data_1F44
# 
_entry.id   1F44 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1F44         pdb_00001f44 10.2210/pdb1f44/pdb 
NDB   PD0166       ?            ?                   
RCSB  RCSB011218   ?            ?                   
WWPDB D_1000011218 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1DRG 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF TRIMERIC CRE RECOMBINASE-LOX COMPLEX' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F44 
_pdbx_database_status.recvd_initial_deposition_date   2000-06-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Baldwin, E.P.' 1 
'Woods, K.C.'   2 
# 
_citation.id                        primary 
_citation.title                     
;Quasi-equivalence in site-specific recombinase structure and function: crystal structure and activity of trimeric Cre recombinase bound to a three-way Lox DNA junction.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            313 
_citation.page_first                49 
_citation.page_last                 69 
_citation.year                      2001 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11601846 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2001.5012 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Woods, K.C.'   1 ? 
primary 'Martin, S.S.'  2 ? 
primary 'Chu, V.C.'     3 ? 
primary 'Baldwin, E.P.' 4 ? 
# 
_cell.entry_id           1F44 
_cell.length_a           160.653 
_cell.length_b           160.653 
_cell.length_c           160.653 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1F44 
_symmetry.space_group_name_H-M             'I 2 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     cubic 
_symmetry.Int_Tables_number                197 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'- D(*TP*AP*TP*AP*AP*CP*TP*TP*CP*GP*TP*AP*TP*AP*GP*C)-3')
;
4872.190  1   ? ?     ? ? 
2 polymer syn 
;DNA (5'-D(*AP*TP*AP*TP*GP*CP*TP*AP*TP*AP*CP*GP*AP*AP*GP*TP*TP*AP*T)-3')
;
5842.821  1   ? ?     ? ? 
3 polymer man 'CRE RECOMBINASE'                                                         36561.844 1   ? Y324F ? ? 
4 water   nat water                                                                     18.015    310 ? ?     ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'RECOMBINASE - PHAGE P1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DA)(DT)(DA)(DA)(DC)(DT)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DG)(DC)' TATAACTTCGTATAGC M ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DA)(DT)(DG)(DC)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DG)(DT)(DT)(DA)(DT)' ATATGCTATACGAAGTTAT 
N ? 
3 'polypeptide(L)'        no no 
;SDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLH
RRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNTLLRIAEIAR
IRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTR
ALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNFIRNLDSETGAMVRLL
EDGD
;
;SDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLH
RRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNTLLRIAEIAR
IRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTR
ALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNFIRNLDSETGAMVRLL
EDGD
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DA  n 
1 3   DT  n 
1 4   DA  n 
1 5   DA  n 
1 6   DC  n 
1 7   DT  n 
1 8   DT  n 
1 9   DC  n 
1 10  DG  n 
1 11  DT  n 
1 12  DA  n 
1 13  DT  n 
1 14  DA  n 
1 15  DG  n 
1 16  DC  n 
2 1   DA  n 
2 2   DT  n 
2 3   DA  n 
2 4   DT  n 
2 5   DG  n 
2 6   DC  n 
2 7   DT  n 
2 8   DA  n 
2 9   DT  n 
2 10  DA  n 
2 11  DC  n 
2 12  DG  n 
2 13  DA  n 
2 14  DA  n 
2 15  DG  n 
2 16  DT  n 
2 17  DT  n 
2 18  DA  n 
2 19  DT  n 
3 1   SER n 
3 2   ASP n 
3 3   GLU n 
3 4   VAL n 
3 5   ARG n 
3 6   LYS n 
3 7   ASN n 
3 8   LEU n 
3 9   MET n 
3 10  ASP n 
3 11  MET n 
3 12  PHE n 
3 13  ARG n 
3 14  ASP n 
3 15  ARG n 
3 16  GLN n 
3 17  ALA n 
3 18  PHE n 
3 19  SER n 
3 20  GLU n 
3 21  HIS n 
3 22  THR n 
3 23  TRP n 
3 24  LYS n 
3 25  MET n 
3 26  LEU n 
3 27  LEU n 
3 28  SER n 
3 29  VAL n 
3 30  CYS n 
3 31  ARG n 
3 32  SER n 
3 33  TRP n 
3 34  ALA n 
3 35  ALA n 
3 36  TRP n 
3 37  CYS n 
3 38  LYS n 
3 39  LEU n 
3 40  ASN n 
3 41  ASN n 
3 42  ARG n 
3 43  LYS n 
3 44  TRP n 
3 45  PHE n 
3 46  PRO n 
3 47  ALA n 
3 48  GLU n 
3 49  PRO n 
3 50  GLU n 
3 51  ASP n 
3 52  VAL n 
3 53  ARG n 
3 54  ASP n 
3 55  TYR n 
3 56  LEU n 
3 57  LEU n 
3 58  TYR n 
3 59  LEU n 
3 60  GLN n 
3 61  ALA n 
3 62  ARG n 
3 63  GLY n 
3 64  LEU n 
3 65  ALA n 
3 66  VAL n 
3 67  LYS n 
3 68  THR n 
3 69  ILE n 
3 70  GLN n 
3 71  GLN n 
3 72  HIS n 
3 73  LEU n 
3 74  GLY n 
3 75  GLN n 
3 76  LEU n 
3 77  ASN n 
3 78  MET n 
3 79  LEU n 
3 80  HIS n 
3 81  ARG n 
3 82  ARG n 
3 83  SER n 
3 84  GLY n 
3 85  LEU n 
3 86  PRO n 
3 87  ARG n 
3 88  PRO n 
3 89  SER n 
3 90  ASP n 
3 91  SER n 
3 92  ASN n 
3 93  ALA n 
3 94  VAL n 
3 95  SER n 
3 96  LEU n 
3 97  VAL n 
3 98  MET n 
3 99  ARG n 
3 100 ARG n 
3 101 ILE n 
3 102 ARG n 
3 103 LYS n 
3 104 GLU n 
3 105 ASN n 
3 106 VAL n 
3 107 ASP n 
3 108 ALA n 
3 109 GLY n 
3 110 GLU n 
3 111 ARG n 
3 112 ALA n 
3 113 LYS n 
3 114 GLN n 
3 115 ALA n 
3 116 LEU n 
3 117 ALA n 
3 118 PHE n 
3 119 GLU n 
3 120 ARG n 
3 121 THR n 
3 122 ASP n 
3 123 PHE n 
3 124 ASP n 
3 125 GLN n 
3 126 VAL n 
3 127 ARG n 
3 128 SER n 
3 129 LEU n 
3 130 MET n 
3 131 GLU n 
3 132 ASN n 
3 133 SER n 
3 134 ASP n 
3 135 ARG n 
3 136 CYS n 
3 137 GLN n 
3 138 ASP n 
3 139 ILE n 
3 140 ARG n 
3 141 ASN n 
3 142 LEU n 
3 143 ALA n 
3 144 PHE n 
3 145 LEU n 
3 146 GLY n 
3 147 ILE n 
3 148 ALA n 
3 149 TYR n 
3 150 ASN n 
3 151 THR n 
3 152 LEU n 
3 153 LEU n 
3 154 ARG n 
3 155 ILE n 
3 156 ALA n 
3 157 GLU n 
3 158 ILE n 
3 159 ALA n 
3 160 ARG n 
3 161 ILE n 
3 162 ARG n 
3 163 VAL n 
3 164 LYS n 
3 165 ASP n 
3 166 ILE n 
3 167 SER n 
3 168 ARG n 
3 169 THR n 
3 170 ASP n 
3 171 GLY n 
3 172 GLY n 
3 173 ARG n 
3 174 MET n 
3 175 LEU n 
3 176 ILE n 
3 177 HIS n 
3 178 ILE n 
3 179 GLY n 
3 180 ARG n 
3 181 THR n 
3 182 LYS n 
3 183 THR n 
3 184 LEU n 
3 185 VAL n 
3 186 SER n 
3 187 THR n 
3 188 ALA n 
3 189 GLY n 
3 190 VAL n 
3 191 GLU n 
3 192 LYS n 
3 193 ALA n 
3 194 LEU n 
3 195 SER n 
3 196 LEU n 
3 197 GLY n 
3 198 VAL n 
3 199 THR n 
3 200 LYS n 
3 201 LEU n 
3 202 VAL n 
3 203 GLU n 
3 204 ARG n 
3 205 TRP n 
3 206 ILE n 
3 207 SER n 
3 208 VAL n 
3 209 SER n 
3 210 GLY n 
3 211 VAL n 
3 212 ALA n 
3 213 ASP n 
3 214 ASP n 
3 215 PRO n 
3 216 ASN n 
3 217 ASN n 
3 218 TYR n 
3 219 LEU n 
3 220 PHE n 
3 221 CYS n 
3 222 ARG n 
3 223 VAL n 
3 224 ARG n 
3 225 LYS n 
3 226 ASN n 
3 227 GLY n 
3 228 VAL n 
3 229 ALA n 
3 230 ALA n 
3 231 PRO n 
3 232 SER n 
3 233 ALA n 
3 234 THR n 
3 235 SER n 
3 236 GLN n 
3 237 LEU n 
3 238 SER n 
3 239 THR n 
3 240 ARG n 
3 241 ALA n 
3 242 LEU n 
3 243 GLU n 
3 244 GLY n 
3 245 ILE n 
3 246 PHE n 
3 247 GLU n 
3 248 ALA n 
3 249 THR n 
3 250 HIS n 
3 251 ARG n 
3 252 LEU n 
3 253 ILE n 
3 254 TYR n 
3 255 GLY n 
3 256 ALA n 
3 257 LYS n 
3 258 ASP n 
3 259 ASP n 
3 260 SER n 
3 261 GLY n 
3 262 GLN n 
3 263 ARG n 
3 264 TYR n 
3 265 LEU n 
3 266 ALA n 
3 267 TRP n 
3 268 SER n 
3 269 GLY n 
3 270 HIS n 
3 271 SER n 
3 272 ALA n 
3 273 ARG n 
3 274 VAL n 
3 275 GLY n 
3 276 ALA n 
3 277 ALA n 
3 278 ARG n 
3 279 ASP n 
3 280 MET n 
3 281 ALA n 
3 282 ARG n 
3 283 ALA n 
3 284 GLY n 
3 285 VAL n 
3 286 SER n 
3 287 ILE n 
3 288 PRO n 
3 289 GLU n 
3 290 ILE n 
3 291 MET n 
3 292 GLN n 
3 293 ALA n 
3 294 GLY n 
3 295 GLY n 
3 296 TRP n 
3 297 THR n 
3 298 ASN n 
3 299 VAL n 
3 300 ASN n 
3 301 ILE n 
3 302 VAL n 
3 303 MET n 
3 304 ASN n 
3 305 PHE n 
3 306 ILE n 
3 307 ARG n 
3 308 ASN n 
3 309 LEU n 
3 310 ASP n 
3 311 SER n 
3 312 GLU n 
3 313 THR n 
3 314 GLY n 
3 315 ALA n 
3 316 MET n 
3 317 VAL n 
3 318 ARG n 
3 319 LEU n 
3 320 LEU n 
3 321 GLU n 
3 322 ASP n 
3 323 GLY n 
3 324 ASP n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'P1-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 'CRE RECOMBINASE' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage P1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10678 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP RECR_BPP1 P06956 3 20 ? ? 
2 PDB 1F44      1F44   1 ?  ? ? 
3 PDB 1F44      1F44   2 ?  ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1F44 A 1 ? 324 ? P06956 20 ? 343 ? 20 343 
2 2 1F44 M 1 ? 16  ? 1F44   1  ? 16  ? 1  16  
3 3 1F44 N 1 ? 19  ? 1F44   1  ? 19  ? 1  19  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1F44 
_struct_ref_seq_dif.mon_id                       PHE 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      305 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P06956 
_struct_ref_seq_dif.db_mon_id                    TYR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          324 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            324 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1F44 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   66.09 
_exptl_crystal.density_Matthews      3.63 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.1 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'125 mM LI2SO4, 4% PEG 8000, 40mM NaPIPES PH 6.1, 5% MPD, VAPOR DIFFUSION, HANGING DROP at 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 LI2SO4     ? ? ? 
1 2 1 NaPIPES    ? ? ? 
1 3 1 MPD        ? ? ? 
1 4 1 'PEG 8000' ? ? ? 
1 5 2 MPD        ? ? ? 
1 6 2 'PEG 8000' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-12-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9800 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_wavelength             0.9800 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1F44 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   42556 
_reflns.number_all                   43161 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.0440000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.4 
_reflns.B_iso_Wilson_estimate        27 
_reflns.pdbx_redundancy              5.0 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.12 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.3390000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.number_unique_all      5657 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1F44 
_refine.ls_number_reflns_obs                     37741 
_refine.ls_number_reflns_all                     37741 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             5 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.1760000 
_refine.ls_R_factor_all                          0.1760000 
_refine.ls_R_factor_R_work                       0.1760000 
_refine.ls_R_factor_R_free                       0.2240000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.5 
_refine.ls_number_reflns_R_free                  2063 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            
;random using CCP4 "unique" module
;
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2516 
_refine_hist.pdbx_number_atoms_nucleic_acid   711 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             310 
_refine_hist.number_atoms_total               3537 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        5 
# 
_struct.entry_id                  1F44 
_struct.title                     'CRYSTAL STRUCTURE OF TRIMERIC CRE RECOMBINASE-LOX COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F44 
_struct_keywords.pdbx_keywords   'HYDROLASE, LIGASE/DNA' 
_struct_keywords.text            
;SITE-SPECIFIC RECOMBINASE, RECOMBINATION, PROTEIN-DNA COMPLEX, TRIMERIC, THREE-WAY JUNCTION, BRANCHED DNA, Y-JUNCTION, HYDROLASE, LIGASE/DNA, LIGASE-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'Trimeric complex constructed from chains A, B and C by crystallographic three-fold.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL C 4   ? ASP C 10  ? VAL A 23  ASP A 29  1 ? 7  
HELX_P HELX_P2  2  ASP C 14  ? PHE C 18  ? ASP A 33  PHE A 37  5 ? 5  
HELX_P HELX_P3  3  SER C 19  ? ASN C 40  ? SER A 38  ASN A 59  1 ? 22 
HELX_P HELX_P4  4  GLU C 48  ? ARG C 62  ? GLU A 67  ARG A 81  1 ? 15 
HELX_P HELX_P5  5  ALA C 65  ? SER C 83  ? ALA A 84  SER A 102 1 ? 19 
HELX_P HELX_P6  6  ARG C 87  ? ASP C 90  ? ARG A 106 ASP A 109 5 ? 4  
HELX_P HELX_P7  7  SER C 91  ? ALA C 108 ? SER A 110 ALA A 127 1 ? 18 
HELX_P HELX_P8  8  GLU C 119 ? GLU C 131 ? GLU A 138 GLU A 150 1 ? 13 
HELX_P HELX_P9  9  ARG C 135 ? LEU C 152 ? ARG A 154 LEU A 171 1 ? 18 
HELX_P HELX_P10 10 ARG C 154 ? ILE C 161 ? ARG A 173 ILE A 180 1 ? 8  
HELX_P HELX_P11 11 ASP C 170 ? GLY C 172 ? ASP A 189 GLY A 191 5 ? 3  
HELX_P HELX_P12 12 SER C 195 ? GLY C 210 ? SER A 214 GLY A 229 1 ? 16 
HELX_P HELX_P13 13 VAL C 211 ? ASP C 214 ? VAL A 230 ASP A 233 5 ? 4  
HELX_P HELX_P14 14 SER C 238 ? GLY C 255 ? SER A 257 GLY A 274 1 ? 18 
HELX_P HELX_P15 15 HIS C 270 ? ALA C 283 ? HIS A 289 ALA A 302 1 ? 14 
HELX_P HELX_P16 16 SER C 286 ? GLY C 295 ? SER A 305 GLY A 314 1 ? 10 
HELX_P HELX_P17 17 ASN C 298 ? ILE C 306 ? ASN A 317 ILE A 325 1 ? 9  
HELX_P HELX_P18 18 GLY C 314 ? GLU C 321 ? GLY A 333 GLU A 340 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 19 N3 ? ? M DA 2  N DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 19 O4 ? ? M DA 2  N DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 18 N1 ? ? M DT 3  N DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 18 N6 ? ? M DT 3  N DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 17 N3 ? ? M DA 4  N DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 17 O4 ? ? M DA 4  N DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 16 N3 ? ? M DA 5  N DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 16 O4 ? ? M DA 5  N DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG 15 N1 ? ? M DC 6  N DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG 15 O6 ? ? M DC 6  N DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG 15 N2 ? ? M DC 6  N DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 14 N1 ? ? M DT 7  N DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 14 N6 ? ? M DT 7  N DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 13 N1 ? ? M DT 8  N DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 13 N6 ? ? M DT 8  N DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 12 N1 ? ? M DC 9  N DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 12 O6 ? ? M DC 9  N DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 12 N2 ? ? M DC 9  N DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC 11 N3 ? ? M DG 10 N DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC 11 O2 ? ? M DG 10 N DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC 11 N4 ? ? M DG 10 N DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 10 N1 ? ? M DT 11 N DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 10 N6 ? ? M DT 11 N DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 9  N3 ? ? M DA 12 N DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 9  O4 ? ? M DA 12 N DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 8  N1 ? ? M DT 13 N DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 8  N6 ? ? M DT 13 N DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 7  N3 ? ? M DA 14 N DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 7  O4 ? ? M DA 14 N DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC 6  N3 ? ? M DG 15 N DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC 6  O2 ? ? M DG 15 N DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC 6  N4 ? ? M DG 15 N DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? A DC 16 N3 ? ? ? 1_555 B DG 5  N1 ? ? M DC 16 N DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? A DC 16 N4 ? ? ? 1_555 B DG 5  O6 ? ? M DC 16 N DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35 hydrog ? ? A DC 16 O2 ? ? ? 1_555 B DG 5  N2 ? ? M DC 16 N DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? B DA 1  N1 ? ? ? 1_555 B DT 4  N3 ? ? N DA 1  N DT 4  5_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37 hydrog ? ? B DA 1  N6 ? ? ? 1_555 B DT 4  O4 ? ? N DA 1  N DT 4  5_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38 hydrog ? ? B DT 2  N3 ? ? ? 1_555 B DA 3  N1 ? ? N DT 2  N DA 3  5_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39 hydrog ? ? B DT 2  O4 ? ? ? 1_555 B DA 3  N6 ? ? N DT 2  N DA 3  5_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PHE 
_struct_mon_prot_cis.label_seq_id           45 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PHE 
_struct_mon_prot_cis.auth_seq_id            64 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    46 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     65 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.48 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 166 ? ARG C 168 ? ILE A 185 ARG A 187 
A 2 MET C 174 ? ILE C 178 ? MET A 193 ILE A 197 
A 3 VAL C 190 ? ALA C 193 ? VAL A 209 ALA A 212 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER C 167 ? O SER A 186 N LEU C 175 ? N LEU A 194 
A 2 3 N ILE C 178 ? N ILE A 197 O VAL C 190 ? O VAL A 209 
# 
_database_PDB_matrix.entry_id          1F44 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1F44 
_atom_sites.fract_transf_matrix[1][1]   0.006225 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006225 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006225 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 1   ? 142.738 66.507  140.932 1.00 100.00 ? 1   DT  M "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 1   ? 141.746 65.643  140.399 1.00 100.00 ? 1   DT  M "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 1   ? 142.042 65.311  138.946 1.00 100.00 ? 1   DT  M "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 1   ? 140.922 64.568  138.387 1.00 100.00 ? 1   DT  M "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 1   ? 142.075 66.523  138.020 1.00 91.71  ? 1   DT  M "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 1   ? 142.264 65.993  136.723 1.00 100.00 ? 1   DT  M "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 1   ? 140.591 66.820  138.044 1.00 100.00 ? 1   DT  M "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 1   ? 140.317 65.446  137.460 1.00 96.33  ? 1   DT  M "C1'" 1 
ATOM   9    N N1    . DT  A 1 1   ? 138.934 65.065  137.139 1.00 95.98  ? 1   DT  M N1    1 
ATOM   10   C C2    . DT  A 1 1   ? 138.749 64.734  135.818 1.00 96.54  ? 1   DT  M C2    1 
ATOM   11   O O2    . DT  A 1 1   ? 139.651 64.763  135.006 1.00 96.11  ? 1   DT  M O2    1 
ATOM   12   N N3    . DT  A 1 1   ? 137.471 64.374  135.479 1.00 91.18  ? 1   DT  M N3    1 
ATOM   13   C C4    . DT  A 1 1   ? 136.378 64.320  136.318 1.00 89.00  ? 1   DT  M C4    1 
ATOM   14   O O4    . DT  A 1 1   ? 135.288 63.995  135.857 1.00 88.45  ? 1   DT  M O4    1 
ATOM   15   C C5    . DT  A 1 1   ? 136.636 64.674  137.690 1.00 84.89  ? 1   DT  M C5    1 
ATOM   16   C C7    . DT  A 1 1   ? 135.524 64.679  138.698 1.00 81.09  ? 1   DT  M C7    1 
ATOM   17   C C6    . DT  A 1 1   ? 137.886 65.010  138.038 1.00 89.43  ? 1   DT  M C6    1 
ATOM   18   P P     . DA  A 1 2   ? 143.646 66.045  135.938 1.00 100.00 ? 2   DA  M P     1 
ATOM   19   O OP1   . DA  A 1 2   ? 144.229 64.685  136.016 1.00 100.00 ? 2   DA  M OP1   1 
ATOM   20   O OP2   . DA  A 1 2   ? 144.394 67.229  136.444 1.00 100.00 ? 2   DA  M OP2   1 
ATOM   21   O "O5'" . DA  A 1 2   ? 143.158 66.314  134.425 1.00 100.00 ? 2   DA  M "O5'" 1 
ATOM   22   C "C5'" . DA  A 1 2   ? 142.127 67.283  134.205 1.00 100.00 ? 2   DA  M "C5'" 1 
ATOM   23   C "C4'" . DA  A 1 2   ? 141.349 67.009  132.927 1.00 99.46  ? 2   DA  M "C4'" 1 
ATOM   24   O "O4'" . DA  A 1 2   ? 139.958 66.803  133.268 1.00 99.67  ? 2   DA  M "O4'" 1 
ATOM   25   C "C3'" . DA  A 1 2   ? 141.288 68.200  131.981 1.00 86.30  ? 2   DA  M "C3'" 1 
ATOM   26   O "O3'" . DA  A 1 2   ? 140.855 67.800  130.683 1.00 83.45  ? 2   DA  M "O3'" 1 
ATOM   27   C "C2'" . DA  A 1 2   ? 140.243 69.083  132.656 1.00 81.79  ? 2   DA  M "C2'" 1 
ATOM   28   C "C1'" . DA  A 1 2   ? 139.362 68.077  133.403 1.00 85.34  ? 2   DA  M "C1'" 1 
ATOM   29   N N9    . DA  A 1 2   ? 139.225 68.387  134.822 1.00 73.52  ? 2   DA  M N9    1 
ATOM   30   C C8    . DA  A 1 2   ? 140.108 68.968  135.685 1.00 77.49  ? 2   DA  M C8    1 
ATOM   31   N N7    . DA  A 1 2   ? 139.624 69.141  136.893 1.00 81.13  ? 2   DA  M N7    1 
ATOM   32   C C5    . DA  A 1 2   ? 138.341 68.625  136.811 1.00 69.33  ? 2   DA  M C5    1 
ATOM   33   C C6    . DA  A 1 2   ? 137.304 68.507  137.751 1.00 65.31  ? 2   DA  M C6    1 
ATOM   34   N N6    . DA  A 1 2   ? 137.411 68.901  139.030 1.00 65.08  ? 2   DA  M N6    1 
ATOM   35   N N1    . DA  A 1 2   ? 136.154 67.956  137.317 1.00 61.79  ? 2   DA  M N1    1 
ATOM   36   C C2    . DA  A 1 2   ? 136.057 67.561  136.045 1.00 60.22  ? 2   DA  M C2    1 
ATOM   37   N N3    . DA  A 1 2   ? 136.950 67.639  135.075 1.00 60.73  ? 2   DA  M N3    1 
ATOM   38   C C4    . DA  A 1 2   ? 138.080 68.173  135.534 1.00 63.76  ? 2   DA  M C4    1 
ATOM   39   P P     . DT  A 1 3   ? 140.729 68.883  129.501 1.00 90.44  ? 3   DT  M P     1 
ATOM   40   O OP1   . DT  A 1 3   ? 140.528 68.137  128.241 1.00 70.97  ? 3   DT  M OP1   1 
ATOM   41   O OP2   . DT  A 1 3   ? 141.809 69.894  129.614 1.00 57.51  ? 3   DT  M OP2   1 
ATOM   42   O "O5'" . DT  A 1 3   ? 139.350 69.600  129.861 1.00 100.00 ? 3   DT  M "O5'" 1 
ATOM   43   C "C5'" . DT  A 1 3   ? 138.139 69.070  129.346 1.00 99.64  ? 3   DT  M "C5'" 1 
ATOM   44   C "C4'" . DT  A 1 3   ? 136.936 69.809  129.909 1.00 70.45  ? 3   DT  M "C4'" 1 
ATOM   45   O "O4'" . DT  A 1 3   ? 136.957 69.750  131.350 1.00 59.74  ? 3   DT  M "O4'" 1 
ATOM   46   C "C3'" . DT  A 1 3   ? 136.847 71.285  129.541 1.00 51.07  ? 3   DT  M "C3'" 1 
ATOM   47   O "O3'" . DT  A 1 3   ? 135.695 71.467  128.738 1.00 63.32  ? 3   DT  M "O3'" 1 
ATOM   48   C "C2'" . DT  A 1 3   ? 136.698 71.988  130.888 1.00 45.44  ? 3   DT  M "C2'" 1 
ATOM   49   C "C1'" . DT  A 1 3   ? 136.229 70.862  131.797 1.00 48.26  ? 3   DT  M "C1'" 1 
ATOM   50   N N1    . DT  A 1 3   ? 136.571 71.109  133.217 1.00 50.69  ? 3   DT  M N1    1 
ATOM   51   C C2    . DT  A 1 3   ? 135.566 71.002  134.168 1.00 52.95  ? 3   DT  M C2    1 
ATOM   52   O O2    . DT  A 1 3   ? 134.416 70.674  133.906 1.00 54.12  ? 3   DT  M O2    1 
ATOM   53   N N3    . DT  A 1 3   ? 135.963 71.288  135.448 1.00 50.93  ? 3   DT  M N3    1 
ATOM   54   C C4    . DT  A 1 3   ? 137.226 71.689  135.843 1.00 59.52  ? 3   DT  M C4    1 
ATOM   55   O O4    . DT  A 1 3   ? 137.458 71.919  137.023 1.00 59.94  ? 3   DT  M O4    1 
ATOM   56   C C5    . DT  A 1 3   ? 138.201 71.793  134.797 1.00 50.18  ? 3   DT  M C5    1 
ATOM   57   C C7    . DT  A 1 3   ? 139.574 72.223  135.155 1.00 50.62  ? 3   DT  M C7    1 
ATOM   58   C C6    . DT  A 1 3   ? 137.850 71.511  133.541 1.00 47.25  ? 3   DT  M C6    1 
ATOM   59   P P     . DA  A 1 4   ? 135.627 72.359  127.407 1.00 69.29  ? 4   DA  M P     1 
ATOM   60   O OP1   . DA  A 1 4   ? 135.930 71.518  126.221 1.00 80.26  ? 4   DA  M OP1   1 
ATOM   61   O OP2   . DA  A 1 4   ? 136.349 73.630  127.647 1.00 85.51  ? 4   DA  M OP2   1 
ATOM   62   O "O5'" . DA  A 1 4   ? 134.051 72.609  127.381 1.00 72.77  ? 4   DA  M "O5'" 1 
ATOM   63   C "C5'" . DA  A 1 4   ? 133.331 71.479  127.847 1.00 45.20  ? 4   DA  M "C5'" 1 
ATOM   64   C "C4'" . DA  A 1 4   ? 132.055 71.894  128.535 1.00 47.73  ? 4   DA  M "C4'" 1 
ATOM   65   O "O4'" . DA  A 1 4   ? 132.336 72.154  129.929 1.00 44.93  ? 4   DA  M "O4'" 1 
ATOM   66   C "C3'" . DA  A 1 4   ? 131.405 73.163  127.990 1.00 44.17  ? 4   DA  M "C3'" 1 
ATOM   67   O "O3'" . DA  A 1 4   ? 130.009 73.031  128.190 1.00 49.07  ? 4   DA  M "O3'" 1 
ATOM   68   C "C2'" . DA  A 1 4   ? 132.014 74.232  128.893 1.00 34.00  ? 4   DA  M "C2'" 1 
ATOM   69   C "C1'" . DA  A 1 4   ? 132.057 73.500  130.231 1.00 34.63  ? 4   DA  M "C1'" 1 
ATOM   70   N N9    . DA  A 1 4   ? 133.130 73.913  131.116 1.00 34.31  ? 4   DA  M N9    1 
ATOM   71   C C8    . DA  A 1 4   ? 134.388 74.323  130.789 1.00 35.91  ? 4   DA  M C8    1 
ATOM   72   N N7    . DA  A 1 4   ? 135.148 74.579  131.831 1.00 40.28  ? 4   DA  M N7    1 
ATOM   73   C C5    . DA  A 1 4   ? 134.337 74.283  132.907 1.00 31.34  ? 4   DA  M C5    1 
ATOM   74   C C6    . DA  A 1 4   ? 134.554 74.359  134.279 1.00 39.69  ? 4   DA  M C6    1 
ATOM   75   N N6    . DA  A 1 4   ? 135.723 74.747  134.786 1.00 39.73  ? 4   DA  M N6    1 
ATOM   76   N N1    . DA  A 1 4   ? 133.536 74.030  135.097 1.00 39.30  ? 4   DA  M N1    1 
ATOM   77   C C2    . DA  A 1 4   ? 132.380 73.642  134.556 1.00 35.99  ? 4   DA  M C2    1 
ATOM   78   N N3    . DA  A 1 4   ? 132.061 73.533  133.268 1.00 35.65  ? 4   DA  M N3    1 
ATOM   79   C C4    . DA  A 1 4   ? 133.092 73.872  132.490 1.00 32.78  ? 4   DA  M C4    1 
ATOM   80   P P     . DA  A 1 5   ? 128.871 73.912  127.493 1.00 44.75  ? 5   DA  M P     1 
ATOM   81   O OP1   . DA  A 1 5   ? 127.637 73.090  127.492 1.00 39.30  ? 5   DA  M OP1   1 
ATOM   82   O OP2   . DA  A 1 5   ? 129.359 74.517  126.237 1.00 44.51  ? 5   DA  M OP2   1 
ATOM   83   O "O5'" . DA  A 1 5   ? 128.695 75.073  128.566 1.00 38.99  ? 5   DA  M "O5'" 1 
ATOM   84   C "C5'" . DA  A 1 5   ? 128.110 74.689  129.771 1.00 32.77  ? 5   DA  M "C5'" 1 
ATOM   85   C "C4'" . DA  A 1 5   ? 128.224 75.822  130.745 1.00 36.95  ? 5   DA  M "C4'" 1 
ATOM   86   O "O4'" . DA  A 1 5   ? 129.573 75.875  131.242 1.00 37.67  ? 5   DA  M "O4'" 1 
ATOM   87   C "C3'" . DA  A 1 5   ? 127.938 77.211  130.172 1.00 41.19  ? 5   DA  M "C3'" 1 
ATOM   88   O "O3'" . DA  A 1 5   ? 127.032 77.862  131.045 1.00 39.80  ? 5   DA  M "O3'" 1 
ATOM   89   C "C2'" . DA  A 1 5   ? 129.300 77.908  130.244 1.00 33.43  ? 5   DA  M "C2'" 1 
ATOM   90   C "C1'" . DA  A 1 5   ? 129.844 77.228  131.491 1.00 42.59  ? 5   DA  M "C1'" 1 
ATOM   91   N N9    . DA  A 1 5   ? 131.279 77.392  131.659 1.00 37.96  ? 5   DA  M N9    1 
ATOM   92   C C8    . DA  A 1 5   ? 132.244 77.497  130.703 1.00 32.62  ? 5   DA  M C8    1 
ATOM   93   N N7    . DA  A 1 5   ? 133.445 77.651  131.197 1.00 36.55  ? 5   DA  M N7    1 
ATOM   94   C C5    . DA  A 1 5   ? 133.244 77.631  132.569 1.00 36.37  ? 5   DA  M C5    1 
ATOM   95   C C6    . DA  A 1 5   ? 134.128 77.721  133.653 1.00 38.71  ? 5   DA  M C6    1 
ATOM   96   N N6    . DA  A 1 5   ? 135.440 77.892  133.469 1.00 37.68  ? 5   DA  M N6    1 
ATOM   97   N N1    . DA  A 1 5   ? 133.612 77.655  134.908 1.00 39.06  ? 5   DA  M N1    1 
ATOM   98   C C2    . DA  A 1 5   ? 132.291 77.493  135.055 1.00 36.56  ? 5   DA  M C2    1 
ATOM   99   N N3    . DA  A 1 5   ? 131.355 77.403  134.103 1.00 36.58  ? 5   DA  M N3    1 
ATOM   100  C C4    . DA  A 1 5   ? 131.909 77.463  132.874 1.00 34.56  ? 5   DA  M C4    1 
ATOM   101  P P     . DC  A 1 6   ? 126.125 79.064  130.510 1.00 34.57  ? 6   DC  M P     1 
ATOM   102  O OP1   . DC  A 1 6   ? 125.042 79.241  131.487 1.00 31.66  ? 6   DC  M OP1   1 
ATOM   103  O OP2   . DC  A 1 6   ? 125.848 78.796  129.088 1.00 36.30  ? 6   DC  M OP2   1 
ATOM   104  O "O5'" . DC  A 1 6   ? 127.106 80.318  130.620 1.00 30.32  ? 6   DC  M "O5'" 1 
ATOM   105  C "C5'" . DC  A 1 6   ? 126.961 81.195  131.726 1.00 30.92  ? 6   DC  M "C5'" 1 
ATOM   106  C "C4'" . DC  A 1 6   ? 127.550 80.634  133.000 1.00 32.43  ? 6   DC  M "C4'" 1 
ATOM   107  O "O4'" . DC  A 1 6   ? 128.821 80.000  132.721 1.00 39.89  ? 6   DC  M "O4'" 1 
ATOM   108  C "C3'" . DC  A 1 6   ? 127.877 81.714  134.016 1.00 36.90  ? 6   DC  M "C3'" 1 
ATOM   109  O "O3'" . DC  A 1 6   ? 126.767 81.970  134.815 1.00 33.95  ? 6   DC  M "O3'" 1 
ATOM   110  C "C2'" . DC  A 1 6   ? 129.037 81.147  134.823 1.00 32.83  ? 6   DC  M "C2'" 1 
ATOM   111  C "C1'" . DC  A 1 6   ? 129.654 80.132  133.860 1.00 33.93  ? 6   DC  M "C1'" 1 
ATOM   112  N N1    . DC  A 1 6   ? 131.030 80.457  133.385 1.00 36.13  ? 6   DC  M N1    1 
ATOM   113  C C2    . DC  A 1 6   ? 132.090 80.509  134.297 1.00 37.98  ? 6   DC  M C2    1 
ATOM   114  O O2    . DC  A 1 6   ? 131.894 80.348  135.508 1.00 38.77  ? 6   DC  M O2    1 
ATOM   115  N N3    . DC  A 1 6   ? 133.328 80.772  133.817 1.00 39.53  ? 6   DC  M N3    1 
ATOM   116  C C4    . DC  A 1 6   ? 133.522 80.962  132.510 1.00 37.82  ? 6   DC  M C4    1 
ATOM   117  N N4    . DC  A 1 6   ? 134.767 81.214  132.098 1.00 37.38  ? 6   DC  M N4    1 
ATOM   118  C C5    . DC  A 1 6   ? 132.454 80.912  131.567 1.00 36.16  ? 6   DC  M C5    1 
ATOM   119  C C6    . DC  A 1 6   ? 131.233 80.640  132.047 1.00 36.13  ? 6   DC  M C6    1 
ATOM   120  P P     . DT  A 1 7   ? 126.578 83.472  135.292 1.00 32.33  ? 7   DT  M P     1 
ATOM   121  O OP1   . DT  A 1 7   ? 125.318 83.557  136.053 1.00 33.76  ? 7   DT  M OP1   1 
ATOM   122  O OP2   . DT  A 1 7   ? 126.766 84.338  134.104 1.00 39.58  ? 7   DT  M OP2   1 
ATOM   123  O "O5'" . DT  A 1 7   ? 127.821 83.673  136.288 1.00 38.89  ? 7   DT  M "O5'" 1 
ATOM   124  C "C5'" . DT  A 1 7   ? 127.787 83.180  137.627 1.00 38.10  ? 7   DT  M "C5'" 1 
ATOM   125  C "C4'" . DT  A 1 7   ? 128.948 83.740  138.429 1.00 28.55  ? 7   DT  M "C4'" 1 
ATOM   126  O "O4'" . DT  A 1 7   ? 130.192 83.413  137.748 1.00 37.73  ? 7   DT  M "O4'" 1 
ATOM   127  C "C3'" . DT  A 1 7   ? 128.938 85.248  138.601 1.00 36.03  ? 7   DT  M "C3'" 1 
ATOM   128  O "O3'" . DT  A 1 7   ? 129.358 85.578  139.893 1.00 45.35  ? 7   DT  M "O3'" 1 
ATOM   129  C "C2'" . DT  A 1 7   ? 129.964 85.740  137.595 1.00 36.37  ? 7   DT  M "C2'" 1 
ATOM   130  C "C1'" . DT  A 1 7   ? 130.961 84.590  137.548 1.00 36.06  ? 7   DT  M "C1'" 1 
ATOM   131  N N1    . DT  A 1 7   ? 131.638 84.497  136.204 1.00 39.37  ? 7   DT  M N1    1 
ATOM   132  C C2    . DT  A 1 7   ? 133.018 84.509  136.172 1.00 39.20  ? 7   DT  M C2    1 
ATOM   133  O O2    . DT  A 1 7   ? 133.705 84.581  137.156 1.00 38.94  ? 7   DT  M O2    1 
ATOM   134  N N3    . DT  A 1 7   ? 133.572 84.422  134.928 1.00 30.29  ? 7   DT  M N3    1 
ATOM   135  C C4    . DT  A 1 7   ? 132.889 84.380  133.730 1.00 35.35  ? 7   DT  M C4    1 
ATOM   136  O O4    . DT  A 1 7   ? 133.538 84.302  132.693 1.00 34.67  ? 7   DT  M O4    1 
ATOM   137  C C5    . DT  A 1 7   ? 131.446 84.381  133.817 1.00 34.83  ? 7   DT  M C5    1 
ATOM   138  C C7    . DT  A 1 7   ? 130.594 84.298  132.553 1.00 26.35  ? 7   DT  M C7    1 
ATOM   139  C C6    . DT  A 1 7   ? 130.892 84.439  135.035 1.00 36.50  ? 7   DT  M C6    1 
ATOM   140  P P     . DT  A 1 8   ? 129.140 87.082  140.388 1.00 51.10  ? 8   DT  M P     1 
ATOM   141  O OP1   . DT  A 1 8   ? 128.691 86.985  141.792 1.00 61.66  ? 8   DT  M OP1   1 
ATOM   142  O OP2   . DT  A 1 8   ? 128.347 87.811  139.379 1.00 48.40  ? 8   DT  M OP2   1 
ATOM   143  O "O5'" . DT  A 1 8   ? 130.623 87.666  140.379 1.00 46.86  ? 8   DT  M "O5'" 1 
ATOM   144  C "C5'" . DT  A 1 8   ? 131.617 86.771  140.784 1.00 44.01  ? 8   DT  M "C5'" 1 
ATOM   145  C "C4'" . DT  A 1 8   ? 132.970 87.428  140.742 1.00 45.52  ? 8   DT  M "C4'" 1 
ATOM   146  O "O4'" . DT  A 1 8   ? 133.566 87.228  139.439 1.00 44.81  ? 8   DT  M "O4'" 1 
ATOM   147  C "C3'" . DT  A 1 8   ? 132.979 88.926  141.011 1.00 45.39  ? 8   DT  M "C3'" 1 
ATOM   148  O "O3'" . DT  A 1 8   ? 134.155 89.203  141.785 1.00 58.92  ? 8   DT  M "O3'" 1 
ATOM   149  C "C2'" . DT  A 1 8   ? 133.065 89.503  139.597 1.00 42.37  ? 8   DT  M "C2'" 1 
ATOM   150  C "C1'" . DT  A 1 8   ? 133.944 88.477  138.891 1.00 38.71  ? 8   DT  M "C1'" 1 
ATOM   151  N N1    . DT  A 1 8   ? 133.716 88.337  137.435 1.00 36.92  ? 8   DT  M N1    1 
ATOM   152  C C2    . DT  A 1 8   ? 134.810 88.071  136.644 1.00 34.86  ? 8   DT  M C2    1 
ATOM   153  O O2    . DT  A 1 8   ? 135.949 88.075  137.050 1.00 36.54  ? 8   DT  M O2    1 
ATOM   154  N N3    . DT  A 1 8   ? 134.527 87.838  135.325 1.00 36.56  ? 8   DT  M N3    1 
ATOM   155  C C4    . DT  A 1 8   ? 133.277 87.767  134.744 1.00 34.12  ? 8   DT  M C4    1 
ATOM   156  O O4    . DT  A 1 8   ? 133.203 87.500  133.553 1.00 33.91  ? 8   DT  M O4    1 
ATOM   157  C C5    . DT  A 1 8   ? 132.169 88.012  135.640 1.00 32.32  ? 8   DT  M C5    1 
ATOM   158  C C7    . DT  A 1 8   ? 130.761 87.992  135.165 1.00 30.77  ? 8   DT  M C7    1 
ATOM   159  C C6    . DT  A 1 8   ? 132.426 88.259  136.930 1.00 34.45  ? 8   DT  M C6    1 
ATOM   160  P P     . DC  A 1 9   ? 134.520 90.620  142.442 1.00 63.36  ? 9   DC  M P     1 
ATOM   161  O OP1   . DC  A 1 9   ? 135.306 90.319  143.658 1.00 81.78  ? 9   DC  M OP1   1 
ATOM   162  O OP2   . DC  A 1 9   ? 133.321 91.474  142.497 1.00 40.45  ? 9   DC  M OP2   1 
ATOM   163  O "O5'" . DC  A 1 9   ? 135.519 91.258  141.372 1.00 68.03  ? 9   DC  M "O5'" 1 
ATOM   164  C "C5'" . DC  A 1 9   ? 136.682 90.537  140.994 1.00 39.23  ? 9   DC  M "C5'" 1 
ATOM   165  C "C4'" . DC  A 1 9   ? 137.400 91.272  139.888 1.00 33.23  ? 9   DC  M "C4'" 1 
ATOM   166  O "O4'" . DC  A 1 9   ? 136.784 90.895  138.650 1.00 39.32  ? 9   DC  M "O4'" 1 
ATOM   167  C "C3'" . DC  A 1 9   ? 137.292 92.789  139.939 1.00 39.26  ? 9   DC  M "C3'" 1 
ATOM   168  O "O3'" . DC  A 1 9   ? 138.593 93.289  140.064 1.00 52.74  ? 9   DC  M "O3'" 1 
ATOM   169  C "C2'" . DC  A 1 9   ? 136.689 93.189  138.587 1.00 37.24  ? 9   DC  M "C2'" 1 
ATOM   170  C "C1'" . DC  A 1 9   ? 136.961 91.956  137.749 1.00 37.34  ? 9   DC  M "C1'" 1 
ATOM   171  N N1    . DC  A 1 9   ? 136.051 91.685  136.614 1.00 35.81  ? 9   DC  M N1    1 
ATOM   172  C C2    . DC  A 1 9   ? 136.675 91.372  135.406 1.00 35.82  ? 9   DC  M C2    1 
ATOM   173  O O2    . DC  A 1 9   ? 137.908 91.421  135.343 1.00 37.45  ? 9   DC  M O2    1 
ATOM   174  N N3    . DC  A 1 9   ? 135.922 91.059  134.323 1.00 35.93  ? 9   DC  M N3    1 
ATOM   175  C C4    . DC  A 1 9   ? 134.595 91.025  134.428 1.00 33.97  ? 9   DC  M C4    1 
ATOM   176  N N4    . DC  A 1 9   ? 133.900 90.697  133.330 1.00 28.88  ? 9   DC  M N4    1 
ATOM   177  C C5    . DC  A 1 9   ? 133.934 91.309  135.657 1.00 33.24  ? 9   DC  M C5    1 
ATOM   178  C C6    . DC  A 1 9   ? 134.695 91.618  136.720 1.00 32.66  ? 9   DC  M C6    1 
ATOM   179  P P     . DG  A 1 10  ? 138.959 94.692  140.728 1.00 53.50  ? 10  DG  M P     1 
ATOM   180  O OP1   . DG  A 1 10  ? 139.876 94.367  141.840 1.00 69.05  ? 10  DG  M OP1   1 
ATOM   181  O OP2   . DG  A 1 10  ? 137.753 95.513  140.954 1.00 43.45  ? 10  DG  M OP2   1 
ATOM   182  O "O5'" . DG  A 1 10  ? 139.780 95.425  139.566 1.00 54.46  ? 10  DG  M "O5'" 1 
ATOM   183  C "C5'" . DG  A 1 10  ? 140.682 94.656  138.787 1.00 32.32  ? 10  DG  M "C5'" 1 
ATOM   184  C "C4'" . DG  A 1 10  ? 141.011 95.396  137.516 1.00 38.45  ? 10  DG  M "C4'" 1 
ATOM   185  O "O4'" . DG  A 1 10  ? 140.159 94.910  136.454 1.00 39.60  ? 10  DG  M "O4'" 1 
ATOM   186  C "C3'" . DG  A 1 10  ? 140.824 96.907  137.571 1.00 49.44  ? 10  DG  M "C3'" 1 
ATOM   187  O "O3'" . DG  A 1 10  ? 141.916 97.519  136.890 1.00 47.36  ? 10  DG  M "O3'" 1 
ATOM   188  C "C2'" . DG  A 1 10  ? 139.518 97.134  136.821 1.00 44.38  ? 10  DG  M "C2'" 1 
ATOM   189  C "C1'" . DG  A 1 10  ? 139.555 96.001  135.795 1.00 49.96  ? 10  DG  M "C1'" 1 
ATOM   190  N N9    . DG  A 1 10  ? 138.214 95.567  135.411 1.00 44.55  ? 10  DG  M N9    1 
ATOM   191  C C8    . DG  A 1 10  ? 137.061 95.619  136.160 1.00 42.44  ? 10  DG  M C8    1 
ATOM   192  N N7    . DG  A 1 10  ? 136.016 95.161  135.542 1.00 37.18  ? 10  DG  M N7    1 
ATOM   193  C C5    . DG  A 1 10  ? 136.499 94.796  134.306 1.00 31.34  ? 10  DG  M C5    1 
ATOM   194  C C6    . DG  A 1 10  ? 135.810 94.243  133.221 1.00 31.79  ? 10  DG  M C6    1 
ATOM   195  O O6    . DG  A 1 10  ? 134.612 93.953  133.169 1.00 35.95  ? 10  DG  M O6    1 
ATOM   196  N N1    . DG  A 1 10  ? 136.651 93.989  132.144 1.00 30.04  ? 10  DG  M N1    1 
ATOM   197  C C2    . DG  A 1 10  ? 138.000 94.260  132.125 1.00 33.48  ? 10  DG  M C2    1 
ATOM   198  N N2    . DG  A 1 10  ? 138.638 93.951  130.983 1.00 28.47  ? 10  DG  M N2    1 
ATOM   199  N N3    . DG  A 1 10  ? 138.665 94.787  133.149 1.00 35.17  ? 10  DG  M N3    1 
ATOM   200  C C4    . DG  A 1 10  ? 137.851 95.021  134.204 1.00 31.82  ? 10  DG  M C4    1 
ATOM   201  P P     . DT  A 1 11  ? 142.088 99.104  136.811 1.00 43.65  ? 11  DT  M P     1 
ATOM   202  O OP1   . DT  A 1 11  ? 143.413 99.431  137.380 1.00 68.79  ? 11  DT  M OP1   1 
ATOM   203  O OP2   . DT  A 1 11  ? 140.864 99.797  137.297 1.00 46.16  ? 11  DT  M OP2   1 
ATOM   204  O "O5'" . DT  A 1 11  ? 142.143 99.339  135.236 1.00 46.18  ? 11  DT  M "O5'" 1 
ATOM   205  C "C5'" . DT  A 1 11  ? 142.995 98.545  134.497 1.00 37.82  ? 11  DT  M "C5'" 1 
ATOM   206  C "C4'" . DT  A 1 11  ? 142.623 98.664  133.042 1.00 41.84  ? 11  DT  M "C4'" 1 
ATOM   207  O "O4'" . DT  A 1 11  ? 141.335 98.046  132.822 1.00 44.79  ? 11  DT  M "O4'" 1 
ATOM   208  C "C3'" . DT  A 1 11  ? 142.530 100.079 132.493 1.00 39.91  ? 11  DT  M "C3'" 1 
ATOM   209  O "O3'" . DT  A 1 11  ? 143.069 100.033 131.169 1.00 44.34  ? 11  DT  M "O3'" 1 
ATOM   210  C "C2'" . DT  A 1 11  ? 141.024 100.332 132.474 1.00 33.49  ? 11  DT  M "C2'" 1 
ATOM   211  C "C1'" . DT  A 1 11  ? 140.494 98.939  132.132 1.00 38.46  ? 11  DT  M "C1'" 1 
ATOM   212  N N1    . DT  A 1 11  ? 139.081 98.676  132.570 1.00 38.66  ? 11  DT  M N1    1 
ATOM   213  C C2    . DT  A 1 11  ? 138.240 98.039  131.668 1.00 36.62  ? 11  DT  M C2    1 
ATOM   214  O O2    . DT  A 1 11  ? 138.592 97.674  130.562 1.00 35.70  ? 11  DT  M O2    1 
ATOM   215  N N3    . DT  A 1 11  ? 136.980 97.789  132.130 1.00 27.53  ? 11  DT  M N3    1 
ATOM   216  C C4    . DT  A 1 11  ? 136.466 98.187  133.350 1.00 36.54  ? 11  DT  M C4    1 
ATOM   217  O O4    . DT  A 1 11  ? 135.297 97.938  133.606 1.00 36.21  ? 11  DT  M O4    1 
ATOM   218  C C5    . DT  A 1 11  ? 137.381 98.854  134.247 1.00 41.62  ? 11  DT  M C5    1 
ATOM   219  C C7    . DT  A 1 11  ? 136.892 99.291  135.616 1.00 34.96  ? 11  DT  M C7    1 
ATOM   220  C C6    . DT  A 1 11  ? 138.642 99.051  133.828 1.00 38.82  ? 11  DT  M C6    1 
ATOM   221  P P     . DA  A 1 12  ? 143.189 101.296 130.194 1.00 43.36  ? 12  DA  M P     1 
ATOM   222  O OP1   . DA  A 1 12  ? 144.420 101.072 129.396 1.00 45.21  ? 12  DA  M OP1   1 
ATOM   223  O OP2   . DA  A 1 12  ? 142.978 102.548 130.957 1.00 30.71  ? 12  DA  M OP2   1 
ATOM   224  O "O5'" . DA  A 1 12  ? 141.938 101.163 129.213 1.00 43.96  ? 12  DA  M "O5'" 1 
ATOM   225  C "C5'" . DA  A 1 12  ? 141.954 100.136 128.238 1.00 30.97  ? 12  DA  M "C5'" 1 
ATOM   226  C "C4'" . DA  A 1 12  ? 140.702 100.257 127.396 1.00 37.48  ? 12  DA  M "C4'" 1 
ATOM   227  O "O4'" . DA  A 1 12  ? 139.555 99.887  128.208 1.00 33.83  ? 12  DA  M "O4'" 1 
ATOM   228  C "C3'" . DA  A 1 12  ? 140.444 101.671 126.859 1.00 31.34  ? 12  DA  M "C3'" 1 
ATOM   229  O "O3'" . DA  A 1 12  ? 140.288 101.575 125.445 1.00 24.44  ? 12  DA  M "O3'" 1 
ATOM   230  C "C2'" . DA  A 1 12  ? 139.155 102.108 127.564 1.00 31.03  ? 12  DA  M "C2'" 1 
ATOM   231  C "C1'" . DA  A 1 12  ? 138.500 100.760 127.894 1.00 35.12  ? 12  DA  M "C1'" 1 
ATOM   232  N N9    . DA  A 1 12  ? 137.573 100.796 129.017 1.00 33.57  ? 12  DA  M N9    1 
ATOM   233  C C8    . DA  A 1 12  ? 137.796 101.263 130.279 1.00 36.75  ? 12  DA  M C8    1 
ATOM   234  N N7    . DA  A 1 12  ? 136.759 101.156 131.083 1.00 33.31  ? 12  DA  M N7    1 
ATOM   235  C C5    . DA  A 1 12  ? 135.792 100.565 130.295 1.00 30.04  ? 12  DA  M C5    1 
ATOM   236  C C6    . DA  A 1 12  ? 134.465 100.209 130.574 1.00 28.65  ? 12  DA  M C6    1 
ATOM   237  N N6    . DA  A 1 12  ? 133.896 100.409 131.774 1.00 25.46  ? 12  DA  M N6    1 
ATOM   238  N N1    . DA  A 1 12  ? 133.761 99.650  129.568 1.00 30.31  ? 12  DA  M N1    1 
ATOM   239  C C2    . DA  A 1 12  ? 134.359 99.452  128.381 1.00 29.35  ? 12  DA  M C2    1 
ATOM   240  N N3    . DA  A 1 12  ? 135.598 99.758  127.995 1.00 28.06  ? 12  DA  M N3    1 
ATOM   241  C C4    . DA  A 1 12  ? 136.273 100.324 129.016 1.00 30.78  ? 12  DA  M C4    1 
ATOM   242  P P     . DT  A 1 13  ? 139.974 102.765 124.432 1.00 29.47  ? 13  DT  M P     1 
ATOM   243  O OP1   . DT  A 1 13  ? 140.461 102.339 123.112 1.00 32.50  ? 13  DT  M OP1   1 
ATOM   244  O OP2   . DT  A 1 13  ? 140.417 104.047 125.004 1.00 29.70  ? 13  DT  M OP2   1 
ATOM   245  O "O5'" . DT  A 1 13  ? 138.376 102.806 124.366 1.00 33.84  ? 13  DT  M "O5'" 1 
ATOM   246  C "C5'" . DT  A 1 13  ? 137.581 101.765 123.803 1.00 26.42  ? 13  DT  M "C5'" 1 
ATOM   247  C "C4'" . DT  A 1 13  ? 136.111 102.105 123.971 1.00 28.87  ? 13  DT  M "C4'" 1 
ATOM   248  O "O4'" . DT  A 1 13  ? 135.737 102.004 125.372 1.00 28.31  ? 13  DT  M "O4'" 1 
ATOM   249  C "C3'" . DT  A 1 13  ? 135.699 103.516 123.515 1.00 30.00  ? 13  DT  M "C3'" 1 
ATOM   250  O "O3'" . DT  A 1 13  ? 134.512 103.380 122.757 1.00 33.24  ? 13  DT  M "O3'" 1 
ATOM   251  C "C2'" . DT  A 1 13  ? 135.402 104.245 124.828 1.00 24.32  ? 13  DT  M "C2'" 1 
ATOM   252  C "C1'" . DT  A 1 13  ? 134.848 103.075 125.624 1.00 25.37  ? 13  DT  M "C1'" 1 
ATOM   253  N N1    . DT  A 1 13  ? 134.700 103.313 127.059 1.00 28.70  ? 13  DT  M N1    1 
ATOM   254  C C2    . DT  A 1 13  ? 133.476 102.946 127.605 1.00 31.20  ? 13  DT  M C2    1 
ATOM   255  O O2    . DT  A 1 13  ? 132.577 102.441 126.956 1.00 28.26  ? 13  DT  M O2    1 
ATOM   256  N N3    . DT  A 1 13  ? 133.354 103.148 128.948 1.00 25.12  ? 13  DT  M N3    1 
ATOM   257  C C4    . DT  A 1 13  ? 134.304 103.706 129.771 1.00 30.90  ? 13  DT  M C4    1 
ATOM   258  O O4    . DT  A 1 13  ? 134.019 103.862 130.956 1.00 30.53  ? 13  DT  M O4    1 
ATOM   259  C C5    . DT  A 1 13  ? 135.551 104.084 129.135 1.00 28.02  ? 13  DT  M C5    1 
ATOM   260  C C7    . DT  A 1 13  ? 136.675 104.689 129.931 1.00 25.75  ? 13  DT  M C7    1 
ATOM   261  C C6    . DT  A 1 13  ? 135.692 103.877 127.825 1.00 25.24  ? 13  DT  M C6    1 
ATOM   262  P P     . DA  A 1 14  ? 134.033 104.307 121.565 1.00 31.96  ? 14  DA  M P     1 
ATOM   263  O OP1   . DA  A 1 14  ? 134.639 103.784 120.320 1.00 31.56  ? 14  DA  M OP1   1 
ATOM   264  O OP2   . DA  A 1 14  ? 134.164 105.721 121.994 1.00 31.66  ? 14  DA  M OP2   1 
ATOM   265  O "O5'" . DA  A 1 14  ? 132.494 103.929 121.483 1.00 31.58  ? 14  DA  M "O5'" 1 
ATOM   266  C "C5'" . DA  A 1 14  ? 132.110 102.576 121.348 1.00 19.79  ? 14  DA  M "C5'" 1 
ATOM   267  C "C4'" . DA  A 1 14  ? 130.711 102.422 121.915 1.00 28.04  ? 14  DA  M "C4'" 1 
ATOM   268  O "O4'" . DA  A 1 14  ? 130.763 102.648 123.333 1.00 26.26  ? 14  DA  M "O4'" 1 
ATOM   269  C "C3'" . DA  A 1 14  ? 129.657 103.387 121.377 1.00 26.67  ? 14  DA  M "C3'" 1 
ATOM   270  O "O3'" . DA  A 1 14  ? 128.477 102.637 121.040 1.00 30.80  ? 14  DA  M "O3'" 1 
ATOM   271  C "C2'" . DA  A 1 14  ? 129.432 104.377 122.520 1.00 20.77  ? 14  DA  M "C2'" 1 
ATOM   272  C "C1'" . DA  A 1 14  ? 129.752 103.534 123.750 1.00 22.48  ? 14  DA  M "C1'" 1 
ATOM   273  N N9    . DA  A 1 14  ? 130.329 104.290 124.840 1.00 24.04  ? 14  DA  M N9    1 
ATOM   274  C C8    . DA  A 1 14  ? 131.547 104.902 124.868 1.00 25.15  ? 14  DA  M C8    1 
ATOM   275  N N7    . DA  A 1 14  ? 131.819 105.513 125.999 1.00 27.22  ? 14  DA  M N7    1 
ATOM   276  C C5    . DA  A 1 14  ? 130.704 105.274 126.786 1.00 31.49  ? 14  DA  M C5    1 
ATOM   277  C C6    . DA  A 1 14  ? 130.366 105.651 128.104 1.00 29.71  ? 14  DA  M C6    1 
ATOM   278  N N6    . DA  A 1 14  ? 131.161 106.372 128.910 1.00 21.60  ? 14  DA  M N6    1 
ATOM   279  N N1    . DA  A 1 14  ? 129.171 105.241 128.570 1.00 28.74  ? 14  DA  M N1    1 
ATOM   280  C C2    . DA  A 1 14  ? 128.379 104.496 127.780 1.00 25.05  ? 14  DA  M C2    1 
ATOM   281  N N3    . DA  A 1 14  ? 128.596 104.075 126.538 1.00 23.96  ? 14  DA  M N3    1 
ATOM   282  C C4    . DA  A 1 14  ? 129.779 104.511 126.084 1.00 26.43  ? 14  DA  M C4    1 
ATOM   283  P P     . DG  A 1 15  ? 127.220 103.287 120.303 1.00 28.49  ? 15  DG  M P     1 
ATOM   284  O OP1   . DG  A 1 15  ? 126.527 102.208 119.563 1.00 25.08  ? 15  DG  M OP1   1 
ATOM   285  O OP2   . DG  A 1 15  ? 127.628 104.530 119.612 1.00 29.62  ? 15  DG  M OP2   1 
ATOM   286  O "O5'" . DG  A 1 15  ? 126.293 103.700 121.513 1.00 28.54  ? 15  DG  M "O5'" 1 
ATOM   287  C "C5'" . DG  A 1 15  ? 126.046 102.760 122.521 1.00 24.51  ? 15  DG  M "C5'" 1 
ATOM   288  C "C4'" . DG  A 1 15  ? 125.124 103.417 123.513 1.00 29.97  ? 15  DG  M "C4'" 1 
ATOM   289  O "O4'" . DG  A 1 15  ? 125.905 104.202 124.442 1.00 29.32  ? 15  DG  M "O4'" 1 
ATOM   290  C "C3'" . DG  A 1 15  ? 124.071 104.363 122.949 1.00 30.87  ? 15  DG  M "C3'" 1 
ATOM   291  O "O3'" . DG  A 1 15  ? 122.882 104.059 123.668 1.00 37.50  ? 15  DG  M "O3'" 1 
ATOM   292  C "C2'" . DG  A 1 15  ? 124.597 105.747 123.336 1.00 22.40  ? 15  DG  M "C2'" 1 
ATOM   293  C "C1'" . DG  A 1 15  ? 125.259 105.427 124.670 1.00 23.42  ? 15  DG  M "C1'" 1 
ATOM   294  N N9    . DG  A 1 15  ? 126.303 106.354 125.094 1.00 25.27  ? 15  DG  M N9    1 
ATOM   295  C C8    . DG  A 1 15  ? 127.389 106.823 124.378 1.00 24.79  ? 15  DG  M C8    1 
ATOM   296  N N7    . DG  A 1 15  ? 128.158 107.618 125.071 1.00 27.58  ? 15  DG  M N7    1 
ATOM   297  C C5    . DG  A 1 15  ? 127.577 107.652 126.326 1.00 21.87  ? 15  DG  M C5    1 
ATOM   298  C C6    . DG  A 1 15  ? 127.971 108.349 127.483 1.00 26.25  ? 15  DG  M C6    1 
ATOM   299  O O6    . DG  A 1 15  ? 128.948 109.083 127.619 1.00 28.89  ? 15  DG  M O6    1 
ATOM   300  N N1    . DG  A 1 15  ? 127.106 108.126 128.549 1.00 25.13  ? 15  DG  M N1    1 
ATOM   301  C C2    . DG  A 1 15  ? 125.979 107.341 128.482 1.00 21.48  ? 15  DG  M C2    1 
ATOM   302  N N2    . DG  A 1 15  ? 125.252 107.243 129.598 1.00 23.27  ? 15  DG  M N2    1 
ATOM   303  N N3    . DG  A 1 15  ? 125.619 106.647 127.423 1.00 23.61  ? 15  DG  M N3    1 
ATOM   304  C C4    . DG  A 1 15  ? 126.446 106.869 126.371 1.00 26.30  ? 15  DG  M C4    1 
ATOM   305  P P     . DC  A 1 16  ? 121.362 104.305 123.241 1.00 36.55  ? 16  DC  M P     1 
ATOM   306  O OP1   . DC  A 1 16  ? 120.638 103.032 123.470 1.00 52.10  ? 16  DC  M OP1   1 
ATOM   307  O OP2   . DC  A 1 16  ? 121.289 104.988 121.925 1.00 31.19  ? 16  DC  M OP2   1 
ATOM   308  O "O5'" . DC  A 1 16  ? 120.947 105.386 124.355 1.00 33.06  ? 16  DC  M "O5'" 1 
ATOM   309  C "C5'" . DC  A 1 16  ? 120.408 104.897 125.554 1.00 37.93  ? 16  DC  M "C5'" 1 
ATOM   310  C "C4'" . DC  A 1 16  ? 120.495 105.921 126.660 1.00 42.43  ? 16  DC  M "C4'" 1 
ATOM   311  O "O4'" . DC  A 1 16  ? 121.807 106.504 126.711 1.00 37.44  ? 16  DC  M "O4'" 1 
ATOM   312  C "C3'" . DC  A 1 16  ? 119.486 107.064 126.583 1.00 36.32  ? 16  DC  M "C3'" 1 
ATOM   313  O "O3'" . DC  A 1 16  ? 118.589 106.960 127.682 1.00 100.00 ? 16  DC  M "O3'" 1 
ATOM   314  C "C2'" . DC  A 1 16  ? 120.332 108.328 126.686 1.00 71.06  ? 16  DC  M "C2'" 1 
ATOM   315  C "C1'" . DC  A 1 16  ? 121.666 107.814 127.218 1.00 39.45  ? 16  DC  M "C1'" 1 
ATOM   316  N N1    . DC  A 1 16  ? 122.822 108.599 126.710 1.00 37.28  ? 16  DC  M N1    1 
ATOM   317  C C2    . DC  A 1 16  ? 123.438 109.467 127.614 1.00 34.85  ? 16  DC  M C2    1 
ATOM   318  O O2    . DC  A 1 16  ? 123.001 109.539 128.766 1.00 39.70  ? 16  DC  M O2    1 
ATOM   319  N N3    . DC  A 1 16  ? 124.495 110.206 127.200 1.00 35.10  ? 16  DC  M N3    1 
ATOM   320  C C4    . DC  A 1 16  ? 124.926 110.098 125.946 1.00 28.91  ? 16  DC  M C4    1 
ATOM   321  N N4    . DC  A 1 16  ? 125.978 110.840 125.592 1.00 29.28  ? 16  DC  M N4    1 
ATOM   322  C C5    . DC  A 1 16  ? 124.290 109.245 124.996 1.00 30.79  ? 16  DC  M C5    1 
