data_1F4I
# 
_entry.id   1F4I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1F4I         
RCSB  RCSB011232   
WWPDB D_1000011232 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1DV0 
_pdbx_database_related.details        'Solution structure of wild type HHR23A UBA(2) domain' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F4I 
_pdbx_database_status.recvd_initial_deposition_date   2000-06-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Withers-Ward, E.S.' 1 
'Mueller, T.D.'      2 
'Chen, I.S.'         3 
'Feigon, J.'         4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr.' 
Biochemistry     39 14103 14112 2000 BICHAW US 0006-2960 0033 ? 11087358 10.1021/bi0017071 
1       'Structure of a human DNA repair protein UBA domain that interacts with HIV-1 Vpr' Nat.Struct.Biol. 5  1042  1047  1998 
NSBIEW US 1072-8368 2024 ? ?        10.1038/4220      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Withers-Ward, E.S.' 1  
primary 'Mueller, T.D.'      2  
primary 'Chen, I.S.'         3  
primary 'Feigon, J.'         4  
1       'Dieckmann, T.'      5  
1       'Withers-Ward, E.S.' 6  
1       'Jarosinski, M.A.'   7  
1       'Liu, C.F.'          8  
1       'Chen, I.S.Y.'       9  
1       'Feigon, J.'         10 
# 
_cell.entry_id           1F4I 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1F4I 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 syn 
_entity.pdbx_description           'UV EXCISION REPAIR PROTEIN PROTEIN RAD23 HOMOLOG A' 
_entity.formula_weight             5183.710 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              P333E 
_entity.pdbx_fragment              'C-TERMINAL UBA DOMAIN' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       QEKEAIERLKALGFEESLVIQAYFACEKNENLAANFLLSQNFDDE 
_entity_poly.pdbx_seq_one_letter_code_can   QEKEAIERLKALGFEESLVIQAYFACEKNENLAANFLLSQNFDDE 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLN n 
1 2  GLU n 
1 3  LYS n 
1 4  GLU n 
1 5  ALA n 
1 6  ILE n 
1 7  GLU n 
1 8  ARG n 
1 9  LEU n 
1 10 LYS n 
1 11 ALA n 
1 12 LEU n 
1 13 GLY n 
1 14 PHE n 
1 15 GLU n 
1 16 GLU n 
1 17 SER n 
1 18 LEU n 
1 19 VAL n 
1 20 ILE n 
1 21 GLN n 
1 22 ALA n 
1 23 TYR n 
1 24 PHE n 
1 25 ALA n 
1 26 CYS n 
1 27 GLU n 
1 28 LYS n 
1 29 ASN n 
1 30 GLU n 
1 31 ASN n 
1 32 LEU n 
1 33 ALA n 
1 34 ALA n 
1 35 ASN n 
1 36 PHE n 
1 37 LEU n 
1 38 LEU n 
1 39 SER n 
1 40 GLN n 
1 41 ASN n 
1 42 PHE n 
1 43 ASP n 
1 44 ASP n 
1 45 GLU n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'THIS PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THIS PEPTIDE NATURALLY OCCURS IN HUMANS (HOMO SAPIENS).' 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    RD23A_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P54725 
_struct_ref.pdbx_align_begin           319 
_struct_ref.pdbx_seq_one_letter_code   QEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1F4I 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 45 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P54725 
_struct_ref_seq.db_align_beg                  319 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  363 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       45 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1F4I 
_struct_ref_seq_dif.mon_id                       GLU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      15 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P54725 
_struct_ref_seq_dif.db_mon_id                    PRO 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          333 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            15 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.solution_id     1 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.type            '2D NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '50mM sodium phosphate, 150mM sodium chloride' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'2mM UBA(2) domain mutant P333E; 50mM phosphate buffer, 150mM sodium chloride; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX 600 
2 ? Bruker DRX 500 
# 
_pdbx_nmr_refine.entry_id           1F4I 
_pdbx_nmr_refine.method             
;simulated annealing,  
distance geometry
;
_pdbx_nmr_refine.details            
;total number of restraints 826, 
204 intraresidual, 
182 sequential, 
226 medium range (|i-j|<5), 
214 long range (|i-j|>=5)
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1F4I 
_pdbx_nmr_details.text       'This structure was determined using standard 2D homonuclear techniques' 
# 
_pdbx_nmr_ensemble.entry_id                                      1F4I 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             21 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1F4I 
_pdbx_nmr_representative.conformer_id         12 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 2.6    processing           'Bruker, Karlsruhe' 1 
XEASY   1.3.10 'data analysis'      Bartels             2 
X-PLOR  3.1    refinement           Brunger             3 
X-PLOR  3.1    'structure solution' Brunger             4 
# 
_exptl.entry_id          1F4I 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1F4I 
_struct.title                     
'SOLUTION STRUCTURE OF THE HHR23A UBA(2) MUTANT P333E, DEFICIENT IN BINDING THE HIV-1 ACCESSORY PROTEIN VPR' 
_struct.pdbx_descriptor           'UV EXCISION REPAIR PROTEIN PROTEIN RAD23 HOMOLOG A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F4I 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN,TRANSCRIPTION' 
_struct_keywords.text            'alpha helical bundle, DNA BINDING PROTEIN, TRANSCRIPTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 2  ? LEU A 12 ? GLU A 2  LEU A 12 1 ? 11 
HELX_P HELX_P2 2 LEU A 18 ? ALA A 25 ? LEU A 18 ALA A 25 1 ? 8  
HELX_P HELX_P3 3 LEU A 32 ? SER A 39 ? LEU A 32 SER A 39 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1F4I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1F4I 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLN A 1 1  ? 30.177 -7.222  -11.355 1.00 0.00 ? 1  GLN A N    1  
ATOM 2     C CA   . GLN A 1 1  ? 31.067 -6.147  -10.928 1.00 0.00 ? 1  GLN A CA   1  
ATOM 3     C C    . GLN A 1 1  ? 30.727 -5.701  -9.487  1.00 0.00 ? 1  GLN A C    1  
ATOM 4     O O    . GLN A 1 1  ? 29.729 -6.125  -8.914  1.00 0.00 ? 1  GLN A O    1  
ATOM 5     C CB   . GLN A 1 1  ? 30.996 -4.939  -11.891 1.00 0.00 ? 1  GLN A CB   1  
ATOM 6     C CG   . GLN A 1 1  ? 32.191 -4.837  -12.859 1.00 0.00 ? 1  GLN A CG   1  
ATOM 7     C CD   . GLN A 1 1  ? 32.648 -3.378  -13.019 1.00 0.00 ? 1  GLN A CD   1  
ATOM 8     O OE1  . GLN A 1 1  ? 33.058 -2.731  -12.058 1.00 0.00 ? 1  GLN A OE1  1  
ATOM 9     N NE2  . GLN A 1 1  ? 32.556 -2.895  -14.271 1.00 0.00 ? 1  GLN A NE2  1  
ATOM 10    H H1   . GLN A 1 1  ? 30.459 -7.557  -12.304 1.00 0.00 ? 1  GLN A H1   1  
ATOM 11    H H2   . GLN A 1 1  ? 29.201 -6.876  -11.390 1.00 0.00 ? 1  GLN A H2   1  
ATOM 12    H H3   . GLN A 1 1  ? 30.243 -8.012  -10.684 1.00 0.00 ? 1  GLN A H3   1  
ATOM 13    H HA   . GLN A 1 1  ? 32.071 -6.572  -10.910 1.00 0.00 ? 1  GLN A HA   1  
ATOM 14    H HB2  . GLN A 1 1  ? 30.063 -4.957  -12.457 1.00 0.00 ? 1  GLN A HB2  1  
ATOM 15    H HB3  . GLN A 1 1  ? 30.931 -4.021  -11.314 1.00 0.00 ? 1  GLN A HB3  1  
ATOM 16    H HG2  . GLN A 1 1  ? 33.052 -5.395  -12.492 1.00 0.00 ? 1  GLN A HG2  1  
ATOM 17    H HG3  . GLN A 1 1  ? 31.925 -5.267  -13.826 1.00 0.00 ? 1  GLN A HG3  1  
ATOM 18    H HE21 . GLN A 1 1  ? 32.268 -3.482  -15.033 1.00 0.00 ? 1  GLN A HE21 1  
ATOM 19    H HE22 . GLN A 1 1  ? 32.783 -1.943  -14.447 1.00 0.00 ? 1  GLN A HE22 1  
ATOM 20    N N    . GLU A 1 2  ? 31.613 -4.820  -8.959  1.00 0.00 ? 2  GLU A N    1  
ATOM 21    C CA   . GLU A 1 2  ? 31.455 -4.261  -7.611  1.00 0.00 ? 2  GLU A CA   1  
ATOM 22    C C    . GLU A 1 2  ? 31.344 -2.725  -7.631  1.00 0.00 ? 2  GLU A C    1  
ATOM 23    O O    . GLU A 1 2  ? 31.228 -2.111  -6.581  1.00 0.00 ? 2  GLU A O    1  
ATOM 24    C CB   . GLU A 1 2  ? 32.588 -4.748  -6.688  1.00 0.00 ? 2  GLU A CB   1  
ATOM 25    C CG   . GLU A 1 2  ? 33.906 -3.945  -6.776  1.00 0.00 ? 2  GLU A CG   1  
ATOM 26    C CD   . GLU A 1 2  ? 34.115 -2.895  -5.658  1.00 0.00 ? 2  GLU A CD   1  
ATOM 27    O OE1  . GLU A 1 2  ? 33.190 -2.583  -4.912  1.00 0.00 ? 2  GLU A OE1  1  
ATOM 28    O OE2  . GLU A 1 2  ? 35.236 -2.402  -5.536  1.00 0.00 ? 2  GLU A OE2  1  
ATOM 29    H H    . GLU A 1 2  ? 32.380 -4.523  -9.533  1.00 0.00 ? 2  GLU A H    1  
ATOM 30    H HA   . GLU A 1 2  ? 30.516 -4.624  -7.193  1.00 0.00 ? 2  GLU A HA   1  
ATOM 31    H HB2  . GLU A 1 2  ? 32.229 -4.792  -5.659  1.00 0.00 ? 2  GLU A HB2  1  
ATOM 32    H HB3  . GLU A 1 2  ? 32.801 -5.787  -6.939  1.00 0.00 ? 2  GLU A HB3  1  
ATOM 33    H HG2  . GLU A 1 2  ? 34.723 -4.648  -6.664  1.00 0.00 ? 2  GLU A HG2  1  
ATOM 34    H HG3  . GLU A 1 2  ? 34.040 -3.490  -7.760  1.00 0.00 ? 2  GLU A HG3  1  
ATOM 35    N N    . LYS A 1 3  ? 31.367 -2.142  -8.857  1.00 0.00 ? 3  LYS A N    1  
ATOM 36    C CA   . LYS A 1 3  ? 31.308 -0.684  -9.039  1.00 0.00 ? 3  LYS A CA   1  
ATOM 37    C C    . LYS A 1 3  ? 30.137 0.008   -8.297  1.00 0.00 ? 3  LYS A C    1  
ATOM 38    O O    . LYS A 1 3  ? 30.179 1.202   -8.018  1.00 0.00 ? 3  LYS A O    1  
ATOM 39    C CB   . LYS A 1 3  ? 31.308 -0.317  -10.524 1.00 0.00 ? 3  LYS A CB   1  
ATOM 40    C CG   . LYS A 1 3  ? 30.173 -0.993  -11.308 1.00 0.00 ? 3  LYS A CG   1  
ATOM 41    C CD   . LYS A 1 3  ? 29.802 -0.286  -12.616 1.00 0.00 ? 3  LYS A CD   1  
ATOM 42    C CE   . LYS A 1 3  ? 29.406 1.180   -12.400 1.00 0.00 ? 3  LYS A CE   1  
ATOM 43    N NZ   . LYS A 1 3  ? 30.519 2.082   -12.681 1.00 0.00 ? 3  LYS A NZ   1  
ATOM 44    H H    . LYS A 1 3  ? 31.483 -2.711  -9.671  1.00 0.00 ? 3  LYS A H    1  
ATOM 45    H HA   . LYS A 1 3  ? 32.224 -0.284  -8.635  1.00 0.00 ? 3  LYS A HA   1  
ATOM 46    H HB2  . LYS A 1 3  ? 31.235 0.768   -10.579 1.00 0.00 ? 3  LYS A HB2  1  
ATOM 47    H HB3  . LYS A 1 3  ? 32.271 -0.562  -10.976 1.00 0.00 ? 3  LYS A HB3  1  
ATOM 48    H HG2  . LYS A 1 3  ? 30.440 -2.023  -11.518 1.00 0.00 ? 3  LYS A HG2  1  
ATOM 49    H HG3  . LYS A 1 3  ? 29.281 -1.051  -10.688 1.00 0.00 ? 3  LYS A HG3  1  
ATOM 50    H HD2  . LYS A 1 3  ? 30.602 -0.365  -13.355 1.00 0.00 ? 3  LYS A HD2  1  
ATOM 51    H HD3  . LYS A 1 3  ? 28.946 -0.808  -13.040 1.00 0.00 ? 3  LYS A HD3  1  
ATOM 52    H HE2  . LYS A 1 3  ? 28.578 1.455   -13.052 1.00 0.00 ? 3  LYS A HE2  1  
ATOM 53    H HE3  . LYS A 1 3  ? 29.069 1.349   -11.376 1.00 0.00 ? 3  LYS A HE3  1  
ATOM 54    H HZ1  . LYS A 1 3  ? 31.393 1.677   -12.286 1.00 0.00 ? 3  LYS A HZ1  1  
ATOM 55    H HZ2  . LYS A 1 3  ? 30.342 3.011   -12.250 1.00 0.00 ? 3  LYS A HZ2  1  
ATOM 56    H HZ3  . LYS A 1 3  ? 30.635 2.189   -13.708 1.00 0.00 ? 3  LYS A HZ3  1  
ATOM 57    N N    . GLU A 1 4  ? 29.119 -0.816  -7.988  1.00 0.00 ? 4  GLU A N    1  
ATOM 58    C CA   . GLU A 1 4  ? 27.947 -0.364  -7.252  1.00 0.00 ? 4  GLU A CA   1  
ATOM 59    C C    . GLU A 1 4  ? 28.307 0.044   -5.817  1.00 0.00 ? 4  GLU A C    1  
ATOM 60    O O    . GLU A 1 4  ? 27.924 1.099   -5.320  1.00 0.00 ? 4  GLU A O    1  
ATOM 61    C CB   . GLU A 1 4  ? 26.929 -1.515  -7.197  1.00 0.00 ? 4  GLU A CB   1  
ATOM 62    C CG   . GLU A 1 4  ? 25.503 -0.995  -7.380  1.00 0.00 ? 4  GLU A CG   1  
ATOM 63    C CD   . GLU A 1 4  ? 24.468 -2.001  -6.847  1.00 0.00 ? 4  GLU A CD   1  
ATOM 64    O OE1  . GLU A 1 4  ? 24.149 -2.955  -7.558  1.00 0.00 ? 4  GLU A OE1  1  
ATOM 65    O OE2  . GLU A 1 4  ? 23.993 -1.820  -5.727  1.00 0.00 ? 4  GLU A OE2  1  
ATOM 66    H H    . GLU A 1 4  ? 29.184 -1.771  -8.279  1.00 0.00 ? 4  GLU A H    1  
ATOM 67    H HA   . GLU A 1 4  ? 27.569 0.506   -7.792  1.00 0.00 ? 4  GLU A HA   1  
ATOM 68    H HB2  . GLU A 1 4  ? 27.150 -2.249  -7.971  1.00 0.00 ? 4  GLU A HB2  1  
ATOM 69    H HB3  . GLU A 1 4  ? 27.013 -2.074  -6.261  1.00 0.00 ? 4  GLU A HB3  1  
ATOM 70    H HG2  . GLU A 1 4  ? 25.386 -0.046  -6.856  1.00 0.00 ? 4  GLU A HG2  1  
ATOM 71    H HG3  . GLU A 1 4  ? 25.321 -0.796  -8.437  1.00 0.00 ? 4  GLU A HG3  1  
ATOM 72    N N    . ALA A 1 5  ? 29.074 -0.872  -5.195  1.00 0.00 ? 5  ALA A N    1  
ATOM 73    C CA   . ALA A 1 5  ? 29.554 -0.595  -3.857  1.00 0.00 ? 5  ALA A CA   1  
ATOM 74    C C    . ALA A 1 5  ? 30.649 0.465   -3.881  1.00 0.00 ? 5  ALA A C    1  
ATOM 75    O O    . ALA A 1 5  ? 30.938 1.041   -2.850  1.00 0.00 ? 5  ALA A O    1  
ATOM 76    C CB   . ALA A 1 5  ? 30.084 -1.859  -3.186  1.00 0.00 ? 5  ALA A CB   1  
ATOM 77    H H    . ALA A 1 5  ? 29.314 -1.728  -5.652  1.00 0.00 ? 5  ALA A H    1  
ATOM 78    H HA   . ALA A 1 5  ? 28.709 -0.216  -3.283  1.00 0.00 ? 5  ALA A HA   1  
ATOM 79    H HB1  . ALA A 1 5  ? 31.097 -2.100  -3.506  1.00 0.00 ? 5  ALA A HB1  1  
ATOM 80    H HB2  . ALA A 1 5  ? 29.451 -2.714  -3.419  1.00 0.00 ? 5  ALA A HB2  1  
ATOM 81    H HB3  . ALA A 1 5  ? 30.097 -1.721  -2.103  1.00 0.00 ? 5  ALA A HB3  1  
ATOM 82    N N    . ILE A 1 6  ? 31.245 0.712   -5.072  1.00 0.00 ? 6  ILE A N    1  
ATOM 83    C CA   . ILE A 1 6  ? 32.361 1.653   -5.103  1.00 0.00 ? 6  ILE A CA   1  
ATOM 84    C C    . ILE A 1 6  ? 31.915 3.061   -4.723  1.00 0.00 ? 6  ILE A C    1  
ATOM 85    O O    . ILE A 1 6  ? 32.543 3.683   -3.890  1.00 0.00 ? 6  ILE A O    1  
ATOM 86    C CB   . ILE A 1 6  ? 33.193 1.608   -6.390  1.00 0.00 ? 6  ILE A CB   1  
ATOM 87    C CG1  . ILE A 1 6  ? 33.743 0.195   -6.591  1.00 0.00 ? 6  ILE A CG1  1  
ATOM 88    C CG2  . ILE A 1 6  ? 34.365 2.607   -6.342  1.00 0.00 ? 6  ILE A CG2  1  
ATOM 89    C CD1  . ILE A 1 6  ? 34.594 0.026   -7.855  1.00 0.00 ? 6  ILE A CD1  1  
ATOM 90    H H    . ILE A 1 6  ? 30.930 0.260   -5.906  1.00 0.00 ? 6  ILE A H    1  
ATOM 91    H HA   . ILE A 1 6  ? 33.027 1.336   -4.317  1.00 0.00 ? 6  ILE A HA   1  
ATOM 92    H HB   . ILE A 1 6  ? 32.547 1.865   -7.229  1.00 0.00 ? 6  ILE A HB   1  
ATOM 93    H HG12 . ILE A 1 6  ? 34.346 -0.064  -5.723  1.00 0.00 ? 6  ILE A HG12 1  
ATOM 94    H HG13 . ILE A 1 6  ? 32.915 -0.505  -6.618  1.00 0.00 ? 6  ILE A HG13 1  
ATOM 95    H HG21 . ILE A 1 6  ? 35.326 2.110   -6.445  1.00 0.00 ? 6  ILE A HG21 1  
ATOM 96    H HG22 . ILE A 1 6  ? 34.433 3.152   -5.408  1.00 0.00 ? 6  ILE A HG22 1  
ATOM 97    H HG23 . ILE A 1 6  ? 34.261 3.350   -7.127  1.00 0.00 ? 6  ILE A HG23 1  
ATOM 98    H HD11 . ILE A 1 6  ? 35.622 0.326   -7.684  1.00 0.00 ? 6  ILE A HD11 1  
ATOM 99    H HD12 . ILE A 1 6  ? 34.222 0.628   -8.684  1.00 0.00 ? 6  ILE A HD12 1  
ATOM 100   H HD13 . ILE A 1 6  ? 34.619 -1.018  -8.161  1.00 0.00 ? 6  ILE A HD13 1  
ATOM 101   N N    . GLU A 1 7  ? 30.797 3.500   -5.339  1.00 0.00 ? 7  GLU A N    1  
ATOM 102   C CA   . GLU A 1 7  ? 30.278 4.830   -5.016  1.00 0.00 ? 7  GLU A CA   1  
ATOM 103   C C    . GLU A 1 7  ? 29.742 4.920   -3.573  1.00 0.00 ? 7  GLU A C    1  
ATOM 104   O O    . GLU A 1 7  ? 29.576 6.004   -3.027  1.00 0.00 ? 7  GLU A O    1  
ATOM 105   C CB   . GLU A 1 7  ? 29.182 5.211   -6.019  1.00 0.00 ? 7  GLU A CB   1  
ATOM 106   C CG   . GLU A 1 7  ? 27.923 4.332   -5.936  1.00 0.00 ? 7  GLU A CG   1  
ATOM 107   C CD   . GLU A 1 7  ? 26.772 4.956   -6.745  1.00 0.00 ? 7  GLU A CD   1  
ATOM 108   O OE1  . GLU A 1 7  ? 26.130 5.877   -6.237  1.00 0.00 ? 7  GLU A OE1  1  
ATOM 109   O OE2  . GLU A 1 7  ? 26.527 4.520   -7.869  1.00 0.00 ? 7  GLU A OE2  1  
ATOM 110   H H    . GLU A 1 7  ? 30.322 2.908   -5.989  1.00 0.00 ? 7  GLU A H    1  
ATOM 111   H HA   . GLU A 1 7  ? 31.110 5.530   -5.107  1.00 0.00 ? 7  GLU A HA   1  
ATOM 112   H HB2  . GLU A 1 7  ? 28.916 6.257   -5.861  1.00 0.00 ? 7  GLU A HB2  1  
ATOM 113   H HB3  . GLU A 1 7  ? 29.585 5.148   -7.030  1.00 0.00 ? 7  GLU A HB3  1  
ATOM 114   H HG2  . GLU A 1 7  ? 28.142 3.333   -6.312  1.00 0.00 ? 7  GLU A HG2  1  
ATOM 115   H HG3  . GLU A 1 7  ? 27.587 4.217   -4.906  1.00 0.00 ? 7  GLU A HG3  1  
ATOM 116   N N    . ARG A 1 8  ? 29.476 3.724   -3.011  1.00 0.00 ? 8  ARG A N    1  
ATOM 117   C CA   . ARG A 1 8  ? 28.881 3.603   -1.691  1.00 0.00 ? 8  ARG A CA   1  
ATOM 118   C C    . ARG A 1 8  ? 29.946 3.802   -0.615  1.00 0.00 ? 8  ARG A C    1  
ATOM 119   O O    . ARG A 1 8  ? 29.804 4.646   0.255   1.00 0.00 ? 8  ARG A O    1  
ATOM 120   C CB   . ARG A 1 8  ? 28.222 2.219   -1.597  1.00 0.00 ? 8  ARG A CB   1  
ATOM 121   C CG   . ARG A 1 8  ? 26.843 2.256   -0.934  1.00 0.00 ? 8  ARG A CG   1  
ATOM 122   C CD   . ARG A 1 8  ? 26.027 1.004   -1.273  1.00 0.00 ? 8  ARG A CD   1  
ATOM 123   N NE   . ARG A 1 8  ? 25.155 0.622   -0.170  1.00 0.00 ? 8  ARG A NE   1  
ATOM 124   C CZ   . ARG A 1 8  ? 23.996 1.252   0.128   1.00 0.00 ? 8  ARG A CZ   1  
ATOM 125   N NH1  . ARG A 1 8  ? 23.570 2.297   -0.578  1.00 0.00 ? 8  ARG A NH1  1  
ATOM 126   N NH2  . ARG A 1 8  ? 23.273 0.810   1.152   1.00 0.00 ? 8  ARG A NH2  1  
ATOM 127   H H    . ARG A 1 8  ? 29.672 2.883   -3.517  1.00 0.00 ? 8  ARG A H    1  
ATOM 128   H HA   . ARG A 1 8  ? 28.145 4.405   -1.604  1.00 0.00 ? 8  ARG A HA   1  
ATOM 129   H HB2  . ARG A 1 8  ? 28.119 1.824   -2.606  1.00 0.00 ? 8  ARG A HB2  1  
ATOM 130   H HB3  . ARG A 1 8  ? 28.852 1.496   -1.075  1.00 0.00 ? 8  ARG A HB3  1  
ATOM 131   H HG2  . ARG A 1 8  ? 26.966 2.356   0.144   1.00 0.00 ? 8  ARG A HG2  1  
ATOM 132   H HG3  . ARG A 1 8  ? 26.284 3.132   -1.266  1.00 0.00 ? 8  ARG A HG3  1  
ATOM 133   H HD2  . ARG A 1 8  ? 25.429 1.150   -2.173  1.00 0.00 ? 8  ARG A HD2  1  
ATOM 134   H HD3  . ARG A 1 8  ? 26.677 0.147   -1.452  1.00 0.00 ? 8  ARG A HD3  1  
ATOM 135   H HE   . ARG A 1 8  ? 25.424 -0.152  0.404   1.00 0.00 ? 8  ARG A HE   1  
ATOM 136   H HH11 . ARG A 1 8  ? 24.110 2.637   -1.347  1.00 0.00 ? 8  ARG A HH11 1  
ATOM 137   H HH12 . ARG A 1 8  ? 22.706 2.743   -0.337  1.00 0.00 ? 8  ARG A HH12 1  
ATOM 138   H HH21 . ARG A 1 8  ? 23.592 0.025   1.684   1.00 0.00 ? 8  ARG A HH21 1  
ATOM 139   H HH22 . ARG A 1 8  ? 22.412 1.260   1.391   1.00 0.00 ? 8  ARG A HH22 1  
ATOM 140   N N    . LEU A 1 9  ? 31.014 2.989   -0.777  1.00 0.00 ? 9  LEU A N    1  
ATOM 141   C CA   . LEU A 1 9  ? 32.256 3.005   -0.019  1.00 0.00 ? 9  LEU A CA   1  
ATOM 142   C C    . LEU A 1 9  ? 32.855 4.438   -0.058  1.00 0.00 ? 9  LEU A C    1  
ATOM 143   O O    . LEU A 1 9  ? 33.252 4.995   0.946   1.00 0.00 ? 9  LEU A O    1  
ATOM 144   C CB   . LEU A 1 9  ? 33.195 1.952   -0.616  1.00 0.00 ? 9  LEU A CB   1  
ATOM 145   C CG   . LEU A 1 9  ? 32.633 0.514   -0.606  1.00 0.00 ? 9  LEU A CG   1  
ATOM 146   C CD1  . LEU A 1 9  ? 33.220 -0.267  -1.777  1.00 0.00 ? 9  LEU A CD1  1  
ATOM 147   C CD2  . LEU A 1 9  ? 32.889 -0.245  0.686   1.00 0.00 ? 9  LEU A CD2  1  
ATOM 148   H H    . LEU A 1 9  ? 30.975 2.317   -1.507  1.00 0.00 ? 9  LEU A H    1  
ATOM 149   H HA   . LEU A 1 9  ? 32.039 2.677   0.992   1.00 0.00 ? 9  LEU A HA   1  
ATOM 150   H HB2  . LEU A 1 9  ? 33.382 2.254   -1.644  1.00 0.00 ? 9  LEU A HB2  1  
ATOM 151   H HB3  . LEU A 1 9  ? 34.156 1.950   -0.106  1.00 0.00 ? 9  LEU A HB3  1  
ATOM 152   H HG   . LEU A 1 9  ? 31.550 0.524   -0.693  1.00 0.00 ? 9  LEU A HG   1  
ATOM 153   H HD11 . LEU A 1 9  ? 33.301 0.330   -2.665  1.00 0.00 ? 9  LEU A HD11 1  
ATOM 154   H HD12 . LEU A 1 9  ? 32.554 -1.073  -2.050  1.00 0.00 ? 9  LEU A HD12 1  
ATOM 155   H HD13 . LEU A 1 9  ? 34.228 -0.626  -1.564  1.00 0.00 ? 9  LEU A HD13 1  
ATOM 156   H HD21 . LEU A 1 9  ? 33.908 -0.621  0.692   1.00 0.00 ? 9  LEU A HD21 1  
ATOM 157   H HD22 . LEU A 1 9  ? 32.223 -1.102  0.766   1.00 0.00 ? 9  LEU A HD22 1  
ATOM 158   H HD23 . LEU A 1 9  ? 32.725 0.387   1.555   1.00 0.00 ? 9  LEU A HD23 1  
ATOM 159   N N    . LYS A 1 10 ? 32.829 5.016   -1.277  1.00 0.00 ? 10 LYS A N    1  
ATOM 160   C CA   . LYS A 1 10 ? 33.289 6.396   -1.481  1.00 0.00 ? 10 LYS A CA   1  
ATOM 161   C C    . LYS A 1 10 ? 32.370 7.428   -0.791  1.00 0.00 ? 10 LYS A C    1  
ATOM 162   O O    . LYS A 1 10 ? 32.828 8.459   -0.311  1.00 0.00 ? 10 LYS A O    1  
ATOM 163   C CB   . LYS A 1 10 ? 33.320 6.691   -2.997  1.00 0.00 ? 10 LYS A CB   1  
ATOM 164   C CG   . LYS A 1 10 ? 34.694 7.102   -3.509  1.00 0.00 ? 10 LYS A CG   1  
ATOM 165   C CD   . LYS A 1 10 ? 34.854 8.625   -3.571  1.00 0.00 ? 10 LYS A CD   1  
ATOM 166   C CE   . LYS A 1 10 ? 35.680 9.042   -4.787  1.00 0.00 ? 10 LYS A CE   1  
ATOM 167   N NZ   . LYS A 1 10 ? 35.747 10.488  -4.926  1.00 0.00 ? 10 LYS A NZ   1  
ATOM 168   H H    . LYS A 1 10 ? 32.429 4.486   -2.020  1.00 0.00 ? 10 LYS A H    1  
ATOM 169   H HA   . LYS A 1 10 ? 34.284 6.461   -1.027  1.00 0.00 ? 10 LYS A HA   1  
ATOM 170   H HB2  . LYS A 1 10 ? 33.029 5.815   -3.555  1.00 0.00 ? 10 LYS A HB2  1  
ATOM 171   H HB3  . LYS A 1 10 ? 32.573 7.423   -3.306  1.00 0.00 ? 10 LYS A HB3  1  
ATOM 172   H HG2  . LYS A 1 10 ? 35.459 6.656   -2.883  1.00 0.00 ? 10 LYS A HG2  1  
ATOM 173   H HG3  . LYS A 1 10 ? 34.857 6.665   -4.496  1.00 0.00 ? 10 LYS A HG3  1  
ATOM 174   H HD2  . LYS A 1 10 ? 33.882 9.117   -3.624  1.00 0.00 ? 10 LYS A HD2  1  
ATOM 175   H HD3  . LYS A 1 10 ? 35.306 8.992   -2.651  1.00 0.00 ? 10 LYS A HD3  1  
ATOM 176   H HE2  . LYS A 1 10 ? 36.696 8.660   -4.722  1.00 0.00 ? 10 LYS A HE2  1  
ATOM 177   H HE3  . LYS A 1 10 ? 35.244 8.633   -5.700  1.00 0.00 ? 10 LYS A HE3  1  
ATOM 178   H HZ1  . LYS A 1 10 ? 36.215 10.896  -4.092  1.00 0.00 ? 10 LYS A HZ1  1  
ATOM 179   H HZ2  . LYS A 1 10 ? 34.784 10.873  -5.001  1.00 0.00 ? 10 LYS A HZ2  1  
ATOM 180   H HZ3  . LYS A 1 10 ? 36.290 10.728  -5.780  1.00 0.00 ? 10 LYS A HZ3  1  
ATOM 181   N N    . ALA A 1 11 ? 31.058 7.098   -0.781  1.00 0.00 ? 11 ALA A N    1  
ATOM 182   C CA   . ALA A 1 11 ? 30.049 7.985   -0.195  1.00 0.00 ? 11 ALA A CA   1  
ATOM 183   C C    . ALA A 1 11 ? 30.178 8.109   1.338   1.00 0.00 ? 11 ALA A C    1  
ATOM 184   O O    . ALA A 1 11 ? 29.668 9.055   1.927   1.00 0.00 ? 11 ALA A O    1  
ATOM 185   C CB   . ALA A 1 11 ? 28.640 7.514   -0.569  1.00 0.00 ? 11 ALA A CB   1  
ATOM 186   H H    . ALA A 1 11 ? 30.760 6.239   -1.202  1.00 0.00 ? 11 ALA A H    1  
ATOM 187   H HA   . ALA A 1 11 ? 30.200 8.975   -0.627  1.00 0.00 ? 11 ALA A HA   1  
ATOM 188   H HB1  . ALA A 1 11 ? 28.454 7.681   -1.628  1.00 0.00 ? 11 ALA A HB1  1  
ATOM 189   H HB2  . ALA A 1 11 ? 27.872 8.052   -0.013  1.00 0.00 ? 11 ALA A HB2  1  
ATOM 190   H HB3  . ALA A 1 11 ? 28.494 6.455   -0.374  1.00 0.00 ? 11 ALA A HB3  1  
ATOM 191   N N    . LEU A 1 12 ? 30.902 7.138   1.943   1.00 0.00 ? 12 LEU A N    1  
ATOM 192   C CA   . LEU A 1 12 ? 31.193 7.209   3.373   1.00 0.00 ? 12 LEU A CA   1  
ATOM 193   C C    . LEU A 1 12 ? 32.332 8.227   3.684   1.00 0.00 ? 12 LEU A C    1  
ATOM 194   O O    . LEU A 1 12 ? 32.743 8.353   4.832   1.00 0.00 ? 12 LEU A O    1  
ATOM 195   C CB   . LEU A 1 12 ? 31.593 5.814   3.888   1.00 0.00 ? 12 LEU A CB   1  
ATOM 196   C CG   . LEU A 1 12 ? 30.481 4.738   3.953   1.00 0.00 ? 12 LEU A CG   1  
ATOM 197   C CD1  . LEU A 1 12 ? 30.611 3.753   2.798   1.00 0.00 ? 12 LEU A CD1  1  
ATOM 198   C CD2  . LEU A 1 12 ? 30.554 3.926   5.246   1.00 0.00 ? 12 LEU A CD2  1  
ATOM 199   H H    . LEU A 1 12 ? 31.289 6.380   1.417   1.00 0.00 ? 12 LEU A H    1  
ATOM 200   H HA   . LEU A 1 12 ? 30.291 7.549   3.884   1.00 0.00 ? 12 LEU A HA   1  
ATOM 201   H HB2  . LEU A 1 12 ? 32.392 5.459   3.249   1.00 0.00 ? 12 LEU A HB2  1  
ATOM 202   H HB3  . LEU A 1 12 ? 32.029 5.914   4.877   1.00 0.00 ? 12 LEU A HB3  1  
ATOM 203   H HG   . LEU A 1 12 ? 29.505 5.223   3.897   1.00 0.00 ? 12 LEU A HG   1  
ATOM 204   H HD11 . LEU A 1 12 ? 31.113 4.272   1.998   1.00 0.00 ? 12 LEU A HD11 1  
ATOM 205   H HD12 . LEU A 1 12 ? 29.644 3.392   2.447   1.00 0.00 ? 12 LEU A HD12 1  
ATOM 206   H HD13 . LEU A 1 12 ? 31.232 2.889   3.044   1.00 0.00 ? 12 LEU A HD13 1  
ATOM 207   H HD21 . LEU A 1 12 ? 31.430 3.281   5.234   1.00 0.00 ? 12 LEU A HD21 1  
ATOM 208   H HD22 . LEU A 1 12 ? 29.690 3.269   5.339   1.00 0.00 ? 12 LEU A HD22 1  
ATOM 209   H HD23 . LEU A 1 12 ? 30.617 4.573   6.119   1.00 0.00 ? 12 LEU A HD23 1  
ATOM 210   N N    . GLY A 1 13 ? 32.805 8.938   2.629   1.00 0.00 ? 13 GLY A N    1  
ATOM 211   C CA   . GLY A 1 13 ? 33.818 9.987   2.779   1.00 0.00 ? 13 GLY A CA   1  
ATOM 212   C C    . GLY A 1 13 ? 35.231 9.510   2.413   1.00 0.00 ? 13 GLY A C    1  
ATOM 213   O O    . GLY A 1 13 ? 36.217 10.045  2.914   1.00 0.00 ? 13 GLY A O    1  
ATOM 214   H H    . GLY A 1 13 ? 32.418 8.788   1.721   1.00 0.00 ? 13 GLY A H    1  
ATOM 215   H HA2  . GLY A 1 13 ? 33.536 10.809  2.121   1.00 0.00 ? 13 GLY A HA2  1  
ATOM 216   H HA3  . GLY A 1 13 ? 33.812 10.348  3.808   1.00 0.00 ? 13 GLY A HA3  1  
ATOM 217   N N    . PHE A 1 14 ? 35.274 8.470   1.547   1.00 0.00 ? 14 PHE A N    1  
ATOM 218   C CA   . PHE A 1 14 ? 36.528 7.777   1.234   1.00 0.00 ? 14 PHE A CA   1  
ATOM 219   C C    . PHE A 1 14 ? 36.945 8.123   -0.209  1.00 0.00 ? 14 PHE A C    1  
ATOM 220   O O    . PHE A 1 14 ? 36.805 9.266   -0.625  1.00 0.00 ? 14 PHE A O    1  
ATOM 221   C CB   . PHE A 1 14 ? 36.323 6.263   1.471   1.00 0.00 ? 14 PHE A CB   1  
ATOM 222   C CG   . PHE A 1 14 ? 35.805 5.925   2.849   1.00 0.00 ? 14 PHE A CG   1  
ATOM 223   C CD1  . PHE A 1 14 ? 35.996 6.772   3.939   1.00 0.00 ? 14 PHE A CD1  1  
ATOM 224   C CD2  . PHE A 1 14 ? 35.078 4.756   3.037   1.00 0.00 ? 14 PHE A CD2  1  
ATOM 225   C CE1  . PHE A 1 14 ? 35.393 6.512   5.155   1.00 0.00 ? 14 PHE A CE1  1  
ATOM 226   C CE2  . PHE A 1 14 ? 34.466 4.492   4.252   1.00 0.00 ? 14 PHE A CE2  1  
ATOM 227   C CZ   . PHE A 1 14 ? 34.609 5.389   5.304   1.00 0.00 ? 14 PHE A CZ   1  
ATOM 228   H H    . PHE A 1 14 ? 34.422 8.110   1.169   1.00 0.00 ? 14 PHE A H    1  
ATOM 229   H HA   . PHE A 1 14 ? 37.317 8.169   1.880   1.00 0.00 ? 14 PHE A HA   1  
ATOM 230   H HB2  . PHE A 1 14 ? 35.614 5.893   0.729   1.00 0.00 ? 14 PHE A HB2  1  
ATOM 231   H HB3  . PHE A 1 14 ? 37.234 5.698   1.323   1.00 0.00 ? 14 PHE A HB3  1  
ATOM 232   H HD1  . PHE A 1 14 ? 36.600 7.662   3.871   1.00 0.00 ? 14 PHE A HD1  1  
ATOM 233   H HD2  . PHE A 1 14 ? 34.982 4.039   2.233   1.00 0.00 ? 14 PHE A HD2  1  
ATOM 234   H HE1  . PHE A 1 14 ? 35.516 7.191   5.984   1.00 0.00 ? 14 PHE A HE1  1  
ATOM 235   H HE2  . PHE A 1 14 ? 33.855 3.607   4.348   1.00 0.00 ? 14 PHE A HE2  1  
ATOM 236   H HZ   . PHE A 1 14 ? 34.103 5.252   6.247   1.00 0.00 ? 14 PHE A HZ   1  
ATOM 237   N N    . GLU A 1 15 ? 37.471 7.105   -0.937  1.00 0.00 ? 15 GLU A N    1  
ATOM 238   C CA   . GLU A 1 15 ? 37.974 7.313   -2.293  1.00 0.00 ? 15 GLU A CA   1  
