data_1F3H
# 
_entry.id   1F3H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1F3H         
RCSB  RCSB011196   
WWPDB D_1000011196 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F3H 
_pdbx_database_status.recvd_initial_deposition_date   2000-06-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Verdecia, M.A.' 1 
'Huang, H.'      2 
'Dutil, E.'      3 
'Hunter, T.'     4 
'Noel, J.P.'     5 
# 
_citation.id                        primary 
_citation.title                     'Structure of the human anti-apoptotic protein survivin reveals a dimeric arrangement.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            7 
_citation.page_first                602 
_citation.page_last                 608 
_citation.year                      2000 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10876248 
_citation.pdbx_database_id_DOI      10.1038/77929 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Verdecia, M.A.' 1 
primary 'Huang, H.'      2 
primary 'Dutil, E.'      3 
primary 'Kaiser, D.A.'   4 
primary 'Hunter, T.'     5 
primary 'Noel, J.P.'     6 
# 
_cell.entry_id           1F3H 
_cell.length_a           114.040 
_cell.length_b           71.450 
_cell.length_c           86.630 
_cell.angle_alpha        90.00 
_cell.angle_beta         133.37 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1F3H 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man SURVIVIN      16432.773 2  ? L54M ? ? 
2 non-polymer syn 'ZINC ION'    65.409    2  ? ?    ? ? 
3 non-polymer syn 'SULFATE ION' 96.063    3  ? ?    ? ? 
4 water       nat water         18.015    90 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'APOPTOSIS INHIBITOR 4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDMAQCFFCFKELEGWEPDDDPIEEHKKH
SSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDMAQCFFCFKELEGWEPDDDPIEEHKKH
SSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ALA n 
1 4   PRO n 
1 5   THR n 
1 6   LEU n 
1 7   PRO n 
1 8   PRO n 
1 9   ALA n 
1 10  TRP n 
1 11  GLN n 
1 12  PRO n 
1 13  PHE n 
1 14  LEU n 
1 15  LYS n 
1 16  ASP n 
1 17  HIS n 
1 18  ARG n 
1 19  ILE n 
1 20  SER n 
1 21  THR n 
1 22  PHE n 
1 23  LYS n 
1 24  ASN n 
1 25  TRP n 
1 26  PRO n 
1 27  PHE n 
1 28  LEU n 
1 29  GLU n 
1 30  GLY n 
1 31  CYS n 
1 32  ALA n 
1 33  CYS n 
1 34  THR n 
1 35  PRO n 
1 36  GLU n 
1 37  ARG n 
1 38  MET n 
1 39  ALA n 
1 40  GLU n 
1 41  ALA n 
1 42  GLY n 
1 43  PHE n 
1 44  ILE n 
1 45  HIS n 
1 46  CYS n 
1 47  PRO n 
1 48  THR n 
1 49  GLU n 
1 50  ASN n 
1 51  GLU n 
1 52  PRO n 
1 53  ASP n 
1 54  MET n 
1 55  ALA n 
1 56  GLN n 
1 57  CYS n 
1 58  PHE n 
1 59  PHE n 
1 60  CYS n 
1 61  PHE n 
1 62  LYS n 
1 63  GLU n 
1 64  LEU n 
1 65  GLU n 
1 66  GLY n 
1 67  TRP n 
1 68  GLU n 
1 69  PRO n 
1 70  ASP n 
1 71  ASP n 
1 72  ASP n 
1 73  PRO n 
1 74  ILE n 
1 75  GLU n 
1 76  GLU n 
1 77  HIS n 
1 78  LYS n 
1 79  LYS n 
1 80  HIS n 
1 81  SER n 
1 82  SER n 
1 83  GLY n 
1 84  CYS n 
1 85  ALA n 
1 86  PHE n 
1 87  LEU n 
1 88  SER n 
1 89  VAL n 
1 90  LYS n 
1 91  LYS n 
1 92  GLN n 
1 93  PHE n 
1 94  GLU n 
1 95  GLU n 
1 96  LEU n 
1 97  THR n 
1 98  LEU n 
1 99  GLY n 
1 100 GLU n 
1 101 PHE n 
1 102 LEU n 
1 103 LYS n 
1 104 LEU n 
1 105 ASP n 
1 106 ARG n 
1 107 GLU n 
1 108 ARG n 
1 109 ALA n 
1 110 LYS n 
1 111 ASN n 
1 112 LYS n 
1 113 ILE n 
1 114 ALA n 
1 115 LYS n 
1 116 GLU n 
1 117 THR n 
1 118 ASN n 
1 119 ASN n 
1 120 LYS n 
1 121 LYS n 
1 122 LYS n 
1 123 GLU n 
1 124 PHE n 
1 125 GLU n 
1 126 GLU n 
1 127 THR n 
1 128 ALA n 
1 129 LYS n 
1 130 LYS n 
1 131 VAL n 
1 132 ARG n 
1 133 ARG n 
1 134 ALA n 
1 135 ILE n 
1 136 GLU n 
1 137 GLN n 
1 138 LEU n 
1 139 ALA n 
1 140 ALA n 
1 141 MET n 
1 142 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PHIS8-3 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BIRC5_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          O15392 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1F3H A 1 ? 142 ? O15392 1 ? 142 ? 1 142 
2 1 1F3H B 1 ? 142 ? O15392 1 ? 142 ? 1 142 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1F3H MET A 54 ? UNP O15392 LEU 54 ENGINEERED 54 1 
2 1F3H MET B 54 ? UNP O15392 LEU 54 ENGINEERED 54 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1F3H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.90 
_exptl_crystal.density_percent_sol   68.47 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'PEG 8000, LITHIUMSULPHATE, HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 ?   ? 1 
3 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 4' 2000-02-14 ? 
2 ?   ?                ?          ? 
3 ?   ?                ?          ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 1 M ? 'SINGLE WAVELENGTH' x-ray 
3 1 M ? 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.2830 1.0 
2 1.2826 1.0 
3 1.1271 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'SSRL BEAMLINE BL9-2' SSRL BL9-2 1.2830 ? 
2 SYNCHROTRON 'SSRL BEAMLINE BL9-2' SSRL BL9-2 1.2826 ? 
3 SYNCHROTRON 'SSRL BEAMLINE BL9-2' SSRL BL9-2 1.1271 ? 
# 
_reflns.entry_id                     1F3H 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             54.12 
_reflns.d_resolution_high            2.58 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        60.5 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1,2,3 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.58 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   95.5 
_reflns_shell.Rmerge_I_obs           0.388 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1F3H 
_refine.ls_number_reflns_obs                     15494 
_refine.ls_number_reflns_all                     29469 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          .0 
_refine.pdbx_data_cutoff_high_absF               1711716.61 
_refine.pdbx_data_cutoff_low_absF                .00 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             54.12 
_refine.ls_d_res_high                            2.58 
_refine.ls_percent_reflns_obs                    96.7 
_refine.ls_R_factor_obs                          0.228 
_refine.ls_R_factor_all                          0.228 
_refine.ls_R_factor_R_work                       0.228 
_refine.ls_R_factor_R_free                       0.287 
_refine.ls_R_factor_R_free_error                 .010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  774 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               83.8 
_refine.aniso_B[1][1]                            -3.14 
_refine.aniso_B[2][2]                            -16.88 
_refine.aniso_B[3][3]                            20.03 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            14.19 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 .3262 
_refine.solvent_model_param_bsol                 65.36 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1F3H 
_refine_analyze.Luzzati_coordinate_error_obs    .41 
_refine_analyze.Luzzati_sigma_a_obs             .54 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   .55 
_refine_analyze.Luzzati_sigma_a_free            .65 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2213 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             90 
_refine_hist.number_atoms_total               2320 
_refine_hist.d_res_high                       2.58 
_refine_hist.d_res_low                        54.12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                .025  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             2.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.65  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             17.66 1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            19.33 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             20.98 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            24.47 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.58 
_refine_ls_shell.d_res_low                        2.74 
_refine_ls_shell.number_reflns_R_work             2324 
_refine_ls_shell.R_factor_R_work                  0.406 
_refine_ls_shell.percent_reflns_obs               92.6 
_refine_ls_shell.R_factor_R_free                  0.448 
_refine_ls_shell.R_factor_R_free_error            .042 
_refine_ls_shell.percent_reflns_R_free            4.7 
_refine_ls_shell.number_reflns_R_free             115 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP   'X-RAY DIFFRACTION' 
2 ION.PARAM         ION.TOP       'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER_REP.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1F3H 
_struct.title                     'X-RAY CRYSTAL STRUCTURE OF THE HUMAN ANTI-APOPTOTIC PROTEIN SURVIVIN' 
_struct.pdbx_descriptor           'APOPTOSIS INHIBITOR SURVIVIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F3H 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'APOPTOSIS INHIBITOR SURVIVIN, THIOL PROTEASE INHIBITOR, ALPHA-BETA, APOPTOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 7  ? PHE A 13  ? PRO A 7  PHE A 13  5 ? 7  
HELX_P HELX_P2  2  LEU A 14 ? SER A 20  ? LEU A 14 SER A 20  1 ? 7  
HELX_P HELX_P3  3  THR A 34 ? GLU A 40  ? THR A 34 GLU A 40  1 ? 7  
HELX_P HELX_P4  4  ASP A 72 ? SER A 81  ? ASP A 72 SER A 81  1 ? 10 
HELX_P HELX_P5  5  ALA A 85 ? VAL A 89  ? ALA A 85 VAL A 89  5 ? 5  
HELX_P HELX_P6  6  GLN A 92 ? LEU A 96  ? GLN A 92 LEU A 96  5 ? 5  
HELX_P HELX_P7  7  THR A 97 ? GLN A 137 ? THR A 97 GLN A 137 1 ? 41 
HELX_P HELX_P8  8  TRP B 10 ? PHE B 13  ? TRP B 10 PHE B 13  5 ? 4  
HELX_P HELX_P9  9  LEU B 14 ? THR B 21  ? LEU B 14 THR B 21  1 ? 8  
HELX_P HELX_P10 10 ASP B 72 ? LYS B 79  ? ASP B 72 LYS B 79  1 ? 8  
HELX_P HELX_P11 11 CYS B 84 ? VAL B 89  ? CYS B 84 VAL B 89  1 ? 6  
HELX_P HELX_P12 12 GLN B 92 ? LEU B 96  ? GLN B 92 LEU B 96  5 ? 5  
HELX_P HELX_P13 13 THR B 97 ? GLN B 137 ? THR B 97 GLN B 137 1 ? 41 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 57 SG ? ? ? 1_555 A CYS 60 SG  ? ? A CYS 57  A CYS 60 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf2 disulf ? ? B CYS 57 SG ? ? ? 1_555 B CYS 60 SG  ? ? B CYS 57  B CYS 60 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc1 metalc ? ? C ZN  .  ZN ? ? ? 1_555 A CYS 60 SG  ? ? A ZN  341 A CYS 60 1_555 ? ? ? ? ? ? ? 1.448 ? 
metalc2 metalc ? ? C ZN  .  ZN ? ? ? 1_555 A CYS 84 SG  ? ? A ZN  341 A CYS 84 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc3 metalc ? ? C ZN  .  ZN ? ? ? 1_555 A HIS 77 NE2 ? ? A ZN  341 A HIS 77 1_555 ? ? ? ? ? ? ? 1.887 ? 
metalc4 metalc ? ? C ZN  .  ZN ? ? ? 1_555 A CYS 57 SG  ? ? A ZN  341 A CYS 57 1_555 ? ? ? ? ? ? ? 1.885 ? 
metalc5 metalc ? ? F ZN  .  ZN ? ? ? 1_555 B CYS 60 SG  ? ? B ZN  342 B CYS 60 1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc6 metalc ? ? F ZN  .  ZN ? ? ? 1_555 B HIS 77 NE2 ? ? B ZN  342 B HIS 77 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc7 metalc ? ? F ZN  .  ZN ? ? ? 1_555 B CYS 84 SG  ? ? B ZN  342 B CYS 84 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc8 metalc ? ? F ZN  .  ZN ? ? ? 1_555 B CYS 57 SG  ? ? B ZN  342 B CYS 57 1_555 ? ? ? ? ? ? ? 2.051 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 1 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 43 ? HIS A 45 ? PHE A 43 HIS A 45 
A 2 ALA A 55 ? CYS A 57 ? ALA A 55 CYS A 57 
A 3 GLU A 63 ? LEU A 64 ? GLU A 63 LEU A 64 
B 1 PHE B 43 ? HIS B 45 ? PHE B 43 HIS B 45 
B 2 ALA B 55 ? CYS B 57 ? ALA B 55 CYS B 57 
B 3 GLU B 63 ? LEU B 64 ? GLU B 63 LEU B 64 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 44 ? O ILE A 44 N GLN A 56 ? N GLN A 56 
A 2 3 N ALA A 55 ? N ALA A 55 O LEU A 64 ? O LEU A 64 
B 1 2 N ILE B 44 ? N ILE B 44 O GLN B 56 ? O GLN B 56 
B 2 3 N ALA B 55 ? N ALA B 55 O LEU B 64 ? O LEU B 64 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 341'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 342'  
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 500' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 501' 
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 B 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 57  ? CYS A 57   . ? 1_555 ? 
2  AC1 4 CYS A 60  ? CYS A 60   . ? 1_555 ? 
3  AC1 4 HIS A 77  ? HIS A 77   . ? 1_555 ? 
4  AC1 4 CYS A 84  ? CYS A 84   . ? 1_555 ? 
5  AC2 4 CYS B 57  ? CYS B 57   . ? 1_555 ? 
6  AC2 4 CYS B 60  ? CYS B 60   . ? 1_555 ? 
7  AC2 4 HIS B 77  ? HIS B 77   . ? 1_555 ? 
8  AC2 4 CYS B 84  ? CYS B 84   . ? 1_555 ? 
9  AC3 3 LYS A 103 ? LYS A 103  . ? 1_555 ? 
10 AC3 3 ARG A 106 ? ARG A 106  . ? 1_555 ? 
11 AC3 3 HOH H .   ? HOH A 1089 . ? 1_555 ? 
12 AC4 3 LYS A 62  ? LYS A 62   . ? 1_555 ? 
13 AC4 3 GLU A 63  ? GLU A 63   . ? 1_555 ? 
14 AC4 3 LYS A 115 ? LYS A 115  . ? 1_555 ? 
15 AC5 2 LYS B 103 ? LYS B 103  . ? 1_555 ? 
16 AC5 2 ARG B 106 ? ARG B 106  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1F3H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       .000000 
_database_PDB_matrix.origx[1][3]       .000000 
_database_PDB_matrix.origx[2][1]       .000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       .000000 
_database_PDB_matrix.origx[3][1]       .000000 
_database_PDB_matrix.origx[3][2]       .000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   .00000 
_database_PDB_matrix.origx_vector[2]   .00000 
_database_PDB_matrix.origx_vector[3]   .00000 
# 
_atom_sites.entry_id                    1F3H 
_atom_sites.fract_transf_matrix[1][1]   .008769 
_atom_sites.fract_transf_matrix[1][2]   .000000 
_atom_sites.fract_transf_matrix[1][3]   .008284 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .013996 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .015879 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 5   ? 46.120 -2.435  20.508  1.00 97.66  ? 5    THR A N   1 
ATOM   2    C  CA  . THR A 1 5   ? 45.755 -2.600  19.109  1.00 128.60 ? 5    THR A CA  1 
ATOM   3    C  C   . THR A 1 5   ? 44.906 -3.893  18.901  1.00 135.36 ? 5    THR A C   1 
ATOM   4    O  O   . THR A 1 5   ? 45.129 -4.897  19.596  1.00 135.76 ? 5    THR A O   1 
ATOM   5    C  CB  . THR A 1 5   ? 47.044 -2.660  18.162  1.00 169.76 ? 5    THR A CB  1 
ATOM   6    O  OG1 . THR A 1 5   ? 47.813 -1.357  18.103  1.00 96.29  ? 5    THR A OG1 1 
ATOM   7    C  CG2 . THR A 1 5   ? 46.544 -2.728  16.762  1.00 96.29  ? 5    THR A CG2 1 
ATOM   8    N  N   . LEU A 1 6   ? 43.951 -3.844  17.951  1.00 137.52 ? 6    LEU A N   1 
ATOM   9    C  CA  . LEU A 1 6   ? 43.072 -4.985  17.611  1.00 122.74 ? 6    LEU A CA  1 
ATOM   10   C  C   . LEU A 1 6   ? 43.356 -5.470  16.198  1.00 124.46 ? 6    LEU A C   1 
ATOM   11   O  O   . LEU A 1 6   ? 43.928 -4.731  15.368  1.00 118.60 ? 6    LEU A O   1 
ATOM   12   C  CB  . LEU A 1 6   ? 41.600 -4.611  17.701  1.00 94.16  ? 6    LEU A CB  1 
ATOM   13   C  CG  . LEU A 1 6   ? 41.143 -4.363  19.128  1.00 114.02 ? 6    LEU A CG  1 
ATOM   14   C  CD1 . LEU A 1 6   ? 41.829 -3.113  19.778  1.00 100.92 ? 6    LEU A CD1 1 
ATOM   15   C  CD2 . LEU A 1 6   ? 39.660 -4.188  19.039  1.00 121.25 ? 6    LEU A CD2 1 
ATOM   16   N  N   . PRO A 1 7   ? 42.933 -6.716  15.893  1.00 107.28 ? 7    PRO A N   1 
ATOM   17   C  CA  . PRO A 1 7   ? 43.181 -7.255  14.557  1.00 114.28 ? 7    PRO A CA  1 
ATOM   18   C  C   . PRO A 1 7   ? 42.590 -6.308  13.527  1.00 117.26 ? 7    PRO A C   1 
ATOM   19   O  O   . PRO A 1 7   ? 41.404 -5.993  13.550  1.00 131.06 ? 7    PRO A O   1 
ATOM   20   C  CB  . PRO A 1 7   ? 42.479 -8.621  14.575  1.00 112.46 ? 7    PRO A CB  1 
ATOM   21   C  CG  . PRO A 1 7   ? 42.169 -8.872  16.067  1.00 82.15  ? 7    PRO A CG  1 
ATOM   22   C  CD  . PRO A 1 7   ? 41.911 -7.510  16.602  1.00 72.47  ? 7    PRO A CD  1 
ATOM   23   N  N   . PRO A 1 8   ? 43.407 -5.822  12.618  1.00 109.79 ? 8    PRO A N   1 
ATOM   24   C  CA  . PRO A 1 8   ? 43.035 -4.894  11.547  1.00 112.18 ? 8    PRO A CA  1 
ATOM   25   C  C   . PRO A 1 8   ? 41.608 -4.971  10.992  1.00 108.21 ? 8    PRO A C   1 
ATOM   26   O  O   . PRO A 1 8   ? 40.907 -3.963  10.940  1.00 104.07 ? 8    PRO A O   1 
ATOM   27   C  CB  . PRO A 1 8   ? 44.078 -5.171  10.488  1.00 121.35 ? 8    PRO A CB  1 
ATOM   28   C  CG  . PRO A 1 8   ? 45.335 -5.335  11.366  1.00 113.10 ? 8    PRO A CG  1 
ATOM   29   C  CD  . PRO A 1 8   ? 44.832 -6.206  12.532  1.00 109.39 ? 8    PRO A CD  1 
ATOM   30   N  N   . ALA A 1 9   ? 41.188 -6.163  10.585  1.00 105.13 ? 9    ALA A N   1 
ATOM   31   C  CA  . ALA A 1 9   ? 39.868 -6.367  10.009  1.00 83.03  ? 9    ALA A CA  1 
ATOM   32   C  C   . ALA A 1 9   ? 38.732 -6.155  10.981  1.00 93.45  ? 9    ALA A C   1 
ATOM   33   O  O   . ALA A 1 9   ? 37.584 -6.412  10.635  1.00 101.28 ? 9    ALA A O   1 
ATOM   34   C  CB  . ALA A 1 9   ? 39.779 -7.757  9.393   1.00 83.43  ? 9    ALA A CB  1 
ATOM   35   N  N   . TRP A 1 10  ? 39.047 -5.709  12.192  1.00 90.52  ? 10   TRP A N   1 
ATOM   36   C  CA  . TRP A 1 10  ? 38.027 -5.420  13.208  1.00 77.88  ? 10   TRP A CA  1 
ATOM   37   C  C   . TRP A 1 10  ? 37.932 -3.924  13.609  1.00 97.19  ? 10   TRP A C   1 
ATOM   38   O  O   . TRP A 1 10  ? 36.933 -3.485  14.230  1.00 61.67  ? 10   TRP A O   1 
ATOM   39   C  CB  . TRP A 1 10  ? 38.304 -6.210  14.440  1.00 95.00  ? 10   TRP A CB  1 
ATOM   40   C  CG  . TRP A 1 10  ? 38.067 -7.658  14.270  1.00 135.06 ? 10   TRP A CG  1 
ATOM   41   C  CD1 . TRP A 1 10  ? 37.907 -8.367  13.094  1.00 132.74 ? 10   TRP A CD1 1 
ATOM   42   C  CD2 . TRP A 1 10  ? 38.058 -8.614  15.324  1.00 148.77 ? 10   TRP A CD2 1 
ATOM   43   N  NE1 . TRP A 1 10  ? 37.809 -9.706  13.369  1.00 124.82 ? 10   TRP A NE1 1 
ATOM   44   C  CE2 . TRP A 1 10  ? 37.902 -9.888  14.727  1.00 145.32 ? 10   TRP A CE2 1 
ATOM   45   C  CE3 . TRP A 1 10  ? 38.182 -8.517  16.727  1.00 142.16 ? 10   TRP A CE3 1 
ATOM   46   C  CZ2 . TRP A 1 10  ? 37.862 -11.062 15.496  1.00 136.92 ? 10   TRP A CZ2 1 
ATOM   47   C  CZ3 . TRP A 1 10  ? 38.145 -9.673  17.481  1.00 132.92 ? 10   TRP A CZ3 1 
ATOM   48   C  CH2 . TRP A 1 10  ? 37.989 -10.932 16.864  1.00 147.49 ? 10   TRP A CH2 1 
ATOM   49   N  N   . GLN A 1 11  ? 38.979 -3.151  13.280  1.00 56.01  ? 11   GLN A N   1 
ATOM   50   C  CA  . GLN A 1 11  ? 39.038 -1.702  13.580  1.00 67.17  ? 11   GLN A CA  1 
ATOM   51   C  C   . GLN A 1 11  ? 37.792 -0.966  13.204  1.00 80.79  ? 11   GLN A C   1 
ATOM   52   O  O   . GLN A 1 11  ? 37.288 -0.251  14.042  1.00 57.65  ? 11   GLN A O   1 
ATOM   53   C  CB  . GLN A 1 11  ? 40.225 -1.090  12.913  1.00 60.28  ? 11   GLN A CB  1 
ATOM   54   C  CG  . GLN A 1 11  ? 41.453 -2.029  13.117  1.00 59.09  ? 11   GLN A CG  1 
ATOM   55   C  CD  . GLN A 1 11  ? 42.755 -1.335  12.862  1.00 92.74  ? 11   GLN A CD  1 
ATOM   56   O  OE1 . GLN A 1 11  ? 43.023 -0.289  13.474  1.00 107.00 ? 11   GLN A OE1 1 
ATOM   57   N  NE2 . GLN A 1 11  ? 43.577 -1.886  11.954  1.00 108.26 ? 11   GLN A NE2 1 
ATOM   58   N  N   . PRO A 1 12  ? 37.280 -1.126  11.955  1.00 75.96  ? 12   PRO A N   1 
ATOM   59   C  CA  . PRO A 1 12  ? 36.073 -0.478  11.462  1.00 46.49  ? 12   PRO A CA  1 
ATOM   60   C  C   . PRO A 1 12  ? 35.016 -0.500  12.532  1.00 48.30  ? 12   PRO A C   1 
ATOM   61   O  O   . PRO A 1 12  ? 34.057 0.381   12.633  1.00 62.56  ? 12   PRO A O   1 
ATOM   62   C  CB  . PRO A 1 12  ? 35.715 -1.317  10.242  1.00 86.90  ? 12   PRO A CB  1 
ATOM   63   C  CG  . PRO A 1 12  ? 36.834 -2.409  10.210  1.00 74.31  ? 12   PRO A CG  1 
ATOM   64   C  CD  . PRO A 1 12  ? 37.959 -1.783  10.839  1.00 70.26  ? 12   PRO A CD  1 
ATOM   65   N  N   . PHE A 1 13  ? 35.189 -1.493  13.386  1.00 58.72  ? 13   PHE A N   1 
ATOM   66   C  CA  . PHE A 1 13  ? 34.207 -1.697  14.443  1.00 60.30  ? 13   PHE A CA  1 
ATOM   67   C  C   . PHE A 1 13  ? 34.359 -0.631  15.511  1.00 67.94  ? 13   PHE A C   1 
ATOM   68   O  O   . PHE A 1 13  ? 33.495 -0.364  16.334  1.00 34.08  ? 13   PHE A O   1 
ATOM   69   C  CB  . PHE A 1 13  ? 34.503 -3.056  15.031  1.00 45.96  ? 13   PHE A CB  1 
ATOM   70   C  CG  . PHE A 1 13  ? 33.559 -4.076  14.618  1.00 46.22  ? 13   PHE A CG  1 
ATOM   71   C  CD1 . PHE A 1 13  ? 33.887 -5.061  13.646  1.00 38.31  ? 13   PHE A CD1 1 
ATOM   72   C  CD2 . PHE A 1 13  ? 32.299 -3.956  15.067  1.00 36.15  ? 13   PHE A CD2 1 
ATOM   73   C  CE1 . PHE A 1 13  ? 32.828 -5.933  13.092  1.00 51.59  ? 13   PHE A CE1 1 
ATOM   74   C  CE2 . PHE A 1 13  ? 31.308 -4.769  14.550  1.00 49.64  ? 13   PHE A CE2 1 
ATOM   75   C  CZ  . PHE A 1 13  ? 31.569 -5.761  13.551  1.00 51.47  ? 13   PHE A CZ  1 
ATOM   76   N  N   . LEU A 1 14  ? 35.539 -0.073  15.529  1.00 25.96  ? 14   LEU A N   1 
ATOM   77   C  CA  . LEU A 1 14  ? 36.034 0.948   16.480  1.00 70.16  ? 14   LEU A CA  1 
ATOM   78   C  C   . LEU A 1 14  ? 35.872 2.378   15.962  1.00 66.76  ? 14   LEU A C   1 
ATOM   79   O  O   . LEU A 1 14  ? 36.663 2.820   15.051  1.00 49.36  ? 14   LEU A O   1 
ATOM   80   C  CB  . LEU A 1 14  ? 37.545 0.742   16.628  1.00 63.17  ? 14   LEU A CB  1 
ATOM   81   C  CG  . LEU A 1 14  ? 38.052 -0.449  17.418  1.00 76.54  ? 14   LEU A CG  1 
ATOM   82   C  CD1 . LEU A 1 14  ? 39.611 -0.410  17.475  1.00 64.29  ? 14   LEU A CD1 1 
ATOM   83   C  CD2 . LEU A 1 14  ? 37.401 -0.335  18.835  1.00 67.06  ? 14   LEU A CD2 1 
ATOM   84   N  N   . LYS A 1 15  ? 34.914 3.120   16.509  1.00 44.10  ? 15   LYS A N   1 
ATOM   85   C  CA  . LYS A 1 15  ? 34.755 4.540   16.102  1.00 76.30  ? 15   LYS A CA  1 
ATOM   86   C  C   . LYS A 1 15  ? 35.958 5.419   15.832  1.00 65.43  ? 15   LYS A C   1 
ATOM   87   O  O   . LYS A 1 15  ? 35.998 6.092   14.813  1.00 98.59  ? 15   LYS A O   1 
ATOM   88   C  CB  . LYS A 1 15  ? 33.912 5.262   17.122  1.00 41.74  ? 15   LYS A CB  1 
ATOM   89   C  CG  . LYS A 1 15  ? 33.785 6.797   17.022  1.00 70.13  ? 15   LYS A CG  1 
ATOM   90   C  CD  . LYS A 1 15  ? 32.387 7.177   17.525  1.00 70.89  ? 15   LYS A CD  1 
ATOM   91   C  CE  . LYS A 1 15  ? 32.208 8.696   17.736  1.00 92.35  ? 15   LYS A CE  1 
ATOM   92   N  NZ  . LYS A 1 15  ? 30.814 9.190   18.303  1.00 69.70  ? 15   LYS A NZ  1 
ATOM   93   N  N   . ASP A 1 16  ? 36.939 5.403   16.716  1.00 68.18  ? 16   ASP A N   1 
ATOM   94   C  CA  . ASP A 1 16  ? 38.038 6.307   16.534  1.00 81.82  ? 16   ASP A CA  1 
ATOM   95   C  C   . ASP A 1 16  ? 38.778 5.927   15.308  1.00 53.75  ? 16   ASP A C   1 
ATOM   96   O  O   . ASP A 1 16  ? 39.611 6.693   14.765  1.00 86.07  ? 16   ASP A O   1 
ATOM   97   C  CB  . ASP A 1 16  ? 38.891 6.434   17.860  1.00 52.81  ? 16   ASP A CB  1 
ATOM   98   C  CG  . ASP A 1 16  ? 38.084 7.180   18.972  1.00 96.10  ? 16   ASP A CG  1 
ATOM   99   O  OD1 . ASP A 1 16  ? 38.015 8.457   18.927  1.00 91.29  ? 16   ASP A OD1 1 
ATOM   100  O  OD2 . ASP A 1 16  ? 37.472 6.488   19.853  1.00 67.81  ? 16   ASP A OD2 1 
ATOM   101  N  N   . HIS A 1 17  ? 38.517 4.719   14.860  1.00 73.70  ? 17   HIS A N   1 
ATOM   102  C  CA  . HIS A 1 17  ? 39.152 4.212   13.652  1.00 65.88  ? 17   HIS A CA  1 
ATOM   103  C  C   . HIS A 1 17  ? 38.506 4.896   12.438  1.00 88.12  ? 17   HIS A C   1 
ATOM   104  O  O   . HIS A 1 17  ? 39.187 5.363   11.510  1.00 37.38  ? 17   HIS A O   1 
ATOM   105  C  CB  . HIS A 1 17  ? 38.883 2.740   13.456  1.00 43.74  ? 17   HIS A CB  1 
ATOM   106  C  CG  . HIS A 1 17  ? 39.474 2.241   12.194  1.00 47.93  ? 17   HIS A CG  1 
ATOM   107  N  ND1 . HIS A 1 17  ? 40.824 2.273   11.981  1.00 45.66  ? 17   HIS A ND1 1 
ATOM   108  C  CD2 . HIS A 1 17  ? 38.908 1.906   10.998  1.00 33.73  ? 17   HIS A CD2 1 
ATOM   109  C  CE1 . HIS A 1 17  ? 41.079 1.987   10.702  1.00 42.01  ? 17   HIS A CE1 1 
ATOM   110  N  NE2 . HIS A 1 17  ? 39.928 1.763   10.083  1.00 83.03  ? 17   HIS A NE2 1 
ATOM   111  N  N   . ARG A 1 18  ? 37.174 4.837   12.459  1.00 30.06  ? 18   ARG A N   1 
ATOM   112  C  CA  . ARG A 1 18  ? 36.346 5.414   11.473  1.00 68.55  ? 18   ARG A CA  1 
ATOM   113  C  C   . ARG A 1 18  ? 36.668 6.866   11.404  1.00 70.81  ? 18   ARG A C   1 
ATOM   114  O  O   . ARG A 1 18  ? 37.110 7.334   10.352  1.00 73.03  ? 18   ARG A O   1 
ATOM   115  C  CB  . ARG A 1 18  ? 34.980 5.279   11.908  1.00 45.35  ? 18   ARG A CB  1 
ATOM   116  C  CG  . ARG A 1 18  ? 34.456 3.859   11.757  1.00 19.70  ? 18   ARG A CG  1 
ATOM   117  C  CD  . ARG A 1 18  ? 32.985 3.946   12.308  1.00 38.08  ? 18   ARG A CD  1 
ATOM   118  N  NE  . ARG A 1 18  ? 32.674 2.726   12.921  1.00 47.08  ? 18   ARG A NE  1 
ATOM   119  C  CZ  . ARG A 1 18  ? 31.953 2.625   14.024  1.00 69.89  ? 18   ARG A CZ  1 
ATOM   120  N  NH1 . ARG A 1 18  ? 31.489 3.716   14.623  1.00 50.04  ? 18   ARG A NH1 1 
ATOM   121  N  NH2 . ARG A 1 18  ? 31.680 1.421   14.510  1.00 97.70  ? 18   ARG A NH2 1 
ATOM   122  N  N   . ILE A 1 19  ? 36.385 7.606   12.479  1.00 66.17  ? 19   ILE A N   1 
ATOM   123  C  CA  . ILE A 1 19  ? 36.784 9.004   12.514  1.00 46.11  ? 19   ILE A CA  1 
ATOM   124  C  C   . ILE A 1 19  ? 38.093 9.274   11.711  1.00 55.68  ? 19   ILE A C   1 
ATOM   125  O  O   . ILE A 1 19  ? 38.122 10.106  10.783  1.00 62.94  ? 19   ILE A O   1 
ATOM   126  C  CB  . ILE A 1 19  ? 36.934 9.477   13.914  1.00 62.92  ? 19   ILE A CB  1 
ATOM   127  C  CG1 . ILE A 1 19  ? 35.544 9.767   14.454  1.00 62.75  ? 19   ILE A CG1 1 
ATOM   128  C  CG2 . ILE A 1 19  ? 37.760 10.762  13.964  1.00 53.34  ? 19   ILE A CG2 1 
ATOM   129  C  CD1 . ILE A 1 19  ? 35.494 9.919   15.850  1.00 83.45  ? 19   ILE A CD1 1 
ATOM   130  N  N   . SER A 1 20  ? 39.107 8.457   11.976  1.00 50.75  ? 20   SER A N   1 
ATOM   131  C  CA  . SER A 1 20  ? 40.430 8.586   11.389  1.00 57.24  ? 20   SER A CA  1 
ATOM   132  C  C   . SER A 1 20  ? 40.503 8.445   9.883   1.00 73.12  ? 20   SER A C   1 
ATOM   133  O  O   . SER A 1 20  ? 41.528 8.831   9.316   1.00 62.11  ? 20   SER A O   1 
ATOM   134  C  CB  . SER A 1 20  ? 41.422 7.580   12.105  1.00 70.98  ? 20   SER A CB  1 
ATOM   135  O  OG  . SER A 1 20  ? 41.540 6.277   11.480  1.00 58.70  ? 20   SER A OG  1 
ATOM   136  N  N   . THR A 1 21  ? 39.484 7.859   9.235   1.00 49.19  ? 21   THR A N   1 
ATOM   137  C  CA  . THR A 1 21  ? 39.498 7.687   7.778   1.00 83.48  ? 21   THR A CA  1 
ATOM   138  C  C   . THR A 1 21  ? 39.150 9.004   7.106   1.00 97.91  ? 21   THR A C   1 
ATOM   139  O  O   . THR A 1 21  ? 39.716 9.271   6.042   1.00 63.05  ? 21   THR A O   1 
ATOM   140  C  CB  . THR A 1 21  ? 38.515 6.611   7.286   1.00 61.30  ? 21   THR A CB  1 
ATOM   141  O  OG1 . THR A 1 21  ? 37.214 6.807   7.863   1.00 57.47  ? 21   THR A OG1 1 
ATOM   142  C  CG2 . THR A 1 21  ? 39.021 5.296   7.668   1.00 71.72  ? 21   THR A CG2 1 
ATOM   143  N  N   . PHE A 1 22  ? 38.230 9.795   7.708   1.00 62.67  ? 22   PHE A N   1 
ATOM   144  C  CA  . PHE A 1 22  ? 37.903 11.123  7.175   1.00 58.82  ? 22   PHE A CA  1 
ATOM   145  C  C   . PHE A 1 22  ? 39.122 12.051  7.179   1.00 72.41  ? 22   PHE A C   1 
ATOM   146  O  O   . PHE A 1 22  ? 39.557 12.553  8.212   1.00 88.07  ? 22   PHE A O   1 
ATOM   147  C  CB  . PHE A 1 22  ? 36.730 11.778  7.935   1.00 40.97  ? 22   PHE A CB  1 
ATOM   148  C  CG  . PHE A 1 22  ? 35.503 10.906  7.929   1.00 75.54  ? 22   PHE A CG  1 
ATOM   149  C  CD1 . PHE A 1 22  ? 35.559 9.608   8.476   1.00 52.62  ? 22   PHE A CD1 1 
ATOM   150  C  CD2 . PHE A 1 22  ? 34.312 11.355  7.369   1.00 72.93  ? 22   PHE A CD2 1 
ATOM   151  C  CE1 . PHE A 1 22  ? 34.423 8.785   8.473   1.00 83.31  ? 22   PHE A CE1 1 
ATOM   152  C  CE2 . PHE A 1 22  ? 33.160 10.546  7.355   1.00 89.30  ? 22   PHE A CE2 1 
ATOM   153  C  CZ  . PHE A 1 22  ? 33.210 9.255   7.913   1.00 62.42  ? 22   PHE A CZ  1 
ATOM   154  N  N   . LYS A 1 23  ? 39.700 12.216  6.002   1.00 98.68  ? 23   LYS A N   1 
ATOM   155  C  CA  . LYS A 1 23  ? 40.842 13.070  5.865   1.00 117.37 ? 23   LYS A CA  1 
ATOM   156  C  C   . LYS A 1 23  ? 40.446 13.868  4.672   1.00 113.53 ? 23   LYS A C   1 
ATOM   157  O  O   . LYS A 1 23  ? 40.060 13.344  3.632   1.00 102.24 ? 23   LYS A O   1 
ATOM   158  C  CB  . LYS A 1 23  ? 42.143 12.270  5.664   1.00 130.82 ? 23   LYS A CB  1 
ATOM   159  C  CG  . LYS A 1 23  ? 42.675 11.732  7.003   1.00 116.46 ? 23   LYS A CG  1 
ATOM   160  C  CD  . LYS A 1 23  ? 44.165 11.455  7.028   1.00 119.02 ? 23   LYS A CD  1 
ATOM   161  C  CE  . LYS A 1 23  ? 44.588 11.018  8.440   1.00 131.47 ? 23   LYS A CE  1 
ATOM   162  N  NZ  . LYS A 1 23  ? 46.058 11.024  8.656   1.00 134.02 ? 23   LYS A NZ  1 
ATOM   163  N  N   . ASN A 1 24  ? 40.468 15.167  4.886   1.00 115.58 ? 24   ASN A N   1 
ATOM   164  C  CA  . ASN A 1 24  ? 40.091 16.100  3.861   1.00 92.49  ? 24   ASN A CA  1 
ATOM   165  C  C   . ASN A 1 24  ? 38.610 16.044  3.706   1.00 78.34  ? 24   ASN A C   1 
ATOM   166  O  O   . ASN A 1 24  ? 38.083 16.359  2.663   1.00 97.05  ? 24   ASN A O   1 
ATOM   167  C  CB  . ASN A 1 24  ? 40.819 15.797  2.559   1.00 83.12  ? 24   ASN A CB  1 
ATOM   168  C  CG  . ASN A 1 24  ? 42.269 16.263  2.604   1.00 113.95 ? 24   ASN A CG  1 
ATOM   169  O  OD1 . ASN A 1 24  ? 43.096 15.853  1.794   1.00 122.81 ? 24   ASN A OD1 1 
ATOM   170  N  ND2 . ASN A 1 24  ? 42.581 17.132  3.568   1.00 125.73 ? 24   ASN A ND2 1 
ATOM   171  N  N   . TRP A 1 25  ? 37.928 15.607  4.749   1.00 70.05  ? 25   TRP A N   1 
ATOM   172  C  CA  . TRP A 1 25  ? 36.472 15.641  4.695   1.00 68.98  ? 25   TRP A CA  1 
ATOM   173  C  C   . TRP A 1 25  ? 36.221 17.172  4.806   1.00 78.92  ? 25   TRP A C   1 
ATOM   174  O  O   . TRP A 1 25  ? 36.993 17.907  5.429   1.00 73.07  ? 25   TRP A O   1 
ATOM   175  C  CB  . TRP A 1 25  ? 35.868 14.890  5.858   1.00 40.33  ? 25   TRP A CB  1 
ATOM   176  C  CG  . TRP A 1 25  ? 34.358 14.989  6.018   1.00 24.37  ? 25   TRP A CG  1 
