data_1F3F
# 
_entry.id   1F3F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1F3F         pdb_00001f3f 10.2210/pdb1f3f/pdb 
RCSB  RCSB011195   ?            ?                   
WWPDB D_1000011195 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F3F 
_pdbx_database_status.recvd_initial_deposition_date   2000-06-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Meyer, P.'         1 
'Schneider, B.'     2 
'Sarfati, S.'       3 
'Deville-Bonne, D.' 4 
'Guerreiro, C.'     5 
'Boretto, J.'       6 
'Janin, J.'         7 
'Veron, M.'         8 
'Canard, B.'        9 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for activation of alpha-boranophosphate nucleotide analogues targeting drug-resistant reverse transcriptase.' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            19 
_citation.page_first                3520 
_citation.page_last                 3529 
_citation.year                      2000 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10899107 
_citation.pdbx_database_id_DOI      10.1093/emboj/19.14.3520 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Meyer, P.'         1 ? 
primary 'Schneider, B.'     2 ? 
primary 'Sarfati, S.'       3 ? 
primary 'Deville-Bonne, D.' 4 ? 
primary 'Guerreiro, C.'     5 ? 
primary 'Boretto, J.'       6 ? 
primary 'Janin, J.'         7 ? 
primary 'Veron, M.'         8 ? 
primary 'Canard, B.'        9 ? 
# 
_cell.entry_id           1F3F 
_cell.length_a           70.018 
_cell.length_b           70.018 
_cell.length_c           152.098 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1F3F 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (NUCLEOSIDE DIPHOSPHATE KINASE)'             16735.242 3   2.7.4.6 H122G ? ? 
2 non-polymer syn 'MAGNESIUM ION'                                       24.305    3   ?       ?     ? ? 
3 non-polymer syn 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-TRIPHOSPHATE
;
464.153   3   ?       ?     ? ? 
4 non-polymer syn 'PHOSPHATE ION'                                       94.971    1   ?       ?     ? ? 
5 non-polymer syn 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-DIPHOSPHATE
;
384.173   1   ?       ?     ? ? 
6 water       nat water                                                 18.015    344 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'NDP KINASE, NDK' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAM
VFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAM
VFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   THR n 
1 4   ASN n 
1 5   LYS n 
1 6   VAL n 
1 7   ASN n 
1 8   LYS n 
1 9   GLU n 
1 10  ARG n 
1 11  THR n 
1 12  PHE n 
1 13  LEU n 
1 14  ALA n 
1 15  VAL n 
1 16  LYS n 
1 17  PRO n 
1 18  ASP n 
1 19  GLY n 
1 20  VAL n 
1 21  ALA n 
1 22  ARG n 
1 23  GLY n 
1 24  LEU n 
1 25  VAL n 
1 26  GLY n 
1 27  GLU n 
1 28  ILE n 
1 29  ILE n 
1 30  ALA n 
1 31  ARG n 
1 32  TYR n 
1 33  GLU n 
1 34  LYS n 
1 35  LYS n 
1 36  GLY n 
1 37  PHE n 
1 38  VAL n 
1 39  LEU n 
1 40  VAL n 
1 41  GLY n 
1 42  LEU n 
1 43  LYS n 
1 44  GLN n 
1 45  LEU n 
1 46  VAL n 
1 47  PRO n 
1 48  THR n 
1 49  LYS n 
1 50  ASP n 
1 51  LEU n 
1 52  ALA n 
1 53  GLU n 
1 54  SER n 
1 55  HIS n 
1 56  TYR n 
1 57  ALA n 
1 58  GLU n 
1 59  HIS n 
1 60  LYS n 
1 61  GLU n 
1 62  ARG n 
1 63  PRO n 
1 64  PHE n 
1 65  PHE n 
1 66  GLY n 
1 67  GLY n 
1 68  LEU n 
1 69  VAL n 
1 70  SER n 
1 71  PHE n 
1 72  ILE n 
1 73  THR n 
1 74  SER n 
1 75  GLY n 
1 76  PRO n 
1 77  VAL n 
1 78  VAL n 
1 79  ALA n 
1 80  MET n 
1 81  VAL n 
1 82  PHE n 
1 83  GLU n 
1 84  GLY n 
1 85  LYS n 
1 86  GLY n 
1 87  VAL n 
1 88  VAL n 
1 89  ALA n 
1 90  SER n 
1 91  ALA n 
1 92  ARG n 
1 93  LEU n 
1 94  MET n 
1 95  ILE n 
1 96  GLY n 
1 97  VAL n 
1 98  THR n 
1 99  ASN n 
1 100 PRO n 
1 101 LEU n 
1 102 ALA n 
1 103 SER n 
1 104 ALA n 
1 105 PRO n 
1 106 GLY n 
1 107 SER n 
1 108 ILE n 
1 109 ARG n 
1 110 GLY n 
1 111 ASP n 
1 112 PHE n 
1 113 GLY n 
1 114 VAL n 
1 115 ASP n 
1 116 VAL n 
1 117 GLY n 
1 118 ARG n 
1 119 ASN n 
1 120 ILE n 
1 121 ILE n 
1 122 GLY n 
1 123 GLY n 
1 124 SER n 
1 125 ASP n 
1 126 SER n 
1 127 VAL n 
1 128 GLU n 
1 129 SER n 
1 130 ALA n 
1 131 ASN n 
1 132 ARG n 
1 133 GLU n 
1 134 ILE n 
1 135 ALA n 
1 136 LEU n 
1 137 TRP n 
1 138 PHE n 
1 139 LYS n 
1 140 PRO n 
1 141 GLU n 
1 142 GLU n 
1 143 LEU n 
1 144 LEU n 
1 145 THR n 
1 146 GLU n 
1 147 VAL n 
1 148 LYS n 
1 149 PRO n 
1 150 ASN n 
1 151 PRO n 
1 152 ASN n 
1 153 LEU n 
1 154 TYR n 
1 155 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Dictyostelium 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Dictyostelium discoideum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     44689 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PTZ18R 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NDKC_DICDI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAM
VFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P22887 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1F3F A 1 ? 155 ? P22887 1 ? 155 ? 1 155 
2 1 1F3F B 1 ? 155 ? P22887 1 ? 155 ? 1 155 
3 1 1F3F C 1 ? 155 ? P22887 1 ? 155 ? 1 155 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1F3F GLY A 122 ? UNP P22887 HIS 122 'engineered mutation' 122 1 
2 1F3F GLY B 122 ? UNP P22887 HIS 122 'engineered mutation' 122 2 
3 1F3F GLY C 122 ? UNP P22887 HIS 122 'engineered mutation' 122 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                               ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                              ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ? 'C4 H7 N O4'        133.103 
D4D non-polymer         . 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-DIPHOSPHATE
;
? 'C10 H14 N2 O10 P2' 384.173 
D4T non-polymer         . 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-TRIPHOSPHATE
;
? 'C10 H15 N2 O13 P3' 464.153 
GLN 'L-peptide linking' y GLUTAMINE                                             ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                               ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                             ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                 ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                               ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                            ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                       ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                         ? 'C9 H11 N O2'       165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                                       ? 'O4 P -3'           94.971  
PRO 'L-peptide linking' y PROLINE                                               ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                             ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                              ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1F3F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.14 
_exptl_crystal.density_percent_sol   42.59 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    'pH 7.50' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.364 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'LURE BEAMLINE D41A' 
_diffrn_source.pdbx_synchrotron_site       LURE 
_diffrn_source.pdbx_synchrotron_beamline   D41A 
_diffrn_source.pdbx_wavelength             1.364 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1F3F 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.730 
_reflns.d_resolution_high            1.850 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.0710000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        16.40 
_reflns.pdbx_redundancy              5.000 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   98.7 
_reflns_shell.Rmerge_I_obs           0.3280000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1F3F 
_refine.ls_number_reflns_obs                     37405 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.73 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    99.1 
_refine.ls_R_factor_obs                          0.2030000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2030000 
_refine.ls_R_factor_R_free                       0.2340000 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.000 
_refine.ls_number_reflns_R_free                  1504 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               24.30 
_refine.aniso_B[1][1]                            -0.39000 
_refine.aniso_B[2][2]                            -0.39000 
_refine.aniso_B[3][3]                            0.77000 
_refine.aniso_B[1][2]                            -0.02000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.40 
_refine.solvent_model_param_bsol                 54.40 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1F3F 
_refine_analyze.Luzzati_coordinate_error_obs    0.21 
_refine_analyze.Luzzati_sigma_a_obs             0.11 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.26 
_refine_analyze.Luzzati_sigma_a_free            0.18 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3423 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         116 
_refine_hist.number_atoms_solvent             344 
_refine_hist.number_atoms_total               3883 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        29.73 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.013 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.80  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.90 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.04  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.24  1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.76  2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.92  2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.66  2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.85 
_refine_ls_shell.d_res_low                        1.97 
_refine_ls_shell.number_reflns_R_work             5892 
_refine_ls_shell.R_factor_R_work                  0.2330000 
_refine_ls_shell.percent_reflns_obs               98.70 
_refine_ls_shell.R_factor_R_free                  0.2870000 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            3.40 
_refine_ls_shell.number_reflns_R_free             207 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM     PROTEIN.TOP     'X-RAY DIFFRACTION' 
2 D4T_DNA-RNA_REP.PARAM D4T_DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM       WATER.TOP       'X-RAY DIFFRACTION' 
4 ION.PARAM             ION.TOP         'X-RAY DIFFRACTION' 
5 ?                     D4D_DNA-RNA.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1F3F 
_struct.title                     'STRUCTURE OF THE H122G NUCLEOSIDE DIPHOSPHATE KINASE / D4T-TRIPHOSPHATE.MG COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F3F 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'NUCLEOSIDE DIPHOSPHATE KINASE, ANTI-HIV NUCLEOSIDE ANALOGUE, PHOSPHORYLATION, CH...O BOND, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 2 ? 
H N N 3 ? 
I N N 5 ? 
J N N 2 ? 
K N N 3 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 16  ? ARG A 22  ? LYS A 16  ARG A 22  1 ? 7  
HELX_P HELX_P2  2  LEU A 24  ? GLY A 36  ? LEU A 24  GLY A 36  1 ? 13 
HELX_P HELX_P3  3  THR A 48  ? TYR A 56  ? THR A 48  TYR A 56  1 ? 9  
HELX_P HELX_P4  4  ALA A 57  ? LYS A 60  ? ALA A 57  LYS A 60  5 ? 4  
HELX_P HELX_P5  5  PHE A 64  ? THR A 73  ? PHE A 64  THR A 73  1 ? 10 
HELX_P HELX_P6  6  GLY A 86  ? GLY A 96  ? GLY A 86  GLY A 96  1 ? 11 
HELX_P HELX_P7  7  ASN A 99  ? SER A 103 ? ASN A 99  SER A 103 5 ? 5  
HELX_P HELX_P8  8  SER A 107 ? GLY A 113 ? SER A 107 GLY A 113 1 ? 7  
HELX_P HELX_P9  9  SER A 126 ? PHE A 138 ? SER A 126 PHE A 138 1 ? 13 
HELX_P HELX_P10 10 LYS A 139 ? LEU A 143 ? LYS A 139 LEU A 143 5 ? 5  
HELX_P HELX_P11 11 LYS B 16  ? ARG B 22  ? LYS B 16  ARG B 22  1 ? 7  
HELX_P HELX_P12 12 LEU B 24  ? GLY B 36  ? LEU B 24  GLY B 36  1 ? 13 
HELX_P HELX_P13 13 THR B 48  ? TYR B 56  ? THR B 48  TYR B 56  1 ? 9  
HELX_P HELX_P14 14 ALA B 57  ? LYS B 60  ? ALA B 57  LYS B 60  5 ? 4  
HELX_P HELX_P15 15 PHE B 64  ? THR B 73  ? PHE B 64  THR B 73  1 ? 10 
HELX_P HELX_P16 16 GLY B 86  ? GLY B 96  ? GLY B 86  GLY B 96  1 ? 11 
HELX_P HELX_P17 17 ASN B 99  ? SER B 103 ? ASN B 99  SER B 103 5 ? 5  
HELX_P HELX_P18 18 SER B 107 ? GLY B 113 ? SER B 107 GLY B 113 1 ? 7  
HELX_P HELX_P19 19 SER B 126 ? PHE B 138 ? SER B 126 PHE B 138 1 ? 13 
HELX_P HELX_P20 20 LYS B 139 ? LEU B 143 ? LYS B 139 LEU B 143 5 ? 5  
HELX_P HELX_P21 21 LYS C 16  ? ARG C 22  ? LYS C 16  ARG C 22  1 ? 7  
HELX_P HELX_P22 22 LEU C 24  ? GLY C 36  ? LEU C 24  GLY C 36  1 ? 13 
HELX_P HELX_P23 23 THR C 48  ? TYR C 56  ? THR C 48  TYR C 56  1 ? 9  
HELX_P HELX_P24 24 ALA C 57  ? LYS C 60  ? ALA C 57  LYS C 60  5 ? 4  
HELX_P HELX_P25 25 PHE C 64  ? THR C 73  ? PHE C 64  THR C 73  1 ? 10 
HELX_P HELX_P26 26 GLY C 86  ? GLY C 96  ? GLY C 86  GLY C 96  1 ? 11 
HELX_P HELX_P27 27 ASN C 99  ? SER C 103 ? ASN C 99  SER C 103 5 ? 5  
HELX_P HELX_P28 28 SER C 107 ? GLY C 113 ? SER C 107 GLY C 113 1 ? 7  
HELX_P HELX_P29 29 SER C 126 ? PHE C 138 ? SER C 126 PHE C 138 1 ? 13 
HELX_P HELX_P30 30 LYS C 139 ? LEU C 143 ? LYS C 139 LEU C 143 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? E D4T . O1B ? ? ? 1_555 D MG  . MG ? ? A D4T 160 A MG  165 1_555 ? ? ? ? ? ? ? 2.094 ? ? 
metalc2  metalc ? ? E D4T . O1A ? ? ? 1_555 D MG  . MG ? ? A D4T 160 A MG  165 1_555 ? ? ? ? ? ? ? 1.988 ? ? 
metalc3  metalc ? ? E D4T . O1C ? ? ? 1_555 D MG  . MG ? ? A D4T 160 A MG  165 1_555 ? ? ? ? ? ? ? 1.976 ? ? 
metalc4  metalc ? ? D MG  . MG  ? ? ? 1_555 L HOH . O  ? ? A MG  165 A HOH 725 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc5  metalc ? ? D MG  . MG  ? ? ? 1_555 L HOH . O  ? ? A MG  165 A HOH 726 1_555 ? ? ? ? ? ? ? 2.163 ? ? 
metalc6  metalc ? ? D MG  . MG  ? ? ? 1_555 L HOH . O  ? ? A MG  165 A HOH 727 1_555 ? ? ? ? ? ? ? 2.092 ? ? 
metalc7  metalc ? ? H D4T . O1A A ? ? 1_555 G MG  . MG ? ? B D4T 161 B MG  166 1_555 ? ? ? ? ? ? ? 2.109 ? ? 
metalc8  metalc ? ? H D4T . O1C A ? ? 1_555 G MG  . MG ? ? B D4T 161 B MG  166 1_555 ? ? ? ? ? ? ? 2.206 ? ? 
metalc9  metalc ? ? H D4T . O1B A ? ? 1_555 G MG  . MG ? ? B D4T 161 B MG  166 1_555 ? ? ? ? ? ? ? 2.072 ? ? 
metalc10 metalc ? ? F PO4 . O1  B ? ? 1_555 G MG  . MG ? ? B PO4 162 B MG  166 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc11 metalc ? ? I D4D . O1A B ? ? 1_555 G MG  . MG ? ? B D4D 163 B MG  166 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc12 metalc ? ? I D4D . O1B B ? ? 1_555 G MG  . MG ? ? B D4D 163 B MG  166 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
metalc13 metalc ? ? G MG  . MG  ? ? ? 1_555 M HOH . O  ? ? B MG  166 B HOH 728 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc14 metalc ? ? G MG  . MG  ? ? ? 1_555 M HOH . O  ? ? B MG  166 B HOH 729 1_555 ? ? ? ? ? ? ? 1.982 ? ? 
metalc15 metalc ? ? G MG  . MG  ? ? ? 1_555 M HOH . O  ? ? B MG  166 B HOH 730 1_555 ? ? ? ? ? ? ? 2.081 ? ? 
metalc16 metalc ? ? K D4T . O1A ? ? ? 1_555 J MG  . MG ? ? C D4T 164 C MG  167 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc17 metalc ? ? K D4T . O1B ? ? ? 1_555 J MG  . MG ? ? C D4T 164 C MG  167 1_555 ? ? ? ? ? ? ? 2.237 ? ? 
metalc18 metalc ? ? K D4T . O1C ? ? ? 1_555 J MG  . MG ? ? C D4T 164 C MG  167 1_555 ? ? ? ? ? ? ? 1.984 ? ? 
metalc19 metalc ? ? J MG  . MG  ? ? ? 1_555 N HOH . O  ? ? C MG  167 C HOH 731 1_555 ? ? ? ? ? ? ? 2.169 ? ? 
metalc20 metalc ? ? J MG  . MG  ? ? ? 1_555 N HOH . O  ? ? C MG  167 C HOH 732 1_555 ? ? ? ? ? ? ? 2.361 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 38  ? LEU A 45  ? VAL A 38  LEU A 45  
A 2 VAL A 77  ? GLU A 83  ? VAL A 77  GLU A 83  
A 3 ARG A 10  ? VAL A 15  ? ARG A 10  VAL A 15  
A 4 ILE A 121 ? GLY A 123 ? ILE A 121 GLY A 123 
B 1 VAL B 38  ? LEU B 45  ? VAL B 38  LEU B 45  
B 2 VAL B 77  ? GLU B 83  ? VAL B 77  GLU B 83  
B 3 ARG B 10  ? VAL B 15  ? ARG B 10  VAL B 15  
B 4 ILE B 121 ? GLY B 123 ? ILE B 121 GLY B 123 
C 1 VAL C 38  ? LEU C 45  ? VAL C 38  LEU C 45  
C 2 VAL C 77  ? GLU C 83  ? VAL C 77  GLU C 83  
C 3 ARG C 10  ? VAL C 15  ? ARG C 10  VAL C 15  
C 4 ILE C 121 ? GLY C 123 ? ILE C 121 GLY C 123 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 45 ? O LEU A 45 N VAL A 77  ? N VAL A 77  
A 2 3 O PHE A 82 ? O PHE A 82 N THR A 11  ? N THR A 11  
A 3 4 N ALA A 14 ? N ALA A 14 O GLY A 122 ? O GLY A 122 
B 1 2 O LEU B 45 ? O LEU B 45 N VAL B 77  ? N VAL B 77  
B 2 3 O PHE B 82 ? O PHE B 82 N THR B 11  ? N THR B 11  
B 3 4 N ALA B 14 ? N ALA B 14 O GLY B 122 ? O GLY B 122 
C 1 2 O LEU C 45 ? O LEU C 45 N VAL C 77  ? N VAL C 77  
C 2 3 O PHE C 82 ? O PHE C 82 N THR C 11  ? N THR C 11  
C 3 4 N ALA C 14 ? N ALA C 14 O GLY C 122 ? O GLY C 122 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B PO4 162 ? 11 'BINDING SITE FOR RESIDUE PO4 B 162' 
AC2 Software A MG  165 ? 4  'BINDING SITE FOR RESIDUE MG A 165'  
AC3 Software B MG  166 ? 6  'BINDING SITE FOR RESIDUE MG B 166'  
AC4 Software C MG  167 ? 3  'BINDING SITE FOR RESIDUE MG C 167'  
AC5 Software A D4T 160 ? 20 'BINDING SITE FOR RESIDUE D4T A 160' 
AC6 Software B D4T 161 ? 21 'BINDING SITE FOR RESIDUE D4T B 161' 
AC7 Software B D4D 163 ? 18 'BINDING SITE FOR RESIDUE D4D B 163' 
AC8 Software C D4T 164 ? 16 'BINDING SITE FOR RESIDUE D4T C 164' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 LYS B 16  ? LYS B 16  . ? 1_555 ? 
2  AC1 11 HIS B 55  ? HIS B 55  . ? 1_555 ? 
3  AC1 11 TYR B 56  ? TYR B 56  . ? 1_555 ? 
4  AC1 11 ARG B 92  ? ARG B 92  . ? 1_555 ? 
5  AC1 11 GLY B 122 ? GLY B 122 . ? 1_555 ? 
6  AC1 11 GLY B 123 ? GLY B 123 . ? 1_555 ? 
7  AC1 11 D4D I .   ? D4D B 163 . ? 1_555 ? 
8  AC1 11 MG  G .   ? MG  B 166 . ? 1_555 ? 
9  AC1 11 HOH M .   ? HOH B 728 . ? 1_555 ? 
10 AC1 11 HOH M .   ? HOH B 730 . ? 1_555 ? 
11 AC1 11 HOH M .   ? HOH B 843 . ? 1_555 ? 
12 AC2 4  D4T E .   ? D4T A 160 . ? 1_555 ? 
13 AC2 4  HOH L .   ? HOH A 725 . ? 1_555 ? 
14 AC2 4  HOH L .   ? HOH A 726 . ? 1_555 ? 
15 AC2 4  HOH L .   ? HOH A 727 . ? 1_555 ? 
16 AC3 6  D4T H .   ? D4T B 161 . ? 1_555 ? 
17 AC3 6  PO4 F .   ? PO4 B 162 . ? 1_555 ? 
18 AC3 6  D4D I .   ? D4D B 163 . ? 1_555 ? 
19 AC3 6  HOH M .   ? HOH B 728 . ? 1_555 ? 
20 AC3 6  HOH M .   ? HOH B 729 . ? 1_555 ? 
21 AC3 6  HOH M .   ? HOH B 730 . ? 1_555 ? 
22 AC4 3  D4T K .   ? D4T C 164 . ? 1_555 ? 
23 AC4 3  HOH N .   ? HOH C 731 . ? 1_555 ? 
24 AC4 3  HOH N .   ? HOH C 732 . ? 1_555 ? 
25 AC5 20 LYS A 16  ? LYS A 16  . ? 1_555 ? 
26 AC5 20 TYR A 56  ? TYR A 56  . ? 1_555 ? 
27 AC5 20 HIS A 59  ? HIS A 59  . ? 1_555 ? 
28 AC5 20 PHE A 64  ? PHE A 64  . ? 1_555 ? 
29 AC5 20 LEU A 68  ? LEU A 68  . ? 1_555 ? 
30 AC5 20 ARG A 92  ? ARG A 92  . ? 1_555 ? 
31 AC5 20 THR A 98  ? THR A 98  . ? 1_555 ? 
32 AC5 20 ARG A 109 ? ARG A 109 . ? 1_555 ? 
33 AC5 20 VAL A 116 ? VAL A 116 . ? 1_555 ? 
34 AC5 20 GLY A 117 ? GLY A 117 . ? 1_555 ? 
35 AC5 20 ASN A 119 ? ASN A 119 . ? 1_555 ? 
36 AC5 20 GLY A 122 ? GLY A 122 . ? 1_555 ? 
37 AC5 20 GLY A 123 ? GLY A 123 . ? 1_555 ? 
38 AC5 20 MG  D .   ? MG  A 165 . ? 1_555 ? 
39 AC5 20 HOH L .   ? HOH A 664 . ? 1_555 ? 
40 AC5 20 HOH L .   ? HOH A 725 . ? 1_555 ? 
41 AC5 20 HOH L .   ? HOH A 726 . ? 1_555 ? 
42 AC5 20 HOH L .   ? HOH A 727 . ? 1_555 ? 
43 AC5 20 HOH L .   ? HOH A 809 . ? 1_555 ? 
44 AC5 20 HOH L .   ? HOH A 810 . ? 1_555 ? 
45 AC6 21 LYS B 16  ? LYS B 16  . ? 1_555 ? 
46 AC6 21 TYR B 56  ? TYR B 56  . ? 1_555 ? 
47 AC6 21 HIS B 59  ? HIS B 59  . ? 1_555 ? 
48 AC6 21 PHE B 64  ? PHE B 64  . ? 1_555 ? 
49 AC6 21 LEU B 68  ? LEU B 68  . ? 1_555 ? 
50 AC6 21 ARG B 92  ? ARG B 92  . ? 1_555 ? 
51 AC6 21 THR B 98  ? THR B 98  . ? 1_555 ? 
52 AC6 21 ARG B 109 ? ARG B 109 . ? 1_555 ? 
53 AC6 21 VAL B 116 ? VAL B 116 . ? 1_555 ? 
54 AC6 21 GLY B 117 ? GLY B 117 . ? 1_555 ? 
55 AC6 21 ASN B 119 ? ASN B 119 . ? 1_555 ? 
56 AC6 21 GLY B 122 ? GLY B 122 . ? 1_555 ? 
57 AC6 21 GLY B 123 ? GLY B 123 . ? 1_555 ? 
58 AC6 21 MG  G .   ? MG  B 166 . ? 1_555 ? 
59 AC6 21 HOH M .   ? HOH B 728 . ? 1_555 ? 
60 AC6 21 HOH M .   ? HOH B 729 . ? 1_555 ? 
61 AC6 21 HOH M .   ? HOH B 730 . ? 1_555 ? 
62 AC6 21 HOH M .   ? HOH B 784 . ? 1_555 ? 
63 AC6 21 HOH M .   ? HOH B 811 . ? 1_555 ? 
64 AC6 21 HOH M .   ? HOH B 828 . ? 1_555 ? 
65 AC6 21 HOH M .   ? HOH B 843 . ? 1_555 ? 
66 AC7 18 LYS B 16  ? LYS B 16  . ? 1_555 ? 
67 AC7 18 HIS B 59  ? HIS B 59  . ? 1_555 ? 
68 AC7 18 PHE B 64  ? PHE B 64  . ? 1_555 ? 
69 AC7 18 LEU B 68  ? LEU B 68  . ? 1_555 ? 
70 AC7 18 ARG B 92  ? ARG B 92  . ? 1_555 ? 
71 AC7 18 THR B 98  ? THR B 98  . ? 1_555 ? 
72 AC7 18 ARG B 109 ? ARG B 109 . ? 1_555 ? 
73 AC7 18 VAL B 116 ? VAL B 116 . ? 1_555 ? 
74 AC7 18 GLY B 117 ? GLY B 117 . ? 1_555 ? 
75 AC7 18 ASN B 119 ? ASN B 119 . ? 1_555 ? 
76 AC7 18 PO4 F .   ? PO4 B 162 . ? 1_555 ? 
77 AC7 18 MG  G .   ? MG  B 166 . ? 1_555 ? 
78 AC7 18 HOH M .   ? HOH B 705 . ? 1_555 ? 
79 AC7 18 HOH M .   ? HOH B 723 . ? 1_555 ? 
80 AC7 18 HOH M .   ? HOH B 729 . ? 1_555 ? 
81 AC7 18 HOH M .   ? HOH B 784 . ? 1_555 ? 
82 AC7 18 HOH M .   ? HOH B 811 . ? 1_555 ? 
83 AC7 18 HOH M .   ? HOH B 828 . ? 1_555 ? 
84 AC8 16 LYS C 16  ? LYS C 16  . ? 1_555 ? 
85 AC8 16 TYR C 56  ? TYR C 56  . ? 1_555 ? 
86 AC8 16 HIS C 59  ? HIS C 59  . ? 1_555 ? 
87 AC8 16 PHE C 64  ? PHE C 64  . ? 1_555 ? 
88 AC8 16 LEU C 68  ? LEU C 68  . ? 1_555 ? 
89 AC8 16 ARG C 92  ? ARG C 92  . ? 1_555 ? 
90 AC8 16 THR C 98  ? THR C 98  . ? 1_555 ? 
91 AC8 16 ARG C 109 ? ARG C 109 . ? 1_555 ? 
92 AC8 16 VAL C 116 ? VAL C 116 . ? 1_555 ? 
93 AC8 16 GLY C 117 ? GLY C 117 . ? 1_555 ? 
94 AC8 16 ASN C 119 ? ASN C 119 . ? 1_555 ? 
95 AC8 16 GLY C 122 ? GLY C 122 . ? 1_555 ? 
96 AC8 16 GLY C 123 ? GLY C 123 . ? 1_555 ? 
97 AC8 16 MG  J .   ? MG  C 167 . ? 1_555 ? 
98 AC8 16 HOH N .   ? HOH C 731 . ? 1_555 ? 
99 AC8 16 HOH N .   ? HOH C 732 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1F3F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1F3F 
_atom_sites.fract_transf_matrix[1][1]   0.014282 
_atom_sites.fract_transf_matrix[1][2]   0.008246 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016491 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006575 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . VAL A 1 6   ? 29.483  63.144 29.085 1.00 40.04 ? 6   VAL A N     1 
ATOM   2    C  CA    . VAL A 1 6   ? 29.985  62.691 30.407 1.00 39.00 ? 6   VAL A CA    1 
ATOM   3    C  C     . VAL A 1 6   ? 28.942  63.012 31.491 1.00 38.29 ? 6   VAL A C     1 
ATOM   4    O  O     . VAL A 1 6   ? 27.822  63.444 31.201 1.00 36.04 ? 6   VAL A O     1 
ATOM   5    C  CB    . VAL A 1 6   ? 31.348  63.392 30.748 1.00 39.53 ? 6   VAL A CB    1 
ATOM   6    C  CG1   . VAL A 1 6   ? 31.126  64.879 30.981 1.00 39.43 ? 6   VAL A CG1   1 
ATOM   7    C  CG2   . VAL A 1 6   ? 32.013  62.735 31.978 1.00 41.30 ? 6   VAL A CG2   1 
ATOM   8    N  N     . ASN A 1 7   ? 29.335  62.798 32.739 1.00 37.97 ? 7   ASN A N     1 
ATOM   9    C  CA    . ASN A 1 7   ? 28.479  63.048 33.889 1.00 37.24 ? 7   ASN A CA    1 
ATOM   10   C  C     . ASN A 1 7   ? 28.353  64.543 34.209 1.00 35.88 ? 7   ASN A C     1 
ATOM   11   O  O     . ASN A 1 7   ? 27.752  64.918 35.216 1.00 35.79 ? 7   ASN A O     1 
ATOM   12   C  CB    . ASN A 1 7   ? 29.058  62.310 35.089 1.00 37.84 ? 7   ASN A CB    1 
ATOM   13   C  CG    . ASN A 1 7   ? 29.263  60.840 34.813 1.00 38.09 ? 7   ASN A CG    1 
ATOM   14   O  OD1   . ASN A 1 7   ? 30.020  60.172 35.511 1.00 39.93 ? 7   ASN A OD1   1 
ATOM   15   N  ND2   . ASN A 1 7   ? 28.581  60.323 33.800 1.00 36.08 ? 7   ASN A ND2   1 
ATOM   16   N  N     . LYS A 1 8   ? 28.912  65.390 33.347 1.00 33.31 ? 8   LYS A N     1 
ATOM   17   C  CA    . LYS A 1 8   ? 28.859  66.837 33.553 1.00 31.52 ? 8   LYS A CA    1 
ATOM   18   C  C     . LYS A 1 8   ? 27.732  67.477 32.727 1.00 28.19 ? 8   LYS A C     1 
ATOM   19   O  O     . LYS A 1 8   ? 27.563  68.687 32.772 1.00 26.35 ? 8   LYS A O     1 
ATOM   20   C  CB    . LYS A 1 8   ? 30.199  67.489 33.161 1.00 34.25 ? 8   LYS A CB    1 
ATOM   21   C  CG    . LYS A 1 8   ? 31.433  66.994 33.915 1.00 37.40 ? 8   LYS A CG    1 
ATOM   22   C  CD    . LYS A 1 8   ? 31.527  67.560 35.327 1.00 40.87 ? 8   LYS A CD    1 
ATOM   23   C  CE    . LYS A 1 8   ? 32.807  67.073 36.020 1.00 43.54 ? 8   LYS A CE    1 
ATOM   24   N  NZ    . LYS A 1 8   ? 32.949  67.530 37.440 1.00 45.83 ? 8   LYS A NZ    1 
ATOM   25   N  N     . GLU A 1 9   ? 26.982  66.680 31.963 1.00 27.20 ? 9   GLU A N     1 
ATOM   26   C  CA    . GLU A 1 9   ? 25.875  67.228 31.163 1.00 23.99 ? 9   GLU A CA    1 
ATOM   27   C  C     . GLU A 1 9   ? 24.932  68.040 32.077 1.00 22.71 ? 9   GLU A C     1 
ATOM   28   O  O     . GLU A 1 9   ? 24.762  67.725 33.244 1.00 21.89 ? 9   GLU A O     1 
ATOM   29   C  CB    . GLU A 1 9   ? 25.114  66.097 30.466 1.00 22.74 ? 9   GLU A CB    1 
ATOM   30   C  CG    . GLU A 1 9   ? 24.003  66.553 29.499 1.00 23.05 ? 9   GLU A CG    1 
ATOM   31   C  CD    . GLU A 1 9   ? 23.406  65.409 28.700 1.00 25.12 ? 9   GLU A CD    1 
ATOM   32   O  OE1   . GLU A 1 9   ? 24.150  64.780 27.905 1.00 24.84 ? 9   GLU A OE1   1 
ATOM   33   O  OE2   . GLU A 1 9   ? 22.190  65.120 28.853 1.00 22.47 ? 9   GLU A OE2   1 
ATOM   34   N  N     . ARG A 1 10  ? 24.342  69.109 31.551 1.00 22.11 ? 10  ARG A N     1 
ATOM   35   C  CA    . ARG A 1 10  ? 23.450  69.926 32.360 1.00 20.53 ? 10  ARG A CA    1 
ATOM   36   C  C     . ARG A 1 10  ? 22.199  70.227 31.554 1.00 20.02 ? 10  ARG A C     1 
ATOM   37   O  O     . ARG A 1 10  ? 22.216  70.196 30.331 1.00 20.87 ? 10  ARG A O     1 
ATOM   38   C  CB    . ARG A 1 10  ? 24.131  71.235 32.749 1.00 20.45 ? 10  ARG A CB    1 
ATOM   39   C  CG    . ARG A 1 10  ? 25.313  71.064 33.663 1.00 21.42 ? 10  ARG A CG    1 
ATOM   40   C  CD    . ARG A 1 10  ? 26.069  72.366 33.900 1.00 21.00 ? 10  ARG A CD    1 
ATOM   41   N  NE    . ARG A 1 10  ? 26.919  72.215 35.078 1.00 22.38 ? 10  ARG A NE    1 
ATOM   42   C  CZ    . ARG A 1 10  ? 27.599  73.204 35.640 1.00 22.61 ? 10  ARG A CZ    1 
ATOM   43   N  NH1   . ARG A 1 10  ? 27.535  74.429 35.123 1.00 23.26 ? 10  ARG A NH1   1 
ATOM   44   N  NH2   . ARG A 1 10  ? 28.325  72.970 36.723 1.00 21.68 ? 10  ARG A NH2   1 
ATOM   45   N  N     . THR A 1 11  ? 21.109  70.506 32.254 1.00 19.02 ? 11  THR A N     1 
ATOM   46   C  CA    . THR A 1 11  ? 19.860  70.841 31.597 1.00 18.75 ? 11  THR A CA    1 
ATOM   47   C  C     . THR A 1 11  ? 19.255  71.975 32.371 1.00 18.08 ? 11  THR A C     1 
ATOM   48   O  O     . THR A 1 11  ? 19.585  72.183 33.537 1.00 18.44 ? 11  THR A O     1 
ATOM   49   C  CB    . THR A 1 11  ? 18.856  69.687 31.597 1.00 19.37 ? 11  THR A CB    1 
ATOM   50   O  OG1   . THR A 1 11  ? 17.805  69.987 30.665 1.00 17.39 ? 11  THR A OG1   1 
ATOM   51   C  CG2   . THR A 1 11  ? 18.250  69.469 33.018 1.00 18.62 ? 11  THR A CG2   1 
ATOM   52   N  N     . PHE A 1 12  ? 18.375  72.723 31.711 1.00 18.97 ? 12  PHE A N     1 
ATOM   53   C  CA    . PHE A 1 12  ? 17.697  73.829 32.352 1.00 18.56 ? 12  PHE A CA    1 
ATOM   54   C  C     . PHE A 1 12  ? 16.249  73.415 32.585 1.00 18.62 ? 12  PHE A C     1 
ATOM   55   O  O     . PHE A 1 12  ? 15.570  72.952 31.657 1.00 18.31 ? 12  PHE A O     1 
ATOM   56   C  CB    . PHE A 1 12  ? 17.687  75.069 31.451 1.00 19.13 ? 12  PHE A CB    1 
ATOM   57   C  CG    . PHE A 1 12  ? 16.866  76.189 32.001 1.00 18.99 ? 12  PHE A CG    1 
ATOM   58   C  CD1   . PHE A 1 12  ? 17.379  77.006 32.990 1.00 16.31 ? 12  PHE A CD1   1 
ATOM   59   C  CD2   . PHE A 1 12  ? 15.556  76.391 31.572 1.00 21.62 ? 12  PHE A CD2   1 
ATOM   60   C  CE1   . PHE A 1 12  ? 16.605  78.003 33.550 1.00 19.10 ? 12  PHE A CE1   1 
ATOM   61   C  CE2   . PHE A 1 12  ? 14.770  77.388 32.121 1.00 20.84 ? 12  PHE A CE2   1 
ATOM   62   C  CZ    . PHE A 1 12  ? 15.292  78.199 33.114 1.00 21.97 ? 12  PHE A CZ    1 
ATOM   63   N  N     . LEU A 1 13  ? 15.780  73.609 33.809 1.00 19.03 ? 13  LEU A N     1 
ATOM   64   C  CA    . LEU A 1 13  ? 14.413  73.278 34.179 1.00 18.51 ? 13  LEU A CA    1 
ATOM   65   C  C     . LEU A 1 13  ? 13.808  74.511 34.799 1.00 18.81 ? 13  LEU A C     1 
ATOM   66   O  O     . LEU A 1 13  ? 14.493  75.257 35.500 1.00 19.12 ? 13  LEU A O     1 
ATOM   67   C  CB    . LEU A 1 13  ? 14.414  72.158 35.233 1.00 18.53 ? 13  LEU A CB    1 
ATOM   68   C  CG    . LEU A 1 13  ? 15.029  70.858 34.723 1.00 18.77 ? 13  LEU A CG    1 
ATOM   69   C  CD1   . LEU A 1 13  ? 15.135  69.852 35.837 1.00 22.96 ? 13  LEU A CD1   1 
ATOM   70   C  CD2   . LEU A 1 13  ? 14.188  70.316 33.625 1.00 20.77 ? 13  LEU A CD2   1 
ATOM   71   N  N     . ALA A 1 14  ? 12.518  74.728 34.560 1.00 18.83 ? 14  ALA A N     1 
ATOM   72   C  CA    . ALA A 1 14  ? 11.845  75.870 35.163 1.00 18.69 ? 14  ALA A CA    1 
ATOM   73   C  C     . ALA A 1 14  ? 10.458  75.492 35.655 1.00 16.57 ? 14  ALA A C     1 
ATOM   74   O  O     . ALA A 1 14  ? 9.672   74.956 34.894 1.00 17.54 ? 14  ALA A O     1 
ATOM   75   C  CB    . ALA A 1 14  ? 11.714  76.992 34.160 1.00 19.50 ? 14  ALA A CB    1 
ATOM   76   N  N     . VAL A 1 15  ? 10.198  75.744 36.935 1.00 18.03 ? 15  VAL A N     1 
ATOM   77   C  CA    . VAL A 1 15  ? 8.872   75.530 37.505 1.00 15.96 ? 15  VAL A CA    1 
ATOM   78   C  C     . VAL A 1 15  ? 8.156   76.829 37.077 1.00 16.46 ? 15  VAL A C     1 
ATOM   79   O  O     . VAL A 1 15  ? 8.527   77.935 37.483 1.00 14.81 ? 15  VAL A O     1 
ATOM   80   C  CB    . VAL A 1 15  ? 8.887   75.479 39.049 1.00 16.85 ? 15  VAL A CB    1 
ATOM   81   C  CG1   . VAL A 1 15  ? 7.455   75.177 39.579 1.00 15.15 ? 15  VAL A CG1   1 
ATOM   82   C  CG2   . VAL A 1 15  ? 9.872   74.407 39.531 1.00 16.95 ? 15  VAL A CG2   1 
ATOM   83   N  N     . LYS A 1 16  ? 7.161   76.670 36.227 1.00 15.72 ? 16  LYS A N     1 
ATOM   84   C  CA    . LYS A 1 16  ? 6.408   77.789 35.695 1.00 15.62 ? 16  LYS A CA    1 
ATOM   85   C  C     . LYS A 1 16  ? 5.529   78.399 36.770 1.00 16.76 ? 16  LYS A C     1 
ATOM   86   O  O     . LYS A 1 16  ? 5.362   77.838 37.885 1.00 15.58 ? 16  LYS A O     1 
ATOM   87   C  CB    . LYS A 1 16  ? 5.590   77.301 34.498 1.00 15.80 ? 16  LYS A CB    1 
ATOM   88   C  CG    . LYS A 1 16  ? 6.486   76.728 33.408 1.00 14.73 ? 16  LYS A CG    1 
ATOM   89   C  CD    . LYS A 1 16  ? 5.718   76.085 32.259 1.00 15.51 ? 16  LYS A CD    1 
ATOM   90   C  CE    . LYS A 1 16  ? 6.631   75.749 31.068 1.00 15.58 ? 16  LYS A CE    1 
ATOM   91   N  NZ    . LYS A 1 16  ? 5.800   75.029 30.037 1.00 14.84 ? 16  LYS A NZ    1 
ATOM   92   N  N     . PRO A 1 17  ? 4.956   79.562 36.474 1.00 17.37 ? 17  PRO A N     1 
ATOM   93   C  CA    . PRO A 1 17  ? 4.100   80.224 37.462 1.00 15.91 ? 17  PRO A CA    1 
ATOM   94   C  C     . PRO A 1 17  ? 2.993   79.371 38.073 1.00 14.27 ? 17  PRO A C     1 
ATOM   95   O  O     . PRO A 1 17  ? 2.671   79.566 39.236 1.00 14.05 ? 17  PRO A O     1 
ATOM   96   C  CB    . PRO A 1 17  ? 3.564   81.436 36.704 1.00 17.16 ? 17  PRO A CB    1 
ATOM   97   C  CG    . PRO A 1 17  ? 4.726   81.759 35.760 1.00 16.98 ? 17  PRO A CG    1 
ATOM   98   C  CD    . PRO A 1 17  ? 5.145   80.404 35.268 1.00 18.69 ? 17  PRO A CD    1 
ATOM   99   N  N     . ASP A 1 18  ? 2.402   78.464 37.291 1.00 14.84 ? 18  ASP A N     1 
ATOM   100  C  CA    . ASP A 1 18  ? 1.349   77.601 37.799 1.00 15.57 ? 18  ASP A CA    1 
ATOM   101  C  C     . ASP A 1 18  ? 1.944   76.606 38.802 1.00 16.24 ? 18  ASP A C     1 
ATOM   102  O  O     . ASP A 1 18  ? 1.355   76.343 39.850 1.00 16.86 ? 18  ASP A O     1 
ATOM   103  C  CB    . ASP A 1 18  ? 0.620   76.871 36.644 1.00 15.19 ? 18  ASP A CB    1 
ATOM   104  C  CG    . ASP A 1 18  ? 1.551   76.066 35.738 1.00 16.93 ? 18  ASP A CG    1 
ATOM   105  O  OD1   . ASP A 1 18  ? 2.638   76.576 35.393 1.00 18.95 ? 18  ASP A OD1   1 
ATOM   106  O  OD2   . ASP A 1 18  ? 1.176   74.924 35.347 1.00 17.30 ? 18  ASP A OD2   1 
ATOM   107  N  N     . GLY A 1 19  ? 3.108   76.062 38.473 1.00 15.39 ? 19  GLY A N     1 
ATOM   108  C  CA    . GLY A 1 19  ? 3.766   75.123 39.370 1.00 15.56 ? 19  GLY A CA    1 
ATOM   109  C  C     . GLY A 1 19  ? 4.126   75.813 40.675 1.00 15.87 ? 19  GLY A C     1 
ATOM   110  O  O     . GLY A 1 19  ? 4.003   75.245 41.773 1.00 14.63 ? 19  GLY A O     1 
ATOM   111  N  N     . VAL A 1 20  ? 4.597   77.052 40.567 1.00 15.00 ? 20  VAL A N     1 
ATOM   112  C  CA    . VAL A 1 20  ? 4.954   77.795 41.750 1.00 15.14 ? 20  VAL A CA    1 
ATOM   113  C  C     . VAL A 1 20  ? 3.690   78.144 42.556 1.00 16.83 ? 20  VAL A C     1 
ATOM   114  O  O     . VAL A 1 20  ? 3.634   77.910 43.779 1.00 15.92 ? 20  VAL A O     1 
ATOM   115  C  CB    . VAL A 1 20  ? 5.721   79.089 41.394 1.00 14.78 ? 20  VAL A CB    1 
ATOM   116  C  CG1   . VAL A 1 20  ? 5.954   79.878 42.628 1.00 13.73 ? 20  VAL A CG1   1 
ATOM   117  C  CG2   . VAL A 1 20  ? 7.038   78.761 40.675 1.00 13.80 ? 20  VAL A CG2   1 
ATOM   118  N  N     . ALA A 1 21  ? 2.670   78.682 41.893 1.00 14.63 ? 21  ALA A N     1 
ATOM   119  C  CA    . ALA A 1 21  ? 1.442   79.043 42.611 1.00 15.56 ? 21  ALA A CA    1 
ATOM   120  C  C     . ALA A 1 21  ? 0.848   77.830 43.306 1.00 15.84 ? 21  ALA A C     1 
ATOM   121  O  O     . ALA A 1 21  ? 0.279   77.950 44.402 1.00 15.91 ? 21  ALA A O     1 
ATOM   122  C  CB    . ALA A 1 21  ? 0.382   79.667 41.654 1.00 16.42 ? 21  ALA A CB    1 
ATOM   123  N  N     . ARG A 1 22  ? 0.997   76.664 42.687 1.00 15.00 ? 22  ARG A N     1 
ATOM   124  C  CA    . ARG A 1 22  ? 0.437   75.447 43.252 1.00 15.22 ? 22  ARG A CA    1 
ATOM   125  C  C     . ARG A 1 22  ? 1.245   74.763 44.337 1.00 14.65 ? 22  ARG A C     1 
ATOM   126  O  O     . ARG A 1 22  ? 0.850   73.693 44.822 1.00 15.44 ? 22  ARG A O     1 
ATOM   127  C  CB    . ARG A 1 22  ? 0.162   74.458 42.136 1.00 13.12 ? 22  ARG A CB    1 
ATOM   128  C  CG    . ARG A 1 22  ? -0.965  74.954 41.228 1.00 12.46 ? 22  ARG A CG    1 
ATOM   129  C  CD    . ARG A 1 22  ? -1.197  74.001 40.079 1.00 15.06 ? 22  ARG A CD    1 
ATOM   130  N  NE    . ARG A 1 22  ? -1.674  72.713 40.575 1.00 15.91 ? 22  ARG A NE    1 
ATOM   131  C  CZ    . ARG A 1 22  ? -1.573  71.571 39.902 1.00 18.32 ? 22  ARG A CZ    1 
ATOM   132  N  NH1   . ARG A 1 22  ? -1.012  71.577 38.692 1.00 14.92 ? 22  ARG A NH1   1 
ATOM   133  N  NH2   . ARG A 1 22  ? -1.981  70.416 40.461 1.00 14.49 ? 22  ARG A NH2   1 
ATOM   134  N  N     . GLY A 1 23  ? 2.369   75.367 44.697 1.00 14.90 ? 23  GLY A N     1 
ATOM   135  C  CA    . GLY A 1 23  ? 3.218   74.812 45.738 1.00 13.03 ? 23  GLY A CA    1 
ATOM   136  C  C     . GLY A 1 23  ? 3.892   73.519 45.351 1.00 14.14 ? 23  GLY A C     1 
ATOM   137  O  O     . GLY A 1 23  ? 4.009   72.594 46.166 1.00 14.01 ? 23  GLY A O     1 
ATOM   138  N  N     . LEU A 1 24  ? 4.366   73.440 44.115 1.00 13.58 ? 24  LEU A N     1 
ATOM   139  C  CA    . LEU A 1 24  ? 4.995   72.223 43.639 1.00 12.09 ? 24  LEU A CA    1 
ATOM   140  C  C     . LEU A 1 24  ? 6.508   72.348 43.521 1.00 12.08 ? 24  LEU A C     1 
ATOM   141  O  O     . LEU A 1 24  ? 7.154   71.445 43.027 1.00 12.56 ? 24  LEU A O     1 
ATOM   142  C  CB    . LEU A 1 24  ? 4.406   71.865 42.269 1.00 13.91 ? 24  LEU A CB    1 
ATOM   143  C  CG    . LEU A 1 24  ? 2.914   71.484 42.361 1.00 12.84 ? 24  LEU A CG    1 
ATOM   144  C  CD1   . LEU A 1 24  ? 2.293   71.316 40.967 1.00 14.68 ? 24  LEU A CD1   1 
ATOM   145  C  CD2   . LEU A 1 24  ? 2.817   70.171 43.148 1.00 18.58 ? 24  LEU A CD2   1 
ATOM   146  N  N     . VAL A 1 25  ? 7.071   73.475 43.954 1.00 13.36 ? 25  VAL A N     1 
ATOM   147  C  CA    . VAL A 1 25  ? 8.509   73.658 43.798 1.00 14.22 ? 25  VAL A CA    1 
ATOM   148  C  C     . VAL A 1 25  ? 9.348   72.588 44.503 1.00 11.72 ? 25  VAL A C     1 
ATOM   149  O  O     . VAL A 1 25  ? 10.221  71.968 43.905 1.00 12.99 ? 25  VAL A O     1 
ATOM   150  C  CB    . VAL A 1 25  ? 8.962   75.054 44.309 1.00 13.61 ? 25  VAL A CB    1 
ATOM   151  C  CG1   . VAL A 1 25  ? 10.458  75.200 44.107 1.00 14.79 ? 25  VAL A CG1   1 
ATOM   152  C  CG2   . VAL A 1 25  ? 8.223   76.173 43.547 1.00 14.98 ? 25  VAL A CG2   1 
ATOM   153  N  N     . GLY A 1 26  ? 9.093   72.397 45.790 1.00 12.91 ? 26  GLY A N     1 
ATOM   154  C  CA    . GLY A 1 26  ? 9.878   71.419 46.539 1.00 13.69 ? 26  GLY A CA    1 
ATOM   155  C  C     . GLY A 1 26  ? 9.752   70.010 45.995 1.00 14.03 ? 26  GLY A C     1 
ATOM   156  O  O     . GLY A 1 26  ? 10.741  69.262 45.862 1.00 13.85 ? 26  GLY A O     1 
ATOM   157  N  N     . GLU A 1 27  ? 8.516   69.634 45.698 1.00 13.98 ? 27  GLU A N     1 
ATOM   158  C  CA    . GLU A 1 27  ? 8.245   68.313 45.159 1.00 14.64 ? 27  GLU A CA    1 
ATOM   159  C  C     . GLU A 1 27  ? 9.082   68.078 43.900 1.00 14.01 ? 27  GLU A C     1 
ATOM   160  O  O     . GLU A 1 27  ? 9.697   67.038 43.723 1.00 14.37 ? 27  GLU A O     1 
ATOM   161  C  CB    . GLU A 1 27  ? 6.762   68.222 44.813 1.00 16.18 ? 27  GLU A CB    1 
ATOM   162  C  CG    . GLU A 1 27  ? 6.386   67.043 43.917 1.00 19.99 ? 27  GLU A CG    1 
ATOM   163  C  CD    . GLU A 1 27  ? 6.436   65.708 44.628 1.00 21.72 ? 27  GLU A CD    1 
ATOM   164  O  OE1   . GLU A 1 27  ? 6.333   65.699 45.887 1.00 25.68 ? 27  GLU A OE1   1 
ATOM   165  O  OE2   . GLU A 1 27  ? 6.561   64.673 43.928 1.00 22.47 ? 27  GLU A OE2   1 
ATOM   166  N  N     . ILE A 1 28  ? 9.098   69.065 43.015 1.00 13.59 ? 28  ILE A N     1 
ATOM   167  C  CA    . ILE A 1 28  ? 9.852   68.917 41.778 1.00 12.57 ? 28  ILE A CA    1 
ATOM   168  C  C     . ILE A 1 28  ? 11.350  68.840 42.043 1.00 11.85 ? 28  ILE A C     1 
ATOM   169  O  O     . ILE A 1 28  ? 12.030  67.952 41.519 1.00 13.56 ? 28  ILE A O     1 
ATOM   170  C  CB    . ILE A 1 28  ? 9.495   70.084 40.786 1.00 12.91 ? 28  ILE A CB    1 
ATOM   171  C  CG1   . ILE A 1 28  ? 8.078   69.857 40.257 1.00 13.52 ? 28  ILE A CG1   1 
ATOM   172  C  CG2   . ILE A 1 28  ? 10.526  70.146 39.636 1.00 13.84 ? 28  ILE A CG2   1 
ATOM   173  C  CD1   . ILE A 1 28  ? 7.436   71.095 39.575 1.00 14.61 ? 28  ILE A CD1   1 
ATOM   174  N  N     . ILE A 1 29  ? 11.867  69.732 42.879 1.00 12.04 ? 29  ILE A N     1 
ATOM   175  C  CA    . ILE A 1 29  ? 13.291  69.733 43.151 1.00 13.45 ? 29  ILE A CA    1 
ATOM   176  C  C     . ILE A 1 29  ? 13.668  68.391 43.799 1.00 12.68 ? 29  ILE A C     1 
ATOM   177  O  O     . ILE A 1 29  ? 14.659  67.781 43.438 1.00 10.85 ? 29  ILE A O     1 
ATOM   178  C  CB    . ILE A 1 29  ? 13.712  70.885 44.084 1.00 12.89 ? 29  ILE A CB    1 
ATOM   179  C  CG1   . ILE A 1 29  ? 13.620  72.234 43.357 1.00 14.90 ? 29  ILE A CG1   1 
ATOM   180  C  CG2   . ILE A 1 29  ? 15.201  70.742 44.487 1.00 12.69 ? 29  ILE A CG2   1 
ATOM   181  C  CD1   . ILE A 1 29  ? 13.900  73.446 44.287 1.00 15.43 ? 29  ILE A CD1   1 
ATOM   182  N  N     . ALA A 1 30  ? 12.847  67.933 44.737 1.00 13.15 ? 30  ALA A N     1 
ATOM   183  C  CA    . ALA A 1 30  ? 13.097  66.649 45.414 1.00 14.14 ? 30  ALA A CA    1 
ATOM   184  C  C     . ALA A 1 30  ? 13.181  65.507 44.404 1.00 14.48 ? 30  ALA A C     1 
ATOM   185  O  O     . ALA A 1 30  ? 14.003  64.591 44.543 1.00 17.95 ? 30  ALA A O     1 
ATOM   186  C  CB    . ALA A 1 30  ? 11.990  66.372 46.398 1.00 14.26 ? 30  ALA A CB    1 
ATOM   187  N  N     . ARG A 1 31  ? 12.328  65.522 43.381 1.00 14.43 ? 31  ARG A N     1 
ATOM   188  C  CA    . ARG A 1 31  ? 12.395  64.432 42.415 1.00 12.88 ? 31  ARG A CA    1 
ATOM   189  C  C     . ARG A 1 31  ? 13.760  64.356 41.729 1.00 15.73 ? 31  ARG A C     1 
ATOM   190  O  O     . ARG A 1 31  ? 14.328  63.269 41.508 1.00 15.77 ? 31  ARG A O     1 
ATOM   191  C  CB    . ARG A 1 31  ? 11.284  64.575 41.369 1.00 13.11 ? 31  ARG A CB    1 
ATOM   192  C  CG    . ARG A 1 31  ? 9.892   64.165 41.886 1.00 14.11 ? 31  ARG A CG    1 
ATOM   193  C  CD    . ARG A 1 31  ? 8.826   64.354 40.807 1.00 14.85 ? 31  ARG A CD    1 
ATOM   194  N  NE    . ARG A 1 31  ? 7.487   64.110 41.334 1.00 16.40 ? 31  ARG A NE    1 
ATOM   195  C  CZ    . ARG A 1 31  ? 6.541   63.468 40.658 1.00 15.98 ? 31  ARG A CZ    1 
ATOM   196  N  NH1   . ARG A 1 31  ? 6.799   63.009 39.434 1.00 12.53 ? 31  ARG A NH1   1 
ATOM   197  N  NH2   . ARG A 1 31  ? 5.355   63.267 41.202 1.00 16.58 ? 31  ARG A NH2   1 
ATOM   198  N  N     . TYR A 1 32  ? 14.299  65.506 41.370 1.00 15.91 ? 32  TYR A N     1 
ATOM   199  C  CA    . TYR A 1 32  ? 15.571  65.508 40.697 1.00 17.66 ? 32  TYR A CA    1 
ATOM   200  C  C     . TYR A 1 32  ? 16.728  65.217 41.668 1.00 16.34 ? 32  TYR A C     1 
ATOM   201  O  O     . TYR A 1 32  ? 17.729  64.625 41.289 1.00 18.22 ? 32  TYR A O     1 
ATOM   202  C  CB    . TYR A 1 32  ? 15.732  66.837 39.964 1.00 17.75 ? 32  TYR A CB    1 
ATOM   203  C  CG    . TYR A 1 32  ? 14.836  66.908 38.745 1.00 17.08 ? 32  TYR A CG    1 
ATOM   204  C  CD1   . TYR A 1 32  ? 15.096  66.119 37.631 1.00 16.93 ? 32  TYR A CD1   1 
ATOM   205  C  CD2   . TYR A 1 32  ? 13.704  67.714 38.733 1.00 17.70 ? 32  TYR A CD2   1 
ATOM   206  C  CE1   . TYR A 1 32  ? 14.241  66.126 36.523 1.00 16.51 ? 32  TYR A CE1   1 
ATOM   207  C  CE2   . TYR A 1 32  ? 12.845  67.732 37.646 1.00 16.77 ? 32  TYR A CE2   1 
ATOM   208  C  CZ    . TYR A 1 32  ? 13.118  66.934 36.545 1.00 15.24 ? 32  TYR A CZ    1 
ATOM   209  O  OH    . TYR A 1 32  ? 12.245  66.880 35.484 1.00 16.84 ? 32  TYR A OH    1 
ATOM   210  N  N     . GLU A 1 33  ? 16.571  65.606 42.917 1.00 14.50 ? 33  GLU A N     1 
ATOM   211  C  CA    . GLU A 1 33  ? 17.607  65.325 43.917 1.00 16.76 ? 33  GLU A CA    1 
ATOM   212  C  C     . GLU A 1 33  ? 17.639  63.835 44.165 1.00 18.49 ? 33  GLU A C     1 
ATOM   213  O  O     . GLU A 1 33  ? 18.707  63.239 44.201 1.00 17.43 ? 33  GLU A O     1 
ATOM   214  C  CB    . GLU A 1 33  ? 17.312  66.001 45.255 1.00 16.42 ? 33  GLU A CB    1 
ATOM   215  C  CG    . GLU A 1 33  ? 17.526  67.499 45.251 1.00 16.02 ? 33  GLU A CG    1 
ATOM   216  C  CD    . GLU A 1 33  ? 17.080  68.141 46.537 1.00 16.79 ? 33  GLU A CD    1 
ATOM   217  O  OE1   . GLU A 1 33  ? 15.864  68.162 46.827 1.00 17.38 ? 33  GLU A OE1   1 
ATOM   218  O  OE2   . GLU A 1 33  ? 17.958  68.623 47.264 1.00 17.47 ? 33  GLU A OE2   1 
ATOM   219  N  N     . LYS A 1 34  ? 16.457  63.239 44.329 1.00 18.58 ? 34  LYS A N     1 
ATOM   220  C  CA    . LYS A 1 34  ? 16.365  61.799 44.596 1.00 18.72 ? 34  LYS A CA    1 
ATOM   221  C  C     . LYS A 1 34  ? 16.938  60.967 43.466 1.00 18.21 ? 34  LYS A C     1 
ATOM   222  O  O     . LYS A 1 34  ? 17.429  59.862 43.680 1.00 17.88 ? 34  LYS A O     1 
ATOM   223  C  CB    . LYS A 1 34  ? 14.904  61.387 44.816 1.00 20.88 ? 34  LYS A CB    1 
ATOM   224  C  CG    . LYS A 1 34  ? 14.309  61.830 46.134 1.00 25.24 ? 34  LYS A CG    1 
ATOM   225  C  CD    . LYS A 1 34  ? 12.837  61.403 46.240 1.00 29.58 ? 34  LYS A CD    1 
ATOM   226  C  CE    . LYS A 1 34  ? 12.276  61.584 47.656 1.00 32.21 ? 34  LYS A CE    1 
ATOM   227  N  NZ    . LYS A 1 34  ? 12.006  62.995 48.064 1.00 33.88 ? 34  LYS A NZ    1 
ATOM   228  N  N     . LYS A 1 35  ? 16.866  61.508 42.259 1.00 15.84 ? 35  LYS A N     1 
ATOM   229  C  CA    . LYS A 1 35  ? 17.327  60.835 41.057 1.00 17.11 ? 35  LYS A CA    1 
ATOM   230  C  C     . LYS A 1 35  ? 18.835  60.779 41.029 1.00 17.34 ? 35  LYS A C     1 
ATOM   231  O  O     . LYS A 1 35  ? 19.409  59.882 40.430 1.00 18.76 ? 35  LYS A O     1 
ATOM   232  C  CB    . LYS A 1 35  ? 16.791  61.589 39.836 1.00 16.79 ? 35  LYS A CB    1 
ATOM   233  C  CG    . LYS A 1 35  ? 17.191  61.055 38.467 1.00 17.16 ? 35  LYS A CG    1 
ATOM   234  C  CD    . LYS A 1 35  ? 16.798  59.611 38.251 1.00 16.81 ? 35  LYS A CD    1 
ATOM   235  C  CE    . LYS A 1 35  ? 16.924  59.277 36.790 1.00 14.28 ? 35  LYS A CE    1 
ATOM   236  N  NZ    . LYS A 1 35  ? 16.407  57.924 36.453 1.00 15.52 ? 35  LYS A NZ    1 
ATOM   237  N  N     . GLY A 1 36  ? 19.465  61.739 41.677 1.00 15.04 ? 36  GLY A N     1 
ATOM   238  C  CA    . GLY A 1 36  ? 20.916  61.753 41.728 1.00 18.68 ? 36  GLY A CA    1 
ATOM   239  C  C     . GLY A 1 36  ? 21.529  62.921 40.976 1.00 19.87 ? 36  GLY A C     1 
ATOM   240  O  O     . GLY A 1 36  ? 22.742  63.082 40.936 1.00 20.10 ? 36  GLY A O     1 
ATOM   241  N  N     . PHE A 1 37  ? 20.685  63.730 40.356 1.00 18.87 ? 37  PHE A N     1 
ATOM   242  C  CA    . PHE A 1 37  ? 21.189  64.892 39.643 1.00 19.59 ? 37  PHE A CA    1 
ATOM   243  C  C     . PHE A 1 37  ? 21.524  65.969 40.662 1.00 18.90 ? 37  PHE A C     1 
ATOM   244  O  O     . PHE A 1 37  ? 20.876  66.081 41.720 1.00 18.50 ? 37  PHE A O     1 
ATOM   245  C  CB    . PHE A 1 37  ? 20.148  65.368 38.628 1.00 17.74 ? 37  PHE A CB    1 
ATOM   246  C  CG    . PHE A 1 37  ? 19.942  64.399 37.507 1.00 19.58 ? 37  PHE A CG    1 
ATOM   247  C  CD1   . PHE A 1 37  ? 21.040  63.885 36.814 1.00 17.48 ? 37  PHE A CD1   1 
ATOM   248  C  CD2   . PHE A 1 37  ? 18.663  63.990 37.135 1.00 17.22 ? 37  PHE A CD2   1 
ATOM   249  C  CE1   . PHE A 1 37  ? 20.859  62.991 35.780 1.00 19.43 ? 37  PHE A CE1   1 
ATOM   250  C  CE2   . PHE A 1 37  ? 18.479  63.091 36.092 1.00 18.75 ? 37  PHE A CE2   1 
ATOM   251  C  CZ    . PHE A 1 37  ? 19.581  62.591 35.413 1.00 18.73 ? 37  PHE A CZ    1 
ATOM   252  N  N     . VAL A 1 38  ? 22.575  66.736 40.372 1.00 20.09 ? 38  VAL A N     1 
ATOM   253  C  CA    . VAL A 1 38  ? 23.023  67.774 41.284 1.00 19.28 ? 38  VAL A CA    1 
ATOM   254  C  C     . VAL A 1 38  ? 22.565  69.144 40.832 1.00 20.35 ? 38  VAL A C     1 
ATOM   255  O  O     . VAL A 1 38  ? 22.729  69.509 39.674 1.00 19.81 ? 38  VAL A O     1 
ATOM   256  C  CB    . VAL A 1 38  ? 24.566  67.813 41.407 1.00 19.88 ? 38  VAL A CB    1 
ATOM   257  C  CG1   . VAL A 1 38  ? 24.986  68.979 42.295 1.00 20.89 ? 38  VAL A CG1   1 
ATOM   258  C  CG2   . VAL A 1 38  ? 25.079  66.481 42.000 1.00 22.53 ? 38  VAL A CG2   1 
ATOM   259  N  N     . LEU A 1 39  ? 22.025  69.893 41.779 1.00 18.77 ? 39  LEU A N     1 
ATOM   260  C  CA    . LEU A 1 39  ? 21.519  71.238 41.544 1.00 20.74 ? 39  LEU A CA    1 
ATOM   261  C  C     . LEU A 1 39  ? 22.725  72.182 41.417 1.00 20.43 ? 39  LEU A C     1 
ATOM   262  O  O     . LEU A 1 39  ? 23.390  72.445 42.410 1.00 20.36 ? 39  LEU A O     1 
ATOM   263  C  CB    . LEU A 1 39  ? 20.658  71.643 42.732 1.00 20.53 ? 39  LEU A CB    1 
ATOM   264  C  CG    . LEU A 1 39  ? 19.973  73.001 42.755 1.00 19.55 ? 39  LEU A CG    1 
ATOM   265  C  CD1   . LEU A 1 39  ? 18.938  73.079 41.627 1.00 19.67 ? 39  LEU A CD1   1 
ATOM   266  C  CD2   . LEU A 1 39  ? 19.277  73.190 44.097 1.00 22.70 ? 39  LEU A CD2   1 
ATOM   267  N  N     . VAL A 1 40  ? 22.990  72.690 40.210 1.00 20.49 ? 40  VAL A N     1 
ATOM   268  C  CA    . VAL A 1 40  ? 24.145  73.590 40.019 1.00 19.43 ? 40  VAL A CA    1 
ATOM   269  C  C     . VAL A 1 40  ? 23.764  75.049 39.894 1.00 21.07 ? 40  VAL A C     1 
ATOM   270  O  O     . VAL A 1 40  ? 24.627  75.931 39.887 1.00 21.08 ? 40  VAL A O     1 
ATOM   271  C  CB    . VAL A 1 40  ? 25.028  73.162 38.811 1.00 20.57 ? 40  VAL A CB    1 
ATOM   272  C  CG1   . VAL A 1 40  ? 25.711  71.856 39.135 1.00 21.87 ? 40  VAL A CG1   1 
ATOM   273  C  CG2   . VAL A 1 40  ? 24.209  73.040 37.535 1.00 19.13 ? 40  VAL A CG2   1 
ATOM   274  N  N     . GLY A 1 41  ? 22.459  75.301 39.811 1.00 19.57 ? 41  GLY A N     1 
ATOM   275  C  CA    . GLY A 1 41  ? 21.959  76.663 39.755 1.00 19.60 ? 41  GLY A CA    1 
ATOM   276  C  C     . GLY A 1 41  ? 20.505  76.687 40.193 1.00 19.59 ? 41  GLY A C     1 
ATOM   277  O  O     . GLY A 1 41  ? 19.735  75.788 39.847 1.00 18.53 ? 41  GLY A O     1 
ATOM   278  N  N     . LEU A 1 42  ? 20.124  77.719 40.934 1.00 19.84 ? 42  LEU A N     1 
ATOM   279  C  CA    . LEU A 1 42  ? 18.757  77.848 41.426 1.00 20.73 ? 42  LEU A CA    1 
ATOM   280  C  C     . LEU A 1 42  ? 18.410  79.294 41.751 1.00 19.76 ? 42  LEU A C     1 
ATOM   281  O  O     . LEU A 1 42  ? 19.192  80.000 42.391 1.00 18.48 ? 42  LEU A O     1 
ATOM   282  C  CB    . LEU A 1 42  ? 18.579  77.016 42.709 1.00 20.09 ? 42  LEU A CB    1 
ATOM   283  C  CG    . LEU A 1 42  ? 17.200  77.101 43.368 1.00 19.00 ? 42  LEU A CG    1 
ATOM   284  C  CD1   . LEU A 1 42  ? 16.167  76.432 42.474 1.00 22.29 ? 42  LEU A CD1   1 
ATOM   285  C  CD2   . LEU A 1 42  ? 17.278  76.384 44.744 1.00 21.81 ? 42  LEU A CD2   1 
ATOM   286  N  N     . LYS A 1 43  ? 17.240  79.744 41.307 1.00 19.36 ? 43  LYS A N     1 
ATOM   287  C  CA    . LYS A 1 43  ? 16.799  81.099 41.634 1.00 20.39 ? 43  LYS A CA    1 
ATOM   288  C  C     . LYS A 1 43  ? 15.328  81.279 41.315 1.00 19.98 ? 43  LYS A C     1 
ATOM   289  O  O     . LYS A 1 43  ? 14.782  80.584 40.455 1.00 20.78 ? 43  LYS A O     1 
ATOM   290  C  CB    . LYS A 1 43  ? 17.610  82.159 40.844 1.00 21.39 ? 43  LYS A CB    1 
ATOM   291  C  CG    . LYS A 1 43  ? 17.433  82.073 39.326 1.00 20.79 ? 43  LYS A CG    1 
ATOM   292  C  CD    . LYS A 1 43  ? 17.896  83.383 38.586 1.00 24.38 ? 43  LYS A CD    1 
ATOM   293  C  CE    . LYS A 1 43  ? 19.311  83.306 38.079 1.00 24.18 ? 43  LYS A CE    1 
ATOM   294  N  NZ    . LYS A 1 43  ? 19.581  84.352 37.035 1.00 22.07 ? 43  LYS A NZ    1 
ATOM   295  N  N     . GLN A 1 44  ? 14.676  82.182 42.022 1.00 19.50 ? 44  GLN A N     1 
ATOM   296  C  CA    . GLN A 1 44  ? 13.286  82.466 41.702 1.00 19.38 ? 44  GLN A CA    1 
ATOM   297  C  C     . GLN A 1 44  ? 13.265  83.882 41.147 1.00 19.74 ? 44  GLN A C     1 
ATOM   298  O  O     . GLN A 1 44  ? 13.887  84.785 41.713 1.00 18.33 ? 44  GLN A O     1 
ATOM   299  C  CB    . GLN A 1 44  ? 12.387  82.436 42.926 1.00 19.11 ? 44  GLN A CB    1 
ATOM   300  C  CG    . GLN A 1 44  ? 10.994  82.922 42.566 1.00 19.09 ? 44  GLN A CG    1 
ATOM   301  C  CD    . GLN A 1 44  ? 10.015  82.819 43.711 1.00 20.37 ? 44  GLN A CD    1 
ATOM   302  O  OE1   . GLN A 1 44  ? 9.146   81.961 43.706 1.00 21.33 ? 44  GLN A OE1   1 
ATOM   303  N  NE2   . GLN A 1 44  ? 10.154  83.692 44.694 1.00 21.21 ? 44  GLN A NE2   1 
ATOM   304  N  N     . LEU A 1 45  ? 12.532  84.085 40.060 1.00 18.87 ? 45  LEU A N     1 
ATOM   305  C  CA    . LEU A 1 45  ? 12.446  85.413 39.489 1.00 20.86 ? 45  LEU A CA    1 
ATOM   306  C  C     . LEU A 1 45  ? 11.187  85.487 38.650 1.00 20.72 ? 45  LEU A C     1 
ATOM   307  O  O     . LEU A 1 45  ? 10.644  84.462 38.260 1.00 20.01 ? 45  LEU A O     1 
ATOM   308  C  CB    . LEU A 1 45  ? 13.648  85.677 38.576 1.00 20.46 ? 45  LEU A CB    1 
ATOM   309  C  CG    . LEU A 1 45  ? 13.669  84.932 37.226 1.00 21.05 ? 45  LEU A CG    1 
ATOM   310  C  CD1   . LEU A 1 45  ? 14.712  85.623 36.346 1.00 25.88 ? 45  LEU A CD1   1 
ATOM   311  C  CD2   . LEU A 1 45  ? 13.991  83.429 37.373 1.00 21.79 ? 45  LEU A CD2   1 
ATOM   312  N  N     . VAL A 1 46  ? 10.731  86.705 38.376 1.00 22.42 ? 46  VAL A N     1 
ATOM   313  C  CA    . VAL A 1 46  ? 9.574   86.890 37.514 1.00 21.61 ? 46  VAL A CA    1 
ATOM   314  C  C     . VAL A 1 46  ? 10.179  87.204 36.144 1.00 22.55 ? 46  VAL A C     1 
ATOM   315  O  O     . VAL A 1 46  ? 10.772  88.251 35.949 1.00 23.36 ? 46  VAL A O     1 
ATOM   316  C  CB    . VAL A 1 46  ? 8.700   88.066 37.975 1.00 21.60 ? 46  VAL A CB    1 
ATOM   317  C  CG1   . VAL A 1 46  ? 7.567   88.261 36.988 1.00 22.71 ? 46  VAL A CG1   1 
ATOM   318  C  CG2   . VAL A 1 46  ? 8.134   87.784 39.387 1.00 21.28 ? 46  VAL A CG2   1 
