50.31  ? 203  GLY B O     1 
ATOM   5210  N  N     . LEU B  1 204 ? -59.786  32.087  -88.620  1.00 30.29  ? 204  LEU B N     1 
ATOM   5211  C  CA    . LEU B  1 204 ? -59.177  33.193  -87.910  1.00 32.25  ? 204  LEU B CA    1 
ATOM   5212  C  C     . LEU B  1 204 ? -57.845  33.550  -88.538  1.00 30.09  ? 204  LEU B C     1 
ATOM   5213  O  O     . LEU B  1 204 ? -57.287  32.773  -89.327  1.00 30.71  ? 204  LEU B O     1 
ATOM   5214  C  CB    . LEU B  1 204 ? -58.997  32.848  -86.429  1.00 19.51  ? 204  LEU B CB    1 
ATOM   5215  C  CG    . LEU B  1 204 ? -60.221  33.012  -85.525  1.00 30.48  ? 204  LEU B CG    1 
ATOM   5216  C  CD1   . LEU B  1 204 ? -61.257  31.982  -85.859  1.00 26.36  ? 204  LEU B CD1   1 
ATOM   5217  C  CD2   . LEU B  1 204 ? -59.815  32.908  -84.060  1.00 25.67  ? 204  LEU B CD2   1 
ATOM   5218  N  N     . VAL B  1 205 ? -57.382  34.763  -88.256  1.00 21.94  ? 205  VAL B N     1 
ATOM   5219  C  CA    . VAL B  1 205 ? -56.091  35.207  -88.757  1.00 26.10  ? 205  VAL B CA    1 
ATOM   5220  C  C     . VAL B  1 205 ? -55.260  35.560  -87.551  1.00 37.72  ? 205  VAL B C     1 
ATOM   5221  O  O     . VAL B  1 205 ? -55.626  36.435  -86.756  1.00 35.77  ? 205  VAL B O     1 
ATOM   5222  C  CB    . VAL B  1 205 ? -56.211  36.409  -89.700  1.00 32.97  ? 205  VAL B CB    1 
ATOM   5223  C  CG1   . VAL B  1 205 ? -54.824  36.949  -90.056  1.00 15.39  ? 205  VAL B CG1   1 
ATOM   5224  C  CG2   . VAL B  1 205 ? -56.912  35.975  -90.962  1.00 14.21  ? 205  VAL B CG2   1 
ATOM   5225  N  N     . VAL B  1 206 ? -54.162  34.832  -87.398  1.00 37.14  ? 206  VAL B N     1 
ATOM   5226  C  CA    . VAL B  1 206 ? -53.278  35.025  -86.267  1.00 32.61  ? 206  VAL B CA    1 
ATOM   5227  C  C     . VAL B  1 206 ? -52.220  36.076  -86.516  1.00 32.25  ? 206  VAL B C     1 
ATOM   5228  O  O     . VAL B  1 206 ? -51.578  36.091  -87.561  1.00 46.55  ? 206  VAL B O     1 
ATOM   5229  C  CB    . VAL B  1 206 ? -52.606  33.702  -85.872  1.00 29.64  ? 206  VAL B CB    1 
ATOM   5230  C  CG1   . VAL B  1 206 ? -51.619  33.932  -84.745  1.00 27.77  ? 206  VAL B CG1   1 
ATOM   5231  C  CG2   . VAL B  1 206 ? -53.660  32.699  -85.441  1.00 22.54  ? 206  VAL B CG2   1 
ATOM   5232  N  N     . GLU B  1 207 ? -52.051  36.953  -85.538  1.00 34.20  ? 207  GLU B N     1 
ATOM   5233  C  CA    . GLU B  1 207 ? -51.063  38.016  -85.615  1.00 33.28  ? 207  GLU B CA    1 
ATOM   5234  C  C     . GLU B  1 207 ? -49.798  37.697  -84.815  1.00 34.10  ? 207  GLU B C     1 
ATOM   5235  O  O     . GLU B  1 207 ? -48.695  38.059  -85.230  1.00 39.72  ? 207  GLU B O     1 
ATOM   5236  C  CB    . GLU B  1 207 ? -51.681  39.342  -85.160  1.00 30.09  ? 207  GLU B CB    1 
ATOM   5237  C  CG    . GLU B  1 207 ? -51.899  40.313  -86.309  1.00 49.36  ? 207  GLU B CG    1 
ATOM   5238  C  CD    . GLU B  1 207 ? -53.103  41.214  -86.134  1.00 54.22  ? 207  GLU B CD    1 
ATOM   5239  O  OE1   . GLU B  1 207 ? -53.550  41.428  -84.984  1.00 75.85  ? 207  GLU B OE1   1 
ATOM   5240  O  OE2   . GLU B  1 207 ? -53.602  41.714  -87.168  1.00 67.29  ? 207  GLU B OE2   1 
ATOM   5241  N  N     . ALA B  1 208 ? -49.954  36.990  -83.695  1.00 38.91  ? 208  ALA B N     1 
ATOM   5242  C  CA    . ALA B  1 208 ? -48.818  36.620  -82.839  1.00 36.51  ? 208  ALA B CA    1 
ATOM   5243  C  C     . ALA B  1 208 ? -49.192  35.664  -81.719  1.00 31.60  ? 208  ALA B C     1 
ATOM   5244  O  O     . ALA B  1 208 ? -50.372  35.484  -81.412  1.00 33.44  ? 208  ALA B O     1 
ATOM   5245  C  CB    . ALA B  1 208 ? -48.223  37.865  -82.210  1.00 19.52  ? 208  ALA B CB    1 
ATOM   5246  N  N     . HIS B  1 209 ? -48.174  35.043  -81.120  1.00 28.07  ? 209  HIS B N     1 
ATOM   5247  C  CA    . HIS B  1 209 ? -48.372  34.164  -79.966  1.00 19.78  ? 209  HIS B CA    1 
ATOM   5248  C  C     . HIS B  1 209 ? -47.188  34.253  -79.029  1.00 22.51  ? 209  HIS B C     1 
ATOM   5249  O  O     . HIS B  1 209 ? -46.047  34.422  -79.454  1.00 20.13  ? 209  HIS B O     1 
ATOM   5250  C  CB    . HIS B  1 209 ? -48.754  32.712  -80.341  1.00 21.87  ? 209  HIS B CB    1 
ATOM   5251  C  CG    . HIS B  1 209 ? -47.605  31.784  -80.596  1.00 27.93  ? 209  HIS B CG    1 
ATOM   5252  N  ND1   . HIS B  1 209 ? -46.611  31.545  -79.672  1.00 27.74  ? 209  HIS B ND1   1 
ATOM   5253  C  CD2   . HIS B  1 209 ? -47.352  30.958  -81.642  1.00 26.67  ? 209  HIS B CD2   1 
ATOM   5254  C  CE1   . HIS B  1 209 ? -45.798  30.610  -80.135  1.00 35.58  ? 209  HIS B CE1   1 
ATOM   5255  N  NE2   . HIS B  1 209 ? -46.225  30.237  -81.328  1.00 19.48  ? 209  HIS B NE2   1 
ATOM   5256  N  N     . HIS B  1 210 ? -47.473  34.204  -77.740  1.00 25.63  ? 210  HIS B N     1 
ATOM   5257  C  CA    . HIS B  1 210 ? -46.420  34.314  -76.756  1.00 29.21  ? 210  HIS B CA    1 
ATOM   5258  C  C     . HIS B  1 210 ? -46.905  33.902  -75.387  1.00 27.65  ? 210  HIS B C     1 
ATOM   5259  O  O     . HIS B  1 210 ? -48.112  33.830  -75.140  1.00 27.97  ? 210  HIS B O     1 
ATOM   5260  C  CB    . HIS B  1 210 ? -45.965  35.769  -76.684  1.00 17.14  ? 210  HIS B CB    1 
ATOM   5261  C  CG    . HIS B  1 210 ? -47.070  36.737  -76.360  1.00 21.45  ? 210  HIS B CG    1 
ATOM   5262  N  ND1   . HIS B  1 210 ? -47.391  37.103  -75.072  1.00 25.99  ? 210  HIS B ND1   1 
ATOM   5263  C  CD2   . HIS B  1 210 ? -47.924  37.418  -77.165  1.00 29.56  ? 210  HIS B CD2   1 
ATOM   5264  C  CE1   . HIS B  1 210 ? -48.393  37.967  -75.093  1.00 23.85  ? 210  HIS B CE1   1 
ATOM   5265  N  NE2   . HIS B  1 210 ? -48.734  38.175  -76.353  1.00 23.65  ? 210  HIS B NE2   1 
ATOM   5266  N  N     . HIS B  1 211 ? -45.949  33.641  -74.501  1.00 20.12  ? 211  HIS B N     1 
ATOM   5267  C  CA    . HIS B  1 211 ? -46.257  33.298  -73.122  1.00 25.28  ? 211  HIS B CA    1 
ATOM   5268  C  C     . HIS B  1 211 ? -46.614  34.624  -72.455  1.00 25.23  ? 211  HIS B C     1 
ATOM   5269  O  O     . HIS B  1 211 ? -46.171  35.675  -72.899  1.00 24.94  ? 211  HIS B O     1 
ATOM   5270  C  CB    . HIS B  1 211 ? -45.027  32.719  -72.434  1.00 25.04  ? 211  HIS B CB    1 
ATOM   5271  C  CG    . HIS B  1 211 ? -45.310  32.115  -71.093  1.00 30.78  ? 211  HIS B CG    1 
ATOM   5272  N  ND1   . HIS B  1 211 ? -45.136  30.773  -70.830  1.00 28.34  ? 211  HIS B ND1   1 
ATOM   5273  C  CD2   . HIS B  1 211 ? -45.771  32.666  -69.945  1.00 21.00  ? 211  HIS B CD2   1 
ATOM   5274  C  CE1   . HIS B  1 211 ? -45.482  30.523  -69.579  1.00 21.09  ? 211  HIS B CE1   1 
ATOM   5275  N  NE2   . HIS B  1 211 ? -45.872  31.653  -69.020  1.00 30.07  ? 211  HIS B NE2   1 
ATOM   5276  N  N     . GLU B  1 212 ? -47.424  34.589  -71.409  1.00 20.52  ? 212  GLU B N     1 
ATOM   5277  C  CA    . GLU B  1 212 ? -47.789  35.820  -70.729  1.00 17.97  ? 212  GLU B CA    1 
ATOM   5278  C  C     . GLU B  1 212 ? -47.017  35.977  -69.431  1.00 25.00  ? 212  GLU B C     1 
ATOM   5279  O  O     . GLU B  1 212 ? -46.149  35.175  -69.131  1.00 35.23  ? 212  GLU B O     1 
ATOM   5280  C  CB    . GLU B  1 212 ? -49.291  35.887  -70.486  1.00 27.79  ? 212  GLU B CB    1 
ATOM   5281  C  CG    . GLU B  1 212 ? -50.031  36.824  -71.430  1.00 26.49  ? 212  GLU B CG    1 
ATOM   5282  C  CD    . GLU B  1 212 ? -49.660  38.294  -71.241  1.00 39.65  ? 212  GLU B CD    1 
ATOM   5283  O  OE1   . GLU B  1 212 ? -49.353  38.711  -70.097  1.00 40.28  ? 212  GLU B OE1   1 
ATOM   5284  O  OE2   . GLU B  1 212 ? -49.713  39.040  -72.242  1.00 36.49  ? 212  GLU B OE2   1 
ATOM   5285  N  N     . VAL B  1 213 ? -47.360  36.990  -68.649  1.00 27.67  ? 213  VAL B N     1 
ATOM   5286  C  CA    . VAL B  1 213 ? -46.663  37.290  -67.400  1.00 37.92  ? 213  VAL B CA    1 
ATOM   5287  C  C     . VAL B  1 213 ? -46.680  36.272  -66.252  1.00 30.24  ? 213  VAL B C     1 
ATOM   5288  O  O     . VAL B  1 213 ? -45.657  36.005  -65.615  1.00 34.80  ? 213  VAL B O     1 
ATOM   5289  C  CB    . VAL B  1 213 ? -47.144  38.640  -66.849  1.00 33.02  ? 213  VAL B CB    1 
ATOM   5290  C  CG1   . VAL B  1 213 ? -46.463  38.968  -65.544  1.00 38.72  ? 213  VAL B CG1   1 
ATOM   5291  C  CG2   . VAL B  1 213 ? -46.882  39.702  -67.844  1.00 27.99  ? 213  VAL B CG2   1 
ATOM   5292  N  N     . ALA B  1 214 ? -47.837  35.709  -65.967  1.00 25.64  ? 214  ALA B N     1 
ATOM   5293  C  CA    . ALA B  1 214 ? -47.921  34.789  -64.855  1.00 32.66  ? 214  ALA B CA    1 
ATOM   5294  C  C     . ALA B  1 214 ? -47.179  33.467  -65.016  1.00 36.49  ? 214  ALA B C     1 
ATOM   5295  O  O     . ALA B  1 214 ? -46.909  33.008  -66.132  1.00 35.24  ? 214  ALA B O     1 
ATOM   5296  C  CB    . ALA B  1 214 ? -49.385  34.542  -64.502  1.00 35.27  ? 214  ALA B CB    1 
ATOM   5297  N  N     . THR B  1 215 ? -46.799  32.895  -63.877  1.00 36.82  ? 215  THR B N     1 
ATOM   5298  C  CA    . THR B  1 215 ? -46.149  31.594  -63.834  1.00 26.09  ? 215  THR B CA    1 
ATOM   5299  C  C     . THR B  1 215 ? -47.298  30.592  -64.062  1.00 32.61  ? 215  THR B C     1 
ATOM   5300  O  O     . THR B  1 215 ? -48.445  30.985  -64.298  1.00 44.23  ? 215  THR B O     1 
ATOM   5301  C  CB    . THR B  1 215 ? -45.499  31.339  -62.435  1.00 33.46  ? 215  THR B CB    1 
ATOM   5302  O  OG1   . THR B  1 215 ? -44.850  30.059  -62.419  1.00 49.55  ? 215  THR B OG1   1 
ATOM   5303  C  CG2   . THR B  1 215 ? -46.542  31.371  -61.318  1.00 15.00  ? 215  THR B CG2   1 
ATOM   5304  N  N     . ALA B  1 216 ? -46.996  29.306  -64.036  1.00 35.30  ? 216  ALA B N     1 
ATOM   5305  C  CA    . ALA B  1 216 ? -48.019  28.284  -64.186  1.00 35.46  ? 216  ALA B CA    1 
ATOM   5306  C  C     . ALA B  1 216 ? -48.838  28.374  -65.467  1.00 39.28  ? 216  ALA B C     1 
ATOM   5307  O  O     . ALA B  1 216 ? -50.023  28.094  -65.443  1.00 36.36  ? 216  ALA B O     1 
ATOM   5308  C  CB    . ALA B  1 216 ? -48.932  28.334  -62.970  1.00 29.94  ? 216  ALA B CB    1 
ATOM   5309  N  N     . GLY B  1 217 ? -48.205  28.769  -66.567  1.00 35.96  ? 217  GLY B N     1 
ATOM   5310  C  CA    . GLY B  1 217 ? -48.816  28.699  -67.890  1.00 21.78  ? 217  GLY B CA    1 
ATOM   5311  C  C     . GLY B  1 217 ? -49.737  29.802  -68.419  1.00 22.99  ? 217  GLY B C     1 
ATOM   5312  O  O     . GLY B  1 217 ? -50.694  29.484  -69.129  1.00 28.06  ? 217  GLY B O     1 
ATOM   5313  N  N     . GLN B  1 218 ? -49.510  31.077  -68.103  1.00 18.26  ? 218  GLN B N     1 
ATOM   5314  C  CA    . GLN B  1 218 ? -50.374  32.065  -68.759  1.00 14.89  ? 218  GLN B CA    1 
ATOM   5315  C  C     . GLN B  1 218 ? -49.854  32.205  -70.186  1.00 21.58  ? 218  GLN B C     1 
ATOM   5316  O  O     . GLN B  1 218 ? -48.652  32.320  -70.413  1.00 30.83  ? 218  GLN B O     1 
ATOM   5317  C  CB    . GLN B  1 218 ? -50.404  33.406  -68.044  1.00 14.94  ? 218  GLN B CB    1 
ATOM   5318  C  CG    . GLN B  1 218 ? -51.608  34.224  -68.503  1.00 18.19  ? 218  GLN B CG    1 
ATOM   5319  C  CD    . GLN B  1 218 ? -51.762  35.559  -67.792  1.00 15.27  ? 218  GLN B CD    1 
ATOM   5320  O  OE1   . GLN B  1 218 ? -52.872  35.915  -67.396  1.00 38.93  ? 218  GLN B OE1   1 
ATOM   5321  N  NE2   . GLN B  1 218 ? -50.802  36.426  -67.537  1.00 15.68  ? 218  GLN B NE2   1 
ATOM   5322  N  N     . ASN B  1 219 ? -50.764  32.200  -71.152  1.00 31.02  ? 219  ASN B N     1 
ATOM   5323  C  CA    . ASN B  1 219 ? -50.387  32.308  -72.556  1.00 22.50  ? 219  ASN B CA    1 
ATOM   5324  C  C     . ASN B  1 219 ? -51.356  33.187  -73.326  1.00 28.68  ? 219  ASN B C     1 
ATOM   5325  O  O     . ASN B  1 219 ? -52.434  33.526  -72.823  1.00 26.63  ? 219  ASN B O     1 
ATOM   5326  C  CB    . ASN B  1 219 ? -50.350  30.923  -73.187  1.00 17.44  ? 219  ASN B CB    1 
ATOM   5327  C  CG    . ASN B  1 219 ? -49.220  30.081  -72.657  1.00 26.00  ? 219  ASN B CG    1 
ATOM   5328  O  OD1   . ASN B  1 219 ? -49.398  29.284  -71.736  1.00 36.06  ? 219  ASN B OD1   1 
ATOM   5329  N  ND2   . ASN B  1 219 ? -48.045  30.251  -73.235  1.00 25.44  ? 219  ASN B ND2   1 
ATOM   5330  N  N     . GLU B  1 220 ? -50.979  33.531  -74.555  1.00 21.85  ? 220  GLU B N     1 
ATOM   5331  C  CA    . GLU B  1 220 ? -51.828  34.364  -75.389  1.00 25.37  ? 220  GLU B CA    1 
ATOM   5332  C  C     . GLU B  1 220 ? -51.608  34.177  -76.875  1.00 29.74  ? 220  GLU B C     1 
ATOM   5333  O  O     . GLU B  1 220 ? -50.476  34.012  -77.331  1.00 33.41  ? 220  GLU B O     1 
ATOM   5334  C  CB    . GLU B  1 220 ? -51.602  35.835  -75.069  1.00 25.46  ? 220  GLU B CB    1 
ATOM   5335  C  CG    . GLU B  1 220 ? -52.693  36.718  -75.627  1.00 30.89  ? 220  GLU B CG    1 
ATOM   5336  C  CD    . GLU B  1 220 ? -52.475  38.206  -75.382  1.00 37.48  ? 220  GLU B CD    1 
ATOM   5337  O  OE1   . GLU B  1 220 ? -51.811  38.615  -74.397  1.00 20.94  ? 220  GLU B OE1   1 
ATOM   5338  O  OE2   . GLU B  1 220 ? -52.993  38.979  -76.199  1.00 31.52  ? 220  GLU B OE2   1 
ATOM   5339  N  N     . VAL B  1 221 ? -52.712  34.158  -77.616  1.00 32.11  ? 221  VAL B N     1 
ATOM   5340  C  CA    . VAL B  1 221 ? -52.668  34.075  -79.069  1.00 30.41  ? 221  VAL B CA    1 
ATOM   5341  C  C     . VAL B  1 221 ? -53.434  35.285  -79.577  1.00 36.42  ? 221  VAL B C     1 
ATOM   5342  O  O     . VAL B  1 221 ? -54.641  35.395  -79.362  1.00 43.78  ? 221  VAL B O     1 
ATOM   5343  C  CB    . VAL B  1 221 ? -53.332  32.821  -79.626  1.00 23.02  ? 221  VAL B CB    1 
ATOM   5344  C  CG1   . VAL B  1 221 ? -53.451  32.945  -81.151  1.00 21.49  ? 221  VAL B CG1   1 
ATOM   5345  C  CG2   . VAL B  1 221 ? -52.505  31.609  -79.289  1.00 13.87  ? 221  VAL B CG2   1 
ATOM   5346  N  N     . ALA B  1 222 ? -52.718  36.218  -80.195  1.00 35.17  ? 222  ALA B N     1 
ATOM   5347  C  CA    . ALA B  1 222 ? -53.323  37.428  -80.736  1.00 29.25  ? 222  ALA B CA    1 
ATOM   5348  C  C     . ALA B  1 222 ? -53.847  37.196  -82.158  1.00 31.15  ? 222  ALA B C     1 
ATOM   5349  O  O     . ALA B  1 222 ? -53.108  36.780  -83.050  1.00 42.36  ? 222  ALA B O     1 
ATOM   5350  C  CB    . ALA B  1 222 ? -52.315  38.555  -80.726  1.00 30.92  ? 222  ALA B CB    1 
ATOM   5351  N  N     . THR B  1 223 ? -55.143  37.420  -82.340  1.00 23.74  ? 223  THR B N     1 
ATOM   5352  C  CA    . THR B  1 223 ? -55.796  37.254  -83.630  1.00 27.82  ? 223  THR B CA    1 
ATOM   5353  C  C     . THR B  1 223 ? -56.183  38.631  -84.157  1.00 38.82  ? 223  THR B C     1 
ATOM   5354  O  O     . THR B  1 223 ? -56.295  39.589  -83.383  1.00 26.61  ? 223  THR B O     1 
ATOM   5355  C  CB    . THR B  1 223 ? -57.040  36.372  -83.513  1.00 17.44  ? 223  THR B CB    1 
ATOM   5356  O  OG1   . THR B  1 223 ? -57.853  36.827  -82.424  1.00 41.02  ? 223  THR B OG1   1 
ATOM   5357  C  CG2   . THR B  1 223 ? -56.627  34.947  -83.252  1.00 30.41  ? 223  THR B CG2   1 
ATOM   5358  N  N     . ARG B  1 224 ? -56.342  38.722  -85.477  1.00 37.66  ? 224  ARG B N     1 
ATOM   5359  C  CA    . ARG B  1 224 ? -56.690  39.969  -86.153  1.00 28.17  ? 224  ARG B CA    1 
ATOM   5360  C  C     . ARG B  1 224 ? -58.127  40.373  -85.896  1.00 37.49  ? 224  ARG B C     1 
ATOM   5361  O  O     . ARG B  1 224 ? -59.008  39.518  -85.757  1.00 36.22  ? 224  ARG B O     1 
ATOM   5362  C  CB    . ARG B  1 224 ? -56.453  39.824  -87.660  1.00 44.13  ? 224  ARG B CB    1 
ATOM   5363  C  CG    . ARG B  1 224 ? -56.741  41.079  -88.485  1.00 43.37  ? 224  ARG B CG    1 
ATOM   5364  C  CD    . ARG B  1 224 ? -55.920  41.116  -89.790  1.00 55.57  ? 224  ARG B CD    1 
ATOM   5365  N  NE    . ARG B  1 224 ? -56.485  40.482  -90.994  1.00 57.19  ? 224  ARG B NE    1 
ATOM   5366  C  CZ    . ARG B  1 224 ? -57.664  39.860  -91.118  1.00 80.87  ? 224  ARG B CZ    1 
ATOM   5367  N  NH1   . ARG B  1 224 ? -57.990  39.361  -92.305  1.00 61.84  ? 224  ARG B NH1   1 
ATOM   5368  N  NH2   . ARG B  1 224 ? -58.508  39.698  -90.094  1.00 79.82  ? 224  ARG B NH2   1 
ATOM   5369  N  N     . PHE B  1 225 ? -58.358  41.682  -85.850  1.00 32.82  ? 225  PHE B N     1 
ATOM   5370  C  CA    . PHE B  1 225 ? -59.694  42.239  -85.629  1.00 30.72  ? 225  PHE B CA    1 
ATOM   5371  C  C     . PHE B  1 225 ? -60.672  41.793  -86.726  1.00 31.21  ? 225  PHE B C     1 
ATOM   5372  O  O     . PHE B  1 225 ? -60.286  41.129  -87.700  1.00 44.23  ? 225  PHE B O     1 
ATOM   5373  C  CB    . PHE B  1 225 ? -59.623  43.761  -85.659  1.00 37.45  ? 225  PHE B CB    1 
ATOM   5374  C  CG    . PHE B  1 225 ? -59.350  44.306  -87.023  1.00 45.24  ? 225  PHE B CG    1 
ATOM   5375  C  CD1   . PHE B  1 225 ? -58.048  44.406  -87.493  1.00 56.86  ? 225  PHE B CD1   1 
ATOM   5376  C  CD2   . PHE B  1 225 ? -60.398  44.632  -87.875  1.00 50.64  ? 225  PHE B CD2   1 
ATOM   5377  C  CE1   . PHE B  1 225 ? -57.790  44.814  -88.791  1.00 43.03  ? 225  PHE B CE1   1 
ATOM   5378  C  CE2   . PHE B  1 225 ? -60.153  45.040  -89.178  1.00 43.05  ? 225  PHE B CE2   1 
ATOM   5379  C  CZ    . PHE B  1 225 ? -58.849  45.130  -89.637  1.00 42.51  ? 225  PHE B CZ    1 
ATOM   5380  N  N     . ASN B  1 226 ? -61.920  42.238  -86.596  1.00 33.78  ? 226  ASN B N     1 
ATOM   5381  C  CA    . ASN B  1 226 ? -62.972  41.910  -87.552  1.00 30.27  ? 226  ASN B CA    1 
ATOM   5382  C  C     . ASN B  1 226 ? -64.240  42.651  -87.144  1.00 36.37  ? 226  ASN B C     1 
ATOM   5383  O  O     . ASN B  1 226 ? -64.273  43.291  -86.089  1.00 30.37  ? 226  ASN B O     1 
ATOM   5384  C  CB    . ASN B  1 226 ? -63.221  40.408  -87.559  1.00 27.77  ? 226  ASN B CB    1 
ATOM   5385  C  CG    . ASN B  1 226 ? -63.804  39.919  -88.862  1.00 36.41  ? 226  ASN B CG    1 
ATOM   5386  O  OD1   . ASN B  1 226 ? -64.448  40.667  -89.600  1.00 55.51  ? 226  ASN B OD1   1 
ATOM   5387  N  ND2   . ASN B  1 226 ? -63.588  38.646  -89.151  1.00 38.40  ? 226  ASN B ND2   1 
ATOM   5388  N  N     . THR B  1 227 ? -65.282  42.578  -87.970  1.00 34.44  ? 227  THR B N     1 
ATOM   5389  C  CA    . THR B  1 227 ? -66.524  43.278  -87.651  1.00 40.75  ? 227  THR B CA    1 
ATOM   5390  C  C     . THR B  1 227 ? -67.052  42.699  -86.327  1.00 39.99  ? 227  THR B C     1 
ATOM   5391  O  O     . THR B  1 227 ? -66.874  41.509  -86.029  1.00 46.23  ? 227  THR B O     1 
ATOM   5392  C  CB    . THR B  1 227 ? -67.579  43.164  -88.788  1.00 34.87  ? 227  THR B CB    1 
ATOM   5393  O  OG1   . THR B  1 227 ? -67.968  41.808  -88.933  1.00 35.08  ? 227  THR B OG1   1 
ATOM   5394  C  CG2   . THR B  1 227 ? -67.000  43.545  -90.113  1.00 21.88  ? 227  THR B CG2   1 
ATOM   5395  N  N     . MET B  1 228 ? -67.737  43.535  -85.558  1.00 35.48  ? 228  MET B N     1 
ATOM   5396  C  CA    . MET B  1 228 ? -68.220  43.125  -84.255  1.00 33.55  ? 228  MET B CA    1 
ATOM   5397  C  C     . MET B  1 228 ? -68.789  41.731  -84.080  1.00 31.97  ? 228  MET B C     1 
ATOM   5398  O  O     . MET B  1 228 ? -68.214  40.931  -83.353  1.00 51.56  ? 228  MET B O     1 
ATOM   5399  C  CB    . MET B  1 228 ? -69.170  44.144  -83.657  1.00 34.07  ? 228  MET B CB    1 
ATOM   5400  C  CG    . MET B  1 228 ? -69.424  43.840  -82.203  1.00 32.29  ? 228  MET B CG    1 
ATOM   5401  S  SD    . MET B  1 228 ? -70.528  44.974  -81.412  1.00 38.66  ? 228  MET B SD    1 
ATOM   5402  C  CE    . MET B  1 228 ? -72.065  44.286  -81.974  1.00 18.83  ? 228  MET B CE    1 
ATOM   5403  N  N     . THR B  1 229 ? -69.896  41.423  -84.737  1.00 41.30  ? 229  THR B N     1 
ATOM   5404  C  CA    . THR B  1 229 ? -70.493  40.106  -84.569  1.00 36.11  ? 229  THR B CA    1 
ATOM   5405  C  C     . THR B  1 229 ? -69.596  38.962  -85.045  1.00 37.42  ? 229  THR B C     1 
ATOM   5406  O  O     . THR B  1 229 ? -69.467  37.951  -84.361  1.00 38.27  ? 229  THR B O     1 
ATOM   5407  C  CB    . THR B  1 229 ? -71.872  40.029  -85.225  1.00 34.58  ? 229  THR B CB    1 
ATOM   5408  O  OG1   . THR B  1 229 ? -72.679  41.111  -84.743  1.00 38.50  ? 229  THR B OG1   1 
ATOM   5409  C  CG2   . THR B  1 229 ? -72.549  38.725  -84.875  1.00 30.13  ? 229  THR B CG2   1 
ATOM   5410  N  N     . LYS B  1 230 ? -68.943  39.136  -86.187  1.00 36.58  ? 230  LYS B N     1 
ATOM   5411  C  CA    . LYS B  1 230 ? -68.064  38.095  -86.688  1.00 33.60  ? 230  LYS B CA    1 
ATOM   5412  C  C     . LYS B  1 230 ? -66.937  37.854  -85.679  1.00 33.70  ? 230  LYS B C     1 
ATOM   5413  O  O     . LYS B  1 230 ? -66.564  36.711  -85.417  1.00 37.48  ? 230  LYS B O     1 
ATOM   5414  C  CB    . LYS B  1 230 ? -67.507  38.451  -88.080  1.00 35.59  ? 230  LYS B CB    1 
ATOM   5415  C  CG    . LYS B  1 230 ? -66.721  37.309  -88.737  1.00 65.71  ? 230  LYS B CG    1 
ATOM   5416  C  CD    . LYS B  1 230 ? -66.639  37.459  -90.242  1.00 89.00  ? 230  LYS B CD    1 
ATOM   5417  C  CE    . LYS B  1 230 ? -68.032  37.509  -90.862  1.00 100.00 ? 230  LYS B CE    1 
ATOM   5418  N  NZ    . LYS B  1 230 ? -67.974  37.680  -92.340  1.00 90.42  ? 230  LYS B NZ    1 
ATOM   5419  N  N     . LYS B  1 231 ? -66.449  38.921  -85.056  1.00 36.63  ? 231  LYS B N     1 
ATOM   5420  C  CA    . LYS B  1 231 ? -65.381  38.777  -84.078  1.00 39.23  ? 231  LYS B CA    1 
ATOM   5421  C  C     . LYS B  1 231 ? -65.814  38.003  -82.834  1.00 39.32  ? 231  LYS B C     1 
ATOM   5422  O  O     . LYS B  1 231 ? -65.042  37.210  -82.298  1.00 45.03  ? 231  LYS B O     1 
ATOM   5423  C  CB    . LYS B  1 231 ? -64.791  40.129  -83.685  1.00 31.71  ? 231  LYS B CB    1 
ATOM   5424  C  CG    . LYS B  1 231 ? -63.453  39.993  -82.974  1.00 34.47  ? 231  LYS B CG    1 
ATOM   5425  C  CD    . LYS B  1 231 ? -62.559  39.033  -83.745  1.00 36.93  ? 231  LYS B CD    1 
ATOM   5426  C  CE    . LYS B  1 231 ? -61.214  38.829  -83.094  1.00 26.18  ? 231  LYS B CE    1 
ATOM   5427  N  NZ    . LYS B  1 231 ? -60.375  37.882  -83.893  1.00 29.88  ? 231  LYS B NZ    1 
ATOM   5428  N  N     . ALA B  1 232 ? -67.048  38.215  -82.386  1.00 31.51  ? 232  ALA B N     1 
ATOM   5429  C  CA    . ALA B  1 232 ? -67.549  37.499  -81.222  1.00 25.32  ? 232  ALA B CA    1 
ATOM   5430  C  C     . ALA B  1 232 ? -67.663  36.005  -81.579  1.00 35.31  ? 232  ALA B C     1 
ATOM   5431  O  O     . ALA B  1 232 ? -67.474  35.135  -80.725  1.00 45.73  ? 232  ALA B O     1 
ATOM   5432  C  CB    . ALA B  1 232 ? -68.876  38.071  -80.779  1.00 27.29  ? 232  ALA B CB    1 
ATOM   5433  N  N     . ASP B  1 233 ? -67.948  35.718  -82.851  1.00 36.79  ? 233  ASP B N     1 
ATOM   5434  C  CA    . ASP B  1 233 ? -68.019  34.338  -83.341  1.00 22.99  ? 233  ASP B CA    1 
ATOM   5435  C  C     . ASP B  1 233 ? -66.604  33.767  -83.208  1.00 33.39  ? 233  ASP B C     1 
ATOM   5436  O  O     . ASP B  1 233 ? -66.395  32.673  -82.676  1.00 43.20  ? 233  ASP B O     1 
ATOM   5437  C  CB    . ASP B  1 233 ? -68.379  34.296  -84.831  1.00 31.58  ? 233  ASP B CB    1 
ATOM   5438  C  CG    . ASP B  1 233 ? -69.844  34.574  -85.110  1.00 44.00  ? 233  ASP B CG    1 
ATOM   5439  O  OD1   . ASP B  1 233 ? -70.660  34.599  -84.171  1.00 35.27  ? 233  ASP B OD1   1 
ATOM   5440  O  OD2   . ASP B  1 233 ? -70.180  34.750  -86.302  1.00 39.84  ? 233  ASP B OD2   1 
ATOM   5441  N  N     . GLU B  1 234 ? -65.638  34.528  -83.716  1.00 22.81  ? 234  GLU B N     1 
ATOM   5442  C  CA    . GLU B  1 234 ? -64.235  34.144  -83.674  1.00 28.03  ? 234  GLU B CA    1 
ATOM   5443  C  C     . GLU B  1 234 ? -63.761  33.877  -82.250  1.00 34.86  ? 234  GLU B C     1 
ATOM   5444  O  O     . GLU B  1 234 ? -62.985  32.947  -82.037  1.00 32.77  ? 234  GLU B O     1 
ATOM   5445  C  CB    . GLU B  1 234 ? -63.363  35.198  -84.373  1.00 27.73  ? 234  GLU B CB    1 
ATOM   5446  C  CG    . GLU B  1 234 ? -63.690  35.342  -85.876  1.00 36.39  ? 234  GLU B CG    1 
ATOM   5447  C  CD    . GLU B  1 234 ? -62.646  36.110  -86.680  1.00 40.29  ? 234  GLU B CD    1 
ATOM   5448  O  OE1   . GLU B  1 234 ? -61.772  36.761  -86.070  1.00 37.86  ? 234  GLU B OE1   1 
ATOM   5449  O  OE2   . GLU B  1 234 ? -62.693  36.051  -87.931  1.00 42.68  ? 234  GLU B OE2   1 
ATOM   5450  N  N     . ILE B  1 235 ? -64.255  34.656  -81.281  1.00 21.78  ? 235  ILE B N     1 
ATOM   5451  C  CA    . ILE B  1 235 ? -63.884  34.460  -79.882  1.00 22.16  ? 235  ILE B CA    1 
ATOM   5452  C  C     . ILE B  1 235 ? -64.360  33.086  -79.417  1.00 34.10  ? 235  ILE B C     1 
ATOM   5453  O  O     . ILE B  1 235 ? -63.643  32.374  -78.708  1.00 34.77  ? 235  ILE B O     1 
ATOM   5454  C  CB    . ILE B  1 235 ? -64.466  35.556  -78.959  1.00 31.07  ? 235  ILE B CB    1 
ATOM   5455  C  CG1   . ILE B  1 235 ? -63.614  36.826  -79.050  1.00 31.24  ? 235  ILE B CG1   1 
ATOM   5456  C  CG2   . ILE B  1 235 ? -64.547  35.072  -77.510  1.00 18.87  ? 235  ILE B CG2   1 
ATOM   5457  C  CD1   . ILE B  1 235 ? -62.201  36.690  -78.530  1.00 30.44  ? 235  ILE B CD1   1 
ATOM   5458  N  N     . GLN B  1 236 ? -65.566  32.712  -79.817  1.00 25.03  ? 236  GLN B N     1 
ATOM   5459  C  CA    . GLN B  1 236 ? -66.084  31.406  -79.451  1.00 26.56  ? 236  GLN B CA    1 
ATOM   5460  C  C     . GLN B  1 236 ? -65.242  30.294  -80.093  1.00 24.94  ? 236  GLN B C     1 
ATOM   5461  O  O     . GLN B  1 236 ? -64.954  29.290  -79.444  1.00 47.13  ? 236  GLN B O     1 
ATOM   5462  C  CB    . GLN B  1 236 ? -67.551  31.286  -79.842  1.00 9.21   ? 236  GLN B CB    1 
ATOM   5463  C  CG    . GLN B  1 236 ? -68.427  32.265  -79.100  1.00 20.63  ? 236  GLN B CG    1 
ATOM   5464  C  CD    . GLN B  1 236 ? -68.534  31.970  -77.620  1.00 27.40  ? 236  GLN B CD    1 
ATOM   5465  O  OE1   . GLN B  1 236 ? -67.691  32.388  -76.812  1.00 34.36  ? 236  GLN B OE1   1 
ATOM   5466  N  NE2   . GLN B  1 236 ? -69.601  31.273  -77.247  1.00 33.17  ? 236  GLN B NE2   1 
ATOM   5467  N  N     . ILE B  1 237 ? -64.830  30.489  -81.346  1.00 30.15  ? 237  ILE B N     1 
ATOM   5468  C  CA    . ILE B  1 237 ? -63.991  29.518  -82.065  1.00 20.03  ? 237  ILE B CA    1 
ATOM   5469  C  C     . ILE B  1 237 ? -62.613  29.485  -81.397  1.00 29.99  ? 237  ILE B C     1 
ATOM   5470  O  O     . ILE B  1 237 ? -62.029  28.420  -81.210  1.00 28.83  ? 237  ILE B O     1 
ATOM   5471  C  CB    . ILE B  1 237 ? -63.845  29.905  -83.570  1.00 30.42  ? 237  ILE B CB    1 
ATOM   5472  C  CG1   . ILE B  1 237 ? -65.163  29.660  -84.310  1.00 27.83  ? 237  ILE B CG1   1 
ATOM   5473  C  CG2   . ILE B  1 237 ? -62.720  29.121  -84.243  1.00 25.88  ? 237  ILE B CG2   1 
ATOM   5474  C  CD1   . ILE B  1 237 ? -65.201  30.257  -85.691  1.00 48.12  ? 237  ILE B CD1   1 
ATOM   5475  N  N     . TYR B  1 238 ? -62.115  30.662  -81.023  1.00 28.97  ? 238  TYR B N     1 
ATOM   5476  C  CA    . TYR B  1 238 ? -60.832  30.816  -80.335  1.00 25.55  ? 238  TYR B CA    1 
ATOM   5477  C  C     . TYR B  1 238 ? -60.859  29.985  -79.046  1.00 33.65  ? 238  TYR B C     1 
ATOM   5478  O  O     . TYR B  1 238 ? -60.010  29.119  -78.841  1.00 35.07  ? 238  TYR B O     1 
ATOM   5479  C  CB    . TYR B  1 238 ? -60.619  32.300  -80.004  1.00 23.11  ? 238  TYR B CB    1 
ATOM   5480  C  CG    . TYR B  1 238 ? -59.334  32.666  -79.286  1.00 25.22  ? 238  TYR B CG    1 
ATOM   5481  C  CD1   . TYR B  1 238 ? -59.197  32.477  -77.908  1.00 33.76  ? 238  TYR B CD1   1 
ATOM   5482  C  CD2   . TYR B  1 238 ? -58.281  33.279  -79.972  1.00 26.26  ? 238  TYR B CD2   1 
ATOM   5483  C  CE1   . TYR B  1 238 ? -58.043  32.888  -77.227  1.00 21.45  ? 238  TYR B CE1   1 
ATOM   5484  C  CE2   . TYR B  1 238 ? -57.124  33.694  -79.304  1.00 32.35  ? 238  TYR B CE2   1 
ATOM   5485  C  CZ    . TYR B  1 238 ? -57.015  33.498  -77.929  1.00 33.30  ? 238  TYR B CZ    1 
ATOM   5486  O  OH    . TYR B  1 238 ? -55.885  33.913  -77.260  1.00 34.17  ? 238  TYR B OH    1 
ATOM   5487  N  N     . LYS B  1 239 ? -61.839  30.243  -78.181  1.00 29.44  ? 239  LYS B N     1 
ATOM   5488  C  CA    . LYS B  1 239 ? -61.949  29.492  -76.936  1.00 22.97  ? 239  LYS B CA    1 
ATOM   5489  C  C     . LYS B  1 239 ? -62.040  27.980  -77.212  1.00 33.41  ? 239  LYS B C     1 
ATOM   5490  O  O     . LYS B  1 239 ? -61.431  27.178  -76.502  1.00 36.43  ? 239  LYS B O     1 
ATOM   5491  C  CB    . LYS B  1 239 ? -63.174  29.940  -76.123  1.00 15.83  ? 239  LYS B CB    1 
ATOM   5492  C  CG    . LYS B  1 239 ? -63.106  31.302  -75.384  1.00 15.17  ? 239  LYS B CG    1 
ATOM   5493  C  CD    . LYS B  1 239 ? -64.413  31.476  -74.603  1.00 30.60  ? 239  LYS B CD    1 
ATOM   5494  C  CE    . LYS B  1 239 ? -64.527  32.741  -73.775  1.00 16.02  ? 239  LYS B CE    1 
ATOM   5495  N  NZ    . LYS B  1 239 ? -65.992  32.911  -73.472  1.00 49.18  ? 239  LYS B NZ    1 
ATOM   5496  N  N     . TYR B  1 240 ? -62.774  27.596  -78.257  1.00 33.90  ? 240  TYR B N     1 
ATOM   5497  C  CA    . TYR B  1 240 ? -62.937  26.179  -78.599  1.00 18.40  ? 240  TYR B CA    1 
ATOM   5498  C  C     . TYR B  1 240 ? -61.596  25.537  -78.939  1.00 28.94  ? 240  TYR B C     1 
ATOM   5499  O  O     . TYR B  1 240 ? -61.258  24.473  -78.411  1.00 30.82  ? 240  TYR B O     1 
ATOM   5500  C  CB    . TYR B  1 240 ? -63.924  26.009  -79.762  1.00 26.81  ? 240  TYR B CB    1 
ATOM   5501  C  CG    . TYR B  1 240 ? -64.209  24.570  -80.160  1.00 22.57  ? 240  TYR B CG    1 
ATOM   5502  C  CD1   . TYR B  1 240 ? -64.943  23.725  -79.325  1.00 23.66  ? 240  TYR B CD1   1 
ATOM   5503  C  CD2   . TYR B  1 240 ? -63.726  24.046  -81.369  1.00 15.82  ? 240  TYR B CD2   1 
ATOM   5504  C  CE1   . TYR B  1 240 ? -65.189  22.385  -79.676  1.00 20.01  ? 240  TYR B CE1   1 
ATOM   5505  C  CE2   . TYR B  1 240 ? -63.965  22.711  -81.729  1.00 24.77  ? 240  TYR B CE2   1 
ATOM   5506  C  CZ    . TYR B  1 240 ? -64.693  21.886  -80.878  1.00 31.63  ? 240  TYR B CZ    1 
ATOM   5507  O  OH    . TYR B  1 240 ? -64.883  20.558  -81.200  1.00 34.35  ? 240  TYR B OH    1 
ATOM   5508  N  N     . VAL B  1 241 ? -60.838  26.178  -79.823  1.00 25.06  ? 241  VAL B N     1 
ATOM   5509  C  CA    . VAL B  1 241 ? -59.528  25.669  -80.208  1.00 22.61  ? 241  VAL B CA    1 
ATOM   5510  C  C     . VAL B  1 241 ? -58.590  25.604  -79.005  1.00 23.46  ? 241  VAL B C     1 
ATOM   5511  O  O     . VAL B  1 241 ? -57.921  24.595  -78.797  1.00 34.09  ? 241  VAL B O     1 
ATOM   5512  C  CB    . VAL B  1 241 ? -58.894  26.523  -81.320  1.00 24.32  ? 241  VAL B CB    1 
ATOM   5513  C  CG1   . VAL B  1 241 ? -57.457  26.088  -81.575  1.00 21.66  ? 241  VAL B CG1   1 
ATOM   5514  C  CG2   . VAL B  1 241 ? -59.702  26.375  -82.587  1.00 25.12  ? 241  VAL B CG2   1 
ATOM   5515  N  N     . VAL B  1 242 ? -58.556  26.662  -78.197  1.00 24.97  ? 242  VAL B N     1 
ATOM   5516  C  CA    . VAL B  1 242 ? -57.690  26.680  -77.017  1.00 30.91  ? 242  VAL B CA    1 
ATOM   5517  C  C     . VAL B  1 242 ? -58.035  25.531  -76.072  1.00 23.30  ? 242  VAL B C     1 
ATOM   5518  O  O     . VAL B  1 242 ? -57.172  24.716  -75.732  1.00 29.24  ? 242  VAL B O     1 
ATOM   5519  C  CB    . VAL B  1 242 ? -57.783  28.017  -76.260  1.00 26.39  ? 242  VAL B CB    1 
ATOM   5520  C  CG1   . VAL B  1 242 ? -57.054  27.913  -74.936  1.00 27.52  ? 242  VAL B CG1   1 
ATOM   5521  C  CG2   . VAL B  1 242 ? -57.173  29.136  -77.099  1.00 18.54  ? 242  VAL B CG2   1 
ATOM   5522  N  N     . HIS B  1 243 ? -59.306  25.443  -75.693  1.00 24.52  ? 243  HIS B N     1 
ATOM   5523  C  CA    . HIS B  1 243 ? -59.776  24.384  -74.803  1.00 23.27  ? 243  HIS B CA    1 
ATOM   5524  C  C     . HIS B  1 243 ? -59.433  22.988  -75.330  1.00 24.75  ? 243  HIS B C     1 
ATOM   5525  O  O     . HIS B  1 243 ? -58.826  22.178  -74.630  1.00 32.81  ? 243  HIS B O     1 
ATOM   5526  C  CB    . HIS B  1 243 ? -61.285  24.506  -74.596  1.00 16.14  ? 243  HIS B CB    1 
ATOM   5527  C  CG    . HIS B  1 243 ? -61.678  25.500  -73.549  1.00 18.22  ? 243  HIS B CG    1 
ATOM   5528  N  ND1   . HIS B  1 243 ? -62.764  26.342  -73.692  1.00 35.11  ? 243  HIS B ND1   1 
ATOM   5529  C  CD2   . HIS B  1 243 ? -61.173  25.752  -72.319  1.00 15.64  ? 243  HIS B CD2   1 
ATOM   5530  C  CE1   . HIS B  1 243 ? -62.910  27.061  -72.593  1.00 22.56  ? 243  HIS B CE1   1 
ATOM   5531  N  NE2   . HIS B  1 243 ? -61.956  26.721  -71.745  1.00 24.94  ? 243  HIS B NE2   1 
ATOM   5532  N  N     . ASN B  1 244 ? -59.745  22.738  -76.596  1.00 29.56  ? 244  ASN B N     1 
ATOM   5533  C  CA    . ASN B  1 244 ? -59.485  21.433  -77.189  1.00 19.40  ? 244  ASN B CA    1 
ATOM   5534  C  C     . ASN B  1 244 ? -58.059  21.060  -77.582  1.00 25.94  ? 244  ASN B C     1 
ATOM   5535  O  O     . ASN B  1 244 ? -57.709  19.877  -77.581  1.00 32.37  ? 244  ASN B O     1 
ATOM   5536  C  CB    . ASN B  1 244 ? -60.453  21.181  -78.325  1.00 11.91  ? 244  ASN B CB    1 
ATOM   5537  C  CG    . ASN B  1 244 ? -61.837  20.872  -77.821  1.00 36.87  ? 244  ASN B CG    1 
ATOM   5538  O  OD1   . ASN B  1 244 ? -62.672  21.770  -77.668  1.00 25.70  ? 244  ASN B OD1   1 
ATOM   5539  N  ND2   . ASN B  1 244 ? -62.073  19.599  -77.497  1.00 21.79  ? 244  ASN B ND2   1 
ATOM   5540  N  N     . VAL B  1 245 ? -57.240  22.033  -77.962  1.00 31.73  ? 245  VAL B N     1 
ATOM   5541  C  CA    . VAL B  1 245 ? -55.855  21.709  -78.288  1.00 24.48  ? 245  VAL B CA    1 
ATOM   5542  C  C     . VAL B  1 245 ? -55.167  21.414  -76.961  1.00 28.54  ? 245  VAL B C     1 
ATOM   5543  O  O     . VAL B  1 245 ? -54.398  20.460  -76.847  1.00 26.03  ? 245  VAL B O     1 
ATOM   5544  C  CB    . VAL B  1 245 ? -55.157  22.853  -79.012  1.00 19.81  ? 245  VAL B CB    1 
ATOM   5545  C  CG1   . VAL B  1 245 ? -53.668  22.599  -79.075  1.00 25.53  ? 245  VAL B CG1   1 
ATOM   5546  C  CG2   . VAL B  1 245 ? -55.729  22.983  -80.408  1.00 29.72  ? 245  VAL B CG2   1 
ATOM   5547  N  N     . ALA B  1 246 ? -55.518  22.195  -75.939  1.00 19.42  ? 246  ALA B N     1 
ATOM   5548  C  CA    . ALA B  1 246 ? -54.966  22.005  -74.608  1.00 26.73  ? 246  ALA B CA    1 
ATOM   5549  C  C     . ALA B  1 246 ? -55.276  20.583  -74.169  1.00 22.93  ? 246  ALA B C     1 
ATOM   5550  O  O     . ALA B  1 246 ? -54.390  19.831  -73.781  1.00 30.77  ? 246  ALA B O     1 
ATOM   5551  C  CB    . ALA B  1 246 ? -55.591  22.999  -73.631  1.00 15.84  ? 246  ALA B CB    1 
ATOM   5552  N  N     . HIS B  1 247 ? -56.544  20.211  -74.298  1.00 27.58  ? 247  HIS B N     1 
ATOM   5553  C  CA    . HIS B  1 247 ? -57.005  18.893  -73.910  1.00 22.14  ? 247  HIS B CA    1 
ATOM   5554  C  C     . HIS B  1 247 ? -56.239  17.810  -74.637  1.00 23.54  ? 247  HIS B C     1 
ATOM   5555  O  O     . HIS B  1 247 ? -55.731  16.883  -74.024  1.00 35.52  ? 247  HIS B O     1 
ATOM   5556  C  CB    . HIS B  1 247 ? -58.489  18.762  -74.215  1.00 24.47  ? 247  HIS B CB    1 
ATOM   5557  C  CG    . HIS B  1 247 ? -59.101  17.523  -73.660  1.00 30.90  ? 247  HIS B CG    1 
ATOM   5558  N  ND1   . HIS B  1 247 ? -59.418  17.388  -72.324  1.00 54.48  ? 247  HIS B ND1   1 
ATOM   5559  C  CD2   . HIS B  1 247 ? -59.437  16.352  -74.248  1.00 37.06  ? 247  HIS B CD2   1 
ATOM   5560  C  CE1   . HIS B  1 247 ? -59.925  16.188  -72.114  1.00 28.35  ? 247  HIS B CE1   1 
ATOM   5561  N  NE2   . HIS B  1 247 ? -59.947  15.540  -73.263  1.00 38.37  ? 247  HIS B NE2   1 
ATOM   5562  N  N     . ARG B  1 248 ? -56.135  17.968  -75.949  1.00 38.46  ? 248  ARG B N     1 
ATOM   5563  C  CA    . ARG B  1 248 ? -55.450  17.030  -76.820  1.00 30.04  ? 248  ARG B CA    1 
ATOM   5564  C  C     . ARG B  1 248 ? -53.948  16.899  -76.441  1.00 24.66  ? 248  ARG B C     1 
ATOM   5565  O  O     . ARG B  1 248 ? -53.321  15.907  -76.767  1.00 33.79  ? 248  ARG B O     1 
ATOM   5566  C  CB    . ARG B  1 248 ? -55.655  17.488  -78.273  1.00 30.61  ? 248  ARG B CB    1 
ATOM   5567  C  CG    . ARG B  1 248 ? -55.622  16.409  -79.335  1.00 73.64  ? 248  ARG B CG    1 
ATOM   5568  C  CD    . ARG B  1 248 ? -54.724  16.826  -80.519  1.00 89.01  ? 248  ARG B CD    1 
ATOM   5569  N  NE    . ARG B  1 248 ? -55.432  17.497  -81.616  1.00 95.86  ? 248  ARG B NE    1 
ATOM   5570  C  CZ    . ARG B  1 248 ? -54.875  18.398  -82.429  1.00 94.09  ? 248  ARG B CZ    1 
ATOM   5571  N  NH1   . ARG B  1 248 ? -55.585  18.950  -83.416  1.00 59.94  ? 248  ARG B NH1   1 
ATOM   5572  N  NH2   . ARG B  1 248 ? -53.614  18.778  -82.235  1.00 95.43  ? 248  ARG B NH2   1 
ATOM   5573  N  N     . PHE B  1 249 ? -53.390  17.867  -75.713  1.00 27.42  ? 249  PHE B N     1 
ATOM   5574  C  CA    . PHE B  1 249 ? -51.972  17.819  -75.290  1.00 27.07  ? 249  PHE B CA    1 
ATOM   5575  C  C     . PHE B  1 249 ? -51.805  17.420  -73.826  1.00 29.79  ? 249  PHE B C     1 
ATOM   5576  O  O     . PHE B  1 249 ? -50.719  17.590  -73.262  1.00 31.87  ? 249  PHE B O     1 
ATOM   5577  C  CB    . PHE B  1 249 ? -51.295  19.191  -75.416  1.00 21.77  ? 249  PHE B CB    1 
ATOM   5578  C  CG    . PHE B  1 249 ? -50.718  19.478  -76.765  1.00 36.58  ? 249  PHE B CG    1 
ATOM   5579  C  CD1   . PHE B  1 249 ? -49.377  19.812  -76.888  1.00 24.95  ? 249  PHE B CD1   1 
ATOM   5580  C  CD2   . PHE B  1 249 ? -51.514  19.466  -77.907  1.00 50.07  ? 249  PHE B CD2   1 
ATOM   5581  C  CE1   . PHE B  1 249 ? -48.835  20.134  -78.127  1.00 24.69  ? 249  PHE B CE1   1 
ATOM   5582  C  CE2   . PHE B  1 249 ? -50.980  19.785  -79.154  1.00 41.62  ? 249  PHE B CE2   1 
ATOM   5583  C  CZ    . PHE B  1 249 ? -49.637  20.122  -79.261  1.00 29.28  ? 249  PHE B CZ    1 
ATOM   5584  N  N     . GLY B  1 250 ? -52.887  16.988  -73.186  1.00 29.70  ? 250  GLY B N     1 
ATOM   5585  C  CA    . GLY B  1 250 ? -52.811  16.603  -71.785  1.00 22.64  ? 250  GLY B CA    1 
ATOM   5586  C  C     . GLY B  1 250 ? -52.841  17.769  -70.812  1.00 25.67  ? 250  GLY B C     1 
ATOM   5587  O  O     . GLY B  1 250 ? -52.354  17.662  -69.689  1.00 31.66  ? 250  GLY B O     1 
ATOM   5588  N  N     . LYS B  1 251 ? -53.376  18.897  -71.263  1.00 33.75  ? 251  LYS B N     1 
ATOM   5589  C  CA    . LYS B  1 251 ? -53.498  20.088  -70.431  1.00 17.65  ? 251  LYS B CA    1 
ATOM   5590  C  C     . LYS B  1 251 ? -54.980  20.412  -70.270  1.00 32.42  ? 251  LYS B C     1 
ATOM   5591  O  O     . LYS B  1 251 ? -55.877  19.720  -70.790  1.00 31.17  ? 251  LYS B O     1 
ATOM   5592  C  CB    . LYS B  1 251 ? -52.830  21.301  -71.079  1.00 29.71  ? 251  LYS B CB    1 
ATOM   5593  C  CG    . LYS B  1 251 ? -51.451  21.075  -71.642  1.00 21.27  ? 251  LYS B CG    1 
ATOM   5594  C  CD    . LYS B  1 251 ? -50.409  20.990  -70.578  1.00 19.74  ? 251  LYS B CD    1 
ATOM   5595  C  CE    . LYS B  1 251 ? -49.989  22.353  -70.120  1.00 26.18  ? 251  LYS B CE    1 
ATOM   5596  N  NZ    . LYS B  1 251 ? -48.906  22.168  -69.119  1.00 27.74  ? 251  LYS B NZ    1 
ATOM   5597  N  N     . THR B  1 252 ? -55.227  21.491  -69.549  1.00 19.47  ? 252  THR B N     1 
ATOM   5598  C  CA    . THR B  1 252 ? -56.575  21.957  -69.306  1.00 22.50  ? 252  THR B CA    1 
ATOM   5599  C  C     . THR B  1 252 ? -56.455  23.473  -69.303  1.00 18.41  ? 252  THR B C     1 
ATOM   5600  O  O     . THR B  1 252 ? -55.592  24.038  -68.630  1.00 31.98  ? 252  THR B O     1 
ATOM   5601  C  CB    . THR B  1 252 ? -57.118  21.409  -67.969  1.00 19.02  ? 252  THR B CB    1 
ATOM   5602  O  OG1   . THR B  1 252 ? -58.360  22.041  -67.659  1.00 23.47  ? 252  THR B OG1   1 
ATOM   5603  C  CG2   . THR B  1 252 ? -56.126  21.640  -66.850  1.00 10.97  ? 252  THR B CG2   1 
ATOM   5604  N  N     . ALA B  1 253 ? -57.243  24.121  -70.148  1.00 26.26  ? 253  ALA B N     1 
ATOM   5605  C  CA    . ALA B  1 253 ? -57.196  25.574  -70.263  1.00 23.62  ? 253  ALA B CA    1 
ATOM   5606  C  C     . ALA B  1 253 ? -58.352  26.267  -69.595  1.00 17.89  ? 253  ALA B C     1 
ATOM   5607  O  O     . ALA B  1 253 ? -59.474  25.743  -69.560  1.00 28.87  ? 253  ALA B O     1 
ATOM   5608  C  CB    . ALA B  1 253 ? -57.163  25.975  -71.730  1.00 21.80  ? 253  ALA B CB    1 
ATOM   5609  N  N     . THR B  1 254 ? -58.080  27.453  -69.059  1.00 12.23  ? 254  THR B N     1 
ATOM   5610  C  CA    . THR B  1 254 ? -59.143  28.232  -68.437  1.00 18.27  ? 254  THR B CA    1 
ATOM   5611  C  C     . THR B  1 254 ? -59.057  29.686  -68.836  1.00 19.05  ? 254  THR B C     1 
ATOM   5612  O  O     . THR B  1 254 ? -57.971  30.228  -69.058  1.00 24.42  ? 254  THR B O     1 
ATOM   5613  C  CB    . THR B  1 254 ? -59.162  28.132  -66.890  1.00 20.84  ? 254  THR B CB    1 
ATOM   5614  O  OG1   . THR B  1 254 ? -60.265  28.892  -66.376  1.00 22.68  ? 254  THR B OG1   1 
ATOM   5615  C  CG2   . THR B  1 254 ? -57.894  28.682  -66.299  1.00 10.78  ? 254  THR B CG2   1 
ATOM   5616  N  N     . PHE B  1 255 ? -60.226  30.286  -68.995  1.00 23.39  ? 255  PHE B N     1 
ATOM   5617  C  CA    . PHE B  1 255 ? -60.315  31.682  -69.330  1.00 18.98  ? 255  PHE B CA    1 
ATOM   5618  C  C     . PHE B  1 255 ? -60.748  32.501  -68.123  1.00 17.98  ? 255  PHE B C     1 
ATOM   5619  O  O     . PHE B  1 255 ? -61.115  33.655  -68.271  1.00 31.33  ? 255  PHE B O     1 
ATOM   5620  C  CB    . PHE B  1 255 ? -61.247  31.876  -70.511  1.00 10.38  ? 255  PHE B CB    1 
ATOM   5621  C  CG    . PHE B  1 255 ? -60.635  31.473  -71.812  1.00 20.97  ? 255  PHE B CG    1 
ATOM   5622  C  CD1   . PHE B  1 255 ? -59.801  32.351  -72.495  1.00 16.97  ? 255  PHE B CD1   1 
ATOM   5623  C  CD2   . PHE B  1 255 ? -60.862  30.209  -72.341  1.00 21.07  ? 255  PHE B CD2   1 
ATOM   5624  C  CE1   . PHE B  1 255 ? -59.199  31.975  -73.694  1.00 23.57  ? 255  PHE B CE1   1 
ATOM   5625  C  CE2   . PHE B  1 255 ? -60.264  29.821  -73.541  1.00 17.20  ? 255  PHE B CE2   1 
ATOM   5626  C  CZ    . PHE B  1 255 ? -59.431  30.705  -74.217  1.00 15.55  ? 255  PHE B CZ    1 
ATOM   5627  N  N     . MET B  1 256 ? -60.719  31.896  -66.933  1.00 22.87  ? 256  MET B N     1 
ATOM   5628  C  CA    . MET B  1 256 ? -61.062  32.597  -65.695  1.00 16.46  ? 256  MET B CA    1 
ATOM   5629  C  C     . MET B  1 256 ? -60.186  33.832  -65.612  1.00 27.70  ? 256  MET B C     1 
ATOM   5630  O  O     . MET B  1 256 ? -58.974  33.774  -65.869  1.00 30.44  ? 256  MET B O     1 
ATOM   5631  C  CB    . MET B  1 256 ? -60.668  31.801  -64.462  1.00 21.09  ? 256  MET B CB    1 
ATOM   5632  C  CG    . MET B  1 256 ? -61.500  30.650  -64.082  1.00 40.97  ? 256  MET B CG    1 
ATOM   5633  S  SD    . MET B  1 256 ? -60.673  30.018  -62.637  1.00 29.69  ? 256  MET B SD    1 
ATOM   5634  C  CE    . MET B  1 256 ? -61.470  31.001  -61.380  1.00 9.72   ? 256  MET B CE    1 
ATOM   5635  N  N     . PRO B  1 257 ? -60.750  34.932  -65.122  1.00 19.02  ? 257  PRO B N     1 
ATOM   5636  C  CA    . PRO B  1 257 ? -60.008  36.185  -64.992  1.00 20.88  ? 257  PRO B CA    1 
ATOM   5637  C  C     . PRO B  1 257 ? -58.855  36.139  -63.973  1.00 31.41  ? 257  PRO B C     1 
ATOM   5638  O  O     . PRO B  1 257 ? -57.770  36.666  -64.239  1.00 29.79  ? 257  PRO B O     1 
ATOM   5639  C  CB    . PRO B  1 257 ? -61.092  37.175  -64.556  1.00 18.11  ? 257  PRO B CB    1 
ATOM   5640  C  CG    . PRO B  1 257 ? -62.369  36.547  -65.041  1.00 36.77  ? 257  PRO B CG    1 
ATOM   5641  C  CD    . PRO B  1 257 ? -62.162  35.108  -64.752  1.00 16.27  ? 257  PRO B CD    1 
ATOM   5642  N  N     . LYS B  1 258 ? -59.066  35.470  -62.837  1.00 25.41  ? 258  LYS B N     1 
ATOM   5643  C  CA    . LYS B  1 258 ? -58.050  35.437  -61.785  1.00 16.01  ? 258  LYS B CA    1 
ATOM   5644  C  C     . LYS B  1 258 ? -57.954  34.099  -61.046  1.00 28.34  ? 258  LYS B C     1 
ATOM   5645  O  O     . LYS B  1 258 ? -58.490  33.934  -59.950  1.00 21.46  ? 258  LYS B O     1 
ATOM   5646  C  CB    . LYS B  1 258 ? -58.362  36.547  -60.781  1.00 16.55  ? 258  LYS B CB    1 
ATOM   5647  C  CG    . LYS B  1 258 ? -57.285  36.846  -59.755  1.00 18.13  ? 258  LYS B CG    1 
ATOM   5648  C  CD    . LYS B  1 258 ? -56.121  37.628  -60.348  1.00 32.53  ? 258  LYS B CD    1 
ATOM   5649  C  CE    . LYS B  1 258 ? -55.254  38.211  -59.233  1.00 19.73  ? 258  LYS B CE    1 
ATOM   5650  N  NZ    . LYS B  1 258 ? -54.030  38.897  -59.727  1.00 23.41  ? 258  LYS B NZ    1 
ATOM   5651  N  N     . PRO B  1 259 ? -57.254  33.124  -61.634  1.00 27.27  ? 259  PRO B N     1 
ATOM   5652  C  CA    . PRO B  1 259 ? -57.138  31.831  -60.956  1.00 25.15  ? 259  PRO B CA    1 
ATOM   5653  C  C     . PRO B  1 259 ? -56.233  31.841  -59.719  1.00 18.96  ? 259  PRO B C     1 
ATOM   5654  O  O     . PRO B  1 259 ? -56.451  31.077  -58.774  1.00 28.69  ? 259  PRO B O     1 
ATOM   5655  C  CB    . PRO B  1 259 ? -56.587  30.919  -62.060  1.00 18.71  ? 259  PRO B CB    1 
ATOM   5656  C  CG    . PRO B  1 259 ? -55.818  31.854  -62.936  1.00 17.77  ? 259  PRO B CG    1 
ATOM   5657  C  CD    . PRO B  1 259 ? -56.714  33.062  -63.006  1.00 16.24  ? 259  PRO B CD    1 
ATOM   5658  N  N     . MET B  1 260 ? -55.247  32.735  -59.714  1.00 24.13  ? 260  MET B N     1 
ATOM   5659  C  CA    . MET B  1 260 ? -54.285  32.823  -58.612  1.00 18.36  ? 260  MET B CA    1 
ATOM   5660  C  C     . MET B  1 260 ? -54.081  34.200  -58.004  1.00 20.20  ? 260  MET B C     1 
ATOM   5661  O  O     . MET B  1 260 ? -53.939  35.193  -58.711  1.00 26.31  ? 260  MET B O     1 
ATOM   5662  C  CB    . MET B  1 260 ? -52.906  32.344  -59.070  1.00 11.81  ? 260  MET B CB    1 
ATOM   5663  C  CG    . MET B  1 260 ? -52.828  30.900  -59.498  1.00 19.51  ? 260  MET B CG    1 
ATOM   5664  S  SD    . MET B  1 260 ? -51.236  30.514  -60.244  1.00 27.28  ? 260  MET B SD    1 
ATOM   5665  C  CE    . MET B  1 260 ? -51.448  31.298  -61.838  1.00 12.09  ? 260  MET B CE    1 
ATOM   5666  N  N     . PHE B  1 261 ? -54.017  34.241  -56.680  1.00 20.56  ? 261  PHE B N     1 
ATOM   5667  C  CA    . PHE B  1 261 ? -53.747  35.479  -55.988  1.00 14.87  ? 261  PHE B CA    1 
ATOM   5668  C  C     . PHE B  1 261 ? -52.226  35.650  -56.002  1.00 26.89  ? 261  PHE B C     1 
ATOM   5669  O  O     . PHE B  1 261 ? -51.480  34.714  -55.691  1.00 36.61  ? 261  PHE B O     1 
ATOM   5670  C  CB    . PHE B  1 261 ? -54.222  35.419  -54.531  1.00 24.99  ? 261  PHE B CB    1 
ATOM   5671  C  CG    . PHE B  1 261 ? -53.722  36.569  -53.698  1.00 36.44  ? 261  PHE B CG    1 
ATOM   5672  C  CD1   . PHE B  1 261 ? -54.284  37.835  -53.829  1.00 36.67  ? 261  PHE B CD1   1 
ATOM   5673  C  CD2   . PHE B  1 261 ? -52.628  36.412  -52.853  1.00 47.51  ? 261  PHE B CD2   1 
ATOM   5674  C  CE1   . PHE B  1 261 ? -53.760  38.934  -53.139  1.00 37.79  ? 261  PHE B CE1   1 
ATOM   5675  C  CE2   . PHE B  1 261 ? -52.098  37.507  -52.161  1.00 45.70  ? 261  PHE B CE2   1 
ATOM   5676  C  CZ    . PHE B  1 261 ? -52.668  38.767  -52.309  1.00 41.03  ? 261  PHE B CZ    1 
ATOM   5677  N  N     . GLY B  1 262 ? -51.756  36.836  -56.371  1.00 30.50  ? 262  GLY B N     1 
ATOM   5678  C  CA    . GLY B  1 262 ? -50.325  37.059  -56.353  1.00 27.19  ? 262  GLY B CA    1 
ATOM   5679  C  C     . GLY B  1 262 ? -49.645  37.042  -57.694  1.00 36.32  ? 262  GLY B C     1 
ATOM   5680  O  O     . GLY B  1 262 ? -48.432  37.212  -57.768  1.00 42.12  ? 262  GLY B O     1 
ATOM   5681  N  N     . ASP B  1 263 ? -50.392  36.723  -58.738  1.00 32.51  ? 263  ASP B N     1 
ATOM   5682  C  CA    . ASP B  1 263 ? -49.828  36.743  -60.069  1.00 22.62  ? 263  ASP B CA    1 
ATOM   5683  C  C     . ASP B  1 263 ? -50.884  37.308  -60.988  1.00 29.45  ? 263  ASP B C     1 
ATOM   5684  O  O     . ASP B  1 263 ? -52.026  37.514  -60.586  1.00 35.83  ? 263  ASP B O     1 
ATOM   5685  C  CB    . ASP B  1 263 ? -49.346  35.365  -60.540  1.00 27.00  ? 263  ASP B CB    1 
ATOM   5686  C  CG    . ASP B  1 263 ? -48.112  35.454  -61.458  1.00 39.84  ? 263  ASP B CG    1 
ATOM   5687  O  OD1   . ASP B  1 263 ? -47.315  34.495  -61.510  1.00 46.07  ? 263  ASP B OD1   1 
ATOM   5688  O  OD2   . ASP B  1 263 ? -47.913  36.489  -62.124  1.00 33.71  ? 263  ASP B OD2   1 
ATOM   5689  N  N     . ASN B  1 264 ? -50.452  37.642  -62.194  1.00 31.14  ? 264  ASN B N     1 
ATOM   5690  C  CA    . ASN B  1 264 ? -51.288  38.210  -63.237  1.00 26.67  ? 264  ASN B CA    1 
ATOM   5691  C  C     . ASN B  1 264 ? -52.623  37.512  -63.450  1.00 31.51  ? 264  ASN B C     1 
ATOM   5692  O  O     . ASN B  1 264 ? -52.720  36.283  -63.351  1.00 35.64  ? 264  ASN B O     1 
ATOM   5693  C  CB    . ASN B  1 264 ? -50.526  38.117  -64.552  1.00 49.03  ? 264  ASN B CB    1 
ATOM   5694  C  CG    . ASN B  1 264 ? -50.327  39.446  -65.214  1.00 53.49  ? 264  ASN B CG    1 
ATOM   5695  O  OD1   . ASN B  1 264 ? -50.447  39.553  -66.443  1.00 65.67  ? 264  ASN B OD1   1 
ATOM   5696  N  ND2   . ASN B  1 264 ? -49.969  40.463  -64.422  1.00 31.95  ? 264  ASN B ND2   1 
ATOM   5697  N  N     . GLY B  1 265 ? -53.648  38.305  -63.755  1.00 28.73  ? 265  GLY B N     1 
ATOM   5698  C  CA    . GLY B  1 265 ? -54.950  37.744  -64.071  1.00 18.04  ? 265  GLY B CA    1 