ATOM   177  C  CD1 . TRP A 1 25  ? 33.596 15.685  7.000   1.00 45.01  ? 25   TRP A CD1 1 
ATOM   178  C  CD2 . TRP A 1 25  ? 33.417 14.255  5.209   1.00 41.47  ? 25   TRP A CD2 1 
ATOM   179  N  NE1 . TRP A 1 25  ? 32.188 15.392  6.807   1.00 42.36  ? 25   TRP A NE1 1 
ATOM   180  C  CE2 . TRP A 1 25  ? 32.105 14.547  5.690   1.00 44.20  ? 25   TRP A CE2 1 
ATOM   181  C  CE3 . TRP A 1 25  ? 33.571 13.418  4.108   1.00 42.33  ? 25   TRP A CE3 1 
ATOM   182  C  CZ2 . TRP A 1 25  ? 30.970 13.944  5.105   1.00 41.16  ? 25   TRP A CZ2 1 
ATOM   183  C  CZ3 . TRP A 1 25  ? 32.452 12.822  3.565   1.00 42.03  ? 25   TRP A CZ3 1 
ATOM   184  C  CH2 . TRP A 1 25  ? 31.173 13.105  4.045   1.00 45.32  ? 25   TRP A CH2 1 
ATOM   185  N  N   . PRO A 1 26  ? 35.165 17.668  4.166   1.00 79.29  ? 26   PRO A N   1 
ATOM   186  C  CA  . PRO A 1 26  ? 34.870 19.108  4.198   1.00 100.02 ? 26   PRO A CA  1 
ATOM   187  C  C   . PRO A 1 26  ? 33.859 19.627  5.217   1.00 104.04 ? 26   PRO A C   1 
ATOM   188  O  O   . PRO A 1 26  ? 33.984 20.766  5.676   1.00 100.88 ? 26   PRO A O   1 
ATOM   189  C  CB  . PRO A 1 26  ? 34.379 19.368  2.780   1.00 50.86  ? 26   PRO A CB  1 
ATOM   190  C  CG  . PRO A 1 26  ? 33.513 18.129  2.585   1.00 87.40  ? 26   PRO A CG  1 
ATOM   191  C  CD  . PRO A 1 26  ? 34.327 16.986  3.163   1.00 79.49  ? 26   PRO A CD  1 
ATOM   192  N  N   . PHE A 1 27  ? 32.854 18.805  5.542   1.00 73.17  ? 27   PHE A N   1 
ATOM   193  C  CA  . PHE A 1 27  ? 31.799 19.212  6.463   1.00 91.82  ? 27   PHE A CA  1 
ATOM   194  C  C   . PHE A 1 27  ? 32.300 19.069  7.867   1.00 90.34  ? 27   PHE A C   1 
ATOM   195  O  O   . PHE A 1 27  ? 32.304 17.979  8.446   1.00 97.85  ? 27   PHE A O   1 
ATOM   196  C  CB  . PHE A 1 27  ? 30.522 18.398  6.171   1.00 61.85  ? 27   PHE A CB  1 
ATOM   197  C  CG  . PHE A 1 27  ? 30.126 18.463  4.706   1.00 113.66 ? 27   PHE A CG  1 
ATOM   198  C  CD1 . PHE A 1 27  ? 30.585 17.520  3.801   1.00 99.55  ? 27   PHE A CD1 1 
ATOM   199  C  CD2 . PHE A 1 27  ? 29.442 19.569  4.206   1.00 103.81 ? 27   PHE A CD2 1 
ATOM   200  C  CE1 . PHE A 1 27  ? 30.384 17.685  2.438   1.00 113.50 ? 27   PHE A CE1 1 
ATOM   201  C  CE2 . PHE A 1 27  ? 29.242 19.730  2.846   1.00 94.53  ? 27   PHE A CE2 1 
ATOM   202  C  CZ  . PHE A 1 27  ? 29.717 18.789  1.958   1.00 92.04  ? 27   PHE A CZ  1 
ATOM   203  N  N   . LEU A 1 28  ? 32.765 20.198  8.391   1.00 80.19  ? 28   LEU A N   1 
ATOM   204  C  CA  . LEU A 1 28  ? 33.336 20.245  9.721   1.00 50.64  ? 28   LEU A CA  1 
ATOM   205  C  C   . LEU A 1 28  ? 32.599 20.974  10.822  1.00 39.40  ? 28   LEU A C   1 
ATOM   206  O  O   . LEU A 1 28  ? 31.341 20.803  10.974  1.00 58.29  ? 28   LEU A O   1 
ATOM   207  C  CB  . LEU A 1 28  ? 34.761 20.748  9.664   1.00 44.01  ? 28   LEU A CB  1 
ATOM   208  C  CG  . LEU A 1 28  ? 35.534 19.888  8.662   1.00 70.68  ? 28   LEU A CG  1 
ATOM   209  C  CD1 . LEU A 1 28  ? 36.917 20.452  8.410   1.00 50.73  ? 28   LEU A CD1 1 
ATOM   210  C  CD2 . LEU A 1 28  ? 35.590 18.442  9.204   1.00 72.65  ? 28   LEU A CD2 1 
ATOM   211  N  N   . GLU A 1 29  ? 33.357 21.762  11.608  1.00 68.40  ? 29   GLU A N   1 
ATOM   212  C  CA  . GLU A 1 29  ? 32.773 22.493  12.754  1.00 62.20  ? 29   GLU A CA  1 
ATOM   213  C  C   . GLU A 1 29  ? 31.526 23.283  12.341  1.00 50.45  ? 29   GLU A C   1 
ATOM   214  O  O   . GLU A 1 29  ? 31.518 24.109  11.370  1.00 80.23  ? 29   GLU A O   1 
ATOM   215  C  CB  . GLU A 1 29  ? 33.808 23.442  13.381  1.00 67.63  ? 29   GLU A CB  1 
ATOM   216  C  CG  . GLU A 1 29  ? 35.283 22.959  13.338  1.00 61.60  ? 29   GLU A CG  1 
ATOM   217  C  CD  . GLU A 1 29  ? 36.202 23.858  12.462  1.00 119.88 ? 29   GLU A CD  1 
ATOM   218  O  OE1 . GLU A 1 29  ? 36.420 25.035  12.854  1.00 133.36 ? 29   GLU A OE1 1 
ATOM   219  O  OE2 . GLU A 1 29  ? 36.700 23.412  11.392  1.00 105.50 ? 29   GLU A OE2 1 
ATOM   220  N  N   . GLY A 1 30  ? 30.452 23.008  13.047  1.00 57.15  ? 30   GLY A N   1 
ATOM   221  C  CA  . GLY A 1 30  ? 29.258 23.723  12.691  1.00 40.42  ? 30   GLY A CA  1 
ATOM   222  C  C   . GLY A 1 30  ? 28.365 22.828  11.848  1.00 69.28  ? 30   GLY A C   1 
ATOM   223  O  O   . GLY A 1 30  ? 27.164 22.856  12.046  1.00 48.78  ? 30   GLY A O   1 
ATOM   224  N  N   . CYS A 1 31  ? 28.911 22.027  10.932  1.00 70.86  ? 31   CYS A N   1 
ATOM   225  C  CA  . CYS A 1 31  ? 28.074 21.148  10.119  1.00 52.39  ? 31   CYS A CA  1 
ATOM   226  C  C   . CYS A 1 31  ? 27.500 19.968  10.972  1.00 73.20  ? 31   CYS A C   1 
ATOM   227  O  O   . CYS A 1 31  ? 28.107 19.554  11.928  1.00 79.90  ? 31   CYS A O   1 
ATOM   228  C  CB  . CYS A 1 31  ? 28.938 20.569  9.064   1.00 82.67  ? 31   CYS A CB  1 
ATOM   229  S  SG  . CYS A 1 31  ? 29.808 21.743  7.996   1.00 86.43  ? 31   CYS A SG  1 
ATOM   230  N  N   . ALA A 1 32  ? 26.349 19.429  10.581  1.00 69.88  ? 32   ALA A N   1 
ATOM   231  C  CA  . ALA A 1 32  ? 25.695 18.319  11.246  1.00 59.80  ? 32   ALA A CA  1 
ATOM   232  C  C   . ALA A 1 32  ? 26.318 16.974  10.863  1.00 68.53  ? 32   ALA A C   1 
ATOM   233  O  O   . ALA A 1 32  ? 26.104 15.980  11.576  1.00 60.11  ? 32   ALA A O   1 
ATOM   234  C  CB  . ALA A 1 32  ? 24.207 18.288  10.898  1.00 43.95  ? 32   ALA A CB  1 
ATOM   235  N  N   . CYS A 1 33  ? 27.088 16.945  9.770   1.00 73.90  ? 33   CYS A N   1 
ATOM   236  C  CA  . CYS A 1 33  ? 27.710 15.722  9.302   1.00 41.29  ? 33   CYS A CA  1 
ATOM   237  C  C   . CYS A 1 33  ? 29.246 15.724  9.281   1.00 54.22  ? 33   CYS A C   1 
ATOM   238  O  O   . CYS A 1 33  ? 29.979 15.421  8.213   1.00 52.30  ? 33   CYS A O   1 
ATOM   239  C  CB  . CYS A 1 33  ? 27.090 15.369  7.948   1.00 61.51  ? 33   CYS A CB  1 
ATOM   240  S  SG  . CYS A 1 33  ? 27.677 16.415  6.548   1.00 80.51  ? 33   CYS A SG  1 
ATOM   241  N  N   . THR A 1 34  ? 29.752 16.061  10.472  1.00 79.37  ? 34   THR A N   1 
ATOM   242  C  CA  . THR A 1 34  ? 31.204 16.117  10.810  1.00 55.02  ? 34   THR A CA  1 
ATOM   243  C  C   . THR A 1 34  ? 31.704 14.665  10.807  1.00 46.74  ? 34   THR A C   1 
ATOM   244  O  O   . THR A 1 34  ? 30.879 13.723  11.021  1.00 48.94  ? 34   THR A O   1 
ATOM   245  C  CB  . THR A 1 34  ? 31.343 16.601  12.252  1.00 62.56  ? 34   THR A CB  1 
ATOM   246  O  OG1 . THR A 1 34  ? 30.319 15.942  13.033  1.00 64.49  ? 34   THR A OG1 1 
ATOM   247  C  CG2 . THR A 1 34  ? 31.189 18.142  12.336  1.00 66.81  ? 34   THR A CG2 1 
ATOM   248  N  N   . PRO A 1 35  ? 33.030 14.448  10.594  1.00 33.77  ? 35   PRO A N   1 
ATOM   249  C  CA  . PRO A 1 35  ? 33.625 13.082  10.590  1.00 62.80  ? 35   PRO A CA  1 
ATOM   250  C  C   . PRO A 1 35  ? 33.095 12.265  11.788  1.00 74.82  ? 35   PRO A C   1 
ATOM   251  O  O   . PRO A 1 35  ? 32.635 11.128  11.670  1.00 83.60  ? 35   PRO A O   1 
ATOM   252  C  CB  . PRO A 1 35  ? 35.128 13.363  10.674  1.00 58.30  ? 35   PRO A CB  1 
ATOM   253  C  CG  . PRO A 1 35  ? 35.215 14.836  9.926   1.00 37.67  ? 35   PRO A CG  1 
ATOM   254  C  CD  . PRO A 1 35  ? 34.090 15.474  10.642  1.00 39.83  ? 35   PRO A CD  1 
ATOM   255  N  N   . GLU A 1 36  ? 33.098 12.934  12.923  1.00 60.39  ? 36   GLU A N   1 
ATOM   256  C  CA  . GLU A 1 36  ? 32.673 12.424  14.165  1.00 64.49  ? 36   GLU A CA  1 
ATOM   257  C  C   . GLU A 1 36  ? 31.278 11.926  14.137  1.00 48.37  ? 36   GLU A C   1 
ATOM   258  O  O   . GLU A 1 36  ? 30.938 10.872  14.706  1.00 67.80  ? 36   GLU A O   1 
ATOM   259  C  CB  . GLU A 1 36  ? 32.816 13.541  15.234  1.00 79.81  ? 36   GLU A CB  1 
ATOM   260  C  CG  . GLU A 1 36  ? 32.786 13.078  16.725  1.00 64.48  ? 36   GLU A CG  1 
ATOM   261  C  CD  . GLU A 1 36  ? 31.368 12.821  17.313  1.00 109.64 ? 36   GLU A CD  1 
ATOM   262  O  OE1 . GLU A 1 36  ? 30.455 13.642  17.053  1.00 113.23 ? 36   GLU A OE1 1 
ATOM   263  O  OE2 . GLU A 1 36  ? 31.171 11.822  18.058  1.00 103.47 ? 36   GLU A OE2 1 
ATOM   264  N  N   . ARG A 1 37  ? 30.407 12.724  13.558  1.00 67.24  ? 37   ARG A N   1 
ATOM   265  C  CA  . ARG A 1 37  ? 29.013 12.328  13.527  1.00 62.21  ? 37   ARG A CA  1 
ATOM   266  C  C   . ARG A 1 37  ? 28.730 11.258  12.495  1.00 74.31  ? 37   ARG A C   1 
ATOM   267  O  O   . ARG A 1 37  ? 27.756 10.538  12.621  1.00 44.18  ? 37   ARG A O   1 
ATOM   268  C  CB  . ARG A 1 37  ? 28.168 13.523  13.242  1.00 55.04  ? 37   ARG A CB  1 
ATOM   269  C  CG  . ARG A 1 37  ? 28.032 14.450  14.450  1.00 65.57  ? 37   ARG A CG  1 
ATOM   270  C  CD  . ARG A 1 37  ? 26.934 13.969  15.325  1.00 88.66  ? 37   ARG A CD  1 
ATOM   271  N  NE  . ARG A 1 37  ? 25.851 13.440  14.503  1.00 111.11 ? 37   ARG A NE  1 
ATOM   272  C  CZ  . ARG A 1 37  ? 24.582 13.385  14.924  1.00 148.16 ? 37   ARG A CZ  1 
ATOM   273  N  NH1 . ARG A 1 37  ? 24.305 13.870  16.149  1.00 110.96 ? 37   ARG A NH1 1 
ATOM   274  N  NH2 . ARG A 1 37  ? 23.605 12.774  14.196  1.00 67.32  ? 37   ARG A NH2 1 
ATOM   275  N  N   . MET A 1 38  ? 29.579 11.183  11.478  1.00 45.91  ? 38   MET A N   1 
ATOM   276  C  CA  . MET A 1 38  ? 29.503 10.253  10.403  1.00 57.85  ? 38   MET A CA  1 
ATOM   277  C  C   . MET A 1 38  ? 29.828 8.975   11.095  1.00 67.97  ? 38   MET A C   1 
ATOM   278  O  O   . MET A 1 38  ? 29.014 8.076   11.095  1.00 57.65  ? 38   MET A O   1 
ATOM   279  C  CB  . MET A 1 38  ? 30.584 10.578  9.348   1.00 63.53  ? 38   MET A CB  1 
ATOM   280  C  CG  . MET A 1 38  ? 30.164 11.703  8.323   1.00 101.19 ? 38   MET A CG  1 
ATOM   281  S  SD  . MET A 1 38  ? 29.251 11.184  6.754   1.00 66.47  ? 38   MET A SD  1 
ATOM   282  C  CE  . MET A 1 38  ? 27.693 10.987  7.303   1.00 32.35  ? 38   MET A CE  1 
ATOM   283  N  N   . ALA A 1 39  ? 30.995 8.944   11.729  1.00 64.47  ? 39   ALA A N   1 
ATOM   284  C  CA  . ALA A 1 39  ? 31.485 7.794   12.454  1.00 50.75  ? 39   ALA A CA  1 
ATOM   285  C  C   . ALA A 1 39  ? 30.483 7.118   13.458  1.00 54.07  ? 39   ALA A C   1 
ATOM   286  O  O   . ALA A 1 39  ? 30.240 5.883   13.388  1.00 69.48  ? 39   ALA A O   1 
ATOM   287  C  CB  . ALA A 1 39  ? 32.737 8.166   13.075  1.00 58.93  ? 39   ALA A CB  1 
ATOM   288  N  N   . GLU A 1 40  ? 29.802 7.903   14.300  1.00 51.95  ? 40   GLU A N   1 
ATOM   289  C  CA  . GLU A 1 40  ? 28.892 7.251   15.219  1.00 68.44  ? 40   GLU A CA  1 
ATOM   290  C  C   . GLU A 1 40  ? 27.782 6.615   14.416  1.00 70.86  ? 40   GLU A C   1 
ATOM   291  O  O   . GLU A 1 40  ? 26.966 5.847   14.934  1.00 80.36  ? 40   GLU A O   1 
ATOM   292  C  CB  . GLU A 1 40  ? 28.330 8.232   16.286  1.00 54.59  ? 40   GLU A CB  1 
ATOM   293  C  CG  . GLU A 1 40  ? 27.871 9.605   15.729  1.00 121.82 ? 40   GLU A CG  1 
ATOM   294  C  CD  . GLU A 1 40  ? 27.203 10.543  16.771  1.00 148.84 ? 40   GLU A CD  1 
ATOM   295  O  OE1 . GLU A 1 40  ? 27.899 11.438  17.367  1.00 119.92 ? 40   GLU A OE1 1 
ATOM   296  O  OE2 . GLU A 1 40  ? 25.968 10.362  16.981  1.00 126.58 ? 40   GLU A OE2 1 
ATOM   297  N  N   . ALA A 1 41  ? 27.743 6.930   13.141  1.00 81.85  ? 41   ALA A N   1 
ATOM   298  C  CA  . ALA A 1 41  ? 26.659 6.423   12.348  1.00 76.17  ? 41   ALA A CA  1 
ATOM   299  C  C   . ALA A 1 41  ? 27.084 5.220   11.539  1.00 70.17  ? 41   ALA A C   1 
ATOM   300  O  O   . ALA A 1 41  ? 26.248 4.545   10.970  1.00 64.49  ? 41   ALA A O   1 
ATOM   301  C  CB  . ALA A 1 41  ? 26.138 7.508   11.488  1.00 82.28  ? 41   ALA A CB  1 
ATOM   302  N  N   . GLY A 1 42  ? 28.386 4.971   11.490  1.00 52.63  ? 42   GLY A N   1 
ATOM   303  C  CA  . GLY A 1 42  ? 28.819 3.794   10.822  1.00 52.90  ? 42   GLY A CA  1 
ATOM   304  C  C   . GLY A 1 42  ? 29.614 3.974   9.570   1.00 79.89  ? 42   GLY A C   1 
ATOM   305  O  O   . GLY A 1 42  ? 30.111 2.935   9.018   1.00 52.25  ? 42   GLY A O   1 
ATOM   306  N  N   . PHE A 1 43  ? 29.789 5.240   9.143   1.00 60.50  ? 43   PHE A N   1 
ATOM   307  C  CA  . PHE A 1 43  ? 30.520 5.462   7.911   1.00 55.25  ? 43   PHE A CA  1 
ATOM   308  C  C   . PHE A 1 43  ? 32.019 5.559   8.030   1.00 56.39  ? 43   PHE A C   1 
ATOM   309  O  O   . PHE A 1 43  ? 32.604 5.898   9.077   1.00 47.07  ? 43   PHE A O   1 
ATOM   310  C  CB  . PHE A 1 43  ? 29.978 6.699   7.121   1.00 59.52  ? 43   PHE A CB  1 
ATOM   311  C  CG  . PHE A 1 43  ? 28.490 6.710   6.943   1.00 56.99  ? 43   PHE A CG  1 
ATOM   312  C  CD1 . PHE A 1 43  ? 27.663 7.323   7.939   1.00 32.77  ? 43   PHE A CD1 1 
ATOM   313  C  CD2 . PHE A 1 43  ? 27.893 5.968   5.871   1.00 41.36  ? 43   PHE A CD2 1 
ATOM   314  C  CE1 . PHE A 1 43  ? 26.197 7.197   7.920   1.00 63.76  ? 43   PHE A CE1 1 
ATOM   315  C  CE2 . PHE A 1 43  ? 26.503 5.820   5.823   1.00 39.26  ? 43   PHE A CE2 1 
ATOM   316  C  CZ  . PHE A 1 43  ? 25.614 6.421   6.840   1.00 45.61  ? 43   PHE A CZ  1 
ATOM   317  N  N   . ILE A 1 44  ? 32.619 5.251   6.887   1.00 60.63  ? 44   ILE A N   1 
ATOM   318  C  CA  . ILE A 1 44  ? 34.035 5.262   6.658   1.00 65.91  ? 44   ILE A CA  1 
ATOM   319  C  C   . ILE A 1 44  ? 34.184 6.067   5.354   1.00 86.07  ? 44   ILE A C   1 
ATOM   320  O  O   . ILE A 1 44  ? 33.345 5.962   4.464   1.00 88.42  ? 44   ILE A O   1 
ATOM   321  C  CB  . ILE A 1 44  ? 34.562 3.825   6.467   1.00 72.86  ? 44   ILE A CB  1 
ATOM   322  C  CG1 . ILE A 1 44  ? 34.599 3.137   7.818   1.00 84.77  ? 44   ILE A CG1 1 
ATOM   323  C  CG2 . ILE A 1 44  ? 35.972 3.842   5.927   1.00 69.03  ? 44   ILE A CG2 1 
ATOM   324  C  CD1 . ILE A 1 44  ? 35.612 3.763   8.821   1.00 78.08  ? 44   ILE A CD1 1 
ATOM   325  N  N   . HIS A 1 45  ? 35.226 6.885   5.266   1.00 60.84  ? 45   HIS A N   1 
ATOM   326  C  CA  . HIS A 1 45  ? 35.458 7.683   4.084   1.00 69.10  ? 45   HIS A CA  1 
ATOM   327  C  C   . HIS A 1 45  ? 36.094 6.891   2.913   1.00 65.58  ? 45   HIS A C   1 
ATOM   328  O  O   . HIS A 1 45  ? 37.165 6.295   3.071   1.00 84.14  ? 45   HIS A O   1 
ATOM   329  C  CB  . HIS A 1 45  ? 36.352 8.846   4.493   1.00 80.01  ? 45   HIS A CB  1 
ATOM   330  C  CG  . HIS A 1 45  ? 36.301 9.994   3.556   1.00 94.10  ? 45   HIS A CG  1 
ATOM   331  N  ND1 . HIS A 1 45  ? 37.405 10.769  3.279   1.00 92.30  ? 45   HIS A ND1 1 
ATOM   332  C  CD2 . HIS A 1 45  ? 35.258 10.585  2.925   1.00 71.19  ? 45   HIS A CD2 1 
ATOM   333  C  CE1 . HIS A 1 45  ? 37.048 11.791  2.540   1.00 90.20  ? 45   HIS A CE1 1 
ATOM   334  N  NE2 . HIS A 1 45  ? 35.745 11.705  2.318   1.00 89.44  ? 45   HIS A NE2 1 
ATOM   335  N  N   . CYS A 1 46  ? 35.450 6.881   1.745   1.00 74.54  ? 46   CYS A N   1 
ATOM   336  C  CA  . CYS A 1 46  ? 35.986 6.164   0.555   1.00 98.31  ? 46   CYS A CA  1 
ATOM   337  C  C   . CYS A 1 46  ? 36.025 7.133   -0.578  1.00 86.63  ? 46   CYS A C   1 
ATOM   338  O  O   . CYS A 1 46  ? 35.269 7.013   -1.521  1.00 78.16  ? 46   CYS A O   1 
ATOM   339  C  CB  . CYS A 1 46  ? 35.059 5.034   0.146   1.00 103.92 ? 46   CYS A CB  1 
ATOM   340  S  SG  . CYS A 1 46  ? 35.014 3.799   1.389   1.00 93.13  ? 46   CYS A SG  1 
ATOM   341  N  N   . PRO A 1 47  ? 36.921 8.103   -0.511  1.00 96.10  ? 47   PRO A N   1 
ATOM   342  C  CA  . PRO A 1 47  ? 36.981 9.092   -1.569  1.00 111.48 ? 47   PRO A CA  1 
ATOM   343  C  C   . PRO A 1 47  ? 37.549 8.652   -2.905  1.00 112.76 ? 47   PRO A C   1 
ATOM   344  O  O   . PRO A 1 47  ? 38.693 8.219   -2.998  1.00 116.24 ? 47   PRO A O   1 
ATOM   345  C  CB  . PRO A 1 47  ? 37.764 10.229  -0.905  1.00 92.79  ? 47   PRO A CB  1 
ATOM   346  C  CG  . PRO A 1 47  ? 38.767 9.482   -0.128  1.00 78.59  ? 47   PRO A CG  1 
ATOM   347  C  CD  . PRO A 1 47  ? 37.980 8.338   0.479   1.00 101.90 ? 47   PRO A CD  1 
ATOM   348  N  N   . THR A 1 48  ? 36.708 8.753   -3.933  1.00 122.61 ? 48   THR A N   1 
ATOM   349  C  CA  . THR A 1 48  ? 37.073 8.451   -5.322  1.00 114.86 ? 48   THR A CA  1 
ATOM   350  C  C   . THR A 1 48  ? 37.591 9.808   -5.832  1.00 122.56 ? 48   THR A C   1 
ATOM   351  O  O   . THR A 1 48  ? 37.316 10.848  -5.218  1.00 94.69  ? 48   THR A O   1 
ATOM   352  C  CB  . THR A 1 48  ? 35.834 8.133   -6.226  1.00 113.59 ? 48   THR A CB  1 
ATOM   353  O  OG1 . THR A 1 48  ? 35.076 7.046   -5.694  1.00 93.34  ? 48   THR A OG1 1 
ATOM   354  C  CG2 . THR A 1 48  ? 36.267 7.768   -7.618  1.00 105.31 ? 48   THR A CG2 1 
ATOM   355  N  N   . GLU A 1 49  ? 38.326 9.820   -6.945  1.00 156.48 ? 49   GLU A N   1 
ATOM   356  C  CA  . GLU A 1 49  ? 38.796 11.090  -7.494  1.00 148.73 ? 49   GLU A CA  1 
ATOM   357  C  C   . GLU A 1 49  ? 37.528 11.760  -8.002  1.00 149.65 ? 49   GLU A C   1 
ATOM   358  O  O   . GLU A 1 49  ? 37.394 12.986  -7.954  1.00 159.98 ? 49   GLU A O   1 
ATOM   359  C  CB  . GLU A 1 49  ? 39.786 10.875  -8.648  1.00 147.83 ? 49   GLU A CB  1 
ATOM   360  C  CG  . GLU A 1 49  ? 40.331 12.178  -9.205  1.00 151.72 ? 49   GLU A CG  1 
ATOM   361  C  CD  . GLU A 1 49  ? 40.642 13.190  -8.096  1.00 171.66 ? 49   GLU A CD  1 
ATOM   362  O  OE1 . GLU A 1 49  ? 41.602 12.958  -7.320  1.00 174.47 ? 49   GLU A OE1 1 
ATOM   363  O  OE2 . GLU A 1 49  ? 39.912 14.210  -7.995  1.00 167.76 ? 49   GLU A OE2 1 
ATOM   364  N  N   . ASN A 1 50  ? 36.586 10.921  -8.436  1.00 108.16 ? 50   ASN A N   1 
ATOM   365  C  CA  . ASN A 1 50  ? 35.305 11.363  -8.957  1.00 116.15 ? 50   ASN A CA  1 
ATOM   366  C  C   . ASN A 1 50  ? 34.181 11.251  -7.958  1.00 115.27 ? 50   ASN A C   1 
ATOM   367  O  O   . ASN A 1 50  ? 33.020 11.450  -8.313  1.00 126.21 ? 50   ASN A O   1 
ATOM   368  C  CB  . ASN A 1 50  ? 34.960 10.570  -10.223 1.00 154.22 ? 50   ASN A CB  1 
ATOM   369  C  CG  . ASN A 1 50  ? 35.747 11.055  -11.431 1.00 172.02 ? 50   ASN A CG  1 
ATOM   370  O  OD1 . ASN A 1 50  ? 36.988 11.152  -11.400 1.00 170.90 ? 50   ASN A OD1 1 
ATOM   371  N  ND2 . ASN A 1 50  ? 35.032 11.375  -12.498 1.00 158.65 ? 50   ASN A ND2 1 
ATOM   372  N  N   . GLU A 1 51  ? 34.538 10.963  -6.707  1.00 134.58 ? 51   GLU A N   1 
ATOM   373  C  CA  . GLU A 1 51  ? 33.583 10.804  -5.610  1.00 130.42 ? 51   GLU A CA  1 
ATOM   374  C  C   . GLU A 1 51  ? 34.268 11.108  -4.288  1.00 128.61 ? 51   GLU A C   1 
ATOM   375  O  O   . GLU A 1 51  ? 34.483 10.208  -3.468  1.00 148.18 ? 51   GLU A O   1 
ATOM   376  C  CB  . GLU A 1 51  ? 33.108 9.367   -5.624  1.00 134.51 ? 51   GLU A CB  1 
ATOM   377  C  CG  . GLU A 1 51  ? 32.078 9.130   -6.668  1.00 137.44 ? 51   GLU A CG  1 
ATOM   378  C  CD  . GLU A 1 51  ? 30.774 9.857   -6.315  1.00 150.89 ? 51   GLU A CD  1 
ATOM   379  O  OE1 . GLU A 1 51  ? 30.814 11.050  -5.883  1.00 140.08 ? 51   GLU A OE1 1 
ATOM   380  O  OE2 . GLU A 1 51  ? 29.704 9.225   -6.467  1.00 166.00 ? 51   GLU A OE2 1 
ATOM   381  N  N   . PRO A 1 52  ? 34.544 12.389  -4.014  1.00 95.85  ? 52   PRO A N   1 
ATOM   382  C  CA  . PRO A 1 52  ? 35.232 12.649  -2.760  1.00 98.12  ? 52   PRO A CA  1 
ATOM   383  C  C   . PRO A 1 52  ? 34.429 12.823  -1.465  1.00 68.67  ? 52   PRO A C   1 
ATOM   384  O  O   . PRO A 1 52  ? 34.979 13.203  -0.486  1.00 84.17  ? 52   PRO A O   1 
ATOM   385  C  CB  . PRO A 1 52  ? 36.104 13.872  -3.108  1.00 88.72  ? 52   PRO A CB  1 
ATOM   386  C  CG  . PRO A 1 52  ? 35.596 14.330  -4.519  1.00 90.99  ? 52   PRO A CG  1 
ATOM   387  C  CD  . PRO A 1 52  ? 34.249 13.642  -4.677  1.00 68.40  ? 52   PRO A CD  1 
ATOM   388  N  N   . ASP A 1 53  ? 33.128 12.595  -1.473  1.00 92.94  ? 53   ASP A N   1 
ATOM   389  C  CA  . ASP A 1 53  ? 32.301 12.705  -0.257  1.00 61.68  ? 53   ASP A CA  1 
ATOM   390  C  C   . ASP A 1 53  ? 31.684 11.261  -0.156  1.00 87.52  ? 53   ASP A C   1 
ATOM   391  O  O   . ASP A 1 53  ? 30.586 11.018  0.424   1.00 67.32  ? 53   ASP A O   1 
ATOM   392  C  CB  . ASP A 1 53  ? 31.171 13.747  -0.456  1.00 99.27  ? 53   ASP A CB  1 
ATOM   393  C  CG  . ASP A 1 53  ? 30.166 13.364  -1.616  1.00 128.56 ? 53   ASP A CG  1 
ATOM   394  O  OD1 . ASP A 1 53  ? 30.637 13.018  -2.759  1.00 116.57 ? 53   ASP A OD1 1 
ATOM   395  O  OD2 . ASP A 1 53  ? 28.910 13.425  -1.376  1.00 86.94  ? 53   ASP A OD2 1 
ATOM   396  N  N   . MET A 1 54  ? 32.394 10.309  -0.761  1.00 61.27  ? 54   MET A N   1 
ATOM   397  C  CA  . MET A 1 54  ? 31.945 8.928   -0.763  1.00 72.05  ? 54   MET A CA  1 
ATOM   398  C  C   . MET A 1 54  ? 32.113 8.251   0.595   1.00 93.29  ? 54   MET A C   1 
ATOM   399  O  O   . MET A 1 54  ? 33.273 8.118   1.083   1.00 66.92  ? 54   MET A O   1 
ATOM   400  C  CB  . MET A 1 54  ? 32.768 8.151   -1.795  1.00 97.98  ? 54   MET A CB  1 
ATOM   401  C  CG  . MET A 1 54  ? 32.211 6.766   -2.122  1.00 75.53  ? 54   MET A CG  1 
ATOM   402  S  SD  . MET A 1 54  ? 30.511 6.947   -2.821  1.00 90.43  ? 54   MET A SD  1 
ATOM   403  C  CE  . MET A 1 54  ? 29.560 6.986   -1.358  1.00 102.57 ? 54   MET A CE  1 
ATOM   404  N  N   . ALA A 1 55  ? 31.006 7.821   1.214   1.00 61.17  ? 55   ALA A N   1 
ATOM   405  C  CA  . ALA A 1 55  ? 31.180 7.138   2.481   1.00 77.44  ? 55   ALA A CA  1 
ATOM   406  C  C   . ALA A 1 55  ? 30.331 5.934   2.695   1.00 72.11  ? 55   ALA A C   1 
ATOM   407  O  O   . ALA A 1 55  ? 29.182 6.009   2.350   1.00 73.86  ? 55   ALA A O   1 
ATOM   408  C  CB  . ALA A 1 55  ? 30.944 8.087   3.592   1.00 83.38  ? 55   ALA A CB  1 
ATOM   409  N  N   . GLN A 1 56  ? 30.859 4.808   3.234   1.00 67.24  ? 56   GLN A N   1 
ATOM   410  C  CA  . GLN A 1 56  ? 29.949 3.666   3.540   1.00 77.64  ? 56   GLN A CA  1 
ATOM   411  C  C   . GLN A 1 56  ? 29.967 3.059   4.917   1.00 55.98  ? 56   GLN A C   1 
ATOM   412  O  O   . GLN A 1 56  ? 31.041 2.956   5.483   1.00 60.49  ? 56   GLN A O   1 
ATOM   413  C  CB  . GLN A 1 56  ? 30.136 2.460   2.612   1.00 49.77  ? 56   GLN A CB  1 
ATOM   414  C  CG  . GLN A 1 56  ? 31.634 2.251   2.174   1.00 43.23  ? 56   GLN A CG  1 
ATOM   415  C  CD  . GLN A 1 56  ? 31.894 0.862   1.601   1.00 39.22  ? 56   GLN A CD  1 
ATOM   416  O  OE1 . GLN A 1 56  ? 33.099 0.428   1.432   1.00 44.99  ? 56   GLN A OE1 1 
ATOM   417  N  NE2 . GLN A 1 56  ? 30.789 0.111   1.291   1.00 33.32  ? 56   GLN A NE2 1 
ATOM   418  N  N   . CYS A 1 57  ? 28.799 2.639   5.378   1.00 41.09  ? 57   CYS A N   1 
ATOM   419  C  CA  . CYS A 1 57  ? 28.505 1.865   6.549   1.00 54.01  ? 57   CYS A CA  1 
ATOM   420  C  C   . CYS A 1 57  ? 29.401 0.662   6.477   1.00 52.12  ? 57   CYS A C   1 
ATOM   421  O  O   . CYS A 1 57  ? 29.225 -0.121  5.526   1.00 73.61  ? 57   CYS A O   1 
ATOM   422  C  CB  . CYS A 1 57  ? 27.116 1.370   6.444   1.00 51.10  ? 57   CYS A CB  1 
ATOM   423  S  SG  . CYS A 1 57  ? 26.567 0.292   7.725   1.00 56.27  ? 57   CYS A SG  1 
ATOM   424  N  N   . PHE A 1 58  ? 30.404 0.582   7.383   1.00 80.51  ? 58   PHE A N   1 
ATOM   425  C  CA  . PHE A 1 58  ? 31.394 -0.542  7.547   1.00 62.46  ? 58   PHE A CA  1 
ATOM   426  C  C   . PHE A 1 58  ? 30.664 -1.956  7.730   1.00 54.02  ? 58   PHE A C   1 
ATOM   427  O  O   . PHE A 1 58  ? 31.242 -3.003  7.352   1.00 45.93  ? 58   PHE A O   1 
ATOM   428  C  CB  . PHE A 1 58  ? 32.427 -0.308  8.725   1.00 58.52  ? 58   PHE A CB  1 
ATOM   429  C  CG  . PHE A 1 58  ? 31.935 -0.747  10.060  1.00 39.42  ? 58   PHE A CG  1 
ATOM   430  C  CD1 . PHE A 1 58  ? 32.324 -2.003  10.571  1.00 53.99  ? 58   PHE A CD1 1 
ATOM   431  C  CD2 . PHE A 1 58  ? 30.913 -0.052  10.766  1.00 22.12  ? 58   PHE A CD2 1 
ATOM   432  C  CE1 . PHE A 1 58  ? 31.673 -2.531  11.704  1.00 36.25  ? 58   PHE A CE1 1 
ATOM   433  C  CE2 . PHE A 1 58  ? 30.216 -0.536  11.935  1.00 54.70  ? 58   PHE A CE2 1 
ATOM   434  C  CZ  . PHE A 1 58  ? 30.582 -1.795  12.414  1.00 35.73  ? 58   PHE A CZ  1 
ATOM   435  N  N   . PHE A 1 59  ? 29.457 -1.971  8.266   1.00 40.58  ? 59   PHE A N   1 
ATOM   436  C  CA  . PHE A 1 59  ? 28.620 -3.138  8.444   1.00 63.83  ? 59   PHE A CA  1 
ATOM   437  C  C   . PHE A 1 59  ? 27.826 -3.568  7.115   1.00 93.56  ? 59   PHE A C   1 
ATOM   438  O  O   . PHE A 1 59  ? 28.222 -4.528  6.439   1.00 86.12  ? 59   PHE A O   1 
ATOM   439  C  CB  . PHE A 1 59  ? 27.695 -2.764  9.576   1.00 52.94  ? 59   PHE A CB  1 
ATOM   440  C  CG  . PHE A 1 59  ? 27.213 -3.894  10.327  1.00 64.04  ? 59   PHE A CG  1 
ATOM   441  C  CD1 . PHE A 1 59  ? 28.114 -4.619  11.102  1.00 74.68  ? 59   PHE A CD1 1 
ATOM   442  C  CD2 . PHE A 1 59  ? 25.846 -4.261  10.285  1.00 81.98  ? 59   PHE A CD2 1 
ATOM   443  C  CE1 . PHE A 1 59  ? 27.703 -5.717  11.849  1.00 59.37  ? 59   PHE A CE1 1 
ATOM   444  C  CE2 . PHE A 1 59  ? 25.383 -5.360  11.013  1.00 70.60  ? 59   PHE A CE2 1 
ATOM   445  C  CZ  . PHE A 1 59  ? 26.323 -6.105  11.812  1.00 85.16  ? 59   PHE A CZ  1 
ATOM   446  N  N   . CYS A 1 60  ? 26.747 -2.859  6.789   1.00 112.16 ? 60   CYS A N   1 
ATOM   447  C  CA  . CYS A 1 60  ? 25.786 -2.967  5.643   1.00 65.89  ? 60   CYS A CA  1 
ATOM   448  C  C   . CYS A 1 60  ? 26.374 -2.143  4.581   1.00 66.31  ? 60   CYS A C   1 
ATOM   449  O  O   . CYS A 1 60  ? 25.832 -1.004  4.475   1.00 78.18  ? 60   CYS A O   1 
ATOM   450  C  CB  . CYS A 1 60  ? 24.588 -2.096  6.040   1.00 65.86  ? 60   CYS A CB  1 
ATOM   451  S  SG  . CYS A 1 60  ? 24.778 -0.475  7.094   1.00 88.33  ? 60   CYS A SG  1 
ATOM   452  N  N   . PHE A 1 61  ? 27.353 -2.643  3.822   1.00 43.05  ? 61   PHE A N   1 
ATOM   453  C  CA  . PHE A 1 61  ? 28.173 -1.815  2.892   1.00 56.46  ? 61   PHE A CA  1 
ATOM   454  C  C   . PHE A 1 61  ? 27.721 -0.701  1.938   1.00 69.26  ? 61   PHE A C   1 
ATOM   455  O  O   . PHE A 1 61  ? 28.465 -0.276  1.016   1.00 52.79  ? 61   PHE A O   1 
ATOM   456  C  CB  . PHE A 1 61  ? 29.119 -2.706  2.185   1.00 58.92  ? 61   PHE A CB  1 
ATOM   457  C  CG  . PHE A 1 61  ? 29.946 -3.478  3.090   1.00 63.90  ? 61   PHE A CG  1 
ATOM   458  C  CD1 . PHE A 1 61  ? 29.368 -4.451  3.972   1.00 46.83  ? 61   PHE A CD1 1 
ATOM   459  C  CD2 . PHE A 1 61  ? 31.309 -3.285  3.045   1.00 52.47  ? 61   PHE A CD2 1 
ATOM   460  C  CE1 . PHE A 1 61  ? 30.174 -5.176  4.742   1.00 45.09  ? 61   PHE A CE1 1 
ATOM   461  C  CE2 . PHE A 1 61  ? 32.155 -4.027  3.816   1.00 56.31  ? 61   PHE A CE2 1 
ATOM   462  C  CZ  . PHE A 1 61  ? 31.603 -4.964  4.679   1.00 48.56  ? 61   PHE A CZ  1 
ATOM   463  N  N   . LYS A 1 62  ? 26.551 -0.153  2.254   1.00 50.03  ? 62   LYS A N   1 
ATOM   464  C  CA  . LYS A 1 62  ? 25.974 0.965   1.565   1.00 56.05  ? 62   LYS A CA  1 
ATOM   465  C  C   . LYS A 1 62  ? 26.871 2.144   1.446   1.00 69.48  ? 62   LYS A C   1 
ATOM   466  O  O   . LYS A 1 62  ? 27.543 2.545   2.420   1.00 71.12  ? 62   LYS A O   1 
ATOM   467  C  CB  . LYS A 1 62  ? 24.711 1.470   2.233   1.00 47.81  ? 62   LYS A CB  1 
ATOM   468  C  CG  . LYS A 1 62  ? 24.111 2.609   1.377   1.00 65.05  ? 62   LYS A CG  1 
ATOM   469  C  CD  . LYS A 1 62  ? 22.602 2.649   1.512   1.00 82.42  ? 62   LYS A CD  1 
ATOM   470  C  CE  . LYS A 1 62  ? 21.893 1.423   0.905   1.00 103.60 ? 62   LYS A CE  1 
ATOM   471  N  NZ  . LYS A 1 62  ? 21.808 1.388   -0.587  1.00 86.88  ? 62   LYS A NZ  1 
ATOM   472  N  N   . GLU A 1 63  ? 26.847 2.713   0.237   1.00 70.89  ? 63   GLU A N   1 
ATOM   473  C  CA  . GLU A 1 63  ? 27.620 3.900   -0.031  1.00 57.95  ? 63   GLU A CA  1 
ATOM   474  C  C   . GLU A 1 63  ? 26.716 5.110   -0.248  1.00 71.29  ? 63   GLU A C   1 
ATOM   475  O  O   . GLU A 1 63  ? 25.528 4.964   -0.508  1.00 66.93  ? 63   GLU A O   1 
ATOM   476  C  CB  . GLU A 1 63  ? 28.544 3.620   -1.154  1.00 58.60  ? 63   GLU A CB  1 
ATOM   477  C  CG  . GLU A 1 63  ? 29.265 2.258   -0.978  1.00 53.57  ? 63   GLU A CG  1 
ATOM   478  C  CD  . GLU A 1 63  ? 30.497 2.194   -1.874  1.00 80.22  ? 63   GLU A CD  1 
ATOM   479  O  OE1 . GLU A 1 63  ? 31.468 2.990   -1.635  1.00 92.51  ? 63   GLU A OE1 1 
ATOM   480  O  OE2 . GLU A 1 63  ? 30.474 1.366   -2.820  1.00 96.53  ? 63   GLU A OE2 1 
ATOM   481  N  N   . LEU A 1 64  ? 27.245 6.303   0.004   1.00 80.00  ? 64   LEU A N   1 
ATOM   482  C  CA  . LEU A 1 64  ? 26.434 7.525   -0.150  1.00 77.41  ? 64   LEU A CA  1 
ATOM   483  C  C   . LEU A 1 64  ? 27.229 8.751   -0.498  1.00 72.03  ? 64   LEU A C   1 
ATOM   484  O  O   . LEU A 1 64  ? 28.359 8.961   0.012   1.00 96.70  ? 64   LEU A O   1 
ATOM   485  C  CB  . LEU A 1 64  ? 25.681 7.841   1.103   1.00 45.59  ? 64   LEU A CB  1 
ATOM   486  C  CG  . LEU A 1 64  ? 24.695 6.794   1.615   1.00 70.00  ? 64   LEU A CG  1 
ATOM   487  C  CD1 . LEU A 1 64  ? 24.032 7.215   2.916   1.00 49.60  ? 64   LEU A CD1 1 
ATOM   488  C  CD2 . LEU A 1 64  ? 23.604 6.599   0.618   1.00 61.67  ? 64   LEU A CD2 1 
ATOM   489  N  N   . GLU A 1 65  ? 26.661 9.571   -1.382  1.00 94.43  ? 65   GLU A N   1 
ATOM   490  C  CA  . GLU A 1 65  ? 27.330 10.825  -1.754  1.00 50.43  ? 65   GLU A CA  1 
ATOM   491  C  C   . GLU A 1 65  ? 26.265 11.867  -1.611  1.00 75.79  ? 65   GLU A C   1 
ATOM   492  O  O   . GLU A 1 65  ? 25.091 11.485  -1.247  1.00 69.97  ? 65   GLU A O   1 
ATOM   493  C  CB  . GLU A 1 65  ? 27.871 10.763  -3.191  1.00 98.90  ? 65   GLU A CB  1 
ATOM   494  C  CG  . GLU A 1 65  ? 27.567 9.453   -3.892  1.00 129.15 ? 65   GLU A CG  1 
ATOM   495  C  CD  . GLU A 1 65  ? 26.678 9.624   -5.102  1.00 150.49 ? 65   GLU A CD  1 
ATOM   496  O  OE1 . GLU A 1 65  ? 27.144 10.235  -6.071  1.00 141.84 ? 65   GLU A OE1 1 
ATOM   497  O  OE2 . GLU A 1 65  ? 25.525 9.156   -5.092  1.00 152.41 ? 65   GLU A OE2 1 
ATOM   498  N  N   . GLY A 1 66  ? 26.673 13.140  -1.834  1.00 71.85  ? 66   GLY A N   1 
ATOM   499  C  CA  . GLY A 1 66  ? 25.763 14.281  -1.805  1.00 70.91  ? 66   GLY A CA  1 
ATOM   500  C  C   . GLY A 1 66  ? 25.535 14.844  -0.429  1.00 88.88  ? 66   GLY A C   1 
ATOM   501  O  O   . GLY A 1 66  ? 24.386 15.137  -0.045  1.00 70.49  ? 66   GLY A O   1 
ATOM   502  N  N   . TRP A 1 67  ? 26.632 15.054  0.290   1.00 85.06  ? 67   TRP A N   1 
ATOM   503  C  CA  . TRP A 1 67  ? 26.547 15.490  1.677   1.00 91.46  ? 67   TRP A CA  1 