ATOM 239   C C    . GLU A 1 15 ? 38.060 5.960   -2.998  1.00 0.00 ? 15 GLU A C    1  
ATOM 240   O O    . GLU A 1 15 ? 38.513 4.988   -2.415  1.00 0.00 ? 15 GLU A O    1  
ATOM 241   C CB   . GLU A 1 15 ? 39.334 8.038   -2.290  1.00 0.00 ? 15 GLU A CB   1  
ATOM 242   C CG   . GLU A 1 15 ? 39.598 8.813   -3.589  1.00 0.00 ? 15 GLU A CG   1  
ATOM 243   C CD   . GLU A 1 15 ? 40.719 9.871   -3.486  1.00 0.00 ? 15 GLU A CD   1  
ATOM 244   O OE1  . GLU A 1 15 ? 41.159 10.195  -2.383  1.00 0.00 ? 15 GLU A OE1  1  
ATOM 245   O OE2  . GLU A 1 15 ? 41.136 10.373  -4.531  1.00 0.00 ? 15 GLU A OE2  1  
ATOM 246   H H    . GLU A 1 15 ? 37.552 6.194   -0.535  1.00 0.00 ? 15 GLU A H    1  
ATOM 247   H HA   . GLU A 1 15 ? 37.241 7.930   -2.798  1.00 0.00 ? 15 GLU A HA   1  
ATOM 248   H HB2  . GLU A 1 15 ? 39.332 8.717   -1.440  1.00 0.00 ? 15 GLU A HB2  1  
ATOM 249   H HB3  . GLU A 1 15 ? 40.167 7.349   -2.157  1.00 0.00 ? 15 GLU A HB3  1  
ATOM 250   H HG2  . GLU A 1 15 ? 39.849 8.104   -4.378  1.00 0.00 ? 15 GLU A HG2  1  
ATOM 251   H HG3  . GLU A 1 15 ? 38.696 9.332   -3.903  1.00 0.00 ? 15 GLU A HG3  1  
ATOM 252   N N    . GLU A 1 16 ? 37.591 5.972   -4.270  1.00 0.00 ? 16 GLU A N    1  
ATOM 253   C CA   . GLU A 1 16 ? 37.442 4.801   -5.140  1.00 0.00 ? 16 GLU A CA   1  
ATOM 254   C C    . GLU A 1 16 ? 38.701 3.881   -5.184  1.00 0.00 ? 16 GLU A C    1  
ATOM 255   O O    . GLU A 1 16 ? 38.608 2.714   -5.544  1.00 0.00 ? 16 GLU A O    1  
ATOM 256   C CB   . GLU A 1 16 ? 37.009 5.277   -6.535  1.00 0.00 ? 16 GLU A CB   1  
ATOM 257   C CG   . GLU A 1 16 ? 37.107 4.201   -7.639  1.00 0.00 ? 16 GLU A CG   1  
ATOM 258   C CD   . GLU A 1 16 ? 36.232 4.490   -8.881  1.00 0.00 ? 16 GLU A CD   1  
ATOM 259   O OE1  . GLU A 1 16 ? 35.202 5.152   -8.758  1.00 0.00 ? 16 GLU A OE1  1  
ATOM 260   O OE2  . GLU A 1 16 ? 36.592 4.036   -9.969  1.00 0.00 ? 16 GLU A OE2  1  
ATOM 261   H H    . GLU A 1 16 ? 37.257 6.849   -4.613  1.00 0.00 ? 16 GLU A H    1  
ATOM 262   H HA   . GLU A 1 16 ? 36.590 4.251   -4.742  1.00 0.00 ? 16 GLU A HA   1  
ATOM 263   H HB2  . GLU A 1 16 ? 35.978 5.630   -6.446  1.00 0.00 ? 16 GLU A HB2  1  
ATOM 264   H HB3  . GLU A 1 16 ? 37.614 6.137   -6.817  1.00 0.00 ? 16 GLU A HB3  1  
ATOM 265   H HG2  . GLU A 1 16 ? 38.148 4.103   -7.948  1.00 0.00 ? 16 GLU A HG2  1  
ATOM 266   H HG3  . GLU A 1 16 ? 36.836 3.224   -7.252  1.00 0.00 ? 16 GLU A HG3  1  
ATOM 267   N N    . SER A 1 17 ? 39.857 4.445   -4.781  1.00 0.00 ? 17 SER A N    1  
ATOM 268   C CA   . SER A 1 17 ? 41.087 3.671   -4.679  1.00 0.00 ? 17 SER A CA   1  
ATOM 269   C C    . SER A 1 17 ? 41.148 2.863   -3.364  1.00 0.00 ? 17 SER A C    1  
ATOM 270   O O    . SER A 1 17 ? 41.337 1.653   -3.396  1.00 0.00 ? 17 SER A O    1  
ATOM 271   C CB   . SER A 1 17 ? 42.266 4.646   -4.762  1.00 0.00 ? 17 SER A CB   1  
ATOM 272   O OG   . SER A 1 17 ? 42.662 4.841   -6.112  1.00 0.00 ? 17 SER A OG   1  
ATOM 273   H H    . SER A 1 17 ? 39.874 5.403   -4.488  1.00 0.00 ? 17 SER A H    1  
ATOM 274   H HA   . SER A 1 17 ? 41.096 2.958   -5.509  1.00 0.00 ? 17 SER A HA   1  
ATOM 275   H HB2  . SER A 1 17 ? 41.962 5.599   -4.322  1.00 0.00 ? 17 SER A HB2  1  
ATOM 276   H HB3  . SER A 1 17 ? 43.108 4.277   -4.168  1.00 0.00 ? 17 SER A HB3  1  
ATOM 277   H HG   . SER A 1 17 ? 43.436 5.394   -6.162  1.00 0.00 ? 17 SER A HG   1  
ATOM 278   N N    . LEU A 1 18 ? 40.984 3.571   -2.216  1.00 0.00 ? 18 LEU A N    1  
ATOM 279   C CA   . LEU A 1 18 ? 40.989 2.859   -0.925  1.00 0.00 ? 18 LEU A CA   1  
ATOM 280   C C    . LEU A 1 18 ? 39.793 1.906   -0.809  1.00 0.00 ? 18 LEU A C    1  
ATOM 281   O O    . LEU A 1 18 ? 39.824 0.938   -0.053  1.00 0.00 ? 18 LEU A O    1  
ATOM 282   C CB   . LEU A 1 18 ? 41.118 3.816   0.279   1.00 0.00 ? 18 LEU A CB   1  
ATOM 283   C CG   . LEU A 1 18 ? 39.850 4.525   0.808   1.00 0.00 ? 18 LEU A CG   1  
ATOM 284   C CD1  . LEU A 1 18 ? 39.622 4.262   2.304   1.00 0.00 ? 18 LEU A CD1  1  
ATOM 285   C CD2  . LEU A 1 18 ? 39.946 6.034   0.595   1.00 0.00 ? 18 LEU A CD2  1  
ATOM 286   H H    . LEU A 1 18 ? 40.796 4.552   -2.264  1.00 0.00 ? 18 LEU A H    1  
ATOM 287   H HA   . LEU A 1 18 ? 41.885 2.240   -0.919  1.00 0.00 ? 18 LEU A HA   1  
ATOM 288   H HB2  . LEU A 1 18 ? 41.544 3.247   1.100   1.00 0.00 ? 18 LEU A HB2  1  
ATOM 289   H HB3  . LEU A 1 18 ? 41.881 4.554   0.045   1.00 0.00 ? 18 LEU A HB3  1  
ATOM 290   H HG   . LEU A 1 18 ? 38.980 4.159   0.266   1.00 0.00 ? 18 LEU A HG   1  
ATOM 291   H HD11 . LEU A 1 18 ? 39.645 3.199   2.543   1.00 0.00 ? 18 LEU A HD11 1  
ATOM 292   H HD12 . LEU A 1 18 ? 38.659 4.668   2.603   1.00 0.00 ? 18 LEU A HD12 1  
ATOM 293   H HD13 . LEU A 1 18 ? 40.375 4.754   2.921   1.00 0.00 ? 18 LEU A HD13 1  
ATOM 294   H HD21 . LEU A 1 18 ? 40.870 6.442   0.998   1.00 0.00 ? 18 LEU A HD21 1  
ATOM 295   H HD22 . LEU A 1 18 ? 39.141 6.577   1.086   1.00 0.00 ? 18 LEU A HD22 1  
ATOM 296   H HD23 . LEU A 1 18 ? 39.926 6.237   -0.468  1.00 0.00 ? 18 LEU A HD23 1  
ATOM 297   N N    . VAL A 1 19 ? 38.779 2.234   -1.618  1.00 0.00 ? 19 VAL A N    1  
ATOM 298   C CA   . VAL A 1 19 ? 37.516 1.535   -1.769  1.00 0.00 ? 19 VAL A CA   1  
ATOM 299   C C    . VAL A 1 19 ? 37.724 0.189   -2.462  1.00 0.00 ? 19 VAL A C    1  
ATOM 300   O O    . VAL A 1 19 ? 37.359 -0.847  -1.936  1.00 0.00 ? 19 VAL A O    1  
ATOM 301   C CB   . VAL A 1 19 ? 36.621 2.450   -2.607  1.00 0.00 ? 19 VAL A CB   1  
ATOM 302   C CG1  . VAL A 1 19 ? 35.535 1.710   -3.382  1.00 0.00 ? 19 VAL A CG1  1  
ATOM 303   C CG2  . VAL A 1 19 ? 36.045 3.636   -1.818  1.00 0.00 ? 19 VAL A CG2  1  
ATOM 304   H H    . VAL A 1 19 ? 38.916 3.029   -2.212  1.00 0.00 ? 19 VAL A H    1  
ATOM 305   H HA   . VAL A 1 19 ? 37.093 1.340   -0.791  1.00 0.00 ? 19 VAL A HA   1  
ATOM 306   H HB   . VAL A 1 19 ? 37.291 2.871   -3.347  1.00 0.00 ? 19 VAL A HB   1  
ATOM 307   H HG11 . VAL A 1 19 ? 35.876 1.482   -4.390  1.00 0.00 ? 19 VAL A HG11 1  
ATOM 308   H HG12 . VAL A 1 19 ? 34.642 2.318   -3.435  1.00 0.00 ? 19 VAL A HG12 1  
ATOM 309   H HG13 . VAL A 1 19 ? 35.276 0.760   -2.929  1.00 0.00 ? 19 VAL A HG13 1  
ATOM 310   H HG21 . VAL A 1 19 ? 36.783 4.047   -1.137  1.00 0.00 ? 19 VAL A HG21 1  
ATOM 311   H HG22 . VAL A 1 19 ? 35.188 3.390   -1.209  1.00 0.00 ? 19 VAL A HG22 1  
ATOM 312   H HG23 . VAL A 1 19 ? 35.714 4.415   -2.503  1.00 0.00 ? 19 VAL A HG23 1  
ATOM 313   N N    . ILE A 1 20 ? 38.304 0.286   -3.680  1.00 0.00 ? 20 ILE A N    1  
ATOM 314   C CA   . ILE A 1 20 ? 38.567 -0.910  -4.470  1.00 0.00 ? 20 ILE A CA   1  
ATOM 315   C C    . ILE A 1 20 ? 39.434 -1.883  -3.685  1.00 0.00 ? 20 ILE A C    1  
ATOM 316   O O    . ILE A 1 20 ? 39.089 -3.043  -3.559  1.00 0.00 ? 20 ILE A O    1  
ATOM 317   C CB   . ILE A 1 20 ? 39.182 -0.522  -5.831  1.00 0.00 ? 20 ILE A CB   1  
ATOM 318   C CG1  . ILE A 1 20 ? 38.043 -0.157  -6.795  1.00 0.00 ? 20 ILE A CG1  1  
ATOM 319   C CG2  . ILE A 1 20 ? 40.093 -1.596  -6.450  1.00 0.00 ? 20 ILE A CG2  1  
ATOM 320   C CD1  . ILE A 1 20 ? 38.511 0.156   -8.212  1.00 0.00 ? 20 ILE A CD1  1  
ATOM 321   H H    . ILE A 1 20 ? 38.555 1.181   -4.043  1.00 0.00 ? 20 ILE A H    1  
ATOM 322   H HA   . ILE A 1 20 ? 37.607 -1.410  -4.609  1.00 0.00 ? 20 ILE A HA   1  
ATOM 323   H HB   . ILE A 1 20 ? 39.816 0.351   -5.676  1.00 0.00 ? 20 ILE A HB   1  
ATOM 324   H HG12 . ILE A 1 20 ? 37.317 -0.969  -6.848  1.00 0.00 ? 20 ILE A HG12 1  
ATOM 325   H HG13 . ILE A 1 20 ? 37.503 0.700   -6.401  1.00 0.00 ? 20 ILE A HG13 1  
ATOM 326   H HG21 . ILE A 1 20 ? 40.588 -1.220  -7.343  1.00 0.00 ? 20 ILE A HG21 1  
ATOM 327   H HG22 . ILE A 1 20 ? 39.515 -2.470  -6.735  1.00 0.00 ? 20 ILE A HG22 1  
ATOM 328   H HG23 . ILE A 1 20 ? 40.894 -1.900  -5.778  1.00 0.00 ? 20 ILE A HG23 1  
ATOM 329   H HD11 . ILE A 1 20 ? 39.366 0.831   -8.203  1.00 0.00 ? 20 ILE A HD11 1  
ATOM 330   H HD12 . ILE A 1 20 ? 37.703 0.626   -8.771  1.00 0.00 ? 20 ILE A HD12 1  
ATOM 331   H HD13 . ILE A 1 20 ? 38.794 -0.758  -8.736  1.00 0.00 ? 20 ILE A HD13 1  
ATOM 332   N N    . GLN A 1 21 ? 40.546 -1.341  -3.158  1.00 0.00 ? 21 GLN A N    1  
ATOM 333   C CA   . GLN A 1 21 ? 41.473 -2.169  -2.398  1.00 0.00 ? 21 GLN A CA   1  
ATOM 334   C C    . GLN A 1 21 ? 40.854 -2.666  -1.065  1.00 0.00 ? 21 GLN A C    1  
ATOM 335   O O    . GLN A 1 21 ? 41.294 -3.664  -0.510  1.00 0.00 ? 21 GLN A O    1  
ATOM 336   C CB   . GLN A 1 21 ? 42.750 -1.358  -2.137  1.00 0.00 ? 21 GLN A CB   1  
ATOM 337   C CG   . GLN A 1 21 ? 43.984 -2.256  -1.939  1.00 0.00 ? 21 GLN A CG   1  
ATOM 338   C CD   . GLN A 1 21 ? 44.822 -1.781  -0.751  1.00 0.00 ? 21 GLN A CD   1  
ATOM 339   O OE1  . GLN A 1 21 ? 45.376 -0.683  -0.745  1.00 0.00 ? 21 GLN A OE1  1  
ATOM 340   N NE2  . GLN A 1 21 ? 44.856 -2.664  0.262   1.00 0.00 ? 21 GLN A NE2  1  
ATOM 341   H H    . GLN A 1 21 ? 40.749 -0.378  -3.331  1.00 0.00 ? 21 GLN A H    1  
ATOM 342   H HA   . GLN A 1 21 ? 41.701 -3.031  -3.031  1.00 0.00 ? 21 GLN A HA   1  
ATOM 343   H HB2  . GLN A 1 21 ? 42.954 -0.702  -2.982  1.00 0.00 ? 21 GLN A HB2  1  
ATOM 344   H HB3  . GLN A 1 21 ? 42.581 -0.686  -1.292  1.00 0.00 ? 21 GLN A HB3  1  
ATOM 345   H HG2  . GLN A 1 21 ? 43.682 -3.294  -1.790  1.00 0.00 ? 21 GLN A HG2  1  
ATOM 346   H HG3  . GLN A 1 21 ? 44.618 -2.249  -2.827  1.00 0.00 ? 21 GLN A HG3  1  
ATOM 347   H HE21 . GLN A 1 21 ? 44.431 -3.566  0.147   1.00 0.00 ? 21 GLN A HE21 1  
ATOM 348   H HE22 . GLN A 1 21 ? 45.294 -2.432  1.123   1.00 0.00 ? 21 GLN A HE22 1  
ATOM 349   N N    . ALA A 1 22 ? 39.815 -1.933  -0.602  1.00 0.00 ? 22 ALA A N    1  
ATOM 350   C CA   . ALA A 1 22 ? 39.061 -2.315  0.593   1.00 0.00 ? 22 ALA A CA   1  
ATOM 351   C C    . ALA A 1 22 ? 37.892 -3.262  0.295   1.00 0.00 ? 22 ALA A C    1  
ATOM 352   O O    . ALA A 1 22 ? 37.275 -3.760  1.223   1.00 0.00 ? 22 ALA A O    1  
ATOM 353   C CB   . ALA A 1 22 ? 38.417 -1.091  1.243   1.00 0.00 ? 22 ALA A CB   1  
ATOM 354   H H    . ALA A 1 22 ? 39.518 -1.130  -1.117  1.00 0.00 ? 22 ALA A H    1  
ATOM 355   H HA   . ALA A 1 22 ? 39.742 -2.814  1.283   1.00 0.00 ? 22 ALA A HA   1  
ATOM 356   H HB1  . ALA A 1 22 ? 39.157 -0.400  1.633   1.00 0.00 ? 22 ALA A HB1  1  
ATOM 357   H HB2  . ALA A 1 22 ? 37.796 -1.392  2.086   1.00 0.00 ? 22 ALA A HB2  1  
ATOM 358   H HB3  . ALA A 1 22 ? 37.785 -0.538  0.547   1.00 0.00 ? 22 ALA A HB3  1  
ATOM 359   N N    . TYR A 1 23 ? 37.604 -3.451  -1.009  1.00 0.00 ? 23 TYR A N    1  
ATOM 360   C CA   . TYR A 1 23 ? 36.509 -4.320  -1.453  1.00 0.00 ? 23 TYR A CA   1  
ATOM 361   C C    . TYR A 1 23 ? 37.056 -5.483  -2.283  1.00 0.00 ? 23 TYR A C    1  
ATOM 362   O O    . TYR A 1 23 ? 36.303 -6.326  -2.726  1.00 0.00 ? 23 TYR A O    1  
ATOM 363   C CB   . TYR A 1 23 ? 35.536 -3.514  -2.331  1.00 0.00 ? 23 TYR A CB   1  
ATOM 364   C CG   . TYR A 1 23 ? 34.081 -3.880  -2.133  1.00 0.00 ? 23 TYR A CG   1  
ATOM 365   C CD1  . TYR A 1 23 ? 33.353 -3.236  -1.154  1.00 0.00 ? 23 TYR A CD1  1  
ATOM 366   C CD2  . TYR A 1 23 ? 33.437 -4.818  -2.925  1.00 0.00 ? 23 TYR A CD2  1  
ATOM 367   C CE1  . TYR A 1 23 ? 32.006 -3.493  -0.957  1.00 0.00 ? 23 TYR A CE1  1  
ATOM 368   C CE2  . TYR A 1 23 ? 32.086 -5.094  -2.748  1.00 0.00 ? 23 TYR A CE2  1  
ATOM 369   C CZ   . TYR A 1 23 ? 31.366 -4.415  -1.766  1.00 0.00 ? 23 TYR A CZ   1  
ATOM 370   O OH   . TYR A 1 23 ? 30.021 -4.640  -1.575  1.00 0.00 ? 23 TYR A OH   1  
ATOM 371   H H    . TYR A 1 23 ? 38.129 -2.948  -1.692  1.00 0.00 ? 23 TYR A H    1  
ATOM 372   H HA   . TYR A 1 23 ? 36.001 -4.730  -0.578  1.00 0.00 ? 23 TYR A HA   1  
ATOM 373   H HB2  . TYR A 1 23 ? 35.638 -2.465  -2.078  1.00 0.00 ? 23 TYR A HB2  1  
ATOM 374   H HB3  . TYR A 1 23 ? 35.795 -3.562  -3.387  1.00 0.00 ? 23 TYR A HB3  1  
ATOM 375   H HD1  . TYR A 1 23 ? 33.837 -2.486  -0.559  1.00 0.00 ? 23 TYR A HD1  1  
ATOM 376   H HD2  . TYR A 1 23 ? 33.989 -5.323  -3.696  1.00 0.00 ? 23 TYR A HD2  1  
ATOM 377   H HE1  . TYR A 1 23 ? 31.460 -2.969  -0.185  1.00 0.00 ? 23 TYR A HE1  1  
ATOM 378   H HE2  . TYR A 1 23 ? 31.612 -5.835  -3.376  1.00 0.00 ? 23 TYR A HE2  1  
ATOM 379   H HH   . TYR A 1 23 ? 29.843 -5.568  -1.604  1.00 0.00 ? 23 TYR A HH   1  
ATOM 380   N N    . PHE A 1 24 ? 38.382 -5.484  -2.498  1.00 0.00 ? 24 PHE A N    1  
ATOM 381   C CA   . PHE A 1 24 ? 39.000 -6.565  -3.263  1.00 0.00 ? 24 PHE A CA   1  
ATOM 382   C C    . PHE A 1 24 ? 39.858 -7.392  -2.303  1.00 0.00 ? 24 PHE A C    1  
ATOM 383   O O    . PHE A 1 24 ? 39.891 -8.618  -2.379  1.00 0.00 ? 24 PHE A O    1  
ATOM 384   C CB   . PHE A 1 24 ? 39.875 -5.991  -4.392  1.00 0.00 ? 24 PHE A CB   1  
ATOM 385   C CG   . PHE A 1 24 ? 39.355 -6.272  -5.777  1.00 0.00 ? 24 PHE A CG   1  
ATOM 386   C CD1  . PHE A 1 24 ? 39.449 -7.558  -6.291  1.00 0.00 ? 24 PHE A CD1  1  
ATOM 387   C CD2  . PHE A 1 24 ? 38.813 -5.266  -6.566  1.00 0.00 ? 24 PHE A CD2  1  
ATOM 388   C CE1  . PHE A 1 24 ? 39.055 -7.823  -7.596  1.00 0.00 ? 24 PHE A CE1  1  
ATOM 389   C CE2  . PHE A 1 24 ? 38.416 -5.520  -7.873  1.00 0.00 ? 24 PHE A CE2  1  
ATOM 390   C CZ   . PHE A 1 24 ? 38.549 -6.802  -8.393  1.00 0.00 ? 24 PHE A CZ   1  
ATOM 391   H H    . PHE A 1 24 ? 38.952 -4.751  -2.132  1.00 0.00 ? 24 PHE A H    1  
ATOM 392   H HA   . PHE A 1 24 ? 38.222 -7.221  -3.660  1.00 0.00 ? 24 PHE A HA   1  
ATOM 393   H HB2  . PHE A 1 24 ? 40.021 -4.925  -4.278  1.00 0.00 ? 24 PHE A HB2  1  
ATOM 394   H HB3  . PHE A 1 24 ? 40.879 -6.408  -4.341  1.00 0.00 ? 24 PHE A HB3  1  
ATOM 395   H HD1  . PHE A 1 24 ? 39.822 -8.349  -5.660  1.00 0.00 ? 24 PHE A HD1  1  
ATOM 396   H HD2  . PHE A 1 24 ? 38.691 -4.280  -6.146  1.00 0.00 ? 24 PHE A HD2  1  
ATOM 397   H HE1  . PHE A 1 24 ? 39.131 -8.830  -7.978  1.00 0.00 ? 24 PHE A HE1  1  
ATOM 398   H HE2  . PHE A 1 24 ? 37.991 -4.727  -8.476  1.00 0.00 ? 24 PHE A HE2  1  
ATOM 399   H HZ   . PHE A 1 24 ? 38.243 -7.010  -9.407  1.00 0.00 ? 24 PHE A HZ   1  
ATOM 400   N N    . ALA A 1 25 ? 40.535 -6.650  -1.397  1.00 0.00 ? 25 ALA A N    1  
ATOM 401   C CA   . ALA A 1 25 ? 41.315 -7.293  -0.343  1.00 0.00 ? 25 ALA A CA   1  
ATOM 402   C C    . ALA A 1 25 ? 40.384 -7.952  0.692   1.00 0.00 ? 25 ALA A C    1  
ATOM 403   O O    . ALA A 1 25 ? 40.736 -8.934  1.335   1.00 0.00 ? 25 ALA A O    1  
ATOM 404   C CB   . ALA A 1 25 ? 42.227 -6.266  0.332   1.00 0.00 ? 25 ALA A CB   1  
ATOM 405   H H    . ALA A 1 25 ? 40.472 -5.650  -1.406  1.00 0.00 ? 25 ALA A H    1  
ATOM 406   H HA   . ALA A 1 25 ? 41.927 -8.060  -0.819  1.00 0.00 ? 25 ALA A HA   1  
ATOM 407   H HB1  . ALA A 1 25 ? 42.941 -6.752  0.996   1.00 0.00 ? 25 ALA A HB1  1  
ATOM 408   H HB2  . ALA A 1 25 ? 41.663 -5.548  0.926   1.00 0.00 ? 25 ALA A HB2  1  
ATOM 409   H HB3  . ALA A 1 25 ? 42.800 -5.717  -0.416  1.00 0.00 ? 25 ALA A HB3  1  
ATOM 410   N N    . CYS A 1 26 ? 39.171 -7.364  0.777   1.00 0.00 ? 26 CYS A N    1  
ATOM 411   C CA   . CYS A 1 26 ? 38.109 -7.908  1.621   1.00 0.00 ? 26 CYS A CA   1  
ATOM 412   C C    . CYS A 1 26 ? 37.304 -9.030  0.931   1.00 0.00 ? 26 CYS A C    1  
ATOM 413   O O    . CYS A 1 26 ? 36.291 -9.471  1.462   1.00 0.00 ? 26 CYS A O    1  
ATOM 414   C CB   . CYS A 1 26 ? 37.149 -6.773  1.979   1.00 0.00 ? 26 CYS A CB   1  
ATOM 415   S SG   . CYS A 1 26 ? 37.606 -6.008  3.547   1.00 0.00 ? 26 CYS A SG   1  
ATOM 416   H H    . CYS A 1 26 ? 38.999 -6.534  0.245   1.00 0.00 ? 26 CYS A H    1  
ATOM 417   H HA   . CYS A 1 26 ? 38.581 -8.297  2.526   1.00 0.00 ? 26 CYS A HA   1  
ATOM 418   H HB2  . CYS A 1 26 ? 37.204 -6.032  1.191   1.00 0.00 ? 26 CYS A HB2  1  
ATOM 419   H HB3  . CYS A 1 26 ? 36.097 -7.072  2.003   1.00 0.00 ? 26 CYS A HB3  1  
ATOM 420   H HG   . CYS A 1 26 ? 37.009 -4.830  3.647   1.00 0.00 ? 26 CYS A HG   1  
ATOM 421   N N    . GLU A 1 27 ? 37.771 -9.453  -0.268  1.00 0.00 ? 27 GLU A N    1  
ATOM 422   C CA   . GLU A 1 27 ? 37.077 -10.498 -1.025  1.00 0.00 ? 27 GLU A CA   1  
ATOM 423   C C    . GLU A 1 27 ? 35.603 -10.105 -1.304  1.00 0.00 ? 27 GLU A C    1  
ATOM 424   O O    . GLU A 1 27 ? 34.663 -10.830 -0.995  1.00 0.00 ? 27 GLU A O    1  
ATOM 425   C CB   . GLU A 1 27 ? 37.261 -11.859 -0.319  1.00 0.00 ? 27 GLU A CB   1  
ATOM 426   C CG   . GLU A 1 27 ? 36.389 -12.996 -0.894  1.00 0.00 ? 27 GLU A CG   1  
ATOM 427   C CD   . GLU A 1 27 ? 36.934 -14.412 -0.631  1.00 0.00 ? 27 GLU A CD   1  
ATOM 428   O OE1  . GLU A 1 27 ? 38.148 -14.598 -0.631  1.00 0.00 ? 27 GLU A OE1  1  
ATOM 429   O OE2  . GLU A 1 27 ? 36.125 -15.324 -0.439  1.00 0.00 ? 27 GLU A OE2  1  
ATOM 430   H H    . GLU A 1 27 ? 38.607 -9.061  -0.646  1.00 0.00 ? 27 GLU A H    1  
ATOM 431   H HA   . GLU A 1 27 ? 37.583 -10.540 -1.992  1.00 0.00 ? 27 GLU A HA   1  
ATOM 432   H HB2  . GLU A 1 27 ? 38.320 -12.106 -0.402  1.00 0.00 ? 27 GLU A HB2  1  
ATOM 433   H HB3  . GLU A 1 27 ? 37.060 -11.770 0.747   1.00 0.00 ? 27 GLU A HB3  1  
ATOM 434   H HG2  . GLU A 1 27 ? 35.389 -12.943 -0.461  1.00 0.00 ? 27 GLU A HG2  1  
ATOM 435   H HG3  . GLU A 1 27 ? 36.283 -12.865 -1.970  1.00 0.00 ? 27 GLU A HG3  1  
ATOM 436   N N    . LYS A 1 28 ? 35.484 -8.904  -1.910  1.00 0.00 ? 28 LYS A N    1  
ATOM 437   C CA   . LYS A 1 28 ? 34.246 -8.359  -2.468  1.00 0.00 ? 28 LYS A CA   1  
ATOM 438   C C    . LYS A 1 28 ? 33.004 -8.685  -1.626  1.00 0.00 ? 28 LYS A C    1  
ATOM 439   O O    . LYS A 1 28 ? 32.067 -9.324  -2.093  1.00 0.00 ? 28 LYS A O    1  
ATOM 440   C CB   . LYS A 1 28 ? 34.086 -8.844  -3.917  1.00 0.00 ? 28 LYS A CB   1  
ATOM 441   C CG   . LYS A 1 28 ? 35.350 -8.739  -4.791  1.00 0.00 ? 28 LYS A CG   1  
ATOM 442   C CD   . LYS A 1 28 ? 35.599 -7.356  -5.417  1.00 0.00 ? 28 LYS A CD   1  
ATOM 443   C CE   . LYS A 1 28 ? 35.427 -7.329  -6.938  1.00 0.00 ? 28 LYS A CE   1  
ATOM 444   N NZ   . LYS A 1 28 ? 36.055 -8.477  -7.585  1.00 0.00 ? 28 LYS A NZ   1  
ATOM 445   H H    . LYS A 1 28 ? 36.319 -8.382  -2.089  1.00 0.00 ? 28 LYS A H    1  
ATOM 446   H HA   . LYS A 1 28 ? 34.343 -7.281  -2.446  1.00 0.00 ? 28 LYS A HA   1  
ATOM 447   H HB2  . LYS A 1 28 ? 33.803 -9.895  -3.913  1.00 0.00 ? 28 LYS A HB2  1  
ATOM 448   H HB3  . LYS A 1 28 ? 33.257 -8.315  -4.380  1.00 0.00 ? 28 LYS A HB3  1  
ATOM 449   H HG2  . LYS A 1 28 ? 36.248 -9.036  -4.248  1.00 0.00 ? 28 LYS A HG2  1  
ATOM 450   H HG3  . LYS A 1 28 ? 35.258 -9.501  -5.563  1.00 0.00 ? 28 LYS A HG3  1  
ATOM 451   H HD2  . LYS A 1 28 ? 34.969 -6.590  -4.976  1.00 0.00 ? 28 LYS A HD2  1  
ATOM 452   H HD3  . LYS A 1 28 ? 36.617 -7.053  -5.179  1.00 0.00 ? 28 LYS A HD3  1  
ATOM 453   H HE2  . LYS A 1 28 ? 34.371 -7.334  -7.205  1.00 0.00 ? 28 LYS A HE2  1  
ATOM 454   H HE3  . LYS A 1 28 ? 35.875 -6.420  -7.340  1.00 0.00 ? 28 LYS A HE3  1  
ATOM 455   H HZ1  . LYS A 1 28 ? 36.287 -8.258  -8.580  1.00 0.00 ? 28 LYS A HZ1  1  
ATOM 456   H HZ2  . LYS A 1 28 ? 35.393 -9.279  -7.559  1.00 0.00 ? 28 LYS A HZ2  1  
ATOM 457   H HZ3  . LYS A 1 28 ? 36.922 -8.733  -7.080  1.00 0.00 ? 28 LYS A HZ3  1  
ATOM 458   N N    . ASN A 1 29 ? 33.085 -8.229  -0.355  1.00 0.00 ? 29 ASN A N    1  
ATOM 459   C CA   . ASN A 1 29 ? 32.067 -8.580  0.633   1.00 0.00 ? 29 ASN A CA   1  
ATOM 460   C C    . ASN A 1 29 ? 31.206 -7.329  0.883   1.00 0.00 ? 29 ASN A C    1  
ATOM 461   O O    . ASN A 1 29 ? 31.014 -6.555  -0.033  1.00 0.00 ? 29 ASN A O    1  
ATOM 462   C CB   . ASN A 1 29 ? 32.777 -9.135  1.890   1.00 0.00 ? 29 ASN A CB   1  
ATOM 463   C CG   . ASN A 1 29 ? 32.026 -10.278 2.590   1.00 0.00 ? 29 ASN A CG   1  
ATOM 464   O OD1  . ASN A 1 29 ? 32.629 -11.102 3.273   1.00 0.00 ? 29 ASN A OD1  1  
ATOM 465   N ND2  . ASN A 1 29 ? 30.702 -10.307 2.364   1.00 0.00 ? 29 ASN A ND2  1  
ATOM 466   H H    . ASN A 1 29 ? 33.878 -7.681  -0.087  1.00 0.00 ? 29 ASN A H    1  
ATOM 467   H HA   . ASN A 1 29 ? 31.429 -9.335  0.166   1.00 0.00 ? 29 ASN A HA   1  
ATOM 468   H HB2  . ASN A 1 29 ? 33.740 -9.550  1.597   1.00 0.00 ? 29 ASN A HB2  1  
ATOM 469   H HB3  . ASN A 1 29 ? 32.996 -8.356  2.617   1.00 0.00 ? 29 ASN A HB3  1  
ATOM 470   H HD21 . ASN A 1 29 ? 30.276 -9.588  1.810   1.00 0.00 ? 29 ASN A HD21 1  
ATOM 471   H HD22 . ASN A 1 29 ? 30.142 -11.047 2.731   1.00 0.00 ? 29 ASN A HD22 1  
ATOM 472   N N    . GLU A 1 30 ? 30.704 -7.153  2.129   1.00 0.00 ? 30 GLU A N    1  
ATOM 473   C CA   . GLU A 1 30 ? 29.873 -5.979  2.419   1.00 0.00 ? 30 GLU A CA   1  
ATOM 474   C C    . GLU A 1 30 ? 30.295 -5.354  3.740   1.00 0.00 ? 30 GLU A C    1  
ATOM 475   O O    . GLU A 1 30 ? 30.965 -4.325  3.773   1.00 0.00 ? 30 GLU A O    1  
ATOM 476   C CB   . GLU A 1 30 ? 28.381 -6.347  2.444   1.00 0.00 ? 30 GLU A CB   1  
ATOM 477   C CG   . GLU A 1 30 ? 27.796 -6.562  1.043   1.00 0.00 ? 30 GLU A CG   1  
ATOM 478   C CD   . GLU A 1 30 ? 26.269 -6.367  1.034   1.00 0.00 ? 30 GLU A CD   1  
ATOM 479   O OE1  . GLU A 1 30 ? 25.586 -6.971  1.864   1.00 0.00 ? 30 GLU A OE1  1  
ATOM 480   O OE2  . GLU A 1 30 ? 25.779 -5.607  0.200   1.00 0.00 ? 30 GLU A OE2  1  
ATOM 481   H H    . GLU A 1 30 ? 30.898 -7.824  2.842   1.00 0.00 ? 30 GLU A H    1  
ATOM 482   H HA   . GLU A 1 30 ? 30.060 -5.208  1.673   1.00 0.00 ? 30 GLU A HA   1  
ATOM 483   H HB2  . GLU A 1 30 ? 28.221 -7.249  3.033   1.00 0.00 ? 30 GLU A HB2  1  
ATOM 484   H HB3  . GLU A 1 30 ? 27.834 -5.548  2.948   1.00 0.00 ? 30 GLU A HB3  1  
ATOM 485   H HG2  . GLU A 1 30 ? 28.235 -5.851  0.345   1.00 0.00 ? 30 GLU A HG2  1  
ATOM 486   H HG3  . GLU A 1 30 ? 28.034 -7.563  0.684   1.00 0.00 ? 30 GLU A HG3  1  
ATOM 487   N N    . ASN A 1 31 ? 29.864 -6.034  4.817   1.00 0.00 ? 31 ASN A N    1  
ATOM 488   C CA   . ASN A 1 31 ? 30.224 -5.614  6.164   1.00 0.00 ? 31 ASN A CA   1  
ATOM 489   C C    . ASN A 1 31 ? 31.746 -5.639  6.362   1.00 0.00 ? 31 ASN A C    1  
ATOM 490   O O    . ASN A 1 31 ? 32.257 -4.948  7.223   1.00 0.00 ? 31 ASN A O    1  
ATOM 491   C CB   . ASN A 1 31 ? 29.562 -6.563  7.183   1.00 0.00 ? 31 ASN A CB   1  
ATOM 492   C CG   . ASN A 1 31 ? 28.563 -5.823  8.077   1.00 0.00 ? 31 ASN A CG   1  
ATOM 493   O OD1  . ASN A 1 31 ? 27.716 -5.065  7.612   1.00 0.00 ? 31 ASN A OD1  1  
ATOM 494   N ND2  . ASN A 1 31 ? 28.714 -6.085  9.387   1.00 0.00 ? 31 ASN A ND2  1  
ATOM 495   H H    . ASN A 1 31 ? 29.326 -6.866  4.679   1.00 0.00 ? 31 ASN A H    1  
ATOM 496   H HA   . ASN A 1 31 ? 29.891 -4.577  6.278   1.00 0.00 ? 31 ASN A HA   1  
ATOM 497   H HB2  . ASN A 1 31 ? 29.027 -7.358  6.665   1.00 0.00 ? 31 ASN A HB2  1  
ATOM 498   H HB3  . ASN A 1 31 ? 30.292 -7.073  7.816   1.00 0.00 ? 31 ASN A HB3  1  
ATOM 499   H HD21 . ASN A 1 31 ? 29.418 -6.727  9.710   1.00 0.00 ? 31 ASN A HD21 1  
ATOM 500   H HD22 . ASN A 1 31 ? 28.117 -5.640  10.045  1.00 0.00 ? 31 ASN A HD22 1  
ATOM 501   N N    . LEU A 1 32 ? 32.418 -6.467  5.526   1.00 0.00 ? 32 LEU A N    1  
ATOM 502   C CA   . LEU A 1 32 ? 33.865 -6.616  5.643   1.00 0.00 ? 32 LEU A CA   1  
ATOM 503   C C    . LEU A 1 32 ? 34.563 -5.378  5.051   1.00 0.00 ? 32 LEU A C    1  
ATOM 504   O O    . LEU A 1 32 ? 35.487 -4.823  5.636   1.00 0.00 ? 32 LEU A O    1  
ATOM 505   C CB   . LEU A 1 32 ? 34.326 -7.879  4.885   1.00 0.00 ? 32 LEU A CB   1  
ATOM 506   C CG   . LEU A 1 32 ? 35.455 -8.693  5.548   1.00 0.00 ? 32 LEU A CG   1  
ATOM 507   C CD1  . LEU A 1 32 ? 36.236 -9.451  4.477   1.00 0.00 ? 32 LEU A CD1  1  
ATOM 508   C CD2  . LEU A 1 32 ? 36.409 -7.862  6.411   1.00 0.00 ? 32 LEU A CD2  1  
ATOM 509   H H    . LEU A 1 32 ? 31.917 -6.952  4.808   1.00 0.00 ? 32 LEU A H    1  
ATOM 510   H HA   . LEU A 1 32 ? 34.074 -6.688  6.711   1.00 0.00 ? 32 LEU A HA   1  
ATOM 511   H HB2  . LEU A 1 32 ? 33.483 -8.550  4.736   1.00 0.00 ? 32 LEU A HB2  1  
ATOM 512   H HB3  . LEU A 1 32 ? 34.628 -7.610  3.872   1.00 0.00 ? 32 LEU A HB3  1  
ATOM 513   H HG   . LEU A 1 32 ? 35.005 -9.437  6.205   1.00 0.00 ? 32 LEU A HG   1  
ATOM 514   H HD11 . LEU A 1 32 ? 36.689 -8.753  3.779   1.00 0.00 ? 32 LEU A HD11 1  
ATOM 515   H HD12 . LEU A 1 32 ? 35.576 -10.115 3.918   1.00 0.00 ? 32 LEU A HD12 1  
ATOM 516   H HD13 . LEU A 1 32 ? 37.046 -10.028 4.920   1.00 0.00 ? 32 LEU A HD13 1  
ATOM 517   H HD21 . LEU A 1 32 ? 37.309 -8.430  6.643   1.00 0.00 ? 32 LEU A HD21 1  
ATOM 518   H HD22 . LEU A 1 32 ? 35.939 -7.596  7.357   1.00 0.00 ? 32 LEU A HD22 1  
ATOM 519   H HD23 . LEU A 1 32 ? 36.724 -6.951  5.910   1.00 0.00 ? 32 LEU A HD23 1  
ATOM 520   N N    . ALA A 1 33 ? 34.056 -4.994  3.860   1.00 0.00 ? 33 ALA A N    1  
ATOM 521   C CA   . ALA A 1 33 ? 34.614 -3.855  3.144   1.00 0.00 ? 33 ALA A CA   1  
ATOM 522   C C    . ALA A 1 33 ? 34.457 -2.561  3.927   1.00 0.00 ? 33 ALA A C    1  
ATOM 523   O O    . ALA A 1 33 ? 35.409 -1.809  4.088   1.00 0.00 ? 33 ALA A O    1  
ATOM 524   C CB   . ALA A 1 33 ? 33.964 -3.683  1.787   1.00 0.00 ? 33 ALA A CB   1  
ATOM 525   H H    . ALA A 1 33 ? 33.296 -5.505  3.456   1.00 0.00 ? 33 ALA A H    1  
ATOM 526   H HA   . ALA A 1 33 ? 35.672 -4.037  3.005   1.00 0.00 ? 33 ALA A HA   1  
ATOM 527   H HB1  . ALA A 1 33 ? 34.418 -2.804  1.334   1.00 0.00 ? 33 ALA A HB1  1  
ATOM 528   H HB2  . ALA A 1 33 ? 32.885 -3.532  1.857   1.00 0.00 ? 33 ALA A HB2  1  
ATOM 529   H HB3  . ALA A 1 33 ? 34.153 -4.536  1.136   1.00 0.00 ? 33 ALA A HB3  1  
ATOM 530   N N    . ALA A 1 34 ? 33.220 -2.360  4.420   1.00 0.00 ? 34 ALA A N    1  
ATOM 531   C CA   . ALA A 1 34 ? 32.955 -1.219  5.285   1.00 0.00 ? 34 ALA A CA   1  
ATOM 532   C C    . ALA A 1 34 ? 33.908 -1.239  6.492   1.00 0.00 ? 34 ALA A C    1  
ATOM 533   O O    . ALA A 1 34 ? 34.569 -0.263  6.782   1.00 0.00 ? 34 ALA A O    1  
ATOM 534   C CB   . ALA A 1 34 ? 31.496 -1.226  5.744   1.00 0.00 ? 34 ALA A CB   1  
ATOM 535   H H    . ALA A 1 34 ? 32.500 -3.016  4.199   1.00 0.00 ? 34 ALA A H    1  
ATOM 536   H HA   . ALA A 1 34 ? 33.156 -0.319  4.699   1.00 0.00 ? 34 ALA A HA   1  
ATOM 537   H HB1  . ALA A 1 34 ? 31.248 -2.136  6.294   1.00 0.00 ? 34 ALA A HB1  1  
ATOM 538   H HB2  . ALA A 1 34 ? 30.819 -1.159  4.892   1.00 0.00 ? 34 ALA A HB2  1  
ATOM 539   H HB3  . ALA A 1 34 ? 31.298 -0.370  6.389   1.00 0.00 ? 34 ALA A HB3  1  
ATOM 540   N N    . ASN A 1 35 ? 33.988 -2.423  7.139   1.00 0.00 ? 35 ASN A N    1  
ATOM 541   C CA   . ASN A 1 35 ? 34.884 -2.529  8.293   1.00 0.00 ? 35 ASN A CA   1  
ATOM 542   C C    . ASN A 1 35 ? 36.345 -2.185  7.943   1.00 0.00 ? 35 ASN A C    1  
ATOM 543   O O    . ASN A 1 35 ? 37.051 -1.643  8.768   1.00 0.00 ? 35 ASN A O    1  
ATOM 544   C CB   . ASN A 1 35 ? 34.864 -3.948  8.885   1.00 0.00 ? 35 ASN A CB   1  
ATOM 545   C CG   . ASN A 1 35 ? 34.826 -3.936  10.418  1.00 0.00 ? 35 ASN A CG   1  