ATOM   319  N  N     . PRO A 1 47  ? 10.016  86.306 35.171 1.00 22.88 ? 47  PRO A N     1 
ATOM   320  C  CA    . PRO A 1 47  ? 10.594  86.544 33.848 1.00 23.39 ? 47  PRO A CA    1 
ATOM   321  C  C     . PRO A 1 47  ? 10.147  87.832 33.163 1.00 23.81 ? 47  PRO A C     1 
ATOM   322  O  O     . PRO A 1 47  ? 9.025   88.289 33.342 1.00 22.39 ? 47  PRO A O     1 
ATOM   323  C  CB    . PRO A 1 47  ? 10.169  85.307 33.058 1.00 23.91 ? 47  PRO A CB    1 
ATOM   324  C  CG    . PRO A 1 47  ? 9.921   84.272 34.120 1.00 22.56 ? 47  PRO A CG    1 
ATOM   325  C  CD    . PRO A 1 47  ? 9.251   85.044 35.192 1.00 20.78 ? 47  PRO A CD    1 
ATOM   326  N  N     . THR A 1 48  ? 11.046  88.413 32.383 1.00 25.56 ? 48  THR A N     1 
ATOM   327  C  CA    . THR A 1 48  ? 10.713  89.616 31.623 1.00 25.55 ? 48  THR A CA    1 
ATOM   328  C  C     . THR A 1 48  ? 10.197  89.147 30.282 1.00 25.55 ? 48  THR A C     1 
ATOM   329  O  O     . THR A 1 48  ? 10.426  87.999 29.881 1.00 23.27 ? 48  THR A O     1 
ATOM   330  C  CB    . THR A 1 48  ? 11.960  90.499 31.343 1.00 27.14 ? 48  THR A CB    1 
ATOM   331  O  OG1   . THR A 1 48  ? 12.955  89.709 30.692 1.00 30.17 ? 48  THR A OG1   1 
ATOM   332  C  CG2   . THR A 1 48  ? 12.521  91.092 32.629 1.00 29.08 ? 48  THR A CG2   1 
ATOM   333  N  N     . LYS A 1 49  ? 9.511   90.035 29.564 1.00 24.46 ? 49  LYS A N     1 
ATOM   334  C  CA    . LYS A 1 49  ? 9.021   89.670 28.247 1.00 26.97 ? 49  LYS A CA    1 
ATOM   335  C  C     . LYS A 1 49  ? 10.184  89.204 27.386 1.00 25.21 ? 49  LYS A C     1 
ATOM   336  O  O     . LYS A 1 49  ? 10.060  88.216 26.663 1.00 27.46 ? 49  LYS A O     1 
ATOM   337  C  CB    . LYS A 1 49  ? 8.335   90.864 27.575 1.00 27.80 ? 49  LYS A CB    1 
ATOM   338  C  CG    . LYS A 1 49  ? 7.764   90.568 26.204 1.00 28.72 ? 49  LYS A CG    1 
ATOM   339  C  CD    . LYS A 1 49  ? 6.247   90.793 26.172 1.00 32.79 ? 49  LYS A CD    1 
ATOM   340  C  CE    . LYS A 1 49  ? 5.672   90.684 24.768 1.00 33.02 ? 49  LYS A CE    1 
ATOM   341  N  NZ    . LYS A 1 49  ? 6.240   91.770 23.918 1.00 35.81 ? 49  LYS A NZ    1 
ATOM   342  N  N     . ASP A 1 50  ? 11.310  89.919 27.465 1.00 26.14 ? 50  ASP A N     1 
ATOM   343  C  CA    . ASP A 1 50  ? 12.518  89.600 26.685 1.00 25.37 ? 50  ASP A CA    1 
ATOM   344  C  C     . ASP A 1 50  ? 13.058  88.214 26.990 1.00 23.55 ? 50  ASP A C     1 
ATOM   345  O  O     . ASP A 1 50  ? 13.365  87.434 26.093 1.00 22.89 ? 50  ASP A O     1 
ATOM   346  C  CB    . ASP A 1 50  ? 13.644  90.618 26.952 1.00 27.42 ? 50  ASP A CB    1 
ATOM   347  C  CG    . ASP A 1 50  ? 13.378  92.003 26.321 1.00 31.00 ? 50  ASP A CG    1 
ATOM   348  O  OD1   . ASP A 1 50  ? 12.474  92.121 25.465 1.00 29.99 ? 50  ASP A OD1   1 
ATOM   349  O  OD2   . ASP A 1 50  ? 14.095  92.968 26.689 1.00 31.90 ? 50  ASP A OD2   1 
ATOM   350  N  N     . LEU A 1 51  ? 13.205  87.920 28.270 1.00 24.33 ? 51  LEU A N     1 
ATOM   351  C  CA    . LEU A 1 51  ? 13.694  86.614 28.665 1.00 22.95 ? 51  LEU A CA    1 
ATOM   352  C  C     . LEU A 1 51  ? 12.738  85.559 28.120 1.00 22.37 ? 51  LEU A C     1 
ATOM   353  O  O     . LEU A 1 51  ? 13.138  84.610 27.424 1.00 22.22 ? 51  LEU A O     1 
ATOM   354  C  CB    . LEU A 1 51  ? 13.751  86.524 30.188 1.00 24.49 ? 51  LEU A CB    1 
ATOM   355  C  CG    . LEU A 1 51  ? 14.197  85.187 30.792 1.00 25.44 ? 51  LEU A CG    1 
ATOM   356  C  CD1   . LEU A 1 51  ? 15.521  84.750 30.185 1.00 25.53 ? 51  LEU A CD1   1 
ATOM   357  C  CD2   . LEU A 1 51  ? 14.319  85.324 32.296 1.00 25.71 ? 51  LEU A CD2   1 
ATOM   358  N  N     . ALA A 1 52  ? 11.458  85.731 28.423 1.00 24.20 ? 52  ALA A N     1 
ATOM   359  C  CA    . ALA A 1 52  ? 10.453  84.771 27.978 1.00 23.19 ? 52  ALA A CA    1 
ATOM   360  C  C     . ALA A 1 52  ? 10.440  84.543 26.484 1.00 23.34 ? 52  ALA A C     1 
ATOM   361  O  O     . ALA A 1 52  ? 10.338  83.409 26.039 1.00 20.45 ? 52  ALA A O     1 
ATOM   362  C  CB    . ALA A 1 52  ? 9.075   85.213 28.439 1.00 24.05 ? 52  ALA A CB    1 
ATOM   363  N  N     . GLU A 1 53  ? 10.537  85.620 25.699 1.00 22.08 ? 53  GLU A N     1 
ATOM   364  C  CA    . GLU A 1 53  ? 10.499  85.491 24.250 1.00 22.54 ? 53  GLU A CA    1 
ATOM   365  C  C     . GLU A 1 53  ? 11.762  84.838 23.714 1.00 21.46 ? 53  GLU A C     1 
ATOM   366  O  O     . GLU A 1 53  ? 11.724  84.142 22.706 1.00 20.31 ? 53  GLU A O     1 
ATOM   367  C  CB    . GLU A 1 53  ? 10.276  86.876 23.596 1.00 24.19 ? 53  GLU A CB    1 
ATOM   368  C  CG    . GLU A 1 53  ? 8.898   87.444 23.982 1.00 26.68 ? 53  GLU A CG    1 
ATOM   369  C  CD    . GLU A 1 53  ? 8.540   88.734 23.275 1.00 30.95 ? 53  GLU A CD    1 
ATOM   370  O  OE1   . GLU A 1 53  ? 9.453   89.546 23.020 1.00 29.04 ? 53  GLU A OE1   1 
ATOM   371  O  OE2   . GLU A 1 53  ? 7.334   88.935 22.999 1.00 34.07 ? 53  GLU A OE2   1 
ATOM   372  N  N     . SER A 1 54  ? 12.881  85.068 24.391 1.00 23.47 ? 54  SER A N     1 
ATOM   373  C  CA    . SER A 1 54  ? 14.143  84.461 23.983 1.00 23.52 ? 54  SER A CA    1 
ATOM   374  C  C     . SER A 1 54  ? 14.103  82.979 24.356 1.00 22.53 ? 54  SER A C     1 
ATOM   375  O  O     . SER A 1 54  ? 14.539  82.127 23.585 1.00 22.83 ? 54  SER A O     1 
ATOM   376  C  CB    . SER A 1 54  ? 15.333  85.116 24.706 1.00 25.03 ? 54  SER A CB    1 
ATOM   377  O  OG    . SER A 1 54  ? 15.524  86.490 24.370 1.00 28.04 ? 54  SER A OG    1 
ATOM   378  N  N     . HIS A 1 55  ? 13.591  82.682 25.554 1.00 21.82 ? 55  HIS A N     1 
ATOM   379  C  CA    . HIS A 1 55  ? 13.538  81.295 26.014 1.00 20.75 ? 55  HIS A CA    1 
ATOM   380  C  C     . HIS A 1 55  ? 12.734  80.461 25.037 1.00 20.50 ? 55  HIS A C     1 
ATOM   381  O  O     . HIS A 1 55  ? 13.150  79.381 24.635 1.00 19.92 ? 55  HIS A O     1 
ATOM   382  C  CB    . HIS A 1 55  ? 12.937  81.216 27.430 1.00 21.15 ? 55  HIS A CB    1 
ATOM   383  C  CG    . HIS A 1 55  ? 12.809  79.814 27.955 1.00 21.10 ? 55  HIS A CG    1 
ATOM   384  N  ND1   . HIS A 1 55  ? 13.900  79.035 28.289 1.00 22.20 ? 55  HIS A ND1   1 
ATOM   385  C  CD2   . HIS A 1 55  ? 11.725  79.009 28.074 1.00 21.89 ? 55  HIS A CD2   1 
ATOM   386  C  CE1   . HIS A 1 55  ? 13.493  77.808 28.578 1.00 19.47 ? 55  HIS A CE1   1 
ATOM   387  N  NE2   . HIS A 1 55  ? 12.178  77.765 28.452 1.00 22.32 ? 55  HIS A NE2   1 
ATOM   388  N  N     . TYR A 1 56  ? 11.609  81.011 24.599 1.00 21.00 ? 56  TYR A N     1 
ATOM   389  C  CA    . TYR A 1 56  ? 10.716  80.309 23.693 1.00 20.40 ? 56  TYR A CA    1 
ATOM   390  C  C     . TYR A 1 56  ? 10.803  80.790 22.251 1.00 21.92 ? 56  TYR A C     1 
ATOM   391  O  O     . TYR A 1 56  ? 9.864   80.631 21.475 1.00 21.80 ? 56  TYR A O     1 
ATOM   392  C  CB    . TYR A 1 56  ? 9.293   80.471 24.207 1.00 20.25 ? 56  TYR A CB    1 
ATOM   393  C  CG    . TYR A 1 56  ? 9.012   79.611 25.409 1.00 22.57 ? 56  TYR A CG    1 
ATOM   394  C  CD1   . TYR A 1 56  ? 9.296   78.249 25.375 1.00 22.10 ? 56  TYR A CD1   1 
ATOM   395  C  CD2   . TYR A 1 56  ? 8.438   80.143 26.566 1.00 21.55 ? 56  TYR A CD2   1 
ATOM   396  C  CE1   . TYR A 1 56  ? 9.003   77.411 26.486 1.00 25.26 ? 56  TYR A CE1   1 
ATOM   397  C  CE2   . TYR A 1 56  ? 8.150   79.311 27.681 1.00 23.89 ? 56  TYR A CE2   1 
ATOM   398  C  CZ    . TYR A 1 56  ? 8.439   77.951 27.620 1.00 23.00 ? 56  TYR A CZ    1 
ATOM   399  O  OH    . TYR A 1 56  ? 8.183   77.095 28.698 1.00 24.11 ? 56  TYR A OH    1 
ATOM   400  N  N     . ALA A 1 57  ? 11.954  81.330 21.885 1.00 22.99 ? 57  ALA A N     1 
ATOM   401  C  CA    . ALA A 1 57  ? 12.126  81.869 20.548 1.00 22.80 ? 57  ALA A CA    1 
ATOM   402  C  C     . ALA A 1 57  ? 11.763  80.905 19.446 1.00 23.43 ? 57  ALA A C     1 
ATOM   403  O  O     . ALA A 1 57  ? 11.223  81.329 18.423 1.00 23.98 ? 57  ALA A O     1 
ATOM   404  C  CB    . ALA A 1 57  ? 13.552  82.376 20.384 1.00 21.86 ? 57  ALA A CB    1 
ATOM   405  N  N     . GLU A 1 58  ? 12.052  79.613 19.633 1.00 20.87 ? 58  GLU A N     1 
ATOM   406  C  CA    . GLU A 1 58  ? 11.715  78.625 18.609 1.00 22.58 ? 58  GLU A CA    1 
ATOM   407  C  C     . GLU A 1 58  ? 10.215  78.582 18.293 1.00 20.75 ? 58  GLU A C     1 
ATOM   408  O  O     . GLU A 1 58  ? 9.799   78.119 17.224 1.00 20.77 ? 58  GLU A O     1 
ATOM   409  C  CB    . GLU A 1 58  ? 12.163  77.223 19.038 1.00 23.99 ? 58  GLU A CB    1 
ATOM   410  C  CG    . GLU A 1 58  ? 11.338  76.633 20.177 1.00 27.01 ? 58  GLU A CG    1 
ATOM   411  C  CD    . GLU A 1 58  ? 11.892  75.304 20.701 1.00 27.18 ? 58  GLU A CD    1 
ATOM   412  O  OE1   . GLU A 1 58  ? 11.925  74.293 19.951 1.00 27.60 ? 58  GLU A OE1   1 
ATOM   413  O  OE2   . GLU A 1 58  ? 12.301  75.279 21.871 1.00 27.41 ? 58  GLU A OE2   1 
ATOM   414  N  N     . HIS A 1 59  ? 9.403   79.072 19.215 1.00 20.05 ? 59  HIS A N     1 
ATOM   415  C  CA    . HIS A 1 59  ? 7.957   79.029 19.009 1.00 20.51 ? 59  HIS A CA    1 
ATOM   416  C  C     . HIS A 1 59  ? 7.369   80.389 18.656 1.00 21.70 ? 59  HIS A C     1 
ATOM   417  O  O     . HIS A 1 59  ? 6.150   80.539 18.669 1.00 21.65 ? 59  HIS A O     1 
ATOM   418  C  CB    . HIS A 1 59  ? 7.259   78.533 20.296 1.00 19.88 ? 59  HIS A CB    1 
ATOM   419  C  CG    . HIS A 1 59  ? 7.742   77.203 20.795 1.00 20.55 ? 59  HIS A CG    1 
ATOM   420  N  ND1   . HIS A 1 59  ? 7.717   76.056 20.024 1.00 20.70 ? 59  HIS A ND1   1 
ATOM   421  C  CD2   . HIS A 1 59  ? 8.201   76.822 22.017 1.00 22.06 ? 59  HIS A CD2   1 
ATOM   422  C  CE1   . HIS A 1 59  ? 8.139   75.029 20.747 1.00 21.62 ? 59  HIS A CE1   1 
ATOM   423  N  NE2   . HIS A 1 59  ? 8.439   75.468 21.959 1.00 20.67 ? 59  HIS A NE2   1 
ATOM   424  N  N     . LYS A 1 60  ? 8.199   81.375 18.328 1.00 22.47 ? 60  LYS A N     1 
ATOM   425  C  CA    . LYS A 1 60  ? 7.665   82.712 18.069 1.00 25.18 ? 60  LYS A CA    1 
ATOM   426  C  C     . LYS A 1 60  ? 6.583   82.822 17.007 1.00 24.35 ? 60  LYS A C     1 
ATOM   427  O  O     . LYS A 1 60  ? 5.798   83.751 17.051 1.00 24.77 ? 60  LYS A O     1 
ATOM   428  C  CB    . LYS A 1 60  ? 8.794   83.715 17.779 1.00 28.25 ? 60  LYS A CB    1 
ATOM   429  C  CG    . LYS A 1 60  ? 9.594   83.436 16.534 1.00 32.12 ? 60  LYS A CG    1 
ATOM   430  C  CD    . LYS A 1 60  ? 10.578  84.571 16.234 1.00 37.64 ? 60  LYS A CD    1 
ATOM   431  C  CE    . LYS A 1 60  ? 11.413  84.246 14.967 1.00 40.87 ? 60  LYS A CE    1 
ATOM   432  N  NZ    . LYS A 1 60  ? 11.997  85.453 14.294 1.00 41.98 ? 60  LYS A NZ    1 
ATOM   433  N  N     . GLU A 1 61  ? 6.520   81.879 16.080 1.00 25.01 ? 61  GLU A N     1 
ATOM   434  C  CA    . GLU A 1 61  ? 5.495   81.924 15.039 1.00 26.26 ? 61  GLU A CA    1 
ATOM   435  C  C     . GLU A 1 61  ? 4.336   80.991 15.345 1.00 25.17 ? 61  GLU A C     1 
ATOM   436  O  O     . GLU A 1 61  ? 3.388   80.910 14.560 1.00 23.03 ? 61  GLU A O     1 
ATOM   437  C  CB    . GLU A 1 61  ? 6.075   81.517 13.695 1.00 29.52 ? 61  GLU A CB    1 
ATOM   438  C  CG    . GLU A 1 61  ? 7.354   82.220 13.353 1.00 35.06 ? 61  GLU A CG    1 
ATOM   439  C  CD    . GLU A 1 61  ? 7.813   81.846 11.963 1.00 38.49 ? 61  GLU A CD    1 
ATOM   440  O  OE1   . GLU A 1 61  ? 7.897   80.628 11.670 1.00 41.28 ? 61  GLU A OE1   1 
ATOM   441  O  OE2   . GLU A 1 61  ? 8.083   82.769 11.166 1.00 42.52 ? 61  GLU A OE2   1 
ATOM   442  N  N     . ARG A 1 62  ? 4.427   80.274 16.471 1.00 22.62 ? 62  ARG A N     1 
ATOM   443  C  CA    . ARG A 1 62  ? 3.372   79.347 16.859 1.00 20.75 ? 62  ARG A CA    1 
ATOM   444  C  C     . ARG A 1 62  ? 2.211   80.175 17.428 1.00 19.34 ? 62  ARG A C     1 
ATOM   445  O  O     . ARG A 1 62  ? 2.414   81.220 18.029 1.00 18.66 ? 62  ARG A O     1 
ATOM   446  C  CB    . ARG A 1 62  ? 3.887   78.324 17.890 1.00 22.82 ? 62  ARG A CB    1 
ATOM   447  C  CG    . ARG A 1 62  ? 4.702   77.133 17.302 1.00 26.55 ? 62  ARG A CG    1 
ATOM   448  C  CD    . ARG A 1 62  ? 3.791   76.123 16.527 1.00 29.78 ? 62  ARG A CD    1 
ATOM   449  N  NE    . ARG A 1 62  ? 3.521   76.669 15.191 1.00 34.15 ? 62  ARG A NE    1 
ATOM   450  C  CZ    . ARG A 1 62  ? 2.462   76.471 14.388 1.00 33.81 ? 62  ARG A CZ    1 
ATOM   451  N  NH1   . ARG A 1 62  ? 1.406   75.682 14.687 1.00 22.53 ? 62  ARG A NH1   1 
ATOM   452  N  NH2   . ARG A 1 62  ? 2.469   77.156 13.237 1.00 36.07 ? 62  ARG A NH2   1 
ATOM   453  N  N     . PRO A 1 63  ? 0.977   79.724 17.220 1.00 19.65 ? 63  PRO A N     1 
ATOM   454  C  CA    . PRO A 1 63  ? -0.190  80.474 17.719 1.00 18.67 ? 63  PRO A CA    1 
ATOM   455  C  C     . PRO A 1 63  ? -0.233  80.667 19.230 1.00 19.66 ? 63  PRO A C     1 
ATOM   456  O  O     . PRO A 1 63  ? -0.648  81.713 19.721 1.00 20.25 ? 63  PRO A O     1 
ATOM   457  C  CB    . PRO A 1 63  ? -1.370  79.654 17.192 1.00 20.24 ? 63  PRO A CB    1 
ATOM   458  C  CG    . PRO A 1 63  ? -0.818  78.262 17.122 1.00 20.35 ? 63  PRO A CG    1 
ATOM   459  C  CD    . PRO A 1 63  ? 0.557   78.497 16.531 1.00 18.59 ? 63  PRO A CD    1 
ATOM   460  N  N     . PHE A 1 64  ? 0.222   79.658 19.964 1.00 19.64 ? 64  PHE A N     1 
ATOM   461  C  CA    . PHE A 1 64  ? 0.217   79.743 21.410 1.00 19.15 ? 64  PHE A CA    1 
ATOM   462  C  C     . PHE A 1 64  ? 1.308   80.642 22.007 1.00 18.69 ? 64  PHE A C     1 
ATOM   463  O  O     . PHE A 1 64  ? 1.313   80.882 23.207 1.00 18.94 ? 64  PHE A O     1 
ATOM   464  C  CB    . PHE A 1 64  ? 0.328   78.325 21.996 1.00 20.49 ? 64  PHE A CB    1 
ATOM   465  C  CG    . PHE A 1 64  ? 1.602   77.618 21.642 1.00 19.70 ? 64  PHE A CG    1 
ATOM   466  C  CD1   . PHE A 1 64  ? 2.790   77.921 22.305 1.00 21.40 ? 64  PHE A CD1   1 
ATOM   467  C  CD2   . PHE A 1 64  ? 1.623   76.668 20.625 1.00 19.87 ? 64  PHE A CD2   1 
ATOM   468  C  CE1   . PHE A 1 64  ? 3.977   77.290 21.961 1.00 20.92 ? 64  PHE A CE1   1 
ATOM   469  C  CE2   . PHE A 1 64  ? 2.816   76.024 20.267 1.00 22.46 ? 64  PHE A CE2   1 
ATOM   470  C  CZ    . PHE A 1 64  ? 3.992   76.341 20.942 1.00 21.05 ? 64  PHE A CZ    1 
ATOM   471  N  N     . PHE A 1 65  ? 2.230   81.158 21.190 1.00 16.92 ? 65  PHE A N     1 
ATOM   472  C  CA    . PHE A 1 65  ? 3.328   81.985 21.712 1.00 17.57 ? 65  PHE A CA    1 
ATOM   473  C  C     . PHE A 1 65  ? 2.926   83.203 22.556 1.00 17.41 ? 65  PHE A C     1 
ATOM   474  O  O     . PHE A 1 65  ? 3.490   83.460 23.620 1.00 15.93 ? 65  PHE A O     1 
ATOM   475  C  CB    . PHE A 1 65  ? 4.209   82.454 20.537 1.00 18.34 ? 65  PHE A CB    1 
ATOM   476  C  CG    . PHE A 1 65  ? 5.433   83.230 20.942 1.00 19.98 ? 65  PHE A CG    1 
ATOM   477  C  CD1   . PHE A 1 65  ? 6.567   82.575 21.447 1.00 18.04 ? 65  PHE A CD1   1 
ATOM   478  C  CD2   . PHE A 1 65  ? 5.482   84.605 20.772 1.00 22.07 ? 65  PHE A CD2   1 
ATOM   479  C  CE1   . PHE A 1 65  ? 7.718   83.280 21.764 1.00 20.45 ? 65  PHE A CE1   1 
ATOM   480  C  CE2   . PHE A 1 65  ? 6.640   85.342 21.089 1.00 22.93 ? 65  PHE A CE2   1 
ATOM   481  C  CZ    . PHE A 1 65  ? 7.764   84.673 21.585 1.00 22.62 ? 65  PHE A CZ    1 
ATOM   482  N  N     . GLY A 1 66  ? 1.966   83.984 22.087 1.00 16.55 ? 66  GLY A N     1 
ATOM   483  C  CA    . GLY A 1 66  ? 1.591   85.157 22.867 1.00 17.78 ? 66  GLY A CA    1 
ATOM   484  C  C     . GLY A 1 66  ? 1.060   84.842 24.261 1.00 17.97 ? 66  GLY A C     1 
ATOM   485  O  O     . GLY A 1 66  ? 1.447   85.479 25.236 1.00 19.58 ? 66  GLY A O     1 
ATOM   486  N  N     . GLY A 1 67  ? 0.162   83.874 24.341 1.00 20.45 ? 67  GLY A N     1 
ATOM   487  C  CA    . GLY A 1 67  ? -0.408  83.478 25.617 1.00 20.60 ? 67  GLY A CA    1 
ATOM   488  C  C     . GLY A 1 67  ? 0.656   82.850 26.507 1.00 22.04 ? 67  GLY A C     1 
ATOM   489  O  O     . GLY A 1 67  ? 0.632   82.993 27.724 1.00 22.69 ? 67  GLY A O     1 
ATOM   490  N  N     . LEU A 1 68  ? 1.593   82.145 25.887 1.00 20.80 ? 68  LEU A N     1 
ATOM   491  C  CA    . LEU A 1 68  ? 2.668   81.493 26.624 1.00 18.32 ? 68  LEU A CA    1 
ATOM   492  C  C     . LEU A 1 68  ? 3.573   82.557 27.239 1.00 19.38 ? 68  LEU A C     1 
ATOM   493  O  O     . LEU A 1 68  ? 3.902   82.505 28.429 1.00 18.37 ? 68  LEU A O     1 
ATOM   494  C  CB    . LEU A 1 68  ? 3.458   80.580 25.669 1.00 19.37 ? 68  LEU A CB    1 
ATOM   495  C  CG    . LEU A 1 68  ? 4.772   79.956 26.175 1.00 18.11 ? 68  LEU A CG    1 
ATOM   496  C  CD1   . LEU A 1 68  ? 4.498   79.050 27.418 1.00 19.33 ? 68  LEU A CD1   1 
ATOM   497  C  CD2   . LEU A 1 68  ? 5.424   79.163 25.058 1.00 17.77 ? 68  LEU A CD2   1 
ATOM   498  N  N     . VAL A 1 69  ? 3.980   83.544 26.432 1.00 18.26 ? 69  VAL A N     1 
ATOM   499  C  CA    . VAL A 1 69  ? 4.830   84.604 26.952 1.00 16.44 ? 69  VAL A CA    1 
ATOM   500  C  C     . VAL A 1 69  ? 4.125   85.375 28.054 1.00 17.79 ? 69  VAL A C     1 
ATOM   501  O  O     . VAL A 1 69  ? 4.731   85.750 29.062 1.00 18.03 ? 69  VAL A O     1 
ATOM   502  C  CB    . VAL A 1 69  ? 5.247   85.596 25.827 1.00 15.43 ? 69  VAL A CB    1 
ATOM   503  C  CG1   . VAL A 1 69  ? 5.858   86.857 26.431 1.00 18.35 ? 69  VAL A CG1   1 
ATOM   504  C  CG2   . VAL A 1 69  ? 6.268   84.925 24.918 1.00 16.71 ? 69  VAL A CG2   1 
ATOM   505  N  N     . SER A 1 70  ? 2.846   85.641 27.844 1.00 18.50 ? 70  SER A N     1 
ATOM   506  C  CA    . SER A 1 70  ? 2.067   86.360 28.823 1.00 20.69 ? 70  SER A CA    1 
ATOM   507  C  C     . SER A 1 70  ? 2.006   85.563 30.108 1.00 21.28 ? 70  SER A C     1 
ATOM   508  O  O     . SER A 1 70  ? 2.169   86.121 31.204 1.00 21.21 ? 70  SER A O     1 
ATOM   509  C  CB    . SER A 1 70  ? 0.634   86.595 28.329 1.00 24.04 ? 70  SER A CB    1 
ATOM   510  O  OG    . SER A 1 70  ? 0.570   87.722 27.452 1.00 28.55 ? 70  SER A OG    1 
ATOM   511  N  N     . PHE A 1 71  ? 1.749   84.267 29.982 1.00 20.76 ? 71  PHE A N     1 
ATOM   512  C  CA    . PHE A 1 71  ? 1.652   83.469 31.187 1.00 22.36 ? 71  PHE A CA    1 
ATOM   513  C  C     . PHE A 1 71  ? 2.987   83.313 31.910 1.00 22.39 ? 71  PHE A C     1 
ATOM   514  O  O     . PHE A 1 71  ? 3.064   83.528 33.129 1.00 20.59 ? 71  PHE A O     1 
ATOM   515  C  CB    . PHE A 1 71  ? 1.078   82.085 30.926 1.00 22.48 ? 71  PHE A CB    1 
ATOM   516  C  CG    . PHE A 1 71  ? 0.871   81.307 32.195 1.00 23.81 ? 71  PHE A CG    1 
ATOM   517  C  CD1   . PHE A 1 71  ? -0.037  81.757 33.149 1.00 24.00 ? 71  PHE A CD1   1 
ATOM   518  C  CD2   . PHE A 1 71  ? 1.672   80.212 32.498 1.00 24.30 ? 71  PHE A CD2   1 
ATOM   519  C  CE1   . PHE A 1 71  ? -0.140  81.124 34.402 1.00 26.34 ? 71  PHE A CE1   1 
ATOM   520  C  CE2   . PHE A 1 71  ? 1.577   79.577 33.741 1.00 19.11 ? 71  PHE A CE2   1 
ATOM   521  C  CZ    . PHE A 1 71  ? 0.683   80.027 34.686 1.00 21.84 ? 71  PHE A CZ    1 
ATOM   522  N  N     . ILE A 1 72  ? 4.035   82.955 31.170 1.00 20.65 ? 72  ILE A N     1 
ATOM   523  C  CA    . ILE A 1 72  ? 5.327   82.777 31.821 1.00 21.98 ? 72  ILE A CA    1 
ATOM   524  C  C     . ILE A 1 72  ? 5.823   84.043 32.524 1.00 21.28 ? 72  ILE A C     1 
ATOM   525  O  O     . ILE A 1 72  ? 6.633   83.968 33.452 1.00 19.98 ? 72  ILE A O     1 
ATOM   526  C  CB    . ILE A 1 72  ? 6.408   82.304 30.828 1.00 23.28 ? 72  ILE A CB    1 
ATOM   527  C  CG1   . ILE A 1 72  ? 7.490   81.549 31.583 1.00 26.49 ? 72  ILE A CG1   1 
ATOM   528  C  CG2   . ILE A 1 72  ? 7.046   83.477 30.138 1.00 27.81 ? 72  ILE A CG2   1 
ATOM   529  C  CD1   . ILE A 1 72  ? 7.076   80.106 31.832 1.00 28.08 ? 72  ILE A CD1   1 
ATOM   530  N  N     . THR A 1 73  ? 5.362   85.215 32.085 1.00 20.68 ? 73  THR A N     1 
ATOM   531  C  CA    . THR A 1 73  ? 5.786   86.457 32.722 1.00 20.54 ? 73  THR A CA    1 
ATOM   532  C  C     . THR A 1 73  ? 4.766   86.944 33.755 1.00 20.01 ? 73  THR A C     1 
ATOM   533  O  O     . THR A 1 73  ? 4.953   87.977 34.367 1.00 19.35 ? 73  THR A O     1 
ATOM   534  C  CB    . THR A 1 73  ? 5.996   87.587 31.665 1.00 20.91 ? 73  THR A CB    1 
ATOM   535  O  OG1   . THR A 1 73  ? 4.822   87.691 30.841 1.00 22.02 ? 73  THR A OG1   1 
ATOM   536  C  CG2   . THR A 1 73  ? 7.195   87.267 30.755 1.00 21.86 ? 73  THR A CG2   1 
ATOM   537  N  N     . SER A 1 74  ? 3.698   86.189 33.959 1.00 20.47 ? 74  SER A N     1 
ATOM   538  C  CA    . SER A 1 74  ? 2.645   86.615 34.872 1.00 21.53 ? 74  SER A CA    1 
ATOM   539  C  C     . SER A 1 74  ? 2.942   86.415 36.337 1.00 21.39 ? 74  SER A C     1 
ATOM   540  O  O     . SER A 1 74  ? 2.203   86.903 37.182 1.00 21.60 ? 74  SER A O     1 
ATOM   541  C  CB    . SER A 1 74  ? 1.348   85.894 34.560 1.00 20.58 ? 74  SER A CB    1 
ATOM   542  O  OG    . SER A 1 74  ? 1.468   84.516 34.851 1.00 18.95 ? 74  SER A OG    1 
ATOM   543  N  N     . GLY A 1 75  ? 4.008   85.691 36.643 1.00 21.38 ? 75  GLY A N     1 
ATOM   544  C  CA    . GLY A 1 75  ? 4.318   85.471 38.058 1.00 20.68 ? 75  GLY A CA    1 
ATOM   545  C  C     . GLY A 1 75  ? 5.693   84.865 38.227 1.00 18.13 ? 75  GLY A C     1 
ATOM   546  O  O     . GLY A 1 75  ? 6.401   84.688 37.240 1.00 20.04 ? 75  GLY A O     1 
ATOM   547  N  N     . PRO A 1 76  ? 6.104   84.515 39.460 1.00 17.14 ? 76  PRO A N     1 
ATOM   548  C  CA    . PRO A 1 76  ? 7.437   83.936 39.634 1.00 17.48 ? 76  PRO A CA    1 
ATOM   549  C  C     . PRO A 1 76  ? 7.631   82.566 39.028 1.00 17.09 ? 76  PRO A C     1 
ATOM   550  O  O     . PRO A 1 76  ? 6.700   81.771 38.922 1.00 16.60 ? 76  PRO A O     1 
ATOM   551  C  CB    . PRO A 1 76  ? 7.622   83.922 41.159 1.00 17.99 ? 76  PRO A CB    1 
ATOM   552  C  CG    . PRO A 1 76  ? 6.240   83.767 41.662 1.00 18.51 ? 76  PRO A CG    1 
ATOM   553  C  CD    . PRO A 1 76  ? 5.429   84.685 40.756 1.00 18.86 ? 76  PRO A CD    1 
ATOM   554  N  N     . VAL A 1 77  ? 8.869   82.321 38.629 1.00 17.38 ? 77  VAL A N     1 
ATOM   555  C  CA    . VAL A 1 77  ? 9.317   81.071 38.048 1.00 17.95 ? 77  VAL A CA    1 
ATOM   556  C  C     . VAL A 1 77  ? 10.506  80.657 38.902 1.00 16.14 ? 77  VAL A C     1 
ATOM   557  O  O     . VAL A 1 77  ? 11.228  81.519 39.404 1.00 17.48 ? 77  VAL A O     1 
ATOM   558  C  CB    . VAL A 1 77  ? 9.817   81.305 36.615 1.00 16.19 ? 77  VAL A CB    1 
ATOM   559  C  CG1   . VAL A 1 77  ? 10.546  80.093 36.080 1.00 18.11 ? 77  VAL A CG1   1 
ATOM   560  C  CG2   . VAL A 1 77  ? 8.624   81.642 35.731 1.00 17.30 ? 77  VAL A CG2   1 
ATOM   561  N  N     . VAL A 1 78  ? 10.677  79.360 39.119 1.00 16.42 ? 78  VAL A N     1 
ATOM   562  C  CA    . VAL A 1 78  ? 11.859  78.908 39.836 1.00 16.35 ? 78  VAL A CA    1 
ATOM   563  C  C     . VAL A 1 78  ? 12.693  78.236 38.777 1.00 16.38 ? 78  VAL A C     1 
ATOM   564  O  O     . VAL A 1 78  ? 12.340  77.187 38.245 1.00 17.07 ? 78  VAL A O     1 
ATOM   565  C  CB    . VAL A 1 78  ? 11.541  77.946 40.980 1.00 15.38 ? 78  VAL A CB    1 
ATOM   566  C  CG1   . VAL A 1 78  ? 12.827  77.321 41.487 1.00 16.39 ? 78  VAL A CG1   1 
ATOM   567  C  CG2   . VAL A 1 78  ? 10.905  78.729 42.084 1.00 15.25 ? 78  VAL A CG2   1 
ATOM   568  N  N     . ALA A 1 79  ? 13.808  78.873 38.468 1.00 15.57 ? 79  ALA A N     1 
ATOM   569  C  CA    . ALA A 1 79  ? 14.705  78.405 37.432 1.00 16.97 ? 79  ALA A CA    1 
ATOM   570  C  C     . ALA A 1 79  ? 15.801  77.569 38.059 1.00 15.94 ? 79  ALA A C     1 
ATOM   571  O  O     . ALA A 1 79  ? 16.323  77.903 39.117 1.00 17.30 ? 79  ALA A O     1 
ATOM   572  C  CB    . ALA A 1 79  ? 15.315  79.611 36.698 1.00 17.62 ? 79  ALA A CB    1 
ATOM   573  N  N     . MET A 1 80  ? 16.170  76.501 37.392 1.00 15.55 ? 80  MET A N     1 
ATOM   574  C  CA    . MET A 1 80  ? 17.219  75.662 37.935 1.00 17.36 ? 80  MET A CA    1 
ATOM   575  C  C     . MET A 1 80  ? 18.028  74.961 36.867 1.00 17.20 ? 80  MET A C     1 
ATOM   576  O  O     . MET A 1 80  ? 17.604  74.792 35.735 1.00 18.94 ? 80  MET A O     1 
ATOM   577  C  CB    . MET A 1 80  ? 16.598  74.621 38.890 1.00 19.48 ? 80  MET A CB    1 
ATOM   578  C  CG    . MET A 1 80  ? 15.461  73.868 38.305 1.00 20.71 ? 80  MET A CG    1 
ATOM   579  S  SD    . MET A 1 80  ? 14.369  72.990 39.590 1.00 22.09 ? 80  MET A SD    1 
ATOM   580  C  CE    . MET A 1 80  ? 13.893  74.106 40.477 1.00 17.87 ? 80  MET A CE    1 
ATOM   581  N  N     . VAL A 1 81  ? 19.225  74.557 37.254 1.00 17.03 ? 81  VAL A N     1 
ATOM   582  C  CA    . VAL A 1 81  ? 20.081  73.830 36.369 1.00 17.71 ? 81  VAL A CA    1 
ATOM   583  C  C     . VAL A 1 81  ? 20.543  72.619 37.151 1.00 15.98 ? 81  VAL A C     1 
ATOM   584  O  O     . VAL A 1 81  ? 20.983  72.727 38.301 1.00 17.65 ? 81  VAL A O     1 
ATOM   585  C  CB    . VAL A 1 81  ? 21.288  74.649 35.908 1.00 17.11 ? 81  VAL A CB    1 
ATOM   586  C  CG1   . VAL A 1 81  ? 22.177  73.783 35.036 1.00 16.32 ? 81  VAL A CG1   1 
ATOM   587  C  CG2   . VAL A 1 81  ? 20.816  75.838 35.102 1.00 20.03 ? 81  VAL A CG2   1 
ATOM   588  N  N     . PHE A 1 82  ? 20.396  71.474 36.516 1.00 17.64 ? 82  PHE A N     1 
ATOM   589  C  CA    . PHE A 1 82  ? 20.766  70.197 37.099 1.00 17.87 ? 82  PHE A CA    1 
ATOM   590  C  C     . PHE A 1 82  ? 21.826  69.550 36.265 1.00 19.49 ? 82  PHE A C     1 
ATOM   591  O  O     . PHE A 1 82  ? 21.769  69.609 35.026 1.00 17.86 ? 82  PHE A O     1 
ATOM   592  C  CB    . PHE A 1 82  ? 19.544  69.285 37.178 1.00 19.99 ? 82  PHE A CB    1 
ATOM   593  C  CG    . PHE A 1 82  ? 18.788  69.433 38.455 1.00 20.06 ? 82  PHE A CG    1 
ATOM   594  C  CD1   . PHE A 1 82  ? 19.290  68.883 39.632 1.00 19.07 ? 82  PHE A CD1   1 
ATOM   595  C  CD2   . PHE A 1 82  ? 17.607  70.182 38.502 1.00 21.90 ? 82  PHE A CD2   1 
ATOM   596  C  CE1   . PHE A 1 82  ? 18.621  69.079 40.839 1.00 19.74 ? 82  PHE A CE1   1 
ATOM   597  C  CE2   . PHE A 1 82  ? 16.939  70.383 39.709 1.00 20.83 ? 82  PHE A CE2   1 
ATOM   598  C  CZ    . PHE A 1 82  ? 17.437  69.836 40.862 1.00 17.25 ? 82  PHE A CZ    1 
ATOM   599  N  N     . GLU A 1 83  ? 22.772  68.903 36.951 1.00 19.24 ? 83  GLU A N     1 
ATOM   600  C  CA    . GLU A 1 83  ? 23.897  68.238 36.296 1.00 19.81 ? 83  GLU A CA    1 
ATOM   601  C  C     . GLU A 1 83  ? 24.003  66.739 36.586 1.00 18.89 ? 83  GLU A C     1 
ATOM   602  O  O     . GLU A 1 83  ? 23.803  66.297 37.719 1.00 18.21 ? 83  GLU A O     1 
ATOM   603  C  CB    . GLU A 1 83  ? 25.191  68.912 36.739 1.00 20.26 ? 83  GLU A CB    1 
ATOM   604  C  CG    . GLU A 1 83  ? 26.450  68.317 36.129 1.00 22.03 ? 83  GLU A CG    1 
ATOM   605  C  CD    . GLU A 1 83  ? 27.696  69.081 36.547 1.00 23.42 ? 83  GLU A CD    1 
ATOM   606  O  OE1   . GLU A 1 83  ? 27.622  70.326 36.600 1.00 25.44 ? 83  GLU A OE1   1 
ATOM   607  O  OE2   . GLU A 1 83  ? 28.743  68.446 36.806 1.00 25.75 ? 83  GLU A OE2   1 
ATOM   608  N  N     . GLY A 1 84  ? 24.315  65.975 35.536 1.00 19.35 ? 84  GLY A N     1 
ATOM   609  C  CA    . GLY A 1 84  ? 24.485  64.544 35.641 1.00 18.46 ? 84  GLY A CA    1 
ATOM   610  C  C     . GLY A 1 84  ? 24.433  63.862 34.294 1.00 22.17 ? 84  GLY A C     1 
ATOM   611  O  O     . GLY A 1 84  ? 23.981  64.442 33.293 1.00 20.59 ? 84  GLY A O     1 
ATOM   612  N  N     . LYS A 1 85  ? 24.892  62.613 34.271 1.00 22.82 ? 85  LYS A N     1 
ATOM   613  C  CA    . LYS A 1 85  ? 24.874  61.803 33.073 1.00 23.72 ? 85  LYS A CA    1 
ATOM   614  C  C     . LYS A 1 85  ? 23.467  61.755 32.471 1.00 23.58 ? 85  LYS A C     1 
ATOM   615  O  O     . LYS A 1 85  ? 22.486  61.399 33.158 1.00 23.54 ? 85  LYS A O     1 
ATOM   616  C  CB    . LYS A 1 85  ? 25.330  60.371 33.420 1.00 24.92 ? 85  LYS A CB    1 
ATOM   617  C  CG    . LYS A 1 85  ? 25.415  59.391 32.242 1.00 26.82 ? 85  LYS A CG    1 
ATOM   618  C  CD    . LYS A 1 85  ? 25.587  57.957 32.783 1.00 30.02 ? 85  LYS A CD    1 
ATOM   619  C  CE    . LYS A 1 85  ? 26.004  56.962 31.717 1.00 32.55 ? 85  LYS A CE    1 
ATOM   620  N  NZ    . LYS A 1 85  ? 25.039  56.809 30.581 1.00 34.51 ? 85  LYS A NZ    1 
ATOM   621  N  N     . GLY A 1 86  ? 23.383  62.093 31.183 1.00 21.13 ? 86  GLY A N     1 
ATOM   622  C  CA    . GLY A 1 86  ? 22.131  62.063 30.455 1.00 18.37 ? 86  GLY A CA    1 
ATOM   623  C  C     . GLY A 1 86  ? 21.013  62.884 31.087 1.00 19.01 ? 86  GLY A C     1 
ATOM   624  O  O     . GLY A 1 86  ? 19.840  62.614 30.862 1.00 19.43 ? 86  GLY A O     1 
ATOM   625  N  N     . VAL A 1 87  ? 21.372  63.915 31.833 1.00 18.15 ? 87  VAL A N     1 
ATOM   626  C  CA    . VAL A 1 87  ? 20.359  64.688 32.537 1.00 18.69 ? 87  VAL A CA    1 
ATOM   627  C  C     . VAL A 1 87  ? 19.280  65.315 31.652 1.00 18.16 ? 87  VAL A C     1 
ATOM   628  O  O     . VAL A 1 87  ? 18.108  65.394 32.034 1.00 15.57 ? 87  VAL A O     1 
ATOM   629  C  CB    . VAL A 1 87  ? 21.022  65.761 33.447 1.00 18.39 ? 87  VAL A CB    1 
ATOM   630  C  CG1   . VAL A 1 87  ? 21.695  66.856 32.622 1.00 18.17 ? 87  VAL A CG1   1 
ATOM   631  C  CG2   . VAL A 1 87  ? 19.966  66.382 34.378 1.00 17.45 ? 87  VAL A CG2   1 
ATOM   632  N  N     . VAL A 1 88  ? 19.661  65.772 30.464 1.00 17.55 ? 88  VAL A N     1 
ATOM   633  C  CA    . VAL A 1 88  ? 18.687  66.404 29.584 1.00 17.33 ? 88  VAL A CA    1 
ATOM   634  C  C     . VAL A 1 88  ? 17.555  65.470 29.164 1.00 16.31 ? 88  VAL A C     1 
ATOM   635  O  O     . VAL A 1 88  ? 16.373  65.798 29.335 1.00 18.42 ? 88  VAL A O     1 
ATOM   636  C  CB    . VAL A 1 88  ? 19.386  66.973 28.318 1.00 17.77 ? 88  VAL A CB    1 
ATOM   637  C  CG1   . VAL A 1 88  ? 18.343  67.531 27.361 1.00 18.51 ? 88  VAL A CG1   1 
ATOM   638  C  CG2   . VAL A 1 88  ? 20.414  68.038 28.733 1.00 16.93 ? 88  VAL A CG2   1 
ATOM   639  N  N     . ALA A 1 89  ? 17.891  64.310 28.615 1.00 17.47 ? 89  ALA A N     1 
ATOM   640  C  CA    . ALA A 1 89  ? 16.851  63.355 28.206 1.00 16.75 ? 89  ALA A CA    1 
ATOM   641  C  C     . ALA A 1 89  ? 16.133  62.776 29.449 1.00 17.47 ? 89  ALA A C     1 
ATOM   642  O  O     . ALA A 1 89  ? 14.929  62.533 29.426 1.00 17.27 ? 89  ALA A O     1 
ATOM   643  C  CB    . ALA A 1 89  ? 17.460  62.199 27.404 1.00 18.79 ? 89  ALA A CB    1 
ATOM   644  N  N     . SER A 1 90  ? 16.886  62.537 30.511 1.00 17.91 ? 90  SER A N     1 
ATOM   645  C  CA    . SER A 1 90  ? 16.282  61.984 31.718 1.00 17.67 ? 90  SER A CA    1 
ATOM   646  C  C     . SER A 1 90  ? 15.279  62.988 32.317 1.00 17.74 ? 90  SER A C     1 
ATOM   647  O  O     . SER A 1 90  ? 14.165  62.616 32.697 1.00 17.57 ? 90  SER A O     1 
ATOM   648  C  CB    . SER A 1 90  ? 17.364  61.652 32.732 1.00 18.82 ? 90  SER A CB    1 
ATOM   649  O  OG    . SER A 1 90  ? 16.789  61.138 33.922 1.00 18.82 ? 90  SER A OG    1 
ATOM   650  N  N     . ALA A 1 91  ? 15.661  64.259 32.374 1.00 17.43 ? 91  ALA A N     1 
ATOM   651  C  CA    . ALA A 1 91  ? 14.768  65.257 32.947 1.00 18.53 ? 91  ALA A CA    1 
ATOM   652  C  C     . ALA A 1 91  ? 13.459  65.318 32.160 1.00 17.10 ? 91  ALA A C     1 
ATOM   653  O  O     . ALA A 1 91  ? 12.385  65.520 32.727 1.00 17.59 ? 91  ALA A O     1 
ATOM   654  C  CB    . ALA A 1 91  ? 15.431  66.607 32.945 1.00 18.50 ? 91  ALA A CB    1 
ATOM   655  N  N     . ARG A 1 92  ? 13.558  65.170 30.849 1.00 17.01 ? 92  ARG A N     1 
ATOM   656  C  CA    . ARG A 1 92  ? 12.388  65.204 29.997 1.00 16.99 ? 92  ARG A CA    1 
ATOM   657  C  C     . ARG A 1 92  ? 11.510  64.008 30.307 1.00 16.38 ? 92  ARG A C     1 
ATOM   658  O  O     . ARG A 1 92  ? 10.308  64.145 30.362 1.00 15.76 ? 92  ARG A O     1 
ATOM   659  C  CB    . ARG A 1 92  ? 12.790  65.159 28.527 1.00 19.37 ? 92  ARG A CB    1 
ATOM   660  C  CG    . ARG A 1 92  ? 13.560  66.409 28.108 1.00 21.89 ? 92  ARG A CG    1 
ATOM   661  C  CD    . ARG A 1 92  ? 12.707  67.337 27.275 1.00 30.01 ? 92  ARG A CD    1 
ATOM   662  N  NE    . ARG A 1 92  ? 11.639  67.979 28.020 1.00 31.48 ? 92  ARG A NE    1 
ATOM   663  C  CZ    . ARG A 1 92  ? 10.909  68.984 27.535 1.00 34.80 ? 92  ARG A CZ    1 
ATOM   664  N  NH1   . ARG A 1 92  ? 11.129  69.444 26.307 1.00 35.75 ? 92  ARG A NH1   1 
ATOM   665  N  NH2   . ARG A 1 92  ? 9.996   69.565 28.288 1.00 35.14 ? 92  ARG A NH2   1 
ATOM   666  N  N     . LEU A 1 93  ? 12.119  62.840 30.465 1.00 15.03 ? 93  LEU A N     1 
ATOM   667  C  CA    . LEU A 1 93  ? 11.358  61.631 30.787 1.00 17.28 ? 93  LEU A CA    1 
ATOM   668  C  C     . LEU A 1 93  ? 10.613  61.854 32.109 1.00 17.35 ? 93  LEU A C     1 
ATOM   669  O  O     . LEU A 1 93  ? 9.441   61.484 32.246 1.00 19.80 ? 93  LEU A O     1 
ATOM   670  C  CB    . LEU A 1 93  ? 12.306  60.438 30.928 1.00 18.45 ? 93  LEU A CB    1 
ATOM   671  C  CG    . LEU A 1 93  ? 11.698  59.023 30.933 1.00 18.98 ? 93  LEU A CG    1 
ATOM   672  C  CD1   . LEU A 1 93  ? 11.059  58.696 29.573 1.00 23.60 ? 93  LEU A CD1   1 
ATOM   673  C  CD2   . LEU A 1 93  ? 12.821  58.027 31.252 1.00 18.90 ? 93  LEU A CD2   1 
ATOM   674  N  N     . MET A 1 94  ? 11.296  62.474 33.069 1.00 16.08 ? 94  MET A N     1 
ATOM   675  C  CA    . MET A 1 94  ? 10.718  62.743 34.391 1.00 15.70 ? 94  MET A CA    1 
ATOM   676  C  C     . MET A 1 94  ? 9.594   63.774 34.360 1.00 17.09 ? 94  MET A C     1 
ATOM   677  O  O     . MET A 1 94  ? 8.703   63.778 35.223 1.00 16.36 ? 94  MET A O     1 
ATOM   678  C  CB    . MET A 1 94  ? 11.845  63.161 35.344 1.00 16.67 ? 94  MET A CB    1 
ATOM   679  C  CG    . MET A 1 94  ? 12.747  61.982 35.686 1.00 17.33 ? 94  MET A CG    1 
ATOM   680  S  SD    . MET A 1 94  ? 14.197  62.458 36.560 1.00 19.68 ? 94  MET A SD    1 
ATOM   681  C  CE    . MET A 1 94  ? 13.484  62.956 38.190 1.00 18.93 ? 94  MET A CE    1 
ATOM   682  N  N     . ILE A 1 95  ? 9.623   64.641 33.355 1.00 15.75 ? 95  ILE A N     1 
ATOM   683  C  CA    . ILE A 1 95  ? 8.622   65.676 33.185 1.00 15.89 ? 95  ILE A CA    1 
ATOM   684  C  C     . ILE A 1 95  ? 7.369   65.117 32.534 1.00 15.32 ? 95  ILE A C     1 
ATOM   685  O  O     . ILE A 1 95  ? 6.252   65.447 32.941 1.00 15.80 ? 95  ILE A O     1 
ATOM   686  C  CB    . ILE A 1 95  ? 9.185   66.812 32.299 1.00 15.99 ? 95  ILE A CB    1 
ATOM   687  C  CG1   . ILE A 1 95  ? 10.078  67.701 33.147 1.00 17.01 ? 95  ILE A CG1   1 
ATOM   688  C  CG2   . ILE A 1 95  ? 8.042   67.543 31.588 1.00 14.80 ? 95  ILE A CG2   1 
ATOM   689  C  CD1   . ILE A 1 95  ? 10.976  68.649 32.341 1.00 17.58 ? 95  ILE A CD1   1 
ATOM   690  N  N     . GLY A 1 96  ? 7.560   64.271 31.520 1.00 15.92 ? 96  GLY A N     1 
ATOM   691  C  CA    . GLY A 1 96  ? 6.437   63.666 30.809 1.00 17.39 ? 96  GLY A CA    1 
ATOM   692  C  C     . GLY A 1 96  ? 6.449   64.079 29.347 1.00 19.11 ? 96  GLY A C     1 
ATOM   693  O  O     . GLY A 1 96  ? 7.506   63.979 28.693 1.00 20.00 ? 96  GLY A O     1 
ATOM   694  N  N     . VAL A 1 97  ? 5.296   64.504 28.826 1.00 18.54 ? 97  VAL A N     1 
ATOM   695  C  CA    . VAL A 1 97  ? 5.211   64.975 27.434 1.00 18.77 ? 97  VAL A CA    1 
ATOM   696  C  C     . VAL A 1 97  ? 4.526   66.321 27.482 1.00 17.76 ? 97  VAL A C     1 
ATOM   697  O  O     . VAL A 1 97  ? 4.007   66.717 28.527 1.00 18.15 ? 97  VAL A O     1 
ATOM   698  C  CB    . VAL A 1 97  ? 4.437   63.969 26.515 1.00 18.62 ? 97  VAL A CB    1 
ATOM   699  C  CG1   . VAL A 1 97  ? 5.237   62.676 26.400 1.00 19.98 ? 97  VAL A CG1   1 
ATOM   700  C  CG2   . VAL A 1 97  ? 3.026   63.649 27.073 1.00 19.54 ? 97  VAL A CG2   1 
ATOM   701  N  N     . THR A 1 98  ? 4.506   67.060 26.374 1.00 17.15 ? 98  THR A N     1 
ATOM   702  C  CA    . THR A 1 98  ? 3.877   68.374 26.419 1.00 16.27 ? 98  THR A CA    1 
ATOM   703  C  C     . THR A 1 98  ? 2.460   68.438 27.025 1.00 16.53 ? 98  THR A C     1 
ATOM   704  O  O     . THR A 1 98  ? 2.157   69.312 27.840 1.00 17.22 ? 98  THR A O     1 
ATOM   705  C  CB    . THR A 1 98  ? 3.862   69.005 25.001 1.00 17.05 ? 98  THR A CB    1 
ATOM   706  O  OG1   . THR A 1 98  ? 5.171   68.858 24.420 1.00 17.27 ? 98  THR A OG1   1 
ATOM   707  C  CG2   . THR A 1 98  ? 3.524   70.458 25.108 1.00 17.72 ? 98  THR A CG2   1 
ATOM   708  N  N     . ASN A 1 99  ? 1.594   67.518 26.622 1.00 16.89 ? 99  ASN A N     1 
ATOM   709  C  CA    . ASN A 1 99  ? 0.223   67.465 27.130 1.00 16.22 ? 99  ASN A CA    1 
ATOM   710  C  C     . ASN A 1 99  ? 0.195   66.676 28.447 1.00 16.44 ? 99  ASN A C     1 
ATOM   711  O  O     . ASN A 1 99  ? 0.409   65.472 28.456 1.00 15.00 ? 99  ASN A O     1 
ATOM   712  C  CB    . ASN A 1 99  ? -0.652  66.755 26.103 1.00 20.06 ? 99  ASN A CB    1 
ATOM   713  C  CG    . ASN A 1 99  ? -2.111  66.700 26.499 1.00 20.14 ? 99  ASN A CG    1 
ATOM   714  O  OD1   . ASN A 1 99  ? -2.937  66.153 25.755 1.00 22.71 ? 99  ASN A OD1   1 
ATOM   715  N  ND2   . ASN A 1 99  ? -2.446  67.242 27.671 1.00 18.72 ? 99  ASN A ND2   1 
ATOM   716  N  N     . PRO A 1 100 ? -0.091  67.346 29.565 1.00 16.06 ? 100 PRO A N     1 
ATOM   717  C  CA    . PRO A 1 100 ? -0.118  66.611 30.836 1.00 16.71 ? 100 PRO A CA    1 
ATOM   718  C  C     . PRO A 1 100 ? -1.099  65.447 30.868 1.00 15.66 ? 100 PRO A C     1 
ATOM   719  O  O     . PRO A 1 100 ? -0.865  64.456 31.567 1.00 16.09 ? 100 PRO A O     1 
ATOM   720  C  CB    . PRO A 1 100 ? -0.475  67.687 31.873 1.00 16.39 ? 100 PRO A CB    1 
ATOM   721  C  CG    . PRO A 1 100 ? -0.100  68.971 31.229 1.00 18.66 ? 100 PRO A CG    1 
ATOM   722  C  CD    . PRO A 1 100 ? -0.467  68.751 29.765 1.00 15.91 ? 100 PRO A CD    1 
ATOM   723  N  N     . LEU A 1 101 ? -2.196  65.545 30.119 1.00 14.70 ? 101 LEU A N     1 
ATOM   724  C  CA    . LEU A 1 101 ? -3.175  64.467 30.136 1.00 16.20 ? 101 LEU A CA    1 
ATOM   725  C  C     . LEU A 1 101 ? -2.625  63.179 29.522 1.00 17.44 ? 101 LEU A C     1 
ATOM   726  O  O     . LEU A 1 101 ? -3.048  62.088 29.876 1.00 18.25 ? 101 LEU A O     1 
ATOM   727  C  CB    . LEU A 1 101 ? -4.484  64.920 29.460 1.00 15.67 ? 101 LEU A CB    1 
ATOM   728  C  CG    . LEU A 1 101 ? -5.150  66.085 30.233 1.00 17.21 ? 101 LEU A CG    1 
ATOM   729  C  CD1   . LEU A 1 101 ? -6.271  66.760 29.443 1.00 19.26 ? 101 LEU A CD1   1 
ATOM   730  C  CD2   . LEU A 1 101 ? -5.715  65.533 31.537 1.00 18.64 ? 101 LEU A CD2   1 
ATOM   731  N  N     . ALA A 1 102 ? -1.631  63.323 28.655 1.00 16.94 ? 102 ALA A N     1 
ATOM   732  C  CA    . ALA A 1 102 ? -1.011  62.198 27.981 1.00 18.86 ? 102 ALA A CA    1 
ATOM   733  C  C     . ALA A 1 102 ? 0.262   61.745 28.679 1.00 19.24 ? 102 ALA A C     1 
ATOM   734  O  O     . ALA A 1 102 ? 0.902   60.766 28.256 1.00 20.05 ? 102 ALA A O     1 
ATOM   735  C  CB    . ALA A 1 102 ? -0.701  62.592 26.542 1.00 18.57 ? 102 ALA A CB    1 
ATOM   736  N  N     . SER A 1 103 ? 0.653   62.476 29.723 1.00 16.90 ? 103 SER A N     1 
ATOM   737  C  CA    . SER A 1 103 ? 1.860   62.162 30.468 1.00 16.85 ? 103 SER A CA    1 
ATOM   738  C  C     . SER A 1 103 ? 1.569   61.026 31.448 1.00 17.28 ? 103 SER A C     1 
ATOM   739  O  O     . SER A 1 103 ? 0.517   61.001 32.091 1.00 16.32 ? 103 SER A O     1 
ATOM   740  C  CB    . SER A 1 103 ? 2.368   63.410 31.185 1.00 17.06 ? 103 SER A CB    1 
ATOM   741  O  OG    . SER A 1 103 ? 2.728   64.432 30.236 1.00 18.44 ? 103 SER A OG    1 
ATOM   742  N  N     . ALA A 1 104 ? 2.507   60.093 31.536 1.00 16.16 ? 104 ALA A N     1 
ATOM   743  C  CA    . ALA A 1 104 ? 2.360   58.904 32.364 1.00 17.16 ? 104 ALA A CA    1 
ATOM   744  C  C     . ALA A 1 104 ? 2.365   59.159 33.863 1.00 15.54 ? 104 ALA A C     1 
ATOM   745  O  O     . ALA A 1 104 ? 3.024   60.067 34.333 1.00 13.98 ? 104 ALA A O     1 
ATOM   746  C  CB    . ALA A 1 104 ? 3.493   57.906 32.041 1.00 17.95 ? 104 ALA A CB    1 
ATOM   747  N  N     . PRO A 1 105 ? 1.596   58.358 34.622 1.00 15.55 ? 105 PRO A N     1 
ATOM   748  C  CA    . PRO A 1 105 ? 1.579   58.527 36.074 1.00 14.81 ? 105 PRO A CA    1 
ATOM   749  C  C     . PRO A 1 105 ? 3.048   58.344 36.455 1.00 13.96 ? 105 PRO A C     1 
ATOM   750  O  O     . PRO A 1 105 ? 3.753   57.500 35.866 1.00 15.70 ? 105 PRO A O     1 
ATOM   751  C  CB    . PRO A 1 105 ? 0.729   57.351 36.554 1.00 16.60 ? 105 PRO A CB    1 
ATOM   752  C  CG    . PRO A 1 105 ? -0.259  57.170 35.444 1.00 16.43 ? 105 PRO A CG    1 
ATOM   753  C  CD    . PRO A 1 105 ? 0.574   57.394 34.179 1.00 14.54 ? 105 PRO A CD    1 
ATOM   754  N  N     . GLY A 1 106 ? 3.520   59.097 37.443 1.00 13.92 ? 106 GLY A N     1 
ATOM   755  C  CA    . GLY A 1 106 ? 4.914   58.986 37.819 1.00 13.24 ? 106 GLY A CA    1 
ATOM   756  C  C     . GLY A 1 106 ? 5.747   60.151 37.291 1.00 14.24 ? 106 GLY A C     1 
ATOM   757  O  O     . GLY A 1 106 ? 6.771   60.506 37.883 1.00 15.80 ? 106 GLY A O     1 
ATOM   758  N  N     . SER A 1 107 ? 5.336   60.745 36.166 1.00 14.31 ? 107 SER A N     1 
ATOM   759  C  CA    . SER A 1 107 ? 6.059   61.906 35.622 1.00 13.99 ? 107 SER A CA    1 
ATOM   760  C  C     . SER A 1 107 ? 5.436   63.131 36.280 1.00 13.83 ? 107 SER A C     1 
ATOM   761  O  O     . SER A 1 107 ? 4.325   63.060 36.813 1.00 11.52 ? 107 SER A O     1 
ATOM   762  C  CB    . SER A 1 107 ? 5.902   62.014 34.089 1.00 13.70 ? 107 SER A CB    1 
ATOM   763  O  OG    . SER A 1 107 ? 4.546   62.163 33.720 1.00 16.35 ? 107 SER A OG    1 
ATOM   764  N  N     . ILE A 1 108 ? 6.150   64.251 36.271 1.00 13.80 ? 108 ILE A N     1 
ATOM   765  C  CA    . ILE A 1 108 ? 5.636   65.457 36.903 1.00 13.97 ? 108 ILE A CA    1 
ATOM   766  C  C     . ILE A 1 108 ? 4.331   65.956 36.279 1.00 14.12 ? 108 ILE A C     1 
ATOM   767  O  O     . ILE A 1 108 ? 3.361   66.206 36.975 1.00 12.18 ? 108 ILE A O     1 
ATOM   768  C  CB    . ILE A 1 108 ? 6.715   66.580 36.879 1.00 13.29 ? 108 ILE A CB    1 
ATOM   769  C  CG1   . ILE A 1 108 ? 7.921   66.130 37.725 1.00 12.24 ? 108 ILE A CG1   1 
ATOM   770  C  CG2   . ILE A 1 108 ? 6.129   67.881 37.428 1.00 12.95 ? 108 ILE A CG2   1 
ATOM   771  C  CD1   . ILE A 1 108 ? 9.223   66.903 37.406 1.00 13.46 ? 108 ILE A CD1   1 
ATOM   772  N  N     . ARG A 1 109 ? 4.288   66.128 34.962 1.00 15.64 ? 109 ARG A N     1 
ATOM   773  C  CA    . ARG A 1 109 ? 3.045   66.588 34.354 1.00 13.58 ? 109 ARG A CA    1 
ATOM   774  C  C     . ARG A 1 109 ? 1.988   65.511 34.494 1.00 13.88 ? 109 ARG A C     1 
ATOM   775  O  O     . ARG A 1 109 ? 0.807   65.805 34.644 1.00 13.84 ? 109 ARG A O     1 
ATOM   776  C  CB    . ARG A 1 109 ? 3.252   66.923 32.869 1.00 13.44 ? 109 ARG A CB    1 
ATOM   777  C  CG    . ARG A 1 109 ? 4.215   68.086 32.685 1.00 14.80 ? 109 ARG A CG    1 
ATOM   778  C  CD    . ARG A 1 109 ? 4.419   68.431 31.191 1.00 17.33 ? 109 ARG A CD    1 
ATOM   779  N  NE    . ARG A 1 109 ? 5.289   69.597 31.047 1.00 15.48 ? 109 ARG A NE    1 
ATOM   780  C  CZ    . ARG A 1 109 ? 6.030   69.830 29.968 1.00 16.07 ? 109 ARG A CZ    1 
ATOM   781  N  NH1   . ARG A 1 109 ? 6.007   68.970 28.940 1.00 16.65 ? 109 ARG A NH1   1 
ATOM   782  N  NH2   . ARG A 1 109 ? 6.787   70.907 29.909 1.00 15.98 ? 109 ARG A NH2   1 
ATOM   783  N  N     . GLY A 1 110 ? 2.414   64.257 34.428 1.00 13.83 ? 110 GLY A N     1 
ATOM   784  C  CA    . GLY A 1 110 ? 1.464   63.172 34.561 1.00 14.64 ? 110 GLY A CA    1 
ATOM   785  C  C     . GLY A 1 110 ? 0.802   63.165 35.938 1.00 15.79 ? 110 GLY A C     1 
ATOM   786  O  O     . GLY A 1 110 ? -0.390  62.892 36.061 1.00 14.81 ? 110 GLY A O     1 
ATOM   787  N  N     . ASP A 1 111 ? 1.569   63.452 36.975 1.00 14.11 ? 111 ASP A N     1 
ATOM   788  C  CA    . ASP A 1 111 ? 0.996   63.422 38.311 1.00 13.99 ? 111 ASP A CA    1 
ATOM   789  C  C     . ASP A 1 111 ? 0.268   64.693 38.681 1.00 14.57 ? 111 ASP A C     1 
ATOM   790  O  O     . ASP A 1 111 ? -0.669  64.672 39.489 1.00 13.66 ? 111 ASP A O     1 
ATOM   791  C  CB    . ASP A 1 111 ? 2.084   63.186 39.370 1.00 13.96 ? 111 ASP A CB    1 
ATOM   792  C  CG    . ASP A 1 111 ? 2.692   61.795 39.303 1.00 12.28 ? 111 ASP A CG    1 
ATOM   793  O  OD1   . ASP A 1 111 ? 2.021   60.877 38.816 1.00 15.69 ? 111 ASP A OD1   1 
ATOM   794  O  OD2   . ASP A 1 111 ? 3.849   61.637 39.752 1.00 15.86 ? 111 ASP A OD2   1 
ATOM   795  N  N     . PHE A 1 112 ? 0.654   65.808 38.067 1.00 13.64 ? 112 PHE A N     1 
ATOM   796  C  CA    . PHE A 1 112 ? 0.065   67.073 38.513 1.00 15.42 ? 112 PHE A CA    1 
ATOM   797  C  C     . PHE A 1 112 ? -0.678  67.981 37.560 1.00 14.19 ? 112 PHE A C     1 
ATOM   798  O  O     . PHE A 1 112 ? -1.271  68.963 38.007 1.00 16.18 ? 112 PHE A O     1 
ATOM   799  C  CB    . PHE A 1 112 ? 1.153   67.927 39.155 1.00 13.56 ? 112 PHE A CB    1 
ATOM   800  C  CG    . PHE A 1 112 ? 1.919   67.228 40.240 1.00 17.84 ? 112 PHE A CG    1 
ATOM   801  C  CD1   . PHE A 1 112 ? 1.286   66.793 41.399 1.00 18.70 ? 112 PHE A CD1   1 
ATOM   802  C  CD2   . PHE A 1 112 ? 3.280   67.034 40.116 1.00 18.88 ? 112 PHE A CD2   1 
ATOM   803  C  CE1   . PHE A 1 112 ? 2.023   66.170 42.417 1.00 17.95 ? 112 PHE A CE1   1 
ATOM   804  C  CE2   . PHE A 1 112 ? 4.028   66.412 41.138 1.00 19.91 ? 112 PHE A CE2   1 
ATOM   805  C  CZ    . PHE A 1 112 ? 3.393   65.989 42.276 1.00 18.05 ? 112 PHE A CZ    1 
ATOM   806  N  N     . GLY A 1 113 ? -0.676  67.683 36.262 1.00 14.98 ? 113 GLY A N     1 
ATOM   807  C  CA    . GLY A 1 113 ? -1.334  68.639 35.375 1.00 13.26 ? 113 GLY A CA    1 
ATOM   808  C  C     . GLY A 1 113 ? -2.422  68.119 34.481 1.00 14.24 ? 113 GLY A C     1 
ATOM   809  O  O     . GLY A 1 113 ? -2.550  66.913 34.281 1.00 13.01 ? 113 GLY A O     1 
ATOM   810  N  N     . VAL A 1 114 ? -3.215  69.040 33.935 1.00 14.69 ? 114 VAL A N     1 
ATOM   811  C  CA    . VAL A 1 114 ? -4.292  68.669 33.033 1.00 15.24 ? 114 VAL A CA    1 
ATOM   812  C  C     . VAL A 1 114 ? -4.351  69.559 31.780 1.00 18.07 ? 114 VAL A C     1 
ATOM   813  O  O     . VAL A 1 114 ? -5.006  69.188 30.815 1.00 18.96 ? 114 VAL A O     1 
ATOM   814  C  CB    . VAL A 1 114 ? -5.687  68.796 33.707 1.00 16.84 ? 114 VAL A CB    1 
ATOM   815  C  CG1   . VAL A 1 114 ? -5.824  67.770 34.857 1.00 15.29 ? 114 VAL A CG1   1 
ATOM   816  C  CG2   . VAL A 1 114 ? -5.876  70.218 34.258 1.00 19.72 ? 114 VAL A CG2   1 
ATOM   817  N  N     . ASP A 1 115 ? -3.677  70.706 31.790 1.00 16.47 ? 115 ASP A N     1 
ATOM   818  C  CA    . ASP A 1 115 ? -3.776  71.620 30.631 1.00 18.74 ? 115 ASP A CA    1 
ATOM   819  C  C     . ASP A 1 115 ? -2.402  71.877 30.009 1.00 18.53 ? 115 ASP A C     1 
ATOM   820  O  O     . ASP A 1 115 ? -1.435  72.108 30.731 1.00 16.85 ? 115 ASP A O     1 
ATOM   821  C  CB    . ASP A 1 115 ? -4.384  72.930 31.140 1.00 19.36 ? 115 ASP A CB    1 
ATOM   822  C  CG    . ASP A 1 115 ? -4.835  73.867 30.033 1.00 24.22 ? 115 ASP A CG    1 
ATOM   823  O  OD1   . ASP A 1 115 ? -4.065  74.111 29.090 1.00 29.44 ? 115 ASP A OD1   1 
ATOM   824  O  OD2   . ASP A 1 115 ? -5.965  74.396 30.130 1.00 24.68 ? 115 ASP A OD2   1 
ATOM   825  N  N     . VAL A 1 116 ? -2.324  71.891 28.677 1.00 18.52 ? 116 VAL A N     1 
ATOM   826  C  CA    . VAL A 1 116 ? -1.046  72.127 28.014 1.00 19.35 ? 116 VAL A CA    1 
ATOM   827  C  C     . VAL A 1 116 ? -0.470  73.474 28.371 1.00 18.45 ? 116 VAL A C     1 
ATOM   828  O  O     . VAL A 1 116 ? 0.743   73.615 28.504 1.00 19.80 ? 116 VAL A O     1 
ATOM   829  C  CB    . VAL A 1 116 ? -1.183  72.042 26.473 1.00 21.97 ? 116 VAL A CB    1 
ATOM   830  C  CG1   . VAL A 1 116 ? 0.133   72.456 25.814 1.00 25.43 ? 116 VAL A CG1   1 
ATOM   831  C  CG2   . VAL A 1 116 ? -1.519  70.641 26.075 1.00 24.21 ? 116 VAL A CG2   1 
ATOM   832  N  N     . GLY A 1 117 ? -1.339  74.469 28.531 1.00 17.17 ? 117 GLY A N     1 
ATOM   833  C  CA    . GLY A 1 117 ? -0.894  75.808 28.869 1.00 17.83 ? 117 GLY A CA    1 
ATOM   834  C  C     . GLY A 1 117 ? -0.562  75.986 30.334 1.00 18.92 ? 117 GLY A C     1 
ATOM   835  O  O     . GLY A 1 117 ? -0.060  77.027 30.743 1.00 18.54 ? 117 GLY A O     1 
ATOM   836  N  N     . ARG A 1 118 ? -0.838  74.954 31.127 1.00 16.58 ? 118 ARG A N     1 
ATOM   837  C  CA    . ARG A 1 118 ? -0.560  75.022 32.554 1.00 18.06 ? 118 ARG A CA    1 
ATOM   838  C  C     . ARG A 1 118 ? 0.129   73.700 32.839 1.00 15.78 ? 118 ARG A C     1 
ATOM   839  O  O     . ARG A 1 118 ? -0.390  72.890 33.606 1.00 16.03 ? 118 ARG A O     1 
ATOM   840  C  CB    . ARG A 1 118 ? -1.887  75.133 33.326 1.00 18.04 ? 118 ARG A CB    1 
ATOM   841  C  CG    . ARG A 1 118 ? -2.678  76.452 33.030 1.00 18.34 ? 118 ARG A CG    1 
ATOM   842  C  CD    . ARG A 1 118 ? -1.984  77.629 33.726 1.00 18.66 ? 118 ARG A CD    1 
ATOM   843  N  NE    . ARG A 1 118 ? -2.744  78.866 33.575 1.00 19.35 ? 118 ARG A NE    1 
ATOM   844  C  CZ    . ARG A 1 118 ? -2.640  79.664 32.511 1.00 23.12 ? 118 ARG A CZ    1 
ATOM   845  N  NH1   . ARG A 1 118 ? -1.815  79.353 31.530 1.00 21.45 ? 118 ARG A NH1   1 
ATOM   846  N  NH2   . ARG A 1 118 ? -3.352  80.781 32.438 1.00 22.48 ? 118 ARG A NH2   1 
ATOM   847  N  N     . ASN A 1 119 ? 1.279   73.479 32.195 1.00 15.43 ? 119 ASN A N     1 
ATOM   848  C  CA    . ASN A 1 119 ? 1.957   72.213 32.369 1.00 15.20 ? 119 ASN A CA    1 
ATOM   849  C  C     . ASN A 1 119 ? 3.102   72.157 33.333 1.00 14.86 ? 119 ASN A C     1 
ATOM   850  O  O     . ASN A 1 119 ? 4.001   71.344 33.193 1.00 15.28 ? 119 ASN A O     1 
ATOM   851  C  CB    . ASN A 1 119 ? 2.325   71.533 31.045 1.00 16.45 ? 119 ASN A CB    1 
ATOM   852  C  CG    . ASN A 1 119 ? 3.353   72.276 30.251 1.00 17.88 ? 119 ASN A CG    1 
ATOM   853  O  OD1   . ASN A 1 119 ? 3.920   73.291 30.696 1.00 19.38 ? 119 ASN A OD1   1 
ATOM   854  N  ND2   . ASN A 1 119 ? 3.619   71.758 29.039 1.00 17.88 ? 119 ASN A ND2   1 
ATOM   855  N  N     . ILE A 1 120 ? 3.032   73.065 34.293 1.00 14.70 ? 120 ILE A N     1 
ATOM   856  C  CA    . ILE A 1 120 ? 3.877   73.059 35.471 1.00 14.52 ? 120 ILE A CA    1 
ATOM   857  C  C     . ILE A 1 120 ? 5.357   73.336 35.465 1.00 15.56 ? 120 ILE A C     1 
ATOM   858  O  O     . ILE A 1 120 ? 5.856   74.105 36.306 1.00 14.41 ? 120 ILE A O     1 
ATOM   859  C  CB    . ILE A 1 120 ? 3.619   71.697 36.153 1.00 15.83 ? 120 ILE A CB    1 
ATOM   860  C  CG1   . ILE A 1 120 ? 2.116   71.615 36.440 1.00 18.31 ? 120 ILE A CG1   1 
ATOM   861  C  CG2   . ILE A 1 120 ? 4.438   71.526 37.464 1.00 15.92 ? 120 ILE A CG2   1 
ATOM   862  C  CD1   . ILE A 1 120 ? 1.599   70.264 36.561 1.00 19.55 ? 120 ILE A CD1   1 
ATOM   863  N  N     . ILE A 1 121 ? 6.041   72.699 34.534 1.00 14.11 ? 121 ILE A N     1 
ATOM   864  C  CA    . ILE A 1 121 ? 7.481   72.786 34.463 1.00 16.15 ? 121 ILE A CA    1 
ATOM   865  C  C     . ILE A 1 121 ? 7.878   72.770 32.996 1.00 15.64 ? 121 ILE A C     1 
ATOM   866  O  O     . ILE A 1 121 ? 7.135   72.283 32.133 1.00 16.01 ? 121 ILE A O     1 
ATOM   867  C  CB    . ILE A 1 121 ? 8.093   71.534 35.220 1.00 14.96 ? 121 ILE A CB    1 
ATOM   868  C  CG1   . ILE A 1 121 ? 9.616   71.517 35.150 1.00 15.65 ? 121 ILE A CG1   1 
ATOM   869  C  CG2   . ILE A 1 121 ? 7.538   70.233 34.588 1.00 17.97 ? 121 ILE A CG2   1 
ATOM   870  C  CD1   . ILE A 1 121 ? 10.258  70.458 36.063 1.00 14.84 ? 121 ILE A CD1   1 
ATOM   871  N  N     . GLY A 1 122 ? 9.047   73.324 32.717 1.00 16.26 ? 122 GLY A N     1 
ATOM   872  C  CA    . GLY A 1 122 ? 9.572   73.315 31.368 1.00 16.76 ? 122 GLY A CA    1 
ATOM   873  C  C     . GLY A 1 122 ? 10.992  72.805 31.496 1.00 16.82 ? 122 GLY A C     1 
ATOM   874  O  O     . GLY A 1 122 ? 11.635  73.060 32.509 1.00 17.50 ? 122 GLY A O     1 
ATOM   875  N  N     . GLY A 1 123 ? 11.464  72.042 30.510 1.00 17.22 ? 123 GLY A N     1 
ATOM   876  C  CA    . GLY A 1 123 ? 12.829  71.540 30.565 1.00 17.13 ? 123 GLY A CA    1 
ATOM   877  C  C     . GLY A 1 123 ? 13.448  71.526 29.177 1.00 16.60 ? 123 GLY A C     1 
ATOM   878  O  O     . GLY A 1 123 ? 12.726  71.364 28.192 1.00 15.91 ? 123 GLY A O     1 
ATOM   879  N  N     . SER A 1 124 ? 14.771  71.680 29.095 1.00 16.82 ? 124 SER A N     1 
ATOM   880  C  CA    . SER A 1 124 ? 15.458  71.676 27.800 1.00 16.93 ? 124 SER A CA    1 