ATOM   5699  C  C     . GLY B  1 265 ? -55.002  37.714  -65.596  1.00 25.40  ? 265  GLY B C     1 
ATOM   5700  O  O     . GLY B  1 265 ? -54.047  38.122  -66.263  1.00 36.41  ? 265  GLY B O     1 
ATOM   5701  N  N     . SER B  1 266 ? -56.082  37.203  -66.168  1.00 25.67  ? 266  SER B N     1 
ATOM   5702  C  CA    . SER B  1 266 ? -56.199  37.190  -67.617  1.00 26.01  ? 266  SER B CA    1 
ATOM   5703  C  C     . SER B  1 266 ? -57.223  38.247  -68.020  1.00 33.37  ? 266  SER B C     1 
ATOM   5704  O  O     . SER B  1 266 ? -58.327  38.292  -67.482  1.00 33.54  ? 266  SER B O     1 
ATOM   5705  C  CB    . SER B  1 266 ? -56.641  35.816  -68.118  1.00 15.15  ? 266  SER B CB    1 
ATOM   5706  O  OG    . SER B  1 266 ? -55.620  34.862  -67.927  1.00 27.89  ? 266  SER B OG    1 
ATOM   5707  N  N     . GLY B  1 267 ? -56.843  39.123  -68.938  1.00 35.84  ? 267  GLY B N     1 
ATOM   5708  C  CA    . GLY B  1 267 ? -57.773  40.136  -69.379  1.00 23.45  ? 267  GLY B CA    1 
ATOM   5709  C  C     . GLY B  1 267 ? -58.116  39.965  -70.839  1.00 30.85  ? 267  GLY B C     1 
ATOM   5710  O  O     . GLY B  1 267 ? -57.607  39.067  -71.510  1.00 31.09  ? 267  GLY B O     1 
ATOM   5711  N  N     . MET B  1 268 ? -59.042  40.784  -71.316  1.00 33.53  ? 268  MET B N     1 
ATOM   5712  C  CA    . MET B  1 268 ? -59.413  40.754  -72.718  1.00 31.90  ? 268  MET B CA    1 
ATOM   5713  C  C     . MET B  1 268 ? -59.580  42.177  -73.200  1.00 30.92  ? 268  MET B C     1 
ATOM   5714  O  O     . MET B  1 268 ? -60.705  42.662  -73.347  1.00 36.90  ? 268  MET B O     1 
ATOM   5715  C  CB    . MET B  1 268 ? -60.704  39.976  -72.949  1.00 28.75  ? 268  MET B CB    1 
ATOM   5716  C  CG    . MET B  1 268 ? -61.040  39.894  -74.414  1.00 17.34  ? 268  MET B CG    1 
ATOM   5717  S  SD    . MET B  1 268 ? -62.277  38.675  -74.795  1.00 28.70  ? 268  MET B SD    1 
ATOM   5718  C  CE    . MET B  1 268 ? -63.732  39.476  -74.152  1.00 19.26  ? 268  MET B CE    1 
ATOM   5719  N  N     . HIS B  1 269 ? -58.455  42.865  -73.394  1.00 34.51  ? 269  HIS B N     1 
ATOM   5720  C  CA    . HIS B  1 269 ? -58.487  44.242  -73.875  1.00 30.54  ? 269  HIS B CA    1 
ATOM   5721  C  C     . HIS B  1 269 ? -59.302  44.250  -75.166  1.00 35.94  ? 269  HIS B C     1 
ATOM   5722  O  O     . HIS B  1 269 ? -59.279  43.288  -75.944  1.00 30.69  ? 269  HIS B O     1 
ATOM   5723  C  CB    . HIS B  1 269 ? -57.084  44.761  -74.213  1.00 30.38  ? 269  HIS B CB    1 
ATOM   5724  C  CG    . HIS B  1 269 ? -56.113  44.761  -73.069  1.00 44.81  ? 269  HIS B CG    1 
ATOM   5725  N  ND1   . HIS B  1 269 ? -54.746  44.844  -73.265  1.00 29.89  ? 269  HIS B ND1   1 
ATOM   5726  C  CD2   . HIS B  1 269 ? -56.293  44.699  -71.729  1.00 25.07  ? 269  HIS B CD2   1 
ATOM   5727  C  CE1   . HIS B  1 269 ? -54.135  44.828  -72.097  1.00 43.47  ? 269  HIS B CE1   1 
ATOM   5728  N  NE2   . HIS B  1 269 ? -55.053  44.742  -71.146  1.00 37.85  ? 269  HIS B NE2   1 
ATOM   5729  N  N     . CYS B  1 270 ? -60.051  45.321  -75.379  1.00 37.07  ? 270  CYS B N     1 
ATOM   5730  C  CA    . CYS B  1 270 ? -60.838  45.427  -76.590  1.00 32.75  ? 270  CYS B CA    1 
ATOM   5731  C  C     . CYS B  1 270 ? -60.493  46.672  -77.394  1.00 42.17  ? 270  CYS B C     1 
ATOM   5732  O  O     . CYS B  1 270 ? -60.776  47.798  -76.968  1.00 33.17  ? 270  CYS B O     1 
ATOM   5733  C  CB    . CYS B  1 270 ? -62.319  45.422  -76.259  1.00 28.09  ? 270  CYS B CB    1 
ATOM   5734  S  SG    . CYS B  1 270 ? -62.894  43.861  -75.704  1.00 30.29  ? 270  CYS B SG    1 
ATOM   5735  N  N     . HIS B  1 271 ? -59.818  46.458  -78.520  1.00 44.03  ? 271  HIS B N     1 
ATOM   5736  C  CA    . HIS B  1 271 ? -59.455  47.538  -79.430  1.00 43.89  ? 271  HIS B CA    1 
ATOM   5737  C  C     . HIS B  1 271 ? -60.694  47.765  -80.295  1.00 44.30  ? 271  HIS B C     1 
ATOM   5738  O  O     . HIS B  1 271 ? -61.312  46.810  -80.764  1.00 49.50  ? 271  HIS B O     1 
ATOM   5739  C  CB    . HIS B  1 271 ? -58.282  47.132  -80.331  1.00 39.61  ? 271  HIS B CB    1 
ATOM   5740  C  CG    . HIS B  1 271 ? -56.962  47.032  -79.627  1.00 37.82  ? 271  HIS B CG    1 
ATOM   5741  N  ND1   . HIS B  1 271 ? -56.111  48.108  -79.482  1.00 45.57  ? 271  HIS B ND1   1 
ATOM   5742  C  CD2   . HIS B  1 271 ? -56.321  45.975  -79.076  1.00 55.88  ? 271  HIS B CD2   1 
ATOM   5743  C  CE1   . HIS B  1 271 ? -55.005  47.715  -78.878  1.00 41.16  ? 271  HIS B CE1   1 
ATOM   5744  N  NE2   . HIS B  1 271 ? -55.105  46.427  -78.620  1.00 50.80  ? 271  HIS B NE2   1 
ATOM   5745  N  N     . MET B  1 272 ? -61.060  49.025  -80.494  1.00 57.76  ? 272  MET B N     1 
ATOM   5746  C  CA    . MET B  1 272 ? -62.241  49.362  -81.288  1.00 55.82  ? 272  MET B CA    1 
ATOM   5747  C  C     . MET B  1 272 ? -62.092  50.631  -82.118  1.00 57.72  ? 272  MET B C     1 
ATOM   5748  O  O     . MET B  1 272 ? -61.342  51.546  -81.760  1.00 52.84  ? 272  MET B O     1 
ATOM   5749  C  CB    . MET B  1 272 ? -63.438  49.585  -80.374  1.00 35.96  ? 272  MET B CB    1 
ATOM   5750  C  CG    . MET B  1 272 ? -63.847  48.426  -79.539  1.00 43.57  ? 272  MET B CG    1 
ATOM   5751  S  SD    . MET B  1 272 ? -65.131  48.980  -78.424  1.00 46.44  ? 272  MET B SD    1 
ATOM   5752  C  CE    . MET B  1 272 ? -64.123  49.692  -77.157  1.00 21.71  ? 272  MET B CE    1 
ATOM   5753  N  N     . SER B  1 273 ? -62.878  50.694  -83.190  1.00 58.76  ? 273  SER B N     1 
ATOM   5754  C  CA    . SER B  1 273 ? -62.929  51.846  -84.090  1.00 57.63  ? 273  SER B CA    1 
ATOM   5755  C  C     . SER B  1 273 ? -64.166  51.712  -84.972  1.00 54.04  ? 273  SER B C     1 
ATOM   5756  O  O     . SER B  1 273 ? -64.693  50.610  -85.152  1.00 55.90  ? 273  SER B O     1 
ATOM   5757  C  CB    . SER B  1 273 ? -61.670  51.945  -84.963  1.00 38.95  ? 273  SER B CB    1 
ATOM   5758  O  OG    . SER B  1 273 ? -61.755  51.107  -86.098  1.00 73.28  ? 273  SER B OG    1 
ATOM   5759  N  N     . LEU B  1 274 ? -64.655  52.843  -85.474  1.00 56.39  ? 274  LEU B N     1 
ATOM   5760  C  CA    . LEU B  1 274 ? -65.814  52.850  -86.360  1.00 46.15  ? 274  LEU B CA    1 
ATOM   5761  C  C     . LEU B  1 274 ? -65.379  53.257  -87.763  1.00 42.66  ? 274  LEU B C     1 
ATOM   5762  O  O     . LEU B  1 274 ? -64.333  53.890  -87.942  1.00 52.75  ? 274  LEU B O     1 
ATOM   5763  C  CB    . LEU B  1 274 ? -66.877  53.807  -85.838  1.00 41.30  ? 274  LEU B CB    1 
ATOM   5764  C  CG    . LEU B  1 274 ? -67.527  53.354  -84.539  1.00 40.67  ? 274  LEU B CG    1 
ATOM   5765  C  CD1   . LEU B  1 274 ? -68.415  54.449  -83.999  1.00 45.52  ? 274  LEU B CD1   1 
ATOM   5766  C  CD2   . LEU B  1 274 ? -68.323  52.089  -84.796  1.00 48.68  ? 274  LEU B CD2   1 
ATOM   5767  N  N     . ALA B  1 275 ? -66.166  52.883  -88.763  1.00 43.90  ? 275  ALA B N     1 
ATOM   5768  C  CA    . ALA B  1 275 ? -65.814  53.236  -90.129  1.00 55.63  ? 275  ALA B CA    1 
ATOM   5769  C  C     . ALA B  1 275 ? -67.016  53.480  -91.030  1.00 63.98  ? 275  ALA B C     1 
ATOM   5770  O  O     . ALA B  1 275 ? -68.118  52.986  -90.770  1.00 63.60  ? 275  ALA B O     1 
ATOM   5771  C  CB    . ALA B  1 275 ? -64.915  52.172  -90.722  1.00 44.77  ? 275  ALA B CB    1 
ATOM   5772  N  N     . LYS B  1 276 ? -66.790  54.271  -92.077  1.00 70.17  ? 276  LYS B N     1 
ATOM   5773  C  CA    . LYS B  1 276 ? -67.823  54.614  -93.053  1.00 67.70  ? 276  LYS B CA    1 
ATOM   5774  C  C     . LYS B  1 276 ? -67.143  54.745  -94.410  1.00 70.81  ? 276  LYS B C     1 
ATOM   5775  O  O     . LYS B  1 276 ? -66.168  55.494  -94.554  1.00 62.55  ? 276  LYS B O     1 
ATOM   5776  C  CB    . LYS B  1 276 ? -68.506  55.932  -92.670  1.00 58.79  ? 276  LYS B CB    1 
ATOM   5777  C  CG    . LYS B  1 276 ? -69.899  56.166  -93.266  1.00 65.24  ? 276  LYS B CG    1 
ATOM   5778  C  CD    . LYS B  1 276 ? -70.472  57.498  -92.745  1.00 78.63  ? 276  LYS B CD    1 
ATOM   5779  C  CE    . LYS B  1 276 ? -71.864  57.814  -93.282  1.00 73.99  ? 276  LYS B CE    1 
ATOM   5780  N  NZ    . LYS B  1 276 ? -72.905  56.892  -92.749  1.00 76.75  ? 276  LYS B NZ    1 
ATOM   5781  N  N     . ASN B  1 277 ? -67.625  53.957  -95.373  1.00 81.57  ? 277  ASN B N     1 
ATOM   5782  C  CA    . ASN B  1 277 ? -67.104  53.936  -96.743  1.00 81.07  ? 277  ASN B CA    1 
ATOM   5783  C  C     . ASN B  1 277 ? -65.592  53.819  -96.741  1.00 83.14  ? 277  ASN B C     1 
ATOM   5784  O  O     . ASN B  1 277 ? -64.900  54.623  -97.369  1.00 93.86  ? 277  ASN B O     1 
ATOM   5785  C  CB    . ASN B  1 277 ? -67.517  55.203  -97.501  1.00 80.90  ? 277  ASN B CB    1 
ATOM   5786  C  CG    . ASN B  1 277 ? -68.995  55.498  -97.380  1.00 88.92  ? 277  ASN B CG    1 
ATOM   5787  O  OD1   . ASN B  1 277 ? -69.836  54.671  -97.741  1.00 92.88  ? 277  ASN B OD1   1 
ATOM   5788  N  ND2   . ASN B  1 277 ? -69.324  56.675  -96.849  1.00 71.76  ? 277  ASN B ND2   1 
ATOM   5789  N  N     . GLY B  1 278 ? -65.084  52.862  -95.970  1.00 77.22  ? 278  GLY B N     1 
ATOM   5790  C  CA    . GLY B  1 278 ? -63.649  52.653  -95.897  1.00 76.41  ? 278  GLY B CA    1 
ATOM   5791  C  C     . GLY B  1 278 ? -62.818  53.744  -95.233  1.00 77.80  ? 278  GLY B C     1 
ATOM   5792  O  O     . GLY B  1 278 ? -61.596  53.781  -95.412  1.00 80.91  ? 278  GLY B O     1 
ATOM   5793  N  N     . THR B  1 279 ? -63.459  54.646  -94.495  1.00 69.95  ? 279  THR B N     1 
ATOM   5794  C  CA    . THR B  1 279 ? -62.721  55.702  -93.811  1.00 71.65  ? 279  THR B CA    1 
ATOM   5795  C  C     . THR B  1 279 ? -62.806  55.481  -92.303  1.00 69.41  ? 279  THR B C     1 
ATOM   5796  O  O     . THR B  1 279 ? -63.875  55.177  -91.768  1.00 61.37  ? 279  THR B O     1 
ATOM   5797  C  CB    . THR B  1 279 ? -63.257  57.107  -94.144  1.00 71.32  ? 279  THR B CB    1 
ATOM   5798  O  OG1   . THR B  1 279 ? -63.489  57.212  -95.555  1.00 77.70  ? 279  THR B OG1   1 
ATOM   5799  C  CG2   . THR B  1 279 ? -62.234  58.160  -93.733  1.00 58.24  ? 279  THR B CG2   1 
ATOM   5800  N  N     . ASN B  1 280 ? -61.674  55.625  -91.622  1.00 58.24  ? 280  ASN B N     1 
ATOM   5801  C  CA    . ASN B  1 280 ? -61.641  55.434  -90.178  1.00 57.08  ? 280  ASN B CA    1 
ATOM   5802  C  C     . ASN B  1 280 ? -62.152  56.674  -89.446  1.00 58.55  ? 280  ASN B C     1 
ATOM   5803  O  O     . ASN B  1 280 ? -61.421  57.655  -89.261  1.00 67.23  ? 280  ASN B O     1 
ATOM   5804  C  CB    . ASN B  1 280 ? -60.220  55.084  -89.728  1.00 59.16  ? 280  ASN B CB    1 
ATOM   5805  C  CG    . ASN B  1 280 ? -60.150  54.664  -88.269  1.00 62.96  ? 280  ASN B CG    1 
ATOM   5806  O  OD1   . ASN B  1 280 ? -61.112  54.810  -87.510  1.00 56.64  ? 280  ASN B OD1   1 
ATOM   5807  N  ND2   . ASN B  1 280 ? -58.998  54.138  -87.871  1.00 79.93  ? 280  ASN B ND2   1 
ATOM   5808  N  N     . LEU B  1 281 ? -63.402  56.611  -89.003  1.00 42.78  ? 281  LEU B N     1 
ATOM   5809  C  CA    . LEU B  1 281 ? -64.028  57.722  -88.287  1.00 53.38  ? 281  LEU B CA    1 
ATOM   5810  C  C     . LEU B  1 281 ? -63.373  58.117  -86.964  1.00 52.21  ? 281  LEU B C     1 
ATOM   5811  O  O     . LEU B  1 281 ? -63.851  59.027  -86.288  1.00 61.89  ? 281  LEU B O     1 
ATOM   5812  C  CB    . LEU B  1 281 ? -65.508  57.415  -88.041  1.00 44.76  ? 281  LEU B CB    1 
ATOM   5813  C  CG    . LEU B  1 281 ? -66.464  57.708  -89.200  1.00 58.26  ? 281  LEU B CG    1 
ATOM   5814  C  CD1   . LEU B  1 281 ? -65.873  57.238  -90.517  1.00 69.79  ? 281  LEU B CD1   1 
ATOM   5815  C  CD2   . LEU B  1 281 ? -67.810  57.056  -88.943  1.00 51.20  ? 281  LEU B CD2   1 
ATOM   5816  N  N     . PHE B  1 282 ? -62.285  57.441  -86.596  1.00 60.83  ? 282  PHE B N     1 
ATOM   5817  C  CA    . PHE B  1 282 ? -61.594  57.723  -85.338  1.00 56.77  ? 282  PHE B CA    1 
ATOM   5818  C  C     . PHE B  1 282 ? -60.306  58.519  -85.468  1.00 61.36  ? 282  PHE B C     1 
ATOM   5819  O  O     . PHE B  1 282 ? -59.709  58.886  -84.458  1.00 65.63  ? 282  PHE B O     1 
ATOM   5820  C  CB    . PHE B  1 282 ? -61.346  56.428  -84.551  1.00 62.66  ? 282  PHE B CB    1 
ATOM   5821  C  CG    . PHE B  1 282 ? -62.544  55.946  -83.773  1.00 53.72  ? 282  PHE B CG    1 
ATOM   5822  C  CD1   . PHE B  1 282 ? -63.839  56.129  -84.260  1.00 68.49  ? 282  PHE B CD1   1 
ATOM   5823  C  CD2   . PHE B  1 282 ? -62.381  55.320  -82.543  1.00 49.63  ? 282  PHE B CD2   1 
ATOM   5824  C  CE1   . PHE B  1 282 ? -64.956  55.701  -83.532  1.00 59.20  ? 282  PHE B CE1   1 
ATOM   5825  C  CE2   . PHE B  1 282 ? -63.492  54.888  -81.806  1.00 40.04  ? 282  PHE B CE2   1 
ATOM   5826  C  CZ    . PHE B  1 282 ? -64.780  55.079  -82.306  1.00 48.73  ? 282  PHE B CZ    1 
ATOM   5827  N  N     . SER B  1 283 ? -59.847  58.745  -86.698  1.00 66.49  ? 283  SER B N     1 
ATOM   5828  C  CA    . SER B  1 283 ? -58.643  59.547  -86.906  1.00 66.53  ? 283  SER B CA    1 
ATOM   5829  C  C     . SER B  1 283 ? -59.095  60.993  -87.093  1.00 68.04  ? 283  SER B C     1 
ATOM   5830  O  O     . SER B  1 283 ? -60.087  61.261  -87.779  1.00 64.10  ? 283  SER B O     1 
ATOM   5831  C  CB    . SER B  1 283 ? -57.862  59.093  -88.138  1.00 60.85  ? 283  SER B CB    1 
ATOM   5832  O  OG    . SER B  1 283 ? -58.500  59.515  -89.327  1.00 63.48  ? 283  SER B OG    1 
ATOM   5833  N  N     . GLY B  1 284 ? -58.374  61.917  -86.466  1.00 66.57  ? 284  GLY B N     1 
ATOM   5834  C  CA    . GLY B  1 284 ? -58.715  63.321  -86.566  1.00 65.75  ? 284  GLY B CA    1 
ATOM   5835  C  C     . GLY B  1 284 ? -57.569  64.204  -86.126  1.00 71.47  ? 284  GLY B C     1 
ATOM   5836  O  O     . GLY B  1 284 ? -56.421  63.758  -86.047  1.00 72.41  ? 284  GLY B O     1 
ATOM   5837  N  N     . ASP B  1 285 ? -57.887  65.457  -85.817  1.00 78.44  ? 285  ASP B N     1 
ATOM   5838  C  CA    . ASP B  1 285 ? -56.893  66.441  -85.393  1.00 84.14  ? 285  ASP B CA    1 
ATOM   5839  C  C     . ASP B  1 285 ? -56.727  66.544  -83.872  1.00 85.84  ? 285  ASP B C     1 
ATOM   5840  O  O     . ASP B  1 285 ? -55.721  67.079  -83.399  1.00 91.40  ? 285  ASP B O     1 
ATOM   5841  C  CB    . ASP B  1 285 ? -57.244  67.818  -85.982  1.00 80.13  ? 285  ASP B CB    1 
ATOM   5842  C  CG    . ASP B  1 285 ? -58.657  68.275  -85.611  1.00 100.00 ? 285  ASP B CG    1 
ATOM   5843  O  OD1   . ASP B  1 285 ? -58.924  68.490  -84.407  1.00 100.00 ? 285  ASP B OD1   1 
ATOM   5844  O  OD2   . ASP B  1 285 ? -59.508  68.410  -86.521  1.00 100.00 ? 285  ASP B OD2   1 
ATOM   5845  N  N     . LYS B  1 286 ? -57.698  66.013  -83.122  1.00 76.86  ? 286  LYS B N     1 
ATOM   5846  C  CA    . LYS B  1 286 ? -57.686  66.049  -81.651  1.00 67.78  ? 286  LYS B CA    1 
ATOM   5847  C  C     . LYS B  1 286 ? -56.578  65.184  -81.030  1.00 66.61  ? 286  LYS B C     1 
ATOM   5848  O  O     . LYS B  1 286 ? -55.700  64.686  -81.743  1.00 62.39  ? 286  LYS B O     1 
ATOM   5849  C  CB    . LYS B  1 286 ? -59.046  65.617  -81.081  1.00 61.86  ? 286  LYS B CB    1 
ATOM   5850  C  CG    . LYS B  1 286 ? -60.287  66.165  -81.796  1.00 84.33  ? 286  LYS B CG    1 
ATOM   5851  C  CD    . LYS B  1 286 ? -60.421  67.686  -81.741  1.00 94.83  ? 286  LYS B CD    1 
ATOM   5852  C  CE    . LYS B  1 286 ? -61.738  68.122  -82.373  1.00 87.59  ? 286  LYS B CE    1 
ATOM   5853  N  NZ    . LYS B  1 286 ? -61.548  69.057  -83.512  1.00 81.92  ? 286  LYS B NZ    1 
ATOM   5854  N  N     . TYR B  1 287 ? -56.648  64.997  -79.707  1.00 62.51  ? 287  TYR B N     1 
ATOM   5855  C  CA    . TYR B  1 287 ? -55.668  64.210  -78.935  1.00 59.83  ? 287  TYR B CA    1 
ATOM   5856  C  C     . TYR B  1 287 ? -55.142  62.927  -79.583  1.00 57.90  ? 287  TYR B C     1 
ATOM   5857  O  O     . TYR B  1 287 ? -55.906  62.048  -79.980  1.00 65.01  ? 287  TYR B O     1 
ATOM   5858  C  CB    . TYR B  1 287 ? -56.234  63.864  -77.556  1.00 56.00  ? 287  TYR B CB    1 
ATOM   5859  C  CG    . TYR B  1 287 ? -55.275  63.099  -76.664  1.00 59.02  ? 287  TYR B CG    1 
ATOM   5860  C  CD1   . TYR B  1 287 ? -54.466  63.769  -75.756  1.00 69.46  ? 287  TYR B CD1   1 
ATOM   5861  C  CD2   . TYR B  1 287 ? -55.197  61.706  -76.706  1.00 62.71  ? 287  TYR B CD2   1 
ATOM   5862  C  CE1   . TYR B  1 287 ? -53.601  63.078  -74.903  1.00 70.53  ? 287  TYR B CE1   1 
ATOM   5863  C  CE2   . TYR B  1 287 ? -54.332  61.005  -75.855  1.00 59.61  ? 287  TYR B CE2   1 
ATOM   5864  C  CZ    . TYR B  1 287 ? -53.539  61.703  -74.957  1.00 60.83  ? 287  TYR B CZ    1 
ATOM   5865  O  OH    . TYR B  1 287 ? -52.675  61.039  -74.113  1.00 53.11  ? 287  TYR B OH    1 
ATOM   5866  N  N     . ALA B  1 288 ? -53.821  62.818  -79.649  1.00 49.86  ? 288  ALA B N     1 
ATOM   5867  C  CA    . ALA B  1 288 ? -53.159  61.651  -80.225  1.00 55.00  ? 288  ALA B CA    1 
ATOM   5868  C  C     . ALA B  1 288 ? -53.667  61.155  -81.594  1.00 57.99  ? 288  ALA B C     1 
ATOM   5869  O  O     . ALA B  1 288 ? -53.556  59.970  -81.918  1.00 73.71  ? 288  ALA B O     1 
ATOM   5870  C  CB    . ALA B  1 288 ? -53.154  60.518  -79.218  1.00 49.01  ? 288  ALA B CB    1 
ATOM   5871  N  N     . GLY B  1 289 ? -54.209  62.062  -82.400  1.00 52.91  ? 289  GLY B N     1 
ATOM   5872  C  CA    . GLY B  1 289 ? -54.685  61.686  -83.722  1.00 57.25  ? 289  GLY B CA    1 
ATOM   5873  C  C     . GLY B  1 289 ? -56.143  61.284  -83.788  1.00 57.83  ? 289  GLY B C     1 
ATOM   5874  O  O     . GLY B  1 289 ? -56.644  60.907  -84.851  1.00 60.01  ? 289  GLY B O     1 
ATOM   5875  N  N     . LEU B  1 290 ? -56.818  61.377  -82.649  1.00 50.06  ? 290  LEU B N     1 
ATOM   5876  C  CA    . LEU B  1 290 ? -58.223  61.023  -82.516  1.00 51.19  ? 290  LEU B CA    1 
ATOM   5877  C  C     . LEU B  1 290 ? -59.162  62.043  -83.133  1.00 48.70  ? 290  LEU B C     1 
ATOM   5878  O  O     . LEU B  1 290 ? -58.855  63.230  -83.176  1.00 69.85  ? 290  LEU B O     1 
ATOM   5879  C  CB    . LEU B  1 290 ? -58.560  60.906  -81.025  1.00 57.04  ? 290  LEU B CB    1 
ATOM   5880  C  CG    . LEU B  1 290 ? -58.777  59.572  -80.296  1.00 57.50  ? 290  LEU B CG    1 
ATOM   5881  C  CD1   . LEU B  1 290 ? -58.039  58.433  -80.952  1.00 37.53  ? 290  LEU B CD1   1 
ATOM   5882  C  CD2   . LEU B  1 290 ? -58.346  59.731  -78.845  1.00 51.95  ? 290  LEU B CD2   1 
ATOM   5883  N  N     . SER B  1 291 ? -60.306  61.571  -83.623  1.00 50.42  ? 291  SER B N     1 
ATOM   5884  C  CA    . SER B  1 291 ? -61.329  62.455  -84.167  1.00 57.74  ? 291  SER B CA    1 
ATOM   5885  C  C     . SER B  1 291 ? -62.166  62.846  -82.942  1.00 60.46  ? 291  SER B C     1 
ATOM   5886  O  O     . SER B  1 291 ? -61.986  62.273  -81.864  1.00 57.56  ? 291  SER B O     1 
ATOM   5887  C  CB    . SER B  1 291 ? -62.205  61.720  -85.185  1.00 55.99  ? 291  SER B CB    1 
ATOM   5888  O  OG    . SER B  1 291 ? -63.085  60.808  -84.552  1.00 63.45  ? 291  SER B OG    1 
ATOM   5889  N  N     . GLU B  1 292 ? -63.049  63.829  -83.073  1.00 75.69  ? 292  GLU B N     1 
ATOM   5890  C  CA    . GLU B  1 292 ? -63.860  64.198  -81.919  1.00 78.19  ? 292  GLU B CA    1 
ATOM   5891  C  C     . GLU B  1 292 ? -64.912  63.118  -81.713  1.00 76.23  ? 292  GLU B C     1 
ATOM   5892  O  O     . GLU B  1 292 ? -65.423  62.930  -80.608  1.00 72.14  ? 292  GLU B O     1 
ATOM   5893  C  CB    . GLU B  1 292 ? -64.501  65.581  -82.079  1.00 92.16  ? 292  GLU B CB    1 
ATOM   5894  C  CG    . GLU B  1 292 ? -65.612  65.691  -83.113  1.00 99.57  ? 292  GLU B CG    1 
ATOM   5895  C  CD    . GLU B  1 292 ? -66.372  67.007  -82.995  1.00 100.00 ? 292  GLU B CD    1 
ATOM   5896  O  OE1   . GLU B  1 292 ? -67.623  66.971  -82.969  1.00 90.57  ? 292  GLU B OE1   1 
ATOM   5897  O  OE2   . GLU B  1 292 ? -65.718  68.072  -82.915  1.00 100.00 ? 292  GLU B OE2   1 
ATOM   5898  N  N     . GLN B  1 293 ? -65.183  62.378  -82.784  1.00 77.14  ? 293  GLN B N     1 
ATOM   5899  C  CA    . GLN B  1 293 ? -66.149  61.290  -82.760  1.00 71.14  ? 293  GLN B CA    1 
ATOM   5900  C  C     . GLN B  1 293 ? -65.656  60.187  -81.823  1.00 63.10  ? 293  GLN B C     1 
ATOM   5901  O  O     . GLN B  1 293 ? -66.439  59.578  -81.093  1.00 58.83  ? 293  GLN B O     1 
ATOM   5902  C  CB    . GLN B  1 293 ? -66.330  60.748  -84.171  1.00 76.24  ? 293  GLN B CB    1 
ATOM   5903  C  CG    . GLN B  1 293 ? -67.455  59.758  -84.295  1.00 98.82  ? 293  GLN B CG    1 
ATOM   5904  C  CD    . GLN B  1 293 ? -68.076  59.762  -85.678  1.00 100.00 ? 293  GLN B CD    1 
ATOM   5905  O  OE1   . GLN B  1 293 ? -67.854  58.844  -86.474  1.00 100.00 ? 293  GLN B OE1   1 
ATOM   5906  N  NE2   . GLN B  1 293 ? -68.864  60.801  -85.975  1.00 100.00 ? 293  GLN B NE2   1 
ATOM   5907  N  N     . ALA B  1 294 ? -64.346  59.958  -81.846  1.00 56.79  ? 294  ALA B N     1 
ATOM   5908  C  CA    . ALA B  1 294 ? -63.700  58.965  -81.001  1.00 43.55  ? 294  ALA B CA    1 
ATOM   5909  C  C     . ALA B  1 294 ? -63.814  59.371  -79.530  1.00 52.58  ? 294  ALA B C     1 
ATOM   5910  O  O     . ALA B  1 294 ? -64.083  58.533  -78.670  1.00 60.23  ? 294  ALA B O     1 
ATOM   5911  C  CB    . ALA B  1 294 ? -62.223  58.811  -81.395  1.00 27.42  ? 294  ALA B CB    1 
ATOM   5912  N  N     . LEU B  1 295 ? -63.619  60.659  -79.247  1.00 58.60  ? 295  LEU B N     1 
ATOM   5913  C  CA    . LEU B  1 295 ? -63.707  61.161  -77.878  1.00 53.69  ? 295  LEU B CA    1 
ATOM   5914  C  C     . LEU B  1 295 ? -65.105  60.996  -77.292  1.00 53.43  ? 295  LEU B C     1 
ATOM   5915  O  O     . LEU B  1 295 ? -65.243  60.677  -76.117  1.00 55.03  ? 295  LEU B O     1 
ATOM   5916  C  CB    . LEU B  1 295 ? -63.292  62.622  -77.818  1.00 51.96  ? 295  LEU B CB    1 
ATOM   5917  C  CG    . LEU B  1 295 ? -61.876  62.923  -78.302  1.00 55.21  ? 295  LEU B CG    1 
ATOM   5918  C  CD1   . LEU B  1 295 ? -61.670  64.427  -78.301  1.00 82.04  ? 295  LEU B CD1   1 
ATOM   5919  C  CD2   . LEU B  1 295 ? -60.852  62.248  -77.414  1.00 48.55  ? 295  LEU B CD2   1 
ATOM   5920  N  N     . TYR B  1 296 ? -66.140  61.211  -78.106  1.00 49.23  ? 296  TYR B N     1 
ATOM   5921  C  CA    . TYR B  1 296 ? -67.517  61.056  -77.633  1.00 69.43  ? 296  TYR B CA    1 
ATOM   5922  C  C     . TYR B  1 296 ? -67.797  59.583  -77.369  1.00 66.33  ? 296  TYR B C     1 
ATOM   5923  O  O     . TYR B  1 296 ? -68.533  59.223  -76.448  1.00 59.73  ? 296  TYR B O     1 
ATOM   5924  C  CB    . TYR B  1 296 ? -68.524  61.644  -78.634  1.00 81.15  ? 296  TYR B CB    1 
ATOM   5925  C  CG    . TYR B  1 296 ? -68.475  63.160  -78.724  1.00 94.90  ? 296  TYR B CG    1 
ATOM   5926  C  CD1   . TYR B  1 296 ? -67.926  63.921  -77.688  1.00 96.61  ? 296  TYR B CD1   1 
ATOM   5927  C  CD2   . TYR B  1 296 ? -68.933  63.830  -79.858  1.00 97.47  ? 296  TYR B CD2   1 
ATOM   5928  C  CE1   . TYR B  1 296 ? -67.825  65.306  -77.781  1.00 100.00 ? 296  TYR B CE1   1 
ATOM   5929  C  CE2   . TYR B  1 296 ? -68.836  65.219  -79.961  1.00 100.00 ? 296  TYR B CE2   1 
ATOM   5930  C  CZ    . TYR B  1 296 ? -68.279  65.949  -78.919  1.00 100.00 ? 296  TYR B CZ    1 
ATOM   5931  O  OH    . TYR B  1 296 ? -68.149  67.315  -79.022  1.00 100.00 ? 296  TYR B OH    1 
ATOM   5932  N  N     . TYR B  1 297 ? -67.160  58.734  -78.167  1.00 61.44  ? 297  TYR B N     1 
ATOM   5933  C  CA    . TYR B  1 297 ? -67.297  57.296  -78.016  1.00 53.19  ? 297  TYR B CA    1 
ATOM   5934  C  C     . TYR B  1 297 ? -66.748  56.961  -76.631  1.00 47.86  ? 297  TYR B C     1 
ATOM   5935  O  O     . TYR B  1 297 ? -67.413  56.304  -75.834  1.00 51.00  ? 297  TYR B O     1 
ATOM   5936  C  CB    . TYR B  1 297 ? -66.484  56.583  -79.093  1.00 50.52  ? 297  TYR B CB    1 
ATOM   5937  C  CG    . TYR B  1 297 ? -66.830  55.128  -79.250  1.00 56.85  ? 297  TYR B CG    1 
ATOM   5938  C  CD1   . TYR B  1 297 ? -67.683  54.705  -80.262  1.00 54.84  ? 297  TYR B CD1   1 
ATOM   5939  C  CD2   . TYR B  1 297 ? -66.314  54.172  -78.381  1.00 58.83  ? 297  TYR B CD2   1 
ATOM   5940  C  CE1   . TYR B  1 297 ? -68.015  53.363  -80.406  1.00 61.94  ? 297  TYR B CE1   1 
ATOM   5941  C  CE2   . TYR B  1 297 ? -66.638  52.827  -78.516  1.00 54.44  ? 297  TYR B CE2   1 
ATOM   5942  C  CZ    . TYR B  1 297 ? -67.489  52.428  -79.530  1.00 57.65  ? 297  TYR B CZ    1 
ATOM   5943  O  OH    . TYR B  1 297 ? -67.819  51.096  -79.662  1.00 48.02  ? 297  TYR B OH    1 
ATOM   5944  N  N     . ILE B  1 298 ? -65.554  57.474  -76.345  1.00 40.28  ? 298  ILE B N     1 
ATOM   5945  C  CA    . ILE B  1 298 ? -64.895  57.273  -75.059  1.00 35.22  ? 298  ILE B CA    1 
ATOM   5946  C  C     . ILE B  1 298 ? -65.771  57.778  -73.927  1.00 47.95  ? 298  ILE B C     1 
ATOM   5947  O  O     . ILE B  1 298 ? -65.951  57.104  -72.913  1.00 52.89  ? 298  ILE B O     1 
ATOM   5948  C  CB    . ILE B  1 298 ? -63.569  58.054  -74.984  1.00 34.49  ? 298  ILE B CB    1 
ATOM   5949  C  CG1   . ILE B  1 298 ? -62.599  57.529  -76.044  1.00 38.48  ? 298  ILE B CG1   1 
ATOM   5950  C  CG2   . ILE B  1 298 ? -62.985  57.988  -73.566  1.00 30.45  ? 298  ILE B CG2   1 
ATOM   5951  C  CD1   . ILE B  1 298 ? -61.188  58.069  -75.923  1.00 32.94  ? 298  ILE B CD1   1 
ATOM   5952  N  N     . GLY B  1 299 ? -66.292  58.986  -74.104  1.00 52.69  ? 299  GLY B N     1 
ATOM   5953  C  CA    . GLY B  1 299 ? -67.140  59.582  -73.093  1.00 50.87  ? 299  GLY B CA    1 
ATOM   5954  C  C     . GLY B  1 299 ? -68.266  58.650  -72.731  1.00 46.63  ? 299  GLY B C     1 
ATOM   5955  O  O     . GLY B  1 299 ? -68.554  58.457  -71.548  1.00 53.22  ? 299  GLY B O     1 
ATOM   5956  N  N     . GLY B  1 300 ? -68.864  58.040  -73.756  1.00 42.83  ? 300  GLY B N     1 
ATOM   5957  C  CA    . GLY B  1 300 ? -69.962  57.109  -73.553  1.00 47.12  ? 300  GLY B CA    1 
ATOM   5958  C  C     . GLY B  1 300 ? -69.557  55.905  -72.726  1.00 55.80  ? 300  GLY B C     1 
ATOM   5959  O  O     . GLY B  1 300 ? -70.260  55.518  -71.784  1.00 52.87  ? 300  GLY B O     1 
ATOM   5960  N  N     . VAL B  1 301 ? -68.401  55.333  -73.060  1.00 47.00  ? 301  VAL B N     1 
ATOM   5961  C  CA    . VAL B  1 301 ? -67.877  54.172  -72.350  1.00 40.94  ? 301  VAL B CA    1 
ATOM   5962  C  C     . VAL B  1 301 ? -67.605  54.521  -70.887  1.00 43.29  ? 301  VAL B C     1 
ATOM   5963  O  O     . VAL B  1 301 ? -67.905  53.737  -69.986  1.00 48.89  ? 301  VAL B O     1 
ATOM   5964  C  CB    . VAL B  1 301 ? -66.582  53.629  -73.006  1.00 40.94  ? 301  VAL B CB    1 
ATOM   5965  C  CG1   . VAL B  1 301 ? -66.033  52.491  -72.198  1.00 44.43  ? 301  VAL B CG1   1 
ATOM   5966  C  CG2   . VAL B  1 301 ? -66.851  53.140  -74.427  1.00 29.42  ? 301  VAL B CG2   1 
ATOM   5967  N  N     . ILE B  1 302 ? -67.068  55.710  -70.646  1.00 37.95  ? 302  ILE B N     1 
ATOM   5968  C  CA    . ILE B  1 302 ? -66.789  56.119  -69.280  1.00 38.69  ? 302  ILE B CA    1 
ATOM   5969  C  C     . ILE B  1 302 ? -68.073  56.362  -68.496  1.00 41.11  ? 302  ILE B C     1 
ATOM   5970  O  O     . ILE B  1 302 ? -68.173  56.007  -67.326  1.00 48.71  ? 302  ILE B O     1 
ATOM   5971  C  CB    . ILE B  1 302 ? -65.898  57.362  -69.239  1.00 36.09  ? 302  ILE B CB    1 
ATOM   5972  C  CG1   . ILE B  1 302 ? -64.602  57.084  -70.009  1.00 34.97  ? 302  ILE B CG1   1 
ATOM   5973  C  CG2   . ILE B  1 302 ? -65.575  57.722  -67.804  1.00 27.77  ? 302  ILE B CG2   1 
ATOM   5974  C  CD1   . ILE B  1 302 ? -63.507  58.100  -69.777  1.00 40.96  ? 302  ILE B CD1   1 
ATOM   5975  N  N     . LYS B  1 303 ? -69.078  56.917  -69.159  1.00 42.44  ? 303  LYS B N     1 
ATOM   5976  C  CA    . LYS B  1 303 ? -70.334  57.187  -68.487  1.00 48.36  ? 303  LYS B CA    1 
ATOM   5977  C  C     . LYS B  1 303 ? -71.037  55.897  -68.083  1.00 53.41  ? 303  LYS B C     1 
ATOM   5978  O  O     . LYS B  1 303 ? -71.518  55.772  -66.952  1.00 51.20  ? 303  LYS B O     1 
ATOM   5979  C  CB    . LYS B  1 303 ? -71.254  58.041  -69.375  1.00 51.83  ? 303  LYS B CB    1 
ATOM   5980  C  CG    . LYS B  1 303 ? -72.566  58.468  -68.693  1.00 50.72  ? 303  LYS B CG    1 
ATOM   5981  C  CD    . LYS B  1 303 ? -73.312  59.505  -69.510  1.00 60.04  ? 303  LYS B CD    1 
ATOM   5982  C  CE    . LYS B  1 303 ? -74.711  59.752  -68.964  1.00 69.88  ? 303  LYS B CE    1 
ATOM   5983  N  NZ    . LYS B  1 303 ? -75.569  60.410  -69.993  1.00 56.80  ? 303  LYS B NZ    1 
ATOM   5984  N  N     . HIS B  1 304 ? -71.029  54.917  -68.982  1.00 50.41  ? 304  HIS B N     1 
ATOM   5985  C  CA    . HIS B  1 304 ? -71.707  53.647  -68.734  1.00 52.58  ? 304  HIS B CA    1 
ATOM   5986  C  C     . HIS B  1 304 ? -70.808  52.470  -68.339  1.00 48.46  ? 304  HIS B C     1 
ATOM   5987  O  O     . HIS B  1 304 ? -71.236  51.314  -68.361  1.00 43.53  ? 304  HIS B O     1 
ATOM   5988  C  CB    . HIS B  1 304 ? -72.513  53.273  -69.967  1.00 49.81  ? 304  HIS B CB    1 
ATOM   5989  C  CG    . HIS B  1 304 ? -73.416  54.360  -70.447  1.00 48.86  ? 304  HIS B CG    1 
ATOM   5990  N  ND1   . HIS B  1 304 ? -74.445  54.864  -69.682  1.00 50.12  ? 304  HIS B ND1   1 
ATOM   5991  C  CD2   . HIS B  1 304 ? -73.474  55.014  -71.630  1.00 47.42  ? 304  HIS B CD2   1 
ATOM   5992  C  CE1   . HIS B  1 304 ? -75.103  55.775  -70.376  1.00 53.03  ? 304  HIS B CE1   1 
ATOM   5993  N  NE2   . HIS B  1 304 ? -74.534  55.884  -71.563  1.00 44.37  ? 304  HIS B NE2   1 
ATOM   5994  N  N     . ALA B  1 305 ? -69.581  52.774  -67.933  1.00 47.07  ? 305  ALA B N     1 
ATOM   5995  C  CA    . ALA B  1 305 ? -68.620  51.753  -67.547  1.00 37.03  ? 305  ALA B CA    1 
ATOM   5996  C  C     . ALA B  1 305 ? -69.149  50.706  -66.562  1.00 40.38  ? 305  ALA B C     1 
ATOM   5997  O  O     . ALA B  1 305 ? -69.143  49.514  -66.875  1.00 41.89  ? 305  ALA B O     1 
ATOM   5998  C  CB    . ALA B  1 305 ? -67.351  52.406  -67.015  1.00 25.76  ? 305  ALA B CB    1 
ATOM   5999  N  N     . LYS B  1 306 ? -69.635  51.137  -65.396  1.00 32.19  ? 306  LYS B N     1 
ATOM   6000  C  CA    . LYS B  1 306 ? -70.145  50.181  -64.409  1.00 36.70  ? 306  LYS B CA    1 
ATOM   6001  C  C     . LYS B  1 306 ? -71.220  49.242  -64.970  1.00 40.29  ? 306  LYS B C     1 
ATOM   6002  O  O     . LYS B  1 306 ? -71.297  48.079  -64.584  1.00 44.13  ? 306  LYS B O     1 
ATOM   6003  C  CB    . LYS B  1 306 ? -70.667  50.893  -63.161  1.00 30.48  ? 306  LYS B CB    1 
ATOM   6004  C  CG    . LYS B  1 306 ? -69.630  51.662  -62.378  1.00 29.89  ? 306  LYS B CG    1 
ATOM   6005  C  CD    . LYS B  1 306 ? -70.267  52.229  -61.117  1.00 47.56  ? 306  LYS B CD    1 
ATOM   6006  C  CE    . LYS B  1 306 ? -69.432  53.339  -60.496  1.00 62.34  ? 306  LYS B CE    1 
ATOM   6007  N  NZ    . LYS B  1 306 ? -68.271  52.830  -59.725  1.00 65.37  ? 306  LYS B NZ    1 
ATOM   6008  N  N     . ALA B  1 307 ? -72.062  49.744  -65.867  1.00 46.04  ? 307  ALA B N     1 
ATOM   6009  C  CA    . ALA B  1 307 ? -73.087  48.899  -66.457  1.00 37.39  ? 307  ALA B CA    1 
ATOM   6010  C  C     . ALA B  1 307 ? -72.409  47.948  -67.441  1.00 39.73  ? 307  ALA B C     1 
ATOM   6011  O  O     . ALA B  1 307 ? -72.747  46.765  -67.500  1.00 52.60  ? 307  ALA B O     1 
ATOM   6012  C  CB    . ALA B  1 307 ? -74.129  49.734  -67.156  1.00 37.76  ? 307  ALA B CB    1 
ATOM   6013  N  N     . ILE B  1 308 ? -71.431  48.458  -68.193  1.00 29.98  ? 308  ILE B N     1 
ATOM   6014  C  CA    . ILE B  1 308 ? -70.711  47.621  -69.153  1.00 41.96  ? 308  ILE B CA    1 
ATOM   6015  C  C     . ILE B  1 308 ? -69.984  46.491  -68.418  1.00 44.13  ? 308  ILE B C     1 
ATOM   6016  O  O     . ILE B  1 308 ? -69.865  45.379  -68.937  1.00 44.26  ? 308  ILE B O     1 
ATOM   6017  C  CB    . ILE B  1 308 ? -69.697  48.436  -69.978  1.00 39.88  ? 308  ILE B CB    1 
ATOM   6018  C  CG1   . ILE B  1 308 ? -70.426  49.507  -70.782  1.00 26.61  ? 308  ILE B CG1   1 
ATOM   6019  C  CG2   . ILE B  1 308 ? -68.930  47.515  -70.932  1.00 27.30  ? 308  ILE B CG2   1 
ATOM   6020  C  CD1   . ILE B  1 308 ? -69.497  50.456  -71.500  1.00 28.57  ? 308  ILE B CD1   1 
ATOM   6021  N  N     . ASN B  1 309 ? -69.531  46.785  -67.198  1.00 34.85  ? 309  ASN B N     1 
ATOM   6022  C  CA    . ASN B  1 309 ? -68.837  45.812  -66.354  1.00 25.41  ? 309  ASN B CA    1 
ATOM   6023  C  C     . ASN B  1 309 ? -69.661  44.538  -66.166  1.00 31.76  ? 309  ASN B C     1 
ATOM   6024  O  O     . ASN B  1 309 ? -69.116  43.436  -66.181  1.00 35.81  ? 309  ASN B O     1 
ATOM   6025  C  CB    . ASN B  1 309 ? -68.547  46.400  -64.968  1.00 26.20  ? 309  ASN B CB    1 
ATOM   6026  C  CG    . ASN B  1 309 ? -67.336  47.316  -64.946  1.00 39.19  ? 309  ASN B CG    1 
ATOM   6027  O  OD1   . ASN B  1 309 ? -67.273  48.249  -64.142  1.00 36.38  ? 309  ASN B OD1   1 
ATOM   6028  N  ND2   . ASN B  1 309 ? -66.350  47.030  -65.794  1.00 32.54  ? 309  ASN B ND2   1 
ATOM   6029  N  N     . ALA B  1 310 ? -70.966  44.698  -65.965  1.00 29.79  ? 310  ALA B N     1 
ATOM   6030  C  CA    . ALA B  1 310 ? -71.865  43.570  -65.781  1.00 18.61  ? 310  ALA B CA    1 
ATOM   6031  C  C     . ALA B  1 310 ? -71.767  42.598  -66.952  1.00 24.02  ? 310  ALA B C     1 
ATOM   6032  O  O     . ALA B  1 310 ? -72.110  41.429  -66.813  1.00 26.98  ? 310  ALA B O     1 
ATOM   6033  C  CB    . ALA B  1 310 ? -73.300  44.056  -65.612  1.00 14.88  ? 310  ALA B CB    1 
ATOM   6034  N  N     . LEU B  1 311 ? -71.272  43.071  -68.095  1.00 30.47  ? 311  LEU B N     1 
ATOM   6035  C  CA    . LEU B  1 311 ? -71.129  42.218  -69.280  1.00 35.73  ? 311  LEU B CA    1 
ATOM   6036  C  C     . LEU B  1 311 ? -69.696  41.873  -69.651  1.00 35.89  ? 311  LEU B C     1 
ATOM   6037  O  O     . LEU B  1 311 ? -69.432  40.782  -70.144  1.00 45.14  ? 311  LEU B O     1 
ATOM   6038  C  CB    . LEU B  1 311 ? -71.824  42.849  -70.472  1.00 26.18  ? 311  LEU B CB    1 
ATOM   6039  C  CG    . LEU B  1 311 ? -73.281  43.055  -70.080  1.00 32.81  ? 311  LEU B CG    1 
ATOM   6040  C  CD1   . LEU B  1 311 ? -73.708  44.461  -70.389  1.00 40.18  ? 311  LEU B CD1   1 
ATOM   6041  C  CD2   . LEU B  1 311 ? -74.140  42.039  -70.760  1.00 22.84  ? 311  LEU B CD2   1 
ATOM   6042  N  N     . ALA B  1 312 ? -68.778  42.805  -69.419  1.00 30.29  ? 312  ALA B N     1 
ATOM   6043  C  CA    . ALA B  1 312 ? -67.366  42.597  -69.721  1.00 22.60  ? 312  ALA B CA    1 
ATOM   6044  C  C     . ALA B  1 312 ? -66.602  41.919  -68.585  1.00 33.66  ? 312  ALA B C     1 
ATOM   6045  O  O     . ALA B  1 312 ? -65.511  41.398  -68.791  1.00 46.56  ? 312  ALA B O     1 
ATOM   6046  C  CB    . ALA B  1 312 ? -66.715  43.921  -70.058  1.00 26.60  ? 312  ALA B CB    1 
ATOM   6047  N  N     . ASN B  1 313 ? -67.158  41.976  -67.380  1.00 29.58  ? 313  ASN B N     1 
ATOM   6048  C  CA    . ASN B  1 313 ? -66.559  41.384  -66.184  1.00 26.66  ? 313  ASN B CA    1 
ATOM   6049  C  C     . ASN B  1 313 ? -67.753  40.792  -65.448  1.00 29.66  ? 313  ASN B C     1 
ATOM   6050  O  O     . ASN B  1 313 ? -68.065  41.204  -64.336  1.00 37.48  ? 313  ASN B O     1 
ATOM   6051  C  CB    . ASN B  1 313 ? -65.931  42.500  -65.351  1.00 21.54  ? 313  ASN B CB    1 
ATOM   6052  C  CG    . ASN B  1 313 ? -64.955  43.338  -66.158  1.00 27.42  ? 313  ASN B CG    1 
ATOM   6053  O  OD1   . ASN B  1 313 ? -63.747  43.108  -66.136  1.00 53.55  ? 313  ASN B OD1   1 
ATOM   6054  N  ND2   . ASN B  1 313 ? -65.480  44.294  -66.904  1.00 48.13  ? 313  ASN B ND2   1 
ATOM   6055  N  N     . PRO B  1 314 ? -68.368  39.738  -66.024  1.00 26.49  ? 314  PRO B N     1 
ATOM   6056  C  CA    . PRO B  1 314 ? -69.548  39.038  -65.514  1.00 19.03  ? 314  PRO B CA    1 
ATOM   6057  C  C     . PRO B  1 314 ? -69.419  38.048  -64.388  1.00 25.43  ? 314  PRO B C     1 
ATOM   6058  O  O     . PRO B  1 314 ? -70.407  37.405  -64.034  1.00 36.74  ? 314  PRO B O     1 
ATOM   6059  C  CB    . PRO B  1 314 ? -70.076  38.353  -66.770  1.00 23.04  ? 314  PRO B CB    1 
ATOM   6060  C  CG    . PRO B  1 314 ? -68.795  37.862  -67.403  1.00 17.50  ? 314  PRO B CG    1 
ATOM   6061  C  CD    . PRO B  1 314 ? -67.803  39.009  -67.182  1.00 24.45  ? 314  PRO B CD    1 
ATOM   6062  N  N     . THR B  1 315 ? -68.230  37.923  -63.816  1.00 33.60  ? 315  THR B N     1 
ATOM   6063  C  CA    . THR B  1 315 ? -68.013  36.960  -62.734  1.00 28.42  ? 315  THR B CA    1 
ATOM   6064  C  C     . THR B  1 315 ? -67.507  37.646  -61.480  1.00 26.90  ? 315  THR B C     1 
ATOM   6065  O  O     . THR B  1 315 ? -66.899  38.714  -61.561  1.00 43.09  ? 315  THR B O     1 
ATOM   6066  C  CB    . THR B  1 315 ? -66.949  35.908  -63.145  1.00 25.40  ? 315  THR B CB    1 
ATOM   6067  O  OG1   . THR B  1 315 ? -65.642  36.499  -63.120  1.00 23.44  ? 315  THR B OG1   1 
ATOM   6068  C  CG2   . THR B  1 315 ? -67.212  35.408  -64.544  1.00 16.46  ? 315  THR B CG2   1 
ATOM   6069  N  N     . THR B  1 316 ? -67.719  37.022  -60.327  1.00 23.55  ? 316  THR B N     1 
ATOM   6070  C  CA    . THR B  1 316 ? -67.220  37.601  -59.080  1.00 31.10  ? 316  THR B CA    1 
ATOM   6071  C  C     . THR B  1 316 ? -65.695  37.572  -59.113  1.00 33.26  ? 316  THR B C     1 
ATOM   6072  O  O     . THR B  1 316 ? -65.028  38.427  -58.518  1.00 36.66  ? 316  THR B O     1 
ATOM   6073  C  CB    . THR B  1 316 ? -67.686  36.816  -57.843  1.00 23.56  ? 316  THR B CB    1 
ATOM   6074  O  OG1   . THR B  1 316 ? -67.214  35.466  -57.916  1.00 39.16  ? 316  THR B OG1   1 
ATOM   6075  C  CG2   . THR B  1 316 ? -69.174  36.800  -57.771  1.00 28.12  ? 316  THR B CG2   1 
ATOM   6076  N  N     . ASN B  1 317 ? -65.161  36.593  -59.846  1.00 26.32  ? 317  ASN B N     1 
ATOM   6077  C  CA    . ASN B  1 317 ? -63.717  36.389  -59.993  1.00 32.73  ? 317  ASN B CA    1 
ATOM   6078  C  C     . ASN B  1 317 ? -63.094  37.554  -60.757  1.00 28.35  ? 317  ASN B C     1 
ATOM   6079  O  O     . ASN B  1 317 ? -61.960  37.949  -60.480  1.00 37.02  ? 317  ASN B O     1 
ATOM   6080  C  CB    . ASN B  1 317 ? -63.455  35.052  -60.717  1.00 23.19  ? 317  ASN B CB    1 
ATOM   6081  C  CG    . ASN B  1 317 ? -61.986  34.626  -60.703  1.00 29.02  ? 317  ASN B CG    1 
ATOM   6082  O  OD1   . ASN B  1 317 ? -61.351  34.504  -61.753  1.00 31.92  ? 317  ASN B OD1   1 
ATOM   6083  N  ND2   . ASN B  1 317 ? -61.463  34.347  -59.519  1.00 24.88  ? 317  ASN B ND2   1 
ATOM   6084  N  N     . SER B  1 318 ? -63.865  38.128  -61.679  1.00 29.67  ? 318  SER B N     1 
ATOM   6085  C  CA    . SER B  1 318 ? -63.403  39.249  -62.494  1.00 30.61  ? 318  SER B CA    1 
ATOM   6086  C  C     . SER B  1 318 ? -62.908  40.389  -61.629  1.00 34.96  ? 318  SER B C     1 
ATOM   6087  O  O     . SER B  1 318 ? -61.943  41.081  -61.981  1.00 30.86  ? 318  SER B O     1 
ATOM   6088  C  CB    . SER B  1 318 ? -64.540  39.782  -63.352  1.00 24.93  ? 318  SER B CB    1 
ATOM   6089  O  OG    . SER B  1 318 ? -65.032  38.799  -64.231  1.00 23.34  ? 318  SER B OG    1 
ATOM   6090  N  N     . TYR B  1 319 ? -63.590  40.591  -60.492  1.00 32.52  ? 319  TYR B N     1 
ATOM   6091  C  CA    . TYR B  1 319 ? -63.280  41.672  -59.567  1.00 31.96  ? 319  TYR B CA    1 
ATOM   6092  C  C     . TYR B  1 319 ? -62.044  41.434  -58.695  1.00 29.01  ? 319  TYR B C     1 
ATOM   6093  O  O     . TYR B  1 319 ? -61.636  42.301  -57.909  1.00 54.26  ? 319  TYR B O     1 
ATOM   6094  C  CB    . TYR B  1 319 ? -64.544  42.000  -58.764  1.00 27.22  ? 319  TYR B CB    1 
ATOM   6095  C  CG    . TYR B  1 319 ? -65.569  42.423  -59.791  1.00 36.39  ? 319  TYR B CG    1 
ATOM   6096  C  CD1   . TYR B  1 319 ? -65.465  43.658  -60.368  1.00 36.19  ? 319  TYR B CD1   1 
ATOM   6097  C  CD2   . TYR B  1 319 ? -66.572  41.559  -60.204  1.00 33.92  ? 319  TYR B CD2   1 
ATOM   6098  C  CE1   . TYR B  1 319 ? -66.360  44.043  -61.382  1.00 35.58  ? 319  TYR B CE1   1 
ATOM   6099  C  CE2   . TYR B  1 319 ? -67.452  41.927  -61.191  1.00 36.11  ? 319  TYR B CE2   1 
ATOM   6100  C  CZ    . TYR B  1 319 ? -67.330  43.167  -61.792  1.00 29.57  ? 319  TYR B CZ    1 
ATOM   6101  O  OH    . TYR B  1 319 ? -68.181  43.508  -62.757  1.00 33.74  ? 319  TYR B OH    1 
ATOM   6102  N  N     . LYS B  1 320 ? -61.431  40.261  -58.827  1.00 38.75  ? 320  LYS B N     1 
ATOM   6103  C  CA    . LYS B  1 320 ? -60.214  39.941  -58.088  1.00 32.68  ? 320  LYS B CA    1 
ATOM   6104  C  C     . LYS B  1 320 ? -59.010  40.291  -58.957  1.00 33.70  ? 320  LYS B C     1 
ATOM   6105  O  O     . LYS B  1 320 ? -57.879  40.288  -58.489  1.00 33.10  ? 320  LYS B O     1 
ATOM   6106  C  CB    . LYS B  1 320 ? -60.215  38.475  -57.641  1.00 11.98  ? 320  LYS B CB    1 
ATOM   6107  C  CG    . LYS B  1 320 ? -61.311  38.234  -56.602  1.00 22.63  ? 320  LYS B CG    1 
ATOM   6108  C  CD    . LYS B  1 320 ? -61.378  36.827  -56.097  1.00 23.18  ? 320  LYS B CD    1 
ATOM   6109  C  CE    . LYS B  1 320 ? -62.338  36.731  -54.917  1.00 21.39  ? 320  LYS B CE    1 
ATOM   6110  N  NZ    . LYS B  1 320 ? -63.713  37.138  -55.269  1.00 21.97  ? 320  LYS B NZ    1 
ATOM   6111  N  N     . ARG B  1 321 ? -59.288  40.602  -60.226  1.00 35.02  ? 321  ARG B N     1 
ATOM   6112  C  CA    . ARG B  1 321 ? -58.295  41.022  -61.211  1.00 24.44  ? 321  ARG B CA    1 
ATOM   6113  C  C     . ARG B  1 321 ? -58.298  42.562  -61.227  1.00 38.15  ? 321  ARG B C     1 
ATOM   6114  O  O     . ARG B  1 321 ? -57.240  43.201  -61.271  1.00 50.54  ? 321  ARG B O     1 
ATOM   6115  C  CB    . ARG B  1 321 ? -58.695  40.526  -62.602  1.00 29.98  ? 321  ARG B CB    1 
ATOM   6116  C  CG    . ARG B  1 321 ? -57.901  41.185  -63.723  1.00 30.85  ? 321  ARG B CG    1 
ATOM   6117  C  CD    . ARG B  1 321 ? -58.260  40.630  -65.078  1.00 26.99  ? 321  ARG B CD    1 
ATOM   6118  N  NE    . ARG B  1 321 ? -57.689  41.458  -66.132  1.00 31.94  ? 321  ARG B NE    1 
ATOM   6119  C  CZ    . ARG B  1 321 ? -58.372  42.362  -66.819  1.00 35.09  ? 321  ARG B CZ    1 
ATOM   6120  N  NH1   . ARG B  1 321 ? -57.751  43.073  -67.748  1.00 30.18  ? 321  ARG B NH1   1 
ATOM   6121  N  NH2   . ARG B  1 321 ? -59.676  42.529  -66.604  1.00 30.05  ? 321  ARG B NH2   1 
ATOM   6122  N  N     . LEU B  1 322 ? -59.504  43.127  -61.267  1.00 46.69  ? 322  LEU B N     1 
ATOM   6123  C  CA    . LEU B  1 322 ? -59.718  44.564  -61.257  1.00 39.60  ? 322  LEU B CA    1 
ATOM   6124  C  C     . LEU B  1 322 ? -59.645  44.988  -59.789  1.00 54.01  ? 322  LEU B C     1 
ATOM   6125  O  O     . LEU B  1 322 ? -60.653  45.315  -59.142  1.00 55.54  ? 322  LEU B O     1 
ATOM   6126  C  CB    . LEU B  1 322 ? -61.126  44.902  -61.770  1.00 36.06  ? 322  LEU B CB    1 
ATOM   6127  C  CG    . LEU B  1 322 ? -61.477  44.503  -63.185  1.00 28.42  ? 322  LEU B CG    1 
ATOM   6128  C  CD1   . LEU B  1 322 ? -62.931  44.849  -63.441  1.00 40.15  ? 322  LEU B CD1   1 
ATOM   6129  C  CD2   . LEU B  1 322 ? -60.571  45.217  -64.137  1.00 28.80  ? 322  LEU B CD2   1 
ATOM   6130  N  N     . VAL B  1 323 ? -58.410  44.942  -59.280  1.00 56.74  ? 323  VAL B N     1 
ATOM   6131  C  CA    . VAL B  1 323 ? -58.143  45.285  -57.903  1.00 66.57  ? 323  VAL B CA    1 
ATOM   6132  C  C     . VAL B  1 323 ? -57.036  46.342  -57.875  1.00 86.62  ? 323  VAL B C     1 
ATOM   6133  O  O     . VAL B  1 323 ? -56.080  46.268  -58.647  1.00 78.84  ? 323  VAL B O     1 
ATOM   6134  C  CB    . VAL B  1 323 ? -57.824  44.000  -57.115  1.00 62.24  ? 323  VAL B CB    1 
ATOM   6135  C  CG1   . VAL B  1 323 ? -56.324  43.822  -57.004  1.00 65.67  ? 323  VAL B CG1   1 
ATOM   6136  C  CG2   . VAL B  1 323 ? -58.464  44.043  -55.737  1.00 59.94  ? 323  VAL B CG2   1 
ATOM   6137  N  N     . PRO B  1 324 ? -57.198  47.294  -56.970  1.00 100.00 ? 324  PRO B N     1 
ATOM   6138  C  CA    . PRO B  1 324 ? -56.209  48.344  -56.949  1.00 96.20  ? 324  PRO B CA    1 
ATOM   6139  C  C     . PRO B  1 324 ? -54.790  47.882  -56.999  1.00 82.58  ? 324  PRO B C     1 
ATOM   6140  O  O     . PRO B  1 324 ? -54.092  47.822  -56.001  1.00 85.94  ? 324  PRO B O     1 
ATOM   6141  C  CB    . PRO B  1 324 ? -56.647  49.309  -55.858  1.00 97.91  ? 324  PRO B CB    1 
ATOM   6142  C  CG    . PRO B  1 324 ? -58.157  49.120  -55.894  1.00 100.00 ? 324  PRO B CG    1 
ATOM   6143  C  CD    . PRO B  1 324 ? -58.503  47.839  -56.615  1.00 100.00 ? 324  PRO B CD    1 
ATOM   6144  N  N     . GLY B  1 325 ? -54.343  47.558  -58.244  0.73 72.58  ? 325  GLY B N     1 
ATOM   6145  C  CA    . GLY B  1 325 ? -53.008  47.256  -58.573  0.73 70.28  ? 325  GLY B CA    1 
ATOM   6146  C  C     . GLY B  1 325 ? -52.497  48.484  -59.192  0.73 85.96  ? 325  GLY B C     1 
ATOM   6147  O  O     . GLY B  1 325 ? -53.218  49.472  -59.196  0.73 87.71  ? 325  GLY B O     1 
ATOM   6148  N  N     . TYR B  1 326 ? -51.297  48.504  -59.736  0.73 96.17  ? 326  TYR B N     1 
ATOM   6149  C  CA    . TYR B  1 326 ? -50.840  49.732  -60.368  0.73 91.00  ? 326  TYR B CA    1 
ATOM   6150  C  C     . TYR B  1 326 ? -51.029  49.614  -61.879  0.73 87.15  ? 326  TYR B C     1 
ATOM   6151  O  O     . TYR B  1 326 ? -51.231  50.598  -62.599  0.73 88.12  ? 326  TYR B O     1 
ATOM   6152  C  CB    . TYR B  1 326 ? -49.389  50.047  -59.931  0.73 100.00 ? 326  TYR B CB    1 
ATOM   6153  C  CG    . TYR B  1 326 ? -49.034  49.672  -58.498  0.73 100.00 ? 326  TYR B CG    1 
ATOM   6154  C  CD1   . TYR B  1 326 ? -47.697  49.523  -58.094  0.73 100.00 ? 326  TYR B CD1   1 
ATOM   6155  C  CD2   . TYR B  1 326 ? -50.016  49.441  -57.527  0.73 100.00 ? 326  TYR B CD2   1 
ATOM   6156  C  CE1   . TYR B  1 326 ? -47.374  49.132  -56.790  0.73 100.00 ? 326  TYR B CE1   1 
ATOM   6157  C  CE2   . TYR B  1 326 ? -49.710  49.054  -56.239  0.73 100.00 ? 326  TYR B CE2   1 
ATOM   6158  C  CZ    . TYR B  1 326 ? -48.382  48.898  -55.860  0.73 100.00 ? 326  TYR B CZ    1 
ATOM   6159  O  OH    . TYR B  1 326 ? -48.071  48.524  -54.566  0.73 100.00 ? 326  TYR B OH    1 
ATOM   6160  N  N     . GLU B  1 327 ? -50.958  48.365  -62.326  0.73 86.16  ? 327  GLU B N     1 
ATOM   6161  C  CA    . GLU B  1 327 ? -51.114  48.002  -63.728  0.73 88.60  ? 327  GLU B CA    1 
ATOM   6162  C  C     . GLU B  1 327 ? -52.593  47.723  -63.994  0.73 85.66  ? 327  GLU B C     1 
ATOM   6163  O  O     . GLU B  1 327 ? -53.049  47.806  -65.143  0.73 89.98  ? 327  GLU B O     1 
ATOM   6164  C  CB    . GLU B  1 327 ? -50.271  46.752  -64.051  0.73 99.20  ? 327  GLU B CB    1 
ATOM   6165  C  CG    . GLU B  1 327 ? -48.750  46.881  -63.750  0.73 96.80  ? 327  GLU B CG    1 
ATOM   6166  C  CD    . GLU B  1 327 ? -47.936  47.739  -64.766  0.73 100.00 ? 327  GLU B CD    1 
ATOM   6167  O  OE1   . GLU B  1 327 ? -46.701  47.519  -64.834  0.73 100.00 ? 327  GLU B OE1   1 
ATOM   6168  O  OE2   . GLU B  1 327 ? -48.491  48.625  -65.480  0.73 100.00 ? 327  GLU B OE2   1 
ATOM   6169  N  N     . ALA B  1 328 ? -53.326  47.397  -62.924  0.73 85.89  ? 328  ALA B N     1 
ATOM   6170  C  CA    . ALA B  1 328 ? -54.759  47.099  -62.995  0.73 87.08  ? 328  ALA B CA    1 
ATOM   6171  C  C     . ALA B  1 328 ? -55.530  48.303  -63.546  0.73 79.24  ? 328  ALA B C     1 
ATOM   6172  O  O     . ALA B  1 328 ? -55.599  49.370  -62.920  0.73 69.40  ? 328  ALA B O     1 
ATOM   6173  C  CB    . ALA B  1 328 ? -55.290  46.686  -61.624  0.73 87.06  ? 328  ALA B CB    1 
ATOM   6174  N  N     . PRO B  1 329 ? -56.099  48.140  -64.750  1.00 66.56  ? 329  PRO B N     1 
ATOM   6175  C  CA    . PRO B  1 329 ? -56.871  49.147  -65.479  1.00 63.71  ? 329  PRO B CA    1 
ATOM   6176  C  C     . PRO B  1 329 ? -58.232  49.439  -64.859  1.00 64.97  ? 329  PRO B C     1 
ATOM   6177  O  O     . PRO B  1 329 ? -59.262  49.085  -65.434  1.00 66.13  ? 329  PRO B O     1 
ATOM   6178  C  CB    . PRO B  1 329 ? -57.012  48.507  -66.856  1.00 62.29  ? 329  PRO B CB    1 
ATOM   6179  C  CG    . PRO B  1 329 ? -57.176  47.067  -66.511  1.00 63.99  ? 329  PRO B CG    1 
ATOM   6180  C  CD    . PRO B  1 329 ? -56.099  46.855  -65.477  1.00 69.38  ? 329  PRO B CD    1 
ATOM   6181  N  N     . VAL B  1 330 ? -58.240  50.143  -63.727  1.00 60.80  ? 330  VAL B N     1 
ATOM   6182  C  CA    . VAL B  1 330 ? -59.496  50.456  -63.036  1.00 56.14  ? 330  VAL B CA    1 
ATOM   6183  C  C     . VAL B  1 330 ? -59.978  51.907  -63.090  1.00 54.32  ? 330  VAL B C     1 
ATOM   6184  O  O     . VAL B  1 330 ? -61.125  52.196  -62.747  1.00 44.01  ? 330  VAL B O     1 
ATOM   6185  C  CB    . VAL B  1 330 ? -59.445  50.021  -61.550  1.00 52.76  ? 330  VAL B CB    1 
ATOM   6186  C  CG1   . VAL B  1 330 ? -59.115  48.556  -61.458  1.00 50.55  ? 330  VAL B CG1   1 
ATOM   6187  C  CG2   . VAL B  1 330 ? -58.428  50.844  -60.769  1.00 45.11  ? 330  VAL B CG2   1 
ATOM   6188  N  N     . MET B  1 331 ? -59.107  52.816  -63.515  1.00 56.53  ? 331  MET B N     1 