ATOM   504  C  C   . TRP A 1 67  ? 26.432 16.985  1.821   1.00 85.87  ? 67   TRP A C   1 
ATOM   505  O  O   . TRP A 1 67  ? 27.280 17.688  1.317   1.00 91.10  ? 67   TRP A O   1 
ATOM   506  C  CB  . TRP A 1 67  ? 27.796 14.970  2.455   1.00 110.78 ? 67   TRP A CB  1 
ATOM   507  C  CG  . TRP A 1 67  ? 27.822 13.423  2.718   1.00 75.82  ? 67   TRP A CG  1 
ATOM   508  C  CD1 . TRP A 1 67  ? 28.570 12.462  2.042   1.00 74.25  ? 67   TRP A CD1 1 
ATOM   509  C  CD2 . TRP A 1 67  ? 26.902 12.686  3.554   1.00 62.94  ? 67   TRP A CD2 1 
ATOM   510  N  NE1 . TRP A 1 67  ? 28.150 11.204  2.404   1.00 71.77  ? 67   TRP A NE1 1 
ATOM   511  C  CE2 . TRP A 1 67  ? 27.131 11.319  3.372   1.00 47.12  ? 67   TRP A CE2 1 
ATOM   512  C  CE3 . TRP A 1 67  ? 25.920 13.050  4.496   1.00 55.77  ? 67   TRP A CE3 1 
ATOM   513  C  CZ2 . TRP A 1 67  ? 26.407 10.321  4.004   1.00 62.26  ? 67   TRP A CZ2 1 
ATOM   514  C  CZ3 . TRP A 1 67  ? 25.180 12.057  5.131   1.00 77.54  ? 67   TRP A CZ3 1 
ATOM   515  C  CH2 . TRP A 1 67  ? 25.449 10.719  4.898   1.00 71.53  ? 67   TRP A CH2 1 
ATOM   516  N  N   . GLU A 1 68  ? 25.405 17.448  2.531   1.00 91.21  ? 68   GLU A N   1 
ATOM   517  C  CA  . GLU A 1 68  ? 25.156 18.876  2.801   1.00 81.88  ? 68   GLU A CA  1 
ATOM   518  C  C   . GLU A 1 68  ? 25.348 19.103  4.283   1.00 73.89  ? 68   GLU A C   1 
ATOM   519  O  O   . GLU A 1 68  ? 24.792 18.369  5.091   1.00 70.75  ? 68   GLU A O   1 
ATOM   520  C  CB  . GLU A 1 68  ? 23.703 19.261  2.523   1.00 99.28  ? 68   GLU A CB  1 
ATOM   521  C  CG  . GLU A 1 68  ? 23.085 18.556  1.365   1.00 113.26 ? 68   GLU A CG  1 
ATOM   522  C  CD  . GLU A 1 68  ? 21.888 19.280  0.833   1.00 100.11 ? 68   GLU A CD  1 
ATOM   523  O  OE1 . GLU A 1 68  ? 20.860 19.426  1.576   1.00 90.26  ? 68   GLU A OE1 1 
ATOM   524  O  OE2 . GLU A 1 68  ? 22.024 19.695  -0.344  1.00 87.17  ? 68   GLU A OE2 1 
ATOM   525  N  N   . PRO A 1 69  ? 26.046 20.170  4.670   1.00 86.26  ? 69   PRO A N   1 
ATOM   526  C  CA  . PRO A 1 69  ? 26.345 20.555  6.068   1.00 72.59  ? 69   PRO A CA  1 
ATOM   527  C  C   . PRO A 1 69  ? 25.235 20.344  7.099   1.00 48.43  ? 69   PRO A C   1 
ATOM   528  O  O   . PRO A 1 69  ? 25.442 20.350  8.327   1.00 105.72 ? 69   PRO A O   1 
ATOM   529  C  CB  . PRO A 1 69  ? 26.707 22.020  5.925   1.00 97.36  ? 69   PRO A CB  1 
ATOM   530  C  CG  . PRO A 1 69  ? 27.438 22.045  4.607   1.00 51.92  ? 69   PRO A CG  1 
ATOM   531  C  CD  . PRO A 1 69  ? 26.471 21.228  3.744   1.00 99.78  ? 69   PRO A CD  1 
ATOM   532  N  N   . ASP A 1 70  ? 24.042 20.163  6.570   1.00 70.31  ? 70   ASP A N   1 
ATOM   533  C  CA  . ASP A 1 70  ? 22.855 20.056  7.362   1.00 60.36  ? 70   ASP A CA  1 
ATOM   534  C  C   . ASP A 1 70  ? 22.354 18.665  7.591   1.00 69.17  ? 70   ASP A C   1 
ATOM   535  O  O   . ASP A 1 70  ? 21.419 18.454  8.376   1.00 65.98  ? 70   ASP A O   1 
ATOM   536  C  CB  . ASP A 1 70  ? 21.792 20.961  6.698   1.00 93.64  ? 70   ASP A CB  1 
ATOM   537  C  CG  . ASP A 1 70  ? 21.117 21.885  7.686   1.00 114.92 ? 70   ASP A CG  1 
ATOM   538  O  OD1 . ASP A 1 70  ? 20.164 21.423  8.359   1.00 115.57 ? 70   ASP A OD1 1 
ATOM   539  O  OD2 . ASP A 1 70  ? 21.548 23.054  7.793   1.00 104.94 ? 70   ASP A OD2 1 
ATOM   540  N  N   . ASP A 1 71  ? 23.002 17.741  6.895   1.00 69.61  ? 71   ASP A N   1 
ATOM   541  C  CA  . ASP A 1 71  ? 22.714 16.301  6.936   1.00 83.31  ? 71   ASP A CA  1 
ATOM   542  C  C   . ASP A 1 71  ? 23.143 15.529  8.217   1.00 72.58  ? 71   ASP A C   1 
ATOM   543  O  O   . ASP A 1 71  ? 24.331 15.439  8.576   1.00 66.34  ? 71   ASP A O   1 
ATOM   544  C  CB  . ASP A 1 71  ? 23.404 15.598  5.742   1.00 87.32  ? 71   ASP A CB  1 
ATOM   545  C  CG  . ASP A 1 71  ? 22.714 15.851  4.397   1.00 112.98 ? 71   ASP A CG  1 
ATOM   546  O  OD1 . ASP A 1 71  ? 21.559 16.340  4.437   1.00 87.99  ? 71   ASP A OD1 1 
ATOM   547  O  OD2 . ASP A 1 71  ? 23.319 15.538  3.311   1.00 78.89  ? 71   ASP A OD2 1 
ATOM   548  N  N   . ASP A 1 72  ? 22.149 14.958  8.855   1.00 61.45  ? 72   ASP A N   1 
ATOM   549  C  CA  . ASP A 1 72  ? 22.255 14.057  9.997   1.00 66.01  ? 72   ASP A CA  1 
ATOM   550  C  C   . ASP A 1 72  ? 22.666 12.585  9.447   1.00 74.78  ? 72   ASP A C   1 
ATOM   551  O  O   . ASP A 1 72  ? 21.833 11.834  8.908   1.00 42.83  ? 72   ASP A O   1 
ATOM   552  C  CB  . ASP A 1 72  ? 20.851 14.003  10.669  1.00 58.63  ? 72   ASP A CB  1 
ATOM   553  C  CG  . ASP A 1 72  ? 20.824 13.041  11.877  1.00 95.41  ? 72   ASP A CG  1 
ATOM   554  O  OD1 . ASP A 1 72  ? 21.836 12.318  12.069  1.00 67.12  ? 72   ASP A OD1 1 
ATOM   555  O  OD2 . ASP A 1 72  ? 19.826 12.971  12.632  1.00 70.05  ? 72   ASP A OD2 1 
ATOM   556  N  N   . PRO A 1 73  ? 23.935 12.167  9.595   1.00 46.80  ? 73   PRO A N   1 
ATOM   557  C  CA  . PRO A 1 73  ? 24.262 10.842  9.068   1.00 43.07  ? 73   PRO A CA  1 
ATOM   558  C  C   . PRO A 1 73  ? 23.422 9.664   9.593   1.00 42.91  ? 73   PRO A C   1 
ATOM   559  O  O   . PRO A 1 73  ? 23.375 8.610   8.993   1.00 78.59  ? 73   PRO A O   1 
ATOM   560  C  CB  . PRO A 1 73  ? 25.744 10.690  9.393   1.00 53.32  ? 73   PRO A CB  1 
ATOM   561  C  CG  . PRO A 1 73  ? 26.281 12.100  9.567   1.00 52.61  ? 73   PRO A CG  1 
ATOM   562  C  CD  . PRO A 1 73  ? 25.112 12.799  10.255  1.00 77.88  ? 73   PRO A CD  1 
ATOM   563  N  N   . ILE A 1 74  ? 22.801 9.833   10.736  1.00 61.96  ? 74   ILE A N   1 
ATOM   564  C  CA  . ILE A 1 74  ? 22.043 8.772   11.277  1.00 52.05  ? 74   ILE A CA  1 
ATOM   565  C  C   . ILE A 1 74  ? 20.759 8.571   10.499  1.00 80.08  ? 74   ILE A C   1 
ATOM   566  O  O   . ILE A 1 74  ? 20.712 7.654   9.660   1.00 77.48  ? 74   ILE A O   1 
ATOM   567  C  CB  . ILE A 1 74  ? 21.858 9.002   12.765  1.00 71.50  ? 74   ILE A CB  1 
ATOM   568  C  CG1 . ILE A 1 74  ? 23.192 8.669   13.449  1.00 78.43  ? 74   ILE A CG1 1 
ATOM   569  C  CG2 . ILE A 1 74  ? 20.802 8.124   13.352  1.00 47.49  ? 74   ILE A CG2 1 
ATOM   570  C  CD1 . ILE A 1 74  ? 23.328 9.189   14.939  1.00 77.08  ? 74   ILE A CD1 1 
ATOM   571  N  N   . GLU A 1 75  ? 19.743 9.413   10.729  1.00 81.62  ? 75   GLU A N   1 
ATOM   572  C  CA  . GLU A 1 75  ? 18.453 9.294   10.009  1.00 97.81  ? 75   GLU A CA  1 
ATOM   573  C  C   . GLU A 1 75  ? 18.615 9.107   8.468   1.00 89.74  ? 75   GLU A C   1 
ATOM   574  O  O   . GLU A 1 75  ? 17.726 8.533   7.845   1.00 69.08  ? 75   GLU A O   1 
ATOM   575  C  CB  . GLU A 1 75  ? 17.499 10.477  10.353  1.00 55.86  ? 75   GLU A CB  1 
ATOM   576  C  CG  . GLU A 1 75  ? 16.080 9.983   10.863  1.00 130.63 ? 75   GLU A CG  1 
ATOM   577  C  CD  . GLU A 1 75  ? 16.062 9.521   12.363  1.00 123.19 ? 75   GLU A CD  1 
ATOM   578  O  OE1 . GLU A 1 75  ? 17.139 9.472   12.989  1.00 128.11 ? 75   GLU A OE1 1 
ATOM   579  O  OE2 . GLU A 1 75  ? 14.979 9.209   12.924  1.00 122.57 ? 75   GLU A OE2 1 
ATOM   580  N  N   . GLU A 1 76  ? 19.731 9.585   7.887   1.00 50.72  ? 76   GLU A N   1 
ATOM   581  C  CA  . GLU A 1 76  ? 20.056 9.348   6.462   1.00 60.90  ? 76   GLU A CA  1 
ATOM   582  C  C   . GLU A 1 76  ? 20.141 7.812   6.266   1.00 89.15  ? 76   GLU A C   1 
ATOM   583  O  O   . GLU A 1 76  ? 19.433 7.185   5.474   1.00 81.89  ? 76   GLU A O   1 
ATOM   584  C  CB  . GLU A 1 76  ? 21.446 9.916   6.088   1.00 46.91  ? 76   GLU A CB  1 
ATOM   585  C  CG  . GLU A 1 76  ? 21.503 11.310  5.516   1.00 101.78 ? 76   GLU A CG  1 
ATOM   586  C  CD  . GLU A 1 76  ? 20.573 11.461  4.345   1.00 107.41 ? 76   GLU A CD  1 
ATOM   587  O  OE1 . GLU A 1 76  ? 21.040 11.323  3.164   1.00 76.79  ? 76   GLU A OE1 1 
ATOM   588  O  OE2 . GLU A 1 76  ? 19.361 11.692  4.626   1.00 79.04  ? 76   GLU A OE2 1 
ATOM   589  N  N   . HIS A 1 77  ? 21.081 7.239   6.999   1.00 109.36 ? 77   HIS A N   1 
ATOM   590  C  CA  . HIS A 1 77  ? 21.346 5.812   7.050   1.00 76.85  ? 77   HIS A CA  1 
ATOM   591  C  C   . HIS A 1 77  ? 20.054 4.970   7.259   1.00 82.81  ? 77   HIS A C   1 
ATOM   592  O  O   . HIS A 1 77  ? 19.868 3.958   6.591   1.00 73.67  ? 77   HIS A O   1 
ATOM   593  C  CB  . HIS A 1 77  ? 22.291 5.603   8.221   1.00 92.70  ? 77   HIS A CB  1 
ATOM   594  C  CG  . HIS A 1 77  ? 22.949 4.268   8.288   1.00 88.62  ? 77   HIS A CG  1 
ATOM   595  N  ND1 . HIS A 1 77  ? 24.182 4.125   8.878   1.00 88.24  ? 77   HIS A ND1 1 
ATOM   596  C  CD2 . HIS A 1 77  ? 22.642 3.056   7.763   1.00 62.76  ? 77   HIS A CD2 1 
ATOM   597  C  CE1 . HIS A 1 77  ? 24.622 2.907   8.686   1.00 69.04  ? 77   HIS A CE1 1 
ATOM   598  N  NE2 . HIS A 1 77  ? 23.704 2.235   8.012   1.00 97.72  ? 77   HIS A NE2 1 
ATOM   599  N  N   . LYS A 1 78  ? 19.185 5.362   8.198   1.00 68.20  ? 78   LYS A N   1 
ATOM   600  C  CA  . LYS A 1 78  ? 17.959 4.600   8.451   1.00 72.64  ? 78   LYS A CA  1 
ATOM   601  C  C   . LYS A 1 78  ? 17.025 4.731   7.272   1.00 86.20  ? 78   LYS A C   1 
ATOM   602  O  O   . LYS A 1 78  ? 16.054 4.008   7.154   1.00 83.68  ? 78   LYS A O   1 
ATOM   603  C  CB  . LYS A 1 78  ? 17.196 5.138   9.678   1.00 83.34  ? 78   LYS A CB  1 
ATOM   604  C  CG  . LYS A 1 78  ? 18.004 5.368   10.965  1.00 103.13 ? 78   LYS A CG  1 
ATOM   605  C  CD  . LYS A 1 78  ? 17.102 6.047   11.986  1.00 100.27 ? 78   LYS A CD  1 
ATOM   606  C  CE  . LYS A 1 78  ? 17.352 5.625   13.421  1.00 103.92 ? 78   LYS A CE  1 
ATOM   607  N  NZ  . LYS A 1 78  ? 16.242 6.143   14.283  1.00 91.56  ? 78   LYS A NZ  1 
ATOM   608  N  N   . LYS A 1 79  ? 17.299 5.695   6.418   1.00 96.63  ? 79   LYS A N   1 
ATOM   609  C  CA  . LYS A 1 79  ? 16.443 5.964   5.290   1.00 84.92  ? 79   LYS A CA  1 
ATOM   610  C  C   . LYS A 1 79  ? 16.884 5.011   4.214   1.00 78.60  ? 79   LYS A C   1 
ATOM   611  O  O   . LYS A 1 79  ? 16.155 4.117   3.802   1.00 93.95  ? 79   LYS A O   1 
ATOM   612  C  CB  . LYS A 1 79  ? 16.636 7.426   4.844   1.00 94.91  ? 79   LYS A CB  1 
ATOM   613  C  CG  . LYS A 1 79  ? 15.800 7.868   3.678   1.00 88.48  ? 79   LYS A CG  1 
ATOM   614  C  CD  . LYS A 1 79  ? 16.003 9.306   3.395   1.00 105.52 ? 79   LYS A CD  1 
ATOM   615  C  CE  . LYS A 1 79  ? 15.211 9.723   2.170   1.00 97.12  ? 79   LYS A CE  1 
ATOM   616  N  NZ  . LYS A 1 79  ? 15.950 10.825  1.467   1.00 67.32  ? 79   LYS A NZ  1 
ATOM   617  N  N   . HIS A 1 80  ? 18.117 5.187   3.798   1.00 54.25  ? 80   HIS A N   1 
ATOM   618  C  CA  . HIS A 1 80  ? 18.694 4.361   2.757   1.00 57.93  ? 80   HIS A CA  1 
ATOM   619  C  C   . HIS A 1 80  ? 19.198 2.937   3.112   1.00 90.23  ? 80   HIS A C   1 
ATOM   620  O  O   . HIS A 1 80  ? 19.792 2.277   2.249   1.00 102.23 ? 80   HIS A O   1 
ATOM   621  C  CB  . HIS A 1 80  ? 19.842 5.130   2.072   1.00 65.38  ? 80   HIS A CB  1 
ATOM   622  C  CG  . HIS A 1 80  ? 19.425 6.454   1.518   1.00 107.72 ? 80   HIS A CG  1 
ATOM   623  N  ND1 . HIS A 1 80  ? 20.294 7.289   0.861   1.00 104.21 ? 80   HIS A ND1 1 
ATOM   624  C  CD2 . HIS A 1 80  ? 18.243 7.111   1.582   1.00 92.34  ? 80   HIS A CD2 1 
ATOM   625  C  CE1 . HIS A 1 80  ? 19.670 8.412   0.547   1.00 107.30 ? 80   HIS A CE1 1 
ATOM   626  N  NE2 . HIS A 1 80  ? 18.425 8.327   0.976   1.00 120.26 ? 80   HIS A NE2 1 
ATOM   627  N  N   . SER A 1 81  ? 18.990 2.463   4.350   1.00 89.57  ? 81   SER A N   1 
ATOM   628  C  CA  . SER A 1 81  ? 19.442 1.117   4.762   1.00 60.61  ? 81   SER A CA  1 
ATOM   629  C  C   . SER A 1 81  ? 18.756 0.610   6.003   1.00 71.37  ? 81   SER A C   1 
ATOM   630  O  O   . SER A 1 81  ? 19.339 -0.128  6.767   1.00 74.66  ? 81   SER A O   1 
ATOM   631  C  CB  . SER A 1 81  ? 20.966 1.030   4.959   1.00 59.10  ? 81   SER A CB  1 
ATOM   632  O  OG  . SER A 1 81  ? 21.466 -0.303  5.080   1.00 71.12  ? 81   SER A OG  1 
ATOM   633  N  N   . SER A 1 82  ? 17.497 0.985   6.166   1.00 91.81  ? 82   SER A N   1 
ATOM   634  C  CA  . SER A 1 82  ? 16.695 0.578   7.309   1.00 78.36  ? 82   SER A CA  1 
ATOM   635  C  C   . SER A 1 82  ? 17.075 -0.767  7.974   1.00 93.40  ? 82   SER A C   1 
ATOM   636  O  O   . SER A 1 82  ? 16.991 -0.909  9.203   1.00 102.54 ? 82   SER A O   1 
ATOM   637  C  CB  . SER A 1 82  ? 15.214 0.582   6.890   1.00 94.84  ? 82   SER A CB  1 
ATOM   638  O  OG  . SER A 1 82  ? 14.383 0.303   7.998   1.00 106.90 ? 82   SER A OG  1 
ATOM   639  N  N   . GLY A 1 83  ? 17.501 -1.745  7.175   1.00 91.29  ? 83   GLY A N   1 
ATOM   640  C  CA  . GLY A 1 83  ? 17.856 -3.039  7.747   1.00 81.43  ? 83   GLY A CA  1 
ATOM   641  C  C   . GLY A 1 83  ? 19.320 -3.283  8.087   1.00 78.12  ? 83   GLY A C   1 
ATOM   642  O  O   . GLY A 1 83  ? 19.864 -4.379  7.897   1.00 96.08  ? 83   GLY A O   1 
ATOM   643  N  N   . CYS A 1 84  ? 19.987 -2.235  8.557   1.00 113.86 ? 84   CYS A N   1 
ATOM   644  C  CA  . CYS A 1 84  ? 21.394 -2.368  8.949   1.00 94.49  ? 84   CYS A CA  1 
ATOM   645  C  C   . CYS A 1 84  ? 21.280 -2.735  10.403  1.00 100.59 ? 84   CYS A C   1 
ATOM   646  O  O   . CYS A 1 84  ? 20.522 -2.116  11.181  1.00 89.55  ? 84   CYS A O   1 
ATOM   647  C  CB  . CYS A 1 84  ? 22.147 -1.058  8.824   1.00 63.85  ? 84   CYS A CB  1 
ATOM   648  S  SG  . CYS A 1 84  ? 23.934 -1.137  8.914   1.00 68.65  ? 84   CYS A SG  1 
ATOM   649  N  N   . ALA A 1 85  ? 22.021 -3.774  10.756  1.00 87.80  ? 85   ALA A N   1 
ATOM   650  C  CA  . ALA A 1 85  ? 22.002 -4.262  12.111  1.00 97.09  ? 85   ALA A CA  1 
ATOM   651  C  C   . ALA A 1 85  ? 22.718 -3.267  13.020  1.00 95.03  ? 85   ALA A C   1 
ATOM   652  O  O   . ALA A 1 85  ? 22.278 -3.009  14.146  1.00 68.61  ? 85   ALA A O   1 
ATOM   653  C  CB  . ALA A 1 85  ? 22.650 -5.574  12.165  1.00 75.95  ? 85   ALA A CB  1 
ATOM   654  N  N   . PHE A 1 86  ? 23.830 -2.716  12.541  1.00 61.52  ? 86   PHE A N   1 
ATOM   655  C  CA  . PHE A 1 86  ? 24.526 -1.723  13.313  1.00 58.28  ? 86   PHE A CA  1 
ATOM   656  C  C   . PHE A 1 86  ? 23.601 -0.781  14.004  1.00 66.73  ? 86   PHE A C   1 
ATOM   657  O  O   . PHE A 1 86  ? 23.734 -0.503  15.188  1.00 84.96  ? 86   PHE A O   1 
ATOM   658  C  CB  . PHE A 1 86  ? 25.379 -0.886  12.441  1.00 42.44  ? 86   PHE A CB  1 
ATOM   659  C  CG  . PHE A 1 86  ? 26.363 -0.030  13.179  1.00 76.81  ? 86   PHE A CG  1 
ATOM   660  C  CD1 . PHE A 1 86  ? 27.568 -0.522  13.591  1.00 75.78  ? 86   PHE A CD1 1 
ATOM   661  C  CD2 . PHE A 1 86  ? 26.066 1.283   13.460  1.00 98.40  ? 86   PHE A CD2 1 
ATOM   662  C  CE1 . PHE A 1 86  ? 28.460 0.306   14.298  1.00 85.92  ? 86   PHE A CE1 1 
ATOM   663  C  CE2 . PHE A 1 86  ? 26.942 2.092   14.144  1.00 73.36  ? 86   PHE A CE2 1 
ATOM   664  C  CZ  . PHE A 1 86  ? 28.144 1.600   14.563  1.00 87.67  ? 86   PHE A CZ  1 
ATOM   665  N  N   . LEU A 1 87  ? 22.678 -0.257  13.227  1.00 69.46  ? 87   LEU A N   1 
ATOM   666  C  CA  . LEU A 1 87  ? 21.755 0.719   13.765  1.00 64.20  ? 87   LEU A CA  1 
ATOM   667  C  C   . LEU A 1 87  ? 20.994 0.260   14.956  1.00 85.50  ? 87   LEU A C   1 
ATOM   668  O  O   . LEU A 1 87  ? 20.496 1.110   15.675  1.00 87.14  ? 87   LEU A O   1 
ATOM   669  C  CB  . LEU A 1 87  ? 20.741 1.216   12.722  1.00 65.05  ? 87   LEU A CB  1 
ATOM   670  C  CG  . LEU A 1 87  ? 21.194 1.462   11.282  1.00 88.69  ? 87   LEU A CG  1 
ATOM   671  C  CD1 . LEU A 1 87  ? 20.145 2.301   10.581  1.00 85.87  ? 87   LEU A CD1 1 
ATOM   672  C  CD2 . LEU A 1 87  ? 22.557 2.152   11.228  1.00 53.57  ? 87   LEU A CD2 1 
ATOM   673  N  N   . SER A 1 88  ? 20.861 -1.042  15.201  1.00 89.42  ? 88   SER A N   1 
ATOM   674  C  CA  . SER A 1 88  ? 20.077 -1.409  16.388  1.00 86.66  ? 88   SER A CA  1 
ATOM   675  C  C   . SER A 1 88  ? 20.980 -1.667  17.603  1.00 82.75  ? 88   SER A C   1 
ATOM   676  O  O   . SER A 1 88  ? 20.509 -1.813  18.714  1.00 74.63  ? 88   SER A O   1 
ATOM   677  C  CB  . SER A 1 88  ? 19.083 -2.565  16.100  1.00 71.26  ? 88   SER A CB  1 
ATOM   678  O  OG  . SER A 1 88  ? 19.636 -3.583  15.287  1.00 112.57 ? 88   SER A OG  1 
ATOM   679  N  N   . VAL A 1 89  ? 22.281 -1.551  17.370  1.00 58.83  ? 89   VAL A N   1 
ATOM   680  C  CA  . VAL A 1 89  ? 23.352 -1.729  18.317  1.00 54.49  ? 89   VAL A CA  1 
ATOM   681  C  C   . VAL A 1 89  ? 23.549 -0.558  19.259  1.00 87.54  ? 89   VAL A C   1 
ATOM   682  O  O   . VAL A 1 89  ? 24.297 0.396   18.982  1.00 84.47  ? 89   VAL A O   1 
ATOM   683  C  CB  . VAL A 1 89  ? 24.606 -2.044  17.514  1.00 77.36  ? 89   VAL A CB  1 
ATOM   684  C  CG1 . VAL A 1 89  ? 25.902 -1.673  18.239  1.00 57.79  ? 89   VAL A CG1 1 
ATOM   685  C  CG2 . VAL A 1 89  ? 24.539 -3.494  17.189  1.00 62.13  ? 89   VAL A CG2 1 
ATOM   686  N  N   . LYS A 1 90  ? 22.893 -0.653  20.406  1.00 96.07  ? 90   LYS A N   1 
ATOM   687  C  CA  . LYS A 1 90  ? 22.952 0.405   21.403  1.00 98.32  ? 90   LYS A CA  1 
ATOM   688  C  C   . LYS A 1 90  ? 23.823 0.054   22.614  1.00 95.01  ? 90   LYS A C   1 
ATOM   689  O  O   . LYS A 1 90  ? 23.310 -0.117  23.691  1.00 105.59 ? 90   LYS A O   1 
ATOM   690  C  CB  . LYS A 1 90  ? 21.512 0.711   21.824  1.00 91.17  ? 90   LYS A CB  1 
ATOM   691  C  CG  . LYS A 1 90  ? 20.671 -0.566  21.916  1.00 100.72 ? 90   LYS A CG  1 
ATOM   692  C  CD  . LYS A 1 90  ? 19.247 -0.358  22.407  1.00 125.87 ? 90   LYS A CD  1 
ATOM   693  C  CE  . LYS A 1 90  ? 18.718 -1.662  23.044  1.00 129.61 ? 90   LYS A CE  1 
ATOM   694  N  NZ  . LYS A 1 90  ? 17.551 -1.466  23.964  1.00 103.53 ? 90   LYS A NZ  1 
ATOM   695  N  N   . LYS A 1 91  ? 25.133 -0.080  22.437  1.00 76.84  ? 91   LYS A N   1 
ATOM   696  C  CA  . LYS A 1 91  ? 26.079 -0.415  23.521  1.00 71.97  ? 91   LYS A CA  1 
ATOM   697  C  C   . LYS A 1 91  ? 27.423 -0.020  22.969  1.00 70.19  ? 91   LYS A C   1 
ATOM   698  O  O   . LYS A 1 91  ? 27.650 -0.083  21.742  1.00 81.43  ? 91   LYS A O   1 
ATOM   699  C  CB  . LYS A 1 91  ? 26.148 -1.931  23.859  1.00 59.78  ? 91   LYS A CB  1 
ATOM   700  C  CG  . LYS A 1 91  ? 24.964 -2.510  24.657  1.00 71.75  ? 91   LYS A CG  1 
ATOM   701  C  CD  . LYS A 1 91  ? 25.187 -4.016  24.936  1.00 63.37  ? 91   LYS A CD  1 
ATOM   702  C  CE  . LYS A 1 91  ? 24.022 -4.643  25.628  1.00 79.73  ? 91   LYS A CE  1 
ATOM   703  N  NZ  . LYS A 1 91  ? 24.379 -5.955  26.137  1.00 88.49  ? 91   LYS A NZ  1 
ATOM   704  N  N   . GLN A 1 92  ? 28.336 0.403   23.834  1.00 77.22  ? 92   GLN A N   1 
ATOM   705  C  CA  . GLN A 1 92  ? 29.603 0.754   23.269  1.00 87.83  ? 92   GLN A CA  1 
ATOM   706  C  C   . GLN A 1 92  ? 30.313 -0.538  22.986  1.00 88.23  ? 92   GLN A C   1 
ATOM   707  O  O   . GLN A 1 92  ? 29.888 -1.640  23.412  1.00 82.54  ? 92   GLN A O   1 
ATOM   708  C  CB  . GLN A 1 92  ? 30.412 1.693   24.165  1.00 127.19 ? 92   GLN A CB  1 
ATOM   709  C  CG  . GLN A 1 92  ? 30.181 3.191   23.831  1.00 123.16 ? 92   GLN A CG  1 
ATOM   710  C  CD  . GLN A 1 92  ? 30.646 3.605   22.402  1.00 141.54 ? 92   GLN A CD  1 
ATOM   711  O  OE1 . GLN A 1 92  ? 30.097 3.144   21.389  1.00 130.00 ? 92   GLN A OE1 1 
ATOM   712  N  NE2 . GLN A 1 92  ? 31.659 4.480   22.334  1.00 131.63 ? 92   GLN A NE2 1 
ATOM   713  N  N   . PHE A 1 93  ? 31.367 -0.417  22.195  1.00 87.13  ? 93   PHE A N   1 
ATOM   714  C  CA  . PHE A 1 93  ? 32.126 -1.586  21.815  1.00 71.89  ? 93   PHE A CA  1 
ATOM   715  C  C   . PHE A 1 93  ? 32.446 -2.524  23.018  1.00 101.89 ? 93   PHE A C   1 
ATOM   716  O  O   . PHE A 1 93  ? 31.886 -3.621  23.125  1.00 88.08  ? 93   PHE A O   1 
ATOM   717  C  CB  . PHE A 1 93  ? 33.394 -1.116  21.115  1.00 65.03  ? 93   PHE A CB  1 
ATOM   718  C  CG  . PHE A 1 93  ? 34.091 -2.179  20.385  1.00 65.68  ? 93   PHE A CG  1 
ATOM   719  C  CD1 . PHE A 1 93  ? 33.383 -3.047  19.577  1.00 67.27  ? 93   PHE A CD1 1 
ATOM   720  C  CD2 . PHE A 1 93  ? 35.456 -2.330  20.502  1.00 95.48  ? 93   PHE A CD2 1 
ATOM   721  C  CE1 . PHE A 1 93  ? 34.056 -4.072  18.891  1.00 63.92  ? 93   PHE A CE1 1 
ATOM   722  C  CE2 . PHE A 1 93  ? 36.123 -3.339  19.826  1.00 91.93  ? 93   PHE A CE2 1 
ATOM   723  C  CZ  . PHE A 1 93  ? 35.425 -4.208  19.018  1.00 81.49  ? 93   PHE A CZ  1 
ATOM   724  N  N   . GLU A 1 94  ? 33.302 -2.065  23.934  1.00 108.35 ? 94   GLU A N   1 
ATOM   725  C  CA  . GLU A 1 94  ? 33.728 -2.880  25.072  1.00 72.93  ? 94   GLU A CA  1 
ATOM   726  C  C   . GLU A 1 94  ? 32.638 -3.455  25.943  1.00 70.01  ? 94   GLU A C   1 
ATOM   727  O  O   . GLU A 1 94  ? 32.872 -4.387  26.709  1.00 84.91  ? 94   GLU A O   1 
ATOM   728  C  CB  . GLU A 1 94  ? 34.682 -2.103  25.935  1.00 70.78  ? 94   GLU A CB  1 
ATOM   729  C  CG  . GLU A 1 94  ? 35.461 -1.123  25.154  1.00 110.30 ? 94   GLU A CG  1 
ATOM   730  C  CD  . GLU A 1 94  ? 36.945 -1.258  25.355  1.00 103.21 ? 94   GLU A CD  1 
ATOM   731  O  OE1 . GLU A 1 94  ? 37.457 -0.954  26.462  1.00 98.21  ? 94   GLU A OE1 1 
ATOM   732  O  OE2 . GLU A 1 94  ? 37.610 -1.664  24.383  1.00 121.36 ? 94   GLU A OE2 1 
ATOM   733  N  N   . GLU A 1 95  ? 31.432 -2.956  25.787  1.00 57.38  ? 95   GLU A N   1 
ATOM   734  C  CA  . GLU A 1 95  ? 30.352 -3.427  26.624  1.00 63.04  ? 95   GLU A CA  1 
ATOM   735  C  C   . GLU A 1 95  ? 29.647 -4.640  26.064  1.00 64.32  ? 95   GLU A C   1 
ATOM   736  O  O   . GLU A 1 95  ? 28.658 -5.151  26.621  1.00 81.23  ? 95   GLU A O   1 
ATOM   737  C  CB  . GLU A 1 95  ? 29.412 -2.253  26.787  1.00 58.01  ? 95   GLU A CB  1 
ATOM   738  C  CG  . GLU A 1 95  ? 28.385 -2.274  27.890  1.00 124.74 ? 95   GLU A CG  1 
ATOM   739  C  CD  . GLU A 1 95  ? 27.485 -1.024  27.824  1.00 141.28 ? 95   GLU A CD  1 
ATOM   740  O  OE1 . GLU A 1 95  ? 28.043 0.086   27.565  1.00 104.27 ? 95   GLU A OE1 1 
ATOM   741  O  OE2 . GLU A 1 95  ? 26.246 -1.163  28.029  1.00 121.36 ? 95   GLU A OE2 1 
ATOM   742  N  N   . LEU A 1 96  ? 30.149 -5.121  24.946  1.00 88.06  ? 96   LEU A N   1 
ATOM   743  C  CA  . LEU A 1 96  ? 29.551 -6.259  24.290  1.00 79.92  ? 96   LEU A CA  1 
ATOM   744  C  C   . LEU A 1 96  ? 30.166 -7.604  24.670  1.00 83.23  ? 96   LEU A C   1 
ATOM   745  O  O   . LEU A 1 96  ? 31.366 -7.692  24.917  1.00 63.37  ? 96   LEU A O   1 
ATOM   746  C  CB  . LEU A 1 96  ? 29.709 -6.073  22.788  1.00 103.70 ? 96   LEU A CB  1 
ATOM   747  C  CG  . LEU A 1 96  ? 28.843 -5.220  21.872  1.00 81.22  ? 96   LEU A CG  1 
ATOM   748  C  CD1 . LEU A 1 96  ? 29.527 -5.281  20.603  1.00 52.56  ? 96   LEU A CD1 1 
ATOM   749  C  CD2 . LEU A 1 96  ? 27.450 -5.801  21.636  1.00 49.59  ? 96   LEU A CD2 1 
ATOM   750  N  N   . THR A 1 97  ? 29.349 -8.652  24.680  1.00 74.70  ? 97   THR A N   1 
ATOM   751  C  CA  . THR A 1 97  ? 29.837 -10.026 24.927  1.00 70.11  ? 97   THR A CA  1 
ATOM   752  C  C   . THR A 1 97  ? 30.557 -10.522 23.673  1.00 66.18  ? 97   THR A C   1 
ATOM   753  O  O   . THR A 1 97  ? 29.959 -10.418 22.598  1.00 100.92 ? 97   THR A O   1 
ATOM   754  C  CB  . THR A 1 97  ? 28.689 -10.965 25.074  1.00 60.65  ? 97   THR A CB  1 
ATOM   755  O  OG1 . THR A 1 97  ? 27.713 -10.370 25.914  1.00 96.54  ? 97   THR A OG1 1 
ATOM   756  C  CG2 . THR A 1 97  ? 29.115 -12.228 25.679  1.00 89.80  ? 97   THR A CG2 1 
ATOM   757  N  N   . LEU A 1 98  ? 31.778 -11.073 23.777  1.00 80.37  ? 98   LEU A N   1 
ATOM   758  C  CA  . LEU A 1 98  ? 32.437 -11.606 22.577  1.00 68.53  ? 98   LEU A CA  1 
ATOM   759  C  C   . LEU A 1 98  ? 31.402 -12.399 21.763  1.00 84.94  ? 98   LEU A C   1 
ATOM   760  O  O   . LEU A 1 98  ? 31.524 -12.531 20.550  1.00 81.86  ? 98   LEU A O   1 
ATOM   761  C  CB  . LEU A 1 98  ? 33.549 -12.581 22.904  1.00 47.56  ? 98   LEU A CB  1 
ATOM   762  C  CG  . LEU A 1 98  ? 34.824 -12.118 23.637  1.00 62.91  ? 98   LEU A CG  1 
ATOM   763  C  CD1 . LEU A 1 98  ? 35.910 -11.617 22.763  1.00 62.53  ? 98   LEU A CD1 1 
ATOM   764  C  CD2 . LEU A 1 98  ? 34.391 -11.052 24.619  1.00 73.53  ? 98   LEU A CD2 1 
ATOM   765  N  N   . GLY A 1 99  ? 30.405 -12.964 22.434  1.00 75.32  ? 99   GLY A N   1 
ATOM   766  C  CA  . GLY A 1 99  ? 29.355 -13.667 21.726  1.00 65.35  ? 99   GLY A CA  1 
ATOM   767  C  C   . GLY A 1 99  ? 28.681 -12.631 20.839  1.00 85.81  ? 99   GLY A C   1 
ATOM   768  O  O   . GLY A 1 99  ? 28.878 -12.603 19.612  1.00 63.18  ? 99   GLY A O   1 
ATOM   769  N  N   . GLU A 1 100 ? 27.914 -11.748 21.477  1.00 75.10  ? 100  GLU A N   1 
ATOM   770  C  CA  . GLU A 1 100 ? 27.207 -10.692 20.758  1.00 90.61  ? 100  GLU A CA  1 
ATOM   771  C  C   . GLU A 1 100 ? 27.993 -10.137 19.537  1.00 70.05  ? 100  GLU A C   1 
ATOM   772  O  O   . GLU A 1 100 ? 27.501 -9.972  18.411  1.00 77.86  ? 100  GLU A O   1 
ATOM   773  C  CB  . GLU A 1 100 ? 26.935 -9.588  21.762  1.00 55.26  ? 100  GLU A CB  1 
ATOM   774  C  CG  . GLU A 1 100 ? 25.765 -9.884  22.635  1.00 68.28  ? 100  GLU A CG  1 
ATOM   775  C  CD  . GLU A 1 100 ? 25.618 -8.932  23.851  1.00 97.04  ? 100  GLU A CD  1 
ATOM   776  O  OE1 . GLU A 1 100 ? 26.570 -8.165  24.232  1.00 82.89  ? 100  GLU A OE1 1 
ATOM   777  O  OE2 . GLU A 1 100 ? 24.513 -8.980  24.452  1.00 89.69  ? 100  GLU A OE2 1 
ATOM   778  N  N   . PHE A 1 101 ? 29.258 -9.889  19.781  1.00 56.69  ? 101  PHE A N   1 
ATOM   779  C  CA  . PHE A 1 101 ? 30.157 -9.342  18.807  1.00 52.87  ? 101  PHE A CA  1 
ATOM   780  C  C   . PHE A 1 101 ? 30.477 -10.265 17.651  1.00 53.91  ? 101  PHE A C   1 
ATOM   781  O  O   . PHE A 1 101 ? 30.444 -9.863  16.499  1.00 92.64  ? 101  PHE A O   1 
ATOM   782  C  CB  . PHE A 1 101 ? 31.471 -8.955  19.542  1.00 34.54  ? 101  PHE A CB  1 
ATOM   783  C  CG  . PHE A 1 101 ? 32.564 -8.605  18.634  1.00 48.55  ? 101  PHE A CG  1 
ATOM   784  C  CD1 . PHE A 1 101 ? 32.613 -7.321  18.070  1.00 58.53  ? 101  PHE A CD1 1 
ATOM   785  C  CD2 . PHE A 1 101 ? 33.546 -9.525  18.308  1.00 53.21  ? 101  PHE A CD2 1 
ATOM   786  C  CE1 . PHE A 1 101 ? 33.662 -6.920  17.168  1.00 50.86  ? 101  PHE A CE1 1 
ATOM   787  C  CE2 . PHE A 1 101 ? 34.607 -9.188  17.422  1.00 64.70  ? 101  PHE A CE2 1 
ATOM   788  C  CZ  . PHE A 1 101 ? 34.658 -7.830  16.835  1.00 55.55  ? 101  PHE A CZ  1 
ATOM   789  N  N   . LEU A 1 102 ? 30.881 -11.490 17.984  1.00 84.07  ? 102  LEU A N   1 
ATOM   790  C  CA  . LEU A 1 102 ? 31.260 -12.478 16.970  1.00 69.29  ? 102  LEU A CA  1 
ATOM   791  C  C   . LEU A 1 102 ? 30.047 -12.798 16.030  1.00 80.99  ? 102  LEU A C   1 
ATOM   792  O  O   . LEU A 1 102 ? 30.240 -13.140 14.903  1.00 52.50  ? 102  LEU A O   1 
ATOM   793  C  CB  . LEU A 1 102 ? 31.779 -13.750 17.607  1.00 78.54  ? 102  LEU A CB  1 
ATOM   794  C  CG  . LEU A 1 102 ? 33.240 -13.596 18.000  1.00 75.94  ? 102  LEU A CG  1 
ATOM   795  C  CD1 . LEU A 1 102 ? 33.623 -14.780 18.778  1.00 69.55  ? 102  LEU A CD1 1 
ATOM   796  C  CD2 . LEU A 1 102 ? 34.133 -13.414 16.806  1.00 61.90  ? 102  LEU A CD2 1 
ATOM   797  N  N   . LYS A 1 103 ? 28.901 -12.759 16.541  1.00 43.62  ? 103  LYS A N   1 
ATOM   798  C  CA  . LYS A 1 103 ? 27.653 -12.865 15.780  1.00 50.45  ? 103  LYS A CA  1 
ATOM   799  C  C   . LYS A 1 103 ? 27.580 -11.680 14.728  1.00 84.13  ? 103  LYS A C   1 
ATOM   800  O  O   . LYS A 1 103 ? 27.384 -11.909 13.526  1.00 102.24 ? 103  LYS A O   1 
ATOM   801  C  CB  . LYS A 1 103 ? 26.461 -12.793 16.751  1.00 42.71  ? 103  LYS A CB  1 
ATOM   802  C  CG  . LYS A 1 103 ? 25.165 -12.984 16.095  1.00 82.77  ? 103  LYS A CG  1 
ATOM   803  C  CD  . LYS A 1 103 ? 24.101 -13.033 17.177  1.00 85.40  ? 103  LYS A CD  1 
ATOM   804  C  CE  . LYS A 1 103 ? 22.909 -13.903 16.796  1.00 90.63  ? 103  LYS A CE  1 
ATOM   805  N  NZ  . LYS A 1 103 ? 23.158 -14.566 15.509  1.00 108.92 ? 103  LYS A NZ  1 
ATOM   806  N  N   . LEU A 1 104 ? 27.781 -10.443 15.178  1.00 82.20  ? 104  LEU A N   1 
ATOM   807  C  CA  . LEU A 1 104 ? 27.737 -9.315  14.250  1.00 59.21  ? 104  LEU A CA  1 
ATOM   808  C  C   . LEU A 1 104 ? 28.905 -9.378  13.306  1.00 56.77  ? 104  LEU A C   1 
ATOM   809  O  O   . LEU A 1 104 ? 28.827 -8.900  12.163  1.00 91.16  ? 104  LEU A O   1 
ATOM   810  C  CB  . LEU A 1 104 ? 27.774 -7.960  14.989  1.00 59.76  ? 104  LEU A CB  1 
ATOM   811  C  CG  . LEU A 1 104 ? 26.687 -7.753  16.045  1.00 66.37  ? 104  LEU A CG  1 
ATOM   812  C  CD1 . LEU A 1 104 ? 27.099 -6.546  16.709  1.00 59.66  ? 104  LEU A CD1 1 
ATOM   813  C  CD2 . LEU A 1 104 ? 25.279 -7.607  15.480  1.00 81.99  ? 104  LEU A CD2 1 
ATOM   814  N  N   . ASP A 1 105 ? 30.011 -9.954  13.728  1.00 55.72  ? 105  ASP A N   1 
ATOM   815  C  CA  . ASP A 1 105 ? 31.040 -9.897  12.726  1.00 58.54  ? 105  ASP A CA  1 
ATOM   816  C  C   . ASP A 1 105 ? 30.668 -10.879 11.659  1.00 64.54  ? 105  ASP A C   1 
ATOM   817  O  O   . ASP A 1 105 ? 31.293 -10.956 10.613  1.00 65.87  ? 105  ASP A O   1 
ATOM   818  C  CB  . ASP A 1 105 ? 32.427 -10.213 13.239  1.00 40.52  ? 105  ASP A CB  1 
ATOM   819  C  CG  . ASP A 1 105 ? 33.440 -9.658  12.323  1.00 68.17  ? 105  ASP A CG  1 
ATOM   820  O  OD1 . ASP A 1 105 ? 33.089 -8.561  11.807  1.00 109.67 ? 105  ASP A OD1 1 
ATOM   821  O  OD2 . ASP A 1 105 ? 34.548 -10.223 12.105  1.00 66.05  ? 105  ASP A OD2 1 
ATOM   822  N  N   . ARG A 1 106 ? 29.645 -11.658 11.970  1.00 66.07  ? 106  ARG A N   1 
ATOM   823  C  CA  . ARG A 1 106 ? 29.126 -12.636 11.059  1.00 80.68  ? 106  ARG A CA  1 
ATOM   824  C  C   . ARG A 1 106 ? 28.179 -11.939 10.133  1.00 90.29  ? 106  ARG A C   1 
ATOM   825  O  O   . ARG A 1 106 ? 28.444 -12.053 8.951   1.00 73.07  ? 106  ARG A O   1 
ATOM   826  C  CB  . ARG A 1 106 ? 28.534 -13.832 11.795  1.00 70.31  ? 106  ARG A CB  1 
ATOM   827  C  CG  . ARG A 1 106 ? 29.704 -14.804 12.140  1.00 75.92  ? 106  ARG A CG  1 
ATOM   828  C  CD  . ARG A 1 106 ? 29.305 -16.196 12.617  1.00 78.14  ? 106  ARG A CD  1 
ATOM   829  N  NE  . ARG A 1 106 ? 28.270 -16.230 13.696  1.00 91.27  ? 106  ARG A NE  1 
ATOM   830  C  CZ  . ARG A 1 106 ? 28.529 -16.291 15.021  1.00 93.35  ? 106  ARG A CZ  1 
ATOM   831  N  NH1 . ARG A 1 106 ? 29.808 -16.333 15.461  1.00 50.84  ? 106  ARG A NH1 1 