ATOM   323  C C6    . DC  A 1 16  ? 123.252 108.514 125.417 1.00 34.64  ? 16  DC  M C6    1 
ATOM   324  O "O5'" . DA  B 2 1   ? 126.926 118.739 111.077 1.00 66.13  ? 1   DA  N "O5'" 1 
ATOM   325  C "C5'" . DA  B 2 1   ? 127.698 117.929 111.939 1.00 48.74  ? 1   DA  N "C5'" 1 
ATOM   326  C "C4'" . DA  B 2 1   ? 128.974 118.637 112.368 1.00 55.73  ? 1   DA  N "C4'" 1 
ATOM   327  O "O4'" . DA  B 2 1   ? 129.028 119.936 111.728 1.00 61.57  ? 1   DA  N "O4'" 1 
ATOM   328  C "C3'" . DA  B 2 1   ? 129.093 118.908 113.865 1.00 49.61  ? 1   DA  N "C3'" 1 
ATOM   329  O "O3'" . DA  B 2 1   ? 129.782 117.847 114.514 1.00 70.58  ? 1   DA  N "O3'" 1 
ATOM   330  C "C2'" . DA  B 2 1   ? 129.919 120.189 113.919 1.00 63.32  ? 1   DA  N "C2'" 1 
ATOM   331  C "C1'" . DA  B 2 1   ? 129.457 120.914 112.660 1.00 51.55  ? 1   DA  N "C1'" 1 
ATOM   332  N N9    . DA  B 2 1   ? 128.345 121.834 112.862 1.00 38.65  ? 1   DA  N N9    1 
ATOM   333  C C8    . DA  B 2 1   ? 127.095 121.747 112.309 1.00 35.15  ? 1   DA  N C8    1 
ATOM   334  N N7    . DA  B 2 1   ? 126.302 122.734 112.648 1.00 35.88  ? 1   DA  N N7    1 
ATOM   335  C C5    . DA  B 2 1   ? 127.088 123.517 113.475 1.00 37.08  ? 1   DA  N C5    1 
ATOM   336  C C6    . DA  B 2 1   ? 126.824 124.720 114.146 1.00 40.36  ? 1   DA  N C6    1 
ATOM   337  N N6    . DA  B 2 1   ? 125.628 125.316 114.049 1.00 37.15  ? 1   DA  N N6    1 
ATOM   338  N N1    . DA  B 2 1   ? 127.823 125.263 114.897 1.00 36.28  ? 1   DA  N N1    1 
ATOM   339  C C2    . DA  B 2 1   ? 128.995 124.623 114.970 1.00 32.43  ? 1   DA  N C2    1 
ATOM   340  N N3    . DA  B 2 1   ? 129.357 123.493 114.367 1.00 34.16  ? 1   DA  N N3    1 
ATOM   341  C C4    . DA  B 2 1   ? 128.348 122.978 113.634 1.00 36.72  ? 1   DA  N C4    1 
ATOM   342  P P     . DT  B 2 2   ? 129.315 117.297 115.945 1.00 58.13  ? 2   DT  N P     1 
ATOM   343  O OP1   . DT  B 2 2   ? 130.083 116.047 116.204 1.00 59.07  ? 2   DT  N OP1   1 
ATOM   344  O OP2   . DT  B 2 2   ? 127.831 117.285 115.956 1.00 49.48  ? 2   DT  N OP2   1 
ATOM   345  O "O5'" . DT  B 2 2   ? 129.797 118.409 116.993 1.00 57.35  ? 2   DT  N "O5'" 1 
ATOM   346  C "C5'" . DT  B 2 2   ? 131.176 118.760 117.028 1.00 58.71  ? 2   DT  N "C5'" 1 
ATOM   347  C "C4'" . DT  B 2 2   ? 131.390 119.898 118.003 1.00 54.40  ? 2   DT  N "C4'" 1 
ATOM   348  O "O4'" . DT  B 2 2   ? 130.601 121.031 117.555 1.00 56.88  ? 2   DT  N "O4'" 1 
ATOM   349  C "C3'" . DT  B 2 2   ? 130.915 119.589 119.411 1.00 52.95  ? 2   DT  N "C3'" 1 
ATOM   350  O "O3'" . DT  B 2 2   ? 131.721 120.260 120.380 1.00 74.14  ? 2   DT  N "O3'" 1 
ATOM   351  C "C2'" . DT  B 2 2   ? 129.488 120.112 119.382 1.00 45.75  ? 2   DT  N "C2'" 1 
ATOM   352  C "C1'" . DT  B 2 2   ? 129.656 121.372 118.539 1.00 41.85  ? 2   DT  N "C1'" 1 
ATOM   353  N N1    . DT  B 2 2   ? 128.383 121.791 117.869 1.00 41.83  ? 2   DT  N N1    1 
ATOM   354  C C2    . DT  B 2 2   ? 127.936 123.078 118.113 1.00 41.08  ? 2   DT  N C2    1 
ATOM   355  O O2    . DT  B 2 2   ? 128.548 123.897 118.783 1.00 42.11  ? 2   DT  N O2    1 
ATOM   356  N N3    . DT  B 2 2   ? 126.742 123.391 117.514 1.00 35.54  ? 2   DT  N N3    1 
ATOM   357  C C4    . DT  B 2 2   ? 125.956 122.568 116.732 1.00 38.08  ? 2   DT  N C4    1 
ATOM   358  O O4    . DT  B 2 2   ? 124.888 122.999 116.294 1.00 37.70  ? 2   DT  N O4    1 
ATOM   359  C C5    . DT  B 2 2   ? 126.491 121.238 116.508 1.00 36.06  ? 2   DT  N C5    1 
ATOM   360  C C7    . DT  B 2 2   ? 125.728 120.245 115.663 1.00 32.78  ? 2   DT  N C7    1 
ATOM   361  C C6    . DT  B 2 2   ? 127.661 120.909 117.081 1.00 35.94  ? 2   DT  N C6    1 
ATOM   362  P P     . DA  B 2 3   ? 132.909 119.468 121.109 1.00 67.39  ? 3   DA  N P     1 
ATOM   363  O OP1   . DA  B 2 3   ? 134.164 119.855 120.427 1.00 82.33  ? 3   DA  N OP1   1 
ATOM   364  O OP2   . DA  B 2 3   ? 132.519 118.052 121.254 1.00 61.18  ? 3   DA  N OP2   1 
ATOM   365  O "O5'" . DA  B 2 3   ? 132.959 120.076 122.578 1.00 47.71  ? 3   DA  N "O5'" 1 
ATOM   366  C "C5'" . DA  B 2 3   ? 132.589 121.411 122.786 1.00 49.41  ? 3   DA  N "C5'" 1 
ATOM   367  C "C4'" . DA  B 2 3   ? 132.097 121.510 124.203 1.00 54.06  ? 3   DA  N "C4'" 1 
ATOM   368  O "O4'" . DA  B 2 3   ? 130.690 121.181 124.229 1.00 59.68  ? 3   DA  N "O4'" 1 
ATOM   369  C "C3'" . DA  B 2 3   ? 132.779 120.540 125.148 1.00 58.11  ? 3   DA  N "C3'" 1 
ATOM   370  O "O3'" . DA  B 2 3   ? 133.123 121.230 126.320 1.00 82.69  ? 3   DA  N "O3'" 1 
ATOM   371  C "C2'" . DA  B 2 3   ? 131.732 119.471 125.441 1.00 54.05  ? 3   DA  N "C2'" 1 
ATOM   372  C "C1'" . DA  B 2 3   ? 130.418 120.194 125.195 1.00 53.33  ? 3   DA  N "C1'" 1 
ATOM   373  N N9    . DA  B 2 3   ? 129.383 119.355 124.609 1.00 51.95  ? 3   DA  N N9    1 
ATOM   374  C C8    . DA  B 2 3   ? 129.367 118.799 123.358 1.00 54.38  ? 3   DA  N C8    1 
ATOM   375  N N7    . DA  B 2 3   ? 128.281 118.111 123.086 1.00 51.41  ? 3   DA  N N7    1 
ATOM   376  C C5    . DA  B 2 3   ? 127.528 118.244 124.231 1.00 49.08  ? 3   DA  N C5    1 
ATOM   377  C C6    . DA  B 2 3   ? 126.272 117.743 124.579 1.00 41.75  ? 3   DA  N C6    1 
ATOM   378  N N6    . DA  B 2 3   ? 125.546 116.981 123.756 1.00 42.55  ? 3   DA  N N6    1 
ATOM   379  N N1    . DA  B 2 3   ? 125.778 118.065 125.797 1.00 43.81  ? 3   DA  N N1    1 
ATOM   380  C C2    . DA  B 2 3   ? 126.504 118.832 126.617 1.00 46.47  ? 3   DA  N C2    1 
ATOM   381  N N3    . DA  B 2 3   ? 127.717 119.348 126.406 1.00 49.77  ? 3   DA  N N3    1 
ATOM   382  C C4    . DA  B 2 3   ? 128.175 119.020 125.177 1.00 51.82  ? 3   DA  N C4    1 
ATOM   383  P P     . DT  B 2 4   ? 133.775 120.398 127.506 1.00 96.42  ? 4   DT  N P     1 
ATOM   384  O OP1   . DT  B 2 4   ? 134.444 121.354 128.423 1.00 100.00 ? 4   DT  N OP1   1 
ATOM   385  O OP2   . DT  B 2 4   ? 134.551 119.266 126.948 1.00 77.28  ? 4   DT  N OP2   1 
ATOM   386  O "O5'" . DT  B 2 4   ? 132.490 119.858 128.261 1.00 73.60  ? 4   DT  N "O5'" 1 
ATOM   387  C "C5'" . DT  B 2 4   ? 132.388 120.332 129.587 1.00 66.32  ? 4   DT  N "C5'" 1 
ATOM   388  C "C4'" . DT  B 2 4   ? 131.247 119.656 130.308 1.00 70.99  ? 4   DT  N "C4'" 1 
ATOM   389  O "O4'" . DT  B 2 4   ? 130.346 119.078 129.337 1.00 66.57  ? 4   DT  N "O4'" 1 
ATOM   390  C "C3'" . DT  B 2 4   ? 131.672 118.542 131.249 1.00 66.21  ? 4   DT  N "C3'" 1 
ATOM   391  O "O3'" . DT  B 2 4   ? 131.075 118.766 132.511 1.00 76.48  ? 4   DT  N "O3'" 1 
ATOM   392  C "C2'" . DT  B 2 4   ? 131.155 117.269 130.578 1.00 52.58  ? 4   DT  N "C2'" 1 
ATOM   393  C "C1'" . DT  B 2 4   ? 129.973 117.791 129.768 1.00 56.78  ? 4   DT  N "C1'" 1 
ATOM   394  N N1    . DT  B 2 4   ? 129.632 116.991 128.549 1.00 57.13  ? 4   DT  N N1    1 
ATOM   395  C C2    . DT  B 2 4   ? 128.332 116.534 128.496 1.00 54.20  ? 4   DT  N C2    1 
ATOM   396  O O2    . DT  B 2 4   ? 127.525 116.731 129.383 1.00 52.52  ? 4   DT  N O2    1 
ATOM   397  N N3    . DT  B 2 4   ? 128.008 115.816 127.379 1.00 52.71  ? 4   DT  N N3    1 
ATOM   398  C C4    . DT  B 2 4   ? 128.837 115.536 126.320 1.00 53.29  ? 4   DT  N C4    1 
ATOM   399  O O4    . DT  B 2 4   ? 128.395 114.897 125.381 1.00 53.06  ? 4   DT  N O4    1 
ATOM   400  C C5    . DT  B 2 4   ? 130.175 116.058 126.413 1.00 46.67  ? 4   DT  N C5    1 
ATOM   401  C C7    . DT  B 2 4   ? 131.145 115.817 125.298 1.00 43.07  ? 4   DT  N C7    1 
ATOM   402  C C6    . DT  B 2 4   ? 130.509 116.760 127.500 1.00 51.74  ? 4   DT  N C6    1 
ATOM   403  P P     . DG  B 2 5   ? 131.356 117.796 133.749 1.00 80.64  ? 5   DG  N P     1 
ATOM   404  O OP1   . DG  B 2 5   ? 131.354 118.608 134.982 1.00 99.62  ? 5   DG  N OP1   1 
ATOM   405  O OP2   . DG  B 2 5   ? 132.536 116.948 133.457 1.00 57.01  ? 5   DG  N OP2   1 
ATOM   406  O "O5'" . DG  B 2 5   ? 130.040 116.890 133.736 1.00 66.16  ? 5   DG  N "O5'" 1 
ATOM   407  C "C5'" . DG  B 2 5   ? 128.781 117.482 133.962 1.00 37.32  ? 5   DG  N "C5'" 1 
ATOM   408  C "C4'" . DG  B 2 5   ? 127.804 116.386 134.307 1.00 50.86  ? 5   DG  N "C4'" 1 
ATOM   409  O "O4'" . DG  B 2 5   ? 127.405 115.737 133.073 1.00 55.23  ? 5   DG  N "O4'" 1 
ATOM   410  C "C3'" . DG  B 2 5   ? 128.366 115.277 135.201 1.00 48.82  ? 5   DG  N "C3'" 1 
ATOM   411  O "O3'" . DG  B 2 5   ? 127.365 114.855 136.110 1.00 56.20  ? 5   DG  N "O3'" 1 
ATOM   412  C "C2'" . DG  B 2 5   ? 128.716 114.163 134.216 1.00 57.89  ? 5   DG  N "C2'" 1 
ATOM   413  C "C1'" . DG  B 2 5   ? 127.629 114.337 133.161 1.00 57.37  ? 5   DG  N "C1'" 1 
ATOM   414  N N9    . DG  B 2 5   ? 127.965 113.916 131.804 1.00 47.49  ? 5   DG  N N9    1 
ATOM   415  C C8    . DG  B 2 5   ? 129.037 114.264 131.018 1.00 43.37  ? 5   DG  N C8    1 
ATOM   416  N N7    . DG  B 2 5   ? 128.968 113.780 129.807 1.00 45.03  ? 5   DG  N N7    1 
ATOM   417  C C5    . DG  B 2 5   ? 127.764 113.088 129.781 1.00 42.88  ? 5   DG  N C5    1 
ATOM   418  C C6    . DG  B 2 5   ? 127.142 112.369 128.731 1.00 46.20  ? 5   DG  N C6    1 
ATOM   419  O O6    . DG  B 2 5   ? 127.555 112.187 127.581 1.00 49.81  ? 5   DG  N O6    1 
ATOM   420  N N1    . DG  B 2 5   ? 125.914 111.832 129.113 1.00 40.01  ? 5   DG  N N1    1 
ATOM   421  C C2    . DG  B 2 5   ? 125.368 111.972 130.369 1.00 42.06  ? 5   DG  N C2    1 
ATOM   422  N N2    . DG  B 2 5   ? 124.175 111.404 130.569 1.00 39.42  ? 5   DG  N N2    1 
ATOM   423  N N3    . DG  B 2 5   ? 125.930 112.649 131.363 1.00 47.99  ? 5   DG  N N3    1 
ATOM   424  C C4    . DG  B 2 5   ? 127.129 113.173 130.999 1.00 49.24  ? 5   DG  N C4    1 
ATOM   425  P P     . DC  B 2 6   ? 127.741 113.875 137.308 1.00 61.12  ? 6   DC  N P     1 
ATOM   426  O OP1   . DC  B 2 6   ? 126.965 114.313 138.490 1.00 66.67  ? 6   DC  N OP1   1 
ATOM   427  O OP2   . DC  B 2 6   ? 129.214 113.753 137.372 1.00 66.12  ? 6   DC  N OP2   1 
ATOM   428  O "O5'" . DC  B 2 6   ? 127.158 112.484 136.805 1.00 68.37  ? 6   DC  N "O5'" 1 
ATOM   429  C "C5'" . DC  B 2 6   ? 125.769 112.356 136.757 1.00 51.98  ? 6   DC  N "C5'" 1 
ATOM   430  C "C4'" . DC  B 2 6   ? 125.395 111.083 136.043 1.00 36.37  ? 6   DC  N "C4'" 1 
ATOM   431  O "O4'" . DC  B 2 6   ? 125.973 111.091 134.725 1.00 38.74  ? 6   DC  N "O4'" 1 
ATOM   432  C "C3'" . DC  B 2 6   ? 125.835 109.799 136.721 1.00 26.90  ? 6   DC  N "C3'" 1 
ATOM   433  O "O3'" . DC  B 2 6   ? 124.652 109.023 136.863 1.00 36.27  ? 6   DC  N "O3'" 1 
ATOM   434  C "C2'" . DC  B 2 6   ? 126.812 109.197 135.712 1.00 25.08  ? 6   DC  N "C2'" 1 
ATOM   435  C "C1'" . DC  B 2 6   ? 126.302 109.767 134.401 1.00 29.90  ? 6   DC  N "C1'" 1 
ATOM   436  N N1    . DC  B 2 6   ? 127.273 109.838 133.273 1.00 34.08  ? 6   DC  N N1    1 
ATOM   437  C C2    . DC  B 2 6   ? 126.942 109.186 132.065 1.00 39.05  ? 6   DC  N C2    1 
ATOM   438  O O2    . DC  B 2 6   ? 125.893 108.534 131.994 1.00 34.05  ? 6   DC  N O2    1 
ATOM   439  N N3    . DC  B 2 6   ? 127.811 109.259 131.009 1.00 35.22  ? 6   DC  N N3    1 
ATOM   440  C C4    . DC  B 2 6   ? 128.940 109.965 131.139 1.00 33.14  ? 6   DC  N C4    1 
ATOM   441  N N4    . DC  B 2 6   ? 129.763 110.028 130.100 1.00 29.02  ? 6   DC  N N4    1 
ATOM   442  C C5    . DC  B 2 6   ? 129.272 110.648 132.343 1.00 36.59  ? 6   DC  N C5    1 
ATOM   443  C C6    . DC  B 2 6   ? 128.417 110.569 133.372 1.00 40.65  ? 6   DC  N C6    1 
ATOM   444  P P     . DT  B 2 7   ? 124.580 107.660 137.699 1.00 43.88  ? 7   DT  N P     1 
ATOM   445  O OP1   . DT  B 2 7   ? 123.254 107.661 138.350 1.00 53.75  ? 7   DT  N OP1   1 
ATOM   446  O OP2   . DT  B 2 7   ? 125.819 107.474 138.491 1.00 41.84  ? 7   DT  N OP2   1 
ATOM   447  O "O5'" . DT  B 2 7   ? 124.573 106.521 136.574 1.00 51.63  ? 7   DT  N "O5'" 1 
ATOM   448  C "C5'" . DT  B 2 7   ? 123.625 106.623 135.514 1.00 45.60  ? 7   DT  N "C5'" 1 
ATOM   449  C "C4'" . DT  B 2 7   ? 123.802 105.500 134.512 1.00 43.00  ? 7   DT  N "C4'" 1 
ATOM   450  O "O4'" . DT  B 2 7   ? 124.786 105.877 133.517 1.00 39.87  ? 7   DT  N "O4'" 1 
ATOM   451  C "C3'" . DT  B 2 7   ? 124.269 104.158 135.078 1.00 48.67  ? 7   DT  N "C3'" 1 
ATOM   452  O "O3'" . DT  B 2 7   ? 123.583 103.123 134.376 1.00 50.22  ? 7   DT  N "O3'" 1 
ATOM   453  C "C2'" . DT  B 2 7   ? 125.754 104.147 134.734 1.00 34.07  ? 7   DT  N "C2'" 1 
ATOM   454  C "C1'" . DT  B 2 7   ? 125.693 104.806 133.366 1.00 37.88  ? 7   DT  N "C1'" 1 
ATOM   455  N N1    . DT  B 2 7   ? 126.968 105.372 132.921 1.00 38.96  ? 7   DT  N N1    1 
ATOM   456  C C2    . DT  B 2 7   ? 127.247 105.244 131.578 1.00 33.82  ? 7   DT  N C2    1 
ATOM   457  O O2    . DT  B 2 7   ? 126.500 104.660 130.789 1.00 27.62  ? 7   DT  N O2    1 
ATOM   458  N N3    . DT  B 2 7   ? 128.449 105.812 131.208 1.00 31.01  ? 7   DT  N N3    1 
ATOM   459  C C4    . DT  B 2 7   ? 129.351 106.486 132.028 1.00 37.68  ? 7   DT  N C4    1 
ATOM   460  O O4    . DT  B 2 7   ? 130.382 106.947 131.541 1.00 36.93  ? 7   DT  N O4    1 
ATOM   461  C C5    . DT  B 2 7   ? 128.982 106.577 133.421 1.00 34.80  ? 7   DT  N C5    1 
ATOM   462  C C7    . DT  B 2 7   ? 129.881 107.250 134.433 1.00 30.94  ? 7   DT  N C7    1 
ATOM   463  C C6    . DT  B 2 7   ? 127.815 106.032 133.794 1.00 36.70  ? 7   DT  N C6    1 
ATOM   464  P P     . DA  B 2 8   ? 123.603 101.591 134.839 1.00 48.07  ? 8   DA  N P     1 
ATOM   465  O OP1   . DA  B 2 8   ? 122.220 101.247 135.222 1.00 65.24  ? 8   DA  N OP1   1 
ATOM   466  O OP2   . DA  B 2 8   ? 124.724 101.334 135.766 1.00 44.46  ? 8   DA  N OP2   1 
ATOM   467  O "O5'" . DA  B 2 8   ? 123.985 100.841 133.480 1.00 52.62  ? 8   DA  N "O5'" 1 
ATOM   468  C "C5'" . DA  B 2 8   ? 123.081 100.789 132.420 1.00 31.25  ? 8   DA  N "C5'" 1 
ATOM   469  C "C4'" . DA  B 2 8   ? 123.828 100.774 131.110 1.00 29.26  ? 8   DA  N "C4'" 1 
ATOM   470  O "O4'" . DA  B 2 8   ? 124.781 101.859 131.077 1.00 34.15  ? 8   DA  N "O4'" 1 
ATOM   471  C "C3'" . DA  B 2 8   ? 124.625 99.521  130.804 1.00 31.31  ? 8   DA  N "C3'" 1 
ATOM   472  O "O3'" . DA  B 2 8   ? 123.767 98.631  130.145 1.00 27.23  ? 8   DA  N "O3'" 1 
ATOM   473  C "C2'" . DA  B 2 8   ? 125.681 100.035 129.823 1.00 36.28  ? 8   DA  N "C2'" 1 
ATOM   474  C "C1'" . DA  B 2 8   ? 125.866 101.486 130.255 1.00 31.88  ? 8   DA  N "C1'" 1 
ATOM   475  N N9    . DA  B 2 8   ? 127.073 101.796 131.018 1.00 33.23  ? 8   DA  N N9    1 
ATOM   476  C C8    . DA  B 2 8   ? 127.214 102.055 132.356 1.00 27.34  ? 8   DA  N C8    1 
ATOM   477  N N7    . DA  B 2 8   ? 128.436 102.374 132.709 1.00 29.31  ? 8   DA  N N7    1 
ATOM   478  C C5    . DA  B 2 8   ? 129.136 102.340 131.508 1.00 32.21  ? 8   DA  N C5    1 
ATOM   479  C C6    . DA  B 2 8   ? 130.477 102.605 131.188 1.00 25.38  ? 8   DA  N C6    1 
ATOM   480  N N6    . DA  B 2 8   ? 131.380 102.959 132.092 1.00 28.73  ? 8   DA  N N6    1 
ATOM   481  N N1    . DA  B 2 8   ? 130.858 102.465 129.909 1.00 26.18  ? 8   DA  N N1    1 
ATOM   482  C C2    . DA  B 2 8   ? 129.953 102.090 128.997 1.00 28.76  ? 8   DA  N C2    1 
ATOM   483  N N3    . DA  B 2 8   ? 128.661 101.831 129.157 1.00 30.35  ? 8   DA  N N3    1 
ATOM   484  C C4    . DA  B 2 8   ? 128.316 101.979 130.452 1.00 32.95  ? 8   DA  N C4    1 
ATOM   485  P P     . DT  B 2 9   ? 124.209 97.124  129.933 1.00 28.10  ? 9   DT  N P     1 
ATOM   486  O OP1   . DT  B 2 9   ? 122.999 96.400  129.485 1.00 31.37  ? 9   DT  N OP1   1 
ATOM   487  O OP2   . DT  B 2 9   ? 124.930 96.708  131.153 1.00 26.13  ? 9   DT  N OP2   1 
ATOM   488  O "O5'" . DT  B 2 9   ? 125.274 97.192  128.735 1.00 30.03  ? 9   DT  N "O5'" 1 
ATOM   489  C "C5'" . DT  B 2 9   ? 124.988 97.649  127.405 1.00 23.50  ? 9   DT  N "C5'" 1 
ATOM   490  C "C4'" . DT  B 2 9   ? 126.276 97.698  126.603 1.00 22.31  ? 9   DT  N "C4'" 1 
ATOM   491  O "O4'" . DT  B 2 9   ? 127.267 98.451  127.340 1.00 30.27  ? 9   DT  N "O4'" 1 
ATOM   492  C "C3'" . DT  B 2 9   ? 126.937 96.353  126.316 1.00 18.10  ? 9   DT  N "C3'" 1 
ATOM   493  O "O3'" . DT  B 2 9   ? 127.558 96.495  125.060 1.00 23.56  ? 9   DT  N "O3'" 1 
ATOM   494  C "C2'" . DT  B 2 9   ? 128.005 96.256  127.398 1.00 19.41  ? 9   DT  N "C2'" 1 
ATOM   495  C "C1'" . DT  B 2 9   ? 128.466 97.704  127.402 1.00 23.70  ? 9   DT  N "C1'" 1 
ATOM   496  N N1    . DT  B 2 9   ? 129.181 98.124  128.647 1.00 27.77  ? 9   DT  N N1    1 
ATOM   497  C C2    . DT  B 2 9   ? 130.458 98.642  128.533 1.00 29.00  ? 9   DT  N C2    1 
ATOM   498  O O2    . DT  B 2 9   ? 131.092 98.711  127.493 1.00 25.16  ? 9   DT  N O2    1 
ATOM   499  N N3    . DT  B 2 9   ? 131.016 99.004  129.724 1.00 27.09  ? 9   DT  N N3    1 
ATOM   500  C C4    . DT  B 2 9   ? 130.413 98.985  130.973 1.00 30.41  ? 9   DT  N C4    1 
ATOM   501  O O4    . DT  B 2 9   ? 131.035 99.413  131.941 1.00 29.62  ? 9   DT  N O4    1 
ATOM   502  C C5    . DT  B 2 9   ? 129.065 98.482  131.016 1.00 24.98  ? 9   DT  N C5    1 
ATOM   503  C C7    . DT  B 2 9   ? 128.324 98.401  132.349 1.00 22.97  ? 9   DT  N C7    1 
ATOM   504  C C6    . DT  B 2 9   ? 128.504 98.115  129.861 1.00 26.23  ? 9   DT  N C6    1 
ATOM   505  P P     . DA  B 2 10  ? 128.507 95.375  124.422 1.00 29.38  ? 10  DA  N P     1 
ATOM   506  O OP1   . DA  B 2 10  ? 128.393 95.505  122.945 1.00 26.46  ? 10  DA  N OP1   1 
ATOM   507  O OP2   . DA  B 2 10  ? 128.185 94.090  125.058 1.00 33.57  ? 10  DA  N OP2   1 
ATOM   508  O "O5'" . DA  B 2 10  ? 129.986 95.828  124.870 1.00 31.61  ? 10  DA  N "O5'" 1 
ATOM   509  C "C5'" . DA  B 2 10  ? 130.765 96.787  124.147 1.00 25.11  ? 10  DA  N "C5'" 1 
ATOM   510  C "C4'" . DA  B 2 10  ? 132.191 96.289  123.937 1.00 30.65  ? 10  DA  N "C4'" 1 
ATOM   511  O "O4'" . DA  B 2 10  ? 132.995 96.488  125.141 1.00 35.26  ? 10  DA  N "O4'" 1 
ATOM   512  C "C3'" . DA  B 2 10  ? 132.328 94.814  123.622 1.00 33.34  ? 10  DA  N "C3'" 1 
ATOM   513  O "O3'" . DA  B 2 10  ? 133.451 94.627  122.757 1.00 29.14  ? 10  DA  N "O3'" 1 
ATOM   514  C "C2'" . DA  B 2 10  ? 132.533 94.194  125.015 1.00 29.24  ? 10  DA  N "C2'" 1 
ATOM   515  C "C1'" . DA  B 2 10  ? 133.379 95.249  125.720 1.00 28.09  ? 10  DA  N "C1'" 1 
ATOM   516  N N9    . DA  B 2 10  ? 133.062 95.433  127.128 1.00 28.08  ? 10  DA  N N9    1 
ATOM   517  C C8    . DA  B 2 10  ? 131.839 95.396  127.734 1.00 27.95  ? 10  DA  N C8    1 
ATOM   518  N N7    . DA  B 2 10  ? 131.856 95.759  129.001 1.00 31.11  ? 10  DA  N N7    1 
ATOM   519  C C5    . DA  B 2 10  ? 133.184 96.037  129.245 1.00 29.93  ? 10  DA  N C5    1 
ATOM   520  C C6    . DA  B 2 10  ? 133.855 96.443  130.412 1.00 29.38  ? 10  DA  N C6    1 
ATOM   521  N N6    . DA  B 2 10  ? 133.247 96.626  131.591 1.00 25.11  ? 10  DA  N N6    1 
ATOM   522  N N1    . DA  B 2 10  ? 135.180 96.684  130.306 1.00 30.01  ? 10  DA  N N1    1 
ATOM   523  C C2    . DA  B 2 10  ? 135.782 96.467  129.124 1.00 28.23  ? 10  DA  N C2    1 
ATOM   524  N N3    . DA  B 2 10  ? 135.261 96.061  127.961 1.00 29.85  ? 10  DA  N N3    1 
ATOM   525  C C4    . DA  B 2 10  ? 133.939 95.870  128.094 1.00 32.47  ? 10  DA  N C4    1 
ATOM   526  P P     . DC  B 2 11  ? 133.846 93.180  122.193 1.00 33.24  ? 11  DC  N P     1 
ATOM   527  O OP1   . DC  B 2 11  ? 134.461 93.334  120.865 1.00 40.26  ? 11  DC  N OP1   1 
ATOM   528  O OP2   . DC  B 2 11  ? 132.698 92.271  122.322 1.00 32.22  ? 11  DC  N OP2   1 
ATOM   529  O "O5'" . DC  B 2 11  ? 134.962 92.673  123.227 1.00 44.09  ? 11  DC  N "O5'" 1 
ATOM   530  C "C5'" . DC  B 2 11  ? 136.158 93.389  123.508 1.00 33.69  ? 11  DC  N "C5'" 1 
ATOM   531  C "C4'" . DC  B 2 11  ? 136.947 92.588  124.519 1.00 30.53  ? 11  DC  N "C4'" 1 
ATOM   532  O "O4'" . DC  B 2 11  ? 136.541 92.985  125.843 1.00 32.79  ? 11  DC  N "O4'" 1 
ATOM   533  C "C3'" . DC  B 2 11  ? 136.713 91.078  124.479 1.00 30.70  ? 11  DC  N "C3'" 1 
ATOM   534  O "O3'" . DC  B 2 11  ? 137.919 90.405  124.836 1.00 48.01  ? 11  DC  N "O3'" 1 
ATOM   535  C "C2'" . DC  B 2 11  ? 135.707 90.881  125.601 1.00 33.61  ? 11  DC  N "C2'" 1 
ATOM   536  C "C1'" . DC  B 2 11  ? 136.326 91.824  126.613 1.00 32.13  ? 11  DC  N "C1'" 1 
ATOM   537  N N1    . DC  B 2 11  ? 135.429 92.162  127.768 1.00 38.25  ? 11  DC  N N1    1 
ATOM   538  C C2    . DC  B 2 11  ? 136.020 92.769  128.898 1.00 36.92  ? 11  DC  N C2    1 
ATOM   539  O O2    . DC  B 2 11  ? 137.236 93.017  128.909 1.00 33.47  ? 11  DC  N O2    1 
ATOM   540  N N3    . DC  B 2 11  ? 135.222 93.077  129.955 1.00 34.56  ? 11  DC  N N3    1 
ATOM   541  C C4    . DC  B 2 11  ? 133.918 92.803  129.907 1.00 28.87  ? 11  DC  N C4    1 
ATOM   542  N N4    . DC  B 2 11  ? 133.196 93.132  130.979 1.00 27.17  ? 11  DC  N N4    1 
ATOM   543  C C5    . DC  B 2 11  ? 133.296 92.193  128.778 1.00 26.32  ? 11  DC  N C5    1 
ATOM   544  C C6    . DC  B 2 11  ? 134.077 91.894  127.731 1.00 29.99  ? 11  DC  N C6    1 
ATOM   545  P P     . DG  B 2 12  ? 138.679 89.422  123.823 1.00 49.02  ? 12  DG  N P     1 
ATOM   546  O OP1   . DG  B 2 12  ? 138.994 90.188  122.591 1.00 56.09  ? 12  DG  N OP1   1 
ATOM   547  O OP2   . DG  B 2 12  ? 137.933 88.158  123.748 1.00 44.33  ? 12  DG  N OP2   1 
ATOM   548  O "O5'" . DG  B 2 12  ? 140.049 89.140  124.598 1.00 52.74  ? 12  DG  N "O5'" 1 
ATOM   549  C "C5'" . DG  B 2 12  ? 140.945 90.202  124.843 1.00 34.42  ? 12  DG  N "C5'" 1 
ATOM   550  C "C4'" . DG  B 2 12  ? 141.571 89.992  126.200 1.00 39.67  ? 12  DG  N "C4'" 1 
ATOM   551  O "O4'" . DG  B 2 12  ? 140.658 90.365  127.264 1.00 38.04  ? 12  DG  N "O4'" 1 
ATOM   552  C "C3'" . DG  B 2 12  ? 142.007 88.559  126.489 1.00 40.72  ? 12  DG  N "C3'" 1 
ATOM   553  O "O3'" . DG  B 2 12  ? 143.228 88.628  127.200 1.00 55.74  ? 12  DG  N "O3'" 1 
ATOM   554  C "C2'" . DG  B 2 12  ? 140.887 88.038  127.383 1.00 32.41  ? 12  DG  N "C2'" 1 
ATOM   555  C "C1'" . DG  B 2 12  ? 140.510 89.286  128.169 1.00 39.90  ? 12  DG  N "C1'" 1 
ATOM   556  N N9    . DG  B 2 12  ? 139.121 89.272  128.608 1.00 35.90  ? 12  DG  N N9    1 
ATOM   557  C C8    . DG  B 2 12  ? 138.012 88.809  127.934 1.00 31.67  ? 12  DG  N C8    1 
ATOM   558  N N7    . DG  B 2 12  ? 136.901 88.960  128.594 1.00 30.71  ? 12  DG  N N7    1 
ATOM   559  C C5    . DG  B 2 12  ? 137.297 89.574  129.776 1.00 30.10  ? 12  DG  N C5    1 
ATOM   560  C C6    . DG  B 2 12  ? 136.522 89.990  130.876 1.00 33.63  ? 12  DG  N C6    1 
ATOM   561  O O6    . DG  B 2 12  ? 135.294 89.901  131.015 1.00 34.33  ? 12  DG  N O6    1 
ATOM   562  N N1    . DG  B 2 12  ? 137.311 90.558  131.876 1.00 37.41  ? 12  DG  N N1    1 
ATOM   563  C C2    . DG  B 2 12  ? 138.677 90.713  131.820 1.00 36.88  ? 12  DG  N C2    1 
ATOM   564  N N2    . DG  B 2 12  ? 139.243 91.296  132.887 1.00 29.36  ? 12  DG  N N2    1 
ATOM   565  N N3    . DG  B 2 12  ? 139.415 90.350  130.782 1.00 34.15  ? 12  DG  N N3    1 
ATOM   566  C C4    . DG  B 2 12  ? 138.661 89.779  129.803 1.00 32.80  ? 12  DG  N C4    1 
ATOM   567  P P     . DA  B 2 13  ? 144.125 87.393  127.682 1.00 52.39  ? 13  DA  N P     1 
ATOM   568  O OP1   . DA  B 2 13  ? 145.508 87.910  127.739 1.00 70.13  ? 13  DA  N OP1   1 
ATOM   569  O OP2   . DA  B 2 13  ? 143.807 86.197  126.874 1.00 45.68  ? 13  DA  N OP2   1 
ATOM   570  O "O5'" . DA  B 2 13  ? 143.637 87.176  129.184 1.00 49.37  ? 13  DA  N "O5'" 1 
ATOM   571  C "C5'" . DA  B 2 13  ? 143.900 88.284  130.036 1.00 41.11  ? 13  DA  N "C5'" 1 
ATOM   572  C "C4'" . DA  B 2 13  ? 143.464 87.983  131.449 1.00 50.06  ? 13  DA  N "C4'" 1 
ATOM   573  O "O4'" . DA  B 2 13  ? 142.028 88.165  131.548 1.00 52.17  ? 13  DA  N "O4'" 1 
ATOM   574  C "C3'" . DA  B 2 13  ? 143.732 86.538  131.830 1.00 53.14  ? 13  DA  N "C3'" 1 
ATOM   575  O "O3'" . DA  B 2 13  ? 144.039 86.464  133.202 1.00 69.90  ? 13  DA  N "O3'" 1 
ATOM   576  C "C2'" . DA  B 2 13  ? 142.399 85.873  131.527 1.00 55.54  ? 13  DA  N "C2'" 1 
ATOM   577  C "C1'" . DA  B 2 13  ? 141.463 86.966  132.019 1.00 55.17  ? 13  DA  N "C1'" 1 
ATOM   578  N N9    . DA  B 2 13  ? 140.065 86.798  131.604 1.00 43.05  ? 13  DA  N N9    1 
ATOM   579  C C8    . DA  B 2 13  ? 139.528 86.198  130.494 1.00 40.91  ? 13  DA  N C8    1 
ATOM   580  N N7    . DA  B 2 13  ? 138.214 86.176  130.509 1.00 42.72  ? 13  DA  N N7    1 
ATOM   581  C C5    . DA  B 2 13  ? 137.883 86.778  131.717 1.00 37.78  ? 13  DA  N C5    1 
ATOM   582  C C6    . DA  B 2 13  ? 136.656 87.057  132.338 1.00 35.55  ? 13  DA  N C6    1 
ATOM   583  N N6    . DA  B 2 13  ? 135.466 86.752  131.797 1.00 37.62  ? 13  DA  N N6    1 
ATOM   584  N N1    . DA  B 2 13  ? 136.693 87.673  133.540 1.00 35.31  ? 13  DA  N N1    1 
ATOM   585  C C2    . DA  B 2 13  ? 137.870 87.970  134.096 1.00 37.42  ? 13  DA  N C2    1 
ATOM   586  N N3    . DA  B 2 13  ? 139.084 87.752  133.609 1.00 37.68  ? 13  DA  N N3    1 
ATOM   587  C C4    . DA  B 2 13  ? 139.014 87.151  132.411 1.00 37.50  ? 13  DA  N C4    1 
ATOM   588  P P     . DA  B 2 14  ? 144.946 85.286  133.795 1.00 62.41  ? 14  DA  N P     1 
ATOM   589  O OP1   . DA  B 2 14  ? 146.349 85.606  133.485 1.00 69.11  ? 14  DA  N OP1   1 
ATOM   590  O OP2   . DA  B 2 14  ? 144.386 83.968  133.408 1.00 58.48  ? 14  DA  N OP2   1 
ATOM   591  O "O5'" . DA  B 2 14  ? 144.704 85.502  135.356 1.00 48.62  ? 14  DA  N "O5'" 1 
ATOM   592  C "C5'" . DA  B 2 14  ? 144.027 86.652  135.810 1.00 51.76  ? 14  DA  N "C5'" 1 
ATOM   593  C "C4'" . DA  B 2 14  ? 143.043 86.216  136.868 1.00 64.77  ? 14  DA  N "C4'" 1 
ATOM   594  O "O4'" . DA  B 2 14  ? 141.699 86.161  136.308 1.00 60.97  ? 14  DA  N "O4'" 1 
ATOM   595  C "C3'" . DA  B 2 14  ? 143.310 84.803  137.375 1.00 70.81  ? 14  DA  N "C3'" 1 
ATOM   596  O "O3'" . DA  B 2 14  ? 142.676 84.670  138.637 1.00 83.35  ? 14  DA  N "O3'" 1 
ATOM   597  C "C2'" . DA  B 2 14  ? 142.552 84.016  136.322 1.00 58.71  ? 14  DA  N "C2'" 1 
ATOM   598  C "C1'" . DA  B 2 14  ? 141.262 84.823  136.395 1.00 55.54  ? 14  DA  N "C1'" 1 
ATOM   599  N N9    . DA  B 2 14  ? 140.338 84.501  135.322 1.00 39.74  ? 14  DA  N N9    1 
ATOM   600  C C8    . DA  B 2 14  ? 140.635 83.957  134.106 1.00 43.28  ? 14  DA  N C8    1 
ATOM   601  N N7    . DA  B 2 14  ? 139.589 83.721  133.356 1.00 42.75  ? 14  DA  N N7    1 
ATOM   602  C C5    . DA  B 2 14  ? 138.536 84.132  134.145 1.00 38.59  ? 14  DA  N C5    1 
ATOM   603  C C6    . DA  B 2 14  ? 137.158 84.137  133.904 1.00 33.41  ? 14  DA  N C6    1 
ATOM   604  N N6    . DA  B 2 14  ? 136.657 83.697  132.750 1.00 29.13  ? 14  DA  N N6    1 
ATOM   605  N N1    . DA  B 2 14  ? 136.353 84.596  134.889 1.00 34.15  ? 14  DA  N N1    1 
ATOM   606  C C2    . DA  B 2 14  ? 136.911 85.041  136.030 1.00 34.58  ? 14  DA  N C2    1 
ATOM   607  N N3    . DA  B 2 14  ? 138.208 85.069  136.370 1.00 35.86  ? 14  DA  N N3    1 
ATOM   608  C C4    . DA  B 2 14  ? 138.969 84.598  135.368 1.00 35.17  ? 14  DA  N C4    1 
ATOM   609  P P     . DG  B 2 15  ? 143.070 83.591  139.749 1.00 78.88  ? 15  DG  N P     1 
ATOM   610  O OP1   . DG  B 2 15  ? 143.840 84.316  140.783 1.00 58.74  ? 15  DG  N OP1   1 
ATOM   611  O OP2   . DG  B 2 15  ? 143.572 82.369  139.077 1.00 50.16  ? 15  DG  N OP2   1 
ATOM   612  O "O5'" . DG  B 2 15  ? 141.659 83.271  140.409 1.00 64.74  ? 15  DG  N "O5'" 1 
ATOM   613  C "C5'" . DG  B 2 15  ? 140.923 84.434  140.759 1.00 72.19  ? 15  DG  N "C5'" 1 
ATOM   614  C "C4'" . DG  B 2 15  ? 139.487 84.064  141.034 1.00 71.33  ? 15  DG  N "C4'" 1 
ATOM   615  O "O4'" . DG  B 2 15  ? 138.777 83.890  139.784 1.00 65.16  ? 15  DG  N "O4'" 1 
ATOM   616  C "C3'" . DG  B 2 15  ? 139.343 82.765  141.806 1.00 61.91  ? 15  DG  N "C3'" 1 
ATOM   617  O "O3'" . DG  B 2 15  ? 138.358 82.968  142.794 1.00 59.76  ? 15  DG  N "O3'" 1 
ATOM   618  C "C2'" . DG  B 2 15  ? 138.944 81.733  140.754 1.00 57.03  ? 15  DG  N "C2'" 1 
ATOM   619  C "C1'" . DG  B 2 15  ? 138.229 82.590  139.717 1.00 54.11  ? 15  DG  N "C1'" 1 
ATOM   620  N N9    . DG  B 2 15  ? 138.345 82.119  138.343 1.00 49.72  ? 15  DG  N N9    1 
ATOM   621  C C8    . DG  B 2 15  ? 139.438 81.911  137.533 1.00 47.52  ? 15  DG  N C8    1 
ATOM   622  N N7    . DG  B 2 15  ? 139.128 81.472  136.341 1.00 39.52  ? 15  DG  N N7    1 
ATOM   623  C C5    . DG  B 2 15  ? 137.736 81.430  136.363 1.00 39.45  ? 15  DG  N C5    1 
ATOM   624  C C6    . DG  B 2 15  ? 136.821 81.064  135.355 1.00 34.68  ? 15  DG  N C6    1 
ATOM   625  O O6    . DG  B 2 15  ? 137.060 80.694  134.195 1.00 35.45  ? 15  DG  N O6    1 
ATOM   626  N N1    . DG  B 2 15  ? 135.512 81.110  135.807 1.00 31.83  ? 15  DG  N N1    1 
ATOM   627  C C2    . DG  B 2 15  ? 135.111 81.539  137.048 1.00 39.62  ? 15  DG  N C2    1 
ATOM   628  N N2    . DG  B 2 15  ? 133.791 81.547  137.278 1.00 38.93  ? 15  DG  N N2    1 
ATOM   629  N N3    . DG  B 2 15  ? 135.952 81.905  138.002 1.00 47.52  ? 15  DG  N N3    1 
ATOM   630  C C4    . DG  B 2 15  ? 137.242 81.816  137.589 1.00 51.19  ? 15  DG  N C4    1 
ATOM   631  P P     . DT  B 2 16  ? 137.778 81.744  143.626 1.00 65.55  ? 16  DT  N P     1 
ATOM   632  O OP1   . DT  B 2 16  ? 137.327 82.349  144.899 1.00 58.65  ? 16  DT  N OP1   1 
ATOM   633  O OP2   . DT  B 2 16  ? 138.740 80.626  143.587 1.00 52.49  ? 16  DT  N OP2   1 
ATOM   634  O "O5'" . DT  B 2 16  ? 136.537 81.288  142.722 1.00 77.10  ? 16  DT  N "O5'" 1 
ATOM   635  C "C5'" . DT  B 2 16  ? 135.188 81.453  143.115 1.00 78.07  ? 16  DT  N "C5'" 1 
ATOM   636  C "C4'" . DT  B 2 16  ? 134.282 80.498  142.361 1.00 55.38  ? 16  DT  N "C4'" 1 
ATOM   637  O "O4'" . DT  B 2 16  ? 134.740 80.273  141.009 1.00 49.46  ? 16  DT  N "O4'" 1 
ATOM   638  C "C3'" . DT  B 2 16  ? 134.124 79.120  142.978 1.00 49.28  ? 16  DT  N "C3'" 1 
ATOM   639  O "O3'" . DT  B 2 16  ? 132.754 78.971  143.248 1.00 70.03  ? 16  DT  N "O3'" 1 
ATOM   640  C "C2'" . DT  B 2 16  ? 134.574 78.161  141.873 1.00 47.83  ? 16  DT  N "C2'" 1 
ATOM   641  C "C1'" . DT  B 2 16  ? 134.281 78.993  140.634 1.00 42.16  ? 16  DT  N "C1'" 1 
ATOM   642  N N1    . DT  B 2 16  ? 135.023 78.574  139.416 1.00 41.83  ? 16  DT  N N1    1 
ATOM   643  C C2    . DT  B 2 16  ? 134.304 78.120  138.329 1.00 46.61  ? 16  DT  N C2    1 
ATOM   644  O O2    . DT  B 2 16  ? 133.097 77.985  138.340 1.00 50.94  ? 16  DT  N O2    1 
ATOM   645  N N3    . DT  B 2 16  ? 135.053 77.809  137.225 1.00 45.15  ? 16  DT  N N3    1 
ATOM   646  C C4    . DT  B 2 16  ? 136.422 77.952  137.100 1.00 45.02  ? 16  DT  N C4    1 
ATOM   647  O O4    . DT  B 2 16  ? 136.987 77.674  136.046 1.00 45.04  ? 16  DT  N O4    1 
ATOM   648  C C5    . DT  B 2 16  ? 137.102 78.411  138.272 1.00 41.10  ? 16  DT  N C5    1 
ATOM   649  C C7    . DT  B 2 16  ? 138.582 78.580  138.199 1.00 41.77  ? 16  DT  N C7    1 
ATOM   650  C C6    . DT  B 2 16  ? 136.386 78.746  139.347 1.00 43.23  ? 16  DT  N C6    1 
ATOM   651  P P     . DT  B 2 17  ? 132.289 78.319  144.617 1.00 66.89  ? 17  DT  N P     1 
ATOM   652  O OP1   . DT  B 2 17  ? 131.108 79.059  145.114 1.00 80.98  ? 17  DT  N OP1   1 
ATOM   653  O OP2   . DT  B 2 17  ? 133.508 78.131  145.434 1.00 66.21  ? 17  DT  N OP2   1 
ATOM   654  O "O5'" . DT  B 2 17  ? 131.810 76.899  144.128 1.00 53.99  ? 17  DT  N "O5'" 1 
ATOM   655  C "C5'" . DT  B 2 17  ? 131.988 76.712  142.779 1.00 48.32  ? 17  DT  N "C5'" 1 
ATOM   656  C "C4'" . DT  B 2 17  ? 130.718 76.142  142.238 1.00 48.78  ? 17  DT  N "C4'" 1 
ATOM   657  O "O4'" . DT  B 2 17  ? 130.910 76.110  140.814 1.00 63.05  ? 17  DT  N "O4'" 1 
ATOM   658  C "C3'" . DT  B 2 17  ? 130.511 74.689  142.625 1.00 54.55  ? 17  DT  N "C3'" 1 
ATOM   659  O "O3'" . DT  B 2 17  ? 129.211 74.247  142.290 1.00 81.19  ? 17  DT  N "O3'" 1 
ATOM   660  C "C2'" . DT  B 2 17  ? 131.514 74.014  141.715 1.00 51.15  ? 17  DT  N "C2'" 1 
ATOM   661  C "C1'" . DT  B 2 17  ? 131.315 74.816  140.436 1.00 52.01  ? 17  DT  N "C1'" 1 
ATOM   662  N N1    . DT  B 2 17  ? 132.567 74.884  139.667 1.00 51.52  ? 17  DT  N N1    1 
ATOM   663  C C2    . DT  B 2 17  ? 132.465 74.673  138.317 1.00 54.08  ? 17  DT  N C2    1 
ATOM   664  O O2    . DT  B 2 17  ? 131.400 74.553  137.758 1.00 58.97  ? 17  DT  N O2    1 
ATOM   665  N N3    . DT  B 2 17  ? 133.658 74.656  137.652 1.00 49.56  ? 17  DT  N N3    1 
ATOM   666  C C4    . DT  B 2 17  ? 134.913 74.809  138.214 1.00 55.16  ? 17  DT  N C4    1 
ATOM   667  O O4    . DT  B 2 17  ? 135.895 74.760  137.489 1.00 54.80  ? 17  DT  N O4    1 
ATOM   668  C C5    . DT  B 2 17  ? 134.948 74.934  139.641 1.00 53.76  ? 17  DT  N C5    1 
ATOM   669  C C7    . DT  B 2 17  ? 136.269 75.111  140.335 1.00 49.95  ? 17  DT  N C7    1 
ATOM   670  C C6    . DT  B 2 17  ? 133.786 74.991  140.306 1.00 53.83  ? 17  DT  N C6    1 
ATOM   671  P P     . DA  B 2 18  ? 128.511 73.117  143.159 1.00 75.83  ? 18  DA  N P     1 
ATOM   672  O OP1   . DA  B 2 18  ? 127.550 73.821  144.032 1.00 67.30  ? 18  DA  N OP1   1 
ATOM   673  O OP2   . DA  B 2 18  ? 129.575 72.279  143.749 1.00 93.78  ? 18  DA  N OP2   1 
ATOM   674  O "O5'" . DA  B 2 18  ? 127.718 72.250  142.080 1.00 62.69  ? 18  DA  N "O5'" 1 
ATOM   675  C "C5'" . DA  B 2 18  ? 127.197 72.837  140.896 1.00 60.91  ? 18  DA  N "C5'" 1 
ATOM   676  C "C4'" . DA  B 2 18  ? 127.385 71.867  139.751 1.00 59.76  ? 18  DA  N "C4'" 1 
ATOM   677  O "O4'" . DA  B 2 18  ? 128.738 71.974  139.233 1.00 60.90  ? 18  DA  N "O4'" 1 
ATOM   678  C "C3'" . DA  B 2 18  ? 127.203 70.405  140.120 1.00 63.69  ? 18  DA  N "C3'" 1 
ATOM   679  O "O3'" . DA  B 2 18  ? 126.624 69.716  139.003 1.00 79.51  ? 18  DA  N "O3'" 1 
ATOM   680  C "C2'" . DA  B 2 18  ? 128.651 69.977  140.361 1.00 77.48  ? 18  DA  N "C2'" 1 
ATOM   681  C "C1'" . DA  B 2 18  ? 129.325 70.690  139.194 1.00 69.34  ? 18  DA  N "C1'" 1 
ATOM   682  N N9    . DA  B 2 18  ? 130.773 70.872  139.302 1.00 53.17  ? 18  DA  N N9    1 
ATOM   683  C C8    . DA  B 2 18  ? 131.531 71.144  140.405 1.00 50.30  ? 18  DA  N C8    1 
ATOM   684  N N7    . DA  B 2 18  ? 132.812 71.288  140.142 1.00 46.79  ? 18  DA  N N7    1 
ATOM   685  C C5    . DA  B 2 18  ? 132.889 71.104  138.775 1.00 41.44  ? 18  DA  N C5    1 
ATOM   686  C C6    . DA  B 2 18  ? 133.968 71.149  137.877 1.00 49.18  ? 18  DA  N C6    1 
ATOM   687  N N6    . DA  B 2 18  ? 135.219 71.390  138.280 1.00 53.42  ? 18  DA  N N6    1 
ATOM   688  N N1    . DA  B 2 18  ? 133.719 70.929  136.561 1.00 47.49  ? 18  DA  N N1    1 
ATOM   689  C C2    . DA  B 2 18  ? 132.461 70.705  136.178 1.00 44.86  ? 18  DA  N C2    1 
ATOM   690  N N3    . DA  B 2 18  ? 131.367 70.627  136.938 1.00 44.75  ? 18  DA  N N3    1 
ATOM   691  C C4    . DA  B 2 18  ? 131.651 70.844  138.237 1.00 43.51  ? 18  DA  N C4    1 
ATOM   692  P P     . DT  B 2 19  ? 126.061 68.214  139.099 1.00 81.64  ? 19  DT  N P     1 
ATOM   693  O OP1   . DT  B 2 19  ? 125.093 68.027  137.991 1.00 100.00 ? 19  DT  N OP1   1 
ATOM   694  O OP2   . DT  B 2 19  ? 125.634 67.976  140.493 1.00 73.10  ? 19  DT  N OP2   1 
ATOM   695  O "O5'" . DT  B 2 19  ? 127.338 67.304  138.769 1.00 95.04  ? 19  DT  N "O5'" 1 
ATOM   696  C "C5'" . DT  B 2 19  ? 127.336 66.549  137.555 1.00 60.27  ? 19  DT  N "C5'" 1 
ATOM   697  C "C4'" . DT  B 2 19  ? 128.235 67.205  136.526 1.00 45.69  ? 19  DT  N "C4'" 1 
ATOM   698  O "O4'" . DT  B 2 19  ? 129.363 67.769  137.230 1.00 63.51  ? 19  DT  N "O4'" 1 
ATOM   699  C "C3'" . DT  B 2 19  ? 128.808 66.279  135.450 1.00 60.88  ? 19  DT  N "C3'" 1 
ATOM   700  O "O3'" . DT  B 2 19  ? 128.485 66.780  134.174 1.00 47.90  ? 19  DT  N "O3'" 1 
ATOM   701  C "C2'" . DT  B 2 19  ? 130.324 66.279  135.687 1.00 49.23  ? 19  DT  N "C2'" 1 
ATOM   702  C "C1'" . DT  B 2 19  ? 130.508 67.598  136.429 1.00 66.61  ? 19  DT  N "C1'" 1 
ATOM   703  N N1    . DT  B 2 19  ? 131.667 67.709  137.337 1.00 65.33  ? 19  DT  N N1    1 
ATOM   704  C C2    . DT  B 2 19  ? 132.905 67.847  136.754 1.00 67.04  ? 19  DT  N C2    1 
ATOM   705  O O2    . DT  B 2 19  ? 133.074 67.835  135.547 1.00 67.30  ? 19  DT  N O2    1 
ATOM   706  N N3    . DT  B 2 19  ? 133.917 68.073  137.646 1.00 72.29  ? 19  DT  N N3    1 
ATOM   707  C C4    . DT  B 2 19  ? 133.844 68.173  139.026 1.00 73.18  ? 19  DT  N C4    1 
ATOM   708  O O4    . DT  B 2 19  ? 134.860 68.349  139.688 1.00 72.63  ? 19  DT  N O4    1 
ATOM   709  C C5    . DT  B 2 19  ? 132.510 68.007  139.554 1.00 65.20  ? 19  DT  N C5    1 
ATOM   710  C C7    . DT  B 2 19  ? 132.322 68.126  141.042 1.00 64.68  ? 19  DT  N C7    1 
ATOM   711  C C6    . DT  B 2 19  ? 131.501 67.803  138.701 1.00 60.01  ? 19  DT  N C6    1 
ATOM   712  N N     . SER C 3 1   ? 144.956 100.877 144.119 1.00 100.00 ? 20  SER A N     1 
ATOM   713  C CA    . SER C 3 1   ? 145.752 101.440 145.212 1.00 99.40  ? 20  SER A CA    1 
ATOM   714  C C     . SER C 3 1   ? 144.857 101.684 146.415 1.00 100.00 ? 20  SER A C     1 
ATOM   715  O O     . SER C 3 1   ? 143.818 102.317 146.292 1.00 99.88  ? 20  SER A O     1 
ATOM   716  C CB    . SER C 3 1   ? 146.447 102.738 144.767 1.00 99.48  ? 20  SER A CB    1 
ATOM   717  O OG    . SER C 3 1   ? 145.872 103.887 145.384 1.00 100.00 ? 20  SER A OG    1 
ATOM   718  N N     . ASP C 3 2   ? 145.258 101.174 147.572 1.00 99.91  ? 21  ASP A N     1 
ATOM   719  C CA    . ASP C 3 2   ? 144.474 101.359 148.777 1.00 98.85  ? 21  ASP A CA    1 
ATOM   720  C C     . ASP C 3 2   ? 144.408 102.831 149.187 1.00 100.00 ? 21  ASP A C     1 
ATOM   721  O O     . ASP C 3 2   ? 143.320 103.363 149.416 1.00 99.54  ? 21  ASP A O     1 
ATOM   722  C CB    . ASP C 3 2   ? 144.970 100.451 149.904 1.00 99.41  ? 21  ASP A CB    1 
ATOM   723  C CG    . ASP C 3 2   ? 144.834 98.966  149.553 1.00 100.00 ? 21  ASP A CG    1 
ATOM   724  O OD1   . ASP C 3 2   ? 143.851 98.612  148.843 1.00 100.00 ? 21  ASP A OD1   1 
ATOM   725  O OD2   . ASP C 3 2   ? 145.686 98.159  150.008 1.00 100.00 ? 21  ASP A OD2   1 
ATOM   726  N N     . GLU C 3 3   ? 145.552 103.513 149.239 1.00 100.00 ? 22  GLU A N     1 
ATOM   727  C CA    . GLU C 3 3   ? 145.529 104.931 149.605 1.00 99.52  ? 22  GLU A CA    1 
ATOM   728  C C     . GLU C 3 3   ? 144.322 105.534 148.910 1.00 100.00 ? 22  GLU A C     1 
ATOM   729  O O     . GLU C 3 3   ? 143.573 106.327 149.488 1.00 100.00 ? 22  GLU A O     1 
ATOM   730  C CB    . GLU C 3 3   ? 146.793 105.639 149.136 1.00 100.00 ? 22  GLU A CB    1 
ATOM   731  C CG    . GLU C 3 3   ? 147.891 105.658 150.165 1.00 100.00 ? 22  GLU A CG    1 
ATOM   732  C CD    . GLU C 3 3   ? 149.043 104.759 149.782 1.00 100.00 ? 22  GLU A CD    1 
ATOM   733  O OE1   . GLU C 3 3   ? 148.786 103.555 149.549 1.00 98.72  ? 22  GLU A OE1   1 
ATOM   734  O OE2   . GLU C 3 3   ? 150.190 105.262 149.692 1.00 100.00 ? 22  GLU A OE2   1 
ATOM   735  N N     . VAL C 3 4   ? 144.139 105.148 147.655 1.00 95.76  ? 23  VAL A N     1 
ATOM   736  C CA    . VAL C 3 4   ? 142.990 105.607 146.913 1.00 92.56  ? 23  VAL A CA    1 
ATOM   737  C C     . VAL C 3 4   ? 141.826 104.672 147.252 1.00 93.17  ? 23  VAL A C     1 
ATOM   738  O O     . VAL C 3 4   ? 140.720 105.122 147.510 1.00 90.26  ? 23  VAL A O     1 
ATOM   739  C CB    . VAL C 3 4   ? 143.283 105.658 145.389 1.00 95.34  ? 23  VAL A CB    1 
ATOM   740  C CG1   . VAL C 3 4   ? 142.773 104.403 144.675 1.00 95.07  ? 23  VAL A CG1   1 
ATOM   741  C CG2   . VAL C 3 4   ? 142.706 106.932 144.778 1.00 95.22  ? 23  VAL A CG2   1 
ATOM   742  N N     . ARG C 3 5   ? 142.106 103.373 147.326 1.00 95.15  ? 24  ARG A N     1 
ATOM   743  C CA    . ARG C 3 5   ? 141.085 102.361 147.636 1.00 97.78  ? 24  ARG A CA    1 
ATOM   744  C C     . ARG C 3 5   ? 140.710 102.413 149.098 1.00 100.00 ? 24  ARG A C     1 
ATOM   745  O O     . ARG C 3 5   ? 139.623 102.889 149.462 1.00 97.86  ? 24  ARG A O     1 
ATOM   746  C CB    . ARG C 3 5   ? 141.626 100.958 147.322 1.00 100.00 ? 24  ARG A CB    1 
ATOM   747  C CG    . ARG C 3 5   ? 140.818 99.819  147.944 1.00 100.00 ? 24  ARG A CG    1 
ATOM   748  C CD    . ARG C 3 5   ? 141.054 98.521  147.184 1.00 100.00 ? 24  ARG A CD    1 
ATOM   749  N NE    . ARG C 3 5   ? 141.927 98.735  146.022 1.00 100.00 ? 24  ARG A NE    1 
ATOM   750  C CZ    . ARG C 3 5   ? 142.305 97.779  145.171 1.00 100.00 ? 24  ARG A CZ    1 
ATOM   751  N NH1   . ARG C 3 5   ? 141.892 96.517  145.324 1.00 100.00 ? 24  ARG A NH1   1 
ATOM   752  N NH2   . ARG C 3 5   ? 143.102 98.081  144.162 1.00 95.57  ? 24  ARG A NH2   1 
ATOM   753  N N     . LYS C 3 6   ? 141.640 101.916 149.922 1.00 99.55  ? 25  LYS A N     1 
ATOM   754  C CA    . LYS C 3 6   ? 141.507 101.883 151.369 1.00 97.95  ? 25  LYS A CA    1 
ATOM   755  C C     . LYS C 3 6   ? 140.783 103.158 151.803 1.00 100.00 ? 25  LYS A C     1 
ATOM   756  O O     . LYS C 3 6   ? 139.931 103.142 152.714 1.00 100.00 ? 25  LYS A O     1 
ATOM   757  C CB    . LYS C 3 6   ? 142.894 101.769 152.022 1.00 100.00 ? 25  LYS A CB    1 
ATOM   758  C CG    . LYS C 3 6   ? 143.140 100.436 152.748 1.00 100.00 ? 25  LYS A CG    1 
ATOM   759  C CD    . LYS C 3 6   ? 142.613 99.230  151.943 1.00 100.00 ? 25  LYS A CD    1 
ATOM   760  C CE    . LYS C 3 6   ? 143.297 97.928  152.396 1.00 100.00 ? 25  LYS A CE    1 
ATOM   761  N NZ    . LYS C 3 6   ? 142.417 96.721  152.317 1.00 100.00 ? 25  LYS A NZ    1 
ATOM   762  N N     . ASN C 3 7   ? 141.092 104.249 151.112 1.00 98.56  ? 26  ASN A N     1 
ATOM   763  C CA    . ASN C 3 7   ? 140.420 105.499 151.371 1.00 98.22  ? 26  ASN A CA    1 
ATOM   764  C C     . ASN C 3 7   ? 139.104 105.551 150.622 1.00 100.00 ? 26  ASN A C     1 
ATOM   765  O O     . ASN C 3 7   ? 138.096 105.990 151.182 1.00 100.00 ? 26  ASN A O     1 
ATOM   766  C CB    . ASN C 3 7   ? 141.265 106.693 150.992 1.00 100.00 ? 26  ASN A CB    1 
ATOM   767  C CG    . ASN C 3 7   ? 140.745 107.957 151.596 1.00 100.00 ? 26  ASN A CG    1 
ATOM   768  O OD1   . ASN C 3 7   ? 141.239 109.063 151.304 1.00 100.00 ? 26  ASN A OD1   1 
ATOM   769  N ND2   . ASN C 3 7   ? 139.754 107.817 152.483 1.00 95.85  ? 26  ASN A ND2   1 
ATOM   770  N N     . LEU C 3 8   ? 139.090 105.123 149.361 1.00 95.45  ? 27  LEU A N     1 
ATOM   771  C CA    . LEU C 3 8   ? 137.824 105.149 148.641 1.00 92.58  ? 27  LEU A CA    1 
ATOM   772  C C     . LEU C 3 8   ? 136.876 104.104 149.216 1.00 99.82  ? 27  LEU A C     1 
ATOM   773  O O     . LEU C 3 8   ? 135.730 103.976 148.790 1.00 100.00 ? 27  LEU A O     1 
ATOM   774  C CB    . LEU C 3 8   ? 137.960 105.128 147.107 1.00 89.45  ? 27  LEU A CB    1 
ATOM   775  C CG    . LEU C 3 8   ? 137.751 106.493 146.414 1.00 83.71  ? 27  LEU A CG    1 
ATOM   776  C CD1   . LEU C 3 8   ? 138.139 107.645 147.333 1.00 79.62  ? 27  LEU A CD1   1 
ATOM   777  C CD2   . LEU C 3 8   ? 138.514 106.565 145.109 1.00 76.89  ? 27  LEU A CD2   1 
ATOM   778  N N     . MET C 3 9   ? 137.350 103.403 150.241 1.00 96.50  ? 28  MET A N     1 
ATOM   779  C CA    . MET C 3 9   ? 136.492 102.501 150.964 1.00 96.08  ? 28  MET A CA    1 
ATOM   780  C C     . MET C 3 9   ? 135.747 103.555 151.762 1.00 98.27  ? 28  MET A C     1 
ATOM   781  O O     . MET C 3 9   ? 134.542 103.489 151.933 1.00 100.00 ? 28  MET A O     1 
ATOM   782  C CB    . MET C 3 9   ? 137.293 101.596 151.928 1.00 97.70  ? 28  MET A CB    1 
ATOM   783  C CG    . MET C 3 9   ? 138.643 101.063 151.403 1.00 98.52  ? 28  MET A CG    1 
ATOM   784  S SD    . MET C 3 9   ? 138.677 99.466  150.445 1.00 100.00 ? 28  MET A SD    1 
ATOM   785  C CE    . MET C 3 9   ? 136.977 98.691  150.881 1.00 95.41  ? 28  MET A CE    1 
ATOM   786  N N     . ASP C 3 10  ? 136.497 104.564 152.193 1.00 93.48  ? 29  ASP A N     1 
ATOM   787  C CA    . ASP C 3 10  ? 135.962 105.664 152.986 1.00 93.69  ? 29  ASP A CA    1 
ATOM   788  C C     . ASP C 3 10  ? 135.652 106.977 152.255 1.00 100.00 ? 29  ASP A C     1 
ATOM   789  O O     . ASP C 3 10  ? 136.542 107.598 151.650 1.00 100.00 ? 29  ASP A O     1 
ATOM   790  C CB    . ASP C 3 10  ? 136.902 105.922 154.156 1.00 95.05  ? 29  ASP A CB    1 
ATOM   791  C CG    . ASP C 3 10  ? 137.641 104.668 154.576 1.00 100.00 ? 29  ASP A CG    1 
ATOM   792  O OD1   . ASP C 3 10  ? 136.992 103.792 155.204 1.00 100.00 ? 29  ASP A OD1   1 
ATOM   793  O OD2   . ASP C 3 10  ? 138.841 104.536 154.220 1.00 100.00 ? 29  ASP A OD2   1 
ATOM   794  N N     . MET C 3 11  ? 134.374 107.378 152.361 1.00 100.00 ? 30  MET A N     1 
ATOM   795  C CA    . MET C 3 11  ? 133.784 108.635 151.835 1.00 99.84  ? 30  MET A CA    1 
ATOM   796  C C     . MET C 3 11  ? 132.483 108.618 151.010 1.00 100.00 ? 30  MET A C     1 
ATOM   797  O O     . MET C 3 11  ? 131.818 107.586 150.871 1.00 99.61  ? 30  MET A O     1 
ATOM   798  C CB    . MET C 3 11  ? 134.796 109.665 151.299 1.00 100.00 ? 30  MET A CB    1 
ATOM   799  C CG    . MET C 3 11  ? 135.061 110.849 152.259 1.00 100.00 ? 30  MET A CG    1 
ATOM   800  S SD    . MET C 3 11  ? 134.161 112.359 151.810 1.00 100.00 ? 30  MET A SD    1 
ATOM   801  C CE    . MET C 3 11  ? 134.745 113.471 153.106 1.00 97.51  ? 30  MET A CE    1 
ATOM   802  N N     . PHE C 3 12  ? 132.142 109.794 150.486 1.00 97.55  ? 31  PHE A N     1 
ATOM   803  C CA    . PHE C 3 12  ? 130.950 109.984 149.674 1.00 94.23  ? 31  PHE A CA    1 
ATOM   804  C C     . PHE C 3 12  ? 129.721 109.548 150.479 1.00 100.00 ? 31  PHE A C     1 
ATOM   805  O O     . PHE C 3 12  ? 129.072 108.535 150.182 1.00 100.00 ? 31  PHE A O     1 
ATOM   806  C CB    . PHE C 3 12  ? 131.113 109.294 148.314 1.00 92.61  ? 31  PHE A CB    1 
ATOM   807  C CG    . PHE C 3 12  ? 132.018 110.055 147.367 1.00 90.54  ? 31  PHE A CG    1 
ATOM   808  C CD1   . PHE C 3 12  ? 133.224 109.527 146.931 1.00 91.29  ? 31  PHE A CD1   1 
ATOM   809  C CD2   . PHE C 3 12  ? 131.658 111.322 146.931 1.00 88.50  ? 31  PHE A CD2   1 
ATOM   810  C CE1   . PHE C 3 12  ? 134.054 110.257 146.075 1.00 89.97  ? 31  PHE A CE1   1 
ATOM   811  C CE2   . PHE C 3 12  ? 132.477 112.046 146.081 1.00 89.00  ? 31  PHE A CE2   1 
ATOM   812  C CZ    . PHE C 3 12  ? 133.672 111.513 145.651 1.00 86.64  ? 31  PHE A CZ    1 
ATOM   813  N N     . ARG C 3 13  ? 129.456 110.335 151.529 1.00 99.82  ? 32  ARG A N     1 
ATOM   814  C CA    . ARG C 3 13  ? 128.401 110.116 152.531 1.00 99.92  ? 32  ARG A CA    1 
ATOM   815  C C     . ARG C 3 13  ? 127.084 109.427 152.198 1.00 100.00 ? 32  ARG A C     1 
ATOM   816  O O     . ARG C 3 13  ? 126.405 108.917 153.088 1.00 99.67  ? 32  ARG A O     1 
ATOM   817  C CB    . ARG C 3 13  ? 128.199 111.328 153.454 1.00 99.96  ? 32  ARG A CB    1 
ATOM   818  C CG    . ARG C 3 13  ? 127.829 110.974 154.918 1.00 100.00 ? 32  ARG A CG    1 
ATOM   819  C CD    . ARG C 3 13  ? 128.806 109.976 155.588 1.00 100.00 ? 32  ARG A CD    1 
ATOM   820  N NE    . ARG C 3 13  ? 128.432 108.591 155.313 1.00 100.00 ? 32  ARG A NE    1 
ATOM   821  C CZ    . ARG C 3 13  ? 129.044 107.802 154.426 1.00 100.00 ? 32  ARG A CZ    1 
ATOM   822  N NH1   . ARG C 3 13  ? 130.089 108.239 153.734 1.00 100.00 ? 32  ARG A NH1   1 
ATOM   823  N NH2   . ARG C 3 13  ? 128.608 106.568 154.224 1.00 90.80  ? 32  ARG A NH2   1 
ATOM   824  N N     . ASP C 3 14  ? 126.705 109.413 150.935 1.00 99.75  ? 33  ASP A N     1 
ATOM   825  C CA    . ASP C 3 14  ? 125.461 108.758 150.584 1.00 99.68  ? 33  ASP A CA    1 
ATOM   826  C C     . ASP C 3 14  ? 125.544 107.930 149.315 1.00 100.00 ? 33  ASP A C     1 
ATOM   827  O O     . ASP C 3 14  ? 125.167 108.378 148.234 1.00 99.92  ? 33  ASP A O     1 
ATOM   828  C CB    . ASP C 3 14  ? 124.269 109.717 150.601 1.00 100.00 ? 33  ASP A CB    1 
ATOM   829  C CG    . ASP C 3 14  ? 123.388 109.521 151.836 1.00 100.00 ? 33  ASP A CG    1 
ATOM   830  O OD1   . ASP C 3 14  ? 123.877 108.910 152.814 1.00 100.00 ? 33  ASP A OD1   1 