ATOM   881  C  C     . SER A 1 124 ? 15.215  70.364 27.060 1.00 18.38 ? 124 SER A C     1 
ATOM   882  O  O     . SER A 1 124 ? 15.206  69.287 27.683 1.00 19.09 ? 124 SER A O     1 
ATOM   883  C  CB    . SER A 1 124 ? 16.960  71.858 28.028 1.00 15.41 ? 124 SER A CB    1 
ATOM   884  O  OG    . SER A 1 124 ? 17.165  73.003 28.821 1.00 17.25 ? 124 SER A OG    1 
ATOM   885  N  N     . ASP A 1 125 ? 15.076  70.439 25.731 1.00 17.86 ? 125 ASP A N     1 
ATOM   886  C  CA    . ASP A 1 125 ? 14.801  69.253 24.941 1.00 20.30 ? 125 ASP A CA    1 
ATOM   887  C  C     . ASP A 1 125 ? 16.026  68.645 24.288 1.00 19.96 ? 125 ASP A C     1 
ATOM   888  O  O     . ASP A 1 125 ? 15.927  67.599 23.675 1.00 20.76 ? 125 ASP A O     1 
ATOM   889  C  CB    . ASP A 1 125 ? 13.716  69.516 23.877 1.00 23.18 ? 125 ASP A CB    1 
ATOM   890  C  CG    . ASP A 1 125 ? 14.084  70.630 22.896 1.00 24.99 ? 125 ASP A CG    1 
ATOM   891  O  OD1   . ASP A 1 125 ? 15.280  70.966 22.763 1.00 26.12 ? 125 ASP A OD1   1 
ATOM   892  O  OD2   . ASP A 1 125 ? 13.157  71.176 22.251 1.00 26.44 ? 125 ASP A OD2   1 
ATOM   893  N  N     . SER A 1 126 ? 17.177  69.287 24.435 1.00 21.24 ? 126 SER A N     1 
ATOM   894  C  CA    . SER A 1 126 ? 18.422  68.751 23.876 1.00 20.94 ? 126 SER A CA    1 
ATOM   895  C  C     . SER A 1 126 ? 19.594  69.445 24.542 1.00 21.76 ? 126 SER A C     1 
ATOM   896  O  O     . SER A 1 126 ? 19.416  70.465 25.200 1.00 20.53 ? 126 SER A O     1 
ATOM   897  C  CB    . SER A 1 126 ? 18.478  68.994 22.370 1.00 22.97 ? 126 SER A CB    1 
ATOM   898  O  OG    . SER A 1 126 ? 18.533  70.376 22.116 1.00 20.18 ? 126 SER A OG    1 
ATOM   899  N  N     . VAL A 1 127 ? 20.792  68.882 24.397 1.00 21.73 ? 127 VAL A N     1 
ATOM   900  C  CA    . VAL A 1 127 ? 21.969  69.500 24.986 1.00 22.76 ? 127 VAL A CA    1 
ATOM   901  C  C     . VAL A 1 127 ? 22.172  70.899 24.401 1.00 22.82 ? 127 VAL A C     1 
ATOM   902  O  O     . VAL A 1 127 ? 22.550  71.813 25.110 1.00 21.88 ? 127 VAL A O     1 
ATOM   903  C  CB    . VAL A 1 127 ? 23.229  68.622 24.759 1.00 23.80 ? 127 VAL A CB    1 
ATOM   904  C  CG1   . VAL A 1 127 ? 24.497  69.418 25.019 1.00 24.19 ? 127 VAL A CG1   1 
ATOM   905  C  CG2   . VAL A 1 127 ? 23.179  67.429 25.694 1.00 23.99 ? 127 VAL A CG2   1 
ATOM   906  N  N     . GLU A 1 128 ? 21.894  71.057 23.109 1.00 25.51 ? 128 GLU A N     1 
ATOM   907  C  CA    . GLU A 1 128 ? 22.028  72.358 22.461 1.00 26.28 ? 128 GLU A CA    1 
ATOM   908  C  C     . GLU A 1 128 ? 21.092  73.363 23.085 1.00 26.34 ? 128 GLU A C     1 
ATOM   909  O  O     . GLU A 1 128 ? 21.490  74.495 23.412 1.00 24.12 ? 128 GLU A O     1 
ATOM   910  C  CB    . GLU A 1 128 ? 21.685  72.270 20.982 1.00 30.77 ? 128 GLU A CB    1 
ATOM   911  C  CG    . GLU A 1 128 ? 22.820  71.850 20.102 1.00 37.07 ? 128 GLU A CG    1 
ATOM   912  C  CD    . GLU A 1 128 ? 22.472  72.042 18.635 1.00 41.29 ? 128 GLU A CD    1 
ATOM   913  O  OE1   . GLU A 1 128 ? 22.029  73.166 18.257 1.00 42.44 ? 128 GLU A OE1   1 
ATOM   914  O  OE2   . GLU A 1 128 ? 22.642  71.066 17.867 1.00 44.70 ? 128 GLU A OE2   1 
ATOM   915  N  N     . SER A 1 129 ? 19.826  72.969 23.204 1.00 24.04 ? 129 SER A N     1 
ATOM   916  C  CA    . SER A 1 129 ? 18.842  73.863 23.798 1.00 23.12 ? 129 SER A CA    1 
ATOM   917  C  C     . SER A 1 129 ? 19.216  74.115 25.242 1.00 20.16 ? 129 SER A C     1 
ATOM   918  O  O     . SER A 1 129 ? 19.103  75.241 25.732 1.00 19.43 ? 129 SER A O     1 
ATOM   919  C  CB    . SER A 1 129 ? 17.436  73.264 23.725 1.00 23.82 ? 129 SER A CB    1 
ATOM   920  O  OG    . SER A 1 129 ? 17.011  73.169 22.378 1.00 27.26 ? 129 SER A OG    1 
ATOM   921  N  N     . ALA A 1 130 ? 19.653  73.071 25.941 1.00 20.74 ? 130 ALA A N     1 
ATOM   922  C  CA    . ALA A 1 130 ? 20.061  73.252 27.337 1.00 19.47 ? 130 ALA A CA    1 
ATOM   923  C  C     . ALA A 1 130 ? 21.193  74.289 27.450 1.00 20.83 ? 130 ALA A C     1 
ATOM   924  O  O     . ALA A 1 130 ? 21.121  75.219 28.257 1.00 19.82 ? 130 ALA A O     1 
ATOM   925  C  CB    . ALA A 1 130 ? 20.501  71.910 27.932 1.00 18.35 ? 130 ALA A CB    1 
ATOM   926  N  N     . ASN A 1 131 ? 22.248  74.156 26.641 1.00 22.36 ? 131 ASN A N     1 
ATOM   927  C  CA    . ASN A 1 131 ? 23.320  75.154 26.720 1.00 23.64 ? 131 ASN A CA    1 
ATOM   928  C  C     . ASN A 1 131 ? 22.799  76.585 26.500 1.00 23.31 ? 131 ASN A C     1 
ATOM   929  O  O     . ASN A 1 131 ? 23.171  77.520 27.220 1.00 23.29 ? 131 ASN A O     1 
ATOM   930  C  CB    . ASN A 1 131 ? 24.414  74.833 25.711 1.00 24.35 ? 131 ASN A CB    1 
ATOM   931  C  CG    . ASN A 1 131 ? 25.198  73.601 26.104 1.00 25.62 ? 131 ASN A CG    1 
ATOM   932  O  OD1   . ASN A 1 131 ? 25.244  73.241 27.283 1.00 30.15 ? 131 ASN A OD1   1 
ATOM   933  N  ND2   . ASN A 1 131 ? 25.835  72.959 25.134 1.00 28.29 ? 131 ASN A ND2   1 
ATOM   934  N  N     . ARG A 1 132 ? 21.925  76.743 25.517 1.00 23.97 ? 132 ARG A N     1 
ATOM   935  C  CA    . ARG A 1 132 ? 21.347  78.047 25.225 1.00 22.65 ? 132 ARG A CA    1 
ATOM   936  C  C     . ARG A 1 132 ? 20.480  78.541 26.364 1.00 22.02 ? 132 ARG A C     1 
ATOM   937  O  O     . ARG A 1 132 ? 20.591  79.698 26.783 1.00 20.58 ? 132 ARG A O     1 
ATOM   938  C  CB    . ARG A 1 132 ? 20.507  77.988 23.953 1.00 25.43 ? 132 ARG A CB    1 
ATOM   939  C  CG    . ARG A 1 132 ? 19.623  79.211 23.809 1.00 30.27 ? 132 ARG A CG    1 
ATOM   940  C  CD    . ARG A 1 132 ? 18.938  79.289 22.472 1.00 34.82 ? 132 ARG A CD    1 
ATOM   941  N  NE    . ARG A 1 132 ? 18.420  80.640 22.259 1.00 37.64 ? 132 ARG A NE    1 
ATOM   942  C  CZ    . ARG A 1 132 ? 17.233  81.066 22.676 1.00 40.08 ? 132 ARG A CZ    1 
ATOM   943  N  NH1   . ARG A 1 132 ? 16.411  80.235 23.338 1.00 40.54 ? 132 ARG A NH1   1 
ATOM   944  N  NH2   . ARG A 1 132 ? 16.869  82.324 22.425 1.00 39.66 ? 132 ARG A NH2   1 
ATOM   945  N  N     . GLU A 1 133 ? 19.613  77.665 26.881 1.00 20.02 ? 133 GLU A N     1 
ATOM   946  C  CA    . GLU A 1 133 ? 18.738  78.064 27.964 1.00 19.72 ? 133 GLU A CA    1 
ATOM   947  C  C     . GLU A 1 133 ? 19.493  78.377 29.253 1.00 19.46 ? 133 GLU A C     1 
ATOM   948  O  O     . GLU A 1 133 ? 19.211  79.382 29.899 1.00 19.37 ? 133 GLU A O     1 
ATOM   949  C  CB    . GLU A 1 133 ? 17.648  77.005 28.169 1.00 20.12 ? 133 GLU A CB    1 
ATOM   950  C  CG    . GLU A 1 133 ? 16.649  77.011 27.002 1.00 18.46 ? 133 GLU A CG    1 
ATOM   951  C  CD    . GLU A 1 133 ? 15.783  75.771 26.913 1.00 22.07 ? 133 GLU A CD    1 
ATOM   952  O  OE1   . GLU A 1 133 ? 15.664  75.011 27.907 1.00 19.30 ? 133 GLU A OE1   1 
ATOM   953  O  OE2   . GLU A 1 133 ? 15.209  75.547 25.835 1.00 22.00 ? 133 GLU A OE2   1 
ATOM   954  N  N     . ILE A 1 134 ? 20.470  77.551 29.621 1.00 19.32 ? 134 ILE A N     1 
ATOM   955  C  CA    . ILE A 1 134 ? 21.220  77.863 30.839 1.00 20.20 ? 134 ILE A CA    1 
ATOM   956  C  C     . ILE A 1 134 ? 21.834  79.256 30.722 1.00 20.76 ? 134 ILE A C     1 
ATOM   957  O  O     . ILE A 1 134 ? 21.744  80.086 31.634 1.00 20.67 ? 134 ILE A O     1 
ATOM   958  C  CB    . ILE A 1 134 ? 22.353  76.835 31.083 1.00 19.52 ? 134 ILE A CB    1 
ATOM   959  C  CG1   . ILE A 1 134 ? 21.754  75.483 31.503 1.00 19.19 ? 134 ILE A CG1   1 
ATOM   960  C  CG2   . ILE A 1 134 ? 23.277  77.340 32.161 1.00 21.31 ? 134 ILE A CG2   1 
ATOM   961  C  CD1   . ILE A 1 134 ? 22.621  74.256 31.093 1.00 19.98 ? 134 ILE A CD1   1 
ATOM   962  N  N     . ALA A 1 135 ? 22.448  79.520 29.578 1.00 22.08 ? 135 ALA A N     1 
ATOM   963  C  CA    . ALA A 1 135 ? 23.094  80.803 29.354 1.00 22.55 ? 135 ALA A CA    1 
ATOM   964  C  C     . ALA A 1 135 ? 22.125  81.965 29.440 1.00 23.23 ? 135 ALA A C     1 
ATOM   965  O  O     . ALA A 1 135 ? 22.504  83.029 29.894 1.00 23.38 ? 135 ALA A O     1 
ATOM   966  C  CB    . ALA A 1 135 ? 23.788  80.801 27.999 1.00 23.54 ? 135 ALA A CB    1 
ATOM   967  N  N     . LEU A 1 136 ? 20.887  81.775 28.977 1.00 22.13 ? 136 LEU A N     1 
ATOM   968  C  CA    . LEU A 1 136 ? 19.880  82.843 29.035 1.00 23.62 ? 136 LEU A CA    1 
ATOM   969  C  C     . LEU A 1 136 ? 19.473  83.219 30.444 1.00 22.78 ? 136 LEU A C     1 
ATOM   970  O  O     . LEU A 1 136 ? 19.350  84.400 30.789 1.00 21.90 ? 136 LEU A O     1 
ATOM   971  C  CB    . LEU A 1 136 ? 18.579  82.426 28.323 1.00 24.00 ? 136 LEU A CB    1 
ATOM   972  C  CG    . LEU A 1 136 ? 18.271  82.707 26.863 1.00 27.22 ? 136 LEU A CG    1 
ATOM   973  C  CD1   . LEU A 1 136 ? 16.847  82.241 26.607 1.00 24.02 ? 136 LEU A CD1   1 
ATOM   974  C  CD2   . LEU A 1 136 ? 18.408  84.220 26.546 1.00 26.77 ? 136 LEU A CD2   1 
ATOM   975  N  N     . TRP A 1 137 ? 19.228  82.195 31.260 1.00 22.76 ? 137 TRP A N     1 
ATOM   976  C  CA    . TRP A 1 137 ? 18.737  82.398 32.606 1.00 20.95 ? 137 TRP A CA    1 
ATOM   977  C  C     . TRP A 1 137 ? 19.754  82.548 33.726 1.00 21.49 ? 137 TRP A C     1 
ATOM   978  O  O     . TRP A 1 137 ? 19.430  83.114 34.782 1.00 19.76 ? 137 TRP A O     1 
ATOM   979  C  CB    . TRP A 1 137 ? 17.781  81.245 33.002 1.00 21.13 ? 137 TRP A CB    1 
ATOM   980  C  CG    . TRP A 1 137 ? 16.535  81.118 32.207 1.00 20.73 ? 137 TRP A CG    1 
ATOM   981  C  CD1   . TRP A 1 137 ? 16.414  80.627 30.942 1.00 21.83 ? 137 TRP A CD1   1 
ATOM   982  C  CD2   . TRP A 1 137 ? 15.210  81.437 32.642 1.00 21.98 ? 137 TRP A CD2   1 
ATOM   983  N  NE1   . TRP A 1 137 ? 15.096  80.616 30.560 1.00 21.43 ? 137 TRP A NE1   1 
ATOM   984  C  CE2   . TRP A 1 137 ? 14.334  81.109 31.583 1.00 20.83 ? 137 TRP A CE2   1 
ATOM   985  C  CE3   . TRP A 1 137 ? 14.679  81.964 33.825 1.00 21.22 ? 137 TRP A CE3   1 
ATOM   986  C  CZ2   . TRP A 1 137 ? 12.946  81.291 31.667 1.00 22.06 ? 137 TRP A CZ2   1 
ATOM   987  C  CZ3   . TRP A 1 137 ? 13.288  82.150 33.914 1.00 22.59 ? 137 TRP A CZ3   1 
ATOM   988  C  CH2   . TRP A 1 137 ? 12.444  81.812 32.836 1.00 20.89 ? 137 TRP A CH2   1 
ATOM   989  N  N     . PHE A 1 138 ? 20.960  82.030 33.516 1.00 21.31 ? 138 PHE A N     1 
ATOM   990  C  CA    . PHE A 1 138 ? 21.983  82.077 34.553 1.00 21.91 ? 138 PHE A CA    1 
ATOM   991  C  C     . PHE A 1 138 ? 23.326  82.667 34.134 1.00 22.45 ? 138 PHE A C     1 
ATOM   992  O  O     . PHE A 1 138 ? 23.875  82.284 33.102 1.00 25.66 ? 138 PHE A O     1 
ATOM   993  C  CB    . PHE A 1 138 ? 22.275  80.676 35.057 1.00 20.79 ? 138 PHE A CB    1 
ATOM   994  C  CG    . PHE A 1 138 ? 21.223  80.121 35.977 1.00 20.73 ? 138 PHE A CG    1 
ATOM   995  C  CD1   . PHE A 1 138 ? 21.242  80.416 37.321 1.00 19.07 ? 138 PHE A CD1   1 
ATOM   996  C  CD2   . PHE A 1 138 ? 20.217  79.301 35.480 1.00 21.32 ? 138 PHE A CD2   1 
ATOM   997  C  CE1   . PHE A 1 138 ? 20.270  79.900 38.180 1.00 20.93 ? 138 PHE A CE1   1 
ATOM   998  C  CE2   . PHE A 1 138 ? 19.241  78.779 36.347 1.00 21.95 ? 138 PHE A CE2   1 
ATOM   999  C  CZ    . PHE A 1 138 ? 19.286  79.087 37.689 1.00 18.58 ? 138 PHE A CZ    1 
ATOM   1000 N  N     . LYS A 1 139 ? 23.856  83.548 34.970 1.00 24.03 ? 139 LYS A N     1 
ATOM   1001 C  CA    . LYS A 1 139 ? 25.190  84.125 34.755 1.00 24.36 ? 139 LYS A CA    1 
ATOM   1002 C  C     . LYS A 1 139 ? 26.164  83.023 35.180 1.00 24.61 ? 139 LYS A C     1 
ATOM   1003 O  O     . LYS A 1 139 ? 25.835  82.169 36.018 1.00 23.15 ? 139 LYS A O     1 
ATOM   1004 C  CB    . LYS A 1 139 ? 25.407  85.326 35.676 1.00 26.53 ? 139 LYS A CB    1 
ATOM   1005 C  CG    . LYS A 1 139 ? 24.519  86.534 35.408 1.00 30.35 ? 139 LYS A CG    1 
ATOM   1006 C  CD    . LYS A 1 139 ? 24.712  87.566 36.523 1.00 33.61 ? 139 LYS A CD    1 
ATOM   1007 C  CE    . LYS A 1 139 ? 24.188  88.954 36.146 1.00 37.43 ? 139 LYS A CE    1 
ATOM   1008 N  NZ    . LYS A 1 139 ? 22.760  88.958 35.715 1.00 37.86 ? 139 LYS A NZ    1 
ATOM   1009 N  N     . PRO A 1 140 ? 27.379  83.021 34.628 1.00 24.33 ? 140 PRO A N     1 
ATOM   1010 C  CA    . PRO A 1 140 ? 28.325  81.981 35.026 1.00 23.93 ? 140 PRO A CA    1 
ATOM   1011 C  C     . PRO A 1 140 ? 28.538  81.916 36.524 1.00 24.27 ? 140 PRO A C     1 
ATOM   1012 O  O     . PRO A 1 140 ? 28.715  80.835 37.084 1.00 24.83 ? 140 PRO A O     1 
ATOM   1013 C  CB    . PRO A 1 140 ? 29.616  82.398 34.319 1.00 25.25 ? 140 PRO A CB    1 
ATOM   1014 C  CG    . PRO A 1 140 ? 29.113  83.034 33.079 1.00 25.75 ? 140 PRO A CG    1 
ATOM   1015 C  CD    . PRO A 1 140 ? 27.962  83.889 33.591 1.00 25.19 ? 140 PRO A CD    1 
ATOM   1016 N  N     . GLU A 1 141 ? 28.525  83.071 37.177 1.00 23.88 ? 141 GLU A N     1 
ATOM   1017 C  CA    . GLU A 1 141 ? 28.808  83.085 38.612 1.00 26.15 ? 141 GLU A CA    1 
ATOM   1018 C  C     . GLU A 1 141 ? 27.722  82.480 39.482 1.00 25.83 ? 141 GLU A C     1 
ATOM   1019 O  O     . GLU A 1 141 ? 27.922  82.298 40.687 1.00 23.69 ? 141 GLU A O     1 
ATOM   1020 C  CB    . GLU A 1 141 ? 29.082  84.504 39.095 1.00 27.84 ? 141 GLU A CB    1 
ATOM   1021 C  CG    . GLU A 1 141 ? 27.953  85.477 38.824 1.00 29.79 ? 141 GLU A CG    1 
ATOM   1022 C  CD    . GLU A 1 141 ? 28.249  86.356 37.622 1.00 30.66 ? 141 GLU A CD    1 
ATOM   1023 O  OE1   . GLU A 1 141 ? 28.692  85.822 36.572 1.00 27.88 ? 141 GLU A OE1   1 
ATOM   1024 O  OE2   . GLU A 1 141 ? 28.038  87.582 37.744 1.00 32.95 ? 141 GLU A OE2   1 
ATOM   1025 N  N     . GLU A 1 142 ? 26.582  82.172 38.876 1.00 23.97 ? 142 GLU A N     1 
ATOM   1026 C  CA    . GLU A 1 142 ? 25.471  81.597 39.637 1.00 24.68 ? 142 GLU A CA    1 
ATOM   1027 C  C     . GLU A 1 142 ? 25.455  80.084 39.541 1.00 24.93 ? 142 GLU A C     1 
ATOM   1028 O  O     . GLU A 1 142 ? 24.638  79.417 40.200 1.00 25.09 ? 142 GLU A O     1 
ATOM   1029 C  CB    . GLU A 1 142 ? 24.154  82.179 39.125 1.00 25.54 ? 142 GLU A CB    1 
ATOM   1030 C  CG    . GLU A 1 142 ? 24.086  83.685 39.314 1.00 27.17 ? 142 GLU A CG    1 
ATOM   1031 C  CD    . GLU A 1 142 ? 22.859  84.303 38.686 1.00 27.92 ? 142 GLU A CD    1 
ATOM   1032 O  OE1   . GLU A 1 142 ? 22.510  83.922 37.553 1.00 27.67 ? 142 GLU A OE1   1 
ATOM   1033 O  OE2   . GLU A 1 142 ? 22.261  85.184 39.329 1.00 30.91 ? 142 GLU A OE2   1 
ATOM   1034 N  N     . LEU A 1 143 ? 26.354  79.542 38.721 1.00 23.42 ? 143 LEU A N     1 
ATOM   1035 C  CA    . LEU A 1 143 ? 26.427  78.106 38.526 1.00 25.14 ? 143 LEU A CA    1 
ATOM   1036 C  C     . LEU A 1 143 ? 27.628  77.534 39.273 1.00 27.21 ? 143 LEU A C     1 
ATOM   1037 O  O     . LEU A 1 143 ? 28.727  78.097 39.241 1.00 24.82 ? 143 LEU A O     1 
ATOM   1038 C  CB    . LEU A 1 143 ? 26.532  77.786 37.038 1.00 25.70 ? 143 LEU A CB    1 
ATOM   1039 C  CG    . LEU A 1 143 ? 25.419  78.408 36.186 1.00 23.73 ? 143 LEU A CG    1 
ATOM   1040 C  CD1   . LEU A 1 143 ? 25.624  78.055 34.739 1.00 25.06 ? 143 LEU A CD1   1 
ATOM   1041 C  CD2   . LEU A 1 143 ? 24.058  77.883 36.666 1.00 26.10 ? 143 LEU A CD2   1 
ATOM   1042 N  N     . LEU A 1 144 ? 27.416  76.429 39.974 1.00 27.31 ? 144 LEU A N     1 
ATOM   1043 C  CA    . LEU A 1 144 ? 28.510  75.822 40.706 1.00 28.89 ? 144 LEU A CA    1 
ATOM   1044 C  C     . LEU A 1 144 ? 29.542  75.355 39.710 1.00 30.89 ? 144 LEU A C     1 
ATOM   1045 O  O     . LEU A 1 144 ? 29.236  75.029 38.563 1.00 31.11 ? 144 LEU A O     1 
ATOM   1046 C  CB    . LEU A 1 144 ? 28.040  74.611 41.503 1.00 30.21 ? 144 LEU A CB    1 
ATOM   1047 C  CG    . LEU A 1 144 ? 27.058  74.819 42.654 1.00 30.15 ? 144 LEU A CG    1 
ATOM   1048 C  CD1   . LEU A 1 144 ? 26.681  73.446 43.229 1.00 30.49 ? 144 LEU A CD1   1 
ATOM   1049 C  CD2   . LEU A 1 144 ? 27.690  75.692 43.723 1.00 31.04 ? 144 LEU A CD2   1 
ATOM   1050 N  N     . THR A 1 145 ? 30.784  75.326 40.158 1.00 33.79 ? 145 THR A N     1 
ATOM   1051 C  CA    . THR A 1 145 ? 31.870  74.865 39.311 1.00 37.12 ? 145 THR A CA    1 
ATOM   1052 C  C     . THR A 1 145 ? 32.415  73.604 39.978 1.00 39.37 ? 145 THR A C     1 
ATOM   1053 O  O     . THR A 1 145 ? 32.919  72.682 39.332 1.00 40.32 ? 145 THR A O     1 
ATOM   1054 C  CB    . THR A 1 145 ? 32.955  75.946 39.216 1.00 36.38 ? 145 THR A CB    1 
ATOM   1055 O  OG1   . THR A 1 145 ? 33.372  76.322 40.535 1.00 36.82 ? 145 THR A OG1   1 
ATOM   1056 C  CG2   . THR A 1 145 ? 32.398  77.174 38.510 1.00 36.69 ? 145 THR A CG2   1 
ATOM   1057 N  N     . GLU A 1 146 ? 32.278  73.562 41.292 1.00 42.57 ? 146 GLU A N     1 
ATOM   1058 C  CA    . GLU A 1 146 ? 32.763  72.429 42.052 1.00 46.01 ? 146 GLU A CA    1 
ATOM   1059 C  C     . GLU A 1 146 ? 31.657  71.397 42.224 1.00 46.31 ? 146 GLU A C     1 
ATOM   1060 O  O     . GLU A 1 146 ? 30.724  71.606 43.011 1.00 46.01 ? 146 GLU A O     1 
ATOM   1061 C  CB    . GLU A 1 146 ? 33.270  72.902 43.421 1.00 49.50 ? 146 GLU A CB    1 
ATOM   1062 C  CG    . GLU A 1 146 ? 34.244  74.101 43.348 1.00 53.91 ? 146 GLU A CG    1 
ATOM   1063 C  CD    . GLU A 1 146 ? 35.526  73.791 42.558 1.00 56.41 ? 146 GLU A CD    1 
ATOM   1064 O  OE1   . GLU A 1 146 ? 36.337  72.959 43.035 1.00 57.72 ? 146 GLU A OE1   1 
ATOM   1065 O  OE2   . GLU A 1 146 ? 35.719  74.377 41.460 1.00 57.54 ? 146 GLU A OE2   1 
ATOM   1066 N  N     . VAL A 1 147 ? 31.756  70.309 41.459 1.00 46.44 ? 147 VAL A N     1 
ATOM   1067 C  CA    . VAL A 1 147 ? 30.798  69.208 41.546 1.00 46.24 ? 147 VAL A CA    1 
ATOM   1068 C  C     . VAL A 1 147 ? 31.531  67.849 41.588 1.00 45.86 ? 147 VAL A C     1 
ATOM   1069 O  O     . VAL A 1 147 ? 31.840  67.249 40.553 1.00 44.82 ? 147 VAL A O     1 
ATOM   1070 C  CB    . VAL A 1 147 ? 29.795  69.214 40.365 1.00 46.50 ? 147 VAL A CB    1 
ATOM   1071 C  CG1   . VAL A 1 147 ? 28.737  68.161 40.589 1.00 46.67 ? 147 VAL A CG1   1 
ATOM   1072 C  CG2   . VAL A 1 147 ? 29.140  70.570 40.237 1.00 46.93 ? 147 VAL A CG2   1 
ATOM   1073 N  N     . LYS A 1 148 ? 31.833  67.405 42.809 1.00 46.02 ? 148 LYS A N     1 
ATOM   1074 C  CA    . LYS A 1 148 ? 32.496  66.124 43.090 1.00 46.34 ? 148 LYS A CA    1 
ATOM   1075 C  C     . LYS A 1 148 ? 31.387  65.091 42.861 1.00 45.04 ? 148 LYS A C     1 
ATOM   1076 O  O     . LYS A 1 148 ? 30.372  65.099 43.572 1.00 44.41 ? 148 LYS A O     1 
ATOM   1077 C  CB    . LYS A 1 148 ? 32.948  66.079 44.563 1.00 47.96 ? 148 LYS A CB    1 
ATOM   1078 C  CG    . LYS A 1 148 ? 34.101  67.030 44.970 1.00 51.13 ? 148 LYS A CG    1 
ATOM   1079 C  CD    . LYS A 1 148 ? 33.932  68.491 44.479 1.00 53.25 ? 148 LYS A CD    1 
ATOM   1080 C  CE    . LYS A 1 148 ? 32.654  69.181 44.983 1.00 54.08 ? 148 LYS A CE    1 
ATOM   1081 N  NZ    . LYS A 1 148 ? 32.666  69.440 46.443 1.00 55.21 ? 148 LYS A NZ    1 
ATOM   1082 N  N     . PRO A 1 149 ? 31.564  64.191 41.877 1.00 43.87 ? 149 PRO A N     1 
ATOM   1083 C  CA    . PRO A 1 149 ? 30.531  63.190 41.609 1.00 43.65 ? 149 PRO A CA    1 
ATOM   1084 C  C     . PRO A 1 149 ? 30.348  62.253 42.779 1.00 42.56 ? 149 PRO A C     1 
ATOM   1085 O  O     . PRO A 1 149 ? 31.322  61.854 43.428 1.00 42.94 ? 149 PRO A O     1 
ATOM   1086 C  CB    . PRO A 1 149 ? 31.055  62.472 40.377 1.00 43.49 ? 149 PRO A CB    1 
ATOM   1087 C  CG    . PRO A 1 149 ? 32.505  62.458 40.625 1.00 44.52 ? 149 PRO A CG    1 
ATOM   1088 C  CD    . PRO A 1 149 ? 32.786  63.879 41.119 1.00 44.04 ? 149 PRO A CD    1 
ATOM   1089 N  N     . ASN A 1 150 ? 29.095  61.916 43.053 1.00 41.27 ? 150 ASN A N     1 
ATOM   1090 C  CA    . ASN A 1 150 ? 28.780  61.021 44.151 1.00 39.62 ? 150 ASN A CA    1 
ATOM   1091 C  C     . ASN A 1 150 ? 29.254  59.599 43.828 1.00 37.01 ? 150 ASN A C     1 
ATOM   1092 O  O     . ASN A 1 150 ? 28.846  59.002 42.823 1.00 35.13 ? 150 ASN A O     1 
ATOM   1093 C  CB    . ASN A 1 150 ? 27.274  61.030 44.412 1.00 39.75 ? 150 ASN A CB    1 
ATOM   1094 C  CG    . ASN A 1 150 ? 26.924  60.380 45.714 1.00 41.04 ? 150 ASN A CG    1 
ATOM   1095 O  OD1   . ASN A 1 150 ? 27.422  59.299 46.026 1.00 42.66 ? 150 ASN A OD1   1 
ATOM   1096 N  ND2   . ASN A 1 150 ? 26.060  61.029 46.489 1.00 40.39 ? 150 ASN A ND2   1 
ATOM   1097 N  N     . PRO A 1 151 ? 30.135  59.039 44.680 1.00 35.88 ? 151 PRO A N     1 
ATOM   1098 C  CA    . PRO A 1 151 ? 30.639  57.682 44.445 1.00 34.94 ? 151 PRO A CA    1 
ATOM   1099 C  C     . PRO A 1 151 ? 29.509  56.659 44.491 1.00 33.31 ? 151 PRO A C     1 
ATOM   1100 O  O     . PRO A 1 151 ? 29.643  55.556 43.949 1.00 33.40 ? 151 PRO A O     1 
ATOM   1101 C  CB    . PRO A 1 151 ? 31.657  57.491 45.575 1.00 36.04 ? 151 PRO A CB    1 
ATOM   1102 C  CG    . PRO A 1 151 ? 31.068  58.314 46.693 1.00 37.09 ? 151 PRO A CG    1 
ATOM   1103 C  CD    . PRO A 1 151 ? 30.614  59.571 45.971 1.00 36.54 ? 151 PRO A CD    1 
ATOM   1104 N  N     . ASN A 1 152 ? 28.404  57.034 45.152 1.00 31.08 ? 152 ASN A N     1 
ATOM   1105 C  CA    . ASN A 1 152 ? 27.221  56.178 45.266 1.00 29.75 ? 152 ASN A CA    1 
ATOM   1106 C  C     . ASN A 1 152 ? 26.351  56.217 44.025 1.00 28.97 ? 152 ASN A C     1 
ATOM   1107 O  O     . ASN A 1 152 ? 25.570  55.297 43.791 1.00 29.56 ? 152 ASN A O     1 
ATOM   1108 C  CB    . ASN A 1 152 ? 26.342  56.577 46.460 1.00 28.42 ? 152 ASN A CB    1 
ATOM   1109 C  CG    . ASN A 1 152 ? 26.998  56.296 47.794 1.00 29.24 ? 152 ASN A CG    1 
ATOM   1110 O  OD1   . ASN A 1 152 ? 27.679  55.293 47.954 1.00 29.76 ? 152 ASN A OD1   1 
ATOM   1111 N  ND2   . ASN A 1 152 ? 26.766  57.168 48.769 1.00 28.84 ? 152 ASN A ND2   1 
ATOM   1112 N  N     . LEU A 1 153 ? 26.477  57.280 43.227 1.00 27.75 ? 153 LEU A N     1 
ATOM   1113 C  CA    . LEU A 1 153 ? 25.664  57.420 42.022 1.00 25.27 ? 153 LEU A CA    1 
ATOM   1114 C  C     . LEU A 1 153 ? 26.383  57.070 40.732 1.00 24.64 ? 153 LEU A C     1 
ATOM   1115 O  O     . LEU A 1 153 ? 25.747  56.646 39.757 1.00 21.96 ? 153 LEU A O     1 
ATOM   1116 C  CB    . LEU A 1 153 ? 25.112  58.847 41.928 1.00 27.10 ? 153 LEU A CB    1 
ATOM   1117 C  CG    . LEU A 1 153 ? 23.829  59.031 42.742 1.00 29.09 ? 153 LEU A CG    1 
ATOM   1118 C  CD1   . LEU A 1 153 ? 23.643  60.476 43.054 1.00 32.72 ? 153 LEU A CD1   1 
ATOM   1119 C  CD2   . LEU A 1 153 ? 22.635  58.457 41.955 1.00 27.54 ? 153 LEU A CD2   1 
ATOM   1120 N  N     . TYR A 1 154 ? 27.706  57.226 40.748 1.00 24.94 ? 154 TYR A N     1 
ATOM   1121 C  CA    . TYR A 1 154 ? 28.542  56.960 39.587 1.00 26.32 ? 154 TYR A CA    1 
ATOM   1122 C  C     . TYR A 1 154 ? 29.663  55.956 39.812 1.00 27.93 ? 154 TYR A C     1 
ATOM   1123 O  O     . TYR A 1 154 ? 30.412  56.020 40.792 1.00 26.40 ? 154 TYR A O     1 
ATOM   1124 C  CB    . TYR A 1 154 ? 29.151  58.267 39.090 1.00 27.22 ? 154 TYR A CB    1 
ATOM   1125 C  CG    . TYR A 1 154 ? 28.118  59.247 38.613 1.00 26.28 ? 154 TYR A CG    1 
ATOM   1126 C  CD1   . TYR A 1 154 ? 27.465  59.049 37.402 1.00 26.93 ? 154 TYR A CD1   1 
ATOM   1127 C  CD2   . TYR A 1 154 ? 27.782  60.362 39.374 1.00 26.41 ? 154 TYR A CD2   1 
ATOM   1128 C  CE1   . TYR A 1 154 ? 26.499  59.939 36.947 1.00 26.01 ? 154 TYR A CE1   1 
ATOM   1129 C  CE2   . TYR A 1 154 ? 26.806  61.269 38.924 1.00 25.33 ? 154 TYR A CE2   1 
ATOM   1130 C  CZ    . TYR A 1 154 ? 26.177  61.041 37.712 1.00 25.65 ? 154 TYR A CZ    1 
ATOM   1131 O  OH    . TYR A 1 154 ? 25.205  61.897 37.255 1.00 26.30 ? 154 TYR A OH    1 
ATOM   1132 N  N     . GLU A 1 155 ? 29.757  55.029 38.875 1.00 30.55 ? 155 GLU A N     1 
ATOM   1133 C  CA    . GLU A 1 155 ? 30.779  54.010 38.895 1.00 33.65 ? 155 GLU A CA    1 
ATOM   1134 C  C     . GLU A 1 155 ? 32.067  54.778 38.641 1.00 35.28 ? 155 GLU A C     1 
ATOM   1135 O  O     . GLU A 1 155 ? 33.018  54.629 39.438 1.00 37.72 ? 155 GLU A O     1 
ATOM   1136 C  CB    . GLU A 1 155 ? 30.499  53.026 37.772 1.00 34.81 ? 155 GLU A CB    1 
ATOM   1137 C  CG    . GLU A 1 155 ? 31.244  51.724 37.856 1.00 39.48 ? 155 GLU A CG    1 
ATOM   1138 C  CD    . GLU A 1 155 ? 30.632  50.698 36.937 1.00 41.47 ? 155 GLU A CD    1 
ATOM   1139 O  OE1   . GLU A 1 155 ? 30.272  51.080 35.802 1.00 42.51 ? 155 GLU A OE1   1 
ATOM   1140 O  OE2   . GLU A 1 155 ? 30.507  49.515 37.345 1.00 45.02 ? 155 GLU A OE2   1 
ATOM   1141 O  OXT   . GLU A 1 155 ? 32.096  55.547 37.654 1.00 35.02 ? 155 GLU A OXT   1 
ATOM   1142 N  N     . VAL B 1 6   ? -14.283 69.893 26.926 1.00 33.42 ? 6   VAL B N     1 
ATOM   1143 C  CA    . VAL B 1 6   ? -14.557 70.960 27.931 1.00 30.83 ? 6   VAL B CA    1 
ATOM   1144 C  C     . VAL B 1 6   ? -13.914 70.567 29.249 1.00 30.01 ? 6   VAL B C     1 
ATOM   1145 O  O     . VAL B 1 6   ? -13.709 69.379 29.540 1.00 28.36 ? 6   VAL B O     1 
ATOM   1146 C  CB    . VAL B 1 6   ? -16.101 71.157 28.191 1.00 32.10 ? 6   VAL B CB    1 
ATOM   1147 C  CG1   . VAL B 1 6   ? -16.668 69.978 28.986 1.00 29.69 ? 6   VAL B CG1   1 
ATOM   1148 C  CG2   . VAL B 1 6   ? -16.357 72.452 28.963 1.00 33.50 ? 6   VAL B CG2   1 
ATOM   1149 N  N     . ASN B 1 7   ? -13.638 71.582 30.055 1.00 29.61 ? 7   ASN B N     1 
ATOM   1150 C  CA    . ASN B 1 7   ? -13.037 71.388 31.355 1.00 29.02 ? 7   ASN B CA    1 
ATOM   1151 C  C     . ASN B 1 7   ? -14.036 70.846 32.377 1.00 28.91 ? 7   ASN B C     1 
ATOM   1152 O  O     . ASN B 1 7   ? -13.672 70.637 33.523 1.00 29.05 ? 7   ASN B O     1 
ATOM   1153 C  CB    . ASN B 1 7   ? -12.451 72.704 31.844 1.00 30.14 ? 7   ASN B CB    1 
ATOM   1154 C  CG    . ASN B 1 7   ? -11.338 73.198 30.952 1.00 29.76 ? 7   ASN B CG    1 
ATOM   1155 O  OD1   . ASN B 1 7   ? -10.834 74.309 31.131 1.00 34.26 ? 7   ASN B OD1   1 
ATOM   1156 N  ND2   . ASN B 1 7   ? -10.941 72.375 29.986 1.00 25.63 ? 7   ASN B ND2   1 
ATOM   1157 N  N     . LYS B 1 8   ? -15.281 70.617 31.962 1.00 27.49 ? 8   LYS B N     1 
ATOM   1158 C  CA    . LYS B 1 8   ? -16.280 70.088 32.874 1.00 26.04 ? 8   LYS B CA    1 
ATOM   1159 C  C     . LYS B 1 8   ? -16.619 68.605 32.677 1.00 23.41 ? 8   LYS B C     1 
ATOM   1160 O  O     . LYS B 1 8   ? -17.603 68.122 33.211 1.00 22.54 ? 8   LYS B O     1 
ATOM   1161 C  CB    . LYS B 1 8   ? -17.540 70.940 32.815 1.00 27.83 ? 8   LYS B CB    1 
ATOM   1162 C  CG    . LYS B 1 8   ? -17.281 72.381 33.242 1.00 31.46 ? 8   LYS B CG    1 
ATOM   1163 C  CD    . LYS B 1 8   ? -18.443 73.294 32.860 1.00 35.10 ? 8   LYS B CD    1 
ATOM   1164 C  CE    . LYS B 1 8   ? -18.999 73.991 34.079 1.00 36.67 ? 8   LYS B CE    1 
ATOM   1165 N  NZ    . LYS B 1 8   ? -17.944 74.777 34.796 1.00 39.66 ? 8   LYS B NZ    1 
ATOM   1166 N  N     . GLU B 1 9   ? -15.793 67.886 31.929 1.00 21.24 ? 9   GLU B N     1 
ATOM   1167 C  CA    . GLU B 1 9   ? -16.004 66.451 31.740 1.00 20.42 ? 9   GLU B CA    1 
ATOM   1168 C  C     . GLU B 1 9   ? -15.983 65.802 33.136 1.00 19.80 ? 9   GLU B C     1 
ATOM   1169 O  O     . GLU B 1 9   ? -15.334 66.295 34.036 1.00 17.88 ? 9   GLU B O     1 
ATOM   1170 C  CB    . GLU B 1 9   ? -14.889 65.862 30.872 1.00 19.47 ? 9   GLU B CB    1 
ATOM   1171 C  CG    . GLU B 1 9   ? -14.958 64.349 30.674 1.00 17.92 ? 9   GLU B CG    1 
ATOM   1172 C  CD    . GLU B 1 9   ? -14.012 63.882 29.592 1.00 22.69 ? 9   GLU B CD    1 
ATOM   1173 O  OE1   . GLU B 1 9   ? -14.103 64.419 28.466 1.00 20.49 ? 9   GLU B OE1   1 
ATOM   1174 O  OE2   . GLU B 1 9   ? -13.166 62.992 29.849 1.00 20.76 ? 9   GLU B OE2   1 
ATOM   1175 N  N     . ARG B 1 10  ? -16.722 64.720 33.314 1.00 19.67 ? 10  ARG B N     1 
ATOM   1176 C  CA    . ARG B 1 10  ? -16.748 64.041 34.608 1.00 19.23 ? 10  ARG B CA    1 
ATOM   1177 C  C     . ARG B 1 10  ? -16.565 62.550 34.444 1.00 19.33 ? 10  ARG B C     1 
ATOM   1178 O  O     . ARG B 1 10  ? -16.897 61.985 33.405 1.00 19.39 ? 10  ARG B O     1 
ATOM   1179 C  CB    . ARG B 1 10  ? -18.075 64.294 35.307 1.00 17.85 ? 10  ARG B CB    1 
ATOM   1180 C  CG    . ARG B 1 10  ? -18.211 65.699 35.821 1.00 18.10 ? 10  ARG B CG    1 
ATOM   1181 C  CD    . ARG B 1 10  ? -19.586 65.957 36.450 1.00 18.04 ? 10  ARG B CD    1 
ATOM   1182 N  NE    . ARG B 1 10  ? -19.576 67.243 37.145 1.00 20.58 ? 10  ARG B NE    1 
ATOM   1183 C  CZ    . ARG B 1 10  ? -20.603 67.761 37.810 1.00 19.48 ? 10  ARG B CZ    1 
ATOM   1184 N  NH1   . ARG B 1 10  ? -21.758 67.112 37.878 1.00 20.47 ? 10  ARG B NH1   1 
ATOM   1185 N  NH2   . ARG B 1 10  ? -20.463 68.929 38.422 1.00 21.60 ? 10  ARG B NH2   1 
ATOM   1186 N  N     . THR B 1 11  ? -16.049 61.906 35.485 1.00 16.54 ? 11  THR B N     1 
ATOM   1187 C  CA    . THR B 1 11  ? -15.896 60.467 35.433 1.00 17.11 ? 11  THR B CA    1 
ATOM   1188 C  C     . THR B 1 11  ? -16.293 59.870 36.774 1.00 16.94 ? 11  THR B C     1 
ATOM   1189 O  O     . THR B 1 11  ? -16.242 60.547 37.798 1.00 16.22 ? 11  THR B O     1 
ATOM   1190 C  CB    . THR B 1 11  ? -14.472 60.057 35.099 1.00 14.57 ? 11  THR B CB    1 
ATOM   1191 O  OG1   . THR B 1 11  ? -14.466 58.657 34.791 1.00 16.09 ? 11  THR B OG1   1 
ATOM   1192 C  CG2   . THR B 1 11  ? -13.541 60.344 36.246 1.00 15.42 ? 11  THR B CG2   1 
ATOM   1193 N  N     . PHE B 1 12  ? -16.695 58.610 36.747 1.00 17.06 ? 12  PHE B N     1 
ATOM   1194 C  CA    . PHE B 1 12  ? -17.098 57.932 37.963 1.00 17.10 ? 12  PHE B CA    1 
ATOM   1195 C  C     . PHE B 1 12  ? -15.997 56.972 38.381 1.00 16.39 ? 12  PHE B C     1 
ATOM   1196 O  O     . PHE B 1 12  ? -15.546 56.172 37.594 1.00 16.18 ? 12  PHE B O     1 
ATOM   1197 C  CB    . PHE B 1 12  ? -18.388 57.142 37.739 1.00 17.77 ? 12  PHE B CB    1 
ATOM   1198 C  CG    . PHE B 1 12  ? -18.740 56.274 38.906 1.00 16.73 ? 12  PHE B CG    1 
ATOM   1199 C  CD1   . PHE B 1 12  ? -19.246 56.841 40.065 1.00 17.15 ? 12  PHE B CD1   1 
ATOM   1200 C  CD2   . PHE B 1 12  ? -18.432 54.926 38.891 1.00 19.45 ? 12  PHE B CD2   1 
ATOM   1201 C  CE1   . PHE B 1 12  ? -19.430 56.076 41.208 1.00 18.44 ? 12  PHE B CE1   1 
ATOM   1202 C  CE2   . PHE B 1 12  ? -18.607 54.147 40.033 1.00 20.01 ? 12  PHE B CE2   1 
ATOM   1203 C  CZ    . PHE B 1 12  ? -19.104 54.731 41.183 1.00 16.83 ? 12  PHE B CZ    1 
ATOM   1204 N  N     . LEU B 1 13  ? -15.571 57.068 39.636 1.00 18.38 ? 13  LEU B N     1 
ATOM   1205 C  CA    . LEU B 1 13  ? -14.510 56.207 40.167 1.00 16.06 ? 13  LEU B CA    1 
ATOM   1206 C  C     . LEU B 1 13  ? -15.012 55.577 41.446 1.00 16.40 ? 13  LEU B C     1 
ATOM   1207 O  O     . LEU B 1 13  ? -15.670 56.229 42.246 1.00 15.90 ? 13  LEU B O     1 
ATOM   1208 C  CB    . LEU B 1 13  ? -13.257 57.039 40.509 1.00 14.96 ? 13  LEU B CB    1 
ATOM   1209 C  CG    . LEU B 1 13  ? -12.589 57.792 39.349 1.00 17.30 ? 13  LEU B CG    1 
ATOM   1210 C  CD1   . LEU B 1 13  ? -11.495 58.730 39.888 1.00 19.70 ? 13  LEU B CD1   1 
ATOM   1211 C  CD2   . LEU B 1 13  ? -11.970 56.810 38.402 1.00 17.55 ? 13  LEU B CD2   1 
ATOM   1212 N  N     . ALA B 1 14  ? -14.685 54.311 41.647 1.00 16.98 ? 14  ALA B N     1 
ATOM   1213 C  CA    . ALA B 1 14  ? -15.101 53.652 42.887 1.00 17.03 ? 14  ALA B CA    1 
ATOM   1214 C  C     . ALA B 1 14  ? -13.926 52.964 43.541 1.00 17.96 ? 14  ALA B C     1 
ATOM   1215 O  O     . ALA B 1 14  ? -13.214 52.182 42.888 1.00 16.75 ? 14  ALA B O     1 
ATOM   1216 C  CB    . ALA B 1 14  ? -16.173 52.635 42.604 1.00 18.49 ? 14  ALA B CB    1 
ATOM   1217 N  N     . VAL B 1 15  ? -13.699 53.253 44.823 1.00 18.29 ? 15  VAL B N     1 
ATOM   1218 C  CA    . VAL B 1 15  ? -12.640 52.535 45.496 1.00 16.48 ? 15  VAL B CA    1 
ATOM   1219 C  C     . VAL B 1 15  ? -13.407 51.275 45.906 1.00 16.58 ? 15  VAL B C     1 
ATOM   1220 O  O     . VAL B 1 15  ? -14.381 51.336 46.680 1.00 13.33 ? 15  VAL B O     1 
ATOM   1221 C  CB    . VAL B 1 15  ? -12.101 53.256 46.728 1.00 18.48 ? 15  VAL B CB    1 
ATOM   1222 C  CG1   . VAL B 1 15  ? -10.990 52.405 47.332 1.00 14.62 ? 15  VAL B CG1   1 
ATOM   1223 C  CG2   . VAL B 1 15  ? -11.541 54.662 46.343 1.00 16.88 ? 15  VAL B CG2   1 
ATOM   1224 N  N     . LYS B 1 16  ? -13.007 50.148 45.325 1.00 16.68 ? 16  LYS B N     1 
ATOM   1225 C  CA    . LYS B 1 16  ? -13.706 48.887 45.560 1.00 18.23 ? 16  LYS B CA    1 
ATOM   1226 C  C     . LYS B 1 16  ? -13.506 48.385 46.988 1.00 17.38 ? 16  LYS B C     1 
ATOM   1227 O  O     . LYS B 1 16  ? -12.663 48.903 47.721 1.00 14.99 ? 16  LYS B O     1 
ATOM   1228 C  CB    . LYS B 1 16  ? -13.263 47.856 44.522 1.00 16.70 ? 16  LYS B CB    1 
ATOM   1229 C  CG    . LYS B 1 16  ? -13.605 48.294 43.112 1.00 20.15 ? 16  LYS B CG    1 
ATOM   1230 C  CD    . LYS B 1 16  ? -12.952 47.331 42.105 1.00 22.28 ? 16  LYS B CD    1 
ATOM   1231 C  CE    . LYS B 1 16  ? -13.280 47.695 40.679 1.00 25.78 ? 16  LYS B CE    1 
ATOM   1232 N  NZ    . LYS B 1 16  ? -12.724 46.661 39.716 1.00 26.16 ? 16  LYS B NZ    1 
ATOM   1233 N  N     . PRO B 1 17  ? -14.282 47.368 47.401 1.00 18.12 ? 17  PRO B N     1 
ATOM   1234 C  CA    . PRO B 1 17  ? -14.137 46.880 48.773 1.00 18.53 ? 17  PRO B CA    1 
ATOM   1235 C  C     . PRO B 1 17  ? -12.718 46.565 49.196 1.00 17.10 ? 17  PRO B C     1 
ATOM   1236 O  O     . PRO B 1 17  ? -12.374 46.776 50.348 1.00 18.54 ? 17  PRO B O     1 
ATOM   1237 C  CB    . PRO B 1 17  ? -15.075 45.663 48.807 1.00 17.21 ? 17  PRO B CB    1 
ATOM   1238 C  CG    . PRO B 1 17  ? -16.182 46.106 47.907 1.00 15.63 ? 17  PRO B CG    1 
ATOM   1239 C  CD    . PRO B 1 17  ? -15.372 46.660 46.718 1.00 17.16 ? 17  PRO B CD    1 
ATOM   1240 N  N     . ASP B 1 18  ? -11.896 46.057 48.282 1.00 17.03 ? 18  ASP B N     1 
ATOM   1241 C  CA    . ASP B 1 18  ? -10.523 45.751 48.651 1.00 17.30 ? 18  ASP B CA    1 
ATOM   1242 C  C     . ASP B 1 18  ? -9.723  47.032 48.894 1.00 16.18 ? 18  ASP B C     1 
ATOM   1243 O  O     . ASP B 1 18  ? -8.974  47.111 49.873 1.00 15.87 ? 18  ASP B O     1 
ATOM   1244 C  CB    . ASP B 1 18  ? -9.859  44.843 47.590 1.00 17.89 ? 18  ASP B CB    1 
ATOM   1245 C  CG    . ASP B 1 18  ? -9.894  45.429 46.191 1.00 17.95 ? 18  ASP B CG    1 
ATOM   1246 O  OD1   . ASP B 1 18  ? -10.955 45.949 45.791 1.00 19.30 ? 18  ASP B OD1   1 
ATOM   1247 O  OD2   . ASP B 1 18  ? -8.865  45.330 45.496 1.00 16.10 ? 18  ASP B OD2   1 
ATOM   1248 N  N     . GLY B 1 19  ? -9.904  48.038 48.034 1.00 15.86 ? 19  GLY B N     1 
ATOM   1249 C  CA    . GLY B 1 19  ? -9.194  49.302 48.239 1.00 13.71 ? 19  GLY B CA    1 
ATOM   1250 C  C     . GLY B 1 19  ? -9.592  49.939 49.574 1.00 15.26 ? 19  GLY B C     1 
ATOM   1251 O  O     . GLY B 1 19  ? -8.762  50.480 50.286 1.00 14.87 ? 19  GLY B O     1 
ATOM   1252 N  N     . VAL B 1 20  ? -10.871 49.870 49.929 1.00 14.02 ? 20  VAL B N     1 
ATOM   1253 C  CA    . VAL B 1 20  ? -11.345 50.460 51.181 1.00 13.46 ? 20  VAL B CA    1 
ATOM   1254 C  C     . VAL B 1 20  ? -10.787 49.680 52.368 1.00 14.63 ? 20  VAL B C     1 
ATOM   1255 O  O     . VAL B 1 20  ? -10.242 50.269 53.318 1.00 13.49 ? 20  VAL B O     1 
ATOM   1256 C  CB    . VAL B 1 20  ? -12.917 50.460 51.238 1.00 13.60 ? 20  VAL B CB    1 
ATOM   1257 C  CG1   . VAL B 1 20  ? -13.418 50.990 52.598 1.00 12.06 ? 20  VAL B CG1   1 
ATOM   1258 C  CG2   . VAL B 1 20  ? -13.481 51.291 50.096 1.00 13.28 ? 20  VAL B CG2   1 
ATOM   1259 N  N     . ALA B 1 21  ? -10.869 48.353 52.294 1.00 14.83 ? 21  ALA B N     1 
ATOM   1260 C  CA    . ALA B 1 21  ? -10.389 47.523 53.421 1.00 16.10 ? 21  ALA B CA    1 
ATOM   1261 C  C     . ALA B 1 21  ? -8.893  47.697 53.635 1.00 15.80 ? 21  ALA B C     1 
ATOM   1262 O  O     . ALA B 1 21  ? -8.365  47.587 54.757 1.00 16.60 ? 21  ALA B O     1 
ATOM   1263 C  CB    . ALA B 1 21  ? -10.697 46.063 53.149 1.00 16.47 ? 21  ALA B CB    1 
ATOM   1264 N  N     . ARG B 1 22  ? -8.190  47.955 52.548 1.00 15.04 ? 22  ARG B N     1 
ATOM   1265 C  CA    . ARG B 1 22  ? -6.739  48.120 52.638 1.00 14.13 ? 22  ARG B CA    1 
ATOM   1266 C  C     . ARG B 1 22  ? -6.274  49.523 53.008 1.00 14.14 ? 22  ARG B C     1 
ATOM   1267 O  O     . ARG B 1 22  ? -5.075  49.792 53.056 1.00 15.91 ? 22  ARG B O     1 
ATOM   1268 C  CB    . ARG B 1 22  ? -6.099  47.659 51.339 1.00 14.12 ? 22  ARG B CB    1 
ATOM   1269 C  CG    . ARG B 1 22  ? -6.226  46.163 51.127 1.00 15.39 ? 22  ARG B CG    1 
ATOM   1270 C  CD    . ARG B 1 22  ? -5.578  45.738 49.787 1.00 17.40 ? 22  ARG B CD    1 
ATOM   1271 N  NE    . ARG B 1 22  ? -4.156  46.084 49.726 1.00 16.73 ? 22  ARG B NE    1 
ATOM   1272 C  CZ    . ARG B 1 22  ? -3.500  46.366 48.600 1.00 18.32 ? 22  ARG B CZ    1 
ATOM   1273 N  NH1   . ARG B 1 22  ? -4.143  46.338 47.443 1.00 16.45 ? 22  ARG B NH1   1 
ATOM   1274 N  NH2   . ARG B 1 22  ? -2.211  46.686 48.634 1.00 15.79 ? 22  ARG B NH2   1 
ATOM   1275 N  N     . GLY B 1 23  ? -7.229  50.402 53.240 1.00 12.21 ? 23  GLY B N     1 
ATOM   1276 C  CA    . GLY B 1 23  ? -6.937  51.761 53.657 1.00 11.68 ? 23  GLY B CA    1 
ATOM   1277 C  C     . GLY B 1 23  ? -6.257  52.565 52.583 1.00 10.74 ? 23  GLY B C     1 
ATOM   1278 O  O     . GLY B 1 23  ? -5.279  53.254 52.856 1.00 11.45 ? 23  GLY B O     1 
ATOM   1279 N  N     . LEU B 1 24  ? -6.796  52.485 51.367 1.00 11.32 ? 24  LEU B N     1 
ATOM   1280 C  CA    . LEU B 1 24  ? -6.223  53.207 50.245 1.00 12.31 ? 24  LEU B CA    1 
ATOM   1281 C  C     . LEU B 1 24  ? -7.107  54.343 49.760 1.00 12.21 ? 24  LEU B C     1 
ATOM   1282 O  O     . LEU B 1 24  ? -6.787  54.990 48.758 1.00 12.66 ? 24  LEU B O     1 
ATOM   1283 C  CB    . LEU B 1 24  ? -5.982  52.230 49.088 1.00 13.42 ? 24  LEU B CB    1 
ATOM   1284 C  CG    . LEU B 1 24  ? -4.959  51.117 49.391 1.00 14.69 ? 24  LEU B CG    1 
ATOM   1285 C  CD1   . LEU B 1 24  ? -4.880  50.115 48.210 1.00 16.25 ? 24  LEU B CD1   1 
ATOM   1286 C  CD2   . LEU B 1 24  ? -3.574  51.755 49.612 1.00 17.35 ? 24  LEU B CD2   1 
ATOM   1287 N  N     . VAL B 1 25  ? -8.226  54.577 50.443 1.00 12.14 ? 25  VAL B N     1 
ATOM   1288 C  CA    . VAL B 1 25  ? -9.137  55.642 50.016 1.00 12.30 ? 25  VAL B CA    1 
ATOM   1289 C  C     . VAL B 1 25  ? -8.464  57.016 49.917 1.00 10.97 ? 25  VAL B C     1 
ATOM   1290 O  O     . VAL B 1 25  ? -8.586  57.693 48.891 1.00 9.28  ? 25  VAL B O     1 
ATOM   1291 C  CB    . VAL B 1 25  ? -10.353 55.771 50.959 1.00 12.95 ? 25  VAL B CB    1 
ATOM   1292 C  CG1   . VAL B 1 25  ? -11.246 56.972 50.527 1.00 14.02 ? 25  VAL B CG1   1 
ATOM   1293 C  CG2   . VAL B 1 25  ? -11.165 54.476 50.948 1.00 12.22 ? 25  VAL B CG2   1 
ATOM   1294 N  N     . GLY B 1 26  ? -7.786  57.440 50.986 1.00 10.64 ? 26  GLY B N     1 
ATOM   1295 C  CA    . GLY B 1 26  ? -7.143  58.745 50.970 1.00 10.96 ? 26  GLY B CA    1 
ATOM   1296 C  C     . GLY B 1 26  ? -6.059  58.861 49.928 1.00 11.51 ? 26  GLY B C     1 
ATOM   1297 O  O     . GLY B 1 26  ? -5.977  59.871 49.198 1.00 11.02 ? 26  GLY B O     1 
ATOM   1298 N  N     . GLU B 1 27  ? -5.224  57.833 49.841 1.00 11.95 ? 27  GLU B N     1 
ATOM   1299 C  CA    . GLU B 1 27  ? -4.147  57.816 48.861 1.00 13.57 ? 27  GLU B CA    1 
ATOM   1300 C  C     . GLU B 1 27  ? -4.708  58.013 47.449 1.00 13.98 ? 27  GLU B C     1 
ATOM   1301 O  O     . GLU B 1 27  ? -4.158  58.761 46.649 1.00 13.22 ? 27  GLU B O     1 
ATOM   1302 C  CB    . GLU B 1 27  ? -3.412  56.484 48.941 1.00 14.93 ? 27  GLU B CB    1 
ATOM   1303 C  CG    . GLU B 1 27  ? -2.527  56.131 47.733 1.00 19.72 ? 27  GLU B CG    1 
ATOM   1304 C  CD    . GLU B 1 27  ? -1.282  56.988 47.641 1.00 21.89 ? 27  GLU B CD    1 
ATOM   1305 O  OE1   . GLU B 1 27  ? -0.930  57.614 48.662 1.00 25.20 ? 27  GLU B OE1   1 
ATOM   1306 O  OE2   . GLU B 1 27  ? -0.641  57.035 46.566 1.00 20.82 ? 27  GLU B OE2   1 
ATOM   1307 N  N     . ILE B 1 28  ? -5.799  57.331 47.152 1.00 12.83 ? 28  ILE B N     1 
ATOM   1308 C  CA    . ILE B 1 28  ? -6.392  57.441 45.829 1.00 13.94 ? 28  ILE B CA    1 
ATOM   1309 C  C     . ILE B 1 28  ? -6.969  58.810 45.597 1.00 12.73 ? 28  ILE B C     1 
ATOM   1310 O  O     . ILE B 1 28  ? -6.698  59.453 44.574 1.00 14.12 ? 28  ILE B O     1 
ATOM   1311 C  CB    . ILE B 1 28  ? -7.472  56.387 45.642 1.00 13.96 ? 28  ILE B CB    1 
ATOM   1312 C  CG1   . ILE B 1 28  ? -6.797  55.015 45.476 1.00 12.41 ? 28  ILE B CG1   1 
ATOM   1313 C  CG2   . ILE B 1 28  ? -8.341  56.759 44.442 1.00 13.48 ? 28  ILE B CG2   1 
ATOM   1314 C  CD1   . ILE B 1 28  ? -7.755  53.781 45.645 1.00 12.37 ? 28  ILE B CD1   1 
ATOM   1315 N  N     . ILE B 1 29  ? -7.776  59.281 46.539 1.00 12.02 ? 29  ILE B N     1 
ATOM   1316 C  CA    . ILE B 1 29  ? -8.361  60.613 46.372 1.00 12.82 ? 29  ILE B CA    1 
ATOM   1317 C  C     . ILE B 1 29  ? -7.265  61.650 46.184 1.00 12.86 ? 29  ILE B C     1 
ATOM   1318 O  O     . ILE B 1 29  ? -7.366  62.544 45.308 1.00 10.62 ? 29  ILE B O     1 
ATOM   1319 C  CB    . ILE B 1 29  ? -9.211  60.987 47.575 1.00 11.94 ? 29  ILE B CB    1 
ATOM   1320 C  CG1   . ILE B 1 29  ? -10.414 60.024 47.619 1.00 12.74 ? 29  ILE B CG1   1 
ATOM   1321 C  CG2   . ILE B 1 29  ? -9.710  62.487 47.458 1.00 13.14 ? 29  ILE B CG2   1 
ATOM   1322 C  CD1   . ILE B 1 29  ? -11.420 60.331 48.715 1.00 12.31 ? 29  ILE B CD1   1 
ATOM   1323 N  N     . ALA B 1 30  ? -6.200  61.520 46.970 1.00 11.52 ? 30  ALA B N     1 
ATOM   1324 C  CA    . ALA B 1 30  ? -5.104  62.472 46.894 1.00 10.75 ? 30  ALA B CA    1 
ATOM   1325 C  C     . ALA B 1 30  ? -4.474  62.494 45.502 1.00 11.05 ? 30  ALA B C     1 
ATOM   1326 O  O     . ALA B 1 30  ? -4.045  63.557 45.013 1.00 11.61 ? 30  ALA B O     1 
ATOM   1327 C  CB    . ALA B 1 30  ? -4.042  62.132 47.950 1.00 11.84 ? 30  ALA B CB    1 
ATOM   1328 N  N     . ARG B 1 31  ? -4.371  61.339 44.864 1.00 10.00 ? 31  ARG B N     1 
ATOM   1329 C  CA    . ARG B 1 31  ? -3.764  61.345 43.532 1.00 9.62  ? 31  ARG B CA    1 
ATOM   1330 C  C     . ARG B 1 31  ? -4.603  62.156 42.563 1.00 11.11 ? 31  ARG B C     1 
ATOM   1331 O  O     . ARG B 1 31  ? -4.042  62.876 41.743 1.00 12.11 ? 31  ARG B O     1 
ATOM   1332 C  CB    . ARG B 1 31  ? -3.602  59.930 42.992 1.00 10.49 ? 31  ARG B CB    1 
ATOM   1333 C  CG    . ARG B 1 31  ? -2.472  59.177 43.707 1.00 10.65 ? 31  ARG B CG    1 
ATOM   1334 C  CD    . ARG B 1 31  ? -2.450  57.757 43.219 1.00 14.83 ? 31  ARG B CD    1 
ATOM   1335 N  NE    . ARG B 1 31  ? -1.453  56.987 43.945 1.00 14.46 ? 31  ARG B NE    1 
ATOM   1336 C  CZ    . ARG B 1 31  ? -0.597  56.171 43.359 1.00 15.99 ? 31  ARG B CZ    1 
ATOM   1337 N  NH1   . ARG B 1 31  ? -0.642  56.016 42.028 1.00 14.87 ? 31  ARG B NH1   1 
ATOM   1338 N  NH2   . ARG B 1 31  ? 0.339   55.564 44.088 1.00 15.76 ? 31  ARG B NH2   1 
ATOM   1339 N  N     . TYR B 1 32  ? -5.929  62.033 42.645 1.00 10.90 ? 32  TYR B N     1 
ATOM   1340 C  CA    . TYR B 1 32  ? -6.786  62.810 41.739 1.00 10.86 ? 32  TYR B CA    1 
ATOM   1341 C  C     . TYR B 1 32  ? -6.819  64.275 42.115 1.00 12.36 ? 32  TYR B C     1 
ATOM   1342 O  O     . TYR B 1 32  ? -6.870  65.141 41.239 1.00 11.61 ? 32  TYR B O     1 
ATOM   1343 C  CB    . TYR B 1 32  ? -8.179  62.226 41.690 1.00 12.41 ? 32  TYR B CB    1 
ATOM   1344 C  CG    . TYR B 1 32  ? -8.186  60.902 40.934 1.00 14.70 ? 32  TYR B CG    1 
ATOM   1345 C  CD1   . TYR B 1 32  ? -7.999  60.871 39.574 1.00 12.76 ? 32  TYR B CD1   1 
ATOM   1346 C  CD2   . TYR B 1 32  ? -8.263  59.678 41.625 1.00 15.36 ? 32  TYR B CD2   1 
ATOM   1347 C  CE1   . TYR B 1 32  ? -7.873  59.631 38.878 1.00 12.73 ? 32  TYR B CE1   1 
ATOM   1348 C  CE2   . TYR B 1 32  ? -8.146  58.454 40.964 1.00 14.74 ? 32  TYR B CE2   1 
ATOM   1349 C  CZ    . TYR B 1 32  ? -7.953  58.432 39.597 1.00 14.97 ? 32  TYR B CZ    1 
ATOM   1350 O  OH    . TYR B 1 32  ? -7.857  57.228 38.936 1.00 13.53 ? 32  TYR B OH    1 
ATOM   1351 N  N     . GLU B 1 33  ? -6.821  64.577 43.412 1.00 10.23 ? 33  GLU B N     1 
ATOM   1352 C  CA    . GLU B 1 33  ? -6.762  65.989 43.806 1.00 11.78 ? 33  GLU B CA    1 
ATOM   1353 C  C     . GLU B 1 33  ? -5.461  66.622 43.320 1.00 13.17 ? 33  GLU B C     1 
ATOM   1354 O  O     . GLU B 1 33  ? -5.452  67.752 42.787 1.00 14.53 ? 33  GLU B O     1 
ATOM   1355 C  CB    . GLU B 1 33  ? -6.774  66.109 45.332 1.00 11.58 ? 33  GLU B CB    1 
ATOM   1356 C  CG    . GLU B 1 33  ? -8.116  65.828 45.953 1.00 10.26 ? 33  GLU B CG    1 
ATOM   1357 C  CD    . GLU B 1 33  ? -8.038  65.928 47.440 1.00 10.88 ? 33  GLU B CD    1 
ATOM   1358 O  OE1   . GLU B 1 33  ? -7.360  65.041 48.028 1.00 13.09 ? 33  GLU B OE1   1 
ATOM   1359 O  OE2   . GLU B 1 33  ? -8.616  66.882 48.006 1.00 15.18 ? 33  GLU B OE2   1 
ATOM   1360 N  N     . LYS B 1 34  ? -4.345  65.928 43.528 1.00 11.82 ? 34  LYS B N     1 
ATOM   1361 C  CA    . LYS B 1 34  ? -3.049  66.477 43.127 1.00 13.26 ? 34  LYS B CA    1 
ATOM   1362 C  C     . LYS B 1 34  ? -2.953  66.712 41.633 1.00 13.07 ? 34  LYS B C     1 
ATOM   1363 O  O     . LYS B 1 34  ? -2.286  67.656 41.190 1.00 13.39 ? 34  LYS B O     1 
ATOM   1364 C  CB    . LYS B 1 34  ? -1.903  65.558 43.569 1.00 15.19 ? 34  LYS B CB    1 
ATOM   1365 C  CG    . LYS B 1 34  ? -1.588  65.652 45.075 1.00 20.73 ? 34  LYS B CG    1 
ATOM   1366 C  CD    . LYS B 1 34  ? -0.391  64.763 45.466 1.00 23.68 ? 34  LYS B CD    1 
ATOM   1367 C  CE    . LYS B 1 34  ? -0.381  64.510 46.995 1.00 28.67 ? 34  LYS B CE    1 
ATOM   1368 N  NZ    . LYS B 1 34  ? 0.682   63.530 47.418 1.00 32.32 ? 34  LYS B NZ    1 
ATOM   1369 N  N     . LYS B 1 35  ? -3.600  65.843 40.867 1.00 11.57 ? 35  LYS B N     1 
ATOM   1370 C  CA    . LYS B 1 35  ? -3.612  65.921 39.395 1.00 12.54 ? 35  LYS B CA    1 
ATOM   1371 C  C     . LYS B 1 35  ? -4.334  67.190 38.929 1.00 16.11 ? 35  LYS B C     1 
ATOM   1372 O  O     . LYS B 1 35  ? -4.105  67.670 37.808 1.00 15.35 ? 35  LYS B O     1 
ATOM   1373 C  CB    . LYS B 1 35  ? -4.339  64.690 38.851 1.00 13.43 ? 35  LYS B CB    1 
ATOM   1374 C  CG    . LYS B 1 35  ? -4.567  64.656 37.338 1.00 11.40 ? 35  LYS B CG    1 
ATOM   1375 C  CD    . LYS B 1 35  ? -3.241  64.600 36.569 1.00 15.04 ? 35  LYS B CD    1 
ATOM   1376 C  CE    . LYS B 1 35  ? -3.512  64.209 35.116 1.00 12.51 ? 35  LYS B CE    1 
ATOM   1377 N  NZ    . LYS B 1 35  ? -2.280  64.176 34.296 1.00 13.63 ? 35  LYS B NZ    1 
ATOM   1378 N  N     . GLY B 1 36  ? -5.240  67.691 39.763 1.00 15.12 ? 36  GLY B N     1 
ATOM   1379 C  CA    . GLY B 1 36  ? -5.978  68.894 39.406 1.00 17.78 ? 36  GLY B CA    1 
ATOM   1380 C  C     . GLY B 1 36  ? -7.450  68.661 39.134 1.00 16.41 ? 36  GLY B C     1 
ATOM   1381 O  O     . GLY B 1 36  ? -8.170  69.576 38.721 1.00 21.09 ? 36  GLY B O     1 
ATOM   1382 N  N     . PHE B 1 37  ? -7.912  67.437 39.347 1.00 17.34 ? 37  PHE B N     1 
ATOM   1383 C  CA    . PHE B 1 37  ? -9.310  67.127 39.148 1.00 15.23 ? 37  PHE B CA    1 
ATOM   1384 C  C     . PHE B 1 37  ? -10.097 67.512 40.385 1.00 15.39 ? 37  PHE B C     1 
ATOM   1385 O  O     . PHE B 1 37  ? -9.591  67.458 41.514 1.00 17.26 ? 37  PHE B O     1 
ATOM   1386 C  CB    . PHE B 1 37  ? -9.486  65.647 38.824 1.00 14.47 ? 37  PHE B CB    1 
ATOM   1387 C  CG    . PHE B 1 37  ? -8.915  65.271 37.489 1.00 14.96 ? 37  PHE B CG    1 
ATOM   1388 C  CD1   . PHE B 1 37  ? -9.235  66.028 36.348 1.00 14.57 ? 37  PHE B CD1   1 
ATOM   1389 C  CD2   . PHE B 1 37  ? -8.053  64.197 37.361 1.00 16.19 ? 37  PHE B CD2   1 
ATOM   1390 C  CE1   . PHE B 1 37  ? -8.699  65.708 35.090 1.00 14.32 ? 37  PHE B CE1   1 
ATOM   1391 C  CE2   . PHE B 1 37  ? -7.506  63.862 36.099 1.00 17.56 ? 37  PHE B CE2   1 
ATOM   1392 C  CZ    . PHE B 1 37  ? -7.845  64.635 34.964 1.00 17.10 ? 37  PHE B CZ    1 
ATOM   1393 N  N     . VAL B 1 38  ? -11.345 67.892 40.165 1.00 16.49 ? 38  VAL B N     1 
ATOM   1394 C  CA    . VAL B 1 38  ? -12.194 68.353 41.228 1.00 17.06 ? 38  VAL B CA    1 
ATOM   1395 C  C     . VAL B 1 38  ? -13.244 67.343 41.669 1.00 16.03 ? 38  VAL B C     1 
ATOM   1396 O  O     . VAL B 1 38  ? -13.972 66.777 40.869 1.00 15.12 ? 38  VAL B O     1 
ATOM   1397 C  CB    . VAL B 1 38  ? -12.861 69.685 40.817 1.00 17.86 ? 38  VAL B CB    1 
ATOM   1398 C  CG1   . VAL B 1 38  ? -13.878 70.119 41.871 1.00 18.23 ? 38  VAL B CG1   1 
ATOM   1399 C  CG2   . VAL B 1 38  ? -11.786 70.790 40.691 1.00 21.38 ? 38  VAL B CG2   1 
ATOM   1400 N  N     . LEU B 1 39  ? -13.286 67.101 42.966 1.00 17.81 ? 39  LEU B N     1 
ATOM   1401 C  CA    . LEU B 1 39  ? -14.259 66.190 43.534 1.00 17.42 ? 39  LEU B CA    1 
ATOM   1402 C  C     . LEU B 1 39  ? -15.642 66.848 43.471 1.00 16.62 ? 39  LEU B C     1 
ATOM   1403 O  O     . LEU B 1 39  ? -15.867 67.858 44.124 1.00 18.18 ? 39  LEU B O     1 
ATOM   1404 C  CB    . LEU B 1 39  ? -13.888 65.946 44.992 1.00 19.33 ? 39  LEU B CB    1 
ATOM   1405 C  CG    . LEU B 1 39  ? -14.558 64.814 45.728 1.00 18.55 ? 39  LEU B CG    1 
ATOM   1406 C  CD1   . LEU B 1 39  ? -14.319 63.500 44.975 1.00 16.49 ? 39  LEU B CD1   1 
ATOM   1407 C  CD2   . LEU B 1 39  ? -13.943 64.764 47.146 1.00 19.06 ? 39  LEU B CD2   1 
ATOM   1408 N  N     . VAL B 1 40  ? -16.555 66.283 42.690 1.00 16.30 ? 40  VAL B N     1 
ATOM   1409 C  CA    . VAL B 1 40  ? -17.885 66.845 42.600 1.00 17.47 ? 40  VAL B CA    1 
ATOM   1410 C  C     . VAL B 1 40  ? -18.932 65.931 43.243 1.00 17.56 ? 40  VAL B C     1 
ATOM   1411 O  O     . VAL B 1 40  ? -20.099 66.294 43.371 1.00 17.68 ? 40  VAL B O     1 
ATOM   1412 C  CB    . VAL B 1 40  ? -18.253 67.186 41.140 1.00 16.71 ? 40  VAL B CB    1 
ATOM   1413 C  CG1   . VAL B 1 40  ? -17.319 68.316 40.640 1.00 16.25 ? 40  VAL B CG1   1 
ATOM   1414 C  CG2   . VAL B 1 40  ? -18.132 65.954 40.226 1.00 16.23 ? 40  VAL B CG2   1 
ATOM   1415 N  N     . GLY B 1 41  ? -18.489 64.757 43.683 1.00 17.90 ? 41  GLY B N     1 
ATOM   1416 C  CA    . GLY B 1 41  ? -19.377 63.814 44.325 1.00 15.86 ? 41  GLY B CA    1 
ATOM   1417 C  C     . GLY B 1 41  ? -18.564 62.827 45.141 1.00 16.77 ? 41  GLY B C     1 
ATOM   1418 O  O     . GLY B 1 41  ? -17.502 62.373 44.698 1.00 16.04 ? 41  GLY B O     1 
ATOM   1419 N  N     . LEU B 1 42  ? -19.044 62.499 46.336 1.00 17.56 ? 42  LEU B N     1 
ATOM   1420 C  CA    . LEU B 1 42  ? -18.324 61.551 47.179 1.00 16.14 ? 42  LEU B CA    1 
ATOM   1421 C  C     . LEU B 1 42  ? -19.198 60.909 48.257 1.00 17.27 ? 42  LEU B C     1 
ATOM   1422 O  O     . LEU B 1 42  ? -19.989 61.573 48.925 1.00 16.15 ? 42  LEU B O     1 
ATOM   1423 C  CB    . LEU B 1 42  ? -17.135 62.255 47.839 1.00 16.29 ? 42  LEU B CB    1 
ATOM   1424 C  CG    . LEU B 1 42  ? -16.263 61.407 48.768 1.00 15.50 ? 42  LEU B CG    1 
ATOM   1425 C  CD1   . LEU B 1 42  ? -15.397 60.503 47.932 1.00 16.07 ? 42  LEU B CD1   1 
ATOM   1426 C  CD2   . LEU B 1 42  ? -15.409 62.302 49.631 1.00 17.63 ? 42  LEU B CD2   1 
ATOM   1427 N  N     . LYS B 1 43  ? -19.070 59.599 48.407 1.00 16.48 ? 43  LYS B N     1 
ATOM   1428 C  CA    . LYS B 1 43  ? -19.822 58.938 49.448 1.00 17.67 ? 43  LYS B CA    1 
ATOM   1429 C  C     . LYS B 1 43  ? -19.378 57.511 49.639 1.00 17.85 ? 43  LYS B C     1 
ATOM   1430 O  O     . LYS B 1 43  ? -18.848 56.882 48.725 1.00 18.32 ? 43  LYS B O     1 
ATOM   1431 C  CB    . LYS B 1 43  ? -21.306 58.962 49.139 1.00 20.58 ? 43  LYS B CB    1 
ATOM   1432 C  CG    . LYS B 1 43  ? -21.749 58.112 47.967 1.00 20.76 ? 43  LYS B CG    1 
ATOM   1433 C  CD    . LYS B 1 43  ? -23.251 58.301 47.841 1.00 25.77 ? 43  LYS B CD    1 
ATOM   1434 C  CE    . LYS B 1 43  ? -23.821 57.670 46.607 1.00 25.24 ? 43  LYS B CE    1 
ATOM   1435 N  NZ    . LYS B 1 43  ? -25.237 58.154 46.411 1.00 27.52 ? 43  LYS B NZ    1 
ATOM   1436 N  N     . GLN B 1 44  ? -19.564 56.995 50.841 1.00 19.19 ? 44  GLN B N     1 
ATOM   1437 C  CA    . GLN B 1 44  ? -19.230 55.597 51.058 1.00 18.77 ? 44  GLN B CA    1 
ATOM   1438 C  C     . GLN B 1 44  ? -20.564 54.877 51.206 1.00 18.89 ? 44  GLN B C     1 
ATOM   1439 O  O     . GLN B 1 44  ? -21.479 55.391 51.829 1.00 20.69 ? 44  GLN B O     1 
ATOM   1440 C  CB    . GLN B 1 44  ? -18.396 55.398 52.318 1.00 17.26 ? 44  GLN B CB    1 
ATOM   1441 C  CG    . GLN B 1 44  ? -18.133 53.933 52.616 1.00 17.52 ? 44  GLN B CG    1 
ATOM   1442 C  CD    . GLN B 1 44  ? -17.214 53.725 53.796 1.00 18.09 ? 44  GLN B CD    1 