ATOM   832  N  NH2 . ARG A 1 106 ? 27.537 -16.336 15.932  1.00 61.41  ? 106  ARG A NH2 1 
ATOM   833  N  N   . GLU A 1 107 ? 27.121 -11.233 10.577  1.00 64.23  ? 107  GLU A N   1 
ATOM   834  C  CA  . GLU A 1 107 ? 26.354 -10.508 9.532   1.00 66.58  ? 107  GLU A CA  1 
ATOM   835  C  C   . GLU A 1 107 ? 27.268 -9.660  8.591   1.00 63.22  ? 107  GLU A C   1 
ATOM   836  O  O   . GLU A 1 107 ? 27.191 -9.738  7.359   1.00 91.98  ? 107  GLU A O   1 
ATOM   837  C  CB  . GLU A 1 107 ? 25.369 -9.550  10.099  1.00 52.46  ? 107  GLU A CB  1 
ATOM   838  C  CG  . GLU A 1 107 ? 24.191 -10.144 10.883  1.00 73.39  ? 107  GLU A CG  1 
ATOM   839  C  CD  . GLU A 1 107 ? 22.986 -9.165  10.932  1.00 66.88  ? 107  GLU A CD  1 
ATOM   840  O  OE1 . GLU A 1 107 ? 22.794 -8.436  9.919   1.00 115.67 ? 107  GLU A OE1 1 
ATOM   841  O  OE2 . GLU A 1 107 ? 22.219 -9.137  11.951  1.00 99.98  ? 107  GLU A OE2 1 
ATOM   842  N  N   . ARG A 1 108 ? 28.137 -8.852  9.178   1.00 49.45  ? 108  ARG A N   1 
ATOM   843  C  CA  . ARG A 1 108 ? 29.029 -8.050  8.392   1.00 66.88  ? 108  ARG A CA  1 
ATOM   844  C  C   . ARG A 1 108 ? 29.587 -8.900  7.239   1.00 61.03  ? 108  ARG A C   1 
ATOM   845  O  O   . ARG A 1 108 ? 29.380 -8.579  6.063   1.00 70.93  ? 108  ARG A O   1 
ATOM   846  C  CB  . ARG A 1 108 ? 30.237 -7.505  9.218   1.00 50.45  ? 108  ARG A CB  1 
ATOM   847  C  CG  . ARG A 1 108 ? 30.647 -6.116  8.888   1.00 68.77  ? 108  ARG A CG  1 
ATOM   848  C  CD  . ARG A 1 108 ? 32.134 -5.910  8.551   1.00 52.88  ? 108  ARG A CD  1 
ATOM   849  N  NE  . ARG A 1 108 ? 32.994 -6.455  9.567   1.00 68.58  ? 108  ARG A NE  1 
ATOM   850  C  CZ  . ARG A 1 108 ? 34.296 -6.222  9.639   1.00 89.78  ? 108  ARG A CZ  1 
ATOM   851  N  NH1 . ARG A 1 108 ? 34.870 -5.416  8.775   1.00 61.96  ? 108  ARG A NH1 1 
ATOM   852  N  NH2 . ARG A 1 108 ? 35.047 -6.905  10.489  1.00 72.57  ? 108  ARG A NH2 1 
ATOM   853  N  N   . ALA A 1 109 ? 30.259 -10.000 7.559   1.00 78.14  ? 109  ALA A N   1 
ATOM   854  C  CA  . ALA A 1 109 ? 30.902 -10.694 6.459   1.00 65.65  ? 109  ALA A CA  1 
ATOM   855  C  C   . ALA A 1 109 ? 29.956 -11.276 5.449   1.00 79.51  ? 109  ALA A C   1 
ATOM   856  O  O   . ALA A 1 109 ? 30.250 -11.316 4.244   1.00 41.64  ? 109  ALA A O   1 
ATOM   857  C  CB  . ALA A 1 109 ? 31.922 -11.693 6.941   1.00 53.68  ? 109  ALA A CB  1 
ATOM   858  N  N   . LYS A 1 110 ? 28.788 -11.641 5.926   1.00 39.90  ? 110  LYS A N   1 
ATOM   859  C  CA  . LYS A 1 110 ? 27.694 -12.164 5.096   1.00 48.96  ? 110  LYS A CA  1 
ATOM   860  C  C   . LYS A 1 110 ? 27.314 -10.884 4.324   1.00 78.46  ? 110  LYS A C   1 
ATOM   861  O  O   . LYS A 1 110 ? 27.715 -10.766 3.187   1.00 73.20  ? 110  LYS A O   1 
ATOM   862  C  CB  . LYS A 1 110 ? 26.552 -12.675 6.025   1.00 59.00  ? 110  LYS A CB  1 
ATOM   863  C  CG  . LYS A 1 110 ? 25.299 -13.301 5.421   1.00 93.24  ? 110  LYS A CG  1 
ATOM   864  C  CD  . LYS A 1 110 ? 24.083 -13.343 6.416   1.00 109.99 ? 110  LYS A CD  1 
ATOM   865  C  CE  . LYS A 1 110 ? 24.332 -14.284 7.623   1.00 125.36 ? 110  LYS A CE  1 
ATOM   866  N  NZ  . LYS A 1 110 ? 23.626 -13.843 8.886   1.00 100.55 ? 110  LYS A NZ  1 
ATOM   867  N  N   . ASN A 1 111 ? 26.591 -9.933  4.921   1.00 71.12  ? 111  ASN A N   1 
ATOM   868  C  CA  . ASN A 1 111 ? 26.303 -8.676  4.240   1.00 63.14  ? 111  ASN A CA  1 
ATOM   869  C  C   . ASN A 1 111 ? 27.400 -8.298  3.210   1.00 79.10  ? 111  ASN A C   1 
ATOM   870  O  O   . ASN A 1 111 ? 27.140 -7.836  2.094   1.00 65.98  ? 111  ASN A O   1 
ATOM   871  C  CB  . ASN A 1 111 ? 26.319 -7.479  5.227   1.00 33.14  ? 111  ASN A CB  1 
ATOM   872  C  CG  . ASN A 1 111 ? 25.082 -7.412  6.117   1.00 82.69  ? 111  ASN A CG  1 
ATOM   873  O  OD1 . ASN A 1 111 ? 24.145 -8.222  5.979   1.00 63.47  ? 111  ASN A OD1 1 
ATOM   874  N  ND2 . ASN A 1 111 ? 25.075 -6.424  7.064   1.00 44.74  ? 111  ASN A ND2 1 
ATOM   875  N  N   . LYS A 1 112 ? 28.656 -8.434  3.601   1.00 53.09  ? 112  LYS A N   1 
ATOM   876  C  CA  . LYS A 1 112 ? 29.684 -8.017  2.678   1.00 72.56  ? 112  LYS A CA  1 
ATOM   877  C  C   . LYS A 1 112 ? 29.598 -8.763  1.365   1.00 72.64  ? 112  LYS A C   1 
ATOM   878  O  O   . LYS A 1 112 ? 29.659 -8.199  0.290   1.00 92.35  ? 112  LYS A O   1 
ATOM   879  C  CB  . LYS A 1 112 ? 31.076 -8.195  3.295   1.00 41.26  ? 112  LYS A CB  1 
ATOM   880  C  CG  . LYS A 1 112 ? 32.229 -7.647  2.372   1.00 56.16  ? 112  LYS A CG  1 
ATOM   881  C  CD  . LYS A 1 112 ? 33.670 -8.000  2.883   1.00 38.66  ? 112  LYS A CD  1 
ATOM   882  C  CE  . LYS A 1 112 ? 34.609 -7.376  1.887   1.00 53.35  ? 112  LYS A CE  1 
ATOM   883  N  NZ  . LYS A 1 112 ? 36.028 -7.667  2.257   1.00 55.96  ? 112  LYS A NZ  1 
ATOM   884  N  N   . ILE A 1 113 ? 29.465 -10.064 1.490   1.00 90.12  ? 113  ILE A N   1 
ATOM   885  C  CA  . ILE A 1 113 ? 29.381 -11.007 0.385   1.00 73.25  ? 113  ILE A CA  1 
ATOM   886  C  C   . ILE A 1 113 ? 28.107 -10.710 -0.470  1.00 80.87  ? 113  ILE A C   1 
ATOM   887  O  O   . ILE A 1 113 ? 28.156 -10.715 -1.674  1.00 53.69  ? 113  ILE A O   1 
ATOM   888  C  CB  . ILE A 1 113 ? 29.432 -12.470 1.009   1.00 76.75  ? 113  ILE A CB  1 
ATOM   889  C  CG1 . ILE A 1 113 ? 30.911 -13.016 1.015   1.00 48.95  ? 113  ILE A CG1 1 
ATOM   890  C  CG2 . ILE A 1 113 ? 28.386 -13.349 0.336   1.00 64.27  ? 113  ILE A CG2 1 
ATOM   891  C  CD1 . ILE A 1 113 ? 32.042 -11.866 0.878   1.00 79.86  ? 113  ILE A CD1 1 
ATOM   892  N  N   . ALA A 1 114 ? 26.971 -10.448 0.175   1.00 39.33  ? 114  ALA A N   1 
ATOM   893  C  CA  . ALA A 1 114 ? 25.766 -10.109 -0.536  1.00 59.73  ? 114  ALA A CA  1 
ATOM   894  C  C   . ALA A 1 114 ? 25.853 -8.784  -1.380  1.00 75.68  ? 114  ALA A C   1 
ATOM   895  O  O   . ALA A 1 114 ? 25.074 -8.558  -2.301  1.00 100.52 ? 114  ALA A O   1 
ATOM   896  C  CB  . ALA A 1 114 ? 24.623 -10.035 0.451   1.00 41.55  ? 114  ALA A CB  1 
ATOM   897  N  N   . LYS A 1 115 ? 26.820 -7.950  -1.044  1.00 66.26  ? 115  LYS A N   1 
ATOM   898  C  CA  . LYS A 1 115 ? 27.065 -6.674  -1.674  1.00 51.87  ? 115  LYS A CA  1 
ATOM   899  C  C   . LYS A 1 115 ? 28.012 -6.914  -2.816  1.00 50.60  ? 115  LYS A C   1 
ATOM   900  O  O   . LYS A 1 115 ? 27.946 -6.241  -3.862  1.00 83.35  ? 115  LYS A O   1 
ATOM   901  C  CB  . LYS A 1 115 ? 27.702 -5.684  -0.658  1.00 94.22  ? 115  LYS A CB  1 
ATOM   902  C  CG  . LYS A 1 115 ? 28.373 -4.393  -1.232  1.00 71.45  ? 115  LYS A CG  1 
ATOM   903  C  CD  . LYS A 1 115 ? 27.319 -3.474  -1.806  1.00 93.79  ? 115  LYS A CD  1 
ATOM   904  C  CE  . LYS A 1 115 ? 27.777 -2.081  -2.207  1.00 80.61  ? 115  LYS A CE  1 
ATOM   905  N  NZ  . LYS A 1 115 ? 26.503 -1.253  -2.088  1.00 64.02  ? 115  LYS A NZ  1 
ATOM   906  N  N   . GLU A 1 116 ? 28.958 -7.825  -2.626  1.00 50.27  ? 116  GLU A N   1 
ATOM   907  C  CA  . GLU A 1 116 ? 29.789 -8.109  -3.783  1.00 70.12  ? 116  GLU A CA  1 
ATOM   908  C  C   . GLU A 1 116 ? 29.002 -8.946  -4.875  1.00 76.29  ? 116  GLU A C   1 
ATOM   909  O  O   . GLU A 1 116 ? 29.412 -9.041  -6.004  1.00 64.68  ? 116  GLU A O   1 
ATOM   910  C  CB  . GLU A 1 116 ? 31.028 -8.812  -3.376  1.00 51.12  ? 116  GLU A CB  1 
ATOM   911  C  CG  . GLU A 1 116 ? 32.013 -8.874  -4.544  1.00 126.77 ? 116  GLU A CG  1 
ATOM   912  C  CD  . GLU A 1 116 ? 33.094 -9.891  -4.334  1.00 143.83 ? 116  GLU A CD  1 
ATOM   913  O  OE1 . GLU A 1 116 ? 33.211 -10.374 -3.179  1.00 123.58 ? 116  GLU A OE1 1 
ATOM   914  O  OE2 . GLU A 1 116 ? 33.813 -10.191 -5.324  1.00 126.19 ? 116  GLU A OE2 1 
ATOM   915  N  N   . THR A 1 117 ? 27.851 -9.502  -4.535  1.00 53.37  ? 117  THR A N   1 
ATOM   916  C  CA  . THR A 1 117 ? 27.025 -10.237 -5.452  1.00 87.86  ? 117  THR A CA  1 
ATOM   917  C  C   . THR A 1 117 ? 26.170 -9.235  -6.205  1.00 99.90  ? 117  THR A C   1 
ATOM   918  O  O   . THR A 1 117 ? 26.219 -9.196  -7.438  1.00 78.99  ? 117  THR A O   1 
ATOM   919  C  CB  . THR A 1 117 ? 26.198 -11.249 -4.658  1.00 53.06  ? 117  THR A CB  1 
ATOM   920  O  OG1 . THR A 1 117 ? 26.971 -12.413 -4.574  1.00 61.44  ? 117  THR A OG1 1 
ATOM   921  C  CG2 . THR A 1 117 ? 24.865 -11.567 -5.274  1.00 55.34  ? 117  THR A CG2 1 
ATOM   922  N  N   . ASN A 1 118 ? 25.416 -8.417  -5.469  1.00 90.73  ? 118  ASN A N   1 
ATOM   923  C  CA  . ASN A 1 118 ? 24.574 -7.410  -6.115  1.00 83.59  ? 118  ASN A CA  1 
ATOM   924  C  C   . ASN A 1 118 ? 25.464 -6.384  -6.829  1.00 64.79  ? 118  ASN A C   1 
ATOM   925  O  O   . ASN A 1 118 ? 24.979 -5.402  -7.390  1.00 100.88 ? 118  ASN A O   1 
ATOM   926  C  CB  . ASN A 1 118 ? 23.616 -6.763  -5.093  1.00 74.18  ? 118  ASN A CB  1 
ATOM   927  C  CG  . ASN A 1 118 ? 22.731 -5.601  -5.673  1.00 100.94 ? 118  ASN A CG  1 
ATOM   928  O  OD1 . ASN A 1 118 ? 23.230 -4.617  -6.225  1.00 96.09  ? 118  ASN A OD1 1 
ATOM   929  N  ND2 . ASN A 1 118 ? 21.413 -5.708  -5.476  1.00 79.75  ? 118  ASN A ND2 1 
ATOM   930  N  N   . ASN A 1 119 ? 26.767 -6.635  -6.854  1.00 68.47  ? 119  ASN A N   1 
ATOM   931  C  CA  . ASN A 1 119 ? 27.714 -5.757  -7.539  1.00 70.67  ? 119  ASN A CA  1 
ATOM   932  C  C   . ASN A 1 119 ? 28.257 -6.436  -8.794  1.00 74.91  ? 119  ASN A C   1 
ATOM   933  O  O   . ASN A 1 119 ? 28.659 -5.814  -9.772  1.00 89.97  ? 119  ASN A O   1 
ATOM   934  C  CB  . ASN A 1 119 ? 28.874 -5.468  -6.578  1.00 101.08 ? 119  ASN A CB  1 
ATOM   935  C  CG  . ASN A 1 119 ? 28.947 -3.981  -6.130  1.00 81.52  ? 119  ASN A CG  1 
ATOM   936  O  OD1 . ASN A 1 119 ? 30.010 -3.444  -6.194  1.00 76.29  ? 119  ASN A OD1 1 
ATOM   937  N  ND2 . ASN A 1 119 ? 27.810 -3.329  -5.684  1.00 52.81  ? 119  ASN A ND2 1 
ATOM   938  N  N   . LYS A 1 120 ? 28.323 -7.756  -8.720  1.00 101.14 ? 120  LYS A N   1 
ATOM   939  C  CA  . LYS A 1 120 ? 28.814 -8.533  -9.823  1.00 63.13  ? 120  LYS A CA  1 
ATOM   940  C  C   . LYS A 1 120 ? 27.646 -8.533  -10.776 1.00 98.18  ? 120  LYS A C   1 
ATOM   941  O  O   . LYS A 1 120 ? 27.793 -8.504  -11.999 1.00 52.62  ? 120  LYS A O   1 
ATOM   942  C  CB  . LYS A 1 120 ? 29.185 -9.945  -9.370  1.00 75.36  ? 120  LYS A CB  1 
ATOM   943  C  CG  . LYS A 1 120 ? 30.668 -9.993  -9.402  1.00 79.68  ? 120  LYS A CG  1 
ATOM   944  C  CD  . LYS A 1 120 ? 31.302 -11.118 -8.726  1.00 62.55  ? 120  LYS A CD  1 
ATOM   945  C  CE  . LYS A 1 120 ? 32.851 -10.892 -8.922  1.00 71.66  ? 120  LYS A CE  1 
ATOM   946  N  NZ  . LYS A 1 120 ? 33.568 -12.237 -8.830  1.00 89.23  ? 120  LYS A NZ  1 
ATOM   947  N  N   . LYS A 1 121 ? 26.459 -8.561  -10.181 1.00 37.74  ? 121  LYS A N   1 
ATOM   948  C  CA  . LYS A 1 121 ? 25.298 -8.470  -10.992 1.00 52.49  ? 121  LYS A CA  1 
ATOM   949  C  C   . LYS A 1 121 ? 25.273 -7.162  -11.826 1.00 92.55  ? 121  LYS A C   1 
ATOM   950  O  O   . LYS A 1 121 ? 25.151 -7.148  -13.070 1.00 77.63  ? 121  LYS A O   1 
ATOM   951  C  CB  . LYS A 1 121 ? 24.104 -8.444  -10.122 1.00 26.27  ? 121  LYS A CB  1 
ATOM   952  C  CG  . LYS A 1 121 ? 22.747 -8.315  -10.832 1.00 58.52  ? 121  LYS A CG  1 
ATOM   953  C  CD  . LYS A 1 121 ? 21.623 -8.305  -9.711  1.00 41.56  ? 121  LYS A CD  1 
ATOM   954  C  CE  . LYS A 1 121 ? 20.187 -8.411  -10.327 1.00 87.58  ? 121  LYS A CE  1 
ATOM   955  N  NZ  . LYS A 1 121 ? 19.061 -8.356  -9.284  1.00 75.03  ? 121  LYS A NZ  1 
ATOM   956  N  N   . LYS A 1 122 ? 25.289 -6.063  -11.089 1.00 86.42  ? 122  LYS A N   1 
ATOM   957  C  CA  . LYS A 1 122 ? 25.236 -4.747  -11.683 1.00 67.80  ? 122  LYS A CA  1 
ATOM   958  C  C   . LYS A 1 122 ? 26.315 -4.572  -12.728 1.00 57.05  ? 122  LYS A C   1 
ATOM   959  O  O   . LYS A 1 122 ? 26.151 -3.784  -13.670 1.00 92.39  ? 122  LYS A O   1 
ATOM   960  C  CB  . LYS A 1 122 ? 25.359 -3.663  -10.596 1.00 87.76  ? 122  LYS A CB  1 
ATOM   961  C  CG  . LYS A 1 122 ? 24.017 -3.227  -10.027 1.00 93.79  ? 122  LYS A CG  1 
ATOM   962  C  CD  . LYS A 1 122 ? 24.204 -2.005  -9.161  1.00 94.99  ? 122  LYS A CD  1 
ATOM   963  C  CE  . LYS A 1 122 ? 22.934 -1.638  -8.401  1.00 96.67  ? 122  LYS A CE  1 
ATOM   964  N  NZ  . LYS A 1 122 ? 23.288 -0.584  -7.394  1.00 104.41 ? 122  LYS A NZ  1 
ATOM   965  N  N   . GLU A 1 123 ? 27.377 -5.349  -12.630 1.00 62.16  ? 123  GLU A N   1 
ATOM   966  C  CA  . GLU A 1 123 ? 28.486 -5.216  -13.632 1.00 74.30  ? 123  GLU A CA  1 
ATOM   967  C  C   . GLU A 1 123 ? 28.249 -6.118  -14.869 1.00 90.60  ? 123  GLU A C   1 
ATOM   968  O  O   . GLU A 1 123 ? 28.863 -5.947  -15.926 1.00 86.68  ? 123  GLU A O   1 
ATOM   969  C  CB  . GLU A 1 123 ? 29.803 -5.587  -12.927 1.00 93.87  ? 123  GLU A CB  1 
ATOM   970  C  CG  . GLU A 1 123 ? 31.079 -5.662  -13.734 1.00 102.46 ? 123  GLU A CG  1 
ATOM   971  C  CD  . GLU A 1 123 ? 32.076 -6.655  -13.084 1.00 121.86 ? 123  GLU A CD  1 
ATOM   972  O  OE1 . GLU A 1 123 ? 31.770 -7.128  -11.962 1.00 131.14 ? 123  GLU A OE1 1 
ATOM   973  O  OE2 . GLU A 1 123 ? 33.148 -6.978  -13.666 1.00 101.22 ? 123  GLU A OE2 1 
ATOM   974  N  N   . PHE A 1 124 ? 27.323 -7.059  -14.714 1.00 80.58  ? 124  PHE A N   1 
ATOM   975  C  CA  . PHE A 1 124 ? 26.945 -8.068  -15.705 1.00 73.98  ? 124  PHE A CA  1 
ATOM   976  C  C   . PHE A 1 124 ? 25.961 -7.379  -16.633 1.00 79.93  ? 124  PHE A C   1 
ATOM   977  O  O   . PHE A 1 124 ? 26.165 -7.372  -17.843 1.00 54.05  ? 124  PHE A O   1 
ATOM   978  C  CB  . PHE A 1 124 ? 26.289 -9.240  -14.957 1.00 96.58  ? 124  PHE A CB  1 
ATOM   979  C  CG  . PHE A 1 124 ? 25.602 -10.230 -15.835 1.00 77.75  ? 124  PHE A CG  1 
ATOM   980  C  CD1 . PHE A 1 124 ? 26.345 -11.066 -16.652 1.00 105.70 ? 124  PHE A CD1 1 
ATOM   981  C  CD2 . PHE A 1 124 ? 24.201 -10.285 -15.889 1.00 95.12  ? 124  PHE A CD2 1 
ATOM   982  C  CE1 . PHE A 1 124 ? 25.709 -11.945 -17.514 1.00 75.75  ? 124  PHE A CE1 1 
ATOM   983  C  CE2 . PHE A 1 124 ? 23.544 -11.157 -16.758 1.00 66.78  ? 124  PHE A CE2 1 
ATOM   984  C  CZ  . PHE A 1 124 ? 24.300 -11.985 -17.566 1.00 92.76  ? 124  PHE A CZ  1 
ATOM   985  N  N   . GLU A 1 125 ? 24.870 -6.896  -16.035 1.00 43.78  ? 125  GLU A N   1 
ATOM   986  C  CA  . GLU A 1 125 ? 23.855 -6.064  -16.689 1.00 69.62  ? 125  GLU A CA  1 
ATOM   987  C  C   . GLU A 1 125 ? 24.516 -4.919  -17.478 1.00 79.50  ? 125  GLU A C   1 
ATOM   988  O  O   . GLU A 1 125 ? 24.198 -4.633  -18.633 1.00 84.76  ? 125  GLU A O   1 
ATOM   989  C  CB  . GLU A 1 125 ? 22.930 -5.411  -15.655 1.00 42.14  ? 125  GLU A CB  1 
ATOM   990  C  CG  . GLU A 1 125 ? 22.141 -6.478  -14.991 1.00 58.93  ? 125  GLU A CG  1 
ATOM   991  C  CD  . GLU A 1 125 ? 21.102 -5.960  -14.035 1.00 88.06  ? 125  GLU A CD  1 
ATOM   992  O  OE1 . GLU A 1 125 ? 21.372 -4.906  -13.446 1.00 86.83  ? 125  GLU A OE1 1 
ATOM   993  O  OE2 . GLU A 1 125 ? 20.038 -6.624  -13.864 1.00 91.30  ? 125  GLU A OE2 1 
ATOM   994  N  N   . GLU A 1 126 ? 25.417 -4.228  -16.835 1.00 71.96  ? 126  GLU A N   1 
ATOM   995  C  CA  . GLU A 1 126 ? 26.088 -3.203  -17.561 1.00 87.34  ? 126  GLU A CA  1 
ATOM   996  C  C   . GLU A 1 126 ? 26.653 -3.794  -18.873 1.00 55.58  ? 126  GLU A C   1 
ATOM   997  O  O   . GLU A 1 126 ? 26.373 -3.286  -19.953 1.00 79.91  ? 126  GLU A O   1 
ATOM   998  C  CB  . GLU A 1 126 ? 27.202 -2.619  -16.690 1.00 103.77 ? 126  GLU A CB  1 
ATOM   999  C  CG  . GLU A 1 126 ? 28.154 -1.693  -17.413 1.00 132.71 ? 126  GLU A CG  1 
ATOM   1000 C  CD  . GLU A 1 126 ? 29.611 -1.969  -17.042 1.00 152.62 ? 126  GLU A CD  1 
ATOM   1001 O  OE1 . GLU A 1 126 ? 30.167 -3.021  -17.471 1.00 147.53 ? 126  GLU A OE1 1 
ATOM   1002 O  OE2 . GLU A 1 126 ? 30.189 -1.132  -16.310 1.00 157.10 ? 126  GLU A OE2 1 
ATOM   1003 N  N   . THR A 1 127 ? 27.481 -4.830  -18.785 1.00 64.23  ? 127  THR A N   1 
ATOM   1004 C  CA  . THR A 1 127 ? 28.114 -5.453  -19.966 1.00 67.14  ? 127  THR A CA  1 
ATOM   1005 C  C   . THR A 1 127 ? 27.126 -6.018  -21.048 1.00 78.77  ? 127  THR A C   1 
ATOM   1006 O  O   . THR A 1 127 ? 27.432 -6.080  -22.206 1.00 65.23  ? 127  THR A O   1 
ATOM   1007 C  CB  . THR A 1 127 ? 29.065 -6.524  -19.454 1.00 66.95  ? 127  THR A CB  1 
ATOM   1008 O  OG1 . THR A 1 127 ? 30.395 -6.033  -19.606 1.00 73.01  ? 127  THR A OG1 1 
ATOM   1009 C  CG2 . THR A 1 127 ? 28.891 -7.843  -20.181 1.00 102.50 ? 127  THR A CG2 1 
ATOM   1010 N  N   . ALA A 1 128 ? 25.954 -6.445  -20.634 1.00 50.29  ? 128  ALA A N   1 
ATOM   1011 C  CA  . ALA A 1 128 ? 24.934 -6.929  -21.480 1.00 55.01  ? 128  ALA A CA  1 
ATOM   1012 C  C   . ALA A 1 128 ? 24.480 -5.724  -22.325 1.00 90.73  ? 128  ALA A C   1 
ATOM   1013 O  O   . ALA A 1 128 ? 24.531 -5.780  -23.564 1.00 55.11  ? 128  ALA A O   1 
ATOM   1014 C  CB  . ALA A 1 128 ? 23.800 -7.425  -20.622 1.00 51.04  ? 128  ALA A CB  1 
ATOM   1015 N  N   . LYS A 1 129 ? 24.062 -4.641  -21.653 1.00 73.40  ? 129  LYS A N   1 
ATOM   1016 C  CA  . LYS A 1 129 ? 23.613 -3.414  -22.338 1.00 65.13  ? 129  LYS A CA  1 
ATOM   1017 C  C   . LYS A 1 129 ? 24.566 -3.017  -23.488 1.00 58.30  ? 129  LYS A C   1 
ATOM   1018 O  O   . LYS A 1 129 ? 24.142 -2.599  -24.568 1.00 81.13  ? 129  LYS A O   1 
ATOM   1019 C  CB  . LYS A 1 129 ? 23.493 -2.216  -21.357 1.00 64.28  ? 129  LYS A CB  1 
ATOM   1020 C  CG  . LYS A 1 129 ? 22.090 -1.930  -20.851 1.00 89.21  ? 129  LYS A CG  1 
ATOM   1021 C  CD  . LYS A 1 129 ? 21.668 -0.456  -21.000 1.00 86.65  ? 129  LYS A CD  1 
ATOM   1022 C  CE  . LYS A 1 129 ? 20.140 -0.238  -20.675 1.00 89.28  ? 129  LYS A CE  1 
ATOM   1023 N  NZ  . LYS A 1 129 ? 19.624 1.180   -20.861 1.00 101.21 ? 129  LYS A NZ  1 
ATOM   1024 N  N   . LYS A 1 130 ? 25.859 -3.200  -23.273 1.00 53.11  ? 130  LYS A N   1 
ATOM   1025 C  CA  . LYS A 1 130 ? 26.814 -2.834  -24.295 1.00 68.18  ? 130  LYS A CA  1 
ATOM   1026 C  C   . LYS A 1 130 ? 26.904 -3.907  -25.348 1.00 77.89  ? 130  LYS A C   1 
ATOM   1027 O  O   . LYS A 1 130 ? 27.329 -3.646  -26.451 1.00 87.80  ? 130  LYS A O   1 
ATOM   1028 C  CB  . LYS A 1 130 ? 28.191 -2.602  -23.676 1.00 65.51  ? 130  LYS A CB  1 
ATOM   1029 C  CG  . LYS A 1 130 ? 28.179 -1.652  -22.464 1.00 92.18  ? 130  LYS A CG  1 
ATOM   1030 C  CD  . LYS A 1 130 ? 29.631 -1.469  -21.984 1.00 112.54 ? 130  LYS A CD  1 
ATOM   1031 C  CE  . LYS A 1 130 ? 29.771 -0.331  -20.959 1.00 137.84 ? 130  LYS A CE  1 
ATOM   1032 N  NZ  . LYS A 1 130 ? 31.174 -0.167  -20.438 1.00 145.29 ? 130  LYS A NZ  1 
ATOM   1033 N  N   . VAL A 1 131 ? 26.501 -5.127  -25.024 1.00 71.61  ? 131  VAL A N   1 
ATOM   1034 C  CA  . VAL A 1 131 ? 26.642 -6.148  -26.018 1.00 56.82  ? 131  VAL A CA  1 
ATOM   1035 C  C   . VAL A 1 131 ? 25.408 -5.956  -26.865 1.00 80.61  ? 131  VAL A C   1 
ATOM   1036 O  O   . VAL A 1 131 ? 25.513 -5.894  -28.070 1.00 53.49  ? 131  VAL A O   1 
ATOM   1037 C  CB  . VAL A 1 131 ? 26.774 -7.554  -25.357 1.00 76.33  ? 131  VAL A CB  1 
ATOM   1038 C  CG1 . VAL A 1 131 ? 25.472 -8.393  -25.418 1.00 55.25  ? 131  VAL A CG1 1 
ATOM   1039 C  CG2 . VAL A 1 131 ? 27.859 -8.253  -26.027 1.00 53.30  ? 131  VAL A CG2 1 
ATOM   1040 N  N   . ARG A 1 132 ? 24.245 -5.827  -26.223 1.00 44.94  ? 132  ARG A N   1 
ATOM   1041 C  CA  . ARG A 1 132 ? 23.033 -5.572  -26.932 1.00 58.99  ? 132  ARG A CA  1 
ATOM   1042 C  C   . ARG A 1 132 ? 23.172 -4.401  -27.966 1.00 89.29  ? 132  ARG A C   1 
ATOM   1043 O  O   . ARG A 1 132 ? 22.968 -4.541  -29.204 1.00 65.79  ? 132  ARG A O   1 
ATOM   1044 C  CB  . ARG A 1 132 ? 21.923 -5.234  -25.947 1.00 46.50  ? 132  ARG A CB  1 
ATOM   1045 C  CG  . ARG A 1 132 ? 20.801 -4.417  -26.635 1.00 71.89  ? 132  ARG A CG  1 
ATOM   1046 C  CD  . ARG A 1 132 ? 19.528 -4.454  -25.805 1.00 87.26  ? 132  ARG A CD  1 
ATOM   1047 N  NE  . ARG A 1 132 ? 18.435 -3.769  -26.519 1.00 110.12 ? 132  ARG A NE  1 
ATOM   1048 C  CZ  . ARG A 1 132 ? 17.184 -3.610  -26.065 1.00 130.03 ? 132  ARG A CZ  1 
ATOM   1049 N  NH1 . ARG A 1 132 ? 16.828 -4.100  -24.860 1.00 114.25 ? 132  ARG A NH1 1 
ATOM   1050 N  NH2 . ARG A 1 132 ? 16.288 -2.939  -26.821 1.00 75.58  ? 132  ARG A NH2 1 
ATOM   1051 N  N   . ARG A 1 133 ? 23.522 -3.246  -27.419 1.00 76.62  ? 133  ARG A N   1 
ATOM   1052 C  CA  . ARG A 1 133 ? 23.672 -2.051  -28.221 1.00 75.34  ? 133  ARG A CA  1 
ATOM   1053 C  C   . ARG A 1 133 ? 24.543 -2.322  -29.455 1.00 53.07  ? 133  ARG A C   1 
ATOM   1054 O  O   . ARG A 1 133 ? 24.208 -1.981  -30.606 1.00 101.92 ? 133  ARG A O   1 
ATOM   1055 C  CB  . ARG A 1 133 ? 24.276 -0.920  -27.334 1.00 105.86 ? 133  ARG A CB  1 
ATOM   1056 C  CG  . ARG A 1 133 ? 24.109 0.538   -27.851 1.00 143.42 ? 133  ARG A CG  1 
ATOM   1057 C  CD  . ARG A 1 133 ? 24.834 1.568   -26.927 1.00 153.27 ? 133  ARG A CD  1 
ATOM   1058 N  NE  . ARG A 1 133 ? 24.901 2.947   -27.458 1.00 167.80 ? 133  ARG A NE  1 
ATOM   1059 C  CZ  . ARG A 1 133 ? 25.821 3.867   -27.115 1.00 160.91 ? 133  ARG A CZ  1 
ATOM   1060 N  NH1 . ARG A 1 133 ? 26.775 3.578   -26.232 1.00 144.63 ? 133  ARG A NH1 1 
ATOM   1061 N  NH2 . ARG A 1 133 ? 25.805 5.085   -27.661 1.00 156.92 ? 133  ARG A NH2 1 
ATOM   1062 N  N   . ALA A 1 134 ? 25.663 -2.951  -29.211 1.00 51.44  ? 134  ALA A N   1 
ATOM   1063 C  CA  . ALA A 1 134 ? 26.615 -3.220  -30.259 1.00 53.16  ? 134  ALA A CA  1 
ATOM   1064 C  C   . ALA A 1 134 ? 26.044 -4.109  -31.346 1.00 88.15  ? 134  ALA A C   1 
ATOM   1065 O  O   . ALA A 1 134 ? 26.441 -3.969  -32.479 1.00 74.98  ? 134  ALA A O   1 
ATOM   1066 C  CB  . ALA A 1 134 ? 27.819 -3.880  -29.682 1.00 53.00  ? 134  ALA A CB  1 
ATOM   1067 N  N   . ILE A 1 135 ? 25.129 -5.017  -31.000 1.00 62.61  ? 135  ILE A N   1 
ATOM   1068 C  CA  . ILE A 1 135 ? 24.536 -5.946  -31.954 1.00 75.16  ? 135  ILE A CA  1 
ATOM   1069 C  C   . ILE A 1 135 ? 23.574 -5.189  -32.910 1.00 85.48  ? 135  ILE A C   1 
ATOM   1070 O  O   . ILE A 1 135 ? 23.590 -5.361  -34.141 1.00 67.79  ? 135  ILE A O   1 
ATOM   1071 C  CB  . ILE A 1 135 ? 23.767 -7.047  -31.183 1.00 87.33  ? 135  ILE A CB  1 
ATOM   1072 C  CG1 . ILE A 1 135 ? 24.687 -8.187  -30.688 1.00 71.52  ? 135  ILE A CG1 1 
ATOM   1073 C  CG2 . ILE A 1 135 ? 22.698 -7.519  -32.039 1.00 75.59  ? 135  ILE A CG2 1 
ATOM   1074 C  CD1 . ILE A 1 135 ? 26.027 -7.680  -30.130 1.00 85.99  ? 135  ILE A CD1 1 
ATOM   1075 N  N   . GLU A 1 136 ? 22.716 -4.385  -32.303 1.00 63.09  ? 136  GLU A N   1 
ATOM   1076 C  CA  . GLU A 1 136 ? 21.774 -3.521  -32.993 1.00 65.85  ? 136  GLU A CA  1 
ATOM   1077 C  C   . GLU A 1 136 ? 22.499 -2.618  -34.016 1.00 63.36  ? 136  GLU A C   1 
ATOM   1078 O  O   . GLU A 1 136 ? 21.990 -2.372  -35.103 1.00 100.43 ? 136  GLU A O   1 
ATOM   1079 C  CB  . GLU A 1 136 ? 21.056 -2.649  -31.980 1.00 71.62  ? 136  GLU A CB  1 
ATOM   1080 C  CG  . GLU A 1 136 ? 20.182 -3.447  -30.945 1.00 64.89  ? 136  GLU A CG  1 
ATOM   1081 C  CD  . GLU A 1 136 ? 19.518 -2.543  -29.860 1.00 111.14 ? 136  GLU A CD  1 
ATOM   1082 O  OE1 . GLU A 1 136 ? 20.168 -1.477  -29.550 1.00 91.79  ? 136  GLU A OE1 1 
ATOM   1083 O  OE2 . GLU A 1 136 ? 18.384 -2.918  -29.335 1.00 72.46  ? 136  GLU A OE2 1 
ATOM   1084 N  N   . GLN A 1 137 ? 23.687 -2.147  -33.693 1.00 70.95  ? 137  GLN A N   1 
ATOM   1085 C  CA  . GLN A 1 137 ? 24.416 -1.301  -34.623 1.00 73.25  ? 137  GLN A CA  1 
ATOM   1086 C  C   . GLN A 1 137 ? 24.961 -2.129  -35.761 1.00 84.58  ? 137  GLN A C   1 
ATOM   1087 O  O   . GLN A 1 137 ? 25.429 -1.649  -36.778 1.00 101.16 ? 137  GLN A O   1 
ATOM   1088 C  CB  . GLN A 1 137 ? 25.556 -0.575  -33.890 1.00 88.07  ? 137  GLN A CB  1 
ATOM   1089 C  CG  . GLN A 1 137 ? 25.057 0.701   -33.193 1.00 116.32 ? 137  GLN A CG  1 
ATOM   1090 C  CD  . GLN A 1 137 ? 26.142 1.426   -32.426 1.00 123.67 ? 137  GLN A CD  1 
ATOM   1091 O  OE1 . GLN A 1 137 ? 27.272 1.575   -32.916 1.00 98.34  ? 137  GLN A OE1 1 
ATOM   1092 N  NE2 . GLN A 1 137 ? 25.807 1.895   -31.224 1.00 114.41 ? 137  GLN A NE2 1 
ATOM   1093 N  N   . LEU A 1 138 ? 24.888 -3.413  -35.594 1.00 91.34  ? 138  LEU A N   1 
ATOM   1094 C  CA  . LEU A 1 138 ? 25.401 -4.280  -36.611 1.00 81.46  ? 138  LEU A CA  1 
ATOM   1095 C  C   . LEU A 1 138 ? 24.183 -5.054  -37.142 1.00 98.62  ? 138  LEU A C   1 
ATOM   1096 O  O   . LEU A 1 138 ? 24.200 -6.279  -37.365 1.00 95.49  ? 138  LEU A O   1 
ATOM   1097 C  CB  . LEU A 1 138 ? 26.399 -5.221  -35.952 1.00 65.30  ? 138  LEU A CB  1 
ATOM   1098 C  CG  . LEU A 1 138 ? 27.889 -5.227  -36.258 1.00 74.08  ? 138  LEU A CG  1 
ATOM   1099 C  CD1 . LEU A 1 138 ? 28.483 -3.848  -36.311 1.00 78.33  ? 138  LEU A CD1 1 
ATOM   1100 C  CD2 . LEU A 1 138 ? 28.539 -6.076  -35.195 1.00 72.79  ? 138  LEU A CD2 1 
ATOM   1101 N  N   . ALA A 1 139 ? 23.121 -4.308  -37.343 1.00 94.08  ? 139  ALA A N   1 
ATOM   1102 C  CA  . ALA A 1 139 ? 21.898 -4.888  -37.805 1.00 90.55  ? 139  ALA A CA  1 
ATOM   1103 C  C   . ALA A 1 139 ? 21.130 -3.667  -38.293 1.00 112.47 ? 139  ALA A C   1 
ATOM   1104 O  O   . ALA A 1 139 ? 19.985 -3.414  -37.897 1.00 111.79 ? 139  ALA A O   1 
ATOM   1105 C  CB  . ALA A 1 139 ? 21.197 -5.574  -36.626 1.00 68.35  ? 139  ALA A CB  1 
ATOM   1106 N  N   . ALA A 1 140 ? 21.798 -2.886  -39.133 1.00 100.83 ? 140  ALA A N   1 
ATOM   1107 C  CA  . ALA A 1 140 ? 21.211 -1.676  -39.680 1.00 107.51 ? 140  ALA A CA  1 
ATOM   1108 C  C   . ALA A 1 140 ? 22.230 -1.147  -40.664 1.00 118.66 ? 140  ALA A C   1 
ATOM   1109 O  O   . ALA A 1 140 ? 23.354 -1.712  -40.671 1.00 90.11  ? 140  ALA A O   1 
ATOM   1110 C  CB  . ALA A 1 140 ? 20.963 -0.643  -38.548 1.00 75.32  ? 140  ALA A CB  1 
ATOM   1111 N  N   . LEU B 1 6   ? 38.190 -15.030 14.292  1.00 96.14  ? 6    LEU B N   1 
ATOM   1112 C  CA  . LEU B 1 6   ? 39.098 -14.944 15.480  1.00 107.62 ? 6    LEU B CA  1 
ATOM   1113 C  C   . LEU B 1 6   ? 40.616 -15.087 15.120  1.00 108.25 ? 6    LEU B C   1 
ATOM   1114 O  O   . LEU B 1 6   ? 41.075 -16.193 14.809  1.00 96.42  ? 6    LEU B O   1 
ATOM   1115 C  CB  . LEU B 1 6   ? 38.688 -16.023 16.490  1.00 95.85  ? 6    LEU B CB  1 
ATOM   1116 C  CG  . LEU B 1 6   ? 39.282 -15.873 17.908  1.00 105.59 ? 6    LEU B CG  1 
ATOM   1117 C  CD1 . LEU B 1 6   ? 40.777 -15.439 17.922  1.00 67.52  ? 6    LEU B CD1 1 
ATOM   1118 C  CD2 . LEU B 1 6   ? 38.496 -14.824 18.615  1.00 99.04  ? 6    LEU B CD2 1 
ATOM   1119 N  N   . PRO B 1 7   ? 41.411 -13.982 15.217  1.00 112.84 ? 7    PRO B N   1 
ATOM   1120 C  CA  . PRO B 1 7   ? 42.854 -13.933 14.909  1.00 86.27  ? 7    PRO B CA  1 
ATOM   1121 C  C   . PRO B 1 7   ? 43.697 -15.066 15.389  1.00 87.03  ? 7    PRO B C   1 
ATOM   1122 O  O   . PRO B 1 7   ? 43.168 -16.011 15.932  1.00 113.44 ? 7    PRO B O   1 
ATOM   1123 C  CB  . PRO B 1 7   ? 43.301 -12.596 15.483  1.00 62.96  ? 7    PRO B CB  1 
ATOM   1124 C  CG  . PRO B 1 7   ? 42.260 -12.245 16.425  1.00 96.69  ? 7    PRO B CG  1 
ATOM   1125 C  CD  . PRO B 1 7   ? 41.002 -12.676 15.771  1.00 78.65  ? 7    PRO B CD  1 
ATOM   1126 N  N   . PRO B 1 8   ? 45.029 -14.983 15.199  1.00 92.14  ? 8    PRO B N   1 
ATOM   1127 C  CA  . PRO B 1 8   ? 45.985 -16.024 15.621  1.00 123.92 ? 8    PRO B CA  1 
ATOM   1128 C  C   . PRO B 1 8   ? 46.832 -15.721 16.878  1.00 127.59 ? 8    PRO B C   1 
ATOM   1129 O  O   . PRO B 1 8   ? 47.895 -16.340 17.087  1.00 116.93 ? 8    PRO B O   1 
ATOM   1130 C  CB  . PRO B 1 8   ? 46.877 -16.158 14.401  1.00 127.96 ? 8    PRO B CB  1 
ATOM   1131 C  CG  . PRO B 1 8   ? 47.088 -14.678 14.061  1.00 140.92 ? 8    PRO B CG  1 
ATOM   1132 C  CD  . PRO B 1 8   ? 45.716 -13.979 14.368  1.00 115.96 ? 8    PRO B CD  1 
ATOM   1133 N  N   . ALA B 1 9   ? 46.396 -14.768 17.696  1.00 121.29 ? 9    ALA B N   1 
ATOM   1134 C  CA  . ALA B 1 9   ? 47.155 -14.442 18.892  1.00 98.67  ? 9    ALA B CA  1 
ATOM   1135 C  C   . ALA B 1 9   ? 46.220 -14.593 20.063  1.00 79.23  ? 9    ALA B C   1 
ATOM   1136 O  O   . ALA B 1 9   ? 46.651 -14.721 21.198  1.00 105.21 ? 9    ALA B O   1 
ATOM   1137 C  CB  . ALA B 1 9   ? 47.666 -13.051 18.807  1.00 81.03  ? 9    ALA B CB  1 
ATOM   1138 N  N   . TRP B 1 10  ? 44.937 -14.611 19.743  1.00 70.53  ? 10   TRP B N   1 
ATOM   1139 C  CA  . TRP B 1 10  ? 43.879 -14.745 20.713  1.00 70.37  ? 10   TRP B CA  1 
ATOM   1140 C  C   . TRP B 1 10  ? 43.416 -16.196 20.779  1.00 85.56  ? 10   TRP B C   1 
ATOM   1141 O  O   . TRP B 1 10  ? 42.505 -16.557 21.576  1.00 59.83  ? 10   TRP B O   1 
ATOM   1142 C  CB  . TRP B 1 10  ? 42.667 -13.882 20.294  1.00 85.23  ? 10   TRP B CB  1 
ATOM   1143 C  CG  . TRP B 1 10  ? 42.847 -12.382 20.221  1.00 121.47 ? 10   TRP B CG  1 
ATOM   1144 C  CD1 . TRP B 1 10  ? 44.028 -11.663 20.151  1.00 121.21 ? 10   TRP B CD1 1 
ATOM   1145 C  CD2 . TRP B 1 10  ? 41.779 -11.418 20.154  1.00 127.74 ? 10   TRP B CD2 1 
ATOM   1146 N  NE1 . TRP B 1 10  ? 43.744 -10.315 20.037  1.00 134.47 ? 10   TRP B NE1 1 
ATOM   1147 C  CE2 . TRP B 1 10  ? 42.375 -10.135 20.029  1.00 139.10 ? 10   TRP B CE2 1 
ATOM   1148 C  CE3 . TRP B 1 10  ? 40.354 -11.520 20.165  1.00 109.61 ? 10   TRP B CE3 1 
ATOM   1149 C  CZ2 . TRP B 1 10  ? 41.598 -8.949  19.938  1.00 139.88 ? 10   TRP B CZ2 1 
ATOM   1150 C  CZ3 . TRP B 1 10  ? 39.567 -10.335 20.072  1.00 86.13  ? 10   TRP B CZ3 1 
ATOM   1151 C  CH2 . TRP B 1 10  ? 40.203 -9.074  19.952  1.00 137.74 ? 10   TRP B CH2 1 
ATOM   1152 N  N   . GLN B 1 11  ? 44.011 -17.036 19.940  1.00 77.82  ? 11   GLN B N   1 
ATOM   1153 C  CA  . GLN B 1 11  ? 43.517 -18.392 19.906  1.00 75.51  ? 11   GLN B CA  1 
ATOM   1154 C  C   . GLN B 1 11  ? 43.694 -19.125 21.204  1.00 84.73  ? 11   GLN B C   1 
ATOM   1155 O  O   . GLN B 1 11  ? 42.762 -19.814 21.620  1.00 50.95  ? 11   GLN B O   1 
ATOM   1156 C  CB  . GLN B 1 11  ? 44.157 -19.151 18.801  1.00 69.11  ? 11   GLN B CB  1 
ATOM   1157 C  CG  . GLN B 1 11  ? 43.584 -18.727 17.525  1.00 91.39  ? 11   GLN B CG  1 
ATOM   1158 C  CD  . GLN B 1 11  ? 44.205 -19.450 16.389  1.00 102.63 ? 11   GLN B CD  1 