ATOM 546   O OD1  . ASN A 1 35 ? 34.974 -2.911  11.081  1.00 0.00 ? 35 ASN A OD1  1  
ATOM 547   N ND2  . ASN A 1 35 ? 34.580 -5.152  10.932  1.00 0.00 ? 35 ASN A ND2  1  
ATOM 548   H H    . ASN A 1 35 ? 33.458 -3.203  6.814   1.00 0.00 ? 35 ASN A H    1  
ATOM 549   H HA   . ASN A 1 35 ? 34.512 -1.783  9.004   1.00 0.00 ? 35 ASN A HA   1  
ATOM 550   H HB2  . ASN A 1 35 ? 33.992 -4.482  8.540   1.00 0.00 ? 35 ASN A HB2  1  
ATOM 551   H HB3  . ASN A 1 35 ? 35.701 -4.563  8.548   1.00 0.00 ? 35 ASN A HB3  1  
ATOM 552   H HD21 . ASN A 1 35 ? 34.493 -5.949  10.325  1.00 0.00 ? 35 ASN A HD21 1  
ATOM 553   H HD22 . ASN A 1 35 ? 34.470 -5.276  11.911  1.00 0.00 ? 35 ASN A HD22 1  
ATOM 554   N N    . PHE A 1 36 ? 36.748 -2.514  6.691   1.00 0.00 ? 36 PHE A N    1  
ATOM 555   C CA   . PHE A 1 36 ? 38.107 -2.212  6.228   1.00 0.00 ? 36 PHE A CA   1  
ATOM 556   C C    . PHE A 1 36 ? 38.337 -0.687  6.232   1.00 0.00 ? 36 PHE A C    1  
ATOM 557   O O    . PHE A 1 36 ? 39.280 -0.197  6.831   1.00 0.00 ? 36 PHE A O    1  
ATOM 558   C CB   . PHE A 1 36 ? 38.327 -2.826  4.828   1.00 0.00 ? 36 PHE A CB   1  
ATOM 559   C CG   . PHE A 1 36 ? 39.704 -2.615  4.227   1.00 0.00 ? 36 PHE A CG   1  
ATOM 560   C CD1  . PHE A 1 36 ? 40.139 -1.349  3.838   1.00 0.00 ? 36 PHE A CD1  1  
ATOM 561   C CD2  . PHE A 1 36 ? 40.548 -3.698  3.999   1.00 0.00 ? 36 PHE A CD2  1  
ATOM 562   C CE1  . PHE A 1 36 ? 41.371 -1.159  3.232   1.00 0.00 ? 36 PHE A CE1  1  
ATOM 563   C CE2  . PHE A 1 36 ? 41.786 -3.515  3.391   1.00 0.00 ? 36 PHE A CE2  1  
ATOM 564   C CZ   . PHE A 1 36 ? 42.198 -2.247  3.003   1.00 0.00 ? 36 PHE A CZ   1  
ATOM 565   H H    . PHE A 1 36 ? 36.088 -2.928  6.067   1.00 0.00 ? 36 PHE A H    1  
ATOM 566   H HA   . PHE A 1 36 ? 38.796 -2.674  6.939   1.00 0.00 ? 36 PHE A HA   1  
ATOM 567   H HB2  . PHE A 1 36 ? 38.123 -3.893  4.878   1.00 0.00 ? 36 PHE A HB2  1  
ATOM 568   H HB3  . PHE A 1 36 ? 37.604 -2.434  4.121   1.00 0.00 ? 36 PHE A HB3  1  
ATOM 569   H HD1  . PHE A 1 36 ? 39.510 -0.482  3.957   1.00 0.00 ? 36 PHE A HD1  1  
ATOM 570   H HD2  . PHE A 1 36 ? 40.236 -4.697  4.268   1.00 0.00 ? 36 PHE A HD2  1  
ATOM 571   H HE1  . PHE A 1 36 ? 41.666 -0.166  2.921   1.00 0.00 ? 36 PHE A HE1  1  
ATOM 572   H HE2  . PHE A 1 36 ? 42.426 -4.363  3.201   1.00 0.00 ? 36 PHE A HE2  1  
ATOM 573   H HZ   . PHE A 1 36 ? 43.149 -2.106  2.514   1.00 0.00 ? 36 PHE A HZ   1  
ATOM 574   N N    . LEU A 1 37 ? 37.427 0.016   5.516   1.00 0.00 ? 37 LEU A N    1  
ATOM 575   C CA   . LEU A 1 37 ? 37.602 1.445   5.267   1.00 0.00 ? 37 LEU A CA   1  
ATOM 576   C C    . LEU A 1 37 ? 37.435 2.283   6.550   1.00 0.00 ? 37 LEU A C    1  
ATOM 577   O O    . LEU A 1 37 ? 38.024 3.354   6.686   1.00 0.00 ? 37 LEU A O    1  
ATOM 578   C CB   . LEU A 1 37 ? 36.593 1.920   4.214   1.00 0.00 ? 37 LEU A CB   1  
ATOM 579   C CG   . LEU A 1 37 ? 36.735 1.265   2.828   1.00 0.00 ? 37 LEU A CG   1  
ATOM 580   C CD1  . LEU A 1 37 ? 35.467 0.509   2.433   1.00 0.00 ? 37 LEU A CD1  1  
ATOM 581   C CD2  . LEU A 1 37 ? 37.107 2.268   1.721   1.00 0.00 ? 37 LEU A CD2  1  
ATOM 582   H H    . LEU A 1 37 ? 36.626 -0.442  5.137   1.00 0.00 ? 37 LEU A H    1  
ATOM 583   H HA   . LEU A 1 37 ? 38.612 1.592   4.886   1.00 0.00 ? 37 LEU A HA   1  
ATOM 584   H HB2  . LEU A 1 37 ? 35.584 1.768   4.576   1.00 0.00 ? 37 LEU A HB2  1  
ATOM 585   H HB3  . LEU A 1 37 ? 36.705 2.993   4.138   1.00 0.00 ? 37 LEU A HB3  1  
ATOM 586   H HG   . LEU A 1 37 ? 37.539 0.539   2.905   1.00 0.00 ? 37 LEU A HG   1  
ATOM 587   H HD11 . LEU A 1 37 ? 35.708 -0.399  1.879   1.00 0.00 ? 37 LEU A HD11 1  
ATOM 588   H HD12 . LEU A 1 37 ? 34.831 1.141   1.824   1.00 0.00 ? 37 LEU A HD12 1  
ATOM 589   H HD13 . LEU A 1 37 ? 34.853 0.248   3.290   1.00 0.00 ? 37 LEU A HD13 1  
ATOM 590   H HD21 . LEU A 1 37 ? 38.111 2.060   1.369   1.00 0.00 ? 37 LEU A HD21 1  
ATOM 591   H HD22 . LEU A 1 37 ? 37.098 3.293   2.066   1.00 0.00 ? 37 LEU A HD22 1  
ATOM 592   H HD23 . LEU A 1 37 ? 36.419 2.261   0.875   1.00 0.00 ? 37 LEU A HD23 1  
ATOM 593   N N    . LEU A 1 38 ? 36.601 1.744   7.466   1.00 0.00 ? 38 LEU A N    1  
ATOM 594   C CA   . LEU A 1 38 ? 36.271 2.462   8.696   1.00 0.00 ? 38 LEU A CA   1  
ATOM 595   C C    . LEU A 1 38 ? 37.343 2.177   9.769   1.00 0.00 ? 38 LEU A C    1  
ATOM 596   O O    . LEU A 1 38 ? 37.564 2.974   10.676  1.00 0.00 ? 38 LEU A O    1  
ATOM 597   C CB   . LEU A 1 38 ? 34.856 2.110   9.228   1.00 0.00 ? 38 LEU A CB   1  
ATOM 598   C CG   . LEU A 1 38 ? 33.660 2.132   8.238   1.00 0.00 ? 38 LEU A CG   1  
ATOM 599   C CD1  . LEU A 1 38 ? 32.440 2.880   8.778   1.00 0.00 ? 38 LEU A CD1  1  
ATOM 600   C CD2  . LEU A 1 38 ? 33.999 2.678   6.856   1.00 0.00 ? 38 LEU A CD2  1  
ATOM 601   H H    . LEU A 1 38 ? 36.167 0.862   7.291   1.00 0.00 ? 38 LEU A H    1  
ATOM 602   H HA   . LEU A 1 38 ? 36.299 3.524   8.457   1.00 0.00 ? 38 LEU A HA   1  
ATOM 603   H HB2  . LEU A 1 38 ? 34.894 1.116   9.671   1.00 0.00 ? 38 LEU A HB2  1  
ATOM 604   H HB3  . LEU A 1 38 ? 34.629 2.800   10.043  1.00 0.00 ? 38 LEU A HB3  1  
ATOM 605   H HG   . LEU A 1 38 ? 33.300 1.113   8.125   1.00 0.00 ? 38 LEU A HG   1  
ATOM 606   H HD11 . LEU A 1 38 ? 32.661 3.938   8.920   1.00 0.00 ? 38 LEU A HD11 1  
ATOM 607   H HD12 . LEU A 1 38 ? 32.104 2.450   9.718   1.00 0.00 ? 38 LEU A HD12 1  
ATOM 608   H HD13 . LEU A 1 38 ? 31.609 2.803   8.073   1.00 0.00 ? 38 LEU A HD13 1  
ATOM 609   H HD21 . LEU A 1 38 ? 34.769 3.438   6.917   1.00 0.00 ? 38 LEU A HD21 1  
ATOM 610   H HD22 . LEU A 1 38 ? 33.124 3.120   6.398   1.00 0.00 ? 38 LEU A HD22 1  
ATOM 611   H HD23 . LEU A 1 38 ? 34.342 1.911   6.175   1.00 0.00 ? 38 LEU A HD23 1  
ATOM 612   N N    . SER A 1 39 ? 37.988 0.999   9.588   1.00 0.00 ? 39 SER A N    1  
ATOM 613   C CA   . SER A 1 39 ? 39.059 0.540   10.471  1.00 0.00 ? 39 SER A CA   1  
ATOM 614   C C    . SER A 1 39 ? 40.443 1.023   10.005  1.00 0.00 ? 39 SER A C    1  
ATOM 615   O O    . SER A 1 39 ? 41.429 0.835   10.708  1.00 0.00 ? 39 SER A O    1  
ATOM 616   C CB   . SER A 1 39 ? 39.063 -0.994  10.562  1.00 0.00 ? 39 SER A CB   1  
ATOM 617   O OG   . SER A 1 39 ? 39.979 -1.481  11.523  1.00 0.00 ? 39 SER A OG   1  
ATOM 618   H H    . SER A 1 39 ? 37.725 0.411   8.825   1.00 0.00 ? 39 SER A H    1  
ATOM 619   H HA   . SER A 1 39 ? 38.862 0.960   11.455  1.00 0.00 ? 39 SER A HA   1  
ATOM 620   H HB2  . SER A 1 39 ? 38.083 -1.347  10.883  1.00 0.00 ? 39 SER A HB2  1  
ATOM 621   H HB3  . SER A 1 39 ? 39.274 -1.451  9.587   1.00 0.00 ? 39 SER A HB3  1  
ATOM 622   H HG   . SER A 1 39 ? 40.850 -1.155  11.327  1.00 0.00 ? 39 SER A HG   1  
ATOM 623   N N    . GLN A 1 40 ? 40.463 1.660   8.809   1.00 0.00 ? 40 GLN A N    1  
ATOM 624   C CA   . GLN A 1 40 ? 41.692 2.294   8.333   1.00 0.00 ? 40 GLN A CA   1  
ATOM 625   C C    . GLN A 1 40 ? 41.884 3.634   9.071   1.00 0.00 ? 40 GLN A C    1  
ATOM 626   O O    . GLN A 1 40 ? 41.497 4.700   8.602   1.00 0.00 ? 40 GLN A O    1  
ATOM 627   C CB   . GLN A 1 40 ? 41.665 2.507   6.804   1.00 0.00 ? 40 GLN A CB   1  
ATOM 628   C CG   . GLN A 1 40 ? 42.067 1.285   5.961   1.00 0.00 ? 40 GLN A CG   1  
ATOM 629   C CD   . GLN A 1 40 ? 43.476 0.727   6.243   1.00 0.00 ? 40 GLN A CD   1  
ATOM 630   O OE1  . GLN A 1 40 ? 43.637 -0.272  6.937   1.00 0.00 ? 40 GLN A OE1  1  
ATOM 631   N NE2  . GLN A 1 40 ? 44.445 1.318   5.519   1.00 0.00 ? 40 GLN A NE2  1  
ATOM 632   H H    . GLN A 1 40 ? 39.615 1.752   8.286   1.00 0.00 ? 40 GLN A H    1  
ATOM 633   H HA   . GLN A 1 40 ? 42.525 1.641   8.595   1.00 0.00 ? 40 GLN A HA   1  
ATOM 634   H HB2  . GLN A 1 40 ? 40.664 2.821   6.500   1.00 0.00 ? 40 GLN A HB2  1  
ATOM 635   H HB3  . GLN A 1 40 ? 42.328 3.325   6.520   1.00 0.00 ? 40 GLN A HB3  1  
ATOM 636   H HG2  . GLN A 1 40 ? 41.372 0.469   6.110   1.00 0.00 ? 40 GLN A HG2  1  
ATOM 637   H HG3  . GLN A 1 40 ? 41.995 1.546   4.905   1.00 0.00 ? 40 GLN A HG3  1  
ATOM 638   H HE21 . GLN A 1 40 ? 44.425 2.303   5.369   1.00 0.00 ? 40 GLN A HE21 1  
ATOM 639   H HE22 . GLN A 1 40 ? 45.163 0.755   5.109   1.00 0.00 ? 40 GLN A HE22 1  
ATOM 640   N N    . ASN A 1 41 ? 42.550 3.478   10.236  1.00 0.00 ? 41 ASN A N    1  
ATOM 641   C CA   . ASN A 1 41 ? 43.046 4.576   11.069  1.00 0.00 ? 41 ASN A CA   1  
ATOM 642   C C    . ASN A 1 41 ? 43.833 5.595   10.232  1.00 0.00 ? 41 ASN A C    1  
ATOM 643   O O    . ASN A 1 41 ? 44.772 5.261   9.520   1.00 0.00 ? 41 ASN A O    1  
ATOM 644   C CB   . ASN A 1 41 ? 43.943 4.027   12.196  1.00 0.00 ? 41 ASN A CB   1  
ATOM 645   C CG   . ASN A 1 41 ? 44.647 2.716   11.798  1.00 0.00 ? 41 ASN A CG   1  
ATOM 646   O OD1  . ASN A 1 41 ? 45.505 2.677   10.918  1.00 0.00 ? 41 ASN A OD1  1  
ATOM 647   N ND2  . ASN A 1 41 ? 44.169 1.642   12.456  1.00 0.00 ? 41 ASN A ND2  1  
ATOM 648   H H    . ASN A 1 41 ? 42.770 2.546   10.522  1.00 0.00 ? 41 ASN A H    1  
ATOM 649   H HA   . ASN A 1 41 ? 42.168 5.062   11.501  1.00 0.00 ? 41 ASN A HA   1  
ATOM 650   H HB2  . ASN A 1 41 ? 44.706 4.746   12.500  1.00 0.00 ? 41 ASN A HB2  1  
ATOM 651   H HB3  . ASN A 1 41 ? 43.321 3.862   13.076  1.00 0.00 ? 41 ASN A HB3  1  
ATOM 652   H HD21 . ASN A 1 41 ? 43.546 1.785   13.230  1.00 0.00 ? 41 ASN A HD21 1  
ATOM 653   H HD22 . ASN A 1 41 ? 44.403 0.717   12.184  1.00 0.00 ? 41 ASN A HD22 1  
ATOM 654   N N    . PHE A 1 42 ? 43.344 6.849   10.372  1.00 0.00 ? 42 PHE A N    1  
ATOM 655   C CA   . PHE A 1 42 ? 43.847 7.957   9.576   1.00 0.00 ? 42 PHE A CA   1  
ATOM 656   C C    . PHE A 1 42 ? 43.206 9.259   10.080  1.00 0.00 ? 42 PHE A C    1  
ATOM 657   O O    . PHE A 1 42 ? 42.017 9.491   9.906   1.00 0.00 ? 42 PHE A O    1  
ATOM 658   C CB   . PHE A 1 42 ? 43.504 7.730   8.087   1.00 0.00 ? 42 PHE A CB   1  
ATOM 659   C CG   . PHE A 1 42 ? 44.285 8.644   7.185   1.00 0.00 ? 42 PHE A CG   1  
ATOM 660   C CD1  . PHE A 1 42 ? 45.671 8.530   7.108   1.00 0.00 ? 42 PHE A CD1  1  
ATOM 661   C CD2  . PHE A 1 42 ? 43.641 9.603   6.414   1.00 0.00 ? 42 PHE A CD2  1  
ATOM 662   C CE1  . PHE A 1 42 ? 46.402 9.365   6.276   1.00 0.00 ? 42 PHE A CE1  1  
ATOM 663   C CE2  . PHE A 1 42 ? 44.370 10.440  5.580   1.00 0.00 ? 42 PHE A CE2  1  
ATOM 664   C CZ   . PHE A 1 42 ? 45.751 10.322  5.511   1.00 0.00 ? 42 PHE A CZ   1  
ATOM 665   H H    . PHE A 1 42 ? 42.592 6.987   11.016  1.00 0.00 ? 42 PHE A H    1  
ATOM 666   H HA   . PHE A 1 42 ? 44.927 7.996   9.741   1.00 0.00 ? 42 PHE A HA   1  
ATOM 667   H HB2  . PHE A 1 42 ? 43.767 6.718   7.785   1.00 0.00 ? 42 PHE A HB2  1  
ATOM 668   H HB3  . PHE A 1 42 ? 42.430 7.812   7.899   1.00 0.00 ? 42 PHE A HB3  1  
ATOM 669   H HD1  . PHE A 1 42 ? 46.185 7.785   7.698   1.00 0.00 ? 42 PHE A HD1  1  
ATOM 670   H HD2  . PHE A 1 42 ? 42.566 9.695   6.457   1.00 0.00 ? 42 PHE A HD2  1  
ATOM 671   H HE1  . PHE A 1 42 ? 47.478 9.274   6.228   1.00 0.00 ? 42 PHE A HE1  1  
ATOM 672   H HE2  . PHE A 1 42 ? 43.861 11.183  4.986   1.00 0.00 ? 42 PHE A HE2  1  
ATOM 673   H HZ   . PHE A 1 42 ? 46.316 10.973  4.861   1.00 0.00 ? 42 PHE A HZ   1  
ATOM 674   N N    . ASP A 1 43 ? 44.076 10.080  10.707  1.00 0.00 ? 43 ASP A N    1  
ATOM 675   C CA   . ASP A 1 43 ? 43.657 11.384  11.219  1.00 0.00 ? 43 ASP A CA   1  
ATOM 676   C C    . ASP A 1 43 ? 44.313 12.490  10.369  1.00 0.00 ? 43 ASP A C    1  
ATOM 677   O O    . ASP A 1 43 ? 44.587 12.299  9.192   1.00 0.00 ? 43 ASP A O    1  
ATOM 678   C CB   . ASP A 1 43 ? 43.952 11.465  12.734  1.00 0.00 ? 43 ASP A CB   1  
ATOM 679   C CG   . ASP A 1 43 ? 45.447 11.635  13.108  1.00 0.00 ? 43 ASP A CG   1  
ATOM 680   O OD1  . ASP A 1 43 ? 46.293 10.944  12.544  1.00 0.00 ? 43 ASP A OD1  1  
ATOM 681   O OD2  . ASP A 1 43 ? 45.746 12.472  13.963  1.00 0.00 ? 43 ASP A OD2  1  
ATOM 682   H H    . ASP A 1 43 ? 45.016 9.758   10.827  1.00 0.00 ? 43 ASP A H    1  
ATOM 683   H HA   . ASP A 1 43 ? 42.577 11.479  11.083  1.00 0.00 ? 43 ASP A HA   1  
ATOM 684   H HB2  . ASP A 1 43 ? 43.382 12.297  13.145  1.00 0.00 ? 43 ASP A HB2  1  
ATOM 685   H HB3  . ASP A 1 43 ? 43.568 10.575  13.234  1.00 0.00 ? 43 ASP A HB3  1  
ATOM 686   N N    . ASP A 1 44 ? 44.559 13.634  11.048  1.00 0.00 ? 44 ASP A N    1  
ATOM 687   C CA   . ASP A 1 44 ? 45.229 14.801  10.472  1.00 0.00 ? 44 ASP A CA   1  
ATOM 688   C C    . ASP A 1 44 ? 46.445 14.423  9.602   1.00 0.00 ? 44 ASP A C    1  
ATOM 689   O O    . ASP A 1 44 ? 46.523 14.784  8.432   1.00 0.00 ? 44 ASP A O    1  
ATOM 690   C CB   . ASP A 1 44 ? 45.704 15.707  11.620  1.00 0.00 ? 44 ASP A CB   1  
ATOM 691   C CG   . ASP A 1 44 ? 44.559 16.264  12.492  1.00 0.00 ? 44 ASP A CG   1  
ATOM 692   O OD1  . ASP A 1 44 ? 43.388 16.092  12.149  1.00 0.00 ? 44 ASP A OD1  1  
ATOM 693   O OD2  . ASP A 1 44 ? 44.861 16.874  13.517  1.00 0.00 ? 44 ASP A OD2  1  
ATOM 694   H H    . ASP A 1 44 ? 44.254 13.695  12.000  1.00 0.00 ? 44 ASP A H    1  
ATOM 695   H HA   . ASP A 1 44 ? 44.496 15.311  9.843   1.00 0.00 ? 44 ASP A HA   1  
ATOM 696   H HB2  . ASP A 1 44 ? 46.385 15.153  12.267  1.00 0.00 ? 44 ASP A HB2  1  
ATOM 697   H HB3  . ASP A 1 44 ? 46.272 16.546  11.219  1.00 0.00 ? 44 ASP A HB3  1  
ATOM 698   N N    . GLU A 1 45 ? 47.364 13.673  10.248  1.00 0.00 ? 45 GLU A N    1  
ATOM 699   C CA   . GLU A 1 45 ? 48.541 13.140  9.570   1.00 0.00 ? 45 GLU A CA   1  
ATOM 700   C C    . GLU A 1 45 ? 48.256 11.693  9.104   1.00 0.00 ? 45 GLU A C    1  
ATOM 701   O O    . GLU A 1 45 ? 48.145 10.798  9.939   1.00 0.00 ? 45 GLU A O    1  
ATOM 702   C CB   . GLU A 1 45 ? 49.770 13.259  10.490  1.00 0.00 ? 45 GLU A CB   1  
ATOM 703   C CG   . GLU A 1 45 ? 49.610 12.617  11.888  1.00 0.00 ? 45 GLU A CG   1  
ATOM 704   C CD   . GLU A 1 45 ? 49.799 13.637  13.027  1.00 0.00 ? 45 GLU A CD   1  
ATOM 705   O OE1  . GLU A 1 45 ? 50.819 14.323  13.043  1.00 0.00 ? 45 GLU A OE1  1  
ATOM 706   O OE2  . GLU A 1 45 ? 48.922 13.732  13.889  1.00 0.00 ? 45 GLU A OE2  1  
ATOM 707   O OXT  . GLU A 1 45 ? 48.137 11.481  7.896   1.00 0.00 ? 45 GLU A OXT  1  
ATOM 708   H H    . GLU A 1 45 ? 47.213 13.440  11.209  1.00 0.00 ? 45 GLU A H    1  
ATOM 709   H HA   . GLU A 1 45 ? 48.732 13.760  8.690   1.00 0.00 ? 45 GLU A HA   1  
ATOM 710   H HB2  . GLU A 1 45 ? 50.634 12.810  9.999   1.00 0.00 ? 45 GLU A HB2  1  
ATOM 711   H HB3  . GLU A 1 45 ? 50.018 14.319  10.570  1.00 0.00 ? 45 GLU A HB3  1  
ATOM 712   H HG2  . GLU A 1 45 ? 48.643 12.130  12.008  1.00 0.00 ? 45 GLU A HG2  1  
ATOM 713   H HG3  . GLU A 1 45 ? 50.352 11.828  12.011  1.00 0.00 ? 45 GLU A HG3  1  
ATOM 714   N N    . GLN A 1 1  ? 31.624 -6.584  -11.606 1.00 0.00 ? 1  GLN A N    2  
ATOM 715   C CA   . GLN A 1 1  ? 30.430 -5.818  -11.286 1.00 0.00 ? 1  GLN A CA   2  
ATOM 716   C C    . GLN A 1 1  ? 30.439 -5.475  -9.798  1.00 0.00 ? 1  GLN A C    2  
ATOM 717   O O    . GLN A 1 1  ? 29.735 -6.076  -9.001  1.00 0.00 ? 1  GLN A O    2  
ATOM 718   C CB   . GLN A 1 1  ? 29.115 -6.552  -11.621 1.00 0.00 ? 1  GLN A CB   2  
ATOM 719   C CG   . GLN A 1 1  ? 28.709 -6.394  -13.090 1.00 0.00 ? 1  GLN A CG   2  
ATOM 720   C CD   . GLN A 1 1  ? 27.269 -6.888  -13.307 1.00 0.00 ? 1  GLN A CD   2  
ATOM 721   O OE1  . GLN A 1 1  ? 26.912 -8.005  -12.990 1.00 0.00 ? 1  GLN A OE1  2  
ATOM 722   N NE2  . GLN A 1 1  ? 26.469 -5.946  -13.857 1.00 0.00 ? 1  GLN A NE2  2  
ATOM 723   H H1   . GLN A 1 1  ? 32.453 -5.970  -11.425 1.00 0.00 ? 1  GLN A H1   2  
ATOM 724   H H2   . GLN A 1 1  ? 31.620 -6.868  -12.604 1.00 0.00 ? 1  GLN A H2   2  
ATOM 725   H H3   . GLN A 1 1  ? 31.672 -7.414  -10.986 1.00 0.00 ? 1  GLN A H3   2  
ATOM 726   H HA   . GLN A 1 1  ? 30.482 -4.886  -11.846 1.00 0.00 ? 1  GLN A HA   2  
ATOM 727   H HB2  . GLN A 1 1  ? 29.200 -7.608  -11.365 1.00 0.00 ? 1  GLN A HB2  2  
ATOM 728   H HB3  . GLN A 1 1  ? 28.299 -6.152  -11.014 1.00 0.00 ? 1  GLN A HB3  2  
ATOM 729   H HG2  . GLN A 1 1  ? 28.775 -5.348  -13.383 1.00 0.00 ? 1  GLN A HG2  2  
ATOM 730   H HG3  . GLN A 1 1  ? 29.374 -6.955  -13.744 1.00 0.00 ? 1  GLN A HG3  2  
ATOM 731   H HE21 . GLN A 1 1  ? 26.842 -5.054  -14.116 1.00 0.00 ? 1  GLN A HE21 2  
ATOM 732   H HE22 . GLN A 1 1  ? 25.502 -6.131  -14.005 1.00 0.00 ? 1  GLN A HE22 2  
ATOM 733   N N    . GLU A 1 2  ? 31.276 -4.458  -9.488  1.00 0.00 ? 2  GLU A N    2  
ATOM 734   C CA   . GLU A 1 2  ? 31.359 -4.008  -8.105  1.00 0.00 ? 2  GLU A CA   2  
ATOM 735   C C    . GLU A 1 2  ? 31.320 -2.486  -7.966  1.00 0.00 ? 2  GLU A C    2  
ATOM 736   O O    . GLU A 1 2  ? 31.343 -1.979  -6.857  1.00 0.00 ? 2  GLU A O    2  
ATOM 737   C CB   . GLU A 1 2  ? 32.588 -4.642  -7.425  1.00 0.00 ? 2  GLU A CB   2  
ATOM 738   C CG   . GLU A 1 2  ? 32.486 -4.658  -5.896  1.00 0.00 ? 2  GLU A CG   2  
ATOM 739   C CD   . GLU A 1 2  ? 31.128 -5.236  -5.438  1.00 0.00 ? 2  GLU A CD   2  
ATOM 740   O OE1  . GLU A 1 2  ? 30.933 -6.446  -5.549  1.00 0.00 ? 2  GLU A OE1  2  
ATOM 741   O OE2  . GLU A 1 2  ? 30.278 -4.469  -4.982  1.00 0.00 ? 2  GLU A OE2  2  
ATOM 742   H H    . GLU A 1 2  ? 31.852 -4.052  -10.191 1.00 0.00 ? 2  GLU A H    2  
ATOM 743   H HA   . GLU A 1 2  ? 30.437 -4.317  -7.621  1.00 0.00 ? 2  GLU A HA   2  
ATOM 744   H HB2  . GLU A 1 2  ? 32.687 -5.672  -7.768  1.00 0.00 ? 2  GLU A HB2  2  
ATOM 745   H HB3  . GLU A 1 2  ? 33.514 -4.148  -7.725  1.00 0.00 ? 2  GLU A HB3  2  
ATOM 746   H HG2  . GLU A 1 2  ? 33.296 -5.256  -5.483  1.00 0.00 ? 2  GLU A HG2  2  
ATOM 747   H HG3  . GLU A 1 2  ? 32.622 -3.655  -5.492  1.00 0.00 ? 2  GLU A HG3  2  
ATOM 748   N N    . LYS A 1 3  ? 31.211 -1.811  -9.130  1.00 0.00 ? 3  LYS A N    2  
ATOM 749   C CA   . LYS A 1 3  ? 31.105 -0.356  -9.226  1.00 0.00 ? 3  LYS A CA   2  
ATOM 750   C C    . LYS A 1 3  ? 29.971 0.262   -8.384  1.00 0.00 ? 3  LYS A C    2  
ATOM 751   O O    . LYS A 1 3  ? 30.011 1.442   -8.063  1.00 0.00 ? 3  LYS A O    2  
ATOM 752   C CB   . LYS A 1 3  ? 31.029 0.044   -10.693 1.00 0.00 ? 3  LYS A CB   2  
ATOM 753   C CG   . LYS A 1 3  ? 29.858 -0.585  -11.458 1.00 0.00 ? 3  LYS A CG   2  
ATOM 754   C CD   . LYS A 1 3  ? 29.975 -0.321  -12.962 1.00 0.00 ? 3  LYS A CD   2  
ATOM 755   C CE   . LYS A 1 3  ? 29.801 1.160   -13.336 1.00 0.00 ? 3  LYS A CE   2  
ATOM 756   N NZ   . LYS A 1 3  ? 30.630 1.524   -14.479 1.00 0.00 ? 3  LYS A NZ   2  
ATOM 757   H H    . LYS A 1 3  ? 31.296 -2.311  -9.988  1.00 0.00 ? 3  LYS A H    2  
ATOM 758   H HA   . LYS A 1 3  ? 32.032 0.060   -8.869  1.00 0.00 ? 3  LYS A HA   2  
ATOM 759   H HB2  . LYS A 1 3  ? 30.999 1.131   -10.750 1.00 0.00 ? 3  LYS A HB2  2  
ATOM 760   H HB3  . LYS A 1 3  ? 31.960 -0.251  -11.180 1.00 0.00 ? 3  LYS A HB3  2  
ATOM 761   H HG2  . LYS A 1 3  ? 29.851 -1.664  -11.303 1.00 0.00 ? 3  LYS A HG2  2  
ATOM 762   H HG3  . LYS A 1 3  ? 28.911 -0.223  -11.063 1.00 0.00 ? 3  LYS A HG3  2  
ATOM 763   H HD2  . LYS A 1 3  ? 30.951 -0.674  -13.300 1.00 0.00 ? 3  LYS A HD2  2  
ATOM 764   H HD3  . LYS A 1 3  ? 29.242 -0.925  -13.499 1.00 0.00 ? 3  LYS A HD3  2  
ATOM 765   H HE2  . LYS A 1 3  ? 28.759 1.367   -13.582 1.00 0.00 ? 3  LYS A HE2  2  
ATOM 766   H HE3  . LYS A 1 3  ? 30.073 1.833   -12.523 1.00 0.00 ? 3  LYS A HE3  2  
ATOM 767   H HZ1  . LYS A 1 3  ? 31.629 1.375   -14.231 1.00 0.00 ? 3  LYS A HZ1  2  
ATOM 768   H HZ2  . LYS A 1 3  ? 30.486 2.527   -14.715 1.00 0.00 ? 3  LYS A HZ2  2  
ATOM 769   H HZ3  . LYS A 1 3  ? 30.390 0.926   -15.295 1.00 0.00 ? 3  LYS A HZ3  2  
ATOM 770   N N    . GLU A 1 4  ? 28.989 -0.592  -8.032  1.00 0.00 ? 4  GLU A N    2  
ATOM 771   C CA   . GLU A 1 4  ? 27.871 -0.159  -7.202  1.00 0.00 ? 4  GLU A CA   2  
ATOM 772   C C    . GLU A 1 4  ? 28.339 0.168   -5.776  1.00 0.00 ? 4  GLU A C    2  
ATOM 773   O O    . GLU A 1 4  ? 27.988 1.183   -5.198  1.00 0.00 ? 4  GLU A O    2  
ATOM 774   C CB   . GLU A 1 4  ? 26.821 -1.289  -7.130  1.00 0.00 ? 4  GLU A CB   2  
ATOM 775   C CG   . GLU A 1 4  ? 25.467 -0.909  -7.734  1.00 0.00 ? 4  GLU A CG   2  
ATOM 776   C CD   . GLU A 1 4  ? 24.839 0.393   -7.175  1.00 0.00 ? 4  GLU A CD   2  
ATOM 777   O OE1  . GLU A 1 4  ? 25.319 0.930   -6.175  1.00 0.00 ? 4  GLU A OE1  2  
ATOM 778   O OE2  . GLU A 1 4  ? 23.865 0.864   -7.757  1.00 0.00 ? 4  GLU A OE2  2  
ATOM 779   H H    . GLU A 1 4  ? 29.048 -1.539  -8.336  1.00 0.00 ? 4  GLU A H    2  
ATOM 780   H HA   . GLU A 1 4  ? 27.481 0.749   -7.672  1.00 0.00 ? 4  GLU A HA   2  
ATOM 781   H HB2  . GLU A 1 4  ? 27.194 -2.183  -7.630  1.00 0.00 ? 4  GLU A HB2  2  
ATOM 782   H HB3  . GLU A 1 4  ? 26.644 -1.634  -6.112  1.00 0.00 ? 4  GLU A HB3  2  
ATOM 783   H HG2  . GLU A 1 4  ? 25.578 -0.824  -8.812  1.00 0.00 ? 4  GLU A HG2  2  
ATOM 784   H HG3  . GLU A 1 4  ? 24.768 -1.727  -7.576  1.00 0.00 ? 4  GLU A HG3  2  
ATOM 785   N N    . ALA A 1 5  ? 29.158 -0.769  -5.251  1.00 0.00 ? 5  ALA A N    2  
ATOM 786   C CA   . ALA A 1 5  ? 29.691 -0.507  -3.925  1.00 0.00 ? 5  ALA A CA   2  
ATOM 787   C C    . ALA A 1 5  ? 30.723 0.620   -3.972  1.00 0.00 ? 5  ALA A C    2  
ATOM 788   O O    . ALA A 1 5  ? 31.028 1.185   -2.930  1.00 0.00 ? 5  ALA A O    2  
ATOM 789   C CB   . ALA A 1 5  ? 30.282 -1.765  -3.292  1.00 0.00 ? 5  ALA A CB   2  
ATOM 790   H H    . ALA A 1 5  ? 29.431 -1.574  -5.770  1.00 0.00 ? 5  ALA A H    2  
ATOM 791   H HA   . ALA A 1 5  ? 28.856 -0.188  -3.304  1.00 0.00 ? 5  ALA A HA   2  
ATOM 792   H HB1  . ALA A 1 5  ? 31.173 -2.109  -3.818  1.00 0.00 ? 5  ALA A HB1  2  
ATOM 793   H HB2  . ALA A 1 5  ? 29.558 -2.577  -3.262  1.00 0.00 ? 5  ALA A HB2  2  
ATOM 794   H HB3  . ALA A 1 5  ? 30.548 -1.554  -2.257  1.00 0.00 ? 5  ALA A HB3  2  
ATOM 795   N N    . ILE A 1 6  ? 31.252 0.958   -5.160  1.00 0.00 ? 6  ILE A N    2  
ATOM 796   C CA   . ILE A 1 6  ? 32.350 1.931   -5.203  1.00 0.00 ? 6  ILE A CA   2  
ATOM 797   C C    . ILE A 1 6  ? 31.859 3.349   -4.890  1.00 0.00 ? 6  ILE A C    2  
ATOM 798   O O    . ILE A 1 6  ? 32.572 4.130   -4.276  1.00 0.00 ? 6  ILE A O    2  
ATOM 799   C CB   . ILE A 1 6  ? 33.137 1.860   -6.522  1.00 0.00 ? 6  ILE A CB   2  
ATOM 800   C CG1  . ILE A 1 6  ? 33.564 0.413   -6.783  1.00 0.00 ? 6  ILE A CG1  2  
ATOM 801   C CG2  . ILE A 1 6  ? 34.371 2.773   -6.547  1.00 0.00 ? 6  ILE A CG2  2  
ATOM 802   C CD1  . ILE A 1 6  ? 34.402 0.250   -8.053  1.00 0.00 ? 6  ILE A CD1  2  
ATOM 803   H H    . ILE A 1 6  ? 30.895 0.551   -6.004  1.00 0.00 ? 6  ILE A H    2  
ATOM 804   H HA   . ILE A 1 6  ? 33.026 1.651   -4.403  1.00 0.00 ? 6  ILE A HA   2  
ATOM 805   H HB   . ILE A 1 6  ? 32.484 2.186   -7.329  1.00 0.00 ? 6  ILE A HB   2  
ATOM 806   H HG12 . ILE A 1 6  ? 34.113 0.010   -5.929  1.00 0.00 ? 6  ILE A HG12 2  
ATOM 807   H HG13 . ILE A 1 6  ? 32.669 -0.185  -6.864  1.00 0.00 ? 6  ILE A HG13 2  
ATOM 808   H HG21 . ILE A 1 6  ? 35.217 2.256   -6.103  1.00 0.00 ? 6  ILE A HG21 2  
ATOM 809   H HG22 . ILE A 1 6  ? 34.245 3.698   -5.994  1.00 0.00 ? 6  ILE A HG22 2  
ATOM 810   H HG23 . ILE A 1 6  ? 34.631 3.043   -7.572  1.00 0.00 ? 6  ILE A HG23 2  
ATOM 811   H HD11 . ILE A 1 6  ? 35.403 0.643   -7.901  1.00 0.00 ? 6  ILE A HD11 2  
ATOM 812   H HD12 . ILE A 1 6  ? 33.995 0.781   -8.911  1.00 0.00 ? 6  ILE A HD12 2  
ATOM 813   H HD13 . ILE A 1 6  ? 34.473 -0.804  -8.317  1.00 0.00 ? 6  ILE A HD13 2  
ATOM 814   N N    . GLU A 1 7  ? 30.614 3.631   -5.311  1.00 0.00 ? 7  GLU A N    2  
ATOM 815   C CA   . GLU A 1 7  ? 30.024 4.924   -4.989  1.00 0.00 ? 7  GLU A CA   2  
ATOM 816   C C    . GLU A 1 7  ? 29.513 4.950   -3.536  1.00 0.00 ? 7  GLU A C    2  
ATOM 817   O O    . GLU A 1 7  ? 29.285 6.010   -2.980  1.00 0.00 ? 7  GLU A O    2  
ATOM 818   C CB   . GLU A 1 7  ? 28.895 5.241   -5.980  1.00 0.00 ? 7  GLU A CB   2  
ATOM 819   C CG   . GLU A 1 7  ? 27.745 4.221   -5.964  1.00 0.00 ? 7  GLU A CG   2  
ATOM 820   C CD   . GLU A 1 7  ? 26.544 4.726   -6.784  1.00 0.00 ? 7  GLU A CD   2  
ATOM 821   O OE1  . GLU A 1 7  ? 26.622 4.720   -8.013  1.00 0.00 ? 7  GLU A OE1  2  
ATOM 822   O OE2  . GLU A 1 7  ? 25.542 5.119   -6.186  1.00 0.00 ? 7  GLU A OE2  2  
ATOM 823   H H    . GLU A 1 7  ? 30.072 2.926   -5.767  1.00 0.00 ? 7  GLU A H    2  
ATOM 824   H HA   . GLU A 1 7  ? 30.803 5.684   -5.079  1.00 0.00 ? 7  GLU A HA   2  
ATOM 825   H HB2  . GLU A 1 7  ? 28.512 6.241   -5.774  1.00 0.00 ? 7  GLU A HB2  2  
ATOM 826   H HB3  . GLU A 1 7  ? 29.312 5.279   -6.986  1.00 0.00 ? 7  GLU A HB3  2  
ATOM 827   H HG2  . GLU A 1 7  ? 28.083 3.271   -6.375  1.00 0.00 ? 7  GLU A HG2  2  
ATOM 828   H HG3  . GLU A 1 7  ? 27.417 4.023   -4.944  1.00 0.00 ? 7  GLU A HG3  2  
ATOM 829   N N    . ARG A 1 8  ? 29.350 3.729   -2.972  1.00 0.00 ? 8  ARG A N    2  
ATOM 830   C CA   . ARG A 1 8  ? 28.816 3.591   -1.622  1.00 0.00 ? 8  ARG A CA   2  
ATOM 831   C C    . ARG A 1 8  ? 29.927 3.793   -0.592  1.00 0.00 ? 8  ARG A C    2  
ATOM 832   O O    . ARG A 1 8  ? 29.822 4.634   0.283   1.00 0.00 ? 8  ARG A O    2  
ATOM 833   C CB   . ARG A 1 8  ? 28.144 2.212   -1.468  1.00 0.00 ? 8  ARG A CB   2  
ATOM 834   C CG   . ARG A 1 8  ? 26.713 2.311   -0.913  1.00 0.00 ? 8  ARG A CG   2  
ATOM 835   C CD   . ARG A 1 8  ? 25.671 1.671   -1.833  1.00 0.00 ? 8  ARG A CD   2  
ATOM 836   N NE   . ARG A 1 8  ? 25.474 0.272   -1.474  1.00 0.00 ? 8  ARG A NE   2  
ATOM 837   C CZ   . ARG A 1 8  ? 25.017 -0.665  -2.333  1.00 0.00 ? 8  ARG A CZ   2  
ATOM 838   N NH1  . ARG A 1 8  ? 24.812 -0.388  -3.618  1.00 0.00 ? 8  ARG A NH1  2  
ATOM 839   N NH2  . ARG A 1 8  ? 24.764 -1.886  -1.878  1.00 0.00 ? 8  ARG A NH2  2  
ATOM 840   H H    . ARG A 1 8  ? 29.592 2.900   -3.470  1.00 0.00 ? 8  ARG A H    2  
ATOM 841   H HA   . ARG A 1 8  ? 28.097 4.401   -1.498  1.00 0.00 ? 8  ARG A HA   2  
ATOM 842   H HB2  . ARG A 1 8  ? 28.140 1.716   -2.436  1.00 0.00 ? 8  ARG A HB2  2  
ATOM 843   H HB3  . ARG A 1 8  ? 28.721 1.534   -0.838  1.00 0.00 ? 8  ARG A HB3  2  
ATOM 844   H HG2  . ARG A 1 8  ? 26.668 1.866   0.080   1.00 0.00 ? 8  ARG A HG2  2  
ATOM 845   H HG3  . ARG A 1 8  ? 26.425 3.349   -0.753  1.00 0.00 ? 8  ARG A HG3  2  
ATOM 846   H HD2  . ARG A 1 8  ? 24.710 2.165   -1.706  1.00 0.00 ? 8  ARG A HD2  2  
ATOM 847   H HD3  . ARG A 1 8  ? 25.946 1.760   -2.884  1.00 0.00 ? 8  ARG A HD3  2  
ATOM 848   H HE   . ARG A 1 8  ? 25.629 0.004   -0.523  1.00 0.00 ? 8  ARG A HE   2  
ATOM 849   H HH11 . ARG A 1 8  ? 25.006 0.527   -3.972  1.00 0.00 ? 8  ARG A HH11 2  
ATOM 850   H HH12 . ARG A 1 8  ? 24.466 -1.099  -4.232  1.00 0.00 ? 8  ARG A HH12 2  
ATOM 851   H HH21 . ARG A 1 8  ? 24.908 -2.097  -0.909  1.00 0.00 ? 8  ARG A HH21 2  
ATOM 852   H HH22 . ARG A 1 8  ? 24.429 -2.590  -2.503  1.00 0.00 ? 8  ARG A HH22 2  
ATOM 853   N N    . LEU A 1 9  ? 30.983 2.980   -0.803  1.00 0.00 ? 9  LEU A N    2  