ATOM   1443 O  OE1   . GLN B 1 44  ? -16.053 53.337 53.625 1.00 19.37 ? 44  GLN B OE1   1 
ATOM   1444 N  NE2   . GLN B 1 44  ? -17.717 53.980 54.999 1.00 19.01 ? 44  GLN B NE2   1 
ATOM   1445 N  N     . LEU B 1 45  ? -20.684 53.703 50.601 1.00 19.08 ? 45  LEU B N     1 
ATOM   1446 C  CA    . LEU B 1 45  ? -21.921 52.935 50.719 1.00 20.38 ? 45  LEU B CA    1 
ATOM   1447 C  C     . LEU B 1 45  ? -21.590 51.469 50.500 1.00 20.12 ? 45  LEU B C     1 
ATOM   1448 O  O     . LEU B 1 45  ? -20.472 51.121 50.086 1.00 21.41 ? 45  LEU B O     1 
ATOM   1449 C  CB    . LEU B 1 45  ? -22.926 53.393 49.663 1.00 21.87 ? 45  LEU B CB    1 
ATOM   1450 C  CG    . LEU B 1 45  ? -22.565 52.965 48.232 1.00 22.68 ? 45  LEU B CG    1 
ATOM   1451 C  CD1   . LEU B 1 45  ? -23.836 52.905 47.393 1.00 25.63 ? 45  LEU B CD1   1 
ATOM   1452 C  CD2   . LEU B 1 45  ? -21.512 53.909 47.627 1.00 24.32 ? 45  LEU B CD2   1 
ATOM   1453 N  N     . VAL B 1 46  ? -22.526 50.594 50.826 1.00 19.97 ? 46  VAL B N     1 
ATOM   1454 C  CA    . VAL B 1 46  ? -22.305 49.184 50.549 1.00 20.13 ? 46  VAL B CA    1 
ATOM   1455 C  C     . VAL B 1 46  ? -23.231 48.975 49.354 1.00 21.42 ? 46  VAL B C     1 
ATOM   1456 O  O     . VAL B 1 46  ? -24.432 49.081 49.497 1.00 21.90 ? 46  VAL B O     1 
ATOM   1457 C  CB    . VAL B 1 46  ? -22.715 48.307 51.744 1.00 20.59 ? 46  VAL B CB    1 
ATOM   1458 C  CG1   . VAL B 1 46  ? -22.623 46.828 51.338 1.00 18.05 ? 46  VAL B CG1   1 
ATOM   1459 C  CG2   . VAL B 1 46  ? -21.788 48.639 52.955 1.00 20.15 ? 46  VAL B CG2   1 
ATOM   1460 N  N     . PRO B 1 47  ? -22.675 48.711 48.156 1.00 22.87 ? 47  PRO B N     1 
ATOM   1461 C  CA    . PRO B 1 47  ? -23.500 48.515 46.953 1.00 23.94 ? 47  PRO B CA    1 
ATOM   1462 C  C     . PRO B 1 47  ? -24.524 47.394 47.036 1.00 25.27 ? 47  PRO B C     1 
ATOM   1463 O  O     . PRO B 1 47  ? -24.243 46.342 47.585 1.00 25.89 ? 47  PRO B O     1 
ATOM   1464 C  CB    . PRO B 1 47  ? -22.472 48.235 45.867 1.00 23.57 ? 47  PRO B CB    1 
ATOM   1465 C  CG    . PRO B 1 47  ? -21.243 48.946 46.361 1.00 22.75 ? 47  PRO B CG    1 
ATOM   1466 C  CD    . PRO B 1 47  ? -21.244 48.603 47.819 1.00 21.96 ? 47  PRO B CD    1 
ATOM   1467 N  N     . THR B 1 48  ? -25.707 47.630 46.474 1.00 27.30 ? 48  THR B N     1 
ATOM   1468 C  CA    . THR B 1 48  ? -26.743 46.602 46.445 1.00 28.11 ? 48  THR B CA    1 
ATOM   1469 C  C     . THR B 1 48  ? -26.424 45.744 45.241 1.00 28.31 ? 48  THR B C     1 
ATOM   1470 O  O     . THR B 1 48  ? -25.613 46.125 44.389 1.00 28.07 ? 48  THR B O     1 
ATOM   1471 C  CB    . THR B 1 48  ? -28.151 47.171 46.212 1.00 29.22 ? 48  THR B CB    1 
ATOM   1472 O  OG1   . THR B 1 48  ? -28.175 47.850 44.950 1.00 30.28 ? 48  THR B OG1   1 
ATOM   1473 C  CG2   . THR B 1 48  ? -28.558 48.128 47.341 1.00 29.65 ? 48  THR B CG2   1 
ATOM   1474 N  N     . LYS B 1 49  ? -27.074 44.592 45.161 1.00 27.57 ? 49  LYS B N     1 
ATOM   1475 C  CA    . LYS B 1 49  ? -26.862 43.683 44.053 1.00 27.81 ? 49  LYS B CA    1 
ATOM   1476 C  C     . LYS B 1 49  ? -27.285 44.333 42.737 1.00 26.99 ? 49  LYS B C     1 
ATOM   1477 O  O     . LYS B 1 49  ? -26.617 44.167 41.710 1.00 25.70 ? 49  LYS B O     1 
ATOM   1478 C  CB    . LYS B 1 49  ? -27.652 42.398 44.277 1.00 29.19 ? 49  LYS B CB    1 
ATOM   1479 C  CG    . LYS B 1 49  ? -27.367 41.319 43.261 1.00 33.69 ? 49  LYS B CG    1 
ATOM   1480 C  CD    . LYS B 1 49  ? -27.772 39.954 43.809 1.00 35.65 ? 49  LYS B CD    1 
ATOM   1481 C  CE    . LYS B 1 49  ? -27.164 38.845 42.972 1.00 37.68 ? 49  LYS B CE    1 
ATOM   1482 N  NZ    . LYS B 1 49  ? -27.650 38.917 41.568 1.00 40.08 ? 49  LYS B NZ    1 
ATOM   1483 N  N     . ASP B 1 50  ? -28.389 45.075 42.777 1.00 27.97 ? 50  ASP B N     1 
ATOM   1484 C  CA    . ASP B 1 50  ? -28.910 45.757 41.594 1.00 29.35 ? 50  ASP B CA    1 
ATOM   1485 C  C     . ASP B 1 50  ? -27.991 46.831 41.065 1.00 28.62 ? 50  ASP B C     1 
ATOM   1486 O  O     . ASP B 1 50  ? -27.863 47.008 39.857 1.00 29.50 ? 50  ASP B O     1 
ATOM   1487 C  CB    . ASP B 1 50  ? -30.259 46.400 41.896 1.00 30.60 ? 50  ASP B CB    1 
ATOM   1488 C  CG    . ASP B 1 50  ? -31.362 45.390 41.992 1.00 34.03 ? 50  ASP B CG    1 
ATOM   1489 O  OD1   . ASP B 1 50  ? -31.193 44.294 41.396 1.00 34.87 ? 50  ASP B OD1   1 
ATOM   1490 O  OD2   . ASP B 1 50  ? -32.387 45.699 42.650 1.00 33.34 ? 50  ASP B OD2   1 
ATOM   1491 N  N     . LEU B 1 51  ? -27.377 47.567 41.987 1.00 28.73 ? 51  LEU B N     1 
ATOM   1492 C  CA    . LEU B 1 51  ? -26.463 48.635 41.624 1.00 25.71 ? 51  LEU B CA    1 
ATOM   1493 C  C     . LEU B 1 51  ? -25.257 48.023 40.959 1.00 24.16 ? 51  LEU B C     1 
ATOM   1494 O  O     . LEU B 1 51  ? -24.863 48.418 39.863 1.00 24.63 ? 51  LEU B O     1 
ATOM   1495 C  CB    . LEU B 1 51  ? -26.014 49.403 42.874 1.00 24.87 ? 51  LEU B CB    1 
ATOM   1496 C  CG    . LEU B 1 51  ? -25.007 50.531 42.596 1.00 24.53 ? 51  LEU B CG    1 
ATOM   1497 C  CD1   . LEU B 1 51  ? -25.577 51.500 41.586 1.00 25.93 ? 51  LEU B CD1   1 
ATOM   1498 C  CD2   . LEU B 1 51  ? -24.644 51.229 43.893 1.00 24.58 ? 51  LEU B CD2   1 
ATOM   1499 N  N     . ALA B 1 52  ? -24.667 47.047 41.635 1.00 24.82 ? 52  ALA B N     1 
ATOM   1500 C  CA    . ALA B 1 52  ? -23.497 46.390 41.107 1.00 24.96 ? 52  ALA B CA    1 
ATOM   1501 C  C     . ALA B 1 52  ? -23.805 45.867 39.720 1.00 24.53 ? 52  ALA B C     1 
ATOM   1502 O  O     . ALA B 1 52  ? -23.034 46.060 38.790 1.00 24.63 ? 52  ALA B O     1 
ATOM   1503 C  CB    . ALA B 1 52  ? -23.070 45.241 42.021 1.00 25.58 ? 52  ALA B CB    1 
ATOM   1504 N  N     . GLU B 1 53  ? -24.947 45.212 39.582 1.00 25.31 ? 53  GLU B N     1 
ATOM   1505 C  CA    . GLU B 1 53  ? -25.328 44.643 38.303 1.00 24.93 ? 53  GLU B CA    1 
ATOM   1506 C  C     . GLU B 1 53  ? -25.581 45.646 37.199 1.00 26.22 ? 53  GLU B C     1 
ATOM   1507 O  O     . GLU B 1 53  ? -25.258 45.361 36.038 1.00 25.63 ? 53  GLU B O     1 
ATOM   1508 C  CB    . GLU B 1 53  ? -26.525 43.717 38.481 1.00 28.06 ? 53  GLU B CB    1 
ATOM   1509 C  CG    . GLU B 1 53  ? -26.114 42.303 38.866 1.00 29.55 ? 53  GLU B CG    1 
ATOM   1510 C  CD    . GLU B 1 53  ? -27.289 41.409 39.183 1.00 33.95 ? 53  GLU B CD    1 
ATOM   1511 O  OE1   . GLU B 1 53  ? -28.427 41.724 38.749 1.00 35.93 ? 53  GLU B OE1   1 
ATOM   1512 O  OE2   . GLU B 1 53  ? -27.070 40.385 39.861 1.00 33.14 ? 53  GLU B OE2   1 
ATOM   1513 N  N     . SER B 1 54  ? -26.158 46.804 37.516 1.00 25.96 ? 54  SER B N     1 
ATOM   1514 C  CA    . SER B 1 54  ? -26.348 47.791 36.454 1.00 26.79 ? 54  SER B CA    1 
ATOM   1515 C  C     . SER B 1 54  ? -24.982 48.432 36.145 1.00 26.17 ? 54  SER B C     1 
ATOM   1516 O  O     . SER B 1 54  ? -24.668 48.720 35.000 1.00 25.92 ? 54  SER B O     1 
ATOM   1517 C  CB    . SER B 1 54  ? -27.387 48.855 36.825 1.00 28.11 ? 54  SER B CB    1 
ATOM   1518 O  OG    . SER B 1 54  ? -27.189 49.359 38.130 1.00 34.77 ? 54  SER B OG    1 
ATOM   1519 N  N     . HIS B 1 55  ? -24.151 48.614 37.162 1.00 25.07 ? 55  HIS B N     1 
ATOM   1520 C  CA    . HIS B 1 55  ? -22.835 49.210 36.958 1.00 24.45 ? 55  HIS B CA    1 
ATOM   1521 C  C     . HIS B 1 55  ? -22.001 48.356 35.994 1.00 25.21 ? 55  HIS B C     1 
ATOM   1522 O  O     . HIS B 1 55  ? -21.323 48.874 35.082 1.00 25.10 ? 55  HIS B O     1 
ATOM   1523 C  CB    . HIS B 1 55  ? -22.102 49.320 38.305 1.00 24.02 ? 55  HIS B CB    1 
ATOM   1524 C  CG    . HIS B 1 55  ? -20.720 49.885 38.194 1.00 24.20 ? 55  HIS B CG    1 
ATOM   1525 N  ND1   . HIS B 1 55  ? -20.482 51.224 37.992 1.00 24.17 ? 55  HIS B ND1   1 
ATOM   1526 C  CD2   . HIS B 1 55  ? -19.509 49.282 38.197 1.00 23.51 ? 55  HIS B CD2   1 
ATOM   1527 C  CE1   . HIS B 1 55  ? -19.181 51.425 37.870 1.00 24.32 ? 55  HIS B CE1   1 
ATOM   1528 N  NE2   . HIS B 1 55  ? -18.568 50.262 37.988 1.00 25.56 ? 55  HIS B NE2   1 
ATOM   1529 N  N     . TYR B 1 56  ? -22.053 47.043 36.190 1.00 23.71 ? 56  TYR B N     1 
ATOM   1530 C  CA    . TYR B 1 56  ? -21.265 46.142 35.371 1.00 25.88 ? 56  TYR B CA    1 
ATOM   1531 C  C     . TYR B 1 56  ? -22.110 45.426 34.346 1.00 26.88 ? 56  TYR B C     1 
ATOM   1532 O  O     . TYR B 1 56  ? -21.766 44.327 33.905 1.00 26.16 ? 56  TYR B O     1 
ATOM   1533 C  CB    . TYR B 1 56  ? -20.553 45.127 36.267 1.00 25.24 ? 56  TYR B CB    1 
ATOM   1534 C  CG    . TYR B 1 56  ? -19.390 45.724 37.016 1.00 26.20 ? 56  TYR B CG    1 
ATOM   1535 C  CD1   . TYR B 1 56  ? -18.319 46.283 36.321 1.00 25.39 ? 56  TYR B CD1   1 
ATOM   1536 C  CD2   . TYR B 1 56  ? -19.344 45.733 38.417 1.00 25.80 ? 56  TYR B CD2   1 
ATOM   1537 C  CE1   . TYR B 1 56  ? -17.224 46.832 36.996 1.00 26.52 ? 56  TYR B CE1   1 
ATOM   1538 C  CE2   . TYR B 1 56  ? -18.246 46.286 39.095 1.00 25.93 ? 56  TYR B CE2   1 
ATOM   1539 C  CZ    . TYR B 1 56  ? -17.193 46.827 38.372 1.00 25.94 ? 56  TYR B CZ    1 
ATOM   1540 O  OH    . TYR B 1 56  ? -16.073 47.368 38.996 1.00 27.54 ? 56  TYR B OH    1 
ATOM   1541 N  N     . ALA B 1 57  ? -23.200 46.084 33.967 1.00 28.21 ? 57  ALA B N     1 
ATOM   1542 C  CA    . ALA B 1 57  ? -24.156 45.562 33.005 1.00 29.94 ? 57  ALA B CA    1 
ATOM   1543 C  C     . ALA B 1 57  ? -23.505 45.057 31.727 1.00 32.07 ? 57  ALA B C     1 
ATOM   1544 O  O     . ALA B 1 57  ? -23.947 44.055 31.142 1.00 32.08 ? 57  ALA B O     1 
ATOM   1545 C  CB    . ALA B 1 57  ? -25.179 46.639 32.678 1.00 29.19 ? 57  ALA B CB    1 
ATOM   1546 N  N     . GLU B 1 58  ? -22.453 45.741 31.292 1.00 32.59 ? 58  GLU B N     1 
ATOM   1547 C  CA    . GLU B 1 58  ? -21.777 45.354 30.065 1.00 33.45 ? 58  GLU B CA    1 
ATOM   1548 C  C     . GLU B 1 58  ? -21.129 43.972 30.178 1.00 33.57 ? 58  GLU B C     1 
ATOM   1549 O  O     . GLU B 1 58  ? -20.811 43.334 29.168 1.00 33.62 ? 58  GLU B O     1 
ATOM   1550 C  CB    . GLU B 1 58  ? -20.727 46.403 29.706 1.00 34.68 ? 58  GLU B CB    1 
ATOM   1551 C  CG    . GLU B 1 58  ? -19.423 46.244 30.451 1.00 37.48 ? 58  GLU B CG    1 
ATOM   1552 C  CD    . GLU B 1 58  ? -18.493 47.415 30.247 1.00 39.91 ? 58  GLU B CD    1 
ATOM   1553 O  OE1   . GLU B 1 58  ? -18.492 48.328 31.108 1.00 41.33 ? 58  GLU B OE1   1 
ATOM   1554 O  OE2   . GLU B 1 58  ? -17.776 47.427 29.220 1.00 40.73 ? 58  GLU B OE2   1 
ATOM   1555 N  N     . HIS B 1 59  ? -20.941 43.497 31.402 1.00 31.38 ? 59  HIS B N     1 
ATOM   1556 C  CA    . HIS B 1 59  ? -20.312 42.199 31.596 1.00 31.99 ? 59  HIS B CA    1 
ATOM   1557 C  C     . HIS B 1 59  ? -21.301 41.123 32.069 1.00 32.52 ? 59  HIS B C     1 
ATOM   1558 O  O     . HIS B 1 59  ? -20.895 40.010 32.398 1.00 30.52 ? 59  HIS B O     1 
ATOM   1559 C  CB    . HIS B 1 59  ? -19.194 42.320 32.645 1.00 31.77 ? 59  HIS B CB    1 
ATOM   1560 C  CG    . HIS B 1 59  ? -18.176 43.376 32.339 1.00 32.77 ? 59  HIS B CG    1 
ATOM   1561 N  ND1   . HIS B 1 59  ? -17.441 43.386 31.174 1.00 32.37 ? 59  HIS B ND1   1 
ATOM   1562 C  CD2   . HIS B 1 59  ? -17.732 44.430 33.071 1.00 33.06 ? 59  HIS B CD2   1 
ATOM   1563 C  CE1   . HIS B 1 59  ? -16.585 44.394 31.199 1.00 33.63 ? 59  HIS B CE1   1 
ATOM   1564 N  NE2   . HIS B 1 59  ? -16.741 45.043 32.339 1.00 31.30 ? 59  HIS B NE2   1 
ATOM   1565 N  N     . LYS B 1 60  ? -22.592 41.439 32.102 1.00 34.49 ? 60  LYS B N     1 
ATOM   1566 C  CA    . LYS B 1 60  ? -23.546 40.478 32.634 1.00 37.34 ? 60  LYS B CA    1 
ATOM   1567 C  C     . LYS B 1 60  ? -23.519 39.079 32.023 1.00 38.19 ? 60  LYS B C     1 
ATOM   1568 O  O     . LYS B 1 60  ? -23.916 38.108 32.669 1.00 38.58 ? 60  LYS B O     1 
ATOM   1569 C  CB    . LYS B 1 60  ? -24.966 41.052 32.609 1.00 38.14 ? 60  LYS B CB    1 
ATOM   1570 C  CG    . LYS B 1 60  ? -25.526 41.383 31.253 1.00 41.57 ? 60  LYS B CG    1 
ATOM   1571 C  CD    . LYS B 1 60  ? -27.031 41.615 31.377 1.00 43.94 ? 60  LYS B CD    1 
ATOM   1572 C  CE    . LYS B 1 60  ? -27.711 40.400 32.024 1.00 45.42 ? 60  LYS B CE    1 
ATOM   1573 N  NZ    . LYS B 1 60  ? -29.201 40.512 32.092 1.00 47.51 ? 60  LYS B NZ    1 
ATOM   1574 N  N     . GLU B 1 61  ? -23.007 38.966 30.805 1.00 39.73 ? 61  GLU B N     1 
ATOM   1575 C  CA    . GLU B 1 61  ? -22.936 37.678 30.113 1.00 41.47 ? 61  GLU B CA    1 
ATOM   1576 C  C     . GLU B 1 61  ? -21.577 36.990 30.314 1.00 41.48 ? 61  GLU B C     1 
ATOM   1577 O  O     . GLU B 1 61  ? -21.420 35.803 30.024 1.00 40.92 ? 61  GLU B O     1 
ATOM   1578 C  CB    . GLU B 1 61  ? -23.185 37.894 28.613 1.00 43.34 ? 61  GLU B CB    1 
ATOM   1579 C  CG    . GLU B 1 61  ? -22.001 38.553 27.893 1.00 46.85 ? 61  GLU B CG    1 
ATOM   1580 C  CD    . GLU B 1 61  ? -21.566 39.897 28.506 1.00 48.31 ? 61  GLU B CD    1 
ATOM   1581 O  OE1   . GLU B 1 61  ? -20.394 40.292 28.312 1.00 50.54 ? 61  GLU B OE1   1 
ATOM   1582 O  OE2   . GLU B 1 61  ? -22.387 40.567 29.166 1.00 49.46 ? 61  GLU B OE2   1 
ATOM   1583 N  N     . ARG B 1 62  ? -20.596 37.735 30.816 1.00 40.93 ? 62  ARG B N     1 
ATOM   1584 C  CA    . ARG B 1 62  ? -19.257 37.199 31.037 1.00 40.26 ? 62  ARG B CA    1 
ATOM   1585 C  C     . ARG B 1 62  ? -19.172 36.282 32.273 1.00 40.19 ? 62  ARG B C     1 
ATOM   1586 O  O     . ARG B 1 62  ? -19.882 36.472 33.262 1.00 39.68 ? 62  ARG B O     1 
ATOM   1587 C  CB    . ARG B 1 62  ? -18.278 38.364 31.166 1.00 41.93 ? 62  ARG B CB    1 
ATOM   1588 C  CG    . ARG B 1 62  ? -18.190 39.227 29.910 1.00 43.90 ? 62  ARG B CG    1 
ATOM   1589 C  CD    . ARG B 1 62  ? -17.474 38.472 28.812 1.00 47.01 ? 62  ARG B CD    1 
ATOM   1590 N  NE    . ARG B 1 62  ? -16.150 38.082 29.293 1.00 50.97 ? 62  ARG B NE    1 
ATOM   1591 C  CZ    . ARG B 1 62  ? -15.475 37.012 28.881 1.00 51.66 ? 62  ARG B CZ    1 
ATOM   1592 N  NH1   . ARG B 1 62  ? -15.991 36.203 27.959 1.00 52.20 ? 62  ARG B NH1   1 
ATOM   1593 N  NH2   . ARG B 1 62  ? -14.290 36.739 29.423 1.00 52.07 ? 62  ARG B NH2   1 
ATOM   1594 N  N     . PRO B 1 63  ? -18.289 35.273 32.230 1.00 39.40 ? 63  PRO B N     1 
ATOM   1595 C  CA    . PRO B 1 63  ? -18.116 34.325 33.336 1.00 39.03 ? 63  PRO B CA    1 
ATOM   1596 C  C     . PRO B 1 63  ? -17.768 34.901 34.717 1.00 38.46 ? 63  PRO B C     1 
ATOM   1597 O  O     . PRO B 1 63  ? -18.288 34.443 35.727 1.00 39.21 ? 63  PRO B O     1 
ATOM   1598 C  CB    . PRO B 1 63  ? -17.044 33.363 32.802 1.00 38.29 ? 63  PRO B CB    1 
ATOM   1599 C  CG    . PRO B 1 63  ? -16.313 34.174 31.789 1.00 40.11 ? 63  PRO B CG    1 
ATOM   1600 C  CD    . PRO B 1 63  ? -17.413 34.925 31.103 1.00 38.90 ? 63  PRO B CD    1 
ATOM   1601 N  N     . PHE B 1 64  ? -16.904 35.909 34.761 1.00 37.53 ? 64  PHE B N     1 
ATOM   1602 C  CA    . PHE B 1 64  ? -16.494 36.511 36.035 1.00 35.20 ? 64  PHE B CA    1 
ATOM   1603 C  C     . PHE B 1 64  ? -17.559 37.454 36.608 1.00 34.40 ? 64  PHE B C     1 
ATOM   1604 O  O     . PHE B 1 64  ? -17.445 37.898 37.750 1.00 34.89 ? 64  PHE B O     1 
ATOM   1605 C  CB    . PHE B 1 64  ? -15.188 37.283 35.828 1.00 33.58 ? 64  PHE B CB    1 
ATOM   1606 C  CG    . PHE B 1 64  ? -15.345 38.490 34.947 1.00 31.95 ? 64  PHE B CG    1 
ATOM   1607 C  CD1   . PHE B 1 64  ? -15.792 39.697 35.475 1.00 31.48 ? 64  PHE B CD1   1 
ATOM   1608 C  CD2   . PHE B 1 64  ? -15.105 38.405 33.579 1.00 31.05 ? 64  PHE B CD2   1 
ATOM   1609 C  CE1   . PHE B 1 64  ? -16.000 40.805 34.653 1.00 31.69 ? 64  PHE B CE1   1 
ATOM   1610 C  CE2   . PHE B 1 64  ? -15.311 39.510 32.751 1.00 31.99 ? 64  PHE B CE2   1 
ATOM   1611 C  CZ    . PHE B 1 64  ? -15.759 40.709 33.290 1.00 31.16 ? 64  PHE B CZ    1 
ATOM   1612 N  N     . PHE B 1 65  ? -18.590 37.760 35.825 1.00 33.00 ? 65  PHE B N     1 
ATOM   1613 C  CA    . PHE B 1 65  ? -19.646 38.679 36.270 1.00 32.17 ? 65  PHE B CA    1 
ATOM   1614 C  C     . PHE B 1 65  ? -20.199 38.368 37.661 1.00 32.22 ? 65  PHE B C     1 
ATOM   1615 O  O     . PHE B 1 65  ? -20.322 39.257 38.511 1.00 31.79 ? 65  PHE B O     1 
ATOM   1616 C  CB    . PHE B 1 65  ? -20.800 38.680 35.265 1.00 32.45 ? 65  PHE B CB    1 
ATOM   1617 C  CG    . PHE B 1 65  ? -21.936 39.602 35.631 1.00 32.34 ? 65  PHE B CG    1 
ATOM   1618 C  CD1   . PHE B 1 65  ? -21.815 40.983 35.485 1.00 32.62 ? 65  PHE B CD1   1 
ATOM   1619 C  CD2   . PHE B 1 65  ? -23.140 39.087 36.096 1.00 32.96 ? 65  PHE B CD2   1 
ATOM   1620 C  CE1   . PHE B 1 65  ? -22.874 41.837 35.788 1.00 31.02 ? 65  PHE B CE1   1 
ATOM   1621 C  CE2   . PHE B 1 65  ? -24.215 39.937 36.406 1.00 33.67 ? 65  PHE B CE2   1 
ATOM   1622 C  CZ    . PHE B 1 65  ? -24.077 41.316 36.247 1.00 33.12 ? 65  PHE B CZ    1 
ATOM   1623 N  N     . GLY B 1 66  ? -20.536 37.104 37.891 1.00 30.78 ? 66  GLY B N     1 
ATOM   1624 C  CA    . GLY B 1 66  ? -21.098 36.724 39.171 1.00 30.07 ? 66  GLY B CA    1 
ATOM   1625 C  C     . GLY B 1 66  ? -20.172 37.012 40.336 1.00 29.89 ? 66  GLY B C     1 
ATOM   1626 O  O     . GLY B 1 66  ? -20.602 37.551 41.348 1.00 29.32 ? 66  GLY B O     1 
ATOM   1627 N  N     . GLY B 1 67  ? -18.905 36.640 40.188 1.00 29.71 ? 67  GLY B N     1 
ATOM   1628 C  CA    . GLY B 1 67  ? -17.939 36.842 41.249 1.00 30.74 ? 67  GLY B CA    1 
ATOM   1629 C  C     . GLY B 1 67  ? -17.636 38.311 41.474 1.00 30.19 ? 67  GLY B C     1 
ATOM   1630 O  O     . GLY B 1 67  ? -17.287 38.742 42.589 1.00 29.10 ? 67  GLY B O     1 
ATOM   1631 N  N     . LEU B 1 68  ? -17.775 39.074 40.399 1.00 29.22 ? 68  LEU B N     1 
ATOM   1632 C  CA    . LEU B 1 68  ? -17.528 40.504 40.424 1.00 28.13 ? 68  LEU B CA    1 
ATOM   1633 C  C     . LEU B 1 68  ? -18.613 41.206 41.208 1.00 27.93 ? 68  LEU B C     1 
ATOM   1634 O  O     . LEU B 1 68  ? -18.322 42.011 42.100 1.00 26.86 ? 68  LEU B O     1 
ATOM   1635 C  CB    . LEU B 1 68  ? -17.473 41.039 38.997 1.00 26.44 ? 68  LEU B CB    1 
ATOM   1636 C  CG    . LEU B 1 68  ? -17.448 42.557 38.816 1.00 24.67 ? 68  LEU B CG    1 
ATOM   1637 C  CD1   . LEU B 1 68  ? -16.171 43.146 39.437 1.00 24.86 ? 68  LEU B CD1   1 
ATOM   1638 C  CD2   . LEU B 1 68  ? -17.514 42.854 37.332 1.00 23.66 ? 68  LEU B CD2   1 
ATOM   1639 N  N     . VAL B 1 69  ? -19.868 40.901 40.880 1.00 26.92 ? 69  VAL B N     1 
ATOM   1640 C  CA    . VAL B 1 69  ? -20.992 41.499 41.557 1.00 26.69 ? 69  VAL B CA    1 
ATOM   1641 C  C     . VAL B 1 69  ? -21.028 41.152 43.039 1.00 28.22 ? 69  VAL B C     1 
ATOM   1642 O  O     . VAL B 1 69  ? -21.332 41.998 43.874 1.00 27.74 ? 69  VAL B O     1 
ATOM   1643 C  CB    . VAL B 1 69  ? -22.319 41.064 40.892 1.00 26.71 ? 69  VAL B CB    1 
ATOM   1644 C  CG1   . VAL B 1 69  ? -23.479 41.469 41.736 1.00 26.47 ? 69  VAL B CG1   1 
ATOM   1645 C  CG2   . VAL B 1 69  ? -22.429 41.714 39.517 1.00 25.92 ? 69  VAL B CG2   1 
ATOM   1646 N  N     . SER B 1 70  ? -20.733 39.901 43.376 1.00 28.81 ? 70  SER B N     1 
ATOM   1647 C  CA    . SER B 1 70  ? -20.744 39.525 44.784 1.00 28.70 ? 70  SER B CA    1 
ATOM   1648 C  C     . SER B 1 70  ? -19.607 40.262 45.497 1.00 28.33 ? 70  SER B C     1 
ATOM   1649 O  O     . SER B 1 70  ? -19.761 40.705 46.631 1.00 28.44 ? 70  SER B O     1 
ATOM   1650 C  CB    . SER B 1 70  ? -20.599 38.008 44.946 1.00 31.05 ? 70  SER B CB    1 
ATOM   1651 O  OG    . SER B 1 70  ? -19.468 37.531 44.246 1.00 35.82 ? 70  SER B OG    1 
ATOM   1652 N  N     . PHE B 1 71  ? -18.474 40.426 44.829 1.00 27.10 ? 71  PHE B N     1 
ATOM   1653 C  CA    . PHE B 1 71  ? -17.365 41.122 45.474 1.00 26.11 ? 71  PHE B CA    1 
ATOM   1654 C  C     . PHE B 1 71  ? -17.673 42.596 45.731 1.00 26.06 ? 71  PHE B C     1 
ATOM   1655 O  O     . PHE B 1 71  ? -17.470 43.081 46.842 1.00 25.21 ? 71  PHE B O     1 
ATOM   1656 C  CB    . PHE B 1 71  ? -16.074 41.026 44.663 1.00 25.53 ? 71  PHE B CB    1 
ATOM   1657 C  CG    . PHE B 1 71  ? -14.914 41.648 45.365 1.00 26.05 ? 71  PHE B CG    1 
ATOM   1658 C  CD1   . PHE B 1 71  ? -14.475 41.126 46.588 1.00 27.29 ? 71  PHE B CD1   1 
ATOM   1659 C  CD2   . PHE B 1 71  ? -14.358 42.822 44.899 1.00 24.97 ? 71  PHE B CD2   1 
ATOM   1660 C  CE1   . PHE B 1 71  ? -13.491 41.793 47.343 1.00 27.84 ? 71  PHE B CE1   1 
ATOM   1661 C  CE2   . PHE B 1 71  ? -13.378 43.490 45.643 1.00 24.97 ? 71  PHE B CE2   1 
ATOM   1662 C  CZ    . PHE B 1 71  ? -12.952 42.982 46.852 1.00 24.19 ? 71  PHE B CZ    1 
ATOM   1663 N  N     . ILE B 1 72  ? -18.147 43.302 44.705 1.00 27.22 ? 72  ILE B N     1 
ATOM   1664 C  CA    . ILE B 1 72  ? -18.500 44.713 44.830 1.00 26.13 ? 72  ILE B CA    1 
ATOM   1665 C  C     . ILE B 1 72  ? -19.502 44.931 45.944 1.00 25.86 ? 72  ILE B C     1 
ATOM   1666 O  O     . ILE B 1 72  ? -19.528 45.982 46.597 1.00 23.96 ? 72  ILE B O     1 
ATOM   1667 C  CB    . ILE B 1 72  ? -19.109 45.249 43.517 1.00 27.05 ? 72  ILE B CB    1 
ATOM   1668 C  CG1   . ILE B 1 72  ? -18.004 45.653 42.561 1.00 29.36 ? 72  ILE B CG1   1 
ATOM   1669 C  CG2   . ILE B 1 72  ? -19.985 46.446 43.788 1.00 28.88 ? 72  ILE B CG2   1 
ATOM   1670 C  CD1   . ILE B 1 72  ? -17.018 44.587 42.283 1.00 30.01 ? 72  ILE B CD1   1 
ATOM   1671 N  N     . THR B 1 73  ? -20.350 43.935 46.172 1.00 26.62 ? 73  THR B N     1 
ATOM   1672 C  CA    . THR B 1 73  ? -21.336 44.076 47.222 1.00 24.12 ? 73  THR B CA    1 
ATOM   1673 C  C     . THR B 1 73  ? -20.860 43.493 48.547 1.00 25.33 ? 73  THR B C     1 
ATOM   1674 O  O     . THR B 1 73  ? -21.587 43.547 49.535 1.00 25.88 ? 73  THR B O     1 
ATOM   1675 C  CB    . THR B 1 73  ? -22.673 43.393 46.819 1.00 26.17 ? 73  THR B CB    1 
ATOM   1676 O  OG1   . THR B 1 73  ? -22.419 42.040 46.443 1.00 26.96 ? 73  THR B OG1   1 
ATOM   1677 C  CG2   . THR B 1 73  ? -23.303 44.104 45.651 1.00 24.89 ? 73  THR B CG2   1 
ATOM   1678 N  N     . SER B 1 74  ? -19.633 42.981 48.587 1.00 24.64 ? 74  SER B N     1 
ATOM   1679 C  CA    . SER B 1 74  ? -19.126 42.358 49.816 1.00 25.03 ? 74  SER B CA    1 
ATOM   1680 C  C     . SER B 1 74  ? -18.731 43.286 50.968 1.00 24.82 ? 74  SER B C     1 
ATOM   1681 O  O     . SER B 1 74  ? -18.556 42.815 52.095 1.00 23.23 ? 74  SER B O     1 
ATOM   1682 C  CB    . SER B 1 74  ? -17.950 41.451 49.493 1.00 25.86 ? 74  SER B CB    1 
ATOM   1683 O  OG    . SER B 1 74  ? -16.808 42.195 49.125 1.00 25.23 ? 74  SER B OG    1 
ATOM   1684 N  N     . GLY B 1 75  ? -18.616 44.591 50.704 1.00 21.93 ? 75  GLY B N     1 
ATOM   1685 C  CA    . GLY B 1 75  ? -18.241 45.531 51.760 1.00 20.63 ? 75  GLY B CA    1 
ATOM   1686 C  C     . GLY B 1 75  ? -18.359 46.976 51.285 1.00 20.04 ? 75  GLY B C     1 
ATOM   1687 O  O     . GLY B 1 75  ? -18.812 47.200 50.145 1.00 17.35 ? 75  GLY B O     1 
ATOM   1688 N  N     . PRO B 1 76  ? -17.965 47.973 52.111 1.00 17.86 ? 76  PRO B N     1 
ATOM   1689 C  CA    . PRO B 1 76  ? -18.094 49.348 51.628 1.00 16.89 ? 76  PRO B CA    1 
ATOM   1690 C  C     . PRO B 1 76  ? -17.234 49.678 50.427 1.00 18.02 ? 76  PRO B C     1 
ATOM   1691 O  O     . PRO B 1 76  ? -16.137 49.117 50.232 1.00 15.85 ? 76  PRO B O     1 
ATOM   1692 C  CB    . PRO B 1 76  ? -17.715 50.214 52.843 1.00 19.00 ? 76  PRO B CB    1 
ATOM   1693 C  CG    . PRO B 1 76  ? -16.808 49.308 53.667 1.00 18.42 ? 76  PRO B CG    1 
ATOM   1694 C  CD    . PRO B 1 76  ? -17.519 47.948 53.520 1.00 18.78 ? 76  PRO B CD    1 
ATOM   1695 N  N     . VAL B 1 77  ? -17.759 50.618 49.652 1.00 17.15 ? 77  VAL B N     1 
ATOM   1696 C  CA    . VAL B 1 77  ? -17.119 51.146 48.455 1.00 17.04 ? 77  VAL B CA    1 
ATOM   1697 C  C     . VAL B 1 77  ? -17.157 52.667 48.614 1.00 17.84 ? 77  VAL B C     1 
ATOM   1698 O  O     . VAL B 1 77  ? -18.097 53.212 49.186 1.00 16.89 ? 77  VAL B O     1 
ATOM   1699 C  CB    . VAL B 1 77  ? -17.943 50.743 47.209 1.00 18.68 ? 77  VAL B CB    1 
ATOM   1700 C  CG1   . VAL B 1 77  ? -17.620 51.643 46.008 1.00 18.98 ? 77  VAL B CG1   1 
ATOM   1701 C  CG2   . VAL B 1 77  ? -17.650 49.276 46.858 1.00 17.44 ? 77  VAL B CG2   1 
ATOM   1702 N  N     . VAL B 1 78  ? -16.146 53.369 48.126 1.00 18.42 ? 78  VAL B N     1 
ATOM   1703 C  CA    . VAL B 1 78  ? -16.232 54.817 48.202 1.00 16.92 ? 78  VAL B CA    1 
ATOM   1704 C  C     . VAL B 1 78  ? -16.364 55.230 46.744 1.00 17.04 ? 78  VAL B C     1 
ATOM   1705 O  O     . VAL B 1 78  ? -15.468 55.023 45.923 1.00 15.18 ? 78  VAL B O     1 
ATOM   1706 C  CB    . VAL B 1 78  ? -15.010 55.467 48.890 1.00 20.30 ? 78  VAL B CB    1 
ATOM   1707 C  CG1   . VAL B 1 78  ? -15.006 55.136 50.367 1.00 18.28 ? 78  VAL B CG1   1 
ATOM   1708 C  CG2   . VAL B 1 78  ? -13.784 54.969 48.295 1.00 24.79 ? 78  VAL B CG2   1 
ATOM   1709 N  N     . ALA B 1 79  ? -17.535 55.761 46.439 1.00 16.18 ? 79  ALA B N     1 
ATOM   1710 C  CA    . ALA B 1 79  ? -17.900 56.193 45.107 1.00 16.31 ? 79  ALA B CA    1 
ATOM   1711 C  C     . ALA B 1 79  ? -17.556 57.674 44.988 1.00 16.60 ? 79  ALA B C     1 
ATOM   1712 O  O     . ALA B 1 79  ? -17.807 58.466 45.904 1.00 15.88 ? 79  ALA B O     1 
ATOM   1713 C  CB    . ALA B 1 79  ? -19.423 55.960 44.888 1.00 18.66 ? 79  ALA B CB    1 
ATOM   1714 N  N     . MET B 1 80  ? -16.999 58.040 43.845 1.00 17.08 ? 80  MET B N     1 
ATOM   1715 C  CA    . MET B 1 80  ? -16.602 59.419 43.634 1.00 18.21 ? 80  MET B CA    1 
ATOM   1716 C  C     . MET B 1 80  ? -16.844 59.897 42.204 1.00 17.24 ? 80  MET B C     1 
ATOM   1717 O  O     . MET B 1 80  ? -16.923 59.105 41.268 1.00 18.61 ? 80  MET B O     1 
ATOM   1718 C  CB    . MET B 1 80  ? -15.097 59.564 43.907 1.00 18.67 ? 80  MET B CB    1 
ATOM   1719 C  CG    . MET B 1 80  ? -14.548 58.562 44.889 1.00 23.08 ? 80  MET B CG    1 
ATOM   1720 S  SD    . MET B 1 80  ? -12.762 58.727 44.982 1.00 21.39 ? 80  MET B SD    1 
ATOM   1721 C  CE    . MET B 1 80  ? -12.281 57.637 43.707 1.00 25.38 ? 80  MET B CE    1 
ATOM   1722 N  N     . VAL B 1 81  ? -16.979 61.205 42.047 1.00 15.99 ? 81  VAL B N     1 
ATOM   1723 C  CA    . VAL B 1 81  ? -17.097 61.762 40.706 1.00 15.85 ? 81  VAL B CA    1 
ATOM   1724 C  C     . VAL B 1 81  ? -16.080 62.891 40.667 1.00 13.95 ? 81  VAL B C     1 
ATOM   1725 O  O     . VAL B 1 81  ? -16.038 63.730 41.562 1.00 15.66 ? 81  VAL B O     1 
ATOM   1726 C  CB    . VAL B 1 81  ? -18.498 62.288 40.416 1.00 15.11 ? 81  VAL B CB    1 
ATOM   1727 C  CG1   . VAL B 1 81  ? -18.570 62.767 38.924 1.00 15.69 ? 81  VAL B CG1   1 
ATOM   1728 C  CG2   . VAL B 1 81  ? -19.500 61.159 40.647 1.00 14.61 ? 81  VAL B CG2   1 
ATOM   1729 N  N     . PHE B 1 82  ? -15.214 62.873 39.661 1.00 13.91 ? 82  PHE B N     1 
ATOM   1730 C  CA    . PHE B 1 82  ? -14.192 63.904 39.508 1.00 13.26 ? 82  PHE B CA    1 
ATOM   1731 C  C     . PHE B 1 82  ? -14.430 64.594 38.178 1.00 14.90 ? 82  PHE B C     1 
ATOM   1732 O  O     . PHE B 1 82  ? -14.763 63.936 37.183 1.00 14.55 ? 82  PHE B O     1 
ATOM   1733 C  CB    . PHE B 1 82  ? -12.797 63.303 39.476 1.00 15.73 ? 82  PHE B CB    1 
ATOM   1734 C  CG    . PHE B 1 82  ? -12.184 63.154 40.827 1.00 14.90 ? 82  PHE B CG    1 
ATOM   1735 C  CD1   . PHE B 1 82  ? -11.612 64.248 41.456 1.00 16.04 ? 82  PHE B CD1   1 
ATOM   1736 C  CD2   . PHE B 1 82  ? -12.236 61.927 41.499 1.00 17.08 ? 82  PHE B CD2   1 
ATOM   1737 C  CE1   . PHE B 1 82  ? -11.099 64.125 42.742 1.00 19.07 ? 82  PHE B CE1   1 
ATOM   1738 C  CE2   . PHE B 1 82  ? -11.721 61.804 42.797 1.00 15.49 ? 82  PHE B CE2   1 
ATOM   1739 C  CZ    . PHE B 1 82  ? -11.159 62.893 43.411 1.00 15.19 ? 82  PHE B CZ    1 
ATOM   1740 N  N     . GLU B 1 83  ? -14.218 65.903 38.179 1.00 16.47 ? 83  GLU B N     1 
ATOM   1741 C  CA    . GLU B 1 83  ? -14.440 66.722 37.002 1.00 16.43 ? 83  GLU B CA    1 
ATOM   1742 C  C     . GLU B 1 83  ? -13.159 67.408 36.489 1.00 16.82 ? 83  GLU B C     1 
ATOM   1743 O  O     . GLU B 1 83  ? -12.299 67.855 37.256 1.00 17.48 ? 83  GLU B O     1 
ATOM   1744 C  CB    . GLU B 1 83  ? -15.485 67.771 37.337 1.00 18.25 ? 83  GLU B CB    1 
ATOM   1745 C  CG    . GLU B 1 83  ? -15.742 68.805 36.248 1.00 19.46 ? 83  GLU B CG    1 
ATOM   1746 C  CD    . GLU B 1 83  ? -16.807 69.816 36.660 1.00 20.84 ? 83  GLU B CD    1 
ATOM   1747 O  OE1   . GLU B 1 83  ? -17.891 69.394 37.140 1.00 22.67 ? 83  GLU B OE1   1 
ATOM   1748 O  OE2   . GLU B 1 83  ? -16.563 71.032 36.512 1.00 23.64 ? 83  GLU B OE2   1 
ATOM   1749 N  N     . GLY B 1 84  ? -13.043 67.471 35.178 1.00 16.40 ? 84  GLY B N     1 
ATOM   1750 C  CA    . GLY B 1 84  ? -11.905 68.160 34.608 1.00 17.70 ? 84  GLY B CA    1 
ATOM   1751 C  C     . GLY B 1 84  ? -11.700 67.770 33.167 1.00 16.01 ? 84  GLY B C     1 
ATOM   1752 O  O     . GLY B 1 84  ? -12.290 66.814 32.678 1.00 16.22 ? 84  GLY B O     1 
ATOM   1753 N  N     . LYS B 1 85  ? -10.856 68.532 32.493 1.00 17.10 ? 85  LYS B N     1 
ATOM   1754 C  CA    . LYS B 1 85  ? -10.515 68.264 31.098 1.00 17.80 ? 85  LYS B CA    1 
ATOM   1755 C  C     . LYS B 1 85  ? -9.995  66.841 30.893 1.00 17.76 ? 85  LYS B C     1 
ATOM   1756 O  O     . LYS B 1 85  ? -9.007  66.429 31.512 1.00 17.51 ? 85  LYS B O     1 
ATOM   1757 C  CB    . LYS B 1 85  ? -9.442  69.274 30.636 1.00 17.45 ? 85  LYS B CB    1 
ATOM   1758 C  CG    . LYS B 1 85  ? -9.028  69.153 29.178 1.00 18.99 ? 85  LYS B CG    1 
ATOM   1759 C  CD    . LYS B 1 85  ? -7.894  70.144 28.865 1.00 21.68 ? 85  LYS B CD    1 
ATOM   1760 C  CE    . LYS B 1 85  ? -7.322  69.932 27.466 1.00 25.90 ? 85  LYS B CE    1 
ATOM   1761 N  NZ    . LYS B 1 85  ? -6.011  70.681 27.235 1.00 30.61 ? 85  LYS B NZ    1 
ATOM   1762 N  N     . GLY B 1 86  ? -10.669 66.088 30.028 1.00 16.97 ? 86  GLY B N     1 
ATOM   1763 C  CA    . GLY B 1 86  ? -10.243 64.734 29.728 1.00 15.50 ? 86  GLY B CA    1 
ATOM   1764 C  C     . GLY B 1 86  ? -10.091 63.818 30.939 1.00 17.44 ? 86  GLY B C     1 
ATOM   1765 O  O     . GLY B 1 86  ? -9.299  62.885 30.904 1.00 16.96 ? 86  GLY B O     1 
ATOM   1766 N  N     . VAL B 1 87  ? -10.887 64.048 31.978 1.00 16.44 ? 87  VAL B N     1 
ATOM   1767 C  CA    . VAL B 1 87  ? -10.760 63.246 33.209 1.00 16.71 ? 87  VAL B CA    1 
ATOM   1768 C  C     . VAL B 1 87  ? -11.086 61.751 33.019 1.00 17.12 ? 87  VAL B C     1 
ATOM   1769 O  O     . VAL B 1 87  ? -10.491 60.901 33.685 1.00 18.02 ? 87  VAL B O     1 
ATOM   1770 C  CB    . VAL B 1 87  ? -11.605 63.877 34.385 1.00 15.58 ? 87  VAL B CB    1 
ATOM   1771 C  CG1   . VAL B 1 87  ? -13.105 63.800 34.109 1.00 15.00 ? 87  VAL B CG1   1 
ATOM   1772 C  CG2   . VAL B 1 87  ? -11.273 63.171 35.732 1.00 15.49 ? 87  VAL B CG2   1 
ATOM   1773 N  N     . VAL B 1 88  ? -12.005 61.412 32.113 1.00 17.11 ? 88  VAL B N     1 
ATOM   1774 C  CA    . VAL B 1 88  ? -12.316 59.999 31.918 1.00 16.52 ? 88  VAL B CA    1 
ATOM   1775 C  C     . VAL B 1 88  ? -11.077 59.200 31.499 1.00 17.58 ? 88  VAL B C     1 
ATOM   1776 O  O     . VAL B 1 88  ? -10.706 58.242 32.189 1.00 16.86 ? 88  VAL B O     1 
ATOM   1777 C  CB    . VAL B 1 88  ? -13.428 59.781 30.873 1.00 15.75 ? 88  VAL B CB    1 
ATOM   1778 C  CG1   . VAL B 1 88  ? -13.561 58.303 30.554 1.00 18.24 ? 88  VAL B CG1   1 
ATOM   1779 C  CG2   . VAL B 1 88  ? -14.739 60.341 31.387 1.00 15.28 ? 88  VAL B CG2   1 
ATOM   1780 N  N     . ALA B 1 89  ? -10.438 59.580 30.388 1.00 15.45 ? 89  ALA B N     1 
ATOM   1781 C  CA    . ALA B 1 89  ? -9.263  58.845 29.923 1.00 17.28 ? 89  ALA B CA    1 
ATOM   1782 C  C     . ALA B 1 89  ? -8.058  59.023 30.849 1.00 15.77 ? 89  ALA B C     1 
ATOM   1783 O  O     . ALA B 1 89  ? -7.250  58.092 31.020 1.00 15.88 ? 89  ALA B O     1 
ATOM   1784 C  CB    . ALA B 1 89  ? -8.885  59.280 28.470 1.00 16.77 ? 89  ALA B CB    1 
ATOM   1785 N  N     . SER B 1 90  ? -7.912  60.219 31.412 1.00 15.17 ? 90  SER B N     1 
ATOM   1786 C  CA    . SER B 1 90  ? -6.785  60.494 32.308 1.00 15.93 ? 90  SER B CA    1 
ATOM   1787 C  C     . SER B 1 90  ? -6.898  59.641 33.573 1.00 15.12 ? 90  SER B C     1 
ATOM   1788 O  O     . SER B 1 90  ? -5.900  59.076 34.044 1.00 15.26 ? 90  SER B O     1 
ATOM   1789 C  CB    . SER B 1 90  ? -6.763  61.971 32.710 1.00 16.12 ? 90  SER B CB    1 
ATOM   1790 O  OG    . SER B 1 90  ? -5.685  62.232 33.594 1.00 17.52 ? 90  SER B OG    1 
ATOM   1791 N  N     . ALA B 1 91  ? -8.104  59.562 34.122 1.00 14.52 ? 91  ALA B N     1 
ATOM   1792 C  CA    . ALA B 1 91  ? -8.325  58.765 35.335 1.00 15.86 ? 91  ALA B CA    1 
ATOM   1793 C  C     . ALA B 1 91  ? -8.033  57.288 35.081 1.00 16.66 ? 91  ALA B C     1 
ATOM   1794 O  O     . ALA B 1 91  ? -7.591  56.587 35.981 1.00 15.45 ? 91  ALA B O     1 
ATOM   1795 C  CB    . ALA B 1 91  ? -9.785  58.955 35.838 1.00 13.03 ? 91  ALA B CB    1 
ATOM   1796 N  N     . ARG B 1 92  ? -8.270  56.810 33.853 1.00 16.70 ? 92  ARG B N     1 
ATOM   1797 C  CA    . ARG B 1 92  ? -7.969  55.413 33.564 1.00 17.55 ? 92  ARG B CA    1 
ATOM   1798 C  C     . ARG B 1 92  ? -6.459  55.232 33.462 1.00 17.02 ? 92  ARG B C     1 
ATOM   1799 O  O     . ARG B 1 92  ? -5.923  54.224 33.885 1.00 16.80 ? 92  ARG B O     1 
ATOM   1800 C  CB    . ARG B 1 92  ? -8.598  54.990 32.249 1.00 21.03 ? 92  ARG B CB    1 
ATOM   1801 C  CG    . ARG B 1 92  ? -10.070 55.223 32.207 1.00 25.40 ? 92  ARG B CG    1 
ATOM   1802 C  CD    . ARG B 1 92  ? -10.744 53.935 31.958 1.00 32.01 ? 92  ARG B CD    1 
ATOM   1803 N  NE    . ARG B 1 92  ? -10.757 53.108 33.147 1.00 36.14 ? 92  ARG B NE    1 
ATOM   1804 C  CZ    . ARG B 1 92  ? -11.013 51.803 33.127 1.00 38.13 ? 92  ARG B CZ    1 
ATOM   1805 N  NH1   . ARG B 1 92  ? -11.255 51.190 31.968 1.00 39.19 ? 92  ARG B NH1   1 
ATOM   1806 N  NH2   . ARG B 1 92  ? -11.098 51.131 34.267 1.00 38.26 ? 92  ARG B NH2   1 
ATOM   1807 N  N     . LEU B 1 93  ? -5.778  56.204 32.863 1.00 16.37 ? 93  LEU B N     1 
ATOM   1808 C  CA    . LEU B 1 93  ? -4.326  56.115 32.724 1.00 18.16 ? 93  LEU B CA    1 
ATOM   1809 C  C     . LEU B 1 93  ? -3.741  56.068 34.149 1.00 16.94 ? 93  LEU B C     1 
ATOM   1810 O  O     . LEU B 1 93  ? -2.799  55.330 34.427 1.00 16.32 ? 93  LEU B O     1 
ATOM   1811 C  CB    . LEU B 1 93  ? -3.819  57.354 31.968 1.00 20.29 ? 93  LEU B CB    1 
ATOM   1812 C  CG    . LEU B 1 93  ? -2.356  57.500 31.551 1.00 22.40 ? 93  LEU B CG    1 
ATOM   1813 C  CD1   . LEU B 1 93  ? -1.961  56.386 30.580 1.00 23.31 ? 93  LEU B CD1   1 
ATOM   1814 C  CD2   . LEU B 1 93  ? -2.174  58.869 30.890 1.00 21.82 ? 93  LEU B CD2   1 
ATOM   1815 N  N     . MET B 1 94  ? -4.330  56.850 35.044 1.00 16.15 ? 94  MET B N     1 
ATOM   1816 C  CA    . MET B 1 94  ? -3.863  56.896 36.442 1.00 14.19 ? 94  MET B CA    1 
ATOM   1817 C  C     . MET B 1 94  ? -4.155  55.597 37.196 1.00 14.64 ? 94  MET B C     1 
ATOM   1818 O  O     . MET B 1 94  ? -3.485  55.266 38.173 1.00 14.48 ? 94  MET B O     1 
ATOM   1819 C  CB    . MET B 1 94  ? -4.517  58.086 37.142 1.00 17.03 ? 94  MET B CB    1 
ATOM   1820 C  CG    . MET B 1 94  ? -4.004  59.419 36.552 1.00 14.98 ? 94  MET B CG    1 
ATOM   1821 S  SD    . MET B 1 94  ? -4.823  60.861 37.199 1.00 17.25 ? 94  MET B SD    1 
ATOM   1822 C  CE    . MET B 1 94  ? -4.377  60.749 38.981 1.00 16.01 ? 94  MET B CE    1 
ATOM   1823 N  N     . ILE B 1 95  ? -5.155  54.868 36.731 1.00 14.33 ? 95  ILE B N     1 
ATOM   1824 C  CA    . ILE B 1 95  ? -5.530  53.605 37.365 1.00 15.87 ? 95  ILE B CA    1 
ATOM   1825 C  C     . ILE B 1 95  ? -4.603  52.482 36.906 1.00 17.22 ? 95  ILE B C     1 
ATOM   1826 O  O     . ILE B 1 95  ? -4.157  51.675 37.725 1.00 14.99 ? 95  ILE B O     1 
ATOM   1827 C  CB    . ILE B 1 95  ? -7.000  53.246 37.015 1.00 16.26 ? 95  ILE B CB    1 
ATOM   1828 C  CG1   . ILE B 1 95  ? -7.944  54.120 37.842 1.00 15.12 ? 95  ILE B CG1   1 
ATOM   1829 C  CG2   . ILE B 1 95  ? -7.313  51.746 37.287 1.00 15.99 ? 95  ILE B CG2   1 
ATOM   1830 C  CD1   . ILE B 1 95  ? -9.388  54.030 37.331 1.00 15.73 ? 95  ILE B CD1   1 
ATOM   1831 N  N     . GLY B 1 96  ? -4.316  52.446 35.604 1.00 15.70 ? 96  GLY B N     1 
ATOM   1832 C  CA    . GLY B 1 96  ? -3.468  51.396 35.051 1.00 17.85 ? 96  GLY B CA    1 
ATOM   1833 C  C     . GLY B 1 96  ? -4.249  50.585 34.022 1.00 18.60 ? 96  GLY B C     1 
ATOM   1834 O  O     . GLY B 1 96  ? -4.955  51.167 33.211 1.00 21.00 ? 96  GLY B O     1 
ATOM   1835 N  N     . VAL B 1 97  ? -4.126  49.257 34.045 1.00 18.60 ? 97  VAL B N     1 
ATOM   1836 C  CA    . VAL B 1 97  ? -4.855  48.388 33.115 1.00 19.03 ? 97  VAL B CA    1 
ATOM   1837 C  C     . VAL B 1 97  ? -5.596  47.367 33.981 1.00 19.19 ? 97  VAL B C     1 
ATOM   1838 O  O     . VAL B 1 97  ? -5.400  47.330 35.181 1.00 20.13 ? 97  VAL B O     1 
ATOM   1839 C  CB    . VAL B 1 97  ? -3.897  47.662 32.137 1.00 19.54 ? 97  VAL B CB    1 
ATOM   1840 C  CG1   . VAL B 1 97  ? -3.261  48.672 31.191 1.00 18.70 ? 97  VAL B CG1   1 
ATOM   1841 C  CG2   . VAL B 1 97  ? -2.825  46.913 32.909 1.00 17.28 ? 97  VAL B CG2   1 
ATOM   1842 N  N     . THR B 1 98  ? -6.438  46.539 33.389 1.00 19.53 ? 98  THR B N     1 
ATOM   1843 C  CA    . THR B 1 98  ? -7.214  45.580 34.182 1.00 18.89 ? 98  THR B CA    1 
ATOM   1844 C  C     . THR B 1 98  ? -6.402  44.747 35.153 1.00 17.08 ? 98  THR B C     1 
ATOM   1845 O  O     . THR B 1 98  ? -6.777  44.610 36.318 1.00 17.95 ? 98  THR B O     1 
ATOM   1846 C  CB    . THR B 1 98  ? -8.041  44.660 33.264 1.00 21.36 ? 98  THR B CB    1 
ATOM   1847 O  OG1   . THR B 1 98  ? -8.813  45.483 32.388 1.00 23.04 ? 98  THR B OG1   1 
ATOM   1848 C  CG2   . THR B 1 98  ? -8.999  43.787 34.086 1.00 21.35 ? 98  THR B CG2   1 
ATOM   1849 N  N     . ASN B 1 99  ? -5.284  44.201 34.697 1.00 17.52 ? 99  ASN B N     1 
ATOM   1850 C  CA    . ASN B 1 99  ? -4.451  43.396 35.581 1.00 17.00 ? 99  ASN B CA    1 
ATOM   1851 C  C     . ASN B 1 99  ? -3.438  44.295 36.271 1.00 16.87 ? 99  ASN B C     1 
ATOM   1852 O  O     . ASN B 1 99  ? -2.593  44.900 35.615 1.00 16.24 ? 99  ASN B O     1 
ATOM   1853 C  CB    . ASN B 1 99  ? -3.720  42.322 34.768 1.00 17.07 ? 99  ASN B CB    1 
ATOM   1854 C  CG    . ASN B 1 99  ? -3.028  41.287 35.643 1.00 16.24 ? 99  ASN B CG    1 
ATOM   1855 O  OD1   . ASN B 1 99  ? -2.848  40.142 35.217 1.00 20.84 ? 99  ASN B OD1   1 
ATOM   1856 N  ND2   . ASN B 1 99  ? -2.643  41.666 36.853 1.00 14.75 ? 99  ASN B ND2   1 
ATOM   1857 N  N     . PRO B 1 100 ? -3.518  44.411 37.606 1.00 16.36 ? 100 PRO B N     1 
ATOM   1858 C  CA    . PRO B 1 100 ? -2.565  45.252 38.356 1.00 15.93 ? 100 PRO B CA    1 
ATOM   1859 C  C     . PRO B 1 100 ? -1.112  44.837 38.113 1.00 15.45 ? 100 PRO B C     1 
ATOM   1860 O  O     . PRO B 1 100 ? -0.203  45.656 38.154 1.00 16.39 ? 100 PRO B O     1 
ATOM   1861 C  CB    . PRO B 1 100 ? -2.957  45.013 39.809 1.00 14.19 ? 100 PRO B CB    1 
ATOM   1862 C  CG    . PRO B 1 100 ? -4.400  44.725 39.736 1.00 16.09 ? 100 PRO B CG    1 
ATOM   1863 C  CD    . PRO B 1 100 ? -4.597  43.915 38.468 1.00 16.59 ? 100 PRO B CD    1 
ATOM   1864 N  N     . LEU B 1 101 ? -0.878  43.545 37.901 1.00 16.00 ? 101 LEU B N     1 
ATOM   1865 C  CA    . LEU B 1 101 ? 0.480   43.081 37.629 1.00 14.53 ? 101 LEU B CA    1 
ATOM   1866 C  C     . LEU B 1 101 ? 1.051   43.668 36.314 1.00 15.30 ? 101 LEU B C     1 
ATOM   1867 O  O     . LEU B 1 101 ? 2.270   43.798 36.176 1.00 15.04 ? 101 LEU B O     1 
ATOM   1868 C  CB    . LEU B 1 101 ? 0.516   41.553 37.554 1.00 16.12 ? 101 LEU B CB    1 
ATOM   1869 C  CG    . LEU B 1 101 ? 0.251   40.835 38.883 1.00 14.92 ? 101 LEU B CG    1 
ATOM   1870 C  CD1   . LEU B 1 101 ? 0.362   39.296 38.620 1.00 17.86 ? 101 LEU B CD1   1 
ATOM   1871 C  CD2   . LEU B 1 101 ? 1.276   41.245 39.930 1.00 15.32 ? 101 LEU B CD2   1 
ATOM   1872 N  N     . ALA B 1 102 ? 0.177   44.017 35.372 1.00 15.05 ? 102 ALA B N     1 
ATOM   1873 C  CA    . ALA B 1 102 ? 0.621   44.613 34.102 1.00 15.88 ? 102 ALA B CA    1 
ATOM   1874 C  C     . ALA B 1 102 ? 0.553   46.131 34.142 1.00 15.98 ? 102 ALA B C     1 
ATOM   1875 O  O     . ALA B 1 102 ? 0.915   46.812 33.166 1.00 16.31 ? 102 ALA B O     1 
ATOM   1876 C  CB    . ALA B 1 102 ? -0.239  44.122 32.947 1.00 15.47 ? 102 ALA B CB    1 
ATOM   1877 N  N     . SER B 1 103 ? 0.097   46.667 35.259 1.00 15.88 ? 103 SER B N     1 
ATOM   1878 C  CA    . SER B 1 103 ? -0.031  48.116 35.397 1.00 15.54 ? 103 SER B CA    1 
ATOM   1879 C  C     . SER B 1 103 ? 1.296   48.692 35.813 1.00 16.72 ? 103 SER B C     1 
ATOM   1880 O  O     . SER B 1 103 ? 1.963   48.174 36.699 1.00 15.63 ? 103 SER B O     1 
ATOM   1881 C  CB    . SER B 1 103 ? -1.117  48.455 36.438 1.00 14.80 ? 103 SER B CB    1 
ATOM   1882 O  OG    . SER B 1 103 ? -2.365  47.939 36.041 1.00 16.04 ? 103 SER B OG    1 
ATOM   1883 N  N     . ALA B 1 104 ? 1.649   49.796 35.170 1.00 16.50 ? 104 ALA B N     1 
ATOM   1884 C  CA    . ALA B 1 104 ? 2.907   50.454 35.370 1.00 17.46 ? 104 ALA B CA    1 
ATOM   1885 C  C     . ALA B 1 104 ? 3.108   51.090 36.732 1.00 17.20 ? 104 ALA B C     1 
ATOM   1886 O  O     . ALA B 1 104 ? 2.162   51.626 37.304 1.00 15.48 ? 104 ALA B O     1 
ATOM   1887 C  CB    . ALA B 1 104 ? 3.065   51.531 34.298 1.00 20.27 ? 104 ALA B CB    1 
ATOM   1888 N  N     . PRO B 1 105 ? 4.339   51.008 37.271 1.00 16.46 ? 105 PRO B N     1 
ATOM   1889 C  CA    . PRO B 1 105 ? 4.636   51.622 38.569 1.00 16.96 ? 105 PRO B CA    1 
ATOM   1890 C  C     . PRO B 1 105 ? 4.214   53.072 38.317 1.00 16.87 ? 105 PRO B C     1 
ATOM   1891 O  O     . PRO B 1 105 ? 4.418   53.611 37.204 1.00 16.63 ? 105 PRO B O     1 
ATOM   1892 C  CB    . PRO B 1 105 ? 6.152   51.489 38.692 1.00 15.84 ? 105 PRO B CB    1 
ATOM   1893 C  CG    . PRO B 1 105 ? 6.460   50.253 37.847 1.00 18.17 ? 105 PRO B CG    1 
ATOM   1894 C  CD    . PRO B 1 105 ? 5.542   50.394 36.667 1.00 17.80 ? 105 PRO B CD    1 
ATOM   1895 N  N     . GLY B 1 106 ? 3.633   53.703 39.322 1.00 16.15 ? 106 GLY B N     1 
ATOM   1896 C  CA    . GLY B 1 106 ? 3.164   55.051 39.131 1.00 14.69 ? 106 GLY B CA    1 
ATOM   1897 C  C     . GLY B 1 106 ? 1.658   55.074 39.048 1.00 14.90 ? 106 GLY B C     1 
ATOM   1898 O  O     . GLY B 1 106 ? 1.056   56.059 39.462 1.00 13.98 ? 106 GLY B O     1 
ATOM   1899 N  N     . SER B 1 107 ? 1.040   54.016 38.504 1.00 13.47 ? 107 SER B N     1 
ATOM   1900 C  CA    . SER B 1 107 ? -0.417  53.953 38.436 1.00 15.38 ? 107 SER B CA    1 
ATOM   1901 C  C     . SER B 1 107 ? -0.966  53.354 39.736 1.00 13.84 ? 107 SER B C     1 
ATOM   1902 O  O     . SER B 1 107 ? -0.240  52.703 40.490 1.00 12.90 ? 107 SER B O     1 
ATOM   1903 C  CB    . SER B 1 107 ? -0.898  53.098 37.257 1.00 12.42 ? 107 SER B CB    1 
ATOM   1904 O  OG    . SER B 1 107 ? -0.563  51.721 37.467 1.00 13.61 ? 107 SER B OG    1 
ATOM   1905 N  N     . ILE B 1 108 ? -2.248  53.564 39.995 1.00 14.04 ? 108 ILE B N     1 
ATOM   1906 C  CA    . ILE B 1 108 ? -2.829  53.037 41.236 1.00 13.72 ? 108 ILE B CA    1 
ATOM   1907 C  C     . ILE B 1 108 ? -2.715  51.520 41.320 1.00 15.64 ? 108 ILE B C     1 
ATOM   1908 O  O     . ILE B 1 108 ? -2.138  50.983 42.281 1.00 13.95 ? 108 ILE B O     1 
ATOM   1909 C  CB    . ILE B 1 108 ? -4.282  53.485 41.387 1.00 11.26 ? 108 ILE B CB    1 
ATOM   1910 C  CG1   . ILE B 1 108 ? -4.295  55.001 41.623 1.00 11.21 ? 108 ILE B CG1   1 
ATOM   1911 C  CG2   . ILE B 1 108 ? -4.959  52.725 42.565 1.00 10.24 ? 108 ILE B CG2   1 
ATOM   1912 C  CD1   . ILE B 1 108 ? -5.669  55.673 41.509 1.00 11.30 ? 108 ILE B CD1   1 
ATOM   1913 N  N     . ARG B 1 109 ? -3.238  50.811 40.319 1.00 14.86 ? 109 ARG B N     1 
ATOM   1914 C  CA    . ARG B 1 109 ? -3.123  49.344 40.346 1.00 14.51 ? 109 ARG B CA    1 
ATOM   1915 C  C     . ARG B 1 109 ? -1.674  48.877 40.270 1.00 15.35 ? 109 ARG B C     1 
ATOM   1916 O  O     . ARG B 1 109 ? -1.309  47.843 40.867 1.00 14.54 ? 109 ARG B O     1 
ATOM   1917 C  CB    . ARG B 1 109 ? -3.921  48.716 39.196 1.00 13.06 ? 109 ARG B CB    1 
ATOM   1918 C  CG    . ARG B 1 109 ? -5.409  48.829 39.383 1.00 15.27 ? 109 ARG B CG    1 
ATOM   1919 C  CD    . ARG B 1 109 ? -6.162  48.476 38.098 1.00 13.20 ? 109 ARG B CD    1 
ATOM   1920 N  NE    . ARG B 1 109 ? -7.611  48.609 38.272 1.00 15.80 ? 109 ARG B NE    1 
ATOM   1921 C  CZ    . ARG B 1 109 ? -8.484  48.582 37.267 1.00 15.04 ? 109 ARG B CZ    1 
ATOM   1922 N  NH1   . ARG B 1 109 ? -8.041  48.425 36.033 1.00 18.28 ? 109 ARG B NH1   1 
ATOM   1923 N  NH2   . ARG B 1 109 ? -9.786  48.740 37.480 1.00 15.68 ? 109 ARG B NH2   1 
ATOM   1924 N  N     . GLY B 1 110 ? -0.842  49.627 39.540 1.00 14.20 ? 110 GLY B N     1 
ATOM   1925 C  CA    . GLY B 1 110 ? 0.556   49.264 39.418 1.00 14.16 ? 110 GLY B CA    1 
ATOM   1926 C  C     . GLY B 1 110 ? 1.298   49.377 40.738 1.00 15.08 ? 110 GLY B C     1 
ATOM   1927 O  O     . GLY B 1 110 ? 2.220   48.622 41.030 1.00 15.37 ? 110 GLY B O     1 
ATOM   1928 N  N     . ASP B 1 111 ? 0.902   50.336 41.551 1.00 13.14 ? 111 ASP B N     1 
ATOM   1929 C  CA    . ASP B 1 111 ? 1.577   50.518 42.825 1.00 14.07 ? 111 ASP B CA    1 
ATOM   1930 C  C     . ASP B 1 111 ? 1.006   49.669 43.966 1.00 13.16 ? 111 ASP B C     1 
ATOM   1931 O  O     . ASP B 1 111 ? 1.718   49.311 44.918 1.00 15.11 ? 111 ASP B O     1 
ATOM   1932 C  CB    . ASP B 1 111 ? 1.480   51.989 43.261 1.00 14.65 ? 111 ASP B CB    1 
ATOM   1933 C  CG    . ASP B 1 111 ? 2.291   52.943 42.381 1.00 14.38 ? 111 ASP B CG    1 
ATOM   1934 O  OD1   . ASP B 1 111 ? 3.151   52.503 41.599 1.00 14.87 ? 111 ASP B OD1   1 
ATOM   1935 O  OD2   . ASP B 1 111 ? 2.068   54.160 42.503 1.00 13.79 ? 111 ASP B OD2   1 
ATOM   1936 N  N     . PHE B 1 112 ? -0.271  49.341 43.871 1.00 14.86 ? 112 PHE B N     1 
ATOM   1937 C  CA    . PHE B 1 112 ? -0.940  48.662 44.980 1.00 16.38 ? 112 PHE B CA    1 
ATOM   1938 C  C     . PHE B 1 112 ? -1.553  47.285 44.801 1.00 16.61 ? 112 PHE B C     1 
ATOM   1939 O  O     . PHE B 1 112 ? -1.898  46.640 45.793 1.00 16.75 ? 112 PHE B O     1 
ATOM   1940 C  CB    . PHE B 1 112 ? -2.037  49.596 45.497 1.00 15.03 ? 112 PHE B CB    1 
ATOM   1941 C  CG    . PHE B 1 112 ? -1.511  50.906 46.017 1.00 17.83 ? 112 PHE B CG    1 
ATOM   1942 C  CD1   . PHE B 1 112 ? -0.597  50.931 47.065 1.00 21.40 ? 112 PHE B CD1   1 
ATOM   1943 C  CD2   . PHE B 1 112 ? -1.913  52.102 45.455 1.00 19.49 ? 112 PHE B CD2   1 
ATOM   1944 C  CE1   . PHE B 1 112 ? -0.080  52.153 47.549 1.00 22.36 ? 112 PHE B CE1   1 
ATOM   1945 C  CE2   . PHE B 1 112 ? -1.406  53.326 45.931 1.00 20.81 ? 112 PHE B CE2   1 
ATOM   1946 C  CZ    . PHE B 1 112 ? -0.492  53.341 46.973 1.00 21.60 ? 112 PHE B CZ    1 
ATOM   1947 N  N     . GLY B 1 113 ? -1.711  46.814 43.571 1.00 17.56 ? 113 GLY B N     1 
ATOM   1948 C  CA    . GLY B 1 113 ? -2.378  45.536 43.427 1.00 18.52 ? 113 GLY B CA    1 
ATOM   1949 C  C     . GLY B 1 113 ? -1.645  44.397 42.745 1.00 18.14 ? 113 GLY B C     1 
ATOM   1950 O  O     . GLY B 1 113 ? -0.651  44.587 42.065 1.00 16.23 ? 113 GLY B O     1 
ATOM   1951 N  N     . VAL B 1 114 ? -2.171  43.195 42.924 1.00 20.11 ? 114 VAL B N     1 
ATOM   1952 C  CA    . VAL B 1 114 ? -1.542  42.015 42.346 1.00 20.16 ? 114 VAL B CA    1 
ATOM   1953 C  C     . VAL B 1 114 ? -2.537  41.030 41.755 1.00 21.70 ? 114 VAL B C     1 
ATOM   1954 O  O     . VAL B 1 114 ? -2.131  39.972 41.273 1.00 23.82 ? 114 VAL B O     1 
ATOM   1955 C  CB    . VAL B 1 114 ? -0.734  41.243 43.415 1.00 20.36 ? 114 VAL B CB    1 
ATOM   1956 C  CG1   . VAL B 1 114 ? 0.523   42.025 43.809 1.00 20.93 ? 114 VAL B CG1   1 
ATOM   1957 C  CG2   . VAL B 1 114 ? -1.634  40.964 44.649 1.00 23.10 ? 114 VAL B CG2   1 
ATOM   1958 N  N     . ASP B 1 115 ? -3.824  41.354 41.775 1.00 19.87 ? 115 ASP B N     1 
ATOM   1959 C  CA    . ASP B 1 115 ? -4.833  40.411 41.292 1.00 22.01 ? 115 ASP B CA    1 
ATOM   1960 C  C     . ASP B 1 115 ? -5.951  41.102 40.511 1.00 22.75 ? 115 ASP B C     1 
ATOM   1961 O  O     . ASP B 1 115 ? -6.499  42.084 40.974 1.00 20.07 ? 115 ASP B O     1 
ATOM   1962 C  CB    . ASP B 1 115 ? -5.420  39.682 42.527 1.00 23.44 ? 115 ASP B CB    1 
ATOM   1963 C  CG    . ASP B 1 115 ? -6.230  38.434 42.179 1.00 27.26 ? 115 ASP B CG    1 
ATOM   1964 O  OD1   . ASP B 1 115 ? -7.101  38.512 41.301 1.00 28.96 ? 115 ASP B OD1   1 
ATOM   1965 O  OD2   . ASP B 1 115 ? -6.008  37.380 42.813 1.00 24.92 ? 115 ASP B OD2   1 
ATOM   1966 N  N     . VAL B 1 116 ? -6.293  40.594 39.325 1.00 22.39 ? 116 VAL B N     1 
ATOM   1967 C  CA    . VAL B 1 116 ? -7.380  41.190 38.555 1.00 23.25 ? 116 VAL B CA    1 
ATOM   1968 C  C     . VAL B 1 116 ? -8.706  41.340 39.328 1.00 23.90 ? 116 VAL B C     1 
ATOM   1969 O  O     . VAL B 1 116 ? -9.439  42.314 39.117 1.00 24.34 ? 116 VAL B O     1 
ATOM   1970 C  CB    . VAL B 1 116 ? -7.678  40.362 37.281 1.00 25.35 ? 116 VAL B CB    1 
ATOM   1971 C  CG1   . VAL B 1 116 ? -8.941  40.854 36.636 1.00 24.87 ? 116 VAL B CG1   1 
ATOM   1972 C  CG2   . VAL B 1 116 ? -6.515  40.454 36.309 1.00 22.90 ? 116 VAL B CG2   1 
ATOM   1973 N  N     . GLY B 1 117 ? -9.018  40.383 40.207 1.00 22.20 ? 117 GLY B N     1 
ATOM   1974 C  CA    . GLY B 1 117 ? -10.254 40.439 40.976 1.00 21.69 ? 117 GLY B CA    1 
ATOM   1975 C  C     . GLY B 1 117 ? -10.193 41.304 42.220 1.00 22.02 ? 117 GLY B C     1 
ATOM   1976 O  O     . GLY B 1 117 ? -11.190 41.484 42.916 1.00 22.94 ? 117 GLY B O     1 
ATOM   1977 N  N     . ARG B 1 118 ? -9.009  41.830 42.524 1.00 19.65 ? 118 ARG B N     1 
ATOM   1978 C  CA    . ARG B 1 118 ? -8.843  42.702 43.688 1.00 17.23 ? 118 ARG B CA    1 
ATOM   1979 C  C     . ARG B 1 118 ? -7.979  43.805 43.112 1.00 16.30 ? 118 ARG B C     1 
ATOM   1980 O  O     . ARG B 1 118 ? -6.827  43.973 43.513 1.00 15.78 ? 118 ARG B O     1 
ATOM   1981 C  CB    . ARG B 1 118 ? -8.074  41.963 44.781 1.00 18.25 ? 118 ARG B CB    1 
ATOM   1982 C  CG    . ARG B 1 118 ? -8.820  40.741 45.361 1.00 17.22 ? 118 ARG B CG    1 
ATOM   1983 C  CD    . ARG B 1 118 ? -9.982  41.183 46.215 1.00 18.57 ? 118 ARG B CD    1 
ATOM   1984 N  NE    . ARG B 1 118 ? -10.724 40.054 46.797 1.00 21.81 ? 118 ARG B NE    1 
ATOM   1985 C  CZ    . ARG B 1 118 ? -11.684 39.386 46.168 1.00 24.49 ? 118 ARG B CZ    1 
ATOM   1986 N  NH1   . ARG B 1 118 ? -12.038 39.730 44.931 1.00 23.04 ? 118 ARG B NH1   1 
ATOM   1987 N  NH2   . ARG B 1 118 ? -12.291 38.361 46.776 1.00 23.83 ? 118 ARG B NH2   1 
ATOM   1988 N  N     . ASN B 1 119 ? -8.549  44.541 42.162 1.00 16.47 ? 119 ASN B N     1 
ATOM   1989 C  CA    . ASN B 1 119 ? -7.779  45.573 41.516 1.00 17.04 ? 119 ASN B CA    1 
ATOM   1990 C  C     . ASN B 1 119 ? -8.051  46.984 41.991 1.00 17.24 ? 119 ASN B C     1 
ATOM   1991 O  O     . ASN B 1 119 ? -7.901  47.957 41.260 1.00 15.48 ? 119 ASN B O     1 
ATOM   1992 C  CB    . ASN B 1 119 ? -7.808  45.408 39.989 1.00 18.52 ? 119 ASN B CB    1 
ATOM   1993 C  CG    . ASN B 1 119 ? -9.142  45.656 39.383 1.00 19.50 ? 119 ASN B CG    1 
ATOM   1994 O  OD1   . ASN B 1 119 ? -10.101 45.989 40.063 1.00 19.29 ? 119 ASN B OD1   1 
ATOM   1995 N  ND2   . ASN B 1 119 ? -9.210  45.506 38.040 1.00 19.64 ? 119 ASN B ND2   1 
ATOM   1996 N  N     . ILE B 1 120 ? -8.455  47.052 43.259 1.00 15.58 ? 120 ILE B N     1 
ATOM   1997 C  CA    . ILE B 1 120 ? -8.568  48.300 43.978 1.00 17.15 ? 120 ILE B CA    1 
ATOM   1998 C  C     . ILE B 1 120 ? -9.557  49.390 43.681 1.00 14.89 ? 120 ILE B C     1 
ATOM   1999 O  O     . ILE B 1 120 ? -10.226 49.876 44.585 1.00 16.86 ? 120 ILE B O     1 
ATOM   2000 C  CB    . ILE B 1 120 ? -7.168  48.934 43.977 1.00 15.46 ? 120 ILE B CB    1 
ATOM   2001 C  CG1   . ILE B 1 120 ? -6.194  47.899 44.532 1.00 19.11 ? 120 ILE B CG1   1 
ATOM   2002 C  CG2   . ILE B 1 120 ? -7.140  50.250 44.797 1.00 12.75 ? 120 ILE B CG2   1 
ATOM   2003 C  CD1   . ILE B 1 120 ? -4.757  48.131 44.141 1.00 21.53 ? 120 ILE B CD1   1 
ATOM   2004 N  N     . ILE B 1 121 ? -9.642  49.770 42.417 1.00 15.91 ? 121 ILE B N     1 