ATOM   1159 O  OE1 . GLN B 1 11  ? 45.401 -19.310 16.137  1.00 91.08  ? 11   GLN B OE1 1 
ATOM   1160 N  NE2 . GLN B 1 11  ? 43.407 -20.252 15.696  1.00 113.26 ? 11   GLN B NE2 1 
ATOM   1161 N  N   . PRO B 1 12  ? 44.866 -18.970 21.878  1.00 42.57  ? 12   PRO B N   1 
ATOM   1162 C  CA  . PRO B 1 12  ? 45.279 -19.566 23.162  1.00 41.80  ? 12   PRO B CA  1 
ATOM   1163 C  C   . PRO B 1 12  ? 44.157 -19.472 24.194  1.00 55.59  ? 12   PRO B C   1 
ATOM   1164 O  O   . PRO B 1 12  ? 43.903 -20.370 25.062  1.00 62.45  ? 12   PRO B O   1 
ATOM   1165 C  CB  . PRO B 1 12  ? 46.502 -18.763 23.501  1.00 78.28  ? 12   PRO B CB  1 
ATOM   1166 C  CG  . PRO B 1 12  ? 47.162 -18.644 22.163  1.00 46.33  ? 12   PRO B CG  1 
ATOM   1167 C  CD  . PRO B 1 12  ? 46.017 -18.284 21.243  1.00 66.76  ? 12   PRO B CD  1 
ATOM   1168 N  N   . PHE B 1 13  ? 43.401 -18.421 23.945  1.00 38.61  ? 13   PHE B N   1 
ATOM   1169 C  CA  . PHE B 1 13  ? 42.308 -17.965 24.775  1.00 45.65  ? 13   PHE B CA  1 
ATOM   1170 C  C   . PHE B 1 13  ? 41.122 -18.879 24.632  1.00 48.97  ? 13   PHE B C   1 
ATOM   1171 O  O   . PHE B 1 13  ? 40.115 -18.860 25.458  1.00 58.00  ? 13   PHE B O   1 
ATOM   1172 C  CB  . PHE B 1 13  ? 41.944 -16.455 24.451  1.00 59.69  ? 13   PHE B CB  1 
ATOM   1173 C  CG  . PHE B 1 13  ? 42.563 -15.445 25.372  1.00 48.62  ? 13   PHE B CG  1 
ATOM   1174 C  CD1 . PHE B 1 13  ? 43.756 -14.862 25.040  1.00 52.98  ? 13   PHE B CD1 1 
ATOM   1175 C  CD2 . PHE B 1 13  ? 42.004 -15.140 26.636  1.00 65.40  ? 13   PHE B CD2 1 
ATOM   1176 C  CE1 . PHE B 1 13  ? 44.419 -13.975 25.956  1.00 56.37  ? 13   PHE B CE1 1 
ATOM   1177 C  CE2 . PHE B 1 13  ? 42.673 -14.253 27.587  1.00 49.21  ? 13   PHE B CE2 1 
ATOM   1178 C  CZ  . PHE B 1 13  ? 43.865 -13.686 27.229  1.00 68.97  ? 13   PHE B CZ  1 
ATOM   1179 N  N   . LEU B 1 14  ? 41.265 -19.722 23.644  1.00 48.79  ? 14   LEU B N   1 
ATOM   1180 C  CA  . LEU B 1 14  ? 40.206 -20.673 23.298  1.00 75.24  ? 14   LEU B CA  1 
ATOM   1181 C  C   . LEU B 1 14  ? 40.508 -22.125 23.704  1.00 45.57  ? 14   LEU B C   1 
ATOM   1182 O  O   . LEU B 1 14  ? 41.574 -22.656 23.258  1.00 49.13  ? 14   LEU B O   1 
ATOM   1183 C  CB  . LEU B 1 14  ? 40.051 -20.633 21.790  1.00 78.19  ? 14   LEU B CB  1 
ATOM   1184 C  CG  . LEU B 1 14  ? 39.122 -19.506 21.432  1.00 95.80  ? 14   LEU B CG  1 
ATOM   1185 C  CD1 . LEU B 1 14  ? 39.121 -19.301 19.870  1.00 74.33  ? 14   LEU B CD1 1 
ATOM   1186 C  CD2 . LEU B 1 14  ? 37.707 -19.886 22.063  1.00 67.39  ? 14   LEU B CD2 1 
ATOM   1187 N  N   . LYS B 1 15  ? 39.628 -22.776 24.491  1.00 50.09  ? 15   LYS B N   1 
ATOM   1188 C  CA  . LYS B 1 15  ? 39.913 -24.178 24.867  1.00 70.66  ? 15   LYS B CA  1 
ATOM   1189 C  C   . LYS B 1 15  ? 40.318 -25.065 23.689  1.00 62.30  ? 15   LYS B C   1 
ATOM   1190 O  O   . LYS B 1 15  ? 41.448 -25.622 23.655  1.00 68.00  ? 15   LYS B O   1 
ATOM   1191 C  CB  . LYS B 1 15  ? 38.742 -24.800 25.576  1.00 65.82  ? 15   LYS B CB  1 
ATOM   1192 C  CG  . LYS B 1 15  ? 39.220 -25.954 26.522  1.00 57.44  ? 15   LYS B CG  1 
ATOM   1193 C  CD  . LYS B 1 15  ? 38.000 -26.447 27.315  1.00 67.07  ? 15   LYS B CD  1 
ATOM   1194 C  CE  . LYS B 1 15  ? 38.192 -27.914 27.807  1.00 81.71  ? 15   LYS B CE  1 
ATOM   1195 N  NZ  . LYS B 1 15  ? 37.039 -28.483 28.634  1.00 88.85  ? 15   LYS B NZ  1 
ATOM   1196 N  N   . ASP B 1 16  ? 39.408 -25.180 22.717  1.00 80.85  ? 16   ASP B N   1 
ATOM   1197 C  CA  . ASP B 1 16  ? 39.670 -25.969 21.503  1.00 75.48  ? 16   ASP B CA  1 
ATOM   1198 C  C   . ASP B 1 16  ? 41.075 -25.778 20.931  1.00 65.77  ? 16   ASP B C   1 
ATOM   1199 O  O   . ASP B 1 16  ? 41.781 -26.756 20.618  1.00 77.38  ? 16   ASP B O   1 
ATOM   1200 C  CB  . ASP B 1 16  ? 38.624 -25.664 20.429  1.00 84.79  ? 16   ASP B CB  1 
ATOM   1201 C  CG  . ASP B 1 16  ? 37.227 -26.215 20.803  1.00 100.35 ? 16   ASP B CG  1 
ATOM   1202 O  OD1 . ASP B 1 16  ? 36.577 -25.655 21.696  1.00 129.22 ? 16   ASP B OD1 1 
ATOM   1203 O  OD2 . ASP B 1 16  ? 36.767 -27.214 20.230  1.00 110.54 ? 16   ASP B OD2 1 
ATOM   1204 N  N   . HIS B 1 17  ? 41.525 -24.534 20.821  1.00 71.68  ? 17   HIS B N   1 
ATOM   1205 C  CA  . HIS B 1 17  ? 42.856 -24.360 20.264  1.00 80.83  ? 17   HIS B CA  1 
ATOM   1206 C  C   . HIS B 1 17  ? 43.913 -24.846 21.260  1.00 58.60  ? 17   HIS B C   1 
ATOM   1207 O  O   . HIS B 1 17  ? 45.044 -25.263 20.873  1.00 59.22  ? 17   HIS B O   1 
ATOM   1208 C  CB  . HIS B 1 17  ? 43.110 -22.878 19.811  1.00 41.66  ? 17   HIS B CB  1 
ATOM   1209 C  CG  . HIS B 1 17  ? 44.561 -22.600 19.478  1.00 33.44  ? 17   HIS B CG  1 
ATOM   1210 N  ND1 . HIS B 1 17  ? 45.149 -22.961 18.281  1.00 78.79  ? 17   HIS B ND1 1 
ATOM   1211 C  CD2 . HIS B 1 17  ? 45.578 -22.130 20.266  1.00 81.18  ? 17   HIS B CD2 1 
ATOM   1212 C  CE1 . HIS B 1 17  ? 46.459 -22.727 18.337  1.00 55.52  ? 17   HIS B CE1 1 
ATOM   1213 N  NE2 . HIS B 1 17  ? 46.743 -22.225 19.532  1.00 63.79  ? 17   HIS B NE2 1 
ATOM   1214 N  N   . ARG B 1 18  ? 43.593 -24.769 22.546  1.00 72.91  ? 18   ARG B N   1 
ATOM   1215 C  CA  . ARG B 1 18  ? 44.598 -25.202 23.490  1.00 59.67  ? 18   ARG B CA  1 
ATOM   1216 C  C   . ARG B 1 18  ? 44.671 -26.731 23.307  1.00 85.74  ? 18   ARG B C   1 
ATOM   1217 O  O   . ARG B 1 18  ? 45.768 -27.319 23.198  1.00 40.57  ? 18   ARG B O   1 
ATOM   1218 C  CB  . ARG B 1 18  ? 44.203 -24.772 24.854  1.00 89.68  ? 18   ARG B CB  1 
ATOM   1219 C  CG  . ARG B 1 18  ? 45.030 -23.610 25.363  1.00 54.47  ? 18   ARG B CG  1 
ATOM   1220 C  CD  . ARG B 1 18  ? 44.296 -23.305 26.712  1.00 49.52  ? 18   ARG B CD  1 
ATOM   1221 N  NE  . ARG B 1 18  ? 43.206 -22.379 26.473  1.00 46.44  ? 18   ARG B NE  1 
ATOM   1222 C  CZ  . ARG B 1 18  ? 42.073 -22.360 27.150  1.00 71.37  ? 18   ARG B CZ  1 
ATOM   1223 N  NH1 . ARG B 1 18  ? 41.844 -23.242 28.098  1.00 64.71  ? 18   ARG B NH1 1 
ATOM   1224 N  NH2 . ARG B 1 18  ? 41.200 -21.367 26.970  1.00 48.93  ? 18   ARG B NH2 1 
ATOM   1225 N  N   . ILE B 1 19  ? 43.531 -27.395 23.182  1.00 49.23  ? 19   ILE B N   1 
ATOM   1226 C  CA  . ILE B 1 19  ? 43.605 -28.847 22.967  1.00 67.05  ? 19   ILE B CA  1 
ATOM   1227 C  C   . ILE B 1 19  ? 44.312 -29.157 21.647  1.00 66.58  ? 19   ILE B C   1 
ATOM   1228 O  O   . ILE B 1 19  ? 45.141 -30.051 21.558  1.00 82.50  ? 19   ILE B O   1 
ATOM   1229 C  CB  . ILE B 1 19  ? 42.235 -29.505 22.850  1.00 58.61  ? 19   ILE B CB  1 
ATOM   1230 C  CG1 . ILE B 1 19  ? 41.516 -29.543 24.188  1.00 61.82  ? 19   ILE B CG1 1 
ATOM   1231 C  CG2 . ILE B 1 19  ? 42.410 -30.843 22.328  1.00 65.21  ? 19   ILE B CG2 1 
ATOM   1232 C  CD1 . ILE B 1 19  ? 40.122 -29.861 24.040  1.00 62.05  ? 19   ILE B CD1 1 
ATOM   1233 N  N   . SER B 1 20  ? 43.932 -28.438 20.603  1.00 78.00  ? 20   SER B N   1 
ATOM   1234 C  CA  . SER B 1 20  ? 44.546 -28.658 19.321  1.00 58.83  ? 20   SER B CA  1 
ATOM   1235 C  C   . SER B 1 20  ? 46.052 -28.804 19.531  1.00 61.94  ? 20   SER B C   1 
ATOM   1236 O  O   . SER B 1 20  ? 46.692 -29.483 18.758  1.00 81.95  ? 20   SER B O   1 
ATOM   1237 C  CB  . SER B 1 20  ? 44.210 -27.462 18.359  1.00 78.21  ? 20   SER B CB  1 
ATOM   1238 O  OG  . SER B 1 20  ? 45.352 -26.732 17.774  1.00 66.58  ? 20   SER B OG  1 
ATOM   1239 N  N   . THR B 1 21  ? 46.641 -28.196 20.561  1.00 70.55  ? 21   THR B N   1 
ATOM   1240 C  CA  . THR B 1 21  ? 48.103 -28.284 20.687  1.00 79.30  ? 21   THR B CA  1 
ATOM   1241 C  C   . THR B 1 21  ? 48.710 -29.561 21.216  1.00 83.74  ? 21   THR B C   1 
ATOM   1242 O  O   . THR B 1 21  ? 49.921 -29.743 21.088  1.00 66.96  ? 21   THR B O   1 
ATOM   1243 C  CB  . THR B 1 21  ? 48.685 -27.174 21.563  1.00 97.72  ? 21   THR B CB  1 
ATOM   1244 O  OG1 . THR B 1 21  ? 48.087 -27.227 22.880  1.00 54.94  ? 21   THR B OG1 1 
ATOM   1245 C  CG2 . THR B 1 21  ? 48.454 -25.848 20.913  1.00 86.41  ? 21   THR B CG2 1 
ATOM   1246 N  N   . PHE B 1 22  ? 47.921 -30.436 21.843  1.00 94.22  ? 22   PHE B N   1 
ATOM   1247 C  CA  . PHE B 1 22  ? 48.481 -31.698 22.363  1.00 100.81 ? 22   PHE B CA  1 
ATOM   1248 C  C   . PHE B 1 22  ? 48.604 -32.728 21.246  1.00 101.28 ? 22   PHE B C   1 
ATOM   1249 O  O   . PHE B 1 22  ? 47.618 -33.350 20.814  1.00 78.23  ? 22   PHE B O   1 
ATOM   1250 C  CB  . PHE B 1 22  ? 47.647 -32.199 23.538  1.00 77.94  ? 22   PHE B CB  1 
ATOM   1251 C  CG  . PHE B 1 22  ? 47.631 -31.218 24.672  1.00 97.07  ? 22   PHE B CG  1 
ATOM   1252 C  CD1 . PHE B 1 22  ? 46.474 -30.522 25.027  1.00 73.82  ? 22   PHE B CD1 1 
ATOM   1253 C  CD2 . PHE B 1 22  ? 48.812 -30.882 25.303  1.00 92.51  ? 22   PHE B CD2 1 
ATOM   1254 C  CE1 . PHE B 1 22  ? 46.516 -29.516 25.983  1.00 104.62 ? 22   PHE B CE1 1 
ATOM   1255 C  CE2 . PHE B 1 22  ? 48.852 -29.852 26.279  1.00 92.29  ? 22   PHE B CE2 1 
ATOM   1256 C  CZ  . PHE B 1 22  ? 47.721 -29.186 26.607  1.00 101.70 ? 22   PHE B CZ  1 
ATOM   1257 N  N   . LYS B 1 23  ? 49.852 -32.799 20.760  1.00 87.05  ? 23   LYS B N   1 
ATOM   1258 C  CA  . LYS B 1 23  ? 50.355 -33.665 19.681  1.00 115.78 ? 23   LYS B CA  1 
ATOM   1259 C  C   . LYS B 1 23  ? 50.401 -35.114 20.187  1.00 124.49 ? 23   LYS B C   1 
ATOM   1260 O  O   . LYS B 1 23  ? 49.441 -35.893 19.995  1.00 107.06 ? 23   LYS B O   1 
ATOM   1261 C  CB  . LYS B 1 23  ? 51.778 -33.197 19.257  1.00 122.91 ? 23   LYS B CB  1 
ATOM   1262 C  CG  . LYS B 1 23  ? 52.320 -33.841 17.960  1.00 144.39 ? 23   LYS B CG  1 
ATOM   1263 C  CD  . LYS B 1 23  ? 52.533 -32.810 16.841  1.00 156.59 ? 23   LYS B CD  1 
ATOM   1264 C  CE  . LYS B 1 23  ? 52.711 -33.464 15.444  1.00 147.39 ? 23   LYS B CE  1 
ATOM   1265 N  NZ  . LYS B 1 23  ? 52.906 -32.441 14.358  1.00 146.41 ? 23   LYS B NZ  1 
ATOM   1266 N  N   . ASN B 1 24  ? 51.514 -35.496 20.805  1.00 89.06  ? 24   ASN B N   1 
ATOM   1267 C  CA  . ASN B 1 24  ? 51.546 -36.823 21.359  1.00 89.80  ? 24   ASN B CA  1 
ATOM   1268 C  C   . ASN B 1 24  ? 50.705 -36.759 22.657  1.00 94.10  ? 24   ASN B C   1 
ATOM   1269 O  O   . ASN B 1 24  ? 49.480 -36.880 22.663  1.00 122.66 ? 24   ASN B O   1 
ATOM   1270 C  CB  . ASN B 1 24  ? 52.972 -37.233 21.688  1.00 94.26  ? 24   ASN B CB  1 
ATOM   1271 C  CG  . ASN B 1 24  ? 53.203 -38.733 21.533  1.00 139.50 ? 24   ASN B CG  1 
ATOM   1272 O  OD1 . ASN B 1 24  ? 54.273 -39.246 21.845  1.00 131.13 ? 24   ASN B OD1 1 
ATOM   1273 N  ND2 . ASN B 1 24  ? 52.200 -39.437 21.041  1.00 153.04 ? 24   ASN B ND2 1 
ATOM   1274 N  N   . TRP B 1 25  ? 51.377 -36.520 23.756  1.00 103.93 ? 25   TRP B N   1 
ATOM   1275 C  CA  . TRP B 1 25  ? 50.757 -36.453 25.066  1.00 128.61 ? 25   TRP B CA  1 
ATOM   1276 C  C   . TRP B 1 25  ? 50.514 -37.875 25.462  1.00 132.91 ? 25   TRP B C   1 
ATOM   1277 O  O   . TRP B 1 25  ? 49.448 -38.453 25.244  1.00 129.53 ? 25   TRP B O   1 
ATOM   1278 C  CB  . TRP B 1 25  ? 49.457 -35.618 25.140  1.00 104.24 ? 25   TRP B CB  1 
ATOM   1279 C  CG  . TRP B 1 25  ? 49.276 -35.117 26.582  1.00 64.27  ? 25   TRP B CG  1 
ATOM   1280 C  CD1 . TRP B 1 25  ? 48.313 -35.499 27.470  1.00 61.90  ? 25   TRP B CD1 1 
ATOM   1281 C  CD2 . TRP B 1 25  ? 50.201 -34.313 27.358  1.00 95.38  ? 25   TRP B CD2 1 
ATOM   1282 N  NE1 . TRP B 1 25  ? 48.590 -35.016 28.748  1.00 84.91  ? 25   TRP B NE1 1 
ATOM   1283 C  CE2 . TRP B 1 25  ? 49.755 -34.286 28.695  1.00 89.71  ? 25   TRP B CE2 1 
ATOM   1284 C  CE3 . TRP B 1 25  ? 51.395 -33.645 27.035  1.00 103.44 ? 25   TRP B CE3 1 
ATOM   1285 C  CZ2 . TRP B 1 25  ? 50.439 -33.587 29.716  1.00 57.48  ? 25   TRP B CZ2 1 
ATOM   1286 C  CZ3 . TRP B 1 25  ? 52.073 -32.964 28.049  1.00 98.22  ? 25   TRP B CZ3 1 
ATOM   1287 C  CH2 . TRP B 1 25  ? 51.604 -32.949 29.374  1.00 63.72  ? 25   TRP B CH2 1 
ATOM   1288 N  N   . PRO B 1 26  ? 51.546 -38.469 26.045  1.00 119.75 ? 26   PRO B N   1 
ATOM   1289 C  CA  . PRO B 1 26  ? 51.504 -39.841 26.492  1.00 107.25 ? 26   PRO B CA  1 
ATOM   1290 C  C   . PRO B 1 26  ? 50.297 -40.186 27.367  1.00 119.56 ? 26   PRO B C   1 
ATOM   1291 O  O   . PRO B 1 26  ? 50.193 -41.319 27.825  1.00 155.74 ? 26   PRO B O   1 
ATOM   1292 C  CB  . PRO B 1 26  ? 52.833 -39.972 27.238  1.00 126.13 ? 26   PRO B CB  1 
ATOM   1293 C  CG  . PRO B 1 26  ? 53.770 -39.047 26.442  1.00 124.99 ? 26   PRO B CG  1 
ATOM   1294 C  CD  . PRO B 1 26  ? 52.873 -37.859 26.288  1.00 114.50 ? 26   PRO B CD  1 
ATOM   1295 N  N   . PHE B 1 27  ? 49.372 -39.255 27.589  1.00 96.35  ? 27   PHE B N   1 
ATOM   1296 C  CA  . PHE B 1 27  ? 48.250 -39.544 28.495  1.00 99.21  ? 27   PHE B CA  1 
ATOM   1297 C  C   . PHE B 1 27  ? 46.867 -39.315 27.937  1.00 101.14 ? 27   PHE B C   1 
ATOM   1298 O  O   . PHE B 1 27  ? 46.492 -38.183 27.665  1.00 121.68 ? 27   PHE B O   1 
ATOM   1299 C  CB  . PHE B 1 27  ? 48.421 -38.725 29.772  1.00 80.36  ? 27   PHE B CB  1 
ATOM   1300 C  CG  . PHE B 1 27  ? 49.812 -38.749 30.306  1.00 94.49  ? 27   PHE B CG  1 
ATOM   1301 C  CD1 . PHE B 1 27  ? 50.811 -38.004 29.679  1.00 96.54  ? 27   PHE B CD1 1 
ATOM   1302 C  CD2 . PHE B 1 27  ? 50.161 -39.614 31.346  1.00 96.49  ? 27   PHE B CD2 1 
ATOM   1303 C  CE1 . PHE B 1 27  ? 52.128 -38.126 30.070  1.00 113.34 ? 27   PHE B CE1 1 
ATOM   1304 C  CE2 . PHE B 1 27  ? 51.479 -39.748 31.750  1.00 99.38  ? 27   PHE B CE2 1 
ATOM   1305 C  CZ  . PHE B 1 27  ? 52.464 -39.004 31.109  1.00 120.24 ? 27   PHE B CZ  1 
ATOM   1306 N  N   . LEU B 1 28  ? 46.081 -40.382 27.803  1.00 90.49  ? 28   LEU B N   1 
ATOM   1307 C  CA  . LEU B 1 28  ? 44.756 -40.238 27.222  1.00 69.88  ? 28   LEU B CA  1 
ATOM   1308 C  C   . LEU B 1 28  ? 43.622 -40.812 28.040  1.00 65.29  ? 28   LEU B C   1 
ATOM   1309 O  O   . LEU B 1 28  ? 43.571 -40.615 29.256  1.00 115.01 ? 28   LEU B O   1 
ATOM   1310 C  CB  . LEU B 1 28  ? 44.771 -40.797 25.779  1.00 98.65  ? 28   LEU B CB  1 
ATOM   1311 C  CG  . LEU B 1 28  ? 45.895 -40.157 24.916  1.00 113.96 ? 28   LEU B CG  1 
ATOM   1312 C  CD1 . LEU B 1 28  ? 46.159 -40.893 23.613  1.00 82.24  ? 28   LEU B CD1 1 
ATOM   1313 C  CD2 . LEU B 1 28  ? 45.539 -38.732 24.638  1.00 99.27  ? 28   LEU B CD2 1 
ATOM   1314 N  N   . GLU B 1 29  ? 42.701 -41.496 27.369  1.00 86.27  ? 29   GLU B N   1 
ATOM   1315 C  CA  . GLU B 1 29  ? 41.552 -42.129 28.025  1.00 106.40 ? 29   GLU B CA  1 
ATOM   1316 C  C   . GLU B 1 29  ? 42.126 -42.970 29.165  1.00 102.05 ? 29   GLU B C   1 
ATOM   1317 O  O   . GLU B 1 29  ? 43.123 -43.695 29.009  1.00 78.00  ? 29   GLU B O   1 
ATOM   1318 C  CB  . GLU B 1 29  ? 40.767 -43.015 27.031  1.00 127.09 ? 29   GLU B CB  1 
ATOM   1319 C  CG  . GLU B 1 29  ? 41.187 -42.875 25.546  1.00 148.41 ? 29   GLU B CG  1 
ATOM   1320 C  CD  . GLU B 1 29  ? 42.133 -43.996 25.073  1.00 167.83 ? 29   GLU B CD  1 
ATOM   1321 O  OE1 . GLU B 1 29  ? 41.731 -45.183 25.097  1.00 165.39 ? 29   GLU B OE1 1 
ATOM   1322 O  OE2 . GLU B 1 29  ? 43.282 -43.698 24.675  1.00 152.29 ? 29   GLU B OE2 1 
ATOM   1323 N  N   . GLY B 1 30  ? 41.509 -42.865 30.323  1.00 86.08  ? 30   GLY B N   1 
ATOM   1324 C  CA  . GLY B 1 30  ? 42.044 -43.575 31.450  1.00 64.74  ? 30   GLY B CA  1 
ATOM   1325 C  C   . GLY B 1 30  ? 42.725 -42.611 32.407  1.00 95.67  ? 30   GLY B C   1 
ATOM   1326 O  O   . GLY B 1 30  ? 42.544 -42.673 33.619  1.00 85.95  ? 30   GLY B O   1 
ATOM   1327 N  N   . CYS B 1 31  ? 43.514 -41.697 31.866  1.00 86.21  ? 31   CYS B N   1 
ATOM   1328 C  CA  . CYS B 1 31  ? 44.206 -40.744 32.705  1.00 97.49  ? 31   CYS B CA  1 
ATOM   1329 C  C   . CYS B 1 31  ? 43.325 -39.586 33.193  1.00 111.06 ? 31   CYS B C   1 
ATOM   1330 O  O   . CYS B 1 31  ? 42.217 -39.410 32.685  1.00 108.68 ? 31   CYS B O   1 
ATOM   1331 C  CB  . CYS B 1 31  ? 45.354 -40.197 31.914  1.00 98.50  ? 31   CYS B CB  1 
ATOM   1332 S  SG  . CYS B 1 31  ? 46.469 -41.487 31.375  1.00 94.78  ? 31   CYS B SG  1 
ATOM   1333 N  N   . ALA B 1 32  ? 43.806 -38.800 34.168  1.00 95.11  ? 32   ALA B N   1 
ATOM   1334 C  CA  . ALA B 1 32  ? 43.039 -37.636 34.668  1.00 96.63  ? 32   ALA B CA  1 
ATOM   1335 C  C   . ALA B 1 32  ? 43.631 -36.337 34.065  1.00 81.07  ? 32   ALA B C   1 
ATOM   1336 O  O   . ALA B 1 32  ? 42.986 -35.274 34.043  1.00 76.90  ? 32   ALA B O   1 
ATOM   1337 C  CB  . ALA B 1 32  ? 43.067 -37.559 36.241  1.00 66.49  ? 32   ALA B CB  1 
ATOM   1338 N  N   . CYS B 1 33  ? 44.841 -36.502 33.537  1.00 69.70  ? 33   CYS B N   1 
ATOM   1339 C  CA  . CYS B 1 33  ? 45.718 -35.500 32.924  1.00 54.86  ? 33   CYS B CA  1 
ATOM   1340 C  C   . CYS B 1 33  ? 45.545 -35.539 31.420  1.00 66.91  ? 33   CYS B C   1 
ATOM   1341 O  O   . CYS B 1 33  ? 46.552 -35.492 30.667  1.00 55.73  ? 33   CYS B O   1 
ATOM   1342 C  CB  . CYS B 1 33  ? 47.184 -35.904 33.269  1.00 63.86  ? 33   CYS B CB  1 
ATOM   1343 S  SG  . CYS B 1 33  ? 48.386 -34.677 33.066  1.00 105.43 ? 33   CYS B SG  1 
ATOM   1344 N  N   . THR B 1 34  ? 44.292 -35.655 30.977  1.00 81.40  ? 34   THR B N   1 
ATOM   1345 C  CA  . THR B 1 34  ? 43.970 -35.714 29.544  1.00 89.31  ? 34   THR B CA  1 
ATOM   1346 C  C   . THR B 1 34  ? 44.120 -34.383 28.842  1.00 97.02  ? 34   THR B C   1 
ATOM   1347 O  O   . THR B 1 34  ? 44.148 -33.317 29.470  1.00 113.24 ? 34   THR B O   1 
ATOM   1348 C  CB  . THR B 1 34  ? 42.548 -36.171 29.271  1.00 84.47  ? 34   THR B CB  1 
ATOM   1349 O  OG1 . THR B 1 34  ? 41.647 -35.334 29.985  1.00 74.56  ? 34   THR B OG1 1 
ATOM   1350 C  CG2 . THR B 1 34  ? 42.353 -37.596 29.696  1.00 96.13  ? 34   THR B CG2 1 
ATOM   1351 N  N   . PRO B 1 35  ? 44.211 -34.427 27.511  1.00 92.86  ? 35   PRO B N   1 
ATOM   1352 C  CA  . PRO B 1 35  ? 44.366 -33.176 26.787  1.00 103.11 ? 35   PRO B CA  1 
ATOM   1353 C  C   . PRO B 1 35  ? 43.214 -32.209 27.046  1.00 92.56  ? 35   PRO B C   1 
ATOM   1354 O  O   . PRO B 1 35  ? 43.424 -30.995 27.117  1.00 99.70  ? 35   PRO B O   1 
ATOM   1355 C  CB  . PRO B 1 35  ? 44.508 -33.650 25.347  1.00 105.80 ? 35   PRO B CB  1 
ATOM   1356 C  CG  . PRO B 1 35  ? 45.283 -34.893 25.529  1.00 87.32  ? 35   PRO B CG  1 
ATOM   1357 C  CD  . PRO B 1 35  ? 44.459 -35.559 26.615  1.00 114.13 ? 35   PRO B CD  1 
ATOM   1358 N  N   . GLU B 1 36  ? 42.006 -32.734 27.229  1.00 69.06  ? 36   GLU B N   1 
ATOM   1359 C  CA  . GLU B 1 36  ? 40.924 -31.837 27.520  1.00 74.16  ? 36   GLU B CA  1 
ATOM   1360 C  C   . GLU B 1 36  ? 41.093 -31.156 28.865  1.00 89.28  ? 36   GLU B C   1 
ATOM   1361 O  O   . GLU B 1 36  ? 40.954 -29.940 28.940  1.00 107.85 ? 36   GLU B O   1 
ATOM   1362 C  CB  . GLU B 1 36  ? 39.549 -32.520 27.523  1.00 53.77  ? 36   GLU B CB  1 
ATOM   1363 C  CG  . GLU B 1 36  ? 38.482 -31.463 27.795  1.00 108.53 ? 36   GLU B CG  1 
ATOM   1364 C  CD  . GLU B 1 36  ? 37.232 -31.974 28.481  1.00 130.99 ? 36   GLU B CD  1 
ATOM   1365 O  OE1 . GLU B 1 36  ? 36.506 -32.776 27.843  1.00 124.88 ? 36   GLU B OE1 1 
ATOM   1366 O  OE2 . GLU B 1 36  ? 36.976 -31.555 29.645  1.00 134.28 ? 36   GLU B OE2 1 
ATOM   1367 N  N   . ARG B 1 37  ? 41.366 -31.922 29.926  1.00 110.97 ? 37   ARG B N   1 
ATOM   1368 C  CA  . ARG B 1 37  ? 41.506 -31.348 31.285  1.00 92.49  ? 37   ARG B CA  1 
ATOM   1369 C  C   . ARG B 1 37  ? 42.759 -30.509 31.432  1.00 79.44  ? 37   ARG B C   1 
ATOM   1370 O  O   . ARG B 1 37  ? 42.839 -29.617 32.307  1.00 74.93  ? 37   ARG B O   1 
ATOM   1371 C  CB  . ARG B 1 37  ? 41.501 -32.450 32.379  1.00 66.82  ? 37   ARG B CB  1 
ATOM   1372 C  CG  . ARG B 1 37  ? 40.102 -32.713 33.080  1.00 69.24  ? 37   ARG B CG  1 
ATOM   1373 C  CD  . ARG B 1 37  ? 40.117 -34.130 33.651  1.00 126.98 ? 37   ARG B CD  1 
ATOM   1374 N  NE  . ARG B 1 37  ? 38.866 -34.579 34.258  1.00 156.28 ? 37   ARG B NE  1 
ATOM   1375 C  CZ  . ARG B 1 37  ? 38.611 -35.853 34.570  1.00 158.37 ? 37   ARG B CZ  1 
ATOM   1376 N  NH1 . ARG B 1 37  ? 39.512 -36.797 34.315  1.00 144.18 ? 37   ARG B NH1 1 
ATOM   1377 N  NH2 . ARG B 1 37  ? 37.479 -36.189 35.186  1.00 145.27 ? 37   ARG B NH2 1 
ATOM   1378 N  N   . MET B 1 38  ? 43.735 -30.781 30.563  1.00 53.69  ? 38   MET B N   1 
ATOM   1379 C  CA  . MET B 1 38  ? 44.970 -30.030 30.644  1.00 51.02  ? 38   MET B CA  1 
ATOM   1380 C  C   . MET B 1 38  ? 44.969 -28.792 29.782  1.00 76.35  ? 38   MET B C   1 
ATOM   1381 O  O   . MET B 1 38  ? 45.951 -28.081 29.715  1.00 89.28  ? 38   MET B O   1 
ATOM   1382 C  CB  . MET B 1 38  ? 46.182 -30.939 30.328  1.00 70.24  ? 38   MET B CB  1 
ATOM   1383 C  CG  . MET B 1 38  ? 47.181 -30.913 31.561  1.00 52.68  ? 38   MET B CG  1 
ATOM   1384 S  SD  . MET B 1 38  ? 48.736 -31.245 30.977  1.00 87.26  ? 38   MET B SD  1 
ATOM   1385 C  CE  . MET B 1 38  ? 49.652 -29.833 31.177  1.00 82.46  ? 38   MET B CE  1 
ATOM   1386 N  N   . ALA B 1 39  ? 43.863 -28.527 29.109  1.00 85.08  ? 39   ALA B N   1 
ATOM   1387 C  CA  . ALA B 1 39  ? 43.788 -27.352 28.260  1.00 86.29  ? 39   ALA B CA  1 
ATOM   1388 C  C   . ALA B 1 39  ? 42.716 -26.520 28.893  1.00 65.03  ? 39   ALA B C   1 
ATOM   1389 O  O   . ALA B 1 39  ? 42.635 -25.323 28.635  1.00 98.07  ? 39   ALA B O   1 
ATOM   1390 C  CB  . ALA B 1 39  ? 43.429 -27.711 26.838  1.00 106.92 ? 39   ALA B CB  1 
ATOM   1391 N  N   . GLU B 1 40  ? 41.927 -27.172 29.742  1.00 56.42  ? 40   GLU B N   1 
ATOM   1392 C  CA  . GLU B 1 40  ? 40.921 -26.493 30.517  1.00 49.53  ? 40   GLU B CA  1 
ATOM   1393 C  C   . GLU B 1 40  ? 41.607 -25.777 31.732  1.00 76.88  ? 40   GLU B C   1 
ATOM   1394 O  O   . GLU B 1 40  ? 40.954 -25.239 32.616  1.00 69.42  ? 40   GLU B O   1 
ATOM   1395 C  CB  . GLU B 1 40  ? 39.893 -27.496 31.041  1.00 42.68  ? 40   GLU B CB  1 
ATOM   1396 C  CG  . GLU B 1 40  ? 38.575 -26.820 31.603  1.00 83.75  ? 40   GLU B CG  1 
ATOM   1397 C  CD  . GLU B 1 40  ? 37.614 -27.774 32.340  1.00 139.18 ? 40   GLU B CD  1 
ATOM   1398 O  OE1 . GLU B 1 40  ? 38.086 -28.828 32.862  1.00 142.43 ? 40   GLU B OE1 1 
ATOM   1399 O  OE2 . GLU B 1 40  ? 36.390 -27.442 32.406  1.00 134.43 ? 40   GLU B OE2 1 
ATOM   1400 N  N   . ALA B 1 41  ? 42.925 -25.780 31.766  1.00 77.57  ? 41   ALA B N   1 
ATOM   1401 C  CA  . ALA B 1 41  ? 43.664 -25.160 32.836  1.00 77.30  ? 41   ALA B CA  1 
ATOM   1402 C  C   . ALA B 1 41  ? 44.737 -24.264 32.182  1.00 91.69  ? 41   ALA B C   1 
ATOM   1403 O  O   . ALA B 1 41  ? 45.760 -23.891 32.771  1.00 75.89  ? 41   ALA B O   1 
ATOM   1404 C  CB  . ALA B 1 41  ? 44.281 -26.252 33.681  1.00 54.02  ? 41   ALA B CB  1 
ATOM   1405 N  N   . GLY B 1 42  ? 44.495 -23.959 30.920  1.00 77.47  ? 42   GLY B N   1 
ATOM   1406 C  CA  . GLY B 1 42  ? 45.344 -23.048 30.169  1.00 43.36  ? 42   GLY B CA  1 
ATOM   1407 C  C   . GLY B 1 42  ? 46.557 -23.657 29.577  1.00 49.13  ? 42   GLY B C   1 
ATOM   1408 O  O   . GLY B 1 42  ? 47.403 -22.898 29.080  1.00 71.15  ? 42   GLY B O   1 
ATOM   1409 N  N   . PHE B 1 43  ? 46.666 -24.990 29.570  1.00 49.94  ? 43   PHE B N   1 
ATOM   1410 C  CA  . PHE B 1 43  ? 47.912 -25.496 29.004  1.00 52.22  ? 43   PHE B CA  1 
ATOM   1411 C  C   . PHE B 1 43  ? 47.959 -25.673 27.474  1.00 71.63  ? 43   PHE B C   1 
ATOM   1412 O  O   . PHE B 1 43  ? 46.975 -25.928 26.776  1.00 46.52  ? 43   PHE B O   1 
ATOM   1413 C  CB  . PHE B 1 43  ? 48.349 -26.780 29.716  1.00 49.78  ? 43   PHE B CB  1 
ATOM   1414 C  CG  . PHE B 1 43  ? 48.725 -26.553 31.122  1.00 81.13  ? 43   PHE B CG  1 
ATOM   1415 C  CD1 . PHE B 1 43  ? 47.805 -26.756 32.134  1.00 65.79  ? 43   PHE B CD1 1 
ATOM   1416 C  CD2 . PHE B 1 43  ? 49.996 -26.077 31.448  1.00 71.90  ? 43   PHE B CD2 1 
ATOM   1417 C  CE1 . PHE B 1 43  ? 48.130 -26.492 33.478  1.00 72.69  ? 43   PHE B CE1 1 
ATOM   1418 C  CE2 . PHE B 1 43  ? 50.331 -25.811 32.759  1.00 61.13  ? 43   PHE B CE2 1 
ATOM   1419 C  CZ  . PHE B 1 43  ? 49.380 -26.023 33.795  1.00 66.99  ? 43   PHE B CZ  1 
ATOM   1420 N  N   . ILE B 1 44  ? 49.152 -25.497 26.984  1.00 61.71  ? 44   ILE B N   1 
ATOM   1421 C  CA  . ILE B 1 44  ? 49.455 -25.653 25.598  1.00 60.12  ? 44   ILE B CA  1 
ATOM   1422 C  C   . ILE B 1 44  ? 50.703 -26.596 25.593  1.00 93.60  ? 44   ILE B C   1 
ATOM   1423 O  O   . ILE B 1 44  ? 51.635 -26.419 26.413  1.00 82.62  ? 44   ILE B O   1 
ATOM   1424 C  CB  . ILE B 1 44  ? 49.808 -24.268 25.003  1.00 61.37  ? 44   ILE B CB  1 
ATOM   1425 C  CG1 . ILE B 1 44  ? 48.522 -23.572 24.526  1.00 69.76  ? 44   ILE B CG1 1 
ATOM   1426 C  CG2 . ILE B 1 44  ? 50.870 -24.416 23.993  1.00 61.96  ? 44   ILE B CG2 1 
ATOM   1427 C  CD1 . ILE B 1 44  ? 48.651 -22.055 24.413  1.00 101.30 ? 44   ILE B CD1 1 
ATOM   1428 N  N   . HIS B 1 45  ? 50.708 -27.597 24.701  1.00 70.01  ? 45   HIS B N   1 
ATOM   1429 C  CA  . HIS B 1 45  ? 51.812 -28.553 24.609  1.00 91.04  ? 45   HIS B CA  1 
ATOM   1430 C  C   . HIS B 1 45  ? 52.991 -27.919 23.858  1.00 77.32  ? 45   HIS B C   1 
ATOM   1431 O  O   . HIS B 1 45  ? 52.861 -27.558 22.697  1.00 120.90 ? 45   HIS B O   1 
ATOM   1432 C  CB  . HIS B 1 45  ? 51.331 -29.832 23.899  1.00 85.90  ? 45   HIS B CB  1 
ATOM   1433 C  CG  . HIS B 1 45  ? 52.272 -30.988 24.016  1.00 91.06  ? 45   HIS B CG  1 
ATOM   1434 N  ND1 . HIS B 1 45  ? 52.114 -32.146 23.283  1.00 100.45 ? 45   HIS B ND1 1 
ATOM   1435 C  CD2 . HIS B 1 45  ? 53.392 -31.162 24.763  1.00 96.23  ? 45   HIS B CD2 1 
ATOM   1436 C  CE1 . HIS B 1 45  ? 53.098 -32.979 23.566  1.00 122.08 ? 45   HIS B CE1 1 
ATOM   1437 N  NE2 . HIS B 1 45  ? 53.887 -32.407 24.463  1.00 114.96 ? 45   HIS B NE2 1 
ATOM   1438 N  N   . CYS B 1 46  ? 54.128 -27.769 24.531  1.00 80.34  ? 46   CYS B N   1 
ATOM   1439 C  CA  . CYS B 1 46  ? 55.319 -27.177 23.932  1.00 71.16  ? 46   CYS B CA  1 
ATOM   1440 C  C   . CYS B 1 46  ? 56.436 -28.232 24.058  1.00 95.37  ? 46   CYS B C   1 
ATOM   1441 O  O   . CYS B 1 46  ? 57.480 -28.008 24.742  1.00 82.79  ? 46   CYS B O   1 
ATOM   1442 C  CB  . CYS B 1 46  ? 55.706 -25.925 24.710  1.00 102.35 ? 46   CYS B CB  1 
ATOM   1443 S  SG  . CYS B 1 46  ? 54.352 -24.937 25.360  1.00 107.76 ? 46   CYS B SG  1 
ATOM   1444 N  N   . PRO B 1 47  ? 56.235 -29.404 23.395  1.00 105.82 ? 47   PRO B N   1 
ATOM   1445 C  CA  . PRO B 1 47  ? 57.175 -30.533 23.405  1.00 78.73  ? 47   PRO B CA  1 
ATOM   1446 C  C   . PRO B 1 47  ? 58.505 -30.257 22.768  1.00 86.31  ? 47   PRO B C   1 
ATOM   1447 O  O   . PRO B 1 47  ? 58.617 -29.454 21.829  1.00 98.74  ? 47   PRO B O   1 
ATOM   1448 C  CB  . PRO B 1 47  ? 56.402 -31.642 22.692  1.00 96.16  ? 47   PRO B CB  1 
ATOM   1449 C  CG  . PRO B 1 47  ? 55.573 -30.889 21.722  1.00 103.72 ? 47   PRO B CG  1 
ATOM   1450 C  CD  . PRO B 1 47  ? 55.091 -29.700 22.507  1.00 97.63  ? 47   PRO B CD  1 
ATOM   1451 N  N   . THR B 1 48  ? 59.521 -30.939 23.275  1.00 96.47  ? 48   THR B N   1 
ATOM   1452 C  CA  . THR B 1 48  ? 60.842 -30.757 22.753  1.00 105.10 ? 48   THR B CA  1 
ATOM   1453 C  C   . THR B 1 48  ? 61.569 -32.094 22.780  1.00 120.94 ? 48   THR B C   1 
ATOM   1454 O  O   . THR B 1 48  ? 60.918 -33.132 22.774  1.00 130.65 ? 48   THR B O   1 
ATOM   1455 C  CB  . THR B 1 48  ? 61.514 -29.624 23.556  1.00 98.95  ? 48   THR B CB  1 
ATOM   1456 O  OG1 . THR B 1 48  ? 62.858 -29.959 23.888  1.00 110.39 ? 48   THR B OG1 1 
ATOM   1457 C  CG2 . THR B 1 48  ? 60.738 -29.354 24.793  1.00 100.47 ? 48   THR B CG2 1 
ATOM   1458 N  N   . GLU B 1 49  ? 62.899 -32.077 22.756  1.00 143.31 ? 49   GLU B N   1 
ATOM   1459 C  CA  . GLU B 1 49  ? 63.702 -33.301 22.780  1.00 147.74 ? 49   GLU B CA  1 
ATOM   1460 C  C   . GLU B 1 49  ? 63.773 -33.905 24.182  1.00 141.80 ? 49   GLU B C   1 
ATOM   1461 O  O   . GLU B 1 49  ? 63.436 -35.076 24.385  1.00 105.37 ? 49   GLU B O   1 
ATOM   1462 C  CB  . GLU B 1 49  ? 65.115 -32.991 22.278  1.00 159.77 ? 49   GLU B CB  1 
ATOM   1463 C  CG  . GLU B 1 49  ? 65.132 -32.558 20.832  1.00 160.37 ? 49   GLU B CG  1 
ATOM   1464 C  CD  . GLU B 1 49  ? 64.463 -33.585 19.936  1.00 162.74 ? 49   GLU B CD  1 
ATOM   1465 O  OE1 . GLU B 1 49  ? 63.223 -33.778 20.035  1.00 147.73 ? 49   GLU B OE1 1 
ATOM   1466 O  OE2 . GLU B 1 49  ? 65.189 -34.211 19.137  1.00 168.44 ? 49   GLU B OE2 1 
ATOM   1467 N  N   . ASN B 1 50  ? 64.212 -33.084 25.136  1.00 134.61 ? 50   ASN B N   1 
ATOM   1468 C  CA  . ASN B 1 50  ? 64.358 -33.475 26.535  1.00 116.14 ? 50   ASN B CA  1 
ATOM   1469 C  C   . ASN B 1 50  ? 63.119 -33.071 27.335  1.00 119.69 ? 50   ASN B C   1 
ATOM   1470 O  O   . ASN B 1 50  ? 63.145 -33.045 28.580  1.00 120.60 ? 50   ASN B O   1 
ATOM   1471 C  CB  . ASN B 1 50  ? 65.603 -32.802 27.147  1.00 128.63 ? 50   ASN B CB  1 
ATOM   1472 C  CG  . ASN B 1 50  ? 66.654 -32.376 26.085  1.00 144.23 ? 50   ASN B CG  1 
ATOM   1473 O  OD1 . ASN B 1 50  ? 66.950 -33.118 25.133  1.00 139.45 ? 50   ASN B OD1 1 
ATOM   1474 N  ND2 . ASN B 1 50  ? 67.229 -31.176 26.268  1.00 136.41 ? 50   ASN B ND2 1 
ATOM   1475 N  N   . GLU B 1 51  ? 62.044 -32.746 26.612  1.00 125.19 ? 51   GLU B N   1 
ATOM   1476 C  CA  . GLU B 1 51  ? 60.798 -32.330 27.239  1.00 111.62 ? 51   GLU B CA  1 
ATOM   1477 C  C   . GLU B 1 51  ? 59.529 -32.628 26.407  1.00 104.22 ? 51   GLU B C   1 
ATOM   1478 O  O   . GLU B 1 51  ? 58.620 -31.807 26.365  1.00 100.20 ? 51   GLU B O   1 
ATOM   1479 C  CB  . GLU B 1 51  ? 60.861 -30.823 27.534  1.00 119.12 ? 51   GLU B CB  1 
ATOM   1480 C  CG  . GLU B 1 51  ? 62.147 -30.303 28.204  1.00 90.04  ? 51   GLU B CG  1 
ATOM   1481 C  CD  . GLU B 1 51  ? 63.113 -29.642 27.225  1.00 114.16 ? 51   GLU B CD  1 
ATOM   1482 O  OE1 . GLU B 1 51  ? 62.741 -28.660 26.549  1.00 109.61 ? 51   GLU B OE1 1 
ATOM   1483 O  OE2 . GLU B 1 51  ? 64.267 -30.102 27.131  1.00 114.29 ? 51   GLU B OE2 1 
ATOM   1484 N  N   . PRO B 1 52  ? 59.437 -33.815 25.764  1.00 110.14 ? 52   PRO B N   1 
ATOM   1485 C  CA  . PRO B 1 52  ? 58.294 -34.245 24.927  1.00 98.42  ? 52   PRO B CA  1 