ATOM   831  O OD2   . ASP C 3 14  ? 122.208 109.940 151.820 1.00 100.00 ? 33  ASP A OD2   1 
ATOM   832  N N     . ARG C 3 15  ? 126.053 106.706 149.470 1.00 97.09  ? 34  ARG A N     1 
ATOM   833  C CA    . ARG C 3 15  ? 126.214 105.747 148.372 1.00 95.01  ? 34  ARG A CA    1 
ATOM   834  C C     . ARG C 3 15  ? 125.236 105.951 147.222 1.00 98.63  ? 34  ARG A C     1 
ATOM   835  O O     . ARG C 3 15  ? 125.641 106.356 146.124 1.00 98.46  ? 34  ARG A O     1 
ATOM   836  C CB    . ARG C 3 15  ? 126.114 104.306 148.887 1.00 91.13  ? 34  ARG A CB    1 
ATOM   837  C CG    . ARG C 3 15  ? 127.438 103.577 148.915 1.00 92.01  ? 34  ARG A CG    1 
ATOM   838  C CD    . ARG C 3 15  ? 127.289 102.183 148.374 1.00 93.92  ? 34  ARG A CD    1 
ATOM   839  N NE    . ARG C 3 15  ? 127.599 101.178 149.383 1.00 100.00 ? 34  ARG A NE    1 
ATOM   840  C CZ    . ARG C 3 15  ? 126.693 100.625 150.187 1.00 100.00 ? 34  ARG A CZ    1 
ATOM   841  N NH1   . ARG C 3 15  ? 125.413 100.984 150.102 1.00 100.00 ? 34  ARG A NH1   1 
ATOM   842  N NH2   . ARG C 3 15  ? 127.064 99.715  151.084 1.00 100.00 ? 34  ARG A NH2   1 
ATOM   843  N N     . GLN C 3 16  ? 123.954 105.680 147.476 1.00 95.07  ? 35  GLN A N     1 
ATOM   844  C CA    . GLN C 3 16  ? 122.917 105.805 146.456 1.00 92.97  ? 35  GLN A CA    1 
ATOM   845  C C     . GLN C 3 16  ? 122.887 107.136 145.685 1.00 91.06  ? 35  GLN A C     1 
ATOM   846  O O     . GLN C 3 16  ? 121.937 107.423 144.954 1.00 91.99  ? 35  GLN A O     1 
ATOM   847  C CB    . GLN C 3 16  ? 121.538 105.406 146.997 1.00 93.99  ? 35  GLN A CB    1 
ATOM   848  C CG    . GLN C 3 16  ? 121.080 104.019 146.526 1.00 100.00 ? 35  GLN A CG    1 
ATOM   849  C CD    . GLN C 3 16  ? 121.034 103.902 145.008 1.00 100.00 ? 35  GLN A CD    1 
ATOM   850  O OE1   . GLN C 3 16  ? 120.540 104.815 144.314 1.00 100.00 ? 35  GLN A OE1   1 
ATOM   851  N NE2   . GLN C 3 16  ? 121.530 102.772 144.479 1.00 97.46  ? 35  GLN A NE2   1 
ATOM   852  N N     . ALA C 3 17  ? 123.959 107.916 145.829 1.00 80.50  ? 36  ALA A N     1 
ATOM   853  C CA    . ALA C 3 17  ? 124.140 109.172 145.131 1.00 76.96  ? 36  ALA A CA    1 
ATOM   854  C C     . ALA C 3 17  ? 124.668 108.880 143.724 1.00 78.37  ? 36  ALA A C     1 
ATOM   855  O O     . ALA C 3 17  ? 124.394 109.627 142.799 1.00 82.02  ? 36  ALA A O     1 
ATOM   856  C CB    . ALA C 3 17  ? 125.108 110.047 145.871 1.00 78.13  ? 36  ALA A CB    1 
ATOM   857  N N     . PHE C 3 18  ? 125.443 107.810 143.567 1.00 71.21  ? 37  PHE A N     1 
ATOM   858  C CA    . PHE C 3 18  ? 125.959 107.430 142.249 1.00 68.66  ? 37  PHE A CA    1 
ATOM   859  C C     . PHE C 3 18  ? 125.725 105.967 141.986 1.00 62.59  ? 37  PHE A C     1 
ATOM   860  O O     . PHE C 3 18  ? 125.695 105.144 142.905 1.00 63.11  ? 37  PHE A O     1 
ATOM   861  C CB    . PHE C 3 18  ? 127.453 107.757 142.083 1.00 71.94  ? 37  PHE A CB    1 
ATOM   862  C CG    . PHE C 3 18  ? 127.729 109.212 141.903 1.00 77.22  ? 37  PHE A CG    1 
ATOM   863  C CD1   . PHE C 3 18  ? 128.315 109.946 142.920 1.00 83.95  ? 37  PHE A CD1   1 
ATOM   864  C CD2   . PHE C 3 18  ? 127.379 109.861 140.721 1.00 82.22  ? 37  PHE A CD2   1 
ATOM   865  C CE1   . PHE C 3 18  ? 128.537 111.308 142.776 1.00 86.75  ? 37  PHE A CE1   1 
ATOM   866  C CE2   . PHE C 3 18  ? 127.611 111.221 140.554 1.00 85.72  ? 37  PHE A CE2   1 
ATOM   867  C CZ    . PHE C 3 18  ? 128.196 111.946 141.575 1.00 85.31  ? 37  PHE A CZ    1 
ATOM   868  N N     . SER C 3 19  ? 125.601 105.630 140.714 1.00 55.77  ? 38  SER A N     1 
ATOM   869  C CA    . SER C 3 19  ? 125.383 104.249 140.322 1.00 52.89  ? 38  SER A CA    1 
ATOM   870  C C     . SER C 3 19  ? 126.622 103.431 140.713 1.00 54.52  ? 38  SER A C     1 
ATOM   871  O O     . SER C 3 19  ? 127.733 103.967 140.819 1.00 54.34  ? 38  SER A O     1 
ATOM   872  C CB    . SER C 3 19  ? 125.106 104.186 138.817 1.00 47.43  ? 38  SER A CB    1 
ATOM   873  O OG    . SER C 3 19  ? 125.721 103.061 138.249 1.00 57.11  ? 38  SER A OG    1 
ATOM   874  N N     . GLU C 3 20  ? 126.434 102.146 140.966 1.00 50.75  ? 39  GLU A N     1 
ATOM   875  C CA    . GLU C 3 20  ? 127.562 101.282 141.301 1.00 52.45  ? 39  GLU A CA    1 
ATOM   876  C C     . GLU C 3 20  ? 128.571 101.268 140.127 1.00 54.42  ? 39  GLU A C     1 
ATOM   877  O O     . GLU C 3 20  ? 129.782 101.357 140.317 1.00 47.90  ? 39  GLU A O     1 
ATOM   878  C CB    . GLU C 3 20  ? 127.075 99.869  141.595 1.00 55.29  ? 39  GLU A CB    1 
ATOM   879  C CG    . GLU C 3 20  ? 128.095 99.034  142.323 1.00 65.13  ? 39  GLU A CG    1 
ATOM   880  C CD    . GLU C 3 20  ? 128.229 99.451  143.741 1.00 80.06  ? 39  GLU A CD    1 
ATOM   881  O OE1   . GLU C 3 20  ? 127.678 100.513 144.081 1.00 89.43  ? 39  GLU A OE1   1 
ATOM   882  O OE2   . GLU C 3 20  ? 128.848 98.707  144.521 1.00 96.47  ? 39  GLU A OE2   1 
ATOM   883  N N     . HIS C 3 21  ? 128.070 101.154 138.905 1.00 53.82  ? 40  HIS A N     1 
ATOM   884  C CA    . HIS C 3 21  ? 128.972 101.186 137.773 1.00 53.16  ? 40  HIS A CA    1 
ATOM   885  C C     . HIS C 3 21  ? 129.743 102.508 137.864 1.00 63.20  ? 40  HIS A C     1 
ATOM   886  O O     . HIS C 3 21  ? 130.966 102.534 137.717 1.00 67.41  ? 40  HIS A O     1 
ATOM   887  C CB    . HIS C 3 21  ? 128.222 101.078 136.438 1.00 49.56  ? 40  HIS A CB    1 
ATOM   888  C CG    . HIS C 3 21  ? 127.940 99.668  136.026 1.00 49.70  ? 40  HIS A CG    1 
ATOM   889  N ND1   . HIS C 3 21  ? 126.682 99.246  135.639 1.00 49.99  ? 40  HIS A ND1   1 
ATOM   890  C CD2   . HIS C 3 21  ? 128.739 98.577  135.971 1.00 51.38  ? 40  HIS A CD2   1 
ATOM   891  C CE1   . HIS C 3 21  ? 126.725 97.960  135.341 1.00 49.74  ? 40  HIS A CE1   1 
ATOM   892  N NE2   . HIS C 3 21  ? 127.960 97.527  135.538 1.00 51.28  ? 40  HIS A NE2   1 
ATOM   893  N N     . THR C 3 22  ? 129.043 103.601 138.150 1.00 52.77  ? 41  THR A N     1 
ATOM   894  C CA    . THR C 3 22  ? 129.735 104.877 138.255 1.00 50.99  ? 41  THR A CA    1 
ATOM   895  C C     . THR C 3 22  ? 130.860 104.807 139.312 1.00 55.70  ? 41  THR A C     1 
ATOM   896  O O     . THR C 3 22  ? 131.971 105.274 139.070 1.00 54.52  ? 41  THR A O     1 
ATOM   897  C CB    . THR C 3 22  ? 128.777 106.076 138.522 1.00 58.51  ? 41  THR A CB    1 
ATOM   898  O OG1   . THR C 3 22  ? 127.701 106.064 137.571 1.00 49.04  ? 41  THR A OG1   1 
ATOM   899  C CG2   . THR C 3 22  ? 129.532 107.437 138.411 1.00 56.63  ? 41  THR A CG2   1 
ATOM   900  N N     . TRP C 3 23  ? 130.580 104.225 140.473 1.00 47.54  ? 42  TRP A N     1 
ATOM   901  C CA    . TRP C 3 23  ? 131.604 104.159 141.502 1.00 45.39  ? 42  TRP A CA    1 
ATOM   902  C C     . TRP C 3 23  ? 132.813 103.394 141.038 1.00 49.50  ? 42  TRP A C     1 
ATOM   903  O O     . TRP C 3 23  ? 133.934 103.724 141.374 1.00 55.02  ? 42  TRP A O     1 
ATOM   904  C CB    A TRP C 3 23  ? 131.088 103.822 142.929 0.50 45.63  ? 42  TRP A CB    1 
ATOM   905  C CB    B TRP C 3 23  ? 131.053 103.338 142.680 0.50 43.40  ? 42  TRP A CB    1 
ATOM   906  C CG    A TRP C 3 23  ? 130.252 104.964 143.658 0.50 47.03  ? 42  TRP A CG    1 
ATOM   907  C CG    B TRP C 3 23  ? 132.012 103.143 143.808 0.50 43.02  ? 42  TRP A CG    1 
ATOM   908  C CD1   A TRP C 3 23  ? 128.982 104.854 144.156 0.50 50.21  ? 42  TRP A CD1   1 
ATOM   909  C CD1   B TRP C 3 23  ? 132.625 101.981 144.188 0.50 45.70  ? 42  TRP A CD1   1 
ATOM   910  C CD2   A TRP C 3 23  ? 130.683 106.305 143.977 0.50 48.21  ? 42  TRP A CD2   1 
ATOM   911  C CD2   B TRP C 3 23  ? 132.440 104.148 144.731 0.50 43.23  ? 42  TRP A CD2   1 
ATOM   912  N NE1   A TRP C 3 23  ? 128.591 106.036 144.741 0.50 51.09  ? 42  TRP A NE1   1 
ATOM   913  N NE1   B TRP C 3 23  ? 133.437 102.215 145.283 0.50 45.49  ? 42  TRP A NE1   1 
ATOM   914  C CE2   A TRP C 3 23  ? 129.616 106.941 144.648 0.50 53.96  ? 42  TRP A CE2   1 
ATOM   915  C CE2   B TRP C 3 23  ? 133.338 103.540 145.633 0.50 46.23  ? 42  TRP A CE2   1 
ATOM   916  C CE3   A TRP C 3 23  ? 131.867 107.012 143.784 0.50 51.11  ? 42  TRP A CE3   1 
ATOM   917  C CE3   B TRP C 3 23  ? 132.165 105.513 144.868 0.50 45.25  ? 42  TRP A CE3   1 
ATOM   918  C CZ2   A TRP C 3 23  ? 129.695 108.263 145.093 0.50 55.08  ? 42  TRP A CZ2   1 
ATOM   919  C CZ2   B TRP C 3 23  ? 133.944 104.245 146.665 0.50 44.92  ? 42  TRP A CZ2   1 
ATOM   920  C CZ3   A TRP C 3 23  ? 131.941 108.318 144.228 0.50 53.90  ? 42  TRP A CZ3   1 
ATOM   921  C CZ3   B TRP C 3 23  ? 132.755 106.210 145.899 0.50 46.77  ? 42  TRP A CZ3   1 
ATOM   922  C CH2   A TRP C 3 23  ? 130.861 108.935 144.858 0.50 54.99  ? 42  TRP A CH2   1 
ATOM   923  C CH2   B TRP C 3 23  ? 133.645 105.574 146.784 0.50 47.17  ? 42  TRP A CH2   1 
ATOM   924  N N     . LYS C 3 24  ? 132.581 102.356 140.254 1.00 48.06  ? 43  LYS A N     1 
ATOM   925  C CA    . LYS C 3 24  ? 133.664 101.501 139.747 1.00 45.10  ? 43  LYS A CA    1 
ATOM   926  C C     . LYS C 3 24  ? 134.635 102.290 138.872 1.00 44.23  ? 43  LYS A C     1 
ATOM   927  O O     . LYS C 3 24  ? 135.841 102.156 138.984 1.00 41.58  ? 43  LYS A O     1 
ATOM   928  C CB    . LYS C 3 24  ? 133.075 100.342 138.939 1.00 46.40  ? 43  LYS A CB    1 
ATOM   929  C CG    . LYS C 3 24  ? 134.055 99.243  138.625 1.00 69.61  ? 43  LYS A CG    1 
ATOM   930  C CD    . LYS C 3 24  ? 133.400 98.107  137.892 1.00 70.40  ? 43  LYS A CD    1 
ATOM   931  C CE    . LYS C 3 24  ? 133.852 96.776  138.446 1.00 72.96  ? 43  LYS A CE    1 
ATOM   932  N NZ    . LYS C 3 24  ? 133.884 95.742  137.376 1.00 68.04  ? 43  LYS A NZ    1 
ATOM   933  N N     . MET C 3 25  ? 134.082 103.114 137.996 1.00 40.40  ? 44  MET A N     1 
ATOM   934  C CA    . MET C 3 25  ? 134.892 103.910 137.112 1.00 40.89  ? 44  MET A CA    1 
ATOM   935  C C     . MET C 3 25  ? 135.669 104.971 137.875 1.00 47.37  ? 44  MET A C     1 
ATOM   936  O O     . MET C 3 25  ? 136.834 105.207 137.584 1.00 47.33  ? 44  MET A O     1 
ATOM   937  C CB    . MET C 3 25  ? 134.064 104.497 135.953 1.00 41.90  ? 44  MET A CB    1 
ATOM   938  C CG    . MET C 3 25  ? 133.678 103.457 134.852 1.00 44.25  ? 44  MET A CG    1 
ATOM   939  S SD    . MET C 3 25  ? 135.055 102.314 134.249 1.00 47.23  ? 44  MET A SD    1 
ATOM   940  C CE    . MET C 3 25  ? 136.380 103.515 133.900 1.00 43.43  ? 44  MET A CE    1 
ATOM   941  N N     . LEU C 3 26  ? 135.028 105.592 138.864 1.00 46.23  ? 45  LEU A N     1 
ATOM   942  C CA    . LEU C 3 26  ? 135.684 106.626 139.665 1.00 45.30  ? 45  LEU A CA    1 
ATOM   943  C C     . LEU C 3 26  ? 136.934 106.048 140.313 1.00 48.75  ? 45  LEU A C     1 
ATOM   944  O O     . LEU C 3 26  ? 138.004 106.670 140.350 1.00 46.40  ? 45  LEU A O     1 
ATOM   945  C CB    . LEU C 3 26  ? 134.758 107.118 140.761 1.00 44.88  ? 45  LEU A CB    1 
ATOM   946  C CG    . LEU C 3 26  ? 135.489 108.023 141.735 1.00 48.36  ? 45  LEU A CG    1 
ATOM   947  C CD1   . LEU C 3 26  ? 135.877 109.322 141.039 1.00 48.62  ? 45  LEU A CD1   1 
ATOM   948  C CD2   . LEU C 3 26  ? 134.692 108.265 143.031 1.00 45.28  ? 45  LEU A CD2   1 
ATOM   949  N N     . LEU C 3 27  ? 136.787 104.833 140.814 1.00 42.10  ? 46  LEU A N     1 
ATOM   950  C CA    . LEU C 3 27  ? 137.880 104.133 141.459 1.00 41.29  ? 46  LEU A CA    1 
ATOM   951  C C     . LEU C 3 27  ? 139.009 103.758 140.471 1.00 48.36  ? 46  LEU A C     1 
ATOM   952  O O     . LEU C 3 27  ? 140.194 103.890 140.792 1.00 44.91  ? 46  LEU A O     1 
ATOM   953  C CB    . LEU C 3 27  ? 137.355 102.861 142.114 1.00 40.95  ? 46  LEU A CB    1 
ATOM   954  C CG    . LEU C 3 27  ? 137.735 102.690 143.560 1.00 47.97  ? 46  LEU A CG    1 
ATOM   955  C CD1   . LEU C 3 27  ? 136.911 103.635 144.425 1.00 46.17  ? 46  LEU A CD1   1 
ATOM   956  C CD2   . LEU C 3 27  ? 137.451 101.258 143.883 1.00 59.47  ? 46  LEU A CD2   1 
ATOM   957  N N     . SER C 3 28  ? 138.647 103.248 139.292 1.00 43.78  ? 47  SER A N     1 
ATOM   958  C CA    . SER C 3 28  ? 139.650 102.860 138.313 1.00 42.65  ? 47  SER A CA    1 
ATOM   959  C C     . SER C 3 28  ? 140.436 104.116 137.891 1.00 42.52  ? 47  SER A C     1 
ATOM   960  O O     . SER C 3 28  ? 141.665 104.111 137.829 1.00 39.41  ? 47  SER A O     1 
ATOM   961  C CB    . SER C 3 28  ? 138.973 102.255 137.098 1.00 44.58  ? 47  SER A CB    1 
ATOM   962  O OG    . SER C 3 28  ? 139.914 101.683 136.216 1.00 41.62  ? 47  SER A OG    1 
ATOM   963  N N     . VAL C 3 29  ? 139.710 105.193 137.624 1.00 35.75  ? 48  VAL A N     1 
ATOM   964  C CA    . VAL C 3 29  ? 140.332 106.440 137.226 1.00 34.04  ? 48  VAL A CA    1 
ATOM   965  C C     . VAL C 3 29  ? 141.273 106.964 138.325 1.00 41.37  ? 48  VAL A C     1 
ATOM   966  O O     . VAL C 3 29  ? 142.415 107.322 138.054 1.00 34.92  ? 48  VAL A O     1 
ATOM   967  C CB    . VAL C 3 29  ? 139.272 107.473 136.836 1.00 32.03  ? 48  VAL A CB    1 
ATOM   968  C CG1   . VAL C 3 29  ? 139.887 108.825 136.650 1.00 31.98  ? 48  VAL A CG1   1 
ATOM   969  C CG2   . VAL C 3 29  ? 138.579 107.034 135.554 1.00 29.82  ? 48  VAL A CG2   1 
ATOM   970  N N     . CYS C 3 30  ? 140.805 106.910 139.574 1.00 43.26  ? 49  CYS A N     1 
ATOM   971  C CA    . CYS C 3 30  ? 141.578 107.353 140.732 1.00 42.13  ? 49  CYS A CA    1 
ATOM   972  C C     . CYS C 3 30  ? 142.864 106.545 140.907 1.00 41.97  ? 49  CYS A C     1 
ATOM   973  O O     . CYS C 3 30  ? 143.920 107.078 141.280 1.00 40.74  ? 49  CYS A O     1 
ATOM   974  C CB    . CYS C 3 30  ? 140.715 107.307 141.997 1.00 43.68  ? 49  CYS A CB    1 
ATOM   975  S SG    . CYS C 3 30  ? 139.768 108.850 142.202 1.00 49.26  ? 49  CYS A SG    1 
ATOM   976  N N     . ARG C 3 31  ? 142.785 105.259 140.614 1.00 36.13  ? 50  ARG A N     1 
ATOM   977  C CA    . ARG C 3 31  ? 143.956 104.419 140.688 1.00 37.42  ? 50  ARG A CA    1 
ATOM   978  C C     . ARG C 3 31  ? 144.946 104.886 139.610 1.00 44.95  ? 50  ARG A C     1 
ATOM   979  O O     . ARG C 3 31  ? 146.128 105.067 139.869 1.00 44.95  ? 50  ARG A O     1 
ATOM   980  C CB    . ARG C 3 31  ? 143.595 102.951 140.458 1.00 36.70  ? 50  ARG A CB    1 
ATOM   981  C CG    . ARG C 3 31  ? 143.434 102.148 141.762 1.00 46.96  ? 50  ARG A CG    1 
ATOM   982  C CD    . ARG C 3 31  ? 143.157 100.705 141.439 1.00 55.50  ? 50  ARG A CD    1 
ATOM   983  N NE    . ARG C 3 31  ? 142.066 100.578 140.466 1.00 76.67  ? 50  ARG A NE    1 
ATOM   984  C CZ    . ARG C 3 31  ? 140.834 100.161 140.765 1.00 93.43  ? 50  ARG A CZ    1 
ATOM   985  N NH1   . ARG C 3 31  ? 140.527 99.831  142.016 1.00 96.60  ? 50  ARG A NH1   1 
ATOM   986  N NH2   . ARG C 3 31  ? 139.911 100.071 139.814 1.00 45.60  ? 50  ARG A NH2   1 
ATOM   987  N N     . SER C 3 32  ? 144.436 105.105 138.406 1.00 40.46  ? 51  SER A N     1 
ATOM   988  C CA    . SER C 3 32  ? 145.256 105.536 137.283 1.00 39.99  ? 51  SER A CA    1 
ATOM   989  C C     . SER C 3 32  ? 145.926 106.885 137.558 1.00 40.01  ? 51  SER A C     1 
ATOM   990  O O     . SER C 3 32  ? 147.145 107.027 137.444 1.00 36.49  ? 51  SER A O     1 
ATOM   991  C CB    . SER C 3 32  ? 144.381 105.608 136.019 1.00 39.95  ? 51  SER A CB    1 
ATOM   992  O OG    . SER C 3 32  ? 144.950 106.405 134.997 1.00 39.33  ? 51  SER A OG    1 
ATOM   993  N N     . TRP C 3 33  ? 145.109 107.863 137.906 1.00 32.23  ? 52  TRP A N     1 
ATOM   994  C CA    . TRP C 3 33  ? 145.588 109.181 138.203 1.00 33.33  ? 52  TRP A CA    1 
ATOM   995  C C     . TRP C 3 33  ? 146.616 109.145 139.356 1.00 45.75  ? 52  TRP A C     1 
ATOM   996  O O     . TRP C 3 33  ? 147.657 109.782 139.262 1.00 50.85  ? 52  TRP A O     1 
ATOM   997  C CB    . TRP C 3 33  ? 144.404 110.106 138.496 1.00 31.61  ? 52  TRP A CB    1 
ATOM   998  C CG    . TRP C 3 33  ? 144.748 111.294 139.345 1.00 35.60  ? 52  TRP A CG    1 
ATOM   999  C CD1   . TRP C 3 33  ? 144.481 111.464 140.678 1.00 38.81  ? 52  TRP A CD1   1 
ATOM   1000 C CD2   . TRP C 3 33  ? 145.387 112.506 138.909 1.00 34.95  ? 52  TRP A CD2   1 
ATOM   1001 N NE1   . TRP C 3 33  ? 144.904 112.709 141.088 1.00 38.01  ? 52  TRP A NE1   1 
ATOM   1002 C CE2   . TRP C 3 33  ? 145.474 113.362 140.027 1.00 39.69  ? 52  TRP A CE2   1 
ATOM   1003 C CE3   . TRP C 3 33  ? 145.921 112.937 137.683 1.00 35.08  ? 52  TRP A CE3   1 
ATOM   1004 C CZ2   . TRP C 3 33  ? 146.096 114.621 139.965 1.00 40.74  ? 52  TRP A CZ2   1 
ATOM   1005 C CZ3   . TRP C 3 33  ? 146.504 114.208 137.616 1.00 36.28  ? 52  TRP A CZ3   1 
ATOM   1006 C CH2   . TRP C 3 33  ? 146.602 115.021 138.754 1.00 37.37  ? 52  TRP A CH2   1 
ATOM   1007 N N     . ALA C 3 34  ? 146.337 108.371 140.412 1.00 42.63  ? 53  ALA A N     1 
ATOM   1008 C CA    . ALA C 3 34  ? 147.236 108.249 141.582 1.00 39.15  ? 53  ALA A CA    1 
ATOM   1009 C C     . ALA C 3 34  ? 148.601 107.628 141.202 1.00 41.39  ? 53  ALA A C     1 
ATOM   1010 O O     . ALA C 3 34  ? 149.673 108.103 141.627 1.00 36.47  ? 53  ALA A O     1 
ATOM   1011 C CB    . ALA C 3 34  ? 146.564 107.402 142.675 1.00 38.52  ? 53  ALA A CB    1 
ATOM   1012 N N     . ALA C 3 35  ? 148.557 106.550 140.428 1.00 33.64  ? 54  ALA A N     1 
ATOM   1013 C CA    . ALA C 3 35  ? 149.777 105.900 139.986 1.00 30.60  ? 54  ALA A CA    1 
ATOM   1014 C C     . ALA C 3 35  ? 150.637 106.896 139.165 1.00 39.63  ? 54  ALA A C     1 
ATOM   1015 O O     . ALA C 3 35  ? 151.854 106.939 139.327 1.00 38.89  ? 54  ALA A O     1 
ATOM   1016 C CB    . ALA C 3 35  ? 149.435 104.676 139.133 1.00 29.71  ? 54  ALA A CB    1 
ATOM   1017 N N     . TRP C 3 36  ? 149.995 107.666 138.271 1.00 31.92  ? 55  TRP A N     1 
ATOM   1018 C CA    . TRP C 3 36  ? 150.703 108.621 137.410 1.00 30.97  ? 55  TRP A CA    1 
ATOM   1019 C C     . TRP C 3 36  ? 151.295 109.740 138.237 1.00 39.98  ? 55  TRP A C     1 
ATOM   1020 O O     . TRP C 3 36  ? 152.385 110.237 137.950 1.00 41.80  ? 55  TRP A O     1 
ATOM   1021 C CB    . TRP C 3 36  ? 149.767 109.203 136.358 1.00 27.08  ? 55  TRP A CB    1 
ATOM   1022 C CG    . TRP C 3 36  ? 150.403 110.241 135.403 1.00 25.19  ? 55  TRP A CG    1 
ATOM   1023 C CD1   . TRP C 3 36  ? 150.971 109.998 134.166 1.00 26.58  ? 55  TRP A CD1   1 
ATOM   1024 C CD2   . TRP C 3 36  ? 150.411 111.671 135.576 1.00 24.81  ? 55  TRP A CD2   1 
ATOM   1025 N NE1   . TRP C 3 36  ? 151.343 111.200 133.575 1.00 25.82  ? 55  TRP A NE1   1 
ATOM   1026 C CE2   . TRP C 3 36  ? 151.026 112.233 134.422 1.00 27.24  ? 55  TRP A CE2   1 
ATOM   1027 C CE3   . TRP C 3 36  ? 149.971 112.527 136.596 1.00 27.07  ? 55  TRP A CE3   1 
ATOM   1028 C CZ2   . TRP C 3 36  ? 151.206 113.618 134.263 1.00 26.36  ? 55  TRP A CZ2   1 
ATOM   1029 C CZ3   . TRP C 3 36  ? 150.122 113.898 136.425 1.00 29.25  ? 55  TRP A CZ3   1 
ATOM   1030 C CH2   . TRP C 3 36  ? 150.766 114.432 135.270 1.00 29.42  ? 55  TRP A CH2   1 
ATOM   1031 N N     . CYS C 3 37  ? 150.549 110.158 139.247 1.00 35.39  ? 56  CYS A N     1 
ATOM   1032 C CA    . CYS C 3 37  ? 151.015 111.189 140.136 1.00 35.21  ? 56  CYS A CA    1 
ATOM   1033 C C     . CYS C 3 37  ? 152.241 110.658 140.922 1.00 40.77  ? 56  CYS A C     1 
ATOM   1034 O O     . CYS C 3 37  ? 153.251 111.348 141.103 1.00 38.31  ? 56  CYS A O     1 
ATOM   1035 C CB    . CYS C 3 37  ? 149.874 111.616 141.077 1.00 34.01  ? 56  CYS A CB    1 
ATOM   1036 S SG    . CYS C 3 37  ? 148.805 112.886 140.330 1.00 38.38  ? 56  CYS A SG    1 
ATOM   1037 N N     . LYS C 3 38  ? 152.156 109.407 141.350 1.00 35.72  ? 57  LYS A N     1 
ATOM   1038 C CA    . LYS C 3 38  ? 153.247 108.809 142.090 1.00 32.76  ? 57  LYS A CA    1 
ATOM   1039 C C     . LYS C 3 38  ? 154.535 108.737 141.265 1.00 42.58  ? 57  LYS A C     1 
ATOM   1040 O O     . LYS C 3 38  ? 155.578 109.191 141.687 1.00 46.40  ? 57  LYS A O     1 
ATOM   1041 C CB    . LYS C 3 38  ? 152.870 107.418 142.570 1.00 32.80  ? 57  LYS A CB    1 
ATOM   1042 C CG    . LYS C 3 38  ? 153.874 106.853 143.529 1.00 35.53  ? 57  LYS A CG    1 
ATOM   1043 C CD    . LYS C 3 38  ? 153.628 105.410 143.806 1.00 38.65  ? 57  LYS A CD    1 
ATOM   1044 C CE    . LYS C 3 38  ? 154.753 104.851 144.686 1.00 49.99  ? 57  LYS A CE    1 
ATOM   1045 N NZ    . LYS C 3 38  ? 154.253 103.868 145.683 1.00 88.73  ? 57  LYS A NZ    1 
ATOM   1046 N N     . LEU C 3 39  ? 154.442 108.144 140.083 1.00 38.72  ? 58  LEU A N     1 
ATOM   1047 C CA    . LEU C 3 39  ? 155.577 107.986 139.178 1.00 37.70  ? 58  LEU A CA    1 
ATOM   1048 C C     . LEU C 3 39  ? 156.198 109.324 138.779 1.00 36.20  ? 58  LEU A C     1 
ATOM   1049 O O     . LEU C 3 39  ? 157.395 109.430 138.634 1.00 37.44  ? 58  LEU A O     1 
ATOM   1050 C CB    . LEU C 3 39  ? 155.105 107.265 137.901 1.00 36.04  ? 58  LEU A CB    1 
ATOM   1051 C CG    . LEU C 3 39  ? 156.095 106.902 136.793 1.00 34.64  ? 58  LEU A CG    1 
ATOM   1052 C CD1   . LEU C 3 39  ? 157.125 105.952 137.350 1.00 29.77  ? 58  LEU A CD1   1 
ATOM   1053 C CD2   . LEU C 3 39  ? 155.341 106.261 135.636 1.00 32.11  ? 58  LEU A CD2   1 
ATOM   1054 N N     . ASN C 3 40  ? 155.367 110.330 138.577 1.00 30.51  ? 59  ASN A N     1 
ATOM   1055 C CA    . ASN C 3 40  ? 155.834 111.611 138.115 1.00 28.63  ? 59  ASN A CA    1 
ATOM   1056 C C     . ASN C 3 40  ? 155.949 112.607 139.223 1.00 33.09  ? 59  ASN A C     1 
ATOM   1057 O O     . ASN C 3 40  ? 156.089 113.815 138.995 1.00 33.02  ? 59  ASN A O     1 
ATOM   1058 C CB    . ASN C 3 40  ? 154.899 112.147 137.010 1.00 29.24  ? 59  ASN A CB    1 
ATOM   1059 C CG    . ASN C 3 40  ? 154.998 111.340 135.746 1.00 42.31  ? 59  ASN A CG    1 
ATOM   1060 O OD1   . ASN C 3 40  ? 156.033 111.345 135.090 1.00 43.00  ? 59  ASN A OD1   1 
ATOM   1061 N ND2   . ASN C 3 40  ? 153.962 110.560 135.445 1.00 31.97  ? 59  ASN A ND2   1 
ATOM   1062 N N     . ASN C 3 41  ? 155.801 112.133 140.438 1.00 34.35  ? 60  ASN A N     1 
ATOM   1063 C CA    . ASN C 3 41  ? 155.898 113.034 141.571 1.00 34.86  ? 60  ASN A CA    1 
ATOM   1064 C C     . ASN C 3 41  ? 154.997 114.248 141.583 1.00 39.44  ? 60  ASN A C     1 
ATOM   1065 O O     . ASN C 3 41  ? 155.478 115.353 141.844 1.00 43.73  ? 60  ASN A O     1 
ATOM   1066 C CB    . ASN C 3 41  ? 157.337 113.507 141.711 1.00 39.83  ? 60  ASN A CB    1 
ATOM   1067 C CG    . ASN C 3 41  ? 157.864 113.261 143.062 1.00 73.53  ? 60  ASN A CG    1 
ATOM   1068 O OD1   . ASN C 3 41  ? 157.682 114.083 143.962 1.00 68.50  ? 60  ASN A OD1   1 
ATOM   1069 N ND2   . ASN C 3 41  ? 158.429 112.073 143.267 1.00 66.58  ? 60  ASN A ND2   1 
ATOM   1070 N N     . ARG C 3 42  ? 153.697 114.073 141.344 1.00 35.90  ? 61  ARG A N     1 
ATOM   1071 C CA    . ARG C 3 42  ? 152.767 115.210 141.423 1.00 33.88  ? 61  ARG A CA    1 
ATOM   1072 C C     . ARG C 3 42  ? 151.768 114.983 142.553 1.00 43.42  ? 61  ARG A C     1 
ATOM   1073 O O     . ARG C 3 42  ? 151.572 113.852 143.008 1.00 43.45  ? 61  ARG A O     1 
ATOM   1074 C CB    . ARG C 3 42  ? 151.971 115.383 140.141 1.00 33.25  ? 61  ARG A CB    1 
ATOM   1075 C CG    . ARG C 3 42  ? 152.771 115.201 138.877 1.00 39.41  ? 61  ARG A CG    1 
ATOM   1076 C CD    . ARG C 3 42  ? 153.756 116.334 138.673 1.00 43.52  ? 61  ARG A CD    1 
ATOM   1077 N NE    . ARG C 3 42  ? 154.748 115.989 137.649 1.00 42.47  ? 61  ARG A NE    1 
ATOM   1078 C CZ    . ARG C 3 42  ? 154.638 116.346 136.379 1.00 47.87  ? 61  ARG A CZ    1 
ATOM   1079 N NH1   . ARG C 3 42  ? 153.572 117.050 135.980 1.00 35.98  ? 61  ARG A NH1   1 
ATOM   1080 N NH2   . ARG C 3 42  ? 155.572 115.984 135.517 1.00 35.37  ? 61  ARG A NH2   1 
ATOM   1081 N N     . LYS C 3 43  ? 151.092 116.053 142.958 1.00 45.25  ? 62  LYS A N     1 
ATOM   1082 C CA    . LYS C 3 43  ? 150.075 115.997 144.020 1.00 44.51  ? 62  LYS A CA    1 
ATOM   1083 C C     . LYS C 3 43  ? 148.771 115.445 143.474 1.00 45.20  ? 62  LYS A C     1 
ATOM   1084 O O     . LYS C 3 43  ? 148.192 116.021 142.557 1.00 42.09  ? 62  LYS A O     1 
ATOM   1085 C CB    . LYS C 3 43  ? 149.811 117.402 144.577 1.00 49.46  ? 62  LYS A CB    1 
ATOM   1086 C CG    . LYS C 3 43  ? 149.310 117.408 146.007 1.00 67.95  ? 62  LYS A CG    1 
ATOM   1087 C CD    . LYS C 3 43  ? 150.175 116.490 146.874 1.00 90.95  ? 62  LYS A CD    1 
ATOM   1088 C CE    . LYS C 3 43  ? 149.505 115.142 147.105 1.00 100.00 ? 62  LYS A CE    1 
ATOM   1089 N NZ    . LYS C 3 43  ? 150.447 114.112 147.636 1.00 100.00 ? 62  LYS A NZ    1 
ATOM   1090 N N     . TRP C 3 44  ? 148.296 114.352 144.073 1.00 50.38  ? 63  TRP A N     1 
ATOM   1091 C CA    . TRP C 3 44  ? 147.052 113.698 143.644 1.00 54.21  ? 63  TRP A CA    1 
ATOM   1092 C C     . TRP C 3 44  ? 145.747 114.413 143.965 1.00 55.81  ? 63  TRP A C     1 
ATOM   1093 O O     . TRP C 3 44  ? 144.859 114.469 143.132 1.00 53.38  ? 63  TRP A O     1 
ATOM   1094 C CB    . TRP C 3 44  ? 147.046 112.206 143.958 1.00 57.35  ? 63  TRP A CB    1 
ATOM   1095 C CG    . TRP C 3 44  ? 146.211 111.784 145.099 1.00 63.65  ? 63  TRP A CG    1 
ATOM   1096 C CD1   . TRP C 3 44  ? 146.636 111.450 146.359 1.00 67.67  ? 63  TRP A CD1   1 
ATOM   1097 C CD2   . TRP C 3 44  ? 144.816 111.467 145.053 1.00 65.19  ? 63  TRP A CD2   1 
ATOM   1098 N NE1   . TRP C 3 44  ? 145.568 111.007 147.116 1.00 69.62  ? 63  TRP A NE1   1 
ATOM   1099 C CE2   . TRP C 3 44  ? 144.443 111.010 146.337 1.00 70.33  ? 63  TRP A CE2   1 
ATOM   1100 C CE3   . TRP C 3 44  ? 143.842 111.542 144.055 1.00 66.54  ? 63  TRP A CE3   1 
ATOM   1101 C CZ2   . TRP C 3 44  ? 143.141 110.654 146.649 1.00 69.02  ? 63  TRP A CZ2   1 
ATOM   1102 C CZ3   . TRP C 3 44  ? 142.554 111.178 144.361 1.00 68.11  ? 63  TRP A CZ3   1 
ATOM   1103 C CH2   . TRP C 3 44  ? 142.211 110.749 145.650 1.00 69.32  ? 63  TRP A CH2   1 
ATOM   1104 N N     . PHE C 3 45  ? 145.672 115.049 145.128 1.00 58.65  ? 64  PHE A N     1 
ATOM   1105 C CA    . PHE C 3 45  ? 144.492 115.836 145.496 1.00 58.49  ? 64  PHE A CA    1 
ATOM   1106 C C     . PHE C 3 45  ? 144.806 116.909 146.530 1.00 51.99  ? 64  PHE A C     1 
ATOM   1107 O O     . PHE C 3 45  ? 145.456 116.645 147.524 1.00 49.94  ? 64  PHE A O     1 
ATOM   1108 C CB    . PHE C 3 45  ? 143.355 114.963 146.002 1.00 62.96  ? 64  PHE A CB    1 
ATOM   1109 C CG    . PHE C 3 45  ? 142.060 115.705 146.109 1.00 69.70  ? 64  PHE A CG    1 
ATOM   1110 C CD1   . PHE C 3 45  ? 141.242 115.881 144.988 1.00 74.90  ? 64  PHE A CD1   1 
ATOM   1111 C CD2   . PHE C 3 45  ? 141.704 116.336 147.296 1.00 75.36  ? 64  PHE A CD2   1 
ATOM   1112 C CE1   . PHE C 3 45  ? 140.069 116.613 145.074 1.00 75.20  ? 64  PHE A CE1   1 
ATOM   1113 C CE2   . PHE C 3 45  ? 140.530 117.075 147.375 1.00 78.04  ? 64  PHE A CE2   1 
ATOM   1114 C CZ    . PHE C 3 45  ? 139.713 117.196 146.259 1.00 74.21  ? 64  PHE A CZ    1 
ATOM   1115 N N     . PRO C 3 46  ? 144.337 118.125 146.300 1.00 45.82  ? 65  PRO A N     1 
ATOM   1116 C CA    . PRO C 3 46  ? 143.579 118.474 145.111 1.00 45.73  ? 65  PRO A CA    1 
ATOM   1117 C C     . PRO C 3 46  ? 144.514 118.566 143.906 1.00 58.97  ? 65  PRO A C     1 
ATOM   1118 O O     . PRO C 3 46  ? 145.639 119.049 144.009 1.00 60.91  ? 65  PRO A O     1 
ATOM   1119 C CB    . PRO C 3 46  ? 143.041 119.869 145.427 1.00 44.14  ? 65  PRO A CB    1 
ATOM   1120 C CG    . PRO C 3 46  ? 143.158 120.017 146.873 1.00 50.68  ? 65  PRO A CG    1 
ATOM   1121 C CD    . PRO C 3 46  ? 144.346 119.216 147.277 1.00 46.68  ? 65  PRO A CD    1 
ATOM   1122 N N     . ALA C 3 47  ? 144.014 118.132 142.757 1.00 53.59  ? 66  ALA A N     1 
ATOM   1123 C CA    . ALA C 3 47  ? 144.783 118.122 141.525 1.00 50.30  ? 66  ALA A CA    1 
ATOM   1124 C C     . ALA C 3 47  ? 145.094 119.503 140.973 1.00 56.06  ? 66  ALA A C     1 
ATOM   1125 O O     . ALA C 3 47  ? 144.247 120.371 140.998 1.00 58.39  ? 66  ALA A O     1 
ATOM   1126 C CB    . ALA C 3 47  ? 144.049 117.298 140.477 1.00 49.05  ? 66  ALA A CB    1 
ATOM   1127 N N     . GLU C 3 48  ? 146.300 119.695 140.434 1.00 52.89  ? 67  GLU A N     1 
ATOM   1128 C CA    . GLU C 3 48  ? 146.642 120.968 139.804 1.00 51.17  ? 67  GLU A CA    1 
ATOM   1129 C C     . GLU C 3 48  ? 146.381 120.870 138.324 1.00 47.65  ? 67  GLU A C     1 
ATOM   1130 O O     . GLU C 3 48  ? 146.771 119.905 137.671 1.00 46.69  ? 67  GLU A O     1 
ATOM   1131 C CB    . GLU C 3 48  ? 148.096 121.348 140.030 1.00 54.47  ? 67  GLU A CB    1 
ATOM   1132 C CG    . GLU C 3 48  ? 148.416 122.818 139.619 1.00 84.23  ? 67  GLU A CG    1 
ATOM   1133 C CD    . GLU C 3 48  ? 148.654 122.974 138.104 1.00 100.00 ? 67  GLU A CD    1 
ATOM   1134 O OE1   . GLU C 3 48  ? 148.944 121.949 137.437 1.00 100.00 ? 67  GLU A OE1   1 
ATOM   1135 O OE2   . GLU C 3 48  ? 148.525 124.114 137.588 1.00 93.98  ? 67  GLU A OE2   1 
ATOM   1136 N N     . PRO C 3 49  ? 145.727 121.889 137.798 1.00 42.96  ? 68  PRO A N     1 
ATOM   1137 C CA    . PRO C 3 49  ? 145.350 121.939 136.386 1.00 43.02  ? 68  PRO A CA    1 
ATOM   1138 C C     . PRO C 3 49  ? 146.416 121.501 135.402 1.00 48.14  ? 68  PRO A C     1 
ATOM   1139 O O     . PRO C 3 49  ? 146.120 120.724 134.484 1.00 46.69  ? 68  PRO A O     1 
ATOM   1140 C CB    . PRO C 3 49  ? 144.982 123.412 136.149 1.00 42.58  ? 68  PRO A CB    1 
ATOM   1141 C CG    . PRO C 3 49  ? 144.878 124.013 137.486 1.00 46.42  ? 68  PRO A CG    1 
ATOM   1142 C CD    . PRO C 3 49  ? 145.698 123.211 138.431 1.00 41.78  ? 68  PRO A CD    1 
ATOM   1143 N N     . GLU C 3 50  ? 147.632 122.044 135.562 1.00 43.53  ? 69  GLU A N     1 
ATOM   1144 C CA    . GLU C 3 50  ? 148.759 121.763 134.658 1.00 40.23  ? 69  GLU A CA    1 
ATOM   1145 C C     . GLU C 3 50  ? 149.097 120.301 134.712 1.00 40.68  ? 69  GLU A C     1 
ATOM   1146 O O     . GLU C 3 50  ? 149.447 119.690 133.702 1.00 44.23  ? 69  GLU A O     1 
ATOM   1147 C CB    . GLU C 3 50  ? 149.972 122.655 134.954 1.00 39.38  ? 69  GLU A CB    1 
ATOM   1148 C CG    . GLU C 3 50  ? 149.689 124.126 134.689 1.00 57.30  ? 69  GLU A CG    1 
ATOM   1149 C CD    . GLU C 3 50  ? 150.554 124.738 133.570 1.00 100.00 ? 69  GLU A CD    1 
ATOM   1150 O OE1   . GLU C 3 50  ? 151.785 124.895 133.770 1.00 100.00 ? 69  GLU A OE1   1 
ATOM   1151 O OE2   . GLU C 3 50  ? 149.978 125.122 132.525 1.00 100.00 ? 69  GLU A OE2   1 
ATOM   1152 N N     . ASP C 3 51  ? 148.913 119.727 135.893 1.00 32.35  ? 70  ASP A N     1 
ATOM   1153 C CA    . ASP C 3 51  ? 149.103 118.304 136.097 1.00 33.34  ? 70  ASP A CA    1 
ATOM   1154 C C     . ASP C 3 51  ? 147.983 117.489 135.429 1.00 40.38  ? 70  ASP A C     1 
ATOM   1155 O O     . ASP C 3 51  ? 148.234 116.439 134.845 1.00 40.36  ? 70  ASP A O     1 
ATOM   1156 C CB    . ASP C 3 51  ? 149.104 117.971 137.581 1.00 37.39  ? 70  ASP A CB    1 
ATOM   1157 C CG    . ASP C 3 51  ? 150.455 118.210 138.227 1.00 54.85  ? 70  ASP A CG    1 
ATOM   1158 O OD1   . ASP C 3 51  ? 151.384 118.669 137.526 1.00 53.82  ? 70  ASP A OD1   1 
ATOM   1159 O OD2   . ASP C 3 51  ? 150.590 117.917 139.430 1.00 56.99  ? 70  ASP A OD2   1 
ATOM   1160 N N     . VAL C 3 52  ? 146.744 117.951 135.546 1.00 39.41  ? 71  VAL A N     1 
ATOM   1161 C CA    . VAL C 3 52  ? 145.644 117.227 134.927 1.00 37.60  ? 71  VAL A CA    1 
ATOM   1162 C C     . VAL C 3 52  ? 145.865 117.274 133.441 1.00 33.53  ? 71  VAL A C     1 
ATOM   1163 O O     . VAL C 3 52  ? 145.789 116.254 132.760 1.00 35.47  ? 71  VAL A O     1 
ATOM   1164 C CB    . VAL C 3 52  ? 144.233 117.781 135.321 1.00 40.86  ? 71  VAL A CB    1 
ATOM   1165 C CG1   . VAL C 3 52  ? 143.111 116.891 134.696 1.00 40.70  ? 71  VAL A CG1   1 
ATOM   1166 C CG2   . VAL C 3 52  ? 144.085 117.813 136.836 1.00 39.48  ? 71  VAL A CG2   1 
ATOM   1167 N N     . ARG C 3 53  ? 146.179 118.461 132.941 1.00 31.79  ? 72  ARG A N     1 
ATOM   1168 C CA    . ARG C 3 53  ? 146.459 118.631 131.526 1.00 34.25  ? 72  ARG A CA    1 
ATOM   1169 C C     . ARG C 3 53  ? 147.492 117.618 131.012 1.00 39.87  ? 72  ARG A C     1 
ATOM   1170 O O     . ARG C 3 53  ? 147.313 117.003 129.949 1.00 39.89  ? 72  ARG A O     1 
ATOM   1171 C CB    . ARG C 3 53  ? 146.970 120.037 131.242 1.00 34.05  ? 72  ARG A CB    1 
ATOM   1172 C CG    . ARG C 3 53  ? 147.145 120.279 129.744 1.00 55.29  ? 72  ARG A CG    1 
ATOM   1173 C CD    . ARG C 3 53  ? 148.206 121.302 129.441 1.00 52.20  ? 72  ARG A CD    1 
ATOM   1174 N NE    . ARG C 3 53  ? 149.418 121.007 130.183 1.00 68.25  ? 72  ARG A NE    1 
ATOM   1175 C CZ    . ARG C 3 53  ? 150.293 121.923 130.554 1.00 78.74  ? 72  ARG A CZ    1 
ATOM   1176 N NH1   . ARG C 3 53  ? 150.082 123.195 130.224 1.00 54.07  ? 72  ARG A NH1   1 
ATOM   1177 N NH2   . ARG C 3 53  ? 151.368 121.562 131.250 1.00 61.46  ? 72  ARG A NH2   1 
ATOM   1178 N N     . ASP C 3 54  ? 148.589 117.476 131.751 1.00 35.60  ? 73  ASP A N     1 
ATOM   1179 C CA    . ASP C 3 54  ? 149.653 116.566 131.340 1.00 33.92  ? 73  ASP A CA    1 
ATOM   1180 C C     . ASP C 3 54  ? 149.183 115.128 131.431 1.00 34.94  ? 73  ASP A C     1 
ATOM   1181 O O     . ASP C 3 54  ? 149.528 114.318 130.585 1.00 32.90  ? 73  ASP A O     1 
ATOM   1182 C CB    . ASP C 3 54  ? 150.952 116.779 132.139 1.00 34.80  ? 73  ASP A CB    1 
ATOM   1183 C CG    . ASP C 3 54  ? 151.715 118.079 131.748 1.00 34.61  ? 73  ASP A CG    1 
ATOM   1184 O OD1   . ASP C 3 54  ? 151.444 118.708 130.712 1.00 35.53  ? 73  ASP A OD1   1 
ATOM   1185 O OD2   . ASP C 3 54  ? 152.594 118.479 132.517 1.00 44.26  ? 73  ASP A OD2   1 
ATOM   1186 N N     . TYR C 3 55  ? 148.372 114.813 132.442 1.00 31.29  ? 74  TYR A N     1 
ATOM   1187 C CA    . TYR C 3 55  ? 147.829 113.450 132.594 1.00 29.37  ? 74  TYR A CA    1 
ATOM   1188 C C     . TYR C 3 55  ? 146.906 113.068 131.422 1.00 29.44  ? 74  TYR A C     1 
ATOM   1189 O O     . TYR C 3 55  ? 146.963 111.955 130.909 1.00 32.03  ? 74  TYR A O     1 
ATOM   1190 C CB    . TYR C 3 55  ? 147.115 113.293 133.936 1.00 30.88  ? 74  TYR A CB    1 
ATOM   1191 C CG    . TYR C 3 55  ? 146.329 112.011 134.108 1.00 28.35  ? 74  TYR A CG    1 
ATOM   1192 C CD1   . TYR C 3 55  ? 146.961 110.821 134.432 1.00 27.31  ? 74  TYR A CD1   1 
ATOM   1193 C CD2   . TYR C 3 55  ? 144.932 112.009 134.007 1.00 32.20  ? 74  TYR A CD2   1 
ATOM   1194 C CE1   . TYR C 3 55  ? 146.234 109.633 134.607 1.00 27.42  ? 74  TYR A CE1   1 
ATOM   1195 C CE2   . TYR C 3 55  ? 144.190 110.833 134.203 1.00 34.33  ? 74  TYR A CE2   1 
ATOM   1196 C CZ    . TYR C 3 55  ? 144.844 109.658 134.510 1.00 33.93  ? 74  TYR A CZ    1 
ATOM   1197 O OH    . TYR C 3 55  ? 144.107 108.506 134.685 1.00 30.81  ? 74  TYR A OH    1 
ATOM   1198 N N     . LEU C 3 56  ? 146.090 114.006 130.966 1.00 28.04  ? 75  LEU A N     1 
ATOM   1199 C CA    . LEU C 3 56  ? 145.221 113.743 129.820 1.00 29.20  ? 75  LEU A CA    1 
ATOM   1200 C C     . LEU C 3 56  ? 146.068 113.488 128.554 1.00 33.07  ? 75  LEU A C     1 
ATOM   1201 O O     . LEU C 3 56  ? 145.785 112.580 127.786 1.00 32.24  ? 75  LEU A O     1 
ATOM   1202 C CB    . LEU C 3 56  ? 144.238 114.915 129.601 1.00 30.15  ? 75  LEU A CB    1 
ATOM   1203 C CG    . LEU C 3 56  ? 143.296 115.209 130.799 1.00 36.56  ? 75  LEU A CG    1 
ATOM   1204 C CD1   . LEU C 3 56  ? 142.402 116.419 130.515 1.00 36.39  ? 75  LEU A CD1   1 
ATOM   1205 C CD2   . LEU C 3 56  ? 142.444 113.979 131.217 1.00 32.58  ? 75  LEU A CD2   1 
ATOM   1206 N N     . LEU C 3 57  ? 147.123 114.283 128.359 1.00 29.97  ? 76  LEU A N     1 
ATOM   1207 C CA    . LEU C 3 57  ? 148.018 114.109 127.210 1.00 27.30  ? 76  LEU A CA    1 
ATOM   1208 C C     . LEU C 3 57  ? 148.698 112.743 127.276 1.00 29.88  ? 76  LEU A C     1 
ATOM   1209 O O     . LEU C 3 57  ? 148.940 112.083 126.250 1.00 29.02  ? 76  LEU A O     1 
ATOM   1210 C CB    . LEU C 3 57  ? 149.058 115.225 127.198 1.00 28.56  ? 76  LEU A CB    1 
ATOM   1211 C CG    . LEU C 3 57  ? 148.497 116.623 126.920 1.00 32.39  ? 76  LEU A CG    1 
ATOM   1212 C CD1   . LEU C 3 57  ? 149.523 117.711 127.217 1.00 32.78  ? 76  LEU A CD1   1 
ATOM   1213 C CD2   . LEU C 3 57  ? 148.037 116.682 125.485 1.00 31.74  ? 76  LEU A CD2   1 
ATOM   1214 N N     . TYR C 3 58  ? 148.965 112.311 128.503 1.00 28.34  ? 77  TYR A N     1 
ATOM   1215 C CA    . TYR C 3 58  ? 149.557 111.009 128.753 1.00 27.14  ? 77  TYR A CA    1 
ATOM   1216 C C     . TYR C 3 58  ? 148.584 109.891 128.263 1.00 32.57  ? 77  TYR A C     1 
ATOM   1217 O O     . TYR C 3 58  ? 149.015 108.889 127.647 1.00 28.53  ? 77  TYR A O     1 
ATOM   1218 C CB    . TYR C 3 58  ? 149.879 110.865 130.246 1.00 23.32  ? 77  TYR A CB    1 
ATOM   1219 C CG    . TYR C 3 58  ? 149.985 109.421 130.698 1.00 27.50  ? 77  TYR A CG    1 
ATOM   1220 C CD1   . TYR C 3 58  ? 151.053 108.642 130.310 1.00 27.00  ? 77  TYR A CD1   1 
ATOM   1221 C CD2   . TYR C 3 58  ? 148.999 108.837 131.502 1.00 28.33  ? 77  TYR A CD2   1 
ATOM   1222 C CE1   . TYR C 3 58  ? 151.169 107.327 130.712 1.00 30.03  ? 77  TYR A CE1   1 
ATOM   1223 C CE2   . TYR C 3 58  ? 149.087 107.512 131.895 1.00 27.78  ? 77  TYR A CE2   1 
ATOM   1224 C CZ    . TYR C 3 58  ? 150.168 106.753 131.487 1.00 36.91  ? 77  TYR A CZ    1 
ATOM   1225 O OH    . TYR C 3 58  ? 150.274 105.421 131.844 1.00 34.50  ? 77  TYR A OH    1 
ATOM   1226 N N     . LEU C 3 59  ? 147.280 110.085 128.515 1.00 27.70  ? 78  LEU A N     1 
ATOM   1227 C CA    . LEU C 3 59  ? 146.264 109.100 128.090 1.00 26.27  ? 78  LEU A CA    1 
ATOM   1228 C C     . LEU C 3 59  ? 146.223 109.088 126.575 1.00 28.74  ? 78  LEU A C     1 
ATOM   1229 O O     . LEU C 3 59  ? 146.266 108.020 125.926 1.00 30.54  ? 78  LEU A O     1 
ATOM   1230 C CB    . LEU C 3 59  ? 144.869 109.425 128.678 1.00 25.34  ? 78  LEU A CB    1 
ATOM   1231 C CG    . LEU C 3 59  ? 144.845 109.326 130.211 1.00 29.32  ? 78  LEU A CG    1 
ATOM   1232 C CD1   . LEU C 3 59  ? 143.549 109.840 130.826 1.00 31.12  ? 78  LEU A CD1   1 
ATOM   1233 C CD2   . LEU C 3 59  ? 145.165 107.917 130.667 1.00 25.89  ? 78  LEU A CD2   1 
ATOM   1234 N N     . GLN C 3 60  ? 146.178 110.286 126.004 1.00 25.38  ? 79  GLN A N     1 
ATOM   1235 C CA    . GLN C 3 60  ? 146.173 110.406 124.570 1.00 24.81  ? 79  GLN A CA    1 
ATOM   1236 C C     . GLN C 3 60  ? 147.456 109.779 123.956 1.00 35.08  ? 79  GLN A C     1 
ATOM   1237 O O     . GLN C 3 60  ? 147.395 109.036 122.960 1.00 32.76  ? 79  GLN A O     1 
ATOM   1238 C CB    . GLN C 3 60  ? 146.054 111.879 124.175 1.00 23.46  ? 79  GLN A CB    1 
ATOM   1239 C CG    . GLN C 3 60  ? 146.129 112.043 122.670 1.00 27.36  ? 79  GLN A CG    1 
ATOM   1240 C CD    . GLN C 3 60  ? 146.221 113.464 122.248 1.00 34.72  ? 79  GLN A CD    1 
ATOM   1241 O OE1   . GLN C 3 60  ? 146.834 114.281 122.932 1.00 37.31  ? 79  GLN A OE1   1 
ATOM   1242 N NE2   . GLN C 3 60  ? 145.611 113.787 121.110 1.00 34.15  ? 79  GLN A NE2   1 
ATOM   1243 N N     . ALA C 3 61  ? 148.614 110.058 124.568 1.00 32.93  ? 80  ALA A N     1 
ATOM   1244 C CA    . ALA C 3 61  ? 149.878 109.535 124.045 1.00 30.09  ? 80  ALA A CA    1 
ATOM   1245 C C     . ALA C 3 61  ? 149.988 108.024 124.183 1.00 38.62  ? 80  ALA A C     1 
ATOM   1246 O O     . ALA C 3 61  ? 150.791 107.385 123.488 1.00 34.74  ? 80  ALA A O     1 
ATOM   1247 C CB    . ALA C 3 61  ? 151.108 110.280 124.652 1.00 28.91  ? 80  ALA A CB    1 
ATOM   1248 N N     . ARG C 3 62  ? 149.129 107.434 125.018 1.00 36.22  ? 81  ARG A N     1 
ATOM   1249 C CA    . ARG C 3 62  ? 149.103 105.992 125.086 1.00 34.96  ? 81  ARG A CA    1 
ATOM   1250 C C     . ARG C 3 62  ? 148.049 105.309 124.220 1.00 37.05  ? 81  ARG A C     1 
ATOM   1251 O O     . ARG C 3 62  ? 147.854 104.111 124.281 1.00 40.65  ? 81  ARG A O     1 
ATOM   1252 C CB    . ARG C 3 62  ? 149.343 105.380 126.468 1.00 35.82  ? 81  ARG A CB    1 
ATOM   1253 C CG    . ARG C 3 62  ? 148.316 105.610 127.512 1.00 35.13  ? 81  ARG A CG    1 
ATOM   1254 C CD    . ARG C 3 62  ? 148.683 104.718 128.690 1.00 28.25  ? 81  ARG A CD    1 
ATOM   1255 N NE    . ARG C 3 62  ? 147.709 104.772 129.775 1.00 39.18  ? 81  ARG A NE    1 
ATOM   1256 C CZ    . ARG C 3 62  ? 146.691 103.929 129.901 1.00 38.40  ? 81  ARG A CZ    1 
ATOM   1257 N NH1   . ARG C 3 62  ? 146.507 102.970 129.011 1.00 28.81  ? 81  ARG A NH1   1 
ATOM   1258 N NH2   . ARG C 3 62  ? 145.864 104.033 130.927 1.00 36.73  ? 81  ARG A NH2   1 
ATOM   1259 N N     . GLY C 3 63  ? 147.429 106.084 123.352 1.00 30.83  ? 82  GLY A N     1 
ATOM   1260 C CA    . GLY C 3 63  ? 146.469 105.529 122.414 1.00 33.00  ? 82  GLY A CA    1 
ATOM   1261 C C     . GLY C 3 63  ? 145.029 105.420 122.906 1.00 35.67  ? 82  GLY A C     1 
ATOM   1262 O O     . GLY C 3 63  ? 144.250 104.720 122.306 1.00 36.74  ? 82  GLY A O     1 
ATOM   1263 N N     . LEU C 3 64  ? 144.664 106.109 123.975 1.00 28.56  ? 83  LEU A N     1 
ATOM   1264 C CA    . LEU C 3 64  ? 143.288 105.994 124.432 1.00 28.58  ? 83  LEU A CA    1 
ATOM   1265 C C     . LEU C 3 64  ? 142.296 106.821 123.605 1.00 35.25  ? 83  LEU A C     1 
ATOM   1266 O O     . LEU C 3 64  ? 142.683 107.845 122.997 1.00 33.68  ? 83  LEU A O     1 
ATOM   1267 C CB    . LEU C 3 64  ? 143.159 106.284 125.920 1.00 28.41  ? 83  LEU A CB    1 
ATOM   1268 C CG    . LEU C 3 64  ? 143.974 105.358 126.832 1.00 33.04  ? 83  LEU A CG    1 
ATOM   1269 C CD1   . LEU C 3 64  ? 143.716 105.675 128.301 1.00 31.67  ? 83  LEU A CD1   1 
ATOM   1270 C CD2   . LEU C 3 64  ? 143.769 103.878 126.518 1.00 32.06  ? 83  LEU A CD2   1 
ATOM   1271 N N     . ALA C 3 65  ? 141.029 106.363 123.579 1.00 30.57  ? 84  ALA A N     1 
ATOM   1272 C CA    . ALA C 3 65  ? 139.963 107.029 122.820 1.00 29.74  ? 84  ALA A CA    1 
ATOM   1273 C C     . ALA C 3 65  ? 139.544 108.297 123.512 1.00 31.77  ? 84  ALA A C     1 
ATOM   1274 O O     . ALA C 3 65  ? 139.671 108.406 124.740 1.00 34.74  ? 84  ALA A O     1 
ATOM   1275 C CB    . ALA C 3 65  ? 138.755 106.106 122.662 1.00 30.30  ? 84  ALA A CB    1 
ATOM   1276 N N     . VAL C 3 66  ? 139.015 109.243 122.742 1.00 30.59  ? 85  VAL A N     1 
ATOM   1277 C CA    . VAL C 3 66  ? 138.548 110.509 123.311 1.00 31.48  ? 85  VAL A CA    1 
ATOM   1278 C C     . VAL C 3 66  ? 137.504 110.250 124.406 1.00 30.79  ? 85  VAL A C     1 
ATOM   1279 O O     . VAL C 3 66  ? 137.562 110.848 125.476 1.00 31.83  ? 85  VAL A O     1 
ATOM   1280 C CB    . VAL C 3 66  ? 137.982 111.465 122.223 1.00 37.28  ? 85  VAL A CB    1 
ATOM   1281 C CG1   . VAL C 3 66  ? 137.170 112.569 122.856 1.00 37.17  ? 85  VAL A CG1   1 
ATOM   1282 C CG2   . VAL C 3 66  ? 139.121 112.045 121.392 1.00 37.46  ? 85  VAL A CG2   1 
ATOM   1283 N N     . LYS C 3 67  ? 136.572 109.335 124.158 1.00 28.62  ? 86  LYS A N     1 
ATOM   1284 C CA    . LYS C 3 67  ? 135.574 109.048 125.180 1.00 29.98  ? 86  LYS A CA    1 
ATOM   1285 C C     . LYS C 3 67  ? 136.221 108.541 126.484 1.00 31.85  ? 86  LYS A C     1 
ATOM   1286 O O     . LYS C 3 67  ? 135.758 108.849 127.577 1.00 32.19  ? 86  LYS A O     1 
ATOM   1287 C CB    . LYS C 3 67  ? 134.540 108.070 124.631 1.00 30.74  ? 86  LYS A CB    1 
ATOM   1288 C CG    . LYS C 3 67  ? 133.306 108.708 124.078 1.00 40.54  ? 86  LYS A CG    1 
ATOM   1289 C CD    . LYS C 3 67  ? 132.443 107.639 123.452 1.00 67.30  ? 86  LYS A CD    1 
ATOM   1290 C CE    . LYS C 3 67  ? 132.234 107.814 121.985 1.00 64.90  ? 86  LYS A CE    1 
ATOM   1291 N NZ    . LYS C 3 67  ? 131.624 106.567 121.495 1.00 84.61  ? 86  LYS A NZ    1 
ATOM   1292 N N     . THR C 3 68  ? 137.324 107.803 126.355 1.00 27.84  ? 87  THR A N     1 
ATOM   1293 C CA    . THR C 3 68  ? 138.047 107.307 127.519 1.00 28.05  ? 87  THR A CA    1 
ATOM   1294 C C     . THR C 3 68  ? 138.687 108.464 128.287 1.00 32.49  ? 87  THR A C     1 
ATOM   1295 O O     . THR C 3 68  ? 138.601 108.546 129.530 1.00 28.76  ? 87  THR A O     1 
ATOM   1296 C CB    . THR C 3 68  ? 139.132 106.347 127.084 1.00 34.19  ? 87  THR A CB    1 
ATOM   1297 O OG1   . THR C 3 68  ? 138.531 105.243 126.396 1.00 28.09  ? 87  THR A OG1   1 
ATOM   1298 C CG2   . THR C 3 68  ? 139.924 105.853 128.280 1.00 31.60  ? 87  THR A CG2   1 
ATOM   1299 N N     . ILE C 3 69  ? 139.336 109.364 127.543 1.00 29.89  ? 88  ILE A N     1 
ATOM   1300 C CA    . ILE C 3 69  ? 139.991 110.527 128.148 1.00 27.93  ? 88  ILE A CA    1 
ATOM   1301 C C     . ILE C 3 69  ? 138.970 111.426 128.881 1.00 33.42  ? 88  ILE A C     1 
ATOM   1302 O O     . ILE C 3 69  ? 139.243 111.915 130.004 1.00 30.50  ? 88  ILE A O     1 
ATOM   1303 C CB    . ILE C 3 69  ? 140.842 111.305 127.071 1.00 30.67  ? 88  ILE A CB    1 
ATOM   1304 C CG1   . ILE C 3 69  ? 141.891 110.361 126.471 1.00 30.44  ? 88  ILE A CG1   1 
ATOM   1305 C CG2   . ILE C 3 69  ? 141.537 112.511 127.685 1.00 33.32  ? 88  ILE A CG2   1 
ATOM   1306 C CD1   . ILE C 3 69  ? 142.580 110.870 125.218 1.00 27.47  ? 88  ILE A CD1   1 
ATOM   1307 N N     . GLN C 3 70  ? 137.800 111.636 128.234 1.00 32.57  ? 89  GLN A N     1 
ATOM   1308 C CA    . GLN C 3 70  ? 136.675 112.439 128.772 1.00 31.66  ? 89  GLN A CA    1 
ATOM   1309 C C     . GLN C 3 70  ? 136.230 111.768 130.073 1.00 35.05  ? 89  GLN A C     1 
ATOM   1310 O O     . GLN C 3 70  ? 135.968 112.442 131.094 1.00 33.81  ? 89  GLN A O     1 
ATOM   1311 C CB    . GLN C 3 70  ? 135.506 112.522 127.764 1.00 33.53  ? 89  GLN A CB    1 
ATOM   1312 C CG    . GLN C 3 70  ? 135.699 113.548 126.601 1.00 48.49  ? 89  GLN A CG    1 
ATOM   1313 C CD    . GLN C 3 70  ? 134.637 113.443 125.454 1.00 75.34  ? 89  GLN A CD    1 
ATOM   1314 O OE1   . GLN C 3 70  ? 134.545 114.338 124.586 1.00 66.07  ? 89  GLN A OE1   1 
ATOM   1315 N NE2   . GLN C 3 70  ? 133.856 112.366 125.449 1.00 53.55  ? 89  GLN A NE2   1 
ATOM   1316 N N     . GLN C 3 71  ? 136.218 110.432 130.069 1.00 32.92  ? 90  GLN A N     1 
ATOM   1317 C CA    . GLN C 3 71  ? 135.855 109.695 131.280 1.00 33.50  ? 90  GLN A CA    1 
ATOM   1318 C C     . GLN C 3 71  ? 136.764 110.031 132.487 1.00 39.81  ? 90  GLN A C     1 
ATOM   1319 O O     . GLN C 3 71  ? 136.279 110.377 133.581 1.00 36.65  ? 90  GLN A O     1 
ATOM   1320 C CB    . GLN C 3 71  ? 135.845 108.189 131.021 1.00 34.93  ? 90  GLN A CB    1 
ATOM   1321 C CG    . GLN C 3 71  ? 135.580 107.343 132.280 1.00 41.84  ? 90  GLN A CG    1 
ATOM   1322 C CD    . GLN C 3 71  ? 134.116 107.304 132.622 1.00 61.02  ? 90  GLN A CD    1 
ATOM   1323 O OE1   . GLN C 3 71  ? 133.572 108.242 133.235 1.00 47.62  ? 90  GLN A OE1   1 
ATOM   1324 N NE2   . GLN C 3 71  ? 133.443 106.280 132.142 1.00 56.10  ? 90  GLN A NE2   1 
ATOM   1325 N N     . HIS C 3 72  ? 138.080 109.926 132.281 1.00 35.20  ? 91  HIS A N     1 
ATOM   1326 C CA    . HIS C 3 72  ? 139.051 110.211 133.342 1.00 29.73  ? 91  HIS A CA    1 
ATOM   1327 C C     . HIS C 3 72  ? 138.916 111.657 133.783 1.00 31.23  ? 91  HIS A C     1 
ATOM   1328 O O     . HIS C 3 72  ? 138.957 111.967 134.953 1.00 36.63  ? 91  HIS A O     1 
ATOM   1329 C CB    . HIS C 3 72  ? 140.500 109.961 132.853 1.00 28.65  ? 91  HIS A CB    1 
ATOM   1330 C CG    . HIS C 3 72  ? 140.853 108.511 132.689 1.00 27.77  ? 91  HIS A CG    1 
ATOM   1331 N ND1   . HIS C 3 72  ? 141.831 107.901 133.442 1.00 27.04  ? 91  HIS A ND1   1 
ATOM   1332 C CD2   . HIS C 3 72  ? 140.373 107.561 131.846 1.00 26.66  ? 91  HIS A CD2   1 
ATOM   1333 C CE1   . HIS C 3 72  ? 141.926 106.630 133.084 1.00 27.42  ? 91  HIS A CE1   1 
ATOM   1334 N NE2   . HIS C 3 72  ? 141.032 106.390 132.139 1.00 26.96  ? 91  HIS A NE2   1 
ATOM   1335 N N     . LEU C 3 73  ? 138.772 112.554 132.838 1.00 30.13  ? 92  LEU A N     1 
ATOM   1336 C CA    . LEU C 3 73  ? 138.620 113.953 133.228 1.00 32.39  ? 92  LEU A CA    1 
ATOM   1337 C C     . LEU C 3 73  ? 137.337 114.055 134.042 1.00 40.55  ? 92  LEU A C     1 
ATOM   1338 O O     . LEU C 3 73  ? 137.288 114.775 135.036 1.00 38.52  ? 92  LEU A O     1 
ATOM   1339 C CB    . LEU C 3 73  ? 138.519 114.871 131.987 1.00 32.62  ? 92  LEU A CB    1 