ATOM   2005 C  CA    . ILE B 1 121 ? -10.482 50.891 42.023 1.00 14.62 ? 121 ILE B CA    1 
ATOM   2006 C  C     . ILE B 1 121 ? -11.082 50.619 40.653 1.00 14.59 ? 121 ILE B C     1 
ATOM   2007 O  O     . ILE B 1 121 ? -10.537 49.850 39.865 1.00 16.01 ? 121 ILE B O     1 
ATOM   2008 C  CB    . ILE B 1 121 ? -9.567  52.174 41.987 1.00 14.29 ? 121 ILE B CB    1 
ATOM   2009 C  CG1   . ILE B 1 121 ? -10.335 53.387 41.489 1.00 11.27 ? 121 ILE B CG1   1 
ATOM   2010 C  CG2   . ILE B 1 121 ? -8.298  51.921 41.085 1.00 12.53 ? 121 ILE B CG2   1 
ATOM   2011 C  CD1   . ILE B 1 121 ? -9.477  54.648 41.512 1.00 13.01 ? 121 ILE B CD1   1 
ATOM   2012 N  N     . GLY B 1 122 ? -12.213 51.232 40.374 1.00 15.24 ? 122 GLY B N     1 
ATOM   2013 C  CA    . GLY B 1 122 ? -12.819 51.060 39.067 1.00 16.05 ? 122 GLY B CA    1 
ATOM   2014 C  C     . GLY B 1 122 ? -13.063 52.464 38.520 1.00 16.08 ? 122 GLY B C     1 
ATOM   2015 O  O     . GLY B 1 122 ? -13.321 53.393 39.277 1.00 16.20 ? 122 GLY B O     1 
ATOM   2016 N  N     . GLY B 1 123 ? -12.999 52.637 37.211 1.00 17.25 ? 123 GLY B N     1 
ATOM   2017 C  CA    . GLY B 1 123 ? -13.245 53.966 36.680 1.00 17.45 ? 123 GLY B CA    1 
ATOM   2018 C  C     . GLY B 1 123 ? -13.968 53.857 35.358 1.00 18.29 ? 123 GLY B C     1 
ATOM   2019 O  O     . GLY B 1 123 ? -13.797 52.860 34.647 1.00 19.61 ? 123 GLY B O     1 
ATOM   2020 N  N     . SER B 1 124 ? -14.771 54.864 35.026 1.00 19.15 ? 124 SER B N     1 
ATOM   2021 C  CA    . SER B 1 124 ? -15.520 54.844 33.760 1.00 20.74 ? 124 SER B CA    1 
ATOM   2022 C  C     . SER B 1 124 ? -14.547 54.768 32.596 1.00 21.60 ? 124 SER B C     1 
ATOM   2023 O  O     . SER B 1 124 ? -13.465 55.355 32.641 1.00 21.76 ? 124 SER B O     1 
ATOM   2024 C  CB    . SER B 1 124 ? -16.365 56.103 33.618 1.00 20.64 ? 124 SER B CB    1 
ATOM   2025 O  OG    . SER B 1 124 ? -17.088 56.331 34.803 1.00 21.54 ? 124 SER B OG    1 
ATOM   2026 N  N     . ASP B 1 125 ? -14.945 54.086 31.524 1.00 22.56 ? 125 ASP B N     1 
ATOM   2027 C  CA    . ASP B 1 125 ? -14.019 53.940 30.422 1.00 23.66 ? 125 ASP B CA    1 
ATOM   2028 C  C     . ASP B 1 125 ? -14.306 54.786 29.184 1.00 23.68 ? 125 ASP B C     1 
ATOM   2029 O  O     . ASP B 1 125 ? -13.557 54.732 28.218 1.00 24.38 ? 125 ASP B O     1 
ATOM   2030 C  CB    . ASP B 1 125 ? -13.853 52.455 30.062 1.00 25.47 ? 125 ASP B CB    1 
ATOM   2031 C  CG    . ASP B 1 125 ? -15.121 51.831 29.499 1.00 27.51 ? 125 ASP B CG    1 
ATOM   2032 O  OD1   . ASP B 1 125 ? -16.091 52.556 29.197 1.00 27.82 ? 125 ASP B OD1   1 
ATOM   2033 O  OD2   . ASP B 1 125 ? -15.137 50.599 29.356 1.00 29.68 ? 125 ASP B OD2   1 
ATOM   2034 N  N     . SER B 1 126 ? -15.354 55.599 29.246 1.00 23.56 ? 126 SER B N     1 
ATOM   2035 C  CA    . SER B 1 126 ? -15.728 56.498 28.147 1.00 24.04 ? 126 SER B CA    1 
ATOM   2036 C  C     . SER B 1 126 ? -16.644 57.567 28.754 1.00 24.20 ? 126 SER B C     1 
ATOM   2037 O  O     . SER B 1 126 ? -17.178 57.382 29.845 1.00 22.72 ? 126 SER B O     1 
ATOM   2038 C  CB    . SER B 1 126 ? -16.497 55.720 27.075 1.00 22.63 ? 126 SER B CB    1 
ATOM   2039 O  OG    . SER B 1 126 ? -17.800 55.410 27.536 1.00 23.29 ? 126 SER B OG    1 
ATOM   2040 N  N     . VAL B 1 127 ? -16.831 58.676 28.051 1.00 23.54 ? 127 VAL B N     1 
ATOM   2041 C  CA    . VAL B 1 127 ? -17.699 59.744 28.539 1.00 24.38 ? 127 VAL B CA    1 
ATOM   2042 C  C     . VAL B 1 127 ? -19.134 59.238 28.661 1.00 24.05 ? 127 VAL B C     1 
ATOM   2043 O  O     . VAL B 1 127 ? -19.846 59.590 29.596 1.00 24.26 ? 127 VAL B O     1 
ATOM   2044 C  CB    . VAL B 1 127 ? -17.649 60.986 27.588 1.00 23.75 ? 127 VAL B CB    1 
ATOM   2045 C  CG1   . VAL B 1 127 ? -18.877 61.883 27.817 1.00 22.64 ? 127 VAL B CG1   1 
ATOM   2046 C  CG2   . VAL B 1 127 ? -16.350 61.768 27.839 1.00 24.05 ? 127 VAL B CG2   1 
ATOM   2047 N  N     . GLU B 1 128 ? -19.542 58.391 27.722 1.00 26.02 ? 128 GLU B N     1 
ATOM   2048 C  CA    . GLU B 1 128 ? -20.887 57.827 27.740 1.00 26.78 ? 128 GLU B CA    1 
ATOM   2049 C  C     . GLU B 1 128 ? -21.093 56.984 29.003 1.00 25.62 ? 128 GLU B C     1 
ATOM   2050 O  O     . GLU B 1 128 ? -22.052 57.193 29.743 1.00 24.92 ? 128 GLU B O     1 
ATOM   2051 C  CB    . GLU B 1 128 ? -21.113 56.945 26.510 1.00 31.00 ? 128 GLU B CB    1 
ATOM   2052 C  CG    . GLU B 1 128 ? -20.641 57.562 25.224 1.00 35.54 ? 128 GLU B CG    1 
ATOM   2053 C  CD    . GLU B 1 128 ? -19.205 57.172 24.882 1.00 38.41 ? 128 GLU B CD    1 
ATOM   2054 O  OE1   . GLU B 1 128 ? -18.985 55.997 24.480 1.00 40.53 ? 128 GLU B OE1   1 
ATOM   2055 O  OE2   . GLU B 1 128 ? -18.307 58.036 25.018 1.00 38.41 ? 128 GLU B OE2   1 
ATOM   2056 N  N     . SER B 1 129 ? -20.187 56.037 29.231 1.00 24.47 ? 129 SER B N     1 
ATOM   2057 C  CA    . SER B 1 129 ? -20.247 55.150 30.394 1.00 23.81 ? 129 SER B CA    1 
ATOM   2058 C  C     . SER B 1 129 ? -20.232 55.944 31.697 1.00 23.17 ? 129 SER B C     1 
ATOM   2059 O  O     . SER B 1 129 ? -20.930 55.612 32.659 1.00 22.89 ? 129 SER B O     1 
ATOM   2060 C  CB    . SER B 1 129 ? -19.055 54.199 30.387 1.00 25.24 ? 129 SER B CB    1 
ATOM   2061 O  OG    . SER B 1 129 ? -19.214 53.224 29.370 1.00 29.05 ? 129 SER B OG    1 
ATOM   2062 N  N     . ALA B 1 130 ? -19.406 56.983 31.725 1.00 21.82 ? 130 ALA B N     1 
ATOM   2063 C  CA    . ALA B 1 130 ? -19.293 57.841 32.900 1.00 21.13 ? 130 ALA B CA    1 
ATOM   2064 C  C     . ALA B 1 130 ? -20.607 58.528 33.245 1.00 21.39 ? 130 ALA B C     1 
ATOM   2065 O  O     . ALA B 1 130 ? -21.036 58.533 34.407 1.00 20.88 ? 130 ALA B O     1 
ATOM   2066 C  CB    . ALA B 1 130 ? -18.215 58.886 32.659 1.00 20.44 ? 130 ALA B CB    1 
ATOM   2067 N  N     . ASN B 1 131 ? -21.257 59.128 32.238 1.00 21.63 ? 131 ASN B N     1 
ATOM   2068 C  CA    . ASN B 1 131 ? -22.510 59.824 32.500 1.00 22.55 ? 131 ASN B CA    1 
ATOM   2069 C  C     . ASN B 1 131 ? -23.531 58.830 33.029 1.00 22.36 ? 131 ASN B C     1 
ATOM   2070 O  O     . ASN B 1 131 ? -24.291 59.119 33.957 1.00 23.99 ? 131 ASN B O     1 
ATOM   2071 C  CB    . ASN B 1 131 ? -23.022 60.511 31.223 1.00 24.57 ? 131 ASN B CB    1 
ATOM   2072 C  CG    . ASN B 1 131 ? -22.094 61.626 30.759 1.00 28.16 ? 131 ASN B CG    1 
ATOM   2073 O  OD1   . ASN B 1 131 ? -21.445 62.290 31.581 1.00 30.03 ? 131 ASN B OD1   1 
ATOM   2074 N  ND2   . ASN B 1 131 ? -22.026 61.842 29.446 1.00 30.07 ? 131 ASN B ND2   1 
ATOM   2075 N  N     . ARG B 1 132 ? -23.515 57.639 32.450 1.00 23.90 ? 132 ARG B N     1 
ATOM   2076 C  CA    . ARG B 1 132 ? -24.417 56.579 32.870 1.00 24.02 ? 132 ARG B CA    1 
ATOM   2077 C  C     . ARG B 1 132 ? -24.108 56.153 34.296 1.00 22.99 ? 132 ARG B C     1 
ATOM   2078 O  O     . ARG B 1 132 ? -24.992 56.104 35.144 1.00 23.48 ? 132 ARG B O     1 
ATOM   2079 C  CB    . ARG B 1 132 ? -24.263 55.379 31.954 1.00 24.74 ? 132 ARG B CB    1 
ATOM   2080 C  CG    . ARG B 1 132 ? -25.253 54.297 32.223 1.00 27.83 ? 132 ARG B CG    1 
ATOM   2081 C  CD    . ARG B 1 132 ? -24.750 53.008 31.618 1.00 30.38 ? 132 ARG B CD    1 
ATOM   2082 N  NE    . ARG B 1 132 ? -25.429 51.905 32.250 1.00 36.01 ? 132 ARG B NE    1 
ATOM   2083 C  CZ    . ARG B 1 132 ? -24.831 50.910 32.891 1.00 34.10 ? 132 ARG B CZ    1 
ATOM   2084 N  NH1   . ARG B 1 132 ? -23.512 50.849 32.998 1.00 31.32 ? 132 ARG B NH1   1 
ATOM   2085 N  NH2   . ARG B 1 132 ? -25.587 49.968 33.428 1.00 36.87 ? 132 ARG B NH2   1 
ATOM   2086 N  N     . GLU B 1 133 ? -22.844 55.846 34.555 1.00 23.71 ? 133 GLU B N     1 
ATOM   2087 C  CA    . GLU B 1 133 ? -22.443 55.411 35.887 1.00 22.38 ? 133 GLU B CA    1 
ATOM   2088 C  C     . GLU B 1 133 ? -22.701 56.491 36.936 1.00 22.34 ? 133 GLU B C     1 
ATOM   2089 O  O     . GLU B 1 133 ? -23.204 56.195 38.013 1.00 22.19 ? 133 GLU B O     1 
ATOM   2090 C  CB    . GLU B 1 133 ? -20.972 54.968 35.863 1.00 21.24 ? 133 GLU B CB    1 
ATOM   2091 C  CG    . GLU B 1 133 ? -20.817 53.727 35.022 1.00 20.80 ? 133 GLU B CG    1 
ATOM   2092 C  CD    . GLU B 1 133 ? -19.392 53.373 34.718 1.00 22.87 ? 133 GLU B CD    1 
ATOM   2093 O  OE1   . GLU B 1 133 ? -18.475 54.035 35.257 1.00 21.74 ? 133 GLU B OE1   1 
ATOM   2094 O  OE2   . GLU B 1 133 ? -19.185 52.420 33.931 1.00 23.60 ? 133 GLU B OE2   1 
ATOM   2095 N  N     . ILE B 1 134 ? -22.387 57.748 36.628 1.00 23.08 ? 134 ILE B N     1 
ATOM   2096 C  CA    . ILE B 1 134 ? -22.651 58.819 37.591 1.00 22.55 ? 134 ILE B CA    1 
ATOM   2097 C  C     . ILE B 1 134 ? -24.132 58.872 37.983 1.00 24.86 ? 134 ILE B C     1 
ATOM   2098 O  O     . ILE B 1 134 ? -24.468 59.055 39.156 1.00 24.25 ? 134 ILE B O     1 
ATOM   2099 C  CB    . ILE B 1 134 ? -22.206 60.191 37.028 1.00 22.67 ? 134 ILE B CB    1 
ATOM   2100 C  CG1   . ILE B 1 134 ? -20.685 60.214 36.868 1.00 19.63 ? 134 ILE B CG1   1 
ATOM   2101 C  CG2   . ILE B 1 134 ? -22.622 61.311 37.959 1.00 20.41 ? 134 ILE B CG2   1 
ATOM   2102 C  CD1   . ILE B 1 134 ? -20.177 61.381 36.043 1.00 21.61 ? 134 ILE B CD1   1 
ATOM   2103 N  N     . ALA B 1 135 ? -25.013 58.687 37.001 1.00 24.44 ? 135 ALA B N     1 
ATOM   2104 C  CA    . ALA B 1 135 ? -26.463 58.718 37.220 1.00 25.78 ? 135 ALA B CA    1 
ATOM   2105 C  C     . ALA B 1 135 ? -26.915 57.539 38.081 1.00 25.81 ? 135 ALA B C     1 
ATOM   2106 O  O     . ALA B 1 135 ? -27.871 57.659 38.853 1.00 27.01 ? 135 ALA B O     1 
ATOM   2107 C  CB    . ALA B 1 135 ? -27.206 58.704 35.849 1.00 23.96 ? 135 ALA B CB    1 
ATOM   2108 N  N     . LEU B 1 136 ? -26.208 56.411 37.958 1.00 26.65 ? 136 LEU B N     1 
ATOM   2109 C  CA    . LEU B 1 136 ? -26.497 55.219 38.747 1.00 26.11 ? 136 LEU B CA    1 
ATOM   2110 C  C     . LEU B 1 136 ? -26.128 55.371 40.204 1.00 26.41 ? 136 LEU B C     1 
ATOM   2111 O  O     . LEU B 1 136 ? -26.857 54.915 41.089 1.00 24.74 ? 136 LEU B O     1 
ATOM   2112 C  CB    . LEU B 1 136 ? -25.712 54.008 38.248 1.00 26.87 ? 136 LEU B CB    1 
ATOM   2113 C  CG    . LEU B 1 136 ? -26.193 53.145 37.092 1.00 29.63 ? 136 LEU B CG    1 
ATOM   2114 C  CD1   . LEU B 1 136 ? -25.253 51.927 37.006 1.00 29.68 ? 136 LEU B CD1   1 
ATOM   2115 C  CD2   . LEU B 1 136 ? -27.638 52.679 37.347 1.00 29.91 ? 136 LEU B CD2   1 
ATOM   2116 N  N     . TRP B 1 137 ? -24.977 55.990 40.462 1.00 25.05 ? 137 TRP B N     1 
ATOM   2117 C  CA    . TRP B 1 137 ? -24.522 56.103 41.836 1.00 24.17 ? 137 TRP B CA    1 
ATOM   2118 C  C     . TRP B 1 137 ? -24.854 57.366 42.621 1.00 24.39 ? 137 TRP B C     1 
ATOM   2119 O  O     . TRP B 1 137 ? -24.878 57.320 43.846 1.00 27.00 ? 137 TRP B O     1 
ATOM   2120 C  CB    . TRP B 1 137 ? -23.010 55.879 41.890 1.00 22.87 ? 137 TRP B CB    1 
ATOM   2121 C  CG    . TRP B 1 137 ? -22.557 54.541 41.441 1.00 18.91 ? 137 TRP B CG    1 
ATOM   2122 C  CD1   . TRP B 1 137 ? -22.516 54.070 40.166 1.00 21.80 ? 137 TRP B CD1   1 
ATOM   2123 C  CD2   . TRP B 1 137 ? -22.002 53.523 42.260 1.00 20.23 ? 137 TRP B CD2   1 
ATOM   2124 N  NE1   . TRP B 1 137 ? -21.953 52.817 40.137 1.00 19.85 ? 137 TRP B NE1   1 
ATOM   2125 C  CE2   . TRP B 1 137 ? -21.632 52.460 41.418 1.00 18.63 ? 137 TRP B CE2   1 
ATOM   2126 C  CE3   . TRP B 1 137 ? -21.768 53.409 43.639 1.00 19.18 ? 137 TRP B CE3   1 
ATOM   2127 C  CZ2   . TRP B 1 137 ? -21.043 51.287 41.908 1.00 20.53 ? 137 TRP B CZ2   1 
ATOM   2128 C  CZ3   . TRP B 1 137 ? -21.185 52.250 44.120 1.00 17.66 ? 137 TRP B CZ3   1 
ATOM   2129 C  CH2   . TRP B 1 137 ? -20.827 51.206 43.259 1.00 17.82 ? 137 TRP B CH2   1 
ATOM   2130 N  N     . PHE B 1 138 ? -25.128 58.472 41.934 1.00 23.83 ? 138 PHE B N     1 
ATOM   2131 C  CA    . PHE B 1 138 ? -25.422 59.748 42.590 1.00 24.54 ? 138 PHE B CA    1 
ATOM   2132 C  C     . PHE B 1 138 ? -26.687 60.438 42.124 1.00 26.37 ? 138 PHE B C     1 
ATOM   2133 O  O     . PHE B 1 138 ? -26.972 60.464 40.931 1.00 27.37 ? 138 PHE B O     1 
ATOM   2134 C  CB    . PHE B 1 138 ? -24.295 60.756 42.343 1.00 23.14 ? 138 PHE B CB    1 
ATOM   2135 C  CG    . PHE B 1 138 ? -23.004 60.404 43.012 1.00 22.11 ? 138 PHE B CG    1 
ATOM   2136 C  CD1   . PHE B 1 138 ? -22.111 59.525 42.405 1.00 21.93 ? 138 PHE B CD1   1 
ATOM   2137 C  CD2   . PHE B 1 138 ? -22.685 60.946 44.260 1.00 23.47 ? 138 PHE B CD2   1 
ATOM   2138 C  CE1   . PHE B 1 138 ? -20.906 59.186 43.038 1.00 20.58 ? 138 PHE B CE1   1 
ATOM   2139 C  CE2   . PHE B 1 138 ? -21.479 60.612 44.905 1.00 21.51 ? 138 PHE B CE2   1 
ATOM   2140 C  CZ    . PHE B 1 138 ? -20.593 59.728 44.284 1.00 21.23 ? 138 PHE B CZ    1 
ATOM   2141 N  N     . LYS B 1 139 ? -27.429 61.005 43.070 1.00 27.94 ? 139 LYS B N     1 
ATOM   2142 C  CA    . LYS B 1 139 ? -28.622 61.775 42.721 1.00 29.85 ? 139 LYS B CA    1 
ATOM   2143 C  C     . LYS B 1 139 ? -28.015 63.138 42.395 1.00 29.18 ? 139 LYS B C     1 
ATOM   2144 O  O     . LYS B 1 139 ? -26.962 63.500 42.929 1.00 28.79 ? 139 LYS B O     1 
ATOM   2145 C  CB    . LYS B 1 139 ? -29.577 61.931 43.904 1.00 31.83 ? 139 LYS B CB    1 
ATOM   2146 C  CG    . LYS B 1 139 ? -30.164 60.641 44.456 1.00 36.38 ? 139 LYS B CG    1 
ATOM   2147 C  CD    . LYS B 1 139 ? -31.268 60.974 45.481 1.00 41.10 ? 139 LYS B CD    1 
ATOM   2148 C  CE    . LYS B 1 139 ? -31.817 59.739 46.196 1.00 43.71 ? 139 LYS B CE    1 
ATOM   2149 N  NZ    . LYS B 1 139 ? -30.845 59.143 47.175 1.00 46.08 ? 139 LYS B NZ    1 
ATOM   2150 N  N     . PRO B 1 140 ? -28.654 63.905 41.505 1.00 29.46 ? 140 PRO B N     1 
ATOM   2151 C  CA    . PRO B 1 140 ? -28.136 65.221 41.133 1.00 28.49 ? 140 PRO B CA    1 
ATOM   2152 C  C     . PRO B 1 140 ? -27.747 66.085 42.314 1.00 27.86 ? 140 PRO B C     1 
ATOM   2153 O  O     . PRO B 1 140 ? -26.735 66.766 42.271 1.00 27.15 ? 140 PRO B O     1 
ATOM   2154 C  CB    . PRO B 1 140 ? -29.293 65.827 40.335 1.00 29.35 ? 140 PRO B CB    1 
ATOM   2155 C  CG    . PRO B 1 140 ? -29.833 64.622 39.627 1.00 30.20 ? 140 PRO B CG    1 
ATOM   2156 C  CD    . PRO B 1 140 ? -29.855 63.570 40.721 1.00 28.51 ? 140 PRO B CD    1 
ATOM   2157 N  N     . GLU B 1 141 ? -28.552 66.045 43.367 1.00 27.06 ? 141 GLU B N     1 
ATOM   2158 C  CA    . GLU B 1 141 ? -28.303 66.866 44.547 1.00 28.03 ? 141 GLU B CA    1 
ATOM   2159 C  C     . GLU B 1 141 ? -27.010 66.543 45.289 1.00 26.45 ? 141 GLU B C     1 
ATOM   2160 O  O     . GLU B 1 141 ? -26.547 67.346 46.113 1.00 24.85 ? 141 GLU B O     1 
ATOM   2161 C  CB    . GLU B 1 141 ? -29.457 66.734 45.528 1.00 31.46 ? 141 GLU B CB    1 
ATOM   2162 C  CG    . GLU B 1 141 ? -29.901 65.320 45.714 1.00 35.24 ? 141 GLU B CG    1 
ATOM   2163 C  CD    . GLU B 1 141 ? -31.203 65.045 44.986 1.00 38.59 ? 141 GLU B CD    1 
ATOM   2164 O  OE1   . GLU B 1 141 ? -31.271 65.278 43.755 1.00 37.19 ? 141 GLU B OE1   1 
ATOM   2165 O  OE2   . GLU B 1 141 ? -32.165 64.596 45.659 1.00 42.78 ? 141 GLU B OE2   1 
ATOM   2166 N  N     . GLU B 1 142 ? -26.448 65.371 44.999 1.00 24.02 ? 142 GLU B N     1 
ATOM   2167 C  CA    . GLU B 1 142 ? -25.213 64.928 45.635 1.00 23.77 ? 142 GLU B CA    1 
ATOM   2168 C  C     . GLU B 1 142 ? -23.973 65.353 44.861 1.00 24.71 ? 142 GLU B C     1 
ATOM   2169 O  O     . GLU B 1 142 ? -22.858 65.044 45.274 1.00 23.05 ? 142 GLU B O     1 
ATOM   2170 C  CB    . GLU B 1 142 ? -25.190 63.406 45.750 1.00 24.38 ? 142 GLU B CB    1 
ATOM   2171 C  CG    . GLU B 1 142 ? -26.321 62.798 46.558 1.00 26.28 ? 142 GLU B CG    1 
ATOM   2172 C  CD    . GLU B 1 142 ? -26.291 61.291 46.530 1.00 26.09 ? 142 GLU B CD    1 
ATOM   2173 O  OE1   . GLU B 1 142 ? -26.563 60.685 45.485 1.00 29.15 ? 142 GLU B OE1   1 
ATOM   2174 O  OE2   . GLU B 1 142 ? -25.996 60.694 47.569 1.00 32.59 ? 142 GLU B OE2   1 
ATOM   2175 N  N     . LEU B 1 143 ? -24.181 66.033 43.732 1.00 23.52 ? 143 LEU B N     1 
ATOM   2176 C  CA    . LEU B 1 143 ? -23.092 66.495 42.873 1.00 23.39 ? 143 LEU B CA    1 
ATOM   2177 C  C     . LEU B 1 143 ? -23.005 67.998 42.876 1.00 24.48 ? 143 LEU B C     1 
ATOM   2178 O  O     . LEU B 1 143 ? -24.019 68.694 42.796 1.00 23.85 ? 143 LEU B O     1 
ATOM   2179 C  CB    . LEU B 1 143 ? -23.312 66.012 41.439 1.00 22.18 ? 143 LEU B CB    1 
ATOM   2180 C  CG    . LEU B 1 143 ? -23.447 64.482 41.350 1.00 21.39 ? 143 LEU B CG    1 
ATOM   2181 C  CD1   . LEU B 1 143 ? -23.894 64.022 39.961 1.00 21.71 ? 143 LEU B CD1   1 
ATOM   2182 C  CD2   . LEU B 1 143 ? -22.096 63.890 41.700 1.00 21.77 ? 143 LEU B CD2   1 
ATOM   2183 N  N     . LEU B 1 144 ? -21.790 68.504 42.974 1.00 23.65 ? 144 LEU B N     1 
ATOM   2184 C  CA    . LEU B 1 144 ? -21.594 69.936 42.951 1.00 26.20 ? 144 LEU B CA    1 
ATOM   2185 C  C     . LEU B 1 144 ? -22.117 70.491 41.615 1.00 28.34 ? 144 LEU B C     1 
ATOM   2186 O  O     . LEU B 1 144 ? -22.053 69.822 40.582 1.00 27.27 ? 144 LEU B O     1 
ATOM   2187 C  CB    . LEU B 1 144 ? -20.104 70.270 43.080 1.00 25.27 ? 144 LEU B CB    1 
ATOM   2188 C  CG    . LEU B 1 144 ? -19.388 69.823 44.367 1.00 24.61 ? 144 LEU B CG    1 
ATOM   2189 C  CD1   . LEU B 1 144 ? -17.969 70.391 44.377 1.00 24.07 ? 144 LEU B CD1   1 
ATOM   2190 C  CD2   . LEU B 1 144 ? -20.165 70.306 45.595 1.00 25.85 ? 144 LEU B CD2   1 
ATOM   2191 N  N     . THR B 1 145 ? -22.650 71.704 41.641 1.00 30.29 ? 145 THR B N     1 
ATOM   2192 C  CA    . THR B 1 145 ? -23.098 72.304 40.395 1.00 35.39 ? 145 THR B CA    1 
ATOM   2193 C  C     . THR B 1 145 ? -22.096 73.417 40.108 1.00 37.92 ? 145 THR B C     1 
ATOM   2194 O  O     . THR B 1 145 ? -21.714 73.643 38.969 1.00 39.92 ? 145 THR B O     1 
ATOM   2195 C  CB    . THR B 1 145 ? -24.522 72.874 40.507 1.00 35.20 ? 145 THR B CB    1 
ATOM   2196 O  OG1   . THR B 1 145 ? -24.539 73.909 41.488 1.00 36.59 ? 145 THR B OG1   1 
ATOM   2197 C  CG2   . THR B 1 145 ? -25.500 71.778 40.944 1.00 35.12 ? 145 THR B CG2   1 
ATOM   2198 N  N     . GLU B 1 146 ? -21.634 74.079 41.163 1.00 41.05 ? 146 GLU B N     1 
ATOM   2199 C  CA    . GLU B 1 146 ? -20.672 75.157 40.993 1.00 44.55 ? 146 GLU B CA    1 
ATOM   2200 C  C     . GLU B 1 146 ? -19.203 74.745 41.039 1.00 44.68 ? 146 GLU B C     1 
ATOM   2201 O  O     . GLU B 1 146 ? -18.680 74.384 42.094 1.00 44.89 ? 146 GLU B O     1 
ATOM   2202 C  CB    . GLU B 1 146 ? -20.933 76.276 42.010 1.00 47.02 ? 146 GLU B CB    1 
ATOM   2203 C  CG    . GLU B 1 146 ? -22.138 77.132 41.634 1.00 51.67 ? 146 GLU B CG    1 
ATOM   2204 C  CD    . GLU B 1 146 ? -22.107 77.565 40.164 1.00 54.28 ? 146 GLU B CD    1 
ATOM   2205 O  OE1   . GLU B 1 146 ? -21.237 78.395 39.792 1.00 54.43 ? 146 GLU B OE1   1 
ATOM   2206 O  OE2   . GLU B 1 146 ? -22.949 77.062 39.377 1.00 55.96 ? 146 GLU B OE2   1 
ATOM   2207 N  N     . VAL B 1 147 ? -18.559 74.795 39.870 1.00 45.04 ? 147 VAL B N     1 
ATOM   2208 C  CA    . VAL B 1 147 ? -17.142 74.477 39.730 1.00 44.44 ? 147 VAL B CA    1 
ATOM   2209 C  C     . VAL B 1 147 ? -16.406 75.505 38.842 1.00 45.05 ? 147 VAL B C     1 
ATOM   2210 O  O     . VAL B 1 147 ? -16.288 75.330 37.624 1.00 47.23 ? 147 VAL B O     1 
ATOM   2211 C  CB    . VAL B 1 147 ? -16.924 73.066 39.135 1.00 43.45 ? 147 VAL B CB    1 
ATOM   2212 C  CG1   . VAL B 1 147 ? -15.445 72.759 39.097 1.00 42.04 ? 147 VAL B CG1   1 
ATOM   2213 C  CG2   . VAL B 1 147 ? -17.654 72.016 39.968 1.00 43.10 ? 147 VAL B CG2   1 
ATOM   2214 N  N     . LYS B 1 148 ? -15.943 76.584 39.464 1.00 44.84 ? 148 LYS B N     1 
ATOM   2215 C  CA    . LYS B 1 148 ? -15.177 77.649 38.808 1.00 45.29 ? 148 LYS B CA    1 
ATOM   2216 C  C     . LYS B 1 148 ? -13.802 77.026 38.567 1.00 44.09 ? 148 LYS B C     1 
ATOM   2217 O  O     . LYS B 1 148 ? -13.113 76.658 39.525 1.00 43.56 ? 148 LYS B O     1 
ATOM   2218 C  CB    . LYS B 1 148 ? -15.046 78.839 39.765 1.00 47.17 ? 148 LYS B CB    1 
ATOM   2219 C  CG    . LYS B 1 148 ? -16.346 79.627 40.029 1.00 50.42 ? 148 LYS B CG    1 
ATOM   2220 C  CD    . LYS B 1 148 ? -17.592 78.740 40.231 1.00 52.77 ? 148 LYS B CD    1 
ATOM   2221 C  CE    . LYS B 1 148 ? -17.506 77.847 41.478 1.00 53.60 ? 148 LYS B CE    1 
ATOM   2222 N  NZ    . LYS B 1 148 ? -17.578 78.604 42.758 1.00 54.85 ? 148 LYS B NZ    1 
ATOM   2223 N  N     . PRO B 1 149 ? -13.376 76.903 37.296 1.00 42.85 ? 149 PRO B N     1 
ATOM   2224 C  CA    . PRO B 1 149 ? -12.065 76.297 37.058 1.00 42.05 ? 149 PRO B CA    1 
ATOM   2225 C  C     . PRO B 1 149 ? -10.928 77.058 37.718 1.00 41.14 ? 149 PRO B C     1 
ATOM   2226 O  O     . PRO B 1 149 ? -10.914 78.293 37.767 1.00 40.25 ? 149 PRO B O     1 
ATOM   2227 C  CB    . PRO B 1 149 ? -11.959 76.293 35.540 1.00 42.70 ? 149 PRO B CB    1 
ATOM   2228 C  CG    . PRO B 1 149 ? -12.617 77.555 35.182 1.00 42.97 ? 149 PRO B CG    1 
ATOM   2229 C  CD    . PRO B 1 149 ? -13.869 77.544 36.066 1.00 43.00 ? 149 PRO B CD    1 
ATOM   2230 N  N     . ASN B 1 150 ? -9.982  76.303 38.253 1.00 38.83 ? 150 ASN B N     1 
ATOM   2231 C  CA    . ASN B 1 150 ? -8.844  76.902 38.906 1.00 36.14 ? 150 ASN B CA    1 
ATOM   2232 C  C     . ASN B 1 150 ? -7.977  77.567 37.830 1.00 34.31 ? 150 ASN B C     1 
ATOM   2233 O  O     . ASN B 1 150 ? -7.585  76.937 36.850 1.00 32.80 ? 150 ASN B O     1 
ATOM   2234 C  CB    . ASN B 1 150 ? -8.062  75.825 39.633 1.00 35.60 ? 150 ASN B CB    1 
ATOM   2235 C  CG    . ASN B 1 150 ? -6.992  76.397 40.495 1.00 36.32 ? 150 ASN B CG    1 
ATOM   2236 O  OD1   . ASN B 1 150 ? -6.257  77.286 40.071 1.00 36.21 ? 150 ASN B OD1   1 
ATOM   2237 N  ND2   . ASN B 1 150 ? -6.882  75.889 41.721 1.00 36.38 ? 150 ASN B ND2   1 
ATOM   2238 N  N     . PRO B 1 151 ? -7.669  78.852 38.000 1.00 32.78 ? 151 PRO B N     1 
ATOM   2239 C  CA    . PRO B 1 151 ? -6.845  79.532 36.998 1.00 32.26 ? 151 PRO B CA    1 
ATOM   2240 C  C     . PRO B 1 151 ? -5.409  78.982 36.932 1.00 30.16 ? 151 PRO B C     1 
ATOM   2241 O  O     . PRO B 1 151 ? -4.675  79.244 35.965 1.00 28.48 ? 151 PRO B O     1 
ATOM   2242 C  CB    . PRO B 1 151 ? -6.914  80.993 37.443 1.00 33.86 ? 151 PRO B CB    1 
ATOM   2243 C  CG    . PRO B 1 151 ? -7.034  80.884 38.943 1.00 35.11 ? 151 PRO B CG    1 
ATOM   2244 C  CD    . PRO B 1 151 ? -8.031  79.755 39.104 1.00 34.61 ? 151 PRO B CD    1 
ATOM   2245 N  N     . ASN B 1 152 ? -4.998  78.238 37.965 1.00 26.58 ? 152 ASN B N     1 
ATOM   2246 C  CA    . ASN B 1 152 ? -3.655  77.648 37.971 1.00 25.65 ? 152 ASN B CA    1 
ATOM   2247 C  C     . ASN B 1 152 ? -3.674  76.316 37.237 1.00 23.08 ? 152 ASN B C     1 
ATOM   2248 O  O     . ASN B 1 152 ? -2.624  75.780 36.881 1.00 23.52 ? 152 ASN B O     1 
ATOM   2249 C  CB    . ASN B 1 152 ? -3.141  77.372 39.391 1.00 28.12 ? 152 ASN B CB    1 
ATOM   2250 C  CG    . ASN B 1 152 ? -2.838  78.638 40.172 1.00 29.75 ? 152 ASN B CG    1 
ATOM   2251 O  OD1   . ASN B 1 152 ? -2.339  79.620 39.615 1.00 28.54 ? 152 ASN B OD1   1 
ATOM   2252 N  ND2   . ASN B 1 152 ? -3.113  78.609 41.481 1.00 30.61 ? 152 ASN B ND2   1 
ATOM   2253 N  N     . LEU B 1 153 ? -4.853  75.751 37.037 1.00 21.08 ? 153 LEU B N     1 
ATOM   2254 C  CA    . LEU B 1 153 ? -4.897  74.475 36.349 1.00 21.43 ? 153 LEU B CA    1 
ATOM   2255 C  C     . LEU B 1 153 ? -5.341  74.615 34.909 1.00 19.75 ? 153 LEU B C     1 
ATOM   2256 O  O     . LEU B 1 153 ? -5.001  73.786 34.060 1.00 19.49 ? 153 LEU B O     1 
ATOM   2257 C  CB    . LEU B 1 153 ? -5.840  73.509 37.054 1.00 23.94 ? 153 LEU B CB    1 
ATOM   2258 C  CG    . LEU B 1 153 ? -5.345  72.696 38.247 1.00 25.40 ? 153 LEU B CG    1 
ATOM   2259 C  CD1   . LEU B 1 153 ? -6.575  72.029 38.866 1.00 30.16 ? 153 LEU B CD1   1 
ATOM   2260 C  CD2   . LEU B 1 153 ? -4.351  71.636 37.795 1.00 26.78 ? 153 LEU B CD2   1 
ATOM   2261 N  N     . TYR B 1 154 ? -6.103  75.662 34.631 1.00 21.84 ? 154 TYR B N     1 
ATOM   2262 C  CA    . TYR B 1 154 ? -6.626  75.853 33.279 1.00 22.60 ? 154 TYR B CA    1 
ATOM   2263 C  C     . TYR B 1 154 ? -6.347  77.205 32.654 1.00 23.73 ? 154 TYR B C     1 
ATOM   2264 O  O     . TYR B 1 154 ? -6.401  78.218 33.326 1.00 24.25 ? 154 TYR B O     1 
ATOM   2265 C  CB    . TYR B 1 154 ? -8.137  75.659 33.307 1.00 24.33 ? 154 TYR B CB    1 
ATOM   2266 C  CG    . TYR B 1 154 ? -8.548  74.255 33.636 1.00 22.67 ? 154 TYR B CG    1 
ATOM   2267 C  CD1   . TYR B 1 154 ? -8.408  73.220 32.694 1.00 22.83 ? 154 TYR B CD1   1 
ATOM   2268 C  CD2   . TYR B 1 154 ? -9.074  73.950 34.879 1.00 22.96 ? 154 TYR B CD2   1 
ATOM   2269 C  CE1   . TYR B 1 154 ? -8.793  71.917 33.002 1.00 22.96 ? 154 TYR B CE1   1 
ATOM   2270 C  CE2   . TYR B 1 154 ? -9.464  72.665 35.195 1.00 23.58 ? 154 TYR B CE2   1 
ATOM   2271 C  CZ    . TYR B 1 154 ? -9.322  71.655 34.255 1.00 22.05 ? 154 TYR B CZ    1 
ATOM   2272 O  OH    . TYR B 1 154 ? -9.706  70.393 34.583 1.00 22.31 ? 154 TYR B OH    1 
ATOM   2273 N  N     . GLU B 1 155 ? -6.055  77.204 31.363 1.00 26.04 ? 155 GLU B N     1 
ATOM   2274 C  CA    . GLU B 1 155 ? -5.815  78.440 30.620 1.00 29.18 ? 155 GLU B CA    1 
ATOM   2275 C  C     . GLU B 1 155 ? -7.171  79.112 30.460 1.00 30.33 ? 155 GLU B C     1 
ATOM   2276 O  O     . GLU B 1 155 ? -7.262  80.364 30.550 1.00 30.99 ? 155 GLU B O     1 
ATOM   2277 C  CB    . GLU B 1 155 ? -5.241  78.088 29.260 1.00 31.19 ? 155 GLU B CB    1 
ATOM   2278 C  CG    . GLU B 1 155 ? -4.737  79.253 28.465 1.00 36.85 ? 155 GLU B CG    1 
ATOM   2279 C  CD    . GLU B 1 155 ? -3.637  78.798 27.541 1.00 37.58 ? 155 GLU B CD    1 
ATOM   2280 O  OE1   . GLU B 1 155 ? -3.834  77.749 26.881 1.00 37.07 ? 155 GLU B OE1   1 
ATOM   2281 O  OE2   . GLU B 1 155 ? -2.590  79.479 27.495 1.00 39.80 ? 155 GLU B OE2   1 
ATOM   2282 O  OXT   . GLU B 1 155 ? -8.144  78.352 30.248 1.00 29.51 ? 155 GLU B OXT   1 
ATOM   2283 N  N     . VAL C 1 6   ? 0.359   30.881 40.738 1.00 36.70 ? 6   VAL C N     1 
ATOM   2284 C  CA    . VAL C 1 6   ? 0.100   30.694 42.186 1.00 35.45 ? 6   VAL C CA    1 
ATOM   2285 C  C     . VAL C 1 6   ? 0.585   31.908 42.956 1.00 33.58 ? 6   VAL C C     1 
ATOM   2286 O  O     . VAL C 1 6   ? 1.569   32.549 42.594 1.00 32.76 ? 6   VAL C O     1 
ATOM   2287 C  CB    . VAL C 1 6   ? 0.836   29.445 42.749 1.00 37.50 ? 6   VAL C CB    1 
ATOM   2288 C  CG1   . VAL C 1 6   ? 2.352   29.692 42.796 1.00 38.91 ? 6   VAL C CG1   1 
ATOM   2289 C  CG2   . VAL C 1 6   ? 0.322   29.111 44.146 1.00 38.79 ? 6   VAL C CG2   1 
ATOM   2290 N  N     . ASN C 1 7   ? -0.111  32.194 44.040 1.00 30.70 ? 7   ASN C N     1 
ATOM   2291 C  CA    . ASN C 1 7   ? 0.224   33.310 44.889 1.00 30.71 ? 7   ASN C CA    1 
ATOM   2292 C  C     . ASN C 1 7   ? 1.451   33.026 45.759 1.00 29.18 ? 7   ASN C C     1 
ATOM   2293 O  O     . ASN C 1 7   ? 1.843   33.862 46.568 1.00 30.05 ? 7   ASN C O     1 
ATOM   2294 C  CB    . ASN C 1 7   ? -1.015  33.672 45.717 1.00 30.62 ? 7   ASN C CB    1 
ATOM   2295 C  CG    . ASN C 1 7   ? -2.258  33.868 44.829 1.00 33.47 ? 7   ASN C CG    1 
ATOM   2296 O  OD1   . ASN C 1 7   ? -2.131  34.258 43.672 1.00 35.76 ? 7   ASN C OD1   1 
ATOM   2297 N  ND2   . ASN C 1 7   ? -3.448  33.610 45.368 1.00 31.00 ? 7   ASN C ND2   1 
ATOM   2298 N  N     . LYS C 1 8   ? 2.089   31.867 45.585 1.00 27.39 ? 8   LYS C N     1 
ATOM   2299 C  CA    . LYS C 1 8   ? 3.274   31.591 46.384 1.00 25.81 ? 8   LYS C CA    1 
ATOM   2300 C  C     . LYS C 1 8   ? 4.600   31.732 45.630 1.00 24.47 ? 8   LYS C C     1 
ATOM   2301 O  O     . LYS C 1 8   ? 5.642   31.324 46.122 1.00 23.73 ? 8   LYS C O     1 
ATOM   2302 C  CB    . LYS C 1 8   ? 3.167   30.210 47.047 1.00 28.44 ? 8   LYS C CB    1 
ATOM   2303 C  CG    . LYS C 1 8   ? 2.138   30.194 48.178 1.00 31.38 ? 8   LYS C CG    1 
ATOM   2304 C  CD    . LYS C 1 8   ? 2.234   28.943 49.036 1.00 34.52 ? 8   LYS C CD    1 
ATOM   2305 C  CE    . LYS C 1 8   ? 2.175   29.316 50.510 1.00 36.40 ? 8   LYS C CE    1 
ATOM   2306 N  NZ    . LYS C 1 8   ? 3.249   30.285 50.923 1.00 33.75 ? 8   LYS C NZ    1 
ATOM   2307 N  N     . GLU C 1 9   ? 4.564   32.313 44.433 1.00 23.49 ? 9   GLU C N     1 
ATOM   2308 C  CA    . GLU C 1 9   ? 5.793   32.543 43.666 1.00 22.14 ? 9   GLU C CA    1 
ATOM   2309 C  C     . GLU C 1 9   ? 6.690   33.461 44.506 1.00 20.91 ? 9   GLU C C     1 
ATOM   2310 O  O     . GLU C 1 9   ? 6.187   34.290 45.258 1.00 21.26 ? 9   GLU C O     1 
ATOM   2311 C  CB    . GLU C 1 9   ? 5.444   33.235 42.348 1.00 22.35 ? 9   GLU C CB    1 
ATOM   2312 C  CG    . GLU C 1 9   ? 6.634   33.544 41.468 1.00 23.19 ? 9   GLU C CG    1 
ATOM   2313 C  CD    . GLU C 1 9   ? 6.184   34.039 40.118 1.00 24.78 ? 9   GLU C CD    1 
ATOM   2314 O  OE1   . GLU C 1 9   ? 5.424   33.300 39.453 1.00 26.04 ? 9   GLU C OE1   1 
ATOM   2315 O  OE2   . GLU C 1 9   ? 6.579   35.158 39.723 1.00 23.27 ? 9   GLU C OE2   1 
ATOM   2316 N  N     . ARG C 1 10  ? 8.003   33.304 44.394 1.00 21.06 ? 10  ARG C N     1 
ATOM   2317 C  CA    . ARG C 1 10  ? 8.930   34.125 45.144 1.00 21.23 ? 10  ARG C CA    1 
ATOM   2318 C  C     . ARG C 1 10  ? 10.008  34.676 44.233 1.00 21.51 ? 10  ARG C C     1 
ATOM   2319 O  O     . ARG C 1 10  ? 10.279  34.132 43.161 1.00 22.03 ? 10  ARG C O     1 
ATOM   2320 C  CB    . ARG C 1 10  ? 9.618   33.314 46.243 1.00 21.93 ? 10  ARG C CB    1 
ATOM   2321 C  CG    . ARG C 1 10  ? 8.663   32.796 47.319 1.00 19.68 ? 10  ARG C CG    1 
ATOM   2322 C  CD    . ARG C 1 10  ? 9.365   31.943 48.385 1.00 21.70 ? 10  ARG C CD    1 
ATOM   2323 N  NE    . ARG C 1 10  ? 8.448   31.686 49.497 1.00 23.29 ? 10  ARG C NE    1 
ATOM   2324 C  CZ    . ARG C 1 10  ? 8.773   31.077 50.634 1.00 22.81 ? 10  ARG C CZ    1 
ATOM   2325 N  NH1   . ARG C 1 10  ? 10.008  30.637 50.833 1.00 22.04 ? 10  ARG C NH1   1 
ATOM   2326 N  NH2   . ARG C 1 10  ? 7.861   30.961 51.603 1.00 24.31 ? 10  ARG C NH2   1 
ATOM   2327 N  N     . THR C 1 11  ? 10.630  35.754 44.679 1.00 20.33 ? 11  THR C N     1 
ATOM   2328 C  CA    . THR C 1 11  ? 11.718  36.339 43.942 1.00 19.96 ? 11  THR C CA    1 
ATOM   2329 C  C     . THR C 1 11  ? 12.752  36.844 44.930 1.00 19.67 ? 11  THR C C     1 
ATOM   2330 O  O     . THR C 1 11  ? 12.453  37.095 46.121 1.00 19.78 ? 11  THR C O     1 
ATOM   2331 C  CB    . THR C 1 11  ? 11.241  37.489 42.993 1.00 21.71 ? 11  THR C CB    1 
ATOM   2332 O  OG1   . THR C 1 11  ? 12.320  37.849 42.113 1.00 21.25 ? 11  THR C OG1   1 
ATOM   2333 C  CG2   . THR C 1 11  ? 10.823  38.735 43.786 1.00 21.06 ? 11  THR C CG2   1 
ATOM   2334 N  N     . PHE C 1 12  ? 13.986  36.937 44.454 1.00 19.79 ? 12  PHE C N     1 
ATOM   2335 C  CA    . PHE C 1 12  ? 15.076  37.446 45.259 1.00 20.06 ? 12  PHE C CA    1 
ATOM   2336 C  C     . PHE C 1 12  ? 15.434  38.874 44.832 1.00 20.84 ? 12  PHE C C     1 
ATOM   2337 O  O     . PHE C 1 12  ? 15.623  39.152 43.637 1.00 20.98 ? 12  PHE C O     1 
ATOM   2338 C  CB    . PHE C 1 12  ? 16.312  36.565 45.112 1.00 19.63 ? 12  PHE C CB    1 
ATOM   2339 C  CG    . PHE C 1 12  ? 17.513  37.126 45.801 1.00 18.13 ? 12  PHE C CG    1 
ATOM   2340 C  CD1   . PHE C 1 12  ? 17.626  37.071 47.176 1.00 18.70 ? 12  PHE C CD1   1 
ATOM   2341 C  CD2   . PHE C 1 12  ? 18.463  37.844 45.082 1.00 19.42 ? 12  PHE C CD2   1 
ATOM   2342 C  CE1   . PHE C 1 12  ? 18.662  37.728 47.840 1.00 19.31 ? 12  PHE C CE1   1 
ATOM   2343 C  CE2   . PHE C 1 12  ? 19.493  38.498 45.723 1.00 22.08 ? 12  PHE C CE2   1 
ATOM   2344 C  CZ    . PHE C 1 12  ? 19.604  38.447 47.112 1.00 19.95 ? 12  PHE C CZ    1 
ATOM   2345 N  N     . LEU C 1 13  ? 15.537  39.775 45.809 1.00 20.88 ? 13  LEU C N     1 
ATOM   2346 C  CA    . LEU C 1 13  ? 15.893  41.162 45.521 1.00 19.21 ? 13  LEU C CA    1 
ATOM   2347 C  C     . LEU C 1 13  ? 17.004  41.547 46.476 1.00 20.56 ? 13  LEU C C     1 
ATOM   2348 O  O     . LEU C 1 13  ? 17.008  41.171 47.669 1.00 20.43 ? 13  LEU C O     1 
ATOM   2349 C  CB    . LEU C 1 13  ? 14.690  42.114 45.734 1.00 19.64 ? 13  LEU C CB    1 
ATOM   2350 C  CG    . LEU C 1 13  ? 13.361  41.782 45.042 1.00 19.04 ? 13  LEU C CG    1 
ATOM   2351 C  CD1   . LEU C 1 13  ? 12.297  42.775 45.532 1.00 20.98 ? 13  LEU C CD1   1 
ATOM   2352 C  CD2   . LEU C 1 13  ? 13.481  41.855 43.516 1.00 23.04 ? 13  LEU C CD2   1 
ATOM   2353 N  N     . ALA C 1 14  ? 17.974  42.272 45.952 1.00 20.25 ? 14  ALA C N     1 
ATOM   2354 C  CA    . ALA C 1 14  ? 19.070  42.737 46.776 1.00 21.86 ? 14  ALA C CA    1 
ATOM   2355 C  C     . ALA C 1 14  ? 19.226  44.235 46.634 1.00 20.94 ? 14  ALA C C     1 
ATOM   2356 O  O     . ALA C 1 14  ? 19.361  44.754 45.521 1.00 22.31 ? 14  ALA C O     1 
ATOM   2357 C  CB    . ALA C 1 14  ? 20.367  42.060 46.367 1.00 23.44 ? 14  ALA C CB    1 
ATOM   2358 N  N     . VAL C 1 15  ? 19.166  44.941 47.748 1.00 19.88 ? 15  VAL C N     1 
ATOM   2359 C  CA    . VAL C 1 15  ? 19.413  46.355 47.664 1.00 19.97 ? 15  VAL C CA    1 
ATOM   2360 C  C     . VAL C 1 15  ? 20.942  46.350 47.717 1.00 19.11 ? 15  VAL C C     1 
ATOM   2361 O  O     . VAL C 1 15  ? 21.556  45.938 48.706 1.00 19.02 ? 15  VAL C O     1 
ATOM   2362 C  CB    . VAL C 1 15  ? 18.827  47.106 48.839 1.00 19.51 ? 15  VAL C CB    1 
ATOM   2363 C  CG1   . VAL C 1 15  ? 19.242  48.599 48.764 1.00 20.45 ? 15  VAL C CG1   1 
ATOM   2364 C  CG2   . VAL C 1 15  ? 17.304  46.943 48.815 1.00 20.90 ? 15  VAL C CG2   1 
ATOM   2365 N  N     . LYS C 1 16  ? 21.546  46.801 46.624 1.00 20.45 ? 16  LYS C N     1 
ATOM   2366 C  CA    . LYS C 1 16  ? 22.986  46.815 46.487 1.00 19.87 ? 16  LYS C CA    1 
ATOM   2367 C  C     . LYS C 1 16  ? 23.683  47.794 47.405 1.00 18.81 ? 16  LYS C C     1 
ATOM   2368 O  O     . LYS C 1 16  ? 23.024  48.601 48.060 1.00 19.04 ? 16  LYS C O     1 
ATOM   2369 C  CB    . LYS C 1 16  ? 23.312  47.062 45.028 1.00 22.59 ? 16  LYS C CB    1 
ATOM   2370 C  CG    . LYS C 1 16  ? 22.812  45.948 44.166 1.00 23.43 ? 16  LYS C CG    1 
ATOM   2371 C  CD    . LYS C 1 16  ? 22.887  46.349 42.710 1.00 27.46 ? 16  LYS C CD    1 
ATOM   2372 C  CE    . LYS C 1 16  ? 22.505  45.185 41.827 1.00 27.25 ? 16  LYS C CE    1 
ATOM   2373 N  NZ    . LYS C 1 16  ? 22.556  45.582 40.396 1.00 29.23 ? 16  LYS C NZ    1 
ATOM   2374 N  N     . PRO C 1 17  ? 25.033  47.742 47.480 1.00 17.52 ? 17  PRO C N     1 
ATOM   2375 C  CA    . PRO C 1 17  ? 25.722  48.670 48.379 1.00 18.07 ? 17  PRO C CA    1 
ATOM   2376 C  C     . PRO C 1 17  ? 25.383  50.131 48.145 1.00 16.64 ? 17  PRO C C     1 
ATOM   2377 O  O     . PRO C 1 17  ? 25.358  50.924 49.079 1.00 17.60 ? 17  PRO C O     1 
ATOM   2378 C  CB    . PRO C 1 17  ? 27.207  48.358 48.152 1.00 18.01 ? 17  PRO C CB    1 
ATOM   2379 C  CG    . PRO C 1 17  ? 27.182  46.894 47.820 1.00 20.29 ? 17  PRO C CG    1 
ATOM   2380 C  CD    . PRO C 1 17  ? 25.968  46.752 46.918 1.00 19.98 ? 17  PRO C CD    1 
ATOM   2381 N  N     . ASP C 1 18  ? 25.143  50.492 46.898 1.00 17.99 ? 18  ASP C N     1 
ATOM   2382 C  CA    . ASP C 1 18  ? 24.798  51.875 46.623 1.00 16.90 ? 18  ASP C CA    1 
ATOM   2383 C  C     . ASP C 1 18  ? 23.398  52.189 47.174 1.00 15.71 ? 18  ASP C C     1 
ATOM   2384 O  O     . ASP C 1 18  ? 23.188  53.250 47.776 1.00 17.42 ? 18  ASP C O     1 
ATOM   2385 C  CB    . ASP C 1 18  ? 24.923  52.166 45.115 1.00 18.54 ? 18  ASP C CB    1 
ATOM   2386 C  CG    . ASP C 1 18  ? 24.084  51.262 44.249 1.00 20.21 ? 18  ASP C CG    1 
ATOM   2387 O  OD1   . ASP C 1 18  ? 24.105  50.022 44.407 1.00 22.08 ? 18  ASP C OD1   1 
ATOM   2388 O  OD2   . ASP C 1 18  ? 23.419  51.810 43.348 1.00 20.58 ? 18  ASP C OD2   1 
ATOM   2389 N  N     . GLY C 1 19  ? 22.454  51.268 46.978 1.00 15.95 ? 19  GLY C N     1 
ATOM   2390 C  CA    . GLY C 1 19  ? 21.111  51.478 47.513 1.00 16.24 ? 19  GLY C CA    1 
ATOM   2391 C  C     . GLY C 1 19  ? 21.147  51.593 49.025 1.00 16.81 ? 19  GLY C C     1 
ATOM   2392 O  O     . GLY C 1 19  ? 20.433  52.396 49.620 1.00 17.03 ? 19  GLY C O     1 
ATOM   2393 N  N     . VAL C 1 20  ? 21.982  50.783 49.672 1.00 15.68 ? 20  VAL C N     1 
ATOM   2394 C  CA    . VAL C 1 20  ? 22.063  50.847 51.126 1.00 17.08 ? 20  VAL C CA    1 
ATOM   2395 C  C     . VAL C 1 20  ? 22.765  52.116 51.568 1.00 18.38 ? 20  VAL C C     1 
ATOM   2396 O  O     . VAL C 1 20  ? 22.296  52.814 52.459 1.00 18.60 ? 20  VAL C O     1 
ATOM   2397 C  CB    . VAL C 1 20  ? 22.812  49.607 51.708 1.00 17.24 ? 20  VAL C CB    1 
ATOM   2398 C  CG1   . VAL C 1 20  ? 22.954  49.731 53.188 1.00 17.71 ? 20  VAL C CG1   1 
ATOM   2399 C  CG2   . VAL C 1 20  ? 22.081  48.316 51.323 1.00 17.75 ? 20  VAL C CG2   1 
ATOM   2400 N  N     . ALA C 1 21  ? 23.893  52.428 50.931 1.00 18.65 ? 21  ALA C N     1 
ATOM   2401 C  CA    . ALA C 1 21  ? 24.660  53.614 51.308 1.00 19.56 ? 21  ALA C CA    1 
ATOM   2402 C  C     . ALA C 1 21  ? 23.831  54.895 51.202 1.00 19.09 ? 21  ALA C C     1 
ATOM   2403 O  O     . ALA C 1 21  ? 23.984  55.835 52.003 1.00 19.79 ? 21  ALA C O     1 
ATOM   2404 C  CB    . ALA C 1 21  ? 25.904  53.731 50.411 1.00 18.88 ? 21  ALA C CB    1 
ATOM   2405 N  N     . ARG C 1 22  ? 22.959  54.917 50.210 1.00 19.32 ? 22  ARG C N     1 
ATOM   2406 C  CA    . ARG C 1 22  ? 22.120  56.083 49.949 1.00 17.80 ? 22  ARG C CA    1 
ATOM   2407 C  C     . ARG C 1 22  ? 20.871  56.190 50.811 1.00 19.23 ? 22  ARG C C     1 
ATOM   2408 O  O     . ARG C 1 22  ? 20.088  57.136 50.655 1.00 18.19 ? 22  ARG C O     1 
ATOM   2409 C  CB    . ARG C 1 22  ? 21.728  56.103 48.477 1.00 17.65 ? 22  ARG C CB    1 
ATOM   2410 C  CG    . ARG C 1 22  ? 22.933  56.293 47.544 1.00 19.41 ? 22  ARG C CG    1 
ATOM   2411 C  CD    . ARG C 1 22  ? 22.532  56.264 46.090 1.00 20.66 ? 22  ARG C CD    1 
ATOM   2412 N  NE    . ARG C 1 22  ? 21.594  57.352 45.794 1.00 20.32 ? 22  ARG C NE    1 
ATOM   2413 C  CZ    . ARG C 1 22  ? 20.752  57.347 44.770 1.00 19.85 ? 22  ARG C CZ    1 
ATOM   2414 N  NH1   . ARG C 1 22  ? 20.731  56.309 43.942 1.00 20.17 ? 22  ARG C NH1   1 
ATOM   2415 N  NH2   . ARG C 1 22  ? 19.906  58.371 44.597 1.00 19.65 ? 22  ARG C NH2   1 
ATOM   2416 N  N     . GLY C 1 23  ? 20.682  55.226 51.705 1.00 17.81 ? 23  GLY C N     1 
ATOM   2417 C  CA    . GLY C 1 23  ? 19.510  55.239 52.575 1.00 18.00 ? 23  GLY C CA    1 
ATOM   2418 C  C     . GLY C 1 23  ? 18.205  54.938 51.868 1.00 17.54 ? 23  GLY C C     1 
ATOM   2419 O  O     . GLY C 1 23  ? 17.170  55.546 52.168 1.00 18.33 ? 23  GLY C O     1 
ATOM   2420 N  N     . LEU C 1 24  ? 18.222  53.972 50.960 1.00 14.76 ? 24  LEU C N     1 
ATOM   2421 C  CA    . LEU C 1 24  ? 17.022  53.623 50.200 1.00 15.32 ? 24  LEU C CA    1 
ATOM   2422 C  C     . LEU C 1 24  ? 16.402  52.284 50.581 1.00 14.38 ? 24  LEU C C     1 
ATOM   2423 O  O     . LEU C 1 24  ? 15.453  51.843 49.961 1.00 14.32 ? 24  LEU C O     1 
ATOM   2424 C  CB    . LEU C 1 24  ? 17.356  53.594 48.706 1.00 15.34 ? 24  LEU C CB    1 
ATOM   2425 C  CG    . LEU C 1 24  ? 17.765  54.968 48.148 1.00 16.78 ? 24  LEU C CG    1 
ATOM   2426 C  CD1   . LEU C 1 24  ? 18.295  54.822 46.711 1.00 16.05 ? 24  LEU C CD1   1 
ATOM   2427 C  CD2   . LEU C 1 24  ? 16.524  55.889 48.174 1.00 19.36 ? 24  LEU C CD2   1 
ATOM   2428 N  N     . VAL C 1 25  ? 16.933  51.633 51.604 1.00 15.21 ? 25  VAL C N     1 
ATOM   2429 C  CA    . VAL C 1 25  ? 16.385  50.327 51.964 1.00 14.14 ? 25  VAL C CA    1 
ATOM   2430 C  C     . VAL C 1 25  ? 14.889  50.371 52.283 1.00 13.17 ? 25  VAL C C     1 
ATOM   2431 O  O     . VAL C 1 25  ? 14.106  49.617 51.715 1.00 13.06 ? 25  VAL C O     1 
ATOM   2432 C  CB    . VAL C 1 25  ? 17.133  49.737 53.190 1.00 15.22 ? 25  VAL C CB    1 
ATOM   2433 C  CG1   . VAL C 1 25  ? 16.572  48.359 53.531 1.00 15.42 ? 25  VAL C CG1   1 
ATOM   2434 C  CG2   . VAL C 1 25  ? 18.625  49.601 52.840 1.00 15.23 ? 25  VAL C CG2   1 
ATOM   2435 N  N     . GLY C 1 26  ? 14.514  51.255 53.201 1.00 15.25 ? 26  GLY C N     1 
ATOM   2436 C  CA    . GLY C 1 26  ? 13.129  51.356 53.611 1.00 13.95 ? 26  GLY C CA    1 
ATOM   2437 C  C     . GLY C 1 26  ? 12.199  51.753 52.482 1.00 15.04 ? 26  GLY C C     1 
ATOM   2438 O  O     . GLY C 1 26  ? 11.114  51.218 52.353 1.00 12.86 ? 26  GLY C O     1 
ATOM   2439 N  N     . GLU C 1 27  ? 12.625  52.717 51.677 1.00 14.41 ? 27  GLU C N     1 
ATOM   2440 C  CA    . GLU C 1 27  ? 11.829  53.158 50.544 1.00 14.68 ? 27  GLU C CA    1 
ATOM   2441 C  C     . GLU C 1 27  ? 11.542  51.979 49.615 1.00 14.42 ? 27  GLU C C     1 
ATOM   2442 O  O     . GLU C 1 27  ? 10.442  51.822 49.108 1.00 13.02 ? 27  GLU C O     1 
ATOM   2443 C  CB    . GLU C 1 27  ? 12.603  54.248 49.782 1.00 15.38 ? 27  GLU C CB    1 
ATOM   2444 C  CG    . GLU C 1 27  ? 12.099  54.498 48.351 1.00 21.13 ? 27  GLU C CG    1 
ATOM   2445 C  CD    . GLU C 1 27  ? 10.844  55.345 48.284 1.00 24.69 ? 27  GLU C CD    1 
ATOM   2446 O  OE1   . GLU C 1 27  ? 10.543  56.058 49.268 1.00 26.89 ? 27  GLU C OE1   1 
ATOM   2447 O  OE2   . GLU C 1 27  ? 10.160  55.326 47.235 1.00 21.96 ? 27  GLU C OE2   1 
ATOM   2448 N  N     . ILE C 1 28  ? 12.557  51.158 49.368 1.00 14.13 ? 28  ILE C N     1 
ATOM   2449 C  CA    . ILE C 1 28  ? 12.399  50.032 48.463 1.00 13.98 ? 28  ILE C CA    1 
ATOM   2450 C  C     . ILE C 1 28  ? 11.507  48.956 49.048 1.00 12.92 ? 28  ILE C C     1 
ATOM   2451 O  O     . ILE C 1 28  ? 10.605  48.466 48.391 1.00 14.92 ? 28  ILE C O     1 
ATOM   2452 C  CB    . ILE C 1 28  ? 13.784  49.445 48.100 1.00 15.65 ? 28  ILE C CB    1 
ATOM   2453 C  CG1   . ILE C 1 28  ? 14.494  50.412 47.140 1.00 17.63 ? 28  ILE C CG1   1 
ATOM   2454 C  CG2   . ILE C 1 28  ? 13.643  48.047 47.519 1.00 16.16 ? 28  ILE C CG2   1 
ATOM   2455 C  CD1   . ILE C 1 28  ? 16.005  50.187 47.044 1.00 16.88 ? 28  ILE C CD1   1 
ATOM   2456 N  N     . ILE C 1 29  ? 11.760  48.594 50.292 1.00 11.96 ? 29  ILE C N     1 
ATOM   2457 C  CA    . ILE C 1 29  ? 10.923  47.583 50.930 1.00 13.55 ? 29  ILE C CA    1 
ATOM   2458 C  C     . ILE C 1 29  ? 9.478   48.072 50.921 1.00 14.28 ? 29  ILE C C     1 
ATOM   2459 O  O     . ILE C 1 29  ? 8.547   47.306 50.618 1.00 12.85 ? 29  ILE C O     1 
ATOM   2460 C  CB    . ILE C 1 29  ? 11.399  47.330 52.366 1.00 13.67 ? 29  ILE C CB    1 
ATOM   2461 C  CG1   . ILE C 1 29  ? 12.748  46.610 52.308 1.00 15.20 ? 29  ILE C CG1   1 
ATOM   2462 C  CG2   . ILE C 1 29  ? 10.362  46.516 53.173 1.00 12.31 ? 29  ILE C CG2   1 
ATOM   2463 C  CD1   . ILE C 1 29  ? 13.434  46.410 53.682 1.00 16.35 ? 29  ILE C CD1   1 
ATOM   2464 N  N     . ALA C 1 30  ? 9.299   49.372 51.175 1.00 13.88 ? 30  ALA C N     1 
ATOM   2465 C  CA    . ALA C 1 30  ? 7.952   49.926 51.244 1.00 15.05 ? 30  ALA C CA    1 
ATOM   2466 C  C     . ALA C 1 30  ? 7.217   49.792 49.933 1.00 15.42 ? 30  ALA C C     1 
ATOM   2467 O  O     . ALA C 1 30  ? 6.017   49.548 49.921 1.00 15.29 ? 30  ALA C O     1 
ATOM   2468 C  CB    . ALA C 1 30  ? 8.000   51.392 51.689 1.00 14.60 ? 30  ALA C CB    1 
ATOM   2469 N  N     . ARG C 1 31  ? 7.933   49.948 48.817 1.00 14.52 ? 31  ARG C N     1 
ATOM   2470 C  CA    . ARG C 1 31  ? 7.275   49.815 47.537 1.00 13.44 ? 31  ARG C CA    1 
ATOM   2471 C  C     . ARG C 1 31  ? 6.711   48.426 47.350 1.00 11.49 ? 31  ARG C C     1 
ATOM   2472 O  O     . ARG C 1 31  ? 5.588   48.283 46.886 1.00 12.78 ? 31  ARG C O     1 
ATOM   2473 C  CB    . ARG C 1 31  ? 8.238   50.136 46.394 1.00 12.74 ? 31  ARG C CB    1 
ATOM   2474 C  CG    . ARG C 1 31  ? 8.564   51.601 46.353 1.00 16.06 ? 31  ARG C CG    1 
ATOM   2475 C  CD    . ARG C 1 31  ? 9.543   51.879 45.233 1.00 17.98 ? 31  ARG C CD    1 
ATOM   2476 N  NE    . ARG C 1 31  ? 9.859   53.298 45.180 1.00 18.32 ? 31  ARG C NE    1 
ATOM   2477 C  CZ    . ARG C 1 31  ? 9.831   54.010 44.050 1.00 18.74 ? 31  ARG C CZ    1 
ATOM   2478 N  NH1   . ARG C 1 31  ? 9.505   53.413 42.908 1.00 16.98 ? 31  ARG C NH1   1 
ATOM   2479 N  NH2   . ARG C 1 31  ? 10.079  55.315 44.086 1.00 18.27 ? 31  ARG C NH2   1 
ATOM   2480 N  N     . TYR C 1 32  ? 7.473   47.405 47.733 1.00 12.94 ? 32  TYR C N     1 
ATOM   2481 C  CA    . TYR C 1 32  ? 6.990   46.046 47.576 1.00 14.08 ? 32  TYR C CA    1 
ATOM   2482 C  C     . TYR C 1 32  ? 5.881   45.725 48.592 1.00 12.84 ? 32  TYR C C     1 
ATOM   2483 O  O     . TYR C 1 32  ? 4.961   44.979 48.272 1.00 15.91 ? 32  TYR C O     1 
ATOM   2484 C  CB    . TYR C 1 32  ? 8.142   45.079 47.673 1.00 14.57 ? 32  TYR C CB    1 
ATOM   2485 C  CG    . TYR C 1 32  ? 9.010   45.196 46.446 1.00 13.77 ? 32  TYR C CG    1 
ATOM   2486 C  CD1   . TYR C 1 32  ? 8.560   44.738 45.209 1.00 15.01 ? 32  TYR C CD1   1 
ATOM   2487 C  CD2   . TYR C 1 32  ? 10.245  45.838 46.511 1.00 16.12 ? 32  TYR C CD2   1 
ATOM   2488 C  CE1   . TYR C 1 32  ? 9.348   44.926 44.041 1.00 15.23 ? 32  TYR C CE1   1 
ATOM   2489 C  CE2   . TYR C 1 32  ? 11.009  46.029 45.378 1.00 16.46 ? 32  TYR C CE2   1 
ATOM   2490 C  CZ    . TYR C 1 32  ? 10.554  45.566 44.150 1.00 14.85 ? 32  TYR C CZ    1 
ATOM   2491 O  OH    . TYR C 1 32  ? 11.349  45.712 43.042 1.00 16.74 ? 32  TYR C OH    1 
ATOM   2492 N  N     . GLU C 1 33  ? 5.939   46.305 49.783 1.00 13.81 ? 33  GLU C N     1 
ATOM   2493 C  CA    . GLU C 1 33  ? 4.864   46.047 50.750 1.00 14.27 ? 33  GLU C CA    1 
ATOM   2494 C  C     . GLU C 1 33  ? 3.555   46.682 50.258 1.00 15.17 ? 33  GLU C C     1 
ATOM   2495 O  O     . GLU C 1 33  ? 2.486   46.060 50.298 1.00 14.16 ? 33  GLU C O     1 
ATOM   2496 C  CB    . GLU C 1 33  ? 5.205   46.628 52.105 1.00 10.80 ? 33  GLU C CB    1 
ATOM   2497 C  CG    . GLU C 1 33  ? 6.360   45.917 52.852 1.00 13.63 ? 33  GLU C CG    1 
ATOM   2498 C  CD    . GLU C 1 33  ? 6.691   46.644 54.121 1.00 12.97 ? 33  GLU C CD    1 
ATOM   2499 O  OE1   . GLU C 1 33  ? 7.225   47.772 54.042 1.00 13.75 ? 33  GLU C OE1   1 
ATOM   2500 O  OE2   . GLU C 1 33  ? 6.382   46.110 55.203 1.00 14.89 ? 33  GLU C OE2   1 
ATOM   2501 N  N     . LYS C 1 34  ? 3.652   47.915 49.752 1.00 13.52 ? 34  LYS C N     1 
ATOM   2502 C  CA    . LYS C 1 34  ? 2.457   48.614 49.271 1.00 13.79 ? 34  LYS C CA    1 
ATOM   2503 C  C     . LYS C 1 34  ? 1.755   47.844 48.159 1.00 15.16 ? 34  LYS C C     1 
ATOM   2504 O  O     . LYS C 1 34  ? 0.529   47.884 48.045 1.00 13.23 ? 34  LYS C O     1 
ATOM   2505 C  CB    . LYS C 1 34  ? 2.838   49.989 48.731 1.00 17.49 ? 34  LYS C CB    1 
ATOM   2506 C  CG    . LYS C 1 34  ? 3.114   51.022 49.772 1.00 21.73 ? 34  LYS C CG    1 
ATOM   2507 C  CD    . LYS C 1 34  ? 3.669   52.253 49.064 1.00 26.61 ? 34  LYS C CD    1 
ATOM   2508 C  CE    . LYS C 1 34  ? 3.660   53.476 49.976 1.00 30.63 ? 34  LYS C CE    1 
ATOM   2509 N  NZ    . LYS C 1 34  ? 4.207   53.146 51.314 1.00 31.84 ? 34  LYS C NZ    1 
ATOM   2510 N  N     . LYS C 1 35  ? 2.561   47.159 47.348 1.00 15.29 ? 35  LYS C N     1 
ATOM   2511 C  CA    . LYS C 1 35  ? 2.108   46.362 46.218 1.00 15.53 ? 35  LYS C CA    1 
ATOM   2512 C  C     . LYS C 1 35  ? 1.338   45.137 46.691 1.00 18.82 ? 35  LYS C C     1 
ATOM   2513 O  O     . LYS C 1 35  ? 0.499   44.609 45.967 1.00 18.92 ? 35  LYS C O     1 
ATOM   2514 C  CB    . LYS C 1 35  ? 3.331   45.928 45.412 1.00 16.30 ? 35  LYS C CB    1 
ATOM   2515 C  CG    . LYS C 1 35  ? 3.041   45.146 44.122 1.00 15.21 ? 35  LYS C CG    1 
ATOM   2516 C  CD    . LYS C 1 35  ? 2.188   45.981 43.128 1.00 14.78 ? 35  LYS C CD    1 
ATOM   2517 C  CE    . LYS C 1 35  ? 2.362   45.428 41.703 1.00 15.99 ? 35  LYS C CE    1 
ATOM   2518 N  NZ    . LYS C 1 35  ? 1.458   45.961 40.645 1.00 17.94 ? 35  LYS C NZ    1 
ATOM   2519 N  N     . GLY C 1 36  ? 1.616   44.712 47.921 1.00 20.17 ? 36  GLY C N     1 
ATOM   2520 C  CA    . GLY C 1 36  ? 0.921   43.566 48.479 1.00 22.02 ? 36  GLY C CA    1 
ATOM   2521 C  C     . GLY C 1 36  ? 1.816   42.361 48.669 1.00 22.32 ? 36  GLY C C     1 
ATOM   2522 O  O     . GLY C 1 36  ? 1.415   41.346 49.264 1.00 22.56 ? 36  GLY C O     1 
ATOM   2523 N  N     . PHE C 1 37  ? 3.046   42.471 48.205 1.00 21.33 ? 37  PHE C N     1 
ATOM   2524 C  CA    . PHE C 1 37  ? 3.964   41.351 48.325 1.00 19.89 ? 37  PHE C CA    1 
ATOM   2525 C  C     . PHE C 1 37  ? 4.386   41.142 49.754 1.00 18.93 ? 37  PHE C C     1 
ATOM   2526 O  O     . PHE C 1 37  ? 4.468   42.085 50.532 1.00 17.45 ? 37  PHE C O     1 
ATOM   2527 C  CB    . PHE C 1 37  ? 5.154   41.571 47.421 1.00 19.58 ? 37  PHE C CB    1 
ATOM   2528 C  CG    . PHE C 1 37  ? 4.803   41.508 45.968 1.00 18.07 ? 37  PHE C CG    1 
ATOM   2529 C  CD1   . PHE C 1 37  ? 3.956   40.506 45.498 1.00 19.29 ? 37  PHE C CD1   1 
ATOM   2530 C  CD2   . PHE C 1 37  ? 5.304   42.445 45.075 1.00 20.67 ? 37  PHE C CD2   1 
ATOM   2531 C  CE1   . PHE C 1 37  ? 3.605   40.425 44.162 1.00 19.75 ? 37  PHE C CE1   1 
ATOM   2532 C  CE2   . PHE C 1 37  ? 4.965   42.380 43.729 1.00 18.39 ? 37  PHE C CE2   1 
ATOM   2533 C  CZ    . PHE C 1 37  ? 4.123   41.384 43.263 1.00 21.57 ? 37  PHE C CZ    1 
ATOM   2534 N  N     . VAL C 1 38  ? 4.640   39.884 50.103 1.00 18.00 ? 38  VAL C N     1 
ATOM   2535 C  CA    . VAL C 1 38  ? 5.011   39.554 51.474 1.00 16.97 ? 38  VAL C CA    1 
ATOM   2536 C  C     . VAL C 1 38  ? 6.478   39.187 51.617 1.00 16.64 ? 38  VAL C C     1 
ATOM   2537 O  O     . VAL C 1 38  ? 6.992   38.369 50.888 1.00 17.24 ? 38  VAL C O     1 
ATOM   2538 C  CB    . VAL C 1 38  ? 4.128   38.379 51.990 1.00 18.60 ? 38  VAL C CB    1 
ATOM   2539 C  CG1   . VAL C 1 38  ? 4.628   37.909 53.356 1.00 17.66 ? 38  VAL C CG1   1 
ATOM   2540 C  CG2   . VAL C 1 38  ? 2.667   38.838 52.094 1.00 19.41 ? 38  VAL C CG2   1 
ATOM   2541 N  N     . LEU C 1 39  ? 7.150   39.805 52.573 1.00 16.06 ? 39  LEU C N     1 
ATOM   2542 C  CA    . LEU C 1 39  ? 8.547   39.553 52.825 1.00 15.77 ? 39  LEU C CA    1 
ATOM   2543 C  C     . LEU C 1 39  ? 8.679   38.158 53.471 1.00 16.64 ? 39  LEU C C     1 
ATOM   2544 O  O     . LEU C 1 39  ? 8.097   37.903 54.522 1.00 15.65 ? 39  LEU C O     1 
ATOM   2545 C  CB    . LEU C 1 39  ? 9.022   40.627 53.767 1.00 17.62 ? 39  LEU C CB    1 
ATOM   2546 C  CG    . LEU C 1 39  ? 10.457  40.978 54.000 1.00 21.49 ? 39  LEU C CG    1 
ATOM   2547 C  CD1   . LEU C 1 39  ? 11.134  41.353 52.685 1.00 16.00 ? 39  LEU C CD1   1 
ATOM   2548 C  CD2   . LEU C 1 39  ? 10.473  42.150 54.979 1.00 18.85 ? 39  LEU C CD2   1 
ATOM   2549 N  N     . VAL C 1 40  ? 9.419   37.254 52.837 1.00 17.46 ? 40  VAL C N     1 
ATOM   2550 C  CA    . VAL C 1 40  ? 9.600   35.932 53.429 1.00 17.97 ? 40  VAL C CA    1 
ATOM   2551 C  C     . VAL C 1 40  ? 11.044  35.673 53.837 1.00 17.85 ? 40  VAL C C     1 
ATOM   2552 O  O     . VAL C 1 40  ? 11.352  34.701 54.536 1.00 21.33 ? 40  VAL C O     1 
ATOM   2553 C  CB    . VAL C 1 40  ? 9.048   34.824 52.522 1.00 18.15 ? 40  VAL C CB    1 
ATOM   2554 C  CG1   . VAL C 1 40  ? 7.566   35.043 52.364 1.00 16.98 ? 40  VAL C CG1   1 
ATOM   2555 C  CG2   . VAL C 1 40  ? 9.738   34.802 51.140 1.00 19.68 ? 40  VAL C CG2   1 
ATOM   2556 N  N     . GLY C 1 41  ? 11.919  36.583 53.448 1.00 17.07 ? 41  GLY C N     1 
ATOM   2557 C  CA    . GLY C 1 41  ? 13.306  36.493 53.838 1.00 17.22 ? 41  GLY C CA    1 
ATOM   2558 C  C     . GLY C 1 41  ? 13.891  37.890 53.900 1.00 16.58 ? 41  GLY C C     1 
ATOM   2559 O  O     . GLY C 1 41  ? 13.544  38.705 53.068 1.00 18.78 ? 41  GLY C O     1 
ATOM   2560 N  N     . LEU C 1 42  ? 14.770  38.178 54.862 1.00 15.85 ? 42  LEU C N     1 
ATOM   2561 C  CA    . LEU C 1 42  ? 15.373  39.503 54.939 1.00 17.50 ? 42  LEU C CA    1 
ATOM   2562 C  C     . LEU C 1 42  ? 16.612  39.524 55.814 1.00 19.00 ? 42  LEU C C     1 
ATOM   2563 O  O     . LEU C 1 42  ? 16.610  39.014 56.941 1.00 18.60 ? 42  LEU C O     1 
ATOM   2564 C  CB    . LEU C 1 42  ? 14.373  40.526 55.498 1.00 17.77 ? 42  LEU C CB    1 
ATOM   2565 C  CG    . LEU C 1 42  ? 14.893  41.973 55.647 1.00 18.78 ? 42  LEU C CG    1 
ATOM   2566 C  CD1   . LEU C 1 42  ? 14.982  42.638 54.276 1.00 18.98 ? 42  LEU C CD1   1 