ATOM   6189  C  CA    . MET B  1 331 ? -59.452  54.227  -63.579  1.00 47.78  ? 331  MET B CA    1 
ATOM   6190  C  C     . MET B  1 331 ? -60.136  54.559  -64.889  1.00 52.41  ? 331  MET B C     1 
ATOM   6191  O  O     . MET B  1 331 ? -59.584  54.306  -65.958  1.00 55.61  ? 331  MET B O     1 
ATOM   6192  C  CB    . MET B  1 331 ? -58.192  55.083  -63.430  1.00 76.42  ? 331  MET B CB    1 
ATOM   6193  C  CG    . MET B  1 331 ? -57.292  54.687  -62.256  1.00 100.00 ? 331  MET B CG    1 
ATOM   6194  S  SD    . MET B  1 331 ? -57.748  55.367  -60.635  1.00 100.00 ? 331  MET B SD    1 
ATOM   6195  C  CE    . MET B  1 331 ? -56.916  56.960  -60.768  1.00 100.00 ? 331  MET B CE    1 
ATOM   6196  N  N     . LEU B  1 332 ? -61.333  55.135  -64.788  1.00 47.45  ? 332  LEU B N     1 
ATOM   6197  C  CA    . LEU B  1 332 ? -62.139  55.541  -65.940  1.00 54.67  ? 332  LEU B CA    1 
ATOM   6198  C  C     . LEU B  1 332 ? -61.616  56.831  -66.583  1.00 63.39  ? 332  LEU B C     1 
ATOM   6199  O  O     . LEU B  1 332 ? -62.216  57.906  -66.449  1.00 70.42  ? 332  LEU B O     1 
ATOM   6200  C  CB    . LEU B  1 332 ? -63.598  55.727  -65.508  1.00 62.06  ? 332  LEU B CB    1 
ATOM   6201  C  CG    . LEU B  1 332 ? -64.622  54.612  -65.743  1.00 56.37  ? 332  LEU B CG    1 
ATOM   6202  C  CD1   . LEU B  1 332 ? -63.977  53.246  -65.675  1.00 44.40  ? 332  LEU B CD1   1 
ATOM   6203  C  CD2   . LEU B  1 332 ? -65.774  54.750  -64.741  1.00 59.25  ? 332  LEU B CD2   1 
ATOM   6204  N  N     . ALA B  1 333 ? -60.505  56.699  -67.303  1.00 65.02  ? 333  ALA B N     1 
ATOM   6205  C  CA    . ALA B  1 333 ? -59.865  57.818  -67.983  1.00 71.64  ? 333  ALA B CA    1 
ATOM   6206  C  C     . ALA B  1 333 ? -59.134  57.304  -69.216  1.00 68.77  ? 333  ALA B C     1 
ATOM   6207  O  O     . ALA B  1 333 ? -58.895  56.101  -69.347  1.00 75.88  ? 333  ALA B O     1 
ATOM   6208  C  CB    . ALA B  1 333 ? -58.881  58.493  -67.046  1.00 69.73  ? 333  ALA B CB    1 
ATOM   6209  N  N     . TYR B  1 334 ? -58.792  58.207  -70.129  1.00 60.67  ? 334  TYR B N     1 
ATOM   6210  C  CA    . TYR B  1 334 ? -58.071  57.808  -71.332  1.00 53.44  ? 334  TYR B CA    1 
ATOM   6211  C  C     . TYR B  1 334 ? -56.665  58.402  -71.364  1.00 51.34  ? 334  TYR B C     1 
ATOM   6212  O  O     . TYR B  1 334 ? -56.425  59.458  -70.783  1.00 70.15  ? 334  TYR B O     1 
ATOM   6213  C  CB    . TYR B  1 334 ? -58.857  58.176  -72.592  1.00 54.01  ? 334  TYR B CB    1 
ATOM   6214  C  CG    . TYR B  1 334 ? -59.097  59.654  -72.819  1.00 67.86  ? 334  TYR B CG    1 
ATOM   6215  C  CD1   . TYR B  1 334 ? -60.050  60.355  -72.071  1.00 78.04  ? 334  TYR B CD1   1 
ATOM   6216  C  CD2   . TYR B  1 334 ? -58.428  60.338  -73.841  1.00 70.78  ? 334  TYR B CD2   1 
ATOM   6217  C  CE1   . TYR B  1 334 ? -60.332  61.693  -72.341  1.00 79.18  ? 334  TYR B CE1   1 
ATOM   6218  C  CE2   . TYR B  1 334 ? -58.704  61.675  -74.122  1.00 69.40  ? 334  TYR B CE2   1 
ATOM   6219  C  CZ    . TYR B  1 334 ? -59.658  62.344  -73.370  1.00 77.43  ? 334  TYR B CZ    1 
ATOM   6220  O  OH    . TYR B  1 334 ? -59.944  63.654  -73.661  1.00 76.84  ? 334  TYR B OH    1 
ATOM   6221  N  N     . SER B  1 335 ? -55.730  57.692  -71.997  1.00 42.26  ? 335  SER B N     1 
ATOM   6222  C  CA    . SER B  1 335 ? -54.331  58.129  -72.106  1.00 54.94  ? 335  SER B CA    1 
ATOM   6223  C  C     . SER B  1 335 ? -53.553  57.271  -73.100  1.00 59.73  ? 335  SER B C     1 
ATOM   6224  O  O     . SER B  1 335 ? -53.875  56.105  -73.310  1.00 72.80  ? 335  SER B O     1 
ATOM   6225  C  CB    . SER B  1 335 ? -53.620  58.085  -70.745  1.00 45.07  ? 335  SER B CB    1 
ATOM   6226  O  OG    . SER B  1 335 ? -52.217  58.302  -70.886  1.00 61.31  ? 335  SER B OG    1 
ATOM   6227  N  N     . ALA B  1 336 ? -52.511  57.847  -73.688  1.00 62.97  ? 336  ALA B N     1 
ATOM   6228  C  CA    . ALA B  1 336 ? -51.695  57.130  -74.656  1.00 65.41  ? 336  ALA B CA    1 
ATOM   6229  C  C     . ALA B  1 336 ? -50.547  56.406  -73.974  1.00 66.17  ? 336  ALA B C     1 
ATOM   6230  O  O     . ALA B  1 336 ? -49.993  55.441  -74.515  1.00 72.97  ? 336  ALA B O     1 
ATOM   6231  C  CB    . ALA B  1 336 ? -51.161  58.092  -75.689  1.00 61.70  ? 336  ALA B CB    1 
ATOM   6232  N  N     . ARG B  1 337 ? -50.236  56.847  -72.760  1.00 63.10  ? 337  ARG B N     1 
ATOM   6233  C  CA    . ARG B  1 337 ? -49.139  56.272  -72.009  1.00 82.05  ? 337  ARG B CA    1 
ATOM   6234  C  C     . ARG B  1 337 ? -49.519  55.684  -70.658  1.00 90.84  ? 337  ARG B C     1 
ATOM   6235  O  O     . ARG B  1 337 ? -49.185  54.529  -70.371  1.00 100.00 ? 337  ARG B O     1 
ATOM   6236  C  CB    . ARG B  1 337 ? -48.046  57.317  -71.818  1.00 87.39  ? 337  ARG B CB    1 
ATOM   6237  C  CG    . ARG B  1 337 ? -48.525  58.562  -71.098  1.00 100.00 ? 337  ARG B CG    1 
ATOM   6238  C  CD    . ARG B  1 337 ? -48.419  59.766  -72.006  1.00 100.00 ? 337  ARG B CD    1 
ATOM   6239  N  NE    . ARG B  1 337 ? -47.418  60.720  -71.527  1.00 100.00 ? 337  ARG B NE    1 
ATOM   6240  C  CZ    . ARG B  1 337 ? -47.107  61.865  -72.137  1.00 100.00 ? 337  ARG B CZ    1 
ATOM   6241  N  NH1   . ARG B  1 337 ? -47.717  62.218  -73.270  1.00 100.00 ? 337  ARG B NH1   1 
ATOM   6242  N  NH2   . ARG B  1 337 ? -46.204  62.676  -71.592  1.00 100.00 ? 337  ARG B NH2   1 
ATOM   6243  N  N     . ASN B  1 338 ? -50.205  56.469  -69.829  1.00 72.97  ? 338  ASN B N     1 
ATOM   6244  C  CA    . ASN B  1 338 ? -50.589  56.011  -68.500  1.00 76.68  ? 338  ASN B CA    1 
ATOM   6245  C  C     . ASN B  1 338 ? -51.271  54.647  -68.507  1.00 80.91  ? 338  ASN B C     1 
ATOM   6246  O  O     . ASN B  1 338 ? -52.241  54.430  -69.236  1.00 78.38  ? 338  ASN B O     1 
ATOM   6247  C  CB    . ASN B  1 338 ? -51.476  57.033  -67.812  1.00 83.67  ? 338  ASN B CB    1 
ATOM   6248  C  CG    . ASN B  1 338 ? -51.551  56.810  -66.322  1.00 100.00 ? 338  ASN B CG    1 
ATOM   6249  O  OD1   . ASN B  1 338 ? -50.534  56.502  -65.681  1.00 100.00 ? 338  ASN B OD1   1 
ATOM   6250  N  ND2   . ASN B  1 338 ? -52.753  56.948  -65.755  1.00 96.96  ? 338  ASN B ND2   1 
ATOM   6251  N  N     . ARG B  1 339 ? -50.753  53.737  -67.685  1.00 89.28  ? 339  ARG B N     1 
ATOM   6252  C  CA    . ARG B  1 339 ? -51.281  52.380  -67.619  1.00 96.75  ? 339  ARG B CA    1 
ATOM   6253  C  C     . ARG B  1 339 ? -52.359  52.161  -66.570  1.00 93.23  ? 339  ARG B C     1 
ATOM   6254  O  O     . ARG B  1 339 ? -52.978  51.094  -66.513  1.00 99.58  ? 339  ARG B O     1 
ATOM   6255  C  CB    . ARG B  1 339 ? -50.137  51.365  -67.475  1.00 100.00 ? 339  ARG B CB    1 
ATOM   6256  C  CG    . ARG B  1 339 ? -50.324  50.115  -68.357  1.00 100.00 ? 339  ARG B CG    1 
ATOM   6257  C  CD    . ARG B  1 339 ? -50.907  50.472  -69.747  1.00 100.00 ? 339  ARG B CD    1 
ATOM   6258  N  NE    . ARG B  1 339 ? -49.999  51.246  -70.601  1.00 100.00 ? 339  ARG B NE    1 
ATOM   6259  C  CZ    . ARG B  1 339 ? -48.981  50.719  -71.282  1.00 100.00 ? 339  ARG B CZ    1 
ATOM   6260  N  NH1   . ARG B  1 339 ? -48.730  49.412  -71.200  1.00 100.00 ? 339  ARG B NH1   1 
ATOM   6261  N  NH2   . ARG B  1 339 ? -48.264  51.475  -72.112  1.00 100.00 ? 339  ARG B NH2   1 
ATOM   6262  N  N     . SER B  1 340 ? -52.592  53.182  -65.757  1.00 91.90  ? 340  SER B N     1 
ATOM   6263  C  CA    . SER B  1 340 ? -53.630  53.135  -64.730  1.00 96.86  ? 340  SER B CA    1 
ATOM   6264  C  C     . SER B  1 340 ? -54.953  53.336  -65.460  1.00 97.05  ? 340  SER B C     1 
ATOM   6265  O  O     . SER B  1 340 ? -56.018  52.924  -64.992  1.00 97.66  ? 340  SER B O     1 
ATOM   6266  C  CB    . SER B  1 340 ? -53.443  54.283  -63.748  1.00 90.42  ? 340  SER B CB    1 
ATOM   6267  O  OG    . SER B  1 340 ? -52.181  54.888  -63.947  1.00 100.00 ? 340  SER B OG    1 
ATOM   6268  N  N     . ALA B  1 341 ? -54.848  53.986  -66.619  1.00 95.93  ? 341  ALA B N     1 
ATOM   6269  C  CA    . ALA B  1 341 ? -55.978  54.304  -67.483  1.00 77.47  ? 341  ALA B CA    1 
ATOM   6270  C  C     . ALA B  1 341 ? -56.592  53.068  -68.106  1.00 69.33  ? 341  ALA B C     1 
ATOM   6271  O  O     . ALA B  1 341 ? -55.907  52.292  -68.778  1.00 69.23  ? 341  ALA B O     1 
ATOM   6272  C  CB    . ALA B  1 341 ? -55.534  55.263  -68.570  1.00 82.40  ? 341  ALA B CB    1 
ATOM   6273  N  N     . SER B  1 342 ? -57.890  52.895  -67.894  1.00 48.36  ? 342  SER B N     1 
ATOM   6274  C  CA    . SER B  1 342 ? -58.579  51.746  -68.454  1.00 45.71  ? 342  SER B CA    1 
ATOM   6275  C  C     . SER B  1 342 ? -58.837  51.869  -69.956  1.00 50.98  ? 342  SER B C     1 
ATOM   6276  O  O     . SER B  1 342 ? -59.379  50.956  -70.580  1.00 58.83  ? 342  SER B O     1 
ATOM   6277  C  CB    . SER B  1 342 ? -59.854  51.426  -67.673  1.00 35.07  ? 342  SER B CB    1 
ATOM   6278  O  OG    . SER B  1 342 ? -60.633  52.574  -67.457  1.00 52.95  ? 342  SER B OG    1 
ATOM   6279  N  N     . ILE B  1 343 ? -58.419  52.990  -70.543  1.00 51.01  ? 343  ILE B N     1 
ATOM   6280  C  CA    . ILE B  1 343 ? -58.561  53.187  -71.981  1.00 39.07  ? 343  ILE B CA    1 
ATOM   6281  C  C     . ILE B  1 343 ? -57.259  53.727  -72.538  1.00 38.49  ? 343  ILE B C     1 
ATOM   6282  O  O     . ILE B  1 343 ? -56.919  54.881  -72.312  1.00 47.48  ? 343  ILE B O     1 
ATOM   6283  C  CB    . ILE B  1 343 ? -59.673  54.159  -72.326  1.00 36.79  ? 343  ILE B CB    1 
ATOM   6284  C  CG1   . ILE B  1 343 ? -60.918  53.821  -71.510  1.00 31.80  ? 343  ILE B CG1   1 
ATOM   6285  C  CG2   . ILE B  1 343 ? -59.959  54.091  -73.818  1.00 35.80  ? 343  ILE B CG2   1 
ATOM   6286  C  CD1   . ILE B  1 343 ? -62.180  54.359  -72.086  1.00 22.70  ? 343  ILE B CD1   1 
ATOM   6287  N  N     . ARG B  1 344 ? -56.507  52.861  -73.206  1.00 41.27  ? 344  ARG B N     1 
ATOM   6288  C  CA    . ARG B  1 344 ? -55.230  53.235  -73.801  1.00 43.81  ? 344  ARG B CA    1 
ATOM   6289  C  C     . ARG B  1 344 ? -55.483  53.679  -75.234  1.00 53.97  ? 344  ARG B C     1 
ATOM   6290  O  O     . ARG B  1 344 ? -56.381  53.166  -75.909  1.00 49.54  ? 344  ARG B O     1 
ATOM   6291  C  CB    . ARG B  1 344 ? -54.250  52.046  -73.797  1.00 42.30  ? 344  ARG B CB    1 
ATOM   6292  C  CG    . ARG B  1 344 ? -52.878  52.322  -73.152  1.00 83.26  ? 344  ARG B CG    1 
ATOM   6293  C  CD    . ARG B  1 344 ? -51.767  52.584  -74.189  1.00 100.00 ? 344  ARG B CD    1 
ATOM   6294  N  NE    . ARG B  1 344 ? -50.854  51.450  -74.382  1.00 100.00 ? 344  ARG B NE    1 
ATOM   6295  C  CZ    . ARG B  1 344 ? -51.092  50.390  -75.160  1.00 100.00 ? 344  ARG B CZ    1 
ATOM   6296  N  NH1   . ARG B  1 344 ? -52.231  50.283  -75.843  1.00 85.26  ? 344  ARG B NH1   1 
ATOM   6297  N  NH2   . ARG B  1 344 ? -50.166  49.441  -75.284  1.00 100.00 ? 344  ARG B NH2   1 
ATOM   6298  N  N     . ILE B  1 345 ? -54.743  54.693  -75.663  1.00 58.91  ? 345  ILE B N     1 
ATOM   6299  C  CA    . ILE B  1 345 ? -54.847  55.182  -77.023  1.00 48.85  ? 345  ILE B CA    1 
ATOM   6300  C  C     . ILE B  1 345 ? -53.547  54.754  -77.685  1.00 56.84  ? 345  ILE B C     1 
ATOM   6301  O  O     . ILE B  1 345 ? -52.456  55.235  -77.346  1.00 58.40  ? 345  ILE B O     1 
ATOM   6302  C  CB    . ILE B  1 345 ? -54.987  56.704  -77.098  1.00 50.40  ? 345  ILE B CB    1 
ATOM   6303  C  CG1   . ILE B  1 345 ? -56.118  57.188  -76.183  1.00 45.47  ? 345  ILE B CG1   1 
ATOM   6304  C  CG2   . ILE B  1 345 ? -55.256  57.118  -78.539  1.00 45.87  ? 345  ILE B CG2   1 
ATOM   6305  C  CD1   . ILE B  1 345 ? -57.492  56.681  -76.548  1.00 52.97  ? 345  ILE B CD1   1 
ATOM   6306  N  N     . PRO B  1 346 ? -53.640  53.752  -78.563  1.00 59.92  ? 346  PRO B N     1 
ATOM   6307  C  CA    . PRO B  1 346 ? -52.475  53.235  -79.277  1.00 64.33  ? 346  PRO B CA    1 
ATOM   6308  C  C     . PRO B  1 346 ? -51.820  54.352  -80.065  1.00 79.69  ? 346  PRO B C     1 
ATOM   6309  O  O     . PRO B  1 346 ? -52.461  55.018  -80.886  1.00 83.00  ? 346  PRO B O     1 
ATOM   6310  C  CB    . PRO B  1 346 ? -53.086  52.199  -80.215  1.00 61.06  ? 346  PRO B CB    1 
ATOM   6311  C  CG    . PRO B  1 346 ? -54.292  51.732  -79.468  1.00 51.66  ? 346  PRO B CG    1 
ATOM   6312  C  CD    . PRO B  1 346 ? -54.857  53.008  -78.921  1.00 54.47  ? 346  PRO B CD    1 
ATOM   6313  N  N     . VAL B  1 347 ? -50.569  54.628  -79.747  1.00 83.83  ? 347  VAL B N     1 
ATOM   6314  C  CA    . VAL B  1 347 ? -49.861  55.654  -80.484  1.00 77.93  ? 347  VAL B CA    1 
ATOM   6315  C  C     . VAL B  1 347 ? -49.445  54.957  -81.780  1.00 77.38  ? 347  VAL B C     1 
ATOM   6316  O  O     . VAL B  1 347 ? -48.637  54.019  -81.770  1.00 79.61  ? 347  VAL B O     1 
ATOM   6317  C  CB    . VAL B  1 347 ? -48.670  56.153  -79.676  1.00 84.55  ? 347  VAL B CB    1 
ATOM   6318  C  CG1   . VAL B  1 347 ? -47.863  57.144  -80.487  1.00 82.27  ? 347  VAL B CG1   1 
ATOM   6319  C  CG2   . VAL B  1 347 ? -49.175  56.795  -78.393  1.00 67.23  ? 347  VAL B CG2   1 
ATOM   6320  N  N     . VAL B  1 348 ? -50.048  55.371  -82.889  1.00 65.19  ? 348  VAL B N     1 
ATOM   6321  C  CA    . VAL B  1 348 ? -49.751  54.710  -84.150  1.00 80.21  ? 348  VAL B CA    1 
ATOM   6322  C  C     . VAL B  1 348 ? -49.518  55.616  -85.362  1.00 89.00  ? 348  VAL B C     1 
ATOM   6323  O  O     . VAL B  1 348 ? -50.122  56.690  -85.489  1.00 73.13  ? 348  VAL B O     1 
ATOM   6324  C  CB    . VAL B  1 348 ? -50.839  53.656  -84.461  1.00 73.68  ? 348  VAL B CB    1 
ATOM   6325  C  CG1   . VAL B  1 348 ? -52.174  54.344  -84.760  1.00 48.69  ? 348  VAL B CG1   1 
ATOM   6326  C  CG2   . VAL B  1 348 ? -50.391  52.741  -85.598  1.00 82.03  ? 348  VAL B CG2   1 
ATOM   6327  N  N     . ALA B  1 349 ? -48.647  55.134  -86.253  1.00 98.27  ? 349  ALA B N     1 
ATOM   6328  C  CA    . ALA B  1 349 ? -48.240  55.812  -87.486  1.00 93.33  ? 349  ALA B CA    1 
ATOM   6329  C  C     . ALA B  1 349 ? -49.392  56.221  -88.408  1.00 88.66  ? 349  ALA B C     1 
ATOM   6330  O  O     . ALA B  1 349 ? -49.759  57.401  -88.478  1.00 70.89  ? 349  ALA B O     1 
ATOM   6331  C  CB    . ALA B  1 349 ? -47.242  54.919  -88.256  1.00 95.06  ? 349  ALA B CB    1 
ATOM   6332  N  N     . SER B  1 350 ? -49.948  55.236  -89.109  1.00 78.27  ? 350  SER B N     1 
ATOM   6333  C  CA    . SER B  1 350 ? -51.036  55.452  -90.054  1.00 70.98  ? 350  SER B CA    1 
ATOM   6334  C  C     . SER B  1 350 ? -52.385  55.847  -89.455  1.00 68.73  ? 350  SER B C     1 
ATOM   6335  O  O     . SER B  1 350 ? -52.835  55.257  -88.480  1.00 68.83  ? 350  SER B O     1 
ATOM   6336  C  CB    . SER B  1 350 ? -51.216  54.196  -90.910  1.00 69.91  ? 350  SER B CB    1 
ATOM   6337  O  OG    . SER B  1 350 ? -52.396  54.268  -91.695  1.00 78.99  ? 350  SER B OG    1 
ATOM   6338  N  N     . PRO B  1 351 ? -53.039  56.876  -90.022  1.00 75.76  ? 351  PRO B N     1 
ATOM   6339  C  CA    . PRO B  1 351 ? -54.347  57.305  -89.516  1.00 77.51  ? 351  PRO B CA    1 
ATOM   6340  C  C     . PRO B  1 351 ? -55.368  56.188  -89.734  1.00 72.93  ? 351  PRO B C     1 
ATOM   6341  O  O     . PRO B  1 351 ? -56.371  56.104  -89.030  1.00 69.07  ? 351  PRO B O     1 
ATOM   6342  C  CB    . PRO B  1 351 ? -54.665  58.519  -90.391  1.00 66.02  ? 351  PRO B CB    1 
ATOM   6343  C  CG    . PRO B  1 351 ? -53.324  59.097  -90.632  1.00 81.22  ? 351  PRO B CG    1 
ATOM   6344  C  CD    . PRO B  1 351 ? -52.510  57.867  -90.975  1.00 84.67  ? 351  PRO B CD    1 
ATOM   6345  N  N     . LYS B  1 352 ? -55.092  55.329  -90.712  1.00 69.95  ? 352  LYS B N     1 
ATOM   6346  C  CA    . LYS B  1 352 ? -55.968  54.208  -91.036  1.00 77.66  ? 352  LYS B CA    1 
ATOM   6347  C  C     . LYS B  1 352 ? -56.163  53.253  -89.846  1.00 72.29  ? 352  LYS B C     1 
ATOM   6348  O  O     . LYS B  1 352 ? -57.226  52.645  -89.696  1.00 64.99  ? 352  LYS B O     1 
ATOM   6349  C  CB    . LYS B  1 352 ? -55.418  53.454  -92.264  1.00 77.09  ? 352  LYS B CB    1 
ATOM   6350  C  CG    . LYS B  1 352 ? -56.146  53.776  -93.577  1.00 93.89  ? 352  LYS B CG    1 
ATOM   6351  C  CD    . LYS B  1 352 ? -57.542  53.117  -93.608  1.00 100.00 ? 352  LYS B CD    1 
ATOM   6352  C  CE    . LYS B  1 352 ? -58.591  53.947  -94.376  1.00 100.00 ? 352  LYS B CE    1 
ATOM   6353  N  NZ    . LYS B  1 352 ? -59.124  55.141  -93.624  1.00 89.85  ? 352  LYS B NZ    1 
ATOM   6354  N  N     . ALA B  1 353 ? -55.170  53.212  -88.960  1.00 64.65  ? 353  ALA B N     1 
ATOM   6355  C  CA    . ALA B  1 353 ? -55.184  52.331  -87.796  1.00 57.09  ? 353  ALA B CA    1 
ATOM   6356  C  C     . ALA B  1 353 ? -55.445  52.989  -86.447  1.00 57.14  ? 353  ALA B C     1 
ATOM   6357  O  O     . ALA B  1 353 ? -55.119  52.422  -85.409  1.00 68.61  ? 353  ALA B O     1 
ATOM   6358  C  CB    . ALA B  1 353 ? -53.879  51.565  -87.730  1.00 60.90  ? 353  ALA B CB    1 
ATOM   6359  N  N     . ARG B  1 354 ? -56.024  54.179  -86.448  1.00 58.54  ? 354  ARG B N     1 
ATOM   6360  C  CA    . ARG B  1 354 ? -56.292  54.851  -85.191  1.00 55.80  ? 354  ARG B CA    1 
ATOM   6361  C  C     . ARG B  1 354 ? -57.519  54.233  -84.515  1.00 57.78  ? 354  ARG B C     1 
ATOM   6362  O  O     . ARG B  1 354 ? -58.513  53.928  -85.180  1.00 56.13  ? 354  ARG B O     1 
ATOM   6363  C  CB    . ARG B  1 354 ? -56.468  56.351  -85.421  1.00 58.25  ? 354  ARG B CB    1 
ATOM   6364  C  CG    . ARG B  1 354 ? -56.134  57.153  -84.191  1.00 82.34  ? 354  ARG B CG    1 
ATOM   6365  C  CD    . ARG B  1 354 ? -55.281  58.362  -84.500  1.00 85.95  ? 354  ARG B CD    1 
ATOM   6366  N  NE    . ARG B  1 354 ? -53.979  58.054  -85.078  1.00 83.39  ? 354  ARG B NE    1 
ATOM   6367  C  CZ    . ARG B  1 354 ? -53.459  58.726  -86.102  1.00 89.32  ? 354  ARG B CZ    1 
ATOM   6368  N  NH1   . ARG B  1 354 ? -54.142  59.729  -86.649  1.00 80.61  ? 354  ARG B NH1   1 
ATOM   6369  N  NH2   . ARG B  1 354 ? -52.260  58.407  -86.572  1.00 86.25  ? 354  ARG B NH2   1 
ATOM   6370  N  N     . ARG B  1 355 ? -57.444  54.067  -83.193  1.00 61.65  ? 355  ARG B N     1 
ATOM   6371  C  CA    . ARG B  1 355 ? -58.527  53.443  -82.419  1.00 46.85  ? 355  ARG B CA    1 
ATOM   6372  C  C     . ARG B  1 355 ? -58.324  53.637  -80.915  1.00 44.06  ? 355  ARG B C     1 
ATOM   6373  O  O     . ARG B  1 355 ? -57.393  54.315  -80.487  1.00 49.13  ? 355  ARG B O     1 
ATOM   6374  C  CB    . ARG B  1 355 ? -58.478  51.944  -82.680  1.00 54.08  ? 355  ARG B CB    1 
ATOM   6375  C  CG    . ARG B  1 355 ? -57.157  51.338  -82.184  1.00 48.50  ? 355  ARG B CG    1 
ATOM   6376  C  CD    . ARG B  1 355 ? -56.821  50.058  -82.895  1.00 43.80  ? 355  ARG B CD    1 
ATOM   6377  N  NE    . ARG B  1 355 ? -55.470  50.089  -83.450  1.00 63.45  ? 355  ARG B NE    1 
ATOM   6378  C  CZ    . ARG B  1 355 ? -54.448  49.378  -82.985  1.00 52.85  ? 355  ARG B CZ    1 
ATOM   6379  N  NH1   . ARG B  1 355 ? -54.607  48.574  -81.944  1.00 67.31  ? 355  ARG B NH1   1 
ATOM   6380  N  NH2   . ARG B  1 355 ? -53.275  49.433  -83.597  1.00 60.89  ? 355  ARG B NH2   1 
ATOM   6381  N  N     . ILE B  1 356 ? -59.180  53.002  -80.122  1.00 41.51  ? 356  ILE B N     1 
ATOM   6382  C  CA    . ILE B  1 356 ? -59.061  53.041  -78.662  1.00 47.22  ? 356  ILE B CA    1 
ATOM   6383  C  C     . ILE B  1 356 ? -59.011  51.602  -78.128  1.00 49.04  ? 356  ILE B C     1 
ATOM   6384  O  O     . ILE B  1 356 ? -59.505  50.683  -78.781  1.00 50.90  ? 356  ILE B O     1 
ATOM   6385  C  CB    . ILE B  1 356 ? -60.243  53.756  -78.010  1.00 36.38  ? 356  ILE B CB    1 
ATOM   6386  C  CG1   . ILE B  1 356 ? -61.529  52.977  -78.259  1.00 37.30  ? 356  ILE B CG1   1 
ATOM   6387  C  CG2   . ILE B  1 356 ? -60.368  55.153  -78.557  1.00 42.32  ? 356  ILE B CG2   1 
ATOM   6388  C  CD1   . ILE B  1 356 ? -62.690  53.511  -77.469  1.00 36.45  ? 356  ILE B CD1   1 
ATOM   6389  N  N     . GLU B  1 357 ? -58.394  51.401  -76.964  1.00 47.95  ? 357  GLU B N     1 
ATOM   6390  C  CA    . GLU B  1 357 ? -58.307  50.071  -76.353  1.00 37.80  ? 357  GLU B CA    1 
ATOM   6391  C  C     . GLU B  1 357 ? -58.923  50.101  -74.963  1.00 34.13  ? 357  GLU B C     1 
ATOM   6392  O  O     . GLU B  1 357 ? -58.378  50.726  -74.057  1.00 30.77  ? 357  GLU B O     1 
ATOM   6393  C  CB    . GLU B  1 357 ? -56.850  49.616  -76.230  1.00 27.91  ? 357  GLU B CB    1 
ATOM   6394  C  CG    . GLU B  1 357 ? -56.696  48.152  -75.876  1.00 26.11  ? 357  GLU B CG    1 
ATOM   6395  C  CD    . GLU B  1 357 ? -55.302  47.790  -75.362  1.00 40.64  ? 357  GLU B CD    1 
ATOM   6396  O  OE1   . GLU B  1 357 ? -54.707  48.590  -74.622  1.00 46.02  ? 357  GLU B OE1   1 
ATOM   6397  O  OE2   . GLU B  1 357 ? -54.798  46.693  -75.675  1.00 43.36  ? 357  GLU B OE2   1 
ATOM   6398  N  N     . VAL B  1 358 ? -60.101  49.501  -74.811  1.00 42.12  ? 358  VAL B N     1 
ATOM   6399  C  CA    . VAL B  1 358 ? -60.753  49.455  -73.503  1.00 41.17  ? 358  VAL B CA    1 
ATOM   6400  C  C     . VAL B  1 358 ? -60.170  48.230  -72.808  1.00 48.02  ? 358  VAL B C     1 
ATOM   6401  O  O     . VAL B  1 358 ? -60.474  47.089  -73.165  1.00 49.25  ? 358  VAL B O     1 
ATOM   6402  C  CB    . VAL B  1 358 ? -62.275  49.347  -73.622  1.00 33.52  ? 358  VAL B CB    1 
ATOM   6403  C  CG1   . VAL B  1 358 ? -62.907  49.366  -72.253  1.00 35.16  ? 358  VAL B CG1   1 
ATOM   6404  C  CG2   . VAL B  1 358 ? -62.806  50.506  -74.408  1.00 44.48  ? 358  VAL B CG2   1 
ATOM   6405  N  N     . ARG B  1 359 ? -59.348  48.473  -71.796  1.00 45.25  ? 359  ARG B N     1 
ATOM   6406  C  CA    . ARG B  1 359 ? -58.585  47.417  -71.139  1.00 48.79  ? 359  ARG B CA    1 
ATOM   6407  C  C     . ARG B  1 359 ? -59.275  46.624  -70.002  1.00 39.38  ? 359  ARG B C     1 
ATOM   6408  O  O     . ARG B  1 359 ? -58.713  45.628  -69.540  1.00 56.24  ? 359  ARG B O     1 
ATOM   6409  C  CB    . ARG B  1 359 ? -57.280  48.016  -70.579  1.00 41.50  ? 359  ARG B CB    1 
ATOM   6410  C  CG    . ARG B  1 359 ? -56.295  48.455  -71.654  1.00 29.89  ? 359  ARG B CG    1 
ATOM   6411  C  CD    . ARG B  1 359 ? -55.098  49.189  -71.060  1.00 37.65  ? 359  ARG B CD    1 
ATOM   6412  N  NE    . ARG B  1 359 ? -54.254  48.317  -70.252  1.00 85.10  ? 359  ARG B NE    1 
ATOM   6413  C  CZ    . ARG B  1 359 ? -53.131  47.751  -70.691  1.00 99.20  ? 359  ARG B CZ    1 
ATOM   6414  N  NH1   . ARG B  1 359 ? -52.715  47.968  -71.937  1.00 99.69  ? 359  ARG B NH1   1 
ATOM   6415  N  NH2   . ARG B  1 359 ? -52.421  46.972  -69.883  1.00 100.00 ? 359  ARG B NH2   1 
ATOM   6416  N  N     . PHE B  1 360 ? -60.467  47.035  -69.521  1.00 31.61  ? 360  PHE B N     1 
ATOM   6417  C  CA    . PHE B  1 360 ? -60.982  46.311  -68.347  1.00 31.17  ? 360  PHE B CA    1 
ATOM   6418  C  C     . PHE B  1 360 ? -61.694  44.966  -68.560  1.00 37.79  ? 360  PHE B C     1 
ATOM   6419  O  O     . PHE B  1 360 ? -61.789  44.172  -67.626  1.00 40.39  ? 360  PHE B O     1 
ATOM   6420  C  CB    . PHE B  1 360 ? -61.844  47.264  -67.497  1.00 33.08  ? 360  PHE B CB    1 
ATOM   6421  C  CG    . PHE B  1 360 ? -63.061  47.850  -68.157  1.00 35.80  ? 360  PHE B CG    1 
ATOM   6422  C  CD1   . PHE B  1 360 ? -63.074  49.180  -68.569  1.00 38.18  ? 360  PHE B CD1   1 
ATOM   6423  C  CD2   . PHE B  1 360 ? -64.202  47.084  -68.365  1.00 35.41  ? 360  PHE B CD2   1 
ATOM   6424  C  CE1   . PHE B  1 360 ? -64.205  49.734  -69.180  1.00 26.79  ? 360  PHE B CE1   1 
ATOM   6425  C  CE2   . PHE B  1 360 ? -65.337  47.630  -68.975  1.00 40.08  ? 360  PHE B CE2   1 
ATOM   6426  C  CZ    . PHE B  1 360 ? -65.337  48.956  -69.381  1.00 29.34  ? 360  PHE B CZ    1 
ATOM   6427  N  N     . PRO B  1 361 ? -62.203  44.703  -69.775  1.00 33.91  ? 361  PRO B N     1 
ATOM   6428  C  CA    . PRO B  1 361 ? -62.862  43.384  -70.040  1.00 32.67  ? 361  PRO B CA    1 
ATOM   6429  C  C     . PRO B  1 361 ? -61.989  42.166  -69.764  1.00 34.12  ? 361  PRO B C     1 
ATOM   6430  O  O     . PRO B  1 361 ? -60.770  42.225  -69.875  1.00 29.01  ? 361  PRO B O     1 
ATOM   6431  C  CB    . PRO B  1 361 ? -63.390  43.528  -71.445  1.00 33.98  ? 361  PRO B CB    1 
ATOM   6432  C  CG    . PRO B  1 361 ? -63.816  44.970  -71.453  1.00 36.93  ? 361  PRO B CG    1 
ATOM   6433  C  CD    . PRO B  1 361 ? -63.052  45.713  -70.398  1.00 47.21  ? 361  PRO B CD    1 
ATOM   6434  N  N     . ASP B  1 362 ? -62.605  41.043  -69.416  1.00 31.33  ? 362  ASP B N     1 
ATOM   6435  C  CA    . ASP B  1 362 ? -61.867  39.798  -69.263  1.00 28.39  ? 362  ASP B CA    1 
ATOM   6436  C  C     . ASP B  1 362 ? -62.519  38.722  -70.139  1.00 26.68  ? 362  ASP B C     1 
ATOM   6437  O  O     . ASP B  1 362 ? -63.637  38.885  -70.612  1.00 24.87  ? 362  ASP B O     1 
ATOM   6438  C  CB    . ASP B  1 362 ? -61.724  39.389  -67.782  1.00 24.08  ? 362  ASP B CB    1 
ATOM   6439  C  CG    . ASP B  1 362 ? -63.043  39.130  -67.106  1.00 35.13  ? 362  ASP B CG    1 
ATOM   6440  O  OD1   . ASP B  1 362 ? -63.781  38.239  -67.576  1.00 20.32  ? 362  ASP B OD1   1 
ATOM   6441  O  OD2   . ASP B  1 362 ? -63.324  39.795  -66.083  1.00 21.19  ? 362  ASP B OD2   1 
ATOM   6442  N  N     . PRO B  1 363 ? -61.832  37.602  -70.356  1.00 29.74  ? 363  PRO B N     1 
ATOM   6443  C  CA    . PRO B  1 363 ? -62.353  36.516  -71.192  1.00 17.25  ? 363  PRO B CA    1 
ATOM   6444  C  C     . PRO B  1 363 ? -63.642  35.797  -70.763  1.00 29.19  ? 363  PRO B C     1 
ATOM   6445  O  O     . PRO B  1 363 ? -64.201  35.015  -71.547  1.00 27.12  ? 363  PRO B O     1 
ATOM   6446  C  CB    . PRO B  1 363 ? -61.168  35.545  -71.253  1.00 25.98  ? 363  PRO B CB    1 
ATOM   6447  C  CG    . PRO B  1 363 ? -59.976  36.410  -70.968  1.00 29.53  ? 363  PRO B CG    1 
ATOM   6448  C  CD    . PRO B  1 363 ? -60.481  37.279  -69.871  1.00 27.78  ? 363  PRO B CD    1 
ATOM   6449  N  N     . ALA B  1 364 ? -64.102  36.022  -69.532  1.00 22.32  ? 364  ALA B N     1 
ATOM   6450  C  CA    . ALA B  1 364 ? -65.321  35.362  -69.042  1.00 19.27  ? 364  ALA B CA    1 
ATOM   6451  C  C     . ALA B  1 364 ? -66.565  36.002  -69.625  1.00 25.06  ? 364  ALA B C     1 
ATOM   6452  O  O     . ALA B  1 364 ? -67.676  35.471  -69.536  1.00 38.75  ? 364  ALA B O     1 
ATOM   6453  C  CB    . ALA B  1 364 ? -65.376  35.410  -67.525  1.00 17.37  ? 364  ALA B CB    1 
ATOM   6454  N  N     . ALA B  1 365 ? -66.356  37.174  -70.196  1.00 28.69  ? 365  ALA B N     1 
ATOM   6455  C  CA    . ALA B  1 365 ? -67.404  37.956  -70.802  1.00 24.71  ? 365  ALA B CA    1 
ATOM   6456  C  C     . ALA B  1 365 ? -67.992  37.279  -72.020  1.00 31.03  ? 365  ALA B C     1 
ATOM   6457  O  O     . ALA B  1 365 ? -67.275  36.677  -72.820  1.00 28.25  ? 365  ALA B O     1 
ATOM   6458  C  CB    . ALA B  1 365 ? -66.841  39.300  -71.208  1.00 18.95  ? 365  ALA B CB    1 
ATOM   6459  N  N     . ASN B  1 366 ? -69.307  37.382  -72.152  1.00 32.32  ? 366  ASN B N     1 
ATOM   6460  C  CA    . ASN B  1 366 ? -69.995  36.848  -73.319  1.00 30.56  ? 366  ASN B CA    1 
ATOM   6461  C  C     . ASN B  1 366 ? -69.554  37.829  -74.401  1.00 29.58  ? 366  ASN B C     1 
ATOM   6462  O  O     . ASN B  1 366 ? -69.924  39.003  -74.356  1.00 35.32  ? 366  ASN B O     1 
ATOM   6463  C  CB    . ASN B  1 366 ? -71.501  36.945  -73.107  1.00 27.73  ? 366  ASN B CB    1 
ATOM   6464  C  CG    . ASN B  1 366 ? -72.277  36.435  -74.275  1.00 29.42  ? 366  ASN B CG    1 
ATOM   6465  O  OD1   . ASN B  1 366 ? -71.861  36.591  -75.426  1.00 30.19  ? 366  ASN B OD1   1 
ATOM   6466  N  ND2   . ASN B  1 366 ? -73.413  35.805  -73.996  1.00 25.88  ? 366  ASN B ND2   1 
ATOM   6467  N  N     . PRO B  1 367 ? -68.760  37.369  -75.382  1.00 25.67  ? 367  PRO B N     1 
ATOM   6468  C  CA    . PRO B  1 367 ? -68.305  38.297  -76.426  1.00 28.84  ? 367  PRO B CA    1 
ATOM   6469  C  C     . PRO B  1 367 ? -69.408  39.120  -77.096  1.00 33.94  ? 367  PRO B C     1 
ATOM   6470  O  O     . PRO B  1 367 ? -69.257  40.323  -77.277  1.00 44.37  ? 367  PRO B O     1 
ATOM   6471  C  CB    . PRO B  1 367 ? -67.553  37.384  -77.399  1.00 21.90  ? 367  PRO B CB    1 
ATOM   6472  C  CG    . PRO B  1 367 ? -68.250  36.067  -77.240  1.00 30.71  ? 367  PRO B CG    1 
ATOM   6473  C  CD    . PRO B  1 367 ? -68.429  35.981  -75.737  1.00 28.59  ? 367  PRO B CD    1 
ATOM   6474  N  N     . TYR B  1 368 ? -70.544  38.499  -77.381  1.00 30.27  ? 368  TYR B N     1 
ATOM   6475  C  CA    . TYR B  1 368 ? -71.645  39.209  -78.017  1.00 27.95  ? 368  TYR B CA    1 
ATOM   6476  C  C     . TYR B  1 368 ? -72.192  40.330  -77.154  1.00 31.36  ? 368  TYR B C     1 
ATOM   6477  O  O     . TYR B  1 368 ? -72.160  41.491  -77.545  1.00 36.28  ? 368  TYR B O     1 
ATOM   6478  C  CB    . TYR B  1 368 ? -72.761  38.246  -78.368  1.00 25.54  ? 368  TYR B CB    1 
ATOM   6479  C  CG    . TYR B  1 368 ? -72.317  37.120  -79.263  1.00 35.45  ? 368  TYR B CG    1 
ATOM   6480  C  CD1   . TYR B  1 368 ? -72.172  35.830  -78.761  1.00 24.27  ? 368  TYR B CD1   1 
ATOM   6481  C  CD2   . TYR B  1 368 ? -72.059  37.336  -80.617  1.00 35.33  ? 368  TYR B CD2   1 
ATOM   6482  C  CE1   . TYR B  1 368 ? -71.782  34.774  -79.583  1.00 25.52  ? 368  TYR B CE1   1 
ATOM   6483  C  CE2   . TYR B  1 368 ? -71.664  36.284  -81.454  1.00 41.35  ? 368  TYR B CE2   1 
ATOM   6484  C  CZ    . TYR B  1 368 ? -71.531  35.004  -80.925  1.00 30.25  ? 368  TYR B CZ    1 
ATOM   6485  O  OH    . TYR B  1 368 ? -71.147  33.949  -81.718  1.00 29.97  ? 368  TYR B OH    1 
ATOM   6486  N  N     . LEU B  1 369 ? -72.675  39.987  -75.968  1.00 37.12  ? 369  LEU B N     1 
ATOM   6487  C  CA    . LEU B  1 369 ? -73.224  40.991  -75.065  1.00 26.90  ? 369  LEU B CA    1 
ATOM   6488  C  C     . LEU B  1 369 ? -72.197  42.053  -74.634  1.00 27.39  ? 369  LEU B C     1 
ATOM   6489  O  O     . LEU B  1 369 ? -72.526  43.225  -74.496  1.00 39.99  ? 369  LEU B O     1 
ATOM   6490  C  CB    . LEU B  1 369 ? -73.811  40.315  -73.831  1.00 22.60  ? 369  LEU B CB    1 
ATOM   6491  C  CG    . LEU B  1 369 ? -74.781  39.151  -74.030  1.00 33.81  ? 369  LEU B CG    1 
ATOM   6492  C  CD1   . LEU B  1 369 ? -75.400  38.795  -72.686  1.00 22.62  ? 369  LEU B CD1   1 
ATOM   6493  C  CD2   . LEU B  1 369 ? -75.867  39.511  -75.023  1.00 31.63  ? 369  LEU B CD2   1 
ATOM   6494  N  N     . CYS B  1 370 ? -70.960  41.639  -74.411  1.00 29.07  ? 370  CYS B N     1 
ATOM   6495  C  CA    . CYS B  1 370 ? -69.916  42.566  -73.999  1.00 24.95  ? 370  CYS B CA    1 
ATOM   6496  C  C     . CYS B  1 370 ? -69.604  43.541  -75.128  1.00 30.73  ? 370  CYS B C     1 
ATOM   6497  O  O     . CYS B  1 370 ? -69.578  44.747  -74.910  1.00 38.56  ? 370  CYS B O     1 
ATOM   6498  C  CB    . CYS B  1 370 ? -68.663  41.794  -73.606  1.00 34.08  ? 370  CYS B CB    1 
ATOM   6499  S  SG    . CYS B  1 370 ? -67.220  42.821  -73.317  1.00 30.85  ? 370  CYS B SG    1 
ATOM   6500  N  N     . PHE B  1 371 ? -69.374  43.018  -76.332  1.00 29.50  ? 371  PHE B N     1 
ATOM   6501  C  CA    . PHE B  1 371 ? -69.084  43.862  -77.497  1.00 34.99  ? 371  PHE B CA    1 
ATOM   6502  C  C     . PHE B  1 371 ? -70.220  44.820  -77.800  1.00 33.42  ? 371  PHE B C     1 
ATOM   6503  O  O     . PHE B  1 371 ? -70.000  46.006  -78.006  1.00 40.65  ? 371  PHE B O     1 
ATOM   6504  C  CB    . PHE B  1 371 ? -68.825  43.018  -78.737  1.00 24.38  ? 371  PHE B CB    1 
ATOM   6505  C  CG    . PHE B  1 371 ? -67.573  42.215  -78.665  1.00 35.67  ? 371  PHE B CG    1 
ATOM   6506  C  CD1   . PHE B  1 371 ? -67.215  41.387  -79.720  1.00 35.09  ? 371  PHE B CD1   1 
ATOM   6507  C  CD2   . PHE B  1 371 ? -66.754  42.273  -77.536  1.00 34.22  ? 371  PHE B CD2   1 
ATOM   6508  C  CE1   . PHE B  1 371 ? -66.056  40.624  -79.660  1.00 45.08  ? 371  PHE B CE1   1 
ATOM   6509  C  CE2   . PHE B  1 371 ? -65.598  41.520  -77.463  1.00 23.57  ? 371  PHE B CE2   1 
ATOM   6510  C  CZ    . PHE B  1 371 ? -65.248  40.690  -78.529  1.00 26.54  ? 371  PHE B CZ    1 
ATOM   6511  N  N     . ALA B  1 372 ? -71.434  44.291  -77.854  1.00 30.48  ? 372  ALA B N     1 
ATOM   6512  C  CA    . ALA B  1 372 ? -72.614  45.103  -78.106  1.00 38.26  ? 372  ALA B CA    1 
ATOM   6513  C  C     . ALA B  1 372 ? -72.724  46.237  -77.075  1.00 35.10  ? 372  ALA B C     1 
ATOM   6514  O  O     . ALA B  1 372 ? -72.914  47.391  -77.446  1.00 55.02  ? 372  ALA B O     1 
ATOM   6515  C  CB    . ALA B  1 372 ? -73.873  44.229  -78.069  1.00 23.95  ? 372  ALA B CB    1 
ATOM   6516  N  N     . ALA B  1 373 ? -72.557  45.912  -75.795  1.00 36.15  ? 373  ALA B N     1 
ATOM   6517  C  CA    . ALA B  1 373 ? -72.652  46.907  -74.725  1.00 37.19  ? 373  ALA B CA    1 
ATOM   6518  C  C     . ALA B  1 373 ? -71.615  48.012  -74.876  1.00 39.12  ? 373  ALA B C     1 
ATOM   6519  O  O     . ALA B  1 373 ? -71.891  49.180  -74.611  1.00 57.64  ? 373  ALA B O     1 
ATOM   6520  C  CB    . ALA B  1 373 ? -72.513  46.243  -73.364  1.00 29.84  ? 373  ALA B CB    1 
ATOM   6521  N  N     . LEU B  1 374 ? -70.412  47.636  -75.285  1.00 45.55  ? 374  LEU B N     1 
ATOM   6522  C  CA    . LEU B  1 374 ? -69.349  48.603  -75.485  1.00 40.08  ? 374  LEU B CA    1 
ATOM   6523  C  C     . LEU B  1 374 ? -69.790  49.601  -76.569  1.00 43.82  ? 374  LEU B C     1 
ATOM   6524  O  O     . LEU B  1 374 ? -69.737  50.811  -76.361  1.00 48.28  ? 374  LEU B O     1 
ATOM   6525  C  CB    . LEU B  1 374 ? -68.074  47.872  -75.908  1.00 48.03  ? 374  LEU B CB    1 
ATOM   6526  C  CG    . LEU B  1 374 ? -66.839  47.817  -75.002  1.00 43.65  ? 374  LEU B CG    1 
ATOM   6527  C  CD1   . LEU B  1 374 ? -67.034  48.561  -73.711  1.00 30.80  ? 374  LEU B CD1   1 
ATOM   6528  C  CD2   . LEU B  1 374 ? -66.504  46.383  -74.746  1.00 31.97  ? 374  LEU B CD2   1 
ATOM   6529  N  N     . LEU B  1 375 ? -70.286  49.072  -77.688  1.00 46.82  ? 375  LEU B N     1 
ATOM   6530  C  CA    . LEU B  1 375 ? -70.762  49.857  -78.832  1.00 41.24  ? 375  LEU B CA    1 
ATOM   6531  C  C     . LEU B  1 375 ? -71.889  50.803  -78.449  1.00 44.70  ? 375  LEU B C     1 
ATOM   6532  O  O     . LEU B  1 375 ? -71.788  52.010  -78.646  1.00 55.61  ? 375  LEU B O     1 
ATOM   6533  C  CB    . LEU B  1 375 ? -71.301  48.929  -79.916  1.00 32.29  ? 375  LEU B CB    1 
ATOM   6534  C  CG    . LEU B  1 375 ? -71.112  49.296  -81.389  1.00 46.25  ? 375  LEU B CG    1 
ATOM   6535  C  CD1   . LEU B  1 375 ? -72.293  48.761  -82.175  1.00 19.90  ? 375  LEU B CD1   1 
ATOM   6536  C  CD2   . LEU B  1 375 ? -70.976  50.788  -81.587  1.00 33.56  ? 375  LEU B CD2   1 
ATOM   6537  N  N     . MET B  1 376 ? -72.982  50.236  -77.946  1.00 36.69  ? 376  MET B N     1 
ATOM   6538  C  CA    . MET B  1 376 ? -74.147  51.010  -77.539  1.00 41.25  ? 376  MET B CA    1 
ATOM   6539  C  C     . MET B  1 376 ? -73.809  52.168  -76.610  1.00 46.03  ? 376  MET B C     1 
ATOM   6540  O  O     . MET B  1 376 ? -74.463  53.215  -76.650  1.00 65.29  ? 376  MET B O     1 
ATOM   6541  C  CB    . MET B  1 376 ? -75.175  50.101  -76.888  1.00 33.19  ? 376  MET B CB    1 
ATOM   6542  C  CG    . MET B  1 376 ? -75.693  49.000  -77.803  1.00 47.05  ? 376  MET B CG    1 
ATOM   6543  S  SD    . MET B  1 376 ? -76.606  49.562  -79.254  1.00 39.65  ? 376  MET B SD    1 
ATOM   6544  C  CE    . MET B  1 376 ? -78.136  50.094  -78.479  1.00 42.57  ? 376  MET B CE    1 
ATOM   6545  N  N     . ALA B  1 377 ? -72.803  51.967  -75.766  1.00 42.24  ? 377  ALA B N     1 
ATOM   6546  C  CA    . ALA B  1 377 ? -72.346  52.995  -74.837  1.00 50.05  ? 377  ALA B CA    1 
ATOM   6547  C  C     . ALA B  1 377 ? -71.600  54.067  -75.619  1.00 47.50  ? 377  ALA B C     1 
ATOM   6548  O  O     . ALA B  1 377 ? -71.771  55.256  -75.372  1.00 59.20  ? 377  ALA B O     1 
ATOM   6549  C  CB    . ALA B  1 377 ? -71.428  52.387  -73.775  1.00 44.81  ? 377  ALA B CB    1 
ATOM   6550  N  N     . GLY B  1 378 ? -70.762  53.633  -76.555  1.00 42.94  ? 378  GLY B N     1 
ATOM   6551  C  CA    . GLY B  1 378 ? -70.003  54.561  -77.371  1.00 48.03  ? 378  GLY B CA    1 
ATOM   6552  C  C     . GLY B  1 378 ? -70.919  55.405  -78.237  1.00 54.90  ? 378  GLY B C     1 
ATOM   6553  O  O     . GLY B  1 378 ? -70.701  56.605  -78.393  1.00 67.71  ? 378  GLY B O     1 
ATOM   6554  N  N     . LEU B  1 379 ? -71.957  54.779  -78.784  1.00 53.27  ? 379  LEU B N     1 
ATOM   6555  C  CA    . LEU B  1 379 ? -72.925  55.473  -79.629  1.00 52.03  ? 379  LEU B CA    1 
ATOM   6556  C  C     . LEU B  1 379 ? -73.726  56.494  -78.828  1.00 54.50  ? 379  LEU B C     1 
ATOM   6557  O  O     . LEU B  1 379 ? -74.072  57.551  -79.338  1.00 63.86  ? 379  LEU B O     1 
ATOM   6558  C  CB    . LEU B  1 379 ? -73.872  54.478  -80.307  1.00 35.43  ? 379  LEU B CB    1 
ATOM   6559  C  CG    . LEU B  1 379 ? -73.257  53.506  -81.322  1.00 48.32  ? 379  LEU B CG    1 
ATOM   6560  C  CD1   . LEU B  1 379 ? -74.372  52.750  -82.029  1.00 24.92  ? 379  LEU B CD1   1 
ATOM   6561  C  CD2   . LEU B  1 379 ? -72.366  54.243  -82.341  1.00 27.18  ? 379  LEU B CD2   1 
ATOM   6562  N  N     . ASP B  1 380 ? -74.027  56.169  -77.575  1.00 49.01  ? 380  ASP B N     1 
ATOM   6563  C  CA    . ASP B  1 380 ? -74.766  57.082  -76.718  1.00 36.92  ? 380  ASP B CA    1 
ATOM   6564  C  C     . ASP B  1 380 ? -73.851  58.251  -76.364  1.00 44.17  ? 380  ASP B C     1 
ATOM   6565  O  O     . ASP B  1 380 ? -74.310  59.312  -75.960  1.00 61.04  ? 380  ASP B O     1 
ATOM   6566  C  CB    . ASP B  1 380 ? -75.221  56.360  -75.454  1.00 46.65  ? 380  ASP B CB    1 
ATOM   6567  C  CG    . ASP B  1 380 ? -76.072  57.231  -74.557  1.00 54.00  ? 380  ASP B CG    1 
ATOM   6568  O  OD1   . ASP B  1 380 ? -77.290  57.364  -74.832  1.00 63.98  ? 380  ASP B OD1   1 
ATOM   6569  O  OD2   . ASP B  1 380 ? -75.516  57.781  -73.580  1.00 50.18  ? 380  ASP B OD2   1 
ATOM   6570  N  N     . GLY B  1 381 ? -72.549  58.039  -76.503  1.00 51.69  ? 381  GLY B N     1 
ATOM   6571  C  CA    . GLY B  1 381 ? -71.594  59.093  -76.213  1.00 50.05  ? 381  GLY B CA    1 
ATOM   6572  C  C     . GLY B  1 381 ? -71.554  60.050  -77.384  1.00 55.78  ? 381  GLY B C     1 
ATOM   6573  O  O     . GLY B  1 381 ? -71.415  61.255  -77.213  1.00 60.49  ? 381  GLY B O     1 
ATOM   6574  N  N     . ILE B  1 382 ? -71.678  59.488  -78.581  1.00 52.11  ? 382  ILE B N     1 
ATOM   6575  C  CA    . ILE B  1 382 ? -71.685  60.243  -79.823  1.00 51.90  ? 382  ILE B CA    1 
ATOM   6576  C  C     . ILE B  1 382 ? -73.018  60.973  -80.019  1.00 60.19  ? 382  ILE B C     1 
ATOM   6577  O  O     . ILE B  1 382 ? -73.039  62.194  -80.197  1.00 62.82  ? 382  ILE B O     1 
ATOM   6578  C  CB    . ILE B  1 382 ? -71.405  59.300  -81.008  1.00 47.94  ? 382  ILE B CB    1 
ATOM   6579  C  CG1   . ILE B  1 382 ? -69.909  59.001  -81.081  1.00 52.06  ? 382  ILE B CG1   1 
ATOM   6580  C  CG2   . ILE B  1 382 ? -71.934  59.873  -82.306  1.00 55.89  ? 382  ILE B CG2   1 
ATOM   6581  C  CD1   . ILE B  1 382 ? -69.571  57.877  -82.026  1.00 45.18  ? 382  ILE B CD1   1 
ATOM   6582  N  N     . LYS B  1 383 ? -74.127  60.232  -79.977  1.00 62.18  ? 383  LYS B N     1 
ATOM   6583  C  CA    . LYS B  1 383 ? -75.454  60.835  -80.134  1.00 59.78  ? 383  LYS B CA    1 
ATOM   6584  C  C     . LYS B  1 383 ? -75.597  62.028  -79.205  1.00 59.90  ? 383  LYS B C     1 
ATOM   6585  O  O     . LYS B  1 383 ? -76.176  63.042  -79.582  1.00 77.12  ? 383  LYS B O     1 
ATOM   6586  C  CB    . LYS B  1 383 ? -76.586  59.840  -79.806  1.00 58.66  ? 383  LYS B CB    1 
ATOM   6587  C  CG    . LYS B  1 383 ? -76.978  58.820  -80.887  1.00 75.61  ? 383  LYS B CG    1 
ATOM   6588  C  CD    . LYS B  1 383 ? -78.472  58.433  -80.791  1.00 85.87  ? 383  LYS B CD    1 
ATOM   6589  C  CE    . LYS B  1 383 ? -78.947  58.205  -79.343  1.00 98.75  ? 383  LYS B CE    1 
ATOM   6590  N  NZ    . LYS B  1 383 ? -78.289  57.051  -78.644  1.00 95.31  ? 383  LYS B NZ    1 
ATOM   6591  N  N     . ASN B  1 384 ? -75.020  61.923  -78.008  1.00 46.53  ? 384  ASN B N     1 
ATOM   6592  C  CA    . ASN B  1 384 ? -75.115  62.988  -76.994  1.00 48.04  ? 384  ASN B CA    1 
ATOM   6593  C  C     . ASN B  1 384 ? -73.832  63.791  -76.736  1.00 56.04  ? 384  ASN B C     1 
ATOM   6594  O  O     . ASN B  1 384 ? -73.688  64.402  -75.671  1.00 52.89  ? 384  ASN B O     1 
ATOM   6595  C  CB    . ASN B  1 384 ? -75.633  62.415  -75.662  1.00 39.72  ? 384  ASN B CB    1 
ATOM   6596  C  CG    . ASN B  1 384 ? -77.010  61.780  -75.775  1.00 56.59  ? 384  ASN B CG    1 
ATOM   6597  O  OD1   . ASN B  1 384 ? -77.830  61.928  -74.872  1.00 69.93  ? 384  ASN B OD1   1 
ATOM   6598  N  ND2   . ASN B  1 384 ? -77.276  61.084  -76.870  1.00 71.20  ? 384  ASN B ND2   1 
ATOM   6599  N  N     . LYS B  1 385 ? -72.904  63.787  -77.692  1.00 58.45  ? 385  LYS B N     1 
ATOM   6600  C  CA    . LYS B  1 385 ? -71.646  64.556  -77.577  1.00 67.80  ? 385  LYS B CA    1 
ATOM   6601  C  C     . LYS B  1 385 ? -71.061  64.588  -76.146  1.00 68.05  ? 385  LYS B C     1 
ATOM   6602  O  O     . LYS B  1 385 ? -70.743  65.663  -75.642  1.00 69.65  ? 385  LYS B O     1 
ATOM   6603  C  CB    . LYS B  1 385 ? -71.880  66.000  -78.052  1.00 76.67  ? 385  LYS B CB    1 
ATOM   6604  C  CG    . LYS B  1 385 ? -72.769  66.148  -79.303  1.00 83.99  ? 385  LYS B CG    1 
ATOM   6605  C  CD    . LYS B  1 385 ? -71.971  66.554  -80.542  1.00 95.68  ? 385  LYS B CD    1 
ATOM   6606  C  CE    . LYS B  1 385 ? -72.731  66.226  -81.829  1.00 100.00 ? 385  LYS B CE    1 
ATOM   6607  N  NZ    . LYS B  1 385 ? -72.457  64.852  -82.374  1.00 100.00 ? 385  LYS B NZ    1 
ATOM   6608  N  N     . ILE B  1 386 ? -70.978  63.441  -75.497  1.00 73.01  ? 386  ILE B N     1 
ATOM   6609  C  CA    . ILE B  1 386 ? -70.451  63.381  -74.126  1.00 66.33  ? 386  ILE B CA    1 
ATOM   6610  C  C     . ILE B  1 386 ? -68.945  63.561  -74.125  1.00 65.59  ? 386  ILE B C     1 
ATOM   6611  O  O     . ILE B  1 386 ? -68.206  62.667  -74.512  1.00 57.43  ? 386  ILE B O     1 
ATOM   6612  C  CB    . ILE B  1 386 ? -70.784  62.039  -73.441  1.00 52.91  ? 386  ILE B CB    1 
ATOM   6613  C  CG1   . ILE B  1 386 ? -72.274  61.712  -73.615  1.00 46.25  ? 386  ILE B CG1   1 
ATOM   6614  C  CG2   . ILE B  1 386 ? -70.407  62.091  -71.969  1.00 41.49  ? 386  ILE B CG2   1 
ATOM   6615  C  CD1   . ILE B  1 386 ? -72.744  60.446  -72.971  1.00 50.20  ? 386  ILE B CD1   1 
ATOM   6616  N  N     . HIS B  1 387 ? -68.484  64.731  -73.666  1.00 66.77  ? 387  HIS B N     1 
ATOM   6617  C  CA    . HIS B  1 387 ? -67.066  64.969  -73.645  1.00 66.34  ? 387  HIS B CA    1 
ATOM   6618  C  C     . HIS B  1 387 ? -66.413  64.127  -72.552  1.00 64.07  ? 387  HIS B C     1 
ATOM   6619  O  O     . HIS B  1 387 ? -66.858  64.107  -71.392  1.00 59.75  ? 387  HIS B O     1 
ATOM   6620  C  CB    . HIS B  1 387 ? -66.717  66.461  -73.468  1.00 75.08  ? 387  HIS B CB    1 
ATOM   6621  C  CG    . HIS B  1 387 ? -65.358  66.811  -73.984  1.00 72.33  ? 387  HIS B CG    1 
ATOM   6622  N  ND1   . HIS B  1 387 ? -64.257  66.884  -73.162  1.00 74.14  ? 387  HIS B ND1   1 
ATOM   6623  C  CD2   . HIS B  1 387 ? -64.910  67.023  -75.244  1.00 80.53  ? 387  HIS B CD2   1 
ATOM   6624  C  CE1   . HIS B  1 387 ? -63.183  67.119  -73.897  1.00 80.97  ? 387  HIS B CE1   1 
ATOM   6625  N  NE2   . HIS B  1 387 ? -63.551  67.207  -75.162  1.00 88.55  ? 387  HIS B NE2   1 
ATOM   6626  N  N     . PRO B  1 388 ? -65.385  63.356  -72.941  1.00 53.75  ? 388  PRO B N     1 
ATOM   6627  C  CA    . PRO B  1 388 ? -64.612  62.464  -72.075  1.00 59.10  ? 388  PRO B CA    1 
ATOM   6628  C  C     . PRO B  1 388 ? -63.704  63.210  -71.120  1.00 63.62  ? 388  PRO B C     1 
ATOM   6629  O  O     . PRO B  1 388 ? -62.885  62.604  -70.424  1.00 75.00  ? 388  PRO B O     1 
ATOM   6630  C  CB    . PRO B  1 388 ? -63.791  61.661  -73.082  1.00 56.30  ? 388  PRO B CB    1 
ATOM   6631  C  CG    . PRO B  1 388 ? -63.525  62.641  -74.146  1.00 47.93  ? 388  PRO B CG    1 
ATOM   6632  C  CD    . PRO B  1 388 ? -64.892  63.276  -74.325  1.00 51.47  ? 388  PRO B CD    1 
ATOM   6633  N  N     . GLY B  1 389 ? -63.843  64.530  -71.095  1.00 67.91  ? 389  GLY B N     1 
ATOM   6634  C  CA    . GLY B  1 389 ? -62.996  65.331  -70.240  1.00 68.88  ? 389  GLY B CA    1 
ATOM   6635  C  C     . GLY B  1 389 ? -61.578  65.347  -70.780  1.00 67.88  ? 389  GLY B C     1 
ATOM   6636  O  O     . GLY B  1 389 ? -61.347  65.113  -71.966  1.00 64.86  ? 389  GLY B O     1 
ATOM   6637  N  N     . GLU B  1 390 ? -60.626  65.585  -69.894  1.00 70.47  ? 390  GLU B N     1 
ATOM   6638  C  CA    . GLU B  1 390 ? -59.228  65.654  -70.273  1.00 72.87  ? 390  GLU B CA    1 
ATOM   6639  C  C     . GLU B  1 390 ? -58.528  64.312  -70.023  1.00 80.59  ? 390  GLU B C     1 
ATOM   6640  O  O     . GLU B  1 390 ? -58.955  63.522  -69.169  1.00 94.76  ? 390  GLU B O     1 
ATOM   6641  C  CB    . GLU B  1 390 ? -58.565  66.789  -69.470  1.00 82.39  ? 390  GLU B CB    1 
ATOM   6642  C  CG    . GLU B  1 390 ? -57.548  67.639  -70.237  1.00 91.75  ? 390  GLU B CG    1 
ATOM   6643  C  CD    . GLU B  1 390 ? -58.101  68.238  -71.530  1.00 100.00 ? 390  GLU B CD    1 
ATOM   6644  O  OE1   . GLU B  1 390 ? -59.274  68.682  -71.554  1.00 95.31  ? 390  GLU B OE1   1 
ATOM   6645  O  OE2   . GLU B  1 390 ? -57.352  68.269  -72.532  1.00 100.00 ? 390  GLU B OE2   1 
ATOM   6646  N  N     . PRO B  1 391 ? -57.490  64.003  -70.820  1.00 79.74  ? 391  PRO B N     1 
ATOM   6647  C  CA    . PRO B  1 391 ? -56.728  62.754  -70.679  1.00 78.33  ? 391  PRO B CA    1 
ATOM   6648  C  C     . PRO B  1 391 ? -55.986  62.714  -69.345  1.00 74.90  ? 391  PRO B C     1 
ATOM   6649  O  O     . PRO B  1 391 ? -55.650  63.756  -68.782  1.00 75.31  ? 391  PRO B O     1 
ATOM   6650  C  CB    . PRO B  1 391 ? -55.740  62.820  -71.842  1.00 71.85  ? 391  PRO B CB    1 
ATOM   6651  C  CG    . PRO B  1 391 ? -56.474  63.621  -72.864  1.00 97.70  ? 391  PRO B CG    1 
ATOM   6652  C  CD    . PRO B  1 391 ? -57.091  64.720  -72.043  1.00 93.44  ? 391  PRO B CD    1 
ATOM   6653  N  N     . MET B  1 392 ? -55.713  61.503  -68.865  1.00 83.18  ? 392  MET B N     1 
ATOM   6654  C  CA    . MET B  1 392 ? -55.027  61.294  -67.590  1.00 81.76  ? 392  MET B CA    1 
ATOM   6655  C  C     . MET B  1 392 ? -53.585  60.852  -67.790  1.00 74.82  ? 392  MET B C     1 
ATOM   6656  O  O     . MET B  1 392 ? -53.233  59.719  -67.469  1.00 90.73  ? 392  MET B O     1 
ATOM   6657  C  CB    . MET B  1 392 ? -55.771  60.226  -66.778  1.00 95.20  ? 392  MET B CB    1 
ATOM   6658  C  CG    . MET B  1 392 ? -55.659  60.372  -65.275  1.00 100.00 ? 392  MET B CG    1 
ATOM   6659  S  SD    . MET B  1 392 ? -56.302  61.985  -64.749  1.00 100.00 ? 392  MET B SD    1 
ATOM   6660  C  CE    . MET B  1 392 ? -57.929  62.054  -65.579  1.00 99.31  ? 392  MET B CE    1 
ATOM   6661  N  N     . ASP B  1 393 ? -52.795  61.709  -68.381  0.72 60.87  ? 393  ASP B N     1 
ATOM   6662  C  CA    . ASP B  1 393 ? -51.458  61.288  -68.645  0.72 72.63  ? 393  ASP B CA    1 
ATOM   6663  C  C     . ASP B  1 393 ? -50.604  61.400  -67.436  0.72 85.67  ? 393  ASP B C     1 
ATOM   6664  O  O     . ASP B  1 393 ? -49.409  61.146  -67.537  0.72 90.09  ? 393  ASP B O     1 
ATOM   6665  C  CB    . ASP B  1 393 ? -50.784  62.168  -69.706  0.72 55.95  ? 393  ASP B CB    1 
ATOM   6666  C  CG    . ASP B  1 393 ? -51.340  61.983  -71.105  0.72 71.57  ? 393  ASP B CG    1 
ATOM   6667  O  OD1   . ASP B  1 393 ? -52.575  61.878  -71.250  0.72 84.71  ? 393  ASP B OD1   1 
ATOM   6668  O  OD2   . ASP B  1 393 ? -50.544  61.952  -72.067  0.72 72.64  ? 393  ASP B OD2   1 
ATOM   6669  N  N     . LYS B  1 394 ? -51.121  61.769  -66.303  0.72 93.43  ? 394  LYS B N     1 
ATOM   6670  C  CA    . LYS B  1 394 ? -50.128  61.981  -65.290  0.72 100.00 ? 394  LYS B CA    1 
ATOM   6671  C  C     . LYS B  1 394 ? -49.587  60.686  -64.679  0.72 100.00 ? 394  LYS B C     1 
ATOM   6672  O  O     . LYS B  1 394 ? -48.544  60.199  -65.095  0.72 100.00 ? 394  LYS B O     1 
ATOM   6673  C  CB    . LYS B  1 394 ? -50.669  63.005  -64.298  0.72 100.00 ? 394  LYS B CB    1 
ATOM   6674  C  CG    . LYS B  1 394 ? -50.943  64.341  -64.963  0.72 100.00 ? 394  LYS B CG    1 
ATOM   6675  C  CD    . LYS B  1 394 ? -49.775  64.787  -65.822  0.72 100.00 ? 394  LYS B CD    1 
ATOM   6676  C  CE    . LYS B  1 394 ? -48.531  64.978  -64.987  0.72 100.00 ? 394  LYS B CE    1 
ATOM   6677  N  NZ    . LYS B  1 394 ? -48.863  65.448  -63.615  0.72 100.00 ? 394  LYS B NZ    1 