ATOM 854   C CA   . LEU A 1 9  ? 32.262 2.990   -0.107  1.00 0.00 ? 9  LEU A CA   2  
ATOM 855   C C    . LEU A 1 9  ? 32.844 4.422   -0.160  1.00 0.00 ? 9  LEU A C    2  
ATOM 856   O O    . LEU A 1 9  ? 33.192 4.993   0.865   1.00 0.00 ? 9  LEU A O    2  
ATOM 857   C CB   . LEU A 1 9  ? 33.186 1.939   -0.738  1.00 0.00 ? 9  LEU A CB   2  
ATOM 858   C CG   . LEU A 1 9  ? 32.628 0.500   -0.720  1.00 0.00 ? 9  LEU A CG   2  
ATOM 859   C CD1  . LEU A 1 9  ? 33.220 -0.283  -1.896  1.00 0.00 ? 9  LEU A CD1  2  
ATOM 860   C CD2  . LEU A 1 9  ? 32.867 -0.232  0.597   1.00 0.00 ? 9  LEU A CD2  2  
ATOM 861   H H    . LEU A 1 9  ? 30.874 2.312   -1.522  1.00 0.00 ? 9  LEU A H    2  
ATOM 862   H HA   . LEU A 1 9  ? 32.083 2.670   0.914   1.00 0.00 ? 9  LEU A HA   2  
ATOM 863   H HB2  . LEU A 1 9  ? 33.370 2.248   -1.765  1.00 0.00 ? 9  LEU A HB2  2  
ATOM 864   H HB3  . LEU A 1 9  ? 34.156 1.926   -0.244  1.00 0.00 ? 9  LEU A HB3  2  
ATOM 865   H HG   . LEU A 1 9  ? 31.546 0.514   -0.811  1.00 0.00 ? 9  LEU A HG   2  
ATOM 866   H HD11 . LEU A 1 9  ? 33.255 0.305   -2.802  1.00 0.00 ? 9  LEU A HD11 2  
ATOM 867   H HD12 . LEU A 1 9  ? 32.604 -1.135  -2.143  1.00 0.00 ? 9  LEU A HD12 2  
ATOM 868   H HD13 . LEU A 1 9  ? 34.245 -0.599  -1.703  1.00 0.00 ? 9  LEU A HD13 2  
ATOM 869   H HD21 . LEU A 1 9  ? 33.879 -0.621  0.633   1.00 0.00 ? 9  LEU A HD21 2  
ATOM 870   H HD22 . LEU A 1 9  ? 32.187 -1.073  0.703   1.00 0.00 ? 9  LEU A HD22 2  
ATOM 871   H HD23 . LEU A 1 9  ? 32.704 0.423   1.449   1.00 0.00 ? 9  LEU A HD23 2  
ATOM 872   N N    . LYS A 1 10 ? 32.871 5.000   -1.379  1.00 0.00 ? 10 LYS A N    2  
ATOM 873   C CA   . LYS A 1 10 ? 33.298 6.403   -1.493  1.00 0.00 ? 10 LYS A CA   2  
ATOM 874   C C    . LYS A 1 10 ? 32.352 7.384   -0.770  1.00 0.00 ? 10 LYS A C    2  
ATOM 875   O O    . LYS A 1 10 ? 32.796 8.400   -0.261  1.00 0.00 ? 10 LYS A O    2  
ATOM 876   C CB   . LYS A 1 10 ? 33.372 6.858   -2.954  1.00 0.00 ? 10 LYS A CB   2  
ATOM 877   C CG   . LYS A 1 10 ? 34.646 6.412   -3.658  1.00 0.00 ? 10 LYS A CG   2  
ATOM 878   C CD   . LYS A 1 10 ? 34.929 7.262   -4.896  1.00 0.00 ? 10 LYS A CD   2  
ATOM 879   C CE   . LYS A 1 10 ? 33.691 7.484   -5.765  1.00 0.00 ? 10 LYS A CE   2  
ATOM 880   N NZ   . LYS A 1 10 ? 34.064 7.886   -7.111  1.00 0.00 ? 10 LYS A NZ   2  
ATOM 881   H H    . LYS A 1 10 ? 32.568 4.472   -2.172  1.00 0.00 ? 10 LYS A H    2  
ATOM 882   H HA   . LYS A 1 10 ? 34.281 6.483   -1.021  1.00 0.00 ? 10 LYS A HA   2  
ATOM 883   H HB2  . LYS A 1 10 ? 32.491 6.540   -3.513  1.00 0.00 ? 10 LYS A HB2  2  
ATOM 884   H HB3  . LYS A 1 10 ? 33.367 7.948   -2.991  1.00 0.00 ? 10 LYS A HB3  2  
ATOM 885   H HG2  . LYS A 1 10 ? 35.480 6.520   -2.970  1.00 0.00 ? 10 LYS A HG2  2  
ATOM 886   H HG3  . LYS A 1 10 ? 34.594 5.356   -3.916  1.00 0.00 ? 10 LYS A HG3  2  
ATOM 887   H HD2  . LYS A 1 10 ? 35.337 8.229   -4.591  1.00 0.00 ? 10 LYS A HD2  2  
ATOM 888   H HD3  . LYS A 1 10 ? 35.695 6.774   -5.486  1.00 0.00 ? 10 LYS A HD3  2  
ATOM 889   H HE2  . LYS A 1 10 ? 33.094 6.573   -5.846  1.00 0.00 ? 10 LYS A HE2  2  
ATOM 890   H HE3  . LYS A 1 10 ? 33.069 8.269   -5.330  1.00 0.00 ? 10 LYS A HE3  2  
ATOM 891   H HZ1  . LYS A 1 10 ? 34.623 8.761   -7.064  1.00 0.00 ? 10 LYS A HZ1  2  
ATOM 892   H HZ2  . LYS A 1 10 ? 33.213 8.047   -7.687  1.00 0.00 ? 10 LYS A HZ2  2  
ATOM 893   H HZ3  . LYS A 1 10 ? 34.638 7.132   -7.539  1.00 0.00 ? 10 LYS A HZ3  2  
ATOM 894   N N    . ALA A 1 11 ? 31.043 7.043   -0.777  1.00 0.00 ? 11 ALA A N    2  
ATOM 895   C CA   . ALA A 1 11 ? 30.045 7.942   -0.190  1.00 0.00 ? 11 ALA A CA   2  
ATOM 896   C C    . ALA A 1 11 ? 30.204 8.093   1.337   1.00 0.00 ? 11 ALA A C    2  
ATOM 897   O O    . ALA A 1 11 ? 29.718 9.056   1.912   1.00 0.00 ? 11 ALA A O    2  
ATOM 898   C CB   . ALA A 1 11 ? 28.619 7.483   -0.521  1.00 0.00 ? 11 ALA A CB   2  
ATOM 899   H H    . ALA A 1 11 ? 30.761 6.189   -1.207  1.00 0.00 ? 11 ALA A H    2  
ATOM 900   H HA   . ALA A 1 11 ? 30.203 8.921   -0.645  1.00 0.00 ? 11 ALA A HA   2  
ATOM 901   H HB1  . ALA A 1 11 ? 28.366 7.742   -1.548  1.00 0.00 ? 11 ALA A HB1  2  
ATOM 902   H HB2  . ALA A 1 11 ? 27.879 7.961   0.123   1.00 0.00 ? 11 ALA A HB2  2  
ATOM 903   H HB3  . ALA A 1 11 ? 28.488 6.411   -0.410  1.00 0.00 ? 11 ALA A HB3  2  
ATOM 904   N N    . LEU A 1 12 ? 30.922 7.123   1.950   1.00 0.00 ? 12 LEU A N    2  
ATOM 905   C CA   . LEU A 1 12 ? 31.221 7.200   3.376   1.00 0.00 ? 12 LEU A CA   2  
ATOM 906   C C    . LEU A 1 12 ? 32.383 8.200   3.674   1.00 0.00 ? 12 LEU A C    2  
ATOM 907   O O    . LEU A 1 12 ? 32.812 8.316   4.812   1.00 0.00 ? 12 LEU A O    2  
ATOM 908   C CB   . LEU A 1 12 ? 31.597 5.797   3.887   1.00 0.00 ? 12 LEU A CB   2  
ATOM 909   C CG   . LEU A 1 12 ? 30.484 4.723   3.954   1.00 0.00 ? 12 LEU A CG   2  
ATOM 910   C CD1  . LEU A 1 12 ? 30.641 3.698   2.830   1.00 0.00 ? 12 LEU A CD1  2  
ATOM 911   C CD2  . LEU A 1 12 ? 30.524 3.951   5.277   1.00 0.00 ? 12 LEU A CD2  2  
ATOM 912   H H    . LEU A 1 12 ? 31.290 6.356   1.428   1.00 0.00 ? 12 LEU A H    2  
ATOM 913   H HA   . LEU A 1 12 ? 30.328 7.557   3.891   1.00 0.00 ? 12 LEU A HA   2  
ATOM 914   H HB2  . LEU A 1 12 ? 32.385 5.442   3.234   1.00 0.00 ? 12 LEU A HB2  2  
ATOM 915   H HB3  . LEU A 1 12 ? 32.035 5.897   4.876   1.00 0.00 ? 12 LEU A HB3  2  
ATOM 916   H HG   . LEU A 1 12 ? 29.513 5.214   3.866   1.00 0.00 ? 12 LEU A HG   2  
ATOM 917   H HD11 . LEU A 1 12 ? 31.136 4.185   2.004   1.00 0.00 ? 12 LEU A HD11 2  
ATOM 918   H HD12 . LEU A 1 12 ? 29.681 3.303   2.498   1.00 0.00 ? 12 LEU A HD12 2  
ATOM 919   H HD13 . LEU A 1 12 ? 31.280 2.855   3.106   1.00 0.00 ? 12 LEU A HD13 2  
ATOM 920   H HD21 . LEU A 1 12 ? 31.361 3.258   5.276   1.00 0.00 ? 12 LEU A HD21 2  
ATOM 921   H HD22 . LEU A 1 12 ? 29.630 3.343   5.404   1.00 0.00 ? 12 LEU A HD22 2  
ATOM 922   H HD23 . LEU A 1 12 ? 30.638 4.615   6.133   1.00 0.00 ? 12 LEU A HD23 2  
ATOM 923   N N    . GLY A 1 13 ? 32.853 8.909   2.615   1.00 0.00 ? 13 GLY A N    2  
ATOM 924   C CA   . GLY A 1 13 ? 33.885 9.941   2.748   1.00 0.00 ? 13 GLY A CA   2  
ATOM 925   C C    . GLY A 1 13 ? 35.290 9.419   2.409   1.00 0.00 ? 13 GLY A C    2  
ATOM 926   O O    . GLY A 1 13 ? 36.283 9.912   2.925   1.00 0.00 ? 13 GLY A O    2  
ATOM 927   H H    . GLY A 1 13 ? 32.459 8.761   1.713   1.00 0.00 ? 13 GLY A H    2  
ATOM 928   H HA2  . GLY A 1 13 ? 33.628 10.746  2.057   1.00 0.00 ? 13 GLY A HA2  2  
ATOM 929   H HA3  . GLY A 1 13 ? 33.874 10.335  3.765   1.00 0.00 ? 13 GLY A HA3  2  
ATOM 930   N N    . PHE A 1 14 ? 35.298 8.382   1.533   1.00 0.00 ? 14 PHE A N    2  
ATOM 931   C CA   . PHE A 1 14 ? 36.526 7.662   1.191   1.00 0.00 ? 14 PHE A CA   2  
ATOM 932   C C    . PHE A 1 14 ? 36.928 8.029   -0.253  1.00 0.00 ? 14 PHE A C    2  
ATOM 933   O O    . PHE A 1 14 ? 36.742 9.169   -0.674  1.00 0.00 ? 14 PHE A O    2  
ATOM 934   C CB   . PHE A 1 14 ? 36.291 6.147   1.410   1.00 0.00 ? 14 PHE A CB   2  
ATOM 935   C CG   . PHE A 1 14 ? 35.786 5.801   2.793   1.00 0.00 ? 14 PHE A CG   2  
ATOM 936   C CD1  . PHE A 1 14 ? 36.030 6.624   3.898   1.00 0.00 ? 14 PHE A CD1  2  
ATOM 937   C CD2  . PHE A 1 14 ? 35.011 4.661   2.973   1.00 0.00 ? 14 PHE A CD2  2  
ATOM 938   C CE1  . PHE A 1 14 ? 35.420 6.367   5.114   1.00 0.00 ? 14 PHE A CE1  2  
ATOM 939   C CE2  . PHE A 1 14 ? 34.406 4.400   4.194   1.00 0.00 ? 14 PHE A CE2  2  
ATOM 940   C CZ   . PHE A 1 14 ? 34.587 5.279   5.257   1.00 0.00 ? 14 PHE A CZ   2  
ATOM 941   H H    . PHE A 1 14 ? 34.439 8.072   1.134   1.00 0.00 ? 14 PHE A H    2  
ATOM 942   H HA   . PHE A 1 14 ? 37.325 8.022   1.839   1.00 0.00 ? 14 PHE A HA   2  
ATOM 943   H HB2  . PHE A 1 14 ? 35.559 5.806   0.678   1.00 0.00 ? 14 PHE A HB2  2  
ATOM 944   H HB3  . PHE A 1 14 ? 37.191 5.570   1.229   1.00 0.00 ? 14 PHE A HB3  2  
ATOM 945   H HD1  . PHE A 1 14 ? 36.679 7.485   3.838   1.00 0.00 ? 14 PHE A HD1  2  
ATOM 946   H HD2  . PHE A 1 14 ? 34.868 3.961   2.157   1.00 0.00 ? 14 PHE A HD2  2  
ATOM 947   H HE1  . PHE A 1 14 ? 35.576 7.029   5.953   1.00 0.00 ? 14 PHE A HE1  2  
ATOM 948   H HE2  . PHE A 1 14 ? 33.770 3.533   4.290   1.00 0.00 ? 14 PHE A HE2  2  
ATOM 949   H HZ   . PHE A 1 14 ? 34.069 5.142   6.197   1.00 0.00 ? 14 PHE A HZ   2  
ATOM 950   N N    . GLU A 1 15 ? 37.492 7.032   -0.971  1.00 0.00 ? 15 GLU A N    2  
ATOM 951   C CA   . GLU A 1 15 ? 38.014 7.240   -2.324  1.00 0.00 ? 15 GLU A CA   2  
ATOM 952   C C    . GLU A 1 15 ? 38.165 5.885   -3.010  1.00 0.00 ? 15 GLU A C    2  
ATOM 953   O O    . GLU A 1 15 ? 38.555 4.906   -2.383  1.00 0.00 ? 15 GLU A O    2  
ATOM 954   C CB   . GLU A 1 15 ? 39.377 7.958   -2.283  1.00 0.00 ? 15 GLU A CB   2  
ATOM 955   C CG   . GLU A 1 15 ? 39.722 8.695   -3.585  1.00 0.00 ? 15 GLU A CG   2  
ATOM 956   C CD   . GLU A 1 15 ? 40.218 10.126  -3.305  1.00 0.00 ? 15 GLU A CD   2  
ATOM 957   O OE1  . GLU A 1 15 ? 41.410 10.304  -3.055  1.00 0.00 ? 15 GLU A OE1  2  
ATOM 958   O OE2  . GLU A 1 15 ? 39.401 11.045  -3.339  1.00 0.00 ? 15 GLU A OE2  2  
ATOM 959   H H    . GLU A 1 15 ? 37.587 6.129   -0.553  1.00 0.00 ? 15 GLU A H    2  
ATOM 960   H HA   . GLU A 1 15 ? 37.280 7.842   -2.862  1.00 0.00 ? 15 GLU A HA   2  
ATOM 961   H HB2  . GLU A 1 15 ? 39.363 8.639   -1.436  1.00 0.00 ? 15 GLU A HB2  2  
ATOM 962   H HB3  . GLU A 1 15 ? 40.201 7.278   -2.078  1.00 0.00 ? 15 GLU A HB3  2  
ATOM 963   H HG2  . GLU A 1 15 ? 40.480 8.147   -4.144  1.00 0.00 ? 15 GLU A HG2  2  
ATOM 964   H HG3  . GLU A 1 15 ? 38.859 8.740   -4.245  1.00 0.00 ? 15 GLU A HG3  2  
ATOM 965   N N    . GLU A 1 16 ? 37.840 5.902   -4.314  1.00 0.00 ? 16 GLU A N    2  
ATOM 966   C CA   . GLU A 1 16 ? 37.758 4.754   -5.224  1.00 0.00 ? 16 GLU A CA   2  
ATOM 967   C C    . GLU A 1 16 ? 38.961 3.769   -5.127  1.00 0.00 ? 16 GLU A C    2  
ATOM 968   O O    . GLU A 1 16 ? 38.834 2.596   -5.447  1.00 0.00 ? 16 GLU A O    2  
ATOM 969   C CB   . GLU A 1 16 ? 37.510 5.306   -6.644  1.00 0.00 ? 16 GLU A CB   2  
ATOM 970   C CG   . GLU A 1 16 ? 38.333 4.738   -7.816  1.00 0.00 ? 16 GLU A CG   2  
ATOM 971   C CD   . GLU A 1 16 ? 37.849 3.384   -8.369  1.00 0.00 ? 16 GLU A CD   2  
ATOM 972   O OE1  . GLU A 1 16 ? 37.127 2.672   -7.680  1.00 0.00 ? 16 GLU A OE1  2  
ATOM 973   O OE2  . GLU A 1 16 ? 38.201 3.058   -9.500  1.00 0.00 ? 16 GLU A OE2  2  
ATOM 974   H H    . GLU A 1 16 ? 37.552 6.794   -4.660  1.00 0.00 ? 16 GLU A H    2  
ATOM 975   H HA   . GLU A 1 16 ? 36.844 4.242   -4.924  1.00 0.00 ? 16 GLU A HA   2  
ATOM 976   H HB2  . GLU A 1 16 ? 36.442 5.269   -6.867  1.00 0.00 ? 16 GLU A HB2  2  
ATOM 977   H HB3  . GLU A 1 16 ? 37.736 6.369   -6.621  1.00 0.00 ? 16 GLU A HB3  2  
ATOM 978   H HG2  . GLU A 1 16 ? 38.256 5.456   -8.631  1.00 0.00 ? 16 GLU A HG2  2  
ATOM 979   H HG3  . GLU A 1 16 ? 39.393 4.676   -7.570  1.00 0.00 ? 16 GLU A HG3  2  
ATOM 980   N N    . SER A 1 17 ? 40.115 4.297   -4.670  1.00 0.00 ? 17 SER A N    2  
ATOM 981   C CA   . SER A 1 17 ? 41.314 3.480   -4.527  1.00 0.00 ? 17 SER A CA   2  
ATOM 982   C C    . SER A 1 17 ? 41.322 2.723   -3.188  1.00 0.00 ? 17 SER A C    2  
ATOM 983   O O    . SER A 1 17 ? 41.532 1.523   -3.170  1.00 0.00 ? 17 SER A O    2  
ATOM 984   C CB   . SER A 1 17 ? 42.537 4.401   -4.626  1.00 0.00 ? 17 SER A CB   2  
ATOM 985   O OG   . SER A 1 17 ? 43.122 4.395   -5.913  1.00 0.00 ? 17 SER A OG   2  
ATOM 986   H H    . SER A 1 17 ? 40.160 5.255   -4.394  1.00 0.00 ? 17 SER A H    2  
ATOM 987   H HA   . SER A 1 17 ? 41.310 2.723   -5.319  1.00 0.00 ? 17 SER A HA   2  
ATOM 988   H HB2  . SER A 1 17 ? 42.285 5.421   -4.322  1.00 0.00 ? 17 SER A HB2  2  
ATOM 989   H HB3  . SER A 1 17 ? 43.316 4.093   -3.931  1.00 0.00 ? 17 SER A HB3  2  
ATOM 990   H HG   . SER A 1 17 ? 42.475 4.654   -6.560  1.00 0.00 ? 17 SER A HG   2  
ATOM 991   N N    . LEU A 1 18 ? 41.082 3.476   -2.081  1.00 0.00 ? 18 LEU A N    2  
ATOM 992   C CA   . LEU A 1 18 ? 41.006 2.808   -0.773  1.00 0.00 ? 18 LEU A CA   2  
ATOM 993   C C    . LEU A 1 18 ? 39.796 1.880   -0.716  1.00 0.00 ? 18 LEU A C    2  
ATOM 994   O O    . LEU A 1 18 ? 39.767 0.948   0.093   1.00 0.00 ? 18 LEU A O    2  
ATOM 995   C CB   . LEU A 1 18 ? 41.093 3.790   0.419   1.00 0.00 ? 18 LEU A CB   2  
ATOM 996   C CG   . LEU A 1 18 ? 39.814 4.518   0.901   1.00 0.00 ? 18 LEU A CG   2  
ATOM 997   C CD1  . LEU A 1 18 ? 39.496 4.277   2.384   1.00 0.00 ? 18 LEU A CD1  2  
ATOM 998   C CD2  . LEU A 1 18 ? 39.946 6.028   0.711   1.00 0.00 ? 18 LEU A CD2  2  
ATOM 999   H H    . LEU A 1 18 ? 40.902 4.451   -2.173  1.00 0.00 ? 18 LEU A H    2  
ATOM 1000  H HA   . LEU A 1 18 ? 41.888 2.172   -0.717  1.00 0.00 ? 18 LEU A HA   2  
ATOM 1001  H HB2  . LEU A 1 18 ? 41.492 3.230   1.257   1.00 0.00 ? 18 LEU A HB2  2  
ATOM 1002  H HB3  . LEU A 1 18 ? 41.876 4.514   0.206   1.00 0.00 ? 18 LEU A HB3  2  
ATOM 1003  H HG   . LEU A 1 18 ? 38.969 4.158   0.319   1.00 0.00 ? 18 LEU A HG   2  
ATOM 1004  H HD11 . LEU A 1 18 ? 39.636 3.239   2.689   1.00 0.00 ? 18 LEU A HD11 2  
ATOM 1005  H HD12 . LEU A 1 18 ? 38.476 4.575   2.608   1.00 0.00 ? 18 LEU A HD12 2  
ATOM 1006  H HD13 . LEU A 1 18 ? 40.110 4.919   3.011   1.00 0.00 ? 18 LEU A HD13 2  
ATOM 1007  H HD21 . LEU A 1 18 ? 40.849 6.411   1.184   1.00 0.00 ? 18 LEU A HD21 2  
ATOM 1008  H HD22 . LEU A 1 18 ? 39.114 6.571   1.157   1.00 0.00 ? 18 LEU A HD22 2  
ATOM 1009  H HD23 . LEU A 1 18 ? 40.001 6.248   -0.346  1.00 0.00 ? 18 LEU A HD23 2  
ATOM 1010  N N    . VAL A 1 19 ? 38.847 2.170   -1.614  1.00 0.00 ? 19 VAL A N    2  
ATOM 1011  C CA   . VAL A 1 19 ? 37.568 1.506   -1.791  1.00 0.00 ? 19 VAL A CA   2  
ATOM 1012  C C    . VAL A 1 19 ? 37.742 0.152   -2.469  1.00 0.00 ? 19 VAL A C    2  
ATOM 1013  O O    . VAL A 1 19 ? 37.378 -0.870  -1.917  1.00 0.00 ? 19 VAL A O    2  
ATOM 1014  C CB   . VAL A 1 19 ? 36.688 2.467   -2.598  1.00 0.00 ? 19 VAL A CB   2  
ATOM 1015  C CG1  . VAL A 1 19 ? 35.601 1.778   -3.416  1.00 0.00 ? 19 VAL A CG1  2  
ATOM 1016  C CG2  . VAL A 1 19 ? 36.136 3.611   -1.731  1.00 0.00 ? 19 VAL A CG2  2  
ATOM 1017  H H    . VAL A 1 19 ? 39.020 2.933   -2.247  1.00 0.00 ? 19 VAL A H    2  
ATOM 1018  H HA   . VAL A 1 19 ? 37.140 1.297   -0.820  1.00 0.00 ? 19 VAL A HA   2  
ATOM 1019  H HB   . VAL A 1 19 ? 37.354 2.923   -3.323  1.00 0.00 ? 19 VAL A HB   2  
ATOM 1020  H HG11 . VAL A 1 19 ? 36.015 1.372   -4.337  1.00 0.00 ? 19 VAL A HG11 2  
ATOM 1021  H HG12 . VAL A 1 19 ? 34.815 2.478   -3.679  1.00 0.00 ? 19 VAL A HG12 2  
ATOM 1022  H HG13 . VAL A 1 19 ? 35.163 0.956   -2.869  1.00 0.00 ? 19 VAL A HG13 2  
ATOM 1023  H HG21 . VAL A 1 19 ? 36.837 3.908   -0.954  1.00 0.00 ? 19 VAL A HG21 2  
ATOM 1024  H HG22 . VAL A 1 19 ? 35.204 3.387   -1.235  1.00 0.00 ? 19 VAL A HG22 2  
ATOM 1025  H HG23 . VAL A 1 19 ? 35.928 4.477   -2.347  1.00 0.00 ? 19 VAL A HG23 2  
ATOM 1026  N N    . ILE A 1 20 ? 38.300 0.224   -3.692  1.00 0.00 ? 20 ILE A N    2  
ATOM 1027  C CA   . ILE A 1 20 ? 38.507 -0.972  -4.501  1.00 0.00 ? 20 ILE A CA   2  
ATOM 1028  C C    . ILE A 1 20 ? 39.401 -1.963  -3.779  1.00 0.00 ? 20 ILE A C    2  
ATOM 1029  O O    . ILE A 1 20 ? 39.086 -3.137  -3.720  1.00 0.00 ? 20 ILE A O    2  
ATOM 1030  C CB   . ILE A 1 20 ? 39.085 -0.571  -5.868  1.00 0.00 ? 20 ILE A CB   2  
ATOM 1031  C CG1  . ILE A 1 20 ? 37.952 -0.112  -6.788  1.00 0.00 ? 20 ILE A CG1  2  
ATOM 1032  C CG2  . ILE A 1 20 ? 39.954 -1.640  -6.562  1.00 0.00 ? 20 ILE A CG2  2  
ATOM 1033  C CD1  . ILE A 1 20 ? 37.026 -1.254  -7.221  1.00 0.00 ? 20 ILE A CD1  2  
ATOM 1034  H H    . ILE A 1 20 ? 38.559 1.114   -4.054  1.00 0.00 ? 20 ILE A H    2  
ATOM 1035  H HA   . ILE A 1 20 ? 37.533 -1.446  -4.609  1.00 0.00 ? 20 ILE A HA   2  
ATOM 1036  H HB   . ILE A 1 20 ? 39.747 0.276   -5.696  1.00 0.00 ? 20 ILE A HB   2  
ATOM 1037  H HG12 . ILE A 1 20 ? 37.363 0.658   -6.290  1.00 0.00 ? 20 ILE A HG12 2  
ATOM 1038  H HG13 . ILE A 1 20 ? 38.385 0.353   -7.673  1.00 0.00 ? 20 ILE A HG13 2  
ATOM 1039  H HG21 . ILE A 1 20 ? 40.174 -1.348  -7.588  1.00 0.00 ? 20 ILE A HG21 2  
ATOM 1040  H HG22 . ILE A 1 20 ? 39.476 -2.613  -6.602  1.00 0.00 ? 20 ILE A HG22 2  
ATOM 1041  H HG23 . ILE A 1 20 ? 40.899 -1.780  -6.039  1.00 0.00 ? 20 ILE A HG23 2  
ATOM 1042  H HD11 . ILE A 1 20 ? 37.514 -2.223  -7.205  1.00 0.00 ? 20 ILE A HD11 2  
ATOM 1043  H HD12 . ILE A 1 20 ? 36.694 -1.093  -8.245  1.00 0.00 ? 20 ILE A HD12 2  
ATOM 1044  H HD13 . ILE A 1 20 ? 36.157 -1.325  -6.565  1.00 0.00 ? 20 ILE A HD13 2  
ATOM 1045  N N    . GLN A 1 21 ? 40.503 -1.418  -3.237  1.00 0.00 ? 21 GLN A N    2  
ATOM 1046  C CA   . GLN A 1 21 ? 41.460 -2.242  -2.512  1.00 0.00 ? 21 GLN A CA   2  
ATOM 1047  C C    . GLN A 1 21 ? 40.868 -2.759  -1.180  1.00 0.00 ? 21 GLN A C    2  
ATOM 1048  O O    . GLN A 1 21 ? 41.227 -3.833  -0.726  1.00 0.00 ? 21 GLN A O    2  
ATOM 1049  C CB   . GLN A 1 21 ? 42.748 -1.426  -2.307  1.00 0.00 ? 21 GLN A CB   2  
ATOM 1050  C CG   . GLN A 1 21 ? 44.009 -2.283  -2.097  1.00 0.00 ? 21 GLN A CG   2  
ATOM 1051  C CD   . GLN A 1 21 ? 44.217 -2.713  -0.638  1.00 0.00 ? 21 GLN A CD   2  
ATOM 1052  O OE1  . GLN A 1 21 ? 44.069 -3.861  -0.275  1.00 0.00 ? 21 GLN A OE1  2  
ATOM 1053  N NE2  . GLN A 1 21 ? 44.602 -1.698  0.164   1.00 0.00 ? 21 GLN A NE2  2  
ATOM 1054  H H    . GLN A 1 21 ? 40.655 -0.439  -3.355  1.00 0.00 ? 21 GLN A H    2  
ATOM 1055  H HA   . GLN A 1 21 ? 41.670 -3.095  -3.161  1.00 0.00 ? 21 GLN A HA   2  
ATOM 1056  H HB2  . GLN A 1 21 ? 42.920 -0.854  -3.217  1.00 0.00 ? 21 GLN A HB2  2  
ATOM 1057  H HB3  . GLN A 1 21 ? 42.622 -0.671  -1.530  1.00 0.00 ? 21 GLN A HB3  2  
ATOM 1058  H HG2  . GLN A 1 21 ? 43.975 -3.178  -2.719  1.00 0.00 ? 21 GLN A HG2  2  
ATOM 1059  H HG3  . GLN A 1 21 ? 44.888 -1.726  -2.418  1.00 0.00 ? 21 GLN A HG3  2  
ATOM 1060  H HE21 . GLN A 1 21 ? 44.706 -0.769  -0.191  1.00 0.00 ? 21 GLN A HE21 2  
ATOM 1061  H HE22 . GLN A 1 21 ? 44.786 -1.875  1.127   1.00 0.00 ? 21 GLN A HE22 2  
ATOM 1062  N N    . ALA A 1 22 ? 39.931 -1.958  -0.612  1.00 0.00 ? 22 ALA A N    2  
ATOM 1063  C CA   . ALA A 1 22 ? 39.208 -2.366  0.598   1.00 0.00 ? 22 ALA A CA   2  
ATOM 1064  C C    . ALA A 1 22 ? 38.092 -3.362  0.314   1.00 0.00 ? 22 ALA A C    2  
ATOM 1065  O O    . ALA A 1 22 ? 37.594 -3.989  1.236   1.00 0.00 ? 22 ALA A O    2  
ATOM 1066  C CB   . ALA A 1 22 ? 38.473 -1.191  1.252   1.00 0.00 ? 22 ALA A CB   2  
ATOM 1067  H H    . ALA A 1 22 ? 39.676 -1.111  -1.073  1.00 0.00 ? 22 ALA A H    2  
ATOM 1068  H HA   . ALA A 1 22 ? 39.920 -2.840  1.274   1.00 0.00 ? 22 ALA A HA   2  
ATOM 1069  H HB1  . ALA A 1 22 ? 39.160 -0.477  1.687   1.00 0.00 ? 22 ALA A HB1  2  
ATOM 1070  H HB2  . ALA A 1 22 ? 37.838 -1.540  2.068   1.00 0.00 ? 22 ALA A HB2  2  
ATOM 1071  H HB3  . ALA A 1 22 ? 37.833 -0.655  0.549   1.00 0.00 ? 22 ALA A HB3  2  
ATOM 1072  N N    . TYR A 1 23 ? 37.701 -3.436  -0.972  1.00 0.00 ? 23 TYR A N    2  
ATOM 1073  C CA   . TYR A 1 23 ? 36.611 -4.321  -1.359  1.00 0.00 ? 23 TYR A CA   2  
ATOM 1074  C C    . TYR A 1 23 ? 37.195 -5.601  -1.956  1.00 0.00 ? 23 TYR A C    2  
ATOM 1075  O O    . TYR A 1 23 ? 36.555 -6.637  -1.913  1.00 0.00 ? 23 TYR A O    2  
ATOM 1076  C CB   . TYR A 1 23 ? 35.661 -3.607  -2.339  1.00 0.00 ? 23 TYR A CB   2  
ATOM 1077  C CG   . TYR A 1 23 ? 34.215 -3.946  -2.082  1.00 0.00 ? 23 TYR A CG   2  
ATOM 1078  C CD1  . TYR A 1 23 ? 33.498 -3.216  -1.152  1.00 0.00 ? 23 TYR A CD1  2  
ATOM 1079  C CD2  . TYR A 1 23 ? 33.566 -4.968  -2.761  1.00 0.00 ? 23 TYR A CD2  2  
ATOM 1080  C CE1  . TYR A 1 23 ? 32.146 -3.453  -0.931  1.00 0.00 ? 23 TYR A CE1  2  
ATOM 1081  C CE2  . TYR A 1 23 ? 32.222 -5.228  -2.543  1.00 0.00 ? 23 TYR A CE2  2  
ATOM 1082  C CZ   . TYR A 1 23 ? 31.500 -4.443  -1.648  1.00 0.00 ? 23 TYR A CZ   2  
ATOM 1083  O OH   . TYR A 1 23 ? 30.142 -4.615  -1.452  1.00 0.00 ? 23 TYR A OH   2  
ATOM 1084  H H    . TYR A 1 23 ? 38.163 -2.890  -1.668  1.00 0.00 ? 23 TYR A H    2  
ATOM 1085  H HA   . TYR A 1 23 ? 36.057 -4.590  -0.458  1.00 0.00 ? 23 TYR A HA   2  
ATOM 1086  H HB2  . TYR A 1 23 ? 35.739 -2.536  -2.176  1.00 0.00 ? 23 TYR A HB2  2  
ATOM 1087  H HB3  . TYR A 1 23 ? 35.930 -3.759  -3.388  1.00 0.00 ? 23 TYR A HB3  2  
ATOM 1088  H HD1  . TYR A 1 23 ? 34.007 -2.436  -0.610  1.00 0.00 ? 23 TYR A HD1  2  
ATOM 1089  H HD2  . TYR A 1 23 ? 34.123 -5.560  -3.463  1.00 0.00 ? 23 TYR A HD2  2  
ATOM 1090  H HE1  . TYR A 1 23 ? 31.592 -2.868  -0.210  1.00 0.00 ? 23 TYR A HE1  2  
ATOM 1091  H HE2  . TYR A 1 23 ? 31.766 -6.054  -3.077  1.00 0.00 ? 23 TYR A HE2  2  
ATOM 1092  H HH   . TYR A 1 23 ? 29.838 -5.435  -1.818  1.00 0.00 ? 23 TYR A HH   2  
ATOM 1093  N N    . PHE A 1 24 ? 38.423 -5.496  -2.501  1.00 0.00 ? 24 PHE A N    2  
ATOM 1094  C CA   . PHE A 1 24 ? 39.050 -6.617  -3.200  1.00 0.00 ? 24 PHE A CA   2  
ATOM 1095  C C    . PHE A 1 24 ? 39.872 -7.459  -2.210  1.00 0.00 ? 24 PHE A C    2  
ATOM 1096  O O    . PHE A 1 24 ? 39.909 -8.673  -2.298  1.00 0.00 ? 24 PHE A O    2  
ATOM 1097  C CB   . PHE A 1 24 ? 39.980 -6.103  -4.320  1.00 0.00 ? 24 PHE A CB   2  
ATOM 1098  C CG   . PHE A 1 24 ? 39.460 -6.391  -5.703  1.00 0.00 ? 24 PHE A CG   2  
ATOM 1099  C CD1  . PHE A 1 24 ? 39.642 -7.652  -6.256  1.00 0.00 ? 24 PHE A CD1  2  
ATOM 1100  C CD2  . PHE A 1 24 ? 38.813 -5.412  -6.446  1.00 0.00 ? 24 PHE A CD2  2  
ATOM 1101  C CE1  . PHE A 1 24 ? 39.217 -7.921  -7.550  1.00 0.00 ? 24 PHE A CE1  2  
ATOM 1102  C CE2  . PHE A 1 24 ? 38.392 -5.672  -7.745  1.00 0.00 ? 24 PHE A CE2  2  
ATOM 1103  C CZ   . PHE A 1 24 ? 38.605 -6.926  -8.298  1.00 0.00 ? 24 PHE A CZ   2  
ATOM 1104  H H    . PHE A 1 24 ? 38.945 -4.654  -2.375  1.00 0.00 ? 24 PHE A H    2  
ATOM 1105  H HA   . PHE A 1 24 ? 38.252 -7.250  -3.595  1.00 0.00 ? 24 PHE A HA   2  
ATOM 1106  H HB2  . PHE A 1 24 ? 40.180 -5.042  -4.219  1.00 0.00 ? 24 PHE A HB2  2  
ATOM 1107  H HB3  . PHE A 1 24 ? 40.966 -6.561  -4.253  1.00 0.00 ? 24 PHE A HB3  2  
ATOM 1108  H HD1  . PHE A 1 24 ? 40.104 -8.432  -5.669  1.00 0.00 ? 24 PHE A HD1  2  
ATOM 1109  H HD2  . PHE A 1 24 ? 38.624 -4.446  -6.007  1.00 0.00 ? 24 PHE A HD2  2  
ATOM 1110  H HE1  . PHE A 1 24 ? 39.358 -8.907  -7.966  1.00 0.00 ? 24 PHE A HE1  2  
ATOM 1111  H HE2  . PHE A 1 24 ? 37.901 -4.899  -8.319  1.00 0.00 ? 24 PHE A HE2  2  
ATOM 1112  H HZ   . PHE A 1 24 ? 38.292 -7.132  -9.311  1.00 0.00 ? 24 PHE A HZ   2  
ATOM 1113  N N    . ALA A 1 25 ? 40.521 -6.725  -1.273  1.00 0.00 ? 25 ALA A N    2  
ATOM 1114  C CA   . ALA A 1 25 ? 41.287 -7.361  -0.204  1.00 0.00 ? 25 ALA A CA   2  
ATOM 1115  C C    . ALA A 1 25 ? 40.350 -8.032  0.813   1.00 0.00 ? 25 ALA A C    2  
ATOM 1116  O O    . ALA A 1 25 ? 40.722 -8.986  1.478   1.00 0.00 ? 25 ALA A O    2  
ATOM 1117  C CB   . ALA A 1 25 ? 42.152 -6.312  0.498   1.00 0.00 ? 25 ALA A CB   2  
ATOM 1118  H H    . ALA A 1 25 ? 40.448 -5.733  -1.278  1.00 0.00 ? 25 ALA A H    2  
ATOM 1119  H HA   . ALA A 1 25 ? 41.925 -8.118  -0.663  1.00 0.00 ? 25 ALA A HA   2  
ATOM 1120  H HB1  . ALA A 1 25 ? 42.796 -6.752  1.259   1.00 0.00 ? 25 ALA A HB1  2  
ATOM 1121  H HB2  . ALA A 1 25 ? 41.549 -5.542  0.982   1.00 0.00 ? 25 ALA A HB2  2  
ATOM 1122  H HB3  . ALA A 1 25 ? 42.796 -5.833  -0.235  1.00 0.00 ? 25 ALA A HB3  2  
ATOM 1123  N N    . CYS A 1 26 ? 39.114 -7.488  0.858   1.00 0.00 ? 26 CYS A N    2  
ATOM 1124  C CA   . CYS A 1 26 ? 38.047 -8.076  1.659   1.00 0.00 ? 26 CYS A CA   2  
ATOM 1125  C C    . CYS A 1 26 ? 37.314 -9.217  0.919   1.00 0.00 ? 26 CYS A C    2  
ATOM 1126  O O    . CYS A 1 26 ? 36.290 -9.685  1.394   1.00 0.00 ? 26 CYS A O    2  
ATOM 1127  C CB   . CYS A 1 26 ? 37.047 -6.972  2.022   1.00 0.00 ? 26 CYS A CB   2  
ATOM 1128  S SG   . CYS A 1 26 ? 37.463 -6.236  3.626   1.00 0.00 ? 26 CYS A SG   2  
ATOM 1129  H H    . CYS A 1 26 ? 38.936 -6.658  0.333   1.00 0.00 ? 26 CYS A H    2  
ATOM 1130  H HA   . CYS A 1 26 ? 38.504 -8.472  2.567   1.00 0.00 ? 26 CYS A HA   2  
ATOM 1131  H HB2  . CYS A 1 26 ? 37.084 -6.211  1.252   1.00 0.00 ? 26 CYS A HB2  2  
ATOM 1132  H HB3  . CYS A 1 26 ? 36.008 -7.312  2.005   1.00 0.00 ? 26 CYS A HB3  2  
ATOM 1133  H HG   . CYS A 1 26 ? 37.296 -4.916  3.564   1.00 0.00 ? 26 CYS A HG   2  
ATOM 1134  N N    . GLU A 1 27 ? 37.842 -9.644  -0.254  1.00 0.00 ? 27 GLU A N    2  
ATOM 1135  C CA   . GLU A 1 27 ? 37.152 -10.687 -1.025  1.00 0.00 ? 27 GLU A CA   2  
ATOM 1136  C C    . GLU A 1 27 ? 35.688 -10.285 -1.331  1.00 0.00 ? 27 GLU A C    2  
ATOM 1137  O O    . GLU A 1 27 ? 34.737 -10.959 -0.972  1.00 0.00 ? 27 GLU A O    2  
ATOM 1138  C CB   . GLU A 1 27 ? 37.305 -12.043 -0.301  1.00 0.00 ? 27 GLU A CB   2  
ATOM 1139  C CG   . GLU A 1 27 ? 36.437 -13.210 -0.826  1.00 0.00 ? 27 GLU A CG   2  
ATOM 1140  C CD   . GLU A 1 27 ? 35.282 -13.576 0.147   1.00 0.00 ? 27 GLU A CD   2  
ATOM 1141  O OE1  . GLU A 1 27 ? 35.566 -13.958 1.284   1.00 0.00 ? 27 GLU A OE1  2  
ATOM 1142  O OE2  . GLU A 1 27 ? 34.116 -13.481 -0.235  1.00 0.00 ? 27 GLU A OE2  2  
ATOM 1143  H H    . GLU A 1 27 ? 38.713 -9.287  -0.582  1.00 0.00 ? 27 GLU A H    2  
ATOM 1144  H HA   . GLU A 1 27 ? 37.675 -10.736 -1.980  1.00 0.00 ? 27 GLU A HA   2  
ATOM 1145  H HB2  . GLU A 1 27 ? 38.350 -12.332 -0.385  1.00 0.00 ? 27 GLU A HB2  2  
ATOM 1146  H HB3  . GLU A 1 27 ? 37.181 -11.915 0.772   1.00 0.00 ? 27 GLU A HB3  2  
ATOM 1147  H HG2  . GLU A 1 27 ? 36.060 -12.993 -1.827  1.00 0.00 ? 27 GLU A HG2  2  
ATOM 1148  H HG3  . GLU A 1 27 ? 37.058 -14.094 -0.951  1.00 0.00 ? 27 GLU A HG3  2  
ATOM 1149  N N    . LYS A 1 28 ? 35.601 -9.125  -2.009  1.00 0.00 ? 28 LYS A N    2  
ATOM 1150  C CA   . LYS A 1 28 ? 34.377 -8.537  -2.553  1.00 0.00 ? 28 LYS A CA   2  
ATOM 1151  C C    . LYS A 1 28 ? 33.118 -8.805  -1.696  1.00 0.00 ? 28 LYS A C    2  
ATOM 1152  O O    . LYS A 1 28 ? 32.161 -9.419  -2.151  1.00 0.00 ? 28 LYS A O    2  
ATOM 1153  C CB   . LYS A 1 28 ? 34.222 -9.039  -3.995  1.00 0.00 ? 28 LYS A CB   2  
ATOM 1154  C CG   . LYS A 1 28 ? 35.492 -8.878  -4.850  1.00 0.00 ? 28 LYS A CG   2  
ATOM 1155  C CD   . LYS A 1 28 ? 35.789 -7.437  -5.296  1.00 0.00 ? 28 LYS A CD   2  
ATOM 1156  C CE   . LYS A 1 28 ? 35.348 -7.141  -6.730  1.00 0.00 ? 28 LYS A CE   2  
ATOM 1157  N NZ   . LYS A 1 28 ? 35.902 -8.137  -7.641  1.00 0.00 ? 28 LYS A NZ   2  
ATOM 1158  H H    . LYS A 1 28 ? 36.453 -8.657  -2.236  1.00 0.00 ? 28 LYS A H    2  
ATOM 1159  H HA   . LYS A 1 28 ? 34.540 -7.465  -2.557  1.00 0.00 ? 28 LYS A HA   2  
ATOM 1160  H HB2  . LYS A 1 28 ? 33.972 -10.099 -3.986  1.00 0.00 ? 28 LYS A HB2  2  