ATOM   1340 C CG    . LEU C 3 73  ? 138.162 116.345 132.264 1.00 35.01  ? 92  LEU A CG    1 
ATOM   1341 C CD1   . LEU C 3 73  ? 139.047 116.940 133.378 1.00 36.04  ? 92  LEU A CD1   1 
ATOM   1342 C CD2   . LEU C 3 73  ? 138.249 117.159 130.997 1.00 29.68  ? 92  LEU A CD2   1 
ATOM   1343 N N     . GLY C 3 74  ? 136.292 113.347 133.574 1.00 40.45  ? 93  GLY A N     1 
ATOM   1344 C CA    . GLY C 3 74  ? 134.962 113.342 134.204 1.00 38.63  ? 93  GLY A CA    1 
ATOM   1345 C C     . GLY C 3 74  ? 135.014 112.981 135.689 1.00 41.33  ? 93  GLY A C     1 
ATOM   1346 O O     . GLY C 3 74  ? 134.516 113.701 136.534 1.00 43.48  ? 93  GLY A O     1 
ATOM   1347 N N     . GLN C 3 75  ? 135.632 111.862 135.999 1.00 38.68  ? 94  GLN A N     1 
ATOM   1348 C CA    . GLN C 3 75  ? 135.760 111.443 137.380 1.00 38.48  ? 94  GLN A CA    1 
ATOM   1349 C C     . GLN C 3 75  ? 136.561 112.422 138.231 1.00 47.11  ? 94  GLN A C     1 
ATOM   1350 O O     . GLN C 3 75  ? 136.250 112.652 139.404 1.00 45.85  ? 94  GLN A O     1 
ATOM   1351 C CB    . GLN C 3 75  ? 136.394 110.060 137.420 1.00 38.93  ? 94  GLN A CB    1 
ATOM   1352 C CG    . GLN C 3 75  ? 135.636 109.083 136.533 1.00 42.06  ? 94  GLN A CG    1 
ATOM   1353 C CD    . GLN C 3 75  ? 134.219 108.841 137.058 1.00 65.26  ? 94  GLN A CD    1 
ATOM   1354 O OE1   . GLN C 3 75  ? 133.971 108.911 138.266 1.00 58.17  ? 94  GLN A OE1   1 
ATOM   1355 N NE2   . GLN C 3 75  ? 133.296 108.533 136.157 1.00 45.54  ? 94  GLN A NE2   1 
ATOM   1356 N N     . LEU C 3 76  ? 137.606 112.985 137.636 1.00 46.34  ? 95  LEU A N     1 
ATOM   1357 C CA    . LEU C 3 76  ? 138.464 113.922 138.349 1.00 45.19  ? 95  LEU A CA    1 
ATOM   1358 C C     . LEU C 3 76  ? 137.626 115.110 138.737 1.00 49.14  ? 95  LEU A C     1 
ATOM   1359 O O     . LEU C 3 76  ? 137.703 115.598 139.851 1.00 47.66  ? 95  LEU A O     1 
ATOM   1360 C CB    . LEU C 3 76  ? 139.635 114.372 137.462 1.00 42.83  ? 95  LEU A CB    1 
ATOM   1361 C CG    . LEU C 3 76  ? 140.709 113.315 137.195 1.00 44.35  ? 95  LEU A CG    1 
ATOM   1362 C CD1   . LEU C 3 76  ? 141.915 113.946 136.487 1.00 42.66  ? 95  LEU A CD1   1 
ATOM   1363 C CD2   . LEU C 3 76  ? 141.110 112.597 138.482 1.00 40.79  ? 95  LEU A CD2   1 
ATOM   1364 N N     . ASN C 3 77  ? 136.836 115.587 137.784 1.00 49.01  ? 96  ASN A N     1 
ATOM   1365 C CA    . ASN C 3 77  ? 135.962 116.717 138.033 1.00 50.02  ? 96  ASN A CA    1 
ATOM   1366 C C     . ASN C 3 77  ? 135.036 116.339 139.185 1.00 62.12  ? 96  ASN A C     1 
ATOM   1367 O O     . ASN C 3 77  ? 134.802 117.133 140.099 1.00 62.80  ? 96  ASN A O     1 
ATOM   1368 C CB    . ASN C 3 77  ? 135.127 116.998 136.800 1.00 41.69  ? 96  ASN A CB    1 
ATOM   1369 C CG    . ASN C 3 77  ? 135.872 117.765 135.774 1.00 53.34  ? 96  ASN A CG    1 
ATOM   1370 O OD1   . ASN C 3 77  ? 136.822 118.489 136.087 1.00 53.92  ? 96  ASN A OD1   1 
ATOM   1371 N ND2   . ASN C 3 77  ? 135.441 117.643 134.529 1.00 41.97  ? 96  ASN A ND2   1 
ATOM   1372 N N     . MET C 3 78  ? 134.505 115.121 139.132 1.00 62.17  ? 97  MET A N     1 
ATOM   1373 C CA    . MET C 3 78  ? 133.616 114.672 140.175 1.00 64.91  ? 97  MET A CA    1 
ATOM   1374 C C     . MET C 3 78  ? 134.361 114.705 141.503 1.00 69.36  ? 97  MET A C     1 
ATOM   1375 O O     . MET C 3 78  ? 134.229 115.663 142.261 1.00 71.27  ? 97  MET A O     1 
ATOM   1376 C CB    . MET C 3 78  ? 133.062 113.287 139.879 1.00 69.24  ? 97  MET A CB    1 
ATOM   1377 C CG    . MET C 3 78  ? 131.613 113.104 140.319 1.00 77.19  ? 97  MET A CG    1 
ATOM   1378 S SD    . MET C 3 78  ? 131.219 111.399 140.812 1.00 86.49  ? 97  MET A SD    1 
ATOM   1379 C CE    . MET C 3 78  ? 131.236 110.558 139.187 1.00 83.93  ? 97  MET A CE    1 
ATOM   1380 N N     . LEU C 3 79  ? 135.173 113.691 141.776 1.00 64.79  ? 98  LEU A N     1 
ATOM   1381 C CA    . LEU C 3 79  ? 135.948 113.673 143.018 1.00 66.62  ? 98  LEU A CA    1 
ATOM   1382 C C     . LEU C 3 79  ? 136.007 115.102 143.589 1.00 72.20  ? 98  LEU A C     1 
ATOM   1383 O O     . LEU C 3 79  ? 135.658 115.365 144.738 1.00 73.60  ? 98  LEU A O     1 
ATOM   1384 C CB    . LEU C 3 79  ? 137.380 113.218 142.712 1.00 67.26  ? 98  LEU A CB    1 
ATOM   1385 C CG    . LEU C 3 79  ? 138.037 112.161 143.599 1.00 72.40  ? 98  LEU A CG    1 
ATOM   1386 C CD1   . LEU C 3 79  ? 139.540 112.413 143.714 1.00 71.62  ? 98  LEU A CD1   1 
ATOM   1387 C CD2   . LEU C 3 79  ? 137.366 112.098 144.960 1.00 71.49  ? 98  LEU A CD2   1 
ATOM   1388 N N     . HIS C 3 80  ? 136.479 116.015 142.760 1.00 64.12  ? 99  HIS A N     1 
ATOM   1389 C CA    . HIS C 3 80  ? 136.617 117.398 143.131 1.00 63.05  ? 99  HIS A CA    1 
ATOM   1390 C C     . HIS C 3 80  ? 135.297 118.140 143.359 1.00 68.30  ? 99  HIS A C     1 
ATOM   1391 O O     . HIS C 3 80  ? 135.171 118.879 144.332 1.00 69.56  ? 99  HIS A O     1 
ATOM   1392 C CB    . HIS C 3 80  ? 137.469 118.124 142.074 1.00 63.95  ? 99  HIS A CB    1 
ATOM   1393 C CG    . HIS C 3 80  ? 138.897 117.678 142.055 1.00 66.51  ? 99  HIS A CG    1 
ATOM   1394 N ND1   . HIS C 3 80  ? 139.947 118.559 141.989 1.00 67.68  ? 99  HIS A ND1   1 
ATOM   1395 C CD2   . HIS C 3 80  ? 139.447 116.447 142.168 1.00 68.01  ? 99  HIS A CD2   1 
ATOM   1396 C CE1   . HIS C 3 80  ? 141.084 117.899 142.049 1.00 67.51  ? 99  HIS A CE1   1 
ATOM   1397 N NE2   . HIS C 3 80  ? 140.809 116.617 142.154 1.00 68.39  ? 99  HIS A NE2   1 
ATOM   1398 N N     . ARG C 3 81  ? 134.332 117.993 142.457 1.00 64.30  ? 100 ARG A N     1 
ATOM   1399 C CA    . ARG C 3 81  ? 133.067 118.696 142.635 1.00 63.96  ? 100 ARG A CA    1 
ATOM   1400 C C     . ARG C 3 81  ? 132.455 118.416 144.023 1.00 71.88  ? 100 ARG A C     1 
ATOM   1401 O O     . ARG C 3 81  ? 131.950 119.330 144.683 1.00 75.20  ? 100 ARG A O     1 
ATOM   1402 C CB    . ARG C 3 81  ? 132.073 118.364 141.513 1.00 59.71  ? 100 ARG A CB    1 
ATOM   1403 C CG    . ARG C 3 81  ? 130.984 119.411 141.314 1.00 58.70  ? 100 ARG A CG    1 
ATOM   1404 C CD    . ARG C 3 81  ? 129.943 118.972 140.295 1.00 80.79  ? 100 ARG A CD    1 
ATOM   1405 N NE    . ARG C 3 81  ? 129.195 117.797 140.735 1.00 94.96  ? 100 ARG A NE    1 
ATOM   1406 C CZ    . ARG C 3 81  ? 128.970 116.732 139.971 1.00 100.00 ? 100 ARG A CZ    1 
ATOM   1407 N NH1   . ARG C 3 81  ? 129.422 116.703 138.727 1.00 85.58  ? 100 ARG A NH1   1 
ATOM   1408 N NH2   . ARG C 3 81  ? 128.294 115.700 140.441 1.00 100.00 ? 100 ARG A NH2   1 
ATOM   1409 N N     . ARG C 3 82  ? 132.542 117.163 144.473 1.00 65.92  ? 101 ARG A N     1 
ATOM   1410 C CA    . ARG C 3 82  ? 131.996 116.755 145.765 1.00 66.72  ? 101 ARG A CA    1 
ATOM   1411 C C     . ARG C 3 82  ? 132.575 117.404 147.022 1.00 82.27  ? 101 ARG A C     1 
ATOM   1412 O O     . ARG C 3 82  ? 131.895 117.468 148.041 1.00 89.57  ? 101 ARG A O     1 
ATOM   1413 C CB    . ARG C 3 82  ? 132.002 115.245 145.921 1.00 61.86  ? 101 ARG A CB    1 
ATOM   1414 C CG    . ARG C 3 82  ? 131.385 114.507 144.745 1.00 79.53  ? 101 ARG A CG    1 
ATOM   1415 C CD    . ARG C 3 82  ? 129.974 114.002 145.046 1.00 100.00 ? 101 ARG A CD    1 
ATOM   1416 N NE    . ARG C 3 82  ? 129.839 113.483 146.403 1.00 100.00 ? 101 ARG A NE    1 
ATOM   1417 C CZ    . ARG C 3 82  ? 128.686 113.418 147.064 1.00 100.00 ? 101 ARG A CZ    1 
ATOM   1418 N NH1   . ARG C 3 82  ? 127.556 113.831 146.495 1.00 100.00 ? 101 ARG A NH1   1 
ATOM   1419 N NH2   . ARG C 3 82  ? 128.666 112.946 148.305 1.00 100.00 ? 101 ARG A NH2   1 
ATOM   1420 N N     . SER C 3 83  ? 133.833 117.824 146.983 1.00 79.00  ? 102 SER A N     1 
ATOM   1421 C CA    . SER C 3 83  ? 134.436 118.462 148.144 1.00 76.46  ? 102 SER A CA    1 
ATOM   1422 C C     . SER C 3 83  ? 134.556 119.928 147.835 1.00 78.76  ? 102 SER A C     1 
ATOM   1423 O O     . SER C 3 83  ? 135.503 120.583 148.257 1.00 80.39  ? 102 SER A O     1 
ATOM   1424 C CB    . SER C 3 83  ? 135.829 117.884 148.421 1.00 79.75  ? 102 SER A CB    1 
ATOM   1425 O OG    . SER C 3 83  ? 135.982 116.588 147.848 1.00 87.08  ? 102 SER A OG    1 
ATOM   1426 N N     . GLY C 3 84  ? 133.604 120.433 147.063 1.00 74.29  ? 103 GLY A N     1 
ATOM   1427 C CA    . GLY C 3 84  ? 133.588 121.843 146.692 1.00 74.47  ? 103 GLY A CA    1 
ATOM   1428 C C     . GLY C 3 84  ? 134.971 122.432 146.435 1.00 77.85  ? 103 GLY A C     1 
ATOM   1429 O O     . GLY C 3 84  ? 135.515 123.144 147.284 1.00 77.61  ? 103 GLY A O     1 
ATOM   1430 N N     . LEU C 3 85  ? 135.515 122.130 145.253 1.00 72.73  ? 104 LEU A N     1 
ATOM   1431 C CA    . LEU C 3 85  ? 136.805 122.642 144.788 1.00 67.62  ? 104 LEU A CA    1 
ATOM   1432 C C     . LEU C 3 85  ? 136.638 122.868 143.285 1.00 76.22  ? 104 LEU A C     1 
ATOM   1433 O O     . LEU C 3 85  ? 135.979 122.069 142.609 1.00 79.67  ? 104 LEU A O     1 
ATOM   1434 C CB    . LEU C 3 85  ? 137.881 121.600 145.026 1.00 64.41  ? 104 LEU A CB    1 
ATOM   1435 C CG    . LEU C 3 85  ? 138.197 121.339 146.486 1.00 67.19  ? 104 LEU A CG    1 
ATOM   1436 C CD1   . LEU C 3 85  ? 138.583 119.894 146.730 1.00 64.80  ? 104 LEU A CD1   1 
ATOM   1437 C CD2   . LEU C 3 85  ? 139.296 122.271 146.931 1.00 75.41  ? 104 LEU A CD2   1 
ATOM   1438 N N     . PRO C 3 86  ? 137.187 123.956 142.757 1.00 70.81  ? 105 PRO A N     1 
ATOM   1439 C CA    . PRO C 3 86  ? 137.072 124.202 141.319 1.00 69.66  ? 105 PRO A CA    1 
ATOM   1440 C C     . PRO C 3 86  ? 137.403 122.884 140.608 1.00 72.95  ? 105 PRO A C     1 
ATOM   1441 O O     . PRO C 3 86  ? 138.404 122.228 140.920 1.00 73.69  ? 105 PRO A O     1 
ATOM   1442 C CB    . PRO C 3 86  ? 138.161 125.239 141.040 1.00 70.65  ? 105 PRO A CB    1 
ATOM   1443 C CG    . PRO C 3 86  ? 138.594 125.734 142.387 1.00 77.26  ? 105 PRO A CG    1 
ATOM   1444 C CD    . PRO C 3 86  ? 138.362 124.612 143.333 1.00 72.04  ? 105 PRO A CD    1 
ATOM   1445 N N     . ARG C 3 87  ? 136.531 122.470 139.701 1.00 66.76  ? 106 ARG A N     1 
ATOM   1446 C CA    . ARG C 3 87  ? 136.735 121.226 138.979 1.00 64.50  ? 106 ARG A CA    1 
ATOM   1447 C C     . ARG C 3 87  ? 137.906 121.421 138.050 1.00 63.51  ? 106 ARG A C     1 
ATOM   1448 O O     . ARG C 3 87  ? 138.027 122.480 137.427 1.00 59.07  ? 106 ARG A O     1 
ATOM   1449 C CB    . ARG C 3 87  ? 135.512 120.930 138.116 1.00 65.14  ? 106 ARG A CB    1 
ATOM   1450 C CG    . ARG C 3 87  ? 134.505 120.017 138.746 1.00 71.09  ? 106 ARG A CG    1 
ATOM   1451 C CD    . ARG C 3 87  ? 133.146 120.350 138.227 1.00 68.13  ? 106 ARG A CD    1 
ATOM   1452 N NE    . ARG C 3 87  ? 133.101 120.532 136.780 1.00 54.12  ? 106 ARG A NE    1 
ATOM   1453 C CZ    . ARG C 3 87  ? 133.396 121.659 136.132 1.00 54.30  ? 106 ARG A CZ    1 
ATOM   1454 N NH1   . ARG C 3 87  ? 133.842 122.712 136.778 1.00 53.54  ? 106 ARG A NH1   1 
ATOM   1455 N NH2   . ARG C 3 87  ? 133.278 121.705 134.823 1.00 54.11  ? 106 ARG A NH2   1 
ATOM   1456 N N     . PRO C 3 88  ? 138.750 120.393 137.917 1.00 58.76  ? 107 PRO A N     1 
ATOM   1457 C CA    . PRO C 3 88  ? 139.881 120.513 137.012 1.00 55.98  ? 107 PRO A CA    1 
ATOM   1458 C C     . PRO C 3 88  ? 139.449 121.104 135.672 1.00 54.61  ? 107 PRO A C     1 
ATOM   1459 O O     . PRO C 3 88  ? 140.147 121.947 135.115 1.00 55.16  ? 107 PRO A O     1 
ATOM   1460 C CB    . PRO C 3 88  ? 140.359 119.076 136.867 1.00 56.93  ? 107 PRO A CB    1 
ATOM   1461 C CG    . PRO C 3 88  ? 140.143 118.501 138.253 1.00 60.30  ? 107 PRO A CG    1 
ATOM   1462 C CD    . PRO C 3 88  ? 138.887 119.204 138.793 1.00 57.55  ? 107 PRO A CD    1 
ATOM   1463 N N     . SER C 3 89  ? 138.281 120.707 135.181 1.00 46.92  ? 108 SER A N     1 
ATOM   1464 C CA    . SER C 3 89  ? 137.807 121.231 133.910 1.00 45.81  ? 108 SER A CA    1 
ATOM   1465 C C     . SER C 3 89  ? 137.621 122.737 133.840 1.00 59.68  ? 108 SER A C     1 
ATOM   1466 O O     . SER C 3 89  ? 137.623 123.297 132.746 1.00 61.45  ? 108 SER A O     1 
ATOM   1467 C CB    . SER C 3 89  ? 136.517 120.547 133.472 1.00 46.43  ? 108 SER A CB    1 
ATOM   1468 O OG    . SER C 3 89  ? 136.740 119.200 133.142 1.00 61.31  ? 108 SER A OG    1 
ATOM   1469 N N     . ASP C 3 90  ? 137.394 123.399 134.973 1.00 63.98  ? 109 ASP A N     1 
ATOM   1470 C CA    . ASP C 3 90  ? 137.191 124.845 134.919 1.00 69.10  ? 109 ASP A CA    1 
ATOM   1471 C C     . ASP C 3 90  ? 138.456 125.674 134.906 1.00 77.62  ? 109 ASP A C     1 
ATOM   1472 O O     . ASP C 3 90  ? 138.413 126.911 134.955 1.00 78.66  ? 109 ASP A O     1 
ATOM   1473 C CB    . ASP C 3 90  ? 136.171 125.347 135.918 1.00 72.77  ? 109 ASP A CB    1 
ATOM   1474 C CG    . ASP C 3 90  ? 134.920 125.879 135.247 1.00 96.85  ? 109 ASP A CG    1 
ATOM   1475 O OD1   . ASP C 3 90  ? 135.010 126.923 134.558 1.00 100.00 ? 109 ASP A OD1   1 
ATOM   1476 O OD2   . ASP C 3 90  ? 133.861 125.231 135.386 1.00 100.00 ? 109 ASP A OD2   1 
ATOM   1477 N N     . SER C 3 91  ? 139.576 124.972 134.795 1.00 74.74  ? 110 SER A N     1 
ATOM   1478 C CA    . SER C 3 91  ? 140.888 125.567 134.662 1.00 71.98  ? 110 SER A CA    1 
ATOM   1479 C C     . SER C 3 91  ? 140.987 125.695 133.159 1.00 67.96  ? 110 SER A C     1 
ATOM   1480 O O     . SER C 3 91  ? 140.611 124.786 132.444 1.00 70.42  ? 110 SER A O     1 
ATOM   1481 C CB    . SER C 3 91  ? 141.949 124.581 135.116 1.00 77.94  ? 110 SER A CB    1 
ATOM   1482 O OG    . SER C 3 91  ? 142.785 125.171 136.080 1.00 100.00 ? 110 SER A OG    1 
ATOM   1483 N N     . ASN C 3 92  ? 141.443 126.818 132.656 1.00 61.33  ? 111 ASN A N     1 
ATOM   1484 C CA    . ASN C 3 92  ? 141.498 126.944 131.222 1.00 60.82  ? 111 ASN A CA    1 
ATOM   1485 C C     . ASN C 3 92  ? 142.576 126.071 130.591 1.00 60.54  ? 111 ASN A C     1 
ATOM   1486 O O     . ASN C 3 92  ? 142.520 125.775 129.403 1.00 60.69  ? 111 ASN A O     1 
ATOM   1487 C CB    . ASN C 3 92  ? 141.565 128.411 130.778 1.00 74.39  ? 111 ASN A CB    1 
ATOM   1488 C CG    . ASN C 3 92  ? 142.982 128.882 130.536 1.00 100.00 ? 111 ASN A CG    1 
ATOM   1489 O OD1   . ASN C 3 92  ? 143.296 129.421 129.473 1.00 100.00 ? 111 ASN A OD1   1 
ATOM   1490 N ND2   . ASN C 3 92  ? 143.852 128.688 131.528 1.00 100.00 ? 111 ASN A ND2   1 
ATOM   1491 N N     . ALA C 3 93  ? 143.524 125.592 131.388 1.00 53.89  ? 112 ALA A N     1 
ATOM   1492 C CA    . ALA C 3 93  ? 144.561 124.718 130.829 1.00 53.46  ? 112 ALA A CA    1 
ATOM   1493 C C     . ALA C 3 93  ? 143.965 123.365 130.426 1.00 54.25  ? 112 ALA A C     1 
ATOM   1494 O O     . ALA C 3 93  ? 144.331 122.784 129.400 1.00 52.75  ? 112 ALA A O     1 
ATOM   1495 C CB    . ALA C 3 93  ? 145.719 124.532 131.808 1.00 54.67  ? 112 ALA A CB    1 
ATOM   1496 N N     . VAL C 3 94  ? 143.027 122.886 131.235 1.00 50.99  ? 113 VAL A N     1 
ATOM   1497 C CA    . VAL C 3 94  ? 142.354 121.612 130.980 1.00 51.87  ? 113 VAL A CA    1 
ATOM   1498 C C     . VAL C 3 94  ? 141.347 121.747 129.840 1.00 56.15  ? 113 VAL A C     1 
ATOM   1499 O O     . VAL C 3 94  ? 141.168 120.830 129.046 1.00 57.62  ? 113 VAL A O     1 
ATOM   1500 C CB    . VAL C 3 94  ? 141.650 121.095 132.231 1.00 56.08  ? 113 VAL A CB    1 
ATOM   1501 C CG1   . VAL C 3 94  ? 140.855 119.820 131.921 1.00 56.46  ? 113 VAL A CG1   1 
ATOM   1502 C CG2   . VAL C 3 94  ? 142.663 120.868 133.353 1.00 56.08  ? 113 VAL A CG2   1 
ATOM   1503 N N     . SER C 3 95  ? 140.727 122.917 129.743 1.00 50.92  ? 114 SER A N     1 
ATOM   1504 C CA    . SER C 3 95  ? 139.771 123.190 128.683 1.00 51.23  ? 114 SER A CA    1 
ATOM   1505 C C     . SER C 3 95  ? 140.432 123.224 127.321 1.00 51.69  ? 114 SER A C     1 
ATOM   1506 O O     . SER C 3 95  ? 139.934 122.647 126.371 1.00 55.66  ? 114 SER A O     1 
ATOM   1507 C CB    . SER C 3 95  ? 139.083 124.532 128.934 1.00 62.49  ? 114 SER A CB    1 
ATOM   1508 O OG    . SER C 3 95  ? 138.042 124.384 129.882 1.00 91.36  ? 114 SER A OG    1 
ATOM   1509 N N     . LEU C 3 96  ? 141.539 123.937 127.211 1.00 49.15  ? 115 LEU A N     1 
ATOM   1510 C CA    . LEU C 3 96  ? 142.229 124.017 125.923 1.00 50.36  ? 115 LEU A CA    1 
ATOM   1511 C C     . LEU C 3 96  ? 142.696 122.627 125.550 1.00 47.76  ? 115 LEU A C     1 
ATOM   1512 O O     . LEU C 3 96  ? 142.621 122.219 124.376 1.00 47.28  ? 115 LEU A O     1 
ATOM   1513 C CB    . LEU C 3 96  ? 143.436 124.993 125.969 1.00 51.53  ? 115 LEU A CB    1 
ATOM   1514 C CG    . LEU C 3 96  ? 144.089 125.345 124.627 1.00 54.97  ? 115 LEU A CG    1 
ATOM   1515 C CD1   . LEU C 3 96  ? 143.014 125.508 123.571 1.00 57.77  ? 115 LEU A CD1   1 
ATOM   1516 C CD2   . LEU C 3 96  ? 144.920 126.591 124.725 1.00 56.07  ? 115 LEU A CD2   1 
ATOM   1517 N N     . VAL C 3 97  ? 143.178 121.884 126.544 1.00 41.52  ? 116 VAL A N     1 
ATOM   1518 C CA    . VAL C 3 97  ? 143.655 120.550 126.239 1.00 41.45  ? 116 VAL A CA    1 
ATOM   1519 C C     . VAL C 3 97  ? 142.612 119.607 125.663 1.00 44.74  ? 116 VAL A C     1 
ATOM   1520 O O     . VAL C 3 97  ? 142.855 118.948 124.637 1.00 43.58  ? 116 VAL A O     1 
ATOM   1521 C CB    . VAL C 3 97  ? 144.516 119.882 127.333 1.00 41.15  ? 116 VAL A CB    1 
ATOM   1522 C CG1   . VAL C 3 97  ? 143.648 119.074 128.284 1.00 39.80  ? 116 VAL A CG1   1 
ATOM   1523 C CG2   . VAL C 3 97  ? 145.579 118.964 126.657 1.00 38.17  ? 116 VAL A CG2   1 
ATOM   1524 N N     . MET C 3 98  ? 141.445 119.549 126.303 1.00 41.73  ? 117 MET A N     1 
ATOM   1525 C CA    . MET C 3 98  ? 140.376 118.666 125.821 1.00 41.22  ? 117 MET A CA    1 
ATOM   1526 C C     . MET C 3 98  ? 139.950 119.033 124.403 1.00 48.99  ? 117 MET A C     1 
ATOM   1527 O O     . MET C 3 98  ? 139.621 118.174 123.588 1.00 48.84  ? 117 MET A O     1 
ATOM   1528 C CB    . MET C 3 98  ? 139.210 118.662 126.779 1.00 40.98  ? 117 MET A CB    1 
ATOM   1529 C CG    . MET C 3 98  ? 139.447 117.789 127.956 1.00 45.74  ? 117 MET A CG    1 
ATOM   1530 S SD    . MET C 3 98  ? 139.521 116.005 127.566 1.00 53.95  ? 117 MET A SD    1 
ATOM   1531 C CE    . MET C 3 98  ? 138.477 115.891 126.146 1.00 49.89  ? 117 MET A CE    1 
ATOM   1532 N N     . ARG C 3 99  ? 140.030 120.325 124.106 1.00 49.03  ? 118 ARG A N     1 
ATOM   1533 C CA    . ARG C 3 99  ? 139.707 120.862 122.799 1.00 49.06  ? 118 ARG A CA    1 
ATOM   1534 C C     . ARG C 3 99  ? 140.786 120.411 121.811 1.00 52.35  ? 118 ARG A C     1 
ATOM   1535 O O     . ARG C 3 99  ? 140.488 119.797 120.786 1.00 56.51  ? 118 ARG A O     1 
ATOM   1536 C CB    . ARG C 3 99  ? 139.634 122.398 122.889 1.00 59.03  ? 118 ARG A CB    1 
ATOM   1537 C CG    . ARG C 3 99  ? 139.854 123.144 121.573 1.00 83.83  ? 118 ARG A CG    1 
ATOM   1538 C CD    . ARG C 3 99  ? 139.140 124.483 121.584 1.00 85.94  ? 118 ARG A CD    1 
ATOM   1539 N NE    . ARG C 3 99  ? 139.309 125.165 122.860 1.00 95.24  ? 118 ARG A NE    1 
ATOM   1540 C CZ    . ARG C 3 99  ? 140.084 126.228 123.041 1.00 100.00 ? 118 ARG A CZ    1 
ATOM   1541 N NH1   . ARG C 3 99  ? 140.784 126.731 122.026 1.00 100.00 ? 118 ARG A NH1   1 
ATOM   1542 N NH2   . ARG C 3 99  ? 140.165 126.774 124.249 1.00 94.60  ? 118 ARG A NH2   1 
ATOM   1543 N N     . ARG C 3 100 ? 142.048 120.681 122.129 1.00 48.42  ? 119 ARG A N     1 
ATOM   1544 C CA    . ARG C 3 100 ? 143.110 120.246 121.235 1.00 49.74  ? 119 ARG A CA    1 
ATOM   1545 C C     . ARG C 3 100 ? 142.984 118.744 120.982 1.00 58.34  ? 119 ARG A C     1 
ATOM   1546 O O     . ARG C 3 100 ? 142.915 118.318 119.834 1.00 60.97  ? 119 ARG A O     1 
ATOM   1547 C CB    . ARG C 3 100 ? 144.488 120.586 121.798 1.00 46.80  ? 119 ARG A CB    1 
ATOM   1548 C CG    . ARG C 3 100 ? 144.884 122.062 121.651 1.00 59.98  ? 119 ARG A CG    1 
ATOM   1549 C CD    . ARG C 3 100 ? 144.066 122.780 120.586 1.00 78.07  ? 119 ARG A CD    1 
ATOM   1550 N NE    . ARG C 3 100 ? 144.619 122.592 119.246 1.00 95.68  ? 119 ARG A NE    1 
ATOM   1551 C CZ    . ARG C 3 100 ? 143.884 122.273 118.181 1.00 100.00 ? 119 ARG A CZ    1 
ATOM   1552 N NH1   . ARG C 3 100 ? 142.568 122.113 118.310 1.00 100.00 ? 119 ARG A NH1   1 
ATOM   1553 N NH2   . ARG C 3 100 ? 144.458 122.112 116.991 1.00 100.00 ? 119 ARG A NH2   1 
ATOM   1554 N N     . ILE C 3 101 ? 142.914 117.962 122.067 1.00 53.46  ? 120 ILE A N     1 
ATOM   1555 C CA    . ILE C 3 101 ? 142.792 116.490 122.004 1.00 46.74  ? 120 ILE A CA    1 
ATOM   1556 C C     . ILE C 3 101 ? 141.666 115.998 121.086 1.00 50.54  ? 120 ILE A C     1 
ATOM   1557 O O     . ILE C 3 101 ? 141.853 115.083 120.272 1.00 53.68  ? 120 ILE A O     1 
ATOM   1558 C CB    . ILE C 3 101 ? 142.632 115.879 123.415 1.00 43.81  ? 120 ILE A CB    1 
ATOM   1559 C CG1   . ILE C 3 101 ? 143.921 116.067 124.224 1.00 37.55  ? 120 ILE A CG1   1 
ATOM   1560 C CG2   . ILE C 3 101 ? 142.273 114.401 123.305 1.00 46.88  ? 120 ILE A CG2   1 
ATOM   1561 C CD1   . ILE C 3 101 ? 143.861 115.491 125.595 1.00 36.11  ? 120 ILE A CD1   1 
ATOM   1562 N N     . ARG C 3 102 ? 140.509 116.624 121.207 1.00 47.13  ? 121 ARG A N     1 
ATOM   1563 C CA    . ARG C 3 102 ? 139.366 116.255 120.384 1.00 52.25  ? 121 ARG A CA    1 
ATOM   1564 C C     . ARG C 3 102 ? 139.628 116.501 118.919 1.00 62.52  ? 121 ARG A C     1 
ATOM   1565 O O     . ARG C 3 102 ? 139.290 115.689 118.073 1.00 71.20  ? 121 ARG A O     1 
ATOM   1566 C CB    . ARG C 3 102 ? 138.135 117.059 120.780 1.00 57.30  ? 121 ARG A CB    1 
ATOM   1567 C CG    . ARG C 3 102 ? 137.434 116.514 121.962 1.00 57.01  ? 121 ARG A CG    1 
ATOM   1568 C CD    . ARG C 3 102 ? 136.081 117.115 122.101 1.00 52.68  ? 121 ARG A CD    1 
ATOM   1569 N NE    . ARG C 3 102 ? 135.613 116.893 123.446 1.00 62.72  ? 121 ARG A NE    1 
ATOM   1570 C CZ    . ARG C 3 102 ? 135.630 117.825 124.379 1.00 83.07  ? 121 ARG A CZ    1 
ATOM   1571 N NH1   . ARG C 3 102 ? 136.061 119.052 124.073 1.00 54.51  ? 121 ARG A NH1   1 
ATOM   1572 N NH2   . ARG C 3 102 ? 135.202 117.535 125.606 1.00 76.68  ? 121 ARG A NH2   1 
ATOM   1573 N N     . LYS C 3 103 ? 140.220 117.648 118.628 1.00 56.01  ? 122 LYS A N     1 
ATOM   1574 C CA    . LYS C 3 103 ? 140.521 118.032 117.256 1.00 51.70  ? 122 LYS A CA    1 
ATOM   1575 C C     . LYS C 3 103 ? 141.544 117.117 116.584 1.00 57.73  ? 122 LYS A C     1 
ATOM   1576 O O     . LYS C 3 103 ? 141.307 116.640 115.477 1.00 60.08  ? 122 LYS A O     1 
ATOM   1577 C CB    . LYS C 3 103 ? 140.984 119.485 117.217 1.00 53.33  ? 122 LYS A CB    1 
ATOM   1578 C CG    . LYS C 3 103 ? 141.563 119.924 115.895 1.00 67.71  ? 122 LYS A CG    1 
ATOM   1579 C CD    . LYS C 3 103 ? 141.411 121.427 115.682 1.00 82.56  ? 122 LYS A CD    1 
ATOM   1580 C CE    . LYS C 3 103 ? 141.033 121.703 114.242 1.00 100.00 ? 122 LYS A CE    1 
ATOM   1581 N NZ    . LYS C 3 103 ? 140.870 120.416 113.492 1.00 100.00 ? 122 LYS A NZ    1 
ATOM   1582 N N     . GLU C 3 104 ? 142.669 116.855 117.252 1.00 50.05  ? 123 GLU A N     1 
ATOM   1583 C CA    . GLU C 3 104 ? 143.665 116.001 116.656 1.00 50.18  ? 123 GLU A CA    1 
ATOM   1584 C C     . GLU C 3 104 ? 143.108 114.618 116.385 1.00 63.25  ? 123 GLU A C     1 
ATOM   1585 O O     . GLU C 3 104 ? 143.180 114.109 115.257 1.00 62.96  ? 123 GLU A O     1 
ATOM   1586 C CB    . GLU C 3 104 ? 144.902 115.890 117.529 1.00 51.18  ? 123 GLU A CB    1 
ATOM   1587 C CG    . GLU C 3 104 ? 144.851 116.609 118.830 1.00 59.25  ? 123 GLU A CG    1 
ATOM   1588 C CD    . GLU C 3 104 ? 146.173 116.493 119.567 1.00 83.69  ? 123 GLU A CD    1 
ATOM   1589 O OE1   . GLU C 3 104 ? 146.960 115.598 119.210 1.00 100.00 ? 123 GLU A OE1   1 
ATOM   1590 O OE2   . GLU C 3 104 ? 146.425 117.309 120.470 1.00 72.08  ? 123 GLU A OE2   1 
ATOM   1591 N N     . ASN C 3 105 ? 142.587 114.001 117.446 1.00 63.66  ? 124 ASN A N     1 
ATOM   1592 C CA    . ASN C 3 105 ? 142.039 112.642 117.382 1.00 61.90  ? 124 ASN A CA    1 
ATOM   1593 C C     . ASN C 3 105 ? 141.075 112.540 116.206 1.00 63.05  ? 124 ASN A C     1 
ATOM   1594 O O     . ASN C 3 105 ? 141.176 111.638 115.375 1.00 63.55  ? 124 ASN A O     1 
ATOM   1595 C CB    . ASN C 3 105 ? 141.385 112.263 118.722 1.00 48.15  ? 124 ASN A CB    1 
ATOM   1596 C CG    . ASN C 3 105 ? 142.423 111.992 119.827 1.00 92.05  ? 124 ASN A CG    1 
ATOM   1597 O OD1   . ASN C 3 105 ? 142.330 110.997 120.564 1.00 86.42  ? 124 ASN A OD1   1 
ATOM   1598 N ND2   . ASN C 3 105 ? 143.424 112.866 119.928 1.00 91.31  ? 124 ASN A ND2   1 
ATOM   1599 N N     . VAL C 3 106 ? 140.196 113.525 116.099 1.00 56.13  ? 125 VAL A N     1 
ATOM   1600 C CA    . VAL C 3 106 ? 139.259 113.590 114.989 1.00 58.10  ? 125 VAL A CA    1 
ATOM   1601 C C     . VAL C 3 106 ? 140.037 113.680 113.660 1.00 73.45  ? 125 VAL A C     1 
ATOM   1602 O O     . VAL C 3 106 ? 139.914 112.804 112.791 1.00 75.71  ? 125 VAL A O     1 
ATOM   1603 C CB    . VAL C 3 106 ? 138.314 114.825 115.130 1.00 58.50  ? 125 VAL A CB    1 
ATOM   1604 C CG1   . VAL C 3 106 ? 138.023 115.469 113.778 1.00 56.86  ? 125 VAL A CG1   1 
ATOM   1605 C CG2   . VAL C 3 106 ? 137.041 114.437 115.823 1.00 57.09  ? 125 VAL A CG2   1 
ATOM   1606 N N     . ASP C 3 107 ? 140.856 114.719 113.513 1.00 73.85  ? 126 ASP A N     1 
ATOM   1607 C CA    . ASP C 3 107 ? 141.644 114.891 112.292 1.00 73.80  ? 126 ASP A CA    1 
ATOM   1608 C C     . ASP C 3 107 ? 142.478 113.652 112.016 1.00 74.21  ? 126 ASP A C     1 
ATOM   1609 O O     . ASP C 3 107 ? 142.982 113.461 110.913 1.00 74.54  ? 126 ASP A O     1 
ATOM   1610 C CB    . ASP C 3 107 ? 142.523 116.145 112.377 1.00 77.38  ? 126 ASP A CB    1 
ATOM   1611 C CG    . ASP C 3 107 ? 141.703 117.424 112.560 1.00 98.73  ? 126 ASP A CG    1 
ATOM   1612 O OD1   . ASP C 3 107 ? 140.624 117.554 111.928 1.00 100.00 ? 126 ASP A OD1   1 
ATOM   1613 O OD2   . ASP C 3 107 ? 142.150 118.304 113.331 1.00 100.00 ? 126 ASP A OD2   1 
ATOM   1614 N N     . ALA C 3 108 ? 142.594 112.797 113.024 1.00 69.72  ? 127 ALA A N     1 
ATOM   1615 C CA    . ALA C 3 108 ? 143.330 111.552 112.911 1.00 67.90  ? 127 ALA A CA    1 
ATOM   1616 C C     . ALA C 3 108 ? 142.376 110.496 112.389 1.00 72.40  ? 127 ALA A C     1 
ATOM   1617 O O     . ALA C 3 108 ? 142.708 109.312 112.328 1.00 75.92  ? 127 ALA A O     1 
ATOM   1618 C CB    . ALA C 3 108 ? 143.876 111.141 114.276 1.00 67.77  ? 127 ALA A CB    1 
ATOM   1619 N N     . GLY C 3 109 ? 141.171 110.935 112.041 1.00 65.63  ? 128 GLY A N     1 
ATOM   1620 C CA    . GLY C 3 109 ? 140.140 110.040 111.533 1.00 65.28  ? 128 GLY A CA    1 
ATOM   1621 C C     . GLY C 3 109 ? 139.482 109.190 112.626 1.00 66.37  ? 128 GLY A C     1 
ATOM   1622 O O     . GLY C 3 109 ? 138.707 108.284 112.337 1.00 70.11  ? 128 GLY A O     1 
ATOM   1623 N N     . GLU C 3 110 ? 139.786 109.474 113.881 1.00 55.28  ? 129 GLU A N     1 
ATOM   1624 C CA    . GLU C 3 110 ? 139.173 108.709 114.948 1.00 51.34  ? 129 GLU A CA    1 
ATOM   1625 C C     . GLU C 3 110 ? 137.697 109.057 115.130 1.00 55.61  ? 129 GLU A C     1 
ATOM   1626 O O     . GLU C 3 110 ? 137.303 110.217 115.028 1.00 58.03  ? 129 GLU A O     1 
ATOM   1627 C CB    . GLU C 3 110 ? 139.961 108.823 116.230 1.00 51.89  ? 129 GLU A CB    1 
ATOM   1628 C CG    . GLU C 3 110 ? 141.212 107.990 116.163 1.00 71.27  ? 129 GLU A CG    1 
ATOM   1629 C CD    . GLU C 3 110 ? 141.061 106.809 115.202 1.00 100.00 ? 129 GLU A CD    1 
ATOM   1630 O OE1   . GLU C 3 110 ? 140.302 105.865 115.536 1.00 100.00 ? 129 GLU A OE1   1 
ATOM   1631 O OE2   . GLU C 3 110 ? 141.693 106.829 114.119 1.00 100.00 ? 129 GLU A OE2   1 
ATOM   1632 N N     . ARG C 3 111 ? 136.881 108.021 115.316 1.00 47.20  ? 130 ARG A N     1 
ATOM   1633 C CA    . ARG C 3 111 ? 135.430 108.150 115.491 1.00 42.97  ? 130 ARG A CA    1 
ATOM   1634 C C     . ARG C 3 111 ? 134.916 107.025 116.414 1.00 40.09  ? 130 ARG A C     1 
ATOM   1635 O O     . ARG C 3 111 ? 135.483 105.927 116.461 1.00 36.21  ? 130 ARG A O     1 
ATOM   1636 C CB    . ARG C 3 111 ? 134.754 108.025 114.133 1.00 42.77  ? 130 ARG A CB    1 
ATOM   1637 C CG    . ARG C 3 111 ? 135.234 109.053 113.127 1.00 62.16  ? 130 ARG A CG    1 
ATOM   1638 C CD    . ARG C 3 111 ? 134.858 110.462 113.603 1.00 100.00 ? 130 ARG A CD    1 
ATOM   1639 N NE    . ARG C 3 111 ? 134.953 111.452 112.533 1.00 100.00 ? 130 ARG A NE    1 
ATOM   1640 C CZ    . ARG C 3 111 ? 136.027 111.617 111.765 1.00 100.00 ? 130 ARG A CZ    1 
ATOM   1641 N NH1   . ARG C 3 111 ? 137.092 110.848 111.951 1.00 66.89  ? 130 ARG A NH1   1 
ATOM   1642 N NH2   . ARG C 3 111 ? 136.039 112.548 110.819 1.00 96.45  ? 130 ARG A NH2   1 
ATOM   1643 N N     . ALA C 3 112 ? 133.837 107.293 117.144 1.00 34.68  ? 131 ALA A N     1 
ATOM   1644 C CA    . ALA C 3 112 ? 133.277 106.293 118.059 1.00 32.67  ? 131 ALA A CA    1 
ATOM   1645 C C     . ALA C 3 112 ? 132.874 105.031 117.310 1.00 35.96  ? 131 ALA A C     1 
ATOM   1646 O O     . ALA C 3 112 ? 132.150 105.075 116.325 1.00 36.19  ? 131 ALA A O     1 
ATOM   1647 C CB    . ALA C 3 112 ? 132.125 106.836 118.800 1.00 31.80  ? 131 ALA A CB    1 
ATOM   1648 N N     . LYS C 3 113 ? 133.341 103.897 117.796 1.00 30.85  ? 132 LYS A N     1 
ATOM   1649 C CA    . LYS C 3 113 ? 133.001 102.622 117.198 1.00 30.82  ? 132 LYS A CA    1 
ATOM   1650 C C     . LYS C 3 113 ? 131.531 102.254 117.529 1.00 30.43  ? 132 LYS A C     1 
ATOM   1651 O O     . LYS C 3 113 ? 130.846 102.968 118.221 1.00 28.51  ? 132 LYS A O     1 
ATOM   1652 C CB    . LYS C 3 113 ? 133.933 101.533 117.745 1.00 34.77  ? 132 LYS A CB    1 
ATOM   1653 C CG    . LYS C 3 113 ? 135.285 101.382 117.032 1.00 41.57  ? 132 LYS A CG    1 
ATOM   1654 C CD    . LYS C 3 113 ? 135.648 102.596 116.262 1.00 48.81  ? 132 LYS A CD    1 
ATOM   1655 C CE    . LYS C 3 113 ? 137.151 102.807 116.307 1.00 86.85  ? 132 LYS A CE    1 
ATOM   1656 N NZ    . LYS C 3 113 ? 137.527 104.251 116.500 1.00 94.03  ? 132 LYS A NZ    1 
ATOM   1657 N N     . GLN C 3 114 ? 131.087 101.107 117.041 1.00 30.74  ? 133 GLN A N     1 
ATOM   1658 C CA    . GLN C 3 114 ? 129.735 100.624 117.283 1.00 31.40  ? 133 GLN A CA    1 
ATOM   1659 C C     . GLN C 3 114 ? 129.758 99.107  117.110 1.00 33.56  ? 133 GLN A C     1 
ATOM   1660 O O     . GLN C 3 114 ? 130.516 98.582  116.289 1.00 29.71  ? 133 GLN A O     1 
ATOM   1661 C CB    . GLN C 3 114 ? 128.741 101.268 116.293 1.00 32.92  ? 133 GLN A CB    1 
ATOM   1662 C CG    . GLN C 3 114 ? 127.294 100.857 116.508 1.00 28.86  ? 133 GLN A CG    1 
ATOM   1663 C CD    . GLN C 3 114 ? 126.277 101.839 115.940 1.00 27.95  ? 133 GLN A CD    1 
ATOM   1664 O OE1   . GLN C 3 114 ? 126.107 101.924 114.724 1.00 30.98  ? 133 GLN A OE1   1 
ATOM   1665 N NE2   . GLN C 3 114 ? 125.471 102.444 116.829 1.00 20.21  ? 133 GLN A NE2   1 
ATOM   1666 N N     . ALA C 3 115 ? 128.982 98.408  117.936 1.00 29.90  ? 134 ALA A N     1 
ATOM   1667 C CA    . ALA C 3 115 ? 128.913 96.951  117.885 1.00 28.47  ? 134 ALA A CA    1 
ATOM   1668 C C     . ALA C 3 115 ? 128.586 96.431  116.496 1.00 30.60  ? 134 ALA A C     1 
ATOM   1669 O O     . ALA C 3 115 ? 127.894 97.082  115.697 1.00 26.31  ? 134 ALA A O     1 
ATOM   1670 C CB    . ALA C 3 115 ? 127.894 96.427  118.907 1.00 28.57  ? 134 ALA A CB    1 
ATOM   1671 N N     . LEU C 3 116 ? 129.107 95.253  116.211 1.00 26.34  ? 135 LEU A N     1 
ATOM   1672 C CA    . LEU C 3 116 ? 128.860 94.629  114.939 1.00 26.65  ? 135 LEU A CA    1 
ATOM   1673 C C     . LEU C 3 116 ? 127.366 94.312  114.959 1.00 29.49  ? 135 LEU A C     1 
ATOM   1674 O O     . LEU C 3 116 ? 126.854 93.701  115.914 1.00 26.11  ? 135 LEU A O     1 
ATOM   1675 C CB    . LEU C 3 116 ? 129.709 93.346  114.816 1.00 28.05  ? 135 LEU A CB    1 
ATOM   1676 C CG    . LEU C 3 116 ? 129.509 92.463  113.584 1.00 31.55  ? 135 LEU A CG    1 
ATOM   1677 C CD1   . LEU C 3 116 ? 129.890 93.199  112.283 1.00 28.55  ? 135 LEU A CD1   1 
ATOM   1678 C CD2   . LEU C 3 116 ? 130.278 91.146  113.758 1.00 25.68  ? 135 LEU A CD2   1 
ATOM   1679 N N     . ALA C 3 117 ? 126.668 94.755  113.915 1.00 28.19  ? 136 ALA A N     1 
ATOM   1680 C CA    . ALA C 3 117 ? 125.216 94.575  113.809 1.00 27.76  ? 136 ALA A CA    1 
ATOM   1681 C C     . ALA C 3 117 ? 124.739 93.123  113.688 1.00 31.63  ? 136 ALA A C     1 
ATOM   1682 O O     . ALA C 3 117 ? 125.278 92.336  112.918 1.00 27.10  ? 136 ALA A O     1 
ATOM   1683 C CB    . ALA C 3 117 ? 124.633 95.427  112.638 1.00 24.47  ? 136 ALA A CB    1 
ATOM   1684 N N     . PHE C 3 118 ? 123.709 92.787  114.449 1.00 25.17  ? 137 PHE A N     1 
ATOM   1685 C CA    . PHE C 3 118 ? 123.079 91.489  114.350 1.00 22.40  ? 137 PHE A CA    1 
ATOM   1686 C C     . PHE C 3 118 ? 121.712 91.933  113.782 1.00 30.66  ? 137 PHE A C     1 
ATOM   1687 O O     . PHE C 3 118 ? 120.930 92.595  114.460 1.00 27.28  ? 137 PHE A O     1 
ATOM   1688 C CB    . PHE C 3 118 ? 122.939 90.856  115.733 1.00 22.99  ? 137 PHE A CB    1 
ATOM   1689 C CG    . PHE C 3 118 ? 122.236 89.527  115.724 1.00 25.28  ? 137 PHE A CG    1 
ATOM   1690 C CD1   . PHE C 3 118 ? 122.936 88.347  115.490 1.00 27.55  ? 137 PHE A CD1   1 
ATOM   1691 C CD2   . PHE C 3 118 ? 120.855 89.452  115.949 1.00 26.56  ? 137 PHE A CD2   1 
ATOM   1692 C CE1   . PHE C 3 118 ? 122.273 87.083  115.499 1.00 25.84  ? 137 PHE A CE1   1 
ATOM   1693 C CE2   . PHE C 3 118 ? 120.189 88.210  115.964 1.00 29.77  ? 137 PHE A CE2   1 
ATOM   1694 C CZ    . PHE C 3 118 ? 120.918 87.014  115.747 1.00 25.79  ? 137 PHE A CZ    1 
ATOM   1695 N N     . GLU C 3 119 ? 121.495 91.674  112.499 1.00 26.65  ? 138 GLU A N     1 
ATOM   1696 C CA    . GLU C 3 119 ? 120.302 92.128  111.798 1.00 24.51  ? 138 GLU A CA    1 
ATOM   1697 C C     . GLU C 3 119 ? 119.368 91.008  111.455 1.00 26.30  ? 138 GLU A C     1 
ATOM   1698 O O     . GLU C 3 119 ? 119.624 89.841  111.814 1.00 25.47  ? 138 GLU A O     1 
ATOM   1699 C CB    . GLU C 3 119 ? 120.738 92.884  110.526 1.00 25.94  ? 138 GLU A CB    1 
ATOM   1700 C CG    . GLU C 3 119 ? 121.322 94.237  110.886 1.00 26.71  ? 138 GLU A CG    1 
ATOM   1701 C CD    . GLU C 3 119 ? 122.161 94.859  109.819 1.00 30.78  ? 138 GLU A CD    1 
ATOM   1702 O OE1   . GLU C 3 119 ? 122.366 94.286  108.753 1.00 32.45  ? 138 GLU A OE1   1 
ATOM   1703 O OE2   . GLU C 3 119 ? 122.647 95.949  110.064 1.00 27.82  ? 138 GLU A OE2   1 
ATOM   1704 N N     . ARG C 3 120 ? 118.285 91.340  110.747 1.00 21.25  ? 139 ARG A N     1 
ATOM   1705 C CA    . ARG C 3 120 ? 117.295 90.327  110.365 1.00 21.85  ? 139 ARG A CA    1 
ATOM   1706 C C     . ARG C 3 120 ? 117.882 89.159  109.543 1.00 30.33  ? 139 ARG A C     1 
ATOM   1707 O O     . ARG C 3 120 ? 117.462 88.001  109.696 1.00 28.92  ? 139 ARG A O     1 
ATOM   1708 C CB    . ARG C 3 120 ? 116.132 90.971  109.646 1.00 21.97  ? 139 ARG A CB    1 
ATOM   1709 C CG    . ARG C 3 120 ? 115.201 89.981  108.985 1.00 27.86  ? 139 ARG A CG    1 
ATOM   1710 C CD    . ARG C 3 120 ? 114.399 89.237  110.029 1.00 26.55  ? 139 ARG A CD    1 
ATOM   1711 N NE    . ARG C 3 120 ? 113.339 88.415  109.426 1.00 28.60  ? 139 ARG A NE    1 
ATOM   1712 C CZ    . ARG C 3 120 ? 112.127 88.858  109.096 1.00 36.33  ? 139 ARG A CZ    1 
ATOM   1713 N NH1   . ARG C 3 120 ? 111.792 90.132  109.299 1.00 32.92  ? 139 ARG A NH1   1 
ATOM   1714 N NH2   . ARG C 3 120 ? 111.242 88.018  108.564 1.00 30.31  ? 139 ARG A NH2   1 
ATOM   1715 N N     . THR C 3 121 ? 118.850 89.453  108.674 1.00 28.82  ? 140 THR A N     1 
ATOM   1716 C CA    . THR C 3 121 ? 119.489 88.404  107.857 1.00 26.15  ? 140 THR A CA    1 
ATOM   1717 C C     . THR C 3 121 ? 120.281 87.500  108.767 1.00 32.76  ? 140 THR A C     1 
ATOM   1718 O O     . THR C 3 121 ? 120.264 86.287  108.610 1.00 34.64  ? 140 THR A O     1 
ATOM   1719 C CB    . THR C 3 121 ? 120.372 88.989  106.781 1.00 29.16  ? 140 THR A CB    1 
ATOM   1720 O OG1   . THR C 3 121 ? 121.289 89.916  107.383 1.00 30.54  ? 140 THR A OG1   1 
ATOM   1721 C CG2   . THR C 3 121 ? 119.489 89.686  105.737 1.00 27.97  ? 140 THR A CG2   1 
ATOM   1722 N N     . ASP C 3 122 ? 120.930 88.091  109.758 1.00 29.87  ? 141 ASP A N     1 
ATOM   1723 C CA    . ASP C 3 122 ? 121.655 87.324  110.775 1.00 31.05  ? 141 ASP A CA    1 
ATOM   1724 C C     . ASP C 3 122 ? 120.709 86.457  111.628 1.00 33.65  ? 141 ASP A C     1 
ATOM   1725 O O     . ASP C 3 122 ? 120.982 85.293  111.880 1.00 29.77  ? 141 ASP A O     1 
ATOM   1726 C CB    . ASP C 3 122 ? 122.448 88.281  111.637 1.00 33.59  ? 141 ASP A CB    1 
ATOM   1727 C CG    . ASP C 3 122 ? 123.406 89.110  110.809 1.00 37.61  ? 141 ASP A CG    1 
ATOM   1728 O OD1   . ASP C 3 122 ? 124.223 88.493  110.100 1.00 34.07  ? 141 ASP A OD1   1 
ATOM   1729 O OD2   . ASP C 3 122 ? 123.285 90.351  110.783 1.00 34.54  ? 141 ASP A OD2   1 
ATOM   1730 N N     . PHE C 3 123 ? 119.594 87.041  112.047 1.00 29.99  ? 142 PHE A N     1 
ATOM   1731 C CA    . PHE C 3 123 ? 118.609 86.334  112.855 1.00 28.83  ? 142 PHE A CA    1 
ATOM   1732 C C     . PHE C 3 123 ? 118.009 85.126  112.079 1.00 30.40  ? 142 PHE A C     1 
ATOM   1733 O O     . PHE C 3 123 ? 117.909 84.005  112.601 1.00 27.82  ? 142 PHE A O     1 
ATOM   1734 C CB    . PHE C 3 123 ? 117.513 87.313  113.345 1.00 26.78  ? 142 PHE A CB    1 
ATOM   1735 C CG    . PHE C 3 123 ? 116.497 86.677  114.243 1.00 27.46  ? 142 PHE A CG    1 
ATOM   1736 C CD1   . PHE C 3 123 ? 116.898 85.924  115.360 1.00 28.31  ? 142 PHE A CD1   1 
ATOM   1737 C CD2   . PHE C 3 123 ? 115.141 86.821  113.979 1.00 30.46  ? 142 PHE A CD2   1 
ATOM   1738 C CE1   . PHE C 3 123 ? 115.944 85.305  116.201 1.00 28.97  ? 142 PHE A CE1   1 
ATOM   1739 C CE2   . PHE C 3 123 ? 114.175 86.235  114.822 1.00 34.10  ? 142 PHE A CE2   1 
ATOM   1740 C CZ    . PHE C 3 123 ? 114.583 85.480  115.941 1.00 30.23  ? 142 PHE A CZ    1 
ATOM   1741 N N     . ASP C 3 124 ? 117.649 85.361  110.827 1.00 29.19  ? 143 ASP A N     1 
ATOM   1742 C CA    . ASP C 3 124 ? 117.087 84.303  109.991 1.00 29.46  ? 143 ASP A CA    1 
ATOM   1743 C C     . ASP C 3 124 ? 118.112 83.179  109.788 1.00 36.03  ? 143 ASP A C     1 
ATOM   1744 O O     . ASP C 3 124 ? 117.777 82.006  109.814 1.00 38.65  ? 143 ASP A O     1 
ATOM   1745 C CB    . ASP C 3 124 ? 116.656 84.889  108.642 1.00 29.34  ? 143 ASP A CB    1 
ATOM   1746 C CG    . ASP C 3 124 ? 115.392 85.710  108.764 1.00 40.36  ? 143 ASP A CG    1 
ATOM   1747 O OD1   . ASP C 3 124 ? 114.730 85.570  109.815 1.00 39.15  ? 143 ASP A OD1   1 
ATOM   1748 O OD2   . ASP C 3 124 ? 115.049 86.473  107.818 1.00 38.59  ? 143 ASP A OD2   1 
ATOM   1749 N N     . GLN C 3 125 ? 119.365 83.544  109.600 1.00 29.67  ? 144 GLN A N     1 
ATOM   1750 C CA    . GLN C 3 125 ? 120.387 82.553  109.396 1.00 30.60  ? 144 GLN A CA    1 
ATOM   1751 C C     . GLN C 3 125 ? 120.593 81.725  110.657 1.00 35.43  ? 144 GLN A C     1 
ATOM   1752 O O     . GLN C 3 125 ? 120.606 80.501  110.618 1.00 34.90  ? 144 GLN A O     1 
ATOM   1753 C CB    . GLN C 3 125 ? 121.663 83.234  108.981 1.00 32.66  ? 144 GLN A CB    1 
ATOM   1754 C CG    . GLN C 3 125 ? 122.864 82.357  108.991 1.00 32.65  ? 144 GLN A CG    1 
ATOM   1755 C CD    . GLN C 3 125 ? 124.041 83.049  108.402 1.00 44.86  ? 144 GLN A CD    1 
ATOM   1756 O OE1   . GLN C 3 125 ? 124.118 84.288  108.389 1.00 40.98  ? 144 GLN A OE1   1 
ATOM   1757 N NE2   . GLN C 3 125 ? 124.961 82.259  107.852 1.00 42.73  ? 144 GLN A NE2   1 
ATOM   1758 N N     . VAL C 3 126 ? 120.746 82.386  111.787 1.00 31.95  ? 145 VAL A N     1 
ATOM   1759 C CA    . VAL C 3 126 ? 120.931 81.672  113.039 1.00 30.41  ? 145 VAL A CA    1 
ATOM   1760 C C     . VAL C 3 126 ? 119.700 80.811  113.316 1.00 36.36  ? 145 VAL A C     1 
ATOM   1761 O O     . VAL C 3 126 ? 119.800 79.667  113.777 1.00 35.81  ? 145 VAL A O     1 
ATOM   1762 C CB    . VAL C 3 126 ? 121.198 82.635  114.194 1.00 31.15  ? 145 VAL A CB    1 
ATOM   1763 C CG1   . VAL C 3 126 ? 121.083 81.913  115.572 1.00 29.41  ? 145 VAL A CG1   1 
ATOM   1764 C CG2   . VAL C 3 126 ? 122.575 83.275  114.007 1.00 29.58  ? 145 VAL A CG2   1 
ATOM   1765 N N     . ARG C 3 127 ? 118.528 81.347  113.008 1.00 30.95  ? 146 ARG A N     1 
ATOM   1766 C CA    . ARG C 3 127 ? 117.317 80.584  113.230 1.00 31.46  ? 146 ARG A CA    1 
ATOM   1767 C C     . ARG C 3 127 ? 117.301 79.339  112.336 1.00 42.93  ? 146 ARG A C     1 
ATOM   1768 O O     . ARG C 3 127 ? 116.845 78.270  112.756 1.00 43.69  ? 146 ARG A O     1 
ATOM   1769 C CB    . ARG C 3 127 ? 116.122 81.439  112.971 1.00 31.56  ? 146 ARG A CB    1 
ATOM   1770 C CG    . ARG C 3 127 ? 114.956 81.034  113.773 1.00 51.53  ? 146 ARG A CG    1 
ATOM   1771 C CD    . ARG C 3 127 ? 114.272 82.252  114.235 1.00 58.05  ? 146 ARG A CD    1 
ATOM   1772 N NE    . ARG C 3 127 ? 113.509 82.884  113.180 1.00 48.87  ? 146 ARG A NE    1 
ATOM   1773 C CZ    . ARG C 3 127 ? 112.195 83.028  113.226 1.00 67.92  ? 146 ARG A CZ    1 
ATOM   1774 N NH1   . ARG C 3 127 ? 111.501 82.538  114.248 1.00 54.47  ? 146 ARG A NH1   1 
ATOM   1775 N NH2   . ARG C 3 127 ? 111.567 83.624  112.235 1.00 100.00 ? 146 ARG A NH2   1 
ATOM   1776 N N     . SER C 3 128 ? 117.844 79.464  111.130 1.00 38.82  ? 147 SER A N     1 
ATOM   1777 C CA    . SER C 3 128 ? 117.933 78.337  110.220 1.00 37.61  ? 147 SER A CA    1 
ATOM   1778 C C     . SER C 3 128 ? 118.798 77.233  110.816 1.00 40.56  ? 147 SER A C     1 
ATOM   1779 O O     . SER C 3 128 ? 118.408 76.081  110.812 1.00 42.93  ? 147 SER A O     1 
ATOM   1780 C CB    . SER C 3 128 ? 118.530 78.768  108.895 1.00 37.12  ? 147 SER A CB    1 
ATOM   1781 O OG    . SER C 3 128 ? 117.468 78.993  108.008 1.00 56.12  ? 147 SER A OG    1 
ATOM   1782 N N     . LEU C 3 129 ? 119.963 77.586  111.336 1.00 32.26  ? 148 LEU A N     1 
ATOM   1783 C CA    . LEU C 3 129 ? 120.837 76.590  111.903 1.00 35.03  ? 148 LEU A CA    1 
ATOM   1784 C C     . LEU C 3 129 ? 120.292 75.992  113.200 1.00 44.88  ? 148 LEU A C     1 
ATOM   1785 O O     . LEU C 3 129 ? 120.303 74.786  113.393 1.00 50.63  ? 148 LEU A O     1 
ATOM   1786 C CB    . LEU C 3 129 ? 122.216 77.209  112.155 1.00 35.56  ? 148 LEU A CB    1 
ATOM   1787 C CG    . LEU C 3 129 ? 122.836 77.915  110.959 1.00 46.76  ? 148 LEU A CG    1 
ATOM   1788 C CD1   . LEU C 3 129 ? 124.155 78.617  111.304 1.00 48.68  ? 148 LEU A CD1   1 
ATOM   1789 C CD2   . LEU C 3 129 ? 123.029 76.902  109.841 1.00 59.01  ? 148 LEU A CD2   1 
ATOM   1790 N N     . MET C 3 130 ? 119.844 76.864  114.091 1.00 40.09  ? 149 MET A N     1 
ATOM   1791 C CA    . MET C 3 130 ? 119.438 76.493  115.433 1.00 34.55  ? 149 MET A CA    1 
ATOM   1792 C C     . MET C 3 130 ? 118.006 76.025  115.766 1.00 36.28  ? 149 MET A C     1 
ATOM   1793 O O     . MET C 3 130 ? 117.803 75.341  116.776 1.00 36.32  ? 149 MET A O     1 
ATOM   1794 C CB    . MET C 3 130 ? 119.822 77.628  116.384 1.00 35.95  ? 149 MET A CB    1 
ATOM   1795 C CG    . MET C 3 130 ? 121.287 77.765  116.651 1.00 43.86  ? 149 MET A CG    1 
ATOM   1796 S SD    . MET C 3 130 ? 121.675 79.273  117.706 1.00 54.58  ? 149 MET A SD    1 
ATOM   1797 C CE    . MET C 3 130 ? 121.164 78.754  119.378 1.00 51.83  ? 149 MET A CE    1 
ATOM   1798 N N     . GLU C 3 131 ? 117.017 76.435  114.978 1.00 34.47  ? 150 GLU A N     1 
ATOM   1799 C CA    . GLU C 3 131 ? 115.624 76.135  115.299 1.00 35.29  ? 150 GLU A CA    1 
ATOM   1800 C C     . GLU C 3 131 ? 115.232 74.692  115.538 1.00 40.89  ? 150 GLU A C     1 
ATOM   1801 O O     . GLU C 3 131 ? 114.367 74.435  116.370 1.00 41.37  ? 150 GLU A O     1 
ATOM   1802 C CB    . GLU C 3 131 ? 114.645 76.813  114.349 1.00 35.79  ? 150 GLU A CB    1 
ATOM   1803 C CG    . GLU C 3 131 ? 114.617 76.149  113.015 1.00 50.00  ? 150 GLU A CG    1 
ATOM   1804 C CD    . GLU C 3 131 ? 113.903 76.985  111.987 1.00 80.78  ? 150 GLU A CD    1 
ATOM   1805 O OE1   . GLU C 3 131 ? 113.187 77.914  112.392 1.00 56.90  ? 150 GLU A OE1   1 
ATOM   1806 O OE2   . GLU C 3 131 ? 114.102 76.726  110.775 1.00 89.25  ? 150 GLU A OE2   1 
ATOM   1807 N N     . ASN C 3 132 ? 115.837 73.752  114.813 1.00 41.16  ? 151 ASN A N     1 
ATOM   1808 C CA    . ASN C 3 132 ? 115.507 72.318  115.008 1.00 45.41  ? 151 ASN A CA    1 
ATOM   1809 C C     . ASN C 3 132 ? 116.275 71.653  116.160 1.00 47.68  ? 151 ASN A C     1 
ATOM   1810 O O     . ASN C 3 132 ? 115.980 70.525  116.548 1.00 51.52  ? 151 ASN A O     1 
ATOM   1811 C CB    . ASN C 3 132 ? 115.732 71.505  113.729 1.00 57.78  ? 151 ASN A CB    1 
ATOM   1812 C CG    . ASN C 3 132 ? 114.970 72.054  112.547 1.00 100.00 ? 151 ASN A CG    1 
ATOM   1813 O OD1   . ASN C 3 132 ? 113.736 72.189  112.596 1.00 76.73  ? 151 ASN A OD1   1 
ATOM   1814 N ND2   . ASN C 3 132 ? 115.690 72.335  111.450 1.00 100.00 ? 151 ASN A ND2   1 
ATOM   1815 N N     . SER C 3 133 ? 117.250 72.365  116.709 1.00 40.03  ? 152 SER A N     1 
ATOM   1816 C CA    . SER C 3 133 ? 118.070 71.839  117.788 1.00 35.35  ? 152 SER A CA    1 
ATOM   1817 C C     . SER C 3 133 ? 117.318 71.354  119.026 1.00 40.94  ? 152 SER A C     1 
ATOM   1818 O O     . SER C 3 133 ? 116.339 71.948  119.450 1.00 41.73  ? 152 SER A O     1 
ATOM   1819 C CB    . SER C 3 133 ? 119.113 72.857  118.212 1.00 34.52  ? 152 SER A CB    1 
ATOM   1820 O OG    . SER C 3 133 ? 120.042 72.249  119.098 1.00 38.11  ? 152 SER A OG    1 
ATOM   1821 N N     . ASP C 3 134 ? 117.836 70.296  119.634 1.00 35.16  ? 153 ASP A N     1 
ATOM   1822 C CA    . ASP C 3 134 ? 117.257 69.740  120.841 1.00 32.82  ? 153 ASP A CA    1 
ATOM   1823 C C     . ASP C 3 134 ? 118.171 70.013  122.042 1.00 36.59  ? 153 ASP A C     1 
ATOM   1824 O O     . ASP C 3 134 ? 117.900 69.566  123.161 1.00 39.08  ? 153 ASP A O     1 
ATOM   1825 C CB    . ASP C 3 134 ? 116.977 68.243  120.656 1.00 34.31  ? 153 ASP A CB    1 
ATOM   1826 C CG    . ASP C 3 134 ? 115.750 67.988  119.784 1.00 45.23  ? 153 ASP A CG    1 
ATOM   1827 O OD1   . ASP C 3 134 ? 114.828 68.842  119.800 1.00 44.14  ? 153 ASP A OD1   1 
ATOM   1828 O OD2   . ASP C 3 134 ? 115.706 66.962  119.066 1.00 49.17  ? 153 ASP A OD2   1 
ATOM   1829 N N     . ARG C 3 135 ? 119.241 70.777  121.802 1.00 32.39  ? 154 ARG A N     1 
ATOM   1830 C CA    . ARG C 3 135 ? 120.183 71.151  122.878 1.00 33.33  ? 154 ARG A CA    1 
ATOM   1831 C C     . ARG C 3 135 ? 119.593 72.284  123.708 1.00 36.50  ? 154 ARG A C     1 
ATOM   1832 O O     . ARG C 3 135 ? 119.277 73.346  123.169 1.00 36.39  ? 154 ARG A O     1 
ATOM   1833 C CB    . ARG C 3 135 ? 121.484 71.689  122.302 1.00 38.81  ? 154 ARG A CB    1 
ATOM   1834 C CG    . ARG C 3 135 ? 122.401 70.696  121.657 1.00 51.34  ? 154 ARG A CG    1 
ATOM   1835 C CD    . ARG C 3 135 ? 123.770 71.348  121.472 1.00 71.12  ? 154 ARG A CD    1 
ATOM   1836 N NE    . ARG C 3 135 ? 124.518 71.448  122.733 1.00 99.38  ? 154 ARG A NE    1 
ATOM   1837 C CZ    . ARG C 3 135 ? 125.256 72.501  123.086 1.00 99.96  ? 154 ARG A CZ    1 
ATOM   1838 N NH1   . ARG C 3 135 ? 125.328 73.564  122.281 1.00 64.80  ? 154 ARG A NH1   1 
ATOM   1839 N NH2   . ARG C 3 135 ? 125.914 72.493  124.248 1.00 65.61  ? 154 ARG A NH2   1 
ATOM   1840 N N     . CYS C 3 136 ? 119.513 72.079  125.018 1.00 31.85  ? 155 CYS A N     1 
ATOM   1841 C CA    . CYS C 3 136 ? 118.972 73.070  125.932 1.00 31.56  ? 155 CYS A CA    1 
ATOM   1842 C C     . CYS C 3 136 ? 119.609 74.478  125.722 1.00 36.52  ? 155 CYS A C     1 
ATOM   1843 O O     . CYS C 3 136 ? 118.912 75.485  125.634 1.00 35.04  ? 155 CYS A O     1 
ATOM   1844 C CB    . CYS C 3 136 ? 119.158 72.576  127.355 1.00 30.14  ? 155 CYS A CB    1 
ATOM   1845 S SG    . CYS C 3 136 ? 118.275 73.532  128.628 1.00 34.31  ? 155 CYS A SG    1 
ATOM   1846 N N     . GLN C 3 137 ? 120.933 74.503  125.630 1.00 32.00  ? 156 GLN A N     1 
ATOM   1847 C CA    . GLN C 3 137 ? 121.724 75.710  125.359 1.00 31.20  ? 156 GLN A CA    1 