ATOM   6678  N  N     . ASN B  1 395 ? -50.293  60.138  -63.702  0.72 100.00 ? 395  ASN B N     1 
ATOM   6679  C  CA    . ASN B  1 395 ? -49.884  58.914  -63.043  0.72 100.00 ? 395  ASN B CA    1 
ATOM   6680  C  C     . ASN B  1 395 ? -50.944  58.502  -62.050  0.72 99.08  ? 395  ASN B C     1 
ATOM   6681  O  O     . ASN B  1 395 ? -51.542  59.302  -61.319  0.72 94.19  ? 395  ASN B O     1 
ATOM   6682  C  CB    . ASN B  1 395 ? -48.493  59.047  -62.378  0.72 100.00 ? 395  ASN B CB    1 
ATOM   6683  C  CG    . ASN B  1 395 ? -47.602  57.838  -62.657  0.72 100.00 ? 395  ASN B CG    1 
ATOM   6684  O  OD1   . ASN B  1 395 ? -46.626  57.592  -61.956  0.72 100.00 ? 395  ASN B OD1   1 
ATOM   6685  N  ND2   . ASN B  1 395 ? -47.966  57.077  -63.678  0.72 100.00 ? 395  ASN B ND2   1 
ATOM   6686  N  N     . LEU B  1 396 ? -51.148  57.190  -62.051  0.72 98.84  ? 396  LEU B N     1 
ATOM   6687  C  CA    . LEU B  1 396 ? -52.090  56.448  -61.255  0.72 100.00 ? 396  LEU B CA    1 
ATOM   6688  C  C     . LEU B  1 396 ? -52.239  56.843  -59.802  0.72 100.00 ? 396  LEU B C     1 
ATOM   6689  O  O     . LEU B  1 396 ? -51.410  57.564  -59.233  0.72 100.00 ? 396  LEU B O     1 
ATOM   6690  C  CB    . LEU B  1 396 ? -51.695  54.962  -61.305  0.72 95.32  ? 396  LEU B CB    1 
ATOM   6691  C  CG    . LEU B  1 396 ? -50.280  54.666  -61.787  0.72 88.34  ? 396  LEU B CG    1 
ATOM   6692  C  CD1   . LEU B  1 396 ? -49.270  54.954  -60.698  0.72 95.88  ? 396  LEU B CD1   1 
ATOM   6693  C  CD2   . LEU B  1 396 ? -50.152  53.231  -62.269  0.72 94.94  ? 396  LEU B CD2   1 
ATOM   6694  N  N     . TYR B  1 397 ? -53.331  56.325  -59.216  0.72 97.48  ? 397  TYR B N     1 
ATOM   6695  C  CA    . TYR B  1 397 ? -53.721  56.521  -57.808  0.72 100.00 ? 397  TYR B CA    1 
ATOM   6696  C  C     . TYR B  1 397 ? -52.612  56.037  -56.890  0.72 100.00 ? 397  TYR B C     1 
ATOM   6697  O  O     . TYR B  1 397 ? -52.775  56.089  -55.634  0.72 100.00 ? 397  TYR B O     1 
ATOM   6698  C  CB    . TYR B  1 397 ? -55.057  55.804  -57.501  0.72 100.00 ? 397  TYR B CB    1 
ATOM   6699  C  CG    . TYR B  1 397 ? -56.102  56.336  -56.468  0.72 100.00 ? 397  TYR B CG    1 
ATOM   6700  C  CD1   . TYR B  1 397 ? -55.785  56.635  -55.129  0.72 100.00 ? 397  TYR B CD1   1 
ATOM   6701  C  CD2   . TYR B  1 397 ? -57.435  56.490  -56.864  0.72 100.00 ? 397  TYR B CD2   1 
ATOM   6702  C  CE1   . TYR B  1 397 ? -56.781  57.058  -54.241  0.72 100.00 ? 397  TYR B CE1   1 
ATOM   6703  C  CE2   . TYR B  1 397 ? -58.432  56.906  -55.958  0.72 100.00 ? 397  TYR B CE2   1 
ATOM   6704  C  CZ    . TYR B  1 397 ? -58.100  57.179  -54.638  0.72 100.00 ? 397  TYR B CZ    1 
ATOM   6705  O  OH    . TYR B  1 397 ? -59.075  57.570  -53.747  0.72 100.00 ? 397  TYR B OH    1 
ATOM   6706  N  N     . ASP B  1 398 ? -51.640  55.301  -57.368  0.72 100.00 ? 398  ASP B N     1 
ATOM   6707  C  CA    . ASP B  1 398 ? -50.590  54.967  -56.411  0.72 100.00 ? 398  ASP B CA    1 
ATOM   6708  C  C     . ASP B  1 398 ? -49.943  56.264  -56.132  0.72 100.00 ? 398  ASP B C     1 
ATOM   6709  O  O     . ASP B  1 398 ? -49.158  56.427  -55.201  0.72 100.00 ? 398  ASP B O     1 
ATOM   6710  C  CB    . ASP B  1 398 ? -49.633  53.971  -57.001  0.72 100.00 ? 398  ASP B CB    1 
ATOM   6711  C  CG    . ASP B  1 398 ? -50.501  52.849  -57.560  0.72 100.00 ? 398  ASP B CG    1 
ATOM   6712  O  OD1   . ASP B  1 398 ? -51.283  52.248  -56.775  0.72 100.00 ? 398  ASP B OD1   1 
ATOM   6713  O  OD2   . ASP B  1 398 ? -50.420  52.566  -58.774  0.72 100.00 ? 398  ASP B OD2   1 
ATOM   6714  N  N     . LEU B  1 399 ? -50.287  57.195  -56.945  0.72 100.00 ? 399  LEU B N     1 
ATOM   6715  C  CA    . LEU B  1 399 ? -50.013  58.570  -56.707  0.72 100.00 ? 399  LEU B CA    1 
ATOM   6716  C  C     . LEU B  1 399 ? -51.211  58.976  -55.849  0.72 99.89  ? 399  LEU B C     1 
ATOM   6717  O  O     . LEU B  1 399 ? -51.864  59.951  -56.220  0.72 91.58  ? 399  LEU B O     1 
ATOM   6718  C  CB    . LEU B  1 399 ? -49.915  59.382  -57.978  0.72 91.07  ? 399  LEU B CB    1 
ATOM   6719  C  CG    . LEU B  1 399 ? -48.742  58.991  -58.887  0.72 84.50  ? 399  LEU B CG    1 
ATOM   6720  C  CD1   . LEU B  1 399 ? -48.518  60.031  -59.975  0.72 72.61  ? 399  LEU B CD1   1 
ATOM   6721  C  CD2   . LEU B  1 399 ? -47.481  58.781  -58.058  0.72 53.23  ? 399  LEU B CD2   1 
ATOM   6722  N  N     . PRO B  1 400 ? -51.236  58.262  -54.684  0.72 100.00 ? 400  PRO B N     1 
ATOM   6723  C  CA    . PRO B  1 400 ? -52.416  58.324  -53.758  0.72 100.00 ? 400  PRO B CA    1 
ATOM   6724  C  C     . PRO B  1 400 ? -53.076  59.700  -53.548  0.72 100.00 ? 400  PRO B C     1 
ATOM   6725  O  O     . PRO B  1 400 ? -52.698  60.636  -54.258  0.72 100.00 ? 400  PRO B O     1 
ATOM   6726  C  CB    . PRO B  1 400 ? -51.964  57.785  -52.441  0.72 100.00 ? 400  PRO B CB    1 
ATOM   6727  C  CG    . PRO B  1 400 ? -50.607  57.312  -52.603  0.72 100.00 ? 400  PRO B CG    1 
ATOM   6728  C  CD    . PRO B  1 400 ? -50.097  57.923  -53.860  0.72 100.00 ? 400  PRO B CD    1 
ATOM   6729  N  N     . PRO B  1 401 ? -54.223  59.700  -52.823  0.72 100.00 ? 401  PRO B N     1 
ATOM   6730  C  CA    . PRO B  1 401 ? -54.922  60.900  -52.504  0.72 100.00 ? 401  PRO B CA    1 
ATOM   6731  C  C     . PRO B  1 401 ? -54.234  62.240  -52.643  0.72 100.00 ? 401  PRO B C     1 
ATOM   6732  O  O     . PRO B  1 401 ? -53.549  62.719  -51.725  0.72 100.00 ? 401  PRO B O     1 
ATOM   6733  C  CB    . PRO B  1 401 ? -55.689  60.621  -51.241  0.72 93.40  ? 401  PRO B CB    1 
ATOM   6734  C  CG    . PRO B  1 401 ? -55.940  59.115  -51.390  0.72 85.81  ? 401  PRO B CG    1 
ATOM   6735  C  CD    . PRO B  1 401 ? -54.821  58.524  -52.208  0.72 87.38  ? 401  PRO B CD    1 
ATOM   6736  N  N     . GLU B  1 402 ? -54.424  62.849  -53.823  0.72 100.00 ? 402  GLU B N     1 
ATOM   6737  C  CA    . GLU B  1 402 ? -53.898  64.170  -54.144  0.72 100.00 ? 402  GLU B CA    1 
ATOM   6738  C  C     . GLU B  1 402 ? -55.037  65.200  -54.017  0.72 100.00 ? 402  GLU B C     1 
ATOM   6739  O  O     . GLU B  1 402 ? -54.808  66.415  -53.910  0.72 100.00 ? 402  GLU B O     1 
ATOM   6740  C  CB    . GLU B  1 402 ? -53.257  64.166  -55.553  0.72 93.53  ? 402  GLU B CB    1 
ATOM   6741  C  CG    . GLU B  1 402 ? -51.905  63.478  -55.636  0.72 97.77  ? 402  GLU B CG    1 
ATOM   6742  C  CD    . GLU B  1 402 ? -51.357  63.335  -57.061  0.72 100.00 ? 402  GLU B CD    1 
ATOM   6743  O  OE1   . GLU B  1 402 ? -51.833  64.053  -57.973  0.72 100.00 ? 402  GLU B OE1   1 
ATOM   6744  O  OE2   . GLU B  1 402 ? -50.441  62.500  -57.270  0.72 96.40  ? 402  GLU B OE2   1 
ATOM   6745  N  N     . GLU B  1 403 ? -56.233  64.675  -54.051  0.72 100.00 ? 403  GLU B N     1 
ATOM   6746  C  CA    . GLU B  1 403 ? -57.538  65.320  -53.929  0.72 100.00 ? 403  GLU B CA    1 
ATOM   6747  C  C     . GLU B  1 403 ? -58.459  64.129  -53.628  0.72 100.00 ? 403  GLU B C     1 
ATOM   6748  O  O     . GLU B  1 403 ? -59.665  64.106  -53.917  0.72 100.00 ? 403  GLU B O     1 
ATOM   6749  C  CB    . GLU B  1 403 ? -57.946  66.065  -55.217  0.72 100.00 ? 403  GLU B CB    1 
ATOM   6750  C  CG    . GLU B  1 403 ? -58.797  65.272  -56.215  0.72 97.87  ? 403  GLU B CG    1 
ATOM   6751  C  CD    . GLU B  1 403 ? -58.047  64.834  -57.456  0.72 100.00 ? 403  GLU B CD    1 
ATOM   6752  O  OE1   . GLU B  1 403 ? -58.612  64.009  -58.203  0.72 89.33  ? 403  GLU B OE1   1 
ATOM   6753  O  OE2   . GLU B  1 403 ? -56.906  65.308  -57.670  0.72 96.29  ? 403  GLU B OE2   1 
ATOM   6754  N  N     . ALA B  1 404 ? -57.797  63.116  -53.035  0.72 93.67  ? 404  ALA B N     1 
ATOM   6755  C  CA    . ALA B  1 404 ? -58.341  61.799  -52.723  0.72 98.40  ? 404  ALA B CA    1 
ATOM   6756  C  C     . ALA B  1 404 ? -58.364  61.010  -54.008  0.72 100.00 ? 404  ALA B C     1 
ATOM   6757  O  O     . ALA B  1 404 ? -58.652  59.807  -54.014  0.72 100.00 ? 404  ALA B O     1 
ATOM   6758  C  CB    . ALA B  1 404 ? -59.742  61.907  -52.141  0.72 89.24  ? 404  ALA B CB    1 
ATOM   6759  N  N     . LYS B  1 405 ? -58.047  61.715  -55.107  1.00 100.00 ? 405  LYS B N     1 
ATOM   6760  C  CA    . LYS B  1 405 ? -58.050  61.209  -56.489  1.00 100.00 ? 405  LYS B CA    1 
ATOM   6761  C  C     . LYS B  1 405 ? -59.405  60.573  -56.837  1.00 100.00 ? 405  LYS B C     1 
ATOM   6762  O  O     . LYS B  1 405 ? -59.524  59.374  -57.139  1.00 100.00 ? 405  LYS B O     1 
ATOM   6763  C  CB    . LYS B  1 405 ? -56.850  60.291  -56.801  1.00 100.00 ? 405  LYS B CB    1 
ATOM   6764  C  CG    . LYS B  1 405 ? -55.471  61.008  -56.808  1.00 100.00 ? 405  LYS B CG    1 
ATOM   6765  C  CD    . LYS B  1 405 ? -55.446  62.309  -57.653  1.00 100.00 ? 405  LYS B CD    1 
ATOM   6766  C  CE    . LYS B  1 405 ? -54.974  62.124  -59.114  1.00 100.00 ? 405  LYS B CE    1 
ATOM   6767  N  NZ    . LYS B  1 405 ? -53.482  62.006  -59.281  1.00 100.00 ? 405  LYS B NZ    1 
ATOM   6768  N  N     . GLU B  1 406 ? -60.433  61.416  -56.773  1.00 100.00 ? 406  GLU B N     1 
ATOM   6769  C  CA    . GLU B  1 406 ? -61.796  61.014  -57.033  1.00 100.00 ? 406  GLU B CA    1 
ATOM   6770  C  C     . GLU B  1 406 ? -62.094  61.015  -58.518  1.00 100.00 ? 406  GLU B C     1 
ATOM   6771  O  O     . GLU B  1 406 ? -62.932  61.754  -59.031  1.00 93.24  ? 406  GLU B O     1 
ATOM   6772  C  CB    . GLU B  1 406 ? -62.771  61.844  -56.211  1.00 100.00 ? 406  GLU B CB    1 
ATOM   6773  C  CG    . GLU B  1 406 ? -62.847  61.327  -54.773  1.00 100.00 ? 406  GLU B CG    1 
ATOM   6774  C  CD    . GLU B  1 406 ? -62.903  59.799  -54.709  1.00 100.00 ? 406  GLU B CD    1 
ATOM   6775  O  OE1   . GLU B  1 406 ? -61.835  59.155  -54.545  1.00 90.95  ? 406  GLU B OE1   1 
ATOM   6776  O  OE2   . GLU B  1 406 ? -64.019  59.247  -54.828  1.00 100.00 ? 406  GLU B OE2   1 
ATOM   6777  N  N     . ILE B  1 407 ? -61.342  60.134  -59.173  1.00 100.00 ? 407  ILE B N     1 
ATOM   6778  C  CA    . ILE B  1 407 ? -61.465  59.831  -60.563  1.00 93.00  ? 407  ILE B CA    1 
ATOM   6779  C  C     . ILE B  1 407 ? -62.458  58.687  -60.625  1.00 84.27  ? 407  ILE B C     1 
ATOM   6780  O  O     . ILE B  1 407 ? -62.435  57.773  -59.808  1.00 75.86  ? 407  ILE B O     1 
ATOM   6781  C  CB    . ILE B  1 407 ? -60.106  59.388  -61.165  1.00 95.69  ? 407  ILE B CB    1 
ATOM   6782  C  CG1   . ILE B  1 407 ? -59.063  60.508  -61.033  1.00 100.00 ? 407  ILE B CG1   1 
ATOM   6783  C  CG2   . ILE B  1 407 ? -60.273  58.983  -62.627  1.00 89.67  ? 407  ILE B CG2   1 
ATOM   6784  C  CD1   . ILE B  1 407 ? -59.372  61.723  -61.884  1.00 100.00 ? 407  ILE B CD1   1 
ATOM   6785  N  N     . PRO B  1 408 ? -63.332  58.731  -61.601  1.00 76.55  ? 408  PRO B N     1 
ATOM   6786  C  CA    . PRO B  1 408 ? -64.334  57.623  -61.758  1.00 75.13  ? 408  PRO B CA    1 
ATOM   6787  C  C     . PRO B  1 408 ? -63.718  56.241  -61.886  1.00 73.76  ? 408  PRO B C     1 
ATOM   6788  O  O     . PRO B  1 408 ? -62.738  56.104  -62.604  1.00 66.85  ? 408  PRO B O     1 
ATOM   6789  C  CB    . PRO B  1 408 ? -65.193  58.126  -62.889  1.00 73.90  ? 408  PRO B CB    1 
ATOM   6790  C  CG    . PRO B  1 408 ? -65.229  59.610  -62.617  1.00 94.46  ? 408  PRO B CG    1 
ATOM   6791  C  CD    . PRO B  1 408 ? -64.010  59.997  -61.826  1.00 93.21  ? 408  PRO B CD    1 
ATOM   6792  N  N     . GLN B  1 409 ? -64.244  55.195  -61.223  1.00 62.99  ? 409  GLN B N     1 
ATOM   6793  C  CA    . GLN B  1 409 ? -63.654  53.883  -61.439  1.00 49.78  ? 409  GLN B CA    1 
ATOM   6794  C  C     . GLN B  1 409 ? -64.672  52.841  -61.853  1.00 48.66  ? 409  GLN B C     1 
ATOM   6795  O  O     . GLN B  1 409 ? -65.880  53.093  -61.816  1.00 63.61  ? 409  GLN B O     1 
ATOM   6796  C  CB    . GLN B  1 409 ? -62.941  53.405  -60.182  1.00 43.38  ? 409  GLN B CB    1 
ATOM   6797  C  CG    . GLN B  1 409 ? -61.625  54.087  -59.917  1.00 62.04  ? 409  GLN B CG    1 
ATOM   6798  C  CD    . GLN B  1 409 ? -60.935  53.540  -58.689  1.00 69.24  ? 409  GLN B CD    1 
ATOM   6799  O  OE1   . GLN B  1 409 ? -60.339  54.292  -57.920  1.00 80.09  ? 409  GLN B OE1   1 
ATOM   6800  N  NE2   . GLN B  1 409 ? -61.007  52.222  -58.498  1.00 74.76  ? 409  GLN B NE2   1 
ATOM   6801  N  N     . VAL B  1 410 ? -64.167  51.678  -62.268  1.00 39.72  ? 410  VAL B N     1 
ATOM   6802  C  CA    . VAL B  1 410 ? -65.008  50.553  -62.673  1.00 30.03  ? 410  VAL B CA    1 
ATOM   6803  C  C     . VAL B  1 410 ? -65.677  49.968  -61.427  1.00 34.67  ? 410  VAL B C     1 
ATOM   6804  O  O     . VAL B  1 410 ? -65.263  50.258  -60.297  1.00 43.81  ? 410  VAL B O     1 
ATOM   6805  C  CB    . VAL B  1 410 ? -64.179  49.431  -63.337  1.00 35.36  ? 410  VAL B CB    1 
ATOM   6806  C  CG1   . VAL B  1 410 ? -63.635  49.877  -64.681  1.00 21.27  ? 410  VAL B CG1   1 
ATOM   6807  C  CG2   . VAL B  1 410 ? -63.042  49.013  -62.414  1.00 20.98  ? 410  VAL B CG2   1 
ATOM   6808  N  N     . ALA B  1 411 ? -66.701  49.140  -61.634  1.00 27.30  ? 411  ALA B N     1 
ATOM   6809  C  CA    . ALA B  1 411 ? -67.421  48.516  -60.528  1.00 24.44  ? 411  ALA B CA    1 
ATOM   6810  C  C     . ALA B  1 411 ? -66.442  47.749  -59.627  1.00 35.02  ? 411  ALA B C     1 
ATOM   6811  O  O     . ALA B  1 411 ? -65.454  47.184  -60.103  1.00 47.36  ? 411  ALA B O     1 
ATOM   6812  C  CB    . ALA B  1 411 ? -68.508  47.597  -61.077  1.00 29.30  ? 411  ALA B CB    1 
ATOM   6813  N  N     . GLY B  1 412 ? -66.674  47.774  -58.322  1.00 33.35  ? 412  GLY B N     1 
ATOM   6814  C  CA    . GLY B  1 412 ? -65.767  47.080  -57.419  1.00 28.62  ? 412  GLY B CA    1 
ATOM   6815  C  C     . GLY B  1 412 ? -66.210  45.685  -57.043  1.00 38.58  ? 412  GLY B C     1 
ATOM   6816  O  O     . GLY B  1 412 ? -65.533  44.978  -56.288  1.00 51.19  ? 412  GLY B O     1 
ATOM   6817  N  N     . SER B  1 413 ? -67.353  45.291  -57.590  1.00 34.23  ? 413  SER B N     1 
ATOM   6818  C  CA    . SER B  1 413 ? -67.929  43.988  -57.331  1.00 32.51  ? 413  SER B CA    1 
ATOM   6819  C  C     . SER B  1 413 ? -68.967  43.708  -58.395  1.00 31.75  ? 413  SER B C     1 
ATOM   6820  O  O     . SER B  1 413 ? -69.399  44.609  -59.104  1.00 41.50  ? 413  SER B O     1 
ATOM   6821  C  CB    . SER B  1 413 ? -68.591  43.962  -55.951  1.00 30.58  ? 413  SER B CB    1 
ATOM   6822  O  OG    . SER B  1 413 ? -69.729  44.807  -55.905  1.00 46.18  ? 413  SER B OG    1 
ATOM   6823  N  N     . LEU B  1 414 ? -69.371  42.453  -58.501  1.00 35.78  ? 414  LEU B N     1 
ATOM   6824  C  CA    . LEU B  1 414 ? -70.371  42.068  -59.473  1.00 32.44  ? 414  LEU B CA    1 
ATOM   6825  C  C     . LEU B  1 414 ? -71.729  42.665  -59.101  1.00 33.49  ? 414  LEU B C     1 
ATOM   6826  O  O     . LEU B  1 414 ? -72.420  43.212  -59.956  1.00 39.93  ? 414  LEU B O     1 
ATOM   6827  C  CB    . LEU B  1 414 ? -70.456  40.547  -59.552  1.00 21.37  ? 414  LEU B CB    1 
ATOM   6828  C  CG    . LEU B  1 414 ? -71.468  40.012  -60.555  1.00 28.98  ? 414  LEU B CG    1 
ATOM   6829  C  CD1   . LEU B  1 414 ? -71.141  40.504  -61.949  1.00 21.81  ? 414  LEU B CD1   1 
ATOM   6830  C  CD2   . LEU B  1 414 ? -71.461  38.510  -60.502  1.00 12.25  ? 414  LEU B CD2   1 
ATOM   6831  N  N     . GLU B  1 415 ? -72.083  42.573  -57.819  1.00 35.77  ? 415  GLU B N     1 
ATOM   6832  C  CA    . GLU B  1 415 ? -73.351  43.094  -57.287  1.00 39.43  ? 415  GLU B CA    1 
ATOM   6833  C  C     . GLU B  1 415 ? -73.555  44.533  -57.711  1.00 43.73  ? 415  GLU B C     1 
ATOM   6834  O  O     . GLU B  1 415 ? -74.670  44.948  -58.026  1.00 58.34  ? 415  GLU B O     1 
ATOM   6835  C  CB    . GLU B  1 415 ? -73.309  43.032  -55.774  1.00 49.08  ? 415  GLU B CB    1 
ATOM   6836  C  CG    . GLU B  1 415 ? -74.582  43.413  -55.056  1.00 69.65  ? 415  GLU B CG    1 
ATOM   6837  C  CD    . GLU B  1 415 ? -74.377  43.468  -53.539  1.00 75.67  ? 415  GLU B CD    1 
ATOM   6838  O  OE1   . GLU B  1 415 ? -75.110  44.231  -52.877  1.00 66.43  ? 415  GLU B OE1   1 
ATOM   6839  O  OE2   . GLU B  1 415 ? -73.483  42.759  -53.009  1.00 66.81  ? 415  GLU B OE2   1 
ATOM   6840  N  N     . GLU B  1 416 ? -72.456  45.283  -57.700  1.00 31.78  ? 416  GLU B N     1 
ATOM   6841  C  CA    . GLU B  1 416 ? -72.442  46.682  -58.085  1.00 30.30  ? 416  GLU B CA    1 
ATOM   6842  C  C     . GLU B  1 416 ? -72.586  46.875  -59.594  1.00 39.73  ? 416  GLU B C     1 
ATOM   6843  O  O     . GLU B  1 416 ? -73.228  47.827  -60.041  1.00 59.55  ? 416  GLU B O     1 
ATOM   6844  C  CB    . GLU B  1 416 ? -71.155  47.351  -57.597  1.00 25.39  ? 416  GLU B CB    1 
ATOM   6845  C  CG    . GLU B  1 416 ? -70.949  48.752  -58.160  1.00 50.27  ? 416  GLU B CG    1 
ATOM   6846  C  CD    . GLU B  1 416 ? -69.720  49.463  -57.617  1.00 48.12  ? 416  GLU B CD    1 
ATOM   6847  O  OE1   . GLU B  1 416 ? -69.606  50.685  -57.863  1.00 53.52  ? 416  GLU B OE1   1 
ATOM   6848  O  OE2   . GLU B  1 416 ? -68.879  48.811  -56.956  1.00 49.07  ? 416  GLU B OE2   1 
ATOM   6849  N  N     . ALA B  1 417 ? -71.942  46.011  -60.373  1.00 43.26  ? 417  ALA B N     1 
ATOM   6850  C  CA    . ALA B  1 417 ? -72.027  46.084  -61.831  1.00 41.35  ? 417  ALA B CA    1 
ATOM   6851  C  C     . ALA B  1 417 ? -73.447  45.731  -62.244  1.00 40.69  ? 417  ALA B C     1 
ATOM   6852  O  O     . ALA B  1 417 ? -74.020  46.350  -63.138  1.00 42.75  ? 417  ALA B O     1 
ATOM   6853  C  CB    . ALA B  1 417 ? -71.050  45.114  -62.477  1.00 35.52  ? 417  ALA B CB    1 
ATOM   6854  N  N     . LEU B  1 418 ? -74.012  44.729  -61.583  1.00 28.17  ? 418  LEU B N     1 
ATOM   6855  C  CA    . LEU B  1 418 ? -75.365  44.307  -61.878  1.00 34.95  ? 418  LEU B CA    1 
ATOM   6856  C  C     . LEU B  1 418 ? -76.319  45.452  -61.560  1.00 44.76  ? 418  LEU B C     1 
ATOM   6857  O  O     . LEU B  1 418 ? -77.220  45.757  -62.343  1.00 52.08  ? 418  LEU B O     1 
ATOM   6858  C  CB    . LEU B  1 418 ? -75.720  43.050  -61.086  1.00 37.40  ? 418  LEU B CB    1 
ATOM   6859  C  CG    . LEU B  1 418 ? -74.947  41.775  -61.447  1.00 33.20  ? 418  LEU B CG    1 
ATOM   6860  C  CD1   . LEU B  1 418 ? -75.511  40.597  -60.671  1.00 31.02  ? 418  LEU B CD1   1 
ATOM   6861  C  CD2   . LEU B  1 418 ? -75.057  41.505  -62.929  1.00 15.64  ? 418  LEU B CD2   1 
ATOM   6862  N  N     . ASN B  1 419 ? -76.078  46.117  -60.434  1.00 46.65  ? 419  ASN B N     1 
ATOM   6863  C  CA    . ASN B  1 419 ? -76.884  47.260  -60.020  1.00 47.85  ? 419  ASN B CA    1 
ATOM   6864  C  C     . ASN B  1 419 ? -76.866  48.336  -61.091  1.00 48.20  ? 419  ASN B C     1 
ATOM   6865  O  O     . ASN B  1 419 ? -77.912  48.807  -61.530  1.00 40.94  ? 419  ASN B O     1 
ATOM   6866  C  CB    . ASN B  1 419 ? -76.306  47.864  -58.766  1.00 61.38  ? 419  ASN B CB    1 
ATOM   6867  C  CG    . ASN B  1 419 ? -77.325  48.032  -57.720  1.00 81.34  ? 419  ASN B CG    1 
ATOM   6868  O  OD1   . ASN B  1 419 ? -77.269  47.361  -56.686  1.00 95.59  ? 419  ASN B OD1   1 
ATOM   6869  N  ND2   . ASN B  1 419 ? -78.318  48.890  -57.987  1.00 66.97  ? 419  ASN B ND2   1 
ATOM   6870  N  N     . ALA B  1 420 ? -75.653  48.731  -61.473  1.00 39.22  ? 420  ALA B N     1 
ATOM   6871  C  CA    . ALA B  1 420 ? -75.425  49.739  -62.495  1.00 29.40  ? 420  ALA B CA    1 
ATOM   6872  C  C     . ALA B  1 420 ? -76.191  49.402  -63.762  1.00 38.32  ? 420  ALA B C     1 
ATOM   6873  O  O     . ALA B  1 420 ? -76.878  50.252  -64.316  1.00 57.23  ? 420  ALA B O     1 
ATOM   6874  C  CB    . ALA B  1 420 ? -73.942  49.849  -62.799  1.00 33.40  ? 420  ALA B CB    1 
ATOM   6875  N  N     . LEU B  1 421 ? -76.075  48.158  -64.209  1.00 37.72  ? 421  LEU B N     1 
ATOM   6876  C  CA    . LEU B  1 421 ? -76.767  47.709  -65.409  1.00 41.00  ? 421  LEU B CA    1 
ATOM   6877  C  C     . LEU B  1 421 ? -78.281  47.841  -65.245  1.00 44.36  ? 421  LEU B C     1 
ATOM   6878  O  O     . LEU B  1 421 ? -78.984  48.180  -66.187  1.00 49.87  ? 421  LEU B O     1 
ATOM   6879  C  CB    . LEU B  1 421 ? -76.407  46.256  -65.713  1.00 35.44  ? 421  LEU B CB    1 
ATOM   6880  C  CG    . LEU B  1 421 ? -77.215  45.600  -66.837  1.00 43.26  ? 421  LEU B CG    1 
ATOM   6881  C  CD1   . LEU B  1 421 ? -76.912  46.256  -68.173  1.00 35.64  ? 421  LEU B CD1   1 
ATOM   6882  C  CD2   . LEU B  1 421 ? -76.922  44.116  -66.891  1.00 30.58  ? 421  LEU B CD2   1 
ATOM   6883  N  N     . ASP B  1 422 ? -78.776  47.549  -64.047  1.00 44.58  ? 422  ASP B N     1 
ATOM   6884  C  CA    . ASP B  1 422 ? -80.203  47.641  -63.748  1.00 38.44  ? 422  ASP B CA    1 
ATOM   6885  C  C     . ASP B  1 422 ? -80.690  49.074  -64.006  1.00 50.66  ? 422  ASP B C     1 
ATOM   6886  O  O     . ASP B  1 422 ? -81.570  49.303  -64.843  1.00 55.60  ? 422  ASP B O     1 
ATOM   6887  C  CB    . ASP B  1 422 ? -80.423  47.250  -62.277  1.00 41.22  ? 422  ASP B CB    1 
ATOM   6888  C  CG    . ASP B  1 422 ? -81.885  47.304  -61.843  1.00 48.93  ? 422  ASP B CG    1 
ATOM   6889  O  OD1   . ASP B  1 422 ? -82.786  47.459  -62.694  1.00 47.78  ? 422  ASP B OD1   1 
ATOM   6890  O  OD2   . ASP B  1 422 ? -82.127  47.174  -60.620  1.00 56.80  ? 422  ASP B OD2   1 
ATOM   6891  N  N     . LEU B  1 423 ? -80.058  50.027  -63.325  1.00 34.19  ? 423  LEU B N     1 
ATOM   6892  C  CA    . LEU B  1 423 ? -80.404  51.438  -63.423  1.00 36.81  ? 423  LEU B CA    1 
ATOM   6893  C  C     . LEU B  1 423 ? -80.039  52.090  -64.748  1.00 44.12  ? 423  LEU B C     1 
ATOM   6894  O  O     . LEU B  1 423 ? -80.896  52.649  -65.427  1.00 54.12  ? 423  LEU B O     1 
ATOM   6895  C  CB    . LEU B  1 423 ? -79.747  52.214  -62.274  1.00 25.97  ? 423  LEU B CB    1 
ATOM   6896  C  CG    . LEU B  1 423 ? -79.894  51.586  -60.880  1.00 48.32  ? 423  LEU B CG    1 
ATOM   6897  C  CD1   . LEU B  1 423 ? -79.245  52.454  -59.832  1.00 38.01  ? 423  LEU B CD1   1 
ATOM   6898  C  CD2   . LEU B  1 423 ? -81.350  51.363  -60.536  1.00 33.15  ? 423  LEU B CD2   1 
ATOM   6899  N  N     . ASP B  1 424 ? -78.769  51.999  -65.114  1.00 39.48  ? 424  ASP B N     1 
ATOM   6900  C  CA    . ASP B  1 424 ? -78.240  52.603  -66.338  1.00 38.39  ? 424  ASP B CA    1 
ATOM   6901  C  C     . ASP B  1 424 ? -78.561  51.808  -67.618  1.00 42.55  ? 424  ASP B C     1 
ATOM   6902  O  O     . ASP B  1 424 ? -77.795  51.839  -68.581  1.00 38.86  ? 424  ASP B O     1 
ATOM   6903  C  CB    . ASP B  1 424 ? -76.720  52.763  -66.166  1.00 36.80  ? 424  ASP B CB    1 
ATOM   6904  C  CG    . ASP B  1 424 ? -76.081  53.599  -67.248  1.00 44.89  ? 424  ASP B CG    1 
ATOM   6905  O  OD1   . ASP B  1 424 ? -74.859  53.436  -67.453  1.00 64.18  ? 424  ASP B OD1   1 
ATOM   6906  O  OD2   . ASP B  1 424 ? -76.783  54.422  -67.876  1.00 41.21  ? 424  ASP B OD2   1 
ATOM   6907  N  N     . ARG B  1 425 ? -79.736  51.186  -67.668  1.00 30.24  ? 425  ARG B N     1 
ATOM   6908  C  CA    . ARG B  1 425 ? -80.101  50.361  -68.822  1.00 32.96  ? 425  ARG B CA    1 
ATOM   6909  C  C     . ARG B  1 425 ? -80.573  51.006  -70.115  1.00 41.98  ? 425  ARG B C     1 
ATOM   6910  O  O     . ARG B  1 425 ? -80.564  50.356  -71.161  1.00 54.11  ? 425  ARG B O     1 
ATOM   6911  C  CB    . ARG B  1 425 ? -81.150  49.332  -68.412  1.00 32.82  ? 425  ARG B CB    1 
ATOM   6912  C  CG    . ARG B  1 425 ? -82.519  49.901  -68.184  1.00 27.92  ? 425  ARG B CG    1 
ATOM   6913  C  CD    . ARG B  1 425 ? -83.516  48.795  -67.903  1.00 41.49  ? 425  ARG B CD    1 
ATOM   6914  N  NE    . ARG B  1 425 ? -83.248  48.128  -66.628  1.00 36.84  ? 425  ARG B NE    1 
ATOM   6915  C  CZ    . ARG B  1 425 ? -83.702  46.920  -66.301  1.00 51.06  ? 425  ARG B CZ    1 
ATOM   6916  N  NH1   . ARG B  1 425 ? -83.405  46.406  -65.116  1.00 39.00  ? 425  ARG B NH1   1 
ATOM   6917  N  NH2   . ARG B  1 425 ? -84.441  46.216  -67.158  1.00 35.66  ? 425  ARG B NH2   1 
ATOM   6918  N  N     . GLU B  1 426 ? -80.983  52.265  -70.063  1.00 54.54  ? 426  GLU B N     1 
ATOM   6919  C  CA    . GLU B  1 426 ? -81.514  52.908  -71.261  1.00 55.82  ? 426  GLU B CA    1 
ATOM   6920  C  C     . GLU B  1 426 ? -80.654  52.897  -72.514  1.00 46.91  ? 426  GLU B C     1 
ATOM   6921  O  O     . GLU B  1 426 ? -81.158  52.577  -73.592  1.00 48.15  ? 426  GLU B O     1 
ATOM   6922  C  CB    . GLU B  1 426 ? -82.027  54.322  -70.960  1.00 60.59  ? 426  GLU B CB    1 
ATOM   6923  C  CG    . GLU B  1 426 ? -83.222  54.367  -69.991  1.00 73.40  ? 426  GLU B CG    1 
ATOM   6924  C  CD    . GLU B  1 426 ? -84.357  53.410  -70.370  1.00 83.92  ? 426  GLU B CD    1 
ATOM   6925  O  OE1   . GLU B  1 426 ? -84.841  52.671  -69.467  1.00 64.38  ? 426  GLU B OE1   1 
ATOM   6926  O  OE2   . GLU B  1 426 ? -84.767  53.410  -71.560  1.00 66.91  ? 426  GLU B OE2   1 
ATOM   6927  N  N     . PHE B  1 427 ? -79.356  53.151  -72.373  1.00 39.80  ? 427  PHE B N     1 
ATOM   6928  C  CA    . PHE B  1 427 ? -78.473  53.192  -73.542  1.00 42.79  ? 427  PHE B CA    1 
ATOM   6929  C  C     . PHE B  1 427 ? -78.415  51.894  -74.324  1.00 49.04  ? 427  PHE B C     1 
ATOM   6930  O  O     . PHE B  1 427 ? -78.091  51.886  -75.515  1.00 56.48  ? 427  PHE B O     1 
ATOM   6931  C  CB    . PHE B  1 427 ? -77.065  53.653  -73.156  1.00 49.91  ? 427  PHE B CB    1 
ATOM   6932  C  CG    . PHE B  1 427 ? -76.227  52.599  -72.499  1.00 48.34  ? 427  PHE B CG    1 
ATOM   6933  C  CD1   . PHE B  1 427 ? -75.210  51.968  -73.207  1.00 48.21  ? 427  PHE B CD1   1 
ATOM   6934  C  CD2   . PHE B  1 427 ? -76.426  52.262  -71.166  1.00 51.62  ? 427  PHE B CD2   1 
ATOM   6935  C  CE1   . PHE B  1 427 ? -74.404  51.022  -72.596  1.00 49.09  ? 427  PHE B CE1   1 
ATOM   6936  C  CE2   . PHE B  1 427 ? -75.622  51.313  -70.546  1.00 50.00  ? 427  PHE B CE2   1 
ATOM   6937  C  CZ    . PHE B  1 427 ? -74.612  50.692  -71.260  1.00 36.15  ? 427  PHE B CZ    1 
ATOM   6938  N  N     . LEU B  1 428 ? -78.756  50.808  -73.641  1.00 47.58  ? 428  LEU B N     1 
ATOM   6939  C  CA    . LEU B  1 428 ? -78.763  49.471  -74.213  1.00 41.38  ? 428  LEU B CA    1 
ATOM   6940  C  C     . LEU B  1 428 ? -80.078  49.175  -74.923  1.00 49.20  ? 428  LEU B C     1 
ATOM   6941  O  O     . LEU B  1 428 ? -80.111  48.420  -75.904  1.00 46.99  ? 428  LEU B O     1 
ATOM   6942  C  CB    . LEU B  1 428 ? -78.581  48.444  -73.091  1.00 45.44  ? 428  LEU B CB    1 
ATOM   6943  C  CG    . LEU B  1 428 ? -77.245  47.812  -72.684  1.00 43.12  ? 428  LEU B CG    1 
ATOM   6944  C  CD1   . LEU B  1 428 ? -76.072  48.366  -73.457  1.00 40.50  ? 428  LEU B CD1   1 
ATOM   6945  C  CD2   . LEU B  1 428 ? -77.053  47.979  -71.197  1.00 26.41  ? 428  LEU B CD2   1 
ATOM   6946  N  N     . LYS B  1 429 ? -81.168  49.709  -74.371  1.00 46.14  ? 429  LYS B N     1 
ATOM   6947  C  CA    . LYS B  1 429 ? -82.503  49.497  -74.930  1.00 43.34  ? 429  LYS B CA    1 
ATOM   6948  C  C     . LYS B  1 429 ? -82.726  50.279  -76.222  1.00 46.80  ? 429  LYS B C     1 
ATOM   6949  O  O     . LYS B  1 429 ? -83.685  50.021  -76.956  1.00 41.35  ? 429  LYS B O     1 
ATOM   6950  C  CB    . LYS B  1 429 ? -83.575  49.840  -73.899  1.00 39.89  ? 429  LYS B CB    1 
ATOM   6951  C  CG    . LYS B  1 429 ? -83.356  49.189  -72.547  1.00 41.10  ? 429  LYS B CG    1 
ATOM   6952  C  CD    . LYS B  1 429 ? -84.665  48.926  -71.820  1.00 43.32  ? 429  LYS B CD    1 
ATOM   6953  C  CE    . LYS B  1 429 ? -85.430  50.198  -71.536  1.00 49.39  ? 429  LYS B CE    1 
ATOM   6954  N  NZ    . LYS B  1 429 ? -86.589  49.953  -70.637  1.00 61.68  ? 429  LYS B NZ    1 
ATOM   6955  N  N     . ALA B  1 430 ? -81.815  51.208  -76.509  1.00 38.74  ? 430  ALA B N     1 
ATOM   6956  C  CA    . ALA B  1 430 ? -81.876  52.013  -77.727  1.00 43.51  ? 430  ALA B CA    1 
ATOM   6957  C  C     . ALA B  1 430 ? -81.962  51.118  -78.952  1.00 42.35  ? 430  ALA B C     1 
ATOM   6958  O  O     . ALA B  1 430 ? -81.299  50.086  -79.026  1.00 57.30  ? 430  ALA B O     1 
ATOM   6959  C  CB    . ALA B  1 430 ? -80.649  52.895  -77.840  1.00 33.31  ? 430  ALA B CB    1 
ATOM   6960  N  N     . GLY B  1 431 ? -82.783  51.517  -79.912  1.00 53.90  ? 431  GLY B N     1 
ATOM   6961  C  CA    . GLY B  1 431 ? -82.941  50.737  -81.128  1.00 43.96  ? 431  GLY B CA    1 
ATOM   6962  C  C     . GLY B  1 431 ? -83.556  49.379  -80.886  1.00 48.86  ? 431  GLY B C     1 
ATOM   6963  O  O     . GLY B  1 431 ? -83.489  48.508  -81.762  1.00 61.21  ? 431  GLY B O     1 
ATOM   6964  N  N     . GLY B  1 432 ? -84.121  49.194  -79.690  1.00 49.75  ? 432  GLY B N     1 
ATOM   6965  C  CA    . GLY B  1 432 ? -84.746  47.931  -79.335  1.00 55.15  ? 432  GLY B CA    1 
ATOM   6966  C  C     . GLY B  1 432 ? -83.785  46.757  -79.356  1.00 53.27  ? 432  GLY B C     1 
ATOM   6967  O  O     . GLY B  1 432 ? -84.221  45.612  -79.538  1.00 43.29  ? 432  GLY B O     1 
ATOM   6968  N  N     . VAL B  1 433 ? -82.488  47.058  -79.197  1.00 54.19  ? 433  VAL B N     1 
ATOM   6969  C  CA    . VAL B  1 433 ? -81.397  46.075  -79.179  1.00 44.52  ? 433  VAL B CA    1 
ATOM   6970  C  C     . VAL B  1 433 ? -81.556  45.157  -77.970  1.00 55.56  ? 433  VAL B C     1 
ATOM   6971  O  O     . VAL B  1 433 ? -81.742  43.946  -78.114  1.00 49.76  ? 433  VAL B O     1 
ATOM   6972  C  CB    . VAL B  1 433 ? -80.031  46.774  -79.084  1.00 35.40  ? 433  VAL B CB    1 
ATOM   6973  C  CG1   . VAL B  1 433 ? -78.921  45.750  -78.919  1.00 43.54  ? 433  VAL B CG1   1 
ATOM   6974  C  CG2   . VAL B  1 433 ? -79.774  47.583  -80.332  1.00 37.94  ? 433  VAL B CG2   1 
ATOM   6975  N  N     . PHE B  1 434 ? -81.466  45.747  -76.782  1.00 44.13  ? 434  PHE B N     1 
ATOM   6976  C  CA    . PHE B  1 434 ? -81.643  45.009  -75.543  1.00 27.51  ? 434  PHE B CA    1 
ATOM   6977  C  C     . PHE B  1 434 ? -83.043  45.270  -75.006  1.00 40.45  ? 434  PHE B C     1 
ATOM   6978  O  O     . PHE B  1 434 ? -83.452  46.425  -74.882  1.00 48.45  ? 434  PHE B O     1 
ATOM   6979  C  CB    . PHE B  1 434 ? -80.664  45.512  -74.488  1.00 41.89  ? 434  PHE B CB    1 
ATOM   6980  C  CG    . PHE B  1 434 ? -79.290  44.941  -74.601  1.00 46.24  ? 434  PHE B CG    1 
ATOM   6981  C  CD1   . PHE B  1 434 ? -78.929  43.834  -73.849  1.00 41.74  ? 434  PHE B CD1   1 
ATOM   6982  C  CD2   . PHE B  1 434 ? -78.341  45.528  -75.431  1.00 53.48  ? 434  PHE B CD2   1 
ATOM   6983  C  CE1   . PHE B  1 434 ? -77.638  43.318  -73.917  1.00 37.13  ? 434  PHE B CE1   1 
ATOM   6984  C  CE2   . PHE B  1 434 ? -77.041  45.018  -75.507  1.00 46.42  ? 434  PHE B CE2   1 
ATOM   6985  C  CZ    . PHE B  1 434 ? -76.690  43.913  -74.749  1.00 44.63  ? 434  PHE B CZ    1 
ATOM   6986  N  N     . THR B  1 435 ? -83.766  44.210  -74.660  1.00 35.18  ? 435  THR B N     1 
ATOM   6987  C  CA    . THR B  1 435 ? -85.092  44.371  -74.082  1.00 31.81  ? 435  THR B CA    1 
ATOM   6988  C  C     . THR B  1 435 ? -84.983  44.293  -72.558  1.00 43.22  ? 435  THR B C     1 
ATOM   6989  O  O     . THR B  1 435 ? -83.994  43.800  -72.027  1.00 51.75  ? 435  THR B O     1 
ATOM   6990  C  CB    . THR B  1 435 ? -86.067  43.291  -74.570  1.00 37.32  ? 435  THR B CB    1 
ATOM   6991  O  OG1   . THR B  1 435 ? -85.778  42.043  -73.936  1.00 53.02  ? 435  THR B OG1   1 
ATOM   6992  C  CG2   . THR B  1 435 ? -85.954  43.130  -76.058  1.00 33.15  ? 435  THR B CG2   1 
ATOM   6993  N  N     . ASP B  1 436 ? -86.001  44.780  -71.855  1.00 53.11  ? 436  ASP B N     1 
ATOM   6994  C  CA    . ASP B  1 436 ? -85.990  44.741  -70.396  1.00 47.16  ? 436  ASP B CA    1 
ATOM   6995  C  C     . ASP B  1 436 ? -85.871  43.307  -69.900  1.00 47.99  ? 436  ASP B C     1 
ATOM   6996  O  O     . ASP B  1 436 ? -85.016  43.029  -69.070  1.00 53.78  ? 436  ASP B O     1 
ATOM   6997  C  CB    . ASP B  1 436 ? -87.260  45.375  -69.805  1.00 63.13  ? 436  ASP B CB    1 
ATOM   6998  C  CG    . ASP B  1 436 ? -87.227  46.900  -69.811  1.00 61.43  ? 436  ASP B CG    1 
ATOM   6999  O  OD1   . ASP B  1 436 ? -88.238  47.508  -70.216  1.00 71.67  ? 436  ASP B OD1   1 
ATOM   7000  O  OD2   . ASP B  1 436 ? -86.209  47.490  -69.388  1.00 61.83  ? 436  ASP B OD2   1 
ATOM   7001  N  N     . GLU B  1 437 ? -86.708  42.404  -70.425  1.00 38.27  ? 437  GLU B N     1 
ATOM   7002  C  CA    . GLU B  1 437 ? -86.689  40.997  -70.007  1.00 51.01  ? 437  GLU B CA    1 
ATOM   7003  C  C     . GLU B  1 437 ? -85.318  40.394  -70.269  1.00 48.64  ? 437  GLU B C     1 
ATOM   7004  O  O     . GLU B  1 437 ? -84.804  39.653  -69.437  1.00 54.92  ? 437  GLU B O     1 
ATOM   7005  C  CB    . GLU B  1 437 ? -87.757  40.130  -70.718  1.00 46.05  ? 437  GLU B CB    1 
ATOM   7006  C  CG    . GLU B  1 437 ? -89.133  40.741  -70.878  1.00 71.41  ? 437  GLU B CG    1 
ATOM   7007  C  CD    . GLU B  1 437 ? -89.182  41.724  -72.046  1.00 100.00 ? 437  GLU B CD    1 
ATOM   7008  O  OE1   . GLU B  1 437 ? -89.426  42.938  -71.813  1.00 85.08  ? 437  GLU B OE1   1 
ATOM   7009  O  OE2   . GLU B  1 437 ? -88.949  41.277  -73.198  1.00 100.00 ? 437  GLU B OE2   1 
ATOM   7010  N  N     . ALA B  1 438 ? -84.719  40.716  -71.413  1.00 40.85  ? 438  ALA B N     1 
ATOM   7011  C  CA    . ALA B  1 438 ? -83.399  40.183  -71.737  1.00 39.58  ? 438  ALA B CA    1 
ATOM   7012  C  C     . ALA B  1 438 ? -82.415  40.599  -70.651  1.00 41.09  ? 438  ALA B C     1 
ATOM   7013  O  O     . ALA B  1 438 ? -81.684  39.769  -70.106  1.00 58.31  ? 438  ALA B O     1 
ATOM   7014  C  CB    . ALA B  1 438 ? -82.928  40.673  -73.104  1.00 32.91  ? 438  ALA B CB    1 
ATOM   7015  N  N     . ILE B  1 439 ? -82.453  41.875  -70.291  1.00 27.42  ? 439  ILE B N     1 
ATOM   7016  C  CA    . ILE B  1 439 ? -81.574  42.413  -69.262  1.00 28.91  ? 439  ILE B CA    1 
ATOM   7017  C  C     . ILE B  1 439 ? -81.867  41.850  -67.865  1.00 34.54  ? 439  ILE B C     1 
ATOM   7018  O  O     . ILE B  1 439 ? -80.954  41.462  -67.139  1.00 45.52  ? 439  ILE B O     1 
ATOM   7019  C  CB    . ILE B  1 439 ? -81.651  43.952  -69.254  1.00 31.04  ? 439  ILE B CB    1 
ATOM   7020  C  CG1   . ILE B  1 439 ? -81.068  44.493  -70.563  1.00 32.63  ? 439  ILE B CG1   1 
ATOM   7021  C  CG2   . ILE B  1 439 ? -80.934  44.531  -68.046  1.00 31.98  ? 439  ILE B CG2   1 
ATOM   7022  C  CD1   . ILE B  1 439 ? -81.015  46.003  -70.649  1.00 29.19  ? 439  ILE B CD1   1 
ATOM   7023  N  N     . ASP B  1 440 ? -83.138  41.789  -67.497  1.00 38.88  ? 440  ASP B N     1 
ATOM   7024  C  CA    . ASP B  1 440 ? -83.525  41.268  -66.194  1.00 40.76  ? 440  ASP B CA    1 
ATOM   7025  C  C     . ASP B  1 440 ? -83.180  39.787  -66.061  1.00 40.77  ? 440  ASP B C     1 
ATOM   7026  O  O     . ASP B  1 440 ? -82.785  39.332  -64.994  1.00 43.15  ? 440  ASP B O     1 
ATOM   7027  C  CB    . ASP B  1 440 ? -85.024  41.489  -65.961  1.00 47.21  ? 440  ASP B CB    1 
ATOM   7028  C  CG    . ASP B  1 440 ? -85.398  42.966  -65.878  1.00 54.88  ? 440  ASP B CG    1 
ATOM   7029  O  OD1   . ASP B  1 440 ? -84.586  43.772  -65.361  1.00 40.39  ? 440  ASP B OD1   1 
ATOM   7030  O  OD2   . ASP B  1 440 ? -86.510  43.313  -66.326  1.00 51.56  ? 440  ASP B OD2   1 
ATOM   7031  N  N     . ALA B  1 441 ? -83.328  39.045  -67.155  1.00 43.07  ? 441  ALA B N     1 
ATOM   7032  C  CA    . ALA B  1 441 ? -83.022  37.616  -67.172  1.00 37.38  ? 441  ALA B CA    1 
ATOM   7033  C  C     . ALA B  1 441 ? -81.539  37.413  -66.889  1.00 42.58  ? 441  ALA B C     1 
ATOM   7034  O  O     . ALA B  1 441 ? -81.164  36.555  -66.093  1.00 46.81  ? 441  ALA B O     1 
ATOM   7035  C  CB    . ALA B  1 441 ? -83.379  37.017  -68.526  1.00 34.95  ? 441  ALA B CB    1 
ATOM   7036  N  N     . TYR B  1 442 ? -80.708  38.213  -67.555  1.00 33.77  ? 442  TYR B N     1 
ATOM   7037  C  CA    . TYR B  1 442 ? -79.264  38.161  -67.386  1.00 24.76  ? 442  TYR B CA    1 
ATOM   7038  C  C     . TYR B  1 442 ? -78.888  38.491  -65.950  1.00 30.29  ? 442  TYR B C     1 
ATOM   7039  O  O     . TYR B  1 442 ? -78.140  37.756  -65.312  1.00 49.75  ? 442  TYR B O     1 
ATOM   7040  C  CB    . TYR B  1 442 ? -78.593  39.155  -68.328  1.00 23.94  ? 442  TYR B CB    1 
ATOM   7041  C  CG    . TYR B  1 442 ? -77.077  39.185  -68.242  1.00 31.17  ? 442  TYR B CG    1 
ATOM   7042  C  CD1   . TYR B  1 442 ? -76.421  40.061  -67.376  1.00 29.08  ? 442  TYR B CD1   1 
ATOM   7043  C  CD2   . TYR B  1 442 ? -76.298  38.340  -69.033  1.00 32.95  ? 442  TYR B CD2   1 
ATOM   7044  C  CE1   . TYR B  1 442 ? -75.027  40.093  -67.295  1.00 31.47  ? 442  TYR B CE1   1 
ATOM   7045  C  CE2   . TYR B  1 442 ? -74.907  38.363  -68.959  1.00 38.58  ? 442  TYR B CE2   1 
ATOM   7046  C  CZ    . TYR B  1 442 ? -74.277  39.237  -68.088  1.00 30.73  ? 442  TYR B CZ    1 
ATOM   7047  O  OH    . TYR B  1 442 ? -72.900  39.218  -67.984  1.00 53.88  ? 442  TYR B OH    1 
ATOM   7048  N  N     . ILE B  1 443 ? -79.411  39.602  -65.449  1.00 32.95  ? 443  ILE B N     1 
ATOM   7049  C  CA    . ILE B  1 443 ? -79.137  40.025  -64.083  1.00 31.60  ? 443  ILE B CA    1 
ATOM   7050  C  C     . ILE B  1 443 ? -79.482  38.933  -63.070  1.00 34.72  ? 443  ILE B C     1 
ATOM   7051  O  O     . ILE B  1 443 ? -78.767  38.732  -62.094  1.00 38.37  ? 443  ILE B O     1 
ATOM   7052  C  CB    . ILE B  1 443 ? -79.913  41.321  -63.745  1.00 34.60  ? 443  ILE B CB    1 
ATOM   7053  C  CG1   . ILE B  1 443 ? -79.236  42.516  -64.416  1.00 33.66  ? 443  ILE B CG1   1 
ATOM   7054  C  CG2   . ILE B  1 443 ? -80.023  41.524  -62.231  1.00 29.48  ? 443  ILE B CG2   1 
ATOM   7055  C  CD1   . ILE B  1 443 ? -79.974  43.829  -64.240  1.00 32.69  ? 443  ILE B CD1   1 
ATOM   7056  N  N     . ALA B  1 444 ? -80.550  38.196  -63.329  1.00 31.08  ? 444  ALA B N     1 
ATOM   7057  C  CA    . ALA B  1 444 ? -80.964  37.153  -62.408  1.00 35.24  ? 444  ALA B CA    1 
ATOM   7058  C  C     . ALA B  1 444 ? -80.022  35.954  -62.406  1.00 35.40  ? 444  ALA B C     1 
ATOM   7059  O  O     . ALA B  1 444 ? -79.736  35.394  -61.350  1.00 42.51  ? 444  ALA B O     1 
ATOM   7060  C  CB    . ALA B  1 444 ? -82.375  36.729  -62.712  1.00 18.36  ? 444  ALA B CB    1 
ATOM   7061  N  N     . LEU B  1 445 ? -79.555  35.551  -63.586  1.00 34.11  ? 445  LEU B N     1 
ATOM   7062  C  CA    . LEU B  1 445 ? -78.631  34.425  -63.694  1.00 26.42  ? 445  LEU B CA    1 
ATOM   7063  C  C     . LEU B  1 445 ? -77.366  34.732  -62.914  1.00 32.26  ? 445  LEU B C     1 
ATOM   7064  O  O     . LEU B  1 445 ? -76.926  33.950  -62.076  1.00 41.03  ? 445  LEU B O     1 
ATOM   7065  C  CB    . LEU B  1 445 ? -78.226  34.177  -65.145  1.00 25.94  ? 445  LEU B CB    1 
ATOM   7066  C  CG    . LEU B  1 445 ? -79.196  33.478  -66.079  1.00 29.40  ? 445  LEU B CG    1 
ATOM   7067  C  CD1   . LEU B  1 445 ? -78.570  33.425  -67.453  1.00 41.89  ? 445  LEU B CD1   1 
ATOM   7068  C  CD2   . LEU B  1 445 ? -79.509  32.079  -65.576  1.00 30.69  ? 445  LEU B CD2   1 
ATOM   7069  N  N     . ARG B  1 446 ? -76.800  35.896  -63.184  1.00 24.71  ? 446  ARG B N     1 
ATOM   7070  C  CA    . ARG B  1 446 ? -75.579  36.301  -62.527  1.00 34.55  ? 446  ARG B CA    1 
ATOM   7071  C  C     . ARG B  1 446 ? -75.771  36.534  -61.044  1.00 27.87  ? 446  ARG B C     1 
ATOM   7072  O  O     . ARG B  1 446 ? -74.859  36.329  -60.247  1.00 40.52  ? 446  ARG B O     1 
ATOM   7073  C  CB    . ARG B  1 446 ? -75.035  37.561  -63.188  1.00 27.04  ? 446  ARG B CB    1 
ATOM   7074  C  CG    . ARG B  1 446 ? -74.747  37.394  -64.667  1.00 18.79  ? 446  ARG B CG    1 
ATOM   7075  C  CD    . ARG B  1 446 ? -73.830  36.225  -64.915  1.00 34.94  ? 446  ARG B CD    1 
ATOM   7076  N  NE    . ARG B  1 446 ? -73.129  36.363  -66.182  1.00 43.23  ? 446  ARG B NE    1 
ATOM   7077  C  CZ    . ARG B  1 446 ? -72.343  35.433  -66.700  1.00 40.52  ? 446  ARG B CZ    1 
ATOM   7078  N  NH1   . ARG B  1 446 ? -71.740  35.652  -67.863  1.00 38.64  ? 446  ARG B NH1   1 
ATOM   7079  N  NH2   . ARG B  1 446 ? -72.167  34.286  -66.056  1.00 35.66  ? 446  ARG B NH2   1 
ATOM   7080  N  N     . ARG B  1 447 ? -76.979  36.922  -60.669  1.00 32.39  ? 447  ARG B N     1 
ATOM   7081  C  CA    . ARG B  1 447 ? -77.258  37.209  -59.276  1.00 36.87  ? 447  ARG B CA    1 
ATOM   7082  C  C     . ARG B  1 447 ? -77.218  35.944  -58.443  1.00 36.82  ? 447  ARG B C     1 
ATOM   7083  O  O     . ARG B  1 447 ? -76.798  35.980  -57.281  1.00 36.57  ? 447  ARG B O     1 
ATOM   7084  C  CB    . ARG B  1 447 ? -78.601  37.931  -59.135  1.00 32.63  ? 447  ARG B CB    1 
ATOM   7085  C  CG    . ARG B  1 447 ? -78.591  39.013  -58.093  1.00 48.86  ? 447  ARG B CG    1 
ATOM   7086  C  CD    . ARG B  1 447 ? -79.207  40.281  -58.632  1.00 36.20  ? 447  ARG B CD    1 
ATOM   7087  N  NE    . ARG B  1 447 ? -78.397  41.431  -58.248  1.00 65.59  ? 447  ARG B NE    1 
ATOM   7088  C  CZ    . ARG B  1 447 ? -78.741  42.692  -58.476  1.00 62.84  ? 447  ARG B CZ    1 
ATOM   7089  N  NH1   . ARG B  1 447 ? -77.930  43.680  -58.091  1.00 52.83  ? 447  ARG B NH1   1 
ATOM   7090  N  NH2   . ARG B  1 447 ? -79.901  42.952  -59.082  1.00 29.36  ? 447  ARG B NH2   1 
ATOM   7091  N  N     . GLU B  1 448 ? -77.612  34.818  -59.040  1.00 26.17  ? 448  GLU B N     1 
ATOM   7092  C  CA    . GLU B  1 448 ? -77.590  33.571  -58.296  1.00 35.21  ? 448  GLU B CA    1 
ATOM   7093  C  C     . GLU B  1 448 ? -76.171  33.020  -58.174  1.00 33.71  ? 448  GLU B C     1 
ATOM   7094  O  O     . GLU B  1 448 ? -75.850  32.323  -57.211  1.00 48.72  ? 448  GLU B O     1 
ATOM   7095  C  CB    . GLU B  1 448 ? -78.576  32.550  -58.862  1.00 23.88  ? 448  GLU B CB    1 
ATOM   7096  C  CG    . GLU B  1 448 ? -78.183  31.883  -60.146  1.00 68.51  ? 448  GLU B CG    1 
ATOM   7097  C  CD    . GLU B  1 448 ? -79.225  30.867  -60.591  1.00 81.50  ? 448  GLU B CD    1 
ATOM   7098  O  OE1   . GLU B  1 448 ? -79.939  30.328  -59.712  1.00 61.91  ? 448  GLU B OE1   1 
ATOM   7099  O  OE2   . GLU B  1 448 ? -79.334  30.614  -61.812  1.00 89.55  ? 448  GLU B OE2   1 
ATOM   7100  N  N     . GLU B  1 449 ? -75.312  33.388  -59.122  1.00 32.25  ? 449  GLU B N     1 
ATOM   7101  C  CA    . GLU B  1 449 ? -73.911  32.987  -59.087  1.00 21.16  ? 449  GLU B CA    1 
ATOM   7102  C  C     . GLU B  1 449 ? -73.235  33.805  -57.986  1.00 26.86  ? 449  GLU B C     1 
ATOM   7103  O  O     . GLU B  1 449 ? -72.513  33.264  -57.151  1.00 39.15  ? 449  GLU B O     1 
ATOM   7104  C  CB    . GLU B  1 449 ? -73.246  33.247  -60.434  1.00 16.24  ? 449  GLU B CB    1 
ATOM   7105  C  CG    . GLU B  1 449 ? -73.792  32.344  -61.532  1.00 19.42  ? 449  GLU B CG    1 
ATOM   7106  C  CD    . GLU B  1 449 ? -73.121  32.555  -62.870  1.00 36.15  ? 449  GLU B CD    1 
ATOM   7107  O  OE1   . GLU B  1 449 ? -72.705  33.693  -63.164  1.00 26.54  ? 449  GLU B OE1   1 
ATOM   7108  O  OE2   . GLU B  1 449 ? -73.014  31.573  -63.635  1.00 30.19  ? 449  GLU B OE2   1 
ATOM   7109  N  N     . ASP B  1 450 ? -73.534  35.101  -57.948  1.00 25.78  ? 450  ASP B N     1 
ATOM   7110  C  CA    . ASP B  1 450 ? -72.980  35.986  -56.928  1.00 32.46  ? 450  ASP B CA    1 
ATOM   7111  C  C     . ASP B  1 450 ? -73.364  35.463  -55.529  1.00 34.38  ? 450  ASP B C     1 
ATOM   7112  O  O     . ASP B  1 450 ? -72.554  35.485  -54.595  1.00 40.89  ? 450  ASP B O     1 
ATOM   7113  C  CB    . ASP B  1 450 ? -73.500  37.420  -57.139  1.00 26.94  ? 450  ASP B CB    1 
ATOM   7114  C  CG    . ASP B  1 450 ? -72.763  38.460  -56.286  1.00 32.54  ? 450  ASP B CG    1 
ATOM   7115  O  OD1   . ASP B  1 450 ? -71.518  38.498  -56.324  1.00 49.90  ? 450  ASP B OD1   1 
ATOM   7116  O  OD2   . ASP B  1 450 ? -73.431  39.254  -55.586  1.00 41.30  ? 450  ASP B OD2   1 
ATOM   7117  N  N     . ASP B  1 451 ? -74.579  34.936  -55.410  1.00 29.85  ? 451  ASP B N     1 
ATOM   7118  C  CA    . ASP B  1 451 ? -75.056  34.418  -54.134  1.00 34.46  ? 451  ASP B CA    1 
ATOM   7119  C  C     . ASP B  1 451 ? -74.202  33.288  -53.613  1.00 33.94  ? 451  ASP B C     1 
ATOM   7120  O  O     . ASP B  1 451 ? -73.845  33.265  -52.437  1.00 39.12  ? 451  ASP B O     1 
ATOM   7121  C  CB    . ASP B  1 451 ? -76.509  33.947  -54.233  1.00 38.63  ? 451  ASP B CB    1 
ATOM   7122  C  CG    . ASP B  1 451 ? -77.512  35.090  -54.146  1.00 58.72  ? 451  ASP B CG    1 
ATOM   7123  O  OD1   . ASP B  1 451 ? -77.117  36.258  -53.882  1.00 42.69  ? 451  ASP B OD1   1 
ATOM   7124  O  OD2   . ASP B  1 451 ? -78.714  34.802  -54.341  1.00 61.68  ? 451  ASP B OD2   1 
ATOM   7125  N  N     . ARG B  1 452 ? -73.851  32.362  -54.495  1.00 31.76  ? 452  ARG B N     1 
ATOM   7126  C  CA    . ARG B  1 452 ? -73.051  31.225  -54.079  1.00 25.63  ? 452  ARG B CA    1 
ATOM   7127  C  C     . ARG B  1 452 ? -71.736  31.674  -53.477  1.00 34.66  ? 452  ARG B C     1 
ATOM   7128  O  O     . ARG B  1 452 ? -71.317  31.190  -52.429  1.00 35.60  ? 452  ARG B O     1 
ATOM   7129  C  CB    . ARG B  1 452 ? -72.817  30.273  -55.248  1.00 27.02  ? 452  ARG B CB    1 
ATOM   7130  C  CG    . ARG B  1 452 ? -74.067  29.517  -55.668  1.00 48.83  ? 452  ARG B CG    1 
ATOM   7131  C  CD    . ARG B  1 452 ? -73.723  28.122  -56.151  1.00 51.05  ? 452  ARG B CD    1 
ATOM   7132  N  NE    . ARG B  1 452 ? -72.915  27.430  -55.153  1.00 59.81  ? 452  ARG B NE    1 
ATOM   7133  C  CZ    . ARG B  1 452 ? -72.083  26.430  -55.420  1.00 65.68  ? 452  ARG B CZ    1 
ATOM   7134  N  NH1   . ARG B  1 452 ? -71.387  25.880  -54.426  1.00 51.53  ? 452  ARG B NH1   1 
ATOM   7135  N  NH2   . ARG B  1 452 ? -71.960  25.973  -56.670  1.00 48.57  ? 452  ARG B NH2   1 
ATOM   7136  N  N     . VAL B  1 453 ? -71.123  32.661  -54.105  1.00 26.23  ? 453  VAL B N     1 
ATOM   7137  C  CA    . VAL B  1 453 ? -69.859  33.162  -53.618  1.00 21.70  ? 453  VAL B CA    1 
ATOM   7138  C  C     . VAL B  1 453 ? -70.031  33.969  -52.335  1.00 30.31  ? 453  VAL B C     1 
ATOM   7139  O  O     . VAL B  1 453 ? -69.216  33.850  -51.427  1.00 37.40  ? 453  VAL B O     1 
ATOM   7140  C  CB    . VAL B  1 453 ? -69.145  34.001  -54.702  1.00 27.47  ? 453  VAL B CB    1 
ATOM   7141  C  CG1   . VAL B  1 453 ? -67.808  34.494  -54.199  1.00 15.00  ? 453  VAL B CG1   1 
ATOM   7142  C  CG2   . VAL B  1 453 ? -68.961  33.169  -55.969  1.00 22.05  ? 453  VAL B CG2   1 
ATOM   7143  N  N     . ARG B  1 454 ? -71.089  34.776  -52.244  1.00 34.22  ? 454  ARG B N     1 
ATOM   7144  C  CA    . ARG B  1 454 ? -71.302  35.590  -51.045  1.00 29.78  ? 454  ARG B CA    1 
ATOM   7145  C  C     . ARG B  1 454 ? -71.753  34.776  -49.843  1.00 34.41  ? 454  ARG B C     1 
ATOM   7146  O  O     . ARG B  1 454 ? -71.480  35.144  -48.699  1.00 42.65  ? 454  ARG B O     1 
ATOM   7147  C  CB    . ARG B  1 454 ? -72.337  36.689  -51.290  1.00 36.42  ? 454  ARG B CB    1 
ATOM   7148  C  CG    . ARG B  1 454 ? -71.843  37.958  -52.015  1.00 86.39  ? 454  ARG B CG    1 
ATOM   7149  C  CD    . ARG B  1 454 ? -72.907  39.081  -51.970  1.00 82.77  ? 454  ARG B CD    1 
ATOM   7150  N  NE    . ARG B  1 454 ? -74.261  38.525  -51.959  1.00 82.72  ? 454  ARG B NE    1 
ATOM   7151  C  CZ    . ARG B  1 454 ? -74.962  38.273  -50.851  1.00 100.00 ? 454  ARG B CZ    1 
ATOM   7152  N  NH1   . ARG B  1 454 ? -76.180  37.741  -50.940  1.00 93.88  ? 454  ARG B NH1   1 
ATOM   7153  N  NH2   . ARG B  1 454 ? -74.456  38.576  -49.654  1.00 96.13  ? 454  ARG B NH2   1 
ATOM   7154  N  N     . MET B  1 455 ? -72.440  33.673  -50.107  1.00 29.39  ? 455  MET B N     1 
ATOM   7155  C  CA    . MET B  1 455 ? -72.965  32.826  -49.046  1.00 31.76  ? 455  MET B CA    1 
ATOM   7156  C  C     . MET B  1 455 ? -72.061  31.705  -48.525  1.00 35.53  ? 455  MET B C     1 
ATOM   7157  O  O     . MET B  1 455 ? -72.230  31.259  -47.395  1.00 46.50  ? 455  MET B O     1 
ATOM   7158  C  CB    . MET B  1 455 ? -74.312  32.250  -49.477  1.00 28.88  ? 455  MET B CB    1 
ATOM   7159  C  CG    . MET B  1 455 ? -75.417  33.284  -49.601  1.00 38.64  ? 455  MET B CG    1 
ATOM   7160  S  SD    . MET B  1 455 ? -76.919  32.632  -50.361  1.00 64.78  ? 455  MET B SD    1 
ATOM   7161  C  CE    . MET B  1 455 ? -77.406  31.348  -49.199  1.00 66.95  ? 455  MET B CE    1 
ATOM   7162  N  N     . THR B  1 456 ? -71.095  31.270  -49.332  1.00 38.64  ? 456  THR B N     1 
ATOM   7163  C  CA    . THR B  1 456 ? -70.182  30.174  -48.964  1.00 25.65  ? 456  THR B CA    1 
ATOM   7164  C  C     . THR B  1 456 ? -68.913  30.618  -48.224  1.00 23.71  ? 456  THR B C     1 
ATOM   7165  O  O     . THR B  1 456 ? -68.106  31.357  -48.775  1.00 32.93  ? 456  THR B O     1 
ATOM   7166  C  CB    . THR B  1 456 ? -69.738  29.400  -50.231  1.00 21.23  ? 456  THR B CB    1 
ATOM   7167  O  OG1   . THR B  1 456 ? -70.887  28.889  -50.925  1.00 28.80  ? 456  THR B OG1   1 