ATOM   1486 C  C   . PRO B 1 52  ? 56.927 -34.167 25.560  1.00 95.47  ? 52   PRO B C   1 
ATOM   1487 O  O   . PRO B 1 52  ? 55.926 -34.341 24.860  1.00 86.88  ? 52   PRO B O   1 
ATOM   1488 C  CB  . PRO B 1 52  ? 58.644 -35.687 24.563  1.00 114.27 ? 52   PRO B CB  1 
ATOM   1489 C  CG  . PRO B 1 52  ? 59.541 -36.141 25.705  1.00 104.46 ? 52   PRO B CG  1 
ATOM   1490 C  CD  . PRO B 1 52  ? 60.403 -34.917 25.917  1.00 124.48 ? 52   PRO B CD  1 
ATOM   1491 N  N   . ASP B 1 53  ? 56.899 -33.946 26.880  1.00 97.78  ? 53   ASP B N   1 
ATOM   1492 C  CA  . ASP B 1 53  ? 55.663 -33.825 27.666  1.00 104.38 ? 53   ASP B CA  1 
ATOM   1493 C  C   . ASP B 1 53  ? 55.503 -32.413 28.309  1.00 110.87 ? 53   ASP B C   1 
ATOM   1494 O  O   . ASP B 1 53  ? 54.636 -32.205 29.172  1.00 87.42  ? 53   ASP B O   1 
ATOM   1495 C  CB  . ASP B 1 53  ? 55.629 -34.886 28.789  1.00 116.26 ? 53   ASP B CB  1 
ATOM   1496 C  CG  . ASP B 1 53  ? 56.393 -34.435 30.091  1.00 139.93 ? 53   ASP B CG  1 
ATOM   1497 O  OD1 . ASP B 1 53  ? 55.948 -34.801 31.218  1.00 107.40 ? 53   ASP B OD1 1 
ATOM   1498 O  OD2 . ASP B 1 53  ? 57.439 -33.728 30.003  1.00 106.00 ? 53   ASP B OD2 1 
ATOM   1499 N  N   . MET B 1 54  ? 56.313 -31.435 27.903  1.00 69.31  ? 54   MET B N   1 
ATOM   1500 C  CA  . MET B 1 54  ? 56.208 -30.108 28.501  1.00 90.89  ? 54   MET B CA  1 
ATOM   1501 C  C   . MET B 1 54  ? 55.023 -29.210 28.108  1.00 94.14  ? 54   MET B C   1 
ATOM   1502 O  O   . MET B 1 54  ? 54.787 -28.901 26.941  1.00 105.65 ? 54   MET B O   1 
ATOM   1503 C  CB  . MET B 1 54  ? 57.487 -29.342 28.252  1.00 100.64 ? 54   MET B CB  1 
ATOM   1504 C  CG  . MET B 1 54  ? 57.538 -28.116 29.060  1.00 75.98  ? 54   MET B CG  1 
ATOM   1505 S  SD  . MET B 1 54  ? 59.017 -27.282 28.968  1.00 135.79 ? 54   MET B SD  1 
ATOM   1506 C  CE  . MET B 1 54  ? 60.034 -28.316 30.009  1.00 109.88 ? 54   MET B CE  1 
ATOM   1507 N  N   . ALA B 1 55  ? 54.300 -28.755 29.117  1.00 92.77  ? 55   ALA B N   1 
ATOM   1508 C  CA  . ALA B 1 55  ? 53.171 -27.885 28.879  1.00 82.80  ? 55   ALA B CA  1 
ATOM   1509 C  C   . ALA B 1 55  ? 53.449 -26.435 29.329  1.00 101.09 ? 55   ALA B C   1 
ATOM   1510 O  O   . ALA B 1 55  ? 54.519 -26.133 29.833  1.00 85.50  ? 55   ALA B O   1 
ATOM   1511 C  CB  . ALA B 1 55  ? 51.977 -28.427 29.592  1.00 102.10 ? 55   ALA B CB  1 
ATOM   1512 N  N   . GLN B 1 56  ? 52.483 -25.543 29.128  1.00 95.42  ? 56   GLN B N   1 
ATOM   1513 C  CA  . GLN B 1 56  ? 52.634 -24.143 29.516  1.00 62.30  ? 56   GLN B CA  1 
ATOM   1514 C  C   . GLN B 1 56  ? 51.303 -23.469 29.583  1.00 56.11  ? 56   GLN B C   1 
ATOM   1515 O  O   . GLN B 1 56  ? 50.370 -23.936 28.904  1.00 83.77  ? 56   GLN B O   1 
ATOM   1516 C  CB  . GLN B 1 56  ? 53.481 -23.419 28.525  1.00 65.03  ? 56   GLN B CB  1 
ATOM   1517 C  CG  . GLN B 1 56  ? 53.666 -21.958 28.845  1.00 67.98  ? 56   GLN B CG  1 
ATOM   1518 C  CD  . GLN B 1 56  ? 54.719 -21.382 27.941  1.00 85.05  ? 56   GLN B CD  1 
ATOM   1519 O  OE1 . GLN B 1 56  ? 54.780 -21.761 26.761  1.00 89.78  ? 56   GLN B OE1 1 
ATOM   1520 N  NE2 . GLN B 1 56  ? 55.586 -20.487 28.483  1.00 60.22  ? 56   GLN B NE2 1 
ATOM   1521 N  N   . CYS B 1 57  ? 51.182 -22.412 30.416  1.00 68.61  ? 57   CYS B N   1 
ATOM   1522 C  CA  . CYS B 1 57  ? 49.895 -21.619 30.530  1.00 62.69  ? 57   CYS B CA  1 
ATOM   1523 C  C   . CYS B 1 57  ? 49.952 -20.688 29.282  1.00 76.91  ? 57   CYS B C   1 
ATOM   1524 O  O   . CYS B 1 57  ? 51.042 -20.315 28.836  1.00 67.10  ? 57   CYS B O   1 
ATOM   1525 C  CB  . CYS B 1 57  ? 49.976 -20.663 31.636  1.00 50.58  ? 57   CYS B CB  1 
ATOM   1526 S  SG  . CYS B 1 57  ? 48.774 -20.186 32.916  1.00 70.90  ? 57   CYS B SG  1 
ATOM   1527 N  N   . PHE B 1 58  ? 48.821 -20.300 28.713  1.00 64.80  ? 58   PHE B N   1 
ATOM   1528 C  CA  . PHE B 1 58  ? 48.947 -19.428 27.569  1.00 90.57  ? 58   PHE B CA  1 
ATOM   1529 C  C   . PHE B 1 58  ? 49.015 -18.074 28.195  1.00 66.01  ? 58   PHE B C   1 
ATOM   1530 O  O   . PHE B 1 58  ? 49.689 -17.242 27.664  1.00 75.02  ? 58   PHE B O   1 
ATOM   1531 C  CB  . PHE B 1 58  ? 47.746 -19.514 26.609  1.00 55.74  ? 58   PHE B CB  1 
ATOM   1532 C  CG  . PHE B 1 58  ? 46.460 -18.955 27.187  1.00 36.53  ? 58   PHE B CG  1 
ATOM   1533 C  CD1 . PHE B 1 58  ? 45.911 -17.685 26.738  1.00 47.27  ? 58   PHE B CD1 1 
ATOM   1534 C  CD2 . PHE B 1 58  ? 45.765 -19.729 28.118  1.00 38.34  ? 58   PHE B CD2 1 
ATOM   1535 C  CE1 . PHE B 1 58  ? 44.653 -17.241 27.256  1.00 37.44  ? 58   PHE B CE1 1 
ATOM   1536 C  CE2 . PHE B 1 58  ? 44.504 -19.323 28.640  1.00 40.42  ? 58   PHE B CE2 1 
ATOM   1537 C  CZ  . PHE B 1 58  ? 43.946 -18.069 28.206  1.00 54.79  ? 58   PHE B CZ  1 
ATOM   1538 N  N   . PHE B 1 59  ? 48.367 -17.926 29.360  1.00 77.46  ? 59   PHE B N   1 
ATOM   1539 C  CA  . PHE B 1 59  ? 48.275 -16.670 30.112  1.00 76.07  ? 59   PHE B CA  1 
ATOM   1540 C  C   . PHE B 1 59  ? 49.386 -16.220 31.048  1.00 79.58  ? 59   PHE B C   1 
ATOM   1541 O  O   . PHE B 1 59  ? 49.918 -15.081 30.941  1.00 75.25  ? 59   PHE B O   1 
ATOM   1542 C  CB  . PHE B 1 59  ? 46.992 -16.676 30.913  1.00 61.25  ? 59   PHE B CB  1 
ATOM   1543 C  CG  . PHE B 1 59  ? 46.571 -15.304 31.380  1.00 94.32  ? 59   PHE B CG  1 
ATOM   1544 C  CD1 . PHE B 1 59  ? 45.280 -14.833 31.123  1.00 72.96  ? 59   PHE B CD1 1 
ATOM   1545 C  CD2 . PHE B 1 59  ? 47.439 -14.500 32.111  1.00 63.11  ? 59   PHE B CD2 1 
ATOM   1546 C  CE1 . PHE B 1 59  ? 44.849 -13.614 31.593  1.00 73.95  ? 59   PHE B CE1 1 
ATOM   1547 C  CE2 . PHE B 1 59  ? 47.002 -13.263 32.578  1.00 71.44  ? 59   PHE B CE2 1 
ATOM   1548 C  CZ  . PHE B 1 59  ? 45.713 -12.821 32.327  1.00 72.92  ? 59   PHE B CZ  1 
ATOM   1549 N  N   . CYS B 1 60  ? 49.679 -17.084 32.007  1.00 77.41  ? 60   CYS B N   1 
ATOM   1550 C  CA  . CYS B 1 60  ? 50.725 -16.835 33.034  1.00 84.59  ? 60   CYS B CA  1 
ATOM   1551 C  C   . CYS B 1 60  ? 52.094 -17.253 32.543  1.00 74.44  ? 60   CYS B C   1 
ATOM   1552 O  O   . CYS B 1 60  ? 53.089 -16.705 32.972  1.00 75.89  ? 60   CYS B O   1 
ATOM   1553 C  CB  . CYS B 1 60  ? 50.439 -17.616 34.368  1.00 89.78  ? 60   CYS B CB  1 
ATOM   1554 S  SG  . CYS B 1 60  ? 50.250 -19.478 34.362  1.00 60.28  ? 60   CYS B SG  1 
ATOM   1555 N  N   . PHE B 1 61  ? 52.133 -18.221 31.626  1.00 78.93  ? 61   PHE B N   1 
ATOM   1556 C  CA  . PHE B 1 61  ? 53.395 -18.737 31.054  1.00 73.90  ? 61   PHE B CA  1 
ATOM   1557 C  C   . PHE B 1 61  ? 54.203 -19.731 31.888  1.00 105.01 ? 61   PHE B C   1 
ATOM   1558 O  O   . PHE B 1 61  ? 55.323 -20.092 31.493  1.00 66.93  ? 61   PHE B O   1 
ATOM   1559 C  CB  . PHE B 1 61  ? 54.312 -17.603 30.630  1.00 66.00  ? 61   PHE B CB  1 
ATOM   1560 C  CG  . PHE B 1 61  ? 53.722 -16.736 29.556  1.00 92.82  ? 61   PHE B CG  1 
ATOM   1561 C  CD1 . PHE B 1 61  ? 52.781 -15.729 29.863  1.00 63.57  ? 61   PHE B CD1 1 
ATOM   1562 C  CD2 . PHE B 1 61  ? 54.023 -16.976 28.236  1.00 70.57  ? 61   PHE B CD2 1 
ATOM   1563 C  CE1 . PHE B 1 61  ? 52.168 -15.013 28.889  1.00 64.66  ? 61   PHE B CE1 1 
ATOM   1564 C  CE2 . PHE B 1 61  ? 53.399 -16.238 27.246  1.00 66.99  ? 61   PHE B CE2 1 
ATOM   1565 C  CZ  . PHE B 1 61  ? 52.481 -15.271 27.565  1.00 78.96  ? 61   PHE B CZ  1 
ATOM   1566 N  N   . LYS B 1 62  ? 53.685 -20.199 33.024  1.00 76.72  ? 62   LYS B N   1 
ATOM   1567 C  CA  . LYS B 1 62  ? 54.509 -21.133 33.734  1.00 78.16  ? 62   LYS B CA  1 
ATOM   1568 C  C   . LYS B 1 62  ? 54.590 -22.433 32.909  1.00 85.41  ? 62   LYS B C   1 
ATOM   1569 O  O   . LYS B 1 62  ? 53.575 -22.882 32.353  1.00 88.95  ? 62   LYS B O   1 
ATOM   1570 C  CB  . LYS B 1 62  ? 53.911 -21.400 35.106  1.00 81.32  ? 62   LYS B CB  1 
ATOM   1571 C  CG  . LYS B 1 62  ? 54.838 -22.218 35.952  1.00 81.42  ? 62   LYS B CG  1 
ATOM   1572 C  CD  . LYS B 1 62  ? 55.298 -21.405 37.149  1.00 134.32 ? 62   LYS B CD  1 
ATOM   1573 C  CE  . LYS B 1 62  ? 56.360 -22.113 38.005  1.00 120.73 ? 62   LYS B CE  1 
ATOM   1574 N  NZ  . LYS B 1 62  ? 56.475 -21.437 39.364  1.00 107.55 ? 62   LYS B NZ  1 
ATOM   1575 N  N   . GLU B 1 63  ? 55.804 -22.986 32.800  1.00 73.07  ? 63   GLU B N   1 
ATOM   1576 C  CA  . GLU B 1 63  ? 56.079 -24.266 32.122  1.00 82.52  ? 63   GLU B CA  1 
ATOM   1577 C  C   . GLU B 1 63  ? 56.165 -25.448 33.152  1.00 103.71 ? 63   GLU B C   1 
ATOM   1578 O  O   . GLU B 1 63  ? 56.796 -25.341 34.205  1.00 88.53  ? 63   GLU B O   1 
ATOM   1579 C  CB  . GLU B 1 63  ? 57.394 -24.173 31.329  1.00 76.47  ? 63   GLU B CB  1 
ATOM   1580 C  CG  . GLU B 1 63  ? 57.401 -23.025 30.304  1.00 84.65  ? 63   GLU B CG  1 
ATOM   1581 C  CD  . GLU B 1 63  ? 58.659 -22.934 29.443  1.00 106.36 ? 63   GLU B CD  1 
ATOM   1582 O  OE1 . GLU B 1 63  ? 58.833 -23.767 28.510  1.00 95.94  ? 63   GLU B OE1 1 
ATOM   1583 O  OE2 . GLU B 1 63  ? 59.465 -22.010 29.705  1.00 94.81  ? 63   GLU B OE2 1 
ATOM   1584 N  N   . LEU B 1 64  ? 55.528 -26.577 32.851  1.00 88.50  ? 64   LEU B N   1 
ATOM   1585 C  CA  . LEU B 1 64  ? 55.530 -27.721 33.762  1.00 59.33  ? 64   LEU B CA  1 
ATOM   1586 C  C   . LEU B 1 64  ? 55.810 -29.061 33.077  1.00 94.32  ? 64   LEU B C   1 
ATOM   1587 O  O   . LEU B 1 64  ? 55.149 -29.399 32.100  1.00 95.01  ? 64   LEU B O   1 
ATOM   1588 C  CB  . LEU B 1 64  ? 54.170 -27.819 34.461  1.00 57.66  ? 64   LEU B CB  1 
ATOM   1589 C  CG  . LEU B 1 64  ? 53.952 -26.971 35.710  1.00 58.16  ? 64   LEU B CG  1 
ATOM   1590 C  CD1 . LEU B 1 64  ? 54.666 -25.658 35.724  1.00 69.19  ? 64   LEU B CD1 1 
ATOM   1591 C  CD2 . LEU B 1 64  ? 52.483 -26.771 35.816  1.00 50.11  ? 64   LEU B CD2 1 
ATOM   1592 N  N   . GLU B 1 65  ? 56.762 -29.819 33.647  1.00 107.45 ? 65   GLU B N   1 
ATOM   1593 C  CA  . GLU B 1 65  ? 57.233 -31.124 33.153  1.00 85.85  ? 65   GLU B CA  1 
ATOM   1594 C  C   . GLU B 1 65  ? 56.830 -32.264 34.065  1.00 93.31  ? 65   GLU B C   1 
ATOM   1595 O  O   . GLU B 1 65  ? 56.177 -32.062 35.079  1.00 103.75 ? 65   GLU B O   1 
ATOM   1596 C  CB  . GLU B 1 65  ? 58.763 -31.114 33.062  1.00 80.20  ? 65   GLU B CB  1 
ATOM   1597 C  CG  . GLU B 1 65  ? 59.358 -32.232 32.171  1.00 124.75 ? 65   GLU B CG  1 
ATOM   1598 C  CD  . GLU B 1 65  ? 60.728 -31.857 31.572  1.00 132.25 ? 65   GLU B CD  1 
ATOM   1599 O  OE1 . GLU B 1 65  ? 61.425 -31.050 32.244  1.00 128.09 ? 65   GLU B OE1 1 
ATOM   1600 O  OE2 . GLU B 1 65  ? 61.093 -32.365 30.456  1.00 115.08 ? 65   GLU B OE2 1 
ATOM   1601 N  N   . GLY B 1 66  ? 57.227 -33.477 33.718  1.00 97.38  ? 66   GLY B N   1 
ATOM   1602 C  CA  . GLY B 1 66  ? 56.899 -34.598 34.580  1.00 95.98  ? 66   GLY B CA  1 
ATOM   1603 C  C   . GLY B 1 66  ? 55.441 -34.745 34.934  1.00 97.47  ? 66   GLY B C   1 
ATOM   1604 O  O   . GLY B 1 66  ? 55.018 -34.520 36.070  1.00 105.21 ? 66   GLY B O   1 
ATOM   1605 N  N   . TRP B 1 67  ? 54.660 -35.142 33.945  1.00 100.63 ? 67   TRP B N   1 
ATOM   1606 C  CA  . TRP B 1 67  ? 53.234 -35.320 34.135  1.00 84.99  ? 67   TRP B CA  1 
ATOM   1607 C  C   . TRP B 1 67  ? 53.013 -36.810 34.356  1.00 97.10  ? 67   TRP B C   1 
ATOM   1608 O  O   . TRP B 1 67  ? 53.744 -37.625 33.798  1.00 72.27  ? 67   TRP B O   1 
ATOM   1609 C  CB  . TRP B 1 67  ? 52.484 -34.817 32.868  1.00 77.55  ? 67   TRP B CB  1 
ATOM   1610 C  CG  . TRP B 1 67  ? 52.467 -33.286 32.780  1.00 94.77  ? 67   TRP B CG  1 
ATOM   1611 C  CD1 . TRP B 1 67  ? 53.469 -32.467 32.284  1.00 68.98  ? 67   TRP B CD1 1 
ATOM   1612 C  CD2 . TRP B 1 67  ? 51.545 -32.412 33.492  1.00 48.83  ? 67   TRP B CD2 1 
ATOM   1613 N  NE1 . TRP B 1 67  ? 53.246 -31.152 32.663  1.00 57.82  ? 67   TRP B NE1 1 
ATOM   1614 C  CE2 . TRP B 1 67  ? 52.086 -31.080 33.400  1.00 48.25  ? 67   TRP B CE2 1 
ATOM   1615 C  CE3 . TRP B 1 67  ? 50.345 -32.597 34.204  1.00 64.08  ? 67   TRP B CE3 1 
ATOM   1616 C  CZ2 . TRP B 1 67  ? 51.446 -29.946 34.005  1.00 70.25  ? 67   TRP B CZ2 1 
ATOM   1617 C  CZ3 . TRP B 1 67  ? 49.704 -31.466 34.806  1.00 69.43  ? 67   TRP B CZ3 1 
ATOM   1618 C  CH2 . TRP B 1 67  ? 50.276 -30.161 34.698  1.00 67.30  ? 67   TRP B CH2 1 
ATOM   1619 N  N   . GLU B 1 68  ? 52.027 -37.161 35.182  1.00 83.26  ? 68   GLU B N   1 
ATOM   1620 C  CA  . GLU B 1 68  ? 51.659 -38.558 35.437  1.00 89.14  ? 68   GLU B CA  1 
ATOM   1621 C  C   . GLU B 1 68  ? 50.126 -38.658 35.408  1.00 103.72 ? 68   GLU B C   1 
ATOM   1622 O  O   . GLU B 1 68  ? 49.399 -37.787 35.928  1.00 77.62  ? 68   GLU B O   1 
ATOM   1623 C  CB  . GLU B 1 68  ? 52.194 -39.049 36.787  1.00 140.75 ? 68   GLU B CB  1 
ATOM   1624 C  CG  . GLU B 1 68  ? 53.715 -38.936 36.968  1.00 148.55 ? 68   GLU B CG  1 
ATOM   1625 C  CD  . GLU B 1 68  ? 54.197 -39.640 38.243  1.00 149.85 ? 68   GLU B CD  1 
ATOM   1626 O  OE1 . GLU B 1 68  ? 53.626 -39.378 39.334  1.00 137.96 ? 68   GLU B OE1 1 
ATOM   1627 O  OE2 . GLU B 1 68  ? 55.147 -40.451 38.149  1.00 130.51 ? 68   GLU B OE2 1 
ATOM   1628 N  N   . PRO B 1 69  ? 49.624 -39.753 34.823  1.00 113.49 ? 69   PRO B N   1 
ATOM   1629 C  CA  . PRO B 1 69  ? 48.216 -40.091 34.635  1.00 96.98  ? 69   PRO B CA  1 
ATOM   1630 C  C   . PRO B 1 69  ? 47.255 -39.581 35.679  1.00 106.75 ? 69   PRO B C   1 
ATOM   1631 O  O   . PRO B 1 69  ? 46.075 -39.287 35.371  1.00 117.83 ? 69   PRO B O   1 
ATOM   1632 C  CB  . PRO B 1 69  ? 48.223 -41.627 34.593  1.00 97.07  ? 69   PRO B CB  1 
ATOM   1633 C  CG  . PRO B 1 69  ? 49.529 -41.930 34.032  1.00 87.00  ? 69   PRO B CG  1 
ATOM   1634 C  CD  . PRO B 1 69  ? 50.450 -40.969 34.746  1.00 91.81  ? 69   PRO B CD  1 
ATOM   1635 N  N   . ASP B 1 70  ? 47.748 -39.455 36.906  1.00 86.61  ? 70   ASP B N   1 
ATOM   1636 C  CA  . ASP B 1 70  ? 46.848 -39.098 37.994  1.00 86.99  ? 70   ASP B CA  1 
ATOM   1637 C  C   . ASP B 1 70  ? 46.834 -37.664 38.395  1.00 84.73  ? 70   ASP B C   1 
ATOM   1638 O  O   . ASP B 1 70  ? 45.921 -37.235 39.162  1.00 74.28  ? 70   ASP B O   1 
ATOM   1639 C  CB  . ASP B 1 70  ? 47.098 -40.032 39.196  1.00 135.85 ? 70   ASP B CB  1 
ATOM   1640 C  CG  . ASP B 1 70  ? 46.717 -41.503 38.887  1.00 130.51 ? 70   ASP B CG  1 
ATOM   1641 O  OD1 . ASP B 1 70  ? 45.532 -41.923 38.993  1.00 100.94 ? 70   ASP B OD1 1 
ATOM   1642 O  OD2 . ASP B 1 70  ? 47.621 -42.252 38.493  1.00 131.73 ? 70   ASP B OD2 1 
ATOM   1643 N  N   . ASP B 1 71  ? 47.837 -36.952 37.862  1.00 90.95  ? 71   ASP B N   1 
ATOM   1644 C  CA  . ASP B 1 71  ? 48.061 -35.486 38.014  1.00 79.92  ? 71   ASP B CA  1 
ATOM   1645 C  C   . ASP B 1 71  ? 46.784 -34.663 37.581  1.00 78.16  ? 71   ASP B C   1 
ATOM   1646 O  O   . ASP B 1 71  ? 46.288 -34.794 36.446  1.00 80.99  ? 71   ASP B O   1 
ATOM   1647 C  CB  . ASP B 1 71  ? 49.229 -35.049 37.095  1.00 70.08  ? 71   ASP B CB  1 
ATOM   1648 C  CG  . ASP B 1 71  ? 50.622 -35.430 37.624  1.00 70.14  ? 71   ASP B CG  1 
ATOM   1649 O  OD1 . ASP B 1 71  ? 50.732 -35.690 38.843  1.00 115.70 ? 71   ASP B OD1 1 
ATOM   1650 O  OD2 . ASP B 1 71  ? 51.623 -35.414 36.823  1.00 86.65  ? 71   ASP B OD2 1 
ATOM   1651 N  N   . ASP B 1 72  ? 46.256 -33.834 38.476  1.00 88.86  ? 72   ASP B N   1 
ATOM   1652 C  CA  . ASP B 1 72  ? 45.104 -32.971 38.159  1.00 91.35  ? 72   ASP B CA  1 
ATOM   1653 C  C   . ASP B 1 72  ? 45.722 -31.618 37.700  1.00 86.13  ? 72   ASP B C   1 
ATOM   1654 O  O   . ASP B 1 72  ? 46.177 -30.821 38.509  1.00 91.48  ? 72   ASP B O   1 
ATOM   1655 C  CB  . ASP B 1 72  ? 44.255 -32.792 39.416  1.00 96.62  ? 72   ASP B CB  1 
ATOM   1656 C  CG  . ASP B 1 72  ? 43.131 -31.775 39.245  1.00 98.06  ? 72   ASP B CG  1 
ATOM   1657 O  OD1 . ASP B 1 72  ? 42.344 -31.928 38.293  1.00 119.84 ? 72   ASP B OD1 1 
ATOM   1658 O  OD2 . ASP B 1 72  ? 43.034 -30.839 40.072  1.00 128.14 ? 72   ASP B OD2 1 
ATOM   1659 N  N   . PRO B 1 73  ? 45.710 -31.341 36.390  1.00 104.32 ? 73   PRO B N   1 
ATOM   1660 C  CA  . PRO B 1 73  ? 46.296 -30.100 35.857  1.00 98.11  ? 73   PRO B CA  1 
ATOM   1661 C  C   . PRO B 1 73  ? 45.872 -28.784 36.530  1.00 76.58  ? 73   PRO B C   1 
ATOM   1662 O  O   . PRO B 1 73  ? 46.713 -27.910 36.740  1.00 60.80  ? 73   PRO B O   1 
ATOM   1663 C  CB  . PRO B 1 73  ? 45.940 -30.135 34.366  1.00 74.25  ? 73   PRO B CB  1 
ATOM   1664 C  CG  . PRO B 1 73  ? 45.273 -31.499 34.146  1.00 75.98  ? 73   PRO B CG  1 
ATOM   1665 C  CD  . PRO B 1 73  ? 44.680 -31.854 35.474  1.00 78.55  ? 73   PRO B CD  1 
ATOM   1666 N  N   . ILE B 1 74  ? 44.595 -28.607 36.856  1.00 62.13  ? 74   ILE B N   1 
ATOM   1667 C  CA  . ILE B 1 74  ? 44.185 -27.376 37.553  1.00 60.59  ? 74   ILE B CA  1 
ATOM   1668 C  C   . ILE B 1 74  ? 44.966 -27.209 38.853  1.00 91.53  ? 74   ILE B C   1 
ATOM   1669 O  O   . ILE B 1 74  ? 45.550 -26.151 39.121  1.00 99.65  ? 74   ILE B O   1 
ATOM   1670 C  CB  . ILE B 1 74  ? 42.718 -27.391 37.904  1.00 66.71  ? 74   ILE B CB  1 
ATOM   1671 C  CG1 . ILE B 1 74  ? 41.917 -27.545 36.610  1.00 90.80  ? 74   ILE B CG1 1 
ATOM   1672 C  CG2 . ILE B 1 74  ? 42.348 -26.094 38.661  1.00 76.95  ? 74   ILE B CG2 1 
ATOM   1673 C  CD1 . ILE B 1 74  ? 40.411 -27.499 36.790  1.00 70.00  ? 74   ILE B CD1 1 
ATOM   1674 N  N   . GLU B 1 75  ? 44.961 -28.272 39.656  1.00 102.16 ? 75   GLU B N   1 
ATOM   1675 C  CA  . GLU B 1 75  ? 45.699 -28.290 40.909  1.00 73.59  ? 75   GLU B CA  1 
ATOM   1676 C  C   . GLU B 1 75  ? 47.193 -28.019 40.707  1.00 73.37  ? 75   GLU B C   1 
ATOM   1677 O  O   . GLU B 1 75  ? 47.770 -27.150 41.369  1.00 81.60  ? 75   GLU B O   1 
ATOM   1678 C  CB  . GLU B 1 75  ? 45.456 -29.615 41.635  1.00 106.26 ? 75   GLU B CB  1 
ATOM   1679 C  CG  . GLU B 1 75  ? 44.254 -29.490 42.582  1.00 139.19 ? 75   GLU B CG  1 
ATOM   1680 C  CD  . GLU B 1 75  ? 44.162 -28.080 43.284  1.00 162.09 ? 75   GLU B CD  1 
ATOM   1681 O  OE1 . GLU B 1 75  ? 45.216 -27.457 43.605  1.00 146.97 ? 75   GLU B OE1 1 
ATOM   1682 O  OE2 . GLU B 1 75  ? 43.026 -27.601 43.534  1.00 158.56 ? 75   GLU B OE2 1 
ATOM   1683 N  N   . GLU B 1 76  ? 47.830 -28.751 39.792  1.00 45.72  ? 76   GLU B N   1 
ATOM   1684 C  CA  . GLU B 1 76  ? 49.242 -28.466 39.519  1.00 49.32  ? 76   GLU B CA  1 
ATOM   1685 C  C   . GLU B 1 76  ? 49.453 -26.990 39.167  1.00 83.88  ? 76   GLU B C   1 
ATOM   1686 O  O   . GLU B 1 76  ? 50.495 -26.381 39.494  1.00 75.71  ? 76   GLU B O   1 
ATOM   1687 C  CB  . GLU B 1 76  ? 49.745 -29.330 38.340  1.00 51.46  ? 76   GLU B CB  1 
ATOM   1688 C  CG  . GLU B 1 76  ? 49.837 -30.834 38.647  1.00 112.81 ? 76   GLU B CG  1 
ATOM   1689 C  CD  . GLU B 1 76  ? 50.505 -31.104 39.994  1.00 123.93 ? 76   GLU B CD  1 
ATOM   1690 O  OE1 . GLU B 1 76  ? 51.699 -30.771 40.167  1.00 122.64 ? 76   GLU B OE1 1 
ATOM   1691 O  OE2 . GLU B 1 76  ? 49.822 -31.632 40.888  1.00 83.88  ? 76   GLU B OE2 1 
ATOM   1692 N  N   . HIS B 1 77  ? 48.450 -26.434 38.482  1.00 69.22  ? 77   HIS B N   1 
ATOM   1693 C  CA  . HIS B 1 77  ? 48.522 -25.079 38.032  1.00 80.17  ? 77   HIS B CA  1 
ATOM   1694 C  C   . HIS B 1 77  ? 48.409 -24.092 39.197  1.00 77.17  ? 77   HIS B C   1 
ATOM   1695 O  O   . HIS B 1 77  ? 49.240 -23.198 39.283  1.00 71.26  ? 77   HIS B O   1 
ATOM   1696 C  CB  . HIS B 1 77  ? 47.474 -24.839 36.944  1.00 90.91  ? 77   HIS B CB  1 
ATOM   1697 C  CG  . HIS B 1 77  ? 47.655 -23.552 36.190  1.00 95.63  ? 77   HIS B CG  1 
ATOM   1698 N  ND1 . HIS B 1 77  ? 46.592 -22.735 35.880  1.00 68.96  ? 77   HIS B ND1 1 
ATOM   1699 C  CD2 . HIS B 1 77  ? 48.775 -22.865 35.808  1.00 68.79  ? 77   HIS B CD2 1 
ATOM   1700 C  CE1 . HIS B 1 77  ? 47.036 -21.598 35.364  1.00 73.30  ? 77   HIS B CE1 1 
ATOM   1701 N  NE2 . HIS B 1 77  ? 48.359 -21.653 35.314  1.00 79.20  ? 77   HIS B NE2 1 
ATOM   1702 N  N   . LYS B 1 78  ? 47.432 -24.286 40.089  1.00 74.62  ? 78   LYS B N   1 
ATOM   1703 C  CA  . LYS B 1 78  ? 47.214 -23.439 41.295  1.00 74.10  ? 78   LYS B CA  1 
ATOM   1704 C  C   . LYS B 1 78  ? 48.392 -23.507 42.254  1.00 93.20  ? 78   LYS B C   1 
ATOM   1705 O  O   . LYS B 1 78  ? 48.681 -22.528 42.977  1.00 117.83 ? 78   LYS B O   1 
ATOM   1706 C  CB  . LYS B 1 78  ? 45.991 -23.890 42.127  1.00 57.57  ? 78   LYS B CB  1 
ATOM   1707 C  CG  . LYS B 1 78  ? 44.599 -23.422 41.704  1.00 100.79 ? 78   LYS B CG  1 
ATOM   1708 C  CD  . LYS B 1 78  ? 43.525 -24.071 42.593  1.00 73.20  ? 78   LYS B CD  1 
ATOM   1709 C  CE  . LYS B 1 78  ? 42.107 -23.450 42.386  1.00 105.50 ? 78   LYS B CE  1 
ATOM   1710 N  NZ  . LYS B 1 78  ? 41.000 -24.002 43.296  1.00 97.74  ? 78   LYS B NZ  1 
ATOM   1711 N  N   . LYS B 1 79  ? 49.055 -24.664 42.275  1.00 82.30  ? 79   LYS B N   1 
ATOM   1712 C  CA  . LYS B 1 79  ? 50.174 -24.871 43.168  1.00 97.37  ? 79   LYS B CA  1 
ATOM   1713 C  C   . LYS B 1 79  ? 51.512 -24.816 42.483  1.00 91.15  ? 79   LYS B C   1 
ATOM   1714 O  O   . LYS B 1 79  ? 52.404 -25.636 42.750  1.00 103.44 ? 79   LYS B O   1 
ATOM   1715 C  CB  . LYS B 1 79  ? 50.003 -26.204 43.899  1.00 114.67 ? 79   LYS B CB  1 
ATOM   1716 C  CG  . LYS B 1 79  ? 48.989 -26.122 45.047  1.00 137.03 ? 79   LYS B CG  1 
ATOM   1717 C  CD  . LYS B 1 79  ? 49.451 -26.984 46.230  1.00 153.58 ? 79   LYS B CD  1 
ATOM   1718 C  CE  . LYS B 1 79  ? 48.832 -26.582 47.582  1.00 121.88 ? 79   LYS B CE  1 
ATOM   1719 N  NZ  . LYS B 1 79  ? 49.486 -27.404 48.660  1.00 118.41 ? 79   LYS B NZ  1 
ATOM   1720 N  N   . HIS B 1 80  ? 51.636 -23.834 41.598  1.00 91.54  ? 80   HIS B N   1 
ATOM   1721 C  CA  . HIS B 1 80  ? 52.834 -23.583 40.797  1.00 86.06  ? 80   HIS B CA  1 
ATOM   1722 C  C   . HIS B 1 80  ? 52.713 -22.205 40.141  1.00 100.09 ? 80   HIS B C   1 
ATOM   1723 O  O   . HIS B 1 80  ? 53.669 -21.704 39.529  1.00 95.55  ? 80   HIS B O   1 
ATOM   1724 C  CB  . HIS B 1 80  ? 53.000 -24.658 39.752  1.00 77.83  ? 80   HIS B CB  1 
ATOM   1725 C  CG  . HIS B 1 80  ? 53.754 -25.838 40.236  1.00 98.39  ? 80   HIS B CG  1 
ATOM   1726 N  ND1 . HIS B 1 80  ? 55.109 -25.800 40.484  1.00 88.97  ? 80   HIS B ND1 1 
ATOM   1727 C  CD2 . HIS B 1 80  ? 53.369 -27.114 40.481  1.00 95.94  ? 80   HIS B CD2 1 
ATOM   1728 C  CE1 . HIS B 1 80  ? 55.525 -26.999 40.848  1.00 94.38  ? 80   HIS B CE1 1 
ATOM   1729 N  NE2 . HIS B 1 80  ? 54.477 -27.815 40.850  1.00 117.19 ? 80   HIS B NE2 1 
ATOM   1730 N  N   . SER B 1 81  ? 51.537 -21.600 40.301  1.00 84.44  ? 81   SER B N   1 
ATOM   1731 C  CA  . SER B 1 81  ? 51.231 -20.274 39.808  1.00 76.97  ? 81   SER B CA  1 
ATOM   1732 C  C   . SER B 1 81  ? 49.949 -19.897 40.516  1.00 83.10  ? 81   SER B C   1 
ATOM   1733 O  O   . SER B 1 81  ? 48.881 -20.387 40.207  1.00 117.86 ? 81   SER B O   1 
ATOM   1734 C  CB  . SER B 1 81  ? 51.032 -20.284 38.301  1.00 96.91  ? 81   SER B CB  1 
ATOM   1735 O  OG  . SER B 1 81  ? 51.281 -18.994 37.802  1.00 81.74  ? 81   SER B OG  1 
ATOM   1736 N  N   . SER B 1 82  ? 50.049 -19.047 41.506  1.00 111.65 ? 82   SER B N   1 
ATOM   1737 C  CA  . SER B 1 82  ? 48.863 -18.708 42.232  1.00 105.66 ? 82   SER B CA  1 
ATOM   1738 C  C   . SER B 1 82  ? 48.366 -17.399 41.681  1.00 104.66 ? 82   SER B C   1 
ATOM   1739 O  O   . SER B 1 82  ? 47.181 -17.099 41.783  1.00 87.43  ? 82   SER B O   1 
ATOM   1740 C  CB  . SER B 1 82  ? 49.219 -18.588 43.701  1.00 131.97 ? 82   SER B CB  1 
ATOM   1741 O  OG  . SER B 1 82  ? 48.074 -18.263 44.444  1.00 161.28 ? 82   SER B OG  1 
ATOM   1742 N  N   . GLY B 1 83  ? 49.301 -16.643 41.087  1.00 131.36 ? 83   GLY B N   1 
ATOM   1743 C  CA  . GLY B 1 83  ? 49.033 -15.328 40.510  1.00 137.21 ? 83   GLY B CA  1 
ATOM   1744 C  C   . GLY B 1 83  ? 48.840 -15.404 39.007  1.00 128.34 ? 83   GLY B C   1 
ATOM   1745 O  O   . GLY B 1 83  ? 49.664 -14.981 38.167  1.00 124.76 ? 83   GLY B O   1 
ATOM   1746 N  N   . CYS B 1 84  ? 47.723 -15.995 38.660  1.00 100.57 ? 84   CYS B N   1 
ATOM   1747 C  CA  . CYS B 1 84  ? 47.414 -16.147 37.294  1.00 80.62  ? 84   CYS B CA  1 
ATOM   1748 C  C   . CYS B 1 84  ? 45.935 -15.826 37.169  1.00 86.78  ? 84   CYS B C   1 
ATOM   1749 O  O   . CYS B 1 84  ? 45.086 -16.618 37.568  1.00 76.13  ? 84   CYS B O   1 
ATOM   1750 C  CB  . CYS B 1 84  ? 47.744 -17.556 36.895  1.00 105.20 ? 84   CYS B CB  1 
ATOM   1751 S  SG  . CYS B 1 84  ? 46.799 -17.903 35.459  1.00 85.79  ? 84   CYS B SG  1 
ATOM   1752 N  N   . ALA B 1 85  ? 45.639 -14.642 36.631  1.00 86.49  ? 85   ALA B N   1 
ATOM   1753 C  CA  . ALA B 1 85  ? 44.269 -14.190 36.494  1.00 82.09  ? 85   ALA B CA  1 
ATOM   1754 C  C   . ALA B 1 85  ? 43.372 -15.241 35.893  1.00 71.03  ? 85   ALA B C   1 
ATOM   1755 O  O   . ALA B 1 85  ? 42.211 -15.337 36.269  1.00 73.36  ? 85   ALA B O   1 
ATOM   1756 C  CB  . ALA B 1 85  ? 44.228 -12.948 35.668  1.00 107.11 ? 85   ALA B CB  1 
ATOM   1757 N  N   . PHE B 1 86  ? 43.919 -16.037 34.975  1.00 67.86  ? 86   PHE B N   1 
ATOM   1758 C  CA  . PHE B 1 86  ? 43.168 -17.089 34.300  1.00 57.40  ? 86   PHE B CA  1 
ATOM   1759 C  C   . PHE B 1 86  ? 42.388 -17.994 35.219  1.00 62.38  ? 86   PHE B C   1 
ATOM   1760 O  O   . PHE B 1 86  ? 41.162 -18.166 35.061  1.00 59.75  ? 86   PHE B O   1 
ATOM   1761 C  CB  . PHE B 1 86  ? 44.093 -17.925 33.435  1.00 69.88  ? 86   PHE B CB  1 
ATOM   1762 C  CG  . PHE B 1 86  ? 43.380 -18.882 32.561  1.00 97.51  ? 86   PHE B CG  1 
ATOM   1763 C  CD1 . PHE B 1 86  ? 42.492 -18.415 31.618  1.00 90.12  ? 86   PHE B CD1 1 
ATOM   1764 C  CD2 . PHE B 1 86  ? 43.556 -20.236 32.697  1.00 94.83  ? 86   PHE B CD2 1 
ATOM   1765 C  CE1 . PHE B 1 86  ? 41.774 -19.268 30.826  1.00 91.58  ? 86   PHE B CE1 1 
ATOM   1766 C  CE2 . PHE B 1 86  ? 42.841 -21.097 31.901  1.00 98.39  ? 86   PHE B CE2 1 
ATOM   1767 C  CZ  . PHE B 1 86  ? 41.944 -20.607 30.964  1.00 94.16  ? 86   PHE B CZ  1 
ATOM   1768 N  N   . LEU B 1 87  ? 43.062 -18.565 36.204  1.00 74.34  ? 87   LEU B N   1 
ATOM   1769 C  CA  . LEU B 1 87  ? 42.389 -19.460 37.144  1.00 73.87  ? 87   LEU B CA  1 
ATOM   1770 C  C   . LEU B 1 87  ? 41.134 -18.842 37.748  1.00 72.60  ? 87   LEU B C   1 
ATOM   1771 O  O   . LEU B 1 87  ? 40.155 -19.575 38.010  1.00 87.79  ? 87   LEU B O   1 
ATOM   1772 C  CB  . LEU B 1 87  ? 43.351 -19.902 38.234  1.00 87.60  ? 87   LEU B CB  1 
ATOM   1773 C  CG  . LEU B 1 87  ? 44.481 -20.705 37.608  1.00 100.72 ? 87   LEU B CG  1 
ATOM   1774 C  CD1 . LEU B 1 87  ? 45.700 -20.684 38.514  1.00 72.94  ? 87   LEU B CD1 1 
ATOM   1775 C  CD2 . LEU B 1 87  ? 43.990 -22.091 37.342  1.00 87.93  ? 87   LEU B CD2 1 
ATOM   1776 N  N   . SER B 1 88  ? 41.119 -17.512 37.941  1.00 83.36  ? 88   SER B N   1 
ATOM   1777 C  CA  . SER B 1 88  ? 39.911 -16.855 38.491  1.00 86.42  ? 88   SER B CA  1 
ATOM   1778 C  C   . SER B 1 88  ? 38.793 -16.599 37.439  1.00 66.68  ? 88   SER B C   1 
ATOM   1779 O  O   . SER B 1 88  ? 37.634 -16.350 37.784  1.00 70.14  ? 88   SER B O   1 
ATOM   1780 C  CB  . SER B 1 88  ? 40.314 -15.573 39.190  1.00 62.88  ? 88   SER B CB  1 
ATOM   1781 O  OG  . SER B 1 88  ? 41.694 -15.360 38.991  1.00 90.74  ? 88   SER B OG  1 
ATOM   1782 N  N   . VAL B 1 89  ? 39.136 -16.709 36.158  1.00 81.91  ? 89   VAL B N   1 
ATOM   1783 C  CA  . VAL B 1 89  ? 38.174 -16.554 35.061  1.00 78.83  ? 89   VAL B CA  1 
ATOM   1784 C  C   . VAL B 1 89  ? 37.215 -17.732 35.029  1.00 77.56  ? 89   VAL B C   1 
ATOM   1785 O  O   . VAL B 1 89  ? 37.553 -18.842 34.557  1.00 71.82  ? 89   VAL B O   1 
ATOM   1786 C  CB  . VAL B 1 89  ? 38.875 -16.506 33.699  1.00 91.16  ? 89   VAL B CB  1 
ATOM   1787 C  CG1 . VAL B 1 89  ? 37.881 -16.649 32.605  1.00 85.09  ? 89   VAL B CG1 1 
ATOM   1788 C  CG2 . VAL B 1 89  ? 39.625 -15.214 33.519  1.00 64.13  ? 89   VAL B CG2 1 
ATOM   1789 N  N   . LYS B 1 90  ? 36.018 -17.439 35.514  1.00 61.10  ? 90   LYS B N   1 
ATOM   1790 C  CA  . LYS B 1 90  ? 34.910 -18.363 35.625  1.00 93.09  ? 90   LYS B CA  1 
ATOM   1791 C  C   . LYS B 1 90  ? 33.977 -18.396 34.394  1.00 107.94 ? 90   LYS B C   1 
ATOM   1792 O  O   . LYS B 1 90  ? 33.366 -19.429 34.093  1.00 92.75  ? 90   LYS B O   1 
ATOM   1793 C  CB  . LYS B 1 90  ? 34.107 -18.000 36.886  1.00 102.55 ? 90   LYS B CB  1 
ATOM   1794 C  CG  . LYS B 1 90  ? 34.971 -17.793 38.175  1.00 123.61 ? 90   LYS B CG  1 
ATOM   1795 C  CD  . LYS B 1 90  ? 35.721 -19.065 38.613  1.00 137.64 ? 90   LYS B CD  1 
ATOM   1796 C  CE  . LYS B 1 90  ? 36.628 -18.832 39.835  1.00 129.28 ? 90   LYS B CE  1 
ATOM   1797 N  NZ  . LYS B 1 90  ? 37.252 -20.109 40.361  1.00 133.48 ? 90   LYS B NZ  1 
ATOM   1798 N  N   . LYS B 1 91  ? 33.868 -17.275 33.682  1.00 107.14 ? 91   LYS B N   1 
ATOM   1799 C  CA  . LYS B 1 91  ? 32.996 -17.179 32.506  1.00 81.66  ? 91   LYS B CA  1 
ATOM   1800 C  C   . LYS B 1 91  ? 33.508 -17.859 31.248  1.00 100.58 ? 91   LYS B C   1 
ATOM   1801 O  O   . LYS B 1 91  ? 34.720 -18.011 31.020  1.00 76.27  ? 91   LYS B O   1 
ATOM   1802 C  CB  . LYS B 1 91  ? 32.703 -15.719 32.172  1.00 69.65  ? 91   LYS B CB  1 
ATOM   1803 C  CG  . LYS B 1 91  ? 31.640 -15.122 33.007  1.00 88.94  ? 91   LYS B CG  1 
ATOM   1804 C  CD  . LYS B 1 91  ? 31.698 -13.638 32.921  1.00 79.44  ? 91   LYS B CD  1 
ATOM   1805 C  CE  . LYS B 1 91  ? 30.895 -13.045 34.063  1.00 113.81 ? 91   LYS B CE  1 
ATOM   1806 N  NZ  . LYS B 1 91  ? 31.063 -11.566 34.183  1.00 121.40 ? 91   LYS B NZ  1 
ATOM   1807 N  N   . GLN B 1 92  ? 32.569 -18.293 30.425  1.00 94.37  ? 92   GLN B N   1 
ATOM   1808 C  CA  . GLN B 1 92  ? 32.963 -18.919 29.178  1.00 101.61 ? 92   GLN B CA  1 
ATOM   1809 C  C   . GLN B 1 92  ? 33.546 -17.799 28.311  1.00 88.93  ? 92   GLN B C   1 
ATOM   1810 O  O   . GLN B 1 92  ? 33.198 -16.620 28.486  1.00 75.87  ? 92   GLN B O   1 
ATOM   1811 C  CB  . GLN B 1 92  ? 31.733 -19.553 28.532  1.00 109.36 ? 92   GLN B CB  1 
ATOM   1812 C  CG  . GLN B 1 92  ? 31.527 -20.999 28.924  1.00 121.00 ? 92   GLN B CG  1 