ATOM 1161  H HB3  . LYS A 1 28 ? 33.380 -8.537  -4.462  1.00 0.00 ? 28 LYS A HB3  2  
ATOM 1162  H HG2  . LYS A 1 28 ? 36.366 -9.263  -4.325  1.00 0.00 ? 28 LYS A HG2  2  
ATOM 1163  H HG3  . LYS A 1 28 ? 35.405 -9.538  -5.712  1.00 0.00 ? 28 LYS A HG3  2  
ATOM 1164  H HD2  . LYS A 1 28 ? 35.380 -6.703  -4.610  1.00 0.00 ? 28 LYS A HD2  2  
ATOM 1165  H HD3  . LYS A 1 28 ? 36.864 -7.294  -5.249  1.00 0.00 ? 28 LYS A HD3  2  
ATOM 1166  H HE2  . LYS A 1 28 ? 34.260 -7.150  -6.825  1.00 0.00 ? 28 LYS A HE2  2  
ATOM 1167  H HE3  . LYS A 1 28 ? 35.717 -6.160  -7.037  1.00 0.00 ? 28 LYS A HE3  2  
ATOM 1168  H HZ1  . LYS A 1 28 ? 35.991 -7.753  -8.605  1.00 0.00 ? 28 LYS A HZ1  2  
ATOM 1169  H HZ2  . LYS A 1 28 ? 35.282 -8.972  -7.660  1.00 0.00 ? 28 LYS A HZ2  2  
ATOM 1170  H HZ3  . LYS A 1 28 ? 36.842 -8.422  -7.304  1.00 0.00 ? 28 LYS A HZ3  2  
ATOM 1171  N N    . ASN A 1 29 ? 33.200 -8.339  -0.425  1.00 0.00 ? 29 ASN A N    2  
ATOM 1172  C CA   . ASN A 1 29 ? 32.188 -8.686  0.576   1.00 0.00 ? 29 ASN A CA   2  
ATOM 1173  C C    . ASN A 1 29 ? 31.279 -7.465  0.800   1.00 0.00 ? 29 ASN A C    2  
ATOM 1174  O O    . ASN A 1 29 ? 30.998 -6.762  -0.165  1.00 0.00 ? 29 ASN A O    2  
ATOM 1175  C CB   . ASN A 1 29 ? 32.898 -9.216  1.840   1.00 0.00 ? 29 ASN A CB   2  
ATOM 1176  C CG   . ASN A 1 29 ? 32.068 -10.318 2.522   1.00 0.00 ? 29 ASN A CG   2  
ATOM 1177  O OD1  . ASN A 1 29 ? 30.860 -10.240 2.648   1.00 0.00 ? 29 ASN A OD1  2  
ATOM 1178  N ND2  . ASN A 1 29 ? 32.815 -11.376 2.911   1.00 0.00 ? 29 ASN A ND2  2  
ATOM 1179  H H    . ASN A 1 29 ? 33.995 -7.792  -0.163  1.00 0.00 ? 29 ASN A H    2  
ATOM 1180  H HA   . ASN A 1 29 ? 31.576 -9.479  0.140   1.00 0.00 ? 29 ASN A HA   2  
ATOM 1181  H HB2  . ASN A 1 29 ? 33.858 -9.641  1.558   1.00 0.00 ? 29 ASN A HB2  2  
ATOM 1182  H HB3  . ASN A 1 29 ? 33.127 -8.433  2.558   1.00 0.00 ? 29 ASN A HB3  2  
ATOM 1183  H HD21 . ASN A 1 29 ? 33.812 -11.375 2.824   1.00 0.00 ? 29 ASN A HD21 2  
ATOM 1184  H HD22 . ASN A 1 29 ? 32.370 -12.181 3.288   1.00 0.00 ? 29 ASN A HD22 2  
ATOM 1185  N N    . GLU A 1 30 ? 30.829 -7.218  2.051   1.00 0.00 ? 30 GLU A N    2  
ATOM 1186  C CA   . GLU A 1 30 ? 29.989 -6.041  2.311   1.00 0.00 ? 30 GLU A CA   2  
ATOM 1187  C C    . GLU A 1 30 ? 30.373 -5.403  3.647   1.00 0.00 ? 30 GLU A C    2  
ATOM 1188  O O    . GLU A 1 30 ? 31.019 -4.373  3.697   1.00 0.00 ? 30 GLU A O    2  
ATOM 1189  C CB   . GLU A 1 30 ? 28.490 -6.391  2.294   1.00 0.00 ? 30 GLU A CB   2  
ATOM 1190  C CG   . GLU A 1 30 ? 27.956 -6.627  0.874   1.00 0.00 ? 30 GLU A CG   2  
ATOM 1191  C CD   . GLU A 1 30 ? 26.415 -6.669  0.788   1.00 0.00 ? 30 GLU A CD   2  
ATOM 1192  O OE1  . GLU A 1 30 ? 25.745 -6.088  1.643   1.00 0.00 ? 30 GLU A OE1  2  
ATOM 1193  O OE2  . GLU A 1 30 ? 25.899 -7.280  -0.148  1.00 0.00 ? 30 GLU A OE2  2  
ATOM 1194  H H    . GLU A 1 30 ? 31.040 -7.847  2.799   1.00 0.00 ? 30 GLU A H    2  
ATOM 1195  H HA   . GLU A 1 30 ? 30.211 -5.279  1.564   1.00 0.00 ? 30 GLU A HA   2  
ATOM 1196  H HB2  . GLU A 1 30 ? 28.294 -7.270  2.907   1.00 0.00 ? 30 GLU A HB2  2  
ATOM 1197  H HB3  . GLU A 1 30 ? 27.940 -5.567  2.751   1.00 0.00 ? 30 GLU A HB3  2  
ATOM 1198  H HG2  . GLU A 1 30 ? 28.305 -5.834  0.219   1.00 0.00 ? 30 GLU A HG2  2  
ATOM 1199  H HG3  . GLU A 1 30 ? 28.365 -7.555  0.482   1.00 0.00 ? 30 GLU A HG3  2  
ATOM 1200  N N    . ASN A 1 31 ? 29.922 -6.093  4.715   1.00 0.00 ? 31 ASN A N    2  
ATOM 1201  C CA   . ASN A 1 31 ? 30.229 -5.673  6.079   1.00 0.00 ? 31 ASN A CA   2  
ATOM 1202  C C    . ASN A 1 31 ? 31.742 -5.667  6.326   1.00 0.00 ? 31 ASN A C    2  
ATOM 1203  O O    . ASN A 1 31 ? 32.216 -4.972  7.211   1.00 0.00 ? 31 ASN A O    2  
ATOM 1204  C CB   . ASN A 1 31 ? 29.554 -6.653  7.064   1.00 0.00 ? 31 ASN A CB   2  
ATOM 1205  C CG   . ASN A 1 31 ? 28.578 -5.919  7.993   1.00 0.00 ? 31 ASN A CG   2  
ATOM 1206  O OD1  . ASN A 1 31 ? 28.960 -5.145  8.847   1.00 0.00 ? 31 ASN A OD1  2  
ATOM 1207  N ND2  . ASN A 1 31 ? 27.285 -6.229  7.750   1.00 0.00 ? 31 ASN A ND2  2  
ATOM 1208  H H    . ASN A 1 31 ? 29.389 -6.918  4.556   1.00 0.00 ? 31 ASN A H    2  
ATOM 1209  H HA   . ASN A 1 31 ? 29.859 -4.649  6.185   1.00 0.00 ? 31 ASN A HA   2  
ATOM 1210  H HB2  . ASN A 1 31 ? 29.030 -7.438  6.522   1.00 0.00 ? 31 ASN A HB2  2  
ATOM 1211  H HB3  . ASN A 1 31 ? 30.268 -7.178  7.702   1.00 0.00 ? 31 ASN A HB3  2  
ATOM 1212  H HD21 . ASN A 1 31 ? 27.045 -6.884  7.031   1.00 0.00 ? 31 ASN A HD21 2  
ATOM 1213  H HD22 . ASN A 1 31 ? 26.561 -5.807  8.285   1.00 0.00 ? 31 ASN A HD22 2  
ATOM 1214  N N    . LEU A 1 32 ? 32.451 -6.481  5.509   1.00 0.00 ? 32 LEU A N    2  
ATOM 1215  C CA   . LEU A 1 32 ? 33.893 -6.628  5.676   1.00 0.00 ? 32 LEU A CA   2  
ATOM 1216  C C    . LEU A 1 32 ? 34.608 -5.390  5.100   1.00 0.00 ? 32 LEU A C    2  
ATOM 1217  O O    . LEU A 1 32 ? 35.499 -4.832  5.711   1.00 0.00 ? 32 LEU A O    2  
ATOM 1218  C CB   . LEU A 1 32 ? 34.371 -7.894  4.935   1.00 0.00 ? 32 LEU A CB   2  
ATOM 1219  C CG   . LEU A 1 32 ? 35.527 -8.683  5.601   1.00 0.00 ? 32 LEU A CG   2  
ATOM 1220  C CD1  . LEU A 1 32 ? 36.399 -9.384  4.552   1.00 0.00 ? 32 LEU A CD1  2  
ATOM 1221  C CD2  . LEU A 1 32 ? 36.387 -7.877  6.583   1.00 0.00 ? 32 LEU A CD2  2  
ATOM 1222  H H    . LEU A 1 32 ? 31.980 -6.977  4.781   1.00 0.00 ? 32 LEU A H    2  
ATOM 1223  H HA   . LEU A 1 32 ? 34.071 -6.693  6.752   1.00 0.00 ? 32 LEU A HA   2  
ATOM 1224  H HB2  . LEU A 1 32 ? 33.540 -8.586  4.802   1.00 0.00 ? 32 LEU A HB2  2  
ATOM 1225  H HB3  . LEU A 1 32 ? 34.632 -7.627  3.911   1.00 0.00 ? 32 LEU A HB3  2  
ATOM 1226  H HG   . LEU A 1 32 ? 35.073 -9.470  6.203   1.00 0.00 ? 32 LEU A HG   2  
ATOM 1227  H HD11 . LEU A 1 32 ? 37.465 -9.209  4.710   1.00 0.00 ? 32 LEU A HD11 2  
ATOM 1228  H HD12 . LEU A 1 32 ? 36.174 -9.008  3.563   1.00 0.00 ? 32 LEU A HD12 2  
ATOM 1229  H HD13 . LEU A 1 32 ? 36.210 -10.458 4.545   1.00 0.00 ? 32 LEU A HD13 2  
ATOM 1230  H HD21 . LEU A 1 32 ? 37.263 -8.451  6.881   1.00 0.00 ? 32 LEU A HD21 2  
ATOM 1231  H HD22 . LEU A 1 32 ? 35.831 -7.656  7.493   1.00 0.00 ? 32 LEU A HD22 2  
ATOM 1232  H HD23 . LEU A 1 32 ? 36.747 -6.945  6.154   1.00 0.00 ? 32 LEU A HD23 2  
ATOM 1233  N N    . ALA A 1 33 ? 34.142 -5.017  3.882   1.00 0.00 ? 33 ALA A N    2  
ATOM 1234  C CA   . ALA A 1 33 ? 34.707 -3.871  3.181   1.00 0.00 ? 33 ALA A CA   2  
ATOM 1235  C C    . ALA A 1 33 ? 34.520 -2.576  3.965   1.00 0.00 ? 33 ALA A C    2  
ATOM 1236  O O    . ALA A 1 33 ? 35.452 -1.814  4.138   1.00 0.00 ? 33 ALA A O    2  
ATOM 1237  C CB   . ALA A 1 33 ? 34.041 -3.695  1.829   1.00 0.00 ? 33 ALA A CB   2  
ATOM 1238  H H    . ALA A 1 33 ? 33.410 -5.539  3.453   1.00 0.00 ? 33 ALA A H    2  
ATOM 1239  H HA   . ALA A 1 33 ? 35.773 -4.051  3.057   1.00 0.00 ? 33 ALA A HA   2  
ATOM 1240  H HB1  . ALA A 1 33 ? 34.403 -2.766  1.390   1.00 0.00 ? 33 ALA A HB1  2  
ATOM 1241  H HB2  . ALA A 1 33 ? 32.954 -3.641  1.906   1.00 0.00 ? 33 ALA A HB2  2  
ATOM 1242  H HB3  . ALA A 1 33 ? 34.292 -4.510  1.153   1.00 0.00 ? 33 ALA A HB3  2  
ATOM 1243  N N    . ALA A 1 34 ? 33.268 -2.396  4.441   1.00 0.00 ? 34 ALA A N    2  
ATOM 1244  C CA   . ALA A 1 34 ? 32.984 -1.265  5.318   1.00 0.00 ? 34 ALA A CA   2  
ATOM 1245  C C    . ALA A 1 34 ? 33.923 -1.301  6.529   1.00 0.00 ? 34 ALA A C    2  
ATOM 1246  O O    . ALA A 1 34 ? 34.578 -0.316  6.845   1.00 0.00 ? 34 ALA A O    2  
ATOM 1247  C CB   . ALA A 1 34 ? 31.520 -1.292  5.769   1.00 0.00 ? 34 ALA A CB   2  
ATOM 1248  H H    . ALA A 1 34 ? 32.559 -3.059  4.218   1.00 0.00 ? 34 ALA A H    2  
ATOM 1249  H HA   . ALA A 1 34 ? 33.175 -0.357  4.745   1.00 0.00 ? 34 ALA A HA   2  
ATOM 1250  H HB1  . ALA A 1 34 ? 31.280 -2.197  6.326   1.00 0.00 ? 34 ALA A HB1  2  
ATOM 1251  H HB2  . ALA A 1 34 ? 30.846 -1.242  4.916   1.00 0.00 ? 34 ALA A HB2  2  
ATOM 1252  H HB3  . ALA A 1 34 ? 31.302 -0.434  6.406   1.00 0.00 ? 34 ALA A HB3  2  
ATOM 1253  N N    . ASN A 1 35 ? 34.015 -2.486  7.157   1.00 0.00 ? 35 ASN A N    2  
ATOM 1254  C CA   . ASN A 1 35 ? 34.903 -2.596  8.317   1.00 0.00 ? 35 ASN A CA   2  
ATOM 1255  C C    . ASN A 1 35 ? 36.363 -2.230  7.985   1.00 0.00 ? 35 ASN A C    2  
ATOM 1256  O O    . ASN A 1 35 ? 37.053 -1.672  8.825   1.00 0.00 ? 35 ASN A O    2  
ATOM 1257  C CB   . ASN A 1 35 ? 34.867 -4.016  8.908   1.00 0.00 ? 35 ASN A CB   2  
ATOM 1258  C CG   . ASN A 1 35 ? 34.815 -3.983  10.446  1.00 0.00 ? 35 ASN A CG   2  
ATOM 1259  O OD1  . ASN A 1 35 ? 34.198 -3.134  11.058  1.00 0.00 ? 35 ASN A OD1  2  
ATOM 1260  N ND2  . ASN A 1 35 ? 35.487 -5.004  11.018  1.00 0.00 ? 35 ASN A ND2  2  
ATOM 1261  H H    . ASN A 1 35 ? 33.477 -3.263  6.830   1.00 0.00 ? 35 ASN A H    2  
ATOM 1262  H HA   . ASN A 1 35 ? 34.524 -1.856  9.027   1.00 0.00 ? 35 ASN A HA   2  
ATOM 1263  H HB2  . ASN A 1 35 ? 33.989 -4.549  8.575   1.00 0.00 ? 35 ASN A HB2  2  
ATOM 1264  H HB3  . ASN A 1 35 ? 35.701 -4.632  8.570   1.00 0.00 ? 35 ASN A HB3  2  
ATOM 1265  H HD21 . ASN A 1 35 ? 35.988 -5.665  10.460  1.00 0.00 ? 35 ASN A HD21 2  
ATOM 1266  H HD22 . ASN A 1 35 ? 35.472 -5.107  12.007  1.00 0.00 ? 35 ASN A HD22 2  
ATOM 1267  N N    . PHE A 1 36 ? 36.784 -2.548  6.740   1.00 0.00 ? 36 PHE A N    2  
ATOM 1268  C CA   . PHE A 1 36 ? 38.144 -2.237  6.289   1.00 0.00 ? 36 PHE A CA   2  
ATOM 1269  C C    . PHE A 1 36 ? 38.356 -0.708  6.284   1.00 0.00 ? 36 PHE A C    2  
ATOM 1270  O O    . PHE A 1 36 ? 39.307 -0.200  6.861   1.00 0.00 ? 36 PHE A O    2  
ATOM 1271  C CB   . PHE A 1 36 ? 38.374 -2.863  4.895   1.00 0.00 ? 36 PHE A CB   2  
ATOM 1272  C CG   . PHE A 1 36 ? 39.752 -2.656  4.298   1.00 0.00 ? 36 PHE A CG   2  
ATOM 1273  C CD1  . PHE A 1 36 ? 40.149 -1.402  3.843   1.00 0.00 ? 36 PHE A CD1  2  
ATOM 1274  C CD2  . PHE A 1 36 ? 40.629 -3.727  4.127   1.00 0.00 ? 36 PHE A CD2  2  
ATOM 1275  C CE1  . PHE A 1 36 ? 41.371 -1.218  3.213   1.00 0.00 ? 36 PHE A CE1  2  
ATOM 1276  C CE2  . PHE A 1 36 ? 41.863 -3.544  3.510   1.00 0.00 ? 36 PHE A CE2  2  
ATOM 1277  C CZ   . PHE A 1 36 ? 42.233 -2.290  3.046   1.00 0.00 ? 36 PHE A CZ   2  
ATOM 1278  H H    . PHE A 1 36 ? 36.135 -2.952  6.097   1.00 0.00 ? 36 PHE A H    2  
ATOM 1279  H HA   . PHE A 1 36 ? 38.830 -2.690  7.008   1.00 0.00 ? 36 PHE A HA   2  
ATOM 1280  H HB2  . PHE A 1 36 ? 38.173 -3.932  4.946   1.00 0.00 ? 36 PHE A HB2  2  
ATOM 1281  H HB3  . PHE A 1 36 ? 37.653 -2.477  4.181   1.00 0.00 ? 36 PHE A HB3  2  
ATOM 1282  H HD1  . PHE A 1 36 ? 39.494 -0.549  3.933   1.00 0.00 ? 36 PHE A HD1  2  
ATOM 1283  H HD2  . PHE A 1 36 ? 40.340 -4.719  4.441   1.00 0.00 ? 36 PHE A HD2  2  
ATOM 1284  H HE1  . PHE A 1 36 ? 41.631 -0.245  2.827   1.00 0.00 ? 36 PHE A HE1  2  
ATOM 1285  H HE2  . PHE A 1 36 ? 42.530 -4.382  3.364   1.00 0.00 ? 36 PHE A HE2  2  
ATOM 1286  H HZ   . PHE A 1 36 ? 43.177 -2.146  2.542   1.00 0.00 ? 36 PHE A HZ   2  
ATOM 1287  N N    . LEU A 1 37 ? 37.416 -0.031  5.583   1.00 0.00 ? 37 LEU A N    2  
ATOM 1288  C CA   . LEU A 1 37 ? 37.553 1.388   5.281   1.00 0.00 ? 37 LEU A CA   2  
ATOM 1289  C C    . LEU A 1 37 ? 37.397 2.274   6.540   1.00 0.00 ? 37 LEU A C    2  
ATOM 1290  O O    . LEU A 1 37 ? 37.979 3.348   6.633   1.00 0.00 ? 37 LEU A O    2  
ATOM 1291  C CB   . LEU A 1 37 ? 36.527 1.810   4.231   1.00 0.00 ? 37 LEU A CB   2  
ATOM 1292  C CG   . LEU A 1 37 ? 36.705 1.166   2.844   1.00 0.00 ? 37 LEU A CG   2  
ATOM 1293  C CD1  . LEU A 1 37 ? 35.436 0.441   2.399   1.00 0.00 ? 37 LEU A CD1  2  
ATOM 1294  C CD2  . LEU A 1 37 ? 37.119 2.180   1.766   1.00 0.00 ? 37 LEU A CD2  2  
ATOM 1295  H H    . LEU A 1 37 ? 36.600 -0.504  5.259   1.00 0.00 ? 37 LEU A H    2  
ATOM 1296  H HA   . LEU A 1 37 ? 38.538 1.523   4.844   1.00 0.00 ? 37 LEU A HA   2  
ATOM 1297  H HB2  . LEU A 1 37 ? 35.527 1.619   4.602   1.00 0.00 ? 37 LEU A HB2  2  
ATOM 1298  H HB3  . LEU A 1 37 ? 36.601 2.885   4.150   1.00 0.00 ? 37 LEU A HB3  2  
ATOM 1299  H HG   . LEU A 1 37 ? 37.485 0.413   2.926   1.00 0.00 ? 37 LEU A HG   2  
ATOM 1300  H HD11 . LEU A 1 37 ? 35.684 -0.471  1.855   1.00 0.00 ? 37 LEU A HD11 2  
ATOM 1301  H HD12 . LEU A 1 37 ? 34.839 1.078   1.758   1.00 0.00 ? 37 LEU A HD12 2  
ATOM 1302  H HD13 . LEU A 1 37 ? 34.778 0.190   3.224   1.00 0.00 ? 37 LEU A HD13 2  
ATOM 1303  H HD21 . LEU A 1 37 ? 38.170 2.059   1.522   1.00 0.00 ? 37 LEU A HD21 2  
ATOM 1304  H HD22 . LEU A 1 37 ? 36.978 3.205   2.077   1.00 0.00 ? 37 LEU A HD22 2  
ATOM 1305  H HD23 . LEU A 1 37 ? 36.514 2.100   0.866   1.00 0.00 ? 37 LEU A HD23 2  
ATOM 1306  N N    . LEU A 1 38 ? 36.570 1.750   7.480   1.00 0.00 ? 38 LEU A N    2  
ATOM 1307  C CA   . LEU A 1 38 ? 36.219 2.479   8.698   1.00 0.00 ? 38 LEU A CA   2  
ATOM 1308  C C    . LEU A 1 38 ? 37.286 2.218   9.789   1.00 0.00 ? 38 LEU A C    2  
ATOM 1309  O O    . LEU A 1 38 ? 37.514 3.032   10.672  1.00 0.00 ? 38 LEU A O    2  
ATOM 1310  C CB   . LEU A 1 38 ? 34.809 2.110   9.232   1.00 0.00 ? 38 LEU A CB   2  
ATOM 1311  C CG   . LEU A 1 38 ? 33.605 2.096   8.248   1.00 0.00 ? 38 LEU A CG   2  
ATOM 1312  C CD1  . LEU A 1 38 ? 32.385 2.872   8.762   1.00 0.00 ? 38 LEU A CD1  2  
ATOM 1313  C CD2  . LEU A 1 38 ? 33.938 2.590   6.844   1.00 0.00 ? 38 LEU A CD2  2  
ATOM 1314  H H    . LEU A 1 38 ? 36.182 0.844   7.337   1.00 0.00 ? 38 LEU A H    2  
ATOM 1315  H HA   . LEU A 1 38 ? 36.245 3.535   8.437   1.00 0.00 ? 38 LEU A HA   2  
ATOM 1316  H HB2  . LEU A 1 38 ? 34.870 1.125   9.692   1.00 0.00 ? 38 LEU A HB2  2  
ATOM 1317  H HB3  . LEU A 1 38 ? 34.582 2.804   10.044  1.00 0.00 ? 38 LEU A HB3  2  
ATOM 1318  H HG   . LEU A 1 38 ? 33.257 1.067   8.177   1.00 0.00 ? 38 LEU A HG   2  
ATOM 1319  H HD11 . LEU A 1 38 ? 32.601 3.937   8.857   1.00 0.00 ? 38 LEU A HD11 2  
ATOM 1320  H HD12 . LEU A 1 38 ? 32.037 2.491   9.719   1.00 0.00 ? 38 LEU A HD12 2  
ATOM 1321  H HD13 . LEU A 1 38 ? 31.554 2.769   8.062   1.00 0.00 ? 38 LEU A HD13 2  
ATOM 1322  H HD21 . LEU A 1 38 ? 34.703 3.357   6.882   1.00 0.00 ? 38 LEU A HD21 2  
ATOM 1323  H HD22 . LEU A 1 38 ? 33.064 3.016   6.372   1.00 0.00 ? 38 LEU A HD22 2  
ATOM 1324  H HD23 . LEU A 1 38 ? 34.280 1.801   6.189   1.00 0.00 ? 38 LEU A HD23 2  
ATOM 1325  N N    . SER A 1 39 ? 37.922 1.029   9.637   1.00 0.00 ? 39 SER A N    2  
ATOM 1326  C CA   . SER A 1 39 ? 38.992 0.596   10.531  1.00 0.00 ? 39 SER A CA   2  
ATOM 1327  C C    . SER A 1 39 ? 40.326 1.261   10.193  1.00 0.00 ? 39 SER A C    2  
ATOM 1328  O O    . SER A 1 39 ? 41.228 1.241   11.018  1.00 0.00 ? 39 SER A O    2  
ATOM 1329  C CB   . SER A 1 39 ? 39.177 -0.930  10.472  1.00 0.00 ? 39 SER A CB   2  
ATOM 1330  O OG   . SER A 1 39 ? 40.225 -1.390  11.307  1.00 0.00 ? 39 SER A OG   2  
ATOM 1331  H H    . SER A 1 39 ? 37.689 0.434   8.876   1.00 0.00 ? 39 SER A H    2  
ATOM 1332  H HA   . SER A 1 39 ? 38.712 0.901   11.537  1.00 0.00 ? 39 SER A HA   2  
ATOM 1333  H HB2  . SER A 1 39 ? 38.269 -1.414  10.835  1.00 0.00 ? 39 SER A HB2  2  
ATOM 1334  H HB3  . SER A 1 39 ? 39.356 -1.271  9.446   1.00 0.00 ? 39 SER A HB3  2  
ATOM 1335  H HG   . SER A 1 39 ? 41.033 -0.936  11.092  1.00 0.00 ? 39 SER A HG   2  
ATOM 1336  N N    . GLN A 1 40 ? 40.404 1.841   8.969   1.00 0.00 ? 40 GLN A N    2  
ATOM 1337  C CA   . GLN A 1 40 ? 41.630 2.518   8.547   1.00 0.00 ? 40 GLN A CA   2  
ATOM 1338  C C    . GLN A 1 40 ? 41.999 3.646   9.526   1.00 0.00 ? 40 GLN A C    2  
ATOM 1339  O O    . GLN A 1 40 ? 41.455 4.741   9.496   1.00 0.00 ? 40 GLN A O    2  
ATOM 1340  C CB   . GLN A 1 40 ? 41.514 3.103   7.135   1.00 0.00 ? 40 GLN A CB   2  
ATOM 1341  C CG   . GLN A 1 40 ? 41.280 2.050   6.047   1.00 0.00 ? 40 GLN A CG   2  
ATOM 1342  C CD   . GLN A 1 40 ? 41.789 2.603   4.710   1.00 0.00 ? 40 GLN A CD   2  
ATOM 1343  O OE1  . GLN A 1 40 ? 41.546 3.737   4.357   1.00 0.00 ? 40 GLN A OE1  2  
ATOM 1344  N NE2  . GLN A 1 40 ? 42.556 1.739   4.018   1.00 0.00 ? 40 GLN A NE2  2  
ATOM 1345  H H    . GLN A 1 40 ? 39.633 1.767   8.339   1.00 0.00 ? 40 GLN A H    2  
ATOM 1346  H HA   . GLN A 1 40 ? 42.415 1.762   8.541   1.00 0.00 ? 40 GLN A HA   2  
ATOM 1347  H HB2  . GLN A 1 40 ? 40.730 3.858   7.082   1.00 0.00 ? 40 GLN A HB2  2  
ATOM 1348  H HB3  . GLN A 1 40 ? 42.451 3.620   6.920   1.00 0.00 ? 40 GLN A HB3  2  
ATOM 1349  H HG2  . GLN A 1 40 ? 41.781 1.112   6.273   1.00 0.00 ? 40 GLN A HG2  2  
ATOM 1350  H HG3  . GLN A 1 40 ? 40.222 1.832   5.966   1.00 0.00 ? 40 GLN A HG3  2  
ATOM 1351  H HE21 . GLN A 1 40 ? 42.772 0.836   4.393   1.00 0.00 ? 40 GLN A HE21 2  
ATOM 1352  H HE22 . GLN A 1 40 ? 42.917 1.997   3.128   1.00 0.00 ? 40 GLN A HE22 2  
ATOM 1353  N N    . ASN A 1 41 ? 42.975 3.265   10.377  1.00 0.00 ? 41 ASN A N    2  
ATOM 1354  C CA   . ASN A 1 41 ? 43.448 4.125   11.450  1.00 0.00 ? 41 ASN A CA   2  
ATOM 1355  C C    . ASN A 1 41 ? 44.091 5.371   10.839  1.00 0.00 ? 41 ASN A C    2  
ATOM 1356  O O    . ASN A 1 41 ? 44.846 5.295   9.877   1.00 0.00 ? 41 ASN A O    2  
ATOM 1357  C CB   . ASN A 1 41 ? 44.481 3.394   12.322  1.00 0.00 ? 41 ASN A CB   2  
ATOM 1358  C CG   . ASN A 1 41 ? 44.148 1.909   12.549  1.00 0.00 ? 41 ASN A CG   2  
ATOM 1359  O OD1  . ASN A 1 41 ? 44.553 1.042   11.803  1.00 0.00 ? 41 ASN A OD1  2  
ATOM 1360  N ND2  . ASN A 1 41 ? 43.402 1.680   13.653  1.00 0.00 ? 41 ASN A ND2  2  
ATOM 1361  H H    . ASN A 1 41 ? 43.333 2.339   10.297  1.00 0.00 ? 41 ASN A H    2  
ATOM 1362  H HA   . ASN A 1 41 ? 42.566 4.391   12.033  1.00 0.00 ? 41 ASN A HA   2  
ATOM 1363  H HB2  . ASN A 1 41 ? 45.467 3.427   11.857  1.00 0.00 ? 41 ASN A HB2  2  
ATOM 1364  H HB3  . ASN A 1 41 ? 44.562 3.903   13.281  1.00 0.00 ? 41 ASN A HB3  2  
ATOM 1365  H HD21 . ASN A 1 41 ? 43.088 2.433   14.231  1.00 0.00 ? 41 ASN A HD21 2  
ATOM 1366  H HD22 . ASN A 1 41 ? 43.173 0.743   13.896  1.00 0.00 ? 41 ASN A HD22 2  
ATOM 1367  N N    . PHE A 1 42 ? 43.704 6.510   11.444  1.00 0.00 ? 42 PHE A N    2  
ATOM 1368  C CA   . PHE A 1 42 ? 44.083 7.806   10.911  1.00 0.00 ? 42 PHE A CA   2  
ATOM 1369  C C    . PHE A 1 42 ? 43.616 8.873   11.910  1.00 0.00 ? 42 PHE A C    2  
ATOM 1370  O O    . PHE A 1 42 ? 42.443 8.964   12.251  1.00 0.00 ? 42 PHE A O    2  
ATOM 1371  C CB   . PHE A 1 42 ? 43.460 8.014   9.515   1.00 0.00 ? 42 PHE A CB   2  
ATOM 1372  C CG   . PHE A 1 42 ? 43.625 9.420   9.000   1.00 0.00 ? 42 PHE A CG   2  
ATOM 1373  C CD1  . PHE A 1 42 ? 44.810 9.825   8.401   1.00 0.00 ? 42 PHE A CD1  2  
ATOM 1374  C CD2  . PHE A 1 42 ? 42.579 10.328  9.123   1.00 0.00 ? 42 PHE A CD2  2  
ATOM 1375  C CE1  . PHE A 1 42 ? 44.946 11.123  7.920   1.00 0.00 ? 42 PHE A CE1  2  
ATOM 1376  C CE2  . PHE A 1 42 ? 42.712 11.625  8.648   1.00 0.00 ? 42 PHE A CE2  2  
ATOM 1377  C CZ   . PHE A 1 42 ? 43.894 12.018  8.042   1.00 0.00 ? 42 PHE A CZ   2  
ATOM 1378  H H    . PHE A 1 42 ? 43.123 6.448   12.256  1.00 0.00 ? 42 PHE A H    2  
ATOM 1379  H HA   . PHE A 1 42 ? 45.173 7.812   10.850  1.00 0.00 ? 42 PHE A HA   2  
ATOM 1380  H HB2  . PHE A 1 42 ? 43.929 7.340   8.798   1.00 0.00 ? 42 PHE A HB2  2  
ATOM 1381  H HB3  . PHE A 1 42 ? 42.400 7.755   9.528   1.00 0.00 ? 42 PHE A HB3  2  
ATOM 1382  H HD1  . PHE A 1 42 ? 45.635 9.134   8.305   1.00 0.00 ? 42 PHE A HD1  2  
ATOM 1383  H HD2  . PHE A 1 42 ? 41.658 10.024  9.594   1.00 0.00 ? 42 PHE A HD2  2  
ATOM 1384  H HE1  . PHE A 1 42 ? 45.870 11.436  7.458   1.00 0.00 ? 42 PHE A HE1  2  
ATOM 1385  H HE2  . PHE A 1 42 ? 41.895 12.322  8.755   1.00 0.00 ? 42 PHE A HE2  2  
ATOM 1386  H HZ   . PHE A 1 42 ? 43.999 13.029  7.678   1.00 0.00 ? 42 PHE A HZ   2  
ATOM 1387  N N    . ASP A 1 43 ? 44.619 9.660   12.343  1.00 0.00 ? 43 ASP A N    2  
ATOM 1388  C CA   . ASP A 1 43 ? 44.378 10.741  13.292  1.00 0.00 ? 43 ASP A CA   2  
ATOM 1389  C C    . ASP A 1 43 ? 44.206 12.054  12.510  1.00 0.00 ? 43 ASP A C    2  
ATOM 1390  O O    . ASP A 1 43 ? 43.172 12.703  12.591  1.00 0.00 ? 43 ASP A O    2  
ATOM 1391  C CB   . ASP A 1 43 ? 45.525 10.833  14.321  1.00 0.00 ? 43 ASP A CB   2  
ATOM 1392  C CG   . ASP A 1 43 ? 45.935 9.455   14.889  1.00 0.00 ? 43 ASP A CG   2  
ATOM 1393  O OD1  . ASP A 1 43 ? 46.730 8.770   14.248  1.00 0.00 ? 43 ASP A OD1  2  
ATOM 1394  O OD2  . ASP A 1 43 ? 45.467 9.087   15.968  1.00 0.00 ? 43 ASP A OD2  2  
ATOM 1395  H H    . ASP A 1 43 ? 45.542 9.495   12.003  1.00 0.00 ? 43 ASP A H    2  
ATOM 1396  H HA   . ASP A 1 43 ? 43.441 10.537  13.812  1.00 0.00 ? 43 ASP A HA   2  
ATOM 1397  H HB2  . ASP A 1 43 ? 46.412 11.303  13.895  1.00 0.00 ? 43 ASP A HB2  2  
ATOM 1398  H HB3  . ASP A 1 43 ? 45.219 11.477  15.143  1.00 0.00 ? 43 ASP A HB3  2  
ATOM 1399  N N    . ASP A 1 44 ? 45.289 12.372  11.759  1.00 0.00 ? 44 ASP A N    2  
ATOM 1400  C CA   . ASP A 1 44 ? 45.414 13.567  10.923  1.00 0.00 ? 44 ASP A CA   2  
ATOM 1401  C C    . ASP A 1 44 ? 46.851 13.618  10.363  1.00 0.00 ? 44 ASP A C    2  
ATOM 1402  O O    . ASP A 1 44 ? 47.122 13.114  9.282   1.00 0.00 ? 44 ASP A O    2  
ATOM 1403  C CB   . ASP A 1 44 ? 45.034 14.885  11.650  1.00 0.00 ? 44 ASP A CB   2  
ATOM 1404  C CG   . ASP A 1 44 ? 43.568 15.329  11.445  1.00 0.00 ? 44 ASP A CG   2  
ATOM 1405  O OD1  . ASP A 1 44 ? 43.023 15.113  10.362  1.00 0.00 ? 44 ASP A OD1  2  
ATOM 1406  O OD2  . ASP A 1 44 ? 42.991 15.901  12.369  1.00 0.00 ? 44 ASP A OD2  2  
ATOM 1407  H H    . ASP A 1 44 ? 46.049 11.723  11.743  1.00 0.00 ? 44 ASP A H    2  
ATOM 1408  H HA   . ASP A 1 44 ? 44.771 13.398  10.065  1.00 0.00 ? 44 ASP A HA   2  
ATOM 1409  H HB2  . ASP A 1 44 ? 45.264 14.809  12.710  1.00 0.00 ? 44 ASP A HB2  2  
ATOM 1410  H HB3  . ASP A 1 44 ? 45.634 15.723  11.301  1.00 0.00 ? 44 ASP A HB3  2  
ATOM 1411  N N    . GLU A 1 45 ? 47.735 14.277  11.149  1.00 0.00 ? 45 GLU A N    2  
ATOM 1412  C CA   . GLU A 1 45 ? 49.115 14.523  10.736  1.00 0.00 ? 45 GLU A CA   2  
ATOM 1413  C C    . GLU A 1 45 ? 49.967 14.953  11.950  1.00 0.00 ? 45 GLU A C    2  
ATOM 1414  O O    . GLU A 1 45 ? 49.419 15.487  12.919  1.00 0.00 ? 45 GLU A O    2  
ATOM 1415  C CB   . GLU A 1 45 ? 49.202 15.546  9.580   1.00 0.00 ? 45 GLU A CB   2  
ATOM 1416  C CG   . GLU A 1 45 ? 48.804 16.995  9.920   1.00 0.00 ? 45 GLU A CG   2  
ATOM 1417  C CD   . GLU A 1 45 ? 49.952 17.806  10.567  1.00 0.00 ? 45 GLU A CD   2  
ATOM 1418  O OE1  . GLU A 1 45 ? 51.026 17.885  9.969   1.00 0.00 ? 45 GLU A OE1  2  
ATOM 1419  O OE2  . GLU A 1 45 ? 49.761 18.353  11.654  1.00 0.00 ? 45 GLU A OE2  2  
ATOM 1420  O OXT  . GLU A 1 45 ? 51.179 14.752  11.910  1.00 0.00 ? 45 GLU A OXT  2  
ATOM 1421  H H    . GLU A 1 45 ? 47.429 14.625  12.032  1.00 0.00 ? 45 GLU A H    2  
ATOM 1422  H HA   . GLU A 1 45 ? 49.487 13.563  10.375  1.00 0.00 ? 45 GLU A HA   2  
ATOM 1423  H HB2  . GLU A 1 45 ? 50.203 15.527  9.151   1.00 0.00 ? 45 GLU A HB2  2  
ATOM 1424  H HB3  . GLU A 1 45 ? 48.564 15.206  8.767   1.00 0.00 ? 45 GLU A HB3  2  
ATOM 1425  H HG2  . GLU A 1 45 ? 48.518 17.505  9.002   1.00 0.00 ? 45 GLU A HG2  2  
ATOM 1426  H HG3  . GLU A 1 45 ? 47.914 17.007  10.548  1.00 0.00 ? 45 GLU A HG3  2  
ATOM 1427  N N    . GLN A 1 1  ? 29.309 -3.814  -12.251 1.00 0.00 ? 1  GLN A N    3  
ATOM 1428  C CA   . GLN A 1 1  ? 29.785 -4.954  -11.480 1.00 0.00 ? 1  GLN A CA   3  
ATOM 1429  C C    . GLN A 1 1  ? 29.862 -4.588  -9.991  1.00 0.00 ? 1  GLN A C    3  
ATOM 1430  O O    . GLN A 1 1  ? 28.886 -4.714  -9.260  1.00 0.00 ? 1  GLN A O    3  
ATOM 1431  C CB   . GLN A 1 1  ? 31.130 -5.494  -12.004 1.00 0.00 ? 1  GLN A CB   3  
ATOM 1432  C CG   . GLN A 1 1  ? 31.000 -6.172  -13.383 1.00 0.00 ? 1  GLN A CG   3  
ATOM 1433  C CD   . GLN A 1 1  ? 31.451 -7.645  -13.374 1.00 0.00 ? 1  GLN A CD   3  
ATOM 1434  O OE1  . GLN A 1 1  ? 31.387 -8.341  -12.367 1.00 0.00 ? 1  GLN A OE1  3  
ATOM 1435  N NE2  . GLN A 1 1  ? 31.910 -8.055  -14.568 1.00 0.00 ? 1  GLN A NE2  3  
ATOM 1436  H H1   . GLN A 1 1  ? 30.031 -3.066  -12.236 1.00 0.00 ? 1  GLN A H1   3  
ATOM 1437  H H2   . GLN A 1 1  ? 28.432 -3.453  -11.821 1.00 0.00 ? 1  GLN A H2   3  
ATOM 1438  H H3   . GLN A 1 1  ? 29.124 -4.102  -13.235 1.00 0.00 ? 1  GLN A H3   3  
ATOM 1439  H HA   . GLN A 1 1  ? 29.029 -5.735  -11.567 1.00 0.00 ? 1  GLN A HA   3  
ATOM 1440  H HB2  . GLN A 1 1  ? 31.849 -4.677  -12.087 1.00 0.00 ? 1  GLN A HB2  3  
ATOM 1441  H HB3  . GLN A 1 1  ? 31.564 -6.171  -11.265 1.00 0.00 ? 1  GLN A HB3  3  
ATOM 1442  H HG2  . GLN A 1 1  ? 29.979 -6.132  -13.760 1.00 0.00 ? 1  GLN A HG2  3  
ATOM 1443  H HG3  . GLN A 1 1  ? 31.591 -5.628  -14.118 1.00 0.00 ? 1  GLN A HG3  3  
ATOM 1444  H HE21 . GLN A 1 1  ? 31.944 -7.426  -15.346 1.00 0.00 ? 1  GLN A HE21 3  
ATOM 1445  H HE22 . GLN A 1 1  ? 32.226 -8.997  -14.695 1.00 0.00 ? 1  GLN A HE22 3  
ATOM 1446  N N    . GLU A 1 2  ? 31.074 -4.137  -9.596  1.00 0.00 ? 2  GLU A N    3  
ATOM 1447  C CA   . GLU A 1 2  ? 31.327 -3.780  -8.205  1.00 0.00 ? 2  GLU A CA   3  
ATOM 1448  C C    . GLU A 1 2  ? 31.163 -2.273  -7.986  1.00 0.00 ? 2  GLU A C    3  
ATOM 1449  O O    . GLU A 1 2  ? 31.032 -1.845  -6.852  1.00 0.00 ? 2  GLU A O    3  
ATOM 1450  C CB   . GLU A 1 2  ? 32.715 -4.289  -7.776  1.00 0.00 ? 2  GLU A CB   3  
ATOM 1451  C CG   . GLU A 1 2  ? 32.852 -4.511  -6.254  1.00 0.00 ? 2  GLU A CG   3  
ATOM 1452  C CD   . GLU A 1 2  ? 33.391 -3.267  -5.519  1.00 0.00 ? 2  GLU A CD   3  
ATOM 1453  O OE1  . GLU A 1 2  ? 34.580 -2.986  -5.655  1.00 0.00 ? 2  GLU A OE1  3  
ATOM 1454  O OE2  . GLU A 1 2  ? 32.637 -2.609  -4.811  1.00 0.00 ? 2  GLU A OE2  3  
ATOM 1455  H H    . GLU A 1 2  ? 31.810 -4.020  -10.260 1.00 0.00 ? 2  GLU A H    3  
ATOM 1456  H HA   . GLU A 1 2  ? 30.567 -4.268  -7.594  1.00 0.00 ? 2  GLU A HA   3  
ATOM 1457  H HB2  . GLU A 1 2  ? 32.866 -5.257  -8.252  1.00 0.00 ? 2  GLU A HB2  3  
ATOM 1458  H HB3  . GLU A 1 2  ? 33.517 -3.661  -8.171  1.00 0.00 ? 2  GLU A HB3  3  
ATOM 1459  H HG2  . GLU A 1 2  ? 31.909 -4.841  -5.814  1.00 0.00 ? 2  GLU A HG2  3  
ATOM 1460  H HG3  . GLU A 1 2  ? 33.543 -5.326  -6.057  1.00 0.00 ? 2  GLU A HG3  3  
ATOM 1461  N N    . LYS A 1 3  ? 31.139 -1.513  -9.116  1.00 0.00 ? 3  LYS A N    3  
ATOM 1462  C CA   . LYS A 1 3  ? 30.999 -0.046  -9.127  1.00 0.00 ? 3  LYS A CA   3  
ATOM 1463  C C    . LYS A 1 3  ? 29.863 0.498   -8.241  1.00 0.00 ? 3  LYS A C    3  
ATOM 1464  O O    . LYS A 1 3  ? 29.877 1.648   -7.823  1.00 0.00 ? 3  LYS A O    3  
ATOM 1465  C CB   . LYS A 1 3  ? 30.841 0.481   -10.555 1.00 0.00 ? 3  LYS A CB   3  
ATOM 1466  C CG   . LYS A 1 3  ? 29.661 -0.126  -11.328 1.00 0.00 ? 3  LYS A CG   3  
ATOM 1467  C CD   . LYS A 1 3  ? 29.083 0.854   -12.362 1.00 0.00 ? 3  LYS A CD   3  