ATOM   7168  C  CG2   . THR B  1 456 ? -68.815  28.260  -49.867  1.00 22.21  ? 456  THR B CG2   1 
ATOM   7169  N  N     . PRO B  1 457 ? -68.677  30.105  -47.001  1.00 21.41  ? 457  PRO B N     1 
ATOM   7170  C  CA    . PRO B  1 457 ? -67.473  30.503  -46.261  1.00 17.05  ? 457  PRO B CA    1 
ATOM   7171  C  C     . PRO B  1 457 ? -66.212  30.300  -47.103  1.00 23.54  ? 457  PRO B C     1 
ATOM   7172  O  O     . PRO B  1 457 ? -66.053  29.273  -47.770  1.00 35.85  ? 457  PRO B O     1 
ATOM   7173  C  CB    . PRO B  1 457 ? -67.491  29.570  -45.052  1.00 17.21  ? 457  PRO B CB    1 
ATOM   7174  C  CG    . PRO B  1 457 ? -68.933  29.336  -44.827  1.00 14.82  ? 457  PRO B CG    1 
ATOM   7175  C  CD    . PRO B  1 457 ? -69.459  29.129  -46.228  1.00 16.14  ? 457  PRO B CD    1 
ATOM   7176  N  N     . HIS B  1 458 ? -65.337  31.300  -47.053  1.00 21.98  ? 458  HIS B N     1 
ATOM   7177  C  CA    . HIS B  1 458 ? -64.074  31.340  -47.789  1.00 22.97  ? 458  HIS B CA    1 
ATOM   7178  C  C     . HIS B  1 458 ? -62.922  30.913  -46.898  1.00 25.80  ? 458  HIS B C     1 
ATOM   7179  O  O     . HIS B  1 458 ? -62.786  31.403  -45.786  1.00 39.66  ? 458  HIS B O     1 
ATOM   7180  C  CB    . HIS B  1 458 ? -63.827  32.783  -48.258  1.00 20.49  ? 458  HIS B CB    1 
ATOM   7181  C  CG    . HIS B  1 458 ? -62.613  32.967  -49.119  1.00 21.50  ? 458  HIS B CG    1 
ATOM   7182  N  ND1   . HIS B  1 458 ? -62.665  33.599  -50.343  1.00 23.78  ? 458  HIS B ND1   1 
ATOM   7183  C  CD2   . HIS B  1 458 ? -61.317  32.628  -48.926  1.00 22.34  ? 458  HIS B CD2   1 
ATOM   7184  C  CE1   . HIS B  1 458 ? -61.454  33.638  -50.870  1.00 18.82  ? 458  HIS B CE1   1 
ATOM   7185  N  NE2   . HIS B  1 458 ? -60.616  33.055  -50.028  1.00 28.11  ? 458  HIS B NE2   1 
ATOM   7186  N  N     . PRO B  1 459 ? -62.033  30.050  -47.412  1.00 30.86  ? 459  PRO B N     1 
ATOM   7187  C  CA    . PRO B  1 459 ? -60.853  29.526  -46.719  1.00 23.90  ? 459  PRO B CA    1 
ATOM   7188  C  C     . PRO B  1 459 ? -60.095  30.571  -45.916  1.00 22.61  ? 459  PRO B C     1 
ATOM   7189  O  O     . PRO B  1 459 ? -59.747  30.336  -44.758  1.00 32.52  ? 459  PRO B O     1 
ATOM   7190  C  CB    . PRO B  1 459 ? -60.008  29.013  -47.873  1.00 21.62  ? 459  PRO B CB    1 
ATOM   7191  C  CG    . PRO B  1 459 ? -61.048  28.426  -48.766  1.00 23.96  ? 459  PRO B CG    1 
ATOM   7192  C  CD    . PRO B  1 459 ? -62.137  29.469  -48.764  1.00 25.85  ? 459  PRO B CD    1 
ATOM   7193  N  N     . VAL B  1 460 ? -59.895  31.741  -46.527  1.00 27.85  ? 460  VAL B N     1 
ATOM   7194  C  CA    . VAL B  1 460 ? -59.180  32.867  -45.921  1.00 25.33  ? 460  VAL B CA    1 
ATOM   7195  C  C     . VAL B  1 460 ? -59.876  33.420  -44.663  1.00 24.90  ? 460  VAL B C     1 
ATOM   7196  O  O     . VAL B  1 460 ? -59.234  33.992  -43.766  1.00 28.07  ? 460  VAL B O     1 
ATOM   7197  C  CB    . VAL B  1 460 ? -58.938  33.978  -46.990  1.00 23.71  ? 460  VAL B CB    1 
ATOM   7198  C  CG1   . VAL B  1 460 ? -58.442  35.259  -46.365  1.00 19.93  ? 460  VAL B CG1   1 
ATOM   7199  C  CG2   . VAL B  1 460 ? -57.896  33.499  -47.996  1.00 20.72  ? 460  VAL B CG2   1 
ATOM   7200  N  N     . GLU B  1 461 ? -61.184  33.205  -44.580  1.00 18.28  ? 461  GLU B N     1 
ATOM   7201  C  CA    . GLU B  1 461 ? -61.964  33.659  -43.429  1.00 24.97  ? 461  GLU B CA    1 
ATOM   7202  C  C     . GLU B  1 461 ? -61.595  32.865  -42.186  1.00 25.53  ? 461  GLU B C     1 
ATOM   7203  O  O     . GLU B  1 461 ? -61.766  33.325  -41.062  1.00 29.30  ? 461  GLU B O     1 
ATOM   7204  C  CB    . GLU B  1 461 ? -63.465  33.550  -43.717  1.00 15.19  ? 461  GLU B CB    1 
ATOM   7205  C  CG    . GLU B  1 461 ? -63.944  34.544  -44.787  1.00 27.41  ? 461  GLU B CG    1 
ATOM   7206  C  CD    . GLU B  1 461 ? -65.454  34.530  -45.036  1.00 34.02  ? 461  GLU B CD    1 
ATOM   7207  O  OE1   . GLU B  1 461 ? -66.005  35.601  -45.354  1.00 28.91  ? 461  GLU B OE1   1 
ATOM   7208  O  OE2   . GLU B  1 461 ? -66.091  33.460  -44.951  1.00 26.68  ? 461  GLU B OE2   1 
ATOM   7209  N  N     . PHE B  1 462 ? -61.084  31.659  -42.404  1.00 24.08  ? 462  PHE B N     1 
ATOM   7210  C  CA    . PHE B  1 462 ? -60.646  30.832  -41.301  1.00 18.97  ? 462  PHE B CA    1 
ATOM   7211  C  C     . PHE B  1 462 ? -59.291  31.290  -40.812  1.00 28.57  ? 462  PHE B C     1 
ATOM   7212  O  O     . PHE B  1 462 ? -59.021  31.311  -39.606  1.00 37.66  ? 462  PHE B O     1 
ATOM   7213  C  CB    . PHE B  1 462 ? -60.614  29.352  -41.725  1.00 12.36  ? 462  PHE B CB    1 
ATOM   7214  C  CG    . PHE B  1 462 ? -62.016  28.848  -41.946  1.00 32.58  ? 462  PHE B CG    1 
ATOM   7215  C  CD1   . PHE B  1 462 ? -62.665  28.167  -40.913  1.00 27.63  ? 462  PHE B CD1   1 
ATOM   7216  C  CD2   . PHE B  1 462 ? -62.698  29.067  -43.136  1.00 43.24  ? 462  PHE B CD2   1 
ATOM   7217  C  CE1   . PHE B  1 462 ? -63.976  27.733  -41.070  1.00 23.83  ? 462  PHE B CE1   1 
ATOM   7218  C  CE2   . PHE B  1 462 ? -64.018  28.625  -43.291  1.00 19.79  ? 462  PHE B CE2   1 
ATOM   7219  C  CZ    . PHE B  1 462 ? -64.654  27.970  -42.268  1.00 27.37  ? 462  PHE B CZ    1 
ATOM   7220  N  N     . GLU B  1 463 ? -58.441  31.668  -41.762  1.00 23.48  ? 463  GLU B N     1 
ATOM   7221  C  CA    . GLU B  1 463 ? -57.088  32.143  -41.490  1.00 23.33  ? 463  GLU B CA    1 
ATOM   7222  C  C     . GLU B  1 463 ? -57.211  33.383  -40.622  1.00 27.96  ? 463  GLU B C     1 
ATOM   7223  O  O     . GLU B  1 463 ? -56.530  33.528  -39.601  1.00 39.78  ? 463  GLU B O     1 
ATOM   7224  C  CB    . GLU B  1 463 ? -56.420  32.514  -42.821  1.00 26.99  ? 463  GLU B CB    1 
ATOM   7225  C  CG    . GLU B  1 463 ? -54.918  32.727  -42.798  1.00 57.20  ? 463  GLU B CG    1 
ATOM   7226  C  CD    . GLU B  1 463 ? -54.309  32.369  -44.123  1.00 78.85  ? 463  GLU B CD    1 
ATOM   7227  O  OE1   . GLU B  1 463 ? -53.796  31.234  -44.281  1.00 81.46  ? 463  GLU B OE1   1 
ATOM   7228  O  OE2   . GLU B  1 463 ? -54.368  33.228  -45.019  1.00 71.25  ? 463  GLU B OE2   1 
ATOM   7229  N  N     . LEU B  1 464 ? -58.151  34.227  -41.029  1.00 24.24  ? 464  LEU B N     1 
ATOM   7230  C  CA    . LEU B  1 464 ? -58.479  35.525  -40.403  1.00 13.84  ? 464  LEU B CA    1 
ATOM   7231  C  C     . LEU B  1 464 ? -59.354  35.447  -39.158  1.00 28.31  ? 464  LEU B C     1 
ATOM   7232  O  O     . LEU B  1 464 ? -59.144  36.207  -38.220  1.00 26.08  ? 464  LEU B O     1 
ATOM   7233  C  CB    . LEU B  1 464 ? -59.259  36.386  -41.410  1.00 18.70  ? 464  LEU B CB    1 
ATOM   7234  C  CG    . LEU B  1 464 ? -58.599  37.522  -42.210  1.00 13.06  ? 464  LEU B CG    1 
ATOM   7235  C  CD1   . LEU B  1 464 ? -57.106  37.301  -42.342  1.00 24.76  ? 464  LEU B CD1   1 
ATOM   7236  C  CD2   . LEU B  1 464 ? -59.248  37.655  -43.580  1.00 20.58  ? 464  LEU B CD2   1 
ATOM   7237  N  N     . TYR B  1 465 ? -60.349  34.558  -39.109  1.00 23.94  ? 465  TYR B N     1 
ATOM   7238  C  CA    . TYR B  1 465 ? -61.311  34.580  -38.002  1.00 20.20  ? 465  TYR B CA    1 
ATOM   7239  C  C     . TYR B  1 465 ? -61.518  33.339  -37.153  1.00 23.27  ? 465  TYR B C     1 
ATOM   7240  O  O     . TYR B  1 465 ? -62.277  33.410  -36.173  1.00 31.71  ? 465  TYR B O     1 
ATOM   7241  C  CB    . TYR B  1 465 ? -62.654  34.991  -38.564  1.00 13.84  ? 465  TYR B CB    1 
ATOM   7242  C  CG    . TYR B  1 465 ? -62.614  36.213  -39.451  1.00 24.13  ? 465  TYR B CG    1 
ATOM   7243  C  CD1   . TYR B  1 465 ? -62.131  37.438  -38.975  1.00 28.29  ? 465  TYR B CD1   1 
ATOM   7244  C  CD2   . TYR B  1 465 ? -63.070  36.151  -40.768  1.00 29.30  ? 465  TYR B CD2   1 
ATOM   7245  C  CE1   . TYR B  1 465 ? -62.111  38.571  -39.789  1.00 31.18  ? 465  TYR B CE1   1 
ATOM   7246  C  CE2   . TYR B  1 465 ? -63.054  37.276  -41.591  1.00 35.20  ? 465  TYR B CE2   1 
ATOM   7247  C  CZ    . TYR B  1 465 ? -62.581  38.478  -41.094  1.00 33.03  ? 465  TYR B CZ    1 
ATOM   7248  O  OH    . TYR B  1 465 ? -62.573  39.595  -41.910  1.00 37.50  ? 465  TYR B OH    1 
ATOM   7249  N  N     . TYR B  1 466 ? -60.895  32.224  -37.466  1.00 24.22  ? 466  TYR B N     1 
ATOM   7250  C  CA    . TYR B  1 466 ? -61.180  31.050  -36.644  1.00 19.26  ? 466  TYR B CA    1 
ATOM   7251  C  C     . TYR B  1 466 ? -60.904  31.242  -35.141  1.00 30.40  ? 466  TYR B C     1 
ATOM   7252  O  O     . TYR B  1 466 ? -61.662  30.750  -34.312  1.00 23.64  ? 466  TYR B O     1 
ATOM   7253  C  CB    . TYR B  1 466 ? -60.438  29.834  -37.197  1.00 19.52  ? 466  TYR B CB    1 
ATOM   7254  C  CG    . TYR B  1 466 ? -60.776  28.541  -36.480  1.00 22.57  ? 466  TYR B CG    1 
ATOM   7255  C  CD1   . TYR B  1 466 ? -61.921  27.817  -36.809  1.00 28.55  ? 466  TYR B CD1   1 
ATOM   7256  C  CD2   . TYR B  1 466 ? -59.950  28.042  -35.472  1.00 26.15  ? 466  TYR B CD2   1 
ATOM   7257  C  CE1   . TYR B  1 466 ? -62.235  26.626  -36.159  1.00 21.47  ? 466  TYR B CE1   1 
ATOM   7258  C  CE2   . TYR B  1 466 ? -60.254  26.851  -34.812  1.00 17.94  ? 466  TYR B CE2   1 
ATOM   7259  C  CZ    . TYR B  1 466 ? -61.394  26.147  -35.162  1.00 27.92  ? 466  TYR B CZ    1 
ATOM   7260  O  OH    . TYR B  1 466 ? -61.686  24.968  -34.516  1.00 28.23  ? 466  TYR B OH    1 
ATOM   7261  N  N     . SER B  1 467 ? -59.836  31.959  -34.794  1.00 34.57  ? 467  SER B N     1 
ATOM   7262  C  CA    . SER B  1 467 ? -59.466  32.166  -33.393  1.00 24.63  ? 467  SER B CA    1 
ATOM   7263  C  C     . SER B  1 467 ? -60.075  33.411  -32.776  1.00 31.38  ? 467  SER B C     1 
ATOM   7264  O  O     . SER B  1 467 ? -59.629  33.895  -31.736  1.00 38.67  ? 467  SER B O     1 
ATOM   7265  C  CB    . SER B  1 467 ? -57.947  32.237  -33.259  1.00 17.37  ? 467  SER B CB    1 
ATOM   7266  O  OG    . SER B  1 467 ? -57.343  31.010  -33.589  1.00 30.90  ? 467  SER B OG    1 
ATOM   7267  N  N     . VAL B  1 468 ? -61.137  33.892  -33.391  1.00 36.23  ? 468  VAL B N     1 
ATOM   7268  C  CA    . VAL B  1 468 ? -61.818  35.093  -32.942  1.00 24.91  ? 468  VAL B CA    1 
ATOM   7269  C  C     . VAL B  1 468 ? -62.415  34.991  -31.527  1.00 32.74  ? 468  VAL B C     1 
ATOM   7270  O  O     . VAL B  1 468 ? -62.771  33.873  -31.088  1.00 39.28  ? 468  VAL B O     1 
ATOM   7271  C  CB    . VAL B  1 468 ? -62.865  35.488  -34.019  1.00 16.95  ? 468  VAL B CB    1 
ATOM   7272  C  CG1   . VAL B  1 468 ? -64.265  35.170  -33.581  1.00 25.99  ? 468  VAL B CG1   1 
ATOM   7273  C  CG2   . VAL B  1 468 ? -62.677  36.911  -34.442  1.00 26.78  ? 468  VAL B CG2   1 
ATOM   7274  O  OXT   . VAL B  1 468 ? -62.473  36.039  -30.848  1.00 36.64  ? 468  VAL B OXT   1 
ATOM   7275  N  N     . SER C  1 1   ? -30.132  38.873  -94.886  0.98 91.54  ? 1    SER C N     1 
ATOM   7276  C  CA    . SER C  1 1   ? -30.858  40.134  -94.815  0.98 95.36  ? 1    SER C CA    1 
ATOM   7277  C  C     . SER C  1 1   ? -32.248  39.979  -95.361  0.98 85.20  ? 1    SER C C     1 
ATOM   7278  O  O     . SER C  1 1   ? -32.673  38.894  -95.762  0.98 88.00  ? 1    SER C O     1 
ATOM   7279  C  CB    . SER C  1 1   ? -30.100  41.231  -95.550  0.98 93.37  ? 1    SER C CB    1 
ATOM   7280  O  OG    . SER C  1 1   ? -30.774  41.599  -96.741  0.98 90.73  ? 1    SER C OG    1 
ATOM   7281  N  N     . ALA C  1 2   ? -32.974  41.086  -95.364  0.98 80.68  ? 2    ALA C N     1 
ATOM   7282  C  CA    . ALA C  1 2   ? -34.322  41.071  -95.852  0.98 60.75  ? 2    ALA C CA    1 
ATOM   7283  C  C     . ALA C  1 2   ? -34.511  40.204  -97.093  0.98 64.48  ? 2    ALA C C     1 
ATOM   7284  O  O     . ALA C  1 2   ? -35.323  39.282  -97.075  0.98 59.63  ? 2    ALA C O     1 
ATOM   7285  C  CB    . ALA C  1 2   ? -34.786  42.484  -96.156  0.98 58.77  ? 2    ALA C CB    1 
ATOM   7286  N  N     . GLU C  1 3   ? -33.770  40.471  -98.176  0.98 87.84  ? 3    GLU C N     1 
ATOM   7287  C  CA    . GLU C  1 3   ? -33.955  39.789  -99.440  0.98 87.63  ? 3    GLU C CA    1 
ATOM   7288  C  C     . GLU C  1 3   ? -33.794  38.263  -99.223  0.98 78.47  ? 3    GLU C C     1 
ATOM   7289  O  O     . GLU C  1 3   ? -34.683  37.479  -99.577  0.98 57.02  ? 3    GLU C O     1 
ATOM   7290  C  CB    . GLU C  1 3   ? -32.932  40.410  -100.431 0.98 100.00 ? 3    GLU C CB    1 
ATOM   7291  C  CG    . GLU C  1 3   ? -32.287  39.494  -101.480 0.98 100.00 ? 3    GLU C CG    1 
ATOM   7292  C  CD    . GLU C  1 3   ? -33.281  38.914  -102.488 0.98 100.00 ? 3    GLU C CD    1 
ATOM   7293  O  OE1   . GLU C  1 3   ? -32.886  37.975  -103.225 0.98 100.00 ? 3    GLU C OE1   1 
ATOM   7294  O  OE2   . GLU C  1 3   ? -34.448  39.386  -102.538 0.98 100.00 ? 3    GLU C OE2   1 
ATOM   7295  N  N     . HIS C  1 4   ? -32.707  37.877  -98.551  0.98 78.57  ? 4    HIS C N     1 
ATOM   7296  C  CA    . HIS C  1 4   ? -32.383  36.477  -98.239  0.98 74.33  ? 4    HIS C CA    1 
ATOM   7297  C  C     . HIS C  1 4   ? -33.431  35.798  -97.356  0.98 70.90  ? 4    HIS C C     1 
ATOM   7298  O  O     . HIS C  1 4   ? -33.796  34.649  -97.591  0.98 71.84  ? 4    HIS C O     1 
ATOM   7299  C  CB    . HIS C  1 4   ? -31.002  36.414  -97.560  0.98 86.94  ? 4    HIS C CB    1 
ATOM   7300  C  CG    . HIS C  1 4   ? -30.680  35.095  -96.915  0.98 100.00 ? 4    HIS C CG    1 
ATOM   7301  N  ND1   . HIS C  1 4   ? -30.305  34.989  -95.591  0.98 100.00 ? 4    HIS C ND1   1 
ATOM   7302  C  CD2   . HIS C  1 4   ? -30.632  33.836  -97.420  0.98 92.27  ? 4    HIS C CD2   1 
ATOM   7303  C  CE1   . HIS C  1 4   ? -30.035  33.726  -95.309  0.98 100.00 ? 4    HIS C CE1   1 
ATOM   7304  N  NE2   . HIS C  1 4   ? -30.226  33.007  -96.400  0.98 96.44  ? 4    HIS C NE2   1 
ATOM   7305  N  N     . VAL C  1 5   ? -33.898  36.506  -96.332  0.98 63.23  ? 5    VAL C N     1 
ATOM   7306  C  CA    . VAL C  1 5   ? -34.891  35.971  -95.412  0.98 35.97  ? 5    VAL C CA    1 
ATOM   7307  C  C     . VAL C  1 5   ? -36.167  35.502  -96.109  0.98 60.89  ? 5    VAL C C     1 
ATOM   7308  O  O     . VAL C  1 5   ? -36.683  34.425  -95.785  0.98 61.74  ? 5    VAL C O     1 
ATOM   7309  C  CB    . VAL C  1 5   ? -35.232  36.990  -94.305  0.98 43.20  ? 5    VAL C CB    1 
ATOM   7310  C  CG1   . VAL C  1 5   ? -36.475  36.565  -93.530  0.98 25.94  ? 5    VAL C CG1   1 
ATOM   7311  C  CG2   . VAL C  1 5   ? -34.048  37.138  -93.355  0.98 31.77  ? 5    VAL C CG2   1 
ATOM   7312  N  N     . LEU C  1 6   ? -36.681  36.292  -97.057  0.98 63.75  ? 6    LEU C N     1 
ATOM   7313  C  CA    . LEU C  1 6   ? -37.897  35.895  -97.775  0.98 57.28  ? 6    LEU C CA    1 
ATOM   7314  C  C     . LEU C  1 6   ? -37.673  34.581  -98.545  0.98 60.80  ? 6    LEU C C     1 
ATOM   7315  O  O     . LEU C  1 6   ? -38.615  33.821  -98.784  0.98 66.27  ? 6    LEU C O     1 
ATOM   7316  C  CB    . LEU C  1 6   ? -38.403  37.011  -98.698  0.98 53.84  ? 6    LEU C CB    1 
ATOM   7317  C  CG    . LEU C  1 6   ? -39.285  38.174  -98.173  0.98 71.48  ? 6    LEU C CG    1 
ATOM   7318  C  CD1   . LEU C  1 6   ? -40.352  37.621  -97.250  0.98 75.37  ? 6    LEU C CD1   1 
ATOM   7319  C  CD2   . LEU C  1 6   ? -38.506  39.274  -97.460  0.98 60.22  ? 6    LEU C CD2   1 
ATOM   7320  N  N     . THR C  1 7   ? -36.411  34.293  -98.869  0.98 65.70  ? 7    THR C N     1 
ATOM   7321  C  CA    . THR C  1 7   ? -36.036  33.063  -99.571  0.98 76.39  ? 7    THR C CA    1 
ATOM   7322  C  C     . THR C  1 7   ? -36.198  31.888  -98.613  0.98 70.50  ? 7    THR C C     1 
ATOM   7323  O  O     . THR C  1 7   ? -36.933  30.947  -98.906  0.98 81.02  ? 7    THR C O     1 
ATOM   7324  C  CB    . THR C  1 7   ? -34.558  33.115  -100.084 0.98 92.18  ? 7    THR C CB    1 
ATOM   7325  O  OG1   . THR C  1 7   ? -34.446  34.094  -101.129 0.98 100.00 ? 7    THR C OG1   1 
ATOM   7326  C  CG2   . THR C  1 7   ? -34.083  31.739  -100.604 0.98 66.42  ? 7    THR C CG2   1 
ATOM   7327  N  N     . MET C  1 8   ? -35.531  31.972  -97.460  0.98 71.94  ? 8    MET C N     1 
ATOM   7328  C  CA    . MET C  1 8   ? -35.590  30.933  -96.426  0.98 60.99  ? 8    MET C CA    1 
ATOM   7329  C  C     . MET C  1 8   ? -37.014  30.579  -96.019  0.98 54.14  ? 8    MET C C     1 
ATOM   7330  O  O     . MET C  1 8   ? -37.285  29.438  -95.644  0.98 57.61  ? 8    MET C O     1 
ATOM   7331  C  CB    . MET C  1 8   ? -34.799  31.345  -95.184  0.98 38.10  ? 8    MET C CB    1 
ATOM   7332  C  CG    . MET C  1 8   ? -33.295  31.349  -95.387  0.98 61.48  ? 8    MET C CG    1 
ATOM   7333  S  SD    . MET C  1 8   ? -32.375  31.501  -93.835  0.98 71.20  ? 8    MET C SD    1 
ATOM   7334  C  CE    . MET C  1 8   ? -31.868  29.784  -93.557  0.98 76.50  ? 8    MET C CE    1 
ATOM   7335  N  N     . LEU C  1 9   ? -37.926  31.546  -96.103  0.98 50.81  ? 9    LEU C N     1 
ATOM   7336  C  CA    . LEU C  1 9   ? -39.315  31.280  -95.752  0.98 55.55  ? 9    LEU C CA    1 
ATOM   7337  C  C     . LEU C  1 9   ? -39.933  30.226  -96.671  0.98 61.74  ? 9    LEU C C     1 
ATOM   7338  O  O     . LEU C  1 9   ? -40.655  29.339  -96.209  0.98 70.99  ? 9    LEU C O     1 
ATOM   7339  C  CB    . LEU C  1 9   ? -40.139  32.575  -95.733  0.98 41.30  ? 9    LEU C CB    1 
ATOM   7340  C  CG    . LEU C  1 9   ? -39.744  33.558  -94.613  0.98 35.72  ? 9    LEU C CG    1 
ATOM   7341  C  CD1   . LEU C  1 9   ? -40.605  34.789  -94.666  0.98 35.72  ? 9    LEU C CD1   1 
ATOM   7342  C  CD2   . LEU C  1 9   ? -39.874  32.918  -93.237  0.98 29.89  ? 9    LEU C CD2   1 
ATOM   7343  N  N     . ASN C  1 10  ? -39.586  30.272  -97.955  0.98 68.65  ? 10   ASN C N     1 
ATOM   7344  C  CA    . ASN C  1 10  ? -40.113  29.306  -98.918  0.98 69.56  ? 10   ASN C CA    1 
ATOM   7345  C  C     . ASN C  1 10  ? -39.300  28.026  -99.032  0.98 58.27  ? 10   ASN C C     1 
ATOM   7346  O  O     . ASN C  1 10  ? -39.856  26.941  -99.198  0.98 66.88  ? 10   ASN C O     1 
ATOM   7347  C  CB    . ASN C  1 10  ? -40.295  29.969  -100.278 0.98 60.05  ? 10   ASN C CB    1 
ATOM   7348  C  CG    . ASN C  1 10  ? -41.444  30.949  -100.273 0.98 87.96  ? 10   ASN C CG    1 
ATOM   7349  O  OD1   . ASN C  1 10  ? -41.269  32.134  -99.971  0.98 84.58  ? 10   ASN C OD1   1 
ATOM   7350  N  ND2   . ASN C  1 10  ? -42.647  30.443  -100.529 0.98 87.11  ? 10   ASN C ND2   1 
ATOM   7351  N  N     . GLU C  1 11  ? -37.987  28.164  -98.887  1.00 62.74  ? 11   GLU C N     1 
ATOM   7352  C  CA    . GLU C  1 11  ? -37.054  27.048  -98.969  1.00 69.11  ? 11   GLU C CA    1 
ATOM   7353  C  C     . GLU C  1 11  ? -37.327  26.042  -97.858  1.00 67.44  ? 11   GLU C C     1 
ATOM   7354  O  O     . GLU C  1 11  ? -37.137  24.840  -98.038  1.00 78.51  ? 11   GLU C O     1 
ATOM   7355  C  CB    . GLU C  1 11  ? -35.621  27.578  -98.859  1.00 74.13  ? 11   GLU C CB    1 
ATOM   7356  C  CG    . GLU C  1 11  ? -34.507  26.602  -99.233  1.00 89.86  ? 11   GLU C CG    1 
ATOM   7357  C  CD    . GLU C  1 11  ? -33.124  27.238  -99.105  1.00 100.00 ? 11   GLU C CD    1 
ATOM   7358  O  OE1   . GLU C  1 11  ? -32.819  28.174  -99.885  1.00 100.00 ? 11   GLU C OE1   1 
ATOM   7359  O  OE2   . GLU C  1 11  ? -32.349  26.819  -98.210  1.00 100.00 ? 11   GLU C OE2   1 
ATOM   7360  N  N     . HIS C  1 12  ? -37.800  26.540  -96.719  1.00 70.16  ? 12   HIS C N     1 
ATOM   7361  C  CA    . HIS C  1 12  ? -38.092  25.687  -95.570  1.00 69.82  ? 12   HIS C CA    1 
ATOM   7362  C  C     . HIS C  1 12  ? -39.570  25.635  -95.200  1.00 67.84  ? 12   HIS C C     1 
ATOM   7363  O  O     . HIS C  1 12  ? -39.907  25.121  -94.132  1.00 62.08  ? 12   HIS C O     1 
ATOM   7364  C  CB    . HIS C  1 12  ? -37.307  26.154  -94.340  1.00 69.75  ? 12   HIS C CB    1 
ATOM   7365  C  CG    . HIS C  1 12  ? -35.818  26.056  -94.480  1.00 72.96  ? 12   HIS C CG    1 
ATOM   7366  N  ND1   . HIS C  1 12  ? -35.117  24.902  -94.197  1.00 68.91  ? 12   HIS C ND1   1 
ATOM   7367  C  CD2   . HIS C  1 12  ? -34.891  26.985  -94.819  1.00 63.12  ? 12   HIS C CD2   1 
ATOM   7368  C  CE1   . HIS C  1 12  ? -33.823  25.128  -94.354  1.00 69.92  ? 12   HIS C CE1   1 
ATOM   7369  N  NE2   . HIS C  1 12  ? -33.659  26.382  -94.729  1.00 69.17  ? 12   HIS C NE2   1 
ATOM   7370  N  N     . GLU C  1 13  ? -40.438  26.174  -96.062  1.00 68.05  ? 13   GLU C N     1 
ATOM   7371  C  CA    . GLU C  1 13  ? -41.885  26.202  -95.814  1.00 56.18  ? 13   GLU C CA    1 
ATOM   7372  C  C     . GLU C  1 13  ? -42.149  26.619  -94.370  1.00 55.45  ? 13   GLU C C     1 
ATOM   7373  O  O     . GLU C  1 13  ? -42.846  25.937  -93.615  1.00 47.42  ? 13   GLU C O     1 
ATOM   7374  C  CB    . GLU C  1 13  ? -42.498  24.836  -96.079  1.00 61.80  ? 13   GLU C CB    1 
ATOM   7375  C  CG    . GLU C  1 13  ? -42.291  24.325  -97.476  1.00 72.48  ? 13   GLU C CG    1 
ATOM   7376  C  CD    . GLU C  1 13  ? -42.575  22.847  -97.570  1.00 80.62  ? 13   GLU C CD    1 
ATOM   7377  O  OE1   . GLU C  1 13  ? -41.609  22.067  -97.703  1.00 88.96  ? 13   GLU C OE1   1 
ATOM   7378  O  OE2   . GLU C  1 13  ? -43.764  22.466  -97.484  1.00 90.58  ? 13   GLU C OE2   1 
ATOM   7379  N  N     . VAL C  1 14  ? -41.518  27.715  -93.983  1.00 40.74  ? 14   VAL C N     1 
ATOM   7380  C  CA    . VAL C  1 14  ? -41.637  28.249  -92.644  1.00 30.89  ? 14   VAL C CA    1 
ATOM   7381  C  C     . VAL C  1 14  ? -43.058  28.682  -92.316  1.00 37.46  ? 14   VAL C C     1 
ATOM   7382  O  O     . VAL C  1 14  ? -43.720  29.365  -93.096  1.00 43.37  ? 14   VAL C O     1 
ATOM   7383  C  CB    . VAL C  1 14  ? -40.647  29.404  -92.453  1.00 26.59  ? 14   VAL C CB    1 
ATOM   7384  C  CG1   . VAL C  1 14  ? -40.897  30.118  -91.154  1.00 31.78  ? 14   VAL C CG1   1 
ATOM   7385  C  CG2   . VAL C  1 14  ? -39.238  28.855  -92.468  1.00 20.62  ? 14   VAL C CG2   1 
ATOM   7386  N  N     . LYS C  1 15  ? -43.528  28.244  -91.156  1.00 38.67  ? 15   LYS C N     1 
ATOM   7387  C  CA    . LYS C  1 15  ? -44.869  28.561  -90.710  1.00 27.66  ? 15   LYS C CA    1 
ATOM   7388  C  C     . LYS C  1 15  ? -44.838  29.713  -89.699  1.00 30.72  ? 15   LYS C C     1 
ATOM   7389  O  O     . LYS C  1 15  ? -45.790  30.500  -89.629  1.00 31.27  ? 15   LYS C O     1 
ATOM   7390  C  CB    . LYS C  1 15  ? -45.530  27.316  -90.101  1.00 21.59  ? 15   LYS C CB    1 
ATOM   7391  C  CG    . LYS C  1 15  ? -45.363  26.013  -90.904  1.00 52.25  ? 15   LYS C CG    1 
ATOM   7392  C  CD    . LYS C  1 15  ? -46.651  25.550  -91.580  1.00 60.74  ? 15   LYS C CD    1 
ATOM   7393  C  CE    . LYS C  1 15  ? -46.896  26.239  -92.923  1.00 85.15  ? 15   LYS C CE    1 
ATOM   7394  N  NZ    . LYS C  1 15  ? -45.980  25.784  -94.022  1.00 82.52  ? 15   LYS C NZ    1 
ATOM   7395  N  N     . PHE C  1 16  ? -43.753  29.818  -88.926  1.00 28.14  ? 16   PHE C N     1 
ATOM   7396  C  CA    . PHE C  1 16  ? -43.623  30.896  -87.931  1.00 28.03  ? 16   PHE C CA    1 
ATOM   7397  C  C     . PHE C  1 16  ? -42.242  31.545  -87.907  1.00 32.11  ? 16   PHE C C     1 
ATOM   7398  O  O     . PHE C  1 16  ? -41.255  30.974  -88.370  1.00 29.20  ? 16   PHE C O     1 
ATOM   7399  C  CB    . PHE C  1 16  ? -43.909  30.390  -86.510  1.00 18.81  ? 16   PHE C CB    1 
ATOM   7400  C  CG    . PHE C  1 16  ? -45.268  29.799  -86.339  1.00 22.42  ? 16   PHE C CG    1 
ATOM   7401  C  CD1   . PHE C  1 16  ? -45.497  28.453  -86.636  1.00 8.48   ? 16   PHE C CD1   1 
ATOM   7402  C  CD2   . PHE C  1 16  ? -46.330  30.587  -85.921  1.00 11.95  ? 16   PHE C CD2   1 
ATOM   7403  C  CE1   . PHE C  1 16  ? -46.759  27.897  -86.528  1.00 17.93  ? 16   PHE C CE1   1 
ATOM   7404  C  CE2   . PHE C  1 16  ? -47.612  30.042  -85.810  1.00 13.71  ? 16   PHE C CE2   1 
ATOM   7405  C  CZ    . PHE C  1 16  ? -47.823  28.687  -86.118  1.00 21.68  ? 16   PHE C CZ    1 
ATOM   7406  N  N     . VAL C  1 17  ? -42.187  32.739  -87.330  1.00 27.78  ? 17   VAL C N     1 
ATOM   7407  C  CA    . VAL C  1 17  ? -40.947  33.485  -87.176  1.00 20.54  ? 17   VAL C CA    1 
ATOM   7408  C  C     . VAL C  1 17  ? -40.849  33.819  -85.685  1.00 32.96  ? 17   VAL C C     1 
ATOM   7409  O  O     . VAL C  1 17  ? -41.785  34.367  -85.092  1.00 28.02  ? 17   VAL C O     1 
ATOM   7410  C  CB    . VAL C  1 17  ? -40.952  34.774  -88.021  1.00 24.49  ? 17   VAL C CB    1 
ATOM   7411  C  CG1   . VAL C  1 17  ? -39.814  35.674  -87.610  1.00 16.04  ? 17   VAL C CG1   1 
ATOM   7412  C  CG2   . VAL C  1 17  ? -40.803  34.424  -89.497  1.00 20.26  ? 17   VAL C CG2   1 
ATOM   7413  N  N     . ASP C  1 18  ? -39.736  33.438  -85.075  1.00 29.03  ? 18   ASP C N     1 
ATOM   7414  C  CA    . ASP C  1 18  ? -39.539  33.679  -83.657  1.00 24.31  ? 18   ASP C CA    1 
ATOM   7415  C  C     . ASP C  1 18  ? -38.617  34.869  -83.435  1.00 28.29  ? 18   ASP C C     1 
ATOM   7416  O  O     . ASP C  1 18  ? -37.411  34.821  -83.706  1.00 30.50  ? 18   ASP C O     1 
ATOM   7417  C  CB    . ASP C  1 18  ? -38.993  32.412  -82.971  1.00 25.21  ? 18   ASP C CB    1 
ATOM   7418  C  CG    . ASP C  1 18  ? -39.267  32.387  -81.473  1.00 29.45  ? 18   ASP C CG    1 
ATOM   7419  O  OD1   . ASP C  1 18  ? -38.350  32.047  -80.697  1.00 23.38  ? 18   ASP C OD1   1 
ATOM   7420  O  OD2   . ASP C  1 18  ? -40.403  32.705  -81.068  1.00 27.58  ? 18   ASP C OD2   1 
ATOM   7421  N  N     . LEU C  1 19  ? -39.210  35.958  -82.974  1.00 29.43  ? 19   LEU C N     1 
ATOM   7422  C  CA    . LEU C  1 19  ? -38.462  37.171  -82.704  1.00 27.87  ? 19   LEU C CA    1 
ATOM   7423  C  C     . LEU C  1 19  ? -37.760  37.071  -81.361  1.00 29.84  ? 19   LEU C C     1 
ATOM   7424  O  O     . LEU C  1 19  ? -38.410  36.938  -80.322  1.00 40.84  ? 19   LEU C O     1 
ATOM   7425  C  CB    . LEU C  1 19  ? -39.411  38.367  -82.725  1.00 26.48  ? 19   LEU C CB    1 
ATOM   7426  C  CG    . LEU C  1 19  ? -39.688  39.074  -84.061  1.00 35.13  ? 19   LEU C CG    1 
ATOM   7427  C  CD1   . LEU C  1 19  ? -39.230  38.279  -85.279  1.00 23.73  ? 19   LEU C CD1   1 
ATOM   7428  C  CD2   . LEU C  1 19  ? -41.155  39.384  -84.140  1.00 19.57  ? 19   LEU C CD2   1 
ATOM   7429  N  N     . ARG C  1 20  ? -36.432  37.133  -81.386  1.00 28.84  ? 20   ARG C N     1 
ATOM   7430  C  CA    . ARG C  1 20  ? -35.656  37.039  -80.159  1.00 29.31  ? 20   ARG C CA    1 
ATOM   7431  C  C     . ARG C  1 20  ? -34.792  38.240  -79.809  1.00 29.08  ? 20   ARG C C     1 
ATOM   7432  O  O     . ARG C  1 20  ? -34.285  38.942  -80.678  1.00 41.02  ? 20   ARG C O     1 
ATOM   7433  C  CB    . ARG C  1 20  ? -34.781  35.788  -80.184  1.00 19.28  ? 20   ARG C CB    1 
ATOM   7434  C  CG    . ARG C  1 20  ? -35.594  34.549  -80.271  1.00 27.39  ? 20   ARG C CG    1 
ATOM   7435  C  CD    . ARG C  1 20  ? -34.782  33.318  -80.047  1.00 14.40  ? 20   ARG C CD    1 
ATOM   7436  N  NE    . ARG C  1 20  ? -35.662  32.180  -80.229  1.00 22.85  ? 20   ARG C NE    1 
ATOM   7437  C  CZ    . ARG C  1 20  ? -35.274  30.918  -80.250  1.00 23.69  ? 20   ARG C CZ    1 
ATOM   7438  N  NH1   . ARG C  1 20  ? -36.182  29.970  -80.439  1.00 23.91  ? 20   ARG C NH1   1 
ATOM   7439  N  NH2   . ARG C  1 20  ? -33.996  30.603  -80.062  1.00 28.19  ? 20   ARG C NH2   1 
ATOM   7440  N  N     . PHE C  1 21  ? -34.622  38.441  -78.507  1.00 31.80  ? 21   PHE C N     1 
ATOM   7441  C  CA    . PHE C  1 21  ? -33.798  39.507  -77.974  1.00 32.37  ? 21   PHE C CA    1 
ATOM   7442  C  C     . PHE C  1 21  ? -33.385  39.143  -76.551  1.00 34.14  ? 21   PHE C C     1 
ATOM   7443  O  O     . PHE C  1 21  ? -33.867  38.159  -76.002  1.00 33.65  ? 21   PHE C O     1 
ATOM   7444  C  CB    . PHE C  1 21  ? -34.524  40.848  -78.025  1.00 29.71  ? 21   PHE C CB    1 
ATOM   7445  C  CG    . PHE C  1 21  ? -35.758  40.907  -77.183  1.00 25.22  ? 21   PHE C CG    1 
ATOM   7446  C  CD1   . PHE C  1 21  ? -35.704  41.405  -75.885  1.00 40.70  ? 21   PHE C CD1   1 
ATOM   7447  C  CD2   . PHE C  1 21  ? -36.986  40.514  -77.702  1.00 34.13  ? 21   PHE C CD2   1 
ATOM   7448  C  CE1   . PHE C  1 21  ? -36.860  41.520  -75.115  1.00 26.60  ? 21   PHE C CE1   1 
ATOM   7449  C  CE2   . PHE C  1 21  ? -38.153  40.624  -76.941  1.00 31.88  ? 21   PHE C CE2   1 
ATOM   7450  C  CZ    . PHE C  1 21  ? -38.090  41.129  -75.647  1.00 24.57  ? 21   PHE C CZ    1 
ATOM   7451  N  N     . THR C  1 22  ? -32.492  39.939  -75.969  1.00 32.80  ? 22   THR C N     1 
ATOM   7452  C  CA    . THR C  1 22  ? -31.975  39.697  -74.628  1.00 26.92  ? 22   THR C CA    1 
ATOM   7453  C  C     . THR C  1 22  ? -32.325  40.795  -73.627  1.00 31.11  ? 22   THR C C     1 
ATOM   7454  O  O     . THR C  1 22  ? -32.205  41.977  -73.937  1.00 39.13  ? 22   THR C O     1 
ATOM   7455  C  CB    . THR C  1 22  ? -30.454  39.556  -74.698  1.00 22.60  ? 22   THR C CB    1 
ATOM   7456  O  OG1   . THR C  1 22  ? -30.130  38.432  -75.524  1.00 29.18  ? 22   THR C OG1   1 
ATOM   7457  C  CG2   . THR C  1 22  ? -29.856  39.380  -73.316  1.00 25.72  ? 22   THR C CG2   1 
ATOM   7458  N  N     . ASP C  1 23  ? -32.761  40.407  -72.429  1.00 30.62  ? 23   ASP C N     1 
ATOM   7459  C  CA    . ASP C  1 23  ? -33.112  41.391  -71.399  1.00 19.64  ? 23   ASP C CA    1 
ATOM   7460  C  C     . ASP C  1 23  ? -31.866  41.895  -70.673  1.00 33.48  ? 23   ASP C C     1 
ATOM   7461  O  O     . ASP C  1 23  ? -30.753  41.438  -70.961  1.00 27.81  ? 23   ASP C O     1 
ATOM   7462  C  CB    . ASP C  1 23  ? -34.160  40.836  -70.412  1.00 27.79  ? 23   ASP C CB    1 
ATOM   7463  C  CG    . ASP C  1 23  ? -33.596  39.815  -69.415  1.00 38.28  ? 23   ASP C CG    1 
ATOM   7464  O  OD1   . ASP C  1 23  ? -32.424  39.383  -69.519  1.00 44.20  ? 23   ASP C OD1   1 
ATOM   7465  O  OD2   . ASP C  1 23  ? -34.360  39.433  -68.501  1.00 59.84  ? 23   ASP C OD2   1 
ATOM   7466  N  N     . THR C  1 24  ? -32.042  42.807  -69.720  1.00 34.54  ? 24   THR C N     1 
ATOM   7467  C  CA    . THR C  1 24  ? -30.887  43.347  -69.011  1.00 29.73  ? 24   THR C CA    1 
ATOM   7468  C  C     . THR C  1 24  ? -30.051  42.282  -68.295  1.00 42.44  ? 24   THR C C     1 
ATOM   7469  O  O     . THR C  1 24  ? -28.818  42.295  -68.391  1.00 45.48  ? 24   THR C O     1 
ATOM   7470  C  CB    . THR C  1 24  ? -31.288  44.499  -68.059  1.00 30.89  ? 24   THR C CB    1 
ATOM   7471  O  OG1   . THR C  1 24  ? -31.651  45.645  -68.836  1.00 36.51  ? 24   THR C OG1   1 
ATOM   7472  C  CG2   . THR C  1 24  ? -30.129  44.894  -67.154  1.00 39.91  ? 24   THR C CG2   1 
ATOM   7473  N  N     . LYS C  1 25  ? -30.712  41.332  -67.631  1.00 46.41  ? 25   LYS C N     1 
ATOM   7474  C  CA    . LYS C  1 25  ? -29.998  40.270  -66.917  1.00 32.14  ? 25   LYS C CA    1 
ATOM   7475  C  C     . LYS C  1 25  ? -29.242  39.309  -67.837  1.00 35.61  ? 25   LYS C C     1 
ATOM   7476  O  O     . LYS C  1 25  ? -28.321  38.623  -67.395  1.00 47.19  ? 25   LYS C O     1 
ATOM   7477  C  CB    . LYS C  1 25  ? -30.942  39.514  -65.985  1.00 28.23  ? 25   LYS C CB    1 
ATOM   7478  C  CG    . LYS C  1 25  ? -31.417  40.351  -64.813  1.00 29.00  ? 25   LYS C CG    1 
ATOM   7479  C  CD    . LYS C  1 25  ? -32.325  39.574  -63.897  1.00 27.28  ? 25   LYS C CD    1 
ATOM   7480  C  CE    . LYS C  1 25  ? -32.922  40.465  -62.839  1.00 43.24  ? 25   LYS C CE    1 
ATOM   7481  N  NZ    . LYS C  1 25  ? -34.052  39.773  -62.153  1.00 40.98  ? 25   LYS C NZ    1 
ATOM   7482  N  N     . GLY C  1 26  ? -29.631  39.268  -69.113  1.00 34.55  ? 26   GLY C N     1 
ATOM   7483  C  CA    . GLY C  1 26  ? -28.946  38.427  -70.085  1.00 19.41  ? 26   GLY C CA    1 
ATOM   7484  C  C     . GLY C  1 26  ? -29.685  37.208  -70.596  1.00 35.20  ? 26   GLY C C     1 
ATOM   7485  O  O     . GLY C  1 26  ? -29.103  36.359  -71.293  1.00 36.21  ? 26   GLY C O     1 
ATOM   7486  N  N     . LYS C  1 27  ? -30.970  37.136  -70.255  1.00 28.86  ? 27   LYS C N     1 
ATOM   7487  C  CA    . LYS C  1 27  ? -31.813  36.021  -70.643  1.00 30.37  ? 27   LYS C CA    1 
ATOM   7488  C  C     . LYS C  1 27  ? -32.496  36.291  -71.974  1.00 25.53  ? 27   LYS C C     1 
ATOM   7489  O  O     . LYS C  1 27  ? -33.145  37.318  -72.151  1.00 37.83  ? 27   LYS C O     1 
ATOM   7490  C  CB    . LYS C  1 27  ? -32.860  35.752  -69.551  1.00 17.79  ? 27   LYS C CB    1 
ATOM   7491  C  CG    . LYS C  1 27  ? -33.644  34.450  -69.726  1.00 34.79  ? 27   LYS C CG    1 
ATOM   7492  C  CD    . LYS C  1 27  ? -32.788  33.230  -69.405  1.00 43.27  ? 27   LYS C CD    1 
ATOM   7493  C  CE    . LYS C  1 27  ? -33.351  31.974  -70.045  1.00 34.47  ? 27   LYS C CE    1 
ATOM   7494  N  NZ    . LYS C  1 27  ? -32.467  30.779  -69.883  1.00 35.77  ? 27   LYS C NZ    1 
ATOM   7495  N  N     . GLU C  1 28  ? -32.341  35.360  -72.910  1.00 23.25  ? 28   GLU C N     1 
ATOM   7496  C  CA    . GLU C  1 28  ? -32.955  35.485  -74.228  1.00 20.64  ? 28   GLU C CA    1 
ATOM   7497  C  C     . GLU C  1 28  ? -34.489  35.445  -74.093  1.00 36.27  ? 28   GLU C C     1 
ATOM   7498  O  O     . GLU C  1 28  ? -35.044  34.633  -73.345  1.00 40.93  ? 28   GLU C O     1 
ATOM   7499  C  CB    . GLU C  1 28  ? -32.471  34.342  -75.102  1.00 23.87  ? 28   GLU C CB    1 
ATOM   7500  C  CG    . GLU C  1 28  ? -32.524  34.550  -76.605  1.00 11.97  ? 28   GLU C CG    1 
ATOM   7501  C  CD    . GLU C  1 28  ? -31.939  33.351  -77.328  1.00 37.40  ? 28   GLU C CD    1 
ATOM   7502  O  OE1   . GLU C  1 28  ? -32.021  33.305  -78.572  1.00 46.78  ? 28   GLU C OE1   1 
ATOM   7503  O  OE2   . GLU C  1 28  ? -31.409  32.434  -76.640  1.00 59.28  ? 28   GLU C OE2   1 
ATOM   7504  N  N     . GLN C  1 29  ? -35.162  36.353  -74.795  1.00 31.67  ? 29   GLN C N     1 
ATOM   7505  C  CA    . GLN C  1 29  ? -36.621  36.437  -74.768  1.00 24.75  ? 29   GLN C CA    1 
ATOM   7506  C  C     . GLN C  1 29  ? -37.167  36.203  -76.167  1.00 30.50  ? 29   GLN C C     1 
ATOM   7507  O  O     . GLN C  1 29  ? -36.422  36.253  -77.150  1.00 36.59  ? 29   GLN C O     1 
ATOM   7508  C  CB    . GLN C  1 29  ? -37.062  37.816  -74.307  1.00 15.36  ? 29   GLN C CB    1 
ATOM   7509  C  CG    . GLN C  1 29  ? -36.298  38.335  -73.123  1.00 36.23  ? 29   GLN C CG    1 
ATOM   7510  C  CD    . GLN C  1 29  ? -36.721  37.681  -71.836  1.00 29.62  ? 29   GLN C CD    1 
ATOM   7511  O  OE1   . GLN C  1 29  ? -37.908  37.631  -71.516  1.00 33.70  ? 29   GLN C OE1   1 
ATOM   7512  N  NE2   . GLN C  1 29  ? -35.753  37.188  -71.081  1.00 42.60  ? 29   GLN C NE2   1 
ATOM   7513  N  N     . HIS C  1 30  ? -38.471  35.970  -76.267  1.00 18.45  ? 30   HIS C N     1 
ATOM   7514  C  CA    . HIS C  1 30  ? -39.048  35.747  -77.577  1.00 23.64  ? 30   HIS C CA    1 
ATOM   7515  C  C     . HIS C  1 30  ? -40.541  35.940  -77.677  1.00 21.12  ? 30   HIS C C     1 
ATOM   7516  O  O     . HIS C  1 30  ? -41.270  35.901  -76.694  1.00 32.73  ? 30   HIS C O     1 
ATOM   7517  C  CB    . HIS C  1 30  ? -38.681  34.350  -78.103  1.00 24.12  ? 30   HIS C CB    1 
ATOM   7518  C  CG    . HIS C  1 30  ? -39.573  33.254  -77.601  1.00 31.13  ? 30   HIS C CG    1 
ATOM   7519  N  ND1   . HIS C  1 30  ? -39.863  33.081  -76.267  1.00 36.22  ? 30   HIS C ND1   1 
ATOM   7520  C  CD2   . HIS C  1 30  ? -40.247  32.283  -78.261  1.00 18.59  ? 30   HIS C CD2   1 
ATOM   7521  C  CE1   . HIS C  1 30  ? -40.678  32.051  -76.127  1.00 23.77  ? 30   HIS C CE1   1 
ATOM   7522  N  NE2   . HIS C  1 30  ? -40.929  31.552  -77.322  1.00 26.02  ? 30   HIS C NE2   1 
ATOM   7523  N  N     . VAL C  1 31  ? -40.966  36.185  -78.904  1.00 30.80  ? 31   VAL C N     1 
ATOM   7524  C  CA    . VAL C  1 31  ? -42.368  36.339  -79.242  1.00 32.51  ? 31   VAL C CA    1 
ATOM   7525  C  C     . VAL C  1 31  ? -42.457  35.800  -80.673  1.00 31.57  ? 31   VAL C C     1 
ATOM   7526  O  O     . VAL C  1 31  ? -41.533  35.981  -81.476  1.00 29.18  ? 31   VAL C O     1 
ATOM   7527  C  CB    . VAL C  1 31  ? -42.841  37.788  -79.133  1.00 27.59  ? 31   VAL C CB    1 
ATOM   7528  C  CG1   . VAL C  1 31  ? -41.970  38.689  -79.972  1.00 46.69  ? 31   VAL C CG1   1 
ATOM   7529  C  CG2   . VAL C  1 31  ? -44.283  37.887  -79.577  1.00 37.26  ? 31   VAL C CG2   1 
ATOM   7530  N  N     . THR C  1 32  ? -43.523  35.059  -80.948  1.00 23.36  ? 32   THR C N     1 
ATOM   7531  C  CA    . THR C  1 32  ? -43.720  34.426  -82.238  1.00 22.51  ? 32   THR C CA    1 
ATOM   7532  C  C     . THR C  1 32  ? -44.803  35.082  -83.069  1.00 26.62  ? 32   THR C C     1 
ATOM   7533  O  O     . THR C  1 32  ? -45.906  35.378  -82.602  1.00 26.30  ? 32   THR C O     1 
ATOM   7534  C  CB    . THR C  1 32  ? -44.018  32.942  -82.042  1.00 27.40  ? 32   THR C CB    1 
ATOM   7535  O  OG1   . THR C  1 32  ? -43.006  32.380  -81.205  1.00 27.63  ? 32   THR C OG1   1 
ATOM   7536  C  CG2   . THR C  1 32  ? -44.030  32.207  -83.364  1.00 22.16  ? 32   THR C CG2   1 
ATOM   7537  N  N     . ILE C  1 33  ? -44.476  35.203  -84.345  1.00 30.18  ? 33   ILE C N     1 
ATOM   7538  C  CA    . ILE C  1 33  ? -45.300  35.829  -85.362  1.00 20.67  ? 33   ILE C CA    1 
ATOM   7539  C  C     . ILE C  1 33  ? -45.429  34.821  -86.511  1.00 22.53  ? 33   ILE C C     1 
ATOM   7540  O  O     . ILE C  1 33  ? -44.499  34.053  -86.781  1.00 34.53  ? 33   ILE C O     1 
ATOM   7541  C  CB    . ILE C  1 33  ? -44.631  37.181  -85.780  1.00 32.66  ? 33   ILE C CB    1 
ATOM   7542  C  CG1   . ILE C  1 33  ? -45.522  38.335  -85.354  1.00 45.17  ? 33   ILE C CG1   1 
ATOM   7543  C  CG2   . ILE C  1 33  ? -44.189  37.318  -87.231  1.00 23.22  ? 33   ILE C CG2   1 
ATOM   7544  C  CD1   . ILE C  1 33  ? -45.531  38.519  -83.903  1.00 91.60  ? 33   ILE C CD1   1 
ATOM   7545  N  N     . PRO C  1 34  ? -46.631  34.676  -87.069  1.00 22.90  ? 34   PRO C N     1 
ATOM   7546  C  CA    . PRO C  1 34  ? -46.882  33.747  -88.184  1.00 22.42  ? 34   PRO C CA    1 
ATOM   7547  C  C     . PRO C  1 34  ? -46.007  34.192  -89.354  1.00 36.38  ? 34   PRO C C     1 
ATOM   7548  O  O     . PRO C  1 34  ? -45.752  35.384  -89.484  1.00 29.83  ? 34   PRO C O     1 
ATOM   7549  C  CB    . PRO C  1 34  ? -48.362  33.995  -88.508  1.00 6.41   ? 34   PRO C CB    1 
ATOM   7550  C  CG    . PRO C  1 34  ? -48.940  34.452  -87.177  1.00 22.94  ? 34   PRO C CG    1 
ATOM   7551  C  CD    . PRO C  1 34  ? -47.861  35.361  -86.643  1.00 26.13  ? 34   PRO C CD    1 
ATOM   7552  N  N     . ALA C  1 35  ? -45.569  33.271  -90.214  1.00 35.07  ? 35   ALA C N     1 
ATOM   7553  C  CA    . ALA C  1 35  ? -44.715  33.662  -91.340  1.00 28.55  ? 35   ALA C CA    1 
ATOM   7554  C  C     . ALA C  1 35  ? -45.371  34.709  -92.236  1.00 35.34  ? 35   ALA C C     1 
ATOM   7555  O  O     . ALA C  1 35  ? -44.702  35.632  -92.701  1.00 36.34  ? 35   ALA C O     1 
ATOM   7556  C  CB    . ALA C  1 35  ? -44.285  32.450  -92.160  1.00 25.77  ? 35   ALA C CB    1 
ATOM   7557  N  N     . HIS C  1 36  ? -46.688  34.612  -92.424  1.00 35.91  ? 36   HIS C N     1 
ATOM   7558  C  CA    . HIS C  1 36  ? -47.405  35.572  -93.270  1.00 28.59  ? 36   HIS C CA    1 
ATOM   7559  C  C     . HIS C  1 36  ? -47.398  37.033  -92.816  1.00 33.01  ? 36   HIS C C     1 
ATOM   7560  O  O     . HIS C  1 36  ? -47.832  37.914  -93.553  1.00 52.83  ? 36   HIS C O     1 
ATOM   7561  C  CB    . HIS C  1 36  ? -48.845  35.119  -93.527  1.00 23.72  ? 36   HIS C CB    1 
ATOM   7562  C  CG    . HIS C  1 36  ? -49.710  35.083  -92.305  1.00 33.89  ? 36   HIS C CG    1 
ATOM   7563  N  ND1   . HIS C  1 36  ? -50.053  36.217  -91.600  1.00 42.74  ? 36   HIS C ND1   1 
ATOM   7564  C  CD2   . HIS C  1 36  ? -50.362  34.057  -91.707  1.00 25.70  ? 36   HIS C CD2   1 
ATOM   7565  C  CE1   . HIS C  1 36  ? -50.885  35.893  -90.625  1.00 38.92  ? 36   HIS C CE1   1 
ATOM   7566  N  NE2   . HIS C  1 36  ? -51.089  34.584  -90.670  1.00 30.08  ? 36   HIS C NE2   1 
ATOM   7567  N  N     . GLN C  1 37  ? -46.923  37.286  -91.603  1.00 37.79  ? 37   GLN C N     1 
ATOM   7568  C  CA    . GLN C  1 37  ? -46.859  38.645  -91.069  1.00 36.34  ? 37   GLN C CA    1 
ATOM   7569  C  C     . GLN C  1 37  ? -45.548  39.335  -91.455  1.00 39.09  ? 37   GLN C C     1 
ATOM   7570  O  O     . GLN C  1 37  ? -45.338  40.516  -91.147  1.00 45.61  ? 37   GLN C O     1 
ATOM   7571  C  CB    . GLN C  1 37  ? -46.992  38.624  -89.551  1.00 21.37  ? 37   GLN C CB    1 
ATOM   7572  C  CG    . GLN C  1 37  ? -48.326  38.196  -89.047  1.00 32.72  ? 37   GLN C CG    1 
ATOM   7573  C  CD    . GLN C  1 37  ? -49.408  39.154  -89.445  1.00 40.33  ? 37   GLN C CD    1 
ATOM   7574  O  OE1   . GLN C  1 37  ? -50.177  38.878  -90.356  1.00 43.92  ? 37   GLN C OE1   1 
ATOM   7575  N  NE2   . GLN C  1 37  ? -49.481  40.293  -88.760  1.00 54.64  ? 37   GLN C NE2   1 
ATOM   7576  N  N     . VAL C  1 38  ? -44.649  38.578  -92.076  1.00 37.91  ? 38   VAL C N     1 
ATOM   7577  C  CA    . VAL C  1 38  ? -43.367  39.112  -92.520  1.00 43.28  ? 38   VAL C CA    1 
ATOM   7578  C  C     . VAL C  1 38  ? -43.545  39.738  -93.900  1.00 49.63  ? 38   VAL C C     1 
ATOM   7579  O  O     . VAL C  1 38  ? -44.041  39.094  -94.825  1.00 54.34  ? 38   VAL C O     1 
ATOM   7580  C  CB    . VAL C  1 38  ? -42.304  38.013  -92.600  1.00 44.43  ? 38   VAL C CB    1 
ATOM   7581  C  CG1   . VAL C  1 38  ? -41.018  38.569  -93.174  1.00 48.39  ? 38   VAL C CG1   1 
ATOM   7582  C  CG2   . VAL C  1 38  ? -42.056  37.446  -91.226  1.00 40.83  ? 38   VAL C CG2   1 
ATOM   7583  N  N     . ASN C  1 39  ? -43.124  40.992  -94.026  1.00 55.20  ? 39   ASN C N     1 
ATOM   7584  C  CA    . ASN C  1 39  ? -43.251  41.723  -95.276  1.00 60.48  ? 39   ASN C CA    1 
ATOM   7585  C  C     . ASN C  1 39  ? -42.211  42.824  -95.387  1.00 65.72  ? 39   ASN C C     1 
ATOM   7586  O  O     . ASN C  1 39  ? -41.347  42.971  -94.514  1.00 65.57  ? 39   ASN C O     1 
ATOM   7587  C  CB    . ASN C  1 39  ? -44.646  42.334  -95.369  1.00 53.57  ? 39   ASN C CB    1 
ATOM   7588  C  CG    . ASN C  1 39  ? -45.001  43.138  -94.142  1.00 56.40  ? 39   ASN C CG    1 
ATOM   7589  O  OD1   . ASN C  1 39  ? -44.145  43.778  -93.529  1.00 62.74  ? 39   ASN C OD1   1 
ATOM   7590  N  ND2   . ASN C  1 39  ? -46.265  43.093  -93.757  1.00 64.98  ? 39   ASN C ND2   1 
ATOM   7591  N  N     . ALA C  1 40  ? -42.328  43.601  -96.462  1.00 77.57  ? 40   ALA C N     1 
ATOM   7592  C  CA    . ALA C  1 40  ? -41.436  44.714  -96.753  1.00 74.38  ? 40   ALA C CA    1 
ATOM   7593  C  C     . ALA C  1 40  ? -41.379  45.618  -95.527  1.00 75.94  ? 40   ALA C C     1 
ATOM   7594  O  O     . ALA C  1 40  ? -40.308  45.850  -94.948  1.00 64.60  ? 40   ALA C O     1 
ATOM   7595  C  CB    . ALA C  1 40  ? -41.974  45.486  -97.945  1.00 83.53  ? 40   ALA C CB    1 
ATOM   7596  N  N     . GLU C  1 41  ? -42.567  46.076  -95.140  1.00 68.04  ? 41   GLU C N     1 
ATOM   7597  C  CA    . GLU C  1 41  ? -42.810  46.947  -93.989  1.00 82.38  ? 41   GLU C CA    1 
ATOM   7598  C  C     . GLU C  1 41  ? -41.997  46.553  -92.742  1.00 81.14  ? 41   GLU C C     1 
ATOM   7599  O  O     . GLU C  1 41  ? -41.170  47.317  -92.225  1.00 79.47  ? 41   GLU C O     1 
ATOM   7600  C  CB    . GLU C  1 41  ? -44.314  46.870  -93.683  1.00 91.32  ? 41   GLU C CB    1 
ATOM   7601  C  CG    . GLU C  1 41  ? -44.745  47.398  -92.319  1.00 100.00 ? 41   GLU C CG    1 
ATOM   7602  C  CD    . GLU C  1 41  ? -45.268  48.827  -92.374  1.00 100.00 ? 41   GLU C CD    1 
ATOM   7603  O  OE1   . GLU C  1 41  ? -45.041  49.523  -93.395  1.00 100.00 ? 41   GLU C OE1   1 
ATOM   7604  O  OE2   . GLU C  1 41  ? -45.911  49.252  -91.387  1.00 100.00 ? 41   GLU C OE2   1 
ATOM   7605  N  N     . PHE C  1 42  ? -42.290  45.347  -92.272  1.00 74.57  ? 42   PHE C N     1 
ATOM   7606  C  CA    . PHE C  1 42  ? -41.678  44.717  -91.116  1.00 62.17  ? 42   PHE C CA    1 
ATOM   7607  C  C     . PHE C  1 42  ? -40.159  44.925  -90.972  1.00 58.13  ? 42   PHE C C     1 
ATOM   7608  O  O     . PHE C  1 42  ? -39.667  45.219  -89.881  1.00 59.69  ? 42   PHE C O     1 
ATOM   7609  C  CB    . PHE C  1 42  ? -42.038  43.227  -91.190  1.00 63.78  ? 42   PHE C CB    1 
ATOM   7610  C  CG    . PHE C  1 42  ? -41.287  42.353  -90.234  1.00 59.35  ? 42   PHE C CG    1 
ATOM   7611  C  CD1   . PHE C  1 42  ? -40.427  41.375  -90.717  1.00 51.75  ? 42   PHE C CD1   1 
ATOM   7612  C  CD2   . PHE C  1 42  ? -41.443  42.490  -88.857  1.00 74.03  ? 42   PHE C CD2   1 
ATOM   7613  C  CE1   . PHE C  1 42  ? -39.728  40.540  -89.850  1.00 39.50  ? 42   PHE C CE1   1 
ATOM   7614  C  CE2   . PHE C  1 42  ? -40.747  41.658  -87.979  1.00 69.89  ? 42   PHE C CE2   1 
ATOM   7615  C  CZ    . PHE C  1 42  ? -39.888  40.679  -88.481  1.00 50.16  ? 42   PHE C CZ    1 
ATOM   7616  N  N     . PHE C  1 43  ? -39.422  44.794  -92.068  1.00 48.45  ? 43   PHE C N     1 
ATOM   7617  C  CA    . PHE C  1 43  ? -37.970  44.957  -92.026  1.00 51.93  ? 43   PHE C CA    1 
ATOM   7618  C  C     . PHE C  1 43  ? -37.413  46.348  -91.865  1.00 66.23  ? 43   PHE C C     1 
ATOM   7619  O  O     . PHE C  1 43  ? -36.295  46.520  -91.346  1.00 59.98  ? 43   PHE C O     1 
ATOM   7620  C  CB    . PHE C  1 43  ? -37.347  44.336  -93.256  1.00 49.45  ? 43   PHE C CB    1 
ATOM   7621  C  CG    . PHE C  1 43  ? -37.090  42.898  -93.105  1.00 61.30  ? 43   PHE C CG    1 
ATOM   7622  C  CD1   . PHE C  1 43  ? -37.899  41.959  -93.749  1.00 57.91  ? 43   PHE C CD1   1 
ATOM   7623  C  CD2   . PHE C  1 43  ? -36.066  42.464  -92.261  1.00 61.39  ? 43   PHE C CD2   1 
ATOM   7624  C  CE1   . PHE C  1 43  ? -37.692  40.591  -93.552  1.00 55.75  ? 43   PHE C CE1   1 
ATOM   7625  C  CE2   . PHE C  1 43  ? -35.845  41.101  -92.052  1.00 54.51  ? 43   PHE C CE2   1 
ATOM   7626  C  CZ    . PHE C  1 43  ? -36.661  40.160  -92.698  1.00 53.42  ? 43   PHE C CZ    1 
ATOM   7627  N  N     . GLU C  1 44  ? -38.162  47.325  -92.381  1.00 74.09  ? 44   GLU C N     1 
ATOM   7628  C  CA    . GLU C  1 44  ? -37.763  48.721  -92.341  1.00 73.42  ? 44   GLU C CA    1 
ATOM   7629  C  C     . GLU C  1 44  ? -38.222  49.446  -91.095  1.00 64.44  ? 44   GLU C C     1 
ATOM   7630  O  O     . GLU C  1 44  ? -37.575  50.410  -90.672  1.00 72.75  ? 44   GLU C O     1 
ATOM   7631  C  CB    . GLU C  1 44  ? -38.235  49.451  -93.600  1.00 86.95  ? 44   GLU C CB    1 
ATOM   7632  C  CG    . GLU C  1 44  ? -37.424  49.111  -94.858  1.00 90.85  ? 44   GLU C CG    1 
ATOM   7633  C  CD    . GLU C  1 44  ? -38.309  48.843  -96.075  1.00 100.00 ? 44   GLU C CD    1 
ATOM   7634  O  OE1   . GLU C  1 44  ? -37.890  48.041  -96.943  1.00 100.00 ? 44   GLU C OE1   1 
ATOM   7635  O  OE2   . GLU C  1 44  ? -39.423  49.419  -96.160  1.00 99.74  ? 44   GLU C OE2   1 
ATOM   7636  N  N     . GLU C  1 45  ? -39.326  48.999  -90.498  1.00 46.08  ? 45   GLU C N     1 
ATOM   7637  C  CA    . GLU C  1 45  ? -39.777  49.652  -89.271  1.00 68.83  ? 45   GLU C CA    1 
ATOM   7638  C  C     . GLU C  1 45  ? -40.153  48.743  -88.099  1.00 71.87  ? 45   GLU C C     1 
ATOM   7639  O  O     . GLU C  1 45  ? -40.610  49.222  -87.053  1.00 69.14  ? 45   GLU C O     1 
ATOM   7640  C  CB    . GLU C  1 45  ? -40.888  50.641  -89.564  1.00 74.67  ? 45   GLU C CB    1 
ATOM   7641  C  CG    . GLU C  1 45  ? -42.012  50.072  -90.364  1.00 88.91  ? 45   GLU C CG    1 
ATOM   7642  C  CD    . GLU C  1 45  ? -42.974  51.154  -90.776  1.00 100.00 ? 45   GLU C CD    1 
ATOM   7643  O  OE1   . GLU C  1 45  ? -42.733  51.796  -91.825  1.00 100.00 ? 45   GLU C OE1   1 
ATOM   7644  O  OE2   . GLU C  1 45  ? -43.953  51.380  -90.032  1.00 100.00 ? 45   GLU C OE2   1 
ATOM   7645  N  N     . GLY C  1 46  ? -39.924  47.434  -88.290  1.00 71.94  ? 46   GLY C N     1 
ATOM   7646  C  CA    . GLY C  1 46  ? -40.195  46.382  -87.308  1.00 57.06  ? 46   GLY C CA    1 
ATOM   7647  C  C     . GLY C  1 46  ? -41.662  46.329  -86.881  1.00 55.72  ? 46   GLY C C     1 
ATOM   7648  O  O     . GLY C  1 46  ? -42.540  46.902  -87.525  1.00 72.51  ? 46   GLY C O     1 
ATOM   7649  N  N     . LYS C  1 47  ? -41.906  45.614  -85.795  1.00 54.83  ? 47   LYS C N     1 
ATOM   7650  C  CA    . LYS C  1 47  ? -43.221  45.441  -85.195  1.00 61.51  ? 47   LYS C CA    1 
ATOM   7651  C  C     . LYS C  1 47  ? -43.063  45.886  -83.723  1.00 57.81  ? 47   LYS C C     1 
ATOM   7652  O  O     . LYS C  1 47  ? -42.012  45.624  -83.161  1.00 63.20  ? 47   LYS C O     1 
ATOM   7653  C  CB    . LYS C  1 47  ? -43.686  43.982  -85.292  1.00 49.16  ? 47   LYS C CB    1 
ATOM   7654  C  CG    . LYS C  1 47  ? -45.000  43.707  -84.595  1.00 93.45  ? 47   LYS C CG    1 
ATOM   7655  C  CD    . LYS C  1 47  ? -44.810  43.018  -83.254  1.00 97.85  ? 47   LYS C CD    1 
ATOM   7656  C  CE    . LYS C  1 47  ? -46.142  42.620  -82.650  1.00 84.37  ? 47   LYS C CE    1 