ATOM   1813 C  CD  . GLN B 1 92  ? 32.625 -21.887 28.336  1.00 132.49 ? 92   GLN B CD  1 
ATOM   1814 O  OE1 . GLN B 1 92  ? 33.829 -21.633 28.526  1.00 127.02 ? 92   GLN B OE1 1 
ATOM   1815 N  NE2 . GLN B 1 92  ? 32.214 -22.928 27.607  1.00 119.69 ? 92   GLN B NE2 1 
ATOM   1816 N  N   . PHE B 1 93  ? 34.431 -18.139 27.382  1.00 83.07  ? 93   PHE B N   1 
ATOM   1817 C  CA  . PHE B 1 93  ? 35.033 -17.117 26.528  1.00 84.94  ? 93   PHE B CA  1 
ATOM   1818 C  C   . PHE B 1 93  ? 33.983 -16.117 26.028  1.00 105.57 ? 93   PHE B C   1 
ATOM   1819 O  O   . PHE B 1 93  ? 33.985 -14.911 26.390  1.00 94.48  ? 93   PHE B O   1 
ATOM   1820 C  CB  . PHE B 1 93  ? 35.711 -17.764 25.338  1.00 67.80  ? 93   PHE B CB  1 
ATOM   1821 C  CG  . PHE B 1 93  ? 36.435 -16.800 24.495  1.00 62.43  ? 93   PHE B CG  1 
ATOM   1822 C  CD1 . PHE B 1 93  ? 37.728 -16.429 24.802  1.00 88.87  ? 93   PHE B CD1 1 
ATOM   1823 C  CD2 . PHE B 1 93  ? 35.848 -16.297 23.337  1.00 94.90  ? 93   PHE B CD2 1 
ATOM   1824 C  CE1 . PHE B 1 93  ? 38.459 -15.560 23.942  1.00 79.29  ? 93   PHE B CE1 1 
ATOM   1825 C  CE2 . PHE B 1 93  ? 36.559 -15.441 22.473  1.00 87.11  ? 93   PHE B CE2 1 
ATOM   1826 C  CZ  . PHE B 1 93  ? 37.883 -15.072 22.779  1.00 58.99  ? 93   PHE B CZ  1 
ATOM   1827 N  N   . GLU B 1 94  ? 33.064 -16.659 25.230  1.00 85.86  ? 94   GLU B N   1 
ATOM   1828 C  CA  . GLU B 1 94  ? 31.997 -15.891 24.632  1.00 74.46  ? 94   GLU B CA  1 
ATOM   1829 C  C   . GLU B 1 94  ? 31.079 -15.127 25.575  1.00 71.85  ? 94   GLU B C   1 
ATOM   1830 O  O   . GLU B 1 94  ? 30.302 -14.312 25.105  1.00 75.74  ? 94   GLU B O   1 
ATOM   1831 C  CB  . GLU B 1 94  ? 31.179 -16.792 23.692  1.00 86.38  ? 94   GLU B CB  1 
ATOM   1832 C  CG  . GLU B 1 94  ? 32.051 -17.341 22.540  1.00 111.00 ? 94   GLU B CG  1 
ATOM   1833 C  CD  . GLU B 1 94  ? 31.254 -17.788 21.309  1.00 130.58 ? 94   GLU B CD  1 
ATOM   1834 O  OE1 . GLU B 1 94  ? 31.885 -18.225 20.300  1.00 127.70 ? 94   GLU B OE1 1 
ATOM   1835 O  OE2 . GLU B 1 94  ? 30.001 -17.694 21.349  1.00 117.55 ? 94   GLU B OE2 1 
ATOM   1836 N  N   . GLU B 1 95  ? 31.151 -15.344 26.887  1.00 79.46  ? 95   GLU B N   1 
ATOM   1837 C  CA  . GLU B 1 95  ? 30.253 -14.617 27.780  1.00 65.11  ? 95   GLU B CA  1 
ATOM   1838 C  C   . GLU B 1 95  ? 31.046 -13.463 28.420  1.00 62.78  ? 95   GLU B C   1 
ATOM   1839 O  O   . GLU B 1 95  ? 30.566 -12.695 29.278  1.00 66.44  ? 95   GLU B O   1 
ATOM   1840 C  CB  . GLU B 1 95  ? 29.658 -15.583 28.809  1.00 88.22  ? 95   GLU B CB  1 
ATOM   1841 C  CG  . GLU B 1 95  ? 28.902 -14.952 30.010  1.00 113.68 ? 95   GLU B CG  1 
ATOM   1842 C  CD  . GLU B 1 95  ? 27.918 -13.800 29.640  1.00 122.00 ? 95   GLU B CD  1 
ATOM   1843 O  OE1 . GLU B 1 95  ? 26.713 -14.087 29.378  1.00 119.23 ? 95   GLU B OE1 1 
ATOM   1844 O  OE2 . GLU B 1 95  ? 28.356 -12.601 29.618  1.00 84.54  ? 95   GLU B OE2 1 
ATOM   1845 N  N   . LEU B 1 96  ? 32.307 -13.381 28.013  1.00 48.85  ? 96   LEU B N   1 
ATOM   1846 C  CA  . LEU B 1 96  ? 33.201 -12.288 28.411  1.00 62.17  ? 96   LEU B CA  1 
ATOM   1847 C  C   . LEU B 1 96  ? 32.836 -10.979 27.648  1.00 67.32  ? 96   LEU B C   1 
ATOM   1848 O  O   . LEU B 1 96  ? 32.445 -10.975 26.488  1.00 97.19  ? 96   LEU B O   1 
ATOM   1849 C  CB  . LEU B 1 96  ? 34.655 -12.602 28.027  1.00 58.63  ? 96   LEU B CB  1 
ATOM   1850 C  CG  . LEU B 1 96  ? 35.459 -13.470 28.959  1.00 72.54  ? 96   LEU B CG  1 
ATOM   1851 C  CD1 . LEU B 1 96  ? 36.860 -13.661 28.367  1.00 68.38  ? 96   LEU B CD1 1 
ATOM   1852 C  CD2 . LEU B 1 96  ? 35.464 -12.831 30.277  1.00 59.27  ? 96   LEU B CD2 1 
ATOM   1853 N  N   . THR B 1 97  ? 32.999 -9.871  28.326  1.00 93.07  ? 97   THR B N   1 
ATOM   1854 C  CA  . THR B 1 97  ? 32.791 -8.564  27.728  1.00 45.15  ? 97   THR B CA  1 
ATOM   1855 C  C   . THR B 1 97  ? 34.070 -8.271  26.966  1.00 72.55  ? 97   THR B C   1 
ATOM   1856 O  O   . THR B 1 97  ? 35.154 -8.777  27.351  1.00 66.92  ? 97   THR B O   1 
ATOM   1857 C  CB  . THR B 1 97  ? 32.573 -7.590  28.865  1.00 46.72  ? 97   THR B CB  1 
ATOM   1858 O  OG1 . THR B 1 97  ? 31.200 -7.253  28.840  1.00 48.66  ? 97   THR B OG1 1 
ATOM   1859 C  CG2 . THR B 1 97  ? 33.500 -6.395  28.860  1.00 57.90  ? 97   THR B CG2 1 
ATOM   1860 N  N   . LEU B 1 98  ? 33.947 -7.478  25.893  1.00 70.04  ? 98   LEU B N   1 
ATOM   1861 C  CA  . LEU B 1 98  ? 35.084 -7.048  25.058  1.00 53.99  ? 98   LEU B CA  1 
ATOM   1862 C  C   . LEU B 1 98  ? 36.052 -6.347  25.922  1.00 54.69  ? 98   LEU B C   1 
ATOM   1863 O  O   . LEU B 1 98  ? 37.258 -6.512  25.735  1.00 51.66  ? 98   LEU B O   1 
ATOM   1864 C  CB  . LEU B 1 98  ? 34.621 -6.092  23.975  1.00 84.69  ? 98   LEU B CB  1 
ATOM   1865 C  CG  . LEU B 1 98  ? 34.634 -6.730  22.590  1.00 72.17  ? 98   LEU B CG  1 
ATOM   1866 C  CD1 . LEU B 1 98  ? 36.034 -7.319  22.295  1.00 49.66  ? 98   LEU B CD1 1 
ATOM   1867 C  CD2 . LEU B 1 98  ? 33.631 -7.805  22.534  1.00 71.30  ? 98   LEU B CD2 1 
ATOM   1868 N  N   . GLY B 1 99  ? 35.515 -5.564  26.870  1.00 66.33  ? 99   GLY B N   1 
ATOM   1869 C  CA  . GLY B 1 99  ? 36.340 -4.845  27.814  1.00 59.00  ? 99   GLY B CA  1 
ATOM   1870 C  C   . GLY B 1 99  ? 37.125 -5.819  28.662  1.00 79.84  ? 99   GLY B C   1 
ATOM   1871 O  O   . GLY B 1 99  ? 38.361 -5.799  28.650  1.00 67.38  ? 99   GLY B O   1 
ATOM   1872 N  N   . GLU B 1 100 ? 36.426 -6.673  29.405  1.00 62.74  ? 100  GLU B N   1 
ATOM   1873 C  CA  . GLU B 1 100 ? 37.121 -7.662  30.254  1.00 64.69  ? 100  GLU B CA  1 
ATOM   1874 C  C   . GLU B 1 100 ? 38.147 -8.407  29.417  1.00 78.41  ? 100  GLU B C   1 
ATOM   1875 O  O   . GLU B 1 100 ? 39.322 -8.523  29.794  1.00 93.92  ? 100  GLU B O   1 
ATOM   1876 C  CB  . GLU B 1 100 ? 36.124 -8.661  30.796  1.00 54.20  ? 100  GLU B CB  1 
ATOM   1877 C  CG  . GLU B 1 100 ? 34.974 -7.980  31.576  1.00 67.40  ? 100  GLU B CG  1 
ATOM   1878 C  CD  . GLU B 1 100 ? 33.725 -8.855  31.744  1.00 91.60  ? 100  GLU B CD  1 
ATOM   1879 O  OE1 . GLU B 1 100 ? 33.617 -9.929  31.085  1.00 99.71  ? 100  GLU B OE1 1 
ATOM   1880 O  OE2 . GLU B 1 100 ? 32.831 -8.438  32.536  1.00 94.44  ? 100  GLU B OE2 1 
ATOM   1881 N  N   . PHE B 1 101 ? 37.685 -8.914  28.282  1.00 47.91  ? 101  PHE B N   1 
ATOM   1882 C  CA  . PHE B 1 101 ? 38.585 -9.646  27.431  1.00 65.39  ? 101  PHE B CA  1 
ATOM   1883 C  C   . PHE B 1 101 ? 39.816 -8.841  27.156  1.00 41.06  ? 101  PHE B C   1 
ATOM   1884 O  O   . PHE B 1 101 ? 40.943 -9.390  27.123  1.00 77.13  ? 101  PHE B O   1 
ATOM   1885 C  CB  . PHE B 1 101 ? 37.975 -10.063 26.080  1.00 44.63  ? 101  PHE B CB  1 
ATOM   1886 C  CG  . PHE B 1 101 ? 38.978 -10.673 25.227  1.00 57.78  ? 101  PHE B CG  1 
ATOM   1887 C  CD1 . PHE B 1 101 ? 39.668 -11.790 25.672  1.00 36.10  ? 101  PHE B CD1 1 
ATOM   1888 C  CD2 . PHE B 1 101 ? 39.414 -10.050 24.057  1.00 41.99  ? 101  PHE B CD2 1 
ATOM   1889 C  CE1 . PHE B 1 101 ? 40.819 -12.292 24.949  1.00 52.52  ? 101  PHE B CE1 1 
ATOM   1890 C  CE2 . PHE B 1 101 ? 40.547 -10.520 23.344  1.00 54.85  ? 101  PHE B CE2 1 
ATOM   1891 C  CZ  . PHE B 1 101 ? 41.248 -11.656 23.796  1.00 58.82  ? 101  PHE B CZ  1 
ATOM   1892 N  N   . LEU B 1 102 ? 39.666 -7.538  26.888  1.00 69.10  ? 102  LEU B N   1 
ATOM   1893 C  CA  . LEU B 1 102 ? 40.855 -6.688  26.638  1.00 82.85  ? 102  LEU B CA  1 
ATOM   1894 C  C   . LEU B 1 102 ? 41.768 -6.489  27.877  1.00 62.86  ? 102  LEU B C   1 
ATOM   1895 O  O   . LEU B 1 102 ? 42.999 -6.398  27.803  1.00 56.85  ? 102  LEU B O   1 
ATOM   1896 C  CB  . LEU B 1 102 ? 40.410 -5.350  26.113  1.00 94.52  ? 102  LEU B CB  1 
ATOM   1897 C  CG  . LEU B 1 102 ? 40.554 -5.210  24.597  1.00 91.94  ? 102  LEU B CG  1 
ATOM   1898 C  CD1 . LEU B 1 102 ? 40.516 -6.529  23.897  1.00 63.98  ? 102  LEU B CD1 1 
ATOM   1899 C  CD2 . LEU B 1 102 ? 39.461 -4.276  24.115  1.00 59.88  ? 102  LEU B CD2 1 
ATOM   1900 N  N   . LYS B 1 103 ? 41.154 -6.388  29.035  1.00 48.66  ? 103  LYS B N   1 
ATOM   1901 C  CA  . LYS B 1 103 ? 41.874 -6.310  30.305  1.00 81.71  ? 103  LYS B CA  1 
ATOM   1902 C  C   . LYS B 1 103 ? 42.739 -7.607  30.418  1.00 79.80  ? 103  LYS B C   1 
ATOM   1903 O  O   . LYS B 1 103 ? 43.964 -7.497  30.605  1.00 62.60  ? 103  LYS B O   1 
ATOM   1904 C  CB  . LYS B 1 103 ? 40.827 -6.199  31.420  1.00 78.64  ? 103  LYS B CB  1 
ATOM   1905 C  CG  . LYS B 1 103 ? 41.353 -5.617  32.709  1.00 98.83  ? 103  LYS B CG  1 
ATOM   1906 C  CD  . LYS B 1 103 ? 40.231 -5.406  33.703  1.00 116.71 ? 103  LYS B CD  1 
ATOM   1907 C  CE  . LYS B 1 103 ? 40.750 -5.082  35.117  1.00 84.50  ? 103  LYS B CE  1 
ATOM   1908 N  NZ  . LYS B 1 103 ? 39.584 -4.781  36.098  1.00 83.55  ? 103  LYS B NZ  1 
ATOM   1909 N  N   . LEU B 1 104 ? 42.139 -8.808  30.248  1.00 51.12  ? 104  LEU B N   1 
ATOM   1910 C  CA  . LEU B 1 104 ? 42.959 -10.050 30.335  1.00 45.92  ? 104  LEU B CA  1 
ATOM   1911 C  C   . LEU B 1 104 ? 44.071 -10.074 29.371  1.00 45.78  ? 104  LEU B C   1 
ATOM   1912 O  O   . LEU B 1 104 ? 45.177 -10.589 29.670  1.00 61.79  ? 104  LEU B O   1 
ATOM   1913 C  CB  . LEU B 1 104 ? 42.125 -11.334 30.143  1.00 37.12  ? 104  LEU B CB  1 
ATOM   1914 C  CG  . LEU B 1 104 ? 41.135 -11.392 31.319  1.00 49.35  ? 104  LEU B CG  1 
ATOM   1915 C  CD1 . LEU B 1 104 ? 39.899 -12.120 30.942  1.00 45.00  ? 104  LEU B CD1 1 
ATOM   1916 C  CD2 . LEU B 1 104 ? 41.861 -12.008 32.527  1.00 72.74  ? 104  LEU B CD2 1 
ATOM   1917 N  N   . ASP B 1 105 ? 43.828 -9.502  28.198  1.00 61.78  ? 105  ASP B N   1 
ATOM   1918 C  CA  . ASP B 1 105 ? 44.894 -9.560  27.207  1.00 44.57  ? 105  ASP B CA  1 
ATOM   1919 C  C   . ASP B 1 105 ? 45.948 -8.574  27.560  1.00 35.76  ? 105  ASP B C   1 
ATOM   1920 O  O   . ASP B 1 105 ? 47.205 -8.742  27.269  1.00 44.36  ? 105  ASP B O   1 
ATOM   1921 C  CB  . ASP B 1 105 ? 44.334 -9.356  25.787  1.00 73.64  ? 105  ASP B CB  1 
ATOM   1922 C  CG  . ASP B 1 105 ? 45.084 -10.198 24.751  1.00 61.01  ? 105  ASP B CG  1 
ATOM   1923 O  OD1 . ASP B 1 105 ? 46.357 -10.245 24.786  1.00 72.36  ? 105  ASP B OD1 1 
ATOM   1924 O  OD2 . ASP B 1 105 ? 44.446 -10.861 23.904  1.00 132.49 ? 105  ASP B OD2 1 
ATOM   1925 N  N   . ARG B 1 106 ? 45.496 -7.540  28.263  1.00 63.38  ? 106  ARG B N   1 
ATOM   1926 C  CA  . ARG B 1 106 ? 46.470 -6.551  28.637  1.00 67.59  ? 106  ARG B CA  1 
ATOM   1927 C  C   . ARG B 1 106 ? 47.342 -7.207  29.705  1.00 60.30  ? 106  ARG B C   1 
ATOM   1928 O  O   . ARG B 1 106 ? 48.550 -7.126  29.623  1.00 58.02  ? 106  ARG B O   1 
ATOM   1929 C  CB  . ARG B 1 106 ? 45.779 -5.272  29.099  1.00 79.25  ? 106  ARG B CB  1 
ATOM   1930 C  CG  . ARG B 1 106 ? 46.040 -4.111  28.129  1.00 62.28  ? 106  ARG B CG  1 
ATOM   1931 C  CD  . ARG B 1 106 ? 45.175 -2.872  28.449  1.00 46.47  ? 106  ARG B CD  1 
ATOM   1932 N  NE  . ARG B 1 106 ? 43.900 -3.181  29.061  1.00 47.23  ? 106  ARG B NE  1 
ATOM   1933 C  CZ  . ARG B 1 106 ? 42.756 -2.543  28.833  1.00 45.33  ? 106  ARG B CZ  1 
ATOM   1934 N  NH1 . ARG B 1 106 ? 42.730 -1.531  27.966  1.00 135.43 ? 106  ARG B NH1 1 
ATOM   1935 N  NH2 . ARG B 1 106 ? 41.597 -2.870  29.487  1.00 58.26  ? 106  ARG B NH2 1 
ATOM   1936 N  N   . GLU B 1 107 ? 46.740 -7.924  30.658  1.00 54.67  ? 107  GLU B N   1 
ATOM   1937 C  CA  . GLU B 1 107 ? 47.518 -8.631  31.707  1.00 63.96  ? 107  GLU B CA  1 
ATOM   1938 C  C   . GLU B 1 107 ? 48.359 -9.722  31.088  1.00 76.16  ? 107  GLU B C   1 
ATOM   1939 O  O   . GLU B 1 107 ? 49.533 -9.898  31.445  1.00 70.88  ? 107  GLU B O   1 
ATOM   1940 C  CB  . GLU B 1 107 ? 46.589 -9.273  32.712  1.00 56.27  ? 107  GLU B CB  1 
ATOM   1941 C  CG  . GLU B 1 107 ? 47.309 -9.900  33.902  1.00 69.85  ? 107  GLU B CG  1 
ATOM   1942 C  CD  . GLU B 1 107 ? 46.301 -10.229 35.021  1.00 68.32  ? 107  GLU B CD  1 
ATOM   1943 O  OE1 . GLU B 1 107 ? 46.692 -10.842 36.073  1.00 95.89  ? 107  GLU B OE1 1 
ATOM   1944 O  OE2 . GLU B 1 107 ? 45.105 -9.858  34.802  1.00 76.01  ? 107  GLU B OE2 1 
ATOM   1945 N  N   . ARG B 1 108 ? 47.770 -10.472 30.153  1.00 74.73  ? 108  ARG B N   1 
ATOM   1946 C  CA  . ARG B 1 108 ? 48.582 -11.530 29.558  1.00 64.97  ? 108  ARG B CA  1 
ATOM   1947 C  C   . ARG B 1 108 ? 49.863 -10.963 28.986  1.00 59.85  ? 108  ARG B C   1 
ATOM   1948 O  O   . ARG B 1 108 ? 50.981 -11.482 29.252  1.00 75.91  ? 108  ARG B O   1 
ATOM   1949 C  CB  . ARG B 1 108 ? 47.837 -12.336 28.459  1.00 82.38  ? 108  ARG B CB  1 
ATOM   1950 C  CG  . ARG B 1 108 ? 48.799 -13.222 27.544  1.00 49.97  ? 108  ARG B CG  1 
ATOM   1951 C  CD  . ARG B 1 108 ? 48.107 -14.407 27.006  1.00 66.81  ? 108  ARG B CD  1 
ATOM   1952 N  NE  . ARG B 1 108 ? 47.081 -14.060 26.011  1.00 93.64  ? 108  ARG B NE  1 
ATOM   1953 C  CZ  . ARG B 1 108 ? 47.327 -13.885 24.707  1.00 75.36  ? 108  ARG B CZ  1 
ATOM   1954 N  NH1 . ARG B 1 108 ? 48.529 -14.012 24.231  1.00 54.84  ? 108  ARG B NH1 1 
ATOM   1955 N  NH2 . ARG B 1 108 ? 46.387 -13.604 23.847  1.00 64.28  ? 108  ARG B NH2 1 
ATOM   1956 N  N   . ALA B 1 109 ? 49.763 -9.901  28.184  1.00 74.96  ? 109  ALA B N   1 
ATOM   1957 C  CA  . ALA B 1 109 ? 51.026 -9.421  27.596  1.00 83.83  ? 109  ALA B CA  1 
ATOM   1958 C  C   . ALA B 1 109 ? 52.020 -8.946  28.691  1.00 86.26  ? 109  ALA B C   1 
ATOM   1959 O  O   . ALA B 1 109 ? 53.231 -9.060  28.510  1.00 68.54  ? 109  ALA B O   1 
ATOM   1960 C  CB  . ALA B 1 109 ? 50.767 -8.333  26.546  1.00 95.75  ? 109  ALA B CB  1 
ATOM   1961 N  N   . LYS B 1 110 ? 51.505 -8.438  29.820  1.00 65.94  ? 110  LYS B N   1 
ATOM   1962 C  CA  . LYS B 1 110 ? 52.309 -7.999  30.965  1.00 78.67  ? 110  LYS B CA  1 
ATOM   1963 C  C   . LYS B 1 110 ? 53.114 -9.231  31.435  1.00 84.58  ? 110  LYS B C   1 
ATOM   1964 O  O   . LYS B 1 110 ? 54.347 -9.260  31.331  1.00 67.62  ? 110  LYS B O   1 
ATOM   1965 C  CB  . LYS B 1 110 ? 51.363 -7.520  32.059  1.00 92.51  ? 110  LYS B CB  1 
ATOM   1966 C  CG  . LYS B 1 110 ? 51.970 -6.632  33.128  1.00 114.74 ? 110  LYS B CG  1 
ATOM   1967 C  CD  . LYS B 1 110 ? 50.899 -6.239  34.171  1.00 128.43 ? 110  LYS B CD  1 
ATOM   1968 C  CE  . LYS B 1 110 ? 51.533 -5.693  35.468  1.00 124.19 ? 110  LYS B CE  1 
ATOM   1969 N  NZ  . LYS B 1 110 ? 50.563 -5.261  36.535  1.00 105.96 ? 110  LYS B NZ  1 
ATOM   1970 N  N   . ASN B 1 111 ? 52.431 -10.245 31.949  1.00 65.21  ? 111  ASN B N   1 
ATOM   1971 C  CA  . ASN B 1 111 ? 53.139 -11.478 32.317  1.00 57.99  ? 111  ASN B CA  1 
ATOM   1972 C  C   . ASN B 1 111 ? 54.199 -11.937 31.281  1.00 47.21  ? 111  ASN B C   1 
ATOM   1973 O  O   . ASN B 1 111 ? 55.279 -12.406 31.631  1.00 94.10  ? 111  ASN B O   1 
ATOM   1974 C  CB  . ASN B 1 111 ? 52.125 -12.613 32.485  1.00 31.04  ? 111  ASN B CB  1 
ATOM   1975 C  CG  . ASN B 1 111 ? 50.982 -12.227 33.387  1.00 54.19  ? 111  ASN B CG  1 
ATOM   1976 O  OD1 . ASN B 1 111 ? 51.043 -11.241 34.104  1.00 89.00  ? 111  ASN B OD1 1 
ATOM   1977 N  ND2 . ASN B 1 111 ? 49.921 -13.030 33.372  1.00 57.24  ? 111  ASN B ND2 1 
ATOM   1978 N  N   . LYS B 1 112 ? 53.889 -11.796 29.997  1.00 79.09  ? 112  LYS B N   1 
ATOM   1979 C  CA  . LYS B 1 112 ? 54.867 -12.257 29.017  1.00 89.00  ? 112  LYS B CA  1 
ATOM   1980 C  C   . LYS B 1 112 ? 56.128 -11.432 29.149  1.00 75.06  ? 112  LYS B C   1 
ATOM   1981 O  O   . LYS B 1 112 ? 57.227 -11.968 28.963  1.00 82.99  ? 112  LYS B O   1 
ATOM   1982 C  CB  . LYS B 1 112 ? 54.307 -12.196 27.586  1.00 77.60  ? 112  LYS B CB  1 
ATOM   1983 C  CG  . LYS B 1 112 ? 55.234 -12.826 26.546  1.00 67.02  ? 112  LYS B CG  1 
ATOM   1984 C  CD  . LYS B 1 112 ? 54.722 -12.713 25.116  1.00 87.37  ? 112  LYS B CD  1 
ATOM   1985 C  CE  . LYS B 1 112 ? 55.874 -12.920 24.120  1.00 106.22 ? 112  LYS B CE  1 
ATOM   1986 N  NZ  . LYS B 1 112 ? 55.749 -12.290 22.749  1.00 106.45 ? 112  LYS B NZ  1 
ATOM   1987 N  N   . ILE B 1 113 ? 55.963 -10.133 29.443  1.00 87.97  ? 113  ILE B N   1 
ATOM   1988 C  CA  . ILE B 1 113 ? 57.070 -9.171  29.632  1.00 85.00  ? 113  ILE B CA  1 
ATOM   1989 C  C   . ILE B 1 113 ? 57.832 -9.604  30.857  1.00 88.70  ? 113  ILE B C   1 
ATOM   1990 O  O   . ILE B 1 113 ? 59.026 -9.922  30.797  1.00 79.43  ? 113  ILE B O   1 
ATOM   1991 C  CB  . ILE B 1 113 ? 56.521 -7.753  29.839  1.00 80.58  ? 113  ILE B CB  1 
ATOM   1992 C  CG1 . ILE B 1 113 ? 56.403 -7.114  28.488  1.00 83.83  ? 113  ILE B CG1 1 
ATOM   1993 C  CG2 . ILE B 1 113 ? 57.407 -6.929  30.703  1.00 69.74  ? 113  ILE B CG2 1 
ATOM   1994 C  CD1 . ILE B 1 113 ? 57.686 -7.228  27.762  1.00 87.93  ? 113  ILE B CD1 1 
ATOM   1995 N  N   . ALA B 1 114 ? 57.097 -9.640  31.966  1.00 75.23  ? 114  ALA B N   1 
ATOM   1996 C  CA  . ALA B 1 114 ? 57.600 -10.092 33.260  1.00 68.38  ? 114  ALA B CA  1 
ATOM   1997 C  C   . ALA B 1 114 ? 58.486 -11.316 32.991  1.00 87.61  ? 114  ALA B C   1 
ATOM   1998 O  O   . ALA B 1 114 ? 59.697 -11.289 33.270  1.00 92.76  ? 114  ALA B O   1 
ATOM   1999 C  CB  . ALA B 1 114 ? 56.415 -10.460 34.150  1.00 53.36  ? 114  ALA B CB  1 
ATOM   2000 N  N   . LYS B 1 115 ? 57.903 -12.374 32.407  1.00 71.60  ? 115  LYS B N   1 
ATOM   2001 C  CA  . LYS B 1 115 ? 58.677 -13.567 32.112  1.00 54.50  ? 115  LYS B CA  1 
ATOM   2002 C  C   . LYS B 1 115 ? 59.924 -13.406 31.261  1.00 46.41  ? 115  LYS B C   1 
ATOM   2003 O  O   . LYS B 1 115 ? 60.942 -14.095 31.507  1.00 84.50  ? 115  LYS B O   1 
ATOM   2004 C  CB  . LYS B 1 115 ? 57.806 -14.718 31.541  1.00 78.75  ? 115  LYS B CB  1 
ATOM   2005 C  CG  . LYS B 1 115 ? 58.631 -15.983 31.224  1.00 72.89  ? 115  LYS B CG  1 
ATOM   2006 C  CD  . LYS B 1 115 ? 57.762 -17.204 31.237  1.00 107.71 ? 115  LYS B CD  1 
ATOM   2007 C  CE  . LYS B 1 115 ? 58.543 -18.463 30.922  1.00 90.87  ? 115  LYS B CE  1 
ATOM   2008 N  NZ  . LYS B 1 115 ? 57.591 -19.589 30.591  1.00 103.11 ? 115  LYS B NZ  1 
ATOM   2009 N  N   . GLU B 1 116 ? 59.927 -12.530 30.268  1.00 72.57  ? 116  GLU B N   1 
ATOM   2010 C  CA  . GLU B 1 116 ? 61.176 -12.431 29.486  1.00 75.74  ? 116  GLU B CA  1 
ATOM   2011 C  C   . GLU B 1 116 ? 62.202 -11.563 30.265  1.00 87.76  ? 116  GLU B C   1 
ATOM   2012 O  O   . GLU B 1 116 ? 63.404 -11.701 30.069  1.00 81.99  ? 116  GLU B O   1 
ATOM   2013 C  CB  . GLU B 1 116 ? 60.893 -11.834 28.103  1.00 120.58 ? 116  GLU B CB  1 
ATOM   2014 C  CG  . GLU B 1 116 ? 60.193 -10.490 28.203  1.00 141.76 ? 116  GLU B CG  1 
ATOM   2015 C  CD  . GLU B 1 116 ? 60.488 -9.533  27.039  1.00 147.04 ? 116  GLU B CD  1 
ATOM   2016 O  OE1 . GLU B 1 116 ? 61.681 -9.292  26.668  1.00 126.42 ? 116  GLU B OE1 1 
ATOM   2017 O  OE2 . GLU B 1 116 ? 59.497 -8.990  26.503  1.00 133.70 ? 116  GLU B OE2 1 
ATOM   2018 N  N   . THR B 1 117 ? 61.722 -10.681 31.146  1.00 77.42  ? 117  THR B N   1 
ATOM   2019 C  CA  . THR B 1 117 ? 62.582 -9.813  31.951  1.00 87.65  ? 117  THR B CA  1 
ATOM   2020 C  C   . THR B 1 117 ? 63.346 -10.732 32.885  1.00 94.05  ? 117  THR B C   1 
ATOM   2021 O  O   . THR B 1 117 ? 64.565 -10.630 33.010  1.00 81.93  ? 117  THR B O   1 
ATOM   2022 C  CB  . THR B 1 117 ? 61.750 -8.902  32.830  1.00 87.12  ? 117  THR B CB  1 
ATOM   2023 O  OG1 . THR B 1 117 ? 60.884 -8.146  32.006  1.00 90.52  ? 117  THR B OG1 1 
ATOM   2024 C  CG2 . THR B 1 117 ? 62.608 -7.986  33.651  1.00 108.15 ? 117  THR B CG2 1 
ATOM   2025 N  N   . ASN B 1 118 ? 62.606 -11.626 33.547  1.00 79.30  ? 118  ASN B N   1 
ATOM   2026 C  CA  . ASN B 1 118 ? 63.206 -12.578 34.471  1.00 55.15  ? 118  ASN B CA  1 
ATOM   2027 C  C   . ASN B 1 118 ? 64.253 -13.402 33.766  1.00 69.17  ? 118  ASN B C   1 
ATOM   2028 O  O   . ASN B 1 118 ? 65.342 -13.636 34.293  1.00 87.42  ? 118  ASN B O   1 
ATOM   2029 C  CB  . ASN B 1 118 ? 62.155 -13.441 35.083  1.00 70.64  ? 118  ASN B CB  1 
ATOM   2030 C  CG  . ASN B 1 118 ? 62.381 -13.631 36.545  1.00 99.94  ? 118  ASN B CG  1 
ATOM   2031 O  OD1 . ASN B 1 118 ? 63.435 -14.099 36.969  1.00 97.11  ? 118  ASN B OD1 1 
ATOM   2032 N  ND2 . ASN B 1 118 ? 61.400 -13.255 37.335  1.00 112.94 ? 118  ASN B ND2 1 
ATOM   2033 N  N   . ASN B 1 119 ? 63.970 -13.782 32.529  1.00 69.56  ? 119  ASN B N   1 
ATOM   2034 C  CA  . ASN B 1 119 ? 64.971 -14.545 31.796  1.00 56.83  ? 119  ASN B CA  1 
ATOM   2035 C  C   . ASN B 1 119 ? 66.215 -13.788 31.609  1.00 60.40  ? 119  ASN B C   1 
ATOM   2036 O  O   . ASN B 1 119 ? 67.325 -14.338 31.853  1.00 69.22  ? 119  ASN B O   1 
ATOM   2037 C  CB  . ASN B 1 119 ? 64.503 -14.980 30.400  1.00 110.50 ? 119  ASN B CB  1 
ATOM   2038 C  CG  . ASN B 1 119 ? 63.173 -15.649 30.421  1.00 106.31 ? 119  ASN B CG  1 
ATOM   2039 O  OD1 . ASN B 1 119 ? 62.874 -16.412 31.347  1.00 82.76  ? 119  ASN B OD1 1 
ATOM   2040 N  ND2 . ASN B 1 119 ? 62.344 -15.362 29.406  1.00 118.40 ? 119  ASN B ND2 1 
ATOM   2041 N  N   . LYS B 1 120 ? 66.056 -12.541 31.136  1.00 78.27  ? 120  LYS B N   1 
ATOM   2042 C  CA  . LYS B 1 120 ? 67.206 -11.678 30.906  1.00 84.44  ? 120  LYS B CA  1 
ATOM   2043 C  C   . LYS B 1 120 ? 67.983 -11.535 32.223  1.00 51.04  ? 120  LYS B C   1 
ATOM   2044 O  O   . LYS B 1 120 ? 69.213 -11.554 32.145  1.00 47.24  ? 120  LYS B O   1 
ATOM   2045 C  CB  . LYS B 1 120 ? 66.802 -10.297 30.368  1.00 89.48  ? 120  LYS B CB  1 
ATOM   2046 C  CG  . LYS B 1 120 ? 66.580 -10.226 28.847  1.00 93.05  ? 120  LYS B CG  1 
ATOM   2047 C  CD  . LYS B 1 120 ? 65.574 -9.102  28.497  1.00 95.97  ? 120  LYS B CD  1 
ATOM   2048 C  CE  . LYS B 1 120 ? 65.264 -8.962  27.019  1.00 67.82  ? 120  LYS B CE  1 
ATOM   2049 N  NZ  . LYS B 1 120 ? 66.529 -8.616  26.224  1.00 100.51 ? 120  LYS B NZ  1 
ATOM   2050 N  N   . LYS B 1 121 ? 67.326 -11.451 33.412  1.00 48.93  ? 121  LYS B N   1 
ATOM   2051 C  CA  . LYS B 1 121 ? 68.115 -11.322 34.660  1.00 47.10  ? 121  LYS B CA  1 
ATOM   2052 C  C   . LYS B 1 121 ? 69.008 -12.561 34.845  1.00 75.10  ? 121  LYS B C   1 
ATOM   2053 O  O   . LYS B 1 121 ? 70.243 -12.454 35.044  1.00 52.11  ? 121  LYS B O   1 
ATOM   2054 C  CB  . LYS B 1 121 ? 67.221 -11.148 35.913  1.00 82.19  ? 121  LYS B CB  1 
ATOM   2055 C  CG  . LYS B 1 121 ? 66.830 -9.693  36.151  1.00 115.71 ? 121  LYS B CG  1 
ATOM   2056 C  CD  . LYS B 1 121 ? 65.559 -9.490  36.996  1.00 134.54 ? 121  LYS B CD  1 
ATOM   2057 C  CE  . LYS B 1 121 ? 64.924 -8.095  36.700  1.00 131.39 ? 121  LYS B CE  1 
ATOM   2058 N  NZ  . LYS B 1 121 ? 63.694 -7.737  37.502  1.00 123.69 ? 121  LYS B NZ  1 
ATOM   2059 N  N   . LYS B 1 122 ? 68.383 -13.740 34.785  1.00 52.65  ? 122  LYS B N   1 
ATOM   2060 C  CA  . LYS B 1 122 ? 69.130 -15.002 34.938  1.00 59.46  ? 122  LYS B CA  1 
ATOM   2061 C  C   . LYS B 1 122 ? 70.262 -15.063 33.930  1.00 72.45  ? 122  LYS B C   1 
ATOM   2062 O  O   . LYS B 1 122 ? 71.419 -15.355 34.274  1.00 89.33  ? 122  LYS B O   1 
ATOM   2063 C  CB  . LYS B 1 122 ? 68.187 -16.185 34.756  1.00 70.96  ? 122  LYS B CB  1 
ATOM   2064 C  CG  . LYS B 1 122 ? 67.037 -16.127 35.734  1.00 82.86  ? 122  LYS B CG  1 
ATOM   2065 C  CD  . LYS B 1 122 ? 66.054 -17.316 35.627  1.00 94.74  ? 122  LYS B CD  1 
ATOM   2066 C  CE  . LYS B 1 122 ? 64.998 -17.228 36.778  1.00 102.34 ? 122  LYS B CE  1 
ATOM   2067 N  NZ  . LYS B 1 122 ? 64.175 -18.461 36.845  1.00 94.19  ? 122  LYS B NZ  1 
ATOM   2068 N  N   . GLU B 1 123 ? 69.955 -14.759 32.678  1.00 63.90  ? 123  GLU B N   1 
ATOM   2069 C  CA  . GLU B 1 123 ? 71.019 -14.776 31.666  1.00 78.09  ? 123  GLU B CA  1 
ATOM   2070 C  C   . GLU B 1 123 ? 72.151 -13.744 31.978  1.00 76.57  ? 123  GLU B C   1 
ATOM   2071 O  O   . GLU B 1 123 ? 73.363 -14.024 31.805  1.00 68.73  ? 123  GLU B O   1 
ATOM   2072 C  CB  . GLU B 1 123 ? 70.393 -14.543 30.277  1.00 99.36  ? 123  GLU B CB  1 
ATOM   2073 C  CG  . GLU B 1 123 ? 69.604 -15.732 29.740  1.00 126.86 ? 123  GLU B CG  1 
ATOM   2074 C  CD  . GLU B 1 123 ? 68.531 -15.336 28.735  1.00 145.43 ? 123  GLU B CD  1 
ATOM   2075 O  OE1 . GLU B 1 123 ? 68.868 -14.662 27.739  1.00 150.58 ? 123  GLU B OE1 1 
ATOM   2076 O  OE2 . GLU B 1 123 ? 67.349 -15.711 28.933  1.00 142.15 ? 123  GLU B OE2 1 
ATOM   2077 N  N   . PHE B 1 124 ? 71.766 -12.554 32.448  1.00 67.99  ? 124  PHE B N   1 
ATOM   2078 C  CA  . PHE B 1 124 ? 72.748 -11.554 32.800  1.00 64.15  ? 124  PHE B CA  1 
ATOM   2079 C  C   . PHE B 1 124 ? 73.581 -12.076 33.974  1.00 94.37  ? 124  PHE B C   1 
ATOM   2080 O  O   . PHE B 1 124 ? 74.793 -12.145 33.834  1.00 45.14  ? 124  PHE B O   1 
ATOM   2081 C  CB  . PHE B 1 124 ? 72.062 -10.235 33.182  1.00 91.07  ? 124  PHE B CB  1 
ATOM   2082 C  CG  . PHE B 1 124 ? 73.005 -9.096  33.330  1.00 89.42  ? 124  PHE B CG  1 
ATOM   2083 C  CD1 . PHE B 1 124 ? 73.785 -8.705  32.251  1.00 80.16  ? 124  PHE B CD1 1 
ATOM   2084 C  CD2 . PHE B 1 124 ? 73.219 -8.505  34.577  1.00 95.90  ? 124  PHE B CD2 1 
ATOM   2085 C  CE1 . PHE B 1 124 ? 74.800 -7.746  32.390  1.00 51.10  ? 124  PHE B CE1 1 
ATOM   2086 C  CE2 . PHE B 1 124 ? 74.232 -7.538  34.741  1.00 100.31 ? 124  PHE B CE2 1 
ATOM   2087 C  CZ  . PHE B 1 124 ? 75.031 -7.165  33.628  1.00 102.36 ? 124  PHE B CZ  1 
ATOM   2088 N  N   . GLU B 1 125 ? 72.970 -12.493 35.102  1.00 34.38  ? 125  GLU B N   1 
ATOM   2089 C  CA  . GLU B 1 125 ? 73.739 -12.973 36.284  1.00 90.41  ? 125  GLU B CA  1 
ATOM   2090 C  C   . GLU B 1 125 ? 74.694 -14.093 35.977  1.00 59.41  ? 125  GLU B C   1 
ATOM   2091 O  O   . GLU B 1 125 ? 75.811 -14.116 36.477  1.00 85.90  ? 125  GLU B O   1 
ATOM   2092 C  CB  . GLU B 1 125 ? 72.796 -13.341 37.426  1.00 49.81  ? 125  GLU B CB  1 
ATOM   2093 C  CG  . GLU B 1 125 ? 71.890 -12.146 37.711  1.00 106.32 ? 125  GLU B CG  1 
ATOM   2094 C  CD  . GLU B 1 125 ? 70.816 -12.418 38.746  1.00 142.97 ? 125  GLU B CD  1 
ATOM   2095 O  OE1 . GLU B 1 125 ? 70.001 -13.355 38.525  1.00 129.71 ? 125  GLU B OE1 1 
ATOM   2096 O  OE2 . GLU B 1 125 ? 70.787 -11.680 39.769  1.00 157.45 ? 125  GLU B OE2 1 
ATOM   2097 N  N   . GLU B 1 126 ? 74.267 -14.999 35.107  1.00 70.75  ? 126  GLU B N   1 
ATOM   2098 C  CA  . GLU B 1 126 ? 75.132 -16.092 34.680  1.00 58.88  ? 126  GLU B CA  1 
ATOM   2099 C  C   . GLU B 1 126 ? 76.393 -15.559 34.102  1.00 62.08  ? 126  GLU B C   1 
ATOM   2100 O  O   . GLU B 1 126 ? 77.489 -16.039 34.394  1.00 96.24  ? 126  GLU B O   1 
ATOM   2101 C  CB  . GLU B 1 126 ? 74.476 -16.931 33.592  1.00 112.77 ? 126  GLU B CB  1 
ATOM   2102 C  CG  . GLU B 1 126 ? 74.135 -18.362 33.970  1.00 139.37 ? 126  GLU B CG  1 
ATOM   2103 C  CD  . GLU B 1 126 ? 73.910 -19.254 32.741  1.00 141.26 ? 126  GLU B CD  1 
ATOM   2104 O  OE1 . GLU B 1 126 ? 73.331 -20.343 32.898  1.00 146.37 ? 126  GLU B OE1 1 
ATOM   2105 O  OE2 . GLU B 1 126 ? 74.320 -18.885 31.617  1.00 135.49 ? 126  GLU B OE2 1 
ATOM   2106 N  N   . THR B 1 127 ? 76.243 -14.595 33.206  1.00 75.42  ? 127  THR B N   1 
ATOM   2107 C  CA  . THR B 1 127 ? 77.394 -13.999 32.561  1.00 72.75  ? 127  THR B CA  1 
ATOM   2108 C  C   . THR B 1 127 ? 78.230 -13.254 33.571  1.00 67.63  ? 127  THR B C   1 
ATOM   2109 O  O   . THR B 1 127 ? 79.454 -13.324 33.534  1.00 57.32  ? 127  THR B O   1 
ATOM   2110 C  CB  . THR B 1 127 ? 76.920 -13.041 31.533  1.00 80.30  ? 127  THR B CB  1 
ATOM   2111 O  OG1 . THR B 1 127 ? 75.844 -13.685 30.856  1.00 84.42  ? 127  THR B OG1 1 
ATOM   2112 C  CG2 . THR B 1 127 ? 78.084 -12.586 30.567  1.00 51.20  ? 127  THR B CG2 1 
ATOM   2113 N  N   . ALA B 1 128 ? 77.566 -12.524 34.458  1.00 71.09  ? 128  ALA B N   1 
ATOM   2114 C  CA  . ALA B 1 128 ? 78.257 -11.778 35.497  1.00 75.61  ? 128  ALA B CA  1 
ATOM   2115 C  C   . ALA B 1 128 ? 79.222 -12.745 36.205  1.00 91.61  ? 128  ALA B C   1 
ATOM   2116 O  O   . ALA B 1 128 ? 80.436 -12.423 36.265  1.00 70.17  ? 128  ALA B O   1 
ATOM   2117 C  CB  . ALA B 1 128 ? 77.258 -11.204 36.454  1.00 63.68  ? 128  ALA B CB  1 
ATOM   2118 N  N   . LYS B 1 129 ? 78.717 -13.918 36.676  1.00 63.90  ? 129  LYS B N   1 
ATOM   2119 C  CA  . LYS B 1 129 ? 79.569 -14.946 37.362  1.00 71.28  ? 129  LYS B CA  1 
ATOM   2120 C  C   . LYS B 1 129 ? 80.710 -15.428 36.496  1.00 58.99  ? 129  LYS B C   1 
ATOM   2121 O  O   . LYS B 1 129 ? 81.840 -15.560 36.950  1.00 71.83  ? 129  LYS B O   1 
ATOM   2122 C  CB  . LYS B 1 129 ? 78.813 -16.218 37.764  1.00 73.07  ? 129  LYS B CB  1 
ATOM   2123 C  CG  . LYS B 1 129 ? 77.838 -16.095 38.940  1.00 88.83  ? 129  LYS B CG  1 
ATOM   2124 C  CD  . LYS B 1 129 ? 77.461 -17.486 39.462  1.00 104.12 ? 129  LYS B CD  1 
ATOM   2125 C  CE  . LYS B 1 129 ? 76.362 -17.472 40.558  1.00 111.10 ? 129  LYS B CE  1 
ATOM   2126 N  NZ  . LYS B 1 129 ? 76.013 -18.841 41.135  1.00 98.35  ? 129  LYS B NZ  1 
ATOM   2127 N  N   . LYS B 1 130 ? 80.441 -15.715 35.237  1.00 70.97  ? 130  LYS B N   1 
ATOM   2128 C  CA  . LYS B 1 130 ? 81.539 -16.190 34.405  1.00 63.37  ? 130  LYS B CA  1 
ATOM   2129 C  C   . LYS B 1 130 ? 82.602 -15.086 34.305  1.00 66.85  ? 130  LYS B C   1 
ATOM   2130 O  O   . LYS B 1 130 ? 83.819 -15.339 34.398  1.00 76.85  ? 130  LYS B O   1 
ATOM   2131 C  CB  . LYS B 1 130 ? 81.025 -16.637 33.005  1.00 84.15  ? 130  LYS B CB  1 
ATOM   2132 C  CG  . LYS B 1 130 ? 79.868 -17.685 33.010  1.00 103.16 ? 130  LYS B CG  1 
ATOM   2133 C  CD  . LYS B 1 130 ? 79.731 -18.528 31.698  1.00 99.81  ? 130  LYS B CD  1 
ATOM   2134 C  CE  . LYS B 1 130 ? 79.216 -17.733 30.499  1.00 119.36 ? 130  LYS B CE  1 
ATOM   2135 N  NZ  . LYS B 1 130 ? 79.226 -18.502 29.212  1.00 104.79 ? 130  LYS B NZ  1 
ATOM   2136 N  N   . VAL B 1 131 ? 82.165 -13.838 34.138  1.00 72.72  ? 131  VAL B N   1 
ATOM   2137 C  CA  . VAL B 1 131 ? 83.107 -12.751 34.023  1.00 64.47  ? 131  VAL B CA  1 
ATOM   2138 C  C   . VAL B 1 131 ? 83.868 -12.510 35.320  1.00 74.88  ? 131  VAL B C   1 
ATOM   2139 O  O   . VAL B 1 131 ? 85.078 -12.465 35.286  1.00 46.20  ? 131  VAL B O   1 