ATOM   1848 C C     . GLN C 3 137 ? 121.248 76.424  124.076 1.00 32.42  ? 156 GLN A C     1 
ATOM   1849 O O     . GLN C 3 137 ? 121.081 77.637  124.062 1.00 31.90  ? 156 GLN A O     1 
ATOM   1850 C CB    . GLN C 3 137 ? 123.184 75.296  125.176 1.00 33.55  ? 156 GLN A CB    1 
ATOM   1851 C CG    . GLN C 3 137 ? 124.217 76.351  125.419 1.00 67.23  ? 156 GLN A CG    1 
ATOM   1852 C CD    . GLN C 3 137 ? 125.439 76.133  124.550 1.00 100.00 ? 156 GLN A CD    1 
ATOM   1853 O OE1   . GLN C 3 137 ? 126.237 75.223  124.805 1.00 99.42  ? 156 GLN A OE1   1 
ATOM   1854 N NE2   . GLN C 3 137 ? 125.568 76.928  123.483 1.00 100.00 ? 156 GLN A NE2   1 
ATOM   1855 N N     . ASP C 3 138 ? 121.043 75.668  123.000 1.00 31.88  ? 157 ASP A N     1 
ATOM   1856 C CA    . ASP C 3 138 ? 120.582 76.256  121.755 1.00 30.51  ? 157 ASP A CA    1 
ATOM   1857 C C     . ASP C 3 138 ? 119.178 76.785  121.879 1.00 33.75  ? 157 ASP A C     1 
ATOM   1858 O O     . ASP C 3 138 ? 118.841 77.763  121.256 1.00 32.26  ? 157 ASP A O     1 
ATOM   1859 C CB    . ASP C 3 138 ? 120.611 75.263  120.603 1.00 30.40  ? 157 ASP A CB    1 
ATOM   1860 C CG    . ASP C 3 138 ? 122.015 74.757  120.285 1.00 34.55  ? 157 ASP A CG    1 
ATOM   1861 O OD1   . ASP C 3 138 ? 123.004 75.371  120.727 1.00 33.12  ? 157 ASP A OD1   1 
ATOM   1862 O OD2   . ASP C 3 138 ? 122.120 73.697  119.629 1.00 40.48  ? 157 ASP A OD2   1 
ATOM   1863 N N     . ILE C 3 139 ? 118.334 76.091  122.626 1.00 27.30  ? 158 ILE A N     1 
ATOM   1864 C CA    . ILE C 3 139 ? 116.945 76.521  122.767 1.00 25.93  ? 158 ILE A CA    1 
ATOM   1865 C C     . ILE C 3 139 ? 116.915 77.855  123.536 1.00 24.85  ? 158 ILE A C     1 
ATOM   1866 O O     . ILE C 3 139 ? 116.199 78.795  123.181 1.00 22.25  ? 158 ILE A O     1 
ATOM   1867 C CB    . ILE C 3 139 ? 116.077 75.426  123.481 1.00 31.65  ? 158 ILE A CB    1 
ATOM   1868 C CG1   . ILE C 3 139 ? 115.862 74.207  122.545 1.00 32.91  ? 158 ILE A CG1   1 
ATOM   1869 C CG2   . ILE C 3 139 ? 114.721 76.007  123.943 1.00 26.13  ? 158 ILE A CG2   1 
ATOM   1870 C CD1   . ILE C 3 139 ? 115.379 72.939  123.260 1.00 26.76  ? 158 ILE A CD1   1 
ATOM   1871 N N     . ARG C 3 140 ? 117.709 77.920  124.602 1.00 26.38  ? 159 ARG A N     1 
ATOM   1872 C CA    . ARG C 3 140 ? 117.811 79.127  125.420 1.00 26.44  ? 159 ARG A CA    1 
ATOM   1873 C C     . ARG C 3 140 ? 118.393 80.275  124.606 1.00 32.98  ? 159 ARG A C     1 
ATOM   1874 O O     . ARG C 3 140 ? 117.868 81.391  124.628 1.00 28.63  ? 159 ARG A O     1 
ATOM   1875 C CB    . ARG C 3 140 ? 118.770 78.914  126.602 1.00 23.33  ? 159 ARG A CB    1 
ATOM   1876 C CG    . ARG C 3 140 ? 118.771 80.117  127.613 1.00 25.32  ? 159 ARG A CG    1 
ATOM   1877 C CD    . ARG C 3 140 ? 119.982 80.187  128.531 1.00 25.38  ? 159 ARG A CD    1 
ATOM   1878 N NE    . ARG C 3 140 ? 121.238 80.161  127.786 1.00 27.99  ? 159 ARG A NE    1 
ATOM   1879 C CZ    . ARG C 3 140 ? 122.430 79.946  128.344 1.00 34.00  ? 159 ARG A CZ    1 
ATOM   1880 N NH1   . ARG C 3 140 ? 122.547 79.772  129.661 1.00 25.65  ? 159 ARG A NH1   1 
ATOM   1881 N NH2   . ARG C 3 140 ? 123.517 79.918  127.580 1.00 25.00  ? 159 ARG A NH2   1 
ATOM   1882 N N     . ASN C 3 141 ? 119.522 80.010  123.945 1.00 25.99  ? 160 ASN A N     1 
ATOM   1883 C CA    . ASN C 3 141 ? 120.251 81.040  123.205 1.00 24.68  ? 160 ASN A CA    1 
ATOM   1884 C C     . ASN C 3 141 ? 119.476 81.648  122.070 1.00 28.21  ? 160 ASN A C     1 
ATOM   1885 O O     . ASN C 3 141 ? 119.551 82.855  121.830 1.00 26.34  ? 160 ASN A O     1 
ATOM   1886 C CB    . ASN C 3 141 ? 121.592 80.492  122.733 1.00 25.37  ? 160 ASN A CB    1 
ATOM   1887 C CG    . ASN C 3 141 ? 122.558 80.220  123.891 1.00 25.84  ? 160 ASN A CG    1 
ATOM   1888 O OD1   . ASN C 3 141 ? 122.273 80.474  125.072 1.00 25.17  ? 160 ASN A OD1   1 
ATOM   1889 N ND2   . ASN C 3 141 ? 123.729 79.759  123.541 1.00 28.97  ? 160 ASN A ND2   1 
ATOM   1890 N N     . LEU C 3 142 ? 118.715 80.805  121.376 1.00 27.60  ? 161 LEU A N     1 
ATOM   1891 C CA    . LEU C 3 142 ? 117.883 81.270  120.276 1.00 25.03  ? 161 LEU A CA    1 
ATOM   1892 C C     . LEU C 3 142 ? 116.708 82.131  120.802 1.00 32.37  ? 161 LEU A C     1 
ATOM   1893 O O     . LEU C 3 142 ? 116.343 83.146  120.200 1.00 29.38  ? 161 LEU A O     1 
ATOM   1894 C CB    . LEU C 3 142 ? 117.426 80.105  119.419 1.00 24.26  ? 161 LEU A CB    1 
ATOM   1895 C CG    . LEU C 3 142 ? 116.645 80.471  118.174 1.00 33.94  ? 161 LEU A CG    1 
ATOM   1896 C CD1   . LEU C 3 142 ? 117.475 81.391  117.272 1.00 36.48  ? 161 LEU A CD1   1 
ATOM   1897 C CD2   . LEU C 3 142 ? 116.198 79.215  117.434 1.00 33.24  ? 161 LEU A CD2   1 
ATOM   1898 N N     . ALA C 3 143 ? 116.156 81.773  121.959 1.00 27.81  ? 162 ALA A N     1 
ATOM   1899 C CA    . ALA C 3 143 ? 115.099 82.607  122.509 1.00 22.97  ? 162 ALA A CA    1 
ATOM   1900 C C     . ALA C 3 143 ? 115.695 83.951  122.919 1.00 28.34  ? 162 ALA A C     1 
ATOM   1901 O O     . ALA C 3 143 ? 115.035 84.991  122.785 1.00 26.13  ? 162 ALA A O     1 
ATOM   1902 C CB    . ALA C 3 143 ? 114.442 81.944  123.718 1.00 24.63  ? 162 ALA A CB    1 
ATOM   1903 N N     . PHE C 3 144 ? 116.913 83.912  123.482 1.00 25.57  ? 163 PHE A N     1 
ATOM   1904 C CA    . PHE C 3 144 ? 117.598 85.121  123.935 1.00 23.21  ? 163 PHE A CA    1 
ATOM   1905 C C     . PHE C 3 144 ? 117.850 86.046  122.745 1.00 25.85  ? 163 PHE A C     1 
ATOM   1906 O O     . PHE C 3 144 ? 117.627 87.238  122.831 1.00 25.77  ? 163 PHE A O     1 
ATOM   1907 C CB    . PHE C 3 144 ? 118.919 84.818  124.671 1.00 23.77  ? 163 PHE A CB    1 
ATOM   1908 C CG    . PHE C 3 144 ? 119.874 86.022  124.744 1.00 24.73  ? 163 PHE A CG    1 
ATOM   1909 C CD1   . PHE C 3 144 ? 119.683 87.042  125.678 1.00 22.49  ? 163 PHE A CD1   1 
ATOM   1910 C CD2   . PHE C 3 144 ? 120.947 86.147  123.847 1.00 22.10  ? 163 PHE A CD2   1 
ATOM   1911 C CE1   . PHE C 3 144 ? 120.521 88.161  125.702 1.00 20.95  ? 163 PHE A CE1   1 
ATOM   1912 C CE2   . PHE C 3 144 ? 121.789 87.249  123.883 1.00 22.87  ? 163 PHE A CE2   1 
ATOM   1913 C CZ    . PHE C 3 144 ? 121.576 88.255  124.811 1.00 19.63  ? 163 PHE A CZ    1 
ATOM   1914 N N     . LEU C 3 145 ? 118.302 85.493  121.635 1.00 24.55  ? 164 LEU A N     1 
ATOM   1915 C CA    . LEU C 3 145 ? 118.602 86.324  120.490 1.00 25.32  ? 164 LEU A CA    1 
ATOM   1916 C C     . LEU C 3 145 ? 117.326 86.898  119.894 1.00 27.49  ? 164 LEU A C     1 
ATOM   1917 O O     . LEU C 3 145 ? 117.317 88.031  119.415 1.00 25.45  ? 164 LEU A O     1 
ATOM   1918 C CB    . LEU C 3 145 ? 119.394 85.544  119.433 1.00 26.39  ? 164 LEU A CB    1 
ATOM   1919 C CG    . LEU C 3 145 ? 120.827 85.095  119.741 1.00 30.11  ? 164 LEU A CG    1 
ATOM   1920 C CD1   . LEU C 3 145 ? 121.250 84.074  118.699 1.00 30.39  ? 164 LEU A CD1   1 
ATOM   1921 C CD2   . LEU C 3 145 ? 121.796 86.270  119.768 1.00 27.00  ? 164 LEU A CD2   1 
ATOM   1922 N N     . GLY C 3 146 ? 116.235 86.140  119.971 1.00 21.33  ? 165 GLY A N     1 
ATOM   1923 C CA    . GLY C 3 146 ? 114.957 86.586  119.428 1.00 19.77  ? 165 GLY A CA    1 
ATOM   1924 C C     . GLY C 3 146 ? 114.469 87.796  120.228 1.00 24.02  ? 165 GLY A C     1 
ATOM   1925 O O     . GLY C 3 146 ? 114.048 88.813  119.682 1.00 24.86  ? 165 GLY A O     1 
ATOM   1926 N N     . ILE C 3 147 ? 114.550 87.689  121.535 1.00 21.20  ? 166 ILE A N     1 
ATOM   1927 C CA    . ILE C 3 147 ? 114.129 88.784  122.384 1.00 21.79  ? 166 ILE A CA    1 
ATOM   1928 C C     . ILE C 3 147 ? 115.005 90.017  122.159 1.00 26.71  ? 166 ILE A C     1 
ATOM   1929 O O     . ILE C 3 147 ? 114.517 91.121  122.084 1.00 24.10  ? 166 ILE A O     1 
ATOM   1930 C CB    . ILE C 3 147 ? 114.141 88.356  123.896 1.00 24.61  ? 166 ILE A CB    1 
ATOM   1931 C CG1   . ILE C 3 147 ? 112.887 87.513  124.190 1.00 24.70  ? 166 ILE A CG1   1 
ATOM   1932 C CG2   . ILE C 3 147 ? 114.171 89.590  124.804 1.00 25.13  ? 166 ILE A CG2   1 
ATOM   1933 C CD1   . ILE C 3 147 ? 112.771 86.991  125.608 1.00 22.52  ? 166 ILE A CD1   1 
ATOM   1934 N N     . ALA C 3 148 ? 116.307 89.809  122.118 1.00 24.57  ? 167 ALA A N     1 
ATOM   1935 C CA    . ALA C 3 148 ? 117.245 90.911  121.960 1.00 24.48  ? 167 ALA A CA    1 
ATOM   1936 C C     . ALA C 3 148 ? 116.961 91.706  120.685 1.00 25.39  ? 167 ALA A C     1 
ATOM   1937 O O     . ALA C 3 148 ? 116.961 92.939  120.695 1.00 23.55  ? 167 ALA A O     1 
ATOM   1938 C CB    . ALA C 3 148 ? 118.702 90.365  121.942 1.00 22.86  ? 167 ALA A CB    1 
ATOM   1939 N N     . TYR C 3 149 ? 116.723 90.982  119.586 1.00 22.63  ? 168 TYR A N     1 
ATOM   1940 C CA    . TYR C 3 149 ? 116.468 91.595  118.299 1.00 21.19  ? 168 TYR A CA    1 
ATOM   1941 C C     . TYR C 3 149 ? 115.078 92.262  118.223 1.00 28.22  ? 168 TYR A C     1 
ATOM   1942 O O     . TYR C 3 149 ? 114.952 93.389  117.733 1.00 25.90  ? 168 TYR A O     1 
ATOM   1943 C CB    . TYR C 3 149 ? 116.654 90.605  117.165 1.00 18.08  ? 168 TYR A CB    1 
ATOM   1944 C CG    . TYR C 3 149 ? 116.337 91.206  115.818 1.00 23.06  ? 168 TYR A CG    1 
ATOM   1945 C CD1   . TYR C 3 149 ? 117.259 92.046  115.175 1.00 25.35  ? 168 TYR A CD1   1 
ATOM   1946 C CD2   . TYR C 3 149 ? 115.111 90.983  115.203 1.00 23.52  ? 168 TYR A CD2   1 
ATOM   1947 C CE1   . TYR C 3 149 ? 116.968 92.651  113.930 1.00 24.10  ? 168 TYR A CE1   1 
ATOM   1948 C CE2   . TYR C 3 149 ? 114.802 91.565  113.948 1.00 23.76  ? 168 TYR A CE2   1 
ATOM   1949 C CZ    . TYR C 3 149 ? 115.728 92.404  113.333 1.00 28.10  ? 168 TYR A CZ    1 
ATOM   1950 O OH    . TYR C 3 149 ? 115.416 93.021  112.154 1.00 26.68  ? 168 TYR A OH    1 
ATOM   1951 N N     . ASN C 3 150 ? 114.058 91.550  118.711 1.00 24.88  ? 169 ASN A N     1 
ATOM   1952 C CA    . ASN C 3 150 ? 112.649 92.001  118.707 1.00 24.05  ? 169 ASN A CA    1 
ATOM   1953 C C     . ASN C 3 150 ? 112.412 93.199  119.621 1.00 24.69  ? 169 ASN A C     1 
ATOM   1954 O O     . ASN C 3 150 ? 111.659 94.112  119.287 1.00 25.06  ? 169 ASN A O     1 
ATOM   1955 C CB    . ASN C 3 150 ? 111.789 90.824  119.201 1.00 22.89  ? 169 ASN A CB    1 
ATOM   1956 C CG    . ASN C 3 150 ? 110.282 90.967  118.925 1.00 26.96  ? 169 ASN A CG    1 
ATOM   1957 O OD1   . ASN C 3 150 ? 109.616 89.953  118.885 1.00 26.58  ? 169 ASN A OD1   1 
ATOM   1958 N ND2   . ASN C 3 150 ? 109.743 92.195  118.817 1.00 21.79  ? 169 ASN A ND2   1 
ATOM   1959 N N     . THR C 3 151 ? 113.037 93.178  120.798 1.00 18.87  ? 170 THR A N     1 
ATOM   1960 C CA    . THR C 3 151 ? 112.798 94.215  121.787 1.00 19.14  ? 170 THR A CA    1 
ATOM   1961 C C     . THR C 3 151 ? 113.855 95.301  121.859 1.00 23.15  ? 170 THR A C     1 
ATOM   1962 O O     . THR C 3 151 ? 113.609 96.349  122.442 1.00 22.88  ? 170 THR A O     1 
ATOM   1963 C CB    . THR C 3 151 ? 112.708 93.608  123.180 1.00 21.98  ? 170 THR A CB    1 
ATOM   1964 O OG1   . THR C 3 151 ? 114.010 93.152  123.574 1.00 23.63  ? 170 THR A OG1   1 
ATOM   1965 C CG2   . THR C 3 151 ? 111.728 92.448  123.177 1.00 22.17  ? 170 THR A CG2   1 
ATOM   1966 N N     . LEU C 3 152 ? 115.046 95.052  121.305 1.00 21.90  ? 171 LEU A N     1 
ATOM   1967 C CA    . LEU C 3 152 ? 116.136 96.040  121.367 1.00 20.83  ? 171 LEU A CA    1 
ATOM   1968 C C     . LEU C 3 152 ? 116.543 96.315  122.818 1.00 23.78  ? 171 LEU A C     1 
ATOM   1969 O O     . LEU C 3 152 ? 117.239 97.280  123.120 1.00 23.38  ? 171 LEU A O     1 
ATOM   1970 C CB    . LEU C 3 152 ? 115.709 97.377  120.683 1.00 21.11  ? 171 LEU A CB    1 
ATOM   1971 C CG    . LEU C 3 152 ? 115.715 97.421  119.149 1.00 19.95  ? 171 LEU A CG    1 
ATOM   1972 C CD1   . LEU C 3 152 ? 114.374 96.933  118.591 1.00 17.39  ? 171 LEU A CD1   1 
ATOM   1973 C CD2   . LEU C 3 152 ? 115.986 98.853  118.721 1.00 17.84  ? 171 LEU A CD2   1 
ATOM   1974 N N     . LEU C 3 153 ? 116.146 95.448  123.727 1.00 23.47  ? 172 LEU A N     1 
ATOM   1975 C CA    . LEU C 3 153 ? 116.543 95.659  125.120 1.00 23.92  ? 172 LEU A CA    1 
ATOM   1976 C C     . LEU C 3 153 ? 118.049 95.452  125.329 1.00 24.19  ? 172 LEU A C     1 
ATOM   1977 O O     . LEU C 3 153 ? 118.670 94.592  124.685 1.00 23.34  ? 172 LEU A O     1 
ATOM   1978 C CB    . LEU C 3 153 ? 115.746 94.740  126.065 1.00 21.19  ? 172 LEU A CB    1 
ATOM   1979 C CG    . LEU C 3 153 ? 114.256 94.954  126.245 1.00 21.78  ? 172 LEU A CG    1 
ATOM   1980 C CD1   . LEU C 3 153 ? 113.624 93.748  126.926 1.00 23.59  ? 172 LEU A CD1   1 
ATOM   1981 C CD2   . LEU C 3 153 ? 114.007 96.212  127.034 1.00 21.70  ? 172 LEU A CD2   1 
ATOM   1982 N N     . ARG C 3 154 ? 118.621 96.227  126.257 1.00 21.84  ? 173 ARG A N     1 
ATOM   1983 C CA    . ARG C 3 154 ? 120.030 96.087  126.635 1.00 23.72  ? 173 ARG A CA    1 
ATOM   1984 C C     . ARG C 3 154 ? 120.190 94.751  127.400 1.00 27.61  ? 173 ARG A C     1 
ATOM   1985 O O     . ARG C 3 154 ? 119.245 94.269  128.034 1.00 26.35  ? 173 ARG A O     1 
ATOM   1986 C CB    . ARG C 3 154 ? 120.428 97.222  127.573 1.00 22.09  ? 173 ARG A CB    1 
ATOM   1987 C CG    . ARG C 3 154 ? 120.672 98.544  126.906 1.00 29.57  ? 173 ARG A CG    1 
ATOM   1988 C CD    . ARG C 3 154 ? 121.311 99.505  127.925 1.00 37.65  ? 173 ARG A CD    1 
ATOM   1989 N NE    . ARG C 3 154 ? 120.324 100.068 128.839 1.00 38.18  ? 173 ARG A NE    1 
ATOM   1990 C CZ    . ARG C 3 154 ? 120.132 99.656  130.090 1.00 55.37  ? 173 ARG A CZ    1 
ATOM   1991 N NH1   . ARG C 3 154 ? 120.843 98.657  130.590 1.00 43.29  ? 173 ARG A NH1   1 
ATOM   1992 N NH2   . ARG C 3 154 ? 119.200 100.223 130.837 1.00 38.15  ? 173 ARG A NH2   1 
ATOM   1993 N N     . ILE C 3 155 ? 121.380 94.170  127.363 1.00 24.02  ? 174 ILE A N     1 
ATOM   1994 C CA    . ILE C 3 155 ? 121.629 92.916  128.087 1.00 25.27  ? 174 ILE A CA    1 
ATOM   1995 C C     . ILE C 3 155 ? 121.277 92.961  129.579 1.00 28.26  ? 174 ILE A C     1 
ATOM   1996 O O     . ILE C 3 155 ? 120.747 91.983  130.083 1.00 27.88  ? 174 ILE A O     1 
ATOM   1997 C CB    . ILE C 3 155 ? 123.069 92.361  127.897 1.00 26.50  ? 174 ILE A CB    1 
ATOM   1998 C CG1   . ILE C 3 155 ? 124.116 93.398  128.324 1.00 26.68  ? 174 ILE A CG1   1 
ATOM   1999 C CG2   . ILE C 3 155 ? 123.278 91.856  126.451 1.00 22.73  ? 174 ILE A CG2   1 
ATOM   2000 C CD1   . ILE C 3 155 ? 125.550 92.977  127.980 1.00 26.77  ? 174 ILE A CD1   1 
ATOM   2001 N N     . ALA C 3 156 ? 121.558 94.073  130.278 1.00 24.96  ? 175 ALA A N     1 
ATOM   2002 C CA    . ALA C 3 156 ? 121.200 94.172  131.705 1.00 23.77  ? 175 ALA A CA    1 
ATOM   2003 C C     . ALA C 3 156 ? 119.682 94.091  131.957 1.00 28.58  ? 175 ALA A C     1 
ATOM   2004 O O     . ALA C 3 156 ? 119.248 93.557  132.977 1.00 24.65  ? 175 ALA A O     1 
ATOM   2005 C CB    . ALA C 3 156 ? 121.770 95.407  132.345 1.00 23.55  ? 175 ALA A CB    1 
ATOM   2006 N N     . GLU C 3 157 ? 118.891 94.580  131.002 1.00 23.57  ? 176 GLU A N     1 
ATOM   2007 C CA    . GLU C 3 157 ? 117.438 94.540  131.104 1.00 21.46  ? 176 GLU A CA    1 
ATOM   2008 C C     . GLU C 3 157 ? 116.958 93.136  130.804 1.00 27.10  ? 176 GLU A C     1 
ATOM   2009 O O     . GLU C 3 157 ? 116.035 92.625  131.437 1.00 27.62  ? 176 GLU A O     1 
ATOM   2010 C CB    . GLU C 3 157 ? 116.800 95.519  130.116 1.00 22.68  ? 176 GLU A CB    1 
ATOM   2011 C CG    . GLU C 3 157 ? 117.061 96.994  130.446 1.00 25.73  ? 176 GLU A CG    1 
ATOM   2012 C CD    . GLU C 3 157 ? 116.525 97.947  129.372 1.00 36.62  ? 176 GLU A CD    1 
ATOM   2013 O OE1   . GLU C 3 157 ? 116.993 97.891  128.224 1.00 27.60  ? 176 GLU A OE1   1 
ATOM   2014 O OE2   . GLU C 3 157 ? 115.659 98.781  129.673 1.00 38.53  ? 176 GLU A OE2   1 
ATOM   2015 N N     . ILE C 3 158 ? 117.570 92.504  129.820 1.00 23.22  ? 177 ILE A N     1 
ATOM   2016 C CA    . ILE C 3 158 ? 117.164 91.156  129.488 1.00 23.99  ? 177 ILE A CA    1 
ATOM   2017 C C     . ILE C 3 158 ? 117.508 90.202  130.639 1.00 31.62  ? 177 ILE A C     1 
ATOM   2018 O O     . ILE C 3 158 ? 116.713 89.312  130.972 1.00 28.65  ? 177 ILE A O     1 
ATOM   2019 C CB    . ILE C 3 158 ? 117.825 90.647  128.179 1.00 26.25  ? 177 ILE A CB    1 
ATOM   2020 C CG1   . ILE C 3 158 ? 117.410 91.529  126.991 1.00 24.11  ? 177 ILE A CG1   1 
ATOM   2021 C CG2   . ILE C 3 158 ? 117.443 89.137  127.926 1.00 24.37  ? 177 ILE A CG2   1 
ATOM   2022 C CD1   . ILE C 3 158 ? 118.227 91.294  125.751 1.00 22.79  ? 177 ILE A CD1   1 
ATOM   2023 N N     . ALA C 3 159 ? 118.669 90.404  131.267 1.00 26.28  ? 178 ALA A N     1 
ATOM   2024 C CA    . ALA C 3 159 ? 119.084 89.527  132.377 1.00 25.82  ? 178 ALA A CA    1 
ATOM   2025 C C     . ALA C 3 159 ? 118.090 89.590  133.561 1.00 31.61  ? 178 ALA A C     1 
ATOM   2026 O O     . ALA C 3 159 ? 117.941 88.637  134.350 1.00 31.19  ? 178 ALA A O     1 
ATOM   2027 C CB    . ALA C 3 159 ? 120.534 89.873  132.855 1.00 24.30  ? 178 ALA A CB    1 
ATOM   2028 N N     . ARG C 3 160 ? 117.409 90.716  133.669 1.00 27.59  ? 179 ARG A N     1 
ATOM   2029 C CA    . ARG C 3 160 ? 116.507 90.924  134.774 1.00 27.35  ? 179 ARG A CA    1 
ATOM   2030 C C     . ARG C 3 160 ? 115.031 90.618  134.565 1.00 29.24  ? 179 ARG A C     1 
ATOM   2031 O O     . ARG C 3 160 ? 114.232 90.680  135.495 1.00 32.39  ? 179 ARG A O     1 
ATOM   2032 C CB    . ARG C 3 160 ? 116.790 92.266  135.498 1.00 27.54  ? 179 ARG A CB    1 
ATOM   2033 C CG    . ARG C 3 160 ? 116.104 93.451  134.928 1.00 31.81  ? 179 ARG A CG    1 
ATOM   2034 C CD    . ARG C 3 160 ? 116.295 94.650  135.855 1.00 35.98  ? 179 ARG A CD    1 
ATOM   2035 N NE    . ARG C 3 160 ? 117.698 95.044  135.995 1.00 40.40  ? 179 ARG A NE    1 
ATOM   2036 C CZ    . ARG C 3 160 ? 118.300 96.002  135.266 1.00 58.14  ? 179 ARG A CZ    1 
ATOM   2037 N NH1   . ARG C 3 160 ? 117.655 96.668  134.312 1.00 31.52  ? 179 ARG A NH1   1 
ATOM   2038 N NH2   . ARG C 3 160 ? 119.568 96.299  135.497 1.00 42.81  ? 179 ARG A NH2   1 
ATOM   2039 N N     . ILE C 3 161 ? 114.672 90.190  133.376 1.00 26.63  ? 180 ILE A N     1 
ATOM   2040 C CA    . ILE C 3 161 ? 113.279 89.821  133.146 1.00 27.25  ? 180 ILE A CA    1 
ATOM   2041 C C     . ILE C 3 161 ? 112.959 88.570  134.005 1.00 32.22  ? 180 ILE A C     1 
ATOM   2042 O O     . ILE C 3 161 ? 113.710 87.572  133.985 1.00 27.72  ? 180 ILE A O     1 
ATOM   2043 C CB    . ILE C 3 161 ? 113.036 89.433  131.641 1.00 29.65  ? 180 ILE A CB    1 
ATOM   2044 C CG1   . ILE C 3 161 ? 113.395 90.585  130.689 1.00 29.12  ? 180 ILE A CG1   1 
ATOM   2045 C CG2   . ILE C 3 161 ? 111.607 88.827  131.407 1.00 23.34  ? 180 ILE A CG2   1 
ATOM   2046 C CD1   . ILE C 3 161 ? 113.588 90.120  129.231 1.00 25.59  ? 180 ILE A CD1   1 
ATOM   2047 N N     . ARG C 3 162 ? 111.842 88.622  134.730 1.00 29.02  ? 181 ARG A N     1 
ATOM   2048 C CA    . ARG C 3 162 ? 111.373 87.483  135.511 1.00 26.41  ? 181 ARG A CA    1 
ATOM   2049 C C     . ARG C 3 162 ? 110.157 86.941  134.789 1.00 28.86  ? 181 ARG A C     1 
ATOM   2050 O O     . ARG C 3 162 ? 109.519 87.663  134.013 1.00 27.73  ? 181 ARG A O     1 
ATOM   2051 C CB    . ARG C 3 162 ? 111.010 87.909  136.933 1.00 23.72  ? 181 ARG A CB    1 
ATOM   2052 C CG    . ARG C 3 162 ? 112.205 88.437  137.770 1.00 28.57  ? 181 ARG A CG    1 
ATOM   2053 C CD    . ARG C 3 162 ? 111.721 88.716  139.186 1.00 37.15  ? 181 ARG A CD    1 
ATOM   2054 N NE    . ARG C 3 162 ? 112.686 89.376  140.050 1.00 36.95  ? 181 ARG A NE    1 
ATOM   2055 C CZ    . ARG C 3 162 ? 113.509 88.756  140.891 1.00 45.21  ? 181 ARG A CZ    1 
ATOM   2056 N NH1   . ARG C 3 162 ? 113.514 87.434  141.007 1.00 31.96  ? 181 ARG A NH1   1 
ATOM   2057 N NH2   . ARG C 3 162 ? 114.329 89.471  141.637 1.00 39.19  ? 181 ARG A NH2   1 
ATOM   2058 N N     . VAL C 3 163 ? 109.854 85.668  135.005 1.00 26.12  ? 182 VAL A N     1 
ATOM   2059 C CA    . VAL C 3 163 ? 108.719 85.029  134.349 1.00 24.83  ? 182 VAL A CA    1 
ATOM   2060 C C     . VAL C 3 163 ? 107.390 85.794  134.546 1.00 28.23  ? 182 VAL A C     1 
ATOM   2061 O O     . VAL C 3 163 ? 106.580 85.933  133.617 1.00 25.00  ? 182 VAL A O     1 
ATOM   2062 C CB    . VAL C 3 163 ? 108.589 83.555  134.817 1.00 29.02  ? 182 VAL A CB    1 
ATOM   2063 C CG1   . VAL C 3 163 ? 107.263 82.915  134.311 1.00 27.71  ? 182 VAL A CG1   1 
ATOM   2064 C CG2   . VAL C 3 163 ? 109.800 82.772  134.345 1.00 27.67  ? 182 VAL A CG2   1 
ATOM   2065 N N     . LYS C 3 164 ? 107.188 86.318  135.747 1.00 28.57  ? 183 LYS A N     1 
ATOM   2066 C CA    . LYS C 3 164 ? 105.978 87.069  136.025 1.00 27.43  ? 183 LYS A CA    1 
ATOM   2067 C C     . LYS C 3 164 ? 105.872 88.340  135.197 1.00 36.22  ? 183 LYS A C     1 
ATOM   2068 O O     . LYS C 3 164 ? 104.817 88.919  135.133 1.00 36.19  ? 183 LYS A O     1 
ATOM   2069 C CB    . LYS C 3 164 ? 105.919 87.453  137.482 1.00 26.48  ? 183 LYS A CB    1 
ATOM   2070 C CG    . LYS C 3 164 ? 107.133 88.195  137.968 1.00 30.88  ? 183 LYS A CG    1 
ATOM   2071 C CD    . LYS C 3 164 ? 106.779 89.065  139.133 1.00 41.91  ? 183 LYS A CD    1 
ATOM   2072 C CE    . LYS C 3 164 ? 107.586 88.746  140.343 1.00 44.48  ? 183 LYS A CE    1 
ATOM   2073 N NZ    . LYS C 3 164 ? 106.835 89.211  141.549 1.00 76.27  ? 183 LYS A NZ    1 
ATOM   2074 N N     . ASP C 3 165 ? 106.956 88.773  134.559 1.00 33.22  ? 184 ASP A N     1 
ATOM   2075 C CA    . ASP C 3 165 ? 106.915 89.992  133.758 1.00 30.63  ? 184 ASP A CA    1 
ATOM   2076 C C     . ASP C 3 165 ? 106.230 89.723  132.434 1.00 33.03  ? 184 ASP A C     1 
ATOM   2077 O O     . ASP C 3 165 ? 105.956 90.638  131.638 1.00 31.30  ? 184 ASP A O     1 
ATOM   2078 C CB    . ASP C 3 165 ? 108.339 90.517  133.503 1.00 28.63  ? 184 ASP A CB    1 
ATOM   2079 C CG    . ASP C 3 165 ? 109.005 91.008  134.765 1.00 34.22  ? 184 ASP A CG    1 
ATOM   2080 O OD1   . ASP C 3 165 ? 108.284 91.521  135.655 1.00 35.47  ? 184 ASP A OD1   1 
ATOM   2081 O OD2   . ASP C 3 165 ? 110.235 90.839  134.909 1.00 33.49  ? 184 ASP A OD2   1 
ATOM   2082 N N     . ILE C 3 166 ? 106.013 88.455  132.158 1.00 25.79  ? 185 ILE A N     1 
ATOM   2083 C CA    . ILE C 3 166 ? 105.459 88.089  130.856 1.00 29.53  ? 185 ILE A CA    1 
ATOM   2084 C C     . ILE C 3 166 ? 103.941 87.919  130.883 1.00 38.22  ? 185 ILE A C     1 
ATOM   2085 O O     . ILE C 3 166 ? 103.418 87.251  131.744 1.00 41.90  ? 185 ILE A O     1 
ATOM   2086 C CB    . ILE C 3 166 ? 106.137 86.786  130.329 1.00 30.98  ? 185 ILE A CB    1 
ATOM   2087 C CG1   . ILE C 3 166 ? 107.660 86.898  130.432 1.00 28.56  ? 185 ILE A CG1   1 
ATOM   2088 C CG2   . ILE C 3 166 ? 105.699 86.481  128.928 1.00 33.49  ? 185 ILE A CG2   1 
ATOM   2089 C CD1   . ILE C 3 166 ? 108.394 85.675  129.906 1.00 28.23  ? 185 ILE A CD1   1 
ATOM   2090 N N     . SER C 3 167 ? 103.249 88.524  129.927 1.00 33.23  ? 186 SER A N     1 
ATOM   2091 C CA    . SER C 3 167 ? 101.797 88.402  129.839 1.00 32.33  ? 186 SER A CA    1 
ATOM   2092 C C     . SER C 3 167 ? 101.480 88.152  128.372 1.00 40.33  ? 186 SER A C     1 
ATOM   2093 O O     . SER C 3 167 ? 102.387 88.047  127.536 1.00 37.30  ? 186 SER A O     1 
ATOM   2094 C CB    . SER C 3 167 ? 101.100 89.675  130.356 1.00 33.93  ? 186 SER A CB    1 
ATOM   2095 O OG    . SER C 3 167 ? 101.229 90.753  129.447 1.00 39.71  ? 186 SER A OG    1 
ATOM   2096 N N     . ARG C 3 168 ? 100.209 88.040  128.038 1.00 43.72  ? 187 ARG A N     1 
ATOM   2097 C CA    . ARG C 3 168 ? 99.854  87.814  126.647 1.00 43.18  ? 187 ARG A CA    1 
ATOM   2098 C C     . ARG C 3 168 ? 99.077  88.944  126.029 1.00 53.46  ? 187 ARG A C     1 
ATOM   2099 O O     . ARG C 3 168 ? 98.351  89.686  126.705 1.00 54.31  ? 187 ARG A O     1 
ATOM   2100 C CB    . ARG C 3 168 ? 99.116  86.532  126.480 1.00 35.96  ? 187 ARG A CB    1 
ATOM   2101 C CG    . ARG C 3 168 ? 99.899  85.400  127.047 1.00 45.22  ? 187 ARG A CG    1 
ATOM   2102 C CD    . ARG C 3 168 ? 100.729 84.762  125.995 1.00 47.62  ? 187 ARG A CD    1 
ATOM   2103 N NE    . ARG C 3 168 ? 101.482 83.647  126.543 1.00 42.10  ? 187 ARG A NE    1 
ATOM   2104 C CZ    . ARG C 3 168 ? 102.087 82.738  125.795 1.00 53.40  ? 187 ARG A CZ    1 
ATOM   2105 N NH1   . ARG C 3 168 ? 102.004 82.822  124.475 1.00 39.81  ? 187 ARG A NH1   1 
ATOM   2106 N NH2   . ARG C 3 168 ? 102.765 81.762  126.370 1.00 52.37  ? 187 ARG A NH2   1 
ATOM   2107 N N     . THR C 3 169 ? 99.257  89.104  124.734 1.00 47.20  ? 188 THR A N     1 
ATOM   2108 C CA    . THR C 3 169 ? 98.570  90.156  124.069 1.00 42.39  ? 188 THR A CA    1 
ATOM   2109 C C     . THR C 3 169 ? 97.917  89.643  122.829 1.00 48.91  ? 188 THR A C     1 
ATOM   2110 O O     . THR C 3 169 ? 97.700  88.439  122.668 1.00 50.91  ? 188 THR A O     1 
ATOM   2111 C CB    . THR C 3 169 ? 99.481  91.375  123.826 1.00 51.18  ? 188 THR A CB    1 
ATOM   2112 O OG1   . THR C 3 169 ? 98.740  92.408  123.186 1.00 57.70  ? 188 THR A OG1   1 
ATOM   2113 C CG2   . THR C 3 169 ? 100.691 91.038  123.003 1.00 46.70  ? 188 THR A CG2   1 
ATOM   2114 N N     . ASP C 3 170 ? 97.573  90.565  121.954 1.00 47.65  ? 189 ASP A N     1 
ATOM   2115 C CA    . ASP C 3 170 ? 96.867  90.236  120.747 1.00 47.84  ? 189 ASP A CA    1 
ATOM   2116 C C     . ASP C 3 170 ? 97.465  89.039  120.032 1.00 48.12  ? 189 ASP A C     1 
ATOM   2117 O O     . ASP C 3 170 ? 98.621  89.073  119.620 1.00 49.13  ? 189 ASP A O     1 
ATOM   2118 C CB    . ASP C 3 170 ? 96.836  91.468  119.840 1.00 52.37  ? 189 ASP A CB    1 
ATOM   2119 C CG    . ASP C 3 170 ? 96.098  91.220  118.548 1.00 96.37  ? 189 ASP A CG    1 
ATOM   2120 O OD1   . ASP C 3 170 ? 94.889  90.894  118.617 1.00 100.00 ? 189 ASP A OD1   1 
ATOM   2121 O OD2   . ASP C 3 170 ? 96.725  91.342  117.465 1.00 100.00 ? 189 ASP A OD2   1 
ATOM   2122 N N     . GLY C 3 171 ? 96.665  87.991  119.858 1.00 40.82  ? 190 GLY A N     1 
ATOM   2123 C CA    . GLY C 3 171 ? 97.103  86.814  119.102 1.00 39.82  ? 190 GLY A CA    1 
ATOM   2124 C C     . GLY C 3 171 ? 97.893  85.791  119.885 1.00 43.71  ? 190 GLY A C     1 
ATOM   2125 O O     . GLY C 3 171 ? 98.334  84.794  119.341 1.00 44.89  ? 190 GLY A O     1 
ATOM   2126 N N     . GLY C 3 172 ? 98.083  86.038  121.173 1.00 44.08  ? 191 GLY A N     1 
ATOM   2127 C CA    . GLY C 3 172 ? 98.833  85.100  121.987 1.00 42.69  ? 191 GLY A CA    1 
ATOM   2128 C C     . GLY C 3 172 ? 100.278 85.529  122.078 1.00 40.04  ? 191 GLY A C     1 
ATOM   2129 O O     . GLY C 3 172 ? 101.040 84.965  122.826 1.00 47.10  ? 191 GLY A O     1 
ATOM   2130 N N     . ARG C 3 173 ? 100.639 86.553  121.337 1.00 33.89  ? 192 ARG A N     1 
ATOM   2131 C CA    . ARG C 3 173 ? 102.001 87.064  121.391 1.00 33.37  ? 192 ARG A CA    1 
ATOM   2132 C C     . ARG C 3 173 ? 102.294 87.391  122.824 1.00 35.26  ? 192 ARG A C     1 
ATOM   2133 O O     . ARG C 3 173 ? 101.384 87.751  123.556 1.00 35.94  ? 192 ARG A O     1 
ATOM   2134 C CB    . ARG C 3 173 ? 102.080 88.355  120.591 1.00 25.74  ? 192 ARG A CB    1 
ATOM   2135 C CG    . ARG C 3 173 ? 101.848 88.154  119.118 1.00 22.68  ? 192 ARG A CG    1 
ATOM   2136 C CD    . ARG C 3 173 ? 101.984 89.479  118.402 1.00 26.48  ? 192 ARG A CD    1 
ATOM   2137 N NE    . ARG C 3 173 ? 101.747 89.310  116.983 1.00 34.34  ? 192 ARG A NE    1 
ATOM   2138 C CZ    . ARG C 3 173 ? 100.539 89.261  116.451 1.00 39.83  ? 192 ARG A CZ    1 
ATOM   2139 N NH1   . ARG C 3 173 ? 99.457  89.406  117.221 1.00 42.95  ? 192 ARG A NH1   1 
ATOM   2140 N NH2   . ARG C 3 173 ? 100.417 89.067  115.152 1.00 34.30  ? 192 ARG A NH2   1 
ATOM   2141 N N     . MET C 3 174 ? 103.555 87.301  123.226 1.00 30.24  ? 193 MET A N     1 
ATOM   2142 C CA    . MET C 3 174 ? 103.950 87.686  124.586 1.00 26.67  ? 193 MET A CA    1 
ATOM   2143 C C     . MET C 3 174 ? 104.184 89.186  124.685 1.00 33.10  ? 193 MET A C     1 
ATOM   2144 O O     . MET C 3 174 ? 104.548 89.847  123.711 1.00 28.15  ? 193 MET A O     1 
ATOM   2145 C CB    . MET C 3 174 ? 105.236 86.993  125.018 1.00 27.55  ? 193 MET A CB    1 
ATOM   2146 C CG    . MET C 3 174 ? 105.018 85.599  125.472 1.00 34.22  ? 193 MET A CG    1 
ATOM   2147 S SD    . MET C 3 174 ? 106.558 84.668  125.692 1.00 40.58  ? 193 MET A SD    1 
ATOM   2148 C CE    . MET C 3 174 ? 105.874 83.047  126.017 1.00 36.70  ? 193 MET A CE    1 
ATOM   2149 N N     . LEU C 3 175 ? 104.020 89.693  125.897 1.00 32.74  ? 194 LEU A N     1 
ATOM   2150 C CA    . LEU C 3 175 ? 104.244 91.085  126.219 1.00 33.48  ? 194 LEU A CA    1 
ATOM   2151 C C     . LEU C 3 175 ? 105.197 91.004  127.391 1.00 35.10  ? 194 LEU A C     1 
ATOM   2152 O O     . LEU C 3 175 ? 104.976 90.225  128.313 1.00 33.27  ? 194 LEU A O     1 
ATOM   2153 C CB    . LEU C 3 175 ? 102.929 91.716  126.696 1.00 35.96  ? 194 LEU A CB    1 
ATOM   2154 C CG    . LEU C 3 175 ? 102.329 92.966  126.039 1.00 47.22  ? 194 LEU A CG    1 
ATOM   2155 C CD1   . LEU C 3 175 ? 102.862 93.243  124.632 1.00 48.46  ? 194 LEU A CD1   1 
ATOM   2156 C CD2   . LEU C 3 175 ? 100.815 92.859  126.037 1.00 46.43  ? 194 LEU A CD2   1 
ATOM   2157 N N     . ILE C 3 176 ? 106.290 91.748  127.351 1.00 30.22  ? 195 ILE A N     1 
ATOM   2158 C CA    . ILE C 3 176 ? 107.202 91.698  128.467 1.00 27.29  ? 195 ILE A CA    1 
ATOM   2159 C C     . ILE C 3 176 ? 107.215 93.047  129.122 1.00 31.03  ? 195 ILE A C     1 
ATOM   2160 O O     . ILE C 3 176 ? 107.499 94.049  128.482 1.00 33.07  ? 195 ILE A O     1 
ATOM   2161 C CB    . ILE C 3 176 ? 108.666 91.285  128.090 1.00 29.22  ? 195 ILE A CB    1 
ATOM   2162 C CG1   . ILE C 3 176 ? 108.689 89.952  127.315 1.00 30.80  ? 195 ILE A CG1   1 
ATOM   2163 C CG2   . ILE C 3 176 ? 109.497 91.104  129.349 1.00 24.71  ? 195 ILE A CG2   1 
ATOM   2164 C CD1   . ILE C 3 176 ? 110.102 89.548  126.756 1.00 25.09  ? 195 ILE A CD1   1 
ATOM   2165 N N     . HIS C 3 177 ? 106.935 93.054  130.416 1.00 27.40  ? 196 HIS A N     1 
ATOM   2166 C CA    . HIS C 3 177 ? 106.932 94.261  131.216 1.00 26.28  ? 196 HIS A CA    1 
ATOM   2167 C C     . HIS C 3 177 ? 108.345 94.576  131.691 1.00 30.36  ? 196 HIS A C     1 
ATOM   2168 O O     . HIS C 3 177 ? 109.024 93.715  132.268 1.00 30.57  ? 196 HIS A O     1 
ATOM   2169 C CB    . HIS C 3 177 ? 106.043 94.060  132.431 1.00 28.24  ? 196 HIS A CB    1 
ATOM   2170 C CG    . HIS C 3 177 ? 106.154 95.163  133.406 1.00 34.15  ? 196 HIS A CG    1 
ATOM   2171 N ND1   . HIS C 3 177 ? 105.585 96.398  133.181 1.00 38.76  ? 196 HIS A ND1   1 
ATOM   2172 C CD2   . HIS C 3 177 ? 106.881 95.281  134.540 1.00 38.46  ? 196 HIS A CD2   1 
ATOM   2173 C CE1   . HIS C 3 177 ? 105.934 97.223  134.152 1.00 38.28  ? 196 HIS A CE1   1 
ATOM   2174 N NE2   . HIS C 3 177 ? 106.720 96.571  134.988 1.00 39.16  ? 196 HIS A NE2   1 
ATOM   2175 N N     . ILE C 3 178 ? 108.795 95.799  131.438 1.00 29.50  ? 197 ILE A N     1 
ATOM   2176 C CA    . ILE C 3 178 ? 110.126 96.280  131.866 1.00 30.14  ? 197 ILE A CA    1 
ATOM   2177 C C     . ILE C 3 178 ? 109.864 97.418  132.855 1.00 39.88  ? 197 ILE A C     1 
ATOM   2178 O O     . ILE C 3 178 ? 109.217 98.384  132.503 1.00 41.04  ? 197 ILE A O     1 
ATOM   2179 C CB    . ILE C 3 178 ? 110.913 96.856  130.640 1.00 32.48  ? 197 ILE A CB    1 
ATOM   2180 C CG1   . ILE C 3 178 ? 110.793 95.913  129.439 1.00 31.94  ? 197 ILE A CG1   1 
ATOM   2181 C CG2   . ILE C 3 178 ? 112.374 97.086  130.989 1.00 27.91  ? 197 ILE A CG2   1 
ATOM   2182 C CD1   . ILE C 3 178 ? 111.527 94.548  129.629 1.00 29.23  ? 197 ILE A CD1   1 
ATOM   2183 N N     . GLY C 3 179 ? 110.284 97.283  134.107 1.00 43.84  ? 198 GLY A N     1 
ATOM   2184 C CA    . GLY C 3 179 ? 110.027 98.348  135.105 1.00 45.65  ? 198 GLY A CA    1 
ATOM   2185 C C     . GLY C 3 179 ? 111.041 99.492  134.986 1.00 55.71  ? 198 GLY A C     1 
ATOM   2186 O O     . GLY C 3 179 ? 112.113 99.300  134.409 1.00 60.71  ? 198 GLY A O     1 
ATOM   2187 N N     . ARG C 3 180 ? 110.701 100.668 135.514 1.00 54.13  ? 199 ARG A N     1 
ATOM   2188 C CA    . ARG C 3 180 ? 111.596 101.825 135.454 1.00 77.16  ? 199 ARG A CA    1 
ATOM   2189 C C     . ARG C 3 180 ? 113.071 101.421 135.544 1.00 100.00 ? 199 ARG A C     1 
ATOM   2190 O O     . ARG C 3 180 ? 113.968 102.230 135.304 1.00 98.73  ? 199 ARG A O     1 
ATOM   2191 C CB    . ARG C 3 180 ? 111.256 102.819 136.565 1.00 80.18  ? 199 ARG A CB    1 
ATOM   2192 C CG    . ARG C 3 180 ? 110.130 103.774 136.217 1.00 100.00 ? 199 ARG A CG    1 
ATOM   2193 C CD    . ARG C 3 180 ? 109.608 103.500 134.798 1.00 100.00 ? 199 ARG A CD    1 
ATOM   2194 N NE    . ARG C 3 180 ? 108.216 103.906 134.658 1.00 100.00 ? 199 ARG A NE    1 
ATOM   2195 C CZ    . ARG C 3 180 ? 107.254 103.547 135.504 1.00 100.00 ? 199 ARG A CZ    1 
ATOM   2196 N NH1   . ARG C 3 180 ? 107.535 102.760 136.533 1.00 100.00 ? 199 ARG A NH1   1 
ATOM   2197 N NH2   . ARG C 3 180 ? 106.002 103.951 135.310 1.00 100.00 ? 199 ARG A NH2   1 
ATOM   2198 N N     . GLY C 3 189 ? 109.353 101.434 132.817 1.00 70.44  ? 208 GLY A N     1 
ATOM   2199 C CA    . GLY C 3 189 ? 108.019 100.861 133.027 1.00 68.61  ? 208 GLY A CA    1 
ATOM   2200 C C     . GLY C 3 189 ? 107.217 100.698 131.724 1.00 62.69  ? 208 GLY A C     1 
ATOM   2201 O O     . GLY C 3 189 ? 106.104 101.188 131.611 1.00 66.42  ? 208 GLY A O     1 
ATOM   2202 N N     . VAL C 3 190 ? 107.779 100.003 130.745 1.00 45.04  ? 209 VAL A N     1 
ATOM   2203 C CA    . VAL C 3 190 ? 107.112 99.828  129.476 1.00 38.69  ? 209 VAL A CA    1 
ATOM   2204 C C     . VAL C 3 190 ? 106.757 98.369  129.242 1.00 42.64  ? 209 VAL A C     1 
ATOM   2205 O O     . VAL C 3 190 ? 107.117 97.507  130.041 1.00 41.21  ? 209 VAL A O     1 
ATOM   2206 C CB    . VAL C 3 190 ? 108.023 100.334 128.365 1.00 40.07  ? 209 VAL A CB    1 
ATOM   2207 C CG1   . VAL C 3 190 ? 108.477 101.706 128.724 1.00 40.40  ? 209 VAL A CG1   1 
ATOM   2208 C CG2   . VAL C 3 190 ? 109.248 99.472  128.245 1.00 37.54  ? 209 VAL A CG2   1 
ATOM   2209 N N     . GLU C 3 191 ? 106.046 98.098  128.149 1.00 36.62  ? 210 GLU A N     1 
ATOM   2210 C CA    . GLU C 3 191 ? 105.688 96.738  127.787 1.00 34.99  ? 210 GLU A CA    1 
ATOM   2211 C C     . GLU C 3 191 ? 106.276 96.465  126.396 1.00 35.93  ? 210 GLU A C     1 
ATOM   2212 O O     . GLU C 3 191 ? 106.005 97.212  125.449 1.00 35.06  ? 210 GLU A O     1 
ATOM   2213 C CB    . GLU C 3 191 ? 104.157 96.580  127.734 1.00 36.79  ? 210 GLU A CB    1 
ATOM   2214 C CG    . GLU C 3 191 ? 103.468 96.730  129.055 1.00 39.11  ? 210 GLU A CG    1 
ATOM   2215 C CD    . GLU C 3 191 ? 103.635 95.518  129.937 1.00 44.68  ? 210 GLU A CD    1 
ATOM   2216 O OE1   . GLU C 3 191 ? 103.751 94.392  129.404 1.00 44.33  ? 210 GLU A OE1   1 
ATOM   2217 O OE2   . GLU C 3 191 ? 103.657 95.696  131.173 1.00 58.45  ? 210 GLU A OE2   1 
ATOM   2218 N N     . LYS C 3 192 ? 107.071 95.405  126.273 1.00 27.70  ? 211 LYS A N     1 
ATOM   2219 C CA    . LYS C 3 192 ? 107.665 95.024  124.985 1.00 26.38  ? 211 LYS A CA    1 
ATOM   2220 C C     . LYS C 3 192 ? 106.896 93.878  124.326 1.00 27.50  ? 211 LYS A C     1 
ATOM   2221 O O     . LYS C 3 192 ? 106.739 92.813  124.899 1.00 29.90  ? 211 LYS A O     1 
ATOM   2222 C CB    . LYS C 3 192 ? 109.126 94.610  125.177 1.00 28.02  ? 211 LYS A CB    1 
ATOM   2223 C CG    . LYS C 3 192 ? 109.916 95.605  125.979 1.00 28.20  ? 211 LYS A CG    1 
ATOM   2224 C CD    . LYS C 3 192 ? 109.953 96.970  125.289 1.00 28.65  ? 211 LYS A CD    1 
ATOM   2225 C CE    . LYS C 3 192 ? 111.044 97.032  124.238 1.00 29.23  ? 211 LYS A CE    1 
ATOM   2226 N NZ    . LYS C 3 192 ? 111.128 98.348  123.546 1.00 32.13  ? 211 LYS A NZ    1 
ATOM   2227 N N     . ALA C 3 193 ? 106.425 94.092  123.113 1.00 23.94  ? 212 ALA A N     1 
ATOM   2228 C CA    . ALA C 3 193 ? 105.673 93.061  122.437 1.00 28.10  ? 212 ALA A CA    1 
ATOM   2229 C C     . ALA C 3 193 ? 106.533 92.189  121.552 1.00 30.78  ? 212 ALA A C     1 
ATOM   2230 O O     . ALA C 3 193 ? 107.352 92.704  120.776 1.00 31.62  ? 212 ALA A O     1 
ATOM   2231 C CB    . ALA C 3 193 ? 104.565 93.682  121.594 1.00 30.26  ? 212 ALA A CB    1 
ATOM   2232 N N     . LEU C 3 194 ? 106.300 90.878  121.619 1.00 26.59  ? 213 LEU A N     1 
ATOM   2233 C CA    . LEU C 3 194 ? 107.039 89.910  120.798 1.00 25.66  ? 213 LEU A CA    1 
ATOM   2234 C C     . LEU C 3 194 ? 106.178 89.426  119.631 1.00 29.39  ? 213 LEU A C     1 
ATOM   2235 O O     . LEU C 3 194 ? 104.956 89.407  119.721 1.00 31.27  ? 213 LEU A O     1 
ATOM   2236 C CB    . LEU C 3 194 ? 107.468 88.712  121.642 1.00 25.72  ? 213 LEU A CB    1 
ATOM   2237 C CG    . LEU C 3 194 ? 108.301 88.998  122.891 1.00 29.87  ? 213 LEU A CG    1 
ATOM   2238 C CD1   . LEU C 3 194 ? 108.856 87.659  123.392 1.00 27.48  ? 213 LEU A CD1   1 
ATOM   2239 C CD2   . LEU C 3 194 ? 109.418 90.015  122.623 1.00 25.46  ? 213 LEU A CD2   1 
ATOM   2240 N N     . SER C 3 195 ? 106.836 89.058  118.533 1.00 26.02  ? 214 SER A N     1 
ATOM   2241 C CA    . SER C 3 195 ? 106.157 88.554  117.361 1.00 23.84  ? 214 SER A CA    1 
ATOM   2242 C C     . SER C 3 195 ? 105.720 87.136  117.723 1.00 28.96  ? 214 SER A C     1 
ATOM   2243 O O     . SER C 3 195 ? 106.109 86.613  118.760 1.00 29.73  ? 214 SER A O     1 
ATOM   2244 C CB    . SER C 3 195 ? 107.128 88.482  116.181 1.00 19.54  ? 214 SER A CB    1 
ATOM   2245 O OG    . SER C 3 195 ? 108.166 87.549  116.461 1.00 27.59  ? 214 SER A OG    1 
ATOM   2246 N N     . LEU C 3 196 ? 104.896 86.540  116.862 1.00 33.40  ? 215 LEU A N     1 
ATOM   2247 C CA    . LEU C 3 196 ? 104.388 85.173  117.021 1.00 27.75  ? 215 LEU A CA    1 
ATOM   2248 C C     . LEU C 3 196 ? 105.569 84.205  117.029 1.00 29.98  ? 215 LEU A C     1 
ATOM   2249 O O     . LEU C 3 196 ? 105.677 83.332  117.897 1.00 31.74  ? 215 LEU A O     1 
ATOM   2250 C CB    . LEU C 3 196 ? 103.454 84.822  115.862 1.00 25.63  ? 215 LEU A CB    1 
ATOM   2251 C CG    . LEU C 3 196 ? 102.147 85.624  115.837 1.00 29.90  ? 215 LEU A CG    1 
ATOM   2252 C CD1   . LEU C 3 196 ? 101.464 85.564  114.503 1.00 28.76  ? 215 LEU A CD1   1 
ATOM   2253 C CD2   . LEU C 3 196 ? 101.201 85.246  116.957 1.00 31.08  ? 215 LEU A CD2   1 
ATOM   2254 N N     . GLY C 3 197 ? 106.487 84.388  116.079 1.00 25.62  ? 216 GLY A N     1 
ATOM   2255 C CA    . GLY C 3 197 ? 107.659 83.522  115.986 1.00 24.33  ? 216 GLY A CA    1 
ATOM   2256 C C     . GLY C 3 197 ? 108.591 83.616  117.201 1.00 31.20  ? 216 GLY A C     1 
ATOM   2257 O O     . GLY C 3 197 ? 109.074 82.612  117.696 1.00 29.37  ? 216 GLY A O     1 
ATOM   2258 N N     . VAL C 3 198 ? 108.866 84.834  117.670 1.00 28.25  ? 217 VAL A N     1 
ATOM   2259 C CA    . VAL C 3 198 ? 109.761 84.966  118.811 1.00 24.92  ? 217 VAL A CA    1 
ATOM   2260 C C     . VAL C 3 198 ? 109.054 84.467  120.063 1.00 26.69  ? 217 VAL A C     1 
ATOM   2261 O O     . VAL C 3 198 ? 109.673 83.874  120.930 1.00 28.81  ? 217 VAL A O     1 
ATOM   2262 C CB    . VAL C 3 198 ? 110.331 86.429  118.983 1.00 26.52  ? 217 VAL A CB    1 
ATOM   2263 C CG1   . VAL C 3 198 ? 111.079 86.633  120.340 1.00 21.55  ? 217 VAL A CG1   1 
ATOM   2264 C CG2   . VAL C 3 198 ? 111.237 86.781  117.796 1.00 25.74  ? 217 VAL A CG2   1 
ATOM   2265 N N     . THR C 3 199 ? 107.748 84.709  120.156 1.00 24.28  ? 218 THR A N     1 
ATOM   2266 C CA    . THR C 3 199 ? 106.974 84.249  121.311 1.00 22.47  ? 218 THR A CA    1 
ATOM   2267 C C     . THR C 3 199 ? 107.096 82.720  121.318 1.00 25.79  ? 218 THR A C     1 
ATOM   2268 O O     . THR C 3 199 ? 107.316 82.114  122.345 1.00 26.65  ? 218 THR A O     1 
ATOM   2269 C CB    . THR C 3 199 ? 105.455 84.611  121.161 1.00 31.16  ? 218 THR A CB    1 
ATOM   2270 O OG1   . THR C 3 199 ? 105.282 86.029  121.259 1.00 23.06  ? 218 THR A OG1   1 
ATOM   2271 C CG2   . THR C 3 199 ? 104.600 83.896  122.272 1.00 31.60  ? 218 THR A CG2   1 
ATOM   2272 N N     . LYS C 3 200 ? 106.970 82.102  120.150 1.00 24.30  ? 219 LYS A N     1 
ATOM   2273 C CA    . LYS C 3 200 ? 107.071 80.662  120.071 1.00 26.20  ? 219 LYS A CA    1 
ATOM   2274 C C     . LYS C 3 200 ? 108.436 80.135  120.561 1.00 30.31  ? 219 LYS A C     1 
ATOM   2275 O O     . LYS C 3 200 ? 108.486 79.157  121.295 1.00 32.04  ? 219 LYS A O     1 
ATOM   2276 C CB    . LYS C 3 200 ? 106.701 80.170  118.662 1.00 31.27  ? 219 LYS A CB    1 
ATOM   2277 C CG    . LYS C 3 200 ? 107.208 78.776  118.319 1.00 53.97  ? 219 LYS A CG    1 
ATOM   2278 C CD    . LYS C 3 200 ? 106.695 78.314  116.969 1.00 75.95  ? 219 LYS A CD    1 
ATOM   2279 C CE    . LYS C 3 200 ? 106.997 76.838  116.736 1.00 78.92  ? 219 LYS A CE    1 
ATOM   2280 N NZ    . LYS C 3 200 ? 105.782 76.042  116.455 1.00 91.27  ? 219 LYS A NZ    1 
ATOM   2281 N N     . LEU C 3 201 ? 109.527 80.815  120.190 1.00 27.35  ? 220 LEU A N     1 
ATOM   2282 C CA    . LEU C 3 201 ? 110.885 80.442  120.623 1.00 22.73  ? 220 LEU A CA    1 
ATOM   2283 C C     . LEU C 3 201 ? 111.024 80.575  122.126 1.00 29.51  ? 220 LEU A C     1 
ATOM   2284 O O     . LEU C 3 201 ? 111.709 79.773  122.784 1.00 28.24  ? 220 LEU A O     1 
ATOM   2285 C CB    . LEU C 3 201 ? 111.924 81.388  120.019 1.00 21.34  ? 220 LEU A CB    1 
ATOM   2286 C CG    . LEU C 3 201 ? 112.057 81.400  118.510 1.00 25.16  ? 220 LEU A CG    1 
ATOM   2287 C CD1   . LEU C 3 201 ? 113.048 82.500  118.058 1.00 25.26  ? 220 LEU A CD1   1 
ATOM   2288 C CD2   . LEU C 3 201 ? 112.573 80.028  118.105 1.00 27.80  ? 220 LEU A CD2   1 
ATOM   2289 N N     . VAL C 3 202 ? 110.401 81.612  122.683 1.00 23.74  ? 221 VAL A N     1 
ATOM   2290 C CA    . VAL C 3 202 ? 110.494 81.868  124.115 1.00 23.04  ? 221 VAL A CA    1 
ATOM   2291 C C     . VAL C 3 202 ? 109.669 80.826  124.863 1.00 27.06  ? 221 VAL A C     1 
ATOM   2292 O O     . VAL C 3 202 ? 110.067 80.355  125.926 1.00 26.98  ? 221 VAL A O     1 
ATOM   2293 C CB    . VAL C 3 202 ? 110.000 83.336  124.455 1.00 27.19  ? 221 VAL A CB    1 
ATOM   2294 C CG1   . VAL C 3 202 ? 109.916 83.582  126.000 1.00 25.29  ? 221 VAL A CG1   1 
ATOM   2295 C CG2   . VAL C 3 202 ? 110.882 84.412  123.753 1.00 26.03  ? 221 VAL A CG2   1 
ATOM   2296 N N     . GLU C 3 203 ? 108.513 80.477  124.308 1.00 26.11  ? 222 GLU A N     1 
ATOM   2297 C CA    . GLU C 3 203 ? 107.636 79.465  124.911 1.00 27.64  ? 222 GLU A CA    1 
ATOM   2298 C C     . GLU C 3 203 ? 108.393 78.128  125.013 1.00 32.50  ? 222 GLU A C     1 
ATOM   2299 O O     . GLU C 3 203 ? 108.348 77.430  126.044 1.00 32.10  ? 222 GLU A O     1 
ATOM   2300 C CB    . GLU C 3 203 ? 106.347 79.299  124.081 1.00 26.98  ? 222 GLU A CB    1 
ATOM   2301 C CG    . GLU C 3 203 ? 105.402 80.535  124.171 1.00 34.98  ? 222 GLU A CG    1 
ATOM   2302 C CD    . GLU C 3 203 ? 104.128 80.412  123.309 1.00 51.99  ? 222 GLU A CD    1 
ATOM   2303 O OE1   . GLU C 3 203 ? 104.181 79.766  122.230 1.00 46.84  ? 222 GLU A OE1   1 
ATOM   2304 O OE2   . GLU C 3 203 ? 103.083 80.984  123.688 1.00 43.96  ? 222 GLU A OE2   1 
ATOM   2305 N N     . ARG C 3 204 ? 109.147 77.805  123.968 1.00 25.70  ? 223 ARG A N     1 
ATOM   2306 C CA    . ARG C 3 204 ? 109.904 76.565  123.986 1.00 24.39  ? 223 ARG A CA    1 
ATOM   2307 C C     . ARG C 3 204 ? 110.936 76.576  125.084 1.00 31.30  ? 223 ARG A C     1 
ATOM   2308 O O     . ARG C 3 204 ? 111.027 75.641  125.856 1.00 29.76  ? 223 ARG A O     1 
ATOM   2309 C CB    . ARG C 3 204 ? 110.557 76.278  122.643 1.00 26.35  ? 223 ARG A CB    1 
ATOM   2310 C CG    . ARG C 3 204 ? 111.270 74.905  122.602 1.00 29.76  ? 223 ARG A CG    1 
ATOM   2311 C CD    . ARG C 3 204 ? 111.483 74.428  121.176 1.00 28.83  ? 223 ARG A CD    1 
ATOM   2312 N NE    . ARG C 3 204 ? 111.840 73.017  121.133 1.00 33.57  ? 223 ARG A NE    1 
ATOM   2313 C CZ    . ARG C 3 204 ? 112.918 72.534  120.528 1.00 49.65  ? 223 ARG A CZ    1 
ATOM   2314 N NH1   . ARG C 3 204 ? 113.725 73.354  119.867 1.00 37.28  ? 223 ARG A NH1   1 
ATOM   2315 N NH2   . ARG C 3 204 ? 113.187 71.228  120.578 1.00 36.12  ? 223 ARG A NH2   1 
ATOM   2316 N N     . TRP C 3 205 ? 111.700 77.656  125.182 1.00 29.65  ? 224 TRP A N     1 
ATOM   2317 C CA    . TRP C 3 205 ? 112.719 77.754  126.228 1.00 25.23  ? 224 TRP A CA    1 
ATOM   2318 C C     . TRP C 3 205 ? 112.054 77.641  127.610 1.00 30.51  ? 224 TRP A C     1 
ATOM   2319 O O     . TRP C 3 205 ? 112.556 76.987  128.527 1.00 30.57  ? 224 TRP A O     1 
ATOM   2320 C CB    . TRP C 3 205 ? 113.478 79.088  126.121 1.00 22.37  ? 224 TRP A CB    1 
ATOM   2321 C CG    . TRP C 3 205 ? 114.217 79.425  127.405 1.00 22.78  ? 224 TRP A CG    1 
ATOM   2322 C CD1   . TRP C 3 205 ? 113.936 80.447  128.278 1.00 25.14  ? 224 TRP A CD1   1 
ATOM   2323 C CD2   . TRP C 3 205 ? 115.275 78.655  128.017 1.00 22.82  ? 224 TRP A CD2   1 
ATOM   2324 N NE1   . TRP C 3 205 ? 114.767 80.371  129.379 1.00 24.52  ? 224 TRP A NE1   1 
ATOM   2325 C CE2   . TRP C 3 205 ? 115.596 79.288  129.243 1.00 24.82  ? 224 TRP A CE2   1 
ATOM   2326 C CE3   . TRP C 3 205 ? 115.962 77.483  127.657 1.00 24.72  ? 224 TRP A CE3   1 
ATOM   2327 C CZ2   . TRP C 3 205 ? 116.610 78.817  130.096 1.00 24.98  ? 224 TRP A CZ2   1 
ATOM   2328 C CZ3   . TRP C 3 205 ? 116.947 77.002  128.516 1.00 25.68  ? 224 TRP A CZ3   1 
ATOM   2329 C CH2   . TRP C 3 205 ? 117.287 77.688  129.702 1.00 25.78  ? 224 TRP A CH2   1 
ATOM   2330 N N     . ILE C 3 206 ? 110.955 78.350  127.780 1.00 28.89  ? 225 ILE A N     1 
ATOM   2331 C CA    . ILE C 3 206 ? 110.243 78.328  129.038 1.00 30.53  ? 225 ILE A CA    1 
ATOM   2332 C C     . ILE C 3 206 ? 109.814 76.859  129.352 1.00 32.09  ? 225 ILE A C     1 
ATOM   2333 O O     . ILE C 3 206 ? 110.011 76.346  130.459 1.00 29.81  ? 225 ILE A O     1 
ATOM   2334 C CB    . ILE C 3 206 ? 108.965 79.240  128.959 1.00 32.71  ? 225 ILE A CB    1 
ATOM   2335 C CG1   . ILE C 3 206 ? 109.359 80.724  128.843 1.00 30.65  ? 225 ILE A CG1   1 
ATOM   2336 C CG2   . ILE C 3 206 ? 108.046 78.953  130.156 1.00 33.71  ? 225 ILE A CG2   1 
ATOM   2337 C CD1   . ILE C 3 206 ? 108.222 81.738  129.075 1.00 23.85  ? 225 ILE A CD1   1 
ATOM   2338 N N     . SER C 3 207 ? 109.219 76.198  128.377 1.00 28.28  ? 226 SER A N     1 
ATOM   2339 C CA    . SER C 3 207 ? 108.752 74.830  128.599 1.00 28.65  ? 226 SER A CA    1 
ATOM   2340 C C     . SER C 3 207 ? 109.841 73.812  128.949 1.00 32.51  ? 226 SER A C     1 
ATOM   2341 O O     . SER C 3 207 ? 109.621 72.936  129.785 1.00 35.00  ? 226 SER A O     1 
ATOM   2342 C CB    . SER C 3 207 ? 107.896 74.338  127.428 1.00 27.01  ? 226 SER A CB    1 
ATOM   2343 O OG    . SER C 3 207 ? 108.694 73.956  126.313 1.00 33.35  ? 226 SER A OG    1 
ATOM   2344 N N     . VAL C 3 208 ? 111.009 73.928  128.317 1.00 25.79  ? 227 VAL A N     1 
ATOM   2345 C CA    . VAL C 3 208 ? 112.094 72.992  128.554 1.00 26.07  ? 227 VAL A CA    1 
ATOM   2346 C C     . VAL C 3 208 ? 112.899 73.266  129.816 1.00 34.74  ? 227 VAL A C     1 
ATOM   2347 O O     . VAL C 3 208 ? 113.342 72.344  130.506 1.00 33.78  ? 227 VAL A O     1 
ATOM   2348 C CB    . VAL C 3 208 ? 113.032 72.914  127.342 1.00 30.86  ? 227 VAL A CB    1 
ATOM   2349 C CG1   . VAL C 3 208 ? 114.267 72.173  127.681 1.00 28.70  ? 227 VAL A CG1   1 
ATOM   2350 C CG2   . VAL C 3 208 ? 112.307 72.262  126.128 1.00 30.54  ? 227 VAL A CG2   1 
ATOM   2351 N N     . SER C 3 209 ? 113.090 74.537  130.142 1.00 34.43  ? 228 SER A N     1 
ATOM   2352 C CA    . SER C 3 209 ? 113.900 74.897  131.313 1.00 31.81  ? 228 SER A CA    1 
ATOM   2353 C C     . SER C 3 209 ? 113.164 74.805  132.668 1.00 33.73  ? 228 SER A C     1 
ATOM   2354 O O     . SER C 3 209 ? 113.821 74.772  133.719 1.00 29.80  ? 228 SER A O     1 
ATOM   2355 C CB    . SER C 3 209 ? 114.419 76.321  131.143 1.00 31.73  ? 228 SER A CB    1 
ATOM   2356 O OG    . SER C 3 209 ? 113.338 77.241  131.242 1.00 30.89  ? 228 SER A OG    1 