ATOM   7657  N  NZ    . LYS C  1 47  ? -45.997  42.096  -81.263  1.00 40.01  ? 47   LYS C NZ    1 
ATOM   7658  N  N     . MET C  1 48  ? -44.014  46.526  -83.011  1.00 56.52  ? 48   MET C N     1 
ATOM   7659  C  CA    . MET C  1 48  ? -43.683  46.917  -81.606  1.00 62.21  ? 48   MET C CA    1 
ATOM   7660  C  C     . MET C  1 48  ? -44.423  46.081  -80.508  1.00 57.27  ? 48   MET C C     1 
ATOM   7661  O  O     . MET C  1 48  ? -45.068  45.097  -80.838  1.00 73.04  ? 48   MET C O     1 
ATOM   7662  C  CB    . MET C  1 48  ? -43.975  48.405  -81.375  1.00 73.05  ? 48   MET C CB    1 
ATOM   7663  C  CG    . MET C  1 48  ? -44.923  49.081  -82.358  1.00 71.58  ? 48   MET C CG    1 
ATOM   7664  S  SD    . MET C  1 48  ? -45.053  50.862  -82.090  1.00 100.00 ? 48   MET C SD    1 
ATOM   7665  C  CE    . MET C  1 48  ? -43.551  51.430  -82.894  1.00 86.71  ? 48   MET C CE    1 
ATOM   7666  N  N     . PHE C  1 49  ? -44.414  46.446  -79.205  1.00 74.83  ? 49   PHE C N     1 
ATOM   7667  C  CA    . PHE C  1 49  ? -45.038  45.715  -78.071  1.00 86.74  ? 49   PHE C CA    1 
ATOM   7668  C  C     . PHE C  1 49  ? -45.800  46.533  -76.999  0.39 86.69  ? 49   PHE C C     1 
ATOM   7669  O  O     . PHE C  1 49  ? -46.044  47.722  -77.197  0.39 100.00 ? 49   PHE C O     1 
ATOM   7670  C  CB    . PHE C  1 49  ? -44.024  44.853  -77.289  1.00 74.73  ? 49   PHE C CB    1 
ATOM   7671  C  CG    . PHE C  1 49  ? -42.516  45.213  -77.221  1.00 88.14  ? 49   PHE C CG    1 
ATOM   7672  C  CD1   . PHE C  1 49  ? -41.734  44.546  -76.299  1.00 90.31  ? 49   PHE C CD1   1 
ATOM   7673  C  CD2   . PHE C  1 49  ? -41.889  46.144  -78.057  1.00 92.95  ? 49   PHE C CD2   1 
ATOM   7674  C  CE1   . PHE C  1 49  ? -40.382  44.741  -76.205  1.00 39.75  ? 49   PHE C CE1   1 
ATOM   7675  C  CE2   . PHE C  1 49  ? -40.510  46.346  -77.963  1.00 92.81  ? 49   PHE C CE2   1 
ATOM   7676  C  CZ    . PHE C  1 49  ? -39.773  45.636  -77.035  1.00 51.70  ? 49   PHE C CZ    1 
ATOM   7677  N  N     . ASP C  1 50  ? -46.187  45.874  -75.871  0.39 81.07  ? 50   ASP C N     1 
ATOM   7678  C  CA    . ASP C  1 50  ? -46.856  46.356  -74.609  0.39 68.41  ? 50   ASP C CA    1 
ATOM   7679  C  C     . ASP C  1 50  ? -45.848  46.087  -73.475  0.39 50.11  ? 50   ASP C C     1 
ATOM   7680  O  O     . ASP C  1 50  ? -46.140  45.682  -72.348  0.39 41.71  ? 50   ASP C O     1 
ATOM   7681  C  CB    . ASP C  1 50  ? -48.250  45.777  -74.424  0.39 74.88  ? 50   ASP C CB    1 
ATOM   7682  C  CG    . ASP C  1 50  ? -48.357  44.415  -73.654  0.39 78.97  ? 50   ASP C CG    1 
ATOM   7683  O  OD1   . ASP C  1 50  ? -48.488  44.427  -72.425  0.39 81.17  ? 50   ASP C OD1   1 
ATOM   7684  O  OD2   . ASP C  1 50  ? -48.290  43.356  -74.329  0.39 76.71  ? 50   ASP C OD2   1 
ATOM   7685  N  N     . GLY C  1 51  ? -44.631  46.377  -73.903  0.39 28.93  ? 51   GLY C N     1 
ATOM   7686  C  CA    . GLY C  1 51  ? -43.346  46.274  -73.235  0.39 18.90  ? 51   GLY C CA    1 
ATOM   7687  C  C     . GLY C  1 51  ? -43.344  46.600  -71.738  0.39 42.89  ? 51   GLY C C     1 
ATOM   7688  O  O     . GLY C  1 51  ? -42.720  45.884  -70.943  0.39 31.40  ? 51   GLY C O     1 
ATOM   7689  N  N     . SER C  1 52  ? -44.026  47.650  -71.346  0.39 46.69  ? 52   SER C N     1 
ATOM   7690  C  CA    . SER C  1 52  ? -44.078  47.958  -69.930  0.39 39.57  ? 52   SER C CA    1 
ATOM   7691  C  C     . SER C  1 52  ? -44.062  46.647  -69.142  0.39 41.83  ? 52   SER C C     1 
ATOM   7692  O  O     . SER C  1 52  ? -44.027  46.633  -67.908  0.39 37.60  ? 52   SER C O     1 
ATOM   7693  C  CB    . SER C  1 52  ? -45.343  48.730  -69.578  0.39 51.87  ? 52   SER C CB    1 
ATOM   7694  O  OG    . SER C  1 52  ? -46.370  47.857  -69.154  0.39 64.57  ? 52   SER C OG    1 
ATOM   7695  N  N     . SER C  1 53  ? -44.089  45.544  -69.882  0.39 55.25  ? 53   SER C N     1 
ATOM   7696  C  CA    . SER C  1 53  ? -44.129  44.263  -69.214  0.39 53.12  ? 53   SER C CA    1 
ATOM   7697  C  C     . SER C  1 53  ? -42.741  43.643  -68.936  0.39 53.04  ? 53   SER C C     1 
ATOM   7698  O  O     . SER C  1 53  ? -42.668  42.572  -68.321  0.39 37.25  ? 53   SER C O     1 
ATOM   7699  C  CB    . SER C  1 53  ? -45.024  43.320  -70.012  0.39 64.19  ? 53   SER C CB    1 
ATOM   7700  O  OG    . SER C  1 53  ? -46.343  43.826  -70.121  0.39 55.60  ? 53   SER C OG    1 
ATOM   7701  N  N     . ILE C  1 54  ? -41.624  44.273  -69.365  1.00 75.73  ? 54   ILE C N     1 
ATOM   7702  C  CA    . ILE C  1 54  ? -40.269  43.681  -69.094  1.00 78.50  ? 54   ILE C CA    1 
ATOM   7703  C  C     . ILE C  1 54  ? -39.581  44.359  -67.858  1.00 83.95  ? 54   ILE C C     1 
ATOM   7704  O  O     . ILE C  1 54  ? -40.011  45.437  -67.440  1.00 100.00 ? 54   ILE C O     1 
ATOM   7705  C  CB    . ILE C  1 54  ? -39.379  43.759  -70.374  1.00 77.35  ? 54   ILE C CB    1 
ATOM   7706  C  CG1   . ILE C  1 54  ? -40.108  43.163  -71.596  1.00 98.29  ? 54   ILE C CG1   1 
ATOM   7707  C  CG2   . ILE C  1 54  ? -38.046  43.049  -70.140  1.00 34.45  ? 54   ILE C CG2   1 
ATOM   7708  C  CD1   . ILE C  1 54  ? -40.039  41.657  -71.672  1.00 99.88  ? 54   ILE C CD1   1 
ATOM   7709  N  N     . GLY C  1 55  ? -38.512  43.758  -67.291  1.00 38.24  ? 55   GLY C N     1 
ATOM   7710  C  CA    . GLY C  1 55  ? -37.717  44.167  -66.103  1.00 45.04  ? 55   GLY C CA    1 
ATOM   7711  C  C     . GLY C  1 55  ? -36.453  45.041  -66.376  1.00 54.16  ? 55   GLY C C     1 
ATOM   7712  O  O     . GLY C  1 55  ? -35.608  44.705  -67.197  1.00 58.55  ? 55   GLY C O     1 
ATOM   7713  N  N     . GLY C  1 56  ? -36.350  46.162  -65.649  1.00 53.15  ? 56   GLY C N     1 
ATOM   7714  C  CA    . GLY C  1 56  ? -35.306  47.157  -65.832  1.00 58.81  ? 56   GLY C CA    1 
ATOM   7715  C  C     . GLY C  1 56  ? -35.526  48.040  -67.045  1.00 61.90  ? 56   GLY C C     1 
ATOM   7716  O  O     . GLY C  1 56  ? -34.685  48.878  -67.382  1.00 62.17  ? 56   GLY C O     1 
ATOM   7717  N  N     . TRP C  1 57  ? -36.638  47.806  -67.733  1.00 61.19  ? 57   TRP C N     1 
ATOM   7718  C  CA    . TRP C  1 57  ? -37.014  48.570  -68.919  1.00 64.78  ? 57   TRP C CA    1 
ATOM   7719  C  C     . TRP C  1 57  ? -38.331  49.268  -68.599  1.00 76.78  ? 57   TRP C C     1 
ATOM   7720  O  O     . TRP C  1 57  ? -38.853  50.077  -69.387  1.00 88.48  ? 57   TRP C O     1 
ATOM   7721  C  CB    . TRP C  1 57  ? -37.227  47.636  -70.111  1.00 48.51  ? 57   TRP C CB    1 
ATOM   7722  C  CG    . TRP C  1 57  ? -35.987  46.936  -70.587  1.00 41.24  ? 57   TRP C CG    1 
ATOM   7723  C  CD1   . TRP C  1 57  ? -34.755  46.937  -69.994  1.00 46.59  ? 57   TRP C CD1   1 
ATOM   7724  C  CD2   . TRP C  1 57  ? -35.859  46.140  -71.774  1.00 43.34  ? 57   TRP C CD2   1 
ATOM   7725  N  NE1   . TRP C  1 57  ? -33.868  46.194  -70.739  1.00 46.66  ? 57   TRP C NE1   1 
ATOM   7726  C  CE2   . TRP C  1 57  ? -34.518  45.697  -71.836  1.00 44.32  ? 57   TRP C CE2   1 
ATOM   7727  C  CE3   . TRP C  1 57  ? -36.746  45.759  -72.788  1.00 44.07  ? 57   TRP C CE3   1 
ATOM   7728  C  CZ2   . TRP C  1 57  ? -34.044  44.892  -72.881  1.00 43.65  ? 57   TRP C CZ2   1 
ATOM   7729  C  CZ3   . TRP C  1 57  ? -36.274  44.957  -73.826  1.00 43.11  ? 57   TRP C CZ3   1 
ATOM   7730  C  CH2   . TRP C  1 57  ? -34.934  44.534  -73.864  1.00 30.35  ? 57   TRP C CH2   1 
ATOM   7731  N  N     . LYS C  1 58  ? -38.890  48.937  -67.424  0.72 96.46  ? 58   LYS C N     1 
ATOM   7732  C  CA    . LYS C  1 58  ? -40.199  49.417  -66.984  0.72 93.07  ? 58   LYS C CA    1 
ATOM   7733  C  C     . LYS C  1 58  ? -40.313  50.869  -66.546  0.72 94.91  ? 58   LYS C C     1 
ATOM   7734  O  O     . LYS C  1 58  ? -39.919  51.246  -65.447  0.72 88.79  ? 58   LYS C O     1 
ATOM   7735  C  CB    . LYS C  1 58  ? -40.723  48.569  -65.843  0.72 84.44  ? 58   LYS C CB    1 
ATOM   7736  C  CG    . LYS C  1 58  ? -41.835  49.248  -65.055  0.72 88.12  ? 58   LYS C CG    1 
ATOM   7737  C  CD    . LYS C  1 58  ? -42.349  48.350  -63.953  0.72 93.37  ? 58   LYS C CD    1 
ATOM   7738  C  CE    . LYS C  1 58  ? -43.341  49.060  -63.053  0.72 93.27  ? 58   LYS C CE    1 
ATOM   7739  N  NZ    . LYS C  1 58  ? -44.617  49.358  -63.758  0.72 100.00 ? 58   LYS C NZ    1 
ATOM   7740  N  N     . GLY C  1 59  ? -40.843  51.661  -67.451  0.72 89.58  ? 59   GLY C N     1 
ATOM   7741  C  CA    . GLY C  1 59  ? -41.157  53.051  -67.192  0.72 92.74  ? 59   GLY C CA    1 
ATOM   7742  C  C     . GLY C  1 59  ? -42.656  53.127  -67.091  0.72 98.82  ? 59   GLY C C     1 
ATOM   7743  O  O     . GLY C  1 59  ? -43.355  52.662  -67.992  0.72 96.45  ? 59   GLY C O     1 
ATOM   7744  N  N     . ILE C  1 60  ? -43.177  53.691  -66.012  0.72 98.63  ? 60   ILE C N     1 
ATOM   7745  C  CA    . ILE C  1 60  ? -44.611  53.753  -65.846  0.72 100.00 ? 60   ILE C CA    1 
ATOM   7746  C  C     . ILE C  1 60  ? -45.398  54.385  -66.994  0.72 93.34  ? 60   ILE C C     1 
ATOM   7747  O  O     . ILE C  1 60  ? -46.403  53.828  -67.426  0.72 93.61  ? 60   ILE C O     1 
ATOM   7748  C  CB    . ILE C  1 60  ? -44.943  54.312  -64.444  0.72 98.85  ? 60   ILE C CB    1 
ATOM   7749  C  CG1   . ILE C  1 60  ? -45.428  53.134  -63.581  0.72 100.00 ? 60   ILE C CG1   1 
ATOM   7750  C  CG2   . ILE C  1 60  ? -46.032  55.399  -64.492  0.72 96.54  ? 60   ILE C CG2   1 
ATOM   7751  C  CD1   . ILE C  1 60  ? -45.774  51.900  -64.375  0.72 100.00 ? 60   ILE C CD1   1 
ATOM   7752  N  N     . ASN C  1 61  ? -44.960  55.551  -67.460  0.72 81.49  ? 61   ASN C N     1 
ATOM   7753  C  CA    . ASN C  1 61  ? -45.623  56.226  -68.587  0.72 87.22  ? 61   ASN C CA    1 
ATOM   7754  C  C     . ASN C  1 61  ? -45.247  55.576  -69.932  0.72 90.99  ? 61   ASN C C     1 
ATOM   7755  O  O     . ASN C  1 61  ? -45.954  54.686  -70.422  0.72 77.29  ? 61   ASN C O     1 
ATOM   7756  C  CB    . ASN C  1 61  ? -45.230  57.709  -68.614  0.72 87.62  ? 61   ASN C CB    1 
ATOM   7757  C  CG    . ASN C  1 61  ? -46.089  58.577  -67.711  0.72 91.82  ? 61   ASN C CG    1 
ATOM   7758  O  OD1   . ASN C  1 61  ? -45.902  59.796  -67.645  0.72 88.47  ? 61   ASN C OD1   1 
ATOM   7759  N  ND2   . ASN C  1 61  ? -47.048  57.969  -67.027  0.72 100.00 ? 61   ASN C ND2   1 
ATOM   7760  N  N     . GLU C  1 62  ? -44.112  56.026  -70.491  0.72 96.34  ? 62   GLU C N     1 
ATOM   7761  C  CA    . GLU C  1 62  ? -43.543  55.584  -71.781  0.72 100.00 ? 62   GLU C CA    1 
ATOM   7762  C  C     . GLU C  1 62  ? -43.196  54.094  -71.973  0.72 100.00 ? 62   GLU C C     1 
ATOM   7763  O  O     . GLU C  1 62  ? -42.027  53.729  -72.201  0.72 100.00 ? 62   GLU C O     1 
ATOM   7764  C  CB    . GLU C  1 62  ? -42.297  56.442  -72.125  0.72 100.00 ? 62   GLU C CB    1 
ATOM   7765  C  CG    . GLU C  1 62  ? -41.280  56.867  -71.029  0.72 100.00 ? 62   GLU C CG    1 
ATOM   7766  C  CD    . GLU C  1 62  ? -41.204  55.978  -69.768  0.72 100.00 ? 62   GLU C CD    1 
ATOM   7767  O  OE1   . GLU C  1 62  ? -41.798  56.374  -68.737  0.72 100.00 ? 62   GLU C OE1   1 
ATOM   7768  O  OE2   . GLU C  1 62  ? -40.523  54.918  -69.785  0.72 100.00 ? 62   GLU C OE2   1 
ATOM   7769  N  N     . SER C  1 63  ? -44.222  53.261  -71.983  0.72 94.20  ? 63   SER C N     1 
ATOM   7770  C  CA    . SER C  1 63  ? -44.029  51.812  -72.087  0.72 94.85  ? 63   SER C CA    1 
ATOM   7771  C  C     . SER C  1 63  ? -43.797  51.194  -73.463  0.72 90.33  ? 63   SER C C     1 
ATOM   7772  O  O     . SER C  1 63  ? -43.405  50.038  -73.556  0.72 93.72  ? 63   SER C O     1 
ATOM   7773  C  CB    . SER C  1 63  ? -45.171  51.083  -71.360  0.72 91.94  ? 63   SER C CB    1 
ATOM   7774  O  OG    . SER C  1 63  ? -45.999  51.993  -70.635  0.72 92.15  ? 63   SER C OG    1 
ATOM   7775  N  N     . ASP C  1 64  ? -43.991  51.953  -74.543  0.72 74.19  ? 64   ASP C N     1 
ATOM   7776  C  CA    . ASP C  1 64  ? -43.842  51.356  -75.872  0.72 62.56  ? 64   ASP C CA    1 
ATOM   7777  C  C     . ASP C  1 64  ? -42.553  51.517  -76.659  0.72 59.40  ? 64   ASP C C     1 
ATOM   7778  O  O     . ASP C  1 64  ? -42.126  52.640  -76.942  0.72 48.35  ? 64   ASP C O     1 
ATOM   7779  C  CB    . ASP C  1 64  ? -45.038  51.718  -76.729  0.72 59.45  ? 64   ASP C CB    1 
ATOM   7780  C  CG    . ASP C  1 64  ? -46.146  50.686  -76.625  0.72 69.42  ? 64   ASP C CG    1 
ATOM   7781  O  OD1   . ASP C  1 64  ? -46.702  50.519  -75.506  0.72 59.28  ? 64   ASP C OD1   1 
ATOM   7782  O  OD2   . ASP C  1 64  ? -46.434  50.035  -77.639  0.72 66.23  ? 64   ASP C OD2   1 
ATOM   7783  N  N     . MET C  1 65  ? -41.981  50.365  -77.066  1.00 68.43  ? 65   MET C N     1 
ATOM   7784  C  CA    . MET C  1 65  ? -40.731  50.258  -77.835  1.00 67.01  ? 65   MET C CA    1 
ATOM   7785  C  C     . MET C  1 65  ? -40.888  49.420  -79.126  1.00 66.51  ? 65   MET C C     1 
ATOM   7786  O  O     . MET C  1 65  ? -41.862  48.682  -79.277  1.00 70.47  ? 65   MET C O     1 
ATOM   7787  C  CB    . MET C  1 65  ? -39.622  49.640  -76.964  1.00 71.42  ? 65   MET C CB    1 
ATOM   7788  C  CG    . MET C  1 65  ? -38.421  50.551  -76.657  1.00 70.08  ? 65   MET C CG    1 
ATOM   7789  S  SD    . MET C  1 65  ? -38.646  51.697  -75.280  1.00 93.66  ? 65   MET C SD    1 
ATOM   7790  C  CE    . MET C  1 65  ? -38.865  50.535  -73.930  1.00 92.12  ? 65   MET C CE    1 
ATOM   7791  N  N     . VAL C  1 66  ? -39.887  49.493  -80.011  1.00 57.88  ? 66   VAL C N     1 
ATOM   7792  C  CA    . VAL C  1 66  ? -39.884  48.788  -81.312  1.00 51.96  ? 66   VAL C CA    1 
ATOM   7793  C  C     . VAL C  1 66  ? -38.899  47.614  -81.473  1.00 57.09  ? 66   VAL C C     1 
ATOM   7794  O  O     . VAL C  1 66  ? -37.703  47.739  -81.186  1.00 53.53  ? 66   VAL C O     1 
ATOM   7795  C  CB    . VAL C  1 66  ? -39.551  49.779  -82.457  1.00 49.86  ? 66   VAL C CB    1 
ATOM   7796  C  CG1   . VAL C  1 66  ? -39.560  49.076  -83.813  1.00 39.35  ? 66   VAL C CG1   1 
ATOM   7797  C  CG2   . VAL C  1 66  ? -40.522  50.931  -82.449  1.00 71.33  ? 66   VAL C CG2   1 
ATOM   7798  N  N     . LEU C  1 67  ? -39.397  46.499  -81.998  1.00 50.80  ? 67   LEU C N     1 
ATOM   7799  C  CA    . LEU C  1 67  ? -38.558  45.326  -82.259  1.00 40.95  ? 67   LEU C CA    1 
ATOM   7800  C  C     . LEU C  1 67  ? -38.021  45.395  -83.693  1.00 46.70  ? 67   LEU C C     1 
ATOM   7801  O  O     . LEU C  1 67  ? -38.781  45.219  -84.656  1.00 42.99  ? 67   LEU C O     1 
ATOM   7802  C  CB    . LEU C  1 67  ? -39.370  44.045  -82.109  1.00 43.05  ? 67   LEU C CB    1 
ATOM   7803  C  CG    . LEU C  1 67  ? -39.409  43.358  -80.754  1.00 49.19  ? 67   LEU C CG    1 
ATOM   7804  C  CD1   . LEU C  1 67  ? -40.449  42.281  -80.809  1.00 26.04  ? 67   LEU C CD1   1 
ATOM   7805  C  CD2   . LEU C  1 67  ? -38.059  42.772  -80.420  1.00 33.63  ? 67   LEU C CD2   1 
ATOM   7806  N  N     . MET C  1 68  ? -36.717  45.616  -83.838  1.00 39.32  ? 68   MET C N     1 
ATOM   7807  C  CA    . MET C  1 68  ? -36.121  45.718  -85.164  1.00 34.90  ? 68   MET C CA    1 
ATOM   7808  C  C     . MET C  1 68  ? -35.364  44.477  -85.605  1.00 37.66  ? 68   MET C C     1 
ATOM   7809  O  O     . MET C  1 68  ? -34.202  44.265  -85.230  1.00 51.33  ? 68   MET C O     1 
ATOM   7810  C  CB    . MET C  1 68  ? -35.212  46.950  -85.270  1.00 48.46  ? 68   MET C CB    1 
ATOM   7811  C  CG    . MET C  1 68  ? -34.720  47.250  -86.689  1.00 48.45  ? 68   MET C CG    1 
ATOM   7812  S  SD    . MET C  1 68  ? -36.084  47.454  -87.866  1.00 51.13  ? 68   MET C SD    1 
ATOM   7813  C  CE    . MET C  1 68  ? -36.891  48.885  -87.159  1.00 41.35  ? 68   MET C CE    1 
ATOM   7814  N  N     . PRO C  1 69  ? -35.995  43.675  -86.475  1.00 28.61  ? 69   PRO C N     1 
ATOM   7815  C  CA    . PRO C  1 69  ? -35.377  42.454  -86.980  1.00 32.01  ? 69   PRO C CA    1 
ATOM   7816  C  C     . PRO C  1 69  ? -34.072  42.733  -87.693  1.00 33.26  ? 69   PRO C C     1 
ATOM   7817  O  O     . PRO C  1 69  ? -33.958  43.693  -88.463  1.00 53.98  ? 69   PRO C O     1 
ATOM   7818  C  CB    . PRO C  1 69  ? -36.443  41.896  -87.933  1.00 23.06  ? 69   PRO C CB    1 
ATOM   7819  C  CG    . PRO C  1 69  ? -37.182  43.103  -88.380  1.00 35.29  ? 69   PRO C CG    1 
ATOM   7820  C  CD    . PRO C  1 69  ? -37.320  43.874  -87.086  1.00 35.60  ? 69   PRO C CD    1 
ATOM   7821  N  N     . ASP C  1 70  ? -33.072  41.940  -87.334  1.00 38.15  ? 70   ASP C N     1 
ATOM   7822  C  CA    . ASP C  1 70  ? -31.748  42.010  -87.927  1.00 36.62  ? 70   ASP C CA    1 
ATOM   7823  C  C     . ASP C  1 70  ? -31.718  40.814  -88.887  1.00 31.15  ? 70   ASP C C     1 
ATOM   7824  O  O     . ASP C  1 70  ? -31.450  39.683  -88.485  1.00 35.28  ? 70   ASP C O     1 
ATOM   7825  C  CB    . ASP C  1 70  ? -30.684  41.897  -86.827  1.00 32.33  ? 70   ASP C CB    1 
ATOM   7826  C  CG    . ASP C  1 70  ? -29.263  41.857  -87.372  1.00 44.39  ? 70   ASP C CG    1 
ATOM   7827  O  OD1   . ASP C  1 70  ? -29.050  41.375  -88.506  1.00 39.00  ? 70   ASP C OD1   1 
ATOM   7828  O  OD2   . ASP C  1 70  ? -28.344  42.297  -86.644  1.00 42.92  ? 70   ASP C OD2   1 
ATOM   7829  N  N     . ALA C  1 71  ? -31.973  41.093  -90.162  1.00 38.54  ? 71   ALA C N     1 
ATOM   7830  C  CA    . ALA C  1 71  ? -32.033  40.075  -91.211  1.00 30.21  ? 71   ALA C CA    1 
ATOM   7831  C  C     . ALA C  1 71  ? -30.818  39.189  -91.372  1.00 34.48  ? 71   ALA C C     1 
ATOM   7832  O  O     . ALA C  1 71  ? -30.892  38.136  -92.012  1.00 44.23  ? 71   ALA C O     1 
ATOM   7833  C  CB    . ALA C  1 71  ? -32.366  40.713  -92.523  1.00 31.19  ? 71   ALA C CB    1 
ATOM   7834  N  N     . SER C  1 72  ? -29.697  39.599  -90.798  1.00 32.11  ? 72   SER C N     1 
ATOM   7835  C  CA    . SER C  1 72  ? -28.491  38.794  -90.919  1.00 41.14  ? 72   SER C CA    1 
ATOM   7836  C  C     . SER C  1 72  ? -28.477  37.607  -89.960  1.00 43.96  ? 72   SER C C     1 
ATOM   7837  O  O     . SER C  1 72  ? -27.777  36.624  -90.196  1.00 47.61  ? 72   SER C O     1 
ATOM   7838  C  CB    . SER C  1 72  ? -27.249  39.656  -90.681  1.00 33.69  ? 72   SER C CB    1 
ATOM   7839  O  OG    . SER C  1 72  ? -27.110  39.987  -89.313  1.00 36.72  ? 72   SER C OG    1 
ATOM   7840  N  N     . THR C  1 73  ? -29.281  37.691  -88.899  1.00 41.27  ? 73   THR C N     1 
ATOM   7841  C  CA    . THR C  1 73  ? -29.328  36.655  -87.872  1.00 32.28  ? 73   THR C CA    1 
ATOM   7842  C  C     . THR C  1 73  ? -30.268  35.479  -88.109  1.00 30.61  ? 73   THR C C     1 
ATOM   7843  O  O     . THR C  1 73  ? -30.294  34.541  -87.304  1.00 48.14  ? 73   THR C O     1 
ATOM   7844  C  CB    . THR C  1 73  ? -29.692  37.265  -86.515  1.00 29.27  ? 73   THR C CB    1 
ATOM   7845  O  OG1   . THR C  1 73  ? -31.004  37.825  -86.587  1.00 39.41  ? 73   THR C OG1   1 
ATOM   7846  C  CG2   . THR C  1 73  ? -28.719  38.354  -86.140  1.00 30.73  ? 73   THR C CG2   1 
ATOM   7847  N  N     . ALA C  1 74  ? -30.976  35.490  -89.235  1.00 33.12  ? 74   ALA C N     1 
ATOM   7848  C  CA    . ALA C  1 74  ? -31.952  34.444  -89.545  1.00 32.99  ? 74   ALA C CA    1 
ATOM   7849  C  C     . ALA C  1 74  ? -31.439  33.020  -89.510  1.00 41.73  ? 74   ALA C C     1 
ATOM   7850  O  O     . ALA C  1 74  ? -30.486  32.665  -90.207  1.00 49.22  ? 74   ALA C O     1 
ATOM   7851  C  CB    . ALA C  1 74  ? -32.645  34.718  -90.870  1.00 36.40  ? 74   ALA C CB    1 
ATOM   7852  N  N     . VAL C  1 75  ? -32.100  32.210  -88.689  1.00 44.83  ? 75   VAL C N     1 
ATOM   7853  C  CA    . VAL C  1 75  ? -31.753  30.808  -88.534  1.00 37.83  ? 75   VAL C CA    1 
ATOM   7854  C  C     . VAL C  1 75  ? -32.958  29.983  -88.074  1.00 36.70  ? 75   VAL C C     1 
ATOM   7855  O  O     . VAL C  1 75  ? -33.805  30.454  -87.309  1.00 38.75  ? 75   VAL C O     1 
ATOM   7856  C  CB    . VAL C  1 75  ? -30.535  30.630  -87.597  1.00 16.29  ? 75   VAL C CB    1 
ATOM   7857  C  CG1   . VAL C  1 75  ? -30.776  31.284  -86.237  1.00 37.98  ? 75   VAL C CG1   1 
ATOM   7858  C  CG2   . VAL C  1 75  ? -30.172  29.172  -87.481  1.00 51.81  ? 75   VAL C CG2   1 
ATOM   7859  N  N     . ILE C  1 76  ? -33.058  28.775  -88.623  1.00 32.12  ? 76   ILE C N     1 
ATOM   7860  C  CA    . ILE C  1 76  ? -34.140  27.845  -88.332  1.00 34.57  ? 76   ILE C CA    1 
ATOM   7861  C  C     . ILE C  1 76  ? -34.005  27.262  -86.936  1.00 34.81  ? 76   ILE C C     1 
ATOM   7862  O  O     . ILE C  1 76  ? -32.896  26.907  -86.528  1.00 37.18  ? 76   ILE C O     1 
ATOM   7863  C  CB    . ILE C  1 76  ? -34.119  26.675  -89.351  1.00 26.77  ? 76   ILE C CB    1 
ATOM   7864  C  CG1   . ILE C  1 76  ? -34.514  27.175  -90.735  1.00 28.25  ? 76   ILE C CG1   1 
ATOM   7865  C  CG2   . ILE C  1 76  ? -35.077  25.574  -88.932  1.00 20.03  ? 76   ILE C CG2   1 
ATOM   7866  C  CD1   . ILE C  1 76  ? -35.980  27.581  -90.835  1.00 25.92  ? 76   ILE C CD1   1 
ATOM   7867  N  N     . ASP C  1 77  ? -35.125  27.154  -86.217  1.00 30.42  ? 77   ASP C N     1 
ATOM   7868  C  CA    . ASP C  1 77  ? -35.105  26.564  -84.882  1.00 26.27  ? 77   ASP C CA    1 
ATOM   7869  C  C     . ASP C  1 77  ? -35.133  25.054  -85.078  1.00 24.00  ? 77   ASP C C     1 
ATOM   7870  O  O     . ASP C  1 77  ? -36.027  24.515  -85.738  1.00 34.67  ? 77   ASP C O     1 
ATOM   7871  C  CB    . ASP C  1 77  ? -36.297  27.004  -84.042  1.00 21.65  ? 77   ASP C CB    1 
ATOM   7872  C  CG    . ASP C  1 77  ? -36.166  26.573  -82.592  1.00 26.72  ? 77   ASP C CG    1 
ATOM   7873  O  OD1   . ASP C  1 77  ? -35.831  27.428  -81.760  1.00 30.34  ? 77   ASP C OD1   1 
ATOM   7874  O  OD2   . ASP C  1 77  ? -36.378  25.385  -82.281  1.00 33.52  ? 77   ASP C OD2   1 
ATOM   7875  N  N     . PRO C  1 78  ? -34.151  24.349  -84.498  1.00 22.75  ? 78   PRO C N     1 
ATOM   7876  C  CA    . PRO C  1 78  ? -34.029  22.890  -84.608  1.00 19.29  ? 78   PRO C CA    1 
ATOM   7877  C  C     . PRO C  1 78  ? -34.826  22.059  -83.625  1.00 26.74  ? 78   PRO C C     1 
ATOM   7878  O  O     . PRO C  1 78  ? -34.746  20.836  -83.651  1.00 39.44  ? 78   PRO C O     1 
ATOM   7879  C  CB    . PRO C  1 78  ? -32.530  22.674  -84.420  1.00 18.55  ? 78   PRO C CB    1 
ATOM   7880  C  CG    . PRO C  1 78  ? -32.157  23.726  -83.418  1.00 15.61  ? 78   PRO C CG    1 
ATOM   7881  C  CD    . PRO C  1 78  ? -33.013  24.936  -83.759  1.00 22.58  ? 78   PRO C CD    1 
ATOM   7882  N  N     . PHE C  1 79  ? -35.616  22.721  -82.786  1.00 30.98  ? 79   PHE C N     1 
ATOM   7883  C  CA    . PHE C  1 79  ? -36.398  22.038  -81.764  1.00 20.82  ? 79   PHE C CA    1 
ATOM   7884  C  C     . PHE C  1 79  ? -37.897  22.118  -81.964  1.00 23.51  ? 79   PHE C C     1 
ATOM   7885  O  O     . PHE C  1 79  ? -38.608  21.133  -81.773  1.00 39.21  ? 79   PHE C O     1 
ATOM   7886  C  CB    . PHE C  1 79  ? -36.050  22.602  -80.393  1.00 12.02  ? 79   PHE C CB    1 
ATOM   7887  C  CG    . PHE C  1 79  ? -34.585  22.562  -80.086  1.00 18.37  ? 79   PHE C CG    1 
ATOM   7888  C  CD1   . PHE C  1 79  ? -33.921  21.346  -79.963  1.00 21.57  ? 79   PHE C CD1   1 
ATOM   7889  C  CD2   . PHE C  1 79  ? -33.863  23.736  -79.948  1.00 26.19  ? 79   PHE C CD2   1 
ATOM   7890  C  CE1   . PHE C  1 79  ? -32.559  21.298  -79.715  1.00 18.05  ? 79   PHE C CE1   1 
ATOM   7891  C  CE2   . PHE C  1 79  ? -32.494  23.701  -79.699  1.00 14.56  ? 79   PHE C CE2   1 
ATOM   7892  C  CZ    . PHE C  1 79  ? -31.842  22.480  -79.581  1.00 20.35  ? 79   PHE C CZ    1 
ATOM   7893  N  N     . PHE C  1 80  ? -38.373  23.310  -82.297  1.00 20.51  ? 80   PHE C N     1 
ATOM   7894  C  CA    . PHE C  1 80  ? -39.794  23.548  -82.516  1.00 17.47  ? 80   PHE C CA    1 
ATOM   7895  C  C     . PHE C  1 80  ? -40.391  22.538  -83.518  1.00 21.07  ? 80   PHE C C     1 
ATOM   7896  O  O     . PHE C  1 80  ? -39.722  22.111  -84.463  1.00 36.96  ? 80   PHE C O     1 
ATOM   7897  C  CB    . PHE C  1 80  ? -39.992  25.002  -82.969  1.00 5.66   ? 80   PHE C CB    1 
ATOM   7898  C  CG    . PHE C  1 80  ? -39.627  26.040  -81.912  1.00 23.99  ? 80   PHE C CG    1 
ATOM   7899  C  CD1   . PHE C  1 80  ? -39.536  27.385  -82.241  1.00 27.38  ? 80   PHE C CD1   1 
ATOM   7900  C  CD2   . PHE C  1 80  ? -39.372  25.671  -80.599  1.00 37.38  ? 80   PHE C CD2   1 
ATOM   7901  C  CE1   . PHE C  1 80  ? -39.195  28.339  -81.293  1.00 33.99  ? 80   PHE C CE1   1 
ATOM   7902  C  CE2   . PHE C  1 80  ? -39.026  26.623  -79.644  1.00 37.69  ? 80   PHE C CE2   1 
ATOM   7903  C  CZ    . PHE C  1 80  ? -38.939  27.957  -79.995  1.00 33.97  ? 80   PHE C CZ    1 
ATOM   7904  N  N     . ALA C  1 81  ? -41.636  22.134  -83.284  1.00 17.66  ? 81   ALA C N     1 
ATOM   7905  C  CA    . ALA C  1 81  ? -42.301  21.143  -84.138  1.00 19.68  ? 81   ALA C CA    1 
ATOM   7906  C  C     . ALA C  1 81  ? -42.759  21.625  -85.507  1.00 27.32  ? 81   ALA C C     1 
ATOM   7907  O  O     . ALA C  1 81  ? -42.869  20.826  -86.440  1.00 33.70  ? 81   ALA C O     1 
ATOM   7908  C  CB    . ALA C  1 81  ? -43.465  20.552  -83.403  1.00 11.19  ? 81   ALA C CB    1 
ATOM   7909  N  N     . ASP C  1 82  ? -43.110  22.893  -85.588  1.00 16.79  ? 82   ASP C N     1 
ATOM   7910  C  CA    . ASP C  1 82  ? -43.569  23.527  -86.819  1.00 26.07  ? 82   ASP C CA    1 
ATOM   7911  C  C     . ASP C  1 82  ? -42.407  24.352  -87.323  1.00 32.01  ? 82   ASP C C     1 
ATOM   7912  O  O     . ASP C  1 82  ? -41.776  25.025  -86.535  1.00 22.71  ? 82   ASP C O     1 
ATOM   7913  C  CB    . ASP C  1 82  ? -44.745  24.448  -86.513  1.00 22.09  ? 82   ASP C CB    1 
ATOM   7914  C  CG    . ASP C  1 82  ? -45.836  23.747  -85.743  1.00 35.94  ? 82   ASP C CG    1 
ATOM   7915  O  OD1   . ASP C  1 82  ? -46.610  22.968  -86.354  1.00 26.27  ? 82   ASP C OD1   1 
ATOM   7916  O  OD2   . ASP C  1 82  ? -45.893  23.965  -84.519  1.00 29.36  ? 82   ASP C OD2   1 
ATOM   7917  N  N     . SER C  1 83  ? -42.143  24.314  -88.625  1.00 36.61  ? 83   SER C N     1 
ATOM   7918  C  CA    . SER C  1 83  ? -41.024  25.065  -89.180  1.00 25.78  ? 83   SER C CA    1 
ATOM   7919  C  C     . SER C  1 83  ? -41.062  26.532  -88.784  1.00 34.30  ? 83   SER C C     1 
ATOM   7920  O  O     . SER C  1 83  ? -41.997  27.267  -89.115  1.00 41.21  ? 83   SER C O     1 
ATOM   7921  C  CB    . SER C  1 83  ? -40.969  24.937  -90.697  1.00 23.58  ? 83   SER C CB    1 
ATOM   7922  O  OG    . SER C  1 83  ? -39.641  25.184  -91.119  1.00 39.26  ? 83   SER C OG    1 
ATOM   7923  N  N     . THR C  1 84  ? -40.059  26.938  -88.021  1.00 25.08  ? 84   THR C N     1 
ATOM   7924  C  CA    . THR C  1 84  ? -40.003  28.309  -87.577  1.00 28.59  ? 84   THR C CA    1 
ATOM   7925  C  C     . THR C  1 84  ? -38.593  28.877  -87.695  1.00 26.08  ? 84   THR C C     1 
ATOM   7926  O  O     . THR C  1 84  ? -37.593  28.176  -87.479  1.00 28.22  ? 84   THR C O     1 
ATOM   7927  C  CB    . THR C  1 84  ? -40.642  28.484  -86.152  1.00 28.86  ? 84   THR C CB    1 
ATOM   7928  O  OG1   . THR C  1 84  ? -39.798  29.286  -85.318  1.00 35.27  ? 84   THR C OG1   1 
ATOM   7929  C  CG2   . THR C  1 84  ? -40.814  27.130  -85.459  1.00 21.72  ? 84   THR C CG2   1 
ATOM   7930  N  N     . LEU C  1 85  ? -38.545  30.125  -88.149  1.00 22.19  ? 85   LEU C N     1 
ATOM   7931  C  CA    . LEU C  1 85  ? -37.307  30.852  -88.366  1.00 26.88  ? 85   LEU C CA    1 
ATOM   7932  C  C     . LEU C  1 85  ? -37.092  31.883  -87.276  1.00 28.72  ? 85   LEU C C     1 
ATOM   7933  O  O     . LEU C  1 85  ? -37.961  32.713  -87.003  1.00 33.27  ? 85   LEU C O     1 
ATOM   7934  C  CB    . LEU C  1 85  ? -37.360  31.532  -89.741  1.00 31.57  ? 85   LEU C CB    1 
ATOM   7935  C  CG    . LEU C  1 85  ? -36.127  32.277  -90.255  1.00 25.33  ? 85   LEU C CG    1 
ATOM   7936  C  CD1   . LEU C  1 85  ? -35.068  31.302  -90.709  1.00 29.57  ? 85   LEU C CD1   1 
ATOM   7937  C  CD2   . LEU C  1 85  ? -36.530  33.155  -91.411  1.00 22.40  ? 85   LEU C CD2   1 
ATOM   7938  N  N     . ILE C  1 86  ? -35.928  31.811  -86.649  1.00 25.77  ? 86   ILE C N     1 
ATOM   7939  C  CA    . ILE C  1 86  ? -35.566  32.727  -85.576  1.00 27.59  ? 86   ILE C CA    1 
ATOM   7940  C  C     . ILE C  1 86  ? -34.900  33.949  -86.181  1.00 30.04  ? 86   ILE C C     1 
ATOM   7941  O  O     . ILE C  1 86  ? -34.082  33.822  -87.081  1.00 34.35  ? 86   ILE C O     1 
ATOM   7942  C  CB    . ILE C  1 86  ? -34.518  32.080  -84.621  1.00 25.68  ? 86   ILE C CB    1 
ATOM   7943  C  CG1   . ILE C  1 86  ? -35.057  30.786  -84.027  1.00 25.93  ? 86   ILE C CG1   1 
ATOM   7944  C  CG2   . ILE C  1 86  ? -34.120  33.054  -83.500  1.00 18.64  ? 86   ILE C CG2   1 
ATOM   7945  C  CD1   . ILE C  1 86  ? -33.970  29.893  -83.490  1.00 18.59  ? 86   ILE C CD1   1 
ATOM   7946  N  N     . ILE C  1 87  ? -35.257  35.126  -85.685  1.00 33.39  ? 87   ILE C N     1 
ATOM   7947  C  CA    . ILE C  1 87  ? -34.639  36.366  -86.128  1.00 23.04  ? 87   ILE C CA    1 
ATOM   7948  C  C     . ILE C  1 87  ? -34.389  37.222  -84.891  1.00 31.15  ? 87   ILE C C     1 
ATOM   7949  O  O     . ILE C  1 87  ? -35.318  37.574  -84.164  1.00 35.32  ? 87   ILE C O     1 
ATOM   7950  C  CB    . ILE C  1 87  ? -35.498  37.139  -87.136  1.00 27.46  ? 87   ILE C CB    1 
ATOM   7951  C  CG1   . ILE C  1 87  ? -35.702  36.310  -88.399  1.00 25.36  ? 87   ILE C CG1   1 
ATOM   7952  C  CG2   . ILE C  1 87  ? -34.789  38.420  -87.554  1.00 37.52  ? 87   ILE C CG2   1 
ATOM   7953  C  CD1   . ILE C  1 87  ? -36.638  36.960  -89.377  1.00 34.24  ? 87   ILE C CD1   1 
ATOM   7954  N  N     . ARG C  1 88  ? -33.110  37.462  -84.615  1.00 34.33  ? 88   ARG C N     1 
ATOM   7955  C  CA    . ARG C  1 88  ? -32.669  38.262  -83.484  1.00 24.66  ? 88   ARG C CA    1 
ATOM   7956  C  C     . ARG C  1 88  ? -33.059  39.704  -83.799  1.00 25.68  ? 88   ARG C C     1 
ATOM   7957  O  O     . ARG C  1 88  ? -33.074  40.112  -84.959  1.00 35.43  ? 88   ARG C O     1 
ATOM   7958  C  CB    . ARG C  1 88  ? -31.158  38.082  -83.331  1.00 24.09  ? 88   ARG C CB    1 
ATOM   7959  C  CG    . ARG C  1 88  ? -30.523  38.701  -82.115  1.00 31.12  ? 88   ARG C CG    1 
ATOM   7960  C  CD    . ARG C  1 88  ? -29.430  37.773  -81.608  1.00 20.21  ? 88   ARG C CD    1 
ATOM   7961  N  NE    . ARG C  1 88  ? -29.971  37.063  -80.467  1.00 31.79  ? 88   ARG C NE    1 
ATOM   7962  C  CZ    . ARG C  1 88  ? -30.159  35.757  -80.394  1.00 36.77  ? 88   ARG C CZ    1 
ATOM   7963  N  NH1   . ARG C  1 88  ? -30.689  35.267  -79.287  1.00 37.68  ? 88   ARG C NH1   1 
ATOM   7964  N  NH2   . ARG C  1 88  ? -29.783  34.942  -81.383  1.00 28.40  ? 88   ARG C NH2   1 
ATOM   7965  N  N     . CYS C  1 89  ? -33.434  40.456  -82.776  1.00 28.74  ? 89   CYS C N     1 
ATOM   7966  C  CA    . CYS C  1 89  ? -33.871  41.831  -82.971  1.00 30.86  ? 89   CYS C CA    1 
ATOM   7967  C  C     . CYS C  1 89  ? -33.129  42.783  -82.078  1.00 36.37  ? 89   CYS C C     1 
ATOM   7968  O  O     . CYS C  1 89  ? -32.465  42.352  -81.136  1.00 41.31  ? 89   CYS C O     1 
ATOM   7969  C  CB    . CYS C  1 89  ? -35.351  41.967  -82.614  1.00 28.08  ? 89   CYS C CB    1 
ATOM   7970  S  SG    . CYS C  1 89  ? -36.480  41.027  -83.627  1.00 35.89  ? 89   CYS C SG    1 
ATOM   7971  N  N     . ASP C  1 90  ? -33.249  44.077  -82.389  1.00 42.70  ? 90   ASP C N     1 
ATOM   7972  C  CA    . ASP C  1 90  ? -32.665  45.159  -81.586  1.00 36.60  ? 90   ASP C CA    1 
ATOM   7973  C  C     . ASP C  1 90  ? -33.893  45.899  -81.072  1.00 37.35  ? 90   ASP C C     1 
ATOM   7974  O  O     . ASP C  1 90  ? -34.951  45.868  -81.709  1.00 36.86  ? 90   ASP C O     1 
ATOM   7975  C  CB    . ASP C  1 90  ? -31.833  46.139  -82.420  1.00 31.12  ? 90   ASP C CB    1 
ATOM   7976  C  CG    . ASP C  1 90  ? -30.626  45.494  -83.056  1.00 49.10  ? 90   ASP C CG    1 
ATOM   7977  O  OD1   . ASP C  1 90  ? -29.689  45.144  -82.312  1.00 32.37  ? 90   ASP C OD1   1 
ATOM   7978  O  OD2   . ASP C  1 90  ? -30.616  45.355  -84.301  1.00 65.40  ? 90   ASP C OD2   1 
ATOM   7979  N  N     . ILE C  1 91  ? -33.775  46.513  -79.905  1.00 34.61  ? 91   ILE C N     1 
ATOM   7980  C  CA    . ILE C  1 91  ? -34.884  47.266  -79.327  1.00 40.85  ? 91   ILE C CA    1 
ATOM   7981  C  C     . ILE C  1 91  ? -34.599  48.733  -79.601  1.00 50.30  ? 91   ILE C C     1 
ATOM   7982  O  O     . ILE C  1 91  ? -33.604  49.275  -79.116  1.00 48.19  ? 91   ILE C O     1 
ATOM   7983  C  CB    . ILE C  1 91  ? -34.982  47.051  -77.802  1.00 48.43  ? 91   ILE C CB    1 
ATOM   7984  C  CG1   . ILE C  1 91  ? -34.914  45.559  -77.467  1.00 35.13  ? 91   ILE C CG1   1 
ATOM   7985  C  CG2   . ILE C  1 91  ? -36.271  47.647  -77.273  1.00 37.81  ? 91   ILE C CG2   1 
ATOM   7986  C  CD1   . ILE C  1 91  ? -35.984  44.722  -78.156  1.00 41.58  ? 91   ILE C CD1   1 
ATOM   7987  N  N     . LEU C  1 92  ? -35.450  49.367  -80.401  1.00 52.40  ? 92   LEU C N     1 
ATOM   7988  C  CA    . LEU C  1 92  ? -35.256  50.771  -80.751  1.00 50.50  ? 92   LEU C CA    1 
ATOM   7989  C  C     . LEU C  1 92  ? -36.361  51.616  -80.157  1.00 55.01  ? 92   LEU C C     1 
ATOM   7990  O  O     . LEU C  1 92  ? -37.459  51.108  -79.913  1.00 52.48  ? 92   LEU C O     1 
ATOM   7991  C  CB    . LEU C  1 92  ? -35.250  50.932  -82.274  1.00 23.94  ? 92   LEU C CB    1 
ATOM   7992  C  CG    . LEU C  1 92  ? -34.372  49.950  -83.057  1.00 42.02  ? 92   LEU C CG    1 
ATOM   7993  C  CD1   . LEU C  1 92  ? -34.605  50.133  -84.547  1.00 37.43  ? 92   LEU C CD1   1 
ATOM   7994  C  CD2   . LEU C  1 92  ? -32.889  50.112  -82.696  1.00 33.46  ? 92   LEU C CD2   1 
ATOM   7995  N  N     . GLU C  1 93  ? -36.063  52.891  -79.897  1.00 66.36  ? 93   GLU C N     1 
ATOM   7996  C  CA    . GLU C  1 93  ? -37.069  53.800  -79.351  1.00 64.68  ? 93   GLU C CA    1 
ATOM   7997  C  C     . GLU C  1 93  ? -37.945  54.200  -80.556  1.00 62.06  ? 93   GLU C C     1 
ATOM   7998  O  O     . GLU C  1 93  ? -37.422  54.432  -81.653  1.00 60.54  ? 93   GLU C O     1 
ATOM   7999  C  CB    . GLU C  1 93  ? -36.403  55.016  -78.691  1.00 64.17  ? 93   GLU C CB    1 
ATOM   8000  C  CG    . GLU C  1 93  ? -37.239  55.644  -77.558  1.00 78.76  ? 93   GLU C CG    1 
ATOM   8001  C  CD    . GLU C  1 93  ? -36.872  55.115  -76.174  1.00 80.99  ? 93   GLU C CD    1 
ATOM   8002  O  OE1   . GLU C  1 93  ? -35.653  55.083  -75.873  1.00 71.39  ? 93   GLU C OE1   1 
ATOM   8003  O  OE2   . GLU C  1 93  ? -37.794  54.757  -75.392  1.00 62.07  ? 93   GLU C OE2   1 
ATOM   8004  N  N     . PRO C  1 94  ? -39.283  54.266  -80.376  1.00 55.48  ? 94   PRO C N     1 
ATOM   8005  C  CA    . PRO C  1 94  ? -40.218  54.622  -81.455  1.00 60.76  ? 94   PRO C CA    1 
ATOM   8006  C  C     . PRO C  1 94  ? -39.978  56.000  -82.059  1.00 73.83  ? 94   PRO C C     1 
ATOM   8007  O  O     . PRO C  1 94  ? -39.608  56.951  -81.351  1.00 75.32  ? 94   PRO C O     1 
ATOM   8008  C  CB    . PRO C  1 94  ? -41.583  54.575  -80.764  1.00 55.58  ? 94   PRO C CB    1 
ATOM   8009  C  CG    . PRO C  1 94  ? -41.360  53.719  -79.570  1.00 57.18  ? 94   PRO C CG    1 
ATOM   8010  C  CD    . PRO C  1 94  ? -40.007  54.161  -79.101  1.00 58.21  ? 94   PRO C CD    1 
ATOM   8011  N  N     . GLY C  1 95  ? -40.230  56.106  -83.361  1.00 68.65  ? 95   GLY C N     1 
ATOM   8012  C  CA    . GLY C  1 95  ? -40.039  57.368  -84.053  1.00 70.14  ? 95   GLY C CA    1 
ATOM   8013  C  C     . GLY C  1 95  ? -38.573  57.599  -84.344  1.00 70.94  ? 95   GLY C C     1 
ATOM   8014  O  O     . GLY C  1 95  ? -38.142  57.532  -85.501  1.00 61.19  ? 95   GLY C O     1 
ATOM   8015  N  N     . THR C  1 96  ? -37.803  57.864  -83.291  1.00 68.16  ? 96   THR C N     1 
ATOM   8016  C  CA    . THR C  1 96  ? -36.367  58.080  -83.433  1.00 68.74  ? 96   THR C CA    1 
ATOM   8017  C  C     . THR C  1 96  ? -35.699  56.859  -84.071  1.00 69.35  ? 96   THR C C     1 
ATOM   8018  O  O     . THR C  1 96  ? -34.867  57.013  -84.970  1.00 54.72  ? 96   THR C O     1 
ATOM   8019  C  CB    . THR C  1 96  ? -35.691  58.433  -82.063  1.00 73.76  ? 96   THR C CB    1 
ATOM   8020  O  OG1   . THR C  1 96  ? -34.306  58.068  -82.083  1.00 76.91  ? 96   THR C OG1   1 
ATOM   8021  C  CG2   . THR C  1 96  ? -36.387  57.744  -80.898  1.00 73.93  ? 96   THR C CG2   1 
ATOM   8022  N  N     . LEU C  1 97  ? -36.136  55.660  -83.663  1.00 66.04  ? 97   LEU C N     1 
ATOM   8023  C  CA    . LEU C  1 97  ? -35.591  54.391  -84.165  1.00 62.52  ? 97   LEU C CA    1 
ATOM   8024  C  C     . LEU C  1 97  ? -34.078  54.355  -83.928  1.00 70.35  ? 97   LEU C C     1 
ATOM   8025  O  O     . LEU C  1 97  ? -33.327  53.706  -84.669  1.00 54.13  ? 97   LEU C O     1 
ATOM   8026  C  CB    . LEU C  1 97  ? -35.899  54.217  -85.660  1.00 46.45  ? 97   LEU C CB    1 
ATOM   8027  C  CG    . LEU C  1 97  ? -37.044  53.286  -86.084  1.00 61.52  ? 97   LEU C CG    1 
ATOM   8028  C  CD1   . LEU C  1 97  ? -38.369  53.687  -85.427  1.00 63.28  ? 97   LEU C CD1   1 
ATOM   8029  C  CD2   . LEU C  1 97  ? -37.160  53.296  -87.612  1.00 60.52  ? 97   LEU C CD2   1 
ATOM   8030  N  N     . GLN C  1 98  ? -33.650  55.011  -82.852  1.00 75.90  ? 98   GLN C N     1 
ATOM   8031  C  CA    . GLN C  1 98  ? -32.237  55.120  -82.539  1.00 83.60  ? 98   GLN C CA    1 
ATOM   8032  C  C     . GLN C  1 98  ? -31.587  53.917  -81.843  1.00 84.35  ? 98   GLN C C     1 
ATOM   8033  O  O     . GLN C  1 98  ? -30.483  53.504  -82.221  1.00 95.96  ? 98   GLN C O     1 
ATOM   8034  C  CB    . GLN C  1 98  ? -31.994  56.439  -81.792  1.00 81.10  ? 98   GLN C CB    1 
ATOM   8035  C  CG    . GLN C  1 98  ? -30.594  56.667  -81.247  1.00 96.25  ? 98   GLN C CG    1 
ATOM   8036  C  CD    . GLN C  1 98  ? -30.569  56.714  -79.711  1.00 100.00 ? 98   GLN C CD    1 
ATOM   8037  O  OE1   . GLN C  1 98  ? -31.594  56.480  -79.046  1.00 100.00 ? 98   GLN C OE1   1 
ATOM   8038  N  NE2   . GLN C  1 98  ? -29.398  57.010  -79.144  1.00 95.94  ? 98   GLN C NE2   1 
ATOM   8039  N  N     . GLY C  1 99  ? -32.267  53.319  -80.870  1.00 52.06  ? 99   GLY C N     1 
ATOM   8040  C  CA    . GLY C  1 99  ? -31.647  52.194  -80.193  1.00 47.94  ? 99   GLY C CA    1 
ATOM   8041  C  C     . GLY C  1 99  ? -31.618  52.431  -78.700  1.00 51.27  ? 99   GLY C C     1 
ATOM   8042  O  O     . GLY C  1 99  ? -30.758  53.141  -78.193  1.00 59.37  ? 99   GLY C O     1 
ATOM   8043  N  N     . TYR C  1 100 ? -32.571  51.812  -78.011  1.00 50.71  ? 100  TYR C N     1 
ATOM   8044  C  CA    . TYR C  1 100 ? -32.774  51.908  -76.564  1.00 31.46  ? 100  TYR C CA    1 
ATOM   8045  C  C     . TYR C  1 100 ? -31.494  51.896  -75.723  1.00 41.07  ? 100  TYR C C     1 
ATOM   8046  O  O     . TYR C  1 100 ? -30.613  51.054  -75.923  1.00 40.46  ? 100  TYR C O     1 
ATOM   8047  C  CB    . TYR C  1 100 ? -33.730  50.785  -76.126  1.00 36.33  ? 100  TYR C CB    1 
ATOM   8048  C  CG    . TYR C  1 100 ? -34.313  50.942  -74.746  1.00 40.02  ? 100  TYR C CG    1 
ATOM   8049  C  CD1   . TYR C  1 100 ? -34.527  52.205  -74.206  1.00 37.82  ? 100  TYR C CD1   1 
ATOM   8050  C  CD2   . TYR C  1 100 ? -34.632  49.830  -73.966  1.00 35.44  ? 100  TYR C CD2   1 
ATOM   8051  C  CE1   . TYR C  1 100 ? -35.042  52.370  -72.923  1.00 63.57  ? 100  TYR C CE1   1 
ATOM   8052  C  CE2   . TYR C  1 100 ? -35.153  49.985  -72.667  1.00 40.50  ? 100  TYR C CE2   1 
ATOM   8053  C  CZ    . TYR C  1 100 ? -35.355  51.263  -72.156  1.00 52.44  ? 100  TYR C CZ    1 
ATOM   8054  O  OH    . TYR C  1 100 ? -35.875  51.464  -70.891  1.00 65.14  ? 100  TYR C OH    1 
ATOM   8055  N  N     . ASP C  1 101 ? -31.395  52.849  -74.797  1.00 41.86  ? 101  ASP C N     1 
ATOM   8056  C  CA    . ASP C  1 101 ? -30.232  52.964  -73.913  1.00 45.87  ? 101  ASP C CA    1 
ATOM   8057  C  C     . ASP C  1 101 ? -30.007  51.711  -73.081  1.00 48.45  ? 101  ASP C C     1 
ATOM   8058  O  O     . ASP C  1 101 ? -28.872  51.361  -72.757  1.00 51.72  ? 101  ASP C O     1 
ATOM   8059  C  CB    . ASP C  1 101 ? -30.402  54.135  -72.946  1.00 61.60  ? 101  ASP C CB    1 
ATOM   8060  C  CG    . ASP C  1 101 ? -30.217  55.476  -73.603  1.00 64.81  ? 101  ASP C CG    1 
ATOM   8061  O  OD1   . ASP C  1 101 ? -30.651  56.467  -72.980  1.00 61.95  ? 101  ASP C OD1   1 
ATOM   8062  O  OD2   . ASP C  1 101 ? -29.616  55.545  -74.701  1.00 52.26  ? 101  ASP C OD2   1 
ATOM   8063  N  N     . ARG C  1 102 ? -31.107  51.085  -72.677  1.00 43.34  ? 102  ARG C N     1 
ATOM   8064  C  CA    . ARG C  1 102 ? -31.061  49.877  -71.868  1.00 37.69  ? 102  ARG C CA    1 
ATOM   8065  C  C     . ARG C  1 102 ? -31.031  48.553  -72.643  1.00 40.47  ? 102  ARG C C     1 
ATOM   8066  O  O     . ARG C  1 102 ? -31.043  47.487  -72.027  1.00 50.44  ? 102  ARG C O     1 
ATOM   8067  C  CB    . ARG C  1 102 ? -32.198  49.890  -70.839  1.00 33.43  ? 102  ARG C CB    1 
ATOM   8068  C  CG    . ARG C  1 102 ? -31.875  50.720  -69.605  1.00 42.07  ? 102  ARG C CG    1 
ATOM   8069  C  CD    . ARG C  1 102 ? -32.825  51.889  -69.392  1.00 50.36  ? 102  ARG C CD    1 
ATOM   8070  N  NE    . ARG C  1 102 ? -33.840  51.617  -68.372  1.00 55.86  ? 102  ARG C NE    1 
ATOM   8071  C  CZ    . ARG C  1 102 ? -34.302  52.520  -67.508  1.00 53.56  ? 102  ARG C CZ    1 
ATOM   8072  N  NH1   . ARG C  1 102 ? -35.232  52.176  -66.625  1.00 56.30  ? 102  ARG C NH1   1 
ATOM   8073  N  NH2   . ARG C  1 102 ? -33.829  53.762  -67.515  1.00 47.56  ? 102  ARG C NH2   1 
ATOM   8074  N  N     . ASP C  1 103 ? -31.000  48.615  -73.978  1.00 41.16  ? 103  ASP C N     1 
ATOM   8075  C  CA    . ASP C  1 103 ? -30.933  47.408  -74.813  1.00 25.95  ? 103  ASP C CA    1 
ATOM   8076  C  C     . ASP C  1 103 ? -29.478  46.938  -74.863  1.00 39.68  ? 103  ASP C C     1 
ATOM   8077  O  O     . ASP C  1 103 ? -28.628  47.568  -75.496  1.00 50.31  ? 103  ASP C O     1 
ATOM   8078  C  CB    . ASP C  1 103 ? -31.465  47.679  -76.228  1.00 28.13  ? 103  ASP C CB    1 
ATOM   8079  C  CG    . ASP C  1 103 ? -31.228  46.510  -77.206  1.00 42.30  ? 103  ASP C CG    1 
ATOM   8080  O  OD1   . ASP C  1 103 ? -30.822  45.411  -76.773  1.00 50.23  ? 103  ASP C OD1   1 
ATOM   8081  O  OD2   . ASP C  1 103 ? -31.440  46.695  -78.430  1.00 39.64  ? 103  ASP C OD2   1 
ATOM   8082  N  N     . PRO C  1 104 ? -29.192  45.784  -74.243  1.00 44.16  ? 104  PRO C N     1 
ATOM   8083  C  CA    . PRO C  1 104 ? -27.853  45.203  -74.188  1.00 33.28  ? 104  PRO C CA    1 
ATOM   8084  C  C     . PRO C  1 104 ? -27.209  45.002  -75.549  1.00 31.12  ? 104  PRO C C     1 
ATOM   8085  O  O     . PRO C  1 104 ? -25.999  45.150  -75.689  1.00 39.86  ? 104  PRO C O     1 
ATOM   8086  C  CB    . PRO C  1 104 ? -28.097  43.861  -73.502  1.00 26.02  ? 104  PRO C CB    1 
ATOM   8087  C  CG    . PRO C  1 104 ? -29.282  44.116  -72.663  1.00 37.84  ? 104  PRO C CG    1 
ATOM   8088  C  CD    . PRO C  1 104 ? -30.161  44.881  -73.601  1.00 38.19  ? 104  PRO C CD    1 
ATOM   8089  N  N     . ARG C  1 105 ? -28.002  44.648  -76.551  1.00 35.46  ? 105  ARG C N     1 
ATOM   8090  C  CA    . ARG C  1 105 ? -27.431  44.424  -77.869  1.00 31.49  ? 105  ARG C CA    1 
ATOM   8091  C  C     . ARG C  1 105 ? -27.028  45.740  -78.494  1.00 43.68  ? 105  ARG C C     1 
ATOM   8092  O  O     . ARG C  1 105 ? -25.972  45.828  -79.123  1.00 42.70  ? 105  ARG C O     1 
ATOM   8093  C  CB    . ARG C  1 105 ? -28.402  43.692  -78.785  1.00 33.46  ? 105  ARG C CB    1 
ATOM   8094  C  CG    . ARG C  1 105 ? -27.714  43.100  -79.996  1.00 29.97  ? 105  ARG C CG    1 
ATOM   8095  C  CD    . ARG C  1 105 ? -28.678  42.322  -80.841  1.00 28.42  ? 105  ARG C CD    1 
ATOM   8096  N  NE    . ARG C  1 105 ? -27.998  41.478  -81.817  1.00 29.94  ? 105  ARG C NE    1 
ATOM   8097  C  CZ    . ARG C  1 105 ? -28.129  41.617  -83.132  1.00 34.06  ? 105  ARG C CZ    1 
ATOM   8098  N  NH1   . ARG C  1 105 ? -27.489  40.798  -83.948  1.00 28.28  ? 105  ARG C NH1   1 
ATOM   8099  N  NH2   . ARG C  1 105 ? -28.881  42.590  -83.634  1.00 30.15  ? 105  ARG C NH2   1 
ATOM   8100  N  N     . SER C  1 106 ? -27.875  46.758  -78.331  1.00 51.58  ? 106  SER C N     1 
ATOM   8101  C  CA    . SER C  1 106 ? -27.579  48.082  -78.870  1.00 46.50  ? 106  SER C CA    1 
ATOM   8102  C  C     . SER C  1 106 ? -26.292  48.602  -78.225  1.00 41.08  ? 106  SER C C     1 
ATOM   8103  O  O     . SER C  1 106 ? -25.402  49.105  -78.916  1.00 46.62  ? 106  SER C O     1 
ATOM   8104  C  CB    . SER C  1 106 ? -28.754  49.036  -78.647  1.00 35.69  ? 106  SER C CB    1 
ATOM   8105  O  OG    . SER C  1 106 ? -29.807  48.759  -79.560  1.00 46.22  ? 106  SER C OG    1 
ATOM   8106  N  N     . ILE C  1 107 ? -26.172  48.396  -76.912  1.00 32.72  ? 107  ILE C N     1 
ATOM   8107  C  CA    . ILE C  1 107 ? -24.988  48.796  -76.151  1.00 31.17  ? 107  ILE C CA    1 
ATOM   8108  C  C     . ILE C  1 107 ? -23.704  48.151  -76.692  1.00 34.00  ? 107  ILE C C     1 
ATOM   8109  O  O     . ILE C  1 107 ? -22.666  48.801  -76.788  1.00 50.40  ? 107  ILE C O     1 
ATOM   8110  C  CB    . ILE C  1 107 ? -25.125  48.415  -74.651  1.00 34.28  ? 107  ILE C CB    1 
ATOM   8111  C  CG1   . ILE C  1 107 ? -26.236  49.231  -73.991  1.00 25.35  ? 107  ILE C CG1   1 
ATOM   8112  C  CG2   . ILE C  1 107 ? -23.794  48.623  -73.908  1.00 18.03  ? 107  ILE C CG2   1 
ATOM   8113  C  CD1   . ILE C  1 107 ? -26.344  48.995  -72.498  1.00 20.61  ? 107  ILE C CD1   1 
ATOM   8114  N  N     . ALA C  1 108 ? -23.773  46.870  -77.035  1.00 32.49  ? 108  ALA C N     1 
ATOM   8115  C  CA    . ALA C  1 108 ? -22.605  46.173  -77.555  1.00 39.70  ? 108  ALA C CA    1 
ATOM   8116  C  C     . ALA C  1 108 ? -22.227  46.728  -78.915  1.00 45.36  ? 108  ALA C C     1 
ATOM   8117  O  O     . ALA C  1 108 ? -21.040  46.850  -79.227  1.00 44.44  ? 108  ALA C O     1 
ATOM   8118  C  CB    . ALA C  1 108 ? -22.867  44.676  -77.649  1.00 39.79  ? 108  ALA C CB    1 
ATOM   8119  N  N     . LYS C  1 109 ? -23.240  47.062  -79.717  1.00 34.70  ? 109  LYS C N     1 
ATOM   8120  C  CA    . LYS C  1 109 ? -23.022  47.622  -81.046  1.00 35.64  ? 109  LYS C CA    1 
ATOM   8121  C  C     . LYS C  1 109 ? -22.365  49.001  -80.930  1.00 44.43  ? 109  LYS C C     1 
ATOM   8122  O  O     . LYS C  1 109 ? -21.411  49.290  -81.656  1.00 40.99  ? 109  LYS C O     1 
ATOM   8123  C  CB    . LYS C  1 109 ? -24.336  47.697  -81.823  1.00 38.89  ? 109  LYS C CB    1 
ATOM   8124  C  CG    . LYS C  1 109 ? -24.801  46.361  -82.417  1.00 34.00  ? 109  LYS C CG    1 
ATOM   8125  C  CD    . LYS C  1 109 ? -26.143  46.522  -83.134  1.00 28.51  ? 109  LYS C CD    1 
ATOM   8126  C  CE    . LYS C  1 109 ? -26.391  45.394  -84.124  1.00 44.97  ? 109  LYS C CE    1 
ATOM   8127  N  NZ    . LYS C  1 109 ? -27.608  45.639  -84.939  1.00 45.79  ? 109  LYS C NZ    1 
ATOM   8128  N  N     . ARG C  1 110 ? -22.837  49.813  -79.977  1.00 37.86  ? 110  ARG C N     1 
ATOM   8129  C  CA    . ARG C  1 110 ? -22.287  51.155  -79.731  1.00 37.03  ? 110  ARG C CA    1 
ATOM   8130  C  C     . ARG C  1 110 ? -20.812  51.066  -79.355  1.00 41.48  ? 110  ARG C C     1 
ATOM   8131  O  O     . ARG C  1 110 ? -20.009  51.933  -79.703  1.00 55.19  ? 110  ARG C O     1 
ATOM   8132  C  CB    . ARG C  1 110 ? -23.018  51.854  -78.581  1.00 28.48  ? 110  ARG C CB    1 
ATOM   8133  C  CG    . ARG C  1 110 ? -24.459  52.230  -78.842  1.00 30.68  ? 110  ARG C CG    1 
ATOM   8134  C  CD    . ARG C  1 110 ? -25.021  52.927  -77.606  1.00 33.23  ? 110  ARG C CD    1 
ATOM   8135  N  NE    . ARG C  1 110 ? -26.441  53.268  -77.729  1.00 37.49  ? 110  ARG C NE    1 
ATOM   8136  C  CZ    . ARG C  1 110 ? -27.150  53.859  -76.765  1.00 52.85  ? 110  ARG C CZ    1 
ATOM   8137  N  NH1   . ARG C  1 110 ? -28.436  54.143  -76.958  1.00 37.45  ? 110  ARG C NH1   1 
ATOM   8138  N  NH2   . ARG C  1 110 ? -26.576  54.167  -75.603  1.00 48.15  ? 110  ARG C NH2   1 
ATOM   8139  N  N     . ALA C  1 111 ? -20.475  50.038  -78.590  1.00 39.53  ? 111  ALA C N     1 
ATOM   8140  C  CA    . ALA C  1 111 ? -19.106  49.839  -78.175  1.00 41.04  ? 111  ALA C CA    1 
ATOM   8141  C  C     . ALA C  1 111 ? -18.256  49.407  -79.369  1.00 40.84  ? 111  ALA C C     1 
ATOM   8142  O  O     . ALA C  1 111 ? -17.077  49.730  -79.429  1.00 47.56  ? 111  ALA C O     1 
ATOM   8143  C  CB    . ALA C  1 111 ? -19.037  48.825  -77.055  1.00 33.44  ? 111  ALA C CB    1 
ATOM   8144  N  N     . GLU C  1 112 ? -18.841  48.679  -80.321  1.00 45.96  ? 112  GLU C N     1 
ATOM   8145  C  CA    . GLU C  1 112 ? -18.080  48.269  -81.500  1.00 48.66  ? 112  GLU C CA    1 
ATOM   8146  C  C     . GLU C  1 112 ? -17.852  49.505  -82.366  1.00 57.52  ? 112  GLU C C     1 