ATOM   2567 C  CD2   . LEU C 1 42  ? 13.932  42.766 56.548 1.00 18.30 ? 42  LEU C CD2   1 
ATOM   2568 N  N     . LYS C 1 43  ? 17.688  40.106 55.311 1.00 18.33 ? 43  LYS C N     1 
ATOM   2569 C  CA    . LYS C 1 43  ? 18.871  40.207 56.138 1.00 20.60 ? 43  LYS C CA    1 
ATOM   2570 C  C     . LYS C 1 43  ? 19.847  41.139 55.499 1.00 20.32 ? 43  LYS C C     1 
ATOM   2571 O  O     . LYS C 1 43  ? 19.798  41.362 54.301 1.00 20.26 ? 43  LYS C O     1 
ATOM   2572 C  CB    . LYS C 1 43  ? 19.551  38.835 56.317 1.00 21.88 ? 43  LYS C CB    1 
ATOM   2573 C  CG    . LYS C 1 43  ? 20.081  38.215 55.025 1.00 22.54 ? 43  LYS C CG    1 
ATOM   2574 C  CD    . LYS C 1 43  ? 20.797  36.905 55.368 1.00 25.24 ? 43  LYS C CD    1 
ATOM   2575 C  CE    . LYS C 1 43  ? 21.027  35.983 54.188 1.00 24.46 ? 43  LYS C CE    1 
ATOM   2576 N  NZ    . LYS C 1 43  ? 21.516  34.646 54.696 1.00 21.64 ? 43  LYS C NZ    1 
ATOM   2577 N  N     . GLN C 1 44  ? 20.705  41.728 56.313 1.00 20.38 ? 44  GLN C N     1 
ATOM   2578 C  CA    . GLN C 1 44  ? 21.742  42.569 55.749 1.00 20.06 ? 44  GLN C CA    1 
ATOM   2579 C  C     . GLN C 1 44  ? 23.045  41.785 55.961 1.00 20.59 ? 44  GLN C C     1 
ATOM   2580 O  O     . GLN C 1 44  ? 23.233  41.116 56.984 1.00 20.25 ? 44  GLN C O     1 
ATOM   2581 C  CB    . GLN C 1 44  ? 21.835  43.909 56.465 1.00 21.01 ? 44  GLN C CB    1 
ATOM   2582 C  CG    . GLN C 1 44  ? 23.025  44.732 55.963 1.00 17.48 ? 44  GLN C CG    1 
ATOM   2583 C  CD    . GLN C 1 44  ? 23.108  46.098 56.597 1.00 19.44 ? 44  GLN C CD    1 
ATOM   2584 O  OE1   . GLN C 1 44  ? 22.774  47.109 55.976 1.00 20.87 ? 44  GLN C OE1   1 
ATOM   2585 N  NE2   . GLN C 1 44  ? 23.563  46.144 57.831 1.00 17.77 ? 44  GLN C NE2   1 
ATOM   2586 N  N     . LEU C 1 45  ? 23.950  41.862 54.996 1.00 21.28 ? 45  LEU C N     1 
ATOM   2587 C  CA    . LEU C 1 45  ? 25.226  41.161 55.123 1.00 22.00 ? 45  LEU C CA    1 
ATOM   2588 C  C     . LEU C 1 45  ? 26.177  41.813 54.159 1.00 23.70 ? 45  LEU C C     1 
ATOM   2589 O  O     . LEU C 1 45  ? 25.755  42.616 53.320 1.00 20.85 ? 45  LEU C O     1 
ATOM   2590 C  CB    . LEU C 1 45  ? 25.067  39.707 54.715 1.00 22.20 ? 45  LEU C CB    1 
ATOM   2591 C  CG    . LEU C 1 45  ? 24.684  39.449 53.250 1.00 23.98 ? 45  LEU C CG    1 
ATOM   2592 C  CD1   . LEU C 1 45  ? 24.720  37.947 52.957 1.00 27.31 ? 45  LEU C CD1   1 
ATOM   2593 C  CD2   . LEU C 1 45  ? 23.288  39.991 52.981 1.00 26.94 ? 45  LEU C CD2   1 
ATOM   2594 N  N     . VAL C 1 46  ? 27.459  41.492 54.284 1.00 23.82 ? 46  VAL C N     1 
ATOM   2595 C  CA    . VAL C 1 46  ? 28.421  41.999 53.323 1.00 26.13 ? 46  VAL C CA    1 
ATOM   2596 C  C     . VAL C 1 46  ? 28.695  40.735 52.539 1.00 27.36 ? 46  VAL C C     1 
ATOM   2597 O  O     . VAL C 1 46  ? 29.210  39.750 53.081 1.00 26.50 ? 46  VAL C O     1 
ATOM   2598 C  CB    . VAL C 1 46  ? 29.696  42.526 53.968 1.00 27.73 ? 46  VAL C CB    1 
ATOM   2599 C  CG1   . VAL C 1 46  ? 30.702  42.925 52.855 1.00 27.49 ? 46  VAL C CG1   1 
ATOM   2600 C  CG2   . VAL C 1 46  ? 29.355  43.729 54.855 1.00 28.46 ? 46  VAL C CG2   1 
ATOM   2601 N  N     . PRO C 1 47  ? 28.301  40.725 51.260 1.00 26.74 ? 47  PRO C N     1 
ATOM   2602 C  CA    . PRO C 1 47  ? 28.493  39.562 50.405 1.00 27.38 ? 47  PRO C CA    1 
ATOM   2603 C  C     . PRO C 1 47  ? 29.955  39.195 50.240 1.00 28.06 ? 47  PRO C C     1 
ATOM   2604 O  O     . PRO C 1 47  ? 30.825  40.066 50.167 1.00 27.25 ? 47  PRO C O     1 
ATOM   2605 C  CB    . PRO C 1 47  ? 27.849  39.990 49.079 1.00 25.62 ? 47  PRO C CB    1 
ATOM   2606 C  CG    . PRO C 1 47  ? 26.821  40.971 49.505 1.00 26.46 ? 47  PRO C CG    1 
ATOM   2607 C  CD    . PRO C 1 47  ? 27.527  41.765 50.564 1.00 27.67 ? 47  PRO C CD    1 
ATOM   2608 N  N     . THR C 1 48  ? 30.207  37.896 50.203 1.00 28.24 ? 48  THR C N     1 
ATOM   2609 C  CA    . THR C 1 48  ? 31.550  37.382 50.014 1.00 29.42 ? 48  THR C CA    1 
ATOM   2610 C  C     . THR C 1 48  ? 31.727  37.210 48.514 1.00 28.97 ? 48  THR C C     1 
ATOM   2611 O  O     . THR C 1 48  ? 30.753  37.065 47.780 1.00 28.54 ? 48  THR C O     1 
ATOM   2612 C  CB    . THR C 1 48  ? 31.704  36.004 50.674 1.00 28.69 ? 48  THR C CB    1 
ATOM   2613 O  OG1   . THR C 1 48  ? 30.802  35.092 50.038 1.00 28.80 ? 48  THR C OG1   1 
ATOM   2614 C  CG2   . THR C 1 48  ? 31.396  36.085 52.176 1.00 29.07 ? 48  THR C CG2   1 
ATOM   2615 N  N     . LYS C 1 49  ? 32.972  37.219 48.054 1.00 30.83 ? 49  LYS C N     1 
ATOM   2616 C  CA    . LYS C 1 49  ? 33.245  37.043 46.633 1.00 30.79 ? 49  LYS C CA    1 
ATOM   2617 C  C     . LYS C 1 49  ? 32.547  35.778 46.114 1.00 30.59 ? 49  LYS C C     1 
ATOM   2618 O  O     . LYS C 1 49  ? 31.952  35.754 45.034 1.00 28.66 ? 49  LYS C O     1 
ATOM   2619 C  CB    . LYS C 1 49  ? 34.755  36.938 46.431 1.00 33.85 ? 49  LYS C CB    1 
ATOM   2620 C  CG    . LYS C 1 49  ? 35.194  36.934 44.979 1.00 34.95 ? 49  LYS C CG    1 
ATOM   2621 C  CD    . LYS C 1 49  ? 36.698  36.687 44.890 1.00 38.61 ? 49  LYS C CD    1 
ATOM   2622 C  CE    . LYS C 1 49  ? 37.208  36.899 43.467 1.00 39.90 ? 49  LYS C CE    1 
ATOM   2623 N  NZ    . LYS C 1 49  ? 36.381  36.135 42.496 1.00 41.32 ? 49  LYS C NZ    1 
ATOM   2624 N  N     . ASP C 1 50  ? 32.631  34.711 46.899 1.00 31.64 ? 50  ASP C N     1 
ATOM   2625 C  CA    . ASP C 1 50  ? 31.998  33.456 46.526 1.00 32.19 ? 50  ASP C CA    1 
ATOM   2626 C  C     . ASP C 1 50  ? 30.524  33.692 46.217 1.00 32.22 ? 50  ASP C C     1 
ATOM   2627 O  O     . ASP C 1 50  ? 30.026  33.335 45.148 1.00 30.80 ? 50  ASP C O     1 
ATOM   2628 C  CB    . ASP C 1 50  ? 32.139  32.445 47.669 1.00 34.42 ? 50  ASP C CB    1 
ATOM   2629 C  CG    . ASP C 1 50  ? 33.539  31.873 47.756 1.00 37.29 ? 50  ASP C CG    1 
ATOM   2630 O  OD1   . ASP C 1 50  ? 34.080  31.497 46.689 1.00 37.79 ? 50  ASP C OD1   1 
ATOM   2631 O  OD2   . ASP C 1 50  ? 34.089  31.799 48.876 1.00 39.05 ? 50  ASP C OD2   1 
ATOM   2632 N  N     . LEU C 1 51  ? 29.835  34.324 47.159 1.00 31.39 ? 51  LEU C N     1 
ATOM   2633 C  CA    . LEU C 1 51  ? 28.420  34.611 46.976 1.00 31.38 ? 51  LEU C CA    1 
ATOM   2634 C  C     . LEU C 1 51  ? 28.137  35.409 45.696 1.00 30.87 ? 51  LEU C C     1 
ATOM   2635 O  O     . LEU C 1 51  ? 27.342  34.988 44.852 1.00 30.72 ? 51  LEU C O     1 
ATOM   2636 C  CB    . LEU C 1 51  ? 27.900  35.367 48.191 1.00 30.86 ? 51  LEU C CB    1 
ATOM   2637 C  CG    . LEU C 1 51  ? 26.439  35.801 48.081 1.00 30.33 ? 51  LEU C CG    1 
ATOM   2638 C  CD1   . LEU C 1 51  ? 25.580  34.659 47.567 1.00 29.97 ? 51  LEU C CD1   1 
ATOM   2639 C  CD2   . LEU C 1 51  ? 25.976  36.284 49.431 1.00 29.46 ? 51  LEU C CD2   1 
ATOM   2640 N  N     . ALA C 1 52  ? 28.793  36.559 45.565 1.00 30.28 ? 52  ALA C N     1 
ATOM   2641 C  CA    . ALA C 1 52  ? 28.620  37.426 44.392 1.00 30.45 ? 52  ALA C CA    1 
ATOM   2642 C  C     . ALA C 1 52  ? 28.888  36.700 43.086 1.00 30.39 ? 52  ALA C C     1 
ATOM   2643 O  O     . ALA C 1 52  ? 28.131  36.831 42.120 1.00 30.49 ? 52  ALA C O     1 
ATOM   2644 C  CB    . ALA C 1 52  ? 29.536  38.629 44.502 1.00 29.37 ? 52  ALA C CB    1 
ATOM   2645 N  N     . GLU C 1 53  ? 29.969  35.926 43.046 1.00 31.26 ? 53  GLU C N     1 
ATOM   2646 C  CA    . GLU C 1 53  ? 30.298  35.204 41.835 1.00 32.22 ? 53  GLU C CA    1 
ATOM   2647 C  C     . GLU C 1 53  ? 29.201  34.232 41.428 1.00 31.90 ? 53  GLU C C     1 
ATOM   2648 O  O     . GLU C 1 53  ? 28.874  34.122 40.250 1.00 32.00 ? 53  GLU C O     1 
ATOM   2649 C  CB    . GLU C 1 53  ? 31.617  34.459 42.013 1.00 33.62 ? 53  GLU C CB    1 
ATOM   2650 C  CG    . GLU C 1 53  ? 32.809  35.362 42.060 1.00 35.78 ? 53  GLU C CG    1 
ATOM   2651 C  CD    . GLU C 1 53  ? 34.092  34.585 41.909 1.00 37.91 ? 53  GLU C CD    1 
ATOM   2652 O  OE1   . GLU C 1 53  ? 34.469  33.836 42.843 1.00 35.71 ? 53  GLU C OE1   1 
ATOM   2653 O  OE2   . GLU C 1 53  ? 34.709  34.716 40.833 1.00 41.72 ? 53  GLU C OE2   1 
ATOM   2654 N  N     . SER C 1 54  ? 28.644  33.509 42.399 1.00 31.88 ? 54  SER C N     1 
ATOM   2655 C  CA    . SER C 1 54  ? 27.572  32.555 42.110 1.00 31.65 ? 54  SER C CA    1 
ATOM   2656 C  C     . SER C 1 54  ? 26.325  33.330 41.732 1.00 30.77 ? 54  SER C C     1 
ATOM   2657 O  O     . SER C 1 54  ? 25.604  32.970 40.797 1.00 30.15 ? 54  SER C O     1 
ATOM   2658 C  CB    . SER C 1 54  ? 27.236  31.713 43.343 1.00 32.73 ? 54  SER C CB    1 
ATOM   2659 O  OG    . SER C 1 54  ? 28.370  31.017 43.830 1.00 36.70 ? 54  SER C OG    1 
ATOM   2660 N  N     . HIS C 1 55  ? 26.061  34.398 42.483 1.00 30.00 ? 55  HIS C N     1 
ATOM   2661 C  CA    . HIS C 1 55  ? 24.874  35.202 42.206 1.00 30.21 ? 55  HIS C CA    1 
ATOM   2662 C  C     . HIS C 1 55  ? 24.894  35.652 40.752 1.00 30.85 ? 55  HIS C C     1 
ATOM   2663 O  O     . HIS C 1 55  ? 23.943  35.445 40.003 1.00 29.42 ? 55  HIS C O     1 
ATOM   2664 C  CB    . HIS C 1 55  ? 24.805  36.444 43.106 1.00 28.53 ? 55  HIS C CB    1 
ATOM   2665 C  CG    . HIS C 1 55  ? 23.559  37.254 42.892 1.00 28.90 ? 55  HIS C CG    1 
ATOM   2666 N  ND1   . HIS C 1 55  ? 22.315  36.820 43.302 1.00 28.17 ? 55  HIS C ND1   1 
ATOM   2667 C  CD2   . HIS C 1 55  ? 23.347  38.399 42.200 1.00 29.83 ? 55  HIS C CD2   1 
ATOM   2668 C  CE1   . HIS C 1 55  ? 21.389  37.657 42.866 1.00 29.19 ? 55  HIS C CE1   1 
ATOM   2669 N  NE2   . HIS C 1 55  ? 21.989  38.622 42.192 1.00 29.59 ? 55  HIS C NE2   1 
ATOM   2670 N  N     . TYR C 1 56  ? 26.003  36.262 40.366 1.00 32.57 ? 56  TYR C N     1 
ATOM   2671 C  CA    . TYR C 1 56  ? 26.160  36.777 39.018 1.00 34.87 ? 56  TYR C CA    1 
ATOM   2672 C  C     . TYR C 1 56  ? 26.915  35.823 38.086 1.00 37.10 ? 56  TYR C C     1 
ATOM   2673 O  O     . TYR C 1 56  ? 27.596  36.253 37.145 1.00 37.00 ? 56  TYR C O     1 
ATOM   2674 C  CB    . TYR C 1 56  ? 26.858  38.136 39.101 1.00 34.57 ? 56  TYR C CB    1 
ATOM   2675 C  CG    . TYR C 1 56  ? 25.944  39.266 39.567 1.00 34.53 ? 56  TYR C CG    1 
ATOM   2676 C  CD1   . TYR C 1 56  ? 24.720  39.496 38.933 1.00 36.06 ? 56  TYR C CD1   1 
ATOM   2677 C  CD2   . TYR C 1 56  ? 26.327  40.137 40.595 1.00 35.40 ? 56  TYR C CD2   1 
ATOM   2678 C  CE1   . TYR C 1 56  ? 23.892  40.577 39.302 1.00 35.40 ? 56  TYR C CE1   1 
ATOM   2679 C  CE2   . TYR C 1 56  ? 25.509  41.223 40.975 1.00 35.53 ? 56  TYR C CE2   1 
ATOM   2680 C  CZ    . TYR C 1 56  ? 24.298  41.432 40.317 1.00 36.46 ? 56  TYR C CZ    1 
ATOM   2681 O  OH    . TYR C 1 56  ? 23.490  42.505 40.646 1.00 37.22 ? 56  TYR C OH    1 
ATOM   2682 N  N     . ALA C 1 57  ? 26.755  34.526 38.340 1.00 39.03 ? 57  ALA C N     1 
ATOM   2683 C  CA    . ALA C 1 57  ? 27.420  33.485 37.557 1.00 41.62 ? 57  ALA C CA    1 
ATOM   2684 C  C     . ALA C 1 57  ? 27.213  33.609 36.053 1.00 43.16 ? 57  ALA C C     1 
ATOM   2685 O  O     . ALA C 1 57  ? 28.135  33.355 35.278 1.00 44.15 ? 57  ALA C O     1 
ATOM   2686 C  CB    . ALA C 1 57  ? 26.957  32.104 38.022 1.00 41.15 ? 57  ALA C CB    1 
ATOM   2687 N  N     . GLU C 1 58  ? 26.010  33.994 35.643 1.00 44.14 ? 58  GLU C N     1 
ATOM   2688 C  CA    . GLU C 1 58  ? 25.682  34.127 34.223 1.00 45.63 ? 58  GLU C CA    1 
ATOM   2689 C  C     . GLU C 1 58  ? 26.496  35.187 33.492 1.00 46.07 ? 58  GLU C C     1 
ATOM   2690 O  O     . GLU C 1 58  ? 26.469  35.254 32.259 1.00 45.47 ? 58  GLU C O     1 
ATOM   2691 C  CB    . GLU C 1 58  ? 24.216  34.486 34.058 1.00 45.99 ? 58  GLU C CB    1 
ATOM   2692 C  CG    . GLU C 1 58  ? 23.927  35.911 34.501 1.00 48.64 ? 58  GLU C CG    1 
ATOM   2693 C  CD    . GLU C 1 58  ? 22.460  36.252 34.435 1.00 48.66 ? 58  GLU C CD    1 
ATOM   2694 O  OE1   . GLU C 1 58  ? 21.940  36.434 33.315 1.00 48.57 ? 58  GLU C OE1   1 
ATOM   2695 O  OE2   . GLU C 1 58  ? 21.833  36.325 35.511 1.00 49.07 ? 58  GLU C OE2   1 
ATOM   2696 N  N     . HIS C 1 59  ? 27.200  36.022 34.247 1.00 46.41 ? 59  HIS C N     1 
ATOM   2697 C  CA    . HIS C 1 59  ? 27.996  37.083 33.645 1.00 47.52 ? 59  HIS C CA    1 
ATOM   2698 C  C     . HIS C 1 59  ? 29.494  36.876 33.847 1.00 48.71 ? 59  HIS C C     1 
ATOM   2699 O  O     . HIS C 1 59  ? 30.281  37.792 33.622 1.00 48.51 ? 59  HIS C O     1 
ATOM   2700 C  CB    . HIS C 1 59  ? 27.596  38.445 34.236 1.00 46.99 ? 59  HIS C CB    1 
ATOM   2701 C  CG    . HIS C 1 59  ? 26.148  38.798 34.050 1.00 47.11 ? 59  HIS C CG    1 
ATOM   2702 N  ND1   . HIS C 1 59  ? 25.520  38.767 32.823 1.00 46.88 ? 59  HIS C ND1   1 
ATOM   2703 C  CD2   . HIS C 1 59  ? 25.220  39.245 34.933 1.00 47.01 ? 59  HIS C CD2   1 
ATOM   2704 C  CE1   . HIS C 1 59  ? 24.271  39.181 32.954 1.00 47.42 ? 59  HIS C CE1   1 
ATOM   2705 N  NE2   . HIS C 1 59  ? 24.063  39.478 34.225 1.00 46.62 ? 59  HIS C NE2   1 
ATOM   2706 N  N     . LYS C 1 60  ? 29.892  35.682 34.276 1.00 50.08 ? 60  LYS C N     1 
ATOM   2707 C  CA    . LYS C 1 60  ? 31.306  35.404 34.513 1.00 51.50 ? 60  LYS C CA    1 
ATOM   2708 C  C     . LYS C 1 60  ? 32.157  35.822 33.308 1.00 52.55 ? 60  LYS C C     1 
ATOM   2709 O  O     . LYS C 1 60  ? 33.293  36.273 33.474 1.00 52.11 ? 60  LYS C O     1 
ATOM   2710 C  CB    . LYS C 1 60  ? 31.505  33.919 34.814 1.00 51.47 ? 60  LYS C CB    1 
ATOM   2711 C  CG    . LYS C 1 60  ? 30.942  33.034 33.735 1.00 53.21 ? 60  LYS C CG    1 
ATOM   2712 C  CD    . LYS C 1 60  ? 31.026  31.562 34.068 1.00 54.96 ? 60  LYS C CD    1 
ATOM   2713 C  CE    . LYS C 1 60  ? 30.314  30.741 32.999 1.00 55.47 ? 60  LYS C CE    1 
ATOM   2714 N  NZ    . LYS C 1 60  ? 30.462  29.271 33.212 1.00 57.51 ? 60  LYS C NZ    1 
ATOM   2715 N  N     . GLU C 1 61  ? 31.594  35.694 32.106 1.00 53.36 ? 61  GLU C N     1 
ATOM   2716 C  CA    . GLU C 1 61  ? 32.299  36.056 30.875 1.00 54.93 ? 61  GLU C CA    1 
ATOM   2717 C  C     . GLU C 1 61  ? 32.381  37.560 30.685 1.00 54.92 ? 61  GLU C C     1 
ATOM   2718 O  O     . GLU C 1 61  ? 33.467  38.149 30.705 1.00 54.74 ? 61  GLU C O     1 
ATOM   2719 C  CB    . GLU C 1 61  ? 31.599  35.459 29.650 1.00 56.23 ? 61  GLU C CB    1 
ATOM   2720 C  CG    . GLU C 1 61  ? 31.776  33.961 29.464 1.00 58.87 ? 61  GLU C CG    1 
ATOM   2721 C  CD    . GLU C 1 61  ? 31.164  33.144 30.589 1.00 61.25 ? 61  GLU C CD    1 
ATOM   2722 O  OE1   . GLU C 1 61  ? 29.978  33.398 30.931 1.00 62.12 ? 61  GLU C OE1   1 
ATOM   2723 O  OE2   . GLU C 1 61  ? 31.867  32.243 31.123 1.00 62.02 ? 61  GLU C OE2   1 
ATOM   2724 N  N     . ARG C 1 62  ? 31.213  38.165 30.489 1.00 55.27 ? 62  ARG C N     1 
ATOM   2725 C  CA    . ARG C 1 62  ? 31.095  39.603 30.273 1.00 55.04 ? 62  ARG C CA    1 
ATOM   2726 C  C     . ARG C 1 62  ? 32.210  40.399 30.952 1.00 54.19 ? 62  ARG C C     1 
ATOM   2727 O  O     . ARG C 1 62  ? 32.609  40.109 32.077 1.00 54.40 ? 62  ARG C O     1 
ATOM   2728 C  CB    . ARG C 1 62  ? 29.716  40.078 30.744 1.00 55.78 ? 62  ARG C CB    1 
ATOM   2729 C  CG    . ARG C 1 62  ? 28.825  40.610 29.626 1.00 56.86 ? 62  ARG C CG    1 
ATOM   2730 C  CD    . ARG C 1 62  ? 28.841  39.715 28.382 1.00 58.92 ? 62  ARG C CD    1 
ATOM   2731 N  NE    . ARG C 1 62  ? 27.951  40.192 27.310 1.00 59.98 ? 62  ARG C NE    1 
ATOM   2732 C  CZ    . ARG C 1 62  ? 27.962  41.425 26.796 1.00 59.59 ? 62  ARG C CZ    1 
ATOM   2733 N  NH1   . ARG C 1 62  ? 28.823  42.330 27.256 1.00 60.16 ? 62  ARG C NH1   1 
ATOM   2734 N  NH2   . ARG C 1 62  ? 27.116  41.755 25.816 1.00 58.08 ? 62  ARG C NH2   1 
ATOM   2735 N  N     . PRO C 1 63  ? 32.729  41.422 30.259 1.00 54.06 ? 63  PRO C N     1 
ATOM   2736 C  CA    . PRO C 1 63  ? 33.808  42.273 30.772 1.00 53.46 ? 63  PRO C CA    1 
ATOM   2737 C  C     . PRO C 1 63  ? 33.500  43.025 32.063 1.00 53.25 ? 63  PRO C C     1 
ATOM   2738 O  O     . PRO C 1 63  ? 34.416  43.406 32.797 1.00 53.69 ? 63  PRO C O     1 
ATOM   2739 C  CB    . PRO C 1 63  ? 34.082  43.219 29.605 1.00 53.81 ? 63  PRO C CB    1 
ATOM   2740 C  CG    . PRO C 1 63  ? 32.718  43.351 28.964 1.00 53.50 ? 63  PRO C CG    1 
ATOM   2741 C  CD    . PRO C 1 63  ? 32.231  41.922 28.964 1.00 53.09 ? 63  PRO C CD    1 
ATOM   2742 N  N     . PHE C 1 64  ? 32.218  43.242 32.342 1.00 52.33 ? 64  PHE C N     1 
ATOM   2743 C  CA    . PHE C 1 64  ? 31.834  43.976 33.544 1.00 50.99 ? 64  PHE C CA    1 
ATOM   2744 C  C     . PHE C 1 64  ? 31.717  43.089 34.775 1.00 50.06 ? 64  PHE C C     1 
ATOM   2745 O  O     . PHE C 1 64  ? 31.518  43.585 35.885 1.00 50.41 ? 64  PHE C O     1 
ATOM   2746 C  CB    . PHE C 1 64  ? 30.513  44.720 33.310 1.00 50.53 ? 64  PHE C CB    1 
ATOM   2747 C  CG    . PHE C 1 64  ? 29.348  43.822 32.981 1.00 49.53 ? 64  PHE C CG    1 
ATOM   2748 C  CD1   . PHE C 1 64  ? 28.772  43.013 33.958 1.00 49.48 ? 64  PHE C CD1   1 
ATOM   2749 C  CD2   . PHE C 1 64  ? 28.814  43.804 31.698 1.00 49.79 ? 64  PHE C CD2   1 
ATOM   2750 C  CE1   . PHE C 1 64  ? 27.680  42.203 33.663 1.00 48.98 ? 64  PHE C CE1   1 
ATOM   2751 C  CE2   . PHE C 1 64  ? 27.718  42.997 31.389 1.00 50.24 ? 64  PHE C CE2   1 
ATOM   2752 C  CZ    . PHE C 1 64  ? 27.149  42.193 32.376 1.00 49.71 ? 64  PHE C CZ    1 
ATOM   2753 N  N     . PHE C 1 65  ? 31.861  41.783 34.576 1.00 48.55 ? 65  PHE C N     1 
ATOM   2754 C  CA    . PHE C 1 65  ? 31.753  40.823 35.666 1.00 47.15 ? 65  PHE C CA    1 
ATOM   2755 C  C     . PHE C 1 65  ? 32.622  41.161 36.867 1.00 46.36 ? 65  PHE C C     1 
ATOM   2756 O  O     . PHE C 1 65  ? 32.150  41.201 38.006 1.00 46.31 ? 65  PHE C O     1 
ATOM   2757 C  CB    . PHE C 1 65  ? 32.123  39.427 35.169 1.00 47.14 ? 65  PHE C CB    1 
ATOM   2758 C  CG    . PHE C 1 65  ? 32.060  38.371 36.236 1.00 46.77 ? 65  PHE C CG    1 
ATOM   2759 C  CD1   . PHE C 1 65  ? 30.835  37.899 36.694 1.00 46.67 ? 65  PHE C CD1   1 
ATOM   2760 C  CD2   . PHE C 1 65  ? 33.228  37.862 36.798 1.00 46.15 ? 65  PHE C CD2   1 
ATOM   2761 C  CE1   . PHE C 1 65  ? 30.777  36.933 37.697 1.00 46.83 ? 65  PHE C CE1   1 
ATOM   2762 C  CE2   . PHE C 1 65  ? 33.182  36.904 37.797 1.00 45.76 ? 65  PHE C CE2   1 
ATOM   2763 C  CZ    . PHE C 1 65  ? 31.954  36.434 38.250 1.00 46.12 ? 65  PHE C CZ    1 
ATOM   2764 N  N     . GLY C 1 66  ? 33.903  41.386 36.603 1.00 45.16 ? 66  GLY C N     1 
ATOM   2765 C  CA    . GLY C 1 66  ? 34.842  41.696 37.660 1.00 43.13 ? 66  GLY C CA    1 
ATOM   2766 C  C     . GLY C 1 66  ? 34.406  42.807 38.591 1.00 43.07 ? 66  GLY C C     1 
ATOM   2767 O  O     . GLY C 1 66  ? 34.193  42.578 39.786 1.00 42.24 ? 66  GLY C O     1 
ATOM   2768 N  N     . GLY C 1 67  ? 34.274  44.015 38.048 1.00 42.13 ? 67  GLY C N     1 
ATOM   2769 C  CA    . GLY C 1 67  ? 33.885  45.160 38.858 1.00 40.82 ? 67  GLY C CA    1 
ATOM   2770 C  C     . GLY C 1 67  ? 32.572  44.983 39.603 1.00 40.03 ? 67  GLY C C     1 
ATOM   2771 O  O     . GLY C 1 67  ? 32.394  45.518 40.696 1.00 41.60 ? 67  GLY C O     1 
ATOM   2772 N  N     . LEU C 1 68  ? 31.652  44.244 38.996 1.00 37.97 ? 68  LEU C N     1 
ATOM   2773 C  CA    . LEU C 1 68  ? 30.350  43.969 39.585 1.00 36.57 ? 68  LEU C CA    1 
ATOM   2774 C  C     . LEU C 1 68  ? 30.537  43.169 40.876 1.00 36.13 ? 68  LEU C C     1 
ATOM   2775 O  O     . LEU C 1 68  ? 30.002  43.523 41.937 1.00 34.82 ? 68  LEU C O     1 
ATOM   2776 C  CB    . LEU C 1 68  ? 29.520  43.169 38.590 1.00 36.92 ? 68  LEU C CB    1 
ATOM   2777 C  CG    . LEU C 1 68  ? 28.072  42.868 38.937 1.00 37.68 ? 68  LEU C CG    1 
ATOM   2778 C  CD1   . LEU C 1 68  ? 27.334  44.173 39.203 1.00 39.01 ? 68  LEU C CD1   1 
ATOM   2779 C  CD2   . LEU C 1 68  ? 27.435  42.119 37.789 1.00 36.83 ? 68  LEU C CD2   1 
ATOM   2780 N  N     . VAL C 1 69  ? 31.305  42.084 40.776 1.00 33.96 ? 69  VAL C N     1 
ATOM   2781 C  CA    . VAL C 1 69  ? 31.571  41.242 41.927 1.00 32.99 ? 69  VAL C CA    1 
ATOM   2782 C  C     . VAL C 1 69  ? 32.210  42.076 43.012 1.00 32.69 ? 69  VAL C C     1 
ATOM   2783 O  O     . VAL C 1 69  ? 31.816  42.007 44.175 1.00 32.33 ? 69  VAL C O     1 
ATOM   2784 C  CB    . VAL C 1 69  ? 32.514  40.068 41.566 1.00 32.19 ? 69  VAL C CB    1 
ATOM   2785 C  CG1   . VAL C 1 69  ? 33.011  39.371 42.848 1.00 33.20 ? 69  VAL C CG1   1 
ATOM   2786 C  CG2   . VAL C 1 69  ? 31.771  39.081 40.691 1.00 31.17 ? 69  VAL C CG2   1 
ATOM   2787 N  N     . SER C 1 70  ? 33.203  42.872 42.626 1.00 33.52 ? 70  SER C N     1 
ATOM   2788 C  CA    . SER C 1 70  ? 33.905  43.723 43.572 1.00 34.25 ? 70  SER C CA    1 
ATOM   2789 C  C     . SER C 1 70  ? 32.979  44.778 44.158 1.00 33.92 ? 70  SER C C     1 
ATOM   2790 O  O     . SER C 1 70  ? 33.144  45.191 45.311 1.00 34.83 ? 70  SER C O     1 
ATOM   2791 C  CB    . SER C 1 70  ? 35.073  44.433 42.894 1.00 35.35 ? 70  SER C CB    1 
ATOM   2792 O  OG    . SER C 1 70  ? 35.833  43.525 42.109 1.00 40.21 ? 70  SER C OG    1 
ATOM   2793 N  N     . PHE C 1 71  ? 32.013  45.231 43.367 1.00 32.47 ? 71  PHE C N     1 
ATOM   2794 C  CA    . PHE C 1 71  ? 31.117  46.259 43.878 1.00 31.18 ? 71  PHE C CA    1 
ATOM   2795 C  C     . PHE C 1 71  ? 30.103  45.722 44.884 1.00 29.05 ? 71  PHE C C     1 
ATOM   2796 O  O     . PHE C 1 71  ? 29.887  46.323 45.932 1.00 29.17 ? 71  PHE C O     1 
ATOM   2797 C  CB    . PHE C 1 71  ? 30.354  46.964 42.753 1.00 29.71 ? 71  PHE C CB    1 
ATOM   2798 C  CG    . PHE C 1 71  ? 29.444  48.036 43.273 1.00 29.21 ? 71  PHE C CG    1 
ATOM   2799 C  CD1   . PHE C 1 71  ? 29.966  49.081 44.036 1.00 28.76 ? 71  PHE C CD1   1 
ATOM   2800 C  CD2   . PHE C 1 71  ? 28.069  47.933 43.133 1.00 29.67 ? 71  PHE C CD2   1 
ATOM   2801 C  CE1   . PHE C 1 71  ? 29.130  49.995 44.659 1.00 28.86 ? 71  PHE C CE1   1 
ATOM   2802 C  CE2   . PHE C 1 71  ? 27.225  48.848 43.758 1.00 28.38 ? 71  PHE C CE2   1 
ATOM   2803 C  CZ    . PHE C 1 71  ? 27.755  49.869 44.517 1.00 27.26 ? 71  PHE C CZ    1 
ATOM   2804 N  N     . ILE C 1 72  ? 29.485  44.593 44.562 1.00 30.79 ? 72  ILE C N     1 
ATOM   2805 C  CA    . ILE C 1 72  ? 28.493  44.029 45.469 1.00 31.01 ? 72  ILE C CA    1 
ATOM   2806 C  C     . ILE C 1 72  ? 29.113  43.574 46.795 1.00 30.18 ? 72  ILE C C     1 
ATOM   2807 O  O     . ILE C 1 72  ? 28.423  43.500 47.815 1.00 28.58 ? 72  ILE C O     1 
ATOM   2808 C  CB    . ILE C 1 72  ? 27.726  42.877 44.794 1.00 32.05 ? 72  ILE C CB    1 
ATOM   2809 C  CG1   . ILE C 1 72  ? 26.482  42.525 45.629 1.00 34.07 ? 72  ILE C CG1   1 
ATOM   2810 C  CG2   . ILE C 1 72  ? 28.601  41.657 44.700 1.00 34.99 ? 72  ILE C CG2   1 
ATOM   2811 C  CD1   . ILE C 1 72  ? 25.429  41.743 44.879 1.00 34.11 ? 72  ILE C CD1   1 
ATOM   2812 N  N     . THR C 1 73  ? 30.422  43.298 46.788 1.00 29.36 ? 73  THR C N     1 
ATOM   2813 C  CA    . THR C 1 73  ? 31.121  42.864 47.996 1.00 28.28 ? 73  THR C CA    1 
ATOM   2814 C  C     . THR C 1 73  ? 31.781  44.019 48.742 1.00 28.04 ? 73  THR C C     1 
ATOM   2815 O  O     . THR C 1 73  ? 32.353  43.823 49.823 1.00 25.87 ? 73  THR C O     1 
ATOM   2816 C  CB    . THR C 1 73  ? 32.214  41.806 47.672 1.00 29.65 ? 73  THR C CB    1 
ATOM   2817 O  OG1   . THR C 1 73  ? 33.176  42.377 46.771 1.00 28.81 ? 73  THR C OG1   1 
ATOM   2818 C  CG2   . THR C 1 73  ? 31.590  40.567 47.025 1.00 26.72 ? 73  THR C CG2   1 
ATOM   2819 N  N     . SER C 1 74  ? 31.673  45.222 48.179 1.00 28.30 ? 74  SER C N     1 
ATOM   2820 C  CA    . SER C 1 74  ? 32.272  46.427 48.761 1.00 28.79 ? 74  SER C CA    1 
ATOM   2821 C  C     . SER C 1 74  ? 31.610  46.950 50.014 1.00 28.20 ? 74  SER C C     1 
ATOM   2822 O  O     . SER C 1 74  ? 32.203  47.739 50.751 1.00 30.28 ? 74  SER C O     1 
ATOM   2823 C  CB    . SER C 1 74  ? 32.307  47.565 47.731 1.00 29.79 ? 74  SER C CB    1 
ATOM   2824 O  OG    . SER C 1 74  ? 31.007  47.958 47.308 1.00 31.76 ? 74  SER C OG    1 
ATOM   2825 N  N     . GLY C 1 75  ? 30.374  46.545 50.266 1.00 27.00 ? 75  GLY C N     1 
ATOM   2826 C  CA    . GLY C 1 75  ? 29.723  47.040 51.463 1.00 23.96 ? 75  GLY C CA    1 
ATOM   2827 C  C     . GLY C 1 75  ? 28.459  46.276 51.757 1.00 22.24 ? 75  GLY C C     1 
ATOM   2828 O  O     . GLY C 1 75  ? 28.111  45.360 51.015 1.00 22.24 ? 75  GLY C O     1 
ATOM   2829 N  N     . PRO C 1 76  ? 27.733  46.647 52.822 1.00 20.63 ? 76  PRO C N     1 
ATOM   2830 C  CA    . PRO C 1 76  ? 26.498  45.927 53.138 1.00 22.15 ? 76  PRO C CA    1 
ATOM   2831 C  C     . PRO C 1 76  ? 25.453  45.968 52.013 1.00 22.27 ? 76  PRO C C     1 
ATOM   2832 O  O     . PRO C 1 76  ? 25.350  46.937 51.241 1.00 21.06 ? 76  PRO C O     1 
ATOM   2833 C  CB    . PRO C 1 76  ? 26.017  46.596 54.426 1.00 21.18 ? 76  PRO C CB    1 
ATOM   2834 C  CG    . PRO C 1 76  ? 26.501  48.010 54.273 1.00 21.44 ? 76  PRO C CG    1 
ATOM   2835 C  CD    . PRO C 1 76  ? 27.907  47.817 53.697 1.00 21.81 ? 76  PRO C CD    1 
ATOM   2836 N  N     . VAL C 1 77  ? 24.693  44.877 51.935 1.00 21.39 ? 77  VAL C N     1 
ATOM   2837 C  CA    . VAL C 1 77  ? 23.640  44.683 50.959 1.00 19.54 ? 77  VAL C CA    1 
ATOM   2838 C  C     . VAL C 1 77  ? 22.432  44.168 51.742 1.00 19.51 ? 77  VAL C C     1 
ATOM   2839 O  O     . VAL C 1 77  ? 22.612  43.426 52.723 1.00 18.46 ? 77  VAL C O     1 
ATOM   2840 C  CB    . VAL C 1 77  ? 24.068  43.606 49.951 1.00 20.97 ? 77  VAL C CB    1 
ATOM   2841 C  CG1   . VAL C 1 77  ? 22.888  43.051 49.219 1.00 20.55 ? 77  VAL C CG1   1 
ATOM   2842 C  CG2   . VAL C 1 77  ? 25.064  44.201 48.970 1.00 18.19 ? 77  VAL C CG2   1 
ATOM   2843 N  N     . VAL C 1 78  ? 21.215  44.562 51.363 1.00 18.76 ? 78  VAL C N     1 
ATOM   2844 C  CA    . VAL C 1 78  ? 20.072  43.984 52.067 1.00 20.64 ? 78  VAL C CA    1 
ATOM   2845 C  C     . VAL C 1 78  ? 19.412  43.035 51.074 1.00 18.96 ? 78  VAL C C     1 
ATOM   2846 O  O     . VAL C 1 78  ? 18.896  43.425 50.023 1.00 20.89 ? 78  VAL C O     1 
ATOM   2847 C  CB    . VAL C 1 78  ? 19.043  45.015 52.620 1.00 21.22 ? 78  VAL C CB    1 
ATOM   2848 C  CG1   . VAL C 1 78  ? 19.729  46.022 53.497 1.00 22.57 ? 78  VAL C CG1   1 
ATOM   2849 C  CG2   . VAL C 1 78  ? 18.299  45.660 51.514 1.00 28.01 ? 78  VAL C CG2   1 
ATOM   2850 N  N     . ALA C 1 79  ? 19.505  41.760 51.418 1.00 18.41 ? 79  ALA C N     1 
ATOM   2851 C  CA    . ALA C 1 79  ? 18.975  40.659 50.643 1.00 16.69 ? 79  ALA C CA    1 
ATOM   2852 C  C     . ALA C 1 79  ? 17.547  40.407 51.127 1.00 19.38 ? 79  ALA C C     1 
ATOM   2853 O  O     . ALA C 1 79  ? 17.282  40.342 52.343 1.00 18.69 ? 79  ALA C O     1 
ATOM   2854 C  CB    . ALA C 1 79  ? 19.817  39.412 50.894 1.00 19.05 ? 79  ALA C CB    1 
ATOM   2855 N  N     . MET C 1 80  ? 16.656  40.195 50.180 1.00 16.73 ? 80  MET C N     1 
ATOM   2856 C  CA    . MET C 1 80  ? 15.268  40.003 50.522 1.00 19.64 ? 80  MET C CA    1 
ATOM   2857 C  C     . MET C 1 80  ? 14.619  38.994 49.627 1.00 18.18 ? 80  MET C C     1 
ATOM   2858 O  O     . MET C 1 80  ? 15.047  38.806 48.487 1.00 19.13 ? 80  MET C O     1 
ATOM   2859 C  CB    . MET C 1 80  ? 14.509  41.319 50.312 1.00 19.74 ? 80  MET C CB    1 
ATOM   2860 C  CG    . MET C 1 80  ? 15.284  42.527 50.701 1.00 24.47 ? 80  MET C CG    1 
ATOM   2861 S  SD    . MET C 1 80  ? 14.368  44.037 50.304 1.00 25.70 ? 80  MET C SD    1 
ATOM   2862 C  CE    . MET C 1 80  ? 13.394  43.509 49.165 1.00 23.20 ? 80  MET C CE    1 
ATOM   2863 N  N     . VAL C 1 81  ? 13.583  38.348 50.153 1.00 17.44 ? 81  VAL C N     1 
ATOM   2864 C  CA    . VAL C 1 81  ? 12.779  37.447 49.360 1.00 17.27 ? 81  VAL C CA    1 
ATOM   2865 C  C     . VAL C 1 81  ? 11.316  37.846 49.562 1.00 18.37 ? 81  VAL C C     1 
ATOM   2866 O  O     . VAL C 1 81  ? 10.846  37.950 50.715 1.00 19.07 ? 81  VAL C O     1 
ATOM   2867 C  CB    . VAL C 1 81  ? 12.939  35.993 49.788 1.00 18.52 ? 81  VAL C CB    1 
ATOM   2868 C  CG1   . VAL C 1 81  ? 12.127  35.121 48.820 1.00 18.05 ? 81  VAL C CG1   1 
ATOM   2869 C  CG2   . VAL C 1 81  ? 14.447  35.631 49.811 1.00 17.74 ? 81  VAL C CG2   1 
ATOM   2870 N  N     . PHE C 1 82  ? 10.623  38.071 48.450 1.00 18.34 ? 82  PHE C N     1 
ATOM   2871 C  CA    . PHE C 1 82  ? 9.223   38.485 48.440 1.00 19.16 ? 82  PHE C CA    1 
ATOM   2872 C  C     . PHE C 1 82  ? 8.366   37.461 47.743 1.00 19.20 ? 82  PHE C C     1 
ATOM   2873 O  O     . PHE C 1 82  ? 8.767   36.885 46.732 1.00 20.65 ? 82  PHE C O     1 
ATOM   2874 C  CB    . PHE C 1 82  ? 9.059   39.819 47.722 1.00 19.02 ? 82  PHE C CB    1 
ATOM   2875 C  CG    . PHE C 1 82  ? 9.230   41.005 48.615 1.00 19.25 ? 82  PHE C CG    1 
ATOM   2876 C  CD1   . PHE C 1 82  ? 8.197   41.400 49.464 1.00 20.80 ? 82  PHE C CD1   1 
ATOM   2877 C  CD2   . PHE C 1 82  ? 10.400  41.754 48.595 1.00 20.21 ? 82  PHE C CD2   1 
ATOM   2878 C  CE1   . PHE C 1 82  ? 8.334   42.534 50.279 1.00 21.31 ? 82  PHE C CE1   1 
ATOM   2879 C  CE2   . PHE C 1 82  ? 10.532  42.894 49.417 1.00 20.37 ? 82  PHE C CE2   1 
ATOM   2880 C  CZ    . PHE C 1 82  ? 9.501   43.274 50.250 1.00 18.29 ? 82  PHE C CZ    1 
ATOM   2881 N  N     . GLU C 1 83  ? 7.178   37.254 48.295 1.00 18.86 ? 83  GLU C N     1 
ATOM   2882 C  CA    . GLU C 1 83  ? 6.217   36.289 47.789 1.00 17.56 ? 83  GLU C CA    1 
ATOM   2883 C  C     . GLU C 1 83  ? 4.882   36.905 47.370 1.00 18.35 ? 83  GLU C C     1 
ATOM   2884 O  O     . GLU C 1 83  ? 4.345   37.777 48.042 1.00 19.34 ? 83  GLU C O     1 
ATOM   2885 C  CB    . GLU C 1 83  ? 5.957   35.222 48.873 1.00 15.55 ? 83  GLU C CB    1 
ATOM   2886 C  CG    . GLU C 1 83  ? 4.939   34.171 48.473 1.00 16.94 ? 83  GLU C CG    1 
ATOM   2887 C  CD    . GLU C 1 83  ? 4.794   33.074 49.532 1.00 19.53 ? 83  GLU C CD    1 
ATOM   2888 O  OE1   . GLU C 1 83  ? 5.835   32.585 50.022 1.00 22.45 ? 83  GLU C OE1   1 
ATOM   2889 O  OE2   . GLU C 1 83  ? 3.649   32.719 49.888 1.00 23.04 ? 83  GLU C OE2   1 
ATOM   2890 N  N     . GLY C 1 84  ? 4.340   36.412 46.271 1.00 19.26 ? 84  GLY C N     1 
ATOM   2891 C  CA    . GLY C 1 84  ? 3.061   36.903 45.799 1.00 20.15 ? 84  GLY C CA    1 
ATOM   2892 C  C     . GLY C 1 84  ? 2.878   36.463 44.369 1.00 19.49 ? 84  GLY C C     1 
ATOM   2893 O  O     . GLY C 1 84  ? 3.820   35.970 43.731 1.00 20.57 ? 84  GLY C O     1 
ATOM   2894 N  N     . LYS C 1 85  ? 1.672   36.646 43.862 1.00 21.15 ? 85  LYS C N     1 
ATOM   2895 C  CA    . LYS C 1 85  ? 1.346   36.263 42.506 1.00 21.22 ? 85  LYS C CA    1 
ATOM   2896 C  C     . LYS C 1 85  ? 2.202   37.070 41.543 1.00 22.04 ? 85  LYS C C     1 
ATOM   2897 O  O     . LYS C 1 85  ? 2.264   38.293 41.633 1.00 20.05 ? 85  LYS C O     1 
ATOM   2898 C  CB    . LYS C 1 85  ? -0.147  36.511 42.214 1.00 23.45 ? 85  LYS C CB    1 
ATOM   2899 C  CG    . LYS C 1 85  ? -0.617  35.962 40.842 1.00 22.40 ? 85  LYS C CG    1 
ATOM   2900 C  CD    . LYS C 1 85  ? -1.940  36.582 40.334 1.00 24.75 ? 85  LYS C CD    1 
ATOM   2901 C  CE    . LYS C 1 85  ? -3.030  36.711 41.393 1.00 25.26 ? 85  LYS C CE    1 
ATOM   2902 N  NZ    . LYS C 1 85  ? -3.563  35.411 41.860 1.00 26.46 ? 85  LYS C NZ    1 
ATOM   2903 N  N     . GLY C 1 86  ? 2.894   36.368 40.651 1.00 21.70 ? 86  GLY C N     1 
ATOM   2904 C  CA    . GLY C 1 86  ? 3.717   37.022 39.637 1.00 20.40 ? 86  GLY C CA    1 
ATOM   2905 C  C     . GLY C 1 86  ? 4.759   37.995 40.136 1.00 19.81 ? 86  GLY C C     1 
ATOM   2906 O  O     . GLY C 1 86  ? 5.143   38.932 39.420 1.00 18.83 ? 86  GLY C O     1 
ATOM   2907 N  N     . VAL C 1 87  ? 5.270   37.744 41.334 1.00 18.46 ? 87  VAL C N     1 
ATOM   2908 C  CA    . VAL C 1 87  ? 6.220   38.644 41.958 1.00 17.24 ? 87  VAL C CA    1 
ATOM   2909 C  C     . VAL C 1 87  ? 7.549   38.761 41.201 1.00 18.23 ? 87  VAL C C     1 
ATOM   2910 O  O     . VAL C 1 87  ? 8.227   39.787 41.275 1.00 18.60 ? 87  VAL C O     1 
ATOM   2911 C  CB    . VAL C 1 87  ? 6.485   38.196 43.415 1.00 16.26 ? 87  VAL C CB    1 
ATOM   2912 C  CG1   . VAL C 1 87  ? 7.250   36.856 43.408 1.00 16.32 ? 87  VAL C CG1   1 
ATOM   2913 C  CG2   . VAL C 1 87  ? 7.280   39.230 44.144 1.00 15.64 ? 87  VAL C CG2   1 
ATOM   2914 N  N     . VAL C 1 88  ? 7.936   37.724 40.465 1.00 17.84 ? 88  VAL C N     1 
ATOM   2915 C  CA    . VAL C 1 88  ? 9.192   37.825 39.762 1.00 17.15 ? 88  VAL C CA    1 
ATOM   2916 C  C     . VAL C 1 88  ? 9.101   38.888 38.677 1.00 16.09 ? 88  VAL C C     1 
ATOM   2917 O  O     . VAL C 1 88  ? 9.905   39.812 38.670 1.00 16.89 ? 88  VAL C O     1 
ATOM   2918 C  CB    . VAL C 1 88  ? 9.630   36.474 39.152 1.00 19.10 ? 88  VAL C CB    1 
ATOM   2919 C  CG1   . VAL C 1 88  ? 10.769  36.709 38.177 1.00 20.87 ? 88  VAL C CG1   1 
ATOM   2920 C  CG2   . VAL C 1 88  ? 10.080  35.509 40.302 1.00 18.04 ? 88  VAL C CG2   1 
ATOM   2921 N  N     . ALA C 1 89  ? 8.112   38.775 37.792 1.00 15.11 ? 89  ALA C N     1 
ATOM   2922 C  CA    . ALA C 1 89  ? 7.974   39.741 36.713 1.00 17.73 ? 89  ALA C CA    1 
ATOM   2923 C  C     . ALA C 1 89  ? 7.582   41.110 37.240 1.00 18.42 ? 89  ALA C C     1 
ATOM   2924 O  O     . ALA C 1 89  ? 8.022   42.157 36.741 1.00 18.83 ? 89  ALA C O     1 
ATOM   2925 C  CB    . ALA C 1 89  ? 6.951   39.274 35.720 1.00 15.31 ? 89  ALA C CB    1 
ATOM   2926 N  N     . SER C 1 90  ? 6.742   41.104 38.258 1.00 18.30 ? 90  SER C N     1 
ATOM   2927 C  CA    . SER C 1 90  ? 6.283   42.359 38.801 1.00 17.82 ? 90  SER C CA    1 
ATOM   2928 C  C     . SER C 1 90  ? 7.422   43.167 39.405 1.00 17.59 ? 90  SER C C     1 
ATOM   2929 O  O     . SER C 1 90  ? 7.580   44.344 39.093 1.00 18.05 ? 90  SER C O     1 
ATOM   2930 C  CB    . SER C 1 90  ? 5.201   42.107 39.845 1.00 17.85 ? 90  SER C CB    1 
ATOM   2931 O  OG    . SER C 1 90  ? 4.731   43.347 40.361 1.00 18.58 ? 90  SER C OG    1 
ATOM   2932 N  N     . ALA C 1 91  ? 8.223   42.527 40.244 1.00 14.87 ? 91  ALA C N     1 
ATOM   2933 C  CA    . ALA C 1 91  ? 9.333   43.211 40.891 1.00 16.38 ? 91  ALA C CA    1 
ATOM   2934 C  C     . ALA C 1 91  ? 10.303  43.785 39.866 1.00 17.34 ? 91  ALA C C     1 
ATOM   2935 O  O     . ALA C 1 91  ? 10.931  44.802 40.121 1.00 17.19 ? 91  ALA C O     1 
ATOM   2936 C  CB    . ALA C 1 91  ? 10.073  42.258 41.830 1.00 17.97 ? 91  ALA C CB    1 
ATOM   2937 N  N     . ARG C 1 92  ? 10.474  43.098 38.734 1.00 17.38 ? 92  ARG C N     1 
ATOM   2938 C  CA    . ARG C 1 92  ? 11.374  43.632 37.701 1.00 18.44 ? 92  ARG C CA    1 
ATOM   2939 C  C     . ARG C 1 92  ? 10.722  44.877 37.107 1.00 19.05 ? 92  ARG C C     1 
ATOM   2940 O  O     . ARG C 1 92  ? 11.385  45.877 36.873 1.00 19.29 ? 92  ARG C O     1 
ATOM   2941 C  CB    . ARG C 1 92  ? 11.601  42.606 36.584 1.00 20.77 ? 92  ARG C CB    1 
ATOM   2942 C  CG    . ARG C 1 92  ? 12.383  41.372 36.992 1.00 23.97 ? 92  ARG C CG    1 
ATOM   2943 C  CD    . ARG C 1 92  ? 13.823  41.710 37.411 1.00 29.82 ? 92  ARG C CD    1 
ATOM   2944 N  NE    . ARG C 1 92  ? 14.551  42.442 36.365 1.00 35.03 ? 92  ARG C NE    1 
ATOM   2945 C  CZ    . ARG C 1 92  ? 15.740  43.036 36.529 1.00 36.83 ? 92  ARG C CZ    1 
ATOM   2946 N  NH1   . ARG C 1 92  ? 16.375  42.991 37.701 1.00 36.66 ? 92  ARG C NH1   1 
ATOM   2947 N  NH2   . ARG C 1 92  ? 16.293  43.715 35.525 1.00 37.19 ? 92  ARG C NH2   1 
ATOM   2948 N  N     . LEU C 1 93  ? 9.424   44.806 36.820 1.00 18.48 ? 93  LEU C N     1 
ATOM   2949 C  CA    . LEU C 1 93  ? 8.727   45.972 36.291 1.00 19.13 ? 93  LEU C CA    1 
ATOM   2950 C  C     . LEU C 1 93  ? 8.874   47.147 37.289 1.00 18.03 ? 93  LEU C C     1 
ATOM   2951 O  O     . LEU C 1 93  ? 9.089   48.298 36.909 1.00 16.81 ? 93  LEU C O     1 
ATOM   2952 C  CB    . LEU C 1 93  ? 7.248   45.626 36.067 1.00 20.39 ? 93  LEU C CB    1 
ATOM   2953 C  CG    . LEU C 1 93  ? 6.380   46.631 35.296 1.00 21.29 ? 93  LEU C CG    1 
ATOM   2954 C  CD1   . LEU C 1 93  ? 6.966   46.921 33.907 1.00 24.67 ? 93  LEU C CD1   1 
ATOM   2955 C  CD2   . LEU C 1 93  ? 4.994   46.062 35.164 1.00 21.58 ? 93  LEU C CD2   1 
ATOM   2956 N  N     . MET C 1 94  ? 8.775   46.846 38.578 1.00 17.47 ? 94  MET C N     1 
ATOM   2957 C  CA    . MET C 1 94  ? 8.924   47.873 39.619 1.00 17.41 ? 94  MET C CA    1 
ATOM   2958 C  C     . MET C 1 94  ? 10.343  48.419 39.740 1.00 17.94 ? 94  MET C C     1 
ATOM   2959 O  O     . MET C 1 94  ? 10.562  49.564 40.192 1.00 17.51 ? 94  MET C O     1 
ATOM   2960 C  CB    . MET C 1 94  ? 8.433   47.287 40.961 1.00 15.48 ? 94  MET C CB    1 
ATOM   2961 C  CG    . MET C 1 94  ? 6.916   47.099 40.920 1.00 15.73 ? 94  MET C CG    1 
ATOM   2962 S  SD    . MET C 1 94  ? 6.355   46.130 42.348 1.00 18.85 ? 94  MET C SD    1 
ATOM   2963 C  CE    . MET C 1 94  ? 6.757   47.381 43.697 1.00 18.96 ? 94  MET C CE    1 
ATOM   2964 N  N     . ILE C 1 95  ? 11.318  47.603 39.335 1.00 18.51 ? 95  ILE C N     1 
ATOM   2965 C  CA    . ILE C 1 95  ? 12.703  48.019 39.378 1.00 17.12 ? 95  ILE C CA    1 
ATOM   2966 C  C     . ILE C 1 95  ? 13.009  48.936 38.186 1.00 18.16 ? 95  ILE C C     1 
ATOM   2967 O  O     . ILE C 1 95  ? 13.675  49.954 38.351 1.00 16.19 ? 95  ILE C O     1 
ATOM   2968 C  CB    . ILE C 1 95  ? 13.641  46.769 39.344 1.00 19.28 ? 95  ILE C CB    1 
ATOM   2969 C  CG1   . ILE C 1 95  ? 13.616  46.087 40.709 1.00 17.45 ? 95  ILE C CG1   1 
ATOM   2970 C  CG2   . ILE C 1 95  ? 15.066  47.163 38.940 1.00 19.87 ? 95  ILE C CG2   1 
ATOM   2971 C  CD1   . ILE C 1 95  ? 14.347  44.726 40.736 1.00 19.57 ? 95  ILE C CD1   1 
ATOM   2972 N  N     . GLY C 1 96  ? 12.502  48.582 37.008 1.00 17.65 ? 96  GLY C N     1 
ATOM   2973 C  CA    . GLY C 1 96  ? 12.786  49.382 35.812 1.00 20.15 ? 96  GLY C CA    1 
ATOM   2974 C  C     . GLY C 1 96  ? 13.568  48.514 34.822 1.00 22.25 ? 96  GLY C C     1 
ATOM   2975 O  O     . GLY C 1 96  ? 13.247  47.334 34.674 1.00 24.28 ? 96  GLY C O     1 
ATOM   2976 N  N     . VAL C 1 97  ? 14.546  49.095 34.124 1.00 22.60 ? 97  VAL C N     1 
ATOM   2977 C  CA    . VAL C 1 97  ? 15.415  48.355 33.205 1.00 22.38 ? 97  VAL C CA    1 
ATOM   2978 C  C     . VAL C 1 97  ? 16.858  48.516 33.689 1.00 23.50 ? 97  VAL C C     1 
ATOM   2979 O  O     . VAL C 1 97  ? 17.138  49.322 34.579 1.00 22.66 ? 97  VAL C O     1 
ATOM   2980 C  CB    . VAL C 1 97  ? 15.328  48.861 31.759 1.00 24.29 ? 97  VAL C CB    1 
ATOM   2981 C  CG1   . VAL C 1 97  ? 13.999  48.469 31.158 1.00 20.36 ? 97  VAL C CG1   1 
ATOM   2982 C  CG2   . VAL C 1 97  ? 15.535  50.362 31.716 1.00 21.17 ? 97  VAL C CG2   1 
ATOM   2983 N  N     . THR C 1 98  ? 17.794  47.766 33.095 1.00 23.48 ? 98  THR C N     1 
ATOM   2984 C  CA    . THR C 1 98  ? 19.191  47.833 33.535 1.00 23.69 ? 98  THR C CA    1 
ATOM   2985 C  C     . THR C 1 98  ? 19.750  49.239 33.667 1.00 23.21 ? 98  THR C C     1 
ATOM   2986 O  O     . THR C 1 98  ? 20.415  49.586 34.668 1.00 22.89 ? 98  THR C O     1 
ATOM   2987 C  CB    . THR C 1 98  ? 20.111  47.053 32.554 1.00 25.36 ? 98  THR C CB    1 
ATOM   2988 O  OG1   . THR C 1 98  ? 19.470  45.828 32.199 1.00 29.00 ? 98  THR C OG1   1 
ATOM   2989 C  CG2   . THR C 1 98  ? 21.436  46.749 33.198 1.00 28.13 ? 98  THR C CG2   1 
ATOM   2990 N  N     . ASN C 1 99  ? 19.479  50.048 32.651 1.00 21.89 ? 99  ASN C N     1 
ATOM   2991 C  CA    . ASN C 1 99  ? 19.971  51.421 32.613 1.00 23.38 ? 99  ASN C CA    1 
ATOM   2992 C  C     . ASN C 1 99  ? 18.963  52.304 33.325 1.00 21.20 ? 99  ASN C C     1 
ATOM   2993 O  O     . ASN C 1 99  ? 17.865  52.461 32.840 1.00 20.37 ? 99  ASN C O     1 
ATOM   2994 C  CB    . ASN C 1 99  ? 20.101  51.868 31.151 1.00 24.12 ? 99  ASN C CB    1 
ATOM   2995 C  CG    . ASN C 1 99  ? 20.654  53.292 31.001 1.00 26.86 ? 99  ASN C CG    1 
ATOM   2996 O  OD1   . ASN C 1 99  ? 20.926  53.744 29.869 1.00 29.87 ? 99  ASN C OD1   1 
ATOM   2997 N  ND2   . ASN C 1 99  ? 20.829  53.998 32.115 1.00 22.55 ? 99  ASN C ND2   1 
ATOM   2998 N  N     . PRO C 1 100 ? 19.332  52.882 34.477 1.00 21.70 ? 100 PRO C N     1 
ATOM   2999 C  CA    . PRO C 1 100 ? 18.434  53.757 35.252 1.00 20.32 ? 100 PRO C CA    1 
ATOM   3000 C  C     . PRO C 1 100 ? 17.952  54.996 34.472 1.00 20.94 ? 100 PRO C C     1 
ATOM   3001 O  O     . PRO C 1 100 ? 16.875  55.544 34.739 1.00 16.97 ? 100 PRO C O     1 
ATOM   3002 C  CB    . PRO C 1 100 ? 19.287  54.155 36.442 1.00 21.49 ? 100 PRO C CB    1 
ATOM   3003 C  CG    . PRO C 1 100 ? 20.143  52.964 36.651 1.00 23.89 ? 100 PRO C CG    1 
ATOM   3004 C  CD    . PRO C 1 100 ? 20.570  52.631 35.230 1.00 21.98 ? 100 PRO C CD    1 
ATOM   3005 N  N     . LEU C 1 101 ? 18.762  55.458 33.522 1.00 19.72 ? 101 LEU C N     1 
ATOM   3006 C  CA    . LEU C 1 101 ? 18.364  56.635 32.760 1.00 19.34 ? 101 LEU C CA    1 
ATOM   3007 C  C     . LEU C 1 101 ? 17.213  56.312 31.850 1.00 18.95 ? 101 LEU C C     1 
ATOM   3008 O  O     . LEU C 1 101 ? 16.404  57.188 31.493 1.00 19.68 ? 101 LEU C O     1 
ATOM   3009 C  CB    . LEU C 1 101 ? 19.556  57.155 31.954 1.00 18.58 ? 101 LEU C CB    1 
ATOM   3010 C  CG    . LEU C 1 101 ? 20.645  57.724 32.853 1.00 17.48 ? 101 LEU C CG    1 
ATOM   3011 C  CD1   . LEU C 1 101 ? 21.887  58.079 32.030 1.00 20.43 ? 101 LEU C CD1   1 
ATOM   3012 C  CD2   . LEU C 1 101 ? 20.093  58.941 33.571 1.00 19.56 ? 101 LEU C CD2   1 
ATOM   3013 N  N     . ALA C 1 102 ? 17.108  55.043 31.469 1.00 19.78 ? 102 ALA C N     1 
ATOM   3014 C  CA    . ALA C 1 102 ? 16.034  54.644 30.570 1.00 20.34 ? 102 ALA C CA    1 
ATOM   3015 C  C     . ALA C 1 102 ? 14.842  54.077 31.339 1.00 19.99 ? 102 ALA C C     1 
ATOM   3016 O  O     . ALA C 1 102 ? 13.847  53.702 30.741 1.00 21.97 ? 102 ALA C O     1 
ATOM   3017 C  CB    . ALA C 1 102 ? 16.548  53.593 29.568 1.00 22.53 ? 102 ALA C CB    1 
ATOM   3018 N  N     . SER C 1 103 ? 14.971  53.984 32.658 1.00 19.45 ? 103 SER C N     1 
ATOM   3019 C  CA    . SER C 1 103 ? 13.898  53.424 33.469 1.00 18.43 ? 103 SER C CA    1 
ATOM   3020 C  C     . SER C 1 103 ? 12.829  54.475 33.684 1.00 20.46 ? 103 SER C C     1 
ATOM   3021 O  O     . SER C 1 103 ? 13.137  55.625 33.948 1.00 19.77 ? 103 SER C O     1 
ATOM   3022 C  CB    . SER C 1 103 ? 14.459  52.920 34.794 1.00 18.95 ? 103 SER C CB    1 
ATOM   3023 O  OG    . SER C 1 103 ? 15.368  51.853 34.541 1.00 18.20 ? 103 SER C OG    1 
ATOM   3024 N  N     . ALA C 1 104 ? 11.574  54.058 33.581 1.00 19.25 ? 104 ALA C N     1 
ATOM   3025 C  CA    . ALA C 1 104 ? 10.456  54.983 33.687 1.00 20.14 ? 104 ALA C CA    1 
ATOM   3026 C  C     . ALA C 1 104 ? 10.252  55.596 35.062 1.00 17.94 ? 104 ALA C C     1 
ATOM   3027 O  O     . ALA C 1 104 ? 10.514  54.957 36.074 1.00 17.81 ? 104 ALA C O     1 
ATOM   3028 C  CB    . ALA C 1 104 ? 9.163   54.289 33.255 1.00 21.19 ? 104 ALA C CB    1 
ATOM   3029 N  N     . PRO C 1 105 ? 9.837   56.875 35.103 1.00 18.99 ? 105 PRO C N     1 
ATOM   3030 C  CA    . PRO C 1 105 ? 9.616   57.440 36.432 1.00 17.31 ? 105 PRO C CA    1 
ATOM   3031 C  C     . PRO C 1 105 ? 8.535   56.533 37.059 1.00 16.76 ? 105 PRO C C     1 
ATOM   3032 O  O     . PRO C 1 105 ? 7.624   56.041 36.362 1.00 16.41 ? 105 PRO C O     1 
ATOM   3033 C  CB    . PRO C 1 105 ? 9.110   58.873 36.158 1.00 19.65 ? 105 PRO C CB    1 
ATOM   3034 C  CG    . PRO C 1 105 ? 9.054   59.022 34.637 1.00 22.04 ? 105 PRO C CG    1 
ATOM   3035 C  CD    . PRO C 1 105 ? 9.877   57.912 34.051 1.00 19.33 ? 105 PRO C CD    1 
ATOM   3036 N  N     . GLY C 1 106 ? 8.662   56.302 38.356 1.00 16.43 ? 106 GLY C N     1 
ATOM   3037 C  CA    . GLY C 1 106 ? 7.736   55.433 39.056 1.00 15.66 ? 106 GLY C CA    1 
ATOM   3038 C  C     . GLY C 1 106 ? 8.446   54.135 39.409 1.00 17.38 ? 106 GLY C C     1 
ATOM   3039 O  O     . GLY C 1 106 ? 8.080   53.459 40.389 1.00 14.59 ? 106 GLY C O     1 
ATOM   3040 N  N     . SER C 1 107 ? 9.445   53.766 38.605 1.00 15.83 ? 107 SER C N     1 
ATOM   3041 C  CA    . SER C 1 107 ? 10.212  52.552 38.872 1.00 16.67 ? 107 SER C CA    1 
ATOM   3042 C  C     . SER C 1 107 ? 11.315  52.960 39.819 1.00 17.04 ? 107 SER C C     1 
ATOM   3043 O  O     . SER C 1 107 ? 11.635  54.166 39.943 1.00 17.29 ? 107 SER C O     1 
ATOM   3044 C  CB    . SER C 1 107 ? 10.790  51.987 37.570 1.00 17.95 ? 107 SER C CB    1 
ATOM   3045 O  OG    . SER C 1 107 ? 11.757  52.883 37.046 1.00 17.02 ? 107 SER C OG    1 
ATOM   3046 N  N     . ILE C 1 108 ? 11.921  51.985 40.490 1.00 16.26 ? 108 ILE C N     1 
ATOM   3047 C  CA    . ILE C 1 108 ? 12.963  52.297 41.458 1.00 15.62 ? 108 ILE C CA    1 
ATOM   3048 C  C     . ILE C 1 108 ? 14.192  52.901 40.791 1.00 16.37 ? 108 ILE C C     1 
ATOM   3049 O  O     . ILE C 1 108 ? 14.708  53.926 41.235 1.00 14.04 ? 108 ILE C O     1 
ATOM   3050 C  CB    . ILE C 1 108 ? 13.342  51.034 42.280 1.00 14.67 ? 108 ILE C CB    1 
ATOM   3051 C  CG1   . ILE C 1 108 ? 12.179  50.672 43.224 1.00 15.50 ? 108 ILE C CG1   1 
ATOM   3052 C  CG2   . ILE C 1 108 ? 14.564  51.309 43.122 1.00 14.21 ? 108 ILE C CG2   1 
ATOM   3053 C  CD1   . ILE C 1 108 ? 12.246  49.213 43.768 1.00 15.63 ? 108 ILE C CD1   1 
ATOM   3054 N  N     . ARG C 1 109 ? 14.679  52.257 39.733 1.00 15.22 ? 109 ARG C N     1 
ATOM   3055 C  CA    . ARG C 1 109 ? 15.827  52.812 39.032 1.00 15.14 ? 109 ARG C CA    1 
ATOM   3056 C  C     . ARG C 1 109 ? 15.457  54.114 38.340 1.00 15.74 ? 109 ARG C C     1 
ATOM   3057 O  O     . ARG C 1 109 ? 16.267  55.050 38.321 1.00 16.75 ? 109 ARG C O     1 
ATOM   3058 C  CB    . ARG C 1 109 ? 16.364  51.810 38.007 1.00 15.45 ? 109 ARG C CB    1 
ATOM   3059 C  CG    . ARG C 1 109 ? 17.014  50.599 38.667 1.00 16.15 ? 109 ARG C CG    1 
ATOM   3060 C  CD    . ARG C 1 109 ? 17.496  49.559 37.649 1.00 18.21 ? 109 ARG C CD    1 
ATOM   3061 N  NE    . ARG C 1 109 ? 18.128  48.405 38.292 1.00 18.36 ? 109 ARG C NE    1 
ATOM   3062 C  CZ    . ARG C 1 109 ? 18.282  47.217 37.703 1.00 21.35 ? 109 ARG C CZ    1 
ATOM   3063 N  NH1   . ARG C 1 109 ? 17.853  47.031 36.453 1.00 19.43 ? 109 ARG C NH1   1 
ATOM   3064 N  NH2   . ARG C 1 109 ? 18.859  46.216 38.375 1.00 20.75 ? 109 ARG C NH2   1 
ATOM   3065 N  N     . GLY C 1 110 ? 14.241  54.193 37.790 1.00 16.09 ? 110 GLY C N     1 
ATOM   3066 C  CA    . GLY C 1 110 ? 13.834  55.415 37.112 1.00 17.40 ? 110 GLY C CA    1 
ATOM   3067 C  C     . GLY C 1 110 ? 13.775  56.589 38.082 1.00 18.43 ? 110 GLY C C     1 
ATOM   3068 O  O     . GLY C 1 110 ? 14.092  57.731 37.720 1.00 18.45 ? 110 GLY C O     1 
ATOM   3069 N  N     . ASP C 1 111 ? 13.379  56.320 39.327 1.00 15.13 ? 111 ASP C N     1 
ATOM   3070 C  CA    . ASP C 1 111 ? 13.276  57.389 40.311 1.00 14.36 ? 111 ASP C CA    1 
ATOM   3071 C  C     . ASP C 1 111 ? 14.560  57.732 41.031 1.00 14.03 ? 111 ASP C C     1 
ATOM   3072 O  O     . ASP C 1 111 ? 14.747  58.875 41.450 1.00 14.66 ? 111 ASP C O     1 
ATOM   3073 C  CB    . ASP C 1 111 ? 12.260  57.073 41.412 1.00 15.30 ? 111 ASP C CB    1 
ATOM   3074 C  CG    . ASP C 1 111 ? 10.831  57.050 40.930 1.00 17.98 ? 111 ASP C CG    1 
ATOM   3075 O  OD1   . ASP C 1 111 ? 10.513  57.677 39.900 1.00 18.30 ? 111 ASP C OD1   1 
ATOM   3076 O  OD2   . ASP C 1 111 ? 10.013  56.404 41.622 1.00 16.38 ? 111 ASP C OD2   1 
ATOM   3077 N  N     . PHE C 1 112 ? 15.465  56.763 41.143 1.00 15.70 ? 112 PHE C N     1 
ATOM   3078 C  CA    . PHE C 1 112 ? 16.671  56.977 41.943 1.00 16.67 ? 112 PHE C CA    1 
ATOM   3079 C  C     . PHE C 1 112 ? 18.058  56.837 41.369 1.00 16.06 ? 112 PHE C C     1 
ATOM   3080 O  O     . PHE C 1 112 ? 19.009  57.175 42.059 1.00 17.34 ? 112 PHE C O     1 
ATOM   3081 C  CB    . PHE C 1 112 ? 16.626  56.033 43.144 1.00 18.15 ? 112 PHE C CB    1 
ATOM   3082 C  CG    . PHE C 1 112 ? 15.416  56.213 44.006 1.00 20.14 ? 112 PHE C CG    1 
ATOM   3083 C  CD1   . PHE C 1 112 ? 15.197  57.418 44.667 1.00 23.20 ? 112 PHE C CD1   1 
ATOM   3084 C  CD2   . PHE C 1 112 ? 14.493  55.185 44.157 1.00 22.22 ? 112 PHE C CD2   1 
ATOM   3085 C  CE1   . PHE C 1 112 ? 14.058  57.597 45.477 1.00 24.54 ? 112 PHE C CE1   1 
ATOM   3086 C  CE2   . PHE C 1 112 ? 13.353  55.361 44.973 1.00 22.53 ? 112 PHE C CE2   1 
ATOM   3087 C  CZ    . PHE C 1 112 ? 13.148  56.561 45.621 1.00 20.57 ? 112 PHE C CZ    1 
ATOM   3088 N  N     . GLY C 1 113 ? 18.193  56.346 40.148 1.00 18.40 ? 113 GLY C N     1 
ATOM   3089 C  CA    . GLY C 1 113 ? 19.536  56.157 39.617 1.00 20.62 ? 113 GLY C CA    1 
ATOM   3090 C  C     . GLY C 1 113 ? 19.856  56.770 38.269 1.00 20.79 ? 113 GLY C C     1 
ATOM   3091 O  O     . GLY C 1 113 ? 18.968  57.126 37.508 1.00 18.65 ? 113 GLY C O     1 
ATOM   3092 N  N     . VAL C 1 114 ? 21.155  56.844 37.981 1.00 22.91 ? 114 VAL C N     1 
ATOM   3093 C  CA    . VAL C 1 114 ? 21.661  57.416 36.735 1.00 24.30 ? 114 VAL C CA    1 
ATOM   3094 C  C     . VAL C 1 114 ? 22.714  56.549 36.016 1.00 25.80 ? 114 VAL C C     1 
ATOM   3095 O  O     . VAL C 1 114 ? 22.897  56.680 34.797 1.00 26.86 ? 114 VAL C O     1 
ATOM   3096 C  CB    . VAL C 1 114 ? 22.309  58.800 36.978 1.00 25.20 ? 114 VAL C CB    1 
ATOM   3097 C  CG1   . VAL C 1 114 ? 21.246  59.832 37.417 1.00 26.05 ? 114 VAL C CG1   1 
ATOM   3098 C  CG2   . VAL C 1 114 ? 23.390  58.677 38.047 1.00 27.50 ? 114 VAL C CG2   1 
ATOM   3099 N  N     . ASP C 1 115 ? 23.362  55.655 36.759 1.00 25.25 ? 115 ASP C N     1 
ATOM   3100 C  CA    . ASP C 1 115 ? 24.459  54.819 36.246 1.00 25.38 ? 115 ASP C CA    1 
ATOM   3101 C  C     . ASP C 1 115 ? 24.181  53.313 36.274 1.00 25.41 ? 115 ASP C C     1 
ATOM   3102 O  O     . ASP C 1 115 ? 23.690  52.784 37.272 1.00 23.39 ? 115 ASP C O     1 
ATOM   3103 C  CB    . ASP C 1 115 ? 25.706  55.160 37.071 1.00 27.36 ? 115 ASP C CB    1 
ATOM   3104 C  CG    . ASP C 1 115 ? 27.006  54.634 36.455 1.00 31.92 ? 115 ASP C CG    1 
ATOM   3105 O  OD1   . ASP C 1 115 ? 28.069  55.235 36.736 1.00 30.79 ? 115 ASP C OD1   1 
ATOM   3106 O  OD2   . ASP C 1 115 ? 26.976  53.619 35.715 1.00 34.46 ? 115 ASP C OD2   1 
ATOM   3107 N  N     . VAL C 1 116 ? 24.507  52.616 35.186 1.00 26.98 ? 116 VAL C N     1 
ATOM   3108 C  CA    . VAL C 1 116 ? 24.274  51.173 35.118 1.00 26.92 ? 116 VAL C CA    1 
ATOM   3109 C  C     . VAL C 1 116 ? 24.959  50.419 36.233 1.00 27.34 ? 116 VAL C C     1 
ATOM   3110 O  O     . VAL C 1 116 ? 24.417  49.433 36.722 1.00 27.04 ? 116 VAL C O     1 
ATOM   3111 C  CB    . VAL C 1 116 ? 24.759  50.575 33.786 1.00 28.75 ? 116 VAL C CB    1 
ATOM   3112 C  CG1   . VAL C 1 116 ? 24.789  49.051 33.879 1.00 28.66 ? 116 VAL C CG1   1 
ATOM   3113 C  CG2   . VAL C 1 116 ? 23.843  51.003 32.664 1.00 26.52 ? 116 VAL C CG2   1 
ATOM   3114 N  N     . GLY C 1 117 ? 26.127  50.896 36.662 1.00 25.77 ? 117 GLY C N     1 
ATOM   3115 C  CA    . GLY C 1 117 ? 26.870  50.207 37.699 1.00 27.02 ? 117 GLY C CA    1 
ATOM   3116 C  C     . GLY C 1 117 ? 26.492  50.586 39.108 1.00 26.10 ? 117 GLY C C     1 
ATOM   3117 O  O     . GLY C 1 117 ? 27.018  50.058 40.095 1.00 24.70 ? 117 GLY C O     1 
ATOM   3118 N  N     . ARG C 1 118 ? 25.587  51.548 39.205 1.00 25.31 ? 118 ARG C N     1 
ATOM   3119 C  CA    . ARG C 1 118 ? 25.118  52.004 40.494 1.00 24.38 ? 118 ARG C CA    1 
ATOM   3120 C  C     . ARG C 1 118 ? 23.619  52.067 40.321 1.00 22.98 ? 118 ARG C C     1 
ATOM   3121 O  O     . ARG C 1 118 ? 23.003  53.143 40.460 1.00 21.33 ? 118 ARG C O     1 
ATOM   3122 C  CB    . ARG C 1 118 ? 25.714  53.378 40.809 1.00 25.09 ? 118 ARG C CB    1 
ATOM   3123 C  CG    . ARG C 1 118 ? 27.248  53.352 40.983 1.00 26.32 ? 118 ARG C CG    1 
ATOM   3124 C  CD    . ARG C 1 118 ? 27.663  52.831 42.366 1.00 27.77 ? 118 ARG C CD    1 
ATOM   3125 N  NE    . ARG C 1 118 ? 29.111  52.902 42.599 1.00 28.14 ? 118 ARG C NE    1 
ATOM   3126 C  CZ    . ARG C 1 118 ? 30.011  52.074 42.074 1.00 28.41 ? 118 ARG C CZ    1 
ATOM   3127 N  NH1   . ARG C 1 118 ? 29.638  51.086 41.270 1.00 26.71 ? 118 ARG C NH1   1 
ATOM   3128 N  NH2   . ARG C 1 118 ? 31.295  52.218 42.378 1.00 27.83 ? 118 ARG C NH2   1 
ATOM   3129 N  N     . ASN C 1 119 ? 23.045  50.902 40.006 1.00 20.53 ? 119 ASN C N     1 