ATOM   2357 N N     . GLY C 3 210 ? 111.831 74.877  132.646 1.00 28.01  ? 229 GLY A N     1 
ATOM   2358 C CA    . GLY C 3 210 ? 111.043 74.854  133.860 1.00 27.28  ? 229 GLY A CA    1 
ATOM   2359 C C     . GLY C 3 210 ? 111.102 76.170  134.638 1.00 37.82  ? 229 GLY A C     1 
ATOM   2360 O O     . GLY C 3 210 ? 110.714 76.226  135.799 1.00 38.43  ? 229 GLY A O     1 
ATOM   2361 N N     . VAL C 3 211 ? 111.574 77.247  134.017 1.00 36.42  ? 230 VAL A N     1 
ATOM   2362 C CA    . VAL C 3 211 ? 111.653 78.525  134.744 1.00 30.96  ? 230 VAL A CA    1 
ATOM   2363 C C     . VAL C 3 211 ? 110.287 78.983  135.270 1.00 31.73  ? 230 VAL A C     1 
ATOM   2364 O O     . VAL C 3 211 ? 110.199 79.621  136.305 1.00 29.93  ? 230 VAL A O     1 
ATOM   2365 C CB    . VAL C 3 211 ? 112.334 79.669  133.907 1.00 27.08  ? 230 VAL A CB    1 
ATOM   2366 C CG1   . VAL C 3 211 ? 113.777 79.368  133.676 1.00 26.67  ? 230 VAL A CG1   1 
ATOM   2367 C CG2   . VAL C 3 211 ? 111.604 79.898  132.565 1.00 23.30  ? 230 VAL A CG2   1 
ATOM   2368 N N     . ALA C 3 212 ? 109.226 78.626  134.557 1.00 25.60  ? 231 ALA A N     1 
ATOM   2369 C CA    . ALA C 3 212 ? 107.907 79.037  134.942 1.00 25.52  ? 231 ALA A CA    1 
ATOM   2370 C C     . ALA C 3 212 ? 107.412 78.299  136.203 1.00 37.34  ? 231 ALA A C     1 
ATOM   2371 O O     . ALA C 3 212 ? 106.295 78.562  136.641 1.00 35.88  ? 231 ALA A O     1 
ATOM   2372 C CB    . ALA C 3 212 ? 106.921 78.860  133.757 1.00 23.98  ? 231 ALA A CB    1 
ATOM   2373 N N     . ASP C 3 213 ? 108.230 77.414  136.799 1.00 31.15  ? 232 ASP A N     1 
ATOM   2374 C CA    . ASP C 3 213 ? 107.810 76.706  138.036 1.00 29.26  ? 232 ASP A CA    1 
ATOM   2375 C C     . ASP C 3 213 ? 107.658 77.668  139.188 1.00 40.63  ? 232 ASP A C     1 
ATOM   2376 O O     . ASP C 3 213 ? 106.917 77.399  140.134 1.00 45.41  ? 232 ASP A O     1 
ATOM   2377 C CB    . ASP C 3 213 ? 108.754 75.590  138.433 1.00 25.90  ? 232 ASP A CB    1 
ATOM   2378 C CG    . ASP C 3 213 ? 108.630 74.404  137.541 1.00 32.34  ? 232 ASP A CG    1 
ATOM   2379 O OD1   . ASP C 3 213 ? 107.625 74.307  136.819 1.00 33.34  ? 232 ASP A OD1   1 
ATOM   2380 O OD2   . ASP C 3 213 ? 109.589 73.619  137.461 1.00 43.09  ? 232 ASP A OD2   1 
ATOM   2381 N N     . ASP C 3 214 ? 108.351 78.802  139.100 1.00 32.49  ? 233 ASP A N     1 
ATOM   2382 C CA    . ASP C 3 214 ? 108.244 79.868  140.099 1.00 28.27  ? 233 ASP A CA    1 
ATOM   2383 C C     . ASP C 3 214 ? 108.246 81.204  139.307 1.00 37.57  ? 233 ASP A C     1 
ATOM   2384 O O     . ASP C 3 214 ? 109.226 81.542  138.655 1.00 38.43  ? 233 ASP A O     1 
ATOM   2385 C CB    . ASP C 3 214 ? 109.441 79.799  141.051 1.00 28.82  ? 233 ASP A CB    1 
ATOM   2386 C CG    . ASP C 3 214 ? 109.424 80.892  142.090 1.00 33.99  ? 233 ASP A CG    1 
ATOM   2387 O OD1   . ASP C 3 214 ? 108.528 81.761  142.032 1.00 34.85  ? 233 ASP A OD1   1 
ATOM   2388 O OD2   . ASP C 3 214 ? 110.337 80.926  142.938 1.00 40.19  ? 233 ASP A OD2   1 
ATOM   2389 N N     . PRO C 3 215 ? 107.138 81.931  139.340 1.00 35.68  ? 234 PRO A N     1 
ATOM   2390 C CA    . PRO C 3 215 ? 107.001 83.208  138.623 1.00 32.86  ? 234 PRO A CA    1 
ATOM   2391 C C     . PRO C 3 215 ? 108.056 84.285  138.935 1.00 36.14  ? 234 PRO A C     1 
ATOM   2392 O O     . PRO C 3 215 ? 108.268 85.191  138.144 1.00 36.01  ? 234 PRO A O     1 
ATOM   2393 C CB    . PRO C 3 215 ? 105.629 83.689  139.053 1.00 33.38  ? 234 PRO A CB    1 
ATOM   2394 C CG    . PRO C 3 215 ? 104.901 82.452  139.425 1.00 37.77  ? 234 PRO A CG    1 
ATOM   2395 C CD    . PRO C 3 215 ? 105.898 81.550  140.031 1.00 34.11  ? 234 PRO A CD    1 
ATOM   2396 N N     . ASN C 3 216 ? 108.706 84.179  140.085 1.00 30.68  ? 235 ASN A N     1 
ATOM   2397 C CA    . ASN C 3 216 ? 109.764 85.107  140.463 1.00 30.08  ? 235 ASN A CA    1 
ATOM   2398 C C     . ASN C 3 216 ? 111.079 84.720  139.795 1.00 34.60  ? 235 ASN A C     1 
ATOM   2399 O O     . ASN C 3 216 ? 112.053 85.447  139.906 1.00 35.00  ? 235 ASN A O     1 
ATOM   2400 C CB    . ASN C 3 216 ? 109.993 85.065  141.962 1.00 29.54  ? 235 ASN A CB    1 
ATOM   2401 C CG    . ASN C 3 216 ? 108.907 85.735  142.708 1.00 51.90  ? 235 ASN A CG    1 
ATOM   2402 O OD1   . ASN C 3 216 ? 108.255 86.613  142.178 1.00 43.39  ? 235 ASN A OD1   1 
ATOM   2403 N ND2   . ASN C 3 216 ? 108.682 85.322  143.948 1.00 47.41  ? 235 ASN A ND2   1 
ATOM   2404 N N     . ASN C 3 217 ? 111.130 83.553  139.160 1.00 31.31  ? 236 ASN A N     1 
ATOM   2405 C CA    . ASN C 3 217 ? 112.361 83.107  138.502 1.00 29.80  ? 236 ASN A CA    1 
ATOM   2406 C C     . ASN C 3 217 ? 112.698 84.046  137.357 1.00 30.59  ? 236 ASN A C     1 
ATOM   2407 O O     . ASN C 3 217 ? 111.798 84.466  136.611 1.00 26.89  ? 236 ASN A O     1 
ATOM   2408 C CB    . ASN C 3 217 ? 112.147 81.741  137.851 1.00 26.64  ? 236 ASN A CB    1 
ATOM   2409 C CG    . ASN C 3 217 ? 112.384 80.590  138.794 1.00 44.94  ? 236 ASN A CG    1 
ATOM   2410 O OD1   . ASN C 3 217 ? 113.118 80.708  139.772 1.00 33.19  ? 236 ASN A OD1   1 
ATOM   2411 N ND2   . ASN C 3 217 ? 111.771 79.451  138.489 1.00 30.67  ? 236 ASN A ND2   1 
ATOM   2412 N N     . TYR C 3 218 ? 113.990 84.259  137.137 1.00 29.52  ? 237 TYR A N     1 
ATOM   2413 C CA    . TYR C 3 218 ? 114.446 85.051  135.996 1.00 26.85  ? 237 TYR A CA    1 
ATOM   2414 C C     . TYR C 3 218 ? 114.177 84.209  134.774 1.00 31.88  ? 237 TYR A C     1 
ATOM   2415 O O     . TYR C 3 218 ? 114.283 82.991  134.840 1.00 30.58  ? 237 TYR A O     1 
ATOM   2416 C CB    . TYR C 3 218 ? 115.931 85.332  136.125 1.00 23.76  ? 237 TYR A CB    1 
ATOM   2417 C CG    . TYR C 3 218 ? 116.192 86.393  137.161 1.00 27.13  ? 237 TYR A CG    1 
ATOM   2418 C CD1   . TYR C 3 218 ? 116.735 86.065  138.411 1.00 28.19  ? 237 TYR A CD1   1 
ATOM   2419 C CD2   . TYR C 3 218 ? 115.793 87.722  136.926 1.00 28.55  ? 237 TYR A CD2   1 
ATOM   2420 C CE1   . TYR C 3 218 ? 116.935 87.045  139.389 1.00 28.08  ? 237 TYR A CE1   1 
ATOM   2421 C CE2   . TYR C 3 218 ? 115.990 88.710  137.886 1.00 29.79  ? 237 TYR A CE2   1 
ATOM   2422 C CZ    . TYR C 3 218 ? 116.577 88.374  139.111 1.00 41.73  ? 237 TYR A CZ    1 
ATOM   2423 O OH    . TYR C 3 218 ? 116.798 89.379  140.027 1.00 39.99  ? 237 TYR A OH    1 
ATOM   2424 N N     . LEU C 3 219 ? 113.773 84.840  133.676 1.00 28.30  ? 238 LEU A N     1 
ATOM   2425 C CA    . LEU C 3 219 ? 113.486 84.086  132.460 1.00 26.15  ? 238 LEU A CA    1 
ATOM   2426 C C     . LEU C 3 219 ? 114.700 83.271  131.959 1.00 26.99  ? 238 LEU A C     1 
ATOM   2427 O O     . LEU C 3 219 ? 114.560 82.134  131.530 1.00 25.61  ? 238 LEU A O     1 
ATOM   2428 C CB    . LEU C 3 219 ? 112.965 85.040  131.367 1.00 25.53  ? 238 LEU A CB    1 
ATOM   2429 C CG    . LEU C 3 219 ? 112.823 84.483  129.950 1.00 26.00  ? 238 LEU A CG    1 
ATOM   2430 C CD1   . LEU C 3 219 ? 111.794 83.368  129.934 1.00 23.85  ? 238 LEU A CD1   1 
ATOM   2431 C CD2   . LEU C 3 219 ? 112.462 85.577  128.946 1.00 21.88  ? 238 LEU A CD2   1 
ATOM   2432 N N     . PHE C 3 220 ? 115.886 83.857  131.983 1.00 24.47  ? 239 PHE A N     1 
ATOM   2433 C CA    . PHE C 3 220 ? 117.061 83.139  131.504 1.00 24.91  ? 239 PHE A CA    1 
ATOM   2434 C C     . PHE C 3 220 ? 117.903 82.697  132.690 1.00 26.33  ? 239 PHE A C     1 
ATOM   2435 O O     . PHE C 3 220 ? 118.025 83.420  133.677 1.00 27.93  ? 239 PHE A O     1 
ATOM   2436 C CB    . PHE C 3 220 ? 117.884 84.005  130.521 1.00 27.08  ? 239 PHE A CB    1 
ATOM   2437 C CG    . PHE C 3 220 ? 117.174 84.277  129.222 1.00 27.00  ? 239 PHE A CG    1 
ATOM   2438 C CD1   . PHE C 3 220 ? 116.620 85.542  128.963 1.00 25.78  ? 239 PHE A CD1   1 
ATOM   2439 C CD2   . PHE C 3 220 ? 117.012 83.265  128.279 1.00 24.39  ? 239 PHE A CD2   1 
ATOM   2440 C CE1   . PHE C 3 220 ? 115.906 85.781  127.803 1.00 24.06  ? 239 PHE A CE1   1 
ATOM   2441 C CE2   . PHE C 3 220 ? 116.305 83.493  127.112 1.00 27.87  ? 239 PHE A CE2   1 
ATOM   2442 C CZ    . PHE C 3 220 ? 115.763 84.770  126.861 1.00 24.56  ? 239 PHE A CZ    1 
ATOM   2443 N N     . CYS C 3 221 ? 118.483 81.504  132.586 1.00 25.20  ? 240 CYS A N     1 
ATOM   2444 C CA    . CYS C 3 221 ? 119.303 80.947  133.665 1.00 25.03  ? 240 CYS A CA    1 
ATOM   2445 C C     . CYS C 3 221 ? 120.433 80.126  133.050 1.00 28.39  ? 240 CYS A C     1 
ATOM   2446 O O     . CYS C 3 221 ? 120.451 79.862  131.842 1.00 29.32  ? 240 CYS A O     1 
ATOM   2447 C CB    . CYS C 3 221 ? 118.449 80.036  134.569 1.00 23.72  ? 240 CYS A CB    1 
ATOM   2448 S SG    . CYS C 3 221 ? 117.820 78.612  133.650 1.00 30.29  ? 240 CYS A SG    1 
ATOM   2449 N N     . ARG C 3 222 ? 121.375 79.734  133.896 1.00 27.81  ? 241 ARG A N     1 
ATOM   2450 C CA    . ARG C 3 222 ? 122.504 78.916  133.485 1.00 28.02  ? 241 ARG A CA    1 
ATOM   2451 C C     . ARG C 3 222 ? 122.052 77.548  132.978 1.00 33.16  ? 241 ARG A C     1 
ATOM   2452 O O     . ARG C 3 222 ? 121.036 76.995  133.416 1.00 31.00  ? 241 ARG A O     1 
ATOM   2453 C CB    . ARG C 3 222 ? 123.402 78.655  134.693 1.00 27.40  ? 241 ARG A CB    1 
ATOM   2454 C CG    . ARG C 3 222 ? 124.139 79.832  135.188 1.00 41.63  ? 241 ARG A CG    1 
ATOM   2455 C CD    . ARG C 3 222 ? 124.894 79.432  136.424 1.00 46.28  ? 241 ARG A CD    1 
ATOM   2456 N NE    . ARG C 3 222 ? 125.981 78.514  136.111 1.00 41.52  ? 241 ARG A NE    1 
ATOM   2457 C CZ    . ARG C 3 222 ? 127.120 78.500  136.790 1.00 39.73  ? 241 ARG A CZ    1 
ATOM   2458 N NH1   . ARG C 3 222 ? 127.270 79.350  137.806 1.00 29.15  ? 241 ARG A NH1   1 
ATOM   2459 N NH2   . ARG C 3 222 ? 128.087 77.648  136.467 1.00 32.68  ? 241 ARG A NH2   1 
ATOM   2460 N N     . VAL C 3 223 ? 122.858 76.990  132.096 1.00 31.65  ? 242 VAL A N     1 
ATOM   2461 C CA    . VAL C 3 223 ? 122.648 75.656  131.592 1.00 30.60  ? 242 VAL A CA    1 
ATOM   2462 C C     . VAL C 3 223 ? 124.034 74.984  131.645 1.00 37.95  ? 242 VAL A C     1 
ATOM   2463 O O     . VAL C 3 223 ? 124.934 75.323  130.873 1.00 30.53  ? 242 VAL A O     1 
ATOM   2464 C CB    . VAL C 3 223 ? 122.014 75.625  130.201 1.00 33.80  ? 242 VAL A CB    1 
ATOM   2465 C CG1   . VAL C 3 223 ? 121.892 74.172  129.695 1.00 33.68  ? 242 VAL A CG1   1 
ATOM   2466 C CG2   . VAL C 3 223 ? 120.606 76.269  130.248 1.00 32.50  ? 242 VAL A CG2   1 
ATOM   2467 N N     . ARG C 3 224 ? 124.215 74.096  132.632 1.00 37.70  ? 243 ARG A N     1 
ATOM   2468 C CA    . ARG C 3 224 ? 125.497 73.444  132.835 1.00 34.55  ? 243 ARG A CA    1 
ATOM   2469 C C     . ARG C 3 224 ? 125.858 72.467  131.729 1.00 36.01  ? 243 ARG A C     1 
ATOM   2470 O O     . ARG C 3 224 ? 125.035 72.206  130.851 1.00 34.32  ? 243 ARG A O     1 
ATOM   2471 C CB    . ARG C 3 224 ? 125.638 72.872  134.247 1.00 32.00  ? 243 ARG A CB    1 
ATOM   2472 C CG    . ARG C 3 224 ? 125.907 73.941  135.292 1.00 36.71  ? 243 ARG A CG    1 
ATOM   2473 C CD    . ARG C 3 224 ? 126.145 73.376  136.671 1.00 35.86  ? 243 ARG A CD    1 
ATOM   2474 N NE    . ARG C 3 224 ? 126.632 74.386  137.623 1.00 41.69  ? 243 ARG A NE    1 
ATOM   2475 C CZ    . ARG C 3 224 ? 127.925 74.671  137.839 1.00 63.53  ? 243 ARG A CZ    1 
ATOM   2476 N NH1   . ARG C 3 224 ? 128.875 74.055  137.148 1.00 30.04  ? 243 ARG A NH1   1 
ATOM   2477 N NH2   . ARG C 3 224 ? 128.269 75.589  138.732 1.00 50.80  ? 243 ARG A NH2   1 
ATOM   2478 N N     . LYS C 3 225 ? 127.115 72.010  131.715 1.00 38.75  ? 244 LYS A N     1 
ATOM   2479 C CA    . LYS C 3 225 ? 127.615 71.106  130.657 1.00 40.19  ? 244 LYS A CA    1 
ATOM   2480 C C     . LYS C 3 225 ? 126.786 69.826  130.513 1.00 45.98  ? 244 LYS A C     1 
ATOM   2481 O O     . LYS C 3 225 ? 126.702 69.251  129.428 1.00 47.28  ? 244 LYS A O     1 
ATOM   2482 C CB    . LYS C 3 225 ? 129.087 70.782  130.871 1.00 43.21  ? 244 LYS A CB    1 
ATOM   2483 C CG    . LYS C 3 225 ? 129.389 70.012  132.151 1.00 51.25  ? 244 LYS A CG    1 
ATOM   2484 C CD    . LYS C 3 225 ? 130.760 69.300  132.035 1.00 64.05  ? 244 LYS A CD    1 
ATOM   2485 C CE    . LYS C 3 225 ? 131.233 68.729  133.379 1.00 76.59  ? 244 LYS A CE    1 
ATOM   2486 N NZ    . LYS C 3 225 ? 132.547 69.298  133.799 1.00 69.63  ? 244 LYS A NZ    1 
ATOM   2487 N N     . ASN C 3 226 ? 126.153 69.429  131.619 1.00 44.07  ? 245 ASN A N     1 
ATOM   2488 C CA    . ASN C 3 226 ? 125.232 68.300  131.704 1.00 44.00  ? 245 ASN A CA    1 
ATOM   2489 C C     . ASN C 3 226 ? 123.998 68.567  130.835 1.00 51.45  ? 245 ASN A C     1 
ATOM   2490 O O     . ASN C 3 226 ? 123.327 67.635  130.421 1.00 55.70  ? 245 ASN A O     1 
ATOM   2491 C CB    . ASN C 3 226 ? 124.706 68.219  133.149 1.00 34.96  ? 245 ASN A CB    1 
ATOM   2492 C CG    . ASN C 3 226 ? 125.166 67.010  133.858 1.00 95.43  ? 245 ASN A CG    1 
ATOM   2493 O OD1   . ASN C 3 226 ? 125.453 65.981  133.246 1.00 100.00 ? 245 ASN A OD1   1 
ATOM   2494 N ND2   . ASN C 3 226 ? 125.237 67.106  135.174 1.00 100.00 ? 245 ASN A ND2   1 
ATOM   2495 N N     . GLY C 3 227 ? 123.648 69.837  130.639 1.00 43.77  ? 246 GLY A N     1 
ATOM   2496 C CA    . GLY C 3 227 ? 122.439 70.189  129.898 1.00 38.00  ? 246 GLY A CA    1 
ATOM   2497 C C     . GLY C 3 227 ? 121.304 70.395  130.918 1.00 36.76  ? 246 GLY A C     1 
ATOM   2498 O O     . GLY C 3 227 ? 120.130 70.486  130.558 1.00 37.35  ? 246 GLY A O     1 
ATOM   2499 N N     . VAL C 3 228 ? 121.663 70.524  132.195 1.00 30.00  ? 247 VAL A N     1 
ATOM   2500 C CA    . VAL C 3 228 ? 120.658 70.744  133.235 1.00 30.71  ? 247 VAL A CA    1 
ATOM   2501 C C     . VAL C 3 228 ? 120.592 72.240  133.530 1.00 36.00  ? 247 VAL A C     1 
ATOM   2502 O O     . VAL C 3 228 ? 121.615 72.874  133.851 1.00 32.19  ? 247 VAL A O     1 
ATOM   2503 C CB    . VAL C 3 228 ? 120.979 69.950  134.580 1.00 36.04  ? 247 VAL A CB    1 
ATOM   2504 C CG1   . VAL C 3 228 ? 120.136 70.459  135.771 1.00 34.65  ? 247 VAL A CG1   1 
ATOM   2505 C CG2   . VAL C 3 228 ? 120.790 68.455  134.404 1.00 36.15  ? 247 VAL A CG2   1 
ATOM   2506 N N     . ALA C 3 229 ? 119.389 72.786  133.365 1.00 31.38  ? 248 ALA A N     1 
ATOM   2507 C CA    . ALA C 3 229 ? 119.077 74.192  133.607 1.00 27.89  ? 248 ALA A CA    1 
ATOM   2508 C C     . ALA C 3 229 ? 118.983 74.428  135.110 1.00 36.89  ? 248 ALA A C     1 
ATOM   2509 O O     . ALA C 3 229 ? 118.625 73.525  135.868 1.00 41.29  ? 248 ALA A O     1 
ATOM   2510 C CB    . ALA C 3 229 ? 117.721 74.538  132.934 1.00 26.04  ? 248 ALA A CB    1 
ATOM   2511 N N     . ALA C 3 230 ? 119.278 75.645  135.546 1.00 30.21  ? 249 ALA A N     1 
ATOM   2512 C CA    . ALA C 3 230 ? 119.194 75.976  136.952 1.00 28.47  ? 249 ALA A CA    1 
ATOM   2513 C C     . ALA C 3 230 ? 118.357 77.219  137.167 1.00 31.82  ? 249 ALA A C     1 
ATOM   2514 O O     . ALA C 3 230 ? 118.886 78.282  137.434 1.00 30.38  ? 249 ALA A O     1 
ATOM   2515 C CB    . ALA C 3 230 ? 120.584 76.177  137.526 1.00 29.87  ? 249 ALA A CB    1 
ATOM   2516 N N     . PRO C 3 231 ? 117.039 77.082  137.079 1.00 31.36  ? 250 PRO A N     1 
ATOM   2517 C CA    . PRO C 3 231 ? 116.179 78.229  137.308 1.00 30.45  ? 250 PRO A CA    1 
ATOM   2518 C C     . PRO C 3 231 ? 116.518 78.873  138.653 1.00 37.40  ? 250 PRO A C     1 
ATOM   2519 O O     . PRO C 3 231 ? 117.059 78.219  139.559 1.00 37.48  ? 250 PRO A O     1 
ATOM   2520 C CB    . PRO C 3 231 ? 114.767 77.621  137.289 1.00 29.52  ? 250 PRO A CB    1 
ATOM   2521 C CG    . PRO C 3 231 ? 114.874 76.516  136.300 1.00 32.07  ? 250 PRO A CG    1 
ATOM   2522 C CD    . PRO C 3 231 ? 116.271 75.931  136.554 1.00 30.42  ? 250 PRO A CD    1 
ATOM   2523 N N     . SER C 3 232 ? 116.261 80.174  138.756 1.00 31.49  ? 251 SER A N     1 
ATOM   2524 C CA    . SER C 3 232 ? 116.556 80.890  139.983 1.00 27.84  ? 251 SER A CA    1 
ATOM   2525 C C     . SER C 3 232 ? 115.829 82.222  140.045 1.00 33.53  ? 251 SER A C     1 
ATOM   2526 O O     . SER C 3 232 ? 115.665 82.897  139.029 1.00 32.06  ? 251 SER A O     1 
ATOM   2527 C CB    . SER C 3 232 ? 118.045 81.155  140.091 1.00 27.67  ? 251 SER A CB    1 
ATOM   2528 O OG    . SER C 3 232 ? 118.272 81.999  141.215 1.00 34.20  ? 251 SER A OG    1 
ATOM   2529 N N     . ALA C 3 233 ? 115.430 82.611  141.249 1.00 28.85  ? 252 ALA A N     1 
ATOM   2530 C CA    . ALA C 3 233 ? 114.752 83.881  141.461 1.00 31.32  ? 252 ALA A CA    1 
ATOM   2531 C C     . ALA C 3 233 ? 115.673 84.854  142.173 1.00 35.42  ? 252 ALA A C     1 
ATOM   2532 O O     . ALA C 3 233 ? 115.288 85.998  142.436 1.00 37.38  ? 252 ALA A O     1 
ATOM   2533 C CB    . ALA C 3 233 ? 113.464 83.693  142.278 1.00 32.53  ? 252 ALA A CB    1 
ATOM   2534 N N     . THR C 3 234 ? 116.890 84.411  142.479 1.00 30.07  ? 253 THR A N     1 
ATOM   2535 C CA    . THR C 3 234 ? 117.832 85.264  143.170 1.00 30.96  ? 253 THR A CA    1 
ATOM   2536 C C     . THR C 3 234 ? 119.089 85.471  142.341 1.00 38.91  ? 253 THR A C     1 
ATOM   2537 O O     . THR C 3 234 ? 119.819 86.402  142.554 1.00 44.29  ? 253 THR A O     1 
ATOM   2538 C CB    . THR C 3 234 ? 118.229 84.672  144.511 1.00 32.90  ? 253 THR A CB    1 
ATOM   2539 O OG1   . THR C 3 234 ? 118.791 83.387  144.278 1.00 41.32  ? 253 THR A OG1   1 
ATOM   2540 C CG2   . THR C 3 234 ? 117.035 84.499  145.351 1.00 31.09  ? 253 THR A CG2   1 
ATOM   2541 N N     . SER C 3 235 ? 119.360 84.609  141.390 1.00 32.65  ? 254 SER A N     1 
ATOM   2542 C CA    . SER C 3 235 ? 120.535 84.825  140.598 1.00 30.98  ? 254 SER A CA    1 
ATOM   2543 C C     . SER C 3 235 ? 120.220 84.995  139.117 1.00 33.10  ? 254 SER A C     1 
ATOM   2544 O O     . SER C 3 235 ? 119.553 84.152  138.499 1.00 29.27  ? 254 SER A O     1 
ATOM   2545 C CB    . SER C 3 235 ? 121.560 83.712  140.831 1.00 32.86  ? 254 SER A CB    1 
ATOM   2546 O OG    . SER C 3 235 ? 122.394 83.527  139.699 1.00 48.33  ? 254 SER A OG    1 
ATOM   2547 N N     . GLN C 3 236 ? 120.747 86.085  138.543 1.00 31.23  ? 255 GLN A N     1 
ATOM   2548 C CA    . GLN C 3 236 ? 120.600 86.390  137.110 1.00 28.60  ? 255 GLN A CA    1 
ATOM   2549 C C     . GLN C 3 236 ? 121.790 85.861  136.331 1.00 30.59  ? 255 GLN A C     1 
ATOM   2550 O O     . GLN C 3 236 ? 122.860 85.700  136.886 1.00 32.24  ? 255 GLN A O     1 
ATOM   2551 C CB    . GLN C 3 236 ? 120.574 87.913  136.892 1.00 26.76  ? 255 GLN A CB    1 
ATOM   2552 C CG    . GLN C 3 236 ? 119.387 88.610  137.430 1.00 20.51  ? 255 GLN A CG    1 
ATOM   2553 C CD    . GLN C 3 236 ? 119.536 90.107  137.370 1.00 31.35  ? 255 GLN A CD    1 
ATOM   2554 O OE1   . GLN C 3 236 ? 120.327 90.612  136.593 1.00 30.23  ? 255 GLN A OE1   1 
ATOM   2555 N NE2   . GLN C 3 236 ? 118.742 90.820  138.145 1.00 31.76  ? 255 GLN A NE2   1 
ATOM   2556 N N     . LEU C 3 237 ? 121.625 85.636  135.031 1.00 28.60  ? 256 LEU A N     1 
ATOM   2557 C CA    . LEU C 3 237 ? 122.768 85.303  134.197 1.00 28.42  ? 256 LEU A CA    1 
ATOM   2558 C C     . LEU C 3 237 ? 123.533 86.642  134.181 1.00 31.01  ? 256 LEU A C     1 
ATOM   2559 O O     . LEU C 3 237 ? 122.915 87.711  134.196 1.00 32.24  ? 256 LEU A O     1 
ATOM   2560 C CB    . LEU C 3 237 ? 122.318 84.993  132.768 1.00 28.81  ? 256 LEU A CB    1 
ATOM   2561 C CG    . LEU C 3 237 ? 122.182 83.534  132.349 1.00 34.06  ? 256 LEU A CG    1 
ATOM   2562 C CD1   . LEU C 3 237 ? 121.806 83.445  130.870 1.00 30.57  ? 256 LEU A CD1   1 
ATOM   2563 C CD2   . LEU C 3 237 ? 123.474 82.747  132.653 1.00 32.34  ? 256 LEU A CD2   1 
ATOM   2564 N N     . SER C 3 238 ? 124.857 86.621  134.175 1.00 26.04  ? 257 SER A N     1 
ATOM   2565 C CA    . SER C 3 238 ? 125.609 87.888  134.147 1.00 25.81  ? 257 SER A CA    1 
ATOM   2566 C C     . SER C 3 238 ? 125.453 88.512  132.731 1.00 31.02  ? 257 SER A C     1 
ATOM   2567 O O     . SER C 3 238 ? 125.121 87.803  131.759 1.00 30.95  ? 257 SER A O     1 
ATOM   2568 C CB    . SER C 3 238 ? 127.098 87.631  134.463 1.00 22.25  ? 257 SER A CB    1 
ATOM   2569 O OG    . SER C 3 238 ? 127.673 86.763  133.490 1.00 24.68  ? 257 SER A OG    1 
ATOM   2570 N N     . THR C 3 239 ? 125.680 89.821  132.609 1.00 29.61  ? 258 THR A N     1 
ATOM   2571 C CA    . THR C 3 239 ? 125.627 90.451  131.299 1.00 26.09  ? 258 THR A CA    1 
ATOM   2572 C C     . THR C 3 239 ? 126.820 89.886  130.491 1.00 26.61  ? 258 THR A C     1 
ATOM   2573 O O     . THR C 3 239 ? 126.766 89.745  129.263 1.00 24.25  ? 258 THR A O     1 
ATOM   2574 C CB    . THR C 3 239 ? 125.701 91.956  131.426 1.00 23.44  ? 258 THR A CB    1 
ATOM   2575 O OG1   . THR C 3 239 ? 126.790 92.294  132.259 1.00 28.15  ? 258 THR A OG1   1 
ATOM   2576 C CG2   . THR C 3 239 ? 124.397 92.522  132.055 1.00 19.43  ? 258 THR A CG2   1 
ATOM   2577 N N     . ARG C 3 240 ? 127.877 89.477  131.199 1.00 28.02  ? 259 ARG A N     1 
ATOM   2578 C CA    . ARG C 3 240 ? 129.040 88.845  130.537 1.00 24.64  ? 259 ARG A CA    1 
ATOM   2579 C C     . ARG C 3 240 ? 128.660 87.565  129.756 1.00 26.59  ? 259 ARG A C     1 
ATOM   2580 O O     . ARG C 3 240 ? 129.081 87.380  128.619 1.00 27.33  ? 259 ARG A O     1 
ATOM   2581 C CB    . ARG C 3 240 ? 130.158 88.572  131.550 1.00 27.58  ? 259 ARG A CB    1 
ATOM   2582 C CG    . ARG C 3 240 ? 131.506 88.182  130.906 1.00 26.13  ? 259 ARG A CG    1 
ATOM   2583 C CD    . ARG C 3 240 ? 132.046 89.278  129.957 1.00 29.63  ? 259 ARG A CD    1 
ATOM   2584 N NE    . ARG C 3 240 ? 133.239 88.869  129.197 1.00 23.55  ? 259 ARG A NE    1 
ATOM   2585 C CZ    . ARG C 3 240 ? 133.216 88.226  128.025 1.00 39.74  ? 259 ARG A CZ    1 
ATOM   2586 N NH1   . ARG C 3 240 ? 132.067 87.885  127.431 1.00 26.79  ? 259 ARG A NH1   1 
ATOM   2587 N NH2   . ARG C 3 240 ? 134.361 87.918  127.432 1.00 35.15  ? 259 ARG A NH2   1 
ATOM   2588 N N     . ALA C 3 241 ? 127.843 86.694  130.374 1.00 28.96  ? 260 ALA A N     1 
ATOM   2589 C CA    . ALA C 3 241 ? 127.324 85.440  129.739 1.00 26.08  ? 260 ALA A CA    1 
ATOM   2590 C C     . ALA C 3 241 ? 126.475 85.744  128.498 1.00 27.38  ? 260 ALA A C     1 
ATOM   2591 O O     . ALA C 3 241 ? 126.576 85.066  127.479 1.00 29.38  ? 260 ALA A O     1 
ATOM   2592 C CB    . ALA C 3 241 ? 126.487 84.620  130.738 1.00 25.29  ? 260 ALA A CB    1 
ATOM   2593 N N     . LEU C 3 242 ? 125.623 86.765  128.609 1.00 26.53  ? 261 LEU A N     1 
ATOM   2594 C CA    . LEU C 3 242 ? 124.754 87.234  127.498 1.00 23.98  ? 261 LEU A CA    1 
ATOM   2595 C C     . LEU C 3 242 ? 125.627 87.747  126.340 1.00 28.35  ? 261 LEU A C     1 
ATOM   2596 O O     . LEU C 3 242 ? 125.375 87.464  125.180 1.00 27.66  ? 261 LEU A O     1 
ATOM   2597 C CB    . LEU C 3 242 ? 123.856 88.348  128.020 1.00 23.98  ? 261 LEU A CB    1 
ATOM   2598 C CG    . LEU C 3 242 ? 122.921 87.904  129.157 1.00 27.86  ? 261 LEU A CG    1 
ATOM   2599 C CD1   . LEU C 3 242 ? 121.870 88.988  129.368 1.00 26.91  ? 261 LEU A CD1   1 
ATOM   2600 C CD2   . LEU C 3 242 ? 122.227 86.580  128.742 1.00 30.04  ? 261 LEU A CD2   1 
ATOM   2601 N N     . GLU C 3 243 ? 126.682 88.481  126.664 1.00 26.82  ? 262 GLU A N     1 
ATOM   2602 C CA    . GLU C 3 243 ? 127.615 88.900  125.613 1.00 25.44  ? 262 GLU A CA    1 
ATOM   2603 C C     . GLU C 3 243 ? 128.248 87.611  125.010 1.00 30.85  ? 262 GLU A C     1 
ATOM   2604 O O     . GLU C 3 243 ? 128.471 87.533  123.803 1.00 28.78  ? 262 GLU A O     1 
ATOM   2605 C CB    . GLU C 3 243 ? 128.720 89.766  126.207 1.00 25.78  ? 262 GLU A CB    1 
ATOM   2606 C CG    . GLU C 3 243 ? 128.307 91.180  126.381 1.00 32.12  ? 262 GLU A CG    1 
ATOM   2607 C CD    . GLU C 3 243 ? 129.268 91.960  127.211 1.00 37.90  ? 262 GLU A CD    1 
ATOM   2608 O OE1   . GLU C 3 243 ? 129.919 91.352  128.072 1.00 37.17  ? 262 GLU A OE1   1 
ATOM   2609 O OE2   . GLU C 3 243 ? 129.357 93.194  127.039 1.00 38.75  ? 262 GLU A OE2   1 
ATOM   2610 N N     . GLY C 3 244 ? 128.524 86.609  125.864 1.00 27.82  ? 263 GLY A N     1 
ATOM   2611 C CA    . GLY C 3 244 ? 129.141 85.347  125.428 1.00 23.95  ? 263 GLY A CA    1 
ATOM   2612 C C     . GLY C 3 244 ? 128.262 84.593  124.451 1.00 27.97  ? 263 GLY A C     1 
ATOM   2613 O O     . GLY C 3 244 ? 128.762 83.936  123.527 1.00 29.99  ? 263 GLY A O     1 
ATOM   2614 N N     . ILE C 3 245 ? 126.938 84.694  124.638 1.00 26.64  ? 264 ILE A N     1 
ATOM   2615 C CA    . ILE C 3 245 ? 126.000 84.040  123.714 1.00 25.78  ? 264 ILE A CA    1 
ATOM   2616 C C     . ILE C 3 245 ? 126.133 84.664  122.323 1.00 29.05  ? 264 ILE A C     1 
ATOM   2617 O O     . ILE C 3 245 ? 126.172 83.958  121.304 1.00 28.15  ? 264 ILE A O     1 
ATOM   2618 C CB    . ILE C 3 245 ? 124.535 84.138  124.195 1.00 29.81  ? 264 ILE A CB    1 
ATOM   2619 C CG1   . ILE C 3 245 ? 124.331 83.405  125.548 1.00 28.80  ? 264 ILE A CG1   1 
ATOM   2620 C CG2   . ILE C 3 245 ? 123.572 83.638  123.072 1.00 28.80  ? 264 ILE A CG2   1 
ATOM   2621 C CD1   . ILE C 3 245 ? 123.031 83.832  126.289 1.00 26.94  ? 264 ILE A CD1   1 
ATOM   2622 N N     . PHE C 3 246 ? 126.229 85.993  122.279 1.00 23.82  ? 265 PHE A N     1 
ATOM   2623 C CA    . PHE C 3 246 ? 126.412 86.673  120.994 1.00 23.67  ? 265 PHE A CA    1 
ATOM   2624 C C     . PHE C 3 246 ? 127.754 86.201  120.354 1.00 28.43  ? 265 PHE A C     1 
ATOM   2625 O O     . PHE C 3 246 ? 127.803 85.861  119.177 1.00 28.44  ? 265 PHE A O     1 
ATOM   2626 C CB    . PHE C 3 246 ? 126.413 88.190  121.198 1.00 24.04  ? 265 PHE A CB    1 
ATOM   2627 C CG    . PHE C 3 246 ? 125.044 88.818  121.126 1.00 27.14  ? 265 PHE A CG    1 
ATOM   2628 C CD1   . PHE C 3 246 ? 124.461 89.386  122.267 1.00 26.62  ? 265 PHE A CD1   1 
ATOM   2629 C CD2   . PHE C 3 246 ? 124.351 88.871  119.913 1.00 25.20  ? 265 PHE A CD2   1 
ATOM   2630 C CE1   . PHE C 3 246 ? 123.211 90.015  122.203 1.00 25.19  ? 265 PHE A CE1   1 
ATOM   2631 C CE2   . PHE C 3 246 ? 123.104 89.499  119.831 1.00 25.38  ? 265 PHE A CE2   1 
ATOM   2632 C CZ    . PHE C 3 246 ? 122.530 90.078  120.982 1.00 23.21  ? 265 PHE A CZ    1 
ATOM   2633 N N     . GLU C 3 247 ? 128.833 86.208  121.141 1.00 28.73  ? 266 GLU A N     1 
ATOM   2634 C CA    . GLU C 3 247 ? 130.165 85.792  120.674 1.00 27.66  ? 266 GLU A CA    1 
ATOM   2635 C C     . GLU C 3 247 ? 130.135 84.359  120.147 1.00 32.04  ? 266 GLU A C     1 
ATOM   2636 O O     . GLU C 3 247 ? 130.553 84.094  119.021 1.00 32.18  ? 266 GLU A O     1 
ATOM   2637 C CB    . GLU C 3 247 ? 131.178 85.893  121.814 1.00 28.60  ? 266 GLU A CB    1 
ATOM   2638 C CG    . GLU C 3 247 ? 131.151 87.215  122.585 1.00 62.29  ? 266 GLU A CG    1 
ATOM   2639 C CD    . GLU C 3 247 ? 131.857 87.110  123.949 1.00 87.99  ? 266 GLU A CD    1 
ATOM   2640 O OE1   . GLU C 3 247 ? 132.602 86.138  124.149 1.00 100.00 ? 266 GLU A OE1   1 
ATOM   2641 O OE2   . GLU C 3 247 ? 131.655 87.967  124.834 1.00 47.88  ? 266 GLU A OE2   1 
ATOM   2642 N N     . ALA C 3 248 ? 129.596 83.438  120.948 1.00 31.73  ? 267 ALA A N     1 
ATOM   2643 C CA    . ALA C 3 248 ? 129.494 81.998  120.565 1.00 29.52  ? 267 ALA A CA    1 
ATOM   2644 C C     . ALA C 3 248 ? 128.747 81.849  119.277 1.00 32.20  ? 267 ALA A C     1 
ATOM   2645 O O     . ALA C 3 248 ? 129.162 81.125  118.402 1.00 31.40  ? 267 ALA A O     1 
ATOM   2646 C CB    . ALA C 3 248 ? 128.772 81.180  121.670 1.00 28.49  ? 267 ALA A CB    1 
ATOM   2647 N N     . THR C 3 249 ? 127.615 82.540  119.171 1.00 30.23  ? 268 THR A N     1 
ATOM   2648 C CA    . THR C 3 249 ? 126.770 82.443  117.989 1.00 30.47  ? 268 THR A CA    1 
ATOM   2649 C C     . THR C 3 249 ? 127.506 82.932  116.777 1.00 31.67  ? 268 THR A C     1 
ATOM   2650 O O     . THR C 3 249 ? 127.332 82.403  115.664 1.00 33.46  ? 268 THR A O     1 
ATOM   2651 C CB    . THR C 3 249 ? 125.450 83.217  118.140 1.00 34.15  ? 268 THR A CB    1 
ATOM   2652 O OG1   . THR C 3 249 ? 124.827 82.835  119.366 1.00 32.56  ? 268 THR A OG1   1 
ATOM   2653 C CG2   . THR C 3 249 ? 124.522 82.897  116.996 1.00 31.35  ? 268 THR A CG2   1 
ATOM   2654 N N     . HIS C 3 250 ? 128.330 83.949  116.967 1.00 28.50  ? 269 HIS A N     1 
ATOM   2655 C CA    . HIS C 3 250 ? 129.089 84.461  115.834 1.00 29.19  ? 269 HIS A CA    1 
ATOM   2656 C C     . HIS C 3 250 ? 130.111 83.398  115.423 1.00 38.18  ? 269 HIS A C     1 
ATOM   2657 O O     . HIS C 3 250 ? 130.239 83.077  114.227 1.00 35.27  ? 269 HIS A O     1 
ATOM   2658 C CB    . HIS C 3 250 ? 129.796 85.767  116.183 1.00 28.25  ? 269 HIS A CB    1 
ATOM   2659 C CG    . HIS C 3 250 ? 130.347 86.486  114.988 1.00 32.60  ? 269 HIS A CG    1 
ATOM   2660 N ND1   . HIS C 3 250 ? 131.661 86.353  114.577 1.00 33.39  ? 269 HIS A ND1   1 
ATOM   2661 C CD2   . HIS C 3 250 ? 129.746 87.290  114.077 1.00 32.90  ? 269 HIS A CD2   1 
ATOM   2662 C CE1   . HIS C 3 250 ? 131.857 87.092  113.500 1.00 31.75  ? 269 HIS A CE1   1 
ATOM   2663 N NE2   . HIS C 3 250 ? 130.711 87.666  113.172 1.00 32.76  ? 269 HIS A NE2   1 
ATOM   2664 N N     . ARG C 3 251 ? 130.813 82.835  116.422 1.00 39.99  ? 270 ARG A N     1 
ATOM   2665 C CA    . ARG C 3 251 ? 131.821 81.802  116.159 1.00 40.67  ? 270 ARG A CA    1 
ATOM   2666 C C     . ARG C 3 251 ? 131.184 80.661  115.394 1.00 46.16  ? 270 ARG A C     1 
ATOM   2667 O O     . ARG C 3 251 ? 131.740 80.164  114.421 1.00 49.18  ? 270 ARG A O     1 
ATOM   2668 C CB    . ARG C 3 251 ? 132.415 81.267  117.440 1.00 39.19  ? 270 ARG A CB    1 
ATOM   2669 C CG    . ARG C 3 251 ? 133.597 80.327  117.226 1.00 47.11  ? 270 ARG A CG    1 
ATOM   2670 C CD    . ARG C 3 251 ? 134.295 80.059  118.557 1.00 71.51  ? 270 ARG A CD    1 
ATOM   2671 N NE    . ARG C 3 251 ? 135.504 79.246  118.424 1.00 91.31  ? 270 ARG A NE    1 
ATOM   2672 C CZ    . ARG C 3 251 ? 136.235 78.831  119.454 1.00 100.00 ? 270 ARG A CZ    1 
ATOM   2673 N NH1   . ARG C 3 251 ? 135.887 79.149  120.701 1.00 100.00 ? 270 ARG A NH1   1 
ATOM   2674 N NH2   . ARG C 3 251 ? 137.320 78.108  119.233 1.00 100.00 ? 270 ARG A NH2   1 
ATOM   2675 N N     . LEU C 3 252 ? 129.973 80.300  115.798 1.00 38.09  ? 271 LEU A N     1 
ATOM   2676 C CA    . LEU C 3 252 ? 129.254 79.227  115.141 1.00 37.27  ? 271 LEU A CA    1 
ATOM   2677 C C     . LEU C 3 252 ? 129.139 79.419  113.635 1.00 45.84  ? 271 LEU A C     1 
ATOM   2678 O O     . LEU C 3 252 ? 129.173 78.459  112.868 1.00 49.03  ? 271 LEU A O     1 
ATOM   2679 C CB    . LEU C 3 252 ? 127.865 79.050  115.743 1.00 38.37  ? 271 LEU A CB    1 
ATOM   2680 C CG    . LEU C 3 252 ? 126.963 78.149  114.889 1.00 46.25  ? 271 LEU A CG    1 
ATOM   2681 C CD1   . LEU C 3 252 ? 127.250 76.723  115.236 1.00 45.62  ? 271 LEU A CD1   1 
ATOM   2682 C CD2   . LEU C 3 252 ? 125.462 78.439  115.009 1.00 48.67  ? 271 LEU A CD2   1 
ATOM   2683 N N     . ILE C 3 253 ? 128.958 80.644  113.187 1.00 41.78  ? 272 ILE A N     1 
ATOM   2684 C CA    . ILE C 3 253 ? 128.775 80.804  111.758 1.00 38.98  ? 272 ILE A CA    1 
ATOM   2685 C C     . ILE C 3 253 ? 130.059 81.187  111.069 1.00 44.80  ? 272 ILE A C     1 
ATOM   2686 O O     . ILE C 3 253 ? 130.249 80.880  109.889 1.00 47.60  ? 272 ILE A O     1 
ATOM   2687 C CB    . ILE C 3 253 ? 127.711 81.894  111.441 1.00 39.57  ? 272 ILE A CB    1 
ATOM   2688 C CG1   . ILE C 3 253 ? 126.310 81.402  111.791 1.00 38.81  ? 272 ILE A CG1   1 
ATOM   2689 C CG2   . ILE C 3 253 ? 127.779 82.311  109.977 1.00 33.63  ? 272 ILE A CG2   1 
ATOM   2690 C CD1   . ILE C 3 253 ? 125.332 82.495  111.996 1.00 37.67  ? 272 ILE A CD1   1 
ATOM   2691 N N     . TYR C 3 254 ? 130.925 81.906  111.777 1.00 35.48  ? 273 TYR A N     1 
ATOM   2692 C CA    . TYR C 3 254 ? 132.098 82.432  111.115 1.00 34.43  ? 273 TYR A CA    1 
ATOM   2693 C C     . TYR C 3 254 ? 133.425 81.907  111.585 1.00 37.88  ? 273 TYR A C     1 
ATOM   2694 O O     . TYR C 3 254 ? 134.444 82.387  111.161 1.00 43.44  ? 273 TYR A O     1 
ATOM   2695 C CB    . TYR C 3 254 ? 132.101 83.973  111.219 1.00 35.07  ? 273 TYR A CB    1 
ATOM   2696 C CG    . TYR C 3 254 ? 130.937 84.652  110.561 1.00 34.54  ? 273 TYR A CG    1 
ATOM   2697 C CD1   . TYR C 3 254 ? 129.808 84.995  111.303 1.00 38.26  ? 273 TYR A CD1   1 
ATOM   2698 C CD2   . TYR C 3 254 ? 130.942 84.931  109.208 1.00 32.85  ? 273 TYR A CD2   1 
ATOM   2699 C CE1   . TYR C 3 254 ? 128.729 85.613  110.719 1.00 32.84  ? 273 TYR A CE1   1 
ATOM   2700 C CE2   . TYR C 3 254 ? 129.855 85.533  108.602 1.00 35.08  ? 273 TYR A CE2   1 
ATOM   2701 C CZ    . TYR C 3 254 ? 128.745 85.886  109.370 1.00 40.20  ? 273 TYR A CZ    1 
ATOM   2702 O OH    . TYR C 3 254 ? 127.646 86.484  108.780 1.00 41.64  ? 273 TYR A OH    1 
ATOM   2703 N N     . GLY C 3 255 ? 133.432 80.986  112.514 1.00 34.68  ? 274 GLY A N     1 
ATOM   2704 C CA    . GLY C 3 255 ? 134.695 80.498  113.033 1.00 36.23  ? 274 GLY A CA    1 
ATOM   2705 C C     . GLY C 3 255 ? 135.256 81.478  114.048 1.00 45.62  ? 274 GLY A C     1 
ATOM   2706 O O     . GLY C 3 255 ? 134.595 82.449  114.394 1.00 48.38  ? 274 GLY A O     1 
ATOM   2707 N N     . ALA C 3 256 ? 136.462 81.208  114.549 1.00 44.67  ? 275 ALA A N     1 
ATOM   2708 C CA    . ALA C 3 256 ? 137.095 82.085  115.537 1.00 44.10  ? 275 ALA A CA    1 
ATOM   2709 C C     . ALA C 3 256 ? 137.489 83.429  114.940 1.00 49.47  ? 275 ALA A C     1 
ATOM   2710 O O     . ALA C 3 256 ? 137.666 83.562  113.727 1.00 49.03  ? 275 ALA A O     1 
ATOM   2711 C CB    . ALA C 3 256 ? 138.279 81.412  116.161 1.00 45.62  ? 275 ALA A CB    1 
ATOM   2712 N N     . LYS C 3 257 ? 137.600 84.438  115.794 1.00 50.67  ? 276 LYS A N     1 
ATOM   2713 C CA    . LYS C 3 257 ? 137.925 85.784  115.311 1.00 51.31  ? 276 LYS A CA    1 
ATOM   2714 C C     . LYS C 3 257 ? 139.385 86.077  115.078 1.00 61.61  ? 276 LYS A C     1 
ATOM   2715 O O     . LYS C 3 257 ? 140.256 85.440  115.669 1.00 61.78  ? 276 LYS A O     1 
ATOM   2716 C CB    . LYS C 3 257 ? 137.318 86.869  116.193 1.00 52.91  ? 276 LYS A CB    1 
ATOM   2717 C CG    . LYS C 3 257 ? 137.350 86.632  117.682 1.00 43.67  ? 276 LYS A CG    1 
ATOM   2718 C CD    . LYS C 3 257 ? 137.024 87.954  118.392 1.00 43.15  ? 276 LYS A CD    1 
ATOM   2719 C CE    . LYS C 3 257 ? 137.394 87.905  119.869 1.00 39.32  ? 276 LYS A CE    1 
ATOM   2720 N NZ    . LYS C 3 257 ? 136.893 89.088  120.605 1.00 34.86  ? 276 LYS A NZ    1 
ATOM   2721 N N     . ASP C 3 258 ? 139.653 87.056  114.214 1.00 64.03  ? 277 ASP A N     1 
ATOM   2722 C CA    . ASP C 3 258 ? 141.031 87.431  113.922 1.00 66.37  ? 277 ASP A CA    1 
ATOM   2723 C C     . ASP C 3 258 ? 141.697 87.903  115.197 1.00 77.13  ? 277 ASP A C     1 
ATOM   2724 O O     . ASP C 3 258 ? 141.057 88.531  116.025 1.00 82.49  ? 277 ASP A O     1 
ATOM   2725 C CB    . ASP C 3 258 ? 141.130 88.408  112.726 1.00 68.28  ? 277 ASP A CB    1 
ATOM   2726 C CG    . ASP C 3 258 ? 141.346 89.862  113.131 1.00 84.62  ? 277 ASP A CG    1 
ATOM   2727 O OD1   . ASP C 3 258 ? 142.358 90.153  113.791 1.00 84.02  ? 277 ASP A OD1   1 
ATOM   2728 O OD2   . ASP C 3 258 ? 140.593 90.737  112.641 1.00 99.38  ? 277 ASP A OD2   1 
ATOM   2729 N N     . ASP C 3 259 ? 142.970 87.568  115.376 1.00 75.86  ? 278 ASP A N     1 
ATOM   2730 C CA    . ASP C 3 259 ? 143.694 87.932  116.598 1.00 75.88  ? 278 ASP A CA    1 
ATOM   2731 C C     . ASP C 3 259 ? 144.177 89.383  116.668 1.00 74.15  ? 278 ASP A C     1 
ATOM   2732 O O     . ASP C 3 259 ? 145.109 89.696  117.413 1.00 72.38  ? 278 ASP A O     1 
ATOM   2733 C CB    . ASP C 3 259 ? 144.857 86.962  116.874 1.00 79.61  ? 278 ASP A CB    1 
ATOM   2734 C CG    . ASP C 3 259 ? 145.323 86.983  118.347 1.00 100.00 ? 278 ASP A CG    1 
ATOM   2735 O OD1   . ASP C 3 259 ? 145.262 88.057  118.993 1.00 100.00 ? 278 ASP A OD1   1 
ATOM   2736 O OD2   . ASP C 3 259 ? 145.767 85.921  118.854 1.00 100.00 ? 278 ASP A OD2   1 
ATOM   2737 N N     . SER C 3 260 ? 143.527 90.281  115.932 1.00 66.77  ? 279 SER A N     1 
ATOM   2738 C CA    . SER C 3 260 ? 143.928 91.682  115.976 1.00 64.30  ? 279 SER A CA    1 
ATOM   2739 C C     . SER C 3 260 ? 143.691 92.340  117.324 1.00 61.27  ? 279 SER A C     1 
ATOM   2740 O O     . SER C 3 260 ? 144.316 93.340  117.638 1.00 63.81  ? 279 SER A O     1 
ATOM   2741 C CB    . SER C 3 260 ? 143.322 92.522  114.833 1.00 68.92  ? 279 SER A CB    1 
ATOM   2742 O OG    . SER C 3 260 ? 141.933 92.756  114.999 1.00 74.93  ? 279 SER A OG    1 
ATOM   2743 N N     . GLY C 3 261 ? 142.805 91.776  118.131 1.00 54.26  ? 280 GLY A N     1 
ATOM   2744 C CA    . GLY C 3 261 ? 142.508 92.367  119.434 1.00 52.35  ? 280 GLY A CA    1 
ATOM   2745 C C     . GLY C 3 261 ? 141.607 93.606  119.281 1.00 46.46  ? 280 GLY A C     1 
ATOM   2746 O O     . GLY C 3 261 ? 141.382 94.372  120.233 1.00 45.11  ? 280 GLY A O     1 
ATOM   2747 N N     . GLN C 3 262 ? 141.118 93.824  118.077 1.00 38.95  ? 281 GLN A N     1 
ATOM   2748 C CA    . GLN C 3 262 ? 140.237 94.948  117.868 1.00 42.17  ? 281 GLN A CA    1 
ATOM   2749 C C     . GLN C 3 262 ? 138.850 94.616  118.439 1.00 43.97  ? 281 GLN A C     1 
ATOM   2750 O O     . GLN C 3 262 ? 138.423 93.454  118.433 1.00 40.37  ? 281 GLN A O     1 
ATOM   2751 C CB    . GLN C 3 262 ? 140.126 95.256  116.379 1.00 45.20  ? 281 GLN A CB    1 
ATOM   2752 C CG    . GLN C 3 262 ? 141.037 96.383  115.906 1.00 71.19  ? 281 GLN A CG    1 
ATOM   2753 C CD    . GLN C 3 262 ? 141.362 96.271  114.433 1.00 100.00 ? 281 GLN A CD    1 
ATOM   2754 O OE1   . GLN C 3 262 ? 141.228 95.188  113.839 1.00 95.58  ? 281 GLN A OE1   1 
ATOM   2755 N NE2   . GLN C 3 262 ? 141.781 97.386  113.826 1.00 96.45  ? 281 GLN A NE2   1 
ATOM   2756 N N     . ARG C 3 263 ? 138.150 95.633  118.941 1.00 36.14  ? 282 ARG A N     1 
ATOM   2757 C CA    . ARG C 3 263 ? 136.820 95.410  119.468 1.00 32.40  ? 282 ARG A CA    1 
ATOM   2758 C C     . ARG C 3 263 ? 135.865 95.146  118.312 1.00 35.55  ? 282 ARG A C     1 
ATOM   2759 O O     . ARG C 3 263 ? 136.147 95.470  117.165 1.00 32.50  ? 282 ARG A O     1 
ATOM   2760 C CB    . ARG C 3 263 ? 136.345 96.633  120.270 1.00 31.71  ? 282 ARG A CB    1 
ATOM   2761 C CG    . ARG C 3 263 ? 136.889 96.688  121.683 1.00 35.22  ? 282 ARG A CG    1 
ATOM   2762 C CD    . ARG C 3 263 ? 136.027 97.510  122.641 1.00 34.04  ? 282 ARG A CD    1 
ATOM   2763 N NE    . ARG C 3 263 ? 136.661 97.629  123.963 1.00 41.93  ? 282 ARG A NE    1 
ATOM   2764 C CZ    . ARG C 3 263 ? 136.198 98.380  124.958 1.00 42.43  ? 282 ARG A CZ    1 
ATOM   2765 N NH1   . ARG C 3 263 ? 135.089 99.089  124.814 1.00 39.71  ? 282 ARG A NH1   1 
ATOM   2766 N NH2   . ARG C 3 263 ? 136.859 98.425  126.099 1.00 44.10  ? 282 ARG A NH2   1 
ATOM   2767 N N     . TYR C 3 264 ? 134.732 94.535  118.614 1.00 33.21  ? 283 TYR A N     1 
ATOM   2768 C CA    . TYR C 3 264 ? 133.679 94.320  117.631 1.00 29.23  ? 283 TYR A CA    1 
ATOM   2769 C C     . TYR C 3 264 ? 133.957 93.417  116.463 1.00 34.33  ? 283 TYR A C     1 
ATOM   2770 O O     . TYR C 3 264 ? 133.336 93.564  115.424 1.00 34.04  ? 283 TYR A O     1 
ATOM   2771 C CB    . TYR C 3 264 ? 133.132 95.663  117.166 1.00 29.08  ? 283 TYR A CB    1 
ATOM   2772 C CG    . TYR C 3 264 ? 132.700 96.537  118.327 1.00 32.69  ? 283 TYR A CG    1 
ATOM   2773 C CD1   . TYR C 3 264 ? 133.157 97.836  118.458 1.00 35.18  ? 283 TYR A CD1   1 
ATOM   2774 C CD2   . TYR C 3 264 ? 131.881 96.020  119.337 1.00 36.02  ? 283 TYR A CD2   1 
ATOM   2775 C CE1   . TYR C 3 264 ? 132.776 98.624  119.557 1.00 37.57  ? 283 TYR A CE1   1 
ATOM   2776 C CE2   . TYR C 3 264 ? 131.476 96.797  120.411 1.00 39.43  ? 283 TYR A CE2   1 
ATOM   2777 C CZ    . TYR C 3 264 ? 131.902 98.110  120.506 1.00 48.96  ? 283 TYR A CZ    1 
ATOM   2778 O OH    . TYR C 3 264 ? 131.438 98.906  121.553 1.00 47.03  ? 283 TYR A OH    1 
ATOM   2779 N N     . LEU C 3 265 ? 134.816 92.425  116.646 1.00 32.84  ? 284 LEU A N     1 
ATOM   2780 C CA    . LEU C 3 265 ? 135.112 91.484  115.562 1.00 33.33  ? 284 LEU A CA    1 
ATOM   2781 C C     . LEU C 3 265 ? 134.020 90.420  115.483 1.00 38.73  ? 284 LEU A C     1 
ATOM   2782 O O     . LEU C 3 265 ? 133.875 89.728  114.457 1.00 36.90  ? 284 LEU A O     1 
ATOM   2783 C CB    . LEU C 3 265 ? 136.476 90.819  115.793 1.00 33.32  ? 284 LEU A CB    1 
ATOM   2784 C CG    . LEU C 3 265 ? 137.702 91.737  115.682 1.00 35.14  ? 284 LEU A CG    1 
ATOM   2785 C CD1   . LEU C 3 265 ? 138.943 90.966  115.956 1.00 31.07  ? 284 LEU A CD1   1 
ATOM   2786 C CD2   . LEU C 3 265 ? 137.749 92.379  114.325 1.00 38.29  ? 284 LEU A CD2   1 
ATOM   2787 N N     . ALA C 3 266 ? 133.277 90.290  116.580 1.00 34.28  ? 285 ALA A N     1 
ATOM   2788 C CA    . ALA C 3 266 ? 132.188 89.316  116.720 1.00 29.12  ? 285 ALA A CA    1 
ATOM   2789 C C     . ALA C 3 266 ? 130.991 90.065  117.318 1.00 29.35  ? 285 ALA A C     1 
ATOM   2790 O O     . ALA C 3 266 ? 131.149 91.169  117.836 1.00 25.89  ? 285 ALA A O     1 
ATOM   2791 C CB    . ALA C 3 266 ? 132.632 88.170  117.679 1.00 27.18  ? 285 ALA A CB    1 
ATOM   2792 N N     . TRP C 3 267 ? 129.802 89.477  117.254 1.00 26.21  ? 286 TRP A N     1 
ATOM   2793 C CA    . TRP C 3 267 ? 128.632 90.119  117.867 1.00 25.51  ? 286 TRP A CA    1 
ATOM   2794 C C     . TRP C 3 267 ? 128.859 90.268  119.357 1.00 31.96  ? 286 TRP A C     1 
ATOM   2795 O O     . TRP C 3 267 ? 129.498 89.426  119.990 1.00 31.81  ? 286 TRP A O     1 
ATOM   2796 C CB    . TRP C 3 267 ? 127.367 89.305  117.642 1.00 21.02  ? 286 TRP A CB    1 
ATOM   2797 C CG    . TRP C 3 267 ? 126.973 89.315  116.203 1.00 22.87  ? 286 TRP A CG    1 
ATOM   2798 C CD1   . TRP C 3 267 ? 126.971 90.406  115.336 1.00 25.79  ? 286 TRP A CD1   1 
ATOM   2799 C CD2   . TRP C 3 267 ? 126.551 88.179  115.414 1.00 24.30  ? 286 TRP A CD2   1 
ATOM   2800 N NE1   . TRP C 3 267 ? 126.550 90.010  114.074 1.00 26.96  ? 286 TRP A NE1   1 
ATOM   2801 C CE2   . TRP C 3 267 ? 126.293 88.653  114.097 1.00 28.71  ? 286 TRP A CE2   1 
ATOM   2802 C CE3   . TRP C 3 267 ? 126.349 86.821  115.689 1.00 24.79  ? 286 TRP A CE3   1 
ATOM   2803 C CZ2   . TRP C 3 267 ? 125.832 87.809  113.084 1.00 27.66  ? 286 TRP A CZ2   1 
ATOM   2804 C CZ3   . TRP C 3 267 ? 125.911 85.999  114.666 1.00 25.77  ? 286 TRP A CZ3   1 
ATOM   2805 C CH2   . TRP C 3 267 ? 125.654 86.493  113.389 1.00 24.83  ? 286 TRP A CH2   1 
ATOM   2806 N N     . SER C 3 268 ? 128.309 91.332  119.927 1.00 25.08  ? 287 SER A N     1 
ATOM   2807 C CA    . SER C 3 268 ? 128.416 91.570  121.355 1.00 23.90  ? 287 SER A CA    1 
ATOM   2808 C C     . SER C 3 268 ? 127.024 91.953  121.900 1.00 24.63  ? 287 SER A C     1 
ATOM   2809 O O     . SER C 3 268 ? 126.029 91.915  121.155 1.00 25.29  ? 287 SER A O     1 
ATOM   2810 C CB    . SER C 3 268 ? 129.502 92.620  121.666 1.00 26.97  ? 287 SER A CB    1 
ATOM   2811 O OG    . SER C 3 268 ? 129.264 93.876  121.046 1.00 28.80  ? 287 SER A OG    1 
ATOM   2812 N N     . GLY C 3 269 ? 126.969 92.361  123.173 1.00 20.50  ? 288 GLY A N     1 
ATOM   2813 C CA    . GLY C 3 269 ? 125.714 92.681  123.867 1.00 19.39  ? 288 GLY A CA    1 
ATOM   2814 C C     . GLY C 3 269 ? 124.825 93.682  123.177 1.00 29.99  ? 288 GLY A C     1 
ATOM   2815 O O     . GLY C 3 269 ? 123.572 93.593  123.285 1.00 28.84  ? 288 GLY A O     1 
ATOM   2816 N N     . HIS C 3 270 ? 125.432 94.613  122.433 1.00 26.16  ? 289 HIS A N     1 
ATOM   2817 C CA    . HIS C 3 270 ? 124.637 95.652  121.745 1.00 24.31  ? 289 HIS A CA    1 
ATOM   2818 C C     . HIS C 3 270 ? 124.289 95.380  120.315 1.00 24.11  ? 289 HIS A C     1 
ATOM   2819 O O     . HIS C 3 270 ? 123.612 96.187  119.672 1.00 24.65  ? 289 HIS A O     1 
ATOM   2820 C CB    . HIS C 3 270 ? 125.299 97.037  121.840 1.00 26.23  ? 289 HIS A CB    1 
ATOM   2821 C CG    . HIS C 3 270 ? 124.502 98.023  122.633 1.00 30.97  ? 289 HIS A CG    1 
ATOM   2822 N ND1   . HIS C 3 270 ? 123.857 97.678  123.802 1.00 32.24  ? 289 HIS A ND1   1 
ATOM   2823 C CD2   . HIS C 3 270 ? 124.225 99.330  122.425 1.00 35.56  ? 289 HIS A CD2   1 
ATOM   2824 C CE1   . HIS C 3 270 ? 123.240 98.732  124.296 1.00 32.06  ? 289 HIS A CE1   1 
ATOM   2825 N NE2   . HIS C 3 270 ? 123.425 99.744  123.468 1.00 34.84  ? 289 HIS A NE2   1 
ATOM   2826 N N     . SER C 3 271 ? 124.758 94.244  119.804 1.00 20.72  ? 290 SER A N     1 
ATOM   2827 C CA    . SER C 3 271 ? 124.558 93.910  118.393 1.00 22.32  ? 290 SER A CA    1 
ATOM   2828 C C     . SER C 3 271 ? 123.135 93.897  117.824 1.00 27.63  ? 290 SER A C     1 
ATOM   2829 O O     . SER C 3 271 ? 122.921 94.305  116.674 1.00 26.48  ? 290 SER A O     1 
ATOM   2830 C CB    . SER C 3 271 ? 125.267 92.588  118.062 1.00 20.60  ? 290 SER A CB    1 
ATOM   2831 O OG    . SER C 3 271 ? 126.647 92.766  118.167 1.00 23.25  ? 290 SER A OG    1 
ATOM   2832 N N     . ALA C 3 272 ? 122.191 93.312  118.567 1.00 23.64  ? 291 ALA A N     1 
ATOM   2833 C CA    . ALA C 3 272 ? 120.823 93.185  118.069 1.00 21.39  ? 291 ALA A CA    1 
ATOM   2834 C C     . ALA C 3 272 ? 120.121 94.551  118.162 1.00 24.49  ? 291 ALA A C     1 
ATOM   2835 O O     . ALA C 3 272 ? 119.343 94.911  117.283 1.00 27.78  ? 291 ALA A O     1 
ATOM   2836 C CB    . ALA C 3 272 ? 120.050 92.088  118.824 1.00 20.02  ? 291 ALA A CB    1 
ATOM   2837 N N     . ARG C 3 273 ? 120.460 95.350  119.168 1.00 19.89  ? 292 ARG A N     1 
ATOM   2838 C CA    . ARG C 3 273 ? 119.866 96.681  119.265 1.00 19.46  ? 292 ARG A CA    1 
ATOM   2839 C C     . ARG C 3 273 ? 120.370 97.530  118.051 1.00 28.57  ? 292 ARG A C     1 
ATOM   2840 O O     . ARG C 3 273 ? 119.563 98.165  117.324 1.00 24.82  ? 292 ARG A O     1 
ATOM   2841 C CB    . ARG C 3 273 ? 120.247 97.336  120.592 1.00 16.77  ? 292 ARG A CB    1 
ATOM   2842 C CG    . ARG C 3 273 ? 119.688 98.761  120.775 1.00 18.35  ? 292 ARG A CG    1 
ATOM   2843 C CD    . ARG C 3 273 ? 119.870 99.214  122.210 1.00 22.29  ? 292 ARG A CD    1 
ATOM   2844 N NE    . ARG C 3 273 ? 119.448 100.593 122.455 1.00 24.64  ? 292 ARG A NE    1 
ATOM   2845 C CZ    . ARG C 3 273 ? 118.225 100.934 122.849 1.00 30.80  ? 292 ARG A CZ    1 
ATOM   2846 N NH1   . ARG C 3 273 ? 117.280 100.011 123.000 1.00 19.79  ? 292 ARG A NH1   1 
ATOM   2847 N NH2   . ARG C 3 273 ? 117.936 102.207 123.088 1.00 21.86  ? 292 ARG A NH2   1 
ATOM   2848 N N     . VAL C 3 274 ? 121.693 97.494  117.808 1.00 24.61  ? 293 VAL A N     1 
ATOM   2849 C CA    . VAL C 3 274 ? 122.275 98.186  116.646 1.00 22.32  ? 293 VAL A CA    1 
ATOM   2850 C C     . VAL C 3 274 ? 121.586 97.649  115.361 1.00 29.09  ? 293 VAL A C     1 
ATOM   2851 O O     . VAL C 3 274 ? 121.084 98.416  114.520 1.00 29.75  ? 293 VAL A O     1 
ATOM   2852 C CB    . VAL C 3 274 ? 123.805 97.933  116.505 1.00 21.28  ? 293 VAL A CB    1 
ATOM   2853 C CG1   . VAL C 3 274 ? 124.303 98.424  115.108 1.00 21.08  ? 293 VAL A CG1   1 
ATOM   2854 C CG2   . VAL C 3 274 ? 124.580 98.621  117.608 1.00 19.89  ? 293 VAL A CG2   1 
ATOM   2855 N N     . GLY C 3 275 ? 121.548 96.329  115.219 1.00 22.98  ? 294 GLY A N     1 
ATOM   2856 C CA    . GLY C 3 275 ? 120.977 95.712  114.038 1.00 21.34  ? 294 GLY A CA    1 
ATOM   2857 C C     . GLY C 3 275 ? 119.513 96.019  113.779 1.00 29.37  ? 294 GLY A C     1 
ATOM   2858 O O     . GLY C 3 275 ? 119.124 96.354  112.650 1.00 26.06  ? 294 GLY A O     1 
ATOM   2859 N N     . ALA C 3 276 ? 118.673 95.862  114.799 1.00 26.74  ? 295 ALA A N     1 
ATOM   2860 C CA    . ALA C 3 276 ? 117.239 96.128  114.632 1.00 23.65  ? 295 ALA A CA    1 
ATOM   2861 C C     . ALA C 3 276 ? 116.972 97.613  114.294 1.00 22.22  ? 295 ALA A C     1 
ATOM   2862 O O     . ALA C 3 276 ? 116.055 97.917  113.554 1.00 23.48  ? 295 ALA A O     1 
ATOM   2863 C CB    . ALA C 3 276 ? 116.470 95.729  115.885 1.00 25.01  ? 295 ALA A CB    1 
ATOM   2864 N N     . ALA C 3 277 ? 117.762 98.519  114.881 1.00 20.54  ? 296 ALA A N     1 
ATOM   2865 C CA    . ALA C 3 277 ? 117.594 99.970  114.644 1.00 20.22  ? 296 ALA A CA    1 