ATOM   8147  O  O     . GLU C  1 112 ? -16.752  49.703  -82.881  1.00 60.25  ? 112  GLU C O     1 
ATOM   8148  C  CB    . GLU C  1 112 ? -18.792  47.165  -82.295  1.00 51.58  ? 112  GLU C CB    1 
ATOM   8149  C  CG    . GLU C  1 112 ? -18.820  45.801  -81.588  1.00 60.21  ? 112  GLU C CG    1 
ATOM   8150  C  CD    . GLU C  1 112 ? -18.407  44.639  -82.477  1.00 53.94  ? 112  GLU C CD    1 
ATOM   8151  O  OE1   . GLU C  1 112 ? -17.190  44.466  -82.709  1.00 72.98  ? 112  GLU C OE1   1 
ATOM   8152  O  OE2   . GLU C  1 112 ? -19.288  43.876  -82.923  1.00 45.65  ? 112  GLU C OE2   1 
ATOM   8153  N  N     . ASP C  1 113 ? -18.874  50.361  -82.462  1.00 55.52  ? 113  ASP C N     1 
ATOM   8154  C  CA    . ASP C  1 113 ? -18.802  51.605  -83.237  1.00 48.99  ? 113  ASP C CA    1 
ATOM   8155  C  C     . ASP C  1 113 ? -17.712  52.498  -82.677  1.00 53.16  ? 113  ASP C C     1 
ATOM   8156  O  O     . ASP C  1 113 ? -16.853  52.987  -83.409  1.00 64.79  ? 113  ASP C O     1 
ATOM   8157  C  CB    . ASP C  1 113 ? -20.122  52.375  -83.164  1.00 48.41  ? 113  ASP C CB    1 
ATOM   8158  C  CG    . ASP C  1 113 ? -21.214  51.751  -84.009  1.00 70.46  ? 113  ASP C CG    1 
ATOM   8159  O  OD1   . ASP C  1 113 ? -20.885  50.989  -84.954  1.00 64.95  ? 113  ASP C OD1   1 
ATOM   8160  O  OD2   . ASP C  1 113 ? -22.404  52.038  -83.723  1.00 64.29  ? 113  ASP C OD2   1 
ATOM   8161  N  N     . TYR C  1 114 ? -17.783  52.719  -81.370  1.00 47.46  ? 114  TYR C N     1 
ATOM   8162  C  CA    . TYR C  1 114 ? -16.818  53.537  -80.658  1.00 40.55  ? 114  TYR C CA    1 
ATOM   8163  C  C     . TYR C  1 114 ? -15.376  53.046  -80.853  1.00 43.97  ? 114  TYR C C     1 
ATOM   8164  O  O     . TYR C  1 114 ? -14.449  53.848  -80.848  1.00 58.35  ? 114  TYR C O     1 
ATOM   8165  C  CB    . TYR C  1 114 ? -17.190  53.581  -79.179  1.00 39.89  ? 114  TYR C CB    1 
ATOM   8166  C  CG    . TYR C  1 114 ? -16.202  54.301  -78.288  1.00 54.17  ? 114  TYR C CG    1 
ATOM   8167  C  CD1   . TYR C  1 114 ? -15.179  53.603  -77.650  1.00 54.00  ? 114  TYR C CD1   1 
ATOM   8168  C  CD2   . TYR C  1 114 ? -16.306  55.673  -78.056  1.00 55.23  ? 114  TYR C CD2   1 
ATOM   8169  C  CE1   . TYR C  1 114 ? -14.279  54.253  -76.795  1.00 71.13  ? 114  TYR C CE1   1 
ATOM   8170  C  CE2   . TYR C  1 114 ? -15.410  56.334  -77.199  1.00 47.96  ? 114  TYR C CE2   1 
ATOM   8171  C  CZ    . TYR C  1 114 ? -14.399  55.617  -76.573  1.00 62.30  ? 114  TYR C CZ    1 
ATOM   8172  O  OH    . TYR C  1 114 ? -13.507  56.246  -75.718  1.00 52.14  ? 114  TYR C OH    1 
ATOM   8173  N  N     . LEU C  1 115 ? -15.174  51.744  -81.035  1.00 44.17  ? 115  LEU C N     1 
ATOM   8174  C  CA    . LEU C  1 115 ? -13.816  51.231  -81.238  1.00 44.06  ? 115  LEU C CA    1 
ATOM   8175  C  C     . LEU C  1 115 ? -13.309  51.848  -82.529  1.00 50.44  ? 115  LEU C C     1 
ATOM   8176  O  O     . LEU C  1 115 ? -12.212  52.402  -82.572  1.00 64.94  ? 115  LEU C O     1 
ATOM   8177  C  CB    . LEU C  1 115 ? -13.811  49.708  -81.392  1.00 35.55  ? 115  LEU C CB    1 
ATOM   8178  C  CG    . LEU C  1 115 ? -12.598  48.858  -80.963  1.00 41.13  ? 115  LEU C CG    1 
ATOM   8179  C  CD1   . LEU C  1 115 ? -12.221  47.905  -82.075  1.00 44.68  ? 115  LEU C CD1   1 
ATOM   8180  C  CD2   . LEU C  1 115 ? -11.408  49.687  -80.553  1.00 42.89  ? 115  LEU C CD2   1 
ATOM   8181  N  N     . ARG C  1 116 ? -14.130  51.755  -83.574  1.00 56.31  ? 116  ARG C N     1 
ATOM   8182  C  CA    . ARG C  1 116 ? -13.788  52.298  -84.883  1.00 63.31  ? 116  ARG C CA    1 
ATOM   8183  C  C     . ARG C  1 116 ? -13.638  53.812  -84.851  1.00 69.12  ? 116  ARG C C     1 
ATOM   8184  O  O     . ARG C  1 116 ? -12.673  54.350  -85.390  1.00 77.70  ? 116  ARG C O     1 
ATOM   8185  C  CB    . ARG C  1 116 ? -14.813  51.867  -85.935  1.00 45.26  ? 116  ARG C CB    1 
ATOM   8186  C  CG    . ARG C  1 116 ? -14.598  50.440  -86.424  1.00 71.58  ? 116  ARG C CG    1 
ATOM   8187  C  CD    . ARG C  1 116 ? -15.599  50.030  -87.494  1.00 84.59  ? 116  ARG C CD    1 
ATOM   8188  N  NE    . ARG C  1 116 ? -16.965  50.031  -86.979  1.00 100.00 ? 116  ARG C NE    1 
ATOM   8189  C  CZ    . ARG C  1 116 ? -17.575  48.969  -86.456  1.00 100.00 ? 116  ARG C CZ    1 
ATOM   8190  N  NH1   . ARG C  1 116 ? -18.824  49.074  -86.007  1.00 92.47  ? 116  ARG C NH1   1 
ATOM   8191  N  NH2   . ARG C  1 116 ? -16.946  47.799  -86.396  1.00 100.00 ? 116  ARG C NH2   1 
ATOM   8192  N  N     . ALA C  1 117 ? -14.562  54.486  -84.171  1.00 65.69  ? 117  ALA C N     1 
ATOM   8193  C  CA    . ALA C  1 117 ? -14.525  55.942  -84.050  1.00 60.71  ? 117  ALA C CA    1 
ATOM   8194  C  C     . ALA C  1 117 ? -13.196  56.459  -83.484  1.00 62.33  ? 117  ALA C C     1 
ATOM   8195  O  O     . ALA C  1 117 ? -12.674  57.462  -83.963  1.00 88.06  ? 117  ALA C O     1 
ATOM   8196  C  CB    . ALA C  1 117 ? -15.700  56.438  -83.198  1.00 44.52  ? 117  ALA C CB    1 
ATOM   8197  N  N     . THR C  1 118 ? -12.643  55.782  -82.482  1.00 58.46  ? 118  THR C N     1 
ATOM   8198  C  CA    . THR C  1 118 ? -11.372  56.210  -81.898  1.00 57.60  ? 118  THR C CA    1 
ATOM   8199  C  C     . THR C  1 118 ? -10.199  55.815  -82.784  1.00 58.29  ? 118  THR C C     1 
ATOM   8200  O  O     . THR C  1 118 ? -9.054   56.163  -82.496  1.00 62.05  ? 118  THR C O     1 
ATOM   8201  C  CB    . THR C  1 118 ? -11.107  55.581  -80.513  1.00 68.69  ? 118  THR C CB    1 
ATOM   8202  O  OG1   . THR C  1 118 ? -10.895  54.167  -80.655  1.00 52.30  ? 118  THR C OG1   1 
ATOM   8203  C  CG2   . THR C  1 118 ? -12.258  55.851  -79.566  1.00 59.56  ? 118  THR C CG2   1 
ATOM   8204  N  N     . GLY C  1 119 ? -10.473  55.028  -83.819  1.00 53.61  ? 119  GLY C N     1 
ATOM   8205  C  CA    . GLY C  1 119 ? -9.419   54.592  -84.718  1.00 53.78  ? 119  GLY C CA    1 
ATOM   8206  C  C     . GLY C  1 119 ? -8.362   53.682  -84.104  1.00 60.98  ? 119  GLY C C     1 
ATOM   8207  O  O     . GLY C  1 119 ? -7.365   53.367  -84.761  1.00 60.60  ? 119  GLY C O     1 
ATOM   8208  N  N     . ILE C  1 120 ? -8.557   53.260  -82.853  1.00 55.89  ? 120  ILE C N     1 
ATOM   8209  C  CA    . ILE C  1 120 ? -7.603   52.367  -82.196  1.00 53.29  ? 120  ILE C CA    1 
ATOM   8210  C  C     . ILE C  1 120 ? -7.516   51.011  -82.918  1.00 57.08  ? 120  ILE C C     1 
ATOM   8211  O  O     . ILE C  1 120 ? -6.465   50.367  -82.912  1.00 54.33  ? 120  ILE C O     1 
ATOM   8212  C  CB    . ILE C  1 120 ? -7.956   52.148  -80.716  1.00 46.27  ? 120  ILE C CB    1 
ATOM   8213  C  CG1   . ILE C  1 120 ? -8.078   53.500  -80.014  1.00 46.96  ? 120  ILE C CG1   1 
ATOM   8214  C  CG2   . ILE C  1 120 ? -6.876   51.317  -80.038  1.00 42.64  ? 120  ILE C CG2   1 
ATOM   8215  C  CD1   . ILE C  1 120 ? -8.170   53.418  -78.505  1.00 56.27  ? 120  ILE C CD1   1 
ATOM   8216  N  N     . ALA C  1 121 ? -8.626   50.603  -83.539  1.00 52.10  ? 121  ALA C N     1 
ATOM   8217  C  CA    . ALA C  1 121 ? -8.735   49.354  -84.311  1.00 45.07  ? 121  ALA C CA    1 
ATOM   8218  C  C     . ALA C  1 121 ? -10.083  49.354  -85.023  1.00 48.42  ? 121  ALA C C     1 
ATOM   8219  O  O     . ALA C  1 121 ? -10.909  50.242  -84.772  1.00 46.16  ? 121  ALA C O     1 
ATOM   8220  C  CB    . ALA C  1 121 ? -8.635   48.138  -83.399  1.00 44.52  ? 121  ALA C CB    1 
ATOM   8221  N  N     . ASP C  1 122 ? -10.296  48.397  -85.931  1.00 43.20  ? 122  ASP C N     1 
ATOM   8222  C  CA    . ASP C  1 122 ? -11.584  48.311  -86.634  1.00 57.32  ? 122  ASP C CA    1 
ATOM   8223  C  C     . ASP C  1 122 ? -12.499  47.163  -86.194  1.00 63.56  ? 122  ASP C C     1 
ATOM   8224  O  O     . ASP C  1 122 ? -13.723  47.244  -86.368  1.00 70.18  ? 122  ASP C O     1 
ATOM   8225  C  CB    . ASP C  1 122 ? -11.435  48.343  -88.166  1.00 57.08  ? 122  ASP C CB    1 
ATOM   8226  C  CG    . ASP C  1 122 ? -10.351  47.429  -88.686  1.00 60.83  ? 122  ASP C CG    1 
ATOM   8227  O  OD1   . ASP C  1 122 ? -10.365  46.211  -88.386  1.00 74.93  ? 122  ASP C OD1   1 
ATOM   8228  O  OD2   . ASP C  1 122 ? -9.491   47.947  -89.430  1.00 69.32  ? 122  ASP C OD2   1 
ATOM   8229  N  N     . THR C  1 123 ? -11.916  46.110  -85.615  1.00 60.35  ? 123  THR C N     1 
ATOM   8230  C  CA    . THR C  1 123 ? -12.696  44.965  -85.131  1.00 65.87  ? 123  THR C CA    1 
ATOM   8231  C  C     . THR C  1 123 ? -12.184  44.401  -83.799  1.00 53.18  ? 123  THR C C     1 
ATOM   8232  O  O     . THR C  1 123 ? -10.983  44.423  -83.530  1.00 46.38  ? 123  THR C O     1 
ATOM   8233  C  CB    . THR C  1 123 ? -12.734  43.813  -86.160  1.00 55.83  ? 123  THR C CB    1 
ATOM   8234  O  OG1   . THR C  1 123 ? -11.415  43.584  -86.642  1.00 48.37  ? 123  THR C OG1   1 
ATOM   8235  C  CG2   . THR C  1 123 ? -13.680  44.133  -87.342  1.00 65.47  ? 123  THR C CG2   1 
ATOM   8236  N  N     . VAL C  1 124 ? -13.118  43.951  -82.954  1.00 53.85  ? 124  VAL C N     1 
ATOM   8237  C  CA    . VAL C  1 124 ? -12.788  43.349  -81.657  1.00 45.47  ? 124  VAL C CA    1 
ATOM   8238  C  C     . VAL C  1 124 ? -13.092  41.866  -81.741  1.00 44.98  ? 124  VAL C C     1 
ATOM   8239  O  O     . VAL C  1 124 ? -14.195  41.481  -82.129  1.00 50.74  ? 124  VAL C O     1 
ATOM   8240  C  CB    . VAL C  1 124 ? -13.667  43.843  -80.505  1.00 42.66  ? 124  VAL C CB    1 
ATOM   8241  C  CG1   . VAL C  1 124 ? -12.834  43.971  -79.255  1.00 37.68  ? 124  VAL C CG1   1 
ATOM   8242  C  CG2   . VAL C  1 124 ? -14.403  45.115  -80.860  1.00 51.82  ? 124  VAL C CG2   1 
ATOM   8243  N  N     . LEU C  1 125 ? -12.140  41.036  -81.344  1.00 41.67  ? 125  LEU C N     1 
ATOM   8244  C  CA    . LEU C  1 125 ? -12.343  39.596  -81.379  1.00 43.17  ? 125  LEU C CA    1 
ATOM   8245  C  C     . LEU C  1 125 ? -12.558  38.989  -79.996  1.00 50.85  ? 125  LEU C C     1 
ATOM   8246  O  O     . LEU C  1 125 ? -11.782  39.229  -79.066  1.00 46.60  ? 125  LEU C O     1 
ATOM   8247  C  CB    . LEU C  1 125 ? -11.180  38.920  -82.096  1.00 41.49  ? 125  LEU C CB    1 
ATOM   8248  C  CG    . LEU C  1 125 ? -11.366  38.667  -83.593  1.00 40.67  ? 125  LEU C CG    1 
ATOM   8249  C  CD1   . LEU C  1 125 ? -12.378  39.606  -84.223  1.00 36.29  ? 125  LEU C CD1   1 
ATOM   8250  C  CD2   . LEU C  1 125 ? -10.022  38.774  -84.265  1.00 36.93  ? 125  LEU C CD2   1 
ATOM   8251  N  N     . PHE C  1 126 ? -13.625  38.201  -79.874  1.00 54.98  ? 126  PHE C N     1 
ATOM   8252  C  CA    . PHE C  1 126 ? -13.982  37.548  -78.618  1.00 39.06  ? 126  PHE C CA    1 
ATOM   8253  C  C     . PHE C  1 126 ? -14.124  36.041  -78.726  1.00 45.00  ? 126  PHE C C     1 
ATOM   8254  O  O     . PHE C  1 126 ? -14.761  35.529  -79.647  1.00 51.49  ? 126  PHE C O     1 
ATOM   8255  C  CB    . PHE C  1 126 ? -15.279  38.132  -78.078  1.00 28.84  ? 126  PHE C CB    1 
ATOM   8256  C  CG    . PHE C  1 126 ? -15.079  39.276  -77.135  1.00 46.71  ? 126  PHE C CG    1 
ATOM   8257  C  CD1   . PHE C  1 126 ? -14.876  40.564  -77.617  1.00 39.18  ? 126  PHE C CD1   1 
ATOM   8258  C  CD2   . PHE C  1 126 ? -15.113  39.067  -75.755  1.00 34.90  ? 126  PHE C CD2   1 
ATOM   8259  C  CE1   . PHE C  1 126 ? -14.711  41.631  -76.741  1.00 46.40  ? 126  PHE C CE1   1 
ATOM   8260  C  CE2   . PHE C  1 126 ? -14.948  40.129  -74.867  1.00 39.21  ? 126  PHE C CE2   1 
ATOM   8261  C  CZ    . PHE C  1 126 ? -14.747  41.414  -75.361  1.00 43.88  ? 126  PHE C CZ    1 
ATOM   8262  N  N     . GLY C  1 127 ? -13.535  35.336  -77.763  1.00 41.47  ? 127  GLY C N     1 
ATOM   8263  C  CA    . GLY C  1 127 ? -13.613  33.889  -77.740  1.00 37.41  ? 127  GLY C CA    1 
ATOM   8264  C  C     . GLY C  1 127 ? -13.897  33.399  -76.333  1.00 40.23  ? 127  GLY C C     1 
ATOM   8265  O  O     . GLY C  1 127 ? -12.960  33.059  -75.615  1.00 36.40  ? 127  GLY C O     1 
ATOM   8266  N  N     . PRO C  1 128 ? -15.174  33.347  -75.904  1.00 36.81  ? 128  PRO C N     1 
ATOM   8267  C  CA    . PRO C  1 128 ? -15.515  32.886  -74.555  1.00 30.92  ? 128  PRO C CA    1 
ATOM   8268  C  C     . PRO C  1 128 ? -15.467  31.367  -74.493  1.00 33.38  ? 128  PRO C C     1 
ATOM   8269  O  O     . PRO C  1 128 ? -15.731  30.689  -75.488  1.00 37.69  ? 128  PRO C O     1 
ATOM   8270  C  CB    . PRO C  1 128 ? -16.961  33.360  -74.376  1.00 38.89  ? 128  PRO C CB    1 
ATOM   8271  C  CG    . PRO C  1 128 ? -17.326  34.079  -75.676  1.00 31.31  ? 128  PRO C CG    1 
ATOM   8272  C  CD    . PRO C  1 128 ? -16.396  33.554  -76.696  1.00 27.46  ? 128  PRO C CD    1 
ATOM   8273  N  N     . GLU C  1 129 ? -15.124  30.835  -73.325  1.00 27.93  ? 129  GLU C N     1 
ATOM   8274  C  CA    . GLU C  1 129 ? -15.067  29.385  -73.115  1.00 29.45  ? 129  GLU C CA    1 
ATOM   8275  C  C     . GLU C  1 129 ? -16.099  29.096  -72.008  1.00 37.72  ? 129  GLU C C     1 
ATOM   8276  O  O     . GLU C  1 129 ? -15.746  28.851  -70.855  1.00 35.90  ? 129  GLU C O     1 
ATOM   8277  C  CB    . GLU C  1 129 ? -13.657  28.954  -72.652  1.00 37.24  ? 129  GLU C CB    1 
ATOM   8278  C  CG    . GLU C  1 129 ? -12.437  29.249  -73.608  1.00 19.46  ? 129  GLU C CG    1 
ATOM   8279  C  CD    . GLU C  1 129 ? -11.083  29.102  -72.892  1.00 40.30  ? 129  GLU C CD    1 
ATOM   8280  O  OE1   . GLU C  1 129 ? -10.172  28.399  -73.367  1.00 45.79  ? 129  GLU C OE1   1 
ATOM   8281  O  OE2   . GLU C  1 129 ? -10.915  29.689  -71.810  1.00 54.93  ? 129  GLU C OE2   1 
ATOM   8282  N  N     . PRO C  1 130 ? -17.396  29.146  -72.343  1.00 30.26  ? 130  PRO C N     1 
ATOM   8283  C  CA    . PRO C  1 130 ? -18.403  28.889  -71.315  1.00 30.01  ? 130  PRO C CA    1 
ATOM   8284  C  C     . PRO C  1 130 ? -18.600  27.422  -70.957  1.00 33.45  ? 130  PRO C C     1 
ATOM   8285  O  O     . PRO C  1 130 ? -18.784  26.568  -71.824  1.00 45.55  ? 130  PRO C O     1 
ATOM   8286  C  CB    . PRO C  1 130 ? -19.664  29.512  -71.917  1.00 19.51  ? 130  PRO C CB    1 
ATOM   8287  C  CG    . PRO C  1 130 ? -19.515  29.204  -73.368  1.00 34.49  ? 130  PRO C CG    1 
ATOM   8288  C  CD    . PRO C  1 130 ? -18.029  29.431  -73.645  1.00 35.14  ? 130  PRO C CD    1 
ATOM   8289  N  N     . GLU C  1 131 ? -18.559  27.153  -69.658  1.00 33.40  ? 131  GLU C N     1 
ATOM   8290  C  CA    . GLU C  1 131 ? -18.740  25.808  -69.113  1.00 26.45  ? 131  GLU C CA    1 
ATOM   8291  C  C     . GLU C  1 131 ? -20.130  25.619  -68.509  1.00 24.91  ? 131  GLU C C     1 
ATOM   8292  O  O     . GLU C  1 131 ? -20.798  26.584  -68.149  1.00 25.07  ? 131  GLU C O     1 
ATOM   8293  C  CB    . GLU C  1 131 ? -17.683  25.543  -68.051  1.00 18.98  ? 131  GLU C CB    1 
ATOM   8294  C  CG    . GLU C  1 131 ? -16.319  25.280  -68.639  1.00 24.77  ? 131  GLU C CG    1 
ATOM   8295  C  CD    . GLU C  1 131 ? -15.200  25.495  -67.650  1.00 37.31  ? 131  GLU C CD    1 
ATOM   8296  O  OE1   . GLU C  1 131 ? -14.091  24.967  -67.896  1.00 40.25  ? 131  GLU C OE1   1 
ATOM   8297  O  OE2   . GLU C  1 131 ? -15.416  26.210  -66.640  1.00 32.24  ? 131  GLU C OE2   1 
ATOM   8298  N  N     . PHE C  1 132 ? -20.561  24.373  -68.379  1.00 27.20  ? 132  PHE C N     1 
ATOM   8299  C  CA    . PHE C  1 132 ? -21.877  24.107  -67.815  1.00 24.72  ? 132  PHE C CA    1 
ATOM   8300  C  C     . PHE C  1 132 ? -21.986  22.744  -67.147  1.00 30.73  ? 132  PHE C C     1 
ATOM   8301  O  O     . PHE C  1 132 ? -21.052  21.935  -67.174  1.00 23.21  ? 132  PHE C O     1 
ATOM   8302  C  CB    . PHE C  1 132 ? -22.948  24.244  -68.894  1.00 20.51  ? 132  PHE C CB    1 
ATOM   8303  C  CG    . PHE C  1 132 ? -22.759  23.319  -70.070  1.00 24.36  ? 132  PHE C CG    1 
ATOM   8304  C  CD1   . PHE C  1 132 ? -21.985  23.703  -71.161  1.00 36.17  ? 132  PHE C CD1   1 
ATOM   8305  C  CD2   . PHE C  1 132 ? -23.364  22.068  -70.091  1.00 32.42  ? 132  PHE C CD2   1 
ATOM   8306  C  CE1   . PHE C  1 132 ? -21.819  22.850  -72.249  1.00 24.40  ? 132  PHE C CE1   1 
ATOM   8307  C  CE2   . PHE C  1 132 ? -23.206  21.206  -71.175  1.00 30.26  ? 132  PHE C CE2   1 
ATOM   8308  C  CZ    . PHE C  1 132 ? -22.434  21.597  -72.255  1.00 31.51  ? 132  PHE C CZ    1 
ATOM   8309  N  N     . PHE C  1 133 ? -23.145  22.505  -66.541  1.00 24.77  ? 133  PHE C N     1 
ATOM   8310  C  CA    . PHE C  1 133 ? -23.435  21.245  -65.854  1.00 19.47  ? 133  PHE C CA    1 
ATOM   8311  C  C     . PHE C  1 133 ? -24.703  20.601  -66.406  1.00 24.09  ? 133  PHE C C     1 
ATOM   8312  O  O     . PHE C  1 133 ? -25.683  21.292  -66.726  1.00 28.96  ? 133  PHE C O     1 
ATOM   8313  C  CB    . PHE C  1 133 ? -23.664  21.494  -64.356  1.00 18.21  ? 133  PHE C CB    1 
ATOM   8314  C  CG    . PHE C  1 133 ? -22.407  21.563  -63.541  1.00 19.46  ? 133  PHE C CG    1 
ATOM   8315  C  CD1   . PHE C  1 133 ? -21.813  22.788  -63.256  1.00 22.57  ? 133  PHE C CD1   1 
ATOM   8316  C  CD2   . PHE C  1 133 ? -21.824  20.399  -63.041  1.00 23.19  ? 133  PHE C CD2   1 
ATOM   8317  C  CE1   . PHE C  1 133 ? -20.655  22.854  -62.480  1.00 19.82  ? 133  PHE C CE1   1 
ATOM   8318  C  CE2   . PHE C  1 133 ? -20.675  20.451  -62.270  1.00 18.10  ? 133  PHE C CE2   1 
ATOM   8319  C  CZ    . PHE C  1 133 ? -20.085  21.686  -61.989  1.00 20.97  ? 133  PHE C CZ    1 
ATOM   8320  N  N     . LEU C  1 134 ? -24.692  19.275  -66.482  1.00 19.57  ? 134  LEU C N     1 
ATOM   8321  C  CA    . LEU C  1 134 ? -25.854  18.516  -66.933  1.00 18.96  ? 134  LEU C CA    1 
ATOM   8322  C  C     . LEU C  1 134 ? -26.295  17.627  -65.785  1.00 17.94  ? 134  LEU C C     1 
ATOM   8323  O  O     . LEU C  1 134 ? -25.557  16.737  -65.382  1.00 35.28  ? 134  LEU C O     1 
ATOM   8324  C  CB    . LEU C  1 134 ? -25.507  17.634  -68.129  1.00 17.00  ? 134  LEU C CB    1 
ATOM   8325  C  CG    . LEU C  1 134 ? -25.159  18.358  -69.420  1.00 18.77  ? 134  LEU C CG    1 
ATOM   8326  C  CD1   . LEU C  1 134 ? -24.926  17.347  -70.513  1.00 25.75  ? 134  LEU C CD1   1 
ATOM   8327  C  CD2   . LEU C  1 134 ? -26.303  19.270  -69.798  1.00 22.41  ? 134  LEU C CD2   1 
ATOM   8328  N  N     . PHE C  1 135 ? -27.488  17.872  -65.258  1.00 24.94  ? 135  PHE C N     1 
ATOM   8329  C  CA    . PHE C  1 135 ? -28.032  17.076  -64.155  1.00 16.36  ? 135  PHE C CA    1 
ATOM   8330  C  C     . PHE C  1 135 ? -29.250  16.269  -64.599  1.00 24.57  ? 135  PHE C C     1 
ATOM   8331  O  O     . PHE C  1 135 ? -29.779  16.458  -65.705  1.00 29.62  ? 135  PHE C O     1 
ATOM   8332  C  CB    . PHE C  1 135 ? -28.470  17.991  -63.023  1.00 14.63  ? 135  PHE C CB    1 
ATOM   8333  C  CG    . PHE C  1 135 ? -27.376  18.819  -62.448  1.00 14.26  ? 135  PHE C CG    1 
ATOM   8334  C  CD1   . PHE C  1 135 ? -27.627  20.126  -62.053  1.00 17.99  ? 135  PHE C CD1   1 
ATOM   8335  C  CD2   . PHE C  1 135 ? -26.106  18.289  -62.249  1.00 18.11  ? 135  PHE C CD2   1 
ATOM   8336  C  CE1   . PHE C  1 135 ? -26.624  20.899  -61.451  1.00 16.71  ? 135  PHE C CE1   1 
ATOM   8337  C  CE2   . PHE C  1 135 ? -25.100  19.049  -61.650  1.00 14.58  ? 135  PHE C CE2   1 
ATOM   8338  C  CZ    . PHE C  1 135 ? -25.360  20.359  -61.249  1.00 13.73  ? 135  PHE C CZ    1 
ATOM   8339  N  N     . ASP C  1 136 ? -29.718  15.399  -63.709  1.00 32.23  ? 136  ASP C N     1 
ATOM   8340  C  CA    . ASP C  1 136 ? -30.899  14.576  -63.969  1.00 23.81  ? 136  ASP C CA    1 
ATOM   8341  C  C     . ASP C  1 136 ? -32.101  15.121  -63.195  1.00 22.94  ? 136  ASP C C     1 
ATOM   8342  O  O     . ASP C  1 136 ? -33.246  15.041  -63.647  1.00 25.82  ? 136  ASP C O     1 
ATOM   8343  C  CB    . ASP C  1 136 ? -30.653  13.132  -63.521  1.00 11.78  ? 136  ASP C CB    1 
ATOM   8344  C  CG    . ASP C  1 136 ? -29.892  12.309  -64.541  1.00 34.08  ? 136  ASP C CG    1 
ATOM   8345  O  OD1   . ASP C  1 136 ? -29.227  11.338  -64.119  1.00 36.41  ? 136  ASP C OD1   1 
ATOM   8346  O  OD2   . ASP C  1 136 ? -29.992  12.595  -65.755  1.00 27.71  ? 136  ASP C OD2   1 
ATOM   8347  N  N     . ASP C  1 137 ? -31.818  15.732  -62.050  1.00 25.31  ? 137  ASP C N     1 
ATOM   8348  C  CA    . ASP C  1 137 ? -32.850  16.250  -61.166  1.00 15.11  ? 137  ASP C CA    1 
ATOM   8349  C  C     . ASP C  1 137 ? -32.292  17.418  -60.356  1.00 15.73  ? 137  ASP C C     1 
ATOM   8350  O  O     . ASP C  1 137 ? -31.173  17.359  -59.847  1.00 22.53  ? 137  ASP C O     1 
ATOM   8351  C  CB    . ASP C  1 137 ? -33.263  15.097  -60.239  1.00 28.55  ? 137  ASP C CB    1 
ATOM   8352  C  CG    . ASP C  1 137 ? -34.248  15.497  -59.156  1.00 35.08  ? 137  ASP C CG    1 
ATOM   8353  O  OD1   . ASP C  1 137 ? -35.381  15.903  -59.492  1.00 34.82  ? 137  ASP C OD1   1 
ATOM   8354  O  OD2   . ASP C  1 137 ? -33.910  15.326  -57.960  1.00 26.87  ? 137  ASP C OD2   1 
ATOM   8355  N  N     . ILE C  1 138 ? -33.062  18.496  -60.289  1.00 18.52  ? 138  ILE C N     1 
ATOM   8356  C  CA    . ILE C  1 138 ? -32.694  19.682  -59.528  1.00 21.80  ? 138  ILE C CA    1 
ATOM   8357  C  C     . ILE C  1 138 ? -33.956  20.150  -58.790  1.00 28.63  ? 138  ILE C C     1 
ATOM   8358  O  O     . ILE C  1 138 ? -35.016  20.363  -59.393  1.00 25.75  ? 138  ILE C O     1 
ATOM   8359  C  CB    . ILE C  1 138 ? -32.167  20.833  -60.439  1.00 25.61  ? 138  ILE C CB    1 
ATOM   8360  C  CG1   . ILE C  1 138 ? -31.851  22.084  -59.603  1.00 13.45  ? 138  ILE C CG1   1 
ATOM   8361  C  CG2   . ILE C  1 138 ? -33.201  21.201  -61.501  1.00 17.82  ? 138  ILE C CG2   1 
ATOM   8362  C  CD1   . ILE C  1 138 ? -30.579  21.973  -58.791  1.00 20.79  ? 138  ILE C CD1   1 
ATOM   8363  N  N     . ARG C  1 139 ? -33.855  20.237  -57.472  1.00 21.50  ? 139  ARG C N     1 
ATOM   8364  C  CA    . ARG C  1 139 ? -34.977  20.686  -56.665  1.00 14.07  ? 139  ARG C CA    1 
ATOM   8365  C  C     . ARG C  1 139 ? -34.495  21.738  -55.681  1.00 23.37  ? 139  ARG C C     1 
ATOM   8366  O  O     . ARG C  1 139 ? -33.368  21.682  -55.183  1.00 26.04  ? 139  ARG C O     1 
ATOM   8367  C  CB    . ARG C  1 139 ? -35.621  19.504  -55.938  1.00 8.80   ? 139  ARG C CB    1 
ATOM   8368  C  CG    . ARG C  1 139 ? -36.533  18.624  -56.817  1.00 27.39  ? 139  ARG C CG    1 
ATOM   8369  C  CD    . ARG C  1 139 ? -36.517  17.138  -56.419  1.00 20.85  ? 139  ARG C CD    1 
ATOM   8370  N  NE    . ARG C  1 139 ? -36.307  16.936  -54.987  1.00 27.08  ? 139  ARG C NE    1 
ATOM   8371  C  CZ    . ARG C  1 139 ? -35.312  16.216  -54.484  1.00 36.91  ? 139  ARG C CZ    1 
ATOM   8372  N  NH1   . ARG C  1 139 ? -35.173  16.093  -53.170  1.00 40.55  ? 139  ARG C NH1   1 
ATOM   8373  N  NH2   . ARG C  1 139 ? -34.456  15.610  -55.301  1.00 35.65  ? 139  ARG C NH2   1 
ATOM   8374  N  N     . PHE C  1 140 ? -35.331  22.739  -55.460  1.00 14.60  ? 140  PHE C N     1 
ATOM   8375  C  CA    . PHE C  1 140 ? -34.994  23.809  -54.542  1.00 22.29  ? 140  PHE C CA    1 
ATOM   8376  C  C     . PHE C  1 140 ? -36.223  24.619  -54.141  1.00 26.24  ? 140  PHE C C     1 
ATOM   8377  O  O     . PHE C  1 140 ? -37.277  24.541  -54.777  1.00 27.73  ? 140  PHE C O     1 
ATOM   8378  C  CB    . PHE C  1 140 ? -33.920  24.713  -55.151  1.00 10.45  ? 140  PHE C CB    1 
ATOM   8379  C  CG    . PHE C  1 140 ? -34.327  25.370  -56.438  1.00 25.75  ? 140  PHE C CG    1 
ATOM   8380  C  CD1   . PHE C  1 140 ? -35.214  26.454  -56.437  1.00 24.11  ? 140  PHE C CD1   1 
ATOM   8381  C  CD2   . PHE C  1 140 ? -33.854  24.885  -57.662  1.00 28.72  ? 140  PHE C CD2   1 
ATOM   8382  C  CE1   . PHE C  1 140 ? -35.631  27.045  -57.635  1.00 16.10  ? 140  PHE C CE1   1 
ATOM   8383  C  CE2   . PHE C  1 140 ? -34.261  25.465  -58.865  1.00 7.90   ? 140  PHE C CE2   1 
ATOM   8384  C  CZ    . PHE C  1 140 ? -35.158  26.550  -58.848  1.00 31.38  ? 140  PHE C CZ    1 
ATOM   8385  N  N     . GLY C  1 141 ? -36.082  25.393  -53.077  1.00 23.57  ? 141  GLY C N     1 
ATOM   8386  C  CA    . GLY C  1 141 ? -37.192  26.194  -52.609  1.00 20.28  ? 141  GLY C CA    1 
ATOM   8387  C  C     . GLY C  1 141 ? -36.837  26.955  -51.357  1.00 22.40  ? 141  GLY C C     1 
ATOM   8388  O  O     . GLY C  1 141 ? -35.840  26.648  -50.695  1.00 33.68  ? 141  GLY C O     1 
ATOM   8389  N  N     . ALA C  1 142 ? -37.654  27.954  -51.039  1.00 32.88  ? 142  ALA C N     1 
ATOM   8390  C  CA    . ALA C  1 142 ? -37.459  28.778  -49.851  1.00 22.53  ? 142  ALA C CA    1 
ATOM   8391  C  C     . ALA C  1 142 ? -38.804  29.330  -49.438  1.00 27.75  ? 142  ALA C C     1 
ATOM   8392  O  O     . ALA C  1 142 ? -39.551  29.865  -50.265  1.00 36.95  ? 142  ALA C O     1 
ATOM   8393  C  CB    . ALA C  1 142 ? -36.502  29.909  -50.133  1.00 21.61  ? 142  ALA C CB    1 
ATOM   8394  N  N     . SER C  1 143 ? -39.126  29.125  -48.168  1.00 32.05  ? 143  SER C N     1 
ATOM   8395  C  CA    . SER C  1 143 ? -40.374  29.588  -47.581  1.00 16.76  ? 143  SER C CA    1 
ATOM   8396  C  C     . SER C  1 143 ? -40.037  30.011  -46.158  1.00 28.13  ? 143  SER C C     1 
ATOM   8397  O  O     . SER C  1 143 ? -38.895  29.860  -45.712  1.00 28.43  ? 143  SER C O     1 
ATOM   8398  C  CB    . SER C  1 143 ? -41.428  28.477  -47.596  1.00 18.03  ? 143  SER C CB    1 
ATOM   8399  O  OG    . SER C  1 143 ? -41.286  27.577  -46.511  1.00 32.13  ? 143  SER C OG    1 
ATOM   8400  N  N     . ILE C  1 144 ? -41.025  30.527  -45.440  1.00 21.76  ? 144  ILE C N     1 
ATOM   8401  C  CA    . ILE C  1 144 ? -40.789  30.990  -44.078  1.00 24.84  ? 144  ILE C CA    1 
ATOM   8402  C  C     . ILE C  1 144 ? -40.190  29.917  -43.158  1.00 25.39  ? 144  ILE C C     1 
ATOM   8403  O  O     . ILE C  1 144 ? -39.330  30.215  -42.342  1.00 28.61  ? 144  ILE C O     1 
ATOM   8404  C  CB    . ILE C  1 144 ? -42.078  31.598  -43.464  1.00 26.93  ? 144  ILE C CB    1 
ATOM   8405  C  CG1   . ILE C  1 144 ? -41.774  32.227  -42.106  1.00 19.26  ? 144  ILE C CG1   1 
ATOM   8406  C  CG2   . ILE C  1 144 ? -43.173  30.548  -43.350  1.00 18.60  ? 144  ILE C CG2   1 
ATOM   8407  C  CD1   . ILE C  1 144 ? -42.988  32.826  -41.416  1.00 27.34  ? 144  ILE C CD1   1 
ATOM   8408  N  N     . SER C  1 145 ? -40.597  28.663  -43.339  1.00 29.05  ? 145  SER C N     1 
ATOM   8409  C  CA    . SER C  1 145 ? -40.109  27.551  -42.516  1.00 18.42  ? 145  SER C CA    1 
ATOM   8410  C  C     . SER C  1 145 ? -38.766  26.920  -42.916  1.00 25.36  ? 145  SER C C     1 
ATOM   8411  O  O     . SER C  1 145 ? -38.281  26.017  -42.226  1.00 29.83  ? 145  SER C O     1 
ATOM   8412  C  CB    . SER C  1 145 ? -41.179  26.452  -42.408  1.00 14.40  ? 145  SER C CB    1 
ATOM   8413  O  OG    . SER C  1 145 ? -41.707  26.098  -43.675  1.00 38.70  ? 145  SER C OG    1 
ATOM   8414  N  N     . GLY C  1 146 ? -38.173  27.374  -44.021  1.00 20.95  ? 146  GLY C N     1 
ATOM   8415  C  CA    . GLY C  1 146 ? -36.896  26.813  -44.449  1.00 4.05   ? 146  GLY C CA    1 
ATOM   8416  C  C     . GLY C  1 146 ? -36.508  27.053  -45.900  1.00 19.93  ? 146  GLY C C     1 
ATOM   8417  O  O     . GLY C  1 146 ? -37.148  27.821  -46.628  1.00 27.44  ? 146  GLY C O     1 
ATOM   8418  N  N     . SER C  1 147 ? -35.447  26.371  -46.319  1.00 18.06  ? 147  SER C N     1 
ATOM   8419  C  CA    . SER C  1 147 ? -34.915  26.470  -47.676  1.00 22.09  ? 147  SER C CA    1 
ATOM   8420  C  C     . SER C  1 147 ? -34.209  25.173  -47.973  1.00 31.01  ? 147  SER C C     1 
ATOM   8421  O  O     . SER C  1 147 ? -33.866  24.428  -47.056  1.00 30.12  ? 147  SER C O     1 
ATOM   8422  C  CB    . SER C  1 147 ? -33.875  27.612  -47.807  1.00 13.20  ? 147  SER C CB    1 
ATOM   8423  O  OG    . SER C  1 147 ? -33.404  28.118  -46.550  1.00 43.89  ? 147  SER C OG    1 
ATOM   8424  N  N     . HIS C  1 148 ? -33.973  24.911  -49.252  1.00 25.90  ? 148  HIS C N     1 
ATOM   8425  C  CA    . HIS C  1 148 ? -33.250  23.714  -49.632  1.00 22.39  ? 148  HIS C CA    1 
ATOM   8426  C  C     . HIS C  1 148 ? -32.927  23.687  -51.107  1.00 25.11  ? 148  HIS C C     1 
ATOM   8427  O  O     . HIS C  1 148 ? -33.557  24.374  -51.909  1.00 29.16  ? 148  HIS C O     1 
ATOM   8428  C  CB    . HIS C  1 148 ? -34.060  22.460  -49.302  1.00 23.66  ? 148  HIS C CB    1 
ATOM   8429  C  CG    . HIS C  1 148 ? -35.165  22.188  -50.273  1.00 32.66  ? 148  HIS C CG    1 
ATOM   8430  N  ND1   . HIS C  1 148 ? -36.376  22.847  -50.226  1.00 34.39  ? 148  HIS C ND1   1 
ATOM   8431  C  CD2   . HIS C  1 148 ? -35.230  21.354  -51.342  1.00 13.84  ? 148  HIS C CD2   1 
ATOM   8432  C  CE1   . HIS C  1 148 ? -37.137  22.434  -51.225  1.00 29.17  ? 148  HIS C CE1   1 
ATOM   8433  N  NE2   . HIS C  1 148 ? -36.466  21.529  -51.916  1.00 27.09  ? 148  HIS C NE2   1 
ATOM   8434  N  N     . VAL C  1 149 ? -31.901  22.909  -51.431  1.00 24.46  ? 149  VAL C N     1 
ATOM   8435  C  CA    . VAL C  1 149 ? -31.481  22.654  -52.798  1.00 20.84  ? 149  VAL C CA    1 
ATOM   8436  C  C     . VAL C  1 149 ? -30.934  21.236  -52.812  1.00 19.65  ? 149  VAL C C     1 
ATOM   8437  O  O     . VAL C  1 149 ? -30.162  20.849  -51.929  1.00 26.09  ? 149  VAL C O     1 
ATOM   8438  C  CB    . VAL C  1 149 ? -30.412  23.619  -53.337  1.00 21.92  ? 149  VAL C CB    1 
ATOM   8439  C  CG1   . VAL C  1 149 ? -29.200  23.660  -52.451  1.00 14.67  ? 149  VAL C CG1   1 
ATOM   8440  C  CG2   . VAL C  1 149 ? -29.988  23.153  -54.713  1.00 7.62   ? 149  VAL C CG2   1 
ATOM   8441  N  N     . ALA C  1 150 ? -31.393  20.449  -53.777  1.00 15.11  ? 150  ALA C N     1 
ATOM   8442  C  CA    . ALA C  1 150 ? -30.944  19.075  -53.924  1.00 19.30  ? 150  ALA C CA    1 
ATOM   8443  C  C     . ALA C  1 150 ? -30.610  18.811  -55.389  1.00 28.25  ? 150  ALA C C     1 
ATOM   8444  O  O     . ALA C  1 150 ? -31.471  18.927  -56.263  1.00 28.90  ? 150  ALA C O     1 
ATOM   8445  C  CB    . ALA C  1 150 ? -32.005  18.139  -53.456  1.00 18.72  ? 150  ALA C CB    1 
ATOM   8446  N  N     . ILE C  1 151 ? -29.341  18.513  -55.647  1.00 23.07  ? 151  ILE C N     1 
ATOM   8447  C  CA    . ILE C  1 151 ? -28.849  18.238  -56.997  1.00 16.34  ? 151  ILE C CA    1 
ATOM   8448  C  C     . ILE C  1 151 ? -28.672  16.748  -57.150  1.00 21.67  ? 151  ILE C C     1 
ATOM   8449  O  O     . ILE C  1 151 ? -28.263  16.058  -56.217  1.00 26.49  ? 151  ILE C O     1 
ATOM   8450  C  CB    . ILE C  1 151 ? -27.451  18.865  -57.221  1.00 18.34  ? 151  ILE C CB    1 
ATOM   8451  C  CG1   . ILE C  1 151 ? -27.544  20.374  -57.223  1.00 16.24  ? 151  ILE C CG1   1 
ATOM   8452  C  CG2   . ILE C  1 151 ? -26.856  18.425  -58.533  1.00 13.44  ? 151  ILE C CG2   1 
ATOM   8453  C  CD1   . ILE C  1 151 ? -26.230  21.004  -57.082  1.00 14.69  ? 151  ILE C CD1   1 
ATOM   8454  N  N     . ASP C  1 152 ? -28.980  16.243  -58.331  1.00 23.05  ? 152  ASP C N     1 
ATOM   8455  C  CA    . ASP C  1 152 ? -28.786  14.836  -58.567  1.00 25.19  ? 152  ASP C CA    1 
ATOM   8456  C  C     . ASP C  1 152 ? -28.529  14.512  -60.029  1.00 30.13  ? 152  ASP C C     1 
ATOM   8457  O  O     . ASP C  1 152 ? -29.134  15.092  -60.935  1.00 27.87  ? 152  ASP C O     1 
ATOM   8458  C  CB    . ASP C  1 152 ? -29.949  14.011  -58.025  1.00 14.02  ? 152  ASP C CB    1 
ATOM   8459  C  CG    . ASP C  1 152 ? -29.541  12.581  -57.688  1.00 30.72  ? 152  ASP C CG    1 
ATOM   8460  O  OD1   . ASP C  1 152 ? -28.331  12.318  -57.483  1.00 32.34  ? 152  ASP C OD1   1 
ATOM   8461  O  OD2   . ASP C  1 152 ? -30.434  11.718  -57.612  1.00 36.26  ? 152  ASP C OD2   1 
ATOM   8462  N  N     . ASP C  1 153 ? -27.539  13.652  -60.233  1.00 18.83  ? 153  ASP C N     1 
ATOM   8463  C  CA    . ASP C  1 153 ? -27.172  13.185  -61.549  1.00 28.87  ? 153  ASP C CA    1 
ATOM   8464  C  C     . ASP C  1 153 ? -26.535  11.814  -61.465  1.00 29.46  ? 153  ASP C C     1 
ATOM   8465  O  O     . ASP C  1 153 ? -25.888  11.468  -60.480  1.00 31.18  ? 153  ASP C O     1 
ATOM   8466  C  CB    . ASP C  1 153 ? -26.219  14.138  -62.253  1.00 28.91  ? 153  ASP C CB    1 
ATOM   8467  C  CG    . ASP C  1 153 ? -25.963  13.722  -63.685  1.00 29.50  ? 153  ASP C CG    1 
ATOM   8468  O  OD1   . ASP C  1 153 ? -26.916  13.773  -64.492  1.00 31.84  ? 153  ASP C OD1   1 
ATOM   8469  O  OD2   . ASP C  1 153 ? -24.829  13.300  -63.992  1.00 23.30  ? 153  ASP C OD2   1 
ATOM   8470  N  N     . ILE C  1 154 ? -26.719  11.055  -62.535  1.00 24.95  ? 154  ILE C N     1 
ATOM   8471  C  CA    . ILE C  1 154 ? -26.207  9.706   -62.677  1.00 21.86  ? 154  ILE C CA    1 
ATOM   8472  C  C     . ILE C  1 154 ? -24.682  9.660   -62.476  1.00 31.23  ? 154  ILE C C     1 
ATOM   8473  O  O     . ILE C  1 154 ? -24.149  8.646   -62.011  1.00 31.20  ? 154  ILE C O     1 
ATOM   8474  C  CB    . ILE C  1 154 ? -26.644  9.136   -64.080  1.00 30.90  ? 154  ILE C CB    1 
ATOM   8475  C  CG1   . ILE C  1 154 ? -26.432  7.627   -64.170  1.00 29.85  ? 154  ILE C CG1   1 
ATOM   8476  C  CG2   . ILE C  1 154 ? -25.964  9.881   -65.214  1.00 18.76  ? 154  ILE C CG2   1 
ATOM   8477  C  CD1   . ILE C  1 154 ? -27.548  6.814   -63.518  1.00 39.96  ? 154  ILE C CD1   1 
ATOM   8478  N  N     . GLU C  1 155 ? -23.999  10.772  -62.768  1.00 20.61  ? 155  GLU C N     1 
ATOM   8479  C  CA    . GLU C  1 155 ? -22.541  10.852  -62.615  1.00 20.09  ? 155  GLU C CA    1 
ATOM   8480  C  C     . GLU C  1 155 ? -22.086  11.277  -61.232  1.00 16.92  ? 155  GLU C C     1 
ATOM   8481  O  O     . GLU C  1 155 ? -20.914  11.141  -60.903  1.00 35.70  ? 155  GLU C O     1 
ATOM   8482  C  CB    . GLU C  1 155 ? -21.928  11.824  -63.621  1.00 21.55  ? 155  GLU C CB    1 
ATOM   8483  C  CG    . GLU C  1 155 ? -21.963  11.380  -65.078  1.00 17.34  ? 155  GLU C CG    1 
ATOM   8484  C  CD    . GLU C  1 155 ? -21.097  12.256  -65.951  1.00 37.81  ? 155  GLU C CD    1 
ATOM   8485  O  OE1   . GLU C  1 155 ? -20.479  13.185  -65.397  1.00 32.67  ? 155  GLU C OE1   1 
ATOM   8486  O  OE2   . GLU C  1 155 ? -21.031  12.024  -67.178  1.00 30.00  ? 155  GLU C OE2   1 
ATOM   8487  N  N     . GLY C  1 156 ? -23.000  11.831  -60.443  1.00 27.90  ? 156  GLY C N     1 
ATOM   8488  C  CA    . GLY C  1 156 ? -22.662  12.289  -59.106  1.00 23.57  ? 156  GLY C CA    1 
ATOM   8489  C  C     . GLY C  1 156 ? -21.972  11.219  -58.301  1.00 19.35  ? 156  GLY C C     1 
ATOM   8490  O  O     . GLY C  1 156 ? -22.510  10.137  -58.125  1.00 30.11  ? 156  GLY C O     1 
ATOM   8491  N  N     . ALA C  1 157 ? -20.780  11.523  -57.805  1.00 35.26  ? 157  ALA C N     1 
ATOM   8492  C  CA    . ALA C  1 157 ? -20.001  10.562  -57.037  1.00 31.40  ? 157  ALA C CA    1 
ATOM   8493  C  C     . ALA C  1 157 ? -20.749  10.003  -55.833  1.00 36.88  ? 157  ALA C C     1 
ATOM   8494  O  O     . ALA C  1 157 ? -20.484  8.881   -55.389  1.00 32.17  ? 157  ALA C O     1 
ATOM   8495  C  CB    . ALA C  1 157 ? -18.717  11.190  -56.606  1.00 14.23  ? 157  ALA C CB    1 
ATOM   8496  N  N     . TRP C  1 158 ? -21.691  10.793  -55.323  1.00 32.57  ? 158  TRP C N     1 
ATOM   8497  C  CA    . TRP C  1 158 ? -22.497  10.403  -54.171  1.00 23.00  ? 158  TRP C CA    1 
ATOM   8498  C  C     . TRP C  1 158 ? -23.437  9.249   -54.466  1.00 25.21  ? 158  TRP C C     1 
ATOM   8499  O  O     . TRP C  1 158 ? -23.974  8.639   -53.536  1.00 41.26  ? 158  TRP C O     1 
ATOM   8500  C  CB    . TRP C  1 158 ? -23.309  11.589  -53.643  1.00 24.26  ? 158  TRP C CB    1 
ATOM   8501  C  CG    . TRP C  1 158 ? -24.176  12.265  -54.672  1.00 26.64  ? 158  TRP C CG    1 
ATOM   8502  C  CD1   . TRP C  1 158 ? -25.445  11.913  -55.049  1.00 23.44  ? 158  TRP C CD1   1 
ATOM   8503  C  CD2   . TRP C  1 158 ? -23.834  13.422  -55.447  1.00 34.58  ? 158  TRP C CD2   1 
ATOM   8504  N  NE1   . TRP C  1 158 ? -25.916  12.783  -56.011  1.00 26.42  ? 158  TRP C NE1   1 
ATOM   8505  C  CE2   . TRP C  1 158 ? -24.947  13.720  -56.273  1.00 32.89  ? 158  TRP C CE2   1 
ATOM   8506  C  CE3   . TRP C  1 158 ? -22.694  14.240  -55.522  1.00 26.94  ? 158  TRP C CE3   1 
ATOM   8507  C  CZ2   . TRP C  1 158 ? -24.954  14.804  -57.166  1.00 25.64  ? 158  TRP C CZ2   1 
ATOM   8508  C  CZ3   . TRP C  1 158 ? -22.701  15.321  -56.412  1.00 29.00  ? 158  TRP C CZ3   1 
ATOM   8509  C  CH2   . TRP C  1 158 ? -23.827  15.590  -57.220  1.00 20.64  ? 158  TRP C CH2   1 
ATOM   8510  N  N     . ASN C  1 159 ? -23.638  8.960   -55.752  1.00 24.48  ? 159  ASN C N     1 
ATOM   8511  C  CA    . ASN C  1 159 ? -24.522  7.874   -56.177  1.00 25.31  ? 159  ASN C CA    1 
ATOM   8512  C  C     . ASN C  1 159 ? -23.848  6.506   -56.261  1.00 29.29  ? 159  ASN C C     1 
ATOM   8513  O  O     . ASN C  1 159 ? -24.476  5.509   -56.632  1.00 27.96  ? 159  ASN C O     1 
ATOM   8514  C  CB    . ASN C  1 159 ? -25.213  8.211   -57.500  1.00 28.20  ? 159  ASN C CB    1 
ATOM   8515  C  CG    . ASN C  1 159 ? -26.428  9.117   -57.317  1.00 31.96  ? 159  ASN C CG    1 
ATOM   8516  O  OD1   . ASN C  1 159 ? -27.276  8.869   -56.460  1.00 46.08  ? 159  ASN C OD1   1 
ATOM   8517  N  ND2   . ASN C  1 159 ? -26.524  10.162  -58.137  1.00 38.57  ? 159  ASN C ND2   1 
ATOM   8518  N  N     . SER C  1 160 ? -22.580  6.450   -55.870  1.00 31.60  ? 160  SER C N     1 
ATOM   8519  C  CA    . SER C  1 160 ? -21.829  5.202   -55.879  1.00 29.84  ? 160  SER C CA    1 
ATOM   8520  C  C     . SER C  1 160 ? -22.523  4.182   -54.966  1.00 30.15  ? 160  SER C C     1 
ATOM   8521  O  O     . SER C  1 160 ? -22.378  2.971   -55.131  1.00 31.73  ? 160  SER C O     1 
ATOM   8522  C  CB    . SER C  1 160 ? -20.406  5.463   -55.384  1.00 25.85  ? 160  SER C CB    1 
ATOM   8523  O  OG    . SER C  1 160 ? -20.413  5.974   -54.058  1.00 34.48  ? 160  SER C OG    1 
ATOM   8524  N  N     . SER C  1 161 ? -23.307  4.696   -54.026  1.00 23.57  ? 161  SER C N     1 
ATOM   8525  C  CA    . SER C  1 161 ? -24.033  3.884   -53.056  1.00 34.90  ? 161  SER C CA    1 
ATOM   8526  C  C     . SER C  1 161 ? -25.528  3.726   -53.339  1.00 35.34  ? 161  SER C C     1 
ATOM   8527  O  O     . SER C  1 161 ? -26.203  2.919   -52.693  1.00 33.88  ? 161  SER C O     1 
ATOM   8528  C  CB    . SER C  1 161 ? -23.858  4.489   -51.662  1.00 26.06  ? 161  SER C CB    1 
ATOM   8529  O  OG    . SER C  1 161 ? -24.264  5.849   -51.639  1.00 30.42  ? 161  SER C OG    1 
ATOM   8530  N  N     . THR C  1 162 ? -26.035  4.483   -54.305  1.00 24.37  ? 162  THR C N     1 
ATOM   8531  C  CA    . THR C  1 162 ? -27.454  4.467   -54.652  1.00 14.36  ? 162  THR C CA    1 
ATOM   8532  C  C     . THR C  1 162 ? -27.989  3.193   -55.301  1.00 24.43  ? 162  THR C C     1 
ATOM   8533  O  O     . THR C  1 162 ? -27.326  2.587   -56.145  1.00 38.17  ? 162  THR C O     1 
ATOM   8534  C  CB    . THR C  1 162 ? -27.789  5.664   -55.557  1.00 21.08  ? 162  THR C CB    1 
ATOM   8535  O  OG1   . THR C  1 162 ? -27.515  6.874   -54.847  1.00 26.37  ? 162  THR C OG1   1 
ATOM   8536  C  CG2   . THR C  1 162 ? -29.252  5.645   -55.987  1.00 13.45  ? 162  THR C CG2   1 
ATOM   8537  N  N     . LYS C  1 163 ? -29.187  2.782   -54.881  1.00 24.48  ? 163  LYS C N     1 
ATOM   8538  C  CA    . LYS C  1 163 ? -29.832  1.606   -55.447  1.00 28.07  ? 163  LYS C CA    1 
ATOM   8539  C  C     . LYS C  1 163 ? -30.609  2.083   -56.665  1.00 30.79  ? 163  LYS C C     1 
ATOM   8540  O  O     . LYS C  1 163 ? -31.314  3.092   -56.607  1.00 37.04  ? 163  LYS C O     1 
ATOM   8541  C  CB    . LYS C  1 163 ? -30.786  0.945   -54.449  1.00 23.34  ? 163  LYS C CB    1 
ATOM   8542  C  CG    . LYS C  1 163 ? -30.109  0.342   -53.243  1.00 33.93  ? 163  LYS C CG    1 
ATOM   8543  C  CD    . LYS C  1 163 ? -31.032  -0.610  -52.520  1.00 48.54  ? 163  LYS C CD    1 
ATOM   8544  C  CE    . LYS C  1 163 ? -30.584  -0.793  -51.077  1.00 60.77  ? 163  LYS C CE    1 
ATOM   8545  N  NZ    . LYS C  1 163 ? -31.268  -1.951  -50.446  1.00 56.75  ? 163  LYS C NZ    1 
ATOM   8546  N  N     . TYR C  1 164 ? -30.399  1.435   -57.788  1.00 31.60  ? 164  TYR C N     1 
ATOM   8547  C  CA    . TYR C  1 164 ? -31.055  1.851   -59.015  1.00 32.58  ? 164  TYR C CA    1 
ATOM   8548  C  C     . TYR C  1 164 ? -31.969  0.770   -59.453  1.00 38.02  ? 164  TYR C C     1 
ATOM   8549  O  O     . TYR C  1 164 ? -31.746  -0.375  -59.076  1.00 39.09  ? 164  TYR C O     1 
ATOM   8550  C  CB    . TYR C  1 164 ? -30.046  2.120   -60.128  1.00 16.33  ? 164  TYR C CB    1 
ATOM   8551  C  CG    . TYR C  1 164 ? -29.416  3.485   -60.002  1.00 27.17  ? 164  TYR C CG    1 
ATOM   8552  C  CD1   . TYR C  1 164 ? -29.951  4.566   -60.669  1.00 36.72  ? 164  TYR C CD1   1 
ATOM   8553  C  CD2   . TYR C  1 164 ? -28.295  3.633   -59.218  1.00 26.56  ? 164  TYR C CD2   1 
ATOM   8554  C  CE1   . TYR C  1 164 ? -29.373  5.792   -60.560  1.00 43.16  ? 164  TYR C CE1   1 
ATOM   8555  C  CE2   . TYR C  1 164 ? -27.707  4.860   -59.102  1.00 36.59  ? 164  TYR C CE2   1 
ATOM   8556  C  CZ    . TYR C  1 164 ? -28.244  5.946   -59.776  1.00 33.99  ? 164  TYR C CZ    1 
ATOM   8557  O  OH    . TYR C  1 164 ? -27.640  7.178   -59.666  1.00 44.25  ? 164  TYR C OH    1 
ATOM   8558  N  N     . GLU C  1 165 ? -32.990  1.031   -60.243  1.00 50.82  ? 165  GLU C N     1 
ATOM   8559  C  CA    . GLU C  1 165 ? -33.848  -0.087  -60.454  1.00 56.06  ? 165  GLU C CA    1 
ATOM   8560  C  C     . GLU C  1 165 ? -33.338  -1.142  -61.397  1.00 53.89  ? 165  GLU C C     1 
ATOM   8561  O  O     . GLU C  1 165 ? -33.902  -2.222  -61.437  1.00 54.52  ? 165  GLU C O     1 
ATOM   8562  C  CB    . GLU C  1 165 ? -35.267  0.392   -60.773  1.00 84.70  ? 165  GLU C CB    1 
ATOM   8563  C  CG    . GLU C  1 165 ? -35.582  0.810   -62.188  1.00 99.02  ? 165  GLU C CG    1 
ATOM   8564  C  CD    . GLU C  1 165 ? -37.016  1.311   -62.341  1.00 100.00 ? 165  GLU C CD    1 
ATOM   8565  O  OE1   . GLU C  1 165 ? -37.758  1.389   -61.340  1.00 100.00 ? 165  GLU C OE1   1 
ATOM   8566  O  OE2   . GLU C  1 165 ? -37.386  1.640   -63.488  1.00 100.00 ? 165  GLU C OE2   1 
ATOM   8567  N  N     . GLY C  1 166 ? -32.304  -0.911  -62.147  1.00 31.55  ? 166  GLY C N     1 
ATOM   8568  C  CA    . GLY C  1 166 ? -31.815  -1.996  -62.946  1.00 29.95  ? 166  GLY C CA    1 
ATOM   8569  C  C     . GLY C  1 166 ? -30.419  -2.333  -62.468  1.00 37.98  ? 166  GLY C C     1 
ATOM   8570  O  O     . GLY C  1 166 ? -29.658  -3.014  -63.158  1.00 39.59  ? 166  GLY C O     1 
ATOM   8571  N  N     . GLY C  1 167 ? -30.064  -1.879  -61.257  1.00 42.56  ? 167  GLY C N     1 
ATOM   8572  C  CA    . GLY C  1 167 ? -28.715  -2.071  -60.768  1.00 29.12  ? 167  GLY C CA    1 
ATOM   8573  C  C     . GLY C  1 167 ? -27.859  -0.839  -60.983  1.00 38.84  ? 167  GLY C C     1 
ATOM   8574  O  O     . GLY C  1 167 ? -28.024  -0.111  -61.964  1.00 32.12  ? 167  GLY C O     1 
ATOM   8575  N  N     . ASN C  1 168 ? -26.967  -0.586  -60.032  1.00 28.74  ? 168  ASN C N     1 
ATOM   8576  C  CA    . ASN C  1 168 ? -26.058  0.548   -60.098  1.00 31.86  ? 168  ASN C CA    1 
ATOM   8577  C  C     . ASN C  1 168 ? -24.896  0.037   -60.944  1.00 26.04  ? 168  ASN C C     1 
ATOM   8578  O  O     . ASN C  1 168 ? -24.281  -0.977  -60.606  1.00 32.37  ? 168  ASN C O     1 
ATOM   8579  C  CB    . ASN C  1 168 ? -25.591  0.928   -58.678  1.00 19.63  ? 168  ASN C CB    1 
ATOM   8580  C  CG    . ASN C  1 168 ? -24.799  2.228   -58.645  1.00 33.08  ? 168  ASN C CG    1 
ATOM   8581  O  OD1   . ASN C  1 168 ? -24.042  2.549   -59.569  1.00 29.49  ? 168  ASN C OD1   1 
ATOM   8582  N  ND2   . ASN C  1 168 ? -24.976  2.987   -57.578  1.00 30.78  ? 168  ASN C ND2   1 
ATOM   8583  N  N     . LYS C  1 169 ? -24.605  0.739   -62.057  1.00 23.36  ? 169  LYS C N     1 
ATOM   8584  C  CA    . LYS C  1 169 ? -23.528  0.290   -62.933  1.00 33.28  ? 169  LYS C CA    1 
ATOM   8585  C  C     . LYS C  1 169 ? -22.159  0.720   -62.465  1.00 33.61  ? 169  LYS C C     1 
ATOM   8586  O  O     . LYS C  1 169 ? -21.128  0.127   -62.812  1.00 50.33  ? 169  LYS C O     1 
ATOM   8587  C  CB    . LYS C  1 169 ? -23.944  0.587   -64.380  1.00 18.92  ? 169  LYS C CB    1 
ATOM   8588  C  CG    . LYS C  1 169 ? -25.329  0.011   -64.750  1.00 13.21  ? 169  LYS C CG    1 
ATOM   8589  C  CD    . LYS C  1 169 ? -25.470  -1.501  -64.522  1.00 21.41  ? 169  LYS C CD    1 
ATOM   8590  C  CE    . LYS C  1 169 ? -26.859  -2.022  -64.907  1.00 21.79  ? 169  LYS C CE    1 
ATOM   8591  N  NZ    . LYS C  1 169 ? -27.067  -3.431  -64.456  1.00 25.39  ? 169  LYS C NZ    1 
ATOM   8592  N  N     . GLY C  1 170 ? -22.146  1.767   -61.649  1.00 39.30  ? 170  GLY C N     1 
ATOM   8593  C  CA    . GLY C  1 170 ? -20.963  2.205   -60.928  1.00 39.79  ? 170  GLY C CA    1 
ATOM   8594  C  C     . GLY C  1 170 ? -19.794  2.878   -61.658  1.00 45.70  ? 170  GLY C C     1 
ATOM   8595  O  O     . GLY C  1 170 ? -18.772  3.098   -61.008  1.00 64.07  ? 170  GLY C O     1 
ATOM   8596  N  N     . HIS C  1 171 ? -19.843  3.216   -62.951  1.00 35.71  ? 171  HIS C N     1 
ATOM   8597  C  CA    . HIS C  1 171 ? -18.662  3.914   -63.462  1.00 28.02  ? 171  HIS C CA    1 
ATOM   8598  C  C     . HIS C  1 171 ? -18.881  5.405   -63.514  1.00 39.58  ? 171  HIS C C     1 
ATOM   8599  O  O     . HIS C  1 171 ? -19.418  5.930   -64.499  1.00 56.70  ? 171  HIS C O     1 
ATOM   8600  C  CB    . HIS C  1 171 ? -18.252  3.390   -64.829  1.00 34.23  ? 171  HIS C CB    1 
ATOM   8601  C  CG    . HIS C  1 171 ? -17.699  1.954   -64.766  1.00 17.76  ? 171  HIS C CG    1 
ATOM   8602  N  ND1   . HIS C  1 171 ? -16.527  1.638   -64.111  1.00 31.55  ? 171  HIS C ND1   1 
ATOM   8603  C  CD2   . HIS C  1 171 ? -18.182  0.786   -65.255  1.00 29.07  ? 171  HIS C CD2   1 
ATOM   8604  C  CE1   . HIS C  1 171 ? -16.315  0.336   -64.167  1.00 27.60  ? 171  HIS C CE1   1 
ATOM   8605  N  NE2   . HIS C  1 171 ? -17.306  -0.206  -64.855  1.00 30.46  ? 171  HIS C NE2   1 
ATOM   8606  N  N     . ARG C  1 172 ? -18.475  6.115   -62.471  1.00 26.96  ? 172  ARG C N     1 
ATOM   8607  C  CA    . ARG C  1 172 ? -18.677  7.542   -62.442  1.00 30.39  ? 172  ARG C CA    1 
ATOM   8608  C  C     . ARG C  1 172 ? -17.472  8.313   -61.976  1.00 36.25  ? 172  ARG C C     1 
ATOM   8609  O  O     . ARG C  1 172 ? -16.620  7.801   -61.246  1.00 43.32  ? 172  ARG C O     1 
ATOM   8610  C  CB    . ARG C  1 172 ? -19.931  7.925   -61.639  1.00 27.72  ? 172  ARG C CB    1 
ATOM   8611  C  CG    . ARG C  1 172 ? -20.183  7.152   -60.374  1.00 24.76  ? 172  ARG C CG    1 
ATOM   8612  C  CD    . ARG C  1 172 ? -21.489  7.593   -59.709  1.00 34.41  ? 172  ARG C CD    1 
ATOM   8613  N  NE    . ARG C  1 172 ? -22.759  7.097   -60.280  1.00 14.85  ? 172  ARG C NE    1 
ATOM   8614  C  CZ    . ARG C  1 172 ? -23.241  5.861   -60.117  1.00 33.24  ? 172  ARG C CZ    1 
ATOM   8615  N  NH1   . ARG C  1 172 ? -24.424  5.531   -60.628  1.00 19.71  ? 172  ARG C NH1   1 
ATOM   8616  N  NH2   . ARG C  1 172 ? -22.496  4.917   -59.549  1.00 16.30  ? 172  ARG C NH2   1 
ATOM   8617  N  N     . PRO C  1 173 ? -17.364  9.559   -62.448  1.00 32.73  ? 173  PRO C N     1 
ATOM   8618  C  CA    . PRO C  1 173 ? -16.264  10.451  -62.104  1.00 29.73  ? 173  PRO C CA    1 
ATOM   8619  C  C     . PRO C  1 173 ? -16.309  10.865  -60.637  1.00 41.10  ? 173  PRO C C     1 
ATOM   8620  O  O     . PRO C  1 173 ? -17.363  11.282  -60.133  1.00 38.99  ? 173  PRO C O     1 
ATOM   8621  C  CB    . PRO C  1 173 ? -16.509  11.645  -63.035  1.00 26.27  ? 173  PRO C CB    1 
ATOM   8622  C  CG    . PRO C  1 173 ? -17.996  11.689  -63.158  1.00 29.10  ? 173  PRO C CG    1 
ATOM   8623  C  CD    . PRO C  1 173 ? -18.325  10.229  -63.350  1.00 27.24  ? 173  PRO C CD    1 
ATOM   8624  N  N     . GLY C  1 174 ? -15.186  10.696  -59.943  1.00 39.05  ? 174  GLY C N     1 
ATOM   8625  C  CA    . GLY C  1 174 ? -15.112  11.114  -58.551  1.00 40.69  ? 174  GLY C CA    1 
ATOM   8626  C  C     . GLY C  1 174 ? -15.040  12.644  -58.467  1.00 45.08  ? 174  GLY C C     1 
ATOM   8627  O  O     . GLY C  1 174 ? -15.023  13.338  -59.492  1.00 43.03  ? 174  GLY C O     1 
ATOM   8628  N  N     . VAL C  1 175 ? -15.008  13.186  -57.253  1.00 48.60  ? 175  VAL C N     1 
ATOM   8629  C  CA    . VAL C  1 175 ? -14.936  14.637  -57.061  1.00 44.60  ? 175  VAL C CA    1 
ATOM   8630  C  C     . VAL C  1 175 ? -13.665  15.172  -57.729  1.00 49.59  ? 175  VAL C C     1 
ATOM   8631  O  O     . VAL C  1 175 ? -12.573  14.641  -57.499  1.00 55.36  ? 175  VAL C O     1 
ATOM   8632  C  CB    . VAL C  1 175 ? -14.947  14.984  -55.546  1.00 44.80  ? 175  VAL C CB    1 
ATOM   8633  C  CG1   . VAL C  1 175 ? -14.844  16.490  -55.327  1.00 31.62  ? 175  VAL C CG1   1 
ATOM   8634  C  CG2   . VAL C  1 175 ? -16.221  14.464  -54.913  1.00 36.46  ? 175  VAL C CG2   1 
ATOM   8635  N  N     . LYS C  1 176 ? -13.823  16.196  -58.573  1.00 47.13  ? 176  LYS C N     1 
ATOM   8636  C  CA    . LYS C  1 176 ? -12.705  16.809  -59.312  1.00 48.27  ? 176  LYS C CA    1 