ATOM 1468  C CE   . LYS A 1 3  ? 28.601 0.174   -13.652 1.00 0.00 ? 3  LYS A CE   3  
ATOM 1469  N NZ   . LYS A 1 3  ? 29.365 0.633   -14.805 1.00 0.00 ? 3  LYS A NZ   3  
ATOM 1470  H H    . LYS A 1 3  ? 31.274 -1.966  -9.994  1.00 0.00 ? 3  LYS A H    3  
ATOM 1471  H HA   . LYS A 1 3  ? 31.920 0.366   -8.748  1.00 0.00 ? 3  LYS A HA   3  
ATOM 1472  H HB2  . LYS A 1 3  ? 30.750 1.568   -10.512 1.00 0.00 ? 3  LYS A HB2  3  
ATOM 1473  H HB3  . LYS A 1 3  ? 31.761 0.304   -11.114 1.00 0.00 ? 3  LYS A HB3  3  
ATOM 1474  H HG2  . LYS A 1 3  ? 30.000 -1.051  -11.797 1.00 0.00 ? 3  LYS A HG2  3  
ATOM 1475  H HG3  . LYS A 1 3  ? 28.856 -0.429  -10.659 1.00 0.00 ? 3  LYS A HG3  3  
ATOM 1476  H HD2  . LYS A 1 3  ? 28.262 1.410   -11.907 1.00 0.00 ? 3  LYS A HD2  3  
ATOM 1477  H HD3  . LYS A 1 3  ? 29.814 1.627   -12.605 1.00 0.00 ? 3  LYS A HD3  3  
ATOM 1478  H HE2  . LYS A 1 3  ? 28.693 -0.913  -13.604 1.00 0.00 ? 3  LYS A HE2  3  
ATOM 1479  H HE3  . LYS A 1 3  ? 27.550 0.398   -13.838 1.00 0.00 ? 3  LYS A HE3  3  
ATOM 1480  H HZ1  . LYS A 1 3  ? 30.379 0.479   -14.628 1.00 0.00 ? 3  LYS A HZ1  3  
ATOM 1481  H HZ2  . LYS A 1 3  ? 29.196 1.650   -14.945 1.00 0.00 ? 3  LYS A HZ2  3  
ATOM 1482  H HZ3  . LYS A 1 3  ? 29.079 0.108   -15.656 1.00 0.00 ? 3  LYS A HZ3  3  
ATOM 1483  N N    . GLU A 1 4  ? 28.900 -0.405  -7.993  1.00 0.00 ? 4  GLU A N    3  
ATOM 1484  C CA   . GLU A 1 4  ? 27.728 -0.091  -7.194  1.00 0.00 ? 4  GLU A CA   3  
ATOM 1485  C C    . GLU A 1 4  ? 28.120 0.233   -5.748  1.00 0.00 ? 4  GLU A C    3  
ATOM 1486  O O    . GLU A 1 4  ? 27.719 1.239   -5.175  1.00 0.00 ? 4  GLU A O    3  
ATOM 1487  C CB   . GLU A 1 4  ? 26.816 -1.325  -7.245  1.00 0.00 ? 4  GLU A CB   3  
ATOM 1488  C CG   . GLU A 1 4  ? 25.328 -0.960  -7.322  1.00 0.00 ? 4  GLU A CG   3  
ATOM 1489  C CD   . GLU A 1 4  ? 24.608 -1.286  -6.007  1.00 0.00 ? 4  GLU A CD   3  
ATOM 1490  O OE1  . GLU A 1 4  ? 24.574 -0.428  -5.132  1.00 0.00 ? 4  GLU A OE1  3  
ATOM 1491  O OE2  . GLU A 1 4  ? 24.092 -2.396  -5.882  1.00 0.00 ? 4  GLU A OE2  3  
ATOM 1492  H H    . GLU A 1 4  ? 28.996 -1.320  -8.380  1.00 0.00 ? 4  GLU A H    3  
ATOM 1493  H HA   . GLU A 1 4  ? 27.278 0.790   -7.656  1.00 0.00 ? 4  GLU A HA   3  
ATOM 1494  H HB2  . GLU A 1 4  ? 27.058 -1.903  -8.133  1.00 0.00 ? 4  GLU A HB2  3  
ATOM 1495  H HB3  . GLU A 1 4  ? 27.038 -2.035  -6.444  1.00 0.00 ? 4  GLU A HB3  3  
ATOM 1496  H HG2  . GLU A 1 4  ? 25.188 0.094   -7.559  1.00 0.00 ? 4  GLU A HG2  3  
ATOM 1497  H HG3  . GLU A 1 4  ? 24.859 -1.505  -8.140  1.00 0.00 ? 4  GLU A HG3  3  
ATOM 1498  N N    . ALA A 1 5  ? 28.953 -0.688  -5.220  1.00 0.00 ? 5  ALA A N    3  
ATOM 1499  C CA   . ALA A 1 5  ? 29.494 -0.490  -3.891  1.00 0.00 ? 5  ALA A CA   3  
ATOM 1500  C C    . ALA A 1 5  ? 30.609 0.565   -3.907  1.00 0.00 ? 5  ALA A C    3  
ATOM 1501  O O    . ALA A 1 5  ? 30.941 1.086   -2.867  1.00 0.00 ? 5  ALA A O    3  
ATOM 1502  C CB   . ALA A 1 5  ? 29.978 -1.819  -3.292  1.00 0.00 ? 5  ALA A CB   3  
ATOM 1503  H H    . ALA A 1 5  ? 29.232 -1.487  -5.751  1.00 0.00 ? 5  ALA A H    3  
ATOM 1504  H HA   . ALA A 1 5  ? 28.678 -0.102  -3.280  1.00 0.00 ? 5  ALA A HA   3  
ATOM 1505  H HB1  . ALA A 1 5  ? 31.043 -1.822  -3.091  1.00 0.00 ? 5  ALA A HB1  3  
ATOM 1506  H HB2  . ALA A 1 5  ? 29.792 -2.662  -3.959  1.00 0.00 ? 5  ALA A HB2  3  
ATOM 1507  H HB3  . ALA A 1 5  ? 29.484 -2.007  -2.337  1.00 0.00 ? 5  ALA A HB3  3  
ATOM 1508  N N    . ILE A 1 6  ? 31.166 0.880   -5.102  1.00 0.00 ? 6  ILE A N    3  
ATOM 1509  C CA   . ILE A 1 6  ? 32.270 1.849   -5.114  1.00 0.00 ? 6  ILE A CA   3  
ATOM 1510  C C    . ILE A 1 6  ? 31.775 3.265   -4.800  1.00 0.00 ? 6  ILE A C    3  
ATOM 1511  O O    . ILE A 1 6  ? 32.400 3.976   -4.040  1.00 0.00 ? 6  ILE A O    3  
ATOM 1512  C CB   . ILE A 1 6  ? 33.118 1.793   -6.390  1.00 0.00 ? 6  ILE A CB   3  
ATOM 1513  C CG1  . ILE A 1 6  ? 33.516 0.347   -6.693  1.00 0.00 ? 6  ILE A CG1  3  
ATOM 1514  C CG2  . ILE A 1 6  ? 34.387 2.664   -6.285  1.00 0.00 ? 6  ILE A CG2  3  
ATOM 1515  C CD1  . ILE A 1 6  ? 34.368 0.189   -7.955  1.00 0.00 ? 6  ILE A CD1  3  
ATOM 1516  H H    . ILE A 1 6  ? 30.832 0.477   -5.952  1.00 0.00 ? 6  ILE A H    3  
ATOM 1517  H HA   . ILE A 1 6  ? 32.930 1.567   -4.305  1.00 0.00 ? 6  ILE A HA   3  
ATOM 1518  H HB   . ILE A 1 6  ? 32.500 2.168   -7.203  1.00 0.00 ? 6  ILE A HB   3  
ATOM 1519  H HG12 . ILE A 1 6  ? 34.034 -0.081  -5.834  1.00 0.00 ? 6  ILE A HG12 3  
ATOM 1520  H HG13 . ILE A 1 6  ? 32.624 -0.251  -6.801  1.00 0.00 ? 6  ILE A HG13 3  
ATOM 1521  H HG21 . ILE A 1 6  ? 35.292 2.065   -6.236  1.00 0.00 ? 6  ILE A HG21 3  
ATOM 1522  H HG22 . ILE A 1 6  ? 34.395 3.267   -5.383  1.00 0.00 ? 6  ILE A HG22 3  
ATOM 1523  H HG23 . ILE A 1 6  ? 34.495 3.321   -7.146  1.00 0.00 ? 6  ILE A HG23 3  
ATOM 1524  H HD11 . ILE A 1 6  ? 35.351 0.641   -7.841  1.00 0.00 ? 6  ILE A HD11 3  
ATOM 1525  H HD12 . ILE A 1 6  ? 33.944 0.652   -8.841  1.00 0.00 ? 6  ILE A HD12 3  
ATOM 1526  H HD13 . ILE A 1 6  ? 34.469 -0.874  -8.171  1.00 0.00 ? 6  ILE A HD13 3  
ATOM 1527  N N    . GLU A 1 7  ? 30.614 3.620   -5.383  1.00 0.00 ? 7  GLU A N    3  
ATOM 1528  C CA   . GLU A 1 7  ? 30.062 4.936   -5.066  1.00 0.00 ? 7  GLU A CA   3  
ATOM 1529  C C    . GLU A 1 7  ? 29.544 5.022   -3.615  1.00 0.00 ? 7  GLU A C    3  
ATOM 1530  O O    . GLU A 1 7  ? 29.357 6.107   -3.085  1.00 0.00 ? 7  GLU A O    3  
ATOM 1531  C CB   . GLU A 1 7  ? 28.950 5.298   -6.057  1.00 0.00 ? 7  GLU A CB   3  
ATOM 1532  C CG   . GLU A 1 7  ? 27.694 4.400   -5.977  1.00 0.00 ? 7  GLU A CG   3  
ATOM 1533  C CD   . GLU A 1 7  ? 26.426 5.217   -6.303  1.00 0.00 ? 7  GLU A CD   3  
ATOM 1534  O OE1  . GLU A 1 7  ? 26.217 5.551   -7.467  1.00 0.00 ? 7  GLU A OE1  3  
ATOM 1535  O OE2  . GLU A 1 7  ? 25.666 5.515   -5.381  1.00 0.00 ? 7  GLU A OE2  3  
ATOM 1536  H H    . GLU A 1 7  ? 30.144 2.983   -5.988  1.00 0.00 ? 7  GLU A H    3  
ATOM 1537  H HA   . GLU A 1 7  ? 30.877 5.656   -5.163  1.00 0.00 ? 7  GLU A HA   3  
ATOM 1538  H HB2  . GLU A 1 7  ? 28.696 6.347   -5.892  1.00 0.00 ? 7  GLU A HB2  3  
ATOM 1539  H HB3  . GLU A 1 7  ? 29.343 5.262   -7.073  1.00 0.00 ? 7  GLU A HB3  3  
ATOM 1540  H HG2  . GLU A 1 7  ? 27.780 3.553   -6.661  1.00 0.00 ? 7  GLU A HG2  3  
ATOM 1541  H HG3  . GLU A 1 7  ? 27.563 3.954   -4.992  1.00 0.00 ? 7  GLU A HG3  3  
ATOM 1542  N N    . ARG A 1 8  ? 29.327 3.823   -3.026  1.00 0.00 ? 8  ARG A N    3  
ATOM 1543  C CA   . ARG A 1 8  ? 28.775 3.721   -1.681  1.00 0.00 ? 8  ARG A CA   3  
ATOM 1544  C C    . ARG A 1 8  ? 29.886 3.901   -0.647  1.00 0.00 ? 8  ARG A C    3  
ATOM 1545  O O    . ARG A 1 8  ? 29.816 4.777   0.197   1.00 0.00 ? 8  ARG A O    3  
ATOM 1546  C CB   . ARG A 1 8  ? 28.060 2.363   -1.543  1.00 0.00 ? 8  ARG A CB   3  
ATOM 1547  C CG   . ARG A 1 8  ? 26.642 2.484   -0.954  1.00 0.00 ? 8  ARG A CG   3  
ATOM 1548  C CD   . ARG A 1 8  ? 25.587 1.688   -1.739  1.00 0.00 ? 8  ARG A CD   3  
ATOM 1549  N NE   . ARG A 1 8  ? 25.054 0.595   -0.935  1.00 0.00 ? 8  ARG A NE   3  
ATOM 1550  C CZ   . ARG A 1 8  ? 24.021 -0.159  -1.374  1.00 0.00 ? 8  ARG A CZ   3  
ATOM 1551  N NH1  . ARG A 1 8  ? 23.455 0.080   -2.553  1.00 0.00 ? 8  ARG A NH1  3  
ATOM 1552  N NH2  . ARG A 1 8  ? 23.567 -1.154  -0.619  1.00 0.00 ? 8  ARG A NH2  3  
ATOM 1553  H H    . ARG A 1 8  ? 29.525 2.974   -3.512  1.00 0.00 ? 8  ARG A H    3  
ATOM 1554  H HA   . ARG A 1 8  ? 28.079 4.555   -1.574  1.00 0.00 ? 8  ARG A HA   3  
ATOM 1555  H HB2  . ARG A 1 8  ? 28.023 1.915   -2.535  1.00 0.00 ? 8  ARG A HB2  3  
ATOM 1556  H HB3  . ARG A 1 8  ? 28.630 1.638   -0.960  1.00 0.00 ? 8  ARG A HB3  3  
ATOM 1557  H HG2  . ARG A 1 8  ? 26.655 2.203   0.098   1.00 0.00 ? 8  ARG A HG2  3  
ATOM 1558  H HG3  . ARG A 1 8  ? 26.317 3.524   -0.932  1.00 0.00 ? 8  ARG A HG3  3  
ATOM 1559  H HD2  . ARG A 1 8  ? 24.756 2.341   -2.002  1.00 0.00 ? 8  ARG A HD2  3  
ATOM 1560  H HD3  . ARG A 1 8  ? 25.969 1.262   -2.669  1.00 0.00 ? 8  ARG A HD3  3  
ATOM 1561  H HE   . ARG A 1 8  ? 25.454 0.402   -0.041  1.00 0.00 ? 8  ARG A HE   3  
ATOM 1562  H HH11 . ARG A 1 8  ? 23.797 0.827   -3.125  1.00 0.00 ? 8  ARG A HH11 3  
ATOM 1563  H HH12 . ARG A 1 8  ? 22.695 -0.487  -2.871  1.00 0.00 ? 8  ARG A HH12 3  
ATOM 1564  H HH21 . ARG A 1 8  ? 23.978 -1.336  0.274   1.00 0.00 ? 8  ARG A HH21 3  
ATOM 1565  H HH22 . ARG A 1 8  ? 22.811 -1.719  -0.950  1.00 0.00 ? 8  ARG A HH22 3  
ATOM 1566  N N    . LEU A 1 9  ? 30.909 3.032   -0.818  1.00 0.00 ? 9  LEU A N    3  
ATOM 1567  C CA   . LEU A 1 9  ? 32.165 3.025   -0.075  1.00 0.00 ? 9  LEU A CA   3  
ATOM 1568  C C    . LEU A 1 9  ? 32.766 4.457   -0.075  1.00 0.00 ? 9  LEU A C    3  
ATOM 1569  O O    . LEU A 1 9  ? 33.071 5.016   0.959   1.00 0.00 ? 9  LEU A O    3  
ATOM 1570  C CB   . LEU A 1 9  ? 33.115 1.984   -0.683  1.00 0.00 ? 9  LEU A CB   3  
ATOM 1571  C CG   . LEU A 1 9  ? 32.594 0.534   -0.649  1.00 0.00 ? 9  LEU A CG   3  
ATOM 1572  C CD1  . LEU A 1 9  ? 33.224 -0.250  -1.803  1.00 0.00 ? 9  LEU A CD1  3  
ATOM 1573  C CD2  . LEU A 1 9  ? 32.826 -0.194  0.670   1.00 0.00 ? 9  LEU A CD2  3  
ATOM 1574  H H    . LEU A 1 9  ? 30.798 2.340   -1.517  1.00 0.00 ? 9  LEU A H    3  
ATOM 1575  H HA   . LEU A 1 9  ? 31.940 2.685   0.932   1.00 0.00 ? 9  LEU A HA   3  
ATOM 1576  H HB2  . LEU A 1 9  ? 33.306 2.283   -1.713  1.00 0.00 ? 9  LEU A HB2  3  
ATOM 1577  H HB3  . LEU A 1 9  ? 34.076 1.999   -0.175  1.00 0.00 ? 9  LEU A HB3  3  
ATOM 1578  H HG   . LEU A 1 9  ? 31.511 0.527   -0.736  1.00 0.00 ? 9  LEU A HG   3  
ATOM 1579  H HD11 . LEU A 1 9  ? 33.277 0.314   -2.725  1.00 0.00 ? 9  LEU A HD11 3  
ATOM 1580  H HD12 . LEU A 1 9  ? 32.618 -1.109  -2.029  1.00 0.00 ? 9  LEU A HD12 3  
ATOM 1581  H HD13 . LEU A 1 9  ? 34.242 -0.567  -1.573  1.00 0.00 ? 9  LEU A HD13 3  
ATOM 1582  H HD21 . LEU A 1 9  ? 33.829 -0.611  0.698   1.00 0.00 ? 9  LEU A HD21 3  
ATOM 1583  H HD22 . LEU A 1 9  ? 32.124 -1.019  0.790   1.00 0.00 ? 9  LEU A HD22 3  
ATOM 1584  H HD23 . LEU A 1 9  ? 32.692 0.475   1.517   1.00 0.00 ? 9  LEU A HD23 3  
ATOM 1585  N N    . LYS A 1 10 ? 32.854 5.039   -1.288  1.00 0.00 ? 10 LYS A N    3  
ATOM 1586  C CA   . LYS A 1 10 ? 33.364 6.412   -1.426  1.00 0.00 ? 10 LYS A CA   3  
ATOM 1587  C C    . LYS A 1 10 ? 32.469 7.456   -0.729  1.00 0.00 ? 10 LYS A C    3  
ATOM 1588  O O    . LYS A 1 10 ? 32.958 8.440   -0.189  1.00 0.00 ? 10 LYS A O    3  
ATOM 1589  C CB   . LYS A 1 10 ? 33.418 6.778   -2.907  1.00 0.00 ? 10 LYS A CB   3  
ATOM 1590  C CG   . LYS A 1 10 ? 34.434 5.964   -3.691  1.00 0.00 ? 10 LYS A CG   3  
ATOM 1591  C CD   . LYS A 1 10 ? 34.198 6.098   -5.192  1.00 0.00 ? 10 LYS A CD   3  
ATOM 1592  C CE   . LYS A 1 10 ? 34.709 7.425   -5.748  1.00 0.00 ? 10 LYS A CE   3  
ATOM 1593  N NZ   . LYS A 1 10 ? 34.419 7.494   -7.172  1.00 0.00 ? 10 LYS A NZ   3  
ATOM 1594  H H    . LYS A 1 10 ? 32.522 4.533   -2.080  1.00 0.00 ? 10 LYS A H    3  
ATOM 1595  H HA   . LYS A 1 10 ? 34.359 6.451   -0.981  1.00 0.00 ? 10 LYS A HA   3  
ATOM 1596  H HB2  . LYS A 1 10 ? 32.430 6.643   -3.345  1.00 0.00 ? 10 LYS A HB2  3  
ATOM 1597  H HB3  . LYS A 1 10 ? 33.671 7.830   -3.037  1.00 0.00 ? 10 LYS A HB3  3  
ATOM 1598  H HG2  . LYS A 1 10 ? 35.428 6.298   -3.413  1.00 0.00 ? 10 LYS A HG2  3  
ATOM 1599  H HG3  . LYS A 1 10 ? 34.387 4.915   -3.415  1.00 0.00 ? 10 LYS A HG3  3  
ATOM 1600  H HD2  . LYS A 1 10 ? 34.689 5.273   -5.692  1.00 0.00 ? 10 LYS A HD2  3  
ATOM 1601  H HD3  . LYS A 1 10 ? 33.139 5.986   -5.437  1.00 0.00 ? 10 LYS A HD3  3  
ATOM 1602  H HE2  . LYS A 1 10 ? 34.223 8.266   -5.255  1.00 0.00 ? 10 LYS A HE2  3  
ATOM 1603  H HE3  . LYS A 1 10 ? 35.786 7.544   -5.607  1.00 0.00 ? 10 LYS A HE3  3  
ATOM 1604  H HZ1  . LYS A 1 10 ? 34.632 8.443   -7.537  1.00 0.00 ? 10 LYS A HZ1  3  
ATOM 1605  H HZ2  . LYS A 1 10 ? 33.413 7.276   -7.328  1.00 0.00 ? 10 LYS A HZ2  3  
ATOM 1606  H HZ3  . LYS A 1 10 ? 35.001 6.785   -7.664  1.00 0.00 ? 10 LYS A HZ3  3  
ATOM 1607  N N    . ALA A 1 11 ? 31.146 7.189   -0.791  1.00 0.00 ? 11 ALA A N    3  
ATOM 1608  C CA   . ALA A 1 11 ? 30.164 8.108   -0.210  1.00 0.00 ? 11 ALA A CA   3  
ATOM 1609  C C    . ALA A 1 11 ? 30.262 8.195   1.327   1.00 0.00 ? 11 ALA A C    3  
ATOM 1610  O O    . ALA A 1 11 ? 29.805 9.162   1.919   1.00 0.00 ? 11 ALA A O    3  
ATOM 1611  C CB   . ALA A 1 11 ? 28.741 7.706   -0.613  1.00 0.00 ? 11 ALA A CB   3  
ATOM 1612  H H    . ALA A 1 11 ? 30.837 6.365   -1.261  1.00 0.00 ? 11 ALA A H    3  
ATOM 1613  H HA   . ALA A 1 11 ? 30.380 9.095   -0.622  1.00 0.00 ? 11 ALA A HA   3  
ATOM 1614  H HB1  . ALA A 1 11 ? 28.567 7.927   -1.664  1.00 0.00 ? 11 ALA A HB1  3  
ATOM 1615  H HB2  . ALA A 1 11 ? 27.990 8.251   -0.039  1.00 0.00 ? 11 ALA A HB2  3  
ATOM 1616  H HB3  . ALA A 1 11 ? 28.550 6.647   -0.460  1.00 0.00 ? 11 ALA A HB3  3  
ATOM 1617  N N    . LEU A 1 12 ? 30.896 7.162   1.930   1.00 0.00 ? 12 LEU A N    3  
ATOM 1618  C CA   . LEU A 1 12 ? 31.129 7.181   3.373   1.00 0.00 ? 12 LEU A CA   3  
ATOM 1619  C C    . LEU A 1 12 ? 32.320 8.113   3.755   1.00 0.00 ? 12 LEU A C    3  
ATOM 1620  O O    . LEU A 1 12 ? 32.694 8.174   4.920   1.00 0.00 ? 12 LEU A O    3  
ATOM 1621  C CB   . LEU A 1 12 ? 31.429 5.753   3.853   1.00 0.00 ? 12 LEU A CB   3  
ATOM 1622  C CG   . LEU A 1 12 ? 30.262 4.739   3.886   1.00 0.00 ? 12 LEU A CG   3  
ATOM 1623  C CD1  . LEU A 1 12 ? 30.382 3.716   2.756   1.00 0.00 ? 12 LEU A CD1  3  
ATOM 1624  C CD2  . LEU A 1 12 ? 30.242 3.967   5.208   1.00 0.00 ? 12 LEU A CD2  3  
ATOM 1625  H H    . LEU A 1 12 ? 31.249 6.392   1.400   1.00 0.00 ? 12 LEU A H    3  
ATOM 1626  H HA   . LEU A 1 12 ? 30.230 7.558   3.861   1.00 0.00 ? 12 LEU A HA   3  
ATOM 1627  H HB2  . LEU A 1 12 ? 32.211 5.377   3.206   1.00 0.00 ? 12 LEU A HB2  3  
ATOM 1628  H HB3  . LEU A 1 12 ? 31.854 5.801   4.852   1.00 0.00 ? 12 LEU A HB3  3  
ATOM 1629  H HG   . LEU A 1 12 ? 29.319 5.276   3.782   1.00 0.00 ? 12 LEU A HG   3  
ATOM 1630  H HD11 . LEU A 1 12 ? 30.980 4.156   1.974   1.00 0.00 ? 12 LEU A HD11 3  
ATOM 1631  H HD12 . LEU A 1 12 ? 29.411 3.429   2.350   1.00 0.00 ? 12 LEU A HD12 3  
ATOM 1632  H HD13 . LEU A 1 12 ? 30.909 2.809   3.057   1.00 0.00 ? 12 LEU A HD13 3  
ATOM 1633  H HD21 . LEU A 1 12 ? 31.124 3.336   5.273   1.00 0.00 ? 12 LEU A HD21 3  
ATOM 1634  H HD22 . LEU A 1 12 ? 29.380 3.303   5.271   1.00 0.00 ? 12 LEU A HD22 3  
ATOM 1635  H HD23 . LEU A 1 12 ? 30.250 4.635   6.068   1.00 0.00 ? 12 LEU A HD23 3  
ATOM 1636  N N    . GLY A 1 13 ? 32.877 8.824   2.742   1.00 0.00 ? 13 GLY A N    3  
ATOM 1637  C CA   . GLY A 1 13 ? 33.950 9.801   2.960   1.00 0.00 ? 13 GLY A CA   3  
ATOM 1638  C C    . GLY A 1 13 ? 35.335 9.254   2.586   1.00 0.00 ? 13 GLY A C    3  
ATOM 1639  O O    . GLY A 1 13 ? 36.350 9.723   3.092   1.00 0.00 ? 13 GLY A O    3  
ATOM 1640  H H    . GLY A 1 13 ? 32.528 8.722   1.814   1.00 0.00 ? 13 GLY A H    3  
ATOM 1641  H HA2  . GLY A 1 13 ? 33.723 10.671  2.344   1.00 0.00 ? 13 GLY A HA2  3  
ATOM 1642  H HA3  . GLY A 1 13 ? 33.954 10.109  4.005   1.00 0.00 ? 13 GLY A HA3  3  
ATOM 1643  N N    . PHE A 1 14 ? 35.306 8.228   1.698   1.00 0.00 ? 14 PHE A N    3  
ATOM 1644  C CA   . PHE A 1 14 ? 36.513 7.492   1.320   1.00 0.00 ? 14 PHE A CA   3  
ATOM 1645  C C    . PHE A 1 14 ? 36.899 7.888   -0.121  1.00 0.00 ? 14 PHE A C    3  
ATOM 1646  O O    . PHE A 1 14 ? 36.697 9.027   -0.523  1.00 0.00 ? 14 PHE A O    3  
ATOM 1647  C CB   . PHE A 1 14 ? 36.264 5.975   1.504   1.00 0.00 ? 14 PHE A CB   3  
ATOM 1648  C CG   . PHE A 1 14 ? 35.676 5.624   2.853   1.00 0.00 ? 14 PHE A CG   3  
ATOM 1649  C CD1  . PHE A 1 14 ? 35.881 6.414   3.984   1.00 0.00 ? 14 PHE A CD1  3  
ATOM 1650  C CD2  . PHE A 1 14 ? 34.860 4.503   2.971   1.00 0.00 ? 14 PHE A CD2  3  
ATOM 1651  C CE1  . PHE A 1 14 ? 35.197 6.158   5.158   1.00 0.00 ? 14 PHE A CE1  3  
ATOM 1652  C CE2  . PHE A 1 14 ? 34.181 4.237   4.145   1.00 0.00 ? 14 PHE A CE2  3  
ATOM 1653  C CZ   . PHE A 1 14 ? 34.323 5.097   5.227   1.00 0.00 ? 14 PHE A CZ   3  
ATOM 1654  H H    . PHE A 1 14 ? 34.441 7.924   1.309   1.00 0.00 ? 14 PHE A H    3  
ATOM 1655  H HA   . PHE A 1 14 ? 37.319 7.829   1.972   1.00 0.00 ? 14 PHE A HA   3  
ATOM 1656  H HB2  . PHE A 1 14 ? 35.584 5.631   0.721   1.00 0.00 ? 14 PHE A HB2  3  
ATOM 1657  H HB3  . PHE A 1 14 ? 37.181 5.406   1.388   1.00 0.00 ? 14 PHE A HB3  3  
ATOM 1658  H HD1  . PHE A 1 14 ? 36.560 7.253   3.987   1.00 0.00 ? 14 PHE A HD1  3  
ATOM 1659  H HD2  . PHE A 1 14 ? 34.745 3.824   2.138   1.00 0.00 ? 14 PHE A HD2  3  
ATOM 1660  H HE1  . PHE A 1 14 ? 35.331 6.791   6.020   1.00 0.00 ? 14 PHE A HE1  3  
ATOM 1661  H HE2  . PHE A 1 14 ? 33.525 3.378   4.191   1.00 0.00 ? 14 PHE A HE2  3  
ATOM 1662  H HZ   . PHE A 1 14 ? 33.745 4.971   6.129   1.00 0.00 ? 14 PHE A HZ   3  
ATOM 1663  N N    . GLU A 1 15 ? 37.461 6.904   -0.862  1.00 0.00 ? 15 GLU A N    3  
ATOM 1664  C CA   . GLU A 1 15 ? 37.935 7.157   -2.221  1.00 0.00 ? 15 GLU A CA   3  
ATOM 1665  C C    . GLU A 1 15 ? 38.121 5.817   -2.927  1.00 0.00 ? 15 GLU A C    3  
ATOM 1666  O O    . GLU A 1 15 ? 38.558 4.850   -2.322  1.00 0.00 ? 15 GLU A O    3  
ATOM 1667  C CB   . GLU A 1 15 ? 39.274 7.922   -2.183  1.00 0.00 ? 15 GLU A CB   3  
ATOM 1668  C CG   . GLU A 1 15 ? 39.599 8.662   -3.488  1.00 0.00 ? 15 GLU A CG   3  
ATOM 1669  C CD   . GLU A 1 15 ? 38.729 9.920   -3.730  1.00 0.00 ? 15 GLU A CD   3  
ATOM 1670  O OE1  . GLU A 1 15 ? 37.748 10.136  -3.019  1.00 0.00 ? 15 GLU A OE1  3  
ATOM 1671  O OE2  . GLU A 1 15 ? 39.061 10.680  -4.639  1.00 0.00 ? 15 GLU A OE2  3  
ATOM 1672  H H    . GLU A 1 15 ? 37.583 5.995   -0.472  1.00 0.00 ? 15 GLU A H    3  
ATOM 1673  H HA   . GLU A 1 15 ? 37.150 7.715   -2.732  1.00 0.00 ? 15 GLU A HA   3  
ATOM 1674  H HB2  . GLU A 1 15 ? 39.290 8.616   -1.347  1.00 0.00 ? 15 GLU A HB2  3  
ATOM 1675  H HB3  . GLU A 1 15 ? 40.109 7.256   -1.971  1.00 0.00 ? 15 GLU A HB3  3  
ATOM 1676  H HG2  . GLU A 1 15 ? 40.641 8.975   -3.461  1.00 0.00 ? 15 GLU A HG2  3  
ATOM 1677  H HG3  . GLU A 1 15 ? 39.522 7.989   -4.341  1.00 0.00 ? 15 GLU A HG3  3  
ATOM 1678  N N    . GLU A 1 16 ? 37.759 5.846   -4.232  1.00 0.00 ? 16 GLU A N    3  
ATOM 1679  C CA   . GLU A 1 16 ? 37.699 4.688   -5.125  1.00 0.00 ? 16 GLU A CA   3  
ATOM 1680  C C    . GLU A 1 16 ? 38.933 3.746   -5.044  1.00 0.00 ? 16 GLU A C    3  
ATOM 1681  O O    . GLU A 1 16 ? 38.836 2.571   -5.361  1.00 0.00 ? 16 GLU A O    3  
ATOM 1682  C CB   . GLU A 1 16 ? 37.488 5.189   -6.559  1.00 0.00 ? 16 GLU A CB   3  
ATOM 1683  C CG   . GLU A 1 16 ? 37.595 4.087   -7.632  1.00 0.00 ? 16 GLU A CG   3  
ATOM 1684  C CD   . GLU A 1 16 ? 36.973 4.523   -8.975  1.00 0.00 ? 16 GLU A CD   3  
ATOM 1685  O OE1  . GLU A 1 16 ? 37.284 5.622   -9.427  1.00 0.00 ? 16 GLU A OE1  3  
ATOM 1686  O OE2  . GLU A 1 16 ? 36.189 3.764   -9.549  1.00 0.00 ? 16 GLU A OE2  3  
ATOM 1687  H H    . GLU A 1 16 ? 37.442 6.716   -4.599  1.00 0.00 ? 16 GLU A H    3  
ATOM 1688  H HA   . GLU A 1 16 ? 36.799 4.159   -4.822  1.00 0.00 ? 16 GLU A HA   3  
ATOM 1689  H HB2  . GLU A 1 16 ? 36.507 5.655   -6.631  1.00 0.00 ? 16 GLU A HB2  3  
ATOM 1690  H HB3  . GLU A 1 16 ? 38.222 5.972   -6.747  1.00 0.00 ? 16 GLU A HB3  3  
ATOM 1691  H HG2  . GLU A 1 16 ? 38.647 3.850   -7.794  1.00 0.00 ? 16 GLU A HG2  3  
ATOM 1692  H HG3  . GLU A 1 16 ? 37.111 3.172   -7.294  1.00 0.00 ? 16 GLU A HG3  3  
ATOM 1693  N N    . SER A 1 17 ? 40.077 4.311   -4.612  1.00 0.00 ? 17 SER A N    3  
ATOM 1694  C CA   . SER A 1 17 ? 41.294 3.520   -4.493  1.00 0.00 ? 17 SER A CA   3  
ATOM 1695  C C    . SER A 1 17 ? 41.288 2.706   -3.196  1.00 0.00 ? 17 SER A C    3  
ATOM 1696  O O    . SER A 1 17 ? 41.481 1.499   -3.216  1.00 0.00 ? 17 SER A O    3  
ATOM 1697  C CB   . SER A 1 17 ? 42.498 4.476   -4.489  1.00 0.00 ? 17 SER A CB   3  
ATOM 1698  O OG   . SER A 1 17 ? 43.141 4.550   -5.744  1.00 0.00 ? 17 SER A OG   3  
ATOM 1699  H H    . SER A 1 17 ? 40.090 5.271   -4.341  1.00 0.00 ? 17 SER A H    3  
ATOM 1700  H HA   . SER A 1 17 ? 41.303 2.816   -5.333  1.00 0.00 ? 17 SER A HA   3  
ATOM 1701  H HB2  . SER A 1 17 ? 42.165 5.482   -4.243  1.00 0.00 ? 17 SER A HB2  3  
ATOM 1702  H HB3  . SER A 1 17 ? 43.228 4.240   -3.707  1.00 0.00 ? 17 SER A HB3  3  
ATOM 1703  H HG   . SER A 1 17 ? 43.496 3.697   -5.969  1.00 0.00 ? 17 SER A HG   3  
ATOM 1704  N N    . LEU A 1 18 ? 41.058 3.433   -2.073  1.00 0.00 ? 18 LEU A N    3  
ATOM 1705  C CA   . LEU A 1 18 ? 41.010 2.749   -0.779  1.00 0.00 ? 18 LEU A CA   3  
ATOM 1706  C C    . LEU A 1 18 ? 39.774 1.861   -0.665  1.00 0.00 ? 18 LEU A C    3  
ATOM 1707  O O    . LEU A 1 18 ? 39.711 1.006   0.195   1.00 0.00 ? 18 LEU A O    3  
ATOM 1708  C CB   . LEU A 1 18 ? 41.130 3.730   0.404   1.00 0.00 ? 18 LEU A CB   3  
ATOM 1709  C CG   . LEU A 1 18 ? 39.848 4.403   0.960   1.00 0.00 ? 18 LEU A CG   3  
ATOM 1710  C CD1  . LEU A 1 18 ? 39.598 4.029   2.430   1.00 0.00 ? 18 LEU A CD1  3  
ATOM 1711  C CD2  . LEU A 1 18 ? 39.934 5.924   0.855   1.00 0.00 ? 18 LEU A CD2  3  
ATOM 1712  H H    . LEU A 1 18 ? 40.864 4.411   -2.144  1.00 0.00 ? 18 LEU A H    3  
ATOM 1713  H HA   . LEU A 1 18 ? 41.876 2.085   -0.744  1.00 0.00 ? 18 LEU A HA   3  
ATOM 1714  H HB2  . LEU A 1 18 ? 41.596 3.183   1.217   1.00 0.00 ? 18 LEU A HB2  3  
ATOM 1715  H HB3  . LEU A 1 18 ? 41.868 4.484   0.145   1.00 0.00 ? 18 LEU A HB3  3  
ATOM 1716  H HG   . LEU A 1 18 ? 38.985 4.090   0.375   1.00 0.00 ? 18 LEU A HG   3  
ATOM 1717  H HD11 . LEU A 1 18 ? 39.446 2.956   2.554   1.00 0.00 ? 18 LEU A HD11 3  
ATOM 1718  H HD12 . LEU A 1 18 ? 38.725 4.558   2.816   1.00 0.00 ? 18 LEU A HD12 3  
ATOM 1719  H HD13 . LEU A 1 18 ? 40.438 4.307   3.064   1.00 0.00 ? 18 LEU A HD13 3  
ATOM 1720  H HD21 . LEU A 1 18 ? 40.826 6.307   1.346   1.00 0.00 ? 18 LEU A HD21 3  
ATOM 1721  H HD22 . LEU A 1 18 ? 39.078 6.422   1.310   1.00 0.00 ? 18 LEU A HD22 3  
ATOM 1722  H HD23 . LEU A 1 18 ? 39.987 6.207   -0.188  1.00 0.00 ? 18 LEU A HD23 3  
ATOM 1723  N N    . VAL A 1 19 ? 38.831 2.128   -1.587  1.00 0.00 ? 19 VAL A N    3  
ATOM 1724  C CA   . VAL A 1 19 ? 37.549 1.457   -1.721  1.00 0.00 ? 19 VAL A CA   3  
ATOM 1725  C C    . VAL A 1 19 ? 37.734 0.111   -2.425  1.00 0.00 ? 19 VAL A C    3  
ATOM 1726  O O    . VAL A 1 19 ? 37.386 -0.927  -1.893  1.00 0.00 ? 19 VAL A O    3  
ATOM 1727  C CB   . VAL A 1 19 ? 36.673 2.424   -2.520  1.00 0.00 ? 19 VAL A CB   3  
ATOM 1728  C CG1  . VAL A 1 19 ? 35.568 1.742   -3.318  1.00 0.00 ? 19 VAL A CG1  3  
ATOM 1729  C CG2  . VAL A 1 19 ? 36.145 3.572   -1.644  1.00 0.00 ? 19 VAL A CG2  3  
ATOM 1730  H H    . VAL A 1 19 ? 39.019 2.831   -2.270  1.00 0.00 ? 19 VAL A H    3  
ATOM 1731  H HA   . VAL A 1 19 ? 37.116 1.271   -0.742  1.00 0.00 ? 19 VAL A HA   3  
ATOM 1732  H HB   . VAL A 1 19 ? 37.337 2.858   -3.257  1.00 0.00 ? 19 VAL A HB   3  
ATOM 1733  H HG11 . VAL A 1 19 ? 35.938 1.420   -4.289  1.00 0.00 ? 19 VAL A HG11 3  
ATOM 1734  H HG12 . VAL A 1 19 ? 34.718 2.400   -3.460  1.00 0.00 ? 19 VAL A HG12 3  
ATOM 1735  H HG13 . VAL A 1 19 ? 35.228 0.854   -2.809  1.00 0.00 ? 19 VAL A HG13 3  
ATOM 1736  H HG21 . VAL A 1 19 ? 36.828 3.822   -0.837  1.00 0.00 ? 19 VAL A HG21 3  
ATOM 1737  H HG22 . VAL A 1 19 ? 35.180 3.385   -1.195  1.00 0.00 ? 19 VAL A HG22 3  
ATOM 1738  H HG23 . VAL A 1 19 ? 36.022 4.468   -2.234  1.00 0.00 ? 19 VAL A HG23 3  
ATOM 1739  N N    . ILE A 1 20 ? 38.289 0.218   -3.649  1.00 0.00 ? 20 ILE A N    3  
ATOM 1740  C CA   . ILE A 1 20 ? 38.525 -0.947  -4.495  1.00 0.00 ? 20 ILE A CA   3  
ATOM 1741  C C    . ILE A 1 20 ? 39.415 -1.965  -3.792  1.00 0.00 ? 20 ILE A C    3  
ATOM 1742  O O    . ILE A 1 20 ? 39.080 -3.132  -3.737  1.00 0.00 ? 20 ILE A O    3  
ATOM 1743  C CB   . ILE A 1 20 ? 39.113 -0.495  -5.849  1.00 0.00 ? 20 ILE A CB   3  
ATOM 1744  C CG1  . ILE A 1 20 ? 38.000 -0.020  -6.791  1.00 0.00 ? 20 ILE A CG1  3  
ATOM 1745  C CG2  . ILE A 1 20 ? 40.000 -1.539  -6.557  1.00 0.00 ? 20 ILE A CG2  3  
ATOM 1746  C CD1  . ILE A 1 20 ? 37.063 -1.156  -7.222  1.00 0.00 ? 20 ILE A CD1  3  
ATOM 1747  H H    . ILE A 1 20 ? 38.540 1.120   -3.983  1.00 0.00 ? 20 ILE A H    3  
ATOM 1748  H HA   . ILE A 1 20 ? 37.556 -1.429  -4.623  1.00 0.00 ? 20 ILE A HA   3  
ATOM 1749  H HB   . ILE A 1 20 ? 39.768 0.352   -5.652  1.00 0.00 ? 20 ILE A HB   3  
ATOM 1750  H HG12 . ILE A 1 20 ? 37.425 0.787   -6.338  1.00 0.00 ? 20 ILE A HG12 3  
ATOM 1751  H HG13 . ILE A 1 20 ? 38.447 0.431   -7.673  1.00 0.00 ? 20 ILE A HG13 3  
ATOM 1752  H HG21 . ILE A 1 20 ? 40.274 -1.212  -7.559  1.00 0.00 ? 20 ILE A HG21 3  
ATOM 1753  H HG22 . ILE A 1 20 ? 39.509 -2.501  -6.661  1.00 0.00 ? 20 ILE A HG22 3  
ATOM 1754  H HG23 . ILE A 1 20 ? 40.925 -1.706  -6.010  1.00 0.00 ? 20 ILE A HG23 3  
ATOM 1755  H HD11 . ILE A 1 20 ? 37.522 -2.142  -7.260  1.00 0.00 ? 20 ILE A HD11 3  
ATOM 1756  H HD12 . ILE A 1 20 ? 36.704 -0.962  -8.230  1.00 0.00 ? 20 ILE A HD12 3  
ATOM 1757  H HD13 . ILE A 1 20 ? 36.216 -1.218  -6.541  1.00 0.00 ? 20 ILE A HD13 3  
ATOM 1758  N N    . GLN A 1 21 ? 40.542 -1.451  -3.263  1.00 0.00 ? 21 GLN A N    3  
ATOM 1759  C CA   . GLN A 1 21 ? 41.486 -2.308  -2.555  1.00 0.00 ? 21 GLN A CA   3  
ATOM 1760  C C    . GLN A 1 21 ? 40.896 -2.833  -1.230  1.00 0.00 ? 21 GLN A C    3  
ATOM 1761  O O    . GLN A 1 21 ? 41.244 -3.916  -0.789  1.00 0.00 ? 21 GLN A O    3  
ATOM 1762  C CB   . GLN A 1 21 ? 42.774 -1.520  -2.299  1.00 0.00 ? 21 GLN A CB   3  
ATOM 1763  C CG   . GLN A 1 21 ? 43.883 -2.356  -1.641  1.00 0.00 ? 21 GLN A CG   3  
ATOM 1764  C CD   . GLN A 1 21 ? 45.137 -1.481  -1.530  1.00 0.00 ? 21 GLN A CD   3  
ATOM 1765  O OE1  . GLN A 1 21 ? 45.188 -0.529  -0.759  1.00 0.00 ? 21 GLN A OE1  3  
ATOM 1766  N NE2  . GLN A 1 21 ? 46.100 -1.814  -2.406  1.00 0.00 ? 21 GLN A NE2  3  
ATOM 1767  H H    . GLN A 1 21 ? 40.736 -0.481  -3.384  1.00 0.00 ? 21 GLN A H    3  
ATOM 1768  H HA   . GLN A 1 21 ? 41.696 -3.155  -3.211  1.00 0.00 ? 21 GLN A HA   3  
ATOM 1769  H HB2  . GLN A 1 21 ? 43.135 -1.126  -3.251  1.00 0.00 ? 21 GLN A HB2  3  
ATOM 1770  H HB3  . GLN A 1 21 ? 42.555 -0.651  -1.679  1.00 0.00 ? 21 GLN A HB3  3  
ATOM 1771  H HG2  . GLN A 1 21 ? 43.598 -2.691  -0.643  1.00 0.00 ? 21 GLN A HG2  3  
ATOM 1772  H HG3  . GLN A 1 21 ? 44.088 -3.252  -2.228  1.00 0.00 ? 21 GLN A HG3  3  
ATOM 1773  H HE21 . GLN A 1 21 ? 46.072 -2.695  -2.882  1.00 0.00 ? 21 GLN A HE21 3  
ATOM 1774  H HE22 . GLN A 1 21 ? 46.848 -1.179  -2.606  1.00 0.00 ? 21 GLN A HE22 3  
ATOM 1775  N N    . ALA A 1 22 ? 39.988 -2.021  -0.641  1.00 0.00 ? 22 ALA A N    3  