ATOM   2866 C C     . ALA C 3 277 ? 117.892 100.272 113.182 1.00 26.89  ? 296 ALA A C     1 
ATOM   2867 O O     . ALA C 3 277 ? 117.151 101.002 112.527 1.00 26.39  ? 296 ALA A O     1 
ATOM   2868 C CB    . ALA C 3 277 ? 118.491 100.767 115.562 1.00 19.22  ? 296 ALA A CB    1 
ATOM   2869 N N     . ARG C 3 278 ? 118.948 99.660  112.647 1.00 24.71  ? 297 ARG A N     1 
ATOM   2870 C CA    . ARG C 3 278 ? 119.282 99.815  111.233 1.00 21.78  ? 297 ARG A CA    1 
ATOM   2871 C C     . ARG C 3 278 ? 118.185 99.208  110.353 1.00 22.46  ? 297 ARG A C     1 
ATOM   2872 O O     . ARG C 3 278 ? 117.800 99.771  109.333 1.00 25.53  ? 297 ARG A O     1 
ATOM   2873 C CB    . ARG C 3 278 ? 120.630 99.148  110.936 1.00 19.59  ? 297 ARG A CB    1 
ATOM   2874 C CG    . ARG C 3 278 ? 121.825 99.909  111.540 1.00 20.35  ? 297 ARG A CG    1 
ATOM   2875 C CD    . ARG C 3 278 ? 123.189 99.456  110.920 1.00 24.74  ? 297 ARG A CD    1 
ATOM   2876 N NE    . ARG C 3 278 ? 124.307 99.802  111.795 1.00 26.51  ? 297 ARG A NE    1 
ATOM   2877 C CZ    . ARG C 3 278 ? 125.474 99.161  111.812 1.00 32.45  ? 297 ARG A CZ    1 
ATOM   2878 N NH1   . ARG C 3 278 ? 125.703 98.165  110.970 1.00 24.86  ? 297 ARG A NH1   1 
ATOM   2879 N NH2   . ARG C 3 278 ? 126.422 99.533  112.661 1.00 25.25  ? 297 ARG A NH2   1 
ATOM   2880 N N     . ASP C 3 279 ? 117.660 98.063  110.744 1.00 21.67  ? 298 ASP A N     1 
ATOM   2881 C CA    . ASP C 3 279 ? 116.592 97.440  109.937 1.00 20.04  ? 298 ASP A CA    1 
ATOM   2882 C C     . ASP C 3 279 ? 115.338 98.301  109.849 1.00 28.13  ? 298 ASP A C     1 
ATOM   2883 O O     . ASP C 3 279 ? 114.701 98.370  108.791 1.00 29.12  ? 298 ASP A O     1 
ATOM   2884 C CB    . ASP C 3 279 ? 116.216 96.045  110.444 1.00 22.40  ? 298 ASP A CB    1 
ATOM   2885 C CG    . ASP C 3 279 ? 117.281 94.985  110.111 1.00 33.11  ? 298 ASP A CG    1 
ATOM   2886 O OD1   . ASP C 3 279 ? 118.069 95.201  109.143 1.00 26.94  ? 298 ASP A OD1   1 
ATOM   2887 O OD2   . ASP C 3 279 ? 117.344 93.969  110.858 1.00 29.27  ? 298 ASP A OD2   1 
ATOM   2888 N N     . MET C 3 280 ? 114.972 98.930  110.965 1.00 24.64  ? 299 MET A N     1 
ATOM   2889 C CA    . MET C 3 280 ? 113.786 99.799  110.999 1.00 22.34  ? 299 MET A CA    1 
ATOM   2890 C C     . MET C 3 280 ? 114.052 101.034 110.145 1.00 22.27  ? 299 MET A C     1 
ATOM   2891 O O     . MET C 3 280 ? 113.240 101.423 109.328 1.00 24.17  ? 299 MET A O     1 
ATOM   2892 C CB    . MET C 3 280 ? 113.446 100.203 112.441 1.00 23.99  ? 299 MET A CB    1 
ATOM   2893 C CG    . MET C 3 280 ? 112.577 99.155  113.188 1.00 26.44  ? 299 MET A CG    1 
ATOM   2894 S SD    . MET C 3 280 ? 112.169 99.658  114.843 1.00 26.63  ? 299 MET A SD    1 
ATOM   2895 C CE    . MET C 3 280 ? 113.794 99.812  115.614 1.00 22.59  ? 299 MET A CE    1 
ATOM   2896 N N     . ALA C 3 281 ? 115.212 101.639 110.321 1.00 20.94  ? 300 ALA A N     1 
ATOM   2897 C CA    . ALA C 3 281 ? 115.548 102.787 109.502 1.00 20.99  ? 300 ALA A CA    1 
ATOM   2898 C C     . ALA C 3 281 ? 115.500 102.367 108.037 1.00 27.71  ? 300 ALA A C     1 
ATOM   2899 O O     . ALA C 3 281 ? 114.896 103.043 107.230 1.00 26.71  ? 300 ALA A O     1 
ATOM   2900 C CB    . ALA C 3 281 ? 116.943 103.345 109.864 1.00 20.50  ? 300 ALA A CB    1 
ATOM   2901 N N     . ARG C 3 282 ? 116.113 101.238 107.689 1.00 26.67  ? 301 ARG A N     1 
ATOM   2902 C CA    . ARG C 3 282 ? 116.151 100.804 106.277 1.00 26.97  ? 301 ARG A CA    1 
ATOM   2903 C C     . ARG C 3 282 ? 114.802 100.501 105.663 1.00 29.81  ? 301 ARG A C     1 
ATOM   2904 O O     . ARG C 3 282 ? 114.612 100.677 104.468 1.00 28.81  ? 301 ARG A O     1 
ATOM   2905 C CB    . ARG C 3 282 ? 117.157 99.648  106.049 1.00 28.33  ? 301 ARG A CB    1 
ATOM   2906 C CG    . ARG C 3 282 ? 116.554 98.262  105.950 1.00 33.43  ? 301 ARG A CG    1 
ATOM   2907 C CD    . ARG C 3 282 ? 117.620 97.178  105.583 1.00 26.85  ? 301 ARG A CD    1 
ATOM   2908 N NE    . ARG C 3 282 ? 118.380 96.752  106.753 1.00 27.74  ? 301 ARG A NE    1 
ATOM   2909 C CZ    . ARG C 3 282 ? 119.592 97.212  107.058 1.00 34.44  ? 301 ARG A CZ    1 
ATOM   2910 N NH1   . ARG C 3 282 ? 120.185 98.063  106.231 1.00 30.69  ? 301 ARG A NH1   1 
ATOM   2911 N NH2   . ARG C 3 282 ? 120.217 96.811  108.174 1.00 24.79  ? 301 ARG A NH2   1 
ATOM   2912 N N     . ALA C 3 283 ? 113.853 100.094 106.505 1.00 27.95  ? 302 ALA A N     1 
ATOM   2913 C CA    . ALA C 3 283 ? 112.490 99.759  106.071 1.00 24.09  ? 302 ALA A CA    1 
ATOM   2914 C C     . ALA C 3 283 ? 111.562 100.992 105.963 1.00 27.99  ? 302 ALA A C     1 
ATOM   2915 O O     . ALA C 3 283 ? 110.373 100.863 105.744 1.00 29.02  ? 302 ALA A O     1 
ATOM   2916 C CB    . ALA C 3 283 ? 111.873 98.668  107.015 1.00 21.57  ? 302 ALA A CB    1 
ATOM   2917 N N     . GLY C 3 284 ? 112.102 102.181 106.156 1.00 23.10  ? 303 GLY A N     1 
ATOM   2918 C CA    . GLY C 3 284 ? 111.281 103.375 106.060 1.00 23.20  ? 303 GLY A CA    1 
ATOM   2919 C C     . GLY C 3 284 ? 110.406 103.636 107.305 1.00 29.39  ? 303 GLY A C     1 
ATOM   2920 O O     . GLY C 3 284 ? 109.548 104.494 107.298 1.00 29.63  ? 303 GLY A O     1 
ATOM   2921 N N     . VAL C 3 285 ? 110.632 102.925 108.390 1.00 28.39  ? 304 VAL A N     1 
ATOM   2922 C CA    . VAL C 3 285 ? 109.860 103.195 109.608 1.00 22.76  ? 304 VAL A CA    1 
ATOM   2923 C C     . VAL C 3 285 ? 110.135 104.646 110.101 1.00 27.36  ? 304 VAL A C     1 
ATOM   2924 O O     . VAL C 3 285 ? 111.274 105.162 110.049 1.00 25.40  ? 304 VAL A O     1 
ATOM   2925 C CB    . VAL C 3 285 ? 110.246 102.193 110.717 1.00 23.55  ? 304 VAL A CB    1 
ATOM   2926 C CG1   . VAL C 3 285 ? 109.528 102.510 112.023 1.00 21.39  ? 304 VAL A CG1   1 
ATOM   2927 C CG2   . VAL C 3 285 ? 109.967 100.754 110.258 1.00 21.37  ? 304 VAL A CG2   1 
ATOM   2928 N N     . SER C 3 286 ? 109.083 105.303 110.565 1.00 23.88  ? 305 SER A N     1 
ATOM   2929 C CA    . SER C 3 286 ? 109.209 106.670 111.054 1.00 22.66  ? 305 SER A CA    1 
ATOM   2930 C C     . SER C 3 286 ? 110.022 106.755 112.340 1.00 25.44  ? 305 SER A C     1 
ATOM   2931 O O     . SER C 3 286 ? 110.152 105.786 113.103 1.00 25.96  ? 305 SER A O     1 
ATOM   2932 C CB    . SER C 3 286 ? 107.826 107.319 111.266 1.00 30.80  ? 305 SER A CB    1 
ATOM   2933 O OG    . SER C 3 286 ? 107.177 106.811 112.422 1.00 29.36  ? 305 SER A OG    1 
ATOM   2934 N N     . ILE C 3 287 ? 110.574 107.923 112.590 1.00 21.72  ? 306 ILE A N     1 
ATOM   2935 C CA    . ILE C 3 287 ? 111.351 108.113 113.785 1.00 22.94  ? 306 ILE A CA    1 
ATOM   2936 C C     . ILE C 3 287 ? 110.622 107.841 115.143 1.00 27.38  ? 306 ILE A C     1 
ATOM   2937 O O     . ILE C 3 287 ? 111.171 107.185 116.033 1.00 28.66  ? 306 ILE A O     1 
ATOM   2938 C CB    . ILE C 3 287 ? 112.122 109.470 113.729 1.00 30.99  ? 306 ILE A CB    1 
ATOM   2939 C CG1   . ILE C 3 287 ? 113.501 109.247 113.122 1.00 34.59  ? 306 ILE A CG1   1 
ATOM   2940 C CG2   . ILE C 3 287 ? 112.213 110.172 115.126 1.00 34.54  ? 306 ILE A CG2   1 
ATOM   2941 C CD1   . ILE C 3 287 ? 113.892 110.358 112.206 1.00 68.68  ? 306 ILE A CD1   1 
ATOM   2942 N N     . PRO C 3 288 ? 109.401 108.347 115.305 1.00 25.58  ? 307 PRO A N     1 
ATOM   2943 C CA    . PRO C 3 288 ? 108.683 108.099 116.547 1.00 24.74  ? 307 PRO A CA    1 
ATOM   2944 C C     . PRO C 3 288 ? 108.493 106.590 116.788 1.00 24.38  ? 307 PRO A C     1 
ATOM   2945 O O     . PRO C 3 288 ? 108.644 106.109 117.893 1.00 22.21  ? 307 PRO A O     1 
ATOM   2946 C CB    . PRO C 3 288 ? 107.335 108.791 116.295 1.00 26.05  ? 307 PRO A CB    1 
ATOM   2947 C CG    . PRO C 3 288 ? 107.686 109.898 115.327 1.00 28.90  ? 307 PRO A CG    1 
ATOM   2948 C CD    . PRO C 3 288 ? 108.626 109.234 114.407 1.00 24.64  ? 307 PRO A CD    1 
ATOM   2949 N N     . GLU C 3 289 ? 108.144 105.842 115.750 1.00 24.21  ? 308 GLU A N     1 
ATOM   2950 C CA    . GLU C 3 289 ? 107.976 104.402 115.893 1.00 22.69  ? 308 GLU A CA    1 
ATOM   2951 C C     . GLU C 3 289 ? 109.321 103.716 116.174 1.00 30.13  ? 308 GLU A C     1 
ATOM   2952 O O     . GLU C 3 289 ? 109.364 102.756 116.926 1.00 26.47  ? 308 GLU A O     1 
ATOM   2953 C CB    . GLU C 3 289 ? 107.284 103.811 114.674 1.00 20.52  ? 308 GLU A CB    1 
ATOM   2954 C CG    . GLU C 3 289 ? 105.899 104.391 114.480 1.00 26.44  ? 308 GLU A CG    1 
ATOM   2955 C CD    . GLU C 3 289 ? 105.098 103.599 113.457 1.00 40.48  ? 308 GLU A CD    1 
ATOM   2956 O OE1   . GLU C 3 289 ? 105.679 102.674 112.879 1.00 48.57  ? 308 GLU A OE1   1 
ATOM   2957 O OE2   . GLU C 3 289 ? 103.894 103.874 113.251 1.00 48.31  ? 308 GLU A OE2   1 
ATOM   2958 N N     . ILE C 3 290 ? 110.416 104.236 115.604 1.00 29.65  ? 309 ILE A N     1 
ATOM   2959 C CA    . ILE C 3 290 ? 111.758 103.674 115.881 1.00 27.64  ? 309 ILE A CA    1 
ATOM   2960 C C     . ILE C 3 290 ? 112.081 104.015 117.336 1.00 27.28  ? 309 ILE A C     1 
ATOM   2961 O O     . ILE C 3 290 ? 112.604 103.192 118.075 1.00 25.53  ? 309 ILE A O     1 
ATOM   2962 C CB    . ILE C 3 290 ? 112.908 104.282 114.955 1.00 25.80  ? 309 ILE A CB    1 
ATOM   2963 C CG1   . ILE C 3 290 ? 112.752 103.822 113.514 1.00 23.03  ? 309 ILE A CG1   1 
ATOM   2964 C CG2   . ILE C 3 290 ? 114.316 103.898 115.483 1.00 22.36  ? 309 ILE A CG2   1 
ATOM   2965 C CD1   . ILE C 3 290 ? 113.762 104.509 112.548 1.00 21.42  ? 309 ILE A CD1   1 
ATOM   2966 N N     . MET C 3 291 ? 111.735 105.224 117.762 1.00 23.40  ? 310 MET A N     1 
ATOM   2967 C CA    . MET C 3 291 ? 112.017 105.629 119.123 1.00 21.13  ? 310 MET A CA    1 
ATOM   2968 C C     . MET C 3 291 ? 111.270 104.755 120.124 1.00 23.42  ? 310 MET A C     1 
ATOM   2969 O O     . MET C 3 291 ? 111.827 104.312 121.144 1.00 23.47  ? 310 MET A O     1 
ATOM   2970 C CB    . MET C 3 291 ? 111.696 107.118 119.312 1.00 24.86  ? 310 MET A CB    1 
ATOM   2971 C CG    . MET C 3 291 ? 112.546 108.008 118.422 1.00 28.36  ? 310 MET A CG    1 
ATOM   2972 S SD    . MET C 3 291 ? 112.362 109.809 118.628 1.00 32.29  ? 310 MET A SD    1 
ATOM   2973 C CE    . MET C 3 291 ? 112.941 110.044 120.317 1.00 28.21  ? 310 MET A CE    1 
ATOM   2974 N N     . GLN C 3 292 ? 110.008 104.469 119.819 1.00 21.83  ? 311 GLN A N     1 
ATOM   2975 C CA    . GLN C 3 292 ? 109.216 103.609 120.700 1.00 21.16  ? 311 GLN A CA    1 
ATOM   2976 C C     . GLN C 3 292 ? 109.778 102.180 120.758 1.00 27.52  ? 311 GLN A C     1 
ATOM   2977 O O     . GLN C 3 292 ? 109.831 101.565 121.825 1.00 28.90  ? 311 GLN A O     1 
ATOM   2978 C CB    . GLN C 3 292 ? 107.748 103.570 120.282 1.00 20.43  ? 311 GLN A CB    1 
ATOM   2979 C CG    . GLN C 3 292 ? 106.888 102.945 121.368 1.00 26.72  ? 311 GLN A CG    1 
ATOM   2980 C CD    . GLN C 3 292 ? 105.398 102.906 121.028 1.00 41.51  ? 311 GLN A CD    1 
ATOM   2981 O OE1   . GLN C 3 292 ? 104.984 102.375 119.979 1.00 30.32  ? 311 GLN A OE1   1 
ATOM   2982 N NE2   . GLN C 3 292 ? 104.581 103.398 121.948 1.00 30.77  ? 311 GLN A NE2   1 
ATOM   2983 N N     . ALA C 3 293 ? 110.222 101.672 119.611 1.00 23.43  ? 312 ALA A N     1 
ATOM   2984 C CA    . ALA C 3 293 ? 110.786 100.325 119.519 1.00 20.50  ? 312 ALA A CA    1 
ATOM   2985 C C     . ALA C 3 293 ? 111.999 100.116 120.423 1.00 26.33  ? 312 ALA A C     1 
ATOM   2986 O O     . ALA C 3 293 ? 112.184 99.034  120.966 1.00 28.45  ? 312 ALA A O     1 
ATOM   2987 C CB    . ALA C 3 293 ? 111.122 99.973  118.071 1.00 19.48  ? 312 ALA A CB    1 
ATOM   2988 N N     . GLY C 3 294 ? 112.820 101.149 120.584 1.00 25.30  ? 313 GLY A N     1 
ATOM   2989 C CA    . GLY C 3 294 ? 114.012 101.046 121.407 1.00 23.87  ? 313 GLY A CA    1 
ATOM   2990 C C     . GLY C 3 294 ? 113.990 101.868 122.684 1.00 26.80  ? 313 GLY A C     1 
ATOM   2991 O O     . GLY C 3 294 ? 114.988 101.951 123.385 1.00 29.33  ? 313 GLY A O     1 
ATOM   2992 N N     . GLY C 3 295 ? 112.874 102.514 122.975 1.00 26.68  ? 314 GLY A N     1 
ATOM   2993 C CA    . GLY C 3 295 ? 112.793 103.299 124.193 1.00 23.86  ? 314 GLY A CA    1 
ATOM   2994 C C     . GLY C 3 295 ? 113.550 104.618 124.172 1.00 29.85  ? 314 GLY A C     1 
ATOM   2995 O O     . GLY C 3 295 ? 113.921 105.131 125.197 1.00 34.05  ? 314 GLY A O     1 
ATOM   2996 N N     . TRP C 3 296 ? 113.748 105.214 123.017 1.00 28.33  ? 315 TRP A N     1 
ATOM   2997 C CA    . TRP C 3 296 ? 114.432 106.515 123.003 1.00 25.70  ? 315 TRP A CA    1 
ATOM   2998 C C     . TRP C 3 296 ? 113.425 107.666 123.208 1.00 28.83  ? 315 TRP A C     1 
ATOM   2999 O O     . TRP C 3 296 ? 112.301 107.590 122.750 1.00 25.83  ? 315 TRP A O     1 
ATOM   3000 C CB    . TRP C 3 296 ? 115.111 106.718 121.639 1.00 22.50  ? 315 TRP A CB    1 
ATOM   3001 C CG    . TRP C 3 296 ? 116.378 105.876 121.404 1.00 21.42  ? 315 TRP A CG    1 
ATOM   3002 C CD1   . TRP C 3 296 ? 117.671 106.188 121.813 1.00 23.43  ? 315 TRP A CD1   1 
ATOM   3003 C CD2   . TRP C 3 296 ? 116.496 104.682 120.602 1.00 20.67  ? 315 TRP A CD2   1 
ATOM   3004 N NE1   . TRP C 3 296 ? 118.559 105.239 121.348 1.00 22.72  ? 315 TRP A NE1   1 
ATOM   3005 C CE2   . TRP C 3 296 ? 117.885 104.336 120.565 1.00 26.90  ? 315 TRP A CE2   1 
ATOM   3006 C CE3   . TRP C 3 296 ? 115.585 103.894 119.885 1.00 21.97  ? 315 TRP A CE3   1 
ATOM   3007 C CZ2   . TRP C 3 296 ? 118.358 103.191 119.893 1.00 25.68  ? 315 TRP A CZ2   1 
ATOM   3008 C CZ3   . TRP C 3 296 ? 116.071 102.773 119.180 1.00 23.31  ? 315 TRP A CZ3   1 
ATOM   3009 C CH2   . TRP C 3 296 ? 117.440 102.427 119.211 1.00 23.99  ? 315 TRP A CH2   1 
ATOM   3010 N N     . THR C 3 297 ? 113.868 108.760 123.812 1.00 31.13  ? 316 THR A N     1 
ATOM   3011 C CA    . THR C 3 297 ? 113.039 109.957 123.966 1.00 33.59  ? 316 THR A CA    1 
ATOM   3012 C C     . THR C 3 297 ? 113.690 111.168 123.297 1.00 43.33  ? 316 THR A C     1 
ATOM   3013 O O     . THR C 3 297 ? 113.029 112.168 123.023 1.00 45.33  ? 316 THR A O     1 
ATOM   3014 C CB    . THR C 3 297 ? 112.780 110.312 125.398 1.00 37.91  ? 316 THR A CB    1 
ATOM   3015 O OG1   . THR C 3 297 ? 113.994 110.792 125.956 1.00 40.48  ? 316 THR A OG1   1 
ATOM   3016 C CG2   . THR C 3 297 ? 112.321 109.100 126.162 1.00 34.11  ? 316 THR A CG2   1 
ATOM   3017 N N     . ASN C 3 298 ? 114.973 111.063 122.988 1.00 39.22  ? 317 ASN A N     1 
ATOM   3018 C CA    . ASN C 3 298 ? 115.671 112.156 122.325 1.00 35.98  ? 317 ASN A CA    1 
ATOM   3019 C C     . ASN C 3 298 ? 115.988 111.757 120.903 1.00 32.26  ? 317 ASN A C     1 
ATOM   3020 O O     . ASN C 3 298 ? 116.675 110.761 120.676 1.00 31.33  ? 317 ASN A O     1 
ATOM   3021 C CB    . ASN C 3 298 ? 116.969 112.477 123.095 1.00 40.88  ? 317 ASN A CB    1 
ATOM   3022 C CG    . ASN C 3 298 ? 117.747 113.615 122.488 1.00 44.23  ? 317 ASN A CG    1 
ATOM   3023 O OD1   . ASN C 3 298 ? 118.146 113.577 121.312 1.00 45.84  ? 317 ASN A OD1   1 
ATOM   3024 N ND2   . ASN C 3 298 ? 117.996 114.632 123.290 1.00 47.88  ? 317 ASN A ND2   1 
ATOM   3025 N N     . VAL C 3 299 ? 115.488 112.535 119.943 1.00 32.43  ? 318 VAL A N     1 
ATOM   3026 C CA    . VAL C 3 299 ? 115.710 112.294 118.497 1.00 34.57  ? 318 VAL A CA    1 
ATOM   3027 C C     . VAL C 3 299 ? 117.198 112.329 118.077 1.00 40.29  ? 318 VAL A C     1 
ATOM   3028 O O     . VAL C 3 299 ? 117.626 111.634 117.140 1.00 36.78  ? 318 VAL A O     1 
ATOM   3029 C CB    . VAL C 3 299 ? 114.978 113.357 117.644 1.00 36.91  ? 318 VAL A CB    1 
ATOM   3030 C CG1   . VAL C 3 299 ? 114.796 112.891 116.233 1.00 35.77  ? 318 VAL A CG1   1 
ATOM   3031 C CG2   . VAL C 3 299 ? 113.665 113.600 118.217 1.00 40.29  ? 318 VAL A CG2   1 
ATOM   3032 N N     . ASN C 3 300 ? 117.954 113.202 118.735 1.00 35.94  ? 319 ASN A N     1 
ATOM   3033 C CA    . ASN C 3 300 ? 119.355 113.367 118.444 1.00 33.28  ? 319 ASN A CA    1 
ATOM   3034 C C     . ASN C 3 300 ? 120.059 112.103 118.817 1.00 33.84  ? 319 ASN A C     1 
ATOM   3035 O O     . ASN C 3 300 ? 120.877 111.598 118.054 1.00 31.84  ? 319 ASN A O     1 
ATOM   3036 C CB    . ASN C 3 300 ? 119.890 114.526 119.271 1.00 31.50  ? 319 ASN A CB    1 
ATOM   3037 C CG    . ASN C 3 300 ? 119.345 115.850 118.791 1.00 48.59  ? 319 ASN A CG    1 
ATOM   3038 O OD1   . ASN C 3 300 ? 119.498 116.209 117.622 1.00 45.92  ? 319 ASN A OD1   1 
ATOM   3039 N ND2   . ASN C 3 300 ? 118.606 116.518 119.643 1.00 42.92  ? 319 ASN A ND2   1 
ATOM   3040 N N     . ILE C 3 301 ? 119.714 111.598 120.001 1.00 31.78  ? 320 ILE A N     1 
ATOM   3041 C CA    . ILE C 3 301 ? 120.285 110.370 120.512 1.00 29.07  ? 320 ILE A CA    1 
ATOM   3042 C C     . ILE C 3 301 ? 119.940 109.162 119.678 1.00 33.76  ? 320 ILE A C     1 
ATOM   3043 O O     . ILE C 3 301 ? 120.811 108.342 119.399 1.00 35.19  ? 320 ILE A O     1 
ATOM   3044 C CB    . ILE C 3 301 ? 119.973 110.112 121.963 1.00 31.50  ? 320 ILE A CB    1 
ATOM   3045 C CG1   . ILE C 3 301 ? 120.594 111.235 122.825 1.00 33.17  ? 320 ILE A CG1   1 
ATOM   3046 C CG2   . ILE C 3 301 ? 120.504 108.734 122.355 1.00 22.33  ? 320 ILE A CG2   1 
ATOM   3047 C CD1   . ILE C 3 301 ? 120.639 110.907 124.324 1.00 41.26  ? 320 ILE A CD1   1 
ATOM   3048 N N     . VAL C 3 302 ? 118.706 109.073 119.199 1.00 27.45  ? 321 VAL A N     1 
ATOM   3049 C CA    . VAL C 3 302 ? 118.382 107.938 118.342 1.00 26.79  ? 321 VAL A CA    1 
ATOM   3050 C C     . VAL C 3 302 ? 119.095 108.040 116.970 1.00 32.61  ? 321 VAL A C     1 
ATOM   3051 O O     . VAL C 3 302 ? 119.569 107.060 116.401 1.00 27.63  ? 321 VAL A O     1 
ATOM   3052 C CB    . VAL C 3 302 ? 116.823 107.679 118.190 1.00 27.05  ? 321 VAL A CB    1 
ATOM   3053 C CG1   . VAL C 3 302 ? 116.138 108.830 117.452 1.00 25.31  ? 321 VAL A CG1   1 
ATOM   3054 C CG2   . VAL C 3 302 ? 116.567 106.349 117.478 1.00 25.12  ? 321 VAL A CG2   1 
ATOM   3055 N N     . MET C 3 303 ? 119.218 109.248 116.452 1.00 28.87  ? 322 MET A N     1 
ATOM   3056 C CA    . MET C 3 303 ? 119.850 109.368 115.163 1.00 28.55  ? 322 MET A CA    1 
ATOM   3057 C C     . MET C 3 303 ? 121.341 109.104 115.213 1.00 26.89  ? 322 MET A C     1 
ATOM   3058 O O     . MET C 3 303 ? 121.924 108.630 114.237 1.00 27.07  ? 322 MET A O     1 
ATOM   3059 C CB    . MET C 3 303 ? 119.502 110.699 114.522 1.00 33.66  ? 322 MET A CB    1 
ATOM   3060 C CG    . MET C 3 303 ? 118.053 110.779 114.273 1.00 39.60  ? 322 MET A CG    1 
ATOM   3061 S SD    . MET C 3 303 ? 117.849 109.959 112.760 1.00 46.89  ? 322 MET A SD    1 
ATOM   3062 C CE    . MET C 3 303 ? 116.962 108.668 113.276 1.00 44.05  ? 322 MET A CE    1 
ATOM   3063 N N     . ASN C 3 304 ? 121.970 109.409 116.336 1.00 24.54  ? 323 ASN A N     1 
ATOM   3064 C CA    . ASN C 3 304 ? 123.406 109.137 116.441 1.00 26.78  ? 323 ASN A CA    1 
ATOM   3065 C C     . ASN C 3 304 ? 123.571 107.639 116.509 1.00 31.31  ? 323 ASN A C     1 
ATOM   3066 O O     . ASN C 3 304 ? 124.552 107.094 116.029 1.00 37.16  ? 323 ASN A O     1 
ATOM   3067 C CB    . ASN C 3 304 ? 124.069 109.781 117.676 1.00 29.28  ? 323 ASN A CB    1 
ATOM   3068 C CG    . ASN C 3 304 ? 125.630 109.542 117.705 1.00 50.31  ? 323 ASN A CG    1 
ATOM   3069 O OD1   . ASN C 3 304 ? 126.154 108.818 118.557 1.00 41.87  ? 323 ASN A OD1   1 
ATOM   3070 N ND2   . ASN C 3 304 ? 126.345 110.152 116.770 1.00 39.74  ? 323 ASN A ND2   1 
ATOM   3071 N N     . PHE C 3 305 ? 122.611 106.965 117.117 1.00 25.79  ? 324 PHE A N     1 
ATOM   3072 C CA    . PHE C 3 305 ? 122.735 105.516 117.218 1.00 25.20  ? 324 PHE A CA    1 
ATOM   3073 C C     . PHE C 3 305 ? 122.674 104.844 115.857 1.00 29.62  ? 324 PHE A C     1 
ATOM   3074 O O     . PHE C 3 305 ? 123.346 103.841 115.595 1.00 32.07  ? 324 PHE A O     1 
ATOM   3075 C CB    . PHE C 3 305 ? 121.632 104.942 118.091 1.00 27.74  ? 324 PHE A CB    1 
ATOM   3076 C CG    . PHE C 3 305 ? 121.816 103.483 118.398 1.00 28.30  ? 324 PHE A CG    1 
ATOM   3077 C CD1   . PHE C 3 305 ? 122.901 103.068 119.149 1.00 27.51  ? 324 PHE A CD1   1 
ATOM   3078 C CD2   . PHE C 3 305 ? 120.937 102.548 117.918 1.00 24.70  ? 324 PHE A CD2   1 
ATOM   3079 C CE1   . PHE C 3 305 ? 123.074 101.745 119.472 1.00 27.05  ? 324 PHE A CE1   1 
ATOM   3080 C CE2   . PHE C 3 305 ? 121.104 101.221 118.214 1.00 26.54  ? 324 PHE A CE2   1 
ATOM   3081 C CZ    . PHE C 3 305 ? 122.180 100.814 119.001 1.00 25.57  ? 324 PHE A CZ    1 
ATOM   3082 N N     . ILE C 3 306 ? 121.807 105.367 115.005 1.00 27.20  ? 325 ILE A N     1 
ATOM   3083 C CA    . ILE C 3 306 ? 121.632 104.794 113.686 1.00 27.55  ? 325 ILE A CA    1 
ATOM   3084 C C     . ILE C 3 306 ? 122.495 105.491 112.632 1.00 31.63  ? 325 ILE A C     1 
ATOM   3085 O O     . ILE C 3 306 ? 122.146 105.524 111.472 1.00 33.90  ? 325 ILE A O     1 
ATOM   3086 C CB    . ILE C 3 306 ? 120.152 104.802 113.289 1.00 29.95  ? 325 ILE A CB    1 
ATOM   3087 C CG1   . ILE C 3 306 ? 119.349 104.155 114.412 1.00 30.08  ? 325 ILE A CG1   1 
ATOM   3088 C CG2   . ILE C 3 306 ? 119.937 103.949 112.100 1.00 37.33  ? 325 ILE A CG2   1 
ATOM   3089 C CD1   . ILE C 3 306 ? 118.078 103.509 113.949 1.00 50.10  ? 325 ILE A CD1   1 
ATOM   3090 N N     . ARG C 3 307 ? 123.636 106.019 113.041 1.00 27.84  ? 326 ARG A N     1 
ATOM   3091 C CA    . ARG C 3 307 ? 124.535 106.719 112.129 1.00 27.42  ? 326 ARG A CA    1 
ATOM   3092 C C     . ARG C 3 307 ? 125.215 105.808 111.110 1.00 32.99  ? 326 ARG A C     1 
ATOM   3093 O O     . ARG C 3 307 ? 125.869 106.280 110.183 1.00 30.73  ? 326 ARG A O     1 
ATOM   3094 C CB    . ARG C 3 307 ? 125.610 107.426 112.934 1.00 22.80  ? 326 ARG A CB    1 
ATOM   3095 C CG    . ARG C 3 307 ? 126.569 106.461 113.645 1.00 24.64  ? 326 ARG A CG    1 
ATOM   3096 C CD    . ARG C 3 307 ? 127.455 107.214 114.650 1.00 22.19  ? 326 ARG A CD    1 
ATOM   3097 N NE    . ARG C 3 307 ? 128.411 106.327 115.308 1.00 25.54  ? 326 ARG A NE    1 
ATOM   3098 C CZ    . ARG C 3 307 ? 128.180 105.769 116.487 1.00 29.88  ? 326 ARG A CZ    1 
ATOM   3099 N NH1   . ARG C 3 307 ? 127.016 105.975 117.097 1.00 27.53  ? 326 ARG A NH1   1 
ATOM   3100 N NH2   . ARG C 3 307 ? 129.100 104.991 117.048 1.00 26.93  ? 326 ARG A NH2   1 
ATOM   3101 N N     . ASN C 3 308 ? 125.072 104.502 111.263 1.00 31.41  ? 327 ASN A N     1 
ATOM   3102 C CA    . ASN C 3 308 ? 125.725 103.585 110.325 1.00 28.53  ? 327 ASN A CA    1 
ATOM   3103 C C     . ASN C 3 308 ? 124.757 102.767 109.502 1.00 33.03  ? 327 ASN A C     1 
ATOM   3104 O O     . ASN C 3 308 ? 125.037 101.594 109.214 1.00 32.30  ? 327 ASN A O     1 
ATOM   3105 C CB    . ASN C 3 308 ? 126.750 102.655 111.022 1.00 28.79  ? 327 ASN A CB    1 
ATOM   3106 C CG    . ASN C 3 308 ? 127.896 103.414 111.704 1.00 42.33  ? 327 ASN A CG    1 
ATOM   3107 O OD1   . ASN C 3 308 ? 128.551 104.251 111.099 1.00 35.71  ? 327 ASN A OD1   1 
ATOM   3108 N ND2   . ASN C 3 308 ? 128.180 103.056 112.972 1.00 31.58  ? 327 ASN A ND2   1 
ATOM   3109 N N     . LEU C 3 309 ? 123.628 103.374 109.116 1.00 32.32  ? 328 LEU A N     1 
ATOM   3110 C CA    . LEU C 3 309 ? 122.631 102.705 108.254 1.00 32.22  ? 328 LEU A CA    1 
ATOM   3111 C C     . LEU C 3 309 ? 123.469 102.060 107.131 1.00 41.23  ? 328 LEU A C     1 
ATOM   3112 O O     . LEU C 3 309 ? 124.253 102.734 106.485 1.00 40.73  ? 328 LEU A O     1 
ATOM   3113 C CB    . LEU C 3 309 ? 121.623 103.722 107.676 1.00 28.71  ? 328 LEU A CB    1 
ATOM   3114 C CG    . LEU C 3 309 ? 120.687 103.208 106.574 1.00 30.85  ? 328 LEU A CG    1 
ATOM   3115 C CD1   . LEU C 3 309 ? 120.065 101.894 107.072 1.00 30.97  ? 328 LEU A CD1   1 
ATOM   3116 C CD2   . LEU C 3 309 ? 119.585 104.274 106.244 1.00 25.52  ? 328 LEU A CD2   1 
ATOM   3117 N N     . ASP C 3 310 ? 123.334 100.745 106.962 1.00 34.54  ? 329 ASP A N     1 
ATOM   3118 C CA    . ASP C 3 310 ? 124.173 99.990  106.065 1.00 29.51  ? 329 ASP A CA    1 
ATOM   3119 C C     . ASP C 3 310 ? 123.617 99.349  104.809 1.00 34.23  ? 329 ASP A C     1 
ATOM   3120 O O     . ASP C 3 310 ? 124.155 98.364  104.340 1.00 39.94  ? 329 ASP A O     1 
ATOM   3121 C CB    . ASP C 3 310 ? 124.895 98.927  106.857 1.00 29.91  ? 329 ASP A CB    1 
ATOM   3122 C CG    . ASP C 3 310 ? 123.948 98.097  107.708 1.00 35.57  ? 329 ASP A CG    1 
ATOM   3123 O OD1   . ASP C 3 310 ? 122.695 98.223  107.550 1.00 30.67  ? 329 ASP A OD1   1 
ATOM   3124 O OD2   . ASP C 3 310 ? 124.470 97.315  108.541 1.00 34.38  ? 329 ASP A OD2   1 
ATOM   3125 N N     . SER C 3 311 ? 122.582 99.925  104.237 1.00 29.45  ? 330 SER A N     1 
ATOM   3126 C CA    . SER C 3 311 ? 122.071 99.475  102.943 1.00 28.37  ? 330 SER A CA    1 
ATOM   3127 C C     . SER C 3 311 ? 121.532 100.769 102.311 1.00 37.76  ? 330 SER A C     1 
ATOM   3128 O O     . SER C 3 311 ? 121.282 101.748 103.029 1.00 35.82  ? 330 SER A O     1 
ATOM   3129 C CB    . SER C 3 311 ? 121.008 98.372  103.064 1.00 25.31  ? 330 SER A CB    1 
ATOM   3130 O OG    . SER C 3 311 ? 119.751 98.886  103.499 1.00 35.08  ? 330 SER A OG    1 
ATOM   3131 N N     . GLU C 3 312 ? 121.433 100.810 100.985 1.00 34.60  ? 331 GLU A N     1 
ATOM   3132 C CA    . GLU C 3 312 ? 120.981 102.006 100.296 1.00 34.59  ? 331 GLU A CA    1 
ATOM   3133 C C     . GLU C 3 312 ? 119.489 102.036 100.249 1.00 33.64  ? 331 GLU A C     1 
ATOM   3134 O O     . GLU C 3 312 ? 118.890 101.141 99.666  1.00 35.50  ? 331 GLU A O     1 
ATOM   3135 C CB    . GLU C 3 312 ? 121.463 101.950 98.848  1.00 38.16  ? 331 GLU A CB    1 
ATOM   3136 C CG    . GLU C 3 312 ? 120.932 103.076 97.984  1.00 55.13  ? 331 GLU A CG    1 
ATOM   3137 C CD    . GLU C 3 312 ? 121.133 104.423 98.633  1.00 53.45  ? 331 GLU A CD    1 
ATOM   3138 O OE1   . GLU C 3 312 ? 122.271 104.715 99.055  1.00 57.50  ? 331 GLU A OE1   1 
ATOM   3139 O OE2   . GLU C 3 312 ? 120.158 105.185 98.726  1.00 38.34  ? 331 GLU A OE2   1 
ATOM   3140 N N     . THR C 3 313 ? 118.862 103.067 100.801 1.00 29.18  ? 332 THR A N     1 
ATOM   3141 C CA    . THR C 3 313 ? 117.386 103.097 100.740 1.00 30.22  ? 332 THR A CA    1 
ATOM   3142 C C     . THR C 3 313 ? 116.822 103.713 99.444  1.00 29.18  ? 332 THR A C     1 
ATOM   3143 O O     . THR C 3 313 ? 115.651 103.579 99.147  1.00 32.06  ? 332 THR A O     1 
ATOM   3144 C CB    . THR C 3 313 ? 116.735 103.746 101.997 1.00 42.49  ? 332 THR A CB    1 
ATOM   3145 O OG1   . THR C 3 313 ? 117.250 105.073 102.154 1.00 35.91  ? 332 THR A OG1   1 
ATOM   3146 C CG2   . THR C 3 313 ? 117.041 102.915 103.271 1.00 32.00  ? 332 THR A CG2   1 
ATOM   3147 N N     . GLY C 3 314 ? 117.664 104.379 98.675  1.00 28.24  ? 333 GLY A N     1 
ATOM   3148 C CA    . GLY C 3 314 ? 117.261 104.950 97.392  1.00 25.98  ? 333 GLY A CA    1 
ATOM   3149 C C     . GLY C 3 314 ? 115.921 105.667 97.382  1.00 28.16  ? 333 GLY A C     1 
ATOM   3150 O O     . GLY C 3 314 ? 115.118 105.477 96.471  1.00 29.86  ? 333 GLY A O     1 
ATOM   3151 N N     . ALA C 3 315 ? 115.710 106.577 98.331  1.00 27.58  ? 334 ALA A N     1 
ATOM   3152 C CA    . ALA C 3 315 ? 114.477 107.367 98.314  1.00 26.30  ? 334 ALA A CA    1 
ATOM   3153 C C     . ALA C 3 315 ? 114.301 108.198 97.007  1.00 24.49  ? 334 ALA A C     1 
ATOM   3154 O O     . ALA C 3 315 ? 113.200 108.290 96.484  1.00 23.44  ? 334 ALA A O     1 
ATOM   3155 C CB    . ALA C 3 315 ? 114.364 108.249 99.572  1.00 26.44  ? 334 ALA A CB    1 
ATOM   3156 N N     . MET C 3 316 ? 115.380 108.792 96.486  1.00 21.67  ? 335 MET A N     1 
ATOM   3157 C CA    . MET C 3 316 ? 115.266 109.566 95.247  1.00 21.53  ? 335 MET A CA    1 
ATOM   3158 C C     . MET C 3 316 ? 115.004 108.668 94.025  1.00 30.36  ? 335 MET A C     1 
ATOM   3159 O O     . MET C 3 316 ? 114.197 109.009 93.153  1.00 29.46  ? 335 MET A O     1 
ATOM   3160 C CB    . MET C 3 316 ? 116.472 110.469 95.033  1.00 21.75  ? 335 MET A CB    1 
ATOM   3161 C CG    . MET C 3 316 ? 116.535 111.618 95.992  1.00 23.10  ? 335 MET A CG    1 
ATOM   3162 S SD    . MET C 3 316 ? 114.993 112.654 96.045  1.00 26.79  ? 335 MET A SD    1 
ATOM   3163 C CE    . MET C 3 316 ? 114.939 113.289 94.350  1.00 23.53  ? 335 MET A CE    1 
ATOM   3164 N N     . VAL C 3 317 ? 115.641 107.496 93.965  1.00 27.82  ? 336 VAL A N     1 
ATOM   3165 C CA    . VAL C 3 317 ? 115.377 106.576 92.842  1.00 26.31  ? 336 VAL A CA    1 
ATOM   3166 C C     . VAL C 3 317 ? 113.895 106.209 92.903  1.00 28.01  ? 336 VAL A C     1 
ATOM   3167 O O     . VAL C 3 317 ? 113.199 106.288 91.899  1.00 32.47  ? 336 VAL A O     1 
ATOM   3168 C CB    . VAL C 3 317 ? 116.275 105.254 92.893  1.00 28.33  ? 336 VAL A CB    1 
ATOM   3169 C CG1   . VAL C 3 317 ? 115.700 104.143 91.988  1.00 27.06  ? 336 VAL A CG1   1 
ATOM   3170 C CG2   . VAL C 3 317 ? 117.710 105.558 92.513  1.00 26.39  ? 336 VAL A CG2   1 
ATOM   3171 N N     . ARG C 3 318 ? 113.382 105.865 94.085  1.00 23.47  ? 337 ARG A N     1 
ATOM   3172 C CA    . ARG C 3 318 ? 111.975 105.487 94.178  1.00 21.68  ? 337 ARG A CA    1 
ATOM   3173 C C     . ARG C 3 318 ? 111.036 106.598 93.740  1.00 28.24  ? 337 ARG A C     1 
ATOM   3174 O O     . ARG C 3 318 ? 110.081 106.381 92.995  1.00 30.53  ? 337 ARG A O     1 
ATOM   3175 C CB    . ARG C 3 318 ? 111.609 105.009 95.583  1.00 26.29  ? 337 ARG A CB    1 
ATOM   3176 C CG    . ARG C 3 318 ? 112.539 103.933 96.174  1.00 50.15  ? 337 ARG A CG    1 
ATOM   3177 C CD    . ARG C 3 318 ? 111.892 103.297 97.438  1.00 62.93  ? 337 ARG A CD    1 
ATOM   3178 N NE    . ARG C 3 318 ? 112.685 103.503 98.647  1.00 54.55  ? 337 ARG A NE    1 
ATOM   3179 C CZ    . ARG C 3 318 ? 112.326 104.274 99.661  1.00 62.48  ? 337 ARG A CZ    1 
ATOM   3180 N NH1   . ARG C 3 318 ? 111.178 104.936 99.628  1.00 54.89  ? 337 ARG A NH1   1 
ATOM   3181 N NH2   . ARG C 3 318 ? 113.137 104.405 100.701 1.00 86.38  ? 337 ARG A NH2   1 
ATOM   3182 N N     . LEU C 3 319 ? 111.305 107.809 94.193  1.00 29.75  ? 338 LEU A N     1 
ATOM   3183 C CA    . LEU C 3 319 ? 110.464 108.947 93.789  1.00 30.63  ? 338 LEU A CA    1 
ATOM   3184 C C     . LEU C 3 319 ? 110.501 109.138 92.253  1.00 31.75  ? 338 LEU A C     1 
ATOM   3185 O O     . LEU C 3 319 ? 109.467 109.328 91.619  1.00 28.71  ? 338 LEU A O     1 
ATOM   3186 C CB    . LEU C 3 319 ? 110.986 110.243 94.453  1.00 31.29  ? 338 LEU A CB    1 
ATOM   3187 C CG    . LEU C 3 319 ? 110.466 110.678 95.817  1.00 35.41  ? 338 LEU A CG    1 
ATOM   3188 C CD1   . LEU C 3 319 ? 110.951 112.072 96.091  1.00 31.95  ? 338 LEU A CD1   1 
ATOM   3189 C CD2   . LEU C 3 319 ? 108.961 110.632 95.806  1.00 32.52  ? 338 LEU A CD2   1 
ATOM   3190 N N     . LEU C 3 320 ? 111.705 109.153 91.680  1.00 26.65  ? 339 LEU A N     1 
ATOM   3191 C CA    . LEU C 3 320 ? 111.890 109.377 90.238  1.00 26.67  ? 339 LEU A CA    1 
ATOM   3192 C C     . LEU C 3 320 ? 111.257 108.274 89.387  1.00 31.43  ? 339 LEU A C     1 
ATOM   3193 O O     . LEU C 3 320 ? 110.700 108.517 88.310  1.00 29.56  ? 339 LEU A O     1 
ATOM   3194 C CB    . LEU C 3 320 ? 113.393 109.522 89.925  1.00 26.12  ? 339 LEU A CB    1 
ATOM   3195 C CG    . LEU C 3 320 ? 114.054 110.875 90.264  1.00 26.60  ? 339 LEU A CG    1 
ATOM   3196 C CD1   . LEU C 3 320 ? 115.557 110.784 90.332  1.00 20.03  ? 339 LEU A CD1   1 
ATOM   3197 C CD2   . LEU C 3 320 ? 113.630 111.929 89.243  1.00 25.28  ? 339 LEU A CD2   1 
ATOM   3198 N N     . GLU C 3 321 ? 111.343 107.052 89.881  1.00 32.24  ? 340 GLU A N     1 
ATOM   3199 C CA    . GLU C 3 321 ? 110.768 105.939 89.169  1.00 35.05  ? 340 GLU A CA    1 
ATOM   3200 C C     . GLU C 3 321 ? 109.301 105.804 89.613  1.00 50.38  ? 340 GLU A C     1 
ATOM   3201 O O     . GLU C 3 321 ? 108.591 104.933 89.141  1.00 48.54  ? 340 GLU A O     1 
ATOM   3202 C CB    . GLU C 3 321 ? 111.622 104.666 89.393  1.00 34.90  ? 340 GLU A CB    1 
ATOM   3203 C CG    . GLU C 3 321 ? 113.058 104.815 88.760  1.00 25.20  ? 340 GLU A CG    1 
ATOM   3204 C CD    . GLU C 3 321 ? 113.960 103.601 88.937  1.00 32.28  ? 340 GLU A CD    1 
ATOM   3205 O OE1   . GLU C 3 321 ? 113.468 102.517 89.282  1.00 36.82  ? 340 GLU A OE1   1 
ATOM   3206 O OE2   . GLU C 3 321 ? 115.175 103.720 88.714  1.00 29.88  ? 340 GLU A OE2   1 
ATOM   3207 N N     . ASP C 3 322 ? 108.882 106.754 90.472  1.00 59.02  ? 341 ASP A N     1 
ATOM   3208 C CA    . ASP C 3 322 ? 107.532 106.897 91.106  1.00 62.01  ? 341 ASP A CA    1 
ATOM   3209 C C     . ASP C 3 322 ? 107.142 105.641 91.821  1.00 81.08  ? 341 ASP A C     1 
ATOM   3210 O O     . ASP C 3 322 ? 106.364 104.837 91.302  1.00 86.11  ? 341 ASP A O     1 
ATOM   3211 C CB    . ASP C 3 322 ? 106.463 107.337 90.113  1.00 63.05  ? 341 ASP A CB    1 
ATOM   3212 C CG    . ASP C 3 322 ? 106.629 108.783 89.689  1.00 71.79  ? 341 ASP A CG    1 
ATOM   3213 O OD1   . ASP C 3 322 ? 107.413 109.033 88.758  1.00 72.85  ? 341 ASP A OD1   1 
ATOM   3214 O OD2   . ASP C 3 322 ? 106.001 109.670 90.303  1.00 76.94  ? 341 ASP A OD2   1 
ATOM   3215 N N     . GLY C 3 323 ? 107.763 105.415 92.977  1.00 79.37  ? 342 GLY A N     1 
ATOM   3216 C CA    . GLY C 3 323 ? 107.632 104.148 93.665  1.00 76.84  ? 342 GLY A CA    1 
ATOM   3217 C C     . GLY C 3 323 ? 108.406 103.388 92.592  1.00 80.31  ? 342 GLY A C     1 
ATOM   3218 O O     . GLY C 3 323 ? 109.636 103.316 92.618  1.00 77.22  ? 342 GLY A O     1 
ATOM   3219 N N     . ASP C 3 324 ? 107.665 102.979 91.570  1.00 81.00  ? 343 ASP A N     1 
ATOM   3220 C CA    . ASP C 3 324 ? 108.177 102.331 90.384  1.00 89.87  ? 343 ASP A CA    1 
ATOM   3221 C C     . ASP C 3 324 ? 106.980 101.644 89.722  1.00 100.00 ? 343 ASP A C     1 
ATOM   3222 O O     . ASP C 3 324 ? 105.946 102.317 89.533  1.00 100.00 ? 343 ASP A O     1 
ATOM   3223 C CB    . ASP C 3 324 ? 109.275 101.332 90.722  1.00 92.61  ? 343 ASP A CB    1 
ATOM   3224 C CG    . ASP C 3 324 ? 109.859 100.687 89.510  1.00 100.00 ? 343 ASP A CG    1 
ATOM   3225 O OD1   . ASP C 3 324 ? 109.180 99.844  88.886  1.00 100.00 ? 343 ASP A OD1   1 
ATOM   3226 O OD2   . ASP C 3 324 ? 111.017 101.008 89.184  1.00 100.00 ? 343 ASP A OD2   1 
ATOM   3227 O OXT   . ASP C 3 324 ? 107.028 100.430 89.441  1.00 100.00 ? 343 ASP A OXT   1 
HETATM 3228 O O     . HOH D 4 .   ? 135.836 107.857 121.655 1.00 35.92  ? 36  HOH M O     1 
HETATM 3229 O O     . HOH D 4 .   ? 131.857 100.331 125.337 1.00 42.28  ? 46  HOH M O     1 
HETATM 3230 O O     . HOH D 4 .   ? 137.699 99.838  120.381 1.00 42.08  ? 60  HOH M O     1 
HETATM 3231 O O     . HOH D 4 .   ? 121.441 101.507 125.418 1.00 39.93  ? 62  HOH M O     1 
HETATM 3232 O O     . HOH D 4 .   ? 131.041 91.653  133.571 1.00 31.47  ? 64  HOH M O     1 
HETATM 3233 O O     . HOH D 4 .   ? 143.445 103.766 133.307 1.00 44.42  ? 65  HOH M O     1 
HETATM 3234 O O     . HOH D 4 .   ? 140.589 103.802 131.174 1.00 35.12  ? 71  HOH M O     1 
HETATM 3235 O O     . HOH D 4 .   ? 132.219 93.869  134.584 1.00 41.23  ? 76  HOH M O     1 
HETATM 3236 O O     . HOH D 4 .   ? 127.458 101.720 126.410 1.00 32.53  ? 86  HOH M O     1 
HETATM 3237 O O     . HOH D 4 .   ? 128.944 100.135 124.475 1.00 35.76  ? 92  HOH M O     1 
HETATM 3238 O O     . HOH D 4 .   ? 133.420 84.866  130.074 1.00 34.19  ? 96  HOH M O     1 
HETATM 3239 O O     . HOH D 4 .   ? 123.938 101.892 126.634 1.00 45.15  ? 109 HOH M O     1 
HETATM 3240 O O     . HOH D 4 .   ? 127.704 107.017 120.908 1.00 43.52  ? 112 HOH M O     1 
HETATM 3241 O O     . HOH D 4 .   ? 136.582 96.780  139.130 1.00 52.94  ? 130 HOH M O     1 
HETATM 3242 O O     . HOH D 4 .   ? 124.088 104.201 127.590 1.00 45.42  ? 137 HOH M O     1 
HETATM 3243 O O     . HOH D 4 .   ? 137.331 78.534  131.282 1.00 55.55  ? 138 HOH M O     1 
HETATM 3244 O O     . HOH D 4 .   ? 135.204 100.585 120.900 1.00 51.18  ? 142 HOH M O     1 
HETATM 3245 O O     . HOH D 4 .   ? 141.226 95.132  132.270 1.00 54.83  ? 166 HOH M O     1 
HETATM 3246 O O     . HOH D 4 .   ? 140.105 97.237  128.911 1.00 60.53  ? 168 HOH M O     1 
HETATM 3247 O O     . HOH D 4 .   ? 141.342 93.783  130.173 1.00 58.05  ? 169 HOH M O     1 
HETATM 3248 O O     . HOH D 4 .   ? 143.628 102.142 137.352 1.00 50.34  ? 171 HOH M O     1 
HETATM 3249 O O     . HOH D 4 .   ? 135.528 81.515  128.925 1.00 55.48  ? 172 HOH M O     1 
HETATM 3250 O O     . HOH D 4 .   ? 124.293 89.159  138.028 1.00 43.94  ? 175 HOH M O     1 
HETATM 3251 O O     . HOH D 4 .   ? 125.095 76.529  128.118 1.00 49.97  ? 187 HOH M O     1 
HETATM 3252 O O     . HOH D 4 .   ? 126.468 87.625  137.721 1.00 43.47  ? 212 HOH M O     1 
HETATM 3253 O O     . HOH D 4 .   ? 130.993 109.632 125.849 1.00 42.34  ? 214 HOH M O     1 
HETATM 3254 O O     . HOH D 4 .   ? 135.855 78.066  129.321 1.00 69.02  ? 217 HOH M O     1 
HETATM 3255 O O     . HOH D 4 .   ? 123.408 105.025 130.200 1.00 69.91  ? 225 HOH M O     1 
HETATM 3256 O O     . HOH D 4 .   ? 141.599 63.765  135.655 1.00 71.93  ? 233 HOH M O     1 
HETATM 3257 O O     . HOH D 4 .   ? 127.418 80.247  126.598 1.00 57.48  ? 235 HOH M O     1 
HETATM 3258 O O     . HOH D 4 .   ? 123.423 112.574 124.123 1.00 47.13  ? 236 HOH M O     1 
HETATM 3259 O O     . HOH D 4 .   ? 127.310 110.789 122.812 1.00 61.92  ? 249 HOH M O     1 
HETATM 3260 O O     . HOH D 4 .   ? 133.962 106.081 127.758 1.00 70.61  ? 260 HOH M O     1 
HETATM 3261 O O     . HOH D 4 .   ? 127.434 70.548  127.100 1.00 61.96  ? 261 HOH M O     1 
HETATM 3262 O O     . HOH D 4 .   ? 134.883 84.028  139.821 1.00 66.81  ? 277 HOH M O     1 
HETATM 3263 O O     . HOH D 4 .   ? 130.148 109.102 123.538 1.00 43.96  ? 282 HOH M O     1 
HETATM 3264 O O     . HOH D 4 .   ? 137.793 75.532  132.428 1.00 72.08  ? 298 HOH M O     1 
HETATM 3265 O O     . HOH E 4 .   ? 124.686 96.788  133.819 1.00 32.15  ? 25  HOH N O     1 
HETATM 3266 O O     . HOH E 4 .   ? 130.953 96.027  133.324 1.00 43.99  ? 26  HOH N O     1 
HETATM 3267 O O     . HOH E 4 .   ? 123.916 113.153 133.366 1.00 53.76  ? 56  HOH N O     1 
HETATM 3268 O O     . HOH E 4 .   ? 129.734 112.268 126.413 1.00 48.75  ? 66  HOH N O     1 
HETATM 3269 O O     . HOH E 4 .   ? 129.793 95.195  130.831 1.00 35.61  ? 84  HOH N O     1 
HETATM 3270 O O     . HOH E 4 .   ? 128.519 98.443  122.358 1.00 37.21  ? 91  HOH N O     1 
HETATM 3271 O O     . HOH E 4 .   ? 130.700 103.895 134.829 1.00 77.79  ? 116 HOH N O     1 
HETATM 3272 O O     . HOH E 4 .   ? 140.579 80.107  134.421 1.00 46.71  ? 118 HOH N O     1 
HETATM 3273 O O     . HOH E 4 .   ? 127.742 69.633  134.445 1.00 72.71  ? 127 HOH N O     1 
HETATM 3274 O O     . HOH E 4 .   ? 140.848 88.615  135.180 1.00 55.67  ? 131 HOH N O     1 
HETATM 3275 O O     . HOH E 4 .   ? 141.913 91.460  130.411 1.00 50.24  ? 133 HOH N O     1 
HETATM 3276 O O     . HOH E 4 .   ? 139.831 92.562  127.514 1.00 46.69  ? 136 HOH N O     1 
HETATM 3277 O O     . HOH E 4 .   ? 131.635 123.048 115.049 1.00 49.89  ? 152 HOH N O     1 
HETATM 3278 O O     . HOH E 4 .   ? 138.992 82.833  131.334 1.00 57.54  ? 157 HOH N O     1 
HETATM 3279 O O     . HOH E 4 .   ? 126.572 117.801 118.405 1.00 69.12  ? 158 HOH N O     1 
HETATM 3280 O O     . HOH E 4 .   ? 138.434 78.547  142.318 1.00 54.68  ? 162 HOH N O     1 
HETATM 3281 O O     . HOH E 4 .   ? 136.652 120.869 120.758 1.00 62.16  ? 173 HOH N O     1 
HETATM 3282 O O     . HOH E 4 .   ? 132.418 111.113 129.965 1.00 37.73  ? 188 HOH N O     1 
HETATM 3283 O O     . HOH E 4 .   ? 131.038 113.349 128.412 1.00 48.16  ? 194 HOH N O     1 
HETATM 3284 O O     . HOH E 4 .   ? 134.378 76.110  144.213 1.00 69.16  ? 208 HOH N O     1 
HETATM 3285 O O     . HOH E 4 .   ? 128.252 116.976 121.067 1.00 64.22  ? 224 HOH N O     1 
HETATM 3286 O O     . HOH E 4 .   ? 134.915 117.687 118.516 1.00 69.68  ? 227 HOH N O     1 
HETATM 3287 O O     . HOH E 4 .   ? 138.704 80.108  132.689 1.00 50.96  ? 239 HOH N O     1 
HETATM 3288 O O     . HOH E 4 .   ? 135.983 91.646  119.262 1.00 48.21  ? 242 HOH N O     1 
HETATM 3289 O O     . HOH E 4 .   ? 136.000 85.386  129.266 1.00 62.32  ? 245 HOH N O     1 
HETATM 3290 O O     . HOH E 4 .   ? 136.908 95.694  126.408 1.00 65.10  ? 250 HOH N O     1 
HETATM 3291 O O     . HOH E 4 .   ? 128.797 66.121  132.013 1.00 57.70  ? 251 HOH N O     1 
HETATM 3292 O O     . HOH E 4 .   ? 123.061 121.836 114.912 1.00 58.20  ? 271 HOH N O     1 
HETATM 3293 O O     . HOH E 4 .   ? 126.209 115.419 121.880 1.00 55.64  ? 272 HOH N O     1 
HETATM 3294 O O     . HOH E 4 .   ? 121.368 109.235 136.985 1.00 63.52  ? 283 HOH N O     1 
HETATM 3295 O O     . HOH E 4 .   ? 123.725 115.518 121.435 1.00 64.33  ? 293 HOH N O     1 
HETATM 3296 O O     . HOH E 4 .   ? 136.686 86.069  140.827 1.00 58.22  ? 295 HOH N O     1 
HETATM 3297 O O     . HOH E 4 .   ? 138.310 86.570  138.431 1.00 62.58  ? 303 HOH N O     1 
HETATM 3298 O O     . HOH E 4 .   ? 133.086 91.177  119.820 1.00 70.25  ? 308 HOH N O     1 
HETATM 3299 O O     . HOH F 4 .   ? 148.384 117.783 141.110 1.00 39.71  ? 344 HOH A O     1 
HETATM 3300 O O     . HOH F 4 .   ? 127.347 99.501  120.005 1.00 25.40  ? 345 HOH A O     1 
HETATM 3301 O O     . HOH F 4 .   ? 130.073 93.744  118.429 1.00 29.60  ? 346 HOH A O     1 
HETATM 3302 O O     . HOH F 4 .   ? 124.580 92.136  109.315 1.00 31.88  ? 347 HOH A O     1 
HETATM 3303 O O     . HOH F 4 .   ? 125.190 86.061  109.914 1.00 31.96  ? 348 HOH A O     1 
HETATM 3304 O O     . HOH F 4 .   ? 114.255 76.670  119.810 1.00 30.89  ? 349 HOH A O     1 
HETATM 3305 O O     . HOH F 4 .   ? 124.379 78.252  120.746 1.00 57.99  ? 350 HOH A O     1 
HETATM 3306 O O     . HOH F 4 .   ? 117.047 108.931 124.411 1.00 21.86  ? 351 HOH A O     1 
HETATM 3307 O O     . HOH F 4 .   ? 116.303 99.316  126.282 1.00 41.13  ? 352 HOH A O     1 
HETATM 3308 O O     . HOH F 4 .   ? 115.994 86.919  132.521 1.00 23.13  ? 353 HOH A O     1 
HETATM 3309 O O     . HOH F 4 .   ? 109.525 86.100  114.079 1.00 17.33  ? 354 HOH A O     1 
HETATM 3310 O O     . HOH F 4 .   ? 151.556 107.952 127.026 1.00 27.34  ? 355 HOH A O     1 
HETATM 3311 O O     . HOH F 4 .   ? 124.609 75.218  138.199 1.00 45.81  ? 356 HOH A O     1 
HETATM 3312 O O     . HOH F 4 .   ? 129.151 71.887  135.729 1.00 47.48  ? 357 HOH A O     1 
HETATM 3313 O O     . HOH F 4 .   ? 133.600 84.847  115.743 1.00 37.68  ? 358 HOH A O     1 
HETATM 3314 O O     . HOH F 4 .   ? 121.593 93.670  121.410 1.00 21.11  ? 359 HOH A O     1 
HETATM 3315 O O     . HOH F 4 .   ? 128.633 90.862  133.812 1.00 29.13  ? 360 HOH A O     1 
HETATM 3316 O O     . HOH F 4 .   ? 126.397 77.204  134.146 1.00 29.43  ? 361 HOH A O     1 
HETATM 3317 O O     . HOH F 4 .   ? 111.798 95.015  135.204 1.00 46.42  ? 362 HOH A O     1 
HETATM 3318 O O     . HOH F 4 .   ? 115.177 99.032  132.079 1.00 41.57  ? 363 HOH A O     1 
HETATM 3319 O O     . HOH F 4 .   ? 111.496 93.006  133.309 1.00 34.53  ? 364 HOH A O     1 
HETATM 3320 O O     . HOH F 4 .   ? 114.097 93.968  132.513 1.00 34.50  ? 365 HOH A O     1 
HETATM 3321 O O     . HOH F 4 .   ? 118.907 94.077  122.066 1.00 22.10  ? 366 HOH A O     1 
HETATM 3322 O O     . HOH F 4 .   ? 130.329 92.455  130.671 1.00 29.42  ? 367 HOH A O     1 
HETATM 3323 O O     . HOH F 4 .   ? 118.755 82.966  136.326 1.00 26.93  ? 368 HOH A O     1 
HETATM 3324 O O     . HOH F 4 .   ? 122.498 88.067  139.952 1.00 43.12  ? 369 HOH A O     1 
HETATM 3325 O O     . HOH F 4 .   ? 121.138 81.393  136.361 1.00 27.90  ? 370 HOH A O     1 
HETATM 3326 O O     . HOH F 4 .   ? 108.569 76.454  132.793 1.00 31.05  ? 371 HOH A O     1 
HETATM 3327 O O     . HOH F 4 .   ? 110.790 96.728  120.107 1.00 25.38  ? 372 HOH A O     1 
HETATM 3328 O O     . HOH F 4 .   ? 118.127 108.827 97.413  1.00 29.93  ? 373 HOH A O     1 
HETATM 3329 O O     . HOH F 4 .   ? 120.704 93.044  135.040 1.00 35.25  ? 374 HOH A O     1 
HETATM 3330 O O     . HOH F 4 .   ? 115.771 91.865  139.714 1.00 55.90  ? 375 HOH A O     1 
HETATM 3331 O O     . HOH F 4 .   ? 149.359 113.349 124.049 1.00 28.55  ? 376 HOH A O     1 
HETATM 3332 O O     . HOH F 4 .   ? 144.781 108.608 121.624 1.00 42.37  ? 377 HOH A O     1 
HETATM 3333 O O     . HOH F 4 .   ? 151.793 103.180 141.781 1.00 49.56  ? 378 HOH A O     1 
HETATM 3334 O O     . HOH F 4 .   ? 153.123 104.638 139.956 1.00 33.61  ? 379 HOH A O     1 
HETATM 3335 O O     . HOH F 4 .   ? 120.859 98.389  133.585 1.00 37.80  ? 380 HOH A O     1 
HETATM 3336 O O     . HOH F 4 .   ? 118.563 99.208  132.887 1.00 57.39  ? 381 HOH A O     1 
HETATM 3337 O O     . HOH F 4 .   ? 117.208 107.358 100.918 1.00 23.38  ? 382 HOH A O     1 
HETATM 3338 O O     . HOH F 4 .   ? 119.700 107.501 99.500  1.00 21.68  ? 383 HOH A O     1 
HETATM 3339 O O     . HOH F 4 .   ? 106.593 104.183 110.517 1.00 36.19  ? 384 HOH A O     1 
HETATM 3340 O O     . HOH F 4 .   ? 105.214 108.280 113.194 1.00 21.89  ? 385 HOH A O     1 
HETATM 3341 O O     . HOH F 4 .   ? 122.829 107.120 120.823 1.00 27.94  ? 386 HOH A O     1 
HETATM 3342 O O     . HOH F 4 .   ? 125.294 85.673  138.060 1.00 49.25  ? 387 HOH A O     1 
HETATM 3343 O O     . HOH F 4 .   ? 102.002 102.265 112.089 1.00 49.89  ? 388 HOH A O     1 
HETATM 3344 O O     . HOH F 4 .   ? 116.336 81.576  136.262 1.00 29.85  ? 389 HOH A O     1 
HETATM 3345 O O     . HOH F 4 .   ? 119.017 86.111  133.894 1.00 25.47  ? 390 HOH A O     1 
HETATM 3346 O O     . HOH F 4 .   ? 105.794 77.554  127.136 1.00 40.61  ? 391 HOH A O     1 
HETATM 3347 O O     . HOH F 4 .   ? 148.637 105.500 135.748 1.00 32.96  ? 392 HOH A O     1 
HETATM 3348 O O     . HOH F 4 .   ? 114.453 98.671  124.055 1.00 30.97  ? 393 HOH A O     1 
HETATM 3349 O O     . HOH F 4 .   ? 116.701 75.596  119.123 1.00 48.21  ? 394 HOH A O     1 
HETATM 3350 O O     . HOH F 4 .   ? 116.766 70.917  125.253 1.00 49.99  ? 395 HOH A O     1 
HETATM 3351 O O     . HOH F 4 .   ? 114.098 78.748  121.629 1.00 26.67  ? 396 HOH A O     1 
HETATM 3352 O O     . HOH F 4 .   ? 111.256 110.234 86.498  1.00 34.16  ? 397 HOH A O     1 
HETATM 3353 O O     . HOH F 4 .   ? 139.261 108.592 119.664 1.00 53.62  ? 398 HOH A O     1 
HETATM 3354 O O     . HOH F 4 .   ? 124.059 102.375 113.177 1.00 23.42  ? 399 HOH A O     1 
HETATM 3355 O O     . HOH F 4 .   ? 133.277 109.554 128.297 1.00 42.26  ? 400 HOH A O     1 
HETATM 3356 O O     . HOH F 4 .   ? 128.763 98.446  113.580 1.00 34.36  ? 401 HOH A O     1 
HETATM 3357 O O     . HOH F 4 .   ? 123.098 95.515  125.221 1.00 20.75  ? 402 HOH A O     1 
HETATM 3358 O O     . HOH F 4 .   ? 128.933 76.049  134.669 1.00 37.28  ? 403 HOH A O     1 
HETATM 3359 O O     . HOH F 4 .   ? 113.245 92.414  110.256 1.00 32.45  ? 404 HOH A O     1 
HETATM 3360 O O     . HOH F 4 .   ? 121.920 101.343 114.770 1.00 30.23  ? 405 HOH A O     1 
HETATM 3361 O O     . HOH F 4 .   ? 132.086 90.902  125.091 1.00 41.41  ? 406 HOH A O     1 
HETATM 3362 O O     . HOH F 4 .   ? 118.481 107.040 95.361  1.00 36.42  ? 407 HOH A O     1 
HETATM 3363 O O     . HOH F 4 .   ? 127.059 94.902  131.354 1.00 28.57  ? 408 HOH A O     1 
HETATM 3364 O O     . HOH F 4 .   ? 129.140 73.177  133.342 1.00 34.76  ? 409 HOH A O     1 
HETATM 3365 O O     . HOH F 4 .   ? 147.984 116.540 121.924 1.00 39.13  ? 410 HOH A O     1 
HETATM 3366 O O     . HOH F 4 .   ? 118.459 92.926  107.538 1.00 30.15  ? 411 HOH A O     1 
HETATM 3367 O O     . HOH F 4 .   ? 127.837 96.459  111.683 1.00 30.46  ? 412 HOH A O     1 
HETATM 3368 O O     . HOH F 4 .   ? 114.104 93.573  108.071 1.00 33.91  ? 413 HOH A O     1 
HETATM 3369 O O     . HOH F 4 .   ? 114.773 96.116  107.265 1.00 29.89  ? 414 HOH A O     1 
HETATM 3370 O O     . HOH F 4 .   ? 151.408 105.761 135.981 1.00 36.85  ? 415 HOH A O     1 
HETATM 3371 O O     . HOH F 4 .   ? 147.605 102.190 126.515 1.00 39.70  ? 416 HOH A O     1 
HETATM 3372 O O     . HOH F 4 .   ? 133.439 99.514  123.157 1.00 38.49  ? 417 HOH A O     1 
HETATM 3373 O O     . HOH F 4 .   ? 109.493 94.633  121.704 1.00 36.09  ? 418 HOH A O     1 