ATOM   8637  C  C     . LYS C  1 176 ? -12.019  15.805  -60.258  1.00 47.79  ? 176  LYS C C     1 
ATOM   8638  O  O     . LYS C  1 176 ? -10.921  16.068  -60.749  1.00 40.91  ? 176  LYS C O     1 
ATOM   8639  C  CB    . LYS C  1 176 ? -11.638  17.392  -58.355  1.00 45.95  ? 176  LYS C CB    1 
ATOM   8640  C  CG    . LYS C  1 176 ? -11.921  18.760  -57.725  1.00 53.04  ? 176  LYS C CG    1 
ATOM   8641  C  CD    . LYS C  1 176 ? -10.677  19.254  -56.966  1.00 72.52  ? 176  LYS C CD    1 
ATOM   8642  C  CE    . LYS C  1 176 ? -10.820  20.674  -56.404  1.00 100.00 ? 176  LYS C CE    1 
ATOM   8643  N  NZ    . LYS C  1 176 ? -11.641  20.746  -55.157  1.00 97.77  ? 176  LYS C NZ    1 
ATOM   8644  N  N     . GLY C  1 177 ? -12.675  14.685  -60.554  1.00 40.92  ? 177  GLY C N     1 
ATOM   8645  C  CA    . GLY C  1 177 ? -12.048  13.682  -61.401  1.00 52.09  ? 177  GLY C CA    1 
ATOM   8646  C  C     . GLY C  1 177 ? -12.699  13.397  -62.735  1.00 53.17  ? 177  GLY C C     1 
ATOM   8647  O  O     . GLY C  1 177 ? -12.467  12.341  -63.348  1.00 46.65  ? 177  GLY C O     1 
ATOM   8648  N  N     . GLY C  1 178 ? -13.620  14.253  -63.193  1.00 37.96  ? 178  GLY C N     1 
ATOM   8649  C  CA    . GLY C  1 178 ? -14.366  13.934  -64.400  1.00 62.64  ? 178  GLY C CA    1 
ATOM   8650  C  C     . GLY C  1 178 ? -13.615  14.354  -65.609  1.00 59.04  ? 178  GLY C C     1 
ATOM   8651  O  O     . GLY C  1 178 ? -14.138  14.499  -66.714  1.00 66.01  ? 178  GLY C O     1 
ATOM   8652  N  N     . TYR C  1 179 ? -12.365  14.532  -65.344  0.93 56.62  ? 179  TYR C N     1 
ATOM   8653  C  CA    . TYR C  1 179 ? -11.622  15.020  -66.460  0.93 34.36  ? 179  TYR C CA    1 
ATOM   8654  C  C     . TYR C  1 179 ? -11.040  13.945  -67.289  0.39 41.24  ? 179  TYR C C     1 
ATOM   8655  O  O     . TYR C  1 179 ? -10.133  13.215  -66.923  0.93 42.02  ? 179  TYR C O     1 
ATOM   8656  C  CB    . TYR C  1 179 ? -10.627  16.028  -66.010  0.39 42.39  ? 179  TYR C CB    1 
ATOM   8657  C  CG    . TYR C  1 179 ? -10.582  17.191  -66.957  0.39 44.86  ? 179  TYR C CG    1 
ATOM   8658  C  CD1   . TYR C  1 179 ? -11.701  17.707  -67.649  0.39 60.55  ? 179  TYR C CD1   1 
ATOM   8659  C  CD2   . TYR C  1 179 ? -9.359   17.793  -67.179  0.39 52.21  ? 179  TYR C CD2   1 
ATOM   8660  C  CE1   . TYR C  1 179 ? -11.587  18.790  -68.503  0.39 78.68  ? 179  TYR C CE1   1 
ATOM   8661  C  CE2   . TYR C  1 179 ? -9.230   18.884  -68.032  0.39 64.92  ? 179  TYR C CE2   1 
ATOM   8662  C  CZ    . TYR C  1 179 ? -10.351  19.366  -68.677  0.39 68.46  ? 179  TYR C CZ    1 
ATOM   8663  O  OH    . TYR C  1 179 ? -10.227  20.430  -69.527  0.39 86.06  ? 179  TYR C OH    1 
ATOM   8664  N  N     . PHE C  1 180 ? -11.645  13.920  -68.443  1.00 55.29  ? 180  PHE C N     1 
ATOM   8665  C  CA    . PHE C  1 180 ? -11.286  13.063  -69.536  1.00 42.44  ? 180  PHE C CA    1 
ATOM   8666  C  C     . PHE C  1 180 ? -11.393  11.556  -69.278  1.00 41.55  ? 180  PHE C C     1 
ATOM   8667  O  O     . PHE C  1 180 ? -11.000  10.826  -70.177  1.00 52.43  ? 180  PHE C O     1 
ATOM   8668  C  CB    . PHE C  1 180 ? -9.911   13.446  -70.047  1.00 61.64  ? 180  PHE C CB    1 
ATOM   8669  C  CG    . PHE C  1 180 ? -9.965   14.817  -70.648  1.00 68.06  ? 180  PHE C CG    1 
ATOM   8670  C  CD1   . PHE C  1 180 ? -11.089  15.605  -70.482  1.00 63.64  ? 180  PHE C CD1   1 
ATOM   8671  C  CD2   . PHE C  1 180 ? -8.899   15.320  -71.349  1.00 76.86  ? 180  PHE C CD2   1 
ATOM   8672  C  CE1   . PHE C  1 180 ? -11.135  16.898  -70.997  1.00 80.34  ? 180  PHE C CE1   1 
ATOM   8673  C  CE2   . PHE C  1 180 ? -8.909   16.604  -71.869  1.00 77.53  ? 180  PHE C CE2   1 
ATOM   8674  C  CZ    . PHE C  1 180 ? -10.036  17.380  -71.691  1.00 81.37  ? 180  PHE C CZ    1 
ATOM   8675  N  N     . PRO C  1 181 ? -11.885  10.998  -68.157  1.00 38.25  ? 181  PRO C N     1 
ATOM   8676  C  CA    . PRO C  1 181 ? -12.072  9.519   -68.278  1.00 38.13  ? 181  PRO C CA    1 
ATOM   8677  C  C     . PRO C  1 181 ? -12.900  9.155   -69.544  1.00 30.96  ? 181  PRO C C     1 
ATOM   8678  O  O     . PRO C  1 181 ? -13.837  9.880   -69.836  1.00 45.17  ? 181  PRO C O     1 
ATOM   8679  C  CB    . PRO C  1 181 ? -12.642  9.127   -66.939  1.00 31.65  ? 181  PRO C CB    1 
ATOM   8680  C  CG    . PRO C  1 181 ? -11.851  10.008  -66.018  1.00 57.71  ? 181  PRO C CG    1 
ATOM   8681  C  CD    . PRO C  1 181 ? -11.351  11.197  -66.812  1.00 58.55  ? 181  PRO C CD    1 
ATOM   8682  N  N     . VAL C  1 182 ? -12.587  8.081   -70.293  1.00 30.94  ? 182  VAL C N     1 
ATOM   8683  C  CA    . VAL C  1 182 ? -13.418  7.747   -71.491  1.00 35.77  ? 182  VAL C CA    1 
ATOM   8684  C  C     . VAL C  1 182 ? -14.717  7.093   -71.032  1.00 35.88  ? 182  VAL C C     1 
ATOM   8685  O  O     . VAL C  1 182 ? -14.790  6.658   -69.869  1.00 37.61  ? 182  VAL C O     1 
ATOM   8686  C  CB    . VAL C  1 182 ? -12.690  6.761   -72.468  1.00 26.99  ? 182  VAL C CB    1 
ATOM   8687  C  CG1   . VAL C  1 182 ? -11.568  7.469   -73.212  1.00 32.44  ? 182  VAL C CG1   1 
ATOM   8688  C  CG2   . VAL C  1 182 ? -12.156  5.548   -71.719  1.00 27.09  ? 182  VAL C CG2   1 
ATOM   8689  N  N     . PRO C  1 183 ? -15.744  6.999   -71.874  1.00 32.70  ? 183  PRO C N     1 
ATOM   8690  C  CA    . PRO C  1 183 ? -16.993  6.362   -71.441  1.00 32.79  ? 183  PRO C CA    1 
ATOM   8691  C  C     . PRO C  1 183 ? -16.687  4.913   -71.020  1.00 35.01  ? 183  PRO C C     1 
ATOM   8692  O  O     . PRO C  1 183 ? -15.724  4.309   -71.502  1.00 46.48  ? 183  PRO C O     1 
ATOM   8693  C  CB    . PRO C  1 183 ? -17.844  6.405   -72.711  1.00 37.54  ? 183  PRO C CB    1 
ATOM   8694  C  CG    . PRO C  1 183 ? -17.437  7.692   -73.329  1.00 22.77  ? 183  PRO C CG    1 
ATOM   8695  C  CD    . PRO C  1 183 ? -15.922  7.649   -73.185  1.00 21.84  ? 183  PRO C CD    1 
ATOM   8696  N  N     . PRO C  1 184 ? -17.520  4.316   -70.155  1.00 39.78  ? 184  PRO C N     1 
ATOM   8697  C  CA    . PRO C  1 184 ? -18.743  4.800   -69.507  1.00 31.19  ? 184  PRO C CA    1 
ATOM   8698  C  C     . PRO C  1 184 ? -18.650  5.778   -68.329  1.00 27.76  ? 184  PRO C C     1 
ATOM   8699  O  O     . PRO C  1 184 ? -19.687  6.203   -67.814  1.00 44.50  ? 184  PRO C O     1 
ATOM   8700  C  CB    . PRO C  1 184 ? -19.431  3.505   -69.108  1.00 33.68  ? 184  PRO C CB    1 
ATOM   8701  C  CG    . PRO C  1 184 ? -18.292  2.644   -68.737  1.00 23.73  ? 184  PRO C CG    1 
ATOM   8702  C  CD    . PRO C  1 184 ? -17.283  2.899   -69.823  1.00 35.23  ? 184  PRO C CD    1 
ATOM   8703  N  N     . VAL C  1 185 ? -17.436  6.122   -67.892  1.00 22.71  ? 185  VAL C N     1 
ATOM   8704  C  CA    . VAL C  1 185 ? -17.254  7.076   -66.792  1.00 19.65  ? 185  VAL C CA    1 
ATOM   8705  C  C     . VAL C  1 185 ? -17.817  8.417   -67.247  1.00 25.17  ? 185  VAL C C     1 
ATOM   8706  O  O     . VAL C  1 185 ? -18.514  9.101   -66.496  1.00 36.52  ? 185  VAL C O     1 
ATOM   8707  C  CB    . VAL C  1 185 ? -15.767  7.224   -66.394  1.00 16.02  ? 185  VAL C CB    1 
ATOM   8708  C  CG1   . VAL C  1 185 ? -15.609  8.269   -65.313  1.00 7.23   ? 185  VAL C CG1   1 
ATOM   8709  C  CG2   . VAL C  1 185 ? -15.248  5.904   -65.859  1.00 13.25  ? 185  VAL C CG2   1 
ATOM   8710  N  N     . ASP C  1 186 ? -17.491  8.788   -68.481  1.00 31.72  ? 186  ASP C N     1 
ATOM   8711  C  CA    . ASP C  1 186 ? -18.005  10.013  -69.091  1.00 28.38  ? 186  ASP C CA    1 
ATOM   8712  C  C     . ASP C  1 186 ? -19.281  9.542   -69.771  1.00 34.42  ? 186  ASP C C     1 
ATOM   8713  O  O     . ASP C  1 186 ? -19.241  8.809   -70.763  1.00 33.55  ? 186  ASP C O     1 
ATOM   8714  C  CB    . ASP C  1 186 ? -17.015  10.557  -70.132  1.00 25.27  ? 186  ASP C CB    1 
ATOM   8715  C  CG    . ASP C  1 186 ? -17.610  11.648  -71.015  1.00 20.40  ? 186  ASP C CG    1 
ATOM   8716  O  OD1   . ASP C  1 186 ? -16.967  11.970  -72.032  1.00 29.51  ? 186  ASP C OD1   1 
ATOM   8717  O  OD2   . ASP C  1 186 ? -18.709  12.174  -70.724  1.00 30.37  ? 186  ASP C OD2   1 
ATOM   8718  N  N     . SER C  1 187 ? -20.416  9.979   -69.247  1.00 32.04  ? 187  SER C N     1 
ATOM   8719  C  CA    . SER C  1 187 ? -21.691  9.551   -69.791  1.00 21.93  ? 187  SER C CA    1 
ATOM   8720  C  C     . SER C  1 187 ? -22.264  10.492  -70.814  1.00 29.05  ? 187  SER C C     1 
ATOM   8721  O  O     . SER C  1 187 ? -23.372  10.252  -71.296  1.00 28.15  ? 187  SER C O     1 
ATOM   8722  C  CB    . SER C  1 187 ? -22.698  9.443   -68.660  1.00 28.29  ? 187  SER C CB    1 
ATOM   8723  O  OG    . SER C  1 187 ? -23.025  10.745  -68.201  1.00 21.00  ? 187  SER C OG    1 
ATOM   8724  N  N     . ALA C  1 188 ? -21.524  11.537  -71.172  1.00 19.22  ? 188  ALA C N     1 
ATOM   8725  C  CA    . ALA C  1 188 ? -22.074  12.517  -72.093  1.00 19.89  ? 188  ALA C CA    1 
ATOM   8726  C  C     . ALA C  1 188 ? -21.490  12.698  -73.497  1.00 24.94  ? 188  ALA C C     1 
ATOM   8727  O  O     . ALA C  1 188 ? -21.685  13.743  -74.122  1.00 30.25  ? 188  ALA C O     1 
ATOM   8728  C  CB    . ALA C  1 188 ? -22.164  13.838  -71.387  1.00 11.55  ? 188  ALA C CB    1 
ATOM   8729  N  N     . GLN C  1 189 ? -20.853  11.674  -74.039  1.00 22.79  ? 189  GLN C N     1 
ATOM   8730  C  CA    . GLN C  1 189 ? -20.286  11.823  -75.374  1.00 24.90  ? 189  GLN C CA    1 
ATOM   8731  C  C     . GLN C  1 189 ? -21.363  12.111  -76.414  1.00 21.80  ? 189  GLN C C     1 
ATOM   8732  O  O     . GLN C  1 189 ? -21.298  13.123  -77.102  1.00 30.51  ? 189  GLN C O     1 
ATOM   8733  C  CB    . GLN C  1 189 ? -19.482  10.593  -75.748  1.00 26.23  ? 189  GLN C CB    1 
ATOM   8734  C  CG    . GLN C  1 189 ? -18.803  10.675  -77.085  1.00 14.80  ? 189  GLN C CG    1 
ATOM   8735  C  CD    . GLN C  1 189 ? -17.702  11.695  -77.162  1.00 30.31  ? 189  GLN C CD    1 
ATOM   8736  O  OE1   . GLN C  1 189 ? -17.356  12.147  -78.249  1.00 37.57  ? 189  GLN C OE1   1 
ATOM   8737  N  NE2   . GLN C  1 189 ? -17.114  12.043  -76.021  1.00 20.07  ? 189  GLN C NE2   1 
ATOM   8738  N  N     . ASP C  1 190 ? -22.368  11.242  -76.501  1.00 30.46  ? 190  ASP C N     1 
ATOM   8739  C  CA    . ASP C  1 190 ? -23.449  11.432  -77.454  1.00 10.61  ? 190  ASP C CA    1 
ATOM   8740  C  C     . ASP C  1 190 ? -24.153  12.780  -77.258  1.00 26.38  ? 190  ASP C C     1 
ATOM   8741  O  O     . ASP C  1 190 ? -24.466  13.461  -78.236  1.00 25.31  ? 190  ASP C O     1 
ATOM   8742  C  CB    . ASP C  1 190 ? -24.489  10.291  -77.386  1.00 34.98  ? 190  ASP C CB    1 
ATOM   8743  C  CG    . ASP C  1 190 ? -23.944  8.933   -77.838  1.00 20.19  ? 190  ASP C CG    1 
ATOM   8744  O  OD1   . ASP C  1 190 ? -24.145  7.916   -77.136  1.00 69.33  ? 190  ASP C OD1   1 
ATOM   8745  O  OD2   . ASP C  1 190 ? -23.363  8.832   -78.926  1.00 37.68  ? 190  ASP C OD2   1 
ATOM   8746  N  N     . ILE C  1 191 ? -24.361  13.173  -76.000  1.00 34.73  ? 191  ILE C N     1 
ATOM   8747  C  CA    . ILE C  1 191 ? -25.041  14.432  -75.671  1.00 23.40  ? 191  ILE C CA    1 
ATOM   8748  C  C     . ILE C  1 191 ? -24.255  15.626  -76.180  1.00 28.63  ? 191  ILE C C     1 
ATOM   8749  O  O     . ILE C  1 191 ? -24.807  16.478  -76.868  1.00 34.01  ? 191  ILE C O     1 
ATOM   8750  C  CB    . ILE C  1 191 ? -25.278  14.579  -74.138  1.00 39.63  ? 191  ILE C CB    1 
ATOM   8751  C  CG1   . ILE C  1 191 ? -25.693  13.206  -73.563  1.00 63.36  ? 191  ILE C CG1   1 
ATOM   8752  C  CG2   . ILE C  1 191 ? -26.366  15.657  -73.855  1.00 16.31  ? 191  ILE C CG2   1 
ATOM   8753  C  CD1   . ILE C  1 191 ? -25.902  13.147  -72.048  1.00 58.84  ? 191  ILE C CD1   1 
ATOM   8754  N  N     . ARG C  1 192 ? -22.958  15.666  -75.875  1.00 36.86  ? 192  ARG C N     1 
ATOM   8755  C  CA    . ARG C  1 192 ? -22.101  16.769  -76.313  1.00 22.28  ? 192  ARG C CA    1 
ATOM   8756  C  C     . ARG C  1 192 ? -22.036  16.888  -77.840  1.00 30.93  ? 192  ARG C C     1 
ATOM   8757  O  O     . ARG C  1 192 ? -22.235  17.969  -78.401  1.00 40.45  ? 192  ARG C O     1 
ATOM   8758  C  CB    . ARG C  1 192 ? -20.693  16.665  -75.713  1.00 23.34  ? 192  ARG C CB    1 
ATOM   8759  C  CG    . ARG C  1 192 ? -20.637  16.896  -74.195  1.00 23.60  ? 192  ARG C CG    1 
ATOM   8760  C  CD    . ARG C  1 192 ? -19.206  17.118  -73.672  1.00 14.22  ? 192  ARG C CD    1 
ATOM   8761  N  NE    . ARG C  1 192 ? -18.291  16.058  -74.074  1.00 25.10  ? 192  ARG C NE    1 
ATOM   8762  C  CZ    . ARG C  1 192 ? -18.131  14.905  -73.429  1.00 26.00  ? 192  ARG C CZ    1 
ATOM   8763  N  NH1   . ARG C  1 192 ? -17.284  14.001  -73.891  1.00 33.36  ? 192  ARG C NH1   1 
ATOM   8764  N  NH2   . ARG C  1 192 ? -18.788  14.662  -72.311  1.00 35.70  ? 192  ARG C NH2   1 
ATOM   8765  N  N     . SER C  1 193 ? -21.804  15.780  -78.524  1.00 26.35  ? 193  SER C N     1 
ATOM   8766  C  CA    . SER C  1 193 ? -21.764  15.834  -79.976  1.00 16.71  ? 193  SER C CA    1 
ATOM   8767  C  C     . SER C  1 193 ? -23.045  16.308  -80.626  1.00 27.62  ? 193  SER C C     1 
ATOM   8768  O  O     . SER C  1 193 ? -22.987  16.981  -81.657  1.00 36.56  ? 193  SER C O     1 
ATOM   8769  C  CB    . SER C  1 193 ? -21.357  14.509  -80.552  1.00 26.01  ? 193  SER C CB    1 
ATOM   8770  O  OG    . SER C  1 193 ? -19.975  14.320  -80.312  1.00 27.34  ? 193  SER C OG    1 
ATOM   8771  N  N     . GLU C  1 194 ? -24.197  15.943  -80.060  1.00 24.86  ? 194  GLU C N     1 
ATOM   8772  C  CA    . GLU C  1 194 ? -25.470  16.423  -80.602  1.00 20.14  ? 194  GLU C CA    1 
ATOM   8773  C  C     . GLU C  1 194 ? -25.447  17.940  -80.464  1.00 32.34  ? 194  GLU C C     1 
ATOM   8774  O  O     . GLU C  1 194 ? -25.784  18.665  -81.403  1.00 36.34  ? 194  GLU C O     1 
ATOM   8775  C  CB    . GLU C  1 194 ? -26.670  15.892  -79.810  1.00 26.78  ? 194  GLU C CB    1 
ATOM   8776  C  CG    . GLU C  1 194 ? -27.505  14.825  -80.512  1.00 62.86  ? 194  GLU C CG    1 
ATOM   8777  C  CD    . GLU C  1 194 ? -28.194  15.350  -81.741  1.00 66.02  ? 194  GLU C CD    1 
ATOM   8778  O  OE1   . GLU C  1 194 ? -27.905  14.844  -82.851  1.00 80.89  ? 194  GLU C OE1   1 
ATOM   8779  O  OE2   . GLU C  1 194 ? -29.016  16.277  -81.588  1.00 50.58  ? 194  GLU C OE2   1 
ATOM   8780  N  N     . MET C  1 195 ? -25.018  18.420  -79.298  1.00 14.72  ? 195  MET C N     1 
ATOM   8781  C  CA    . MET C  1 195 ? -24.975  19.854  -79.073  1.00 17.34  ? 195  MET C CA    1 
ATOM   8782  C  C     . MET C  1 195 ? -24.089  20.510  -80.116  1.00 22.35  ? 195  MET C C     1 
ATOM   8783  O  O     . MET C  1 195 ? -24.424  21.571  -80.638  1.00 36.15  ? 195  MET C O     1 
ATOM   8784  C  CB    . MET C  1 195 ? -24.484  20.175  -77.666  1.00 12.95  ? 195  MET C CB    1 
ATOM   8785  C  CG    . MET C  1 195 ? -25.401  19.687  -76.557  1.00 20.91  ? 195  MET C CG    1 
ATOM   8786  S  SD    . MET C  1 195 ? -24.649  20.014  -74.965  1.00 23.94  ? 195  MET C SD    1 
ATOM   8787  C  CE    . MET C  1 195 ? -25.988  19.649  -73.856  1.00 15.46  ? 195  MET C CE    1 
ATOM   8788  N  N     . CYS C  1 196 ? -22.984  19.856  -80.461  1.00 22.87  ? 196  CYS C N     1 
ATOM   8789  C  CA    . CYS C  1 196 ? -22.078  20.409  -81.459  1.00 23.55  ? 196  CYS C CA    1 
ATOM   8790  C  C     . CYS C  1 196 ? -22.701  20.466  -82.847  1.00 28.22  ? 196  CYS C C     1 
ATOM   8791  O  O     . CYS C  1 196 ? -22.653  21.504  -83.504  1.00 33.73  ? 196  CYS C O     1 
ATOM   8792  C  CB    . CYS C  1 196 ? -20.772  19.632  -81.490  1.00 16.81  ? 196  CYS C CB    1 
ATOM   8793  S  SG    . CYS C  1 196 ? -19.804  19.830  -79.986  1.00 31.34  ? 196  CYS C SG    1 
ATOM   8794  N  N     . LEU C  1 197 ? -23.320  19.372  -83.276  1.00 17.30  ? 197  LEU C N     1 
ATOM   8795  C  CA    . LEU C  1 197 ? -23.951  19.337  -84.588  1.00 24.43  ? 197  LEU C CA    1 
ATOM   8796  C  C     . LEU C  1 197 ? -25.000  20.435  -84.729  1.00 24.77  ? 197  LEU C C     1 
ATOM   8797  O  O     . LEU C  1 197 ? -25.017  21.161  -85.733  1.00 46.69  ? 197  LEU C O     1 
ATOM   8798  C  CB    . LEU C  1 197 ? -24.586  17.970  -84.849  1.00 15.97  ? 197  LEU C CB    1 
ATOM   8799  C  CG    . LEU C  1 197 ? -23.680  16.736  -84.766  1.00 30.39  ? 197  LEU C CG    1 
ATOM   8800  C  CD1   . LEU C  1 197 ? -24.500  15.482  -85.026  1.00 21.04  ? 197  LEU C CD1   1 
ATOM   8801  C  CD2   . LEU C  1 197 ? -22.543  16.847  -85.754  1.00 13.18  ? 197  LEU C CD2   1 
ATOM   8802  N  N     . VAL C  1 198 ? -25.835  20.584  -83.703  1.00 20.58  ? 198  VAL C N     1 
ATOM   8803  C  CA    . VAL C  1 198 ? -26.895  21.594  -83.700  1.00 22.11  ? 198  VAL C CA    1 
ATOM   8804  C  C     . VAL C  1 198 ? -26.333  23.012  -83.656  1.00 28.03  ? 198  VAL C C     1 
ATOM   8805  O  O     . VAL C  1 198 ? -26.818  23.904  -84.353  1.00 42.15  ? 198  VAL C O     1 
ATOM   8806  C  CB    . VAL C  1 198 ? -27.881  21.399  -82.518  1.00 28.73  ? 198  VAL C CB    1 
ATOM   8807  C  CG1   . VAL C  1 198 ? -28.983  22.432  -82.591  1.00 17.41  ? 198  VAL C CG1   1 
ATOM   8808  C  CG2   . VAL C  1 198 ? -28.489  19.990  -82.545  1.00 8.93   ? 198  VAL C CG2   1 
ATOM   8809  N  N     . MET C  1 199 ? -25.319  23.225  -82.824  1.00 32.10  ? 199  MET C N     1 
ATOM   8810  C  CA    . MET C  1 199 ? -24.694  24.534  -82.728  1.00 23.50  ? 199  MET C CA    1 
ATOM   8811  C  C     . MET C  1 199 ? -24.221  24.945  -84.107  1.00 28.96  ? 199  MET C C     1 
ATOM   8812  O  O     . MET C  1 199 ? -24.451  26.070  -84.542  1.00 49.53  ? 199  MET C O     1 
ATOM   8813  C  CB    . MET C  1 199 ? -23.512  24.492  -81.773  1.00 27.40  ? 199  MET C CB    1 
ATOM   8814  C  CG    . MET C  1 199 ? -23.940  24.499  -80.342  1.00 18.84  ? 199  MET C CG    1 
ATOM   8815  S  SD    . MET C  1 199 ? -22.553  24.645  -79.247  1.00 31.99  ? 199  MET C SD    1 
ATOM   8816  C  CE    . MET C  1 199 ? -23.415  24.432  -77.688  1.00 30.92  ? 199  MET C CE    1 
ATOM   8817  N  N     . GLU C  1 200 ? -23.594  24.009  -84.809  1.00 26.52  ? 200  GLU C N     1 
ATOM   8818  C  CA    . GLU C  1 200 ? -23.112  24.281  -86.147  1.00 25.75  ? 200  GLU C CA    1 
ATOM   8819  C  C     . GLU C  1 200 ? -24.240  24.540  -87.133  1.00 29.47  ? 200  GLU C C     1 
ATOM   8820  O  O     . GLU C  1 200 ? -24.127  25.429  -87.975  1.00 47.01  ? 200  GLU C O     1 
ATOM   8821  C  CB    . GLU C  1 200 ? -22.162  23.189  -86.609  1.00 12.29  ? 200  GLU C CB    1 
ATOM   8822  C  CG    . GLU C  1 200 ? -20.833  23.300  -85.865  1.00 28.62  ? 200  GLU C CG    1 
ATOM   8823  C  CD    . GLU C  1 200 ? -19.705  22.526  -86.507  1.00 35.61  ? 200  GLU C CD    1 
ATOM   8824  O  OE1   . GLU C  1 200 ? -18.540  22.912  -86.263  1.00 32.01  ? 200  GLU C OE1   1 
ATOM   8825  O  OE2   . GLU C  1 200 ? -19.983  21.541  -87.236  1.00 46.98  ? 200  GLU C OE2   1 
ATOM   8826  N  N     . GLN C  1 201 ? -25.346  23.818  -86.995  1.00 27.73  ? 201  GLN C N     1 
ATOM   8827  C  CA    . GLN C  1 201 ? -26.498  24.049  -87.864  1.00 31.00  ? 201  GLN C CA    1 
ATOM   8828  C  C     . GLN C  1 201 ? -27.077  25.444  -87.582  1.00 30.90  ? 201  GLN C C     1 
ATOM   8829  O  O     . GLN C  1 201 ? -27.945  25.921  -88.310  1.00 47.29  ? 201  GLN C O     1 
ATOM   8830  C  CB    . GLN C  1 201 ? -27.608  23.032  -87.597  1.00 23.72  ? 201  GLN C CB    1 
ATOM   8831  C  CG    . GLN C  1 201 ? -27.303  21.586  -87.888  1.00 64.60  ? 201  GLN C CG    1 
ATOM   8832  C  CD    . GLN C  1 201 ? -28.365  20.657  -87.288  1.00 76.56  ? 201  GLN C CD    1 
ATOM   8833  O  OE1   . GLN C  1 201 ? -29.476  21.088  -86.941  1.00 52.75  ? 201  GLN C OE1   1 
ATOM   8834  N  NE2   . GLN C  1 201 ? -28.018  19.379  -87.144  1.00 85.15  ? 201  GLN C NE2   1 
ATOM   8835  N  N     . MET C  1 202 ? -26.670  26.052  -86.470  1.00 37.46  ? 202  MET C N     1 
ATOM   8836  C  CA    . MET C  1 202 ? -27.170  27.375  -86.118  1.00 29.72  ? 202  MET C CA    1 
ATOM   8837  C  C     . MET C  1 202 ? -26.152  28.481  -86.335  1.00 33.65  ? 202  MET C C     1 
ATOM   8838  O  O     . MET C  1 202 ? -26.306  29.597  -85.825  1.00 31.68  ? 202  MET C O     1 
ATOM   8839  C  CB    . MET C  1 202 ? -27.739  27.387  -84.699  1.00 31.85  ? 202  MET C CB    1 
ATOM   8840  C  CG    . MET C  1 202 ? -29.030  26.583  -84.598  1.00 34.26  ? 202  MET C CG    1 
ATOM   8841  S  SD    . MET C  1 202 ? -29.830  26.679  -82.997  1.00 31.50  ? 202  MET C SD    1 
ATOM   8842  C  CE    . MET C  1 202 ? -30.806  28.153  -83.168  1.00 22.85  ? 202  MET C CE    1 
ATOM   8843  N  N     . GLY C  1 203 ? -25.114  28.161  -87.107  1.00 32.11  ? 203  GLY C N     1 
ATOM   8844  C  CA    . GLY C  1 203 ? -24.100  29.143  -87.452  1.00 35.86  ? 203  GLY C CA    1 
ATOM   8845  C  C     . GLY C  1 203 ? -22.807  29.194  -86.680  1.00 36.04  ? 203  GLY C C     1 
ATOM   8846  O  O     . GLY C  1 203 ? -21.884  29.944  -87.035  1.00 50.31  ? 203  GLY C O     1 
ATOM   8847  N  N     . LEU C  1 204 ? -22.741  28.434  -85.601  1.00 30.29  ? 204  LEU C N     1 
ATOM   8848  C  CA    . LEU C  1 204 ? -21.538  28.420  -84.794  1.00 32.25  ? 204  LEU C CA    1 
ATOM   8849  C  C     . LEU C  1 204 ? -20.519  27.469  -85.388  1.00 30.09  ? 204  LEU C C     1 
ATOM   8850  O  O     . LEU C  1 204 ? -20.852  26.636  -86.244  1.00 30.71  ? 204  LEU C O     1 
ATOM   8851  C  CB    . LEU C  1 204 ? -21.863  28.027  -83.350  1.00 19.51  ? 204  LEU C CB    1 
ATOM   8852  C  CG    . LEU C  1 204 ? -22.398  29.129  -82.435  1.00 30.48  ? 204  LEU C CG    1 
ATOM   8853  C  CD1   . LEU C  1 204 ? -23.777  29.535  -82.861  1.00 26.36  ? 204  LEU C CD1   1 
ATOM   8854  C  CD2   . LEU C  1 204 ? -22.401  28.660  -80.986  1.00 25.67  ? 204  LEU C CD2   1 
ATOM   8855  N  N     . VAL C  1 205 ? -19.263  27.653  -84.998  1.00 21.94  ? 205  VAL C N     1 
ATOM   8856  C  CA    . VAL C  1 205 ? -18.199  26.775  -85.458  1.00 26.10  ? 205  VAL C CA    1 
ATOM   8857  C  C     . VAL C  1 205 ? -17.576  26.174  -84.225  1.00 37.72  ? 205  VAL C C     1 
ATOM   8858  O  O     . VAL C  1 205 ? -17.062  26.888  -83.355  1.00 35.77  ? 205  VAL C O     1 
ATOM   8859  C  CB    . VAL C  1 205 ? -17.146  27.515  -86.289  1.00 32.97  ? 205  VAL C CB    1 
ATOM   8860  C  CG1   . VAL C  1 205 ? -15.963  26.594  -86.595  1.00 15.39  ? 205  VAL C CG1   1 
ATOM   8861  C  CG2   . VAL C  1 205 ? -17.770  27.966  -87.584  1.00 14.21  ? 205  VAL C CG2   1 
ATOM   8862  N  N     . VAL C  1 206 ? -17.672  24.854  -84.139  1.00 37.14  ? 206  VAL C N     1 
ATOM   8863  C  CA    . VAL C  1 206 ? -17.154  24.131  -82.995  1.00 32.61  ? 206  VAL C CA    1 
ATOM   8864  C  C     . VAL C  1 206 ? -15.701  23.743  -83.149  1.00 32.25  ? 206  VAL C C     1 
ATOM   8865  O  O     . VAL C  1 206 ? -15.288  23.241  -84.188  1.00 46.55  ? 206  VAL C O     1 
ATOM   8866  C  CB    . VAL C  1 206 ? -17.995  22.876  -82.721  1.00 29.64  ? 206  VAL C CB    1 
ATOM   8867  C  CG1   . VAL C  1 206 ? -17.394  22.082  -81.578  1.00 27.77  ? 206  VAL C CG1   1 
ATOM   8868  C  CG2   . VAL C  1 206 ? -19.420  23.276  -82.382  1.00 22.54  ? 206  VAL C CG2   1 
ATOM   8869  N  N     . GLU C  1 207 ? -14.935  23.986  -82.096  1.00 34.20  ? 207  GLU C N     1 
ATOM   8870  C  CA    . GLU C  1 207 ? -13.520  23.657  -82.078  1.00 33.28  ? 207  GLU C CA    1 
ATOM   8871  C  C     . GLU C  1 207 ? -13.230  22.365  -81.310  1.00 34.10  ? 207  GLU C C     1 
ATOM   8872  O  O     . GLU C  1 207 ? -12.337  21.606  -81.691  1.00 39.72  ? 207  GLU C O     1 
ATOM   8873  C  CB    . GLU C  1 207 ? -12.715  24.828  -81.505  1.00 30.09  ? 207  GLU C CB    1 
ATOM   8874  C  CG    . GLU C  1 207 ? -11.895  25.550  -82.561  1.00 49.36  ? 207  GLU C CG    1 
ATOM   8875  C  CD    . GLU C  1 207 ? -11.727  27.032  -82.306  1.00 54.22  ? 207  GLU C CD    1 
ATOM   8876  O  OE1   . GLU C  1 207 ? -11.853  27.474  -81.141  1.00 75.85  ? 207  GLU C OE1   1 
ATOM   8877  O  OE2   . GLU C  1 207 ? -11.461  27.759  -83.290  1.00 67.29  ? 207  GLU C OE2   1 
ATOM   8878  N  N     . ALA C  1 208 ? -14.006  22.101  -80.258  1.00 38.91  ? 208  ALA C N     1 
ATOM   8879  C  CA    . ALA C  1 208 ? -13.829  20.894  -79.439  1.00 36.51  ? 208  ALA C CA    1 
ATOM   8880  C  C     . ALA C  1 208 ? -14.928  20.696  -78.409  1.00 31.60  ? 208  ALA C C     1 
ATOM   8881  O  O     . ALA C  1 208 ? -15.694  21.617  -78.119  1.00 33.44  ? 208  ALA C O     1 
ATOM   8882  C  CB    . ALA C  1 208 ? -12.506  20.965  -78.701  1.00 19.52  ? 208  ALA C CB    1 
ATOM   8883  N  N     . HIS C  1 209 ? -15.006  19.478  -77.869  1.00 28.07  ? 209  HIS C N     1 
ATOM   8884  C  CA    . HIS C  1 209 ? -15.955  19.163  -76.799  1.00 19.78  ? 209  HIS C CA    1 
ATOM   8885  C  C     . HIS C  1 209 ? -15.363  18.136  -75.858  1.00 22.51  ? 209  HIS C C     1 
ATOM   8886  O  O     . HIS C  1 209 ? -14.618  17.249  -76.266  1.00 20.13  ? 209  HIS C O     1 
ATOM   8887  C  CB    . HIS C  1 209 ? -17.371  18.794  -77.303  1.00 21.87  ? 209  HIS C CB    1 
ATOM   8888  C  CG    . HIS C  1 209 ? -17.582  17.349  -77.641  1.00 27.93  ? 209  HIS C CG    1 
ATOM   8889  N  ND1   . HIS C  1 209 ? -17.368  16.326  -76.742  1.00 27.74  ? 209  HIS C ND1   1 
ATOM   8890  C  CD2   . HIS C  1 209 ? -18.090  16.768  -78.757  1.00 26.67  ? 209  HIS C CD2   1 
ATOM   8891  C  CE1   . HIS C  1 209 ? -17.736  15.179  -77.288  1.00 35.58  ? 209  HIS C CE1   1 
ATOM   8892  N  NE2   . HIS C  1 209 ? -18.178  15.420  -78.509  1.00 19.48  ? 209  HIS C NE2   1 
ATOM   8893  N  N     . HIS C  1 210 ? -15.647  18.302  -74.579  1.00 25.63  ? 210  HIS C N     1 
ATOM   8894  C  CA    . HIS C  1 210 ? -15.107  17.398  -73.589  1.00 29.21  ? 210  HIS C CA    1 
ATOM   8895  C  C     . HIS C  1 210 ? -15.810  17.554  -72.262  1.00 27.65  ? 210  HIS C C     1 
ATOM   8896  O  O     . HIS C  1 210 ? -16.490  18.555  -72.022  1.00 27.97  ? 210  HIS C O     1 
ATOM   8897  C  CB    . HIS C  1 210 ? -13.629  17.719  -73.386  1.00 17.14  ? 210  HIS C CB    1 
ATOM   8898  C  CG    . HIS C  1 210 ? -13.365  19.142  -72.977  1.00 21.45  ? 210  HIS C CG    1 
ATOM   8899  N  ND1   . HIS C  1 210 ? -13.308  19.544  -71.660  1.00 25.99  ? 210  HIS C ND1   1 
ATOM   8900  C  CD2   . HIS C  1 210 ? -13.138  20.256  -73.716  1.00 29.56  ? 210  HIS C CD2   1 
ATOM   8901  C  CE1   . HIS C  1 210 ? -13.057  20.842  -71.603  1.00 23.85  ? 210  HIS C CE1   1 
ATOM   8902  N  NE2   . HIS C  1 210 ? -12.949  21.298  -72.840  1.00 23.65  ? 210  HIS C NE2   1 
ATOM   8903  N  N     . HIS C  1 211 ? -15.631  16.555  -71.404  1.00 20.12  ? 211  HIS C N     1 
ATOM   8904  C  CA    . HIS C  1 211 ? -16.187  16.591  -70.062  1.00 25.28  ? 211  HIS C CA    1 
ATOM   8905  C  C     . HIS C  1 211 ? -15.269  17.526  -69.278  1.00 25.23  ? 211  HIS C C     1 
ATOM   8906  O  O     . HIS C  1 211 ? -14.107  17.681  -69.625  1.00 24.94  ? 211  HIS C O     1 
ATOM   8907  C  CB    . HIS C  1 211 ? -16.131  15.206  -69.429  1.00 25.04  ? 211  HIS C CB    1 
ATOM   8908  C  CG    . HIS C  1 211 ? -16.899  15.093  -68.148  1.00 30.78  ? 211  HIS C CG    1 
ATOM   8909  N  ND1   . HIS C  1 211 ? -17.993  14.267  -68.006  1.00 28.34  ? 211  HIS C ND1   1 
ATOM   8910  C  CD2   . HIS C  1 211 ? -16.740  15.714  -66.955  1.00 21.00  ? 211  HIS C CD2   1 
ATOM   8911  C  CE1   . HIS C  1 211 ? -18.478  14.388  -66.783  1.00 21.09  ? 211  HIS C CE1   1 
ATOM   8912  N  NE2   . HIS C  1 211 ? -17.738  15.259  -66.124  1.00 30.07  ? 211  HIS C NE2   1 
ATOM   8913  N  N     . GLU C  1 212 ? -15.784  18.165  -68.239  1.00 20.52  ? 212  GLU C N     1 
ATOM   8914  C  CA    . GLU C  1 212 ? -14.953  19.060  -67.451  1.00 17.97  ? 212  GLU C CA    1 
ATOM   8915  C  C     . GLU C  1 212 ? -14.536  18.409  -66.144  1.00 25.00  ? 212  GLU C C     1 
ATOM   8916  O  O     . GLU C  1 212 ? -14.822  17.246  -65.917  1.00 35.23  ? 212  GLU C O     1 
ATOM   8917  C  CB    . GLU C  1 212 ? -15.660  20.386  -67.202  1.00 27.79  ? 212  GLU C CB    1 
ATOM   8918  C  CG    . GLU C  1 212 ? -15.144  21.534  -68.058  1.00 26.49  ? 212  GLU C CG    1 
ATOM   8919  C  CD    . GLU C  1 212 ? -13.703  21.931  -67.737  1.00 39.65  ? 212  GLU C CD    1 
ATOM   8920  O  OE1   . GLU C  1 212 ? -13.280  21.818  -66.560  1.00 40.28  ? 212  GLU C OE1   1 
ATOM   8921  O  OE2   . GLU C  1 212 ? -13.006  22.391  -68.667  1.00 36.49  ? 212  GLU C OE2   1 
ATOM   8922  N  N     . VAL C  1 213 ? -13.891  19.173  -65.274  1.00 27.67  ? 213  VAL C N     1 
ATOM   8923  C  CA    . VAL C  1 213 ? -13.384  18.660  -64.003  1.00 37.92  ? 213  VAL C CA    1 
ATOM   8924  C  C     . VAL C  1 213 ? -14.362  18.120  -62.951  1.00 30.24  ? 213  VAL C C     1 
ATOM   8925  O  O     . VAL C  1 213 ? -14.135  17.071  -62.341  1.00 34.80  ? 213  VAL C O     1 
ATOM   8926  C  CB    . VAL C  1 213 ? -12.498  19.720  -63.333  1.00 33.02  ? 213  VAL C CB    1 
ATOM   8927  C  CG1   . VAL C  1 213 ? -11.978  19.232  -62.004  1.00 38.72  ? 213  VAL C CG1   1 
ATOM   8928  C  CG2   . VAL C  1 213 ? -11.372  20.062  -64.228  1.00 27.99  ? 213  VAL C CG2   1 
ATOM   8929  N  N     . ALA C  1 214 ? -15.445  18.833  -62.718  1.00 25.64  ? 214  ALA C N     1 
ATOM   8930  C  CA    . ALA C  1 214 ? -16.368  18.401  -61.693  1.00 32.66  ? 214  ALA C CA    1 
ATOM   8931  C  C     . ALA C  1 214 ? -17.131  17.110  -61.973  1.00 36.49  ? 214  ALA C C     1 
ATOM   8932  O  O     . ALA C  1 214 ? -17.306  16.699  -63.125  1.00 35.24  ? 214  ALA C O     1 
ATOM   8933  C  CB    . ALA C  1 214 ? -17.336  19.534  -61.363  1.00 35.27  ? 214  ALA C CB    1 
ATOM   8934  N  N     . THR C  1 215 ? -17.525  16.446  -60.890  1.00 36.82  ? 215  THR C N     1 
ATOM   8935  C  CA    . THR C  1 215 ? -18.331  15.237  -60.964  1.00 26.09  ? 215  THR C CA    1 
ATOM   8936  C  C     . THR C  1 215 ? -19.750  15.750  -61.282  1.00 32.61  ? 215  THR C C     1 
ATOM   8937  O  O     . THR C  1 215 ? -19.961  16.950  -61.481  1.00 44.23  ? 215  THR C O     1 
ATOM   8938  C  CB    . THR C  1 215 ? -18.338  14.484  -59.594  1.00 33.46  ? 215  THR C CB    1 
ATOM   8939  O  OG1   . THR C  1 215 ? -19.123  13.287  -59.694  1.00 49.55  ? 215  THR C OG1   1 
ATOM   8940  C  CG2   . THR C  1 215 ? -18.915  15.355  -58.479  1.00 15.00  ? 215  THR C CG2   1 
ATOM   8941  N  N     . ALA C  1 216 ? -20.714  14.851  -61.371  1.00 35.30  ? 216  ALA C N     1 
ATOM   8942  C  CA    . ALA C  1 216 ? -22.093  15.240  -61.613  1.00 35.46  ? 216  ALA C CA    1 
ATOM   8943  C  C     . ALA C  1 216 ? -22.322  16.054  -62.879  1.00 39.28  ? 216  ALA C C     1 
ATOM   8944  O  O     . ALA C  1 216 ? -23.155  16.942  -62.881  1.00 36.36  ? 216  ALA C O     1 
ATOM   8945  C  CB    . ALA C  1 216 ? -22.599  16.003  -60.396  1.00 29.94  ? 216  ALA C CB    1 
ATOM   8946  N  N     . GLY C  1 217 ? -21.581  15.749  -63.940  1.00 35.96  ? 217  GLY C N     1 
ATOM   8947  C  CA    . GLY C  1 217 ? -21.842  16.304  -65.263  1.00 21.78  ? 217  GLY C CA    1 
ATOM   8948  C  C     . GLY C  1 217 ? -21.304  17.673  -65.691  1.00 22.99  ? 217  GLY C C     1 
ATOM   8949  O  O     . GLY C  1 217 ? -21.998  18.378  -66.426  1.00 28.06  ? 217  GLY C O     1 
ATOM   8950  N  N     . GLN C  1 218 ? -20.113  18.092  -65.261  1.00 18.26  ? 218  GLN C N     1 
ATOM   8951  C  CA    . GLN C  1 218 ? -19.637  19.360  -65.825  1.00 14.89  ? 218  GLN C CA    1 
ATOM   8952  C  C     . GLN C  1 218 ? -19.147  19.042  -67.235  1.00 21.58  ? 218  GLN C C     1 
ATOM   8953  O  O     . GLN C  1 218 ? -18.433  18.064  -67.451  1.00 30.83  ? 218  GLN C O     1 
ATOM   8954  C  CB    . GLN C  1 218 ? -18.548  20.016  -64.993  1.00 14.94  ? 218  GLN C CB    1 
ATOM   8955  C  CG    . GLN C  1 218 ? -18.403  21.486  -65.376  1.00 18.19  ? 218  GLN C CG    1 
ATOM   8956  C  CD    . GLN C  1 218 ? -17.381  22.248  -64.548  1.00 15.27  ? 218  GLN C CD    1 
ATOM   8957  O  OE1   . GLN C  1 218 ? -17.654  23.370  -64.121  1.00 38.93  ? 218  GLN C OE1   1 
ATOM   8958  N  NE2   . GLN C  1 218 ? -16.174  21.832  -64.216  1.00 15.68  ? 218  GLN C NE2   1 
ATOM   8959  N  N     . ASN C  1 219 ? -19.527  19.872  -68.197  1.00 31.02  ? 219  ASN C N     1 
ATOM   8960  C  CA    . ASN C  1 219 ? -19.137  19.662  -69.585  1.00 22.50  ? 219  ASN C CA    1 
ATOM   8961  C  C     . ASN C  1 219 ? -18.798  20.972  -70.273  1.00 28.68  ? 219  ASN C C     1 
ATOM   8962  O  O     . ASN C  1 219 ? -19.079  22.053  -69.741  1.00 26.63  ? 219  ASN C O     1 
ATOM   8963  C  CB    . ASN C  1 219 ? -20.268  18.973  -70.339  1.00 17.44  ? 219  ASN C CB    1 
ATOM   8964  C  CG    . ASN C  1 219 ? -20.476  17.552  -69.886  1.00 26.00  ? 219  ASN C CG    1 
ATOM   8965  O  OD1   . ASN C  1 219 ? -21.325  17.271  -69.041  1.00 36.06  ? 219  ASN C OD1   1 
ATOM   8966  N  ND2   . ASN C  1 219 ? -19.701  16.642  -70.448  1.00 25.44  ? 219  ASN C ND2   1 
ATOM   8967  N  N     . GLU C  1 220 ? -18.218  20.870  -71.466  1.00 21.85  ? 220  GLU C N     1 
ATOM   8968  C  CA    . GLU C  1 220 ? -17.854  22.056  -72.221  1.00 25.37  ? 220  GLU C CA    1 
ATOM   8969  C  C     . GLU C  1 220 ? -17.790  21.840  -73.718  1.00 29.74  ? 220  GLU C C     1 
ATOM   8970  O  O     . GLU C  1 220 ? -17.336  20.796  -74.188  1.00 33.41  ? 220  GLU C O     1 
ATOM   8971  C  CB    . GLU C  1 220 ? -16.494  22.572  -71.771  1.00 25.46  ? 220  GLU C CB    1 
ATOM   8972  C  CG    . GLU C  1 220 ? -16.229  23.982  -72.246  1.00 30.89  ? 220  GLU C CG    1 
ATOM   8973  C  CD    . GLU C  1 220 ? -14.854  24.517  -71.868  1.00 37.48  ? 220  GLU C CD    1 
ATOM   8974  O  OE1   . GLU C  1 220 ? -14.247  24.098  -70.851  1.00 20.94  ? 220  GLU C OE1   1 
ATOM   8975  O  OE2   . GLU C  1 220 ? -14.379  25.385  -72.612  1.00 31.52  ? 220  GLU C OE2   1 
ATOM   8976  N  N     . VAL C  1 221 ? -18.298  22.822  -74.458  1.00 32.11  ? 221  VAL C N     1 
ATOM   8977  C  CA    . VAL C  1 221 ? -18.234  22.808  -75.912  1.00 30.41  ? 221  VAL C CA    1 
ATOM   8978  C  C     . VAL C  1 221 ? -17.529  24.094  -76.309  1.00 36.42  ? 221  VAL C C     1 
ATOM   8979  O  O     . VAL C  1 221 ? -18.050  25.187  -76.084  1.00 43.78  ? 221  VAL C O     1 
ATOM   8980  C  CB    . VAL C  1 221 ? -19.604  22.790  -76.580  1.00 23.02  ? 221  VAL C CB    1 
ATOM   8981  C  CG1   . VAL C  1 221 ? -19.437  23.023  -78.087  1.00 21.49  ? 221  VAL C CG1   1 
ATOM   8982  C  CG2   . VAL C  1 221 ? -20.268  21.458  -76.353  1.00 13.87  ? 221  VAL C CG2   1 
ATOM   8983  N  N     . ALA C  1 222 ? -16.318  23.961  -76.841  1.00 35.17  ? 222  ALA C N     1 
ATOM   8984  C  CA    . ALA C  1 222 ? -15.530  25.109  -77.270  1.00 29.25  ? 222  ALA C CA    1 
ATOM   8985  C  C     . ALA C  1 222 ? -15.880  25.514  -78.708  1.00 31.15  ? 222  ALA C C     1 
ATOM   8986  O  O     . ALA C  1 222 ? -15.803  24.706  -79.634  1.00 42.36  ? 222  ALA C O     1 
ATOM   8987  C  CB    . ALA C  1 222 ? -14.056  24.790  -77.160  1.00 30.92  ? 222  ALA C CB    1 
ATOM   8988  N  N     . THR C  1 223 ? -16.315  26.757  -78.868  1.00 23.74  ? 223  THR C N     1 
ATOM   8989  C  CA    . THR C  1 223 ? -16.682  27.300  -80.168  1.00 27.82  ? 223  THR C CA    1 
ATOM   8990  C  C     . THR C  1 223 ? -15.643  28.340  -80.568  1.00 38.82  ? 223  THR C C     1 
ATOM   8991  O  O     . THR C  1 223 ? -14.931  28.877  -79.711  1.00 26.61  ? 223  THR C O     1 
ATOM   8992  C  CB    . THR C  1 223 ? -18.071  27.939  -80.130  1.00 17.44  ? 223  THR C CB    1 
ATOM   8993  O  OG1   . THR C  1 223 ? -18.167  28.820  -79.004  1.00 41.02  ? 223  THR C OG1   1 
ATOM   8994  C  CG2   . THR C  1 223 ? -19.119  26.864  -79.998  1.00 30.41  ? 223  THR C CG2   1 
ATOM   8995  N  N     . ARG C  1 224 ? -15.540  28.583  -81.875  1.00 37.66  ? 224  ARG C N     1 
ATOM   8996  C  CA    . ARG C  1 224 ? -14.582  29.531  -82.435  1.00 28.17  ? 224  ARG C CA    1 
ATOM   8997  C  C     . ARG C  1 224 ? -14.966  30.967  -82.142  1.00 37.49  ? 224  ARG C C     1 
ATOM   8998  O  O     . ARG C  1 224 ? -16.153  31.303  -82.081  1.00 36.22  ? 224  ARG C O     1 
ATOM   8999  C  CB    . ARG C  1 224 ? -14.472  29.322  -83.950  1.00 44.13  ? 224  ARG C CB    1 
ATOM   9000  C  CG    . ARG C  1 224 ? -13.466  30.230  -84.659  1.00 43.37  ? 224  ARG C CG    1 
ATOM   9001  C  CD    . ARG C  1 224 ? -12.925  29.594  -85.955  1.00 55.57  ? 224  ARG C CD    1 
ATOM   9002  N  NE    . ARG C  1 224 ? -13.660  29.825  -87.211  1.00 57.19  ? 224  ARG C NE    1 
ATOM   9003  C  CZ    . ARG C  1 224 ? -14.773  30.547  -87.390  1.00 80.87  ? 224  ARG C CZ    1 
ATOM   9004  N  NH1   . ARG C  1 224 ? -15.274  30.636  -88.617  1.00 61.84  ? 224  ARG C NH1   1 
ATOM   9005  N  NH2   . ARG C  1 224 ? -15.411  31.153  -86.384  1.00 79.82  ? 224  ARG C NH2   1 
ATOM   9006  N  N     . PHE C  1 225 ? -13.953  31.812  -81.979  1.00 32.82  ? 225  PHE C N     1 
ATOM   9007  C  CA    . PHE C  1 225 ? -14.151  33.239  -81.709  1.00 30.72  ? 225  PHE C CA    1 
ATOM   9008  C  C     . PHE C  1 225 ? -14.936  33.916  -82.841  1.00 31.21  ? 225  PHE C C     1 
ATOM   9009  O  O     . PHE C  1 225 ? -15.244  33.297  -83.871  1.00 44.23  ? 225  PHE C O     1 
ATOM   9010  C  CB    . PHE C  1 225 ? -12.798  33.930  -81.601  1.00 37.45  ? 225  PHE C CB    1 
ATOM   9011  C  CG    . PHE C  1 225 ? -12.085  34.024  -82.911  1.00 45.24  ? 225  PHE C CG    1 
ATOM   9012  C  CD1   . PHE C  1 225 ? -11.315  32.964  -83.370  1.00 56.86  ? 225  PHE C CD1   1 
ATOM   9013  C  CD2   . PHE C  1 225 ? -12.257  35.133  -83.730  1.00 50.64  ? 225  PHE C CD2   1 
ATOM   9014  C  CE1   . PHE C  1 225 ? -10.734  33.000  -84.626  1.00 43.03  ? 225  PHE C CE1   1 
ATOM   9015  C  CE2   . PHE C  1 225 ? -11.681  35.180  -84.990  1.00 43.05  ? 225  PHE C CE2   1 
ATOM   9016  C  CZ    . PHE C  1 225 ? -10.920  34.114  -85.440  1.00 42.51  ? 225  PHE C CZ    1 
ATOM   9017  N  N     . ASN C  1 226 ? -15.181  35.213  -82.671  1.00 33.78  ? 226  ASN C N     1 
ATOM   9018  C  CA    . ASN C  1 226 ? -15.912  36.007  -83.652  1.00 30.27  ? 226  ASN C CA    1 
ATOM   9019  C  C     . ASN C  1 226 ? -15.933  37.456  -83.179  1.00 36.37  ? 226  ASN C C     1 
ATOM   9020  O  O     . ASN C  1 226 ? -15.478  37.754  -82.071  1.00 30.37  ? 226  ASN C O     1 
ATOM   9021  C  CB    . ASN C  1 226 ? -17.334  35.482  -83.794  1.00 27.77  ? 226  ASN C CB    1 
ATOM   9022  C  CG    . ASN C  1 226 ? -17.945  35.804  -85.136  1.00 36.41  ? 226  ASN C CG    1 
ATOM   9023  O  OD1   . ASN C  1 226 ? -17.560  36.766  -85.804  1.00 55.51  ? 226  ASN C OD1   1 
ATOM   9024  N  ND2   . ASN C  1 226 ? -18.916  35.001  -85.538  1.00 38.40  ? 226  ASN C ND2   1 
ATOM   9025  N  N     . THR C  1 227 ? -16.449  38.361  -84.007  1.00 34.44  ? 227  THR C N     1 
ATOM   9026  C  CA    . THR C  1 227 ? -16.485  39.771  -83.626  1.00 40.75  ? 227  THR C CA    1 
ATOM   9027  C  C     . THR C  1 227 ? -17.351  39.885  -82.359  1.00 39.99  ? 227  THR C C     1 
ATOM   9028  O  O     . THR C  1 227 ? -18.316  39.128  -82.170  1.00 46.23  ? 227  THR C O     1 
ATOM   9029  C  CB    . THR C  1 227 ? -17.019  40.682  -84.769  1.00 34.87  ? 227  THR C CB    1 
ATOM   9030  O  OG1   . THR C  1 227 ? -18.374  40.356  -85.035  1.00 35.08  ? 227  THR C OG1   1 
ATOM   9031  C  CG2   . THR C  1 227 ? -16.299  40.428  -86.054  1.00 21.88  ? 227  THR C CG2   1 
ATOM   9032  N  N     . MET C  1 228 ? -17.029  40.858  -81.518  1.00 35.48  ? 228  MET C N     1 
ATOM   9033  C  CA    . MET C  1 228 ? -17.725  41.015  -80.257  1.00 33.55  ? 228  MET C CA    1 
ATOM   9034  C  C     . MET C  1 228 ? -19.226  40.813  -80.208  1.00 31.97  ? 228  MET C C     1 
ATOM   9035  O  O     . MET C  1 228 ? -19.688  39.886  -79.557  1.00 51.56  ? 228  MET C O     1 
ATOM   9036  C  CB    . MET C  1 228 ? -17.362  42.318  -79.570  1.00 34.07  ? 228  MET C CB    1 
ATOM   9037  C  CG    . MET C  1 228 ? -17.864  42.322  -78.149  1.00 32.29  ? 228  MET C CG    1 
ATOM   9038  S  SD    . MET C  1 228 ? -17.493  43.806  -77.259  1.00 38.66  ? 228  MET C SD    1 
ATOM   9039  C  CE    . MET C  1 228 ? -18.807  44.825  -77.880  1.00 18.83  ? 228  MET C CE    1 
ATOM   9040  N  N     . THR C  1 229 ? -19.990  41.651  -80.890  1.00 41.30  ? 229  THR C N     1 
ATOM   9041  C  CA    . THR C  1 229 ? -21.438  41.510  -80.841  1.00 36.11  ? 229  THR C CA    1 
ATOM   9042  C  C     . THR C  1 229 ? -21.945  40.188  -81.418  1.00 37.42  ? 229  THR C C     1 
ATOM   9043  O  O     . THR C  1 229 ? -22.808  39.545  -80.829  1.00 38.27  ? 229  THR C O     1 
ATOM   9044  C  CB    . THR C  1 229 ? -22.138  42.699  -81.501  1.00 34.58  ? 229  THR C CB    1 
ATOM   9045  O  OG1   . THR C  1 229 ? -21.641  43.913  -80.924  1.00 38.50  ? 229  THR C OG1   1 
ATOM   9046  C  CG2   . THR C  1 229 ? -23.629  42.627  -81.270  1.00 30.13  ? 229  THR C CG2   1 
ATOM   9047  N  N     . LYS C  1 230 ? -21.382  39.758  -82.540  1.00 36.58  ? 230  LYS C N     1 
ATOM   9048  C  CA    . LYS C  1 230 ? -21.806  38.503  -83.134  1.00 33.60  ? 230  LYS C CA    1 
ATOM   9049  C  C     . LYS C  1 230 ? -21.534  37.360  -82.150  1.00 33.70  ? 230  LYS C C     1 
ATOM   9050  O  O     . LYS C  1 230 ? -22.357  36.459  -81.992  1.00 37.48  ? 230  LYS C O     1 
ATOM   9051  C  CB    . LYS C  1 230 ? -21.113  38.258  -84.488  1.00 35.59  ? 230  LYS C CB    1 
ATOM   9052  C  CG    . LYS C  1 230 ? -21.659  37.041  -85.245  1.00 65.71  ? 230  LYS C CG    1 
ATOM   9053  C  CD    . LYS C  1 230 ? -21.372  37.111  -86.731  1.00 89.00  ? 230  LYS C CD    1 
ATOM   9054  C  CE    . LYS C  1 230 ? -21.972  38.373  -87.343  1.00 100.00 ? 230  LYS C CE    1 
ATOM   9055  N  NZ    . LYS C  1 230 ? -21.680  38.474  -88.799  1.00 90.42  ? 230  LYS C NZ    1 
ATOM   9056  N  N     . LYS C  1 231 ? -20.418  37.436  -81.434  1.00 36.63  ? 231  LYS C N     1 
ATOM   9057  C  CA    . LYS C  1 231 ? -20.089  36.393  -80.473  1.00 39.23  ? 231  LYS C CA    1 
ATOM   9058  C  C     . LYS C  1 231 ? -21.070  36.331  -79.303  1.00 39.32  ? 231  LYS C C     1 
ATOM   9059  O  O     . LYS C  1 231 ? -21.413  35.245  -78.842  1.00 45.03  ? 231  LYS C O     1 
ATOM   9060  C  CB    . LYS C  1 231 ? -18.657  36.533  -79.960  1.00 31.71  ? 231  LYS C CB    1 
ATOM   9061  C  CG    . LYS C  1 231 ? -18.166  35.272  -79.265  1.00 34.47  ? 231  LYS C CG    1 
ATOM   9062  C  CD    . LYS C  1 231 ? -18.492  34.055  -80.119  1.00 36.93  ? 231  LYS C CD    1 
ATOM   9063  C  CE    . LYS C  1 231 ? -18.051  32.758  -79.490  1.00 26.18  ? 231  LYS C CE    1 
ATOM   9064  N  NZ    . LYS C  1 231 ? -18.392  31.597  -80.372  1.00 29.88  ? 231  LYS C NZ    1 
ATOM   9065  N  N     . ALA C  1 232 ? -21.534  37.487  -78.838  1.00 31.51  ? 232  ALA C N     1 
ATOM   9066  C  CA    . ALA C  1 232 ? -22.493  37.516  -77.743  1.00 25.32  ? 232  ALA C CA    1 
ATOM   9067  C  C     . ALA C  1 232 ? -23.812  36.893  -78.233  1.00 35.31  ? 232  ALA C C     1 
ATOM   9068  O  O     . ALA C  1 232 ? -24.538  36.259  -77.461  1.00 45.73  ? 232  ALA C O     1 
ATOM   9069  C  CB    . ALA C  1 232 ? -22.690  38.931  -77.250  1.00 27.29  ? 232  ALA C CB    1 
ATOM   9070  N  N     . ASP C  1 233 ? -24.103  37.055  -79.526  1.00 36.79  ? 233  ASP C N     1 
ATOM   9071  C  CA    . ASP C  1 233 ? -25.294  36.456  -80.138  1.00 22.99  ? 233  ASP C CA    1 
ATOM   9072  C  C     . ASP C  1 233 ? -25.095  34.940  -80.057  1.00 33.39  ? 233  ASP C C     1 
ATOM   9073  O  O     . ASP C  1 233 ? -25.979  34.194  -79.626  1.00 43.20  ? 233  ASP C O     1 
ATOM   9074  C  CB    . ASP C  1 233 ? -25.392  36.815  -81.625  1.00 31.58  ? 233  ASP C CB    1 
ATOM   9075  C  CG    . ASP C  1 233 ? -25.857  38.237  -81.878  1.00 44.00  ? 233  ASP C CG    1 
ATOM   9076  O  OD1   . ASP C  1 233 ? -26.314  38.916  -80.940  1.00 35.27  ? 233  ASP C OD1   1 
ATOM   9077  O  OD2   . ASP C  1 233 ? -25.779  38.670  -83.049  1.00 39.84  ? 233  ASP C OD2   1 
ATOM   9078  N  N     . GLU C  1 234 ? -23.918  34.500  -80.495  1.00 22.81  ? 234  GLU C N     1 
ATOM   9079  C  CA    . GLU C  1 234 ? -23.556  33.091  -80.488  1.00 28.03  ? 234  GLU C CA    1 
ATOM   9080  C  C     . GLU C  1 234 ? -23.663  32.483  -79.095  1.00 34.86  ? 234  GLU C C     1 
ATOM   9081  O  O     . GLU C  1 234 ? -24.099  31.340  -78.966  1.00 32.77  ? 234  GLU C O     1 
ATOM   9082  C  CB    . GLU C  1 234 ? -22.158  32.886  -81.090  1.00 27.73  ? 234  GLU C CB    1 
ATOM   9083  C  CG    . GLU C  1 234 ? -22.078  33.309  -82.573  1.00 36.39  ? 234  GLU C CG    1 
ATOM   9084  C  CD    . GLU C  1 234 ? -20.834  32.818  -83.305  1.00 40.29  ? 234  GLU C CD    1 
ATOM   9085  O  OE1   . GLU C  1 234 ? -19.884  32.354  -82.640  1.00 37.86  ? 234  GLU C OE1   1 
ATOM   9086  O  OE2   . GLU C  1 234 ? -20.810  32.886  -84.557  1.00 42.68  ? 234  GLU C OE2   1 
ATOM   9087  N  N     . ILE C  1 235 ? -23.311  33.254  -78.059  1.00 21.78  ? 235  ILE C N     1 
ATOM   9088  C  CA    . ILE C  1 235 ? -23.405  32.772  -76.684  1.00 22.16  ? 235  ILE C CA    1 
ATOM   9089  C  C     . ILE C  1 235 ? -24.865  32.485  -76.344  1.00 34.10  ? 235  ILE C C     1 
ATOM   9090  O  O     . ILE C  1 235 ? -25.181  31.478  -75.702  1.00 34.77  ? 235  ILE C O     1 
ATOM   9091  C  CB    . ILE C  1 235 ? -22.818  33.777  -75.665  1.00 31.07  ? 235  ILE C CB    1 
ATOM   9092  C  CG1   . ILE C  1 235 ? -21.290  33.669  -75.642  1.00 31.24  ? 235  ILE C CG1   1 
ATOM   9093  C  CG2   . ILE C  1 235 ? -23.390  33.544  -74.265  1.00 18.87  ? 235  ILE C CG2   1 
ATOM   9094  C  CD1   . ILE C  1 235 ? -20.747  32.352  -75.137  1.00 30.44  ? 235  ILE C CD1   1 
ATOM   9095  N  N     . GLN C  1 236 ? -25.756  33.365  -76.776  1.00 25.03  ? 236  GLN C N     1 
ATOM   9096  C  CA    . GLN C  1 236 ? -27.171  33.152  -76.528  1.00 26.56  ? 236  GLN C CA    1 
ATOM   9097  C  C     . GLN C  1 236 ? -27.665  31.901  -77.268  1.00 24.94  ? 236  GLN C C     1 
ATOM   9098  O  O     . GLN C  1 236 ? -28.440  31.125  -76.712  1.00 47.13  ? 236  GLN C O     1 
ATOM   9099  C  CB    . GLN C  1 236 ? -27.972  34.385  -76.928  1.00 9.21   ? 236  GLN C CB    1 
ATOM   9100  C  CG    . GLN C  1 236 ? -27.618  35.596  -76.101  1.00 20.63  ? 236  GLN C CG    1 
ATOM   9101  C  CD    . GLN C  1 236 ? -28.042  35.476  -74.653  1.00 27.40  ? 236  GLN C CD    1 
ATOM   9102  O  OE1   . GLN C  1 236 ? -27.325  34.914  -73.811  1.00 34.36  ? 236  GLN C OE1   1 
ATOM   9103  N  NE2   . GLN C  1 236 ? -29.203  36.041  -74.344  1.00 33.17  ? 236  GLN C NE2   1 
ATOM   9104  N  N     . ILE C  1 237 ? -27.193  31.696  -78.499  1.00 30.15  ? 237  ILE C N     1 
ATOM   9105  C  CA    . ILE C  1 237 ? -27.561  30.520  -79.302  1.00 20.03  ? 237  ILE C CA    1 
ATOM   9106  C  C     . ILE C  1 237 ? -26.958  29.277  -78.640  1.00 29.99  ? 237  ILE C C     1 
ATOM   9107  O  O     . ILE C  1 237 ? -27.603  28.235  -78.551  1.00 28.83  ? 237  ILE C O     1 
ATOM   9108  C  CB    . ILE C  1 237 ? -27.036  30.652  -80.767  1.00 30.42  ? 237  ILE C CB    1 
ATOM   9109  C  CG1   . ILE C  1 237 ? -27.844  31.708  -81.525  1.00 27.83  ? 237  ILE C CG1   1 
ATOM   9110  C  CG2   . ILE C  1 237 ? -27.104  29.318  -81.508  1.00 25.88  ? 237  ILE C CG2   1 
ATOM   9111  C  CD1   . ILE C  1 237 ? -27.240  32.099  -82.847  1.00 48.12  ? 237  ILE C CD1   1 
ATOM   9112  N  N     . TYR C  1 238 ? -25.721  29.410  -78.162  1.00 28.97  ? 238  TYR C N     1 
ATOM   9113  C  CA    . TYR C  1 238 ? -25.005  28.341  -77.464  1.00 25.55  ? 238  TYR C CA    1 
ATOM   9114  C  C     . TYR C  1 238 ? -25.838  27.896  -76.255  1.00 33.65  ? 238  TYR C C     1 
ATOM   9115  O  O     . TYR C  1 238 ? -26.181  26.721  -76.129  1.00 35.07  ? 238  TYR C O     1 
ATOM   9116  C  CB    . TYR C  1 238 ? -23.642  28.875  -77.000  1.00 23.11  ? 238  TYR C CB    1 
ATOM   9117  C  CG    . TYR C  1 238 ? -22.744  27.908  -76.253  1.00 25.22  ? 238  TYR C CG    1 
ATOM   9118  C  CD1   . TYR C  1 238 ? -22.947  27.634  -74.898  1.00 33.76  ? 238  TYR C CD1   1 
ATOM   9119  C  CD2   . TYR C  1 238 ? -21.638  27.328  -76.881  1.00 26.26  ? 238  TYR C CD2   1 
ATOM   9120  C  CE1   . TYR C  1 238 ? -22.072  26.805  -74.182  1.00 21.45  ? 238  TYR C CE1   1 
ATOM   9121  C  CE2   . TYR C  1 238 ? -20.757  26.499  -76.179  1.00 32.35  ? 238  TYR C CE2   1 
ATOM   9122  C  CZ    . TYR C  1 238 ? -20.980  26.246  -74.827  1.00 33.30  ? 238  TYR C CZ    1 
ATOM   9123  O  OH    . TYR C  1 238 ? -20.112  25.440  -74.124  1.00 34.17  ? 238  TYR C OH    1 
ATOM   9124  N  N     . LYS C  1 239 ? -26.169  28.835  -75.370  1.00 29.44  ? 239  LYS C N     1 
ATOM   9125  C  CA    . LYS C  1 239 ? -26.969  28.504  -74.197  1.00 22.97  ? 239  LYS C CA    1 
ATOM   9126