ATOM   3130 C  CA    . ASN C 1 119 ? 21.624  50.822 39.768 1.00 20.05 ? 119 ASN C CA    1 
ATOM   3131 C  C     . ASN C 1 119 ? 20.725  50.319 40.896 1.00 18.61 ? 119 ASN C C     1 
ATOM   3132 O  O     . ASN C 1 119 ? 19.667  49.754 40.647 1.00 18.07 ? 119 ASN C O     1 
ATOM   3133 C  CB    . ASN C 1 119 ? 21.305  50.117 38.450 1.00 21.68 ? 119 ASN C CB    1 
ATOM   3134 C  CG    . ASN C 1 119 ? 21.575  48.635 38.467 1.00 23.28 ? 119 ASN C CG    1 
ATOM   3135 O  OD1   . ASN C 1 119 ? 21.937  48.047 39.488 1.00 22.81 ? 119 ASN C OD1   1 
ATOM   3136 N  ND2   . ASN C 1 119 ? 21.371  48.011 37.312 1.00 23.33 ? 119 ASN C ND2   1 
ATOM   3137 N  N     . ILE C 1 120 ? 21.211  50.541 42.117 1.00 18.48 ? 120 ILE C N     1 
ATOM   3138 C  CA    . ILE C 1 120 ? 20.457  50.364 43.359 1.00 20.21 ? 120 ILE C CA    1 
ATOM   3139 C  C     . ILE C 1 120 ? 19.983  49.040 43.888 1.00 18.67 ? 120 ILE C C     1 
ATOM   3140 O  O     . ILE C 1 120 ? 20.192  48.718 45.064 1.00 21.09 ? 120 ILE C O     1 
ATOM   3141 C  CB    . ILE C 1 120 ? 19.199  51.282 43.298 1.00 19.32 ? 120 ILE C CB    1 
ATOM   3142 C  CG1   . ILE C 1 120 ? 19.627  52.691 42.901 1.00 21.17 ? 120 ILE C CG1   1 
ATOM   3143 C  CG2   . ILE C 1 120 ? 18.463  51.338 44.643 1.00 17.04 ? 120 ILE C CG2   1 
ATOM   3144 C  CD1   . ILE C 1 120 ? 18.901  53.165 41.712 1.00 23.56 ? 120 ILE C CD1   1 
ATOM   3145 N  N     . ILE C 1 121 ? 19.321  48.303 43.025 1.00 19.57 ? 121 ILE C N     1 
ATOM   3146 C  CA    . ILE C 1 121 ? 18.707  47.038 43.409 1.00 20.12 ? 121 ILE C CA    1 
ATOM   3147 C  C     . ILE C 1 121 ? 18.853  46.059 42.276 1.00 20.83 ? 121 ILE C C     1 
ATOM   3148 O  O     . ILE C 1 121 ? 19.038  46.467 41.129 1.00 21.52 ? 121 ILE C O     1 
ATOM   3149 C  CB    . ILE C 1 121 ? 17.207  47.307 43.695 1.00 17.71 ? 121 ILE C CB    1 
ATOM   3150 C  CG1   . ILE C 1 121 ? 16.462  46.043 44.113 1.00 19.17 ? 121 ILE C CG1   1 
ATOM   3151 C  CG2   . ILE C 1 121 ? 16.558  47.919 42.471 1.00 18.58 ? 121 ILE C CG2   1 
ATOM   3152 C  CD1   . ILE C 1 121 ? 15.035  46.389 44.568 1.00 18.09 ? 121 ILE C CD1   1 
ATOM   3153 N  N     . GLY C 1 122 ? 18.764  44.772 42.604 1.00 20.97 ? 122 GLY C N     1 
ATOM   3154 C  CA    . GLY C 1 122 ? 18.854  43.711 41.616 1.00 21.15 ? 122 GLY C CA    1 
ATOM   3155 C  C     . GLY C 1 122 ? 17.725  42.754 41.972 1.00 22.48 ? 122 GLY C C     1 
ATOM   3156 O  O     . GLY C 1 122 ? 17.395  42.594 43.160 1.00 22.88 ? 122 GLY C O     1 
ATOM   3157 N  N     . GLY C 1 123 ? 17.105  42.161 40.963 1.00 22.60 ? 123 GLY C N     1 
ATOM   3158 C  CA    . GLY C 1 123 ? 16.003  41.250 41.212 1.00 21.20 ? 123 GLY C CA    1 
ATOM   3159 C  C     . GLY C 1 123 ? 16.096  40.105 40.234 1.00 23.17 ? 123 GLY C C     1 
ATOM   3160 O  O     . GLY C 1 123 ? 16.597  40.287 39.115 1.00 21.79 ? 123 GLY C O     1 
ATOM   3161 N  N     . SER C 1 124 ? 15.616  38.936 40.652 1.00 22.18 ? 124 SER C N     1 
ATOM   3162 C  CA    . SER C 1 124 ? 15.635  37.742 39.825 1.00 22.75 ? 124 SER C CA    1 
ATOM   3163 C  C     . SER C 1 124 ? 14.909  38.001 38.506 1.00 24.70 ? 124 SER C C     1 
ATOM   3164 O  O     . SER C 1 124 ? 13.846  38.624 38.490 1.00 26.00 ? 124 SER C O     1 
ATOM   3165 C  CB    . SER C 1 124 ? 14.965  36.597 40.591 1.00 21.14 ? 124 SER C CB    1 
ATOM   3166 O  OG    . SER C 1 124 ? 15.627  36.382 41.834 1.00 18.41 ? 124 SER C OG    1 
ATOM   3167 N  N     . ASP C 1 125 ? 15.473  37.536 37.395 1.00 27.06 ? 125 ASP C N     1 
ATOM   3168 C  CA    . ASP C 1 125 ? 14.832  37.760 36.109 1.00 28.41 ? 125 ASP C CA    1 
ATOM   3169 C  C     . ASP C 1 125 ? 13.899  36.662 35.618 1.00 28.10 ? 125 ASP C C     1 
ATOM   3170 O  O     . ASP C 1 125 ? 13.286  36.810 34.567 1.00 28.58 ? 125 ASP C O     1 
ATOM   3171 C  CB    . ASP C 1 125 ? 15.869  38.080 35.019 1.00 31.74 ? 125 ASP C CB    1 
ATOM   3172 C  CG    . ASP C 1 125 ? 16.827  36.938 34.764 1.00 35.02 ? 125 ASP C CG    1 
ATOM   3173 O  OD1   . ASP C 1 125 ? 16.436  35.777 35.005 1.00 35.62 ? 125 ASP C OD1   1 
ATOM   3174 O  OD2   . ASP C 1 125 ? 17.966  37.199 34.310 1.00 36.66 ? 125 ASP C OD2   1 
ATOM   3175 N  N     . SER C 1 126 ? 13.777  35.575 36.373 1.00 26.53 ? 126 SER C N     1 
ATOM   3176 C  CA    . SER C 1 126 ? 12.881  34.477 36.003 1.00 25.91 ? 126 SER C CA    1 
ATOM   3177 C  C     . SER C 1 126 ? 12.617  33.628 37.243 1.00 23.90 ? 126 SER C C     1 
ATOM   3178 O  O     . SER C 1 126 ? 13.377  33.668 38.197 1.00 24.67 ? 126 SER C O     1 
ATOM   3179 C  CB    . SER C 1 126 ? 13.540  33.584 34.953 1.00 26.87 ? 126 SER C CB    1 
ATOM   3180 O  OG    . SER C 1 126 ? 14.643  32.945 35.572 1.00 27.46 ? 126 SER C OG    1 
ATOM   3181 N  N     . VAL C 1 127 ? 11.553  32.846 37.242 1.00 25.18 ? 127 VAL C N     1 
ATOM   3182 C  CA    . VAL C 1 127 ? 11.299  32.005 38.408 1.00 26.63 ? 127 VAL C CA    1 
ATOM   3183 C  C     . VAL C 1 127 ? 12.502  31.076 38.619 1.00 26.85 ? 127 VAL C C     1 
ATOM   3184 O  O     . VAL C 1 127 ? 12.941  30.851 39.734 1.00 27.36 ? 127 VAL C O     1 
ATOM   3185 C  CB    . VAL C 1 127 ? 10.024  31.172 38.204 1.00 28.43 ? 127 VAL C CB    1 
ATOM   3186 C  CG1   . VAL C 1 127 ? 9.946   30.063 39.246 1.00 28.62 ? 127 VAL C CG1   1 
ATOM   3187 C  CG2   . VAL C 1 127 ? 8.803   32.074 38.305 1.00 29.13 ? 127 VAL C CG2   1 
ATOM   3188 N  N     . GLU C 1 128 ? 13.039  30.546 37.528 1.00 28.82 ? 128 GLU C N     1 
ATOM   3189 C  CA    . GLU C 1 128 ? 14.190  29.649 37.609 1.00 29.15 ? 128 GLU C CA    1 
ATOM   3190 C  C     . GLU C 1 128 ? 15.341  30.319 38.358 1.00 28.41 ? 128 GLU C C     1 
ATOM   3191 O  O     . GLU C 1 128 ? 15.879  29.758 39.315 1.00 25.82 ? 128 GLU C O     1 
ATOM   3192 C  CB    . GLU C 1 128 ? 14.648  29.256 36.201 1.00 32.66 ? 128 GLU C CB    1 
ATOM   3193 C  CG    . GLU C 1 128 ? 13.606  28.493 35.369 1.00 36.03 ? 128 GLU C CG    1 
ATOM   3194 C  CD    . GLU C 1 128 ? 12.266  29.236 35.195 1.00 39.45 ? 128 GLU C CD    1 
ATOM   3195 O  OE1   . GLU C 1 128 ? 12.256  30.404 34.731 1.00 36.68 ? 128 GLU C OE1   1 
ATOM   3196 O  OE2   . GLU C 1 128 ? 11.212  28.629 35.508 1.00 39.99 ? 128 GLU C OE2   1 
ATOM   3197 N  N     . SER C 1 129 ? 15.713  31.519 37.913 1.00 26.08 ? 129 SER C N     1 
ATOM   3198 C  CA    . SER C 1 129 ? 16.789  32.270 38.541 1.00 28.45 ? 129 SER C CA    1 
ATOM   3199 C  C     . SER C 1 129 ? 16.422  32.667 39.968 1.00 26.31 ? 129 SER C C     1 
ATOM   3200 O  O     . SER C 1 129 ? 17.269  32.664 40.844 1.00 26.49 ? 129 SER C O     1 
ATOM   3201 C  CB    . SER C 1 129 ? 17.111  33.534 37.735 1.00 30.02 ? 129 SER C CB    1 
ATOM   3202 O  OG    . SER C 1 129 ? 17.720  33.186 36.506 1.00 33.12 ? 129 SER C OG    1 
ATOM   3203 N  N     . ALA C 1 130 ? 15.160  33.022 40.183 1.00 25.28 ? 130 ALA C N     1 
ATOM   3204 C  CA    . ALA C 1 130 ? 14.709  33.396 41.528 1.00 24.44 ? 130 ALA C CA    1 
ATOM   3205 C  C     . ALA C 1 130 ? 14.993  32.235 42.474 1.00 24.46 ? 130 ALA C C     1 
ATOM   3206 O  O     . ALA C 1 130 ? 15.626  32.399 43.523 1.00 24.27 ? 130 ALA C O     1 
ATOM   3207 C  CB    . ALA C 1 130 ? 13.201  33.696 41.516 1.00 24.42 ? 130 ALA C CB    1 
ATOM   3208 N  N     . ASN C 1 131 ? 14.532  31.052 42.092 1.00 25.33 ? 131 ASN C N     1 
ATOM   3209 C  CA    . ASN C 1 131 ? 14.723  29.879 42.938 1.00 27.14 ? 131 ASN C CA    1 
ATOM   3210 C  C     . ASN C 1 131 ? 16.190  29.607 43.230 1.00 26.84 ? 131 ASN C C     1 
ATOM   3211 O  O     . ASN C 1 131 ? 16.553  29.287 44.359 1.00 28.80 ? 131 ASN C O     1 
ATOM   3212 C  CB    . ASN C 1 131 ? 14.055  28.671 42.296 1.00 30.47 ? 131 ASN C CB    1 
ATOM   3213 C  CG    . ASN C 1 131 ? 12.552  28.862 42.134 1.00 32.27 ? 131 ASN C CG    1 
ATOM   3214 O  OD1   . ASN C 1 131 ? 11.885  29.474 42.990 1.00 33.25 ? 131 ASN C OD1   1 
ATOM   3215 N  ND2   . ASN C 1 131 ? 12.009  28.339 41.047 1.00 33.56 ? 131 ASN C ND2   1 
ATOM   3216 N  N     . ARG C 1 132 ? 17.033  29.766 42.222 1.00 26.96 ? 132 ARG C N     1 
ATOM   3217 C  CA    . ARG C 1 132 ? 18.465  29.557 42.385 1.00 26.57 ? 132 ARG C CA    1 
ATOM   3218 C  C     . ARG C 1 132 ? 19.083  30.565 43.351 1.00 25.57 ? 132 ARG C C     1 
ATOM   3219 O  O     . ARG C 1 132 ? 19.820  30.193 44.287 1.00 22.97 ? 132 ARG C O     1 
ATOM   3220 C  CB    . ARG C 1 132 ? 19.144  29.676 41.020 1.00 29.83 ? 132 ARG C CB    1 
ATOM   3221 C  CG    . ARG C 1 132 ? 20.665  29.635 41.070 1.00 32.75 ? 132 ARG C CG    1 
ATOM   3222 C  CD    . ARG C 1 132 ? 21.247  30.187 39.780 1.00 34.31 ? 132 ARG C CD    1 
ATOM   3223 N  NE    . ARG C 1 132 ? 22.694  30.162 39.828 1.00 37.68 ? 132 ARG C NE    1 
ATOM   3224 C  CZ    . ARG C 1 132 ? 23.428  30.738 40.775 1.00 39.03 ? 132 ARG C CZ    1 
ATOM   3225 N  NH1   . ARG C 1 132 ? 22.857  31.409 41.765 1.00 41.45 ? 132 ARG C NH1   1 
ATOM   3226 N  NH2   . ARG C 1 132 ? 24.742  30.598 40.758 1.00 40.51 ? 132 ARG C NH2   1 
ATOM   3227 N  N     . GLU C 1 133 ? 18.781  31.849 43.134 1.00 24.00 ? 133 GLU C N     1 
ATOM   3228 C  CA    . GLU C 1 133 ? 19.330  32.900 43.991 1.00 23.60 ? 133 GLU C CA    1 
ATOM   3229 C  C     . GLU C 1 133 ? 18.803  32.829 45.426 1.00 22.38 ? 133 GLU C C     1 
ATOM   3230 O  O     . GLU C 1 133 ? 19.554  33.042 46.374 1.00 23.20 ? 133 GLU C O     1 
ATOM   3231 C  CB    . GLU C 1 133 ? 19.065  34.270 43.369 1.00 24.86 ? 133 GLU C CB    1 
ATOM   3232 C  CG    . GLU C 1 133 ? 19.762  34.458 42.023 1.00 26.58 ? 133 GLU C CG    1 
ATOM   3233 C  CD    . GLU C 1 133 ? 19.138  35.558 41.166 1.00 27.71 ? 133 GLU C CD    1 
ATOM   3234 O  OE1   . GLU C 1 133 ? 18.257  36.299 41.672 1.00 25.36 ? 133 GLU C OE1   1 
ATOM   3235 O  OE2   . GLU C 1 133 ? 19.542  35.684 39.989 1.00 28.95 ? 133 GLU C OE2   1 
ATOM   3236 N  N     . ILE C 1 134 ? 17.526  32.518 45.594 1.00 22.12 ? 134 ILE C N     1 
ATOM   3237 C  CA    . ILE C 1 134 ? 16.979  32.387 46.938 1.00 22.06 ? 134 ILE C CA    1 
ATOM   3238 C  C     . ILE C 1 134 ? 17.789  31.329 47.699 1.00 23.06 ? 134 ILE C C     1 
ATOM   3239 O  O     . ILE C 1 134 ? 18.293  31.574 48.802 1.00 21.99 ? 134 ILE C O     1 
ATOM   3240 C  CB    . ILE C 1 134 ? 15.505  32.003 46.869 1.00 22.51 ? 134 ILE C CB    1 
ATOM   3241 C  CG1   . ILE C 1 134 ? 14.718  33.205 46.318 1.00 19.53 ? 134 ILE C CG1   1 
ATOM   3242 C  CG2   . ILE C 1 134 ? 14.980  31.641 48.252 1.00 21.74 ? 134 ILE C CG2   1 
ATOM   3243 C  CD1   . ILE C 1 134 ? 13.249  32.941 46.058 1.00 20.81 ? 134 ILE C CD1   1 
ATOM   3244 N  N     . ALA C 1 135 ? 17.946  30.167 47.074 1.00 25.61 ? 135 ALA C N     1 
ATOM   3245 C  CA    . ALA C 1 135 ? 18.714  29.065 47.657 1.00 26.29 ? 135 ALA C CA    1 
ATOM   3246 C  C     . ALA C 1 135 ? 20.139  29.501 47.974 1.00 26.50 ? 135 ALA C C     1 
ATOM   3247 O  O     . ALA C 1 135 ? 20.735  29.066 48.961 1.00 28.51 ? 135 ALA C O     1 
ATOM   3248 C  CB    . ALA C 1 135 ? 18.734  27.893 46.683 1.00 27.88 ? 135 ALA C CB    1 
ATOM   3249 N  N     . LEU C 1 136 ? 20.679  30.387 47.148 1.00 26.59 ? 136 LEU C N     1 
ATOM   3250 C  CA    . LEU C 1 136 ? 22.044  30.871 47.325 1.00 26.55 ? 136 LEU C CA    1 
ATOM   3251 C  C     . LEU C 1 136 ? 22.254  31.796 48.519 1.00 25.63 ? 136 LEU C C     1 
ATOM   3252 O  O     . LEU C 1 136 ? 23.208  31.637 49.293 1.00 24.50 ? 136 LEU C O     1 
ATOM   3253 C  CB    . LEU C 1 136 ? 22.456  31.624 46.062 1.00 30.07 ? 136 LEU C CB    1 
ATOM   3254 C  CG    . LEU C 1 136 ? 23.900  31.575 45.570 1.00 34.55 ? 136 LEU C CG    1 
ATOM   3255 C  CD1   . LEU C 1 136 ? 24.091  32.746 44.609 1.00 33.95 ? 136 LEU C CD1   1 
ATOM   3256 C  CD2   . LEU C 1 136 ? 24.890  31.655 46.710 1.00 36.18 ? 136 LEU C CD2   1 
ATOM   3257 N  N     . TRP C 1 137 ? 21.363  32.776 48.658 1.00 24.49 ? 137 TRP C N     1 
ATOM   3258 C  CA    . TRP C 1 137 ? 21.462  33.787 49.709 1.00 23.20 ? 137 TRP C CA    1 
ATOM   3259 C  C     . TRP C 1 137 ? 20.825  33.433 51.044 1.00 22.22 ? 137 TRP C C     1 
ATOM   3260 O  O     . TRP C 1 137 ? 21.253  33.946 52.085 1.00 23.23 ? 137 TRP C O     1 
ATOM   3261 C  CB    . TRP C 1 137 ? 20.841  35.103 49.224 1.00 23.08 ? 137 TRP C CB    1 
ATOM   3262 C  CG    . TRP C 1 137 ? 21.553  35.782 48.093 1.00 20.28 ? 137 TRP C CG    1 
ATOM   3263 C  CD1   . TRP C 1 137 ? 21.528  35.425 46.767 1.00 19.86 ? 137 TRP C CD1   1 
ATOM   3264 C  CD2   . TRP C 1 137 ? 22.365  36.961 48.176 1.00 21.27 ? 137 TRP C CD2   1 
ATOM   3265 N  NE1   . TRP C 1 137 ? 22.269  36.313 46.027 1.00 21.14 ? 137 TRP C NE1   1 
ATOM   3266 C  CE2   . TRP C 1 137 ? 22.795  37.264 46.859 1.00 20.86 ? 137 TRP C CE2   1 
ATOM   3267 C  CE3   . TRP C 1 137 ? 22.770  37.798 49.234 1.00 19.04 ? 137 TRP C CE3   1 
ATOM   3268 C  CZ2   . TRP C 1 137 ? 23.604  38.359 46.575 1.00 22.13 ? 137 TRP C CZ2   1 
ATOM   3269 C  CZ3   . TRP C 1 137 ? 23.572  38.886 48.952 1.00 19.78 ? 137 TRP C CZ3   1 
ATOM   3270 C  CH2   . TRP C 1 137 ? 23.983  39.160 47.624 1.00 21.90 ? 137 TRP C CH2   1 
ATOM   3271 N  N     . PHE C 1 138 ? 19.814  32.572 51.012 1.00 22.50 ? 138 PHE C N     1 
ATOM   3272 C  CA    . PHE C 1 138 ? 19.117  32.176 52.225 1.00 23.76 ? 138 PHE C CA    1 
ATOM   3273 C  C     . PHE C 1 138 ? 19.063  30.687 52.564 1.00 24.77 ? 138 PHE C C     1 
ATOM   3274 O  O     . PHE C 1 138 ? 18.802  29.847 51.705 1.00 23.14 ? 138 PHE C O     1 
ATOM   3275 C  CB    . PHE C 1 138 ? 17.657  32.662 52.188 1.00 23.74 ? 138 PHE C CB    1 
ATOM   3276 C  CG    . PHE C 1 138 ? 17.500  34.145 52.348 1.00 23.77 ? 138 PHE C CG    1 
ATOM   3277 C  CD1   . PHE C 1 138 ? 17.608  34.996 51.251 1.00 25.15 ? 138 PHE C CD1   1 
ATOM   3278 C  CD2   . PHE C 1 138 ? 17.275  34.693 53.618 1.00 23.54 ? 138 PHE C CD2   1 
ATOM   3279 C  CE1   . PHE C 1 138 ? 17.496  36.390 51.410 1.00 21.94 ? 138 PHE C CE1   1 
ATOM   3280 C  CE2   . PHE C 1 138 ? 17.162  36.077 53.797 1.00 23.76 ? 138 PHE C CE2   1 
ATOM   3281 C  CZ    . PHE C 1 138 ? 17.276  36.925 52.682 1.00 23.40 ? 138 PHE C CZ    1 
ATOM   3282 N  N     . LYS C 1 139 ? 19.248  30.405 53.854 1.00 25.76 ? 139 LYS C N     1 
ATOM   3283 C  CA    . LYS C 1 139 ? 19.119  29.058 54.397 1.00 27.43 ? 139 LYS C CA    1 
ATOM   3284 C  C     . LYS C 1 139 ? 17.605  28.849 54.495 1.00 27.87 ? 139 LYS C C     1 
ATOM   3285 O  O     . LYS C 1 139 ? 16.857  29.797 54.772 1.00 26.67 ? 139 LYS C O     1 
ATOM   3286 C  CB    . LYS C 1 139 ? 19.765  28.984 55.785 1.00 28.81 ? 139 LYS C CB    1 
ATOM   3287 C  CG    . LYS C 1 139 ? 21.291  28.859 55.730 1.00 32.67 ? 139 LYS C CG    1 
ATOM   3288 C  CD    . LYS C 1 139 ? 21.934  28.946 57.101 1.00 36.61 ? 139 LYS C CD    1 
ATOM   3289 C  CE    . LYS C 1 139 ? 21.818  30.350 57.702 1.00 38.44 ? 139 LYS C CE    1 
ATOM   3290 N  NZ    . LYS C 1 139 ? 22.519  31.407 56.887 1.00 42.59 ? 139 LYS C NZ    1 
ATOM   3291 N  N     . PRO C 1 140 ? 17.129  27.620 54.264 1.00 27.38 ? 140 PRO C N     1 
ATOM   3292 C  CA    . PRO C 1 140 ? 15.696  27.362 54.338 1.00 27.41 ? 140 PRO C CA    1 
ATOM   3293 C  C     . PRO C 1 140 ? 15.052  27.828 55.634 1.00 27.17 ? 140 PRO C C     1 
ATOM   3294 O  O     . PRO C 1 140 ? 13.949  28.356 55.611 1.00 27.44 ? 140 PRO C O     1 
ATOM   3295 C  CB    . PRO C 1 140 ? 15.619  25.854 54.141 1.00 30.14 ? 140 PRO C CB    1 
ATOM   3296 C  CG    . PRO C 1 140 ? 16.693  25.641 53.138 1.00 29.41 ? 140 PRO C CG    1 
ATOM   3297 C  CD    . PRO C 1 140 ? 17.835  26.451 53.719 1.00 28.95 ? 140 PRO C CD    1 
ATOM   3298 N  N     . GLU C 1 141 ? 15.734  27.668 56.765 1.00 27.89 ? 141 GLU C N     1 
ATOM   3299 C  CA    . GLU C 1 141 ? 15.143  28.095 58.028 1.00 27.79 ? 141 GLU C CA    1 
ATOM   3300 C  C     . GLU C 1 141 ? 15.045  29.623 58.143 1.00 27.53 ? 141 GLU C C     1 
ATOM   3301 O  O     . GLU C 1 141 ? 14.440  30.145 59.091 1.00 28.85 ? 141 GLU C O     1 
ATOM   3302 C  CB    . GLU C 1 141 ? 15.929  27.545 59.212 1.00 29.07 ? 141 GLU C CB    1 
ATOM   3303 C  CG    . GLU C 1 141 ? 17.388  27.879 59.161 1.00 29.36 ? 141 GLU C CG    1 
ATOM   3304 C  CD    . GLU C 1 141 ? 18.210  26.790 58.465 1.00 30.43 ? 141 GLU C CD    1 
ATOM   3305 O  OE1   . GLU C 1 141 ? 17.759  26.210 57.433 1.00 28.76 ? 141 GLU C OE1   1 
ATOM   3306 O  OE2   . GLU C 1 141 ? 19.326  26.527 58.968 1.00 33.47 ? 141 GLU C OE2   1 
ATOM   3307 N  N     . GLU C 1 142 ? 15.637  30.344 57.194 1.00 26.09 ? 142 GLU C N     1 
ATOM   3308 C  CA    . GLU C 1 142 ? 15.573  31.807 57.221 1.00 24.98 ? 142 GLU C CA    1 
ATOM   3309 C  C     . GLU C 1 142 ? 14.349  32.318 56.471 1.00 23.58 ? 142 GLU C C     1 
ATOM   3310 O  O     . GLU C 1 142 ? 14.037  33.505 56.537 1.00 22.52 ? 142 GLU C O     1 
ATOM   3311 C  CB    . GLU C 1 142 ? 16.816  32.422 56.586 1.00 24.76 ? 142 GLU C CB    1 
ATOM   3312 C  CG    . GLU C 1 142 ? 18.109  32.144 57.345 1.00 26.53 ? 142 GLU C CG    1 
ATOM   3313 C  CD    . GLU C 1 142 ? 19.278  32.802 56.691 1.00 28.71 ? 142 GLU C CD    1 
ATOM   3314 O  OE1   . GLU C 1 142 ? 19.751  32.303 55.653 1.00 30.42 ? 142 GLU C OE1   1 
ATOM   3315 O  OE2   . GLU C 1 142 ? 19.709  33.856 57.205 1.00 32.52 ? 142 GLU C OE2   1 
ATOM   3316 N  N     . LEU C 1 143 ? 13.676  31.428 55.753 1.00 21.93 ? 143 LEU C N     1 
ATOM   3317 C  CA    . LEU C 1 143 ? 12.499  31.791 54.965 1.00 21.42 ? 143 LEU C CA    1 
ATOM   3318 C  C     . LEU C 1 143 ? 11.203  31.365 55.642 1.00 22.70 ? 143 LEU C C     1 
ATOM   3319 O  O     . LEU C 1 143 ? 11.101  30.232 56.147 1.00 21.92 ? 143 LEU C O     1 
ATOM   3320 C  CB    . LEU C 1 143 ? 12.576  31.140 53.594 1.00 20.13 ? 143 LEU C CB    1 
ATOM   3321 C  CG    . LEU C 1 143 ? 13.810  31.449 52.743 1.00 22.91 ? 143 LEU C CG    1 
ATOM   3322 C  CD1   . LEU C 1 143 ? 13.776  30.555 51.498 1.00 21.33 ? 143 LEU C CD1   1 
ATOM   3323 C  CD2   . LEU C 1 143 ? 13.847  32.954 52.351 1.00 22.23 ? 143 LEU C CD2   1 
ATOM   3324 N  N     . LEU C 1 144 ? 10.220  32.269 55.661 1.00 20.34 ? 144 LEU C N     1 
ATOM   3325 C  CA    . LEU C 1 144 ? 8.932   31.972 56.283 1.00 22.54 ? 144 LEU C CA    1 
ATOM   3326 C  C     . LEU C 1 144 ? 8.250   30.823 55.560 1.00 23.21 ? 144 LEU C C     1 
ATOM   3327 O  O     . LEU C 1 144 ? 8.365   30.682 54.349 1.00 22.15 ? 144 LEU C O     1 
ATOM   3328 C  CB    . LEU C 1 144 ? 7.982   33.178 56.242 1.00 23.08 ? 144 LEU C CB    1 
ATOM   3329 C  CG    . LEU C 1 144 ? 8.392   34.443 56.982 1.00 21.71 ? 144 LEU C CG    1 
ATOM   3330 C  CD1   . LEU C 1 144 ? 7.283   35.492 56.843 1.00 20.03 ? 144 LEU C CD1   1 
ATOM   3331 C  CD2   . LEU C 1 144 ? 8.613   34.104 58.461 1.00 24.73 ? 144 LEU C CD2   1 
ATOM   3332 N  N     . THR C 1 145 ? 7.541   30.017 56.336 1.00 22.80 ? 145 THR C N     1 
ATOM   3333 C  CA    . THR C 1 145 ? 6.785   28.884 55.821 1.00 26.91 ? 145 THR C CA    1 
ATOM   3334 C  C     . THR C 1 145 ? 5.317   29.232 56.005 1.00 27.60 ? 145 THR C C     1 
ATOM   3335 O  O     . THR C 1 145 ? 4.438   28.770 55.273 1.00 29.54 ? 145 THR C O     1 
ATOM   3336 C  CB    . THR C 1 145 ? 7.138   27.610 56.612 1.00 27.45 ? 145 THR C CB    1 
ATOM   3337 O  OG1   . THR C 1 145 ? 8.523   27.312 56.388 1.00 30.89 ? 145 THR C OG1   1 
ATOM   3338 C  CG2   . THR C 1 145 ? 6.283   26.436 56.143 1.00 30.71 ? 145 THR C CG2   1 
ATOM   3339 N  N     . GLU C 1 146 ? 5.063   30.067 57.003 1.00 29.38 ? 146 GLU C N     1 
ATOM   3340 C  CA    . GLU C 1 146 ? 3.717   30.532 57.292 1.00 30.48 ? 146 GLU C CA    1 
ATOM   3341 C  C     . GLU C 1 146 ? 3.579   31.915 56.671 1.00 31.94 ? 146 GLU C C     1 
ATOM   3342 O  O     . GLU C 1 146 ? 4.034   32.904 57.254 1.00 31.31 ? 146 GLU C O     1 
ATOM   3343 C  CB    . GLU C 1 146 ? 3.516   30.612 58.800 1.00 33.33 ? 146 GLU C CB    1 
ATOM   3344 C  CG    . GLU C 1 146 ? 2.768   29.427 59.316 1.00 37.92 ? 146 GLU C CG    1 
ATOM   3345 C  CD    . GLU C 1 146 ? 1.415   29.337 58.649 1.00 39.78 ? 146 GLU C CD    1 
ATOM   3346 O  OE1   . GLU C 1 146 ? 0.588   30.249 58.885 1.00 42.87 ? 146 GLU C OE1   1 
ATOM   3347 O  OE2   . GLU C 1 146 ? 1.190   28.382 57.877 1.00 42.68 ? 146 GLU C OE2   1 
ATOM   3348 N  N     . VAL C 1 147 ? 2.959   31.986 55.495 1.00 30.97 ? 147 VAL C N     1 
ATOM   3349 C  CA    . VAL C 1 147 ? 2.810   33.272 54.811 1.00 32.29 ? 147 VAL C CA    1 
ATOM   3350 C  C     . VAL C 1 147 ? 1.405   33.823 54.887 1.00 34.20 ? 147 VAL C C     1 
ATOM   3351 O  O     . VAL C 1 147 ? 0.442   33.135 54.498 1.00 31.90 ? 147 VAL C O     1 
ATOM   3352 C  CB    . VAL C 1 147 ? 3.229   33.169 53.333 1.00 30.59 ? 147 VAL C CB    1 
ATOM   3353 C  CG1   . VAL C 1 147 ? 3.192   34.542 52.705 1.00 30.18 ? 147 VAL C CG1   1 
ATOM   3354 C  CG2   . VAL C 1 147 ? 4.631   32.589 53.246 1.00 29.69 ? 147 VAL C CG2   1 
ATOM   3355 N  N     . LYS C 1 148 ? 1.295   35.073 55.363 1.00 37.88 ? 148 LYS C N     1 
ATOM   3356 C  CA    . LYS C 1 148 ? -0.011  35.685 55.524 1.00 41.21 ? 148 LYS C CA    1 
ATOM   3357 C  C     . LYS C 1 148 ? -0.282  36.939 54.700 1.00 40.96 ? 148 LYS C C     1 
ATOM   3358 O  O     . LYS C 1 148 ? -0.128  38.069 55.174 1.00 40.74 ? 148 LYS C O     1 
ATOM   3359 C  CB    . LYS C 1 148 ? -0.268  35.990 57.001 1.00 44.79 ? 148 LYS C CB    1 
ATOM   3360 C  CG    . LYS C 1 148 ? 0.120   34.859 57.956 1.00 49.48 ? 148 LYS C CG    1 
ATOM   3361 C  CD    . LYS C 1 148 ? 1.648   34.628 58.011 1.00 51.95 ? 148 LYS C CD    1 
ATOM   3362 C  CE    . LYS C 1 148 ? 2.418   35.865 58.468 1.00 52.50 ? 148 LYS C CE    1 
ATOM   3363 N  NZ    . LYS C 1 148 ? 2.081   36.210 59.881 1.00 53.66 ? 148 LYS C NZ    1 
ATOM   3364 N  N     . PRO C 1 149 ? -0.695  36.746 53.447 1.00 40.30 ? 149 PRO C N     1 
ATOM   3365 C  CA    . PRO C 1 149 ? -0.995  37.886 52.580 1.00 39.83 ? 149 PRO C CA    1 
ATOM   3366 C  C     . PRO C 1 149 ? -2.247  38.587 53.148 1.00 39.03 ? 149 PRO C C     1 
ATOM   3367 O  O     . PRO C 1 149 ? -3.083  37.946 53.800 1.00 38.13 ? 149 PRO C O     1 
ATOM   3368 C  CB    . PRO C 1 149 ? -1.244  37.220 51.223 1.00 40.17 ? 149 PRO C CB    1 
ATOM   3369 C  CG    . PRO C 1 149 ? -1.833  35.864 51.615 1.00 41.41 ? 149 PRO C CG    1 
ATOM   3370 C  CD    . PRO C 1 149 ? -0.964  35.455 52.776 1.00 41.09 ? 149 PRO C CD    1 
ATOM   3371 N  N     . ASN C 1 150 ? -2.354  39.903 52.956 1.00 37.02 ? 150 ASN C N     1 
ATOM   3372 C  CA    . ASN C 1 150 ? -3.533  40.644 53.438 1.00 35.27 ? 150 ASN C CA    1 
ATOM   3373 C  C     . ASN C 1 150 ? -4.702  40.011 52.681 1.00 33.27 ? 150 ASN C C     1 
ATOM   3374 O  O     . ASN C 1 150 ? -4.646  39.910 51.468 1.00 34.16 ? 150 ASN C O     1 
ATOM   3375 C  CB    . ASN C 1 150 ? -3.376  42.124 53.086 1.00 33.43 ? 150 ASN C CB    1 
ATOM   3376 C  CG    . ASN C 1 150 ? -4.567  42.964 53.514 1.00 32.60 ? 150 ASN C CG    1 
ATOM   3377 O  OD1   . ASN C 1 150 ? -5.686  42.748 53.058 1.00 32.56 ? 150 ASN C OD1   1 
ATOM   3378 N  ND2   . ASN C 1 150 ? -4.328  43.934 54.387 1.00 31.16 ? 150 ASN C ND2   1 
ATOM   3379 N  N     . PRO C 1 151 ? -5.770  39.568 53.387 1.00 34.39 ? 151 PRO C N     1 
ATOM   3380 C  CA    . PRO C 1 151 ? -6.941  38.921 52.760 1.00 32.86 ? 151 PRO C CA    1 
ATOM   3381 C  C     . PRO C 1 151 ? -7.693  39.732 51.722 1.00 31.53 ? 151 PRO C C     1 
ATOM   3382 O  O     . PRO C 1 151 ? -8.677  39.278 51.143 1.00 33.25 ? 151 PRO C O     1 
ATOM   3383 C  CB    . PRO C 1 151 ? -7.817  38.551 53.953 1.00 33.26 ? 151 PRO C CB    1 
ATOM   3384 C  CG    . PRO C 1 151 ? -7.526  39.666 54.907 1.00 34.24 ? 151 PRO C CG    1 
ATOM   3385 C  CD    . PRO C 1 151 ? -6.023  39.809 54.820 1.00 34.53 ? 151 PRO C CD    1 
ATOM   3386 N  N     . ASN C 1 152 ? -7.208  40.918 51.439 1.00 28.23 ? 152 ASN C N     1 
ATOM   3387 C  CA    . ASN C 1 152 ? -7.898  41.734 50.466 1.00 23.64 ? 152 ASN C CA    1 
ATOM   3388 C  C     . ASN C 1 152 ? -7.130  41.786 49.177 1.00 22.37 ? 152 ASN C C     1 
ATOM   3389 O  O     . ASN C 1 152 ? -7.545  42.450 48.259 1.00 22.38 ? 152 ASN C O     1 
ATOM   3390 C  CB    . ASN C 1 152 ? -8.066  43.128 51.050 1.00 22.86 ? 152 ASN C CB    1 
ATOM   3391 C  CG    . ASN C 1 152 ? -8.885  43.111 52.328 1.00 21.29 ? 152 ASN C CG    1 
ATOM   3392 O  OD1   . ASN C 1 152 ? -10.065 42.824 52.289 1.00 21.59 ? 152 ASN C OD1   1 
ATOM   3393 N  ND2   . ASN C 1 152 ? -8.258  43.429 53.458 1.00 22.35 ? 152 ASN C ND2   1 
ATOM   3394 N  N     . LEU C 1 153 ? -6.005  41.075 49.105 1.00 21.85 ? 153 LEU C N     1 
ATOM   3395 C  CA    . LEU C 1 153 ? -5.175  41.103 47.907 1.00 21.75 ? 153 LEU C CA    1 
ATOM   3396 C  C     . LEU C 1 153 ? -5.516  40.064 46.856 1.00 22.31 ? 153 LEU C C     1 
ATOM   3397 O  O     . LEU C 1 153 ? -5.343  40.301 45.652 1.00 21.29 ? 153 LEU C O     1 
ATOM   3398 C  CB    . LEU C 1 153 ? -3.700  40.945 48.291 1.00 21.86 ? 153 LEU C CB    1 
ATOM   3399 C  CG    . LEU C 1 153 ? -2.985  42.182 48.847 1.00 21.00 ? 153 LEU C CG    1 
ATOM   3400 C  CD1   . LEU C 1 153 ? -1.668  41.728 49.468 1.00 26.60 ? 153 LEU C CD1   1 
ATOM   3401 C  CD2   . LEU C 1 153 ? -2.727  43.210 47.721 1.00 22.45 ? 153 LEU C CD2   1 
ATOM   3402 N  N     . TYR C 1 154 ? -5.995  38.909 47.316 1.00 23.57 ? 154 TYR C N     1 
ATOM   3403 C  CA    . TYR C 1 154 ? -6.305  37.807 46.409 1.00 25.34 ? 154 TYR C CA    1 
ATOM   3404 C  C     . TYR C 1 154 ? -7.723  37.312 46.404 1.00 26.64 ? 154 TYR C C     1 
ATOM   3405 O  O     . TYR C 1 154 ? -8.402  37.316 47.428 1.00 26.48 ? 154 TYR C O     1 
ATOM   3406 C  CB    . TYR C 1 154 ? -5.397  36.632 46.741 1.00 23.62 ? 154 TYR C CB    1 
ATOM   3407 C  CG    . TYR C 1 154 ? -3.951  36.971 46.574 1.00 24.68 ? 154 TYR C CG    1 
ATOM   3408 C  CD1   . TYR C 1 154 ? -3.415  37.200 45.297 1.00 25.21 ? 154 TYR C CD1   1 
ATOM   3409 C  CD2   . TYR C 1 154 ? -3.111  37.069 47.676 1.00 23.23 ? 154 TYR C CD2   1 
ATOM   3410 C  CE1   . TYR C 1 154 ? -2.085  37.506 45.133 1.00 24.73 ? 154 TYR C CE1   1 
ATOM   3411 C  CE2   . TYR C 1 154 ? -1.773  37.377 47.517 1.00 24.08 ? 154 TYR C CE2   1 
ATOM   3412 C  CZ    . TYR C 1 154 ? -1.270  37.587 46.251 1.00 23.66 ? 154 TYR C CZ    1 
ATOM   3413 O  OH    . TYR C 1 154 ? 0.068   37.846 46.094 1.00 25.47 ? 154 TYR C OH    1 
ATOM   3414 N  N     . GLU C 1 155 ? -8.152  36.890 45.221 1.00 30.00 ? 155 GLU C N     1 
ATOM   3415 C  CA    . GLU C 1 155 ? -9.470  36.310 45.013 1.00 33.62 ? 155 GLU C CA    1 
ATOM   3416 C  C     . GLU C 1 155 ? -9.471  34.939 45.693 1.00 34.64 ? 155 GLU C C     1 
ATOM   3417 O  O     . GLU C 1 155 ? -10.571 34.427 45.987 1.00 35.10 ? 155 GLU C O     1 
ATOM   3418 C  CB    . GLU C 1 155 ? -9.725  36.085 43.528 1.00 35.98 ? 155 GLU C CB    1 
ATOM   3419 C  CG    . GLU C 1 155 ? -9.979  37.310 42.735 1.00 38.41 ? 155 GLU C CG    1 
ATOM   3420 C  CD    . GLU C 1 155 ? -10.106 36.991 41.267 1.00 42.04 ? 155 GLU C CD    1 
ATOM   3421 O  OE1   . GLU C 1 155 ? -9.062  36.738 40.606 1.00 41.71 ? 155 GLU C OE1   1 
ATOM   3422 O  OE2   . GLU C 1 155 ? -11.259 36.981 40.786 1.00 43.87 ? 155 GLU C OE2   1 
ATOM   3423 O  OXT   . GLU C 1 155 ? -8.362  34.387 45.880 1.00 35.68 ? 155 GLU C OXT   1 
HETATM 3424 MG MG    . MG  D 2 .   ? 9.978   72.969 24.846 1.00 21.22 ? 165 MG  A MG    1 
HETATM 3425 P  PC    . D4T E 3 .   ? 8.712   73.325 27.722 1.00 31.93 ? 160 D4T A PC    1 
HETATM 3426 O  O1C   . D4T E 3 .   ? 9.587   73.794 26.599 1.00 27.89 ? 160 D4T A O1C   1 
HETATM 3427 O  O2C   . D4T E 3 .   ? 7.918   74.364 28.431 1.00 28.01 ? 160 D4T A O2C   1 
HETATM 3428 O  O3C   . D4T E 3 .   ? 9.502   72.361 28.549 1.00 31.67 ? 160 D4T A O3C   1 
HETATM 3429 O  "O7'" . D4T E 3 .   ? 7.642   72.315 27.071 1.00 27.43 ? 160 D4T A "O7'" 1 
HETATM 3430 P  PB    . D4T E 3 .   ? 7.634   71.241 25.876 1.00 23.83 ? 160 D4T A PB    1 
HETATM 3431 O  O1B   . D4T E 3 .   ? 9.012   71.182 25.353 1.00 21.09 ? 160 D4T A O1B   1 
HETATM 3432 O  O2B   . D4T E 3 .   ? 6.954   70.004 26.319 1.00 25.44 ? 160 D4T A O2B   1 
HETATM 3433 O  "O6'" . D4T E 3 .   ? 6.657   71.948 24.835 1.00 23.38 ? 160 D4T A "O6'" 1 
HETATM 3434 P  PA    . D4T E 3 .   ? 6.928   73.000 23.672 1.00 22.31 ? 160 D4T A PA    1 
HETATM 3435 O  O1A   . D4T E 3 .   ? 8.357   73.384 23.773 1.00 20.46 ? 160 D4T A O1A   1 
HETATM 3436 O  O2A   . D4T E 3 .   ? 6.427   72.399 22.410 1.00 21.05 ? 160 D4T A O2A   1 
HETATM 3437 O  "O5'" . D4T E 3 .   ? 6.005   74.219 24.099 1.00 21.63 ? 160 D4T A "O5'" 1 
HETATM 3438 C  "C5'" . D4T E 3 .   ? 6.467   75.199 25.018 1.00 20.38 ? 160 D4T A "C5'" 1 
HETATM 3439 C  "C4'" . D4T E 3 .   ? 5.431   75.441 26.096 1.00 21.64 ? 160 D4T A "C4'" 1 
HETATM 3440 O  "O4'" . D4T E 3 .   ? 4.256   76.066 25.529 1.00 22.03 ? 160 D4T A "O4'" 1 
HETATM 3441 C  "C1'" . D4T E 3 .   ? 3.090   75.517 26.121 1.00 23.52 ? 160 D4T A "C1'" 1 
HETATM 3442 N  N1    . D4T E 3 .   ? 2.152   75.191 25.033 1.00 22.68 ? 160 D4T A N1    1 
HETATM 3443 C  C6    . D4T E 3 .   ? 2.533   74.264 24.093 1.00 22.85 ? 160 D4T A C6    1 
HETATM 3444 C  C2    . D4T E 3 .   ? 0.910   75.817 24.971 1.00 21.64 ? 160 D4T A C2    1 
HETATM 3445 O  O2    . D4T E 3 .   ? 0.520   76.637 25.778 1.00 24.56 ? 160 D4T A O2    1 
HETATM 3446 N  N3    . D4T E 3 .   ? 0.141   75.440 23.911 1.00 24.56 ? 160 D4T A N3    1 
HETATM 3447 C  C4    . D4T E 3 .   ? 0.462   74.532 22.930 1.00 24.00 ? 160 D4T A C4    1 
HETATM 3448 O  O4    . D4T E 3 .   ? -0.348  74.300 22.041 1.00 27.66 ? 160 D4T A O4    1 
HETATM 3449 C  C5    . D4T E 3 .   ? 1.772   73.911 23.056 1.00 22.61 ? 160 D4T A C5    1 
HETATM 3450 C  C5A   . D4T E 3 .   ? 2.218   72.908 22.040 1.00 23.17 ? 160 D4T A C5A   1 
HETATM 3451 C  "C2'" . D4T E 3 .   ? 3.561   74.256 26.826 1.00 20.92 ? 160 D4T A "C2'" 1 
HETATM 3452 C  "C3'" . D4T E 3 .   ? 4.910   74.208 26.800 1.00 22.37 ? 160 D4T A "C3'" 1 
HETATM 3453 P  P     B PO4 F 4 .   ? -14.476 49.155 36.482 0.28 23.45 ? 162 PO4 B P     1 
HETATM 3454 O  O1    B PO4 F 4 .   ? -15.353 48.698 35.375 0.28 25.21 ? 162 PO4 B O1    1 
HETATM 3455 O  O2    B PO4 F 4 .   ? -13.987 48.120 37.428 0.28 24.14 ? 162 PO4 B O2    1 
HETATM 3456 O  O3    B PO4 F 4 .   ? -13.453 49.910 35.709 0.28 25.38 ? 162 PO4 B O3    1 
HETATM 3457 O  O4    B PO4 F 4 .   ? -15.272 50.270 37.055 0.28 24.66 ? 162 PO4 B O4    1 
HETATM 3458 MG MG    . MG  G 2 .   ? -14.623 48.513 33.166 1.00 28.85 ? 166 MG  B MG    1 
HETATM 3459 P  PC    A D4T H 3 .   ? -13.383 48.459 36.279 0.77 28.90 ? 161 D4T B PC    1 
HETATM 3460 O  O1C   A D4T H 3 .   ? -14.543 48.681 35.364 0.77 28.08 ? 161 D4T B O1C   1 
HETATM 3461 O  O2C   A D4T H 3 .   ? -13.640 47.744 37.565 0.77 28.26 ? 161 D4T B O2C   1 
HETATM 3462 O  O3C   A D4T H 3 .   ? -12.558 49.702 36.309 0.77 28.22 ? 161 D4T B O3C   1 
HETATM 3463 O  "O7'" A D4T H 3 .   ? -12.421 47.488 35.453 0.77 27.30 ? 161 D4T B "O7'" 1 
HETATM 3464 P  PB    A D4T H 3 .   ? -11.790 47.605 33.991 0.77 26.87 ? 161 D4T B PB    1 
HETATM 3465 O  O1B   A D4T H 3 .   ? -12.556 48.633 33.231 0.77 26.62 ? 161 D4T B O1B   1 
HETATM 3466 O  O2B   A D4T H 3 .   ? -10.308 47.711 34.065 0.77 28.03 ? 161 D4T B O2B   1 
HETATM 3467 O  "O6'" A D4T H 3 .   ? -12.128 46.152 33.429 0.77 29.21 ? 161 D4T B "O6'" 1 
HETATM 3468 P  PA    A D4T H 3 .   ? -13.504 45.420 33.091 0.77 29.28 ? 161 D4T B PA    1 
HETATM 3469 O  O1A   A D4T H 3 .   ? -14.595 46.411 32.998 0.77 29.61 ? 161 D4T B O1A   1 
HETATM 3470 O  O2A   A D4T H 3 .   ? -13.203 44.538 31.931 0.77 28.92 ? 161 D4T B O2A   1 
HETATM 3471 O  "O5'" A D4T H 3 .   ? -13.820 44.526 34.384 0.77 29.36 ? 161 D4T B "O5'" 1 
HETATM 3472 C  "C5'" A D4T H 3 .   ? -14.515 45.078 35.511 0.77 27.99 ? 161 D4T B "C5'" 1 
HETATM 3473 C  "C4'" A D4T H 3 .   ? -13.901 44.587 36.810 0.77 26.82 ? 161 D4T B "C4'" 1 
HETATM 3474 O  "O4'" A D4T H 3 .   ? -14.089 43.153 36.915 0.77 27.52 ? 161 D4T B "O4'" 1 
HETATM 3475 C  "C1'" A D4T H 3 .   ? -12.896 42.558 37.381 0.77 28.09 ? 161 D4T B "C1'" 1 
HETATM 3476 N  N1    A D4T H 3 .   ? -12.589 41.412 36.504 0.77 29.29 ? 161 D4T B N1    1 
HETATM 3477 C  C6    A D4T H 3 .   ? -12.412 41.625 35.154 0.77 28.80 ? 161 D4T B C6    1 
HETATM 3478 C  C2    A D4T H 3 .   ? -12.469 40.147 37.056 0.77 29.70 ? 161 D4T B C2    1 
HETATM 3479 O  O2    A D4T H 3 .   ? -12.622 39.916 38.248 0.77 30.68 ? 161 D4T B O2    1 
HETATM 3480 N  N3    A D4T H 3 .   ? -12.159 39.157 36.151 0.77 29.64 ? 161 D4T B N3    1 
HETATM 3481 C  C4    A D4T H 3 .   ? -11.964 39.306 34.791 0.77 29.41 ? 161 D4T B C4    1 
HETATM 3482 O  O4    A D4T H 3 .   ? -11.689 38.327 34.105 0.77 31.60 ? 161 D4T B O4    1 
HETATM 3483 C  C5    A D4T H 3 .   ? -12.108 40.656 34.283 0.77 29.77 ? 161 D4T B C5    1 
HETATM 3484 C  C5A   A D4T H 3 .   ? -11.908 40.912 32.822 0.77 28.98 ? 161 D4T B C5A   1 
HETATM 3485 C  "C2'" A D4T H 3 .   ? -11.832 43.630 37.277 0.77 26.12 ? 161 D4T B "C2'" 1 
HETATM 3486 C  "C3'" A D4T H 3 .   ? -12.409 44.796 36.943 0.77 26.57 ? 161 D4T B "C3'" 1 
HETATM 3487 P  PA    B D4D I 5 .   ? -13.113 45.306 33.353 0.28 28.85 ? 163 D4D B PA    1 
HETATM 3488 O  O1A   B D4D I 5 .   ? -14.247 46.212 33.053 0.28 27.34 ? 163 D4D B O1A   1 
HETATM 3489 O  O2A   B D4D I 5 .   ? -12.504 44.504 32.260 0.28 27.22 ? 163 D4D B O2A   1 
HETATM 3490 O  O3A   B D4D I 5 .   ? -11.972 46.148 34.084 0.28 27.44 ? 163 D4D B O3A   1 
HETATM 3491 P  PB    B D4D I 5 .   ? -11.430 47.635 33.877 0.28 26.55 ? 163 D4D B PB    1 
HETATM 3492 O  O1B   B D4D I 5 .   ? -12.592 48.400 33.354 0.28 26.68 ? 163 D4D B O1B   1 
HETATM 3493 O  O2B   B D4D I 5 .   ? -10.236 47.492 33.002 0.28 26.31 ? 163 D4D B O2B   1 
HETATM 3494 O  O3B   B D4D I 5 .   ? -11.229 48.128 35.267 0.28 26.84 ? 163 D4D B O3B   1 
HETATM 3495 O  "O5'" B D4D I 5 .   ? -13.582 44.314 34.510 0.28 28.29 ? 163 D4D B "O5'" 1 
HETATM 3496 C  "C5'" B D4D I 5 .   ? -14.433 44.768 35.562 0.28 28.86 ? 163 D4D B "C5'" 1 
HETATM 3497 C  "C4'" B D4D I 5 .   ? -13.936 44.255 36.894 0.28 28.67 ? 163 D4D B "C4'" 1 
HETATM 3498 O  "O4'" B D4D I 5 .   ? -14.012 42.807 36.902 0.28 29.02 ? 163 D4D B "O4'" 1 
HETATM 3499 C  "C3'" B D4D I 5 .   ? -12.493 44.568 37.217 0.28 28.78 ? 163 D4D B "C3'" 1 
HETATM 3500 C  "C2'" B D4D I 5 .   ? -11.875 43.435 37.592 0.28 28.95 ? 163 D4D B "C2'" 1 
HETATM 3501 C  "C1'" B D4D I 5 .   ? -12.863 42.290 37.537 0.28 29.47 ? 163 D4D B "C1'" 1 
HETATM 3502 N  N1    B D4D I 5 .   ? -12.361 41.166 36.726 0.28 30.06 ? 163 D4D B N1    1 
HETATM 3503 C  C2    B D4D I 5 .   ? -12.011 39.993 37.363 0.28 30.36 ? 163 D4D B C2    1 
HETATM 3504 O  O2    B D4D I 5 .   ? -12.112 39.829 38.570 0.28 29.93 ? 163 D4D B O2    1 
HETATM 3505 N  N3    B D4D I 5 .   ? -11.535 39.011 36.527 0.28 30.32 ? 163 D4D B N3    1 
HETATM 3506 C  C4    B D4D I 5 .   ? -11.377 39.086 35.155 0.28 30.86 ? 163 D4D B C4    1 
HETATM 3507 O  O4    B D4D I 5 .   ? -10.923 38.125 34.539 0.28 31.88 ? 163 D4D B O4    1 
HETATM 3508 C  C5    B D4D I 5 .   ? -11.774 40.341 34.555 0.28 30.56 ? 163 D4D B C5    1 
HETATM 3509 C  C5M   B D4D I 5 .   ? -11.648 40.513 33.073 0.28 30.84 ? 163 D4D B C5M   1 
HETATM 3510 C  C6    B D4D I 5 .   ? -12.239 41.303 35.360 0.28 30.31 ? 163 D4D B C6    1 
HETATM 3511 MG MG    . MG  J 2 .   ? 20.088  40.336 36.327 1.00 41.22 ? 167 MG  C MG    1 
HETATM 3512 P  PC    . D4T K 3 .   ? 20.441  42.752 38.397 1.00 44.99 ? 164 D4T C PC    1 
HETATM 3513 O  O1C   . D4T K 3 .   ? 20.645  41.354 37.936 1.00 44.83 ? 164 D4T C O1C   1 
HETATM 3514 O  O2C   . D4T K 3 .   ? 21.476  43.354 39.278 1.00 43.06 ? 164 D4T C O2C   1 
HETATM 3515 O  O3C   . D4T K 3 .   ? 19.023  42.818 38.837 1.00 45.41 ? 164 D4T C O3C   1 
HETATM 3516 O  "O7'" . D4T K 3 .   ? 20.442  43.635 37.057 1.00 43.66 ? 164 D4T C "O7'" 1 
HETATM 3517 P  PB    . D4T K 3 .   ? 19.770  43.502 35.609 1.00 41.15 ? 164 D4T C PB    1 
HETATM 3518 O  O1B   . D4T K 3 .   ? 19.131  42.167 35.468 1.00 40.73 ? 164 D4T C O1B   1 
HETATM 3519 O  O2B   . D4T K 3 .   ? 18.975  44.718 35.304 1.00 42.48 ? 164 D4T C O2B   1 
HETATM 3520 O  "O6'" . D4T K 3 .   ? 21.033  43.541 34.637 1.00 43.28 ? 164 D4T C "O6'" 1 
HETATM 3521 P  PA    . D4T K 3 .   ? 22.155  42.455 34.309 1.00 43.56 ? 164 D4T C PA    1 
HETATM 3522 O  O1A   . D4T K 3 .   ? 21.789  41.174 34.985 1.00 43.36 ? 164 D4T C O1A   1 
HETATM 3523 O  O2A   . D4T K 3 .   ? 22.367  42.464 32.829 1.00 43.05 ? 164 D4T C O2A   1 
HETATM 3524 O  "O5'" . D4T K 3 .   ? 23.413  43.083 35.058 1.00 41.14 ? 164 D4T C "O5'" 1 
HETATM 3525 C  "C5'" . D4T K 3 .   ? 23.703  42.726 36.415 1.00 42.27 ? 164 D4T C "C5'" 1 
HETATM 3526 C  "C4'" . D4T K 3 .   ? 24.220  43.924 37.196 1.00 41.82 ? 164 D4T C "C4'" 1 
HETATM 3527 O  "O4'" . D4T K 3 .   ? 25.513  44.328 36.681 1.00 41.56 ? 164 D4T C "O4'" 1 
HETATM 3528 C  "C1'" . D4T K 3 .   ? 25.519  45.717 36.464 1.00 41.61 ? 164 D4T C "C1'" 1 
HETATM 3529 N  N1    . D4T K 3 .   ? 25.887  45.946 35.057 1.00 41.88 ? 164 D4T C N1    1 
HETATM 3530 C  C6    . D4T K 3 .   ? 25.158  45.368 34.041 1.00 41.84 ? 164 D4T C C6    1 
HETATM 3531 C  C2    . D4T K 3 .   ? 26.964  46.761 34.795 1.00 41.72 ? 164 D4T C C2    1 
HETATM 3532 O  O2    . D4T K 3 .   ? 27.643  47.267 35.671 1.00 42.69 ? 164 D4T C O2    1 
HETATM 3533 N  N3    . D4T K 3 .   ? 27.220  46.961 33.468 1.00 42.01 ? 164 D4T C N3    1 
HETATM 3534 C  C4    . D4T K 3 .   ? 26.527  46.437 32.399 1.00 43.16 ? 164 D4T C C4    1 
HETATM 3535 O  O4    . D4T K 3 .   ? 26.866  46.731 31.254 1.00 45.36 ? 164 D4T C O4    1 
HETATM 3536 C  C5    . D4T K 3 .   ? 25.420  45.562 32.745 1.00 42.46 ? 164 D4T C C5    1 
HETATM 3537 C  C5A   . D4T K 3 .   ? 24.630  44.918 31.652 1.00 42.81 ? 164 D4T C C5A   1 
HETATM 3538 C  "C2'" . D4T K 3 .   ? 24.123  46.211 36.783 1.00 41.59 ? 164 D4T C "C2'" 1 
HETATM 3539 C  "C3'" . D4T K 3 .   ? 23.370  45.175 37.196 1.00 41.15 ? 164 D4T C "C3'" 1 
HETATM 3540 O  O     . HOH L 6 .   ? -1.395  62.411 40.912 1.00 13.92 ? 504 HOH A O     1 
HETATM 3541 O  O     . HOH L 6 .   ? -2.684  71.820 34.297 1.00 17.63 ? 506 HOH A O     1 
HETATM 3542 O  O     . HOH L 6 .   ? 15.645  58.674 33.757 1.00 18.12 ? 508 HOH A O     1 
HETATM 3543 O  O     . HOH L 6 .   ? 6.610   82.162 45.022 1.00 15.75 ? 512 HOH A O     1 
HETATM 3544 O  O     . HOH L 6 .   ? -5.496  60.795 29.281 1.00 17.14 ? 518 HOH A O     1 
HETATM 3545 O  O     . HOH L 6 .   ? -0.743  73.758 36.643 1.00 17.56 ? 519 HOH A O     1 
HETATM 3546 O  O     . HOH L 6 .   ? 24.511  77.506 42.299 1.00 21.55 ? 526 HOH A O     1 
HETATM 3547 O  O     . HOH L 6 .   ? 22.203  69.236 44.766 1.00 18.98 ? 527 HOH A O     1 
HETATM 3548 O  O     . HOH L 6 .   ? 14.644  66.786 48.697 1.00 15.30 ? 528 HOH A O     1 
HETATM 3549 O  O     . HOH L 6 .   ? 1.825   65.748 24.320 1.00 18.88 ? 529 HOH A O     1 
HETATM 3550 O  O     . HOH L 6 .   ? 9.216   62.791 37.959 1.00 21.92 ? 531 HOH A O     1 
HETATM 3551 O  O     . HOH L 6 .   ? 2.521   76.194 32.421 1.00 19.08 ? 536 HOH A O     1 
HETATM 3552 O  O     . HOH L 6 .   ? 19.408  60.136 29.683 1.00 16.00 ? 542 HOH A O     1 
HETATM 3553 O  O     . HOH L 6 .   ? 4.223   59.590 41.244 1.00 21.90 ? 544 HOH A O     1 
HETATM 3554 O  O     . HOH L 6 .   ? 21.744  68.803 21.057 1.00 20.43 ? 545 HOH A O     1 
HETATM 3555 O  O     . HOH L 6 .   ? 7.878   60.237 30.730 1.00 20.06 ? 550 HOH A O     1 
HETATM 3556 O  O     . HOH L 6 .   ? 11.877  85.798 44.008 1.00 22.73 ? 553 HOH A O     1 
HETATM 3557 O  O     . HOH L 6 .   ? -1.351  60.442 33.978 1.00 16.39 ? 558 HOH A O     1 
HETATM 3558 O  O     . HOH L 6 .   ? 21.140  64.643 43.896 1.00 22.06 ? 563 HOH A O     1 
HETATM 3559 O  O     . HOH L 6 .   ? -6.206  65.100 25.719 1.00 32.48 ? 564 HOH A O     1 
HETATM 3560 O  O     . HOH L 6 .   ? 20.505  63.622 27.419 1.00 21.20 ? 565 HOH A O     1 
HETATM 3561 O  O     . HOH L 6 .   ? -1.249  83.077 22.039 1.00 19.43 ? 566 HOH A O     1 
HETATM 3562 O  O     . HOH L 6 .   ? -0.898  59.966 39.413 1.00 21.57 ? 567 HOH A O     1 
HETATM 3563 O  O     . HOH L 6 .   ? 3.106   84.606 17.754 1.00 23.53 ? 571 HOH A O     1 
HETATM 3564 O  O     . HOH L 6 .   ? 16.949  88.064 26.255 1.00 25.43 ? 573 HOH A O     1 
HETATM 3565 O  O     . HOH L 6 .   ? 0.836   84.041 19.372 1.00 22.54 ? 578 HOH A O     1 
HETATM 3566 O  O     . HOH L 6 .   ? 13.800  61.738 27.177 1.00 23.55 ? 579 HOH A O     1 
HETATM 3567 O  O     . HOH L 6 .   ? 4.901   60.644 29.933 1.00 23.45 ? 580 HOH A O     1 
HETATM 3568 O  O     . HOH L 6 .   ? 20.637  68.565 46.724 1.00 18.48 ? 583 HOH A O     1 
HETATM 3569 O  O     . HOH L 6 .   ? 29.920  78.922 35.702 1.00 24.42 ? 584 HOH A O     1 
HETATM 3570 O  O     . HOH L 6 .   ? 19.415  64.442 25.110 1.00 29.79 ? 594 HOH A O     1 
HETATM 3571 O  O     . HOH L 6 .   ? 9.164   64.574 45.453 1.00 27.91 ? 601 HOH A O     1 
HETATM 3572 O  O     . HOH L 6 .   ? 20.285  80.309 19.868 1.00 26.86 ? 602 HOH A O     1 
HETATM 3573 O  O     . HOH L 6 .   ? 2.568   60.040 26.035 1.00 30.72 ? 604 HOH A O     1 
HETATM 3574 O  O     . HOH L 6 .   ? 22.966  54.554 43.384 1.00 21.64 ? 605 HOH A O     1 
HETATM 3575 O  O     . HOH L 6 .   ? 12.645  76.387 25.539 1.00 19.77 ? 606 HOH A O     1 
HETATM 3576 O  O     . HOH L 6 .   ? 20.996  86.922 27.488 1.00 28.36 ? 608 HOH A O     1 
HETATM 3577 O  O     . HOH L 6 .   ? 0.454   62.113 42.909 1.00 26.93 ? 609 HOH A O     1 
HETATM 3578 O  O     . HOH L 6 .   ? 3.070   54.887 34.983 1.00 18.25 ? 615 HOH A O     1 
HETATM 3579 O  O     . HOH L 6 .   ? 5.210   57.248 41.004 1.00 24.08 ? 616 HOH A O     1 
HETATM 3580 O  O     . HOH L 6 .   ? 6.587   66.089 24.617 1.00 26.90 ? 617 HOH A O     1 
HETATM 3581 O  O     . HOH L 6 .   ? 25.543  62.626 29.369 1.00 24.14 ? 618 HOH A O     1 
HETATM 3582 O  O     . HOH L 6 .   ? 29.579  76.206 36.065 1.00 30.37 ? 619 HOH A O     1 
HETATM 3583 O  O     . HOH L 6 .   ? -5.277  58.770 27.535 1.00 24.94 ? 621 HOH A O     1 
HETATM 3584 O  O     . HOH L 6 .   ? 3.574   82.017 40.164 1.00 29.28 ? 622 HOH A O     1 
HETATM 3585 O  O     . HOH L 6 .   ? 4.027   82.941 44.338 1.00 26.52 ? 623 HOH A O     1 
HETATM 3586 O  O     . HOH L 6 .   ? 12.952  78.162 22.008 1.00 28.18 ? 624 HOH A O     1 
HETATM 3587 O  O     . HOH L 6 .   ? 22.263  79.684 41.502 1.00 19.59 ? 626 HOH A O     1 
HETATM 3588 O  O     . HOH L 6 .   ? 1.477   78.648 29.163 1.00 25.11 ? 629 HOH A O     1 
HETATM 3589 O  O     . HOH L 6 .   ? 8.129   59.741 39.998 1.00 32.46 ? 632 HOH A O     1 
HETATM 3590 O  O     . HOH L 6 .   ? 14.428  73.897 22.273 1.00 32.74 ? 636 HOH A O     1 
HETATM 3591 O  O     . HOH L 6 .   ? 4.537   59.275 27.632 1.00 30.93 ? 641 HOH A O     1 
HETATM 3592 O  O     . HOH L 6 .   ? 23.768  63.161 44.213 1.00 30.75 ? 642 HOH A O     1 
HETATM 3593 O  O     . HOH L 6 .   ? 20.708  60.850 27.518 1.00 31.82 ? 644 HOH A O     1 
HETATM 3594 O  O     . HOH L 6 .   ? 20.838  65.998 23.113 1.00 26.38 ? 646 HOH A O     1 
HETATM 3595 O  O     . HOH L 6 .   ? 8.261   60.814 42.209 1.00 24.77 ? 648 HOH A O     1 
HETATM 3596 O  O     . HOH L 6 .   ? 21.305  81.728 25.158 1.00 27.55 ? 650 HOH A O     1 
HETATM 3597 O  O     . HOH L 6 .   ? 24.527  63.868 38.976 1.00 26.71 ? 654 HOH A O     1 
HETATM 3598 O  O     . HOH L 6 .   ? 3.376   64.186 45.499 1.00 38.56 ? 657 HOH A O     1 
HETATM 3599 O  O     . HOH L 6 .   ? -2.990  79.079 20.526 1.00 27.75 ? 660 HOH A O     1 
HETATM 3600 O  O     . HOH L 6 .   ? 24.109  70.200 28.432 1.00 29.06 ? 662 HOH A O     1 
HETATM 3601 O  O     . HOH L 6 .   ? 5.335   69.998 22.078 1.00 26.75 ? 664 HOH A O     1 
HETATM 3602 O  O     . HOH L 6 .   ? 15.807  68.425 30.211 1.00 17.84 ? 665 HOH A O     1 
HETATM 3603 O  O     . HOH L 6 .   ? -3.318  73.159 43.022 1.00 27.28 ? 667 HOH A O     1 
HETATM 3604 O  O     . HOH L 6 .   ? 3.814   88.574 39.739 1.00 41.20 ? 668 HOH A O     1 
HETATM 3605 O  O     . HOH L 6 .   ? 15.563  87.133 41.328 1.00 35.47 ? 672 HOH A O     1 
HETATM 3606 O  O     . HOH L 6 .   ? -1.703  83.664 28.941 1.00 29.26 ? 674 HOH A O     1 
HETATM 3607 O  O     . HOH L 6 .   ? 2.754   87.997 24.774 1.00 28.76 ? 675 HOH A O     1 
HETATM 3608 O  O     . HOH L 6 .   ? 8.050   79.612 15.673 1.00 33.47 ? 676 HOH A O     1 
HETATM 3609 O  O     . HOH L 6 .   ? 31.127  69.678 37.314 1.00 30.24 ? 679 HOH A O     1 
HETATM 3610 O  O     . HOH L 6 .   ? -1.828  76.550 46.069 1.00 31.01 ? 683 HOH A O     1 
HETATM 3611 O  O     . HOH L 6 .   ? -1.828  64.873 23.245 1.00 39.83 ? 684 HOH A O     1 
HETATM 3612 O  O     . HOH L 6 .   ? 19.883  83.222 23.116 1.00 26.12 ? 685 HOH A O     1 
HETATM 3613 O  O     . HOH L 6 .   ? -2.438  75.236 18.436 1.00 30.57 ? 687 HOH A O     1 
HETATM 3614 O  O     . HOH L 6 .   ? 4.558   87.546 22.911 1.00 33.98 ? 688 HOH A O     1 
HETATM 3615 O  O     . HOH L 6 .   ? 1.959   88.561 32.124 1.00 39.37 ? 690 HOH A O     1 
HETATM 3616 O  O     . HOH L 6 .   ? 7.591   75.369 17.302 1.00 36.23 ? 691 HOH A O     1 
HETATM 3617 O  O     . HOH L 6 .   ? 23.732  63.016 25.908 1.00 27.73 ? 694 HOH A O     1 
HETATM 3618 O  O     . HOH L 6 .   ? 31.275  65.605 38.077 1.00 38.58 ? 700 HOH A O     1 
HETATM 3619 O  O     . HOH L 6 .   ? -0.272  57.945 27.634 1.00 38.33 ? 709 HOH A O     1 
HETATM 3620 O  O     . HOH L 6 .   ? 14.207  73.327 24.965 1.00 21.46 ? 710 HOH A O     1 
HETATM 3621 O  O     . HOH L 6 .   ? 3.140   52.943 31.139 1.00 43.43 ? 711 HOH A O     1 
HETATM 3622 O  O     . HOH L 6 .   ? 3.031   67.241 45.900 1.00 39.38 ? 712 HOH A O     1 
HETATM 3623 O  O     . HOH L 6 .   ? 26.267  65.905 26.807 1.00 31.50 ? 716 HOH A O     1 
HETATM 3624 O  O     . HOH L 6 .   ? 11.967  72.494 25.885 1.00 20.16 ? 725 HOH A O     1 
HETATM 3625 O  O     . HOH L 6 .   ? 10.577  72.065 22.975 1.00 17.39 ? 726 HOH A O     1 
HETATM 3626 O  O     . HOH L 6 .   ? 10.926  74.693 24.136 1.00 21.66 ? 727 HOH A O     1 
HETATM 3627 O  O     . HOH L 6 .   ? 9.639   62.240 45.270 1.00 36.37 ? 734 HOH A O     1 
HETATM 3628 O  O     . HOH L 6 .   ? -4.365  68.824 28.068 1.00 23.04 ? 736 HOH A O     1 
HETATM 3629 O  O     . HOH L 6 .   ? -6.743  58.898 25.494 1.00 25.68 ? 739 HOH A O     1 
HETATM 3630 O  O     . HOH L 6 .   ? 26.585  79.139 43.162 1.00 34.01 ? 740 HOH A O     1 
HETATM 3631 O  O     . HOH L 6 .   ? -5.894  67.701 24.967 1.00 36.61 ? 744 HOH A O     1 
HETATM 3632 O  O     . HOH L 6 .   ? 20.795  77.978 20.336 1.00 32.57 ? 747 HOH A O     1 
HETATM 3633 O  O     . HOH L 6 .   ? 3.381   89.542 26.815 1.00 36.73 ? 750 HOH A O     1 
HETATM 3634 O  O     . HOH L 6 .   ? 0.417   74.849 17.432 1.00 25.23 ? 753 HOH A O     1 
HETATM 3635 O  O     . HOH L 6 .   ? 0.663   57.847 25.298 1.00 37.33 ? 754 HOH A O     1 
HETATM 3636 O  O     . HOH L 6 .   ? 5.482   76.700 12.514 1.00 33.18 ? 759 HOH A O     1 
HETATM 3637 O  O     . HOH L 6 .   ? -4.729  79.178 18.542 1.00 32.34 ? 763 HOH A O     1 
HETATM 3638 O  O     . HOH L 6 .   ? 13.600  89.427 36.157 1.00 31.54 ? 764 HOH A O     1 
HETATM 3639 O  O     . HOH L 6 .   ? 18.689  86.821 33.987 1.00 42.48 ? 766 HOH A O     1 
HETATM 3640 O  O     . HOH L 6 .   ? 19.098  86.615 29.617 1.00 28.04 ? 770 HOH A O     1 
HETATM 3641 O  O     . HOH L 6 .   ? 13.578  74.503 29.483 1.00 27.57 ? 777 HOH A O     1 
HETATM 3642 O  O     . HOH L 6 .   ? 28.526  65.709 37.575 1.00 29.10 ? 779 HOH A O     1 
HETATM 3643 O  O     . HOH L 6 .   ? 19.430  60.261 25.250 1.00 36.67 ? 780 HOH A O     1 
HETATM 3644 O  O     . HOH L 6 .   ? 6.622   66.956 48.195 1.00 32.66 ? 783 HOH A O     1 
HETATM 3645 O  O     . HOH L 6 .   ? 2.915   62.635 43.440 1.00 36.18 ? 789 HOH A O     1 
HETATM 3646 O  O     . HOH L 6 .   ? 8.524   61.435 28.331 1.00 32.12 ? 790 HOH A O     1 
HETATM 3647 O  O     . HOH L 6 .   ? 22.812  64.528 22.991 1.00 43.92 ? 793 HOH A O     1 
HETATM 3648 O  O     . HOH L 6 .   ? 11.263  62.031 26.889 1.00 37.63 ? 795 HOH A O     1 
HETATM 3649 O  O     . HOH L 6 .   ? 14.425  63.322 25.107 1.00 28.39 ? 797 HOH A O     1 
HETATM 3650 O  O     . HOH L 6 .   ? -3.640  65.135 19.785 1.00 48.93 ? 800 HOH A O     1 
HETATM 3651 O  O     . HOH L 6 .   ? -0.918  60.404 36.649 1.00 27.20 ? 801 HOH A O     1 
HETATM 3652 O  O     . HOH L 6 .   ? 11.822  88.913 39.590 1.00 32.96 ? 802 HOH A O     1 
HETATM 3653 O  O     . HOH L 6 .   ? 10.705  64.972 49.082 1.00 31.98 ? 804 HOH A O     1 
HETATM 3654 O  O     . HOH L 6 .   ? 14.975  91.443 30.442 1.00 45.01 ? 805 HOH A O     1 
HETATM 3655 O  O     . HOH L 6 .   ? 1.862   54.527 32.649 1.00 36.71 ? 806 HOH A O     1 
HETATM 3656 O  O     . HOH L 6 .   ? 18.403  86.662 37.660 1.00 39.13 ? 807 HOH A O     1 
HETATM 3657 O  O     . HOH L 6 .   ? 10.031  68.837 24.171 1.00 34.31 ? 809 HOH A O     1 
HETATM 3658 O  O     . HOH L 6 .   ? 11.007  75.025 28.430 1.00 35.22 ? 810 HOH A O     1 
HETATM 3659 O  O     . HOH L 6 .   ? 16.991  88.133 28.772 1.00 30.38 ? 813 HOH A O     1 
HETATM 3660 O  O     . HOH L 6 .   ? 11.608  92.646 28.630 1.00 36.95 ? 815 HOH A O     1 
HETATM 3661 O  O     . HOH L 6 .   ? 27.310  63.927 42.338 1.00 42.10 ? 817 HOH A O     1 
HETATM 3662 O  O     . HOH L 6 .   ? 16.540  89.148 33.661 1.00 44.91 ? 821 HOH A O     1 
HETATM 3663 O  O     . HOH L 6 .   ? 11.466  85.237 20.255 1.00 34.63 ? 823 HOH A O     1 
HETATM 3664 O  O     . HOH L 6 .   ? 4.500   60.418 43.620 1.00 34.29 ? 825 HOH A O     1 
HETATM 3665 O  O     . HOH L 6 .   ? 24.921  59.675 48.586 1.00 34.59 ? 826 HOH A O     1 
HETATM 3666 O  O     . HOH L 6 .   ? -1.252  87.439 25.589 1.00 44.71 ? 832 HOH A O     1 
HETATM 3667 O  O     . HOH L 6 .   ? 15.846  79.092 19.818 1.00 38.90 ? 835 HOH A O     1 
HETATM 3668 O  O     . HOH L 6 .   ? 2.295   72.090 48.180 1.00 35.74 ? 840 HOH A O     1 
HETATM 3669 O  O     . HOH L 6 .   ? 7.674   90.444 33.724 1.00 35.15 ? 841 HOH A O     1 
HETATM 3670 O  O     . HOH M 6 .   ? -3.305  61.980 32.583 1.00 14.78 ? 500 HOH B O     1 
HETATM 3671 O  O     . HOH M 6 .   ? -5.025  65.333 49.289 1.00 10.64 ? 502 HOH B O     1 
HETATM 3672 O  O     . HOH M 6 .   ? -4.546  42.791 44.346 1.00 14.14 ? 505 HOH B O     1 
HETATM 3673 O  O     . HOH M 6 .   ? -1.398  53.611 33.072 1.00 22.39 ? 507 HOH B O     1 
HETATM 3674 O  O     . HOH M 6 .   ? -2.111  57.382 39.837 1.00 15.95 ? 510 HOH B O     1 
HETATM 3675 O  O     . HOH M 6 .   ? -6.560  44.802 46.692 1.00 16.81 ? 513 HOH B O     1 
HETATM 3676 O  O     . HOH M 6 .   ? -4.302  43.788 31.794 1.00 19.61 ? 514 HOH B O     1 
HETATM 3677 O  O     . HOH M 6 .   ? -12.073 68.955 45.026 1.00 18.43 ? 515 HOH B O     1 
HETATM 3678 O  O     . HOH M 6 .   ? 3.789   47.703 38.435 1.00 16.04 ? 516 HOH B O     1 
HETATM 3679 O  O     . HOH M 6 .   ? 6.661   53.553 35.625 1.00 17.48 ? 517 HOH B O     1 
HETATM 3680 O  O     . HOH M 6 .   ? -12.297 57.244 34.234 1.00 19.32 ? 520 HOH B O     1 
HETATM 3681 O  O     . HOH M 6 .   ? -0.510  50.860 33.348 1.00 15.57 ? 523 HOH B O     1 
HETATM 3682 O  O     . HOH M 6 .   ? -14.650 51.844 55.417 1.00 18.05 ? 524 HOH B O     1 
HETATM 3683 O  O     . HOH M 6 .   ? -7.453  62.639 28.912 1.00 19.32 ? 525 HOH B O     1 
HETATM 3684 O  O     . HOH M 6 .   ? -21.405 63.934 47.200 1.00 19.83 ? 532 HOH B O     1 
HETATM 3685 O  O     . HOH M 6 .   ? -14.506 47.249 51.985 1.00 19.53 ? 535 HOH B O     1 
HETATM 3686 O  O     . HOH M 6 .   ? -18.487 49.919 34.722 1.00 23.28 ? 538 HOH B O     1 
HETATM 3687 O  O     . HOH M 6 .   ? -24.138 55.998 52.039 1.00 25.76 ? 541 HOH B O     1 
HETATM 3688 O  O     . HOH M 6 .   ? -10.035 68.643 46.779 1.00 20.98 ? 546 HOH B O     1 
HETATM 3689 O  O     . HOH M 6 .   ? -6.678  56.426 28.976 1.00 19.63 ? 547 HOH B O     1 
HETATM 3690 O  O     . HOH M 6 .   ? -20.650 54.336 54.997 1.00 20.83 ? 551 HOH B O     1 
HETATM 3691 O  O     . HOH M 6 .   ? 5.771   42.245 33.542 1.00 20.08 ? 552 HOH B O     1 