HETATM 3374 O O     . HOH F 4 .   ? 110.232 112.384 123.580 1.00 42.02  ? 419 HOH A O     1 
HETATM 3375 O O     . HOH F 4 .   ? 153.958 108.874 133.042 1.00 31.65  ? 420 HOH A O     1 
HETATM 3376 O O     . HOH F 4 .   ? 152.581 103.846 137.494 1.00 36.73  ? 421 HOH A O     1 
HETATM 3377 O O     . HOH F 4 .   ? 112.028 99.990  125.161 1.00 48.04  ? 422 HOH A O     1 
HETATM 3378 O O     . HOH F 4 .   ? 122.949 90.199  135.615 1.00 30.38  ? 423 HOH A O     1 
HETATM 3379 O O     . HOH F 4 .   ? 107.608 72.572  134.845 1.00 37.60  ? 424 HOH A O     1 
HETATM 3380 O O     . HOH F 4 .   ? 112.998 75.962  118.013 1.00 37.92  ? 425 HOH A O     1 
HETATM 3381 O O     . HOH F 4 .   ? 125.314 91.164  135.219 1.00 37.15  ? 426 HOH A O     1 
HETATM 3382 O O     . HOH F 4 .   ? 121.028 79.401  138.296 1.00 38.55  ? 427 HOH A O     1 
HETATM 3383 O O     . HOH F 4 .   ? 112.109 76.856  140.001 1.00 34.54  ? 428 HOH A O     1 
HETATM 3384 O O     . HOH F 4 .   ? 123.666 88.656  107.587 1.00 47.07  ? 429 HOH A O     1 
HETATM 3385 O O     . HOH F 4 .   ? 155.919 104.635 140.844 1.00 49.89  ? 430 HOH A O     1 
HETATM 3386 O O     . HOH F 4 .   ? 125.314 80.820  139.046 1.00 38.78  ? 431 HOH A O     1 
HETATM 3387 O O     . HOH F 4 .   ? 126.615 92.886  110.504 1.00 40.89  ? 432 HOH A O     1 
HETATM 3388 O O     . HOH F 4 .   ? 123.225 82.528  137.636 1.00 29.44  ? 433 HOH A O     1 
HETATM 3389 O O     . HOH F 4 .   ? 115.578 80.747  143.585 1.00 41.14  ? 434 HOH A O     1 
HETATM 3390 O O     . HOH F 4 .   ? 106.937 96.514  121.597 1.00 41.45  ? 435 HOH A O     1 
HETATM 3391 O O     . HOH F 4 .   ? 122.528 72.297  126.774 1.00 42.26  ? 436 HOH A O     1 
HETATM 3392 O O     . HOH F 4 .   ? 146.985 105.064 132.993 1.00 44.69  ? 437 HOH A O     1 
HETATM 3393 O O     . HOH F 4 .   ? 140.664 103.736 134.129 1.00 44.08  ? 438 HOH A O     1 
HETATM 3394 O O     . HOH F 4 .   ? 125.431 100.687 138.338 1.00 61.02  ? 439 HOH A O     1 
HETATM 3395 O O     . HOH F 4 .   ? 115.237 96.283  133.517 1.00 52.92  ? 440 HOH A O     1 
HETATM 3396 O O     . HOH F 4 .   ? 112.836 79.463  142.568 1.00 48.46  ? 441 HOH A O     1 
HETATM 3397 O O     . HOH F 4 .   ? 123.698 86.184  106.718 1.00 51.13  ? 442 HOH A O     1 
HETATM 3398 O O     . HOH F 4 .   ? 120.504 69.646  126.305 1.00 46.64  ? 443 HOH A O     1 
HETATM 3399 O O     . HOH F 4 .   ? 108.675 98.747  122.317 1.00 37.09  ? 444 HOH A O     1 
HETATM 3400 O O     . HOH F 4 .   ? 137.142 99.975  139.744 1.00 47.09  ? 445 HOH A O     1 
HETATM 3401 O O     . HOH F 4 .   ? 119.471 69.394  128.644 1.00 36.40  ? 446 HOH A O     1 
HETATM 3402 O O     . HOH F 4 .   ? 120.081 68.856  118.598 1.00 48.19  ? 447 HOH A O     1 
HETATM 3403 O O     . HOH F 4 .   ? 139.662 91.098  119.533 1.00 58.47  ? 448 HOH A O     1 
HETATM 3404 O O     . HOH F 4 .   ? 105.153 74.224  138.370 1.00 62.57  ? 449 HOH A O     1 
HETATM 3405 O O     . HOH F 4 .   ? 128.539 108.666 118.060 1.00 67.52  ? 450 HOH A O     1 
HETATM 3406 O O     . HOH F 4 .   ? 146.191 122.989 127.532 1.00 47.03  ? 451 HOH A O     1 
HETATM 3407 O O     . HOH F 4 .   ? 114.106 101.541 99.825  1.00 67.96  ? 452 HOH A O     1 
HETATM 3408 O O     . HOH F 4 .   ? 106.587 86.071  113.676 1.00 42.09  ? 453 HOH A O     1 
HETATM 3409 O O     . HOH F 4 .   ? 135.155 124.554 138.359 1.00 69.68  ? 454 HOH A O     1 
HETATM 3410 O O     . HOH F 4 .   ? 119.650 85.251  106.100 1.00 39.31  ? 455 HOH A O     1 
HETATM 3411 O O     . HOH F 4 .   ? 133.949 110.343 120.636 1.00 52.12  ? 456 HOH A O     1 
HETATM 3412 O O     . HOH F 4 .   ? 136.444 83.558  118.336 1.00 54.16  ? 457 HOH A O     1 
HETATM 3413 O O     . HOH F 4 .   ? 104.593 100.429 127.109 1.00 51.59  ? 458 HOH A O     1 
HETATM 3414 O O     . HOH F 4 .   ? 117.934 98.962  101.804 1.00 45.86  ? 459 HOH A O     1 
HETATM 3415 O O     . HOH F 4 .   ? 112.463 101.764 92.054  1.00 53.03  ? 460 HOH A O     1 
HETATM 3416 O O     . HOH F 4 .   ? 128.020 95.234  134.466 1.00 49.63  ? 461 HOH A O     1 
HETATM 3417 O O     . HOH F 4 .   ? 147.011 103.794 142.228 1.00 49.59  ? 462 HOH A O     1 
HETATM 3418 O O     . HOH F 4 .   ? 125.370 78.899  125.649 1.00 65.03  ? 463 HOH A O     1 
HETATM 3419 O O     . HOH F 4 .   ? 149.822 104.354 143.256 1.00 51.93  ? 464 HOH A O     1 
HETATM 3420 O O     . HOH F 4 .   ? 133.068 110.783 133.220 1.00 49.30  ? 465 HOH A O     1 
HETATM 3421 O O     . HOH F 4 .   ? 128.046 94.962  109.810 1.00 40.00  ? 466 HOH A O     1 
HETATM 3422 O O     . HOH F 4 .   ? 152.098 118.034 141.844 1.00 55.71  ? 467 HOH A O     1 
HETATM 3423 O O     . HOH F 4 .   ? 154.287 117.391 133.621 1.00 40.44  ? 468 HOH A O     1 
HETATM 3424 O O     . HOH F 4 .   ? 132.697 99.698  115.092 1.00 48.90  ? 469 HOH A O     1 
HETATM 3425 O O     . HOH F 4 .   ? 123.841 106.857 99.581  1.00 44.77  ? 470 HOH A O     1 
HETATM 3426 O O     . HOH F 4 .   ? 139.175 97.883  119.061 1.00 60.51  ? 471 HOH A O     1 
HETATM 3427 O O     . HOH F 4 .   ? 113.335 85.571  111.736 1.00 59.10  ? 472 HOH A O     1 
HETATM 3428 O O     . HOH F 4 .   ? 112.729 79.181  114.231 1.00 57.92  ? 473 HOH A O     1 
HETATM 3429 O O     . HOH F 4 .   ? 112.049 91.791  136.543 1.00 57.00  ? 474 HOH A O     1 
HETATM 3430 O O     . HOH F 4 .   ? 107.068 76.437  121.574 1.00 49.32  ? 475 HOH A O     1 
HETATM 3431 O O     . HOH F 4 .   ? 110.037 102.842 101.777 1.00 57.85  ? 476 HOH A O     1 
HETATM 3432 O O     . HOH F 4 .   ? 109.349 101.609 124.283 1.00 64.38  ? 477 HOH A O     1 
HETATM 3433 O O     . HOH F 4 .   ? 124.065 94.064  135.656 1.00 74.21  ? 478 HOH A O     1 
HETATM 3434 O O     . HOH F 4 .   ? 132.671 112.061 122.304 1.00 71.11  ? 479 HOH A O     1 
HETATM 3435 O O     . HOH F 4 .   ? 116.254 92.472  106.328 1.00 32.43  ? 480 HOH A O     1 
HETATM 3436 O O     . HOH F 4 .   ? 115.983 90.045  105.201 1.00 40.53  ? 481 HOH A O     1 
HETATM 3437 O O     . HOH F 4 .   ? 113.784 96.228  104.867 1.00 46.73  ? 482 HOH A O     1 
HETATM 3438 O O     . HOH F 4 .   ? 150.630 101.806 137.544 1.00 50.33  ? 483 HOH A O     1 
HETATM 3439 O O     . HOH F 4 .   ? 117.637 86.150  104.776 1.00 56.57  ? 484 HOH A O     1 
HETATM 3440 O O     . HOH F 4 .   ? 146.229 102.124 138.174 1.00 53.34  ? 485 HOH A O     1 
HETATM 3441 O O     . HOH F 4 .   ? 110.270 110.270 110.270 0.33 40.43  ? 486 HOH A O     1 
HETATM 3442 O O     . HOH F 4 .   ? 134.403 89.006  121.701 1.00 53.37  ? 487 HOH A O     1 
HETATM 3443 O O     . HOH F 4 .   ? 114.044 72.460  135.456 1.00 48.23  ? 488 HOH A O     1 
HETATM 3444 O O     . HOH F 4 .   ? 103.361 91.731  130.714 1.00 42.70  ? 489 HOH A O     1 
HETATM 3445 O O     . HOH F 4 .   ? 116.576 87.591  106.228 1.00 46.67  ? 490 HOH A O     1 
HETATM 3446 O O     . HOH F 4 .   ? 112.473 74.923  138.326 1.00 44.55  ? 491 HOH A O     1 
HETATM 3447 O O     . HOH F 4 .   ? 106.568 111.999 92.627  1.00 47.85  ? 492 HOH A O     1 
HETATM 3448 O O     . HOH F 4 .   ? 126.587 95.897  108.066 1.00 40.83  ? 493 HOH A O     1 
HETATM 3449 O O     . HOH F 4 .   ? 130.113 78.488  118.894 1.00 48.51  ? 494 HOH A O     1 
HETATM 3450 O O     . HOH F 4 .   ? 120.828 92.685  106.754 1.00 50.64  ? 495 HOH A O     1 
HETATM 3451 O O     . HOH F 4 .   ? 122.566 98.731  99.408  1.00 43.29  ? 496 HOH A O     1 
HETATM 3452 O O     . HOH F 4 .   ? 148.136 103.058 136.555 1.00 45.47  ? 497 HOH A O     1 
HETATM 3453 O O     . HOH F 4 .   ? 124.790 72.771  128.234 1.00 52.55  ? 498 HOH A O     1 
HETATM 3454 O O     . HOH F 4 .   ? 118.733 101.081 126.602 1.00 57.77  ? 499 HOH A O     1 
HETATM 3455 O O     . HOH F 4 .   ? 115.609 93.888  104.289 1.00 58.00  ? 500 HOH A O     1 
HETATM 3456 O O     . HOH F 4 .   ? 124.083 79.311  107.629 1.00 56.94  ? 501 HOH A O     1 
HETATM 3457 O O     . HOH F 4 .   ? 141.946 100.634 144.272 1.00 52.87  ? 502 HOH A O     1 
HETATM 3458 O O     . HOH F 4 .   ? 131.394 117.603 137.521 1.00 60.40  ? 503 HOH A O     1 
HETATM 3459 O O     . HOH F 4 .   ? 104.055 84.888  133.512 1.00 51.41  ? 504 HOH A O     1 
HETATM 3460 O O     . HOH F 4 .   ? 149.914 101.276 126.941 1.00 69.82  ? 505 HOH A O     1 
HETATM 3461 O O     . HOH F 4 .   ? 149.811 123.477 127.657 1.00 60.18  ? 506 HOH A O     1 
HETATM 3462 O O     . HOH F 4 .   ? 113.925 91.952  137.836 1.00 55.22  ? 507 HOH A O     1 
HETATM 3463 O O     . HOH F 4 .   ? 119.302 87.436  103.012 1.00 62.62  ? 508 HOH A O     1 
HETATM 3464 O O     . HOH F 4 .   ? 98.280  87.488  129.928 1.00 50.09  ? 509 HOH A O     1 
HETATM 3465 O O     . HOH F 4 .   ? 156.756 110.038 144.271 1.00 65.61  ? 510 HOH A O     1 
HETATM 3466 O O     . HOH F 4 .   ? 111.545 101.705 87.095  1.00 60.21  ? 511 HOH A O     1 
HETATM 3467 O O     . HOH F 4 .   ? 113.371 100.040 128.525 1.00 61.50  ? 512 HOH A O     1 
HETATM 3468 O O     . HOH F 4 .   ? 117.766 67.179  116.317 1.00 64.37  ? 513 HOH A O     1 
HETATM 3469 O O     . HOH F 4 .   ? 127.734 82.302  127.556 1.00 53.20  ? 514 HOH A O     1 
HETATM 3470 O O     . HOH F 4 .   ? 129.969 94.784  137.204 1.00 65.99  ? 515 HOH A O     1 
HETATM 3471 O O     . HOH F 4 .   ? 139.265 93.685  121.977 1.00 49.69  ? 516 HOH A O     1 
HETATM 3472 O O     . HOH F 4 .   ? 107.040 109.312 92.555  1.00 53.38  ? 517 HOH A O     1 
HETATM 3473 O O     . HOH F 4 .   ? 136.592 77.634  114.381 1.00 59.50  ? 518 HOH A O     1 
HETATM 3474 O O     . HOH F 4 .   ? 118.634 93.650  137.990 1.00 54.87  ? 519 HOH A O     1 
HETATM 3475 O O     . HOH F 4 .   ? 124.995 69.507  135.592 1.00 64.86  ? 520 HOH A O     1 
HETATM 3476 O O     . HOH F 4 .   ? 117.143 114.114 126.166 1.00 66.46  ? 521 HOH A O     1 
HETATM 3477 O O     . HOH F 4 .   ? 105.201 100.462 133.931 1.00 61.92  ? 522 HOH A O     1 
HETATM 3478 O O     . HOH F 4 .   ? 150.115 101.413 140.212 1.00 63.38  ? 523 HOH A O     1 
HETATM 3479 O O     . HOH F 4 .   ? 130.305 89.075  110.701 1.00 67.54  ? 524 HOH A O     1 
HETATM 3480 O O     . HOH F 4 .   ? 129.833 82.419  129.145 1.00 52.66  ? 525 HOH A O     1 
HETATM 3481 O O     . HOH F 4 .   ? 99.207  92.087  129.296 1.00 62.62  ? 526 HOH A O     1 
HETATM 3482 O O     . HOH F 4 .   ? 130.594 104.050 114.015 1.00 42.10  ? 527 HOH A O     1 
HETATM 3483 O O     . HOH F 4 .   ? 110.373 82.926  144.638 1.00 55.53  ? 528 HOH A O     1 
HETATM 3484 O O     . HOH F 4 .   ? 124.779 108.510 121.175 1.00 58.50  ? 529 HOH A O     1 
HETATM 3485 O O     . HOH F 4 .   ? 132.844 84.025  126.058 1.00 65.40  ? 530 HOH A O     1 
HETATM 3486 O O     . HOH F 4 .   ? 125.204 106.478 119.384 1.00 44.07  ? 531 HOH A O     1 
HETATM 3487 O O     . HOH F 4 .   ? 118.624 82.266  106.197 1.00 49.18  ? 532 HOH A O     1 
HETATM 3488 O O     . HOH F 4 .   ? 114.077 82.051  109.870 1.00 55.93  ? 533 HOH A O     1 
HETATM 3489 O O     . HOH F 4 .   ? 135.308 87.545  124.859 1.00 57.07  ? 534 HOH A O     1 
HETATM 3490 O O     . HOH F 4 .   ? 130.949 106.993 114.178 1.00 48.15  ? 535 HOH A O     1 
HETATM 3491 O O     . HOH F 4 .   ? 131.085 84.914  128.498 1.00 53.66  ? 536 HOH A O     1 
HETATM 3492 O O     . HOH F 4 .   ? 136.983 104.866 119.155 1.00 63.22  ? 537 HOH A O     1 
HETATM 3493 O O     . HOH F 4 .   ? 113.776 114.618 120.823 1.00 63.30  ? 538 HOH A O     1 
HETATM 3494 O O     . HOH F 4 .   ? 105.482 92.456  136.003 1.00 59.46  ? 539 HOH A O     1 
HETATM 3495 O O     . HOH F 4 .   ? 104.688 76.728  121.659 1.00 61.94  ? 540 HOH A O     1 
HETATM 3496 O O     . HOH F 4 .   ? 108.309 75.424  119.156 1.00 59.59  ? 541 HOH A O     1 
HETATM 3497 O O     . HOH F 4 .   ? 108.991 80.793  115.799 1.00 64.96  ? 542 HOH A O     1 
HETATM 3498 O O     . HOH F 4 .   ? 119.503 116.476 122.237 1.00 58.34  ? 543 HOH A O     1 
HETATM 3499 O O     . HOH F 4 .   ? 128.266 89.368  109.160 1.00 64.65  ? 544 HOH A O     1 
HETATM 3500 O O     . HOH F 4 .   ? 115.163 88.177  144.298 1.00 65.00  ? 545 HOH A O     1 
HETATM 3501 O O     . HOH F 4 .   ? 108.767 107.752 86.714  1.00 54.27  ? 546 HOH A O     1 
HETATM 3502 O O     . HOH F 4 .   ? 105.907 107.452 87.179  1.00 66.89  ? 547 HOH A O     1 
HETATM 3503 O O     . HOH F 4 .   ? 143.115 102.509 122.959 1.00 61.39  ? 548 HOH A O     1 
HETATM 3504 O O     . HOH F 4 .   ? 115.417 99.649  101.807 1.00 65.42  ? 549 HOH A O     1 
HETATM 3505 O O     . HOH F 4 .   ? 110.369 76.462  141.989 1.00 65.00  ? 550 HOH A O     1 
HETATM 3506 O O     . HOH F 4 .   ? 131.822 97.608  114.459 1.00 59.73  ? 551 HOH A O     1 
HETATM 3507 O O     . HOH F 4 .   ? 116.895 90.040  102.691 1.00 63.27  ? 552 HOH A O     1 
HETATM 3508 O O     . HOH F 4 .   ? 131.845 82.649  124.106 1.00 52.71  ? 553 HOH A O     1 
HETATM 3509 O O     . HOH F 4 .   ? 114.835 113.805 125.811 1.00 62.47  ? 554 HOH A O     1 
HETATM 3510 O O     . HOH F 4 .   ? 144.075 119.540 114.564 1.00 78.81  ? 555 HOH A O     1 
HETATM 3511 O O     . HOH F 4 .   ? 130.016 106.232 112.111 1.00 57.52  ? 556 HOH A O     1 
HETATM 3512 O O     . HOH F 4 .   ? 122.427 73.032  136.295 1.00 49.38  ? 557 HOH A O     1 
HETATM 3513 O O     . HOH F 4 .   ? 130.374 78.022  137.928 1.00 63.77  ? 558 HOH A O     1 
HETATM 3514 O O     . HOH F 4 .   ? 111.427 71.792  136.826 1.00 56.45  ? 559 HOH A O     1 
HETATM 3515 O O     . HOH F 4 .   ? 131.375 100.941 113.483 1.00 53.02  ? 560 HOH A O     1 
HETATM 3516 O O     . HOH F 4 .   ? 126.900 90.115  110.837 1.00 63.41  ? 561 HOH A O     1 
HETATM 3517 O O     . HOH F 4 .   ? 105.609 104.712 124.228 1.00 55.29  ? 562 HOH A O     1 
HETATM 3518 O O     . HOH F 4 .   ? 126.566 82.397  140.936 1.00 64.64  ? 563 HOH A O     1 
HETATM 3519 O O     . HOH F 4 .   ? 128.975 79.580  140.120 1.00 71.16  ? 564 HOH A O     1 
HETATM 3520 O O     . HOH F 4 .   ? 144.364 127.391 133.329 1.00 66.16  ? 565 HOH A O     1 
HETATM 3521 O O     . HOH F 4 .   ? 97.413  93.787  125.525 1.00 66.51  ? 566 HOH A O     1 
HETATM 3522 O O     . HOH F 4 .   ? 103.526 98.075  132.080 1.00 75.40  ? 567 HOH A O     1 
HETATM 3523 O O     . HOH F 4 .   ? 138.720 95.462  124.032 1.00 64.89  ? 568 HOH A O     1 
HETATM 3524 O O     . HOH F 4 .   ? 142.578 128.425 122.899 1.00 77.34  ? 569 HOH A O     1 
HETATM 3525 O O     . HOH F 4 .   ? 105.781 85.044  111.756 1.00 64.49  ? 570 HOH A O     1 
HETATM 3526 O O     . HOH F 4 .   ? 121.843 85.550  105.519 1.00 73.63  ? 571 HOH A O     1 
HETATM 3527 O O     . HOH F 4 .   ? 133.191 84.760  118.284 1.00 45.67  ? 572 HOH A O     1 
HETATM 3528 O O     . HOH F 4 .   ? 115.284 76.940  107.765 1.00 70.30  ? 573 HOH A O     1 
HETATM 3529 O O     . HOH F 4 .   ? 122.959 71.022  138.068 1.00 63.41  ? 574 HOH A O     1 
HETATM 3530 O O     . HOH F 4 .   ? 114.525 77.057  141.265 1.00 67.77  ? 575 HOH A O     1 
HETATM 3531 O O     . HOH F 4 .   ? 134.967 115.549 131.056 1.00 77.27  ? 576 HOH A O     1 
HETATM 3532 O O     . HOH F 4 .   ? 101.557 87.400  134.384 1.00 76.91  ? 577 HOH A O     1 
HETATM 3533 O O     . HOH F 4 .   ? 104.687 80.641  136.173 1.00 68.58  ? 578 HOH A O     1 
HETATM 3534 O O     . HOH F 4 .   ? 101.673 83.443  129.494 1.00 68.09  ? 579 HOH A O     1 
HETATM 3535 O O     . HOH F 4 .   ? 103.506 82.134  130.280 1.00 73.80  ? 580 HOH A O     1 
HETATM 3536 O O     . HOH F 4 .   ? 120.307 72.627  138.870 1.00 64.36  ? 581 HOH A O     1 
HETATM 3537 O O     . HOH F 4 .   ? 132.413 122.481 132.829 1.00 74.37  ? 582 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   1   1   DT  T   M . n 
A 1 2   DA  2   2   2   DA  A   M . n 
A 1 3   DT  3   3   3   DT  T   M . n 
A 1 4   DA  4   4   4   DA  A   M . n 
A 1 5   DA  5   5   5   DA  A   M . n 
A 1 6   DC  6   6   6   DC  C   M . n 
A 1 7   DT  7   7   7   DT  T   M . n 
A 1 8   DT  8   8   8   DT  T   M . n 
A 1 9   DC  9   9   9   DC  C   M . n 
A 1 10  DG  10  10  10  DG  G   M . n 
A 1 11  DT  11  11  11  DT  T   M . n 
A 1 12  DA  12  12  12  DA  A   M . n 
A 1 13  DT  13  13  13  DT  T   M . n 
A 1 14  DA  14  14  14  DA  A   M . n 
A 1 15  DG  15  15  15  DG  G   M . n 
A 1 16  DC  16  16  16  DC  C   M . n 
B 2 1   DA  1   1   1   DA  A   N . n 
B 2 2   DT  2   2   2   DT  T   N . n 
B 2 3   DA  3   3   3   DA  A   N . n 
B 2 4   DT  4   4   4   DT  T   N . n 
B 2 5   DG  5   5   5   DG  G   N . n 
B 2 6   DC  6   6   6   DC  C   N . n 
B 2 7   DT  7   7   7   DT  T   N . n 
B 2 8   DA  8   8   8   DA  A   N . n 
B 2 9   DT  9   9   9   DT  T   N . n 
B 2 10  DA  10  10  10  DA  A   N . n 
B 2 11  DC  11  11  11  DC  C   N . n 
B 2 12  DG  12  12  12  DG  G   N . n 
B 2 13  DA  13  13  13  DA  A   N . n 
B 2 14  DA  14  14  14  DA  A   N . n 
B 2 15  DG  15  15  15  DG  G   N . n 
B 2 16  DT  16  16  16  DT  T   N . n 
B 2 17  DT  17  17  17  DT  T   N . n 
B 2 18  DA  18  18  18  DA  A   N . n 
B 2 19  DT  19  19  19  DT  T   N . n 
C 3 1   SER 1   20  20  SER SER A . n 
C 3 2   ASP 2   21  21  ASP ASP A . n 
C 3 3   GLU 3   22  22  GLU GLU A . n 
C 3 4   VAL 4   23  23  VAL VAL A . n 
C 3 5   ARG 5   24  24  ARG ARG A . n 
C 3 6   LYS 6   25  25  LYS LYS A . n 
C 3 7   ASN 7   26  26  ASN ASN A . n 
C 3 8   LEU 8   27  27  LEU LEU A . n 
C 3 9   MET 9   28  28  MET MET A . n 
C 3 10  ASP 10  29  29  ASP ASP A . n 
C 3 11  MET 11  30  30  MET MET A . n 
C 3 12  PHE 12  31  31  PHE PHE A . n 
C 3 13  ARG 13  32  32  ARG ARG A . n 
C 3 14  ASP 14  33  33  ASP ASP A . n 
C 3 15  ARG 15  34  34  ARG ARG A . n 
C 3 16  GLN 16  35  35  GLN GLN A . n 
C 3 17  ALA 17  36  36  ALA ALA A . n 
C 3 18  PHE 18  37  37  PHE PHE A . n 
C 3 19  SER 19  38  38  SER SER A . n 
C 3 20  GLU 20  39  39  GLU GLU A . n 
C 3 21  HIS 21  40  40  HIS HIS A . n 
C 3 22  THR 22  41  41  THR THR A . n 
C 3 23  TRP 23  42  42  TRP TRP A . n 
C 3 24  LYS 24  43  43  LYS LYS A . n 
C 3 25  MET 25  44  44  MET MET A . n 
C 3 26  LEU 26  45  45  LEU LEU A . n 
C 3 27  LEU 27  46  46  LEU LEU A . n 
C 3 28  SER 28  47  47  SER SER A . n 
C 3 29  VAL 29  48  48  VAL VAL A . n 
C 3 30  CYS 30  49  49  CYS CYS A . n 
C 3 31  ARG 31  50  50  ARG ARG A . n 
C 3 32  SER 32  51  51  SER SER A . n 
C 3 33  TRP 33  52  52  TRP TRP A . n 
C 3 34  ALA 34  53  53  ALA ALA A . n 
C 3 35  ALA 35  54  54  ALA ALA A . n 
C 3 36  TRP 36  55  55  TRP TRP A . n 
C 3 37  CYS 37  56  56  CYS CYS A . n 
C 3 38  LYS 38  57  57  LYS LYS A . n 
C 3 39  LEU 39  58  58  LEU LEU A . n 
C 3 40  ASN 40  59  59  ASN ASN A . n 
C 3 41  ASN 41  60  60  ASN ASN A . n 
C 3 42  ARG 42  61  61  ARG ARG A . n 
C 3 43  LYS 43  62  62  LYS LYS A . n 
C 3 44  TRP 44  63  63  TRP TRP A . n 
C 3 45  PHE 45  64  64  PHE PHE A . n 
C 3 46  PRO 46  65  65  PRO PRO A . n 
C 3 47  ALA 47  66  66  ALA ALA A . n 
C 3 48  GLU 48  67  67  GLU GLU A . n 
C 3 49  PRO 49  68  68  PRO PRO A . n 
C 3 50  GLU 50  69  69  GLU GLU A . n 
C 3 51  ASP 51  70  70  ASP ASP A . n 
C 3 52  VAL 52  71  71  VAL VAL A . n 
C 3 53  ARG 53  72  72  ARG ARG A . n 
C 3 54  ASP 54  73  73  ASP ASP A . n 
C 3 55  TYR 55  74  74  TYR TYR A . n 
C 3 56  LEU 56  75  75  LEU LEU A . n 
C 3 57  LEU 57  76  76  LEU LEU A . n 
C 3 58  TYR 58  77  77  TYR TYR A . n 
C 3 59  LEU 59  78  78  LEU LEU A . n 
C 3 60  GLN 60  79  79  GLN GLN A . n 
C 3 61  ALA 61  80  80  ALA ALA A . n 
C 3 62  ARG 62  81  81  ARG ARG A . n 
C 3 63  GLY 63  82  82  GLY GLY A . n 
C 3 64  LEU 64  83  83  LEU LEU A . n 
C 3 65  ALA 65  84  84  ALA ALA A . n 
C 3 66  VAL 66  85  85  VAL VAL A . n 
C 3 67  LYS 67  86  86  LYS LYS A . n 
C 3 68  THR 68  87  87  THR THR A . n 
C 3 69  ILE 69  88  88  ILE ILE A . n 
C 3 70  GLN 70  89  89  GLN GLN A . n 
C 3 71  GLN 71  90  90  GLN GLN A . n 
C 3 72  HIS 72  91  91  HIS HIS A . n 
C 3 73  LEU 73  92  92  LEU LEU A . n 
C 3 74  GLY 74  93  93  GLY GLY A . n 
C 3 75  GLN 75  94  94  GLN GLN A . n 
C 3 76  LEU 76  95  95  LEU LEU A . n 
C 3 77  ASN 77  96  96  ASN ASN A . n 
C 3 78  MET 78  97  97  MET MET A . n 
C 3 79  LEU 79  98  98  LEU LEU A . n 
C 3 80  HIS 80  99  99  HIS HIS A . n 
C 3 81  ARG 81  100 100 ARG ARG A . n 
C 3 82  ARG 82  101 101 ARG ARG A . n 
C 3 83  SER 83  102 102 SER SER A . n 
C 3 84  GLY 84  103 103 GLY GLY A . n 
C 3 85  LEU 85  104 104 LEU LEU A . n 
C 3 86  PRO 86  105 105 PRO PRO A . n 
C 3 87  ARG 87  106 106 ARG ARG A . n 
C 3 88  PRO 88  107 107 PRO PRO A . n 
C 3 89  SER 89  108 108 SER SER A . n 
C 3 90  ASP 90  109 109 ASP ASP A . n 
C 3 91  SER 91  110 110 SER SER A . n 
C 3 92  ASN 92  111 111 ASN ASN A . n 
C 3 93  ALA 93  112 112 ALA ALA A . n 
C 3 94  VAL 94  113 113 VAL VAL A . n 
C 3 95  SER 95  114 114 SER SER A . n 
C 3 96  LEU 96  115 115 LEU LEU A . n 
C 3 97  VAL 97  116 116 VAL VAL A . n 
C 3 98  MET 98  117 117 MET MET A . n 
C 3 99  ARG 99  118 118 ARG ARG A . n 
C 3 100 ARG 100 119 119 ARG ARG A . n 
C 3 101 ILE 101 120 120 ILE ILE A . n 
C 3 102 ARG 102 121 121 ARG ARG A . n 
C 3 103 LYS 103 122 122 LYS LYS A . n 
C 3 104 GLU 104 123 123 GLU GLU A . n 
C 3 105 ASN 105 124 124 ASN ASN A . n 
C 3 106 VAL 106 125 125 VAL VAL A . n 
C 3 107 ASP 107 126 126 ASP ASP A . n 
C 3 108 ALA 108 127 127 ALA ALA A . n 
C 3 109 GLY 109 128 128 GLY GLY A . n 
C 3 110 GLU 110 129 129 GLU GLU A . n 
C 3 111 ARG 111 130 130 ARG ARG A . n 
C 3 112 ALA 112 131 131 ALA ALA A . n 
C 3 113 LYS 113 132 132 LYS LYS A . n 
C 3 114 GLN 114 133 133 GLN GLN A . n 
C 3 115 ALA 115 134 134 ALA ALA A . n 
C 3 116 LEU 116 135 135 LEU LEU A . n 
C 3 117 ALA 117 136 136 ALA ALA A . n 
C 3 118 PHE 118 137 137 PHE PHE A . n 
C 3 119 GLU 119 138 138 GLU GLU A . n 
C 3 120 ARG 120 139 139 ARG ARG A . n 
C 3 121 THR 121 140 140 THR THR A . n 
C 3 122 ASP 122 141 141 ASP ASP A . n 
C 3 123 PHE 123 142 142 PHE PHE A . n 
C 3 124 ASP 124 143 143 ASP ASP A . n 
C 3 125 GLN 125 144 144 GLN GLN A . n 
C 3 126 VAL 126 145 145 VAL VAL A . n 
C 3 127 ARG 127 146 146 ARG ARG A . n 
C 3 128 SER 128 147 147 SER SER A . n 
C 3 129 LEU 129 148 148 LEU LEU A . n 
C 3 130 MET 130 149 149 MET MET A . n 
C 3 131 GLU 131 150 150 GLU GLU A . n 
C 3 132 ASN 132 151 151 ASN ASN A . n 
C 3 133 SER 133 152 152 SER SER A . n 
C 3 134 ASP 134 153 153 ASP ASP A . n 
C 3 135 ARG 135 154 154 ARG ARG A . n 
C 3 136 CYS 136 155 155 CYS CYS A . n 
C 3 137 GLN 137 156 156 GLN GLN A . n 
C 3 138 ASP 138 157 157 ASP ASP A . n 
C 3 139 ILE 139 158 158 ILE ILE A . n 
C 3 140 ARG 140 159 159 ARG ARG A . n 
C 3 141 ASN 141 160 160 ASN ASN A . n 
C 3 142 LEU 142 161 161 LEU LEU A . n 
C 3 143 ALA 143 162 162 ALA ALA A . n 
C 3 144 PHE 144 163 163 PHE PHE A . n 
C 3 145 LEU 145 164 164 LEU LEU A . n 
C 3 146 GLY 146 165 165 GLY GLY A . n 
C 3 147 ILE 147 166 166 ILE ILE A . n 
C 3 148 ALA 148 167 167 ALA ALA A . n 
C 3 149 TYR 149 168 168 TYR TYR A . n 
C 3 150 ASN 150 169 169 ASN ASN A . n 
C 3 151 THR 151 170 170 THR THR A . n 
C 3 152 LEU 152 171 171 LEU LEU A . n 
C 3 153 LEU 153 172 172 LEU LEU A . n 
C 3 154 ARG 154 173 173 ARG ARG A . n 
C 3 155 ILE 155 174 174 ILE ILE A . n 
C 3 156 ALA 156 175 175 ALA ALA A . n 
C 3 157 GLU 157 176 176 GLU GLU A . n 
C 3 158 ILE 158 177 177 ILE ILE A . n 
C 3 159 ALA 159 178 178 ALA ALA A . n 
C 3 160 ARG 160 179 179 ARG ARG A . n 
C 3 161 ILE 161 180 180 ILE ILE A . n 
C 3 162 ARG 162 181 181 ARG ARG A . n 
C 3 163 VAL 163 182 182 VAL VAL A . n 
C 3 164 LYS 164 183 183 LYS LYS A . n 
C 3 165 ASP 165 184 184 ASP ASP A . n 
C 3 166 ILE 166 185 185 ILE ILE A . n 
C 3 167 SER 167 186 186 SER SER A . n 
C 3 168 ARG 168 187 187 ARG ARG A . n 
C 3 169 THR 169 188 188 THR THR A . n 
C 3 170 ASP 170 189 189 ASP ASP A . n 
C 3 171 GLY 171 190 190 GLY GLY A . n 
C 3 172 GLY 172 191 191 GLY GLY A . n 
C 3 173 ARG 173 192 192 ARG ARG A . n 
C 3 174 MET 174 193 193 MET MET A . n 
C 3 175 LEU 175 194 194 LEU LEU A . n 
C 3 176 ILE 176 195 195 ILE ILE A . n 
C 3 177 HIS 177 196 196 HIS HIS A . n 
C 3 178 ILE 178 197 197 ILE ILE A . n 
C 3 179 GLY 179 198 198 GLY GLY A . n 
C 3 180 ARG 180 199 199 ARG ARG A . n 
C 3 181 THR 181 200 ?   ?   ?   A . n 
C 3 182 LYS 182 201 ?   ?   ?   A . n 
C 3 183 THR 183 202 ?   ?   ?   A . n 
C 3 184 LEU 184 203 ?   ?   ?   A . n 
C 3 185 VAL 185 204 ?   ?   ?   A . n 
C 3 186 SER 186 205 ?   ?   ?   A . n 
C 3 187 THR 187 206 ?   ?   ?   A . n 
C 3 188 ALA 188 207 ?   ?   ?   A . n 
C 3 189 GLY 189 208 208 GLY GLY A . n 
C 3 190 VAL 190 209 209 VAL VAL A . n 
C 3 191 GLU 191 210 210 GLU GLU A . n 
C 3 192 LYS 192 211 211 LYS LYS A . n 
C 3 193 ALA 193 212 212 ALA ALA A . n 
C 3 194 LEU 194 213 213 LEU LEU A . n 
C 3 195 SER 195 214 214 SER SER A . n 
C 3 196 LEU 196 215 215 LEU LEU A . n 
C 3 197 GLY 197 216 216 GLY GLY A . n 
C 3 198 VAL 198 217 217 VAL VAL A . n 
C 3 199 THR 199 218 218 THR THR A . n 
C 3 200 LYS 200 219 219 LYS LYS A . n 
C 3 201 LEU 201 220 220 LEU LEU A . n 
C 3 202 VAL 202 221 221 VAL VAL A . n 
C 3 203 GLU 203 222 222 GLU GLU A . n 
C 3 204 ARG 204 223 223 ARG ARG A . n 
C 3 205 TRP 205 224 224 TRP TRP A . n 
C 3 206 ILE 206 225 225 ILE ILE A . n 
C 3 207 SER 207 226 226 SER SER A . n 
C 3 208 VAL 208 227 227 VAL VAL A . n 
C 3 209 SER 209 228 228 SER SER A . n 
C 3 210 GLY 210 229 229 GLY GLY A . n 
C 3 211 VAL 211 230 230 VAL VAL A . n 
C 3 212 ALA 212 231 231 ALA ALA A . n 
C 3 213 ASP 213 232 232 ASP ASP A . n 
C 3 214 ASP 214 233 233 ASP ASP A . n 
C 3 215 PRO 215 234 234 PRO PRO A . n 
C 3 216 ASN 216 235 235 ASN ASN A . n 
C 3 217 ASN 217 236 236 ASN ASN A . n 
C 3 218 TYR 218 237 237 TYR TYR A . n 
C 3 219 LEU 219 238 238 LEU LEU A . n 
C 3 220 PHE 220 239 239 PHE PHE A . n 
C 3 221 CYS 221 240 240 CYS CYS A . n 
C 3 222 ARG 222 241 241 ARG ARG A . n 
C 3 223 VAL 223 242 242 VAL VAL A . n 
C 3 224 ARG 224 243 243 ARG ARG A . n 
C 3 225 LYS 225 244 244 LYS LYS A . n 
C 3 226 ASN 226 245 245 ASN ASN A . n 
C 3 227 GLY 227 246 246 GLY GLY A . n 
C 3 228 VAL 228 247 247 VAL VAL A . n 
C 3 229 ALA 229 248 248 ALA ALA A . n 
C 3 230 ALA 230 249 249 ALA ALA A . n 
C 3 231 PRO 231 250 250 PRO PRO A . n 
C 3 232 SER 232 251 251 SER SER A . n 
C 3 233 ALA 233 252 252 ALA ALA A . n 
C 3 234 THR 234 253 253 THR THR A . n 
C 3 235 SER 235 254 254 SER SER A . n 
C 3 236 GLN 236 255 255 GLN GLN A . n 
C 3 237 LEU 237 256 256 LEU LEU A . n 
C 3 238 SER 238 257 257 SER SER A . n 
C 3 239 THR 239 258 258 THR THR A . n 
C 3 240 ARG 240 259 259 ARG ARG A . n 
C 3 241 ALA 241 260 260 ALA ALA A . n 
C 3 242 LEU 242 261 261 LEU LEU A . n 
C 3 243 GLU 243 262 262 GLU GLU A . n 
C 3 244 GLY 244 263 263 GLY GLY A . n 
C 3 245 ILE 245 264 264 ILE ILE A . n 
C 3 246 PHE 246 265 265 PHE PHE A . n 
C 3 247 GLU 247 266 266 GLU GLU A . n 
C 3 248 ALA 248 267 267 ALA ALA A . n 
C 3 249 THR 249 268 268 THR THR A . n 
C 3 250 HIS 250 269 269 HIS HIS A . n 
C 3 251 ARG 251 270 270 ARG ARG A . n 
C 3 252 LEU 252 271 271 LEU LEU A . n 
C 3 253 ILE 253 272 272 ILE ILE A . n 
C 3 254 TYR 254 273 273 TYR TYR A . n 
C 3 255 GLY 255 274 274 GLY GLY A . n 
C 3 256 ALA 256 275 275 ALA ALA A . n 
C 3 257 LYS 257 276 276 LYS LYS A . n 
C 3 258 ASP 258 277 277 ASP ASP A . n 
C 3 259 ASP 259 278 278 ASP ASP A . n 
C 3 260 SER 260 279 279 SER SER A . n 
C 3 261 GLY 261 280 280 GLY GLY A . n 
C 3 262 GLN 262 281 281 GLN GLN A . n 
C 3 263 ARG 263 282 282 ARG ARG A . n 
C 3 264 TYR 264 283 283 TYR TYR A . n 
C 3 265 LEU 265 284 284 LEU LEU A . n 
C 3 266 ALA 266 285 285 ALA ALA A . n 
C 3 267 TRP 267 286 286 TRP TRP A . n 
C 3 268 SER 268 287 287 SER SER A . n 
C 3 269 GLY 269 288 288 GLY GLY A . n 
C 3 270 HIS 270 289 289 HIS HIS A . n 
C 3 271 SER 271 290 290 SER SER A . n 
C 3 272 ALA 272 291 291 ALA ALA A . n 
C 3 273 ARG 273 292 292 ARG ARG A . n 
C 3 274 VAL 274 293 293 VAL VAL A . n 
C 3 275 GLY 275 294 294 GLY GLY A . n 
C 3 276 ALA 276 295 295 ALA ALA A . n 
C 3 277 ALA 277 296 296 ALA ALA A . n 
C 3 278 ARG 278 297 297 ARG ARG A . n 
C 3 279 ASP 279 298 298 ASP ASP A . n 
C 3 280 MET 280 299 299 MET MET A . n 
C 3 281 ALA 281 300 300 ALA ALA A . n 
C 3 282 ARG 282 301 301 ARG ARG A . n 
C 3 283 ALA 283 302 302 ALA ALA A . n 
C 3 284 GLY 284 303 303 GLY GLY A . n 
C 3 285 VAL 285 304 304 VAL VAL A . n 
C 3 286 SER 286 305 305 SER SER A . n 
C 3 287 ILE 287 306 306 ILE ILE A . n 
C 3 288 PRO 288 307 307 PRO PRO A . n 
C 3 289 GLU 289 308 308 GLU GLU A . n 
C 3 290 ILE 290 309 309 ILE ILE A . n 
C 3 291 MET 291 310 310 MET MET A . n 
C 3 292 GLN 292 311 311 GLN GLN A . n 
C 3 293 ALA 293 312 312 ALA ALA A . n 
C 3 294 GLY 294 313 313 GLY GLY A . n 
C 3 295 GLY 295 314 314 GLY GLY A . n 
C 3 296 TRP 296 315 315 TRP TRP A . n 
C 3 297 THR 297 316 316 THR THR A . n 
C 3 298 ASN 298 317 317 ASN ASN A . n 
C 3 299 VAL 299 318 318 VAL VAL A . n 
C 3 300 ASN 300 319 319 ASN ASN A . n 
C 3 301 ILE 301 320 320 ILE ILE A . n 
C 3 302 VAL 302 321 321 VAL VAL A . n 
C 3 303 MET 303 322 322 MET MET A . n 
C 3 304 ASN 304 323 323 ASN ASN A . n 
C 3 305 PHE 305 324 324 PHE PHE A . n 
C 3 306 ILE 306 325 325 ILE ILE A . n 
C 3 307 ARG 307 326 326 ARG ARG A . n 
C 3 308 ASN 308 327 327 ASN ASN A . n 
C 3 309 LEU 309 328 328 LEU LEU A . n 
C 3 310 ASP 310 329 329 ASP ASP A . n 
C 3 311 SER 311 330 330 SER SER A . n 
C 3 312 GLU 312 331 331 GLU GLU A . n 
C 3 313 THR 313 332 332 THR THR A . n 
C 3 314 GLY 314 333 333 GLY GLY A . n 
C 3 315 ALA 315 334 334 ALA ALA A . n 
C 3 316 MET 316 335 335 MET MET A . n 
C 3 317 VAL 317 336 336 VAL VAL A . n 
C 3 318 ARG 318 337 337 ARG ARG A . n 
C 3 319 LEU 319 338 338 LEU LEU A . n 
C 3 320 LEU 320 339 339 LEU LEU A . n 
C 3 321 GLU 321 340 340 GLU GLU A . n 
C 3 322 ASP 322 341 341 ASP ASP A . n 
C 3 323 GLY 323 342 342 GLY GLY A . n 
C 3 324 ASP 324 343 343 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   36  36  HOH HOH M . 
D 4 HOH 2   46  46  HOH HOH M . 
D 4 HOH 3   60  60  HOH HOH M . 
D 4 HOH 4   62  62  HOH HOH M . 
D 4 HOH 5   64  64  HOH HOH M . 
D 4 HOH 6   65  65  HOH HOH M . 
D 4 HOH 7   71  71  HOH HOH M . 
D 4 HOH 8   76  76  HOH HOH M . 
D 4 HOH 9   86  86  HOH HOH M . 
D 4 HOH 10  92  92  HOH HOH M . 
D 4 HOH 11  96  96  HOH HOH M . 
D 4 HOH 12  109 109 HOH HOH M . 
D 4 HOH 13  112 112 HOH HOH M . 
D 4 HOH 14  130 130 HOH HOH M . 
D 4 HOH 15  137 137 HOH HOH M . 
D 4 HOH 16  138 138 HOH HOH M . 
D 4 HOH 17  142 142 HOH HOH M . 
D 4 HOH 18  166 166 HOH HOH M . 
D 4 HOH 19  168 168 HOH HOH M . 
D 4 HOH 20  169 169 HOH HOH M . 
D 4 HOH 21  171 171 HOH HOH M . 
D 4 HOH 22  172 172 HOH HOH M . 
D 4 HOH 23  175 175 HOH HOH M . 
D 4 HOH 24  187 187 HOH HOH M . 
D 4 HOH 25  212 212 HOH HOH M . 
D 4 HOH 26  214 214 HOH HOH M . 
D 4 HOH 27  217 217 HOH HOH M . 
D 4 HOH 28  225 225 HOH HOH M . 
D 4 HOH 29  233 233 HOH HOH M . 
D 4 HOH 30  235 235 HOH HOH M . 
D 4 HOH 31  236 236 HOH HOH M . 
D 4 HOH 32  249 249 HOH HOH M . 
D 4 HOH 33  260 260 HOH HOH M . 
D 4 HOH 34  261 261 HOH HOH M . 
D 4 HOH 35  277 277 HOH HOH M . 
D 4 HOH 36  282 282 HOH HOH M . 
D 4 HOH 37  298 298 HOH HOH M . 
E 4 HOH 1   25  25  HOH HOH N . 
E 4 HOH 2   26  26  HOH HOH N . 
E 4 HOH 3   56  56  HOH HOH N . 
E 4 HOH 4   66  66  HOH HOH N . 
E 4 HOH 5   84  84  HOH HOH N . 
E 4 HOH 6   91  91  HOH HOH N . 
E 4 HOH 7   116 116 HOH HOH N . 
E 4 HOH 8   118 118 HOH HOH N . 
E 4 HOH 9   127 127 HOH HOH N . 
E 4 HOH 10  131 131 HOH HOH N . 
E 4 HOH 11  133 133 HOH HOH N . 
E 4 HOH 12  136 136 HOH HOH N . 
E 4 HOH 13  152 152 HOH HOH N . 
E 4 HOH 14  157 157 HOH HOH N . 
E 4 HOH 15  158 158 HOH HOH N . 
E 4 HOH 16  162 162 HOH HOH N . 
E 4 HOH 17  173 173 HOH HOH N . 
E 4 HOH 18  188 188 HOH HOH N . 
E 4 HOH 19  194 194 HOH HOH N . 
E 4 HOH 20  208 208 HOH HOH N . 
E 4 HOH 21  224 224 HOH HOH N . 
E 4 HOH 22  227 227 HOH HOH N . 
E 4 HOH 23  239 239 HOH HOH N . 
E 4 HOH 24  242 242 HOH HOH N . 
E 4 HOH 25  245 245 HOH HOH N . 
E 4 HOH 26  250 250 HOH HOH N . 
E 4 HOH 27  251 251 HOH HOH N . 
E 4 HOH 28  271 271 HOH HOH N . 
E 4 HOH 29  272 272 HOH HOH N . 
E 4 HOH 30  283 283 HOH HOH N . 
E 4 HOH 31  293 293 HOH HOH N . 
E 4 HOH 32  295 295 HOH HOH N . 
E 4 HOH 33  303 303 HOH HOH N . 
E 4 HOH 34  308 308 HOH HOH N . 
F 4 HOH 1   344 1   HOH HOH A . 
F 4 HOH 2   345 2   HOH HOH A . 
F 4 HOH 3   346 3   HOH HOH A . 
F 4 HOH 4   347 4   HOH HOH A . 
F 4 HOH 5   348 5   HOH HOH A . 
F 4 HOH 6   349 6   HOH HOH A . 
F 4 HOH 7   350 7   HOH HOH A . 
F 4 HOH 8   351 8   HOH HOH A . 
F 4 HOH 9   352 9   HOH HOH A . 
F 4 HOH 10  353 10  HOH HOH A . 
F 4 HOH 11  354 11  HOH HOH A . 
F 4 HOH 12  355 12  HOH HOH A . 
F 4 HOH 13  356 13  HOH HOH A . 
F 4 HOH 14  357 14  HOH HOH A . 
F 4 HOH 15  358 15  HOH HOH A . 
F 4 HOH 16  359 16  HOH HOH A . 
F 4 HOH 17  360 17  HOH HOH A . 
F 4 HOH 18  361 18  HOH HOH A . 
F 4 HOH 19  362 19  HOH HOH A . 
F 4 HOH 20  363 20  HOH HOH A . 
F 4 HOH 21  364 21  HOH HOH A . 
F 4 HOH 22  365 22  HOH HOH A . 
F 4 HOH 23  366 23  HOH HOH A . 
F 4 HOH 24  367 24  HOH HOH A . 
F 4 HOH 25  368 27  HOH HOH A . 
F 4 HOH 26  369 28  HOH HOH A . 
F 4 HOH 27  370 29  HOH HOH A . 
F 4 HOH 28  371 30  HOH HOH A . 
F 4 HOH 29  372 31  HOH HOH A . 
F 4 HOH 30  373 32  HOH HOH A . 
F 4 HOH 31  374 33  HOH HOH A . 
F 4 HOH 32  375 34  HOH HOH A . 
F 4 HOH 33  376 35  HOH HOH A . 
F 4 HOH 34  377 37  HOH HOH A . 
F 4 HOH 35  378 38  HOH HOH A . 
F 4 HOH 36  379 39  HOH HOH A . 
F 4 HOH 37  380 40  HOH HOH A . 
F 4 HOH 38  381 41  HOH HOH A . 
F 4 HOH 39  382 42  HOH HOH A . 
F 4 HOH 40  383 43  HOH HOH A . 
F 4 HOH 41  384 44  HOH HOH A . 
F 4 HOH 42  385 45  HOH HOH A . 
F 4 HOH 43  386 47  HOH HOH A . 
F 4 HOH 44  387 48  HOH HOH A . 
F 4 HOH 45  388 49  HOH HOH A . 
F 4 HOH 46  389 50  HOH HOH A . 
F 4 HOH 47  390 51  HOH HOH A . 
F 4 HOH 48  391 52  HOH HOH A . 
F 4 HOH 49  392 53  HOH HOH A . 
F 4 HOH 50  393 54  HOH HOH A . 
F 4 HOH 51  394 55  HOH HOH A . 
F 4 HOH 52  395 57  HOH HOH A . 
F 4 HOH 53  396 58  HOH HOH A . 
F 4 HOH 54  397 59  HOH HOH A . 
F 4 HOH 55  398 61  HOH HOH A . 
F 4 HOH 56  399 63  HOH HOH A . 
F 4 HOH 57  400 67  HOH HOH A . 
F 4 HOH 58  401 68  HOH HOH A . 
F 4 HOH 59  402 69  HOH HOH A . 
F 4 HOH 60  403 70  HOH HOH A . 
F 4 HOH 61  404 72  HOH HOH A . 
F 4 HOH 62  405 73  HOH HOH A . 
F 4 HOH 63  406 74  HOH HOH A . 
F 4 HOH 64  407 75  HOH HOH A . 
F 4 HOH 65  408 77  HOH HOH A . 
F 4 HOH 66  409 78  HOH HOH A . 
F 4 HOH 67  410 79  HOH HOH A . 
F 4 HOH 68  411 80  HOH HOH A . 
F 4 HOH 69  412 81  HOH HOH A . 
F 4 HOH 70  413 82  HOH HOH A . 
F 4 HOH 71  414 83  HOH HOH A . 
F 4 HOH 72  415 85  HOH HOH A . 
F 4 HOH 73  416 87  HOH HOH A . 
F 4 HOH 74  417 88  HOH HOH A . 
F 4 HOH 75  418 89  HOH HOH A . 
F 4 HOH 76  419 90  HOH HOH A . 
F 4 HOH 77  420 93  HOH HOH A . 
F 4 HOH 78  421 94  HOH HOH A . 
F 4 HOH 79  422 95  HOH HOH A . 
F 4 HOH 80  423 97  HOH HOH A . 
F 4 HOH 81  424 98  HOH HOH A . 
F 4 HOH 82  425 99  HOH HOH A . 
F 4 HOH 83  426 100 HOH HOH A . 
F 4 HOH 84  427 101 HOH HOH A . 
F 4 HOH 85  428 102 HOH HOH A . 
F 4 HOH 86  429 103 HOH HOH A . 
F 4 HOH 87  430 104 HOH HOH A . 
F 4 HOH 88  431 105 HOH HOH A . 
F 4 HOH 89  432 106 HOH HOH A . 
F 4 HOH 90  433 107 HOH HOH A . 
F 4 HOH 91  434 108 HOH HOH A . 
F 4 HOH 92  435 110 HOH HOH A . 
F 4 HOH 93  436 111 HOH HOH A . 
F 4 HOH 94  437 113 HOH HOH A . 
F 4 HOH 95  438 114 HOH HOH A . 
F 4 HOH 96  439 115 HOH HOH A . 
F 4 HOH 97  440 117 HOH HOH A . 
F 4 HOH 98  441 119 HOH HOH A . 
F 4 HOH 99  442 120 HOH HOH A . 
F 4 HOH 100 443 121 HOH HOH A . 
F 4 HOH 101 444 122 HOH HOH A . 
F 4 HOH 102 445 123 HOH HOH A . 
F 4 HOH 103 446 124 HOH HOH A . 
F 4 HOH 104 447 125 HOH HOH A . 
F 4 HOH 105 448 126 HOH HOH A . 
F 4 HOH 106 449 128 HOH HOH A . 
F 4 HOH 107 450 129 HOH HOH A . 
F 4 HOH 108 451 132 HOH HOH A . 
F 4 HOH 109 452 134 HOH HOH A . 
F 4 HOH 110 453 135 HOH HOH A . 
F 4 HOH 111 454 139 HOH HOH A . 
F 4 HOH 112 455 140 HOH HOH A . 
F 4 HOH 113 456 141 HOH HOH A . 
F 4 HOH 114 457 143 HOH HOH A . 
F 4 HOH 115 458 144 HOH HOH A . 
F 4 HOH 116 459 145 HOH HOH A . 
F 4 HOH 117 460 146 HOH HOH A . 
F 4 HOH 118 461 147 HOH HOH A . 
F 4 HOH 119 462 148 HOH HOH A . 
F 4 HOH 120 463 149 HOH HOH A . 
F 4 HOH 121 464 150 HOH HOH A . 
F 4 HOH 122 465 151 HOH HOH A . 
F 4 HOH 123 466 153 HOH HOH A . 
F 4 HOH 124 467 154 HOH HOH A . 
F 4 HOH 125 468 155 HOH HOH A . 
F 4 HOH 126 469 156 HOH HOH A . 
F 4 HOH 127 470 159 HOH HOH A . 
F 4 HOH 128 471 160 HOH HOH A . 
F 4 HOH 129 472 161 HOH HOH A . 
F 4 HOH 130 473 163 HOH HOH A . 
F 4 HOH 131 474 164 HOH HOH A . 
F 4 HOH 132 475 165 HOH HOH A . 
F 4 HOH 133 476 167 HOH HOH A . 
F 4 HOH 134 477 170 HOH HOH A . 
F 4 HOH 135 478 174 HOH HOH A . 
F 4 HOH 136 479 176 HOH HOH A . 
F 4 HOH 137 480 177 HOH HOH A . 
F 4 HOH 138 481 178 HOH HOH A . 
F 4 HOH 139 482 179 HOH HOH A . 
F 4 HOH 140 483 180 HOH HOH A . 
F 4 HOH 141 484 181 HOH HOH A . 
F 4 HOH 142 485 182 HOH HOH A . 
F 4 HOH 143 486 183 HOH HOH A . 
F 4 HOH 144 487 184 HOH HOH A . 
F 4 HOH 145 488 185 HOH HOH A . 
F 4 HOH 146 489 186 HOH HOH A . 
F 4 HOH 147 490 189 HOH HOH A . 
F 4 HOH 148 491 190 HOH HOH A . 
F 4 HOH 149 492 191 HOH HOH A . 
F 4 HOH 150 493 192 HOH HOH A . 
F 4 HOH 151 494 193 HOH HOH A . 
F 4 HOH 152 495 195 HOH HOH A . 
F 4 HOH 153 496 196 HOH HOH A . 
F 4 HOH 154 497 197 HOH HOH A . 
F 4 HOH 155 498 198 HOH HOH A . 
F 4 HOH 156 499 199 HOH HOH A . 
F 4 HOH 157 500 200 HOH HOH A . 
F 4 HOH 158 501 201 HOH HOH A . 
F 4 HOH 159 502 202 HOH HOH A . 
F 4 HOH 160 503 203 HOH HOH A . 
F 4 HOH 161 504 204 HOH HOH A . 
F 4 HOH 162 505 205 HOH HOH A . 
F 4 HOH 163 506 206 HOH HOH A . 
F 4 HOH 164 507 207 HOH HOH A . 
F 4 HOH 165 508 209 HOH HOH A . 
F 4 HOH 166 509 210 HOH HOH A . 
F 4 HOH 167 510 211 HOH HOH A . 
F 4 HOH 168 511 213 HOH HOH A . 
F 4 HOH 169 512 215 HOH HOH A . 
F 4 HOH 170 513 216 HOH HOH A . 
F 4 HOH 171 514 218 HOH HOH A . 
F 4 HOH 172 515 219 HOH HOH A . 
F 4 HOH 173 516 220 HOH HOH A . 
F 4 HOH 174 517 221 HOH HOH A . 
F 4 HOH 175 518 222 HOH HOH A . 
F 4 HOH 176 519 223 HOH HOH A . 
F 4 HOH 177 520 226 HOH HOH A . 
F 4 HOH 178 521 228 HOH HOH A . 
F 4 HOH 179 522 229 HOH HOH A . 
F 4 HOH 180 523 230 HOH HOH A . 
F 4 HOH 181 524 231 HOH HOH A . 
F 4 HOH 182 525 232 HOH HOH A . 
F 4 HOH 183 526 234 HOH HOH A . 
F 4 HOH 184 527 237 HOH HOH A . 
F 4 HOH 185 528 238 HOH HOH A . 
F 4 HOH 186 529 240 HOH HOH A . 
F 4 HOH 187 530 241 HOH HOH A . 
F 4 HOH 188 531 243 HOH HOH A . 
F 4 HOH 189 532 244 HOH HOH A . 
F 4 HOH 190 533 246 HOH HOH A . 
F 4 HOH 191 534 247 HOH HOH A . 
F 4 HOH 192 535 248 HOH HOH A . 
F 4 HOH 193 536 252 HOH HOH A . 
F 4 HOH 194 537 253 HOH HOH A . 
F 4 HOH 195 538 254 HOH HOH A . 
F 4 HOH 196 539 255 HOH HOH A . 
F 4 HOH 197 540 256 HOH HOH A . 
F 4 HOH 198 541 257 HOH HOH A . 
F 4 HOH 199 542 258 HOH HOH A . 
F 4 HOH 200 543 259 HOH HOH A . 
F 4 HOH 201 544 262 HOH HOH A . 
F 4 HOH 202 545 263 HOH HOH A . 
F 4 HOH 203 546 264 HOH HOH A . 
F 4 HOH 204 547 265 HOH HOH A . 
F 4 HOH 205 548 266 HOH HOH A . 
F 4 HOH 206 549 267 HOH HOH A . 
F 4 HOH 207 550 268 HOH HOH A . 
F 4 HOH 208 551 269 HOH HOH A . 
F 4 HOH 209 552 270 HOH HOH A . 
F 4 HOH 210 553 273 HOH HOH A . 
F 4 HOH 211 554 274 HOH HOH A . 
F 4 HOH 212 555 275 HOH HOH A . 
F 4 HOH 213 556 276 HOH HOH A . 
F 4 HOH 214 557 278 HOH HOH A . 
F 4 HOH 215 558 279 HOH HOH A . 
F 4 HOH 216 559 280 HOH HOH A . 
F 4 HOH 217 560 281 HOH HOH A . 
F 4 HOH 218 561 284 HOH HOH A . 
F 4 HOH 219 562 285 HOH HOH A . 
F 4 HOH 220 563 286 HOH HOH A . 
F 4 HOH 221 564 287 HOH HOH A . 
F 4 HOH 222 565 288 HOH HOH A . 
F 4 HOH 223 566 289 HOH HOH A . 
F 4 HOH 224 567 290 HOH HOH A . 
F 4 HOH 225 568 291 HOH HOH A . 
F 4 HOH 226 569 292 HOH HOH A . 
F 4 HOH 227 570 294 HOH HOH A . 
F 4 HOH 228 571 296 HOH HOH A . 
F 4 HOH 229 572 297 HOH HOH A . 
F 4 HOH 230 573 299 HOH HOH A . 
F 4 HOH 231 574 300 HOH HOH A . 
F 4 HOH 232 575 301 HOH HOH A . 
F 4 HOH 233 576 302 HOH HOH A . 
F 4 HOH 234 577 304 HOH HOH A . 
F 4 HOH 235 578 305 HOH HOH A . 
F 4 HOH 236 579 306 HOH HOH A . 
F 4 HOH 237 580 307 HOH HOH A . 
F 4 HOH 238 581 309 HOH HOH A . 
F 4 HOH 239 582 310 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   nonameric 
_pdbx_struct_assembly.oligomeric_count     9 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 
3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     486 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-10-12 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
5 'Structure model' 1 4 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 5 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' database_2         
2 5 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_database_2.pdbx_DOI'                
2 5 'Structure model' '_database_2.pdbx_database_accession' 
3 5 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
TNT       phasing          . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" M DT  1   ? ? "C4'" M DT  1   ? ? "C3'" M DT  1   ? ? 100.90 104.50 -3.60  0.40 N 
2  1 "C4'" M DT  1   ? ? "C3'" M DT  1   ? ? "C2'" M DT  1   ? ? 97.18  102.20 -5.02  0.70 N 
3  1 "C3'" M DT  1   ? ? "C2'" M DT  1   ? ? "C1'" M DT  1   ? ? 89.61  102.40 -12.79 0.80 N 
4  1 "O4'" M DT  1   ? ? "C1'" M DT  1   ? ? N1    M DT  1   ? ? 112.65 108.30 4.35   0.30 N 
5  1 "C3'" M DA  12  ? ? "O3'" M DA  12  ? ? P     M DT  13  ? ? 126.98 119.70 7.28   1.20 Y 
6  1 "O4'" M DT  13  ? ? "C1'" M DT  13  ? ? N1    M DT  13  ? ? 111.21 108.30 2.91   0.30 N 
7  1 "C3'" M DT  13  ? ? "O3'" M DT  13  ? ? P     M DA  14  ? ? 126.91 119.70 7.21   1.20 Y 
8  1 "C3'" M DG  15  ? ? "O3'" M DG  15  ? ? P     M DC  16  ? ? 128.84 119.70 9.14   1.20 Y 
9  1 "O4'" N DA  10  ? ? "C1'" N DA  10  ? ? N9    N DA  10  ? ? 103.02 108.00 -4.98  0.70 N 
10 1 "O4'" N DA  13  ? ? "C1'" N DA  13  ? ? N9    N DA  13  ? ? 112.67 108.30 4.37   0.30 N 
11 1 "C3'" N DA  14  ? ? "C2'" N DA  14  ? ? "C1'" N DA  14  ? ? 96.60  102.40 -5.80  0.80 N 
12 1 "O4'" N DA  14  ? ? "C1'" N DA  14  ? ? N9    N DA  14  ? ? 111.22 108.30 2.92   0.30 N 
13 1 N     A GLY 342 ? ? CA    A GLY 342 ? ? C     A GLY 342 ? ? 93.20  113.10 -19.90 2.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 24  ? ? -73.69 -73.52  
2  1 LYS A 25  ? ? -36.47 -36.79  
3  1 LEU A 27  ? ? -69.40 0.98    
4  1 MET A 30  ? ? 130.81 -173.39 
5  1 ARG A 32  ? ? -31.14 -21.79  
6  1 ARG A 34  ? ? -26.35 -68.73  
7  1 GLN A 35  ? ? -50.39 13.22   
8  1 MET A 97  ? ? -59.78 -80.44  
9  1 LEU A 98  ? ? -18.46 -55.28  
10 1 ASP A 278 ? ? -78.39 24.07   
11 1 ASP A 341 ? ? 54.56  74.52   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 200 ? C THR 181 
2 1 Y 1 A LYS 201 ? C LYS 182 
3 1 Y 1 A THR 202 ? C THR 183 
4 1 Y 1 A LEU 203 ? C LEU 184 
5 1 Y 1 A VAL 204 ? C VAL 185 
6 1 Y 1 A SER 205 ? C SER 186 
7 1 Y 1 A THR 206 ? C THR 187 
8 1 Y 1 A ALA 207 ? C ALA 188 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1F44 'double helix'        
1F44 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 B DT 19 1_555 0.667  -0.718 -0.334 6.456   -14.181 11.885 1  M_DA2:DT19_N  M 2  ? N 19 ? 20 1 
1 A DT 3  1_555 B DA 18 1_555 0.704  -0.655 0.044  3.526   -5.429  -1.380 2  M_DT3:DA18_N  M 3  ? N 18 ? 20 1 
1 A DA 4  1_555 B DT 17 1_555 0.032  -0.374 -0.199 7.954   -15.603 -0.787 3  M_DA4:DT17_N  M 4  ? N 17 ? 20 1 
1 A DA 5  1_555 B DT 16 1_555 0.116  -0.205 0.756  17.419  -8.647  0.660  4  M_DA5:DT16_N  M 5  ? N 16 ? 20 1 
1 A DC 6  1_555 B DG 15 1_555 0.196  -0.046 0.192  8.646   -24.958 1.008  5  M_DC6:DG15_N  M 6  ? N 15 ? 19 1 
1 A DT 7  1_555 B DA 14 1_555 0.005  -0.128 0.012  -5.862  -19.127 5.290  6  M_DT7:DA14_N  M 7  ? N 14 ? 20 1 
1 A DT 8  1_555 B DA 13 1_555 -0.140 -0.148 -0.224 -6.955  -13.650 3.439  7  M_DT8:DA13_N  M 8  ? N 13 ? 20 1 
1 A DC 9  1_555 B DG 12 1_555 0.209  -0.196 -0.052 -8.380  -7.453  -1.033 8  M_DC9:DG12_N  M 9  ? N 12 ? 19 1 
1 A DG 10 1_555 B DC 11 1_555 -0.366 -0.340 -0.278 -2.144  1.371   -2.413 9  M_DG10:DC11_N M 10 ? N 11 ? 19 1 
1 A DT 11 1_555 B DA 10 1_555 -0.138 -0.070 -0.092 10.268  -0.643  6.573  10 M_DT11:DA10_N M 11 ? N 10 ? 20 1 
1 A DA 12 1_555 B DT 9  1_555 -0.015 -0.132 -0.245 -1.122  -8.574  2.776  11 M_DA12:DT9_N  M 12 ? N 9  ? 20 1 
1 A DT 13 1_555 B DA 8  1_555 0.074  -0.157 0.011  7.481   -5.222  4.165  12 M_DT13:DA8_N  M 13 ? N 8  ? 20 1 
1 A DA 14 1_555 B DT 7  1_555 -0.055 -0.181 -0.261 -9.625  -1.452  -1.275 13 M_DA14:DT7_N  M 14 ? N 7  ? 20 1 
1 A DG 15 1_555 B DC 6  1_555 -0.058 -0.236 0.266  1.282   -5.132  -2.935 14 M_DG15:DC6_N  M 15 ? N 6  ? 19 1 
1 A DC 16 1_555 B DG 5  1_555 0.074  -0.122 0.216  -7.476  -7.748  -1.116 15 M_DC16:DG5_N  M 16 ? N 5  ? 19 1 
1 B DA 1  1_555 B DT 4  5_555 -0.473 -0.077 0.086  -12.206 -9.108  2.657  16 N_DA1:DT4_N   N 1  ? N 4  ? 20 1 
1 B DT 2  1_555 B DA 3  5_555 -0.101 -0.289 -0.118 7.581   3.537   3.770  17 N_DT2:DA3_N   N 2  ? N 3  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 B DT 19 1_555 A DT 3  1_555 B DA 18 1_555 -0.625 -0.549 3.228 -1.038 2.917   28.048 -1.794 1.046  3.176 5.995   
2.134  28.215 1  MM_DA2DT3:DA18DT19_NN   M 2  ? N 19 ? M 3  ? N 18 ? 
1 A DT 3  1_555 B DA 18 1_555 A DA 4  1_555 B DT 17 1_555 -0.319 1.184  3.324 3.933  2.783   35.524 1.515  1.096  3.351 4.536   
-6.410 35.839 2  MM_DT3DA4:DT17DA18_NN   M 3  ? N 18 ? M 4  ? N 17 ? 
1 A DA 4  1_555 B DT 17 1_555 A DA 5  1_555 B DT 16 1_555 0.725  -0.088 3.009 -5.287 4.841   29.959 -1.017 -2.295 2.795 9.200   
10.048 30.785 3  MM_DA4DA5:DT16DT17_NN   M 4  ? N 17 ? M 5  ? N 16 ? 
1 A DA 5  1_555 B DT 16 1_555 A DC 6  1_555 B DG 15 1_555 0.930  -1.122 3.416 3.230  -1.902  30.100 -1.735 -1.082 3.557 -3.644  
-6.189 30.327 4  MM_DA5DC6:DG15DT16_NN   M 5  ? N 16 ? M 6  ? N 15 ? 
1 A DC 6  1_555 B DG 15 1_555 A DT 7  1_555 B DA 14 1_555 0.091  -0.511 3.507 6.123  8.515   39.910 -1.701 0.572  3.312 12.220  
-8.787 41.211 5  MM_DC6DT7:DA14DG15_NN   M 6  ? N 15 ? M 7  ? N 14 ? 
1 A DT 7  1_555 B DA 14 1_555 A DT 8  1_555 B DA 13 1_555 -0.052 -0.005 3.185 1.569  6.534   36.657 -0.853 0.284  3.134 10.283  
-2.469 37.247 6  MM_DT7DT8:DA13DA14_NN   M 7  ? N 14 ? M 8  ? N 13 ? 
1 A DT 8  1_555 B DA 13 1_555 A DC 9  1_555 B DG 12 1_555 -0.378 -0.462 3.319 -2.610 5.131   28.427 -2.064 0.174  3.209 10.315  
5.248  28.992 7  MM_DT8DC9:DG12DA13_NN   M 8  ? N 13 ? M 9  ? N 12 ? 
1 A DC 9  1_555 B DG 12 1_555 A DG 10 1_555 B DC 11 1_555 0.249  0.988  3.245 2.140  5.387   35.205 0.818  -0.091 3.364 8.832   
-3.509 35.664 8  MM_DC9DG10:DC11DG12_NN  M 9  ? N 12 ? M 10 ? N 11 ? 
1 A DG 10 1_555 B DC 11 1_555 A DT 11 1_555 B DA 10 1_555 0.087  0.204  3.110 -1.425 3.902   27.265 -0.481 -0.514 3.100 8.217   
3.001  27.573 9  MM_DG10DT11:DA10DC11_NN M 10 ? N 11 ? M 11 ? N 10 ? 
1 A DT 11 1_555 B DA 10 1_555 A DA 12 1_555 B DT 9  1_555 0.394  -0.848 3.497 3.333  7.557   38.009 -2.241 -0.166 3.297 11.438  
-5.045 38.863 10 MM_DT11DA12:DT9DA10_NN  M 11 ? N 10 ? M 12 ? N 9  ? 
1 A DA 12 1_555 B DT 9  1_555 A DT 13 1_555 B DA 8  1_555 0.648  -0.807 3.199 -1.723 3.126   30.534 -2.111 -1.546 3.063 5.911   
3.257  30.737 11 MM_DA12DT13:DA8DT9_NN   M 12 ? N 9  ? M 13 ? N 8  ? 
1 A DT 13 1_555 B DA 8  1_555 A DA 14 1_555 B DT 7  1_555 -0.793 -0.166 3.828 2.227  -11.366 42.948 1.016  1.291  3.710 -15.195 
-2.978 44.411 12 MM_DT13DA14:DT7DA8_NN   M 13 ? N 8  ? M 14 ? N 7  ? 
1 A DA 14 1_555 B DT 7  1_555 A DG 15 1_555 B DC 6  1_555 -0.041 -0.688 3.177 -2.234 -4.580  32.375 -0.441 -0.306 3.236 -8.151  
3.977  32.763 13 MM_DA14DG15:DC6DT7_NN   M 14 ? N 7  ? M 15 ? N 6  ? 
1 A DG 15 1_555 B DC 6  1_555 A DC 16 1_555 B DG 5  1_555 -0.090 -0.439 3.643 -0.063 -2.316  36.851 -0.344 0.132  3.663 -3.659  
0.100  36.922 14 MM_DG15DC16:DG5DC6_NN   M 15 ? N 6  ? M 16 ? N 5  ? 
1 B DA 1  1_555 B DT 4  5_555 B DT 2  1_555 B DA 3  5_555 0.125  -0.690 3.060 2.234  2.518   33.823 -1.555 0.119  3.005 4.315   
-3.828 33.986 15 NN_DA1DT2:DA3DT4_NN     N 1  ? N 4  ? N 2  ? N 3  ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#