ATOM 1776  C CA   . ALA A 1 22 ? 39.309 -2.433  0.590   1.00 0.00 ? 22 ALA A CA   3  
ATOM 1777  C C    . ALA A 1 22 ? 38.194 -3.442  0.341   1.00 0.00 ? 22 ALA A C    3  
ATOM 1778  O O    . ALA A 1 22 ? 37.757 -4.099  1.271   1.00 0.00 ? 22 ALA A O    3  
ATOM 1779  C CB   . ALA A 1 22 ? 38.607 -1.253  1.259   1.00 0.00 ? 22 ALA A CB   3  
ATOM 1780  H H    . ALA A 1 22 ? 39.729 -1.169  -1.091  1.00 0.00 ? 22 ALA A H    3  
ATOM 1781  H HA   . ALA A 1 22 ? 40.057 -2.889  1.242   1.00 0.00 ? 22 ALA A HA   3  
ATOM 1782  H HB1  . ALA A 1 22 ? 39.342 -0.574  1.663   1.00 0.00 ? 22 ALA A HB1  3  
ATOM 1783  H HB2  . ALA A 1 22 ? 37.981 -1.569  2.094   1.00 0.00 ? 22 ALA A HB2  3  
ATOM 1784  H HB3  . ALA A 1 22 ? 37.971 -0.697  0.569   1.00 0.00 ? 22 ALA A HB3  3  
ATOM 1785  N N    . TYR A 1 23 ? 37.743 -3.492  -0.931  1.00 0.00 ? 23 TYR A N    3  
ATOM 1786  C CA   . TYR A 1 23 ? 36.647 -4.375  -1.312  1.00 0.00 ? 23 TYR A CA   3  
ATOM 1787  C C    . TYR A 1 23 ? 37.220 -5.658  -1.927  1.00 0.00 ? 23 TYR A C    3  
ATOM 1788  O O    . TYR A 1 23 ? 36.599 -6.700  -1.856  1.00 0.00 ? 23 TYR A O    3  
ATOM 1789  C CB   . TYR A 1 23 ? 35.701 -3.651  -2.299  1.00 0.00 ? 23 TYR A CB   3  
ATOM 1790  C CG   . TYR A 1 23 ? 34.254 -3.965  -2.076  1.00 0.00 ? 23 TYR A CG   3  
ATOM 1791  C CD1  . TYR A 1 23 ? 33.518 -3.238  -1.146  1.00 0.00 ? 23 TYR A CD1  3  
ATOM 1792  C CD2  . TYR A 1 23 ? 33.600 -4.968  -2.796  1.00 0.00 ? 23 TYR A CD2  3  
ATOM 1793  C CE1  . TYR A 1 23 ? 32.166 -3.480  -0.948  1.00 0.00 ? 23 TYR A CE1  3  
ATOM 1794  C CE2  . TYR A 1 23 ? 32.250 -5.213  -2.604  1.00 0.00 ? 23 TYR A CE2  3  
ATOM 1795  C CZ   . TYR A 1 23 ? 31.536 -4.448  -1.685  1.00 0.00 ? 23 TYR A CZ   3  
ATOM 1796  O OH   . TYR A 1 23 ? 30.174 -4.652  -1.488  1.00 0.00 ? 23 TYR A OH   3  
ATOM 1797  H H    . TYR A 1 23 ? 38.171 -2.924  -1.633  1.00 0.00 ? 23 TYR A H    3  
ATOM 1798  H HA   . TYR A 1 23 ? 36.106 -4.647  -0.402  1.00 0.00 ? 23 TYR A HA   3  
ATOM 1799  H HB2  . TYR A 1 23 ? 35.779 -2.583  -2.121  1.00 0.00 ? 23 TYR A HB2  3  
ATOM 1800  H HB3  . TYR A 1 23 ? 35.989 -3.794  -3.346  1.00 0.00 ? 23 TYR A HB3  3  
ATOM 1801  H HD1  . TYR A 1 23 ? 33.993 -2.454  -0.579  1.00 0.00 ? 23 TYR A HD1  3  
ATOM 1802  H HD2  . TYR A 1 23 ? 34.145 -5.557  -3.506  1.00 0.00 ? 23 TYR A HD2  3  
ATOM 1803  H HE1  . TYR A 1 23 ? 31.602 -2.912  -0.215  1.00 0.00 ? 23 TYR A HE1  3  
ATOM 1804  H HE2  . TYR A 1 23 ? 31.792 -6.011  -3.168  1.00 0.00 ? 23 TYR A HE2  3  
ATOM 1805  H HH   . TYR A 1 23 ? 29.907 -5.497  -1.802  1.00 0.00 ? 23 TYR A HH   3  
ATOM 1806  N N    . PHE A 1 24 ? 38.428 -5.532  -2.521  1.00 0.00 ? 24 PHE A N    3  
ATOM 1807  C CA   . PHE A 1 24 ? 39.056 -6.652  -3.225  1.00 0.00 ? 24 PHE A CA   3  
ATOM 1808  C C    . PHE A 1 24 ? 39.888 -7.489  -2.245  1.00 0.00 ? 24 PHE A C    3  
ATOM 1809  O O    . PHE A 1 24 ? 39.910 -8.710  -2.320  1.00 0.00 ? 24 PHE A O    3  
ATOM 1810  C CB   . PHE A 1 24 ? 39.978 -6.127  -4.349  1.00 0.00 ? 24 PHE A CB   3  
ATOM 1811  C CG   . PHE A 1 24 ? 39.449 -6.400  -5.730  1.00 0.00 ? 24 PHE A CG   3  
ATOM 1812  C CD1  . PHE A 1 24 ? 39.479 -7.691  -6.243  1.00 0.00 ? 24 PHE A CD1  3  
ATOM 1813  C CD2  . PHE A 1 24 ? 38.943 -5.373  -6.517  1.00 0.00 ? 24 PHE A CD2  3  
ATOM 1814  C CE1  . PHE A 1 24 ? 39.041 -7.947  -7.536  1.00 0.00 ? 24 PHE A CE1  3  
ATOM 1815  C CE2  . PHE A 1 24 ? 38.511 -5.618  -7.815  1.00 0.00 ? 24 PHE A CE2  3  
ATOM 1816  C CZ   . PHE A 1 24 ? 38.567 -6.908  -8.328  1.00 0.00 ? 24 PHE A CZ   3  
ATOM 1817  H H    . PHE A 1 24 ? 38.941 -4.682  -2.431  1.00 0.00 ? 24 PHE A H    3  
ATOM 1818  H HA   . PHE A 1 24 ? 38.256 -7.293  -3.601  1.00 0.00 ? 24 PHE A HA   3  
ATOM 1819  H HB2  . PHE A 1 24 ? 40.174 -5.066  -4.230  1.00 0.00 ? 24 PHE A HB2  3  
ATOM 1820  H HB3  . PHE A 1 24 ? 40.968 -6.581  -4.299  1.00 0.00 ? 24 PHE A HB3  3  
ATOM 1821  H HD1  . PHE A 1 24 ? 39.831 -8.500  -5.622  1.00 0.00 ? 24 PHE A HD1  3  
ATOM 1822  H HD2  . PHE A 1 24 ? 38.875 -4.384  -6.100  1.00 0.00 ? 24 PHE A HD2  3  
ATOM 1823  H HE1  . PHE A 1 24 ? 39.061 -8.957  -7.917  1.00 0.00 ? 24 PHE A HE1  3  
ATOM 1824  H HE2  . PHE A 1 24 ? 38.126 -4.807  -8.416  1.00 0.00 ? 24 PHE A HE2  3  
ATOM 1825  H HZ   . PHE A 1 24 ? 38.229 -7.105  -9.335  1.00 0.00 ? 24 PHE A HZ   3  
ATOM 1826  N N    . ALA A 1 25 ? 40.559 -6.750  -1.333  1.00 0.00 ? 25 ALA A N    3  
ATOM 1827  C CA   . ALA A 1 25 ? 41.340 -7.386  -0.274  1.00 0.00 ? 25 ALA A CA   3  
ATOM 1828  C C    . ALA A 1 25 ? 40.412 -8.088  0.737   1.00 0.00 ? 25 ALA A C    3  
ATOM 1829  O O    . ALA A 1 25 ? 40.794 -9.058  1.378   1.00 0.00 ? 25 ALA A O    3  
ATOM 1830  C CB   . ALA A 1 25 ? 42.205 -6.340  0.438   1.00 0.00 ? 25 ALA A CB   3  
ATOM 1831  H H    . ALA A 1 25 ? 40.491 -5.755  -1.350  1.00 0.00 ? 25 ALA A H    3  
ATOM 1832  H HA   . ALA A 1 25 ? 41.983 -8.126  -0.751  1.00 0.00 ? 25 ALA A HA   3  
ATOM 1833  H HB1  . ALA A 1 25 ? 42.865 -6.800  1.173   1.00 0.00 ? 25 ALA A HB1  3  
ATOM 1834  H HB2  . ALA A 1 25 ? 41.602 -5.599  0.964   1.00 0.00 ? 25 ALA A HB2  3  
ATOM 1835  H HB3  . ALA A 1 25 ? 42.835 -5.813  -0.278  1.00 0.00 ? 25 ALA A HB3  3  
ATOM 1836  N N    . CYS A 1 26 ? 39.173 -7.550  0.804   1.00 0.00 ? 26 CYS A N    3  
ATOM 1837  C CA   . CYS A 1 26 ? 38.125 -8.136  1.641   1.00 0.00 ? 26 CYS A CA   3  
ATOM 1838  C C    . CYS A 1 26 ? 37.386 -9.300  0.955   1.00 0.00 ? 26 CYS A C    3  
ATOM 1839  O O    . CYS A 1 26 ? 36.413 -9.804  1.502   1.00 0.00 ? 26 CYS A O    3  
ATOM 1840  C CB   . CYS A 1 26 ? 37.100 -7.049  1.987   1.00 0.00 ? 26 CYS A CB   3  
ATOM 1841  S SG   . CYS A 1 26 ? 37.480 -6.332  3.606   1.00 0.00 ? 26 CYS A SG   3  
ATOM 1842  H H    . CYS A 1 26 ? 38.967 -6.736  0.263   1.00 0.00 ? 26 CYS A H    3  
ATOM 1843  H HA   . CYS A 1 26 ? 38.610 -8.510  2.545   1.00 0.00 ? 26 CYS A HA   3  
ATOM 1844  H HB2  . CYS A 1 26 ? 37.131 -6.279  1.226   1.00 0.00 ? 26 CYS A HB2  3  
ATOM 1845  H HB3  . CYS A 1 26 ? 36.062 -7.396  1.949   1.00 0.00 ? 26 CYS A HB3  3  
ATOM 1846  H HG   . CYS A 1 26 ? 37.521 -5.002  3.537   1.00 0.00 ? 26 CYS A HG   3  
ATOM 1847  N N    . GLU A 1 27 ? 37.861 -9.680  -0.257  1.00 0.00 ? 27 GLU A N    3  
ATOM 1848  C CA   . GLU A 1 27 ? 37.177 -10.708 -1.048  1.00 0.00 ? 27 GLU A CA   3  
ATOM 1849  C C    . GLU A 1 27 ? 35.704 -10.318 -1.316  1.00 0.00 ? 27 GLU A C    3  
ATOM 1850  O O    . GLU A 1 27 ? 34.766 -10.991 -0.907  1.00 0.00 ? 27 GLU A O    3  
ATOM 1851  C CB   . GLU A 1 27 ? 37.357 -12.096 -0.403  1.00 0.00 ? 27 GLU A CB   3  
ATOM 1852  C CG   . GLU A 1 27 ? 36.458 -13.197 -1.016  1.00 0.00 ? 27 GLU A CG   3  
ATOM 1853  C CD   . GLU A 1 27 ? 37.123 -14.577 -1.163  1.00 0.00 ? 27 GLU A CD   3  
ATOM 1854  O OE1  . GLU A 1 27 ? 38.098 -14.854 -0.461  1.00 0.00 ? 27 GLU A OE1  3  
ATOM 1855  O OE2  . GLU A 1 27 ? 36.658 -15.357 -1.990  1.00 0.00 ? 27 GLU A OE2  3  
ATOM 1856  H H    . GLU A 1 27 ? 38.686 -9.265  -0.635  1.00 0.00 ? 27 GLU A H    3  
ATOM 1857  H HA   . GLU A 1 27 ? 37.688 -10.715 -2.011  1.00 0.00 ? 27 GLU A HA   3  
ATOM 1858  H HB2  . GLU A 1 27 ? 38.420 -12.335 -0.477  1.00 0.00 ? 27 GLU A HB2  3  
ATOM 1859  H HB3  . GLU A 1 27 ? 37.154 -12.052 0.666   1.00 0.00 ? 27 GLU A HB3  3  
ATOM 1860  H HG2  . GLU A 1 27 ? 35.554 -13.305 -0.411  1.00 0.00 ? 27 GLU A HG2  3  
ATOM 1861  H HG3  . GLU A 1 27 ? 36.119 -12.911 -2.012  1.00 0.00 ? 27 GLU A HG3  3  
ATOM 1862  N N    . LYS A 1 28 ? 35.606 -9.178  -2.033  1.00 0.00 ? 28 LYS A N    3  
ATOM 1863  C CA   . LYS A 1 28 ? 34.392 -8.558  -2.567  1.00 0.00 ? 28 LYS A CA   3  
ATOM 1864  C C    . LYS A 1 28 ? 33.139 -8.858  -1.717  1.00 0.00 ? 28 LYS A C    3  
ATOM 1865  O O    . LYS A 1 28 ? 32.188 -9.474  -2.180  1.00 0.00 ? 28 LYS A O    3  
ATOM 1866  C CB   . LYS A 1 28 ? 34.231 -9.012  -4.026  1.00 0.00 ? 28 LYS A CB   3  
ATOM 1867  C CG   . LYS A 1 28 ? 35.506 -8.863  -4.876  1.00 0.00 ? 28 LYS A CG   3  
ATOM 1868  C CD   . LYS A 1 28 ? 35.798 -7.428  -5.351  1.00 0.00 ? 28 LYS A CD   3  
ATOM 1869  C CE   . LYS A 1 28 ? 35.423 -7.165  -6.814  1.00 0.00 ? 28 LYS A CE   3  
ATOM 1870  N NZ   . LYS A 1 28 ? 35.900 -8.224  -7.699  1.00 0.00 ? 28 LYS A NZ   3  
ATOM 1871  H H    . LYS A 1 28 ? 36.464 -8.731  -2.280  1.00 0.00 ? 28 LYS A H    3  
ATOM 1872  H HA   . LYS A 1 28 ? 34.558 -7.483  -2.542  1.00 0.00 ? 28 LYS A HA   3  
ATOM 1873  H HB2  . LYS A 1 28 ? 33.947 -10.062 -4.056  1.00 0.00 ? 28 LYS A HB2  3  
ATOM 1874  H HB3  . LYS A 1 28 ? 33.405 -8.471  -4.481  1.00 0.00 ? 28 LYS A HB3  3  
ATOM 1875  H HG2  . LYS A 1 28 ? 36.386 -9.238  -4.352  1.00 0.00 ? 28 LYS A HG2  3  
ATOM 1876  H HG3  . LYS A 1 28 ? 35.419 -9.542  -5.723  1.00 0.00 ? 28 LYS A HG3  3  
ATOM 1877  H HD2  . LYS A 1 28 ? 35.342 -6.684  -4.707  1.00 0.00 ? 28 LYS A HD2  3  
ATOM 1878  H HD3  . LYS A 1 28 ? 36.862 -7.248  -5.242  1.00 0.00 ? 28 LYS A HD3  3  
ATOM 1879  H HE2  . LYS A 1 28 ? 34.342 -7.099  -6.951  1.00 0.00 ? 28 LYS A HE2  3  
ATOM 1880  H HE3  . LYS A 1 28 ? 35.876 -6.224  -7.136  1.00 0.00 ? 28 LYS A HE3  3  
ATOM 1881  H HZ1  . LYS A 1 28 ? 36.101 -7.850  -8.645  1.00 0.00 ? 28 LYS A HZ1  3  
ATOM 1882  H HZ2  . LYS A 1 28 ? 35.165 -8.957  -7.775  1.00 0.00 ? 28 LYS A HZ2  3  
ATOM 1883  H HZ3  . LYS A 1 28 ? 36.767 -8.647  -7.305  1.00 0.00 ? 28 LYS A HZ3  3  
ATOM 1884  N N    . ASN A 1 29 ? 33.232 -8.413  -0.440  1.00 0.00 ? 29 ASN A N    3  
ATOM 1885  C CA   . ASN A 1 29 ? 32.211 -8.763  0.554   1.00 0.00 ? 29 ASN A CA   3  
ATOM 1886  C C    . ASN A 1 29 ? 31.321 -7.521  0.786   1.00 0.00 ? 29 ASN A C    3  
ATOM 1887  O O    . ASN A 1 29 ? 31.043 -6.801  -0.153  1.00 0.00 ? 29 ASN A O    3  
ATOM 1888  C CB   . ASN A 1 29 ? 32.921 -9.318  1.808   1.00 0.00 ? 29 ASN A CB   3  
ATOM 1889  C CG   . ASN A 1 29 ? 32.067 -10.403 2.495   1.00 0.00 ? 29 ASN A CG   3  
ATOM 1890  O OD1  . ASN A 1 29 ? 30.944 -10.162 2.921   1.00 0.00 ? 29 ASN A OD1  3  
ATOM 1891  N ND2  . ASN A 1 29 ? 32.654 -11.612 2.526   1.00 0.00 ? 29 ASN A ND2  3  
ATOM 1892  H H    . ASN A 1 29 ? 34.030 -7.875  -0.177  1.00 0.00 ? 29 ASN A H    3  
ATOM 1893  H HA   . ASN A 1 29 ? 31.580 -9.534  0.106   1.00 0.00 ? 29 ASN A HA   3  
ATOM 1894  H HB2  . ASN A 1 29 ? 33.869 -9.768  1.514   1.00 0.00 ? 29 ASN A HB2  3  
ATOM 1895  H HB3  . ASN A 1 29 ? 33.184 -8.546  2.529   1.00 0.00 ? 29 ASN A HB3  3  
ATOM 1896  H HD21 . ASN A 1 29 ? 33.590 -11.754 2.198   1.00 0.00 ? 29 ASN A HD21 3  
ATOM 1897  H HD22 . ASN A 1 29 ? 32.148 -12.403 2.875   1.00 0.00 ? 29 ASN A HD22 3  
ATOM 1898  N N    . GLU A 1 30 ? 30.894 -7.306  2.056   1.00 0.00 ? 30 GLU A N    3  
ATOM 1899  C CA   . GLU A 1 30 ? 30.069 -6.133  2.363   1.00 0.00 ? 30 GLU A CA   3  
ATOM 1900  C C    . GLU A 1 30 ? 30.480 -5.533  3.704   1.00 0.00 ? 30 GLU A C    3  
ATOM 1901  O O    . GLU A 1 30 ? 31.133 -4.500  3.766   1.00 0.00 ? 30 GLU A O    3  
ATOM 1902  C CB   . GLU A 1 30 ? 28.567 -6.471  2.369   1.00 0.00 ? 30 GLU A CB   3  
ATOM 1903  C CG   . GLU A 1 30 ? 27.987 -6.677  0.958   1.00 0.00 ? 30 GLU A CG   3  
ATOM 1904  C CD   . GLU A 1 30 ? 26.541 -6.163  0.770   1.00 0.00 ? 30 GLU A CD   3  
ATOM 1905  O OE1  . GLU A 1 30 ? 25.875 -5.859  1.750   1.00 0.00 ? 30 GLU A OE1  3  
ATOM 1906  O OE2  . GLU A 1 30 ? 26.110 -6.064  -0.388  1.00 0.00 ? 30 GLU A OE2  3  
ATOM 1907  H H    . GLU A 1 30 ? 31.121 -7.935  2.791   1.00 0.00 ? 30 GLU A H    3  
ATOM 1908  H HA   . GLU A 1 30 ? 30.285 -5.356  1.634   1.00 0.00 ? 30 GLU A HA   3  
ATOM 1909  H HB2  . GLU A 1 30 ? 28.359 -7.348  2.980   1.00 0.00 ? 30 GLU A HB2  3  
ATOM 1910  H HB3  . GLU A 1 30 ? 28.048 -5.653  2.862   1.00 0.00 ? 30 GLU A HB3  3  
ATOM 1911  H HG2  . GLU A 1 30 ? 28.588 -6.146  0.238   1.00 0.00 ? 30 GLU A HG2  3  
ATOM 1912  H HG3  . GLU A 1 30 ? 28.059 -7.725  0.686   1.00 0.00 ? 30 GLU A HG3  3  
ATOM 1913  N N    . ASN A 1 31 ? 30.040 -6.242  4.761   1.00 0.00 ? 31 ASN A N    3  
ATOM 1914  C CA   . ASN A 1 31 ? 30.347 -5.836  6.126   1.00 0.00 ? 31 ASN A CA   3  
ATOM 1915  C C    . ASN A 1 31 ? 31.862 -5.814  6.373   1.00 0.00 ? 31 ASN A C    3  
ATOM 1916  O O    . ASN A 1 31 ? 32.321 -5.144  7.284   1.00 0.00 ? 31 ASN A O    3  
ATOM 1917  C CB   . ASN A 1 31 ? 29.685 -6.837  7.101   1.00 0.00 ? 31 ASN A CB   3  
ATOM 1918  C CG   . ASN A 1 31 ? 28.616 -6.167  7.972   1.00 0.00 ? 31 ASN A CG   3  
ATOM 1919  O OD1  . ASN A 1 31 ? 27.458 -6.564  7.981   1.00 0.00 ? 31 ASN A OD1  3  
ATOM 1920  N ND2  . ASN A 1 31 ? 29.091 -5.142  8.699   1.00 0.00 ? 31 ASN A ND2  3  
ATOM 1921  H H    . ASN A 1 31 ? 29.516 -7.075  4.600   1.00 0.00 ? 31 ASN A H    3  
ATOM 1922  H HA   . ASN A 1 31 ? 29.982 -4.810  6.231   1.00 0.00 ? 31 ASN A HA   3  
ATOM 1923  H HB2  . ASN A 1 31 ? 29.217 -7.654  6.553   1.00 0.00 ? 31 ASN A HB2  3  
ATOM 1924  H HB3  . ASN A 1 31 ? 30.401 -7.317  7.771   1.00 0.00 ? 31 ASN A HB3  3  
ATOM 1925  H HD21 . ASN A 1 31 ? 30.053 -4.870  8.629   1.00 0.00 ? 31 ASN A HD21 3  
ATOM 1926  H HD22 . ASN A 1 31 ? 28.488 -4.636  9.316   1.00 0.00 ? 31 ASN A HD22 3  
ATOM 1927  N N    . LEU A 1 32 ? 32.584 -6.578  5.520   1.00 0.00 ? 32 LEU A N    3  
ATOM 1928  C CA   . LEU A 1 32 ? 34.034 -6.672  5.657   1.00 0.00 ? 32 LEU A CA   3  
ATOM 1929  C C    . LEU A 1 32 ? 34.693 -5.413  5.073   1.00 0.00 ? 32 LEU A C    3  
ATOM 1930  O O    . LEU A 1 32 ? 35.552 -4.800  5.689   1.00 0.00 ? 32 LEU A O    3  
ATOM 1931  C CB   . LEU A 1 32 ? 34.550 -7.915  4.902   1.00 0.00 ? 32 LEU A CB   3  
ATOM 1932  C CG   . LEU A 1 32 ? 35.699 -8.671  5.599   1.00 0.00 ? 32 LEU A CG   3  
ATOM 1933  C CD1  . LEU A 1 32 ? 36.625 -7.790  6.449   1.00 0.00 ? 32 LEU A CD1  3  
ATOM 1934  C CD2  . LEU A 1 32 ? 35.130 -9.806  6.447   1.00 0.00 ? 32 LEU A CD2  3  
ATOM 1935  H H    . LEU A 1 32 ? 32.122 -7.079  4.790   1.00 0.00 ? 32 LEU A H    3  
ATOM 1936  H HA   . LEU A 1 32 ? 34.231 -6.736  6.730   1.00 0.00 ? 32 LEU A HA   3  
ATOM 1937  H HB2  . LEU A 1 32 ? 33.726 -8.605  4.730   1.00 0.00 ? 32 LEU A HB2  3  
ATOM 1938  H HB3  . LEU A 1 32 ? 34.857 -7.663  3.888   1.00 0.00 ? 32 LEU A HB3  3  
ATOM 1939  H HG   . LEU A 1 32 ? 36.307 -9.122  4.815   1.00 0.00 ? 32 LEU A HG   3  
ATOM 1940  H HD11 . LEU A 1 32 ? 37.570 -8.298  6.637   1.00 0.00 ? 32 LEU A HD11 3  
ATOM 1941  H HD12 . LEU A 1 32 ? 36.175 -7.558  7.414   1.00 0.00 ? 32 LEU A HD12 3  
ATOM 1942  H HD13 . LEU A 1 32 ? 36.853 -6.848  5.963   1.00 0.00 ? 32 LEU A HD13 3  
ATOM 1943  H HD21 . LEU A 1 32 ? 35.922 -10.367 6.940   1.00 0.00 ? 32 LEU A HD21 3  
ATOM 1944  H HD22 . LEU A 1 32 ? 34.555 -10.495 5.830   1.00 0.00 ? 32 LEU A HD22 3  
ATOM 1945  H HD23 . LEU A 1 32 ? 34.469 -9.408  7.216   1.00 0.00 ? 32 LEU A HD23 3  
ATOM 1946  N N    . ALA A 1 33 ? 34.233 -5.083  3.844   1.00 0.00 ? 33 ALA A N    3  
ATOM 1947  C CA   . ALA A 1 33 ? 34.786 -3.935  3.136   1.00 0.00 ? 33 ALA A CA   3  
ATOM 1948  C C    . ALA A 1 33 ? 34.570 -2.637  3.910   1.00 0.00 ? 33 ALA A C    3  
ATOM 1949  O O    . ALA A 1 33 ? 35.480 -1.842  4.067   1.00 0.00 ? 33 ALA A O    3  
ATOM 1950  C CB   . ALA A 1 33 ? 34.145 -3.785  1.769   1.00 0.00 ? 33 ALA A CB   3  
ATOM 1951  H H    . ALA A 1 33 ? 33.522 -5.635  3.409   1.00 0.00 ? 33 ALA A H    3  
ATOM 1952  H HA   . ALA A 1 33 ? 35.857 -4.103  3.030   1.00 0.00 ? 33 ALA A HA   3  
ATOM 1953  H HB1  . ALA A 1 33 ? 34.581 -2.901  1.307   1.00 0.00 ? 33 ALA A HB1  3  
ATOM 1954  H HB2  . ALA A 1 33 ? 33.064 -3.649  1.831   1.00 0.00 ? 33 ALA A HB2  3  
ATOM 1955  H HB3  . ALA A 1 33 ? 34.341 -4.645  1.129   1.00 0.00 ? 33 ALA A HB3  3  
ATOM 1956  N N    . ALA A 1 34 ? 33.322 -2.500  4.406   1.00 0.00 ? 34 ALA A N    3  
ATOM 1957  C CA   . ALA A 1 34 ? 33.008 -1.373  5.271   1.00 0.00 ? 34 ALA A CA   3  
ATOM 1958  C C    . ALA A 1 34 ? 33.948 -1.371  6.484   1.00 0.00 ? 34 ALA A C    3  
ATOM 1959  O O    . ALA A 1 34 ? 34.562 -0.376  6.793   1.00 0.00 ? 34 ALA A O    3  
ATOM 1960  C CB   . ALA A 1 34 ? 31.545 -1.427  5.718   1.00 0.00 ? 34 ALA A CB   3  
ATOM 1961  H H    . ALA A 1 34 ? 32.639 -3.198  4.210   1.00 0.00 ? 34 ALA A H    3  
ATOM 1962  H HA   . ALA A 1 34 ? 33.191 -0.467  4.688   1.00 0.00 ? 34 ALA A HA   3  
ATOM 1963  H HB1  . ALA A 1 34 ? 31.320 -2.336  6.279   1.00 0.00 ? 34 ALA A HB1  3  
ATOM 1964  H HB2  . ALA A 1 34 ? 30.880 -1.398  4.856   1.00 0.00 ? 34 ALA A HB2  3  
ATOM 1965  H HB3  . ALA A 1 34 ? 31.306 -0.569  6.349   1.00 0.00 ? 34 ALA A HB3  3  
ATOM 1966  N N    . ASN A 1 35 ? 34.077 -2.557  7.119   1.00 0.00 ? 35 ASN A N    3  
ATOM 1967  C CA   . ASN A 1 35 ? 34.971 -2.622  8.276   1.00 0.00 ? 35 ASN A CA   3  
ATOM 1968  C C    . ASN A 1 35 ? 36.411 -2.150  7.953   1.00 0.00 ? 35 ASN A C    3  
ATOM 1969  O O    . ASN A 1 35 ? 37.037 -1.511  8.759   1.00 0.00 ? 35 ASN A O    3  
ATOM 1970  C CB   . ASN A 1 35 ? 35.044 -4.053  8.830   1.00 0.00 ? 35 ASN A CB   3  
ATOM 1971  C CG   . ASN A 1 35 ? 35.017 -4.032  10.364  1.00 0.00 ? 35 ASN A CG   3  
ATOM 1972  O OD1  . ASN A 1 35 ? 35.638 -3.198  11.012  1.00 0.00 ? 35 ASN A OD1  3  
ATOM 1973  N ND2  . ASN A 1 35 ? 34.229 -4.989  10.881  1.00 0.00 ? 35 ASN A ND2  3  
ATOM 1974  H H    . ASN A 1 35 ? 33.581 -3.358  6.796   1.00 0.00 ? 35 ASN A H    3  
ATOM 1975  H HA   . ASN A 1 35 ? 34.534 -1.923  9.000   1.00 0.00 ? 35 ASN A HA   3  
ATOM 1976  H HB2  . ASN A 1 35 ? 34.209 -4.641  8.472   1.00 0.00 ? 35 ASN A HB2  3  
ATOM 1977  H HB3  . ASN A 1 35 ? 35.929 -4.596  8.495   1.00 0.00 ? 35 ASN A HB3  3  
ATOM 1978  H HD21 . ASN A 1 35 ? 33.784 -5.661  10.288  1.00 0.00 ? 35 ASN A HD21 3  
ATOM 1979  H HD22 . ASN A 1 35 ? 34.076 -5.044  11.868  1.00 0.00 ? 35 ASN A HD22 3  
ATOM 1980  N N    . PHE A 1 36 ? 36.869 -2.490  6.721   1.00 0.00 ? 36 PHE A N    3  
ATOM 1981  C CA   . PHE A 1 36 ? 38.210 -2.080  6.278   1.00 0.00 ? 36 PHE A CA   3  
ATOM 1982  C C    . PHE A 1 36 ? 38.347 -0.541  6.286   1.00 0.00 ? 36 PHE A C    3  
ATOM 1983  O O    . PHE A 1 36 ? 39.268 0.012   6.872   1.00 0.00 ? 36 PHE A O    3  
ATOM 1984  C CB   . PHE A 1 36 ? 38.460 -2.656  4.868   1.00 0.00 ? 36 PHE A CB   3  
ATOM 1985  C CG   . PHE A 1 36 ? 39.836 -2.372  4.303   1.00 0.00 ? 36 PHE A CG   3  
ATOM 1986  C CD1  . PHE A 1 36 ? 40.213 -1.078  3.939   1.00 0.00 ? 36 PHE A CD1  3  
ATOM 1987  C CD2  . PHE A 1 36 ? 40.740 -3.406  4.077   1.00 0.00 ? 36 PHE A CD2  3  
ATOM 1988  C CE1  . PHE A 1 36 ? 41.445 -0.821  3.361   1.00 0.00 ? 36 PHE A CE1  3  
ATOM 1989  C CE2  . PHE A 1 36 ? 41.981 -3.152  3.501   1.00 0.00 ? 36 PHE A CE2  3  
ATOM 1990  C CZ   . PHE A 1 36 ? 42.334 -1.859  3.139   1.00 0.00 ? 36 PHE A CZ   3  
ATOM 1991  H H    . PHE A 1 36 ? 36.259 -2.976  6.109   1.00 0.00 ? 36 PHE A H    3  
ATOM 1992  H HA   . PHE A 1 36 ? 38.925 -2.506  6.982   1.00 0.00 ? 36 PHE A HA   3  
ATOM 1993  H HB2  . PHE A 1 36 ? 38.277 -3.732  4.873   1.00 0.00 ? 36 PHE A HB2  3  
ATOM 1994  H HB3  . PHE A 1 36 ? 37.734 -2.258  4.169   1.00 0.00 ? 36 PHE A HB3  3  
ATOM 1995  H HD1  . PHE A 1 36 ? 39.542 -0.242  4.042   1.00 0.00 ? 36 PHE A HD1  3  
ATOM 1996  H HD2  . PHE A 1 36 ? 40.468 -4.422  4.322   1.00 0.00 ? 36 PHE A HD2  3  
ATOM 1997  H HE1  . PHE A 1 36 ? 41.687 0.191   3.065   1.00 0.00 ? 36 PHE A HE1  3  
ATOM 1998  H HE2  . PHE A 1 36 ? 42.670 -3.964  3.316   1.00 0.00 ? 36 PHE A HE2  3  
ATOM 1999  H HZ   . PHE A 1 36 ? 43.289 -1.655  2.677   1.00 0.00 ? 36 PHE A HZ   3  
ATOM 2000  N N    . LEU A 1 37 ? 37.392 0.096   5.570   1.00 0.00 ? 37 LEU A N    3  
ATOM 2001  C CA   . LEU A 1 37 ? 37.500 1.523   5.300   1.00 0.00 ? 37 LEU A CA   3  
ATOM 2002  C C    . LEU A 1 37 ? 37.258 2.367   6.574   1.00 0.00 ? 37 LEU A C    3  
ATOM 2003  O O    . LEU A 1 37 ? 37.790 3.463   6.718   1.00 0.00 ? 37 LEU A O    3  
ATOM 2004  C CB   . LEU A 1 37 ? 36.505 1.930   4.212   1.00 0.00 ? 37 LEU A CB   3  
ATOM 2005  C CG   . LEU A 1 37 ? 36.706 1.290   2.817   1.00 0.00 ? 37 LEU A CG   3  
ATOM 2006  C CD1  . LEU A 1 37 ? 35.495 0.448   2.411   1.00 0.00 ? 37 LEU A CD1  3  
ATOM 2007  C CD2  . LEU A 1 37 ? 36.974 2.330   1.711   1.00 0.00 ? 37 LEU A CD2  3  
ATOM 2008  H H    . LEU A 1 37 ? 36.615 -0.403  5.196   1.00 0.00 ? 37 LEU A H    3  
ATOM 2009  H HA   . LEU A 1 37 ? 38.511 1.708   4.942   1.00 0.00 ? 37 LEU A HA   3  
ATOM 2010  H HB2  . LEU A 1 37 ? 35.487 1.755   4.546   1.00 0.00 ? 37 LEU A HB2  3  
ATOM 2011  H HB3  . LEU A 1 37 ? 36.616 3.004   4.154   1.00 0.00 ? 37 LEU A HB3  3  
ATOM 2012  H HG   . LEU A 1 37 ? 37.567 0.624   2.873   1.00 0.00 ? 37 LEU A HG   3  
ATOM 2013  H HD11 . LEU A 1 37 ? 35.796 -0.462  1.890   1.00 0.00 ? 37 LEU A HD11 3  
ATOM 2014  H HD12 . LEU A 1 37 ? 34.847 1.022   1.759   1.00 0.00 ? 37 LEU A HD12 3  
ATOM 2015  H HD13 . LEU A 1 37 ? 34.856 0.192   3.251   1.00 0.00 ? 37 LEU A HD13 3  
ATOM 2016  H HD21 . LEU A 1 37 ? 37.148 3.315   2.120   1.00 0.00 ? 37 LEU A HD21 3  
ATOM 2017  H HD22 . LEU A 1 37 ? 36.166 2.445   0.985   1.00 0.00 ? 37 LEU A HD22 3  
ATOM 2018  H HD23 . LEU A 1 37 ? 37.855 2.059   1.150   1.00 0.00 ? 37 LEU A HD23 3  
ATOM 2019  N N    . LEU A 1 38 ? 36.432 1.781   7.473   1.00 0.00 ? 38 LEU A N    3  
ATOM 2020  C CA   . LEU A 1 38 ? 36.035 2.458   8.707   1.00 0.00 ? 38 LEU A CA   3  
ATOM 2021  C C    . LEU A 1 38 ? 37.103 2.235   9.807   1.00 0.00 ? 38 LEU A C    3  
ATOM 2022  O O    . LEU A 1 38 ? 37.260 3.037   10.720  1.00 0.00 ? 38 LEU A O    3  
ATOM 2023  C CB   . LEU A 1 38 ? 34.637 2.000   9.212   1.00 0.00 ? 38 LEU A CB   3  
ATOM 2024  C CG   . LEU A 1 38 ? 33.447 1.938   8.210   1.00 0.00 ? 38 LEU A CG   3  
ATOM 2025  C CD1  . LEU A 1 38 ? 32.199 2.669   8.714   1.00 0.00 ? 38 LEU A CD1  3  
ATOM 2026  C CD2  . LEU A 1 38 ? 33.771 2.453   6.811   1.00 0.00 ? 38 LEU A CD2  3  
ATOM 2027  H H    . LEU A 1 38 ? 36.053 0.878   7.290   1.00 0.00 ? 38 LEU A H    3  
ATOM 2028  H HA   . LEU A 1 38 ? 36.006 3.519   8.466   1.00 0.00 ? 38 LEU A HA   3  
ATOM 2029  H HB2  . LEU A 1 38 ? 34.733 1.013   9.666   1.00 0.00 ? 38 LEU A HB2  3  
ATOM 2030  H HB3  . LEU A 1 38 ? 34.363 2.672   10.028  1.00 0.00 ? 38 LEU A HB3  3  
ATOM 2031  H HG   . LEU A 1 38 ? 33.131 0.899   8.134   1.00 0.00 ? 38 LEU A HG   3  
ATOM 2032  H HD11 . LEU A 1 38 ? 32.376 3.740   8.818   1.00 0.00 ? 38 LEU A HD11 3  
ATOM 2033  H HD12 . LEU A 1 38 ? 31.870 2.265   9.668   1.00 0.00 ? 38 LEU A HD12 3  
ATOM 2034  H HD13 . LEU A 1 38 ? 31.376 2.540   8.010   1.00 0.00 ? 38 LEU A HD13 3  
ATOM 2035  H HD21 . LEU A 1 38 ? 34.459 3.282   6.895   1.00 0.00 ? 38 LEU A HD21 3  
ATOM 2036  H HD22 . LEU A 1 38 ? 32.884 2.803   6.295   1.00 0.00 ? 38 LEU A HD22 3  
ATOM 2037  H HD23 . LEU A 1 38 ? 34.223 1.714   6.164   1.00 0.00 ? 38 LEU A HD23 3  
ATOM 2038  N N    . SER A 1 39 ? 37.821 1.098   9.638   1.00 0.00 ? 39 SER A N    3  
ATOM 2039  C CA   . SER A 1 39 ? 38.913 0.715   10.533  1.00 0.00 ? 39 SER A CA   3  
ATOM 2040  C C    . SER A 1 39 ? 40.167 1.566   10.283  1.00 0.00 ? 39 SER A C    3  
ATOM 2041  O O    . SER A 1 39 ? 41.011 1.699   11.161  1.00 0.00 ? 39 SER A O    3  
ATOM 2042  C CB   . SER A 1 39 ? 39.282 -0.771  10.360  1.00 0.00 ? 39 SER A CB   3  
ATOM 2043  O OG   . SER A 1 39 ? 38.377 -1.655  10.989  1.00 0.00 ? 39 SER A OG   3  
ATOM 2044  H H    . SER A 1 39 ? 37.619 0.503   8.865   1.00 0.00 ? 39 SER A H    3  
ATOM 2045  H HA   . SER A 1 39 ? 38.567 0.897   11.549  1.00 0.00 ? 39 SER A HA   3  
ATOM 2046  H HB2  . SER A 1 39 ? 39.403 -1.032  9.304   1.00 0.00 ? 39 SER A HB2  3  
ATOM 2047  H HB3  . SER A 1 39 ? 40.246 -0.975  10.826  1.00 0.00 ? 39 SER A HB3  3  
ATOM 2048  H HG   . SER A 1 39 ? 37.492 -1.488  10.675  1.00 0.00 ? 39 SER A HG   3  
ATOM 2049  N N    . GLN A 1 40 ? 40.224 2.130   9.055   1.00 0.00 ? 40 GLN A N    3  
ATOM 2050  C CA   . GLN A 1 40 ? 41.306 3.048   8.705   1.00 0.00 ? 40 GLN A CA   3  
ATOM 2051  C C    . GLN A 1 40 ? 40.970 4.471   9.202   1.00 0.00 ? 40 GLN A C    3  
ATOM 2052  O O    . GLN A 1 40 ? 40.613 5.354   8.430   1.00 0.00 ? 40 GLN A O    3  
ATOM 2053  C CB   . GLN A 1 40 ? 41.531 3.043   7.181   1.00 0.00 ? 40 GLN A CB   3  
ATOM 2054  C CG   . GLN A 1 40 ? 42.034 1.689   6.614   1.00 0.00 ? 40 GLN A CG   3  
ATOM 2055  C CD   . GLN A 1 40 ? 43.305 1.825   5.739   1.00 0.00 ? 40 GLN A CD   3  
ATOM 2056  O OE1  . GLN A 1 40 ? 43.918 2.880   5.639   1.00 0.00 ? 40 GLN A OE1  3  
ATOM 2057  N NE2  . GLN A 1 40 ? 43.616 0.706   5.060   1.00 0.00 ? 40 GLN A NE2  3  
ATOM 2058  H H    . GLN A 1 40 ? 39.499 1.951   8.391   1.00 0.00 ? 40 GLN A H    3  
ATOM 2059  H HA   . GLN A 1 40 ? 42.216 2.713   9.206   1.00 0.00 ? 40 GLN A HA   3  
ATOM 2060  H HB2  . GLN A 1 40 ? 40.606 3.319   6.673   1.00 0.00 ? 40 GLN A HB2  3  
ATOM 2061  H HB3  . GLN A 1 40 ? 42.223 3.853   6.946   1.00 0.00 ? 40 GLN A HB3  3  
ATOM 2062  H HG2  . GLN A 1 40 ? 42.217 0.952   7.397   1.00 0.00 ? 40 GLN A HG2  3  
ATOM 2063  H HG3  . GLN A 1 40 ? 41.254 1.247   5.996   1.00 0.00 ? 40 GLN A HG3  3  
ATOM 2064  H HE21 . GLN A 1 40 ? 43.214 -0.178  5.312   1.00 0.00 ? 40 GLN A HE21 3  
ATOM 2065  H HE22 . GLN A 1 40 ? 44.239 0.737   4.276   1.00 0.00 ? 40 GLN A HE22 3  
ATOM 2066  N N    . ASN A 1 41 ? 41.159 4.622   10.536  1.00 0.00 ? 41 ASN A N    3  
ATOM 2067  C CA   . ASN A 1 41 ? 41.112 5.908   11.245  1.00 0.00 ? 41 ASN A CA   3  
ATOM 2068  C C    . ASN A 1 41 ? 41.913 6.993   10.507  1.00 0.00 ? 41 ASN A C    3  
ATOM 2069  O O    . ASN A 1 41 ? 43.078 6.816   10.173  1.00 0.00 ? 41 ASN A O    3  
ATOM 2070  C CB   . ASN A 1 41 ? 41.660 5.765   12.683  1.00 0.00 ? 41 ASN A CB   3  
ATOM 2071  C CG   . ASN A 1 41 ? 42.738 4.666   12.812  1.00 0.00 ? 41 ASN A CG   3  
ATOM 2072  O OD1  . ASN A 1 41 ? 43.597 4.490   11.956  1.00 0.00 ? 41 ASN A OD1  3  
ATOM 2073  N ND2  . ASN A 1 41 ? 42.572 3.895   13.901  1.00 0.00 ? 41 ASN A ND2  3  
ATOM 2074  H H    . ASN A 1 41 ? 41.375 3.814   11.079  1.00 0.00 ? 41 ASN A H    3  
ATOM 2075  H HA   . ASN A 1 41 ? 40.058 6.192   11.280  1.00 0.00 ? 41 ASN A HA   3  
ATOM 2076  H HB2  . ASN A 1 41 ? 42.066 6.701   13.072  1.00 0.00 ? 41 ASN A HB2  3  
ATOM 2077  H HB3  . ASN A 1 41 ? 40.831 5.534   13.347  1.00 0.00 ? 41 ASN A HB3  3  
ATOM 2078  H HD21 . ASN A 1 41 ? 41.994 4.209   14.657  1.00 0.00 ? 41 ASN A HD21 3  
ATOM 2079  H HD22 . ASN A 1 41 ? 43.009 2.998   13.967  1.00 0.00 ? 41 ASN A HD22 3  
ATOM 2080  N N    . PHE A 1 42 ? 41.171 8.103   10.279  1.00 0.00 ? 42 PHE A N    3  
ATOM 2081  C CA   . PHE A 1 42 ? 41.661 9.232   9.498   1.00 0.00 ? 42 PHE A CA   3  
ATOM 2082  C C    . PHE A 1 42 ? 40.538 10.283  9.391   1.00 0.00 ? 42 PHE A C    3  