HETATM 3692 O  O     . HOH M 6 .   ? -10.000 67.009 26.450 1.00 40.50 ? 554 HOH B O     1 
HETATM 3693 O  O     . HOH M 6 .   ? -11.522 61.569 28.453 1.00 16.97 ? 555 HOH B O     1 
HETATM 3694 O  O     . HOH M 6 .   ? 5.650   50.704 42.679 1.00 22.76 ? 556 HOH B O     1 
HETATM 3695 O  O     . HOH M 6 .   ? -17.013 52.151 32.489 1.00 24.12 ? 559 HOH B O     1 
HETATM 3696 O  O     . HOH M 6 .   ? -2.711  44.997 29.587 1.00 28.72 ? 568 HOH B O     1 
HETATM 3697 O  O     . HOH M 6 .   ? 1.389   58.495 40.438 1.00 25.50 ? 575 HOH B O     1 
HETATM 3698 O  O     . HOH M 6 .   ? -11.538 44.675 43.289 1.00 21.33 ? 576 HOH B O     1 
HETATM 3699 O  O     . HOH M 6 .   ? -12.524 59.136 27.127 1.00 24.35 ? 581 HOH B O     1 
HETATM 3700 O  O     . HOH M 6 .   ? -10.347 70.019 37.064 1.00 19.78 ? 585 HOH B O     1 
HETATM 3701 O  O     . HOH M 6 .   ? -12.667 66.962 28.368 1.00 19.89 ? 586 HOH B O     1 
HETATM 3702 O  O     . HOH M 6 .   ? -23.780 68.699 39.028 1.00 23.05 ? 587 HOH B O     1 
HETATM 3703 O  O     . HOH M 6 .   ? -1.586  59.871 47.136 1.00 26.81 ? 588 HOH B O     1 
HETATM 3704 O  O     . HOH M 6 .   ? -14.303 42.912 50.872 1.00 36.14 ? 595 HOH B O     1 
HETATM 3705 O  O     . HOH M 6 .   ? 0.249   49.624 31.087 1.00 32.11 ? 596 HOH B O     1 
HETATM 3706 O  O     . HOH M 6 .   ? 4.478   41.963 35.914 1.00 21.22 ? 597 HOH B O     1 
HETATM 3707 O  O     . HOH M 6 .   ? -22.686 64.869 36.361 1.00 29.01 ? 598 HOH B O     1 
HETATM 3708 O  O     . HOH M 6 .   ? -7.675  69.134 42.497 1.00 20.48 ? 599 HOH B O     1 
HETATM 3709 O  O     . HOH M 6 .   ? -9.142  62.558 26.934 1.00 27.75 ? 610 HOH B O     1 
HETATM 3710 O  O     . HOH M 6 .   ? 1.262   59.311 42.883 1.00 23.62 ? 611 HOH B O     1 
HETATM 3711 O  O     . HOH M 6 .   ? -12.685 64.289 26.138 1.00 35.03 ? 627 HOH B O     1 
HETATM 3712 O  O     . HOH M 6 .   ? -26.507 67.844 39.827 1.00 27.60 ? 628 HOH B O     1 
HETATM 3713 O  O     . HOH M 6 .   ? -16.550 65.224 27.573 1.00 27.42 ? 630 HOH B O     1 
HETATM 3714 O  O     . HOH M 6 .   ? -21.241 34.773 35.980 1.00 40.09 ? 633 HOH B O     1 
HETATM 3715 O  O     . HOH M 6 .   ? -21.307 48.345 32.515 1.00 27.62 ? 634 HOH B O     1 
HETATM 3716 O  O     . HOH M 6 .   ? -10.849 78.466 32.382 1.00 35.61 ? 637 HOH B O     1 
HETATM 3717 O  O     . HOH M 6 .   ? -3.491  53.273 55.046 1.00 22.70 ? 638 HOH B O     1 
HETATM 3718 O  O     . HOH M 6 .   ? -14.378 49.217 56.345 1.00 25.26 ? 640 HOH B O     1 
HETATM 3719 O  O     . HOH M 6 .   ? -3.457  52.702 31.257 1.00 25.89 ? 643 HOH B O     1 
HETATM 3720 O  O     . HOH M 6 .   ? -24.503 39.131 44.233 1.00 43.97 ? 649 HOH B O     1 
HETATM 3721 O  O     . HOH M 6 .   ? -24.940 51.528 51.827 1.00 30.19 ? 651 HOH B O     1 
HETATM 3722 O  O     . HOH M 6 .   ? -18.448 50.631 30.609 1.00 29.21 ? 653 HOH B O     1 
HETATM 3723 O  O     . HOH M 6 .   ? -23.916 60.330 27.643 1.00 37.02 ? 656 HOH B O     1 
HETATM 3724 O  O     . HOH M 6 .   ? -7.069  40.565 32.861 1.00 32.52 ? 658 HOH B O     1 
HETATM 3725 O  O     . HOH M 6 .   ? -1.861  51.632 29.371 1.00 34.20 ? 663 HOH B O     1 
HETATM 3726 O  O     . HOH M 6 .   ? -28.345 69.807 39.460 1.00 34.20 ? 669 HOH B O     1 
HETATM 3727 O  O     . HOH M 6 .   ? -17.712 64.640 25.311 1.00 32.46 ? 671 HOH B O     1 
HETATM 3728 O  O     . HOH M 6 .   ? -8.522  60.823 24.894 1.00 28.55 ? 677 HOH B O     1 
HETATM 3729 O  O     . HOH M 6 .   ? -8.715  70.195 44.856 1.00 29.95 ? 680 HOH B O     1 
HETATM 3730 O  O     . HOH M 6 .   ? -29.611 50.411 40.768 1.00 44.72 ? 682 HOH B O     1 
HETATM 3731 O  O     . HOH M 6 .   ? -21.163 51.747 32.229 1.00 29.44 ? 689 HOH B O     1 
HETATM 3732 O  O     . HOH M 6 .   ? -24.035 70.290 45.887 1.00 33.61 ? 696 HOH B O     1 
HETATM 3733 O  O     . HOH M 6 .   ? -13.389 44.438 41.018 1.00 30.04 ? 697 HOH B O     1 
HETATM 3734 O  O     . HOH M 6 .   ? -29.409 60.099 39.087 1.00 34.44 ? 699 HOH B O     1 
HETATM 3735 O  O     . HOH M 6 .   ? -0.343  47.099 30.048 1.00 39.39 ? 701 HOH B O     1 
HETATM 3736 O  O     . HOH M 6 .   ? -27.637 55.673 34.454 1.00 29.78 ? 703 HOH B O     1 
HETATM 3737 O  O     . HOH M 6 .   ? -9.007  36.899 35.721 1.00 39.42 ? 705 HOH B O     1 
HETATM 3738 O  O     . HOH M 6 .   ? -5.379  54.028 29.485 1.00 31.20 ? 713 HOH B O     1 
HETATM 3739 O  O     . HOH M 6 .   ? -22.844 68.503 47.063 1.00 35.37 ? 715 HOH B O     1 
HETATM 3740 O  O     . HOH M 6 .   ? -26.050 36.786 44.532 1.00 41.53 ? 719 HOH B O     1 
HETATM 3741 O  O     . HOH M 6 .   ? -30.376 44.694 44.951 1.00 37.49 ? 722 HOH B O     1 
HETATM 3742 O  O     . HOH M 6 .   ? -10.370 47.430 30.267 1.00 38.89 ? 723 HOH B O     1 
HETATM 3743 O  O     . HOH M 6 .   ? -14.809 50.840 33.156 1.00 22.14 ? 728 HOH B O     1 
HETATM 3744 O  O     . HOH M 6 .   ? -14.529 48.378 31.191 1.00 30.98 ? 729 HOH B O     1 
HETATM 3745 O  O     . HOH M 6 .   ? -16.687 48.296 33.322 1.00 32.14 ? 730 HOH B O     1 
HETATM 3746 O  O     . HOH M 6 .   ? -13.982 47.090 54.522 1.00 25.36 ? 738 HOH B O     1 
HETATM 3747 O  O     . HOH M 6 .   ? -12.299 72.015 37.356 1.00 31.39 ? 742 HOH B O     1 
HETATM 3748 O  O     . HOH M 6 .   ? -14.811 74.381 30.345 1.00 46.72 ? 745 HOH B O     1 
HETATM 3749 O  O     . HOH M 6 .   ? -3.313  39.183 38.615 1.00 32.94 ? 751 HOH B O     1 
HETATM 3750 O  O     . HOH M 6 .   ? -28.000 55.961 44.826 1.00 38.37 ? 755 HOH B O     1 
HETATM 3751 O  O     . HOH M 6 .   ? -6.900  47.276 30.642 1.00 29.78 ? 756 HOH B O     1 
HETATM 3752 O  O     . HOH M 6 .   ? -8.937  55.621 27.948 1.00 37.69 ? 758 HOH B O     1 
HETATM 3753 O  O     . HOH M 6 .   ? -14.294 72.012 35.546 1.00 29.15 ? 760 HOH B O     1 
HETATM 3754 O  O     . HOH M 6 .   ? -2.892  45.872 52.136 1.00 26.87 ? 761 HOH B O     1 
HETATM 3755 O  O     . HOH M 6 .   ? -2.410  65.496 48.820 1.00 27.76 ? 768 HOH B O     1 
HETATM 3756 O  O     . HOH M 6 .   ? -7.902  38.069 33.590 1.00 28.70 ? 769 HOH B O     1 
HETATM 3757 O  O     . HOH M 6 .   ? -16.551 53.336 36.867 1.00 26.82 ? 771 HOH B O     1 
HETATM 3758 O  O     . HOH M 6 .   ? -27.224 62.427 39.104 1.00 37.70 ? 772 HOH B O     1 
HETATM 3759 O  O     . HOH M 6 .   ? 5.126   49.544 40.639 1.00 41.03 ? 775 HOH B O     1 
HETATM 3760 O  O     . HOH M 6 .   ? -7.976  71.687 41.447 1.00 31.07 ? 778 HOH B O     1 
HETATM 3761 O  O     . HOH M 6 .   ? -9.657  52.715 28.892 1.00 38.20 ? 782 HOH B O     1 
HETATM 3762 O  O     . HOH M 6 .   ? -10.734 44.232 30.776 1.00 32.13 ? 784 HOH B O     1 
HETATM 3763 O  O     . HOH M 6 .   ? -12.316 45.404 56.198 1.00 37.65 ? 786 HOH B O     1 
HETATM 3764 O  O     . HOH M 6 .   ? 3.688   46.155 31.758 1.00 32.61 ? 787 HOH B O     1 
HETATM 3765 O  O     . HOH M 6 .   ? -22.635 36.142 33.442 1.00 40.86 ? 791 HOH B O     1 
HETATM 3766 O  O     . HOH M 6 .   ? -18.687 62.692 31.411 1.00 31.47 ? 792 HOH B O     1 
HETATM 3767 O  O     . HOH M 6 .   ? -24.706 38.543 39.610 1.00 37.77 ? 794 HOH B O     1 
HETATM 3768 O  O     . HOH M 6 .   ? -9.326  73.774 42.199 1.00 42.03 ? 798 HOH B O     1 
HETATM 3769 O  O     . HOH M 6 .   ? -25.989 49.770 53.676 1.00 41.77 ? 799 HOH B O     1 
HETATM 3770 O  O     . HOH M 6 .   ? -0.317  61.597 45.849 1.00 36.99 ? 808 HOH B O     1 
HETATM 3771 O  O     . HOH M 6 .   ? -11.523 36.511 36.990 1.00 37.11 ? 811 HOH B O     1 
HETATM 3772 O  O     . HOH M 6 .   ? -4.518  75.982 43.027 1.00 29.30 ? 812 HOH B O     1 
HETATM 3773 O  O     . HOH M 6 .   ? -5.320  37.793 38.495 1.00 27.85 ? 814 HOH B O     1 
HETATM 3774 O  O     . HOH M 6 .   ? -10.222 64.725 25.566 1.00 30.12 ? 816 HOH B O     1 
HETATM 3775 O  O     . HOH M 6 .   ? -1.592  58.273 51.157 1.00 34.35 ? 820 HOH B O     1 
HETATM 3776 O  O     . HOH M 6 .   ? -26.564 56.966 48.873 1.00 37.18 ? 827 HOH B O     1 
HETATM 3777 O  O     . HOH M 6 .   ? -13.817 42.676 30.385 1.00 31.98 ? 828 HOH B O     1 
HETATM 3778 O  O     . HOH M 6 .   ? -22.085 43.056 52.304 1.00 40.76 ? 829 HOH B O     1 
HETATM 3779 O  O     . HOH M 6 .   ? -0.585  66.501 50.729 1.00 38.29 ? 830 HOH B O     1 
HETATM 3780 O  O     . HOH M 6 .   ? -2.618  79.705 44.196 1.00 37.02 ? 831 HOH B O     1 
HETATM 3781 O  O     . HOH M 6 .   ? -26.502 50.489 46.621 1.00 34.07 ? 833 HOH B O     1 
HETATM 3782 O  O     . HOH M 6 .   ? -27.976 52.946 33.803 1.00 43.73 ? 834 HOH B O     1 
HETATM 3783 O  O     . HOH M 6 .   ? -28.470 44.299 33.246 1.00 45.38 ? 839 HOH B O     1 
HETATM 3784 O  O     . HOH M 6 .   ? -16.286 50.389 36.771 0.87 33.39 ? 843 HOH B O     1 
HETATM 3785 O  O     . HOH N 6 .   ? 12.881  60.885 41.315 1.00 14.26 ? 501 HOH C O     1 
HETATM 3786 O  O     . HOH N 6 .   ? 6.246   50.183 54.489 1.00 14.28 ? 503 HOH C O     1 
HETATM 3787 O  O     . HOH N 6 .   ? 4.464   50.061 45.095 1.00 14.49 ? 509 HOH C O     1 
HETATM 3788 O  O     . HOH N 6 .   ? 3.706   39.567 37.028 1.00 18.84 ? 511 HOH C O     1 
HETATM 3789 O  O     . HOH N 6 .   ? 8.630   50.769 42.187 1.00 19.02 ? 521 HOH C O     1 
HETATM 3790 O  O     . HOH N 6 .   ? 5.728   41.159 54.613 1.00 19.15 ? 522 HOH C O     1 
HETATM 3791 O  O     . HOH N 6 .   ? 12.210  39.848 40.428 1.00 22.69 ? 530 HOH C O     1 
HETATM 3792 O  O     . HOH N 6 .   ? 3.279   44.975 38.620 1.00 18.00 ? 533 HOH C O     1 
HETATM 3793 O  O     . HOH N 6 .   ? 5.390   43.659 55.514 1.00 16.40 ? 534 HOH C O     1 
HETATM 3794 O  O     . HOH N 6 .   ? 1.569   34.272 49.237 1.00 20.08 ? 537 HOH C O     1 
HETATM 3795 O  O     . HOH N 6 .   ? 7.705   57.657 42.053 1.00 20.71 ? 539 HOH C O     1 
HETATM 3796 O  O     . HOH N 6 .   ? 2.665   33.652 40.124 1.00 24.39 ? 540 HOH C O     1 
HETATM 3797 O  O     . HOH N 6 .   ? 23.869  49.689 56.462 1.00 22.31 ? 543 HOH C O     1 
HETATM 3798 O  O     . HOH N 6 .   ? 15.072  36.090 56.953 1.00 19.11 ? 548 HOH C O     1 
HETATM 3799 O  O     . HOH N 6 .   ? 16.440  59.287 29.603 1.00 18.56 ? 549 HOH C O     1 
HETATM 3800 O  O     . HOH N 6 .   ? 6.605   36.405 37.379 1.00 17.24 ? 557 HOH C O     1 
HETATM 3801 O  O     . HOH N 6 .   ? 13.107  58.303 34.839 1.00 22.81 ? 560 HOH C O     1 
HETATM 3802 O  O     . HOH N 6 .   ? 10.917  60.597 43.394 1.00 25.44 ? 561 HOH C O     1 
HETATM 3803 O  O     . HOH N 6 .   ? 6.070   57.134 34.403 1.00 19.93 ? 562 HOH C O     1 
HETATM 3804 O  O     . HOH N 6 .   ? 24.840  48.901 41.869 1.00 30.57 ? 569 HOH C O     1 
HETATM 3805 O  O     . HOH N 6 .   ? 23.173  55.694 39.670 1.00 20.74 ? 570 HOH C O     1 
HETATM 3806 O  O     . HOH N 6 .   ? 8.515   42.472 34.143 1.00 24.75 ? 572 HOH C O     1 
HETATM 3807 O  O     . HOH N 6 .   ? 21.116  28.149 43.933 1.00 38.42 ? 574 HOH C O     1 
HETATM 3808 O  O     . HOH N 6 .   ? 9.403   49.455 34.505 1.00 21.88 ? 577 HOH C O     1 
HETATM 3809 O  O     . HOH N 6 .   ? 20.923  59.342 49.463 1.00 36.47 ? 582 HOH C O     1 
HETATM 3810 O  O     . HOH N 6 .   ? -0.174  41.585 52.082 1.00 28.95 ? 589 HOH C O     1 
HETATM 3811 O  O     . HOH N 6 .   ? 6.067   53.571 42.298 1.00 27.98 ? 590 HOH C O     1 
HETATM 3812 O  O     . HOH N 6 .   ? 21.834  55.552 55.253 1.00 24.12 ? 591 HOH C O     1 
HETATM 3813 O  O     . HOH N 6 .   ? 1.376   38.615 48.280 1.00 20.07 ? 592 HOH C O     1 
HETATM 3814 O  O     . HOH N 6 .   ? 11.414  51.219 33.304 1.00 19.79 ? 593 HOH C O     1 
HETATM 3815 O  O     . HOH N 6 .   ? 5.819   30.718 39.810 1.00 31.32 ? 600 HOH C O     1 
HETATM 3816 O  O     . HOH N 6 .   ? 18.250  36.570 37.811 1.00 23.64 ? 603 HOH C O     1 
HETATM 3817 O  O     . HOH N 6 .   ? 4.538   52.751 46.051 1.00 23.74 ? 607 HOH C O     1 
HETATM 3818 O  O     . HOH N 6 .   ? 8.325   53.586 49.095 1.00 26.91 ? 612 HOH C O     1 
HETATM 3819 O  O     . HOH N 6 .   ? 26.566  49.521 51.325 1.00 27.13 ? 613 HOH C O     1 
HETATM 3820 O  O     . HOH N 6 .   ? -0.173  46.361 50.864 1.00 33.70 ? 614 HOH C O     1 
HETATM 3821 O  O     . HOH N 6 .   ? 21.104  56.639 28.230 1.00 31.81 ? 620 HOH C O     1 
HETATM 3822 O  O     . HOH N 6 .   ? 25.877  51.057 55.711 1.00 28.20 ? 625 HOH C O     1 
HETATM 3823 O  O     . HOH N 6 .   ? -0.663  44.124 52.332 1.00 24.59 ? 631 HOH C O     1 
HETATM 3824 O  O     . HOH N 6 .   ? 24.526  32.295 53.427 1.00 40.61 ? 635 HOH C O     1 
HETATM 3825 O  O     . HOH N 6 .   ? 23.251  55.134 32.678 1.00 28.44 ? 639 HOH C O     1 
HETATM 3826 O  O     . HOH N 6 .   ? 12.230  27.525 53.743 1.00 37.89 ? 645 HOH C O     1 
HETATM 3827 O  O     . HOH N 6 .   ? 23.980  38.988 58.405 1.00 22.18 ? 647 HOH C O     1 
HETATM 3828 O  O     . HOH N 6 .   ? 14.914  27.956 46.051 1.00 35.81 ? 652 HOH C O     1 
HETATM 3829 O  O     . HOH N 6 .   ? 11.027  60.660 39.109 1.00 22.77 ? 655 HOH C O     1 
HETATM 3830 O  O     . HOH N 6 .   ? 10.352  58.412 44.809 1.00 27.89 ? 659 HOH C O     1 
HETATM 3831 O  O     . HOH N 6 .   ? 9.655   26.931 59.534 1.00 49.49 ? 661 HOH C O     1 
HETATM 3832 O  O     . HOH N 6 .   ? 28.610  36.914 27.007 1.00 48.79 ? 666 HOH C O     1 
HETATM 3833 O  O     . HOH N 6 .   ? 13.204  58.094 49.502 1.00 34.02 ? 670 HOH C O     1 
HETATM 3834 O  O     . HOH N 6 .   ? -5.784  37.972 50.201 1.00 29.09 ? 673 HOH C O     1 
HETATM 3835 O  O     . HOH N 6 .   ? 3.777   56.558 44.664 1.00 32.15 ? 678 HOH C O     1 
HETATM 3836 O  O     . HOH N 6 .   ? 26.881  51.404 53.420 1.00 29.94 ? 681 HOH C O     1 
HETATM 3837 O  O     . HOH N 6 .   ? 4.927   52.199 53.544 1.00 34.43 ? 686 HOH C O     1 
HETATM 3838 O  O     . HOH N 6 .   ? 18.424  49.201 30.033 1.00 27.29 ? 692 HOH C O     1 
HETATM 3839 O  O     . HOH N 6 .   ? 16.048  46.514 28.626 1.00 31.94 ? 693 HOH C O     1 
HETATM 3840 O  O     . HOH N 6 .   ? 7.734   29.986 41.742 1.00 30.18 ? 695 HOH C O     1 
HETATM 3841 O  O     . HOH N 6 .   ? -0.590  32.594 49.959 1.00 33.40 ? 698 HOH C O     1 
HETATM 3842 O  O     . HOH N 6 .   ? 35.138  40.429 46.215 1.00 33.90 ? 702 HOH C O     1 
HETATM 3843 O  O     . HOH N 6 .   ? 10.700  46.982 33.169 1.00 30.18 ? 704 HOH C O     1 
HETATM 3844 O  O     . HOH N 6 .   ? 6.229   54.257 44.489 1.00 32.87 ? 706 HOH C O     1 
HETATM 3845 O  O     . HOH N 6 .   ? 18.232  23.499 56.519 1.00 29.87 ? 707 HOH C O     1 
HETATM 3846 O  O     . HOH N 6 .   ? 34.872  37.766 49.824 1.00 31.81 ? 708 HOH C O     1 
HETATM 3847 O  O     . HOH N 6 .   ? 6.124   55.819 31.703 1.00 43.43 ? 714 HOH C O     1 
HETATM 3848 O  O     . HOH N 6 .   ? 21.672  37.198 39.182 1.00 29.45 ? 717 HOH C O     1 
HETATM 3849 O  O     . HOH N 6 .   ? 7.159   30.751 59.128 1.00 24.59 ? 718 HOH C O     1 
HETATM 3850 O  O     . HOH N 6 .   ? 6.344   29.355 37.449 1.00 33.73 ? 720 HOH C O     1 
HETATM 3851 O  O     . HOH N 6 .   ? 20.736  33.301 38.662 1.00 41.88 ? 721 HOH C O     1 
HETATM 3852 O  O     . HOH N 6 .   ? -8.834  43.796 56.280 1.00 40.34 ? 724 HOH C O     1 
HETATM 3853 O  O     . HOH N 6 .   ? 19.473  39.337 34.503 1.00 36.89 ? 731 HOH C O     1 
HETATM 3854 O  O     . HOH N 6 .   ? 21.616  38.702 37.081 1.00 28.87 ? 732 HOH C O     1 
HETATM 3855 O  O     . HOH N 6 .   ? 14.882  59.113 27.258 1.00 26.11 ? 733 HOH C O     1 
HETATM 3856 O  O     . HOH N 6 .   ? 8.366   35.620 35.506 1.00 29.58 ? 735 HOH C O     1 
HETATM 3857 O  O     . HOH N 6 .   ? 1.983   29.757 54.175 1.00 40.56 ? 737 HOH C O     1 
HETATM 3858 O  O     . HOH N 6 .   ? 19.597  35.197 35.965 1.00 32.98 ? 741 HOH C O     1 
HETATM 3859 O  O     . HOH N 6 .   ? 0.435   31.369 51.995 1.00 30.90 ? 743 HOH C O     1 
HETATM 3860 O  O     . HOH N 6 .   ? 16.019  27.108 39.450 1.00 34.80 ? 746 HOH C O     1 
HETATM 3861 O  O     . HOH N 6 .   ? 5.412   33.177 59.381 1.00 30.07 ? 748 HOH C O     1 
HETATM 3862 O  O     . HOH N 6 .   ? 11.866  59.294 36.985 1.00 33.30 ? 749 HOH C O     1 
HETATM 3863 O  O     . HOH N 6 .   ? 7.497   58.100 44.588 1.00 36.29 ? 752 HOH C O     1 
HETATM 3864 O  O     . HOH N 6 .   ? 9.826   28.927 53.202 1.00 24.73 ? 757 HOH C O     1 
HETATM 3865 O  O     . HOH N 6 .   ? 21.858  57.423 53.495 1.00 31.36 ? 762 HOH C O     1 
HETATM 3866 O  O     . HOH N 6 .   ? 16.766  45.494 31.703 1.00 33.86 ? 765 HOH C O     1 
HETATM 3867 O  O     . HOH N 6 .   ? 9.045   27.545 41.201 1.00 39.52 ? 767 HOH C O     1 
HETATM 3868 O  O     . HOH N 6 .   ? -3.091  33.365 51.267 1.00 47.36 ? 773 HOH C O     1 
HETATM 3869 O  O     . HOH N 6 .   ? 18.408  55.621 26.608 1.00 47.07 ? 774 HOH C O     1 
HETATM 3870 O  O     . HOH N 6 .   ? -12.389 42.994 53.910 1.00 35.29 ? 776 HOH C O     1 
HETATM 3871 O  O     . HOH N 6 .   ? 2.366   43.270 51.353 1.00 26.84 ? 781 HOH C O     1 
HETATM 3872 O  O     . HOH N 6 .   ? 20.020  36.587 59.256 1.00 42.09 ? 785 HOH C O     1 
HETATM 3873 O  O     . HOH N 6 .   ? 11.702  29.434 48.655 1.00 29.48 ? 788 HOH C O     1 
HETATM 3874 O  O     . HOH N 6 .   ? 10.591  50.886 30.512 1.00 38.71 ? 796 HOH C O     1 
HETATM 3875 O  O     . HOH N 6 .   ? 29.776  29.989 39.847 1.00 38.90 ? 803 HOH C O     1 
HETATM 3876 O  O     . HOH N 6 .   ? 23.656  34.950 37.309 1.00 34.33 ? 818 HOH C O     1 
HETATM 3877 O  O     . HOH N 6 .   ? 1.185   41.767 54.649 1.00 29.27 ? 819 HOH C O     1 
HETATM 3878 O  O     . HOH N 6 .   ? 12.491  51.689 29.258 1.00 42.40 ? 822 HOH C O     1 
HETATM 3879 O  O     . HOH N 6 .   ? 28.731  37.344 54.387 1.00 38.20 ? 824 HOH C O     1 
HETATM 3880 O  O     . HOH N 6 .   ? 10.453  44.304 33.335 1.00 35.95 ? 836 HOH C O     1 
HETATM 3881 O  O     . HOH N 6 .   ? 21.882  54.835 25.873 1.00 43.32 ? 837 HOH C O     1 
HETATM 3882 O  O     . HOH N 6 .   ? 9.444   33.282 35.127 1.00 40.26 ? 838 HOH C O     1 
HETATM 3883 O  O     . HOH N 6 .   ? 10.943  54.946 30.150 1.00 37.75 ? 842 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   THR 3   3   ?   ?   ?   A . n 
A 1 4   ASN 4   4   ?   ?   ?   A . n 
A 1 5   LYS 5   5   ?   ?   ?   A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  PHE 12  12  12  PHE PHE A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  ARG 22  22  22  ARG ARG A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  TYR 32  32  32  TYR TYR A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLN 44  44  44  GLN GLN A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  HIS 55  55  55  HIS HIS A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  HIS 59  59  59  HIS HIS A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  MET 80  80  80  MET MET A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  MET 94  94  94  MET MET A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 ASP 111 111 111 ASP ASP A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 TRP 137 137 137 TRP TRP A . n 
A 1 138 PHE 138 138 138 PHE PHE A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   THR 3   3   ?   ?   ?   B . n 
B 1 4   ASN 4   4   ?   ?   ?   B . n 
B 1 5   LYS 5   5   ?   ?   ?   B . n 
B 1 6   VAL 6   6   6   VAL VAL B . n 
B 1 7   ASN 7   7   7   ASN ASN B . n 
B 1 8   LYS 8   8   8   LYS LYS B . n 
B 1 9   GLU 9   9   9   GLU GLU B . n 
B 1 10  ARG 10  10  10  ARG ARG B . n 
B 1 11  THR 11  11  11  THR THR B . n 
B 1 12  PHE 12  12  12  PHE PHE B . n 
B 1 13  LEU 13  13  13  LEU LEU B . n 
B 1 14  ALA 14  14  14  ALA ALA B . n 
B 1 15  VAL 15  15  15  VAL VAL B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  PRO 17  17  17  PRO PRO B . n 
B 1 18  ASP 18  18  18  ASP ASP B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  ARG 22  22  22  ARG ARG B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  LEU 24  24  24  LEU LEU B . n 
B 1 25  VAL 25  25  25  VAL VAL B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLU 27  27  27  GLU GLU B . n 
B 1 28  ILE 28  28  28  ILE ILE B . n 
B 1 29  ILE 29  29  29  ILE ILE B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  ARG 31  31  31  ARG ARG B . n 
B 1 32  TYR 32  32  32  TYR TYR B . n 
B 1 33  GLU 33  33  33  GLU GLU B . n 
B 1 34  LYS 34  34  34  LYS LYS B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  GLY 36  36  36  GLY GLY B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  VAL 38  38  38  VAL VAL B . n 
B 1 39  LEU 39  39  39  LEU LEU B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  LYS 43  43  43  LYS LYS B . n 
B 1 44  GLN 44  44  44  GLN GLN B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  VAL 46  46  46  VAL VAL B . n 
B 1 47  PRO 47  47  47  PRO PRO B . n 
B 1 48  THR 48  48  48  THR THR B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  ASP 50  50  50  ASP ASP B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  ALA 52  52  52  ALA ALA B . n 
B 1 53  GLU 53  53  53  GLU GLU B . n 
B 1 54  SER 54  54  54  SER SER B . n 
B 1 55  HIS 55  55  55  HIS HIS B . n 
B 1 56  TYR 56  56  56  TYR TYR B . n 
B 1 57  ALA 57  57  57  ALA ALA B . n 
B 1 58  GLU 58  58  58  GLU GLU B . n 
B 1 59  HIS 59  59  59  HIS HIS B . n 
B 1 60  LYS 60  60  60  LYS LYS B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  ARG 62  62  62  ARG ARG B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  GLY 67  67  67  GLY GLY B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  VAL 69  69  69  VAL VAL B . n 
B 1 70  SER 70  70  70  SER SER B . n 
B 1 71  PHE 71  71  71  PHE PHE B . n 
B 1 72  ILE 72  72  72  ILE ILE B . n 
B 1 73  THR 73  73  73  THR THR B . n 
B 1 74  SER 74  74  74  SER SER B . n 
B 1 75  GLY 75  75  75  GLY GLY B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  VAL 77  77  77  VAL VAL B . n 
B 1 78  VAL 78  78  78  VAL VAL B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  MET 80  80  80  MET MET B . n 
B 1 81  VAL 81  81  81  VAL VAL B . n 
B 1 82  PHE 82  82  82  PHE PHE B . n 
B 1 83  GLU 83  83  83  GLU GLU B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  LYS 85  85  85  LYS LYS B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  VAL 87  87  87  VAL VAL B . n 
B 1 88  VAL 88  88  88  VAL VAL B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  MET 94  94  94  MET MET B . n 
B 1 95  ILE 95  95  95  ILE ILE B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  VAL 97  97  97  VAL VAL B . n 
B 1 98  THR 98  98  98  THR THR B . n 
B 1 99  ASN 99  99  99  ASN ASN B . n 
B 1 100 PRO 100 100 100 PRO PRO B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 ALA 102 102 102 ALA ALA B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 PRO 105 105 105 PRO PRO B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 SER 107 107 107 SER SER B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 ARG 109 109 109 ARG ARG B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 ASP 111 111 111 ASP ASP B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 GLY 113 113 113 GLY GLY B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 ASP 115 115 115 ASP ASP B . n 
B 1 116 VAL 116 116 116 VAL VAL B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 ARG 118 118 118 ARG ARG B . n 
B 1 119 ASN 119 119 119 ASN ASN B . n 
B 1 120 ILE 120 120 120 ILE ILE B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 SER 124 124 124 SER SER B . n 
B 1 125 ASP 125 125 125 ASP ASP B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 GLU 128 128 128 GLU GLU B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 ALA 130 130 130 ALA ALA B . n 
B 1 131 ASN 131 131 131 ASN ASN B . n 
B 1 132 ARG 132 132 132 ARG ARG B . n 
B 1 133 GLU 133 133 133 GLU GLU B . n 
B 1 134 ILE 134 134 134 ILE ILE B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 LEU 136 136 136 LEU LEU B . n 
B 1 137 TRP 137 137 137 TRP TRP B . n 
B 1 138 PHE 138 138 138 PHE PHE B . n 
B 1 139 LYS 139 139 139 LYS LYS B . n 
B 1 140 PRO 140 140 140 PRO PRO B . n 
B 1 141 GLU 141 141 141 GLU GLU B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 LEU 144 144 144 LEU LEU B . n 
B 1 145 THR 145 145 145 THR THR B . n 
B 1 146 GLU 146 146 146 GLU GLU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 LYS 148 148 148 LYS LYS B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 PRO 151 151 151 PRO PRO B . n 
B 1 152 ASN 152 152 152 ASN ASN B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 TYR 154 154 154 TYR TYR B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   SER 2   2   ?   ?   ?   C . n 
C 1 3   THR 3   3   ?   ?   ?   C . n 
C 1 4   ASN 4   4   ?   ?   ?   C . n 
C 1 5   LYS 5   5   ?   ?   ?   C . n 
C 1 6   VAL 6   6   6   VAL VAL C . n 
C 1 7   ASN 7   7   7   ASN ASN C . n 
C 1 8   LYS 8   8   8   LYS LYS C . n 
C 1 9   GLU 9   9   9   GLU GLU C . n 
C 1 10  ARG 10  10  10  ARG ARG C . n 
C 1 11  THR 11  11  11  THR THR C . n 
C 1 12  PHE 12  12  12  PHE PHE C . n 
C 1 13  LEU 13  13  13  LEU LEU C . n 
C 1 14  ALA 14  14  14  ALA ALA C . n 
C 1 15  VAL 15  15  15  VAL VAL C . n 
C 1 16  LYS 16  16  16  LYS LYS C . n 
C 1 17  PRO 17  17  17  PRO PRO C . n 
C 1 18  ASP 18  18  18  ASP ASP C . n 
C 1 19  GLY 19  19  19  GLY GLY C . n 
C 1 20  VAL 20  20  20  VAL VAL C . n 
C 1 21  ALA 21  21  21  ALA ALA C . n 
C 1 22  ARG 22  22  22  ARG ARG C . n 
C 1 23  GLY 23  23  23  GLY GLY C . n 
C 1 24  LEU 24  24  24  LEU LEU C . n 
C 1 25  VAL 25  25  25  VAL VAL C . n 
C 1 26  GLY 26  26  26  GLY GLY C . n 
C 1 27  GLU 27  27  27  GLU GLU C . n 
C 1 28  ILE 28  28  28  ILE ILE C . n 
C 1 29  ILE 29  29  29  ILE ILE C . n 
C 1 30  ALA 30  30  30  ALA ALA C . n 
C 1 31  ARG 31  31  31  ARG ARG C . n 
C 1 32  TYR 32  32  32  TYR TYR C . n 
C 1 33  GLU 33  33  33  GLU GLU C . n 
C 1 34  LYS 34  34  34  LYS LYS C . n 
C 1 35  LYS 35  35  35  LYS LYS C . n 
C 1 36  GLY 36  36  36  GLY GLY C . n 
C 1 37  PHE 37  37  37  PHE PHE C . n 
C 1 38  VAL 38  38  38  VAL VAL C . n 
C 1 39  LEU 39  39  39  LEU LEU C . n 
C 1 40  VAL 40  40  40  VAL VAL C . n 
C 1 41  GLY 41  41  41  GLY GLY C . n 
C 1 42  LEU 42  42  42  LEU LEU C . n 
C 1 43  LYS 43  43  43  LYS LYS C . n 
C 1 44  GLN 44  44  44  GLN GLN C . n 
C 1 45  LEU 45  45  45  LEU LEU C . n 
C 1 46  VAL 46  46  46  VAL VAL C . n 
C 1 47  PRO 47  47  47  PRO PRO C . n 
C 1 48  THR 48  48  48  THR THR C . n 
C 1 49  LYS 49  49  49  LYS LYS C . n 
C 1 50  ASP 50  50  50  ASP ASP C . n 
C 1 51  LEU 51  51  51  LEU LEU C . n 
C 1 52  ALA 52  52  52  ALA ALA C . n 
C 1 53  GLU 53  53  53  GLU GLU C . n 
C 1 54  SER 54  54  54  SER SER C . n 
C 1 55  HIS 55  55  55  HIS HIS C . n 
C 1 56  TYR 56  56  56  TYR TYR C . n 
C 1 57  ALA 57  57  57  ALA ALA C . n 
C 1 58  GLU 58  58  58  GLU GLU C . n 
C 1 59  HIS 59  59  59  HIS HIS C . n 
C 1 60  LYS 60  60  60  LYS LYS C . n 
C 1 61  GLU 61  61  61  GLU GLU C . n 
C 1 62  ARG 62  62  62  ARG ARG C . n 
C 1 63  PRO 63  63  63  PRO PRO C . n 
C 1 64  PHE 64  64  64  PHE PHE C . n 
C 1 65  PHE 65  65  65  PHE PHE C . n 
C 1 66  GLY 66  66  66  GLY GLY C . n 
C 1 67  GLY 67  67  67  GLY GLY C . n 
C 1 68  LEU 68  68  68  LEU LEU C . n 
C 1 69  VAL 69  69  69  VAL VAL C . n 
C 1 70  SER 70  70  70  SER SER C . n 
C 1 71  PHE 71  71  71  PHE PHE C . n 
C 1 72  ILE 72  72  72  ILE ILE C . n 
C 1 73  THR 73  73  73  THR THR C . n 
C 1 74  SER 74  74  74  SER SER C . n 
C 1 75  GLY 75  75  75  GLY GLY C . n 
C 1 76  PRO 76  76  76  PRO PRO C . n 
C 1 77  VAL 77  77  77  VAL VAL C . n 
C 1 78  VAL 78  78  78  VAL VAL C . n 
C 1 79  ALA 79  79  79  ALA ALA C . n 
C 1 80  MET 80  80  80  MET MET C . n 
C 1 81  VAL 81  81  81  VAL VAL C . n 
C 1 82  PHE 82  82  82  PHE PHE C . n 
C 1 83  GLU 83  83  83  GLU GLU C . n 
C 1 84  GLY 84  84  84  GLY GLY C . n 
C 1 85  LYS 85  85  85  LYS LYS C . n 
C 1 86  GLY 86  86  86  GLY GLY C . n 
C 1 87  VAL 87  87  87  VAL VAL C . n 
C 1 88  VAL 88  88  88  VAL VAL C . n 
C 1 89  ALA 89  89  89  ALA ALA C . n 
C 1 90  SER 90  90  90  SER SER C . n 
C 1 91  ALA 91  91  91  ALA ALA C . n 
C 1 92  ARG 92  92  92  ARG ARG C . n 
C 1 93  LEU 93  93  93  LEU LEU C . n 
C 1 94  MET 94  94  94  MET MET C . n 
C 1 95  ILE 95  95  95  ILE ILE C . n 
C 1 96  GLY 96  96  96  GLY GLY C . n 
C 1 97  VAL 97  97  97  VAL VAL C . n 
C 1 98  THR 98  98  98  THR THR C . n 
C 1 99  ASN 99  99  99  ASN ASN C . n 
C 1 100 PRO 100 100 100 PRO PRO C . n 
C 1 101 LEU 101 101 101 LEU LEU C . n 
C 1 102 ALA 102 102 102 ALA ALA C . n 
C 1 103 SER 103 103 103 SER SER C . n 
C 1 104 ALA 104 104 104 ALA ALA C . n 
C 1 105 PRO 105 105 105 PRO PRO C . n 
C 1 106 GLY 106 106 106 GLY GLY C . n 
C 1 107 SER 107 107 107 SER SER C . n 
C 1 108 ILE 108 108 108 ILE ILE C . n 
C 1 109 ARG 109 109 109 ARG ARG C . n 
C 1 110 GLY 110 110 110 GLY GLY C . n 
C 1 111 ASP 111 111 111 ASP ASP C . n 
C 1 112 PHE 112 112 112 PHE PHE C . n 
C 1 113 GLY 113 113 113 GLY GLY C . n 
C 1 114 VAL 114 114 114 VAL VAL C . n 
C 1 115 ASP 115 115 115 ASP ASP C . n 
C 1 116 VAL 116 116 116 VAL VAL C . n 
C 1 117 GLY 117 117 117 GLY GLY C . n 
C 1 118 ARG 118 118 118 ARG ARG C . n 
C 1 119 ASN 119 119 119 ASN ASN C . n 
C 1 120 ILE 120 120 120 ILE ILE C . n 
C 1 121 ILE 121 121 121 ILE ILE C . n 
C 1 122 GLY 122 122 122 GLY GLY C . n 
C 1 123 GLY 123 123 123 GLY GLY C . n 
C 1 124 SER 124 124 124 SER SER C . n 
C 1 125 ASP 125 125 125 ASP ASP C . n 
C 1 126 SER 126 126 126 SER SER C . n 
C 1 127 VAL 127 127 127 VAL VAL C . n 
C 1 128 GLU 128 128 128 GLU GLU C . n 
C 1 129 SER 129 129 129 SER SER C . n 
C 1 130 ALA 130 130 130 ALA ALA C . n 
C 1 131 ASN 131 131 131 ASN ASN C . n 
C 1 132 ARG 132 132 132 ARG ARG C . n 
C 1 133 GLU 133 133 133 GLU GLU C . n 
C 1 134 ILE 134 134 134 ILE ILE C . n 
C 1 135 ALA 135 135 135 ALA ALA C . n 
C 1 136 LEU 136 136 136 LEU LEU C . n 
C 1 137 TRP 137 137 137 TRP TRP C . n 
C 1 138 PHE 138 138 138 PHE PHE C . n 
C 1 139 LYS 139 139 139 LYS LYS C . n 
C 1 140 PRO 140 140 140 PRO PRO C . n 
C 1 141 GLU 141 141 141 GLU GLU C . n 
C 1 142 GLU 142 142 142 GLU GLU C . n 
C 1 143 LEU 143 143 143 LEU LEU C . n 
C 1 144 LEU 144 144 144 LEU LEU C . n 
C 1 145 THR 145 145 145 THR THR C . n 
C 1 146 GLU 146 146 146 GLU GLU C . n 
C 1 147 VAL 147 147 147 VAL VAL C . n 
C 1 148 LYS 148 148 148 LYS LYS C . n 
C 1 149 PRO 149 149 149 PRO PRO C . n 
C 1 150 ASN 150 150 150 ASN ASN C . n 
C 1 151 PRO 151 151 151 PRO PRO C . n 
C 1 152 ASN 152 152 152 ASN ASN C . n 
C 1 153 LEU 153 153 153 LEU LEU C . n 
C 1 154 TYR 154 154 154 TYR TYR C . n 
C 1 155 GLU 155 155 155 GLU GLU C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 MG  1   165 165 MG  MG  A . 
E 3 D4T 1   160 160 D4T D4T A . 
F 4 PO4 1   162 162 PO4 PO4 B . 
G 2 MG  1   166 166 MG  MG  B . 
H 3 D4T 1   161 161 D4T D4T B . 
I 5 D4D 1   163 163 D4D D4D B . 
J 2 MG  1   167 167 MG  MG  C . 
K 3 D4T 1   164 164 D4T D4T C . 
L 6 HOH 1   504 504 HOH HOH A . 
L 6 HOH 2   506 506 HOH HOH A . 
L 6 HOH 3   508 508 HOH HOH A . 
L 6 HOH 4   512 512 HOH HOH A . 
L 6 HOH 5   518 518 HOH HOH A . 
L 6 HOH 6   519 519 HOH HOH A . 
L 6 HOH 7   526 526 HOH HOH A . 
L 6 HOH 8   527 527 HOH HOH A . 
L 6 HOH 9   528 528 HOH HOH A . 
L 6 HOH 10  529 529 HOH HOH A . 
L 6 HOH 11  531 531 HOH HOH A . 
L 6 HOH 12  536 536 HOH HOH A . 
L 6 HOH 13  542 542 HOH HOH A . 
L 6 HOH 14  544 544 HOH HOH A . 
L 6 HOH 15  545 545 HOH HOH A . 
L 6 HOH 16  550 550 HOH HOH A . 
L 6 HOH 17  553 553 HOH HOH A . 
L 6 HOH 18  558 558 HOH HOH A . 
L 6 HOH 19  563 563 HOH HOH A . 
L 6 HOH 20  564 564 HOH HOH A . 
L 6 HOH 21  565 565 HOH HOH A . 
L 6 HOH 22  566 566 HOH HOH A . 
L 6 HOH 23  567 567 HOH HOH A . 
L 6 HOH 24  571 571 HOH HOH A . 
L 6 HOH 25  573 573 HOH HOH A . 
L 6 HOH 26  578 578 HOH HOH A . 
L 6 HOH 27  579 579 HOH HOH A . 
L 6 HOH 28  580 580 HOH HOH A . 
L 6 HOH 29  583 583 HOH HOH A . 
L 6 HOH 30  584 584 HOH HOH A . 
L 6 HOH 31  594 594 HOH HOH A . 
L 6 HOH 32  601 601 HOH HOH A . 
L 6 HOH 33  602 602 HOH HOH A . 
L 6 HOH 34  604 604 HOH HOH A . 
L 6 HOH 35  605 605 HOH HOH A . 
L 6 HOH 36  606 606 HOH HOH A . 
L 6 HOH 37  608 608 HOH HOH A . 
L 6 HOH 38  609 609 HOH HOH A . 
L 6 HOH 39  615 615 HOH HOH A . 
L 6 HOH 40  616 616 HOH HOH A . 
L 6 HOH 41  617 617 HOH HOH A . 
L 6 HOH 42  618 618 HOH HOH A . 
L 6 HOH 43  619 619 HOH HOH A . 
L 6 HOH 44  621 621 HOH HOH A . 
L 6 HOH 45  622 622 HOH HOH A . 
L 6 HOH 46  623 623 HOH HOH A . 
L 6 HOH 47  624 624 HOH HOH A . 
L 6 HOH 48  626 626 HOH HOH A . 
L 6 HOH 49  629 629 HOH HOH A . 
L 6 HOH 50  632 632 HOH HOH A . 
L 6 HOH 51  636 636 HOH HOH A . 
L 6 HOH 52  641 641 HOH HOH A . 
L 6 HOH 53  642 642 HOH HOH A . 
L 6 HOH 54  644 644 HOH HOH A . 
L 6 HOH 55  646 646 HOH HOH A . 
L 6 HOH 56  648 648 HOH HOH A . 
L 6 HOH 57  650 650 HOH HOH A . 
L 6 HOH 58  654 654 HOH HOH A . 
L 6 HOH 59  657 657 HOH HOH A . 
L 6 HOH 60  660 660 HOH HOH A . 
L 6 HOH 61  662 662 HOH HOH A . 
L 6 HOH 62  664 664 HOH HOH A . 
L 6 HOH 63  665 665 HOH HOH A . 
L 6 HOH 64  667 667 HOH HOH A . 
L 6 HOH 65  668 668 HOH HOH A . 
L 6 HOH 66  672 672 HOH HOH A . 
L 6 HOH 67  674 674 HOH HOH A . 
L 6 HOH 68  675 675 HOH HOH A . 
L 6 HOH 69  676 676 HOH HOH A . 
L 6 HOH 70  679 679 HOH HOH A . 
L 6 HOH 71  683 683 HOH HOH A . 
L 6 HOH 72  684 684 HOH HOH A . 
L 6 HOH 73  685 685 HOH HOH A . 
L 6 HOH 74  687 687 HOH HOH A . 
L 6 HOH 75  688 688 HOH HOH A . 
L 6 HOH 76  690 690 HOH HOH A . 
L 6 HOH 77  691 691 HOH HOH A . 
L 6 HOH 78  694 694 HOH HOH A . 
L 6 HOH 79  700 700 HOH HOH A . 
L 6 HOH 80  709 709 HOH HOH A . 
L 6 HOH 81  710 710 HOH HOH A . 
L 6 HOH 82  711 711 HOH HOH A . 
L 6 HOH 83  712 712 HOH HOH A . 
L 6 HOH 84  716 716 HOH HOH A . 
L 6 HOH 85  725 725 HOH HOH A . 
L 6 HOH 86  726 726 HOH HOH A . 
L 6 HOH 87  727 727 HOH HOH A . 
L 6 HOH 88  734 734 HOH HOH A . 
L 6 HOH 89  736 736 HOH HOH A . 
L 6 HOH 90  739 739 HOH HOH A . 
L 6 HOH 91  740 740 HOH HOH A . 
L 6 HOH 92  744 744 HOH HOH A . 
L 6 HOH 93  747 747 HOH HOH A . 
L 6 HOH 94  750 750 HOH HOH A . 
L 6 HOH 95  753 753 HOH HOH A . 
L 6 HOH 96  754 754 HOH HOH A . 
L 6 HOH 97  759 759 HOH HOH A . 
L 6 HOH 98  763 763 HOH HOH A . 
L 6 HOH 99  764 764 HOH HOH A . 
L 6 HOH 100 766 766 HOH HOH A . 
L 6 HOH 101 770 770 HOH HOH A . 
L 6 HOH 102 777 777 HOH HOH A . 
L 6 HOH 103 779 779 HOH HOH A . 
L 6 HOH 104 780 780 HOH HOH A . 
L 6 HOH 105 783 783 HOH HOH A . 
L 6 HOH 106 789 789 HOH HOH A . 
L 6 HOH 107 790 790 HOH HOH A . 
L 6 HOH 108 793 793 HOH HOH A . 
L 6 HOH 109 795 795 HOH HOH A . 
L 6 HOH 110 797 797 HOH HOH A . 
L 6 HOH 111 800 800 HOH HOH A . 
L 6 HOH 112 801 801 HOH HOH A . 
L 6 HOH 113 802 802 HOH HOH A . 
L 6 HOH 114 804 804 HOH HOH A . 
L 6 HOH 115 805 805 HOH HOH A . 
L 6 HOH 116 806 806 HOH HOH A . 
L 6 HOH 117 807 807 HOH HOH A . 
L 6 HOH 118 809 809 HOH HOH A . 
L 6 HOH 119 810 810 HOH HOH A . 
L 6 HOH 120 813 813 HOH HOH A . 
L 6 HOH 121 815 815 HOH HOH A . 
L 6 HOH 122 817 817 HOH HOH A . 
L 6 HOH 123 821 821 HOH HOH A . 
L 6 HOH 124 823 823 HOH HOH A . 
L 6 HOH 125 825 825 HOH HOH A . 
L 6 HOH 126 826 826 HOH HOH A . 
L 6 HOH 127 832 832 HOH HOH A . 
L 6 HOH 128 835 835 HOH HOH A . 
L 6 HOH 129 840 840 HOH HOH A . 
L 6 HOH 130 841 841 HOH HOH A . 
M 6 HOH 1   500 500 HOH HOH B . 
M 6 HOH 2   502 502 HOH HOH B . 
M 6 HOH 3   505 505 HOH HOH B . 
M 6 HOH 4   507 507 HOH HOH B . 
M 6 HOH 5   510 510 HOH HOH B . 
M 6 HOH 6   513 513 HOH HOH B . 
M 6 HOH 7   514 514 HOH HOH B . 
M 6 HOH 8   515 515 HOH HOH B . 
M 6 HOH 9   516 516 HOH HOH B . 
M 6 HOH 10  517 517 HOH HOH B . 
M 6 HOH 11  520 520 HOH HOH B . 
M 6 HOH 12  523 523 HOH HOH B . 
M 6 HOH 13  524 524 HOH HOH B . 
M 6 HOH 14  525 525 HOH HOH B . 
M 6 HOH 15  532 532 HOH HOH B . 
M 6 HOH 16  535 535 HOH HOH B . 
M 6 HOH 17  538 538 HOH HOH B . 
M 6 HOH 18  541 541 HOH HOH B . 
M 6 HOH 19  546 546 HOH HOH B . 
M 6 HOH 20  547 547 HOH HOH B . 
M 6 HOH 21  551 551 HOH HOH B . 
M 6 HOH 22  552 552 HOH HOH B . 
M 6 HOH 23  554 554 HOH HOH B . 
M 6 HOH 24  555 555 HOH HOH B . 
M 6 HOH 25  556 556 HOH HOH B . 
M 6 HOH 26  559 559 HOH HOH B . 
M 6 HOH 27  568 568 HOH HOH B . 
M 6 HOH 28  575 575 HOH HOH B . 
M 6 HOH 29  576 576 HOH HOH B . 
M 6 HOH 30  581 581 HOH HOH B . 
M 6 HOH 31  585 585 HOH HOH B . 
M 6 HOH 32  586 586 HOH HOH B . 
M 6 HOH 33  587 587 HOH HOH B . 
M 6 HOH 34  588 588 HOH HOH B . 
M 6 HOH 35  595 595 HOH HOH B . 
M 6 HOH 36  596 596 HOH HOH B . 
M 6 HOH 37  597 597 HOH HOH B . 
M 6 HOH 38  598 598 HOH HOH B . 
M 6 HOH 39  599 599 HOH HOH B . 
M 6 HOH 40  610 610 HOH HOH B . 
M 6 HOH 41  611 611 HOH HOH B . 
M 6 HOH 42  627 627 HOH HOH B . 
M 6 HOH 43  628 628 HOH HOH B . 
M 6 HOH 44  630 630 HOH HOH B . 
M 6 HOH 45  633 633 HOH HOH B . 
M 6 HOH 46  634 634 HOH HOH B . 
M 6 HOH 47  637 637 HOH HOH B . 
M 6 HOH 48  638 638 HOH HOH B . 
M 6 HOH 49  640 640 HOH HOH B . 
M 6 HOH 50  643 643 HOH HOH B . 
M 6 HOH 51  649 649 HOH HOH B . 
M 6 HOH 52  651 651 HOH HOH B . 
M 6 HOH 53  653 653 HOH HOH B . 
M 6 HOH 54  656 656 HOH HOH B . 
M 6 HOH 55  658 658 HOH HOH B . 
M 6 HOH 56  663 663 HOH HOH B . 
M 6 HOH 57  669 669 HOH HOH B . 
M 6 HOH 58  671 671 HOH HOH B . 
M 6 HOH 59  677 677 HOH HOH B . 
M 6 HOH 60  680 680 HOH HOH B . 
M 6 HOH 61  682 682 HOH HOH B . 
M 6 HOH 62  689 689 HOH HOH B . 
M 6 HOH 63  696 696 HOH HOH B . 
M 6 HOH 64  697 697 HOH HOH B . 
M 6 HOH 65  699 699 HOH HOH B . 
M 6 HOH 66  701 701 HOH HOH B . 
M 6 HOH 67  703 703 HOH HOH B . 
M 6 HOH 68  705 705 HOH HOH B . 
M 6 HOH 69  713 713 HOH HOH B . 
M 6 HOH 70  715 715 HOH HOH B . 
M 6 HOH 71  719 719 HOH HOH B . 
M 6 HOH 72  722 722 HOH HOH B . 
M 6 HOH 73  723 723 HOH HOH B . 
M 6 HOH 74  728 728 HOH HOH B . 
M 6 HOH 75  729 729 HOH HOH B . 
M 6 HOH 76  730 730 HOH HOH B . 
M 6 HOH 77  738 738 HOH HOH B . 
M 6 HOH 78  742 742 HOH HOH B . 
M 6 HOH 79  745 745 HOH HOH B . 
M 6 HOH 80  751 751 HOH HOH B . 
M 6 HOH 81  755 755 HOH HOH B . 
M 6 HOH 82  756 756 HOH HOH B . 
M 6 HOH 83  758 758 HOH HOH B . 
M 6 HOH 84  760 760 HOH HOH B . 
M 6 HOH 85  761 761 HOH HOH B . 
M 6 HOH 86  768 768 HOH HOH B . 
M 6 HOH 87  769 769 HOH HOH B . 
M 6 HOH 88  771 771 HOH HOH B . 
M 6 HOH 89  772 772 HOH HOH B . 
M 6 HOH 90  775 775 HOH HOH B . 
M 6 HOH 91  778 778 HOH HOH B . 
M 6 HOH 92  782 782 HOH HOH B . 
M 6 HOH 93  784 784 HOH HOH B . 
M 6 HOH 94  786 786 HOH HOH B . 
M 6 HOH 95  787 787 HOH HOH B . 
M 6 HOH 96  791 791 HOH HOH B . 
M 6 HOH 97  792 792 HOH HOH B . 
M 6 HOH 98  794 794 HOH HOH B . 
M 6 HOH 99  798 798 HOH HOH B . 
M 6 HOH 100 799 799 HOH HOH B . 
M 6 HOH 101 808 808 HOH HOH B . 
M 6 HOH 102 811 811 HOH HOH B . 
M 6 HOH 103 812 812 HOH HOH B . 
M 6 HOH 104 814 814 HOH HOH B . 
M 6 HOH 105 816 816 HOH HOH B . 
M 6 HOH 106 820 820 HOH HOH B . 
M 6 HOH 107 827 827 HOH HOH B . 
M 6 HOH 108 828 828 HOH HOH B . 
M 6 HOH 109 829 829 HOH HOH B . 
M 6 HOH 110 830 830 HOH HOH B . 
M 6 HOH 111 831 831 HOH HOH B . 
M 6 HOH 112 833 833 HOH HOH B . 
M 6 HOH 113 834 834 HOH HOH B . 
M 6 HOH 114 839 839 HOH HOH B . 
M 6 HOH 115 843 843 HOH HOH B . 
N 6 HOH 1   501 501 HOH HOH C . 
N 6 HOH 2   503 503 HOH HOH C . 
N 6 HOH 3   509 509 HOH HOH C . 
N 6 HOH 4   511 511 HOH HOH C . 
N 6 HOH 5   521 521 HOH HOH C . 
N 6 HOH 6   522 522 HOH HOH C . 
N 6 HOH 7   530 530 HOH HOH C . 
N 6 HOH 8   533 533 HOH HOH C . 
N 6 HOH 9   534 534 HOH HOH C . 
N 6 HOH 10  537 537 HOH HOH C . 
N 6 HOH 11  539 539 HOH HOH C . 
N 6 HOH 12  540 540 HOH HOH C . 
N 6 HOH 13  543 543 HOH HOH C . 
N 6 HOH 14  548 548 HOH HOH C . 
N 6 HOH 15  549 549 HOH HOH C . 
N 6 HOH 16  557 557 HOH HOH C . 
N 6 HOH 17  560 560 HOH HOH C . 
N 6 HOH 18  561 561 HOH HOH C . 
N 6 HOH 19  562 562 HOH HOH C . 
N 6 HOH 20  569 569 HOH HOH C . 
N 6 HOH 21  570 570 HOH HOH C . 
N 6 HOH 22  572 572 HOH HOH C . 
N 6 HOH 23  574 574 HOH HOH C . 
N 6 HOH 24  577 577 HOH HOH C . 
N 6 HOH 25  582 582 HOH HOH C . 
N 6 HOH 26  589 589 HOH HOH C . 
N 6 HOH 27  590 590 HOH HOH C . 
N 6 HOH 28  591 591 HOH HOH C . 
N 6 HOH 29  592 592 HOH HOH C . 
N 6 HOH 30  593 593 HOH HOH C . 
N 6 HOH 31  600 600 HOH HOH C . 
N 6 HOH 32  603 603 HOH HOH C . 
N 6 HOH 33  607 607 HOH HOH C . 
N 6 HOH 34  612 612 HOH HOH C . 
N 6 HOH 35  613 613 HOH HOH C . 
N 6 HOH 36  614 614 HOH HOH C . 
N 6 HOH 37  620 620 HOH HOH C . 
N 6 HOH 38  625 625 HOH HOH C . 
N 6 HOH 39  631 631 HOH HOH C . 
N 6 HOH 40  635 635 HOH HOH C . 
N 6 HOH 41  639 639 HOH HOH C . 
N 6 HOH 42  645 645 HOH HOH C . 
N 6 HOH 43  647 647 HOH HOH C . 
N 6 HOH 44  652 652 HOH HOH C . 
N 6 HOH 45  655 655 HOH HOH C . 
N 6 HOH 46  659 659 HOH HOH C . 
N 6 HOH 47  661 661 HOH HOH C . 
N 6 HOH 48  666 666 HOH HOH C . 
N 6 HOH 49  670 670 HOH HOH C . 
N 6 HOH 50  673 673 HOH HOH C . 
N 6 HOH 51  678 678 HOH HOH C . 
N 6 HOH 52  681 681 HOH HOH C . 
N 6 HOH 53  686 686 HOH HOH C . 
N 6 HOH 54  692 692 HOH HOH C . 
N 6 HOH 55  693 693 HOH HOH C . 
N 6 HOH 56  695 695 HOH HOH C . 
N 6 HOH 57  698 698 HOH HOH C . 
N 6 HOH 58  702 702 HOH HOH C . 
N 6 HOH 59  704 704 HOH HOH C . 
N 6 HOH 60  706 706 HOH HOH C . 
N 6 HOH 61  707 707 HOH HOH C . 
N 6 HOH 62  708 708 HOH HOH C . 
N 6 HOH 63  714 714 HOH HOH C . 
N 6 HOH 64  717 717 HOH HOH C . 
N 6 HOH 65  718 718 HOH HOH C . 
N 6 HOH 66  720 720 HOH HOH C . 
N 6 HOH 67  721 721 HOH HOH C . 
N 6 HOH 68  724 724 HOH HOH C . 
N 6 HOH 69  731 731 HOH HOH C . 
N 6 HOH 70  732 732 HOH HOH C . 
N 6 HOH 71  733 733 HOH HOH C . 
N 6 HOH 72  735 735 HOH HOH C . 
N 6 HOH 73  737 737 HOH HOH C . 
N 6 HOH 74  741 741 HOH HOH C . 
N 6 HOH 75  743 743 HOH HOH C . 
N 6 HOH 76  746 746 HOH HOH C . 
N 6 HOH 77  748 748 HOH HOH C . 
N 6 HOH 78  749 749 HOH HOH C . 
N 6 HOH 79  752 752 HOH HOH C . 
N 6 HOH 80  757 757 HOH HOH C . 
N 6 HOH 81  762 762 HOH HOH C . 
N 6 HOH 82  765 765 HOH HOH C . 
N 6 HOH 83  767 767 HOH HOH C . 
N 6 HOH 84  773 773 HOH HOH C . 
N 6 HOH 85  774 774 HOH HOH C . 
N 6 HOH 86  776 776 HOH HOH C . 
N 6 HOH 87  781 781 HOH HOH C . 
N 6 HOH 88  785 785 HOH HOH C . 
N 6 HOH 89  788 788 HOH HOH C . 
N 6 HOH 90  796 796 HOH HOH C . 
N 6 HOH 91  803 803 HOH HOH C . 
N 6 HOH 92  818 818 HOH HOH C . 
N 6 HOH 93  819 819 HOH HOH C . 
N 6 HOH 94  822 822 HOH HOH C . 
N 6 HOH 95  824 824 HOH HOH C . 
N 6 HOH 96  836 836 HOH HOH C . 
N 6 HOH 97  837 837 HOH HOH C . 
N 6 HOH 98  838 838 HOH HOH C . 
N 6 HOH 99  842 842 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 20270 ? 
1 MORE         -129  ? 
1 'SSA (A^2)'  32280 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z             1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 5_675 x-y+1,-y+2,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
-1.0000000000 0.0000000000 121.2747334444 0.0000000000 0.0000000000 -1.0000000000 101.3986666667 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O1B ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O1A ? E D4T . ? A D4T 160 ? 1_555 86.1  ? 
2  O1B ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O1C ? E D4T . ? A D4T 160 ? 1_555 92.9  ? 
3  O1A ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O1C ? E D4T . ? A D4T 160 ? 1_555 103.3 ? 
4  O1B ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 725 ? 1_555 96.5  ? 
5  O1A ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 725 ? 1_555 174.2 ? 
6  O1C ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 725 ? 1_555 81.7  ? 
7  O1B ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 726 ? 1_555 88.9  ? 
8  O1A ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 726 ? 1_555 81.1  ? 
9  O1C ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 726 ? 1_555 175.3 ? 
10 O   ? L HOH . ? A HOH 725 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 726 ? 1_555 93.7  ? 
11 O1B ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 727 ? 1_555 174.2 ? 
12 O1A ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 727 ? 1_555 90.8  ? 
13 O1C ? E D4T . ? A D4T 160 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 727 ? 1_555 92.7  ? 
14 O   ? L HOH . ? A HOH 725 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 727 ? 1_555 86.1  ? 
15 O   ? L HOH . ? A HOH 726 ? 1_555 MG ? D MG . ? A MG 165 ? 1_555 O   ? L HOH . ? A HOH 727 ? 1_555 85.7  ? 
16 O1A A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1C A H D4T . ? B D4T 161 ? 1_555 98.9  ? 
17 O1A A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1B A H D4T . ? B D4T 161 ? 1_555 92.7  ? 
18 O1C A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1B A H D4T . ? B D4T 161 ? 1_555 85.9  ? 
19 O1A A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1  B F PO4 . ? B PO4 162 ? 1_555 99.1  ? 
20 O1C A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1  B F PO4 . ? B PO4 162 ? 1_555 20.3  ? 
21 O1B A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1  B F PO4 . ? B PO4 162 ? 1_555 106.1 ? 
22 O1A A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1A B I D4D . ? B D4D 163 ? 1_555 8.7   ? 
23 O1C A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1A B I D4D . ? B D4D 163 ? 1_555 96.7  ? 
24 O1B A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1A B I D4D . ? B D4D 163 ? 1_555 84.1  ? 
25 O1  B F PO4 . ? B PO4 162 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1A B I D4D . ? B D4D 163 ? 1_555 100.0 ? 
26 O1A A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1B B I D4D . ? B D4D 163 ? 1_555 86.5  ? 
27 O1C A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1B B I D4D . ? B D4D 163 ? 1_555 82.9  ? 
28 O1B A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1B B I D4D . ? B D4D 163 ? 1_555 7.4   ? 
29 O1  B F PO4 . ? B PO4 162 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1B B I D4D . ? B D4D 163 ? 1_555 103.2 ? 
30 O1A B I D4D . ? B D4D 163 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O1B B I D4D . ? B D4D 163 ? 1_555 77.9  ? 
31 O1A A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 728 ? 1_555 173.9 ? 
32 O1C A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 728 ? 1_555 86.1  ? 
33 O1B A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 728 ? 1_555 91.3  ? 
34 O1  B F PO4 . ? B PO4 162 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 728 ? 1_555 84.3  ? 
35 O1A B I D4D . ? B D4D 163 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 728 ? 1_555 174.4 ? 
36 O1B B I D4D . ? B D4D 163 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 728 ? 1_555 97.7  ? 
37 O1A A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 729 ? 1_555 81.5  ? 
38 O1C A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 729 ? 1_555 175.2 ? 
39 O1B A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 729 ? 1_555 89.3  ? 
40 O1  B F PO4 . ? B PO4 162 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 729 ? 1_555 164.5 ? 
41 O1A B I D4D . ? B D4D 163 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 729 ? 1_555 82.9  ? 
42 O1B B I D4D . ? B D4D 163 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 729 ? 1_555 92.3  ? 
43 O   ? M HOH . ? B HOH 728 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 729 ? 1_555 93.9  ? 
44 O1A A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 730 ? 1_555 85.1  ? 
45 O1C A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 730 ? 1_555 88.2  ? 
46 O1B A H D4T . ? B D4T 161 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 730 ? 1_555 173.3 ? 
47 O1  B F PO4 . ? B PO4 162 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 730 ? 1_555 68.1  ? 
48 O1A B I D4D . ? B D4D 163 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 730 ? 1_555 93.5  ? 
49 O1B B I D4D . ? B D4D 163 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 730 ? 1_555 166.7 ? 
50 O   ? M HOH . ? B HOH 728 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 730 ? 1_555 91.4  ? 
51 O   ? M HOH . ? B HOH 729 ? 1_555 MG ? G MG . ? B MG 166 ? 1_555 O   ? M HOH . ? B HOH 730 ? 1_555 96.6  ? 
52 O1A ? K D4T . ? C D4T 164 ? 1_555 MG ? J MG . ? C MG 167 ? 1_555 O1B ? K D4T . ? C D4T 164 ? 1_555 78.2  ? 
53 O1A ? K D4T . ? C D4T 164 ? 1_555 MG ? J MG . ? C MG 167 ? 1_555 O1C ? K D4T . ? C D4T 164 ? 1_555 94.5  ? 
54 O1B ? K D4T . ? C D4T 164 ? 1_555 MG ? J MG . ? C MG 167 ? 1_555 O1C ? K D4T . ? C D4T 164 ? 1_555 90.7  ? 
55 O1A ? K D4T . ? C D4T 164 ? 1_555 MG ? J MG . ? C MG 167 ? 1_555 O   ? N HOH . ? C HOH 731 ? 1_555 83.6  ? 
56 O1B ? K D4T . ? C D4T 164 ? 1_555 MG ? J MG . ? C MG 167 ? 1_555 O   ? N HOH . ? C HOH 731 ? 1_555 86.1  ? 
57 O1C ? K D4T . ? C D4T 164 ? 1_555 MG ? J MG . ? C MG 167 ? 1_555 O   ? N HOH . ? C HOH 731 ? 1_555 176.5 ? 
58 O1A ? K D4T . ? C D4T 164 ? 1_555 MG ? J MG . ? C MG 167 ? 1_555 O   ? N HOH . ? C HOH 732 ? 1_555 87.7  ? 
59 O1B ? K D4T . ? C D4T 164 ? 1_555 MG ? J MG . ? C MG 167 ? 1_555 O   ? N HOH . ? C HOH 732 ? 1_555 165.0 ? 
60 O1C ? K D4T . ? C D4T 164 ? 1_555 MG ? J MG . ? C MG 167 ? 1_555 O   ? N HOH . ? C HOH 732 ? 1_555 85.1  ? 
61 O   ? N HOH . ? C HOH 731 ? 1_555 MG ? J MG . ? C MG 167 ? 1_555 O   ? N HOH . ? C HOH 732 ? 1_555 97.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-09-13 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2             
2 4 'Structure model' pdbx_struct_conn_angle 
3 4 'Structure model' struct_conn            
4 4 'Structure model' struct_ref_seq_dif     
5 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id'  
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id'  
17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
20 4 'Structure model' '_pdbx_struct_conn_angle.value'               
21 4 'Structure model' '_struct_conn.pdbx_dist_value'                
22 4 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id'        
23 4 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id'        
24 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
25 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
26 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
27 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
28 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
29 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
30 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
31 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
32 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
33 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
34 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
35 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
36 4 'Structure model' '_struct_ref_seq_dif.details'                 
37 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
38 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
39 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE  phasing          .         ? 1 
CNS    refinement       1.0       ? 2 
MOSFLM 'data reduction' .         ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 62 ? ? CZ A ARG 62 ? ? NH1 A ARG 62 ? ? 124.72 120.30 4.42  0.50 N 
2 1 NE A ARG 62 ? ? CZ A ARG 62 ? ? NH2 A ARG 62 ? ? 115.73 120.30 -4.57 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE A 120 ? ? 69.01  -46.77 
2 1 ILE B 120 ? ? 67.18  -49.23 
3 1 TYR C 56  ? ? -96.97 31.35  
4 1 ARG C 62  ? ? -28.76 139.19 
5 1 ILE C 120 ? ? 67.17  -51.00 
6 1 PRO C 151 ? ? -58.91 2.35   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1 ? A MET 1 
2  1 Y 1 A SER 2 ? A SER 2 
3  1 Y 1 A THR 3 ? A THR 3 
4  1 Y 1 A ASN 4 ? A ASN 4 
5  1 Y 1 A LYS 5 ? A LYS 5 
6  1 Y 1 B MET 1 ? B MET 1 
7  1 Y 1 B SER 2 ? B SER 2 
8  1 Y 1 B THR 3 ? B THR 3 
9  1 Y 1 B ASN 4 ? B ASN 4 
10 1 Y 1 B LYS 5 ? B LYS 5 
11 1 Y 1 C MET 1 ? C MET 1 
12 1 Y 1 C SER 2 ? C SER 2 
13 1 Y 1 C THR 3 ? C THR 3 
14 1 Y 1 C ASN 4 ? C ASN 4 
15 1 Y 1 C LYS 5 ? C LYS 5 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                                       MG  
3 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-TRIPHOSPHATE
;
D4T 
4 'PHOSPHATE ION'                                       PO4 
5 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-DIPHOSPHATE
;
D4D 
6 water                                                 HOH 
#