ATOM   2140 C  CB  . VAL B 1 131 ? 82.398 -11.475 33.540  1.00 77.19  ? 131  VAL B CB  1 
ATOM   2141 C  CG1 . VAL B 1 131 ? 83.337 -10.196 33.633  1.00 57.95  ? 131  VAL B CG1 1 
ATOM   2142 C  CG2 . VAL B 1 131 ? 81.998 -11.691 32.126  1.00 67.68  ? 131  VAL B CG2 1 
ATOM   2143 N  N   . ARG B 1 132 ? 83.185 -12.327 36.445  1.00 47.61  ? 132  ARG B N   1 
ATOM   2144 C  CA  . ARG B 1 132 ? 83.843 -12.132 37.758  1.00 98.93  ? 132  ARG B CA  1 
ATOM   2145 C  C   . ARG B 1 132 ? 84.929 -13.166 38.080  1.00 84.43  ? 132  ARG B C   1 
ATOM   2146 O  O   . ARG B 1 132 ? 86.093 -12.831 38.416  1.00 71.53  ? 132  ARG B O   1 
ATOM   2147 C  CB  . ARG B 1 132 ? 82.820 -12.214 38.853  1.00 88.72  ? 132  ARG B CB  1 
ATOM   2148 C  CG  . ARG B 1 132 ? 83.384 -11.769 40.108  1.00 75.39  ? 132  ARG B CG  1 
ATOM   2149 C  CD  . ARG B 1 132 ? 82.327 -11.845 41.172  1.00 79.86  ? 132  ARG B CD  1 
ATOM   2150 N  NE  . ARG B 1 132 ? 81.086 -11.350 40.595  1.00 115.19 ? 132  ARG B NE  1 
ATOM   2151 C  CZ  . ARG B 1 132 ? 80.110 -10.766 41.284  1.00 131.24 ? 132  ARG B CZ  1 
ATOM   2152 N  NH1 . ARG B 1 132 ? 80.223 -10.601 42.610  1.00 134.31 ? 132  ARG B NH1 1 
ATOM   2153 N  NH2 . ARG B 1 132 ? 79.033 -10.323 40.629  1.00 115.31 ? 132  ARG B NH2 1 
ATOM   2154 N  N   . ARG B 1 133 ? 84.510 -14.418 37.991  1.00 66.66  ? 133  ARG B N   1 
ATOM   2155 C  CA  . ARG B 1 133 ? 85.372 -15.554 38.242  1.00 70.19  ? 133  ARG B CA  1 
ATOM   2156 C  C   . ARG B 1 133 ? 86.614 -15.432 37.412  1.00 61.37  ? 133  ARG B C   1 
ATOM   2157 O  O   . ARG B 1 133 ? 87.755 -15.495 37.919  1.00 92.09  ? 133  ARG B O   1 
ATOM   2158 C  CB  . ARG B 1 133 ? 84.672 -16.892 37.876  1.00 77.91  ? 133  ARG B CB  1 
ATOM   2159 C  CG  . ARG B 1 133 ? 85.569 -17.910 37.109  1.00 128.58 ? 133  ARG B CG  1 
ATOM   2160 C  CD  . ARG B 1 133 ? 84.798 -19.044 36.341  1.00 160.56 ? 133  ARG B CD  1 
ATOM   2161 N  NE  . ARG B 1 133 ? 85.652 -19.753 35.360  1.00 166.68 ? 133  ARG B NE  1 
ATOM   2162 C  CZ  . ARG B 1 133 ? 85.361 -20.921 34.774  1.00 156.25 ? 133  ARG B CZ  1 
ATOM   2163 N  NH1 . ARG B 1 133 ? 84.224 -21.552 35.053  1.00 142.35 ? 133  ARG B NH1 1 
ATOM   2164 N  NH2 . ARG B 1 133 ? 86.219 -21.471 33.911  1.00 133.54 ? 133  ARG B NH2 1 
ATOM   2165 N  N   . ALA B 1 134 ? 86.404 -15.252 36.127  1.00 70.56  ? 134  ALA B N   1 
ATOM   2166 C  CA  . ALA B 1 134 ? 87.534 -15.214 35.234  1.00 73.24  ? 134  ALA B CA  1 
ATOM   2167 C  C   . ALA B 1 134 ? 88.514 -14.123 35.529  1.00 83.63  ? 134  ALA B C   1 
ATOM   2168 O  O   . ALA B 1 134 ? 89.713 -14.275 35.275  1.00 80.73  ? 134  ALA B O   1 
ATOM   2169 C  CB  . ALA B 1 134 ? 87.063 -15.082 33.866  1.00 61.64  ? 134  ALA B CB  1 
ATOM   2170 N  N   . ILE B 1 135 ? 87.996 -13.010 36.046  1.00 92.66  ? 135  ILE B N   1 
ATOM   2171 C  CA  . ILE B 1 135 ? 88.800 -11.842 36.359  1.00 88.85  ? 135  ILE B CA  1 
ATOM   2172 C  C   . ILE B 1 135 ? 89.515 -12.058 37.681  1.00 104.59 ? 135  ILE B C   1 
ATOM   2173 O  O   . ILE B 1 135 ? 90.717 -11.706 37.821  1.00 76.80  ? 135  ILE B O   1 
ATOM   2174 C  CB  . ILE B 1 135 ? 87.913 -10.624 36.397  1.00 94.11  ? 135  ILE B CB  1 
ATOM   2175 C  CG1 . ILE B 1 135 ? 88.629 -9.508  35.687  1.00 94.00  ? 135  ILE B CG1 1 
ATOM   2176 C  CG2 . ILE B 1 135 ? 87.504 -10.265 37.815  1.00 102.99 ? 135  ILE B CG2 1 
ATOM   2177 C  CD1 . ILE B 1 135 ? 87.708 -8.836  34.752  1.00 67.18  ? 135  ILE B CD1 1 
ATOM   2178 N  N   . GLU B 1 136 ? 88.768 -12.627 38.639  1.00 100.63 ? 136  GLU B N   1 
ATOM   2179 C  CA  . GLU B 1 136 ? 89.329 -13.003 39.934  1.00 55.99  ? 136  GLU B CA  1 
ATOM   2180 C  C   . GLU B 1 136 ? 90.570 -13.854 39.617  1.00 87.38  ? 136  GLU B C   1 
ATOM   2181 O  O   . GLU B 1 136 ? 91.702 -13.453 39.924  1.00 108.79 ? 136  GLU B O   1 
ATOM   2182 C  CB  . GLU B 1 136 ? 88.311 -13.812 40.724  1.00 72.57  ? 136  GLU B CB  1 
ATOM   2183 C  CG  . GLU B 1 136 ? 87.412 -12.918 41.629  1.00 76.04  ? 136  GLU B CG  1 
ATOM   2184 C  CD  . GLU B 1 136 ? 86.247 -13.691 42.269  1.00 115.29 ? 136  GLU B CD  1 
ATOM   2185 O  OE1 . GLU B 1 136 ? 86.377 -14.951 42.384  1.00 117.79 ? 136  GLU B OE1 1 
ATOM   2186 O  OE2 . GLU B 1 136 ? 85.229 -13.022 42.660  1.00 77.42  ? 136  GLU B OE2 1 
ATOM   2187 N  N   . GLN B 1 137 ? 90.370 -15.005 38.979  1.00 78.79  ? 137  GLN B N   1 
ATOM   2188 C  CA  . GLN B 1 137 ? 91.520 -15.841 38.577  1.00 77.42  ? 137  GLN B CA  1 
ATOM   2189 C  C   . GLN B 1 137 ? 92.717 -15.131 37.977  1.00 80.77  ? 137  GLN B C   1 
ATOM   2190 O  O   . GLN B 1 137 ? 93.860 -15.662 37.959  1.00 87.84  ? 137  GLN B O   1 
ATOM   2191 C  CB  . GLN B 1 137 ? 91.084 -16.895 37.579  1.00 88.86  ? 137  GLN B CB  1 
ATOM   2192 C  CG  . GLN B 1 137 ? 90.084 -17.854 38.132  1.00 92.37  ? 137  GLN B CG  1 
ATOM   2193 C  CD  . GLN B 1 137 ? 89.623 -18.794 37.073  1.00 108.07 ? 137  GLN B CD  1 
ATOM   2194 O  OE1 . GLN B 1 137 ? 90.384 -19.111 36.136  1.00 99.63  ? 137  GLN B OE1 1 
ATOM   2195 N  NE2 . GLN B 1 137 ? 88.372 -19.259 37.197  1.00 108.75 ? 137  GLN B NE2 1 
ATOM   2196 N  N   . LEU B 1 138 ? 92.480 -13.950 37.430  1.00 88.29  ? 138  LEU B N   1 
ATOM   2197 C  CA  . LEU B 1 138 ? 93.577 -13.217 36.827  1.00 92.29  ? 138  LEU B CA  1 
ATOM   2198 C  C   . LEU B 1 138 ? 94.348 -12.545 37.960  1.00 80.74  ? 138  LEU B C   1 
ATOM   2199 O  O   . LEU B 1 138 ? 95.552 -12.379 37.868  1.00 75.19  ? 138  LEU B O   1 
ATOM   2200 C  CB  . LEU B 1 138 ? 93.038 -12.187 35.831  1.00 63.24  ? 138  LEU B CB  1 
ATOM   2201 C  CG  . LEU B 1 138 ? 94.029 -11.220 35.221  1.00 65.59  ? 138  LEU B CG  1 
ATOM   2202 C  CD1 . LEU B 1 138 ? 95.191 -11.985 34.548  1.00 65.60  ? 138  LEU B CD1 1 
ATOM   2203 C  CD2 . LEU B 1 138 ? 93.323 -10.399 34.192  1.00 94.60  ? 138  LEU B CD2 1 
ATOM   2204 N  N   . ALA B 1 139 ? 93.668 -12.167 39.039  1.00 95.90  ? 139  ALA B N   1 
ATOM   2205 C  CA  . ALA B 1 139 ? 94.339 -11.543 40.192  1.00 108.82 ? 139  ALA B CA  1 
ATOM   2206 C  C   . ALA B 1 139 ? 94.819 -12.712 41.092  1.00 109.76 ? 139  ALA B C   1 
ATOM   2207 O  O   . ALA B 1 139 ? 94.300 -12.923 42.195  1.00 112.51 ? 139  ALA B O   1 
ATOM   2208 C  CB  . ALA B 1 139 ? 93.334 -10.650 40.931  1.00 72.14  ? 139  ALA B CB  1 
ATOM   2209 N  N   . ALA B 1 140 ? 95.797 -13.472 40.578  1.00 131.24 ? 140  ALA B N   1 
ATOM   2210 C  CA  . ALA B 1 140 ? 96.369 -14.686 41.205  1.00 127.02 ? 140  ALA B CA  1 
ATOM   2211 C  C   . ALA B 1 140 ? 97.465 -15.255 40.287  1.00 116.80 ? 140  ALA B C   1 
ATOM   2212 O  O   . ALA B 1 140 ? 98.406 -15.916 40.806  1.00 134.41 ? 140  ALA B O   1 
ATOM   2213 C  CB  . ALA B 1 140 ? 95.265 -15.790 41.429  1.00 62.56  ? 140  ALA B CB  1 
HETATM 2214 ZN ZN  . ZN  C 2 .   ? 24.738 0.656   7.998   1.00 82.63  ? 341  ZN  A ZN  1 
HETATM 2215 S  S   . SO4 D 3 .   ? 24.499 -16.774 13.690  1.00 148.83 ? 500  SO4 A S   1 
HETATM 2216 O  O1  . SO4 D 3 .   ? 24.445 -17.606 12.492  1.00 132.99 ? 500  SO4 A O1  1 
HETATM 2217 O  O2  . SO4 D 3 .   ? 23.919 -15.475 13.459  1.00 112.17 ? 500  SO4 A O2  1 
HETATM 2218 O  O3  . SO4 D 3 .   ? 25.897 -16.500 13.883  1.00 109.73 ? 500  SO4 A O3  1 
HETATM 2219 O  O4  . SO4 D 3 .   ? 23.900 -17.357 14.907  1.00 142.05 ? 500  SO4 A O4  1 
HETATM 2220 S  S   . SO4 E 3 .   ? 24.192 1.125   -2.858  1.00 156.84 ? 501  SO4 A S   1 
HETATM 2221 O  O1  . SO4 E 3 .   ? 25.428 1.050   -3.711  1.00 121.87 ? 501  SO4 A O1  1 
HETATM 2222 O  O2  . SO4 E 3 .   ? 23.073 0.310   -3.400  1.00 131.46 ? 501  SO4 A O2  1 
HETATM 2223 O  O3  . SO4 E 3 .   ? 23.738 2.538   -2.740  1.00 133.77 ? 501  SO4 A O3  1 
HETATM 2224 O  O4  . SO4 E 3 .   ? 24.511 0.601   -1.522  1.00 144.15 ? 501  SO4 A O4  1 
HETATM 2225 ZN ZN  . ZN  F 2 .   ? 48.200 -19.195 34.618  1.00 79.52  ? 342  ZN  B ZN  1 
HETATM 2226 S  S   . SO4 G 3 .   ? 43.786 -2.153  32.837  1.00 141.64 ? 502  SO4 B S   1 
HETATM 2227 O  O1  . SO4 G 3 .   ? 44.157 -2.834  34.107  1.00 154.38 ? 502  SO4 B O1  1 
HETATM 2228 O  O2  . SO4 G 3 .   ? 44.966 -2.085  31.927  1.00 103.98 ? 502  SO4 B O2  1 
HETATM 2229 O  O3  . SO4 G 3 .   ? 43.269 -0.784  33.070  1.00 137.77 ? 502  SO4 B O3  1 
HETATM 2230 O  O4  . SO4 G 3 .   ? 42.696 -2.926  32.231  1.00 153.82 ? 502  SO4 B O4  1 
HETATM 2231 O  O   . HOH H 4 .   ? 32.411 2.511   20.110  1.00 69.51  ? 1000 HOH A O   1 
HETATM 2232 O  O   . HOH H 4 .   ? 31.260 -0.677  17.246  1.00 55.37  ? 1001 HOH A O   1 
HETATM 2233 O  O   . HOH H 4 .   ? 32.470 23.541  8.601   1.00 54.86  ? 1002 HOH A O   1 
HETATM 2234 O  O   . HOH H 4 .   ? 32.665 4.454   1.761   1.00 86.91  ? 1003 HOH A O   1 
HETATM 2235 O  O   . HOH H 4 .   ? 34.723 -10.054 5.120   1.00 68.46  ? 1005 HOH A O   1 
HETATM 2236 O  O   . HOH H 4 .   ? 25.098 -12.623 -2.377  1.00 51.68  ? 1006 HOH A O   1 
HETATM 2237 O  O   . HOH H 4 .   ? 23.182 -6.307  8.560   1.00 48.99  ? 1007 HOH A O   1 
HETATM 2238 O  O   . HOH H 4 .   ? 25.900 10.393  13.891  1.00 57.98  ? 1008 HOH A O   1 
HETATM 2239 O  O   . HOH H 4 .   ? 28.223 -4.653  29.091  1.00 87.74  ? 1009 HOH A O   1 
HETATM 2240 O  O   . HOH H 4 .   ? 19.555 -5.962  -11.102 1.00 74.26  ? 1011 HOH A O   1 
HETATM 2241 O  O   . HOH H 4 .   ? 33.530 15.644  13.569  1.00 79.81  ? 1013 HOH A O   1 
HETATM 2242 O  O   . HOH H 4 .   ? 33.604 -2.871  6.961   1.00 59.94  ? 1015 HOH A O   1 
HETATM 2243 O  O   . HOH H 4 .   ? 26.358 1.775   17.521  1.00 89.68  ? 1017 HOH A O   1 
HETATM 2244 O  O   . HOH H 4 .   ? 19.725 -2.316  -23.486 1.00 75.81  ? 1019 HOH A O   1 
HETATM 2245 O  O   . HOH H 4 .   ? 44.807 14.435  5.807   1.00 86.53  ? 1021 HOH A O   1 
HETATM 2246 O  O   . HOH H 4 .   ? 25.114 21.706  11.042  1.00 93.94  ? 1022 HOH A O   1 
HETATM 2247 O  O   . HOH H 4 .   ? 35.781 23.162  5.724   1.00 59.14  ? 1023 HOH A O   1 
HETATM 2248 O  O   . HOH H 4 .   ? 40.659 -1.204  21.417  1.00 68.35  ? 1024 HOH A O   1 
HETATM 2249 O  O   . HOH H 4 .   ? 18.054 10.968  0.705   1.00 60.82  ? 1025 HOH A O   1 
HETATM 2250 O  O   . HOH H 4 .   ? 19.410 11.418  9.365   1.00 61.98  ? 1026 HOH A O   1 
HETATM 2251 O  O   . HOH H 4 .   ? 24.595 2.691   22.024  1.00 98.75  ? 1027 HOH A O   1 
HETATM 2252 O  O   . HOH H 4 .   ? 38.722 -0.337  22.509  1.00 63.85  ? 1029 HOH A O   1 
HETATM 2253 O  O   . HOH H 4 .   ? 23.073 -8.689  -24.392 1.00 63.92  ? 1030 HOH A O   1 
HETATM 2254 O  O   . HOH H 4 .   ? 24.035 19.739  -1.118  1.00 83.78  ? 1031 HOH A O   1 
HETATM 2255 O  O   . HOH H 4 .   ? 33.069 -9.466  9.036   1.00 55.47  ? 1033 HOH A O   1 
HETATM 2256 O  O   . HOH H 4 .   ? 20.838 -12.643 -0.796  1.00 65.80  ? 1036 HOH A O   1 
HETATM 2257 O  O   . HOH H 4 .   ? 22.891 11.579  1.474   1.00 59.37  ? 1038 HOH A O   1 
HETATM 2258 O  O   . HOH H 4 .   ? 14.825 -2.640  -24.878 1.00 93.43  ? 1040 HOH A O   1 
HETATM 2259 O  O   . HOH H 4 .   ? 40.228 9.327   17.145  1.00 70.00  ? 1041 HOH A O   1 
HETATM 2260 O  O   . HOH H 4 .   ? 24.824 12.442  -5.046  1.00 81.13  ? 1042 HOH A O   1 
HETATM 2261 O  O   . HOH H 4 .   ? 29.350 2.084   -34.168 1.00 74.41  ? 1044 HOH A O   1 
HETATM 2262 O  O   . HOH H 4 .   ? 24.706 -9.746  18.777  1.00 59.87  ? 1045 HOH A O   1 
HETATM 2263 O  O   . HOH H 4 .   ? 40.039 12.160  -4.002  1.00 87.18  ? 1047 HOH A O   1 
HETATM 2264 O  O   . HOH H 4 .   ? 33.342 2.295   18.022  1.00 80.97  ? 1050 HOH A O   1 
HETATM 2265 O  O   . HOH H 4 .   ? 35.025 6.061   20.571  1.00 67.51  ? 1052 HOH A O   1 
HETATM 2266 O  O   . HOH H 4 .   ? 20.312 21.645  -2.090  1.00 85.53  ? 1053 HOH A O   1 
HETATM 2267 O  O   . HOH H 4 .   ? 33.487 -6.399  -5.811  1.00 80.99  ? 1054 HOH A O   1 
HETATM 2268 O  O   . HOH H 4 .   ? 26.268 -14.260 20.169  1.00 85.72  ? 1055 HOH A O   1 
HETATM 2269 O  O   . HOH H 4 .   ? 40.057 -1.464  26.753  1.00 86.45  ? 1056 HOH A O   1 
HETATM 2270 O  O   . HOH H 4 .   ? 22.427 -11.779 -7.685  1.00 46.16  ? 1057 HOH A O   1 
HETATM 2271 O  O   . HOH H 4 .   ? 17.726 -6.721  11.638  1.00 90.37  ? 1058 HOH A O   1 
HETATM 2272 O  O   . HOH H 4 .   ? 34.077 1.155   23.598  1.00 65.84  ? 1060 HOH A O   1 
HETATM 2273 O  O   . HOH H 4 .   ? 36.398 11.612  18.598  1.00 94.64  ? 1062 HOH A O   1 
HETATM 2274 O  O   . HOH H 4 .   ? 29.043 1.338   18.535  1.00 75.76  ? 1063 HOH A O   1 
HETATM 2275 O  O   . HOH H 4 .   ? 26.205 15.164  -5.742  1.00 75.21  ? 1064 HOH A O   1 
HETATM 2276 O  O   . HOH H 4 .   ? 18.802 -9.311  -21.172 1.00 76.64  ? 1065 HOH A O   1 
HETATM 2277 O  O   . HOH H 4 .   ? 22.866 -12.517 -2.107  1.00 52.83  ? 1067 HOH A O   1 
HETATM 2278 O  O   . HOH H 4 .   ? 17.557 -0.586  -19.937 1.00 92.84  ? 1069 HOH A O   1 
HETATM 2279 O  O   . HOH H 4 .   ? 36.881 2.698   26.720  1.00 69.37  ? 1071 HOH A O   1 
HETATM 2280 O  O   . HOH H 4 .   ? 26.236 -1.040  -7.386  1.00 70.29  ? 1072 HOH A O   1 
HETATM 2281 O  O   . HOH H 4 .   ? 35.217 2.987   20.117  1.00 77.70  ? 1073 HOH A O   1 
HETATM 2282 O  O   . HOH H 4 .   ? 34.122 -13.204 -11.617 1.00 77.21  ? 1075 HOH A O   1 
HETATM 2283 O  O   . HOH H 4 .   ? 32.532 -11.442 3.568   1.00 51.91  ? 1084 HOH A O   1 
HETATM 2284 O  O   . HOH H 4 .   ? 43.660 24.253  6.975   1.00 79.62  ? 1085 HOH A O   1 
HETATM 2285 O  O   . HOH H 4 .   ? 23.875 -13.550 11.621  1.00 52.66  ? 1089 HOH A O   1 
HETATM 2286 O  O   . HOH I 4 .   ? 39.065 -17.756 28.187  1.00 52.36  ? 1004 HOH B O   1 
HETATM 2287 O  O   . HOH I 4 .   ? 40.338 -40.512 30.423  1.00 80.40  ? 1010 HOH B O   1 
HETATM 2288 O  O   . HOH I 4 .   ? 38.566 -19.321 16.326  1.00 81.47  ? 1012 HOH B O   1 
HETATM 2289 O  O   . HOH I 4 .   ? 32.787 -19.954 24.409  1.00 61.58  ? 1014 HOH B O   1 
HETATM 2290 O  O   . HOH I 4 .   ? 48.549 -10.785 25.080  1.00 54.98  ? 1016 HOH B O   1 
HETATM 2291 O  O   . HOH I 4 .   ? 48.149 -13.182 35.456  1.00 60.07  ? 1018 HOH B O   1 
HETATM 2292 O  O   . HOH I 4 .   ? 59.020 -7.243  33.899  1.00 73.29  ? 1020 HOH B O   1 
HETATM 2293 O  O   . HOH I 4 .   ? 51.015 -10.947 24.696  1.00 69.67  ? 1028 HOH B O   1 
HETATM 2294 O  O   . HOH I 4 .   ? 57.211 -27.525 31.393  1.00 85.92  ? 1032 HOH B O   1 
HETATM 2295 O  O   . HOH I 4 .   ? 36.857 -21.441 25.913  1.00 66.23  ? 1034 HOH B O   1 
HETATM 2296 O  O   . HOH I 4 .   ? 38.755 -13.006 37.840  1.00 79.37  ? 1035 HOH B O   1 
HETATM 2297 O  O   . HOH I 4 .   ? 64.699 -38.597 23.370  1.00 90.06  ? 1037 HOH B O   1 
HETATM 2298 O  O   . HOH I 4 .   ? 40.241 -18.768 11.867  1.00 71.52  ? 1039 HOH B O   1 
HETATM 2299 O  O   . HOH I 4 .   ? 77.384 -10.979 42.169  1.00 62.01  ? 1043 HOH B O   1 
HETATM 2300 O  O   . HOH I 4 .   ? 40.841 -13.007 36.362  1.00 85.99  ? 1046 HOH B O   1 
HETATM 2301 O  O   . HOH I 4 .   ? 96.766 -16.715 37.077  1.00 64.89  ? 1048 HOH B O   1 
HETATM 2302 O  O   . HOH I 4 .   ? 37.380 -20.948 32.143  1.00 79.88  ? 1049 HOH B O   1 
HETATM 2303 O  O   . HOH I 4 .   ? 35.079 -22.502 26.806  1.00 81.60  ? 1051 HOH B O   1 
HETATM 2304 O  O   . HOH I 4 .   ? 39.074 -21.322 27.899  1.00 53.98  ? 1059 HOH B O   1 
HETATM 2305 O  O   . HOH I 4 .   ? 41.168 -26.408 45.257  1.00 95.99  ? 1061 HOH B O   1 
HETATM 2306 O  O   . HOH I 4 .   ? 39.882 -12.277 41.271  1.00 66.04  ? 1066 HOH B O   1 
HETATM 2307 O  O   . HOH I 4 .   ? 62.103 -30.533 18.312  1.00 84.40  ? 1068 HOH B O   1 
HETATM 2308 O  O   . HOH I 4 .   ? 38.265 -17.981 13.126  1.00 76.37  ? 1070 HOH B O   1 
HETATM 2309 O  O   . HOH I 4 .   ? 53.064 -10.920 22.341  1.00 70.81  ? 1074 HOH B O   1 
HETATM 2310 O  O   . HOH I 4 .   ? 49.179 -16.621 24.681  1.00 96.06  ? 1076 HOH B O   1 
HETATM 2311 O  O   . HOH I 4 .   ? 53.510 -19.801 24.796  1.00 73.33  ? 1077 HOH B O   1 
HETATM 2312 O  O   . HOH I 4 .   ? 37.031 -15.693 11.403  1.00 94.32  ? 1078 HOH B O   1 
HETATM 2313 O  O   . HOH I 4 .   ? 52.436 -14.012 35.697  1.00 64.41  ? 1079 HOH B O   1 
HETATM 2314 O  O   . HOH I 4 .   ? 56.272 -6.929  33.711  1.00 71.46  ? 1080 HOH B O   1 
HETATM 2315 O  O   . HOH I 4 .   ? 34.636 -28.230 19.554  1.00 92.36  ? 1081 HOH B O   1 
HETATM 2316 O  O   . HOH I 4 .   ? 99.849 -14.670 38.793  1.00 77.46  ? 1082 HOH B O   1 
HETATM 2317 O  O   . HOH I 4 .   ? 41.112 -18.754 15.599  1.00 80.28  ? 1083 HOH B O   1 
HETATM 2318 O  O   . HOH I 4 .   ? 34.426 -19.011 19.976  1.00 63.01  ? 1086 HOH B O   1 
HETATM 2319 O  O   . HOH I 4 .   ? 36.950 -13.626 35.104  1.00 77.12  ? 1087 HOH B O   1 
HETATM 2320 O  O   . HOH I 4 .   ? 34.549 -14.707 35.862  1.00 79.20  ? 1088 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   PRO 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  TRP 10  10  10  TRP TRP A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  PHE 13  13  13  PHE PHE A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  TRP 25  25  25  TRP TRP A . n 
A 1 26  PRO 26  26  26  PRO PRO A . n 
A 1 27  PHE 27  27  27  PHE PHE A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  CYS 31  31  31  CYS CYS A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  CYS 33  33  33  CYS CYS A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  HIS 45  45  45  HIS HIS A . n 
A 1 46  CYS 46  46  46  CYS CYS A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  MET 54  54  54  MET MET A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  CYS 57  57  57  CYS CYS A . n 
A 1 58  PHE 58  58  58  PHE PHE A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  CYS 60  60  60  CYS CYS A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  TRP 67  67  67  TRP TRP A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  HIS 77  77  77  HIS HIS A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  HIS 80  80  80  HIS HIS A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  CYS 84  84  84  CYS CYS A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  PHE 86  86  86  PHE PHE A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 MET 141 141 ?   ?   ?   A . n 
A 1 142 ASP 142 142 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ALA 3   3   ?   ?   ?   B . n 
B 1 4   PRO 4   4   ?   ?   ?   B . n 
B 1 5   THR 5   5   ?   ?   ?   B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   PRO 7   7   7   PRO PRO B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   ALA 9   9   9   ALA ALA B . n 
B 1 10  TRP 10  10  10  TRP TRP B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  PRO 12  12  12  PRO PRO B . n 
B 1 13  PHE 13  13  13  PHE PHE B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  LYS 15  15  15  LYS LYS B . n 
B 1 16  ASP 16  16  16  ASP ASP B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  SER 20  20  20  SER SER B . n 
B 1 21  THR 21  21  21  THR THR B . n 
B 1 22  PHE 22  22  22  PHE PHE B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ASN 24  24  24  ASN ASN B . n 
B 1 25  TRP 25  25  25  TRP TRP B . n 
B 1 26  PRO 26  26  26  PRO PRO B . n 
B 1 27  PHE 27  27  27  PHE PHE B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  GLU 29  29  29  GLU GLU B . n 
B 1 30  GLY 30  30  30  GLY GLY B . n 
B 1 31  CYS 31  31  31  CYS CYS B . n 
B 1 32  ALA 32  32  32  ALA ALA B . n 
B 1 33  CYS 33  33  33  CYS CYS B . n 
B 1 34  THR 34  34  34  THR THR B . n 
B 1 35  PRO 35  35  35  PRO PRO B . n 
B 1 36  GLU 36  36  36  GLU GLU B . n 
B 1 37  ARG 37  37  37  ARG ARG B . n 
B 1 38  MET 38  38  38  MET MET B . n 
B 1 39  ALA 39  39  39  ALA ALA B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  ILE 44  44  44  ILE ILE B . n 
B 1 45  HIS 45  45  45  HIS HIS B . n 
B 1 46  CYS 46  46  46  CYS CYS B . n 
B 1 47  PRO 47  47  47  PRO PRO B . n 
B 1 48  THR 48  48  48  THR THR B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  MET 54  54  54  MET MET B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  GLN 56  56  56  GLN GLN B . n 
B 1 57  CYS 57  57  57  CYS CYS B . n 
B 1 58  PHE 58  58  58  PHE PHE B . n 
B 1 59  PHE 59  59  59  PHE PHE B . n 
B 1 60  CYS 60  60  60  CYS CYS B . n 
B 1 61  PHE 61  61  61  PHE PHE B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  GLU 63  63  63  GLU GLU B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  TRP 67  67  67  TRP TRP B . n 
B 1 68  GLU 68  68  68  GLU GLU B . n 
B 1 69  PRO 69  69  69  PRO PRO B . n 
B 1 70  ASP 70  70  70  ASP ASP B . n 
B 1 71  ASP 71  71  71  ASP ASP B . n 
B 1 72  ASP 72  72  72  ASP ASP B . n 
B 1 73  PRO 73  73  73  PRO PRO B . n 
B 1 74  ILE 74  74  74  ILE ILE B . n 
B 1 75  GLU 75  75  75  GLU GLU B . n 
B 1 76  GLU 76  76  76  GLU GLU B . n 
B 1 77  HIS 77  77  77  HIS HIS B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  HIS 80  80  80  HIS HIS B . n 
B 1 81  SER 81  81  81  SER SER B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  CYS 84  84  84  CYS CYS B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  PHE 86  86  86  PHE PHE B . n 
B 1 87  LEU 87  87  87  LEU LEU B . n 
B 1 88  SER 88  88  88  SER SER B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  GLN 92  92  92  GLN GLN B . n 
B 1 93  PHE 93  93  93  PHE PHE B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  GLU 95  95  95  GLU GLU B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  THR 97  97  97  THR THR B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 PHE 101 101 101 PHE PHE B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 GLU 107 107 107 GLU GLU B . n 
B 1 108 ARG 108 108 108 ARG ARG B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 LYS 110 110 110 LYS LYS B . n 
B 1 111 ASN 111 111 111 ASN ASN B . n 
B 1 112 LYS 112 112 112 LYS LYS B . n 
B 1 113 ILE 113 113 113 ILE ILE B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 LYS 115 115 115 LYS LYS B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 THR 117 117 117 THR THR B . n 
B 1 118 ASN 118 118 118 ASN ASN B . n 
B 1 119 ASN 119 119 119 ASN ASN B . n 
B 1 120 LYS 120 120 120 LYS LYS B . n 
B 1 121 LYS 121 121 121 LYS LYS B . n 
B 1 122 LYS 122 122 122 LYS LYS B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 PHE 124 124 124 PHE PHE B . n 
B 1 125 GLU 125 125 125 GLU GLU B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 THR 127 127 127 THR THR B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 LYS 130 130 130 LYS LYS B . n 
B 1 131 VAL 131 131 131 VAL VAL B . n 
B 1 132 ARG 132 132 132 ARG ARG B . n 
B 1 133 ARG 133 133 133 ARG ARG B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 ILE 135 135 135 ILE ILE B . n 
B 1 136 GLU 136 136 136 GLU GLU B . n 
B 1 137 GLN 137 137 137 GLN GLN B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 ALA 140 140 140 ALA ALA B . n 
B 1 141 MET 141 141 ?   ?   ?   B . n 
B 1 142 ASP 142 142 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1550  ? 
1 MORE         -40   ? 
1 'SSA (A^2)'  17930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 60 ? A CYS 60 ? 1_555 ZN ? C ZN . ? A ZN 341 ? 1_555 SG  ? A CYS 84 ? A CYS 84 ? 1_555 68.2  ? 
2  SG  ? A CYS 60 ? A CYS 60 ? 1_555 ZN ? C ZN . ? A ZN 341 ? 1_555 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 132.3 ? 
3  SG  ? A CYS 84 ? A CYS 84 ? 1_555 ZN ? C ZN . ? A ZN 341 ? 1_555 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 119.0 ? 
4  SG  ? A CYS 60 ? A CYS 60 ? 1_555 ZN ? C ZN . ? A ZN 341 ? 1_555 SG  ? A CYS 57 ? A CYS 57 ? 1_555 74.5  ? 
5  SG  ? A CYS 84 ? A CYS 84 ? 1_555 ZN ? C ZN . ? A ZN 341 ? 1_555 SG  ? A CYS 57 ? A CYS 57 ? 1_555 105.2 ? 
6  NE2 ? A HIS 77 ? A HIS 77 ? 1_555 ZN ? C ZN . ? A ZN 341 ? 1_555 SG  ? A CYS 57 ? A CYS 57 ? 1_555 134.0 ? 
7  SG  ? B CYS 60 ? B CYS 60 ? 1_555 ZN ? F ZN . ? B ZN 342 ? 1_555 NE2 ? B HIS 77 ? B HIS 77 ? 1_555 80.9  ? 
8  SG  ? B CYS 60 ? B CYS 60 ? 1_555 ZN ? F ZN . ? B ZN 342 ? 1_555 SG  ? B CYS 84 ? B CYS 84 ? 1_555 142.6 ? 
9  NE2 ? B HIS 77 ? B HIS 77 ? 1_555 ZN ? F ZN . ? B ZN 342 ? 1_555 SG  ? B CYS 84 ? B CYS 84 ? 1_555 121.8 ? 
10 SG  ? B CYS 60 ? B CYS 60 ? 1_555 ZN ? F ZN . ? B ZN 342 ? 1_555 SG  ? B CYS 57 ? B CYS 57 ? 1_555 63.7  ? 
11 NE2 ? B HIS 77 ? B HIS 77 ? 1_555 ZN ? F ZN . ? B ZN 342 ? 1_555 SG  ? B CYS 57 ? B CYS 57 ? 1_555 75.2  ? 
12 SG  ? B CYS 84 ? B CYS 84 ? 1_555 ZN ? F ZN . ? B ZN 342 ? 1_555 SG  ? B CYS 57 ? B CYS 57 ? 1_555 145.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-12-06 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
SHARP     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG  A CYS 60 ? ? SG A CYS 84   ? ? 2.11 
2 1 OE2 A GLU 68 ? ? O  A HOH 1031 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CE1 A PHE 58 ? ? CZ A PHE 58 ? ? 1.495 1.369 0.126 0.019 N 
2 1 CB  A CYS 60 ? ? SG A CYS 60 ? ? 1.943 1.818 0.125 0.017 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A CYS 60 ? ? CB A CYS 60 ? ? SG A CYS 60 ? ? 122.54 114.20 8.34  1.10 N 
2 1 N  A PHE 61 ? ? CA A PHE 61 ? ? C  A PHE 61 ? ? 128.97 111.00 17.97 2.70 N 
3 1 C  B GLN 11 ? ? N  B PRO 12 ? ? CA B PRO 12 ? ? 128.79 119.30 9.49  1.50 Y 
4 1 CA B CYS 57 ? ? CB B CYS 57 ? ? SG B CYS 57 ? ? 131.76 114.20 17.56 1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 9   ? ? -66.84  5.34    
2  1 LEU A 28  ? ? -111.12 -135.95 
3  1 CYS A 33  ? ? -117.91 53.74   
4  1 GLU A 51  ? ? -154.50 73.25   
5  1 PHE A 59  ? ? -81.00  -77.58  
6  1 PHE A 61  ? ? -42.36  21.13   
7  1 PRO A 69  ? ? -38.75  -16.29  
8  1 ILE A 74  ? ? -72.89  -78.22  
9  1 SER A 81  ? ? -161.87 33.35   
10 1 SER A 82  ? ? -27.37  -35.68  
11 1 LYS A 90  ? ? -105.69 66.99   
12 1 LYS A 110 ? ? -69.40  -77.24  
13 1 ASN A 111 ? ? -28.10  -44.85  
14 1 ASN A 118 ? ? -65.20  6.09    
15 1 ALA A 139 ? ? -163.31 51.45   
16 1 PRO B 7   ? ? -42.75  -175.23 
17 1 LYS B 23  ? ? -71.19  -87.89  
18 1 ASN B 24  ? ? -76.22  -93.19  
19 1 TRP B 25  ? ? 77.17   85.67   
20 1 PRO B 26  ? ? -50.75  3.32    
21 1 LEU B 28  ? ? -127.66 -137.00 
22 1 CYS B 33  ? ? -96.82  42.32   
23 1 THR B 48  ? ? -144.16 -158.67 
24 1 GLU B 51  ? ? -152.50 41.55   
25 1 PRO B 69  ? ? -30.65  -30.58  
26 1 LYS B 79  ? ? -104.42 42.85   
27 1 HIS B 80  ? ? -167.41 -6.78   
28 1 SER B 81  ? ? -166.24 104.01  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLY 2   ? A GLY 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A PRO 4   ? A PRO 4   
5  1 Y 1 A MET 141 ? A MET 141 
6  1 Y 1 A ASP 142 ? A ASP 142 
7  1 Y 1 B MET 1   ? B MET 1   
8  1 Y 1 B GLY 2   ? B GLY 2   
9  1 Y 1 B ALA 3   ? B ALA 3   
10 1 Y 1 B PRO 4   ? B PRO 4   
11 1 Y 1 B THR 5   ? B THR 5   
12 1 Y 1 B MET 141 ? B MET 141 
13 1 Y 1 B ASP 142 ? B ASP 142 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 'SULFATE ION' SO4 
4 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1  341  341  ZN  ZN2 A . 
D 3 SO4 1  500  500  SO4 SO4 A . 
E 3 SO4 1  501  501  SO4 SO4 A . 
F 2 ZN  1  342  342  ZN  ZN2 B . 
G 3 SO4 1  502  502  SO4 SO4 B . 
H 4 HOH 1  1000 1000 HOH WAT A . 
H 4 HOH 2  1001 1001 HOH WAT A . 
H 4 HOH 3  1002 1002 HOH WAT A . 
H 4 HOH 4  1003 1003 HOH WAT A . 
H 4 HOH 5  1005 1005 HOH WAT A . 
H 4 HOH 6  1006 1006 HOH WAT A . 
H 4 HOH 7  1007 1007 HOH WAT A . 
H 4 HOH 8  1008 1008 HOH WAT A . 
H 4 HOH 9  1009 1009 HOH WAT A . 
H 4 HOH 10 1011 1011 HOH WAT A . 
H 4 HOH 11 1013 1013 HOH WAT A . 
H 4 HOH 12 1015 1015 HOH WAT A . 
H 4 HOH 13 1017 1017 HOH WAT A . 
H 4 HOH 14 1019 1019 HOH WAT A . 
H 4 HOH 15 1021 1021 HOH WAT A . 
H 4 HOH 16 1022 1022 HOH WAT A . 
H 4 HOH 17 1023 1023 HOH WAT A . 
H 4 HOH 18 1024 1024 HOH WAT A . 
H 4 HOH 19 1025 1025 HOH WAT A . 
H 4 HOH 20 1026 1026 HOH WAT A . 
H 4 HOH 21 1027 1027 HOH WAT A . 
H 4 HOH 22 1029 1029 HOH WAT A . 
H 4 HOH 23 1030 1030 HOH WAT A . 
H 4 HOH 24 1031 1031 HOH WAT A . 
H 4 HOH 25 1033 1033 HOH WAT A . 
H 4 HOH 26 1036 1036 HOH WAT A . 
H 4 HOH 27 1038 1038 HOH WAT A . 
H 4 HOH 28 1040 1040 HOH WAT A . 
H 4 HOH 29 1041 1041 HOH WAT A . 
H 4 HOH 30 1042 1042 HOH WAT A . 
H 4 HOH 31 1044 1044 HOH WAT A . 
H 4 HOH 32 1045 1045 HOH WAT A . 
H 4 HOH 33 1047 1047 HOH WAT A . 
H 4 HOH 34 1050 1050 HOH WAT A . 
H 4 HOH 35 1052 1052 HOH WAT A . 
H 4 HOH 36 1053 1053 HOH WAT A . 
H 4 HOH 37 1054 1054 HOH WAT A . 
H 4 HOH 38 1055 1055 HOH WAT A . 
H 4 HOH 39 1056 1056 HOH WAT A . 
H 4 HOH 40 1057 1057 HOH WAT A . 
H 4 HOH 41 1058 1058 HOH WAT A . 
H 4 HOH 42 1060 1060 HOH WAT A . 
H 4 HOH 43 1062 1062 HOH WAT A . 
H 4 HOH 44 1063 1063 HOH WAT A . 
H 4 HOH 45 1064 1064 HOH WAT A . 
H 4 HOH 46 1065 1065 HOH WAT A . 
H 4 HOH 47 1067 1067 HOH WAT A . 
H 4 HOH 48 1069 1069 HOH WAT A . 
H 4 HOH 49 1071 1071 HOH WAT A . 
H 4 HOH 50 1072 1072 HOH WAT A . 
H 4 HOH 51 1073 1073 HOH WAT A . 
H 4 HOH 52 1075 1075 HOH WAT A . 
H 4 HOH 53 1084 1084 HOH WAT A . 
H 4 HOH 54 1085 1085 HOH WAT A . 
H 4 HOH 55 1089 1089 HOH WAT A . 
I 4 HOH 1  1004 1004 HOH WAT B . 
I 4 HOH 2  1010 1010 HOH WAT B . 
I 4 HOH 3  1012 1012 HOH WAT B . 
I 4 HOH 4  1014 1014 HOH WAT B . 
I 4 HOH 5  1016 1016 HOH WAT B . 
I 4 HOH 6  1018 1018 HOH WAT B . 
I 4 HOH 7  1020 1020 HOH WAT B . 
I 4 HOH 8  1028 1028 HOH WAT B . 
I 4 HOH 9  1032 1032 HOH WAT B . 
I 4 HOH 10 1034 1034 HOH WAT B . 
I 4 HOH 11 1035 1035 HOH WAT B . 
I 4 HOH 12 1037 1037 HOH WAT B . 
I 4 HOH 13 1039 1039 HOH WAT B . 
I 4 HOH 14 1043 1043 HOH WAT B . 
I 4 HOH 15 1046 1046 HOH WAT B . 
I 4 HOH 16 1048 1048 HOH WAT B . 
I 4 HOH 17 1049 1049 HOH WAT B . 
I 4 HOH 18 1051 1051 HOH WAT B . 
I 4 HOH 19 1059 1059 HOH WAT B . 
I 4 HOH 20 1061 1061 HOH WAT B . 
I 4 HOH 21 1066 1066 HOH WAT B . 
I 4 HOH 22 1068 1068 HOH WAT B . 
I 4 HOH 23 1070 1070 HOH WAT B . 
I 4 HOH 24 1074 1074 HOH WAT B . 
I 4 HOH 25 1076 1076 HOH WAT B . 
I 4 HOH 26 1077 1077 HOH WAT B . 
I 4 HOH 27 1078 1078 HOH WAT B . 
I 4 HOH 28 1079 1079 HOH WAT B . 
I 4 HOH 29 1080 1080 HOH WAT B . 
I 4 HOH 30 1081 1081 HOH WAT B . 
I 4 HOH 31 1082 1082 HOH WAT B . 
I 4 HOH 32 1083 1083 HOH WAT B . 
I 4 HOH 33 1086 1086 HOH WAT B . 
I 4 HOH 34 1087 1087 HOH WAT B . 
I 4 HOH 35 1088 1088 HOH WAT B . 
#