ATOM 2083  O O    . PHE A 1 42 ? 39.839 10.354  8.388   1.00 0.00 ? 42 PHE A O    3  
ATOM 2084  C CB   . PHE A 1 42 ? 42.076 8.763   8.083   1.00 0.00 ? 42 PHE A CB   3  
ATOM 2085  C CG   . PHE A 1 42 ? 42.479 9.897   7.177   1.00 0.00 ? 42 PHE A CG   3  
ATOM 2086  C CD1  . PHE A 1 42 ? 43.409 10.848  7.591   1.00 0.00 ? 42 PHE A CD1  3  
ATOM 2087  C CD2  . PHE A 1 42 ? 41.915 10.011  5.912   1.00 0.00 ? 42 PHE A CD2  3  
ATOM 2088  C CE1  . PHE A 1 42 ? 43.753 11.905  6.761   1.00 0.00 ? 42 PHE A CE1  3  
ATOM 2089  C CE2  . PHE A 1 42 ? 42.259 11.067  5.079   1.00 0.00 ? 42 PHE A CE2  3  
ATOM 2090  C CZ   . PHE A 1 42 ? 43.175 12.017  5.504   1.00 0.00 ? 42 PHE A CZ   3  
ATOM 2091  H H    . PHE A 1 42 ? 40.245 8.129   10.651  1.00 0.00 ? 42 PHE A H    3  
ATOM 2092  H HA   . PHE A 1 42 ? 42.500 9.657   10.051  1.00 0.00 ? 42 PHE A HA   3  
ATOM 2093  H HB2  . PHE A 1 42 ? 42.923 8.083   8.124   1.00 0.00 ? 42 PHE A HB2  3  
ATOM 2094  H HB3  . PHE A 1 42 ? 41.254 8.200   7.631   1.00 0.00 ? 42 PHE A HB3  3  
ATOM 2095  H HD1  . PHE A 1 42 ? 43.870 10.771  8.564   1.00 0.00 ? 42 PHE A HD1  3  
ATOM 2096  H HD2  . PHE A 1 42 ? 41.203 9.276   5.571   1.00 0.00 ? 42 PHE A HD2  3  
ATOM 2097  H HE1  . PHE A 1 42 ? 44.466 12.644  7.095   1.00 0.00 ? 42 PHE A HE1  3  
ATOM 2098  H HE2  . PHE A 1 42 ? 41.808 11.147  4.102   1.00 0.00 ? 42 PHE A HE2  3  
ATOM 2099  H HZ   . PHE A 1 42 ? 43.434 12.842  4.860   1.00 0.00 ? 42 PHE A HZ   3  
ATOM 2100  N N    . ASP A 1 43 ? 40.435 11.090  10.474  1.00 0.00 ? 43 ASP A N    3  
ATOM 2101  C CA   . ASP A 1 43 ? 39.503 12.218  10.530  1.00 0.00 ? 43 ASP A CA   3  
ATOM 2102  C C    . ASP A 1 43 ? 39.617 12.871  11.924  1.00 0.00 ? 43 ASP A C    3  
ATOM 2103  O O    . ASP A 1 43 ? 40.265 13.896  12.097  1.00 0.00 ? 43 ASP A O    3  
ATOM 2104  C CB   . ASP A 1 43 ? 38.048 11.788  10.198  1.00 0.00 ? 43 ASP A CB   3  
ATOM 2105  C CG   . ASP A 1 43 ? 37.016 12.926  10.360  1.00 0.00 ? 43 ASP A CG   3  
ATOM 2106  O OD1  . ASP A 1 43 ? 37.286 14.033  9.896   1.00 0.00 ? 43 ASP A OD1  3  
ATOM 2107  O OD2  . ASP A 1 43 ? 35.958 12.688  10.939  1.00 0.00 ? 43 ASP A OD2  3  
ATOM 2108  H H    . ASP A 1 43 ? 41.044 10.928  11.251  1.00 0.00 ? 43 ASP A H    3  
ATOM 2109  H HA   . ASP A 1 43 ? 39.866 12.939  9.793   1.00 0.00 ? 43 ASP A HA   3  
ATOM 2110  H HB2  . ASP A 1 43 ? 37.967 11.476  9.160   1.00 0.00 ? 43 ASP A HB2  3  
ATOM 2111  H HB3  . ASP A 1 43 ? 37.752 10.920  10.790  1.00 0.00 ? 43 ASP A HB3  3  
ATOM 2112  N N    . ASP A 1 44 ? 38.919 12.217  12.881  1.00 0.00 ? 44 ASP A N    3  
ATOM 2113  C CA   . ASP A 1 44 ? 38.818 12.745  14.235  1.00 0.00 ? 44 ASP A CA   3  
ATOM 2114  C C    . ASP A 1 44 ? 38.136 11.671  15.102  1.00 0.00 ? 44 ASP A C    3  
ATOM 2115  O O    . ASP A 1 44 ? 36.932 11.454  15.028  1.00 0.00 ? 44 ASP A O    3  
ATOM 2116  C CB   . ASP A 1 44 ? 37.999 14.073  14.232  1.00 0.00 ? 44 ASP A CB   3  
ATOM 2117  C CG   . ASP A 1 44 ? 38.706 15.265  14.926  1.00 0.00 ? 44 ASP A CG   3  
ATOM 2118  O OD1  . ASP A 1 44 ? 39.933 15.253  15.041  1.00 0.00 ? 44 ASP A OD1  3  
ATOM 2119  O OD2  . ASP A 1 44 ? 38.019 16.195  15.338  1.00 0.00 ? 44 ASP A OD2  3  
ATOM 2120  H H    . ASP A 1 44 ? 38.431 11.377  12.656  1.00 0.00 ? 44 ASP A H    3  
ATOM 2121  H HA   . ASP A 1 44 ? 39.853 12.857  14.571  1.00 0.00 ? 44 ASP A HA   3  
ATOM 2122  H HB2  . ASP A 1 44 ? 37.759 14.384  13.214  1.00 0.00 ? 44 ASP A HB2  3  
ATOM 2123  H HB3  . ASP A 1 44 ? 37.015 13.954  14.689  1.00 0.00 ? 44 ASP A HB3  3  
ATOM 2124  N N    . GLU A 1 45 ? 38.994 11.029  15.922  1.00 0.00 ? 45 GLU A N    3  
ATOM 2125  C CA   . GLU A 1 45 ? 38.517 10.015  16.856  1.00 0.00 ? 45 GLU A CA   3  
ATOM 2126  C C    . GLU A 1 45 ? 39.471 9.987   18.070  1.00 0.00 ? 45 GLU A C    3  
ATOM 2127  O O    . GLU A 1 45 ? 40.561 9.421   17.950  1.00 0.00 ? 45 GLU A O    3  
ATOM 2128  C CB   . GLU A 1 45 ? 38.415 8.650   16.145  1.00 0.00 ? 45 GLU A CB   3  
ATOM 2129  C CG   . GLU A 1 45 ? 37.688 7.574   16.981  1.00 0.00 ? 45 GLU A CG   3  
ATOM 2130  C CD   . GLU A 1 45 ? 38.624 6.416   17.400  1.00 0.00 ? 45 GLU A CD   3  
ATOM 2131  O OE1  . GLU A 1 45 ? 39.490 6.628   18.246  1.00 0.00 ? 45 GLU A OE1  3  
ATOM 2132  O OE2  . GLU A 1 45 ? 38.469 5.313   16.874  1.00 0.00 ? 45 GLU A OE2  3  
ATOM 2133  O OXT  . GLU A 1 45 ? 39.122 10.536  19.111  1.00 0.00 ? 45 GLU A OXT  3  
ATOM 2134  H H    . GLU A 1 45 ? 39.965 11.262  15.886  1.00 0.00 ? 45 GLU A H    3  
ATOM 2135  H HA   . GLU A 1 45 ? 37.526 10.331  17.191  1.00 0.00 ? 45 GLU A HA   3  
ATOM 2136  H HB2  . GLU A 1 45 ? 37.865 8.783   15.212  1.00 0.00 ? 45 GLU A HB2  3  
ATOM 2137  H HB3  . GLU A 1 45 ? 39.398 8.313   15.815  1.00 0.00 ? 45 GLU A HB3  3  
ATOM 2138  H HG2  . GLU A 1 45 ? 37.216 7.998   17.868  1.00 0.00 ? 45 GLU A HG2  3  
ATOM 2139  H HG3  . GLU A 1 45 ? 36.861 7.168   16.401  1.00 0.00 ? 45 GLU A HG3  3  
ATOM 2140  N N    . GLN A 1 1  ? 30.790 -4.519  -12.151 1.00 0.00 ? 1  GLN A N    4  
ATOM 2141  C CA   . GLN A 1 1  ? 29.888 -5.342  -11.348 1.00 0.00 ? 1  GLN A CA   4  
ATOM 2142  C C    . GLN A 1 1  ? 29.849 -4.893  -9.874  1.00 0.00 ? 1  GLN A C    4  
ATOM 2143  O O    . GLN A 1 1  ? 28.853 -5.059  -9.185  1.00 0.00 ? 1  GLN A O    4  
ATOM 2144  C CB   . GLN A 1 1  ? 30.188 -6.852  -11.430 1.00 0.00 ? 1  GLN A CB   4  
ATOM 2145  C CG   . GLN A 1 1  ? 31.528 -7.275  -10.788 1.00 0.00 ? 1  GLN A CG   4  
ATOM 2146  C CD   . GLN A 1 1  ? 31.520 -8.759  -10.395 1.00 0.00 ? 1  GLN A CD   4  
ATOM 2147  O OE1  . GLN A 1 1  ? 30.647 -9.227  -9.683  1.00 0.00 ? 1  GLN A OE1  4  
ATOM 2148  N NE2  . GLN A 1 1  ? 32.571 -9.458  -10.871 1.00 0.00 ? 1  GLN A NE2  4  
ATOM 2149  H H1   . GLN A 1 1  ? 31.775 -4.780  -11.937 1.00 0.00 ? 1  GLN A H1   4  
ATOM 2150  H H2   . GLN A 1 1  ? 30.639 -3.519  -11.914 1.00 0.00 ? 1  GLN A H2   4  
ATOM 2151  H H3   . GLN A 1 1  ? 30.600 -4.667  -13.164 1.00 0.00 ? 1  GLN A H3   4  
ATOM 2152  H HA   . GLN A 1 1  ? 28.888 -5.178  -11.752 1.00 0.00 ? 1  GLN A HA   4  
ATOM 2153  H HB2  . GLN A 1 1  ? 29.364 -7.385  -10.955 1.00 0.00 ? 1  GLN A HB2  4  
ATOM 2154  H HB3  . GLN A 1 1  ? 30.175 -7.181  -12.471 1.00 0.00 ? 1  GLN A HB3  4  
ATOM 2155  H HG2  . GLN A 1 1  ? 32.353 -7.060  -11.465 1.00 0.00 ? 1  GLN A HG2  4  
ATOM 2156  H HG3  . GLN A 1 1  ? 31.739 -6.735  -9.867  1.00 0.00 ? 1  GLN A HG3  4  
ATOM 2157  H HE21 . GLN A 1 1  ? 33.258 -9.023  -11.455 1.00 0.00 ? 1  GLN A HE21 4  
ATOM 2158  H HE22 . GLN A 1 1  ? 32.673 -10.419 -10.626 1.00 0.00 ? 1  GLN A HE22 4  
ATOM 2159  N N    . GLU A 1 2  ? 31.005 -4.335  -9.445  1.00 0.00 ? 2  GLU A N    4  
ATOM 2160  C CA   . GLU A 1 2  ? 31.204 -3.940  -8.056  1.00 0.00 ? 2  GLU A CA   4  
ATOM 2161  C C    . GLU A 1 2  ? 31.160 -2.416  -7.900  1.00 0.00 ? 2  GLU A C    4  
ATOM 2162  O O    . GLU A 1 2  ? 31.144 -1.914  -6.789  1.00 0.00 ? 2  GLU A O    4  
ATOM 2163  C CB   . GLU A 1 2  ? 32.519 -4.555  -7.549  1.00 0.00 ? 2  GLU A CB   4  
ATOM 2164  C CG   . GLU A 1 2  ? 32.717 -4.450  -6.021  1.00 0.00 ? 2  GLU A CG   4  
ATOM 2165  C CD   . GLU A 1 2  ? 33.533 -3.205  -5.604  1.00 0.00 ? 2  GLU A CD   4  
ATOM 2166  O OE1  . GLU A 1 2  ? 34.610 -3.012  -6.153  1.00 0.00 ? 2  GLU A OE1  4  
ATOM 2167  O OE2  . GLU A 1 2  ? 33.099 -2.445  -4.735  1.00 0.00 ? 2  GLU A OE2  4  
ATOM 2168  H H    . GLU A 1 2  ? 31.744 -4.186  -10.100 1.00 0.00 ? 2  GLU A H    4  
ATOM 2169  H HA   . GLU A 1 2  ? 30.373 -4.327  -7.467  1.00 0.00 ? 2  GLU A HA   4  
ATOM 2170  H HB2  . GLU A 1 2  ? 32.499 -5.617  -7.794  1.00 0.00 ? 2  GLU A HB2  4  
ATOM 2171  H HB3  . GLU A 1 2  ? 33.372 -4.159  -8.105  1.00 0.00 ? 2  GLU A HB3  4  
ATOM 2172  H HG2  . GLU A 1 2  ? 31.766 -4.482  -5.492  1.00 0.00 ? 2  GLU A HG2  4  
ATOM 2173  H HG3  . GLU A 1 2  ? 33.241 -5.342  -5.679  1.00 0.00 ? 2  GLU A HG3  4  
ATOM 2174  N N    . LYS A 1 3  ? 31.103 -1.726  -9.066  1.00 0.00 ? 3  LYS A N    4  
ATOM 2175  C CA   . LYS A 1 3  ? 31.018 -0.268  -9.160  1.00 0.00 ? 3  LYS A CA   4  
ATOM 2176  C C    . LYS A 1 3  ? 29.879 0.355   -8.342  1.00 0.00 ? 3  LYS A C    4  
ATOM 2177  O O    . LYS A 1 3  ? 29.918 1.534   -8.021  1.00 0.00 ? 3  LYS A O    4  
ATOM 2178  C CB   . LYS A 1 3  ? 30.982 0.157   -10.628 1.00 0.00 ? 3  LYS A CB   4  
ATOM 2179  C CG   . LYS A 1 3  ? 29.877 -0.501  -11.474 1.00 0.00 ? 3  LYS A CG   4  
ATOM 2180  C CD   . LYS A 1 3  ? 28.655 0.405   -11.670 1.00 0.00 ? 3  LYS A CD   4  
ATOM 2181  C CE   . LYS A 1 3  ? 27.799 -0.032  -12.865 1.00 0.00 ? 3  LYS A CE   4  
ATOM 2182  N NZ   . LYS A 1 3  ? 27.024 1.071   -13.422 1.00 0.00 ? 3  LYS A NZ   4  
ATOM 2183  H H    . LYS A 1 3  ? 31.208 -2.220  -9.926  1.00 0.00 ? 3  LYS A H    4  
ATOM 2184  H HA   . LYS A 1 3  ? 31.940 0.127   -8.766  1.00 0.00 ? 3  LYS A HA   4  
ATOM 2185  H HB2  . LYS A 1 3  ? 30.961 1.244   -10.711 1.00 0.00 ? 3  LYS A HB2  4  
ATOM 2186  H HB3  . LYS A 1 3  ? 31.939 -0.118  -11.066 1.00 0.00 ? 3  LYS A HB3  4  
ATOM 2187  H HG2  . LYS A 1 3  ? 30.311 -0.724  -12.449 1.00 0.00 ? 3  LYS A HG2  4  
ATOM 2188  H HG3  . LYS A 1 3  ? 29.567 -1.469  -11.080 1.00 0.00 ? 3  LYS A HG3  4  
ATOM 2189  H HD2  . LYS A 1 3  ? 28.054 0.449   -10.760 1.00 0.00 ? 3  LYS A HD2  4  
ATOM 2190  H HD3  . LYS A 1 3  ? 28.995 1.423   -11.848 1.00 0.00 ? 3  LYS A HD3  4  
ATOM 2191  H HE2  . LYS A 1 3  ? 28.424 -0.415  -13.672 1.00 0.00 ? 3  LYS A HE2  4  
ATOM 2192  H HE3  . LYS A 1 3  ? 27.117 -0.830  -12.572 1.00 0.00 ? 3  LYS A HE3  4  
ATOM 2193  H HZ1  . LYS A 1 3  ? 27.675 1.818   -13.741 1.00 0.00 ? 3  LYS A HZ1  4  
ATOM 2194  H HZ2  . LYS A 1 3  ? 26.392 1.457   -12.693 1.00 0.00 ? 3  LYS A HZ2  4  
ATOM 2195  H HZ3  . LYS A 1 3  ? 26.467 0.737   -14.236 1.00 0.00 ? 3  LYS A HZ3  4  
ATOM 2196  N N    . GLU A 1 4  ? 28.895 -0.502  -8.005  1.00 0.00 ? 4  GLU A N    4  
ATOM 2197  C CA   . GLU A 1 4  ? 27.778 -0.087  -7.169  1.00 0.00 ? 4  GLU A CA   4  
ATOM 2198  C C    . GLU A 1 4  ? 28.223 0.249   -5.738  1.00 0.00 ? 4  GLU A C    4  
ATOM 2199  O O    . GLU A 1 4  ? 27.819 1.240   -5.151  1.00 0.00 ? 4  GLU A O    4  
ATOM 2200  C CB   . GLU A 1 4  ? 26.753 -1.237  -7.116  1.00 0.00 ? 4  GLU A CB   4  
ATOM 2201  C CG   . GLU A 1 4  ? 25.480 -0.905  -7.894  1.00 0.00 ? 4  GLU A CG   4  
ATOM 2202  C CD   . GLU A 1 4  ? 24.642 0.237   -7.263  1.00 0.00 ? 4  GLU A CD   4  
ATOM 2203  O OE1  . GLU A 1 4  ? 25.159 1.012   -6.455  1.00 0.00 ? 4  GLU A OE1  4  
ATOM 2204  O OE2  . GLU A 1 4  ? 23.461 0.338   -7.590  1.00 0.00 ? 4  GLU A OE2  4  
ATOM 2205  H H    . GLU A 1 4  ? 28.961 -1.451  -8.318  1.00 0.00 ? 4  GLU A H    4  
ATOM 2206  H HA   . GLU A 1 4  ? 27.376 0.823   -7.629  1.00 0.00 ? 4  GLU A HA   4  
ATOM 2207  H HB2  . GLU A 1 4  ? 27.194 -2.150  -7.520  1.00 0.00 ? 4  GLU A HB2  4  
ATOM 2208  H HB3  . GLU A 1 4  ? 26.477 -1.525  -6.100  1.00 0.00 ? 4  GLU A HB3  4  
ATOM 2209  H HG2  . GLU A 1 4  ? 25.732 -0.657  -8.925  1.00 0.00 ? 4  GLU A HG2  4  
ATOM 2210  H HG3  . GLU A 1 4  ? 24.867 -1.803  -7.945  1.00 0.00 ? 4  GLU A HG3  4  
ATOM 2211  N N    . ALA A 1 5  ? 29.082 -0.653  -5.222  1.00 0.00 ? 5  ALA A N    4  
ATOM 2212  C CA   . ALA A 1 5  ? 29.632 -0.400  -3.906  1.00 0.00 ? 5  ALA A CA   4  
ATOM 2213  C C    . ALA A 1 5  ? 30.727 0.668   -3.965  1.00 0.00 ? 5  ALA A C    4  
ATOM 2214  O O    . ALA A 1 5  ? 31.089 1.199   -2.929  1.00 0.00 ? 5  ALA A O    4  
ATOM 2215  C CB   . ALA A 1 5  ? 30.111 -1.700  -3.260  1.00 0.00 ? 5  ALA A CB   4  
ATOM 2216  H H    . ALA A 1 5  ? 29.365 -1.458  -5.740  1.00 0.00 ? 5  ALA A H    4  
ATOM 2217  H HA   . ALA A 1 5  ? 28.831 -0.010  -3.281  1.00 0.00 ? 5  ALA A HA   4  
ATOM 2218  H HB1  . ALA A 1 5  ? 30.789 -2.249  -3.909  1.00 0.00 ? 5  ALA A HB1  4  
ATOM 2219  H HB2  . ALA A 1 5  ? 29.267 -2.348  -3.032  1.00 0.00 ? 5  ALA A HB2  4  
ATOM 2220  H HB3  . ALA A 1 5  ? 30.601 -1.501  -2.310  1.00 0.00 ? 5  ALA A HB3  4  
ATOM 2221  N N    . ILE A 1 6  ? 31.239 1.003   -5.167  1.00 0.00 ? 6  ILE A N    4  
ATOM 2222  C CA   . ILE A 1 6  ? 32.351 1.961   -5.205  1.00 0.00 ? 6  ILE A CA   4  
ATOM 2223  C C    . ILE A 1 6  ? 31.873 3.395   -4.950  1.00 0.00 ? 6  ILE A C    4  
ATOM 2224  O O    . ILE A 1 6  ? 32.619 4.211   -4.439  1.00 0.00 ? 6  ILE A O    4  
ATOM 2225  C CB   . ILE A 1 6  ? 33.191 1.852   -6.489  1.00 0.00 ? 6  ILE A CB   4  
ATOM 2226  C CG1  . ILE A 1 6  ? 33.564 0.392   -6.768  1.00 0.00 ? 6  ILE A CG1  4  
ATOM 2227  C CG2  . ILE A 1 6  ? 34.473 2.710   -6.448  1.00 0.00 ? 6  ILE A CG2  4  
ATOM 2228  C CD1  . ILE A 1 6  ? 34.348 0.226   -8.079  1.00 0.00 ? 6  ILE A CD1  4  
ATOM 2229  H H    . ILE A 1 6  ? 30.877 0.600   -6.010  1.00 0.00 ? 6  ILE A H    4  
ATOM 2230  H HA   . ILE A 1 6  ? 33.002 1.703   -4.380  1.00 0.00 ? 6  ILE A HA   4  
ATOM 2231  H HB   . ILE A 1 6  ? 32.573 2.211   -7.310  1.00 0.00 ? 6  ILE A HB   4  
ATOM 2232  H HG12 . ILE A 1 6  ? 34.142 -0.012  -5.938  1.00 0.00 ? 6  ILE A HG12 4  
ATOM 2233  H HG13 . ILE A 1 6  ? 32.663 -0.206  -6.797  1.00 0.00 ? 6  ILE A HG13 4  
ATOM 2234  H HG21 . ILE A 1 6  ? 35.364 2.093   -6.366  1.00 0.00 ? 6  ILE A HG21 4  
ATOM 2235  H HG22 . ILE A 1 6  ? 34.516 3.382   -5.596  1.00 0.00 ? 6  ILE A HG22 4  
ATOM 2236  H HG23 . ILE A 1 6  ? 34.581 3.296   -7.361  1.00 0.00 ? 6  ILE A HG23 4  
ATOM 2237  H HD11 . ILE A 1 6  ? 35.353 0.638   -8.005  1.00 0.00 ? 6  ILE A HD11 4  
ATOM 2238  H HD12 . ILE A 1 6  ? 33.892 0.741   -8.921  1.00 0.00 ? 6  ILE A HD12 4  
ATOM 2239  H HD13 . ILE A 1 6  ? 34.420 -0.832  -8.327  1.00 0.00 ? 6  ILE A HD13 4  
ATOM 2240  N N    . GLU A 1 7  ? 30.597 3.650   -5.296  1.00 0.00 ? 7  GLU A N    4  
ATOM 2241  C CA   . GLU A 1 7  ? 30.014 4.956   -4.999  1.00 0.00 ? 7  GLU A CA   4  
ATOM 2242  C C    . GLU A 1 7  ? 29.480 5.014   -3.557  1.00 0.00 ? 7  GLU A C    4  
ATOM 2243  O O    . GLU A 1 7  ? 29.229 6.084   -3.027  1.00 0.00 ? 7  GLU A O    4  
ATOM 2244  C CB   . GLU A 1 7  ? 28.909 5.260   -6.018  1.00 0.00 ? 7  GLU A CB   4  
ATOM 2245  C CG   . GLU A 1 7  ? 27.809 4.185   -6.060  1.00 0.00 ? 7  GLU A CG   4  
ATOM 2246  C CD   . GLU A 1 7  ? 26.662 4.561   -7.015  1.00 0.00 ? 7  GLU A CD   4  
ATOM 2247  O OE1  . GLU A 1 7  ? 26.937 4.930   -8.157  1.00 0.00 ? 7  GLU A OE1  4  
ATOM 2248  O OE2  . GLU A 1 7  ? 25.501 4.480   -6.610  1.00 0.00 ? 7  GLU A OE2  4  
ATOM 2249  H H    . GLU A 1 7  ? 30.038 2.920   -5.687  1.00 0.00 ? 7  GLU A H    4  
ATOM 2250  H HA   . GLU A 1 7  ? 30.797 5.714   -5.086  1.00 0.00 ? 7  GLU A HA   4  
ATOM 2251  H HB2  . GLU A 1 7  ? 28.470 6.236   -5.803  1.00 0.00 ? 7  GLU A HB2  4  
ATOM 2252  H HB3  . GLU A 1 7  ? 29.366 5.337   -7.005  1.00 0.00 ? 7  GLU A HB3  4  
ATOM 2253  H HG2  . GLU A 1 7  ? 28.226 3.233   -6.387  1.00 0.00 ? 7  GLU A HG2  4  
ATOM 2254  H HG3  . GLU A 1 7  ? 27.407 4.028   -5.060  1.00 0.00 ? 7  GLU A HG3  4  
ATOM 2255  N N    . ARG A 1 8  ? 29.327 3.805   -2.966  1.00 0.00 ? 8  ARG A N    4  
ATOM 2256  C CA   . ARG A 1 8  ? 28.783 3.675   -1.621  1.00 0.00 ? 8  ARG A CA   4  
ATOM 2257  C C    . ARG A 1 8  ? 29.890 3.841   -0.587  1.00 0.00 ? 8  ARG A C    4  
ATOM 2258  O O    . ARG A 1 8  ? 29.807 4.693   0.278   1.00 0.00 ? 8  ARG A O    4  
ATOM 2259  C CB   . ARG A 1 8  ? 28.095 2.305   -1.494  1.00 0.00 ? 8  ARG A CB   4  
ATOM 2260  C CG   . ARG A 1 8  ? 26.682 2.404   -0.899  1.00 0.00 ? 8  ARG A CG   4  
ATOM 2261  C CD   . ARG A 1 8  ? 25.675 1.487   -1.603  1.00 0.00 ? 8  ARG A CD   4  
ATOM 2262  N NE   . ARG A 1 8  ? 25.250 0.398   -0.733  1.00 0.00 ? 8  ARG A NE   4  
ATOM 2263  C CZ   . ARG A 1 8  ? 24.510 -0.630  -1.204  1.00 0.00 ? 8  ARG A CZ   4  
ATOM 2264  N NH1  . ARG A 1 8  ? 24.192 -0.706  -2.496  1.00 0.00 ? 8  ARG A NH1  4  
ATOM 2265  N NH2  . ARG A 1 8  ? 24.097 -1.574  -0.365  1.00 0.00 ? 8  ARG A NH2  4  
ATOM 2266  H H    . ARG A 1 8  ? 29.577 2.970   -3.454  1.00 0.00 ? 8  ARG A H    4  
ATOM 2267  H HA   . ARG A 1 8  ? 28.077 4.497   -1.491  1.00 0.00 ? 8  ARG A HA   4  
ATOM 2268  H HB2  . ARG A 1 8  ? 28.056 1.881   -2.494  1.00 0.00 ? 8  ARG A HB2  4  
ATOM 2269  H HB3  . ARG A 1 8  ? 28.674 1.577   -0.921  1.00 0.00 ? 8  ARG A HB3  4  
ATOM 2270  H HG2  . ARG A 1 8  ? 26.715 2.219   0.174   1.00 0.00 ? 8  ARG A HG2  4  
ATOM 2271  H HG3  . ARG A 1 8  ? 26.305 3.423   -0.975  1.00 0.00 ? 8  ARG A HG3  4  
ATOM 2272  H HD2  . ARG A 1 8  ? 24.783 2.056   -1.864  1.00 0.00 ? 8  ARG A HD2  4  
ATOM 2273  H HD3  . ARG A 1 8  ? 26.066 1.066   -2.530  1.00 0.00 ? 8  ARG A HD3  4  
ATOM 2274  H HE   . ARG A 1 8  ? 25.480 0.426   0.240   1.00 0.00 ? 8  ARG A HE   4  
ATOM 2275  H HH11 . ARG A 1 8  ? 24.502 0.007   -3.128  1.00 0.00 ? 8  ARG A HH11 4  
ATOM 2276  H HH12 . ARG A 1 8  ? 23.647 -1.473  -2.834  1.00 0.00 ? 8  ARG A HH12 4  
ATOM 2277  H HH21 . ARG A 1 8  ? 24.329 -1.519  0.607   1.00 0.00 ? 8  ARG A HH21 4  
ATOM 2278  H HH22 . ARG A 1 8  ? 23.553 -2.338  -0.710  1.00 0.00 ? 8  ARG A HH22 4  
ATOM 2279  N N    . LEU A 1 9  ? 30.922 2.987   -0.779  1.00 0.00 ? 9  LEU A N    4  
ATOM 2280  C CA   . LEU A 1 9  ? 32.190 2.993   -0.063  1.00 0.00 ? 9  LEU A CA   4  
ATOM 2281  C C    . LEU A 1 9  ? 32.789 4.421   -0.114  1.00 0.00 ? 9  LEU A C    4  
ATOM 2282  O O    . LEU A 1 9  ? 33.122 5.008   0.901   1.00 0.00 ? 9  LEU A O    4  
ATOM 2283  C CB   . LEU A 1 9  ? 33.127 1.950   -0.682  1.00 0.00 ? 9  LEU A CB   4  
ATOM 2284  C CG   . LEU A 1 9  ? 32.592 0.505   -0.678  1.00 0.00 ? 9  LEU A CG   4  
ATOM 2285  C CD1  . LEU A 1 9  ? 33.240 -0.263  -1.835  1.00 0.00 ? 9  LEU A CD1  4  
ATOM 2286  C CD2  . LEU A 1 9  ? 32.818 -0.213  0.646   1.00 0.00 ? 9  LEU A CD2  4  
ATOM 2287  H H    . LEU A 1 9  ? 30.799 2.293   -1.476  1.00 0.00 ? 9  LEU A H    4  
ATOM 2288  H HA   . LEU A 1 9  ? 31.995 2.671   0.957   1.00 0.00 ? 9  LEU A HA   4  
ATOM 2289  H HB2  . LEU A 1 9  ? 33.317 2.262   -1.707  1.00 0.00 ? 9  LEU A HB2  4  
ATOM 2290  H HB3  . LEU A 1 9  ? 34.086 1.951   -0.171  1.00 0.00 ? 9  LEU A HB3  4  
ATOM 2291  H HG   . LEU A 1 9  ? 31.512 0.498   -0.790  1.00 0.00 ? 9  LEU A HG   4  
ATOM 2292  H HD11 . LEU A 1 9  ? 33.307 0.331   -2.738  1.00 0.00 ? 9  LEU A HD11 4  
ATOM 2293  H HD12 . LEU A 1 9  ? 32.647 -1.126  -2.105  1.00 0.00 ? 9  LEU A HD12 4  
ATOM 2294  H HD13 . LEU A 1 9  ? 34.258 -0.564  -1.590  1.00 0.00 ? 9  LEU A HD13 4  
ATOM 2295  H HD21 . LEU A 1 9  ? 33.818 -0.634  0.674   1.00 0.00 ? 9  LEU A HD21 4  
ATOM 2296  H HD22 . LEU A 1 9  ? 32.109 -1.028  0.778   1.00 0.00 ? 9  LEU A HD22 4  
ATOM 2297  H HD23 . LEU A 1 9  ? 32.696 0.465   1.487   1.00 0.00 ? 9  LEU A HD23 4  
ATOM 2298  N N    . LYS A 1 10 ? 32.837 4.973   -1.347  1.00 0.00 ? 10 LYS A N    4  
ATOM 2299  C CA   . LYS A 1 10 ? 33.266 6.366   -1.506  1.00 0.00 ? 10 LYS A CA   4  
ATOM 2300  C C    . LYS A 1 10 ? 32.366 7.374   -0.751  1.00 0.00 ? 10 LYS A C    4  
ATOM 2301  O O    . LYS A 1 10 ? 32.850 8.359   -0.216  1.00 0.00 ? 10 LYS A O    4  
ATOM 2302  C CB   . LYS A 1 10 ? 33.243 6.760   -2.987  1.00 0.00 ? 10 LYS A CB   4  
ATOM 2303  C CG   . LYS A 1 10 ? 34.491 6.329   -3.755  1.00 0.00 ? 10 LYS A CG   4  
ATOM 2304  C CD   . LYS A 1 10 ? 34.517 6.808   -5.214  1.00 0.00 ? 10 LYS A CD   4  
ATOM 2305  C CE   . LYS A 1 10 ? 33.890 8.185   -5.421  1.00 0.00 ? 10 LYS A CE   4  
ATOM 2306  N NZ   . LYS A 1 10 ? 34.537 9.200   -4.589  1.00 0.00 ? 10 LYS A NZ   4  
ATOM 2307  H H    . LYS A 1 10 ? 32.529 4.433   -2.131  1.00 0.00 ? 10 LYS A H    4  
ATOM 2308  H HA   . LYS A 1 10 ? 34.278 6.458   -1.099  1.00 0.00 ? 10 LYS A HA   4  
ATOM 2309  H HB2  . LYS A 1 10 ? 32.346 6.402   -3.489  1.00 0.00 ? 10 LYS A HB2  4  
ATOM 2310  H HB3  . LYS A 1 10 ? 33.192 7.845   -3.028  1.00 0.00 ? 10 LYS A HB3  4  
ATOM 2311  H HG2  . LYS A 1 10 ? 35.345 6.742   -3.234  1.00 0.00 ? 10 LYS A HG2  4  
ATOM 2312  H HG3  . LYS A 1 10 ? 34.613 5.249   -3.723  1.00 0.00 ? 10 LYS A HG3  4  
ATOM 2313  H HD2  . LYS A 1 10 ? 35.552 6.882   -5.536  1.00 0.00 ? 10 LYS A HD2  4  
ATOM 2314  H HD3  . LYS A 1 10 ? 34.021 6.070   -5.848  1.00 0.00 ? 10 LYS A HD3  4  
ATOM 2315  H HE2  . LYS A 1 10 ? 33.977 8.499   -6.462  1.00 0.00 ? 10 LYS A HE2  4  
ATOM 2316  H HE3  . LYS A 1 10 ? 32.827 8.151   -5.172  1.00 0.00 ? 10 LYS A HE3  4  
ATOM 2317  H HZ1  . LYS A 1 10 ? 34.777 8.790   -3.663  1.00 0.00 ? 10 LYS A HZ1  4  
ATOM 2318  H HZ2  . LYS A 1 10 ? 33.888 9.999   -4.449  1.00 0.00 ? 10 LYS A HZ2  4  
ATOM 2319  H HZ3  . LYS A 1 10 ? 35.412 9.539   -5.036  1.00 0.00 ? 10 LYS A HZ3  4  
ATOM 2320  N N    . ALA A 1 11 ? 31.044 7.087   -0.770  1.00 0.00 ? 11 ALA A N    4  
ATOM 2321  C CA   . ALA A 1 11 ? 30.068 8.006   -0.180  1.00 0.00 ? 11 ALA A CA   4  
ATOM 2322  C C    . ALA A 1 11 ? 30.214 8.140   1.349   1.00 0.00 ? 11 ALA A C    4  
ATOM 2323  O O    . ALA A 1 11 ? 29.754 9.114   1.928   1.00 0.00 ? 11 ALA A O    4  
ATOM 2324  C CB   . ALA A 1 11 ? 28.637 7.575   -0.523  1.00 0.00 ? 11 ALA A CB   4  
ATOM 2325  H H    . ALA A 1 11 ? 30.734 6.252   -1.221  1.00 0.00 ? 11 ALA A H    4  
ATOM 2326  H HA   . ALA A 1 11 ? 30.250 8.987   -0.624  1.00 0.00 ? 11 ALA A HA   4  
ATOM 2327  H HB1  . ALA A 1 11 ? 28.408 7.827   -1.556  1.00 0.00 ? 11 ALA A HB1  4  
ATOM 2328  H HB2  . ALA A 1 11 ? 27.900 8.076   0.106   1.00 0.00 ? 11 ALA A HB2  4  
ATOM 2329  H HB3  . ALA A 1 11 ? 28.483 6.506   -0.400  1.00 0.00 ? 11 ALA A HB3  4  
ATOM 2330  N N    . LEU A 1 12 ? 30.890 7.140   1.962   1.00 0.00 ? 12 LEU A N    4  
ATOM 2331  C CA   . LEU A 1 12 ? 31.166 7.202   3.394   1.00 0.00 ? 12 LEU A CA   4  
ATOM 2332  C C    . LEU A 1 12 ? 32.339 8.176   3.721   1.00 0.00 ? 12 LEU A C    4  
ATOM 2333  O O    . LEU A 1 12 ? 32.734 8.290   4.872   1.00 0.00 ? 12 LEU A O    4  
ATOM 2334  C CB   . LEU A 1 12 ? 31.517 5.792   3.893   1.00 0.00 ? 12 LEU A CB   4  
ATOM 2335  C CG   . LEU A 1 12 ? 30.379 4.746   3.949   1.00 0.00 ? 12 LEU A CG   4  
ATOM 2336  C CD1  . LEU A 1 12 ? 30.515 3.726   2.819   1.00 0.00 ? 12 LEU A CD1  4  
ATOM 2337  C CD2  . LEU A 1 12 ? 30.397 3.972   5.269   1.00 0.00 ? 12 LEU A CD2  4  
ATOM 2338  H H    . LEU A 1 12 ? 31.248 6.368   1.437   1.00 0.00 ? 12 LEU A H    4  
ATOM 2339  H HA   . LEU A 1 12 ? 30.273 7.567   3.903   1.00 0.00 ? 12 LEU A HA   4  
ATOM 2340  H HB2  . LEU A 1 12 ? 32.303 5.430   3.243   1.00 0.00 ? 12 LEU A HB2  4  
ATOM 2341  H HB3  . LEU A 1 12 ? 31.952 5.871   4.884   1.00 0.00 ? 12 LEU A HB3  4  
ATOM 2342  H HG   . LEU A 1 12 ? 29.419 5.258   3.862   1.00 0.00 ? 12 LEU A HG   4  
ATOM 2343  H HD11 . LEU A 1 12 ? 31.075 4.188   2.021   1.00 0.00 ? 12 LEU A HD11 4  
ATOM 2344  H HD12 . LEU A 1 12 ? 29.543 3.401   2.444   1.00 0.00 ? 12 LEU A HD12 4  
ATOM 2345  H HD13 . LEU A 1 12 ? 31.085 2.841   3.105   1.00 0.00 ? 12 LEU A HD13 4  
ATOM 2346  H HD21 . LEU A 1 12 ? 31.242 3.290   5.284   1.00 0.00 ? 12 LEU A HD21 4  
ATOM 2347  H HD22 . LEU A 1 12 ? 29.506 3.355   5.377   1.00 0.00 ? 12 LEU A HD22 4  
ATOM 2348  H HD23 . LEU A 1 12 ? 30.489 4.636   6.128   1.00 0.00 ? 12 LEU A HD23 4  
ATOM 2349  N N    . GLY A 1 13 ? 32.857 8.866   2.671   1.00 0.00 ? 13 GLY A N    4  
ATOM 2350  C CA   . GLY A 1 13 ? 33.910 9.871   2.826   1.00 0.00 ? 13 GLY A CA   4  
ATOM 2351  C C    . GLY A 1 13 ? 35.300 9.337   2.453   1.00 0.00 ? 13 GLY A C    4  
ATOM 2352  O O    . GLY A 1 13 ? 36.312 9.834   2.934   1.00 0.00 ? 13 GLY A O    4  
ATOM 2353  H H    . GLY A 1 13 ? 32.477 8.723   1.760   1.00 0.00 ? 13 GLY A H    4  
ATOM 2354  H HA2  . GLY A 1 13 ? 33.657 10.709  2.174   1.00 0.00 ? 13 GLY A HA2  4  
ATOM 2355  H HA3  . GLY A 1 13 ? 33.924 10.223  3.859   1.00 0.00 ? 13 GLY A HA3  4  
ATOM 2356  N N    . PHE A 1 14 ? 35.277 8.287   1.593   1.00 0.00 ? 14 PHE A N    4  
ATOM 2357  C CA   . PHE A 1 14 ? 36.490 7.561   1.222   1.00 0.00 ? 14 PHE A CA   4  
ATOM 2358  C C    . PHE A 1 14 ? 36.872 7.939   -0.224  1.00 0.00 ? 14 PHE A C    4  
ATOM 2359  O O    . PHE A 1 14 ? 36.688 9.080   -0.636  1.00 0.00 ? 14 PHE A O    4  
ATOM 2360  C CB   . PHE A 1 14 ? 36.254 6.042   1.419   1.00 0.00 ? 14 PHE A CB   4  
ATOM 2361  C CG   . PHE A 1 14 ? 35.699 5.684   2.778   1.00 0.00 ? 14 PHE A CG   4  
ATOM 2362  C CD1  . PHE A 1 14 ? 35.893 6.501   3.895   1.00 0.00 ? 14 PHE A CD1  4  
ATOM 2363  C CD2  . PHE A 1 14 ? 34.936 4.529   2.925   1.00 0.00 ? 14 PHE A CD2  4  
ATOM 2364  C CE1  . PHE A 1 14 ? 35.247 6.230   5.085   1.00 0.00 ? 14 PHE A CE1  4  
ATOM 2365  C CE2  . PHE A 1 14 ? 34.292 4.252   4.121   1.00 0.00 ? 14 PHE A CE2  4  
ATOM 2366  C CZ   . PHE A 1 14 ? 34.426 5.129   5.191   1.00 0.00 ? 14 PHE A CZ   4  
ATOM 2367  H H    . PHE A 1 14 ? 34.407 7.958   1.231   1.00 0.00 ? 14 PHE A H    4  
ATOM 2368  H HA   . PHE A 1 14 ? 37.293 7.915   1.871   1.00 0.00 ? 14 PHE A HA   4  
ATOM 2369  H HB2  . PHE A 1 14 ? 35.559 5.696   0.649   1.00 0.00 ? 14 PHE A HB2  4  
ATOM 2370  H HB3  . PHE A 1 14 ? 37.171 5.477   1.291   1.00 0.00 ? 14 PHE A HB3  4  
ATOM 2371  H HD1  . PHE A 1 14 ? 36.530 7.373   3.874   1.00 0.00 ? 14 PHE A HD1  4  
ATOM 2372  H HD2  . PHE A 1 14 ? 34.832 3.837   2.098   1.00 0.00 ? 14 PHE A HD2  4  
ATOM 2373  H HE1  . PHE A 1 14 ? 35.370 6.882   5.934   1.00 0.00 ? 14 PHE A HE1  4  
ATOM 2374  H HE2  . PHE A 1 14 ? 33.668 3.372   4.195   1.00 0.00 ? 14 PHE A HE2  4  
ATOM 2375  H HZ   . PHE A 1 14 ? 33.886 4.999   6.117   1.00 0.00 ? 14 PHE A HZ   4  
ATOM 2376  N N    . GLU A 1 15 ? 37.414 6.945   -0.963  1.00 0.00 ? 15 GLU A N    4  
ATOM 2377  C CA   . GLU A 1 15 ? 37.902 7.178   -2.320  1.00 0.00 ? 15 GLU A CA   4  
ATOM 2378  C C    . GLU A 1 15 ? 38.031 5.828   -3.013  1.00 0.00 ? 15 GLU A C    4  
ATOM 2379  O O    . GLU A 1 15 ? 38.462 4.862   -2.397  1.00 0.00 ? 15 GLU A O    4  
ATOM 2380  C CB   . GLU A 1 15 ? 39.266 7.895   -2.287  1.00 0.00 ? 15 GLU A CB   4  
ATOM 2381  C CG   . GLU A 1 15 ? 39.598 8.641   -3.591  1.00 0.00 ? 15 GLU A CG   4  
ATOM 2382  C CD   . GLU A 1 15 ? 40.310 9.993   -3.368  1.00 0.00 ? 15 GLU A CD   4  
ATOM 2383  O OE1  . GLU A 1 15 ? 41.052 10.135  -2.395  1.00 0.00 ? 15 GLU A OE1  4  
ATOM 2384  O OE2  . GLU A 1 15 ? 40.111 10.900  -4.179  1.00 0.00 ? 15 GLU A OE2  4  
ATOM 2385  H H    . GLU A 1 15 ? 37.511 6.034   -0.559  1.00 0.00 ? 15 GLU A H    4  
ATOM 2386  H HA   . GLU A 1 15 ? 37.152 7.789   -2.828  1.00 0.00 ? 15 GLU A HA   4  
ATOM 2387  H HB2  . GLU A 1 15 ? 39.235 8.575   -1.439  1.00 0.00 ? 15 GLU A HB2  4  
ATOM 2388  H HB3  . GLU A 1 15 ? 40.098 7.221   -2.091  1.00 0.00 ? 15 GLU A HB3  4  
ATOM 2389  H HG2  . GLU A 1 15 ? 40.216 8.015   -4.236  1.00 0.00 ? 15 GLU A HG2  4  
ATOM 2390  H HG3  . GLU A 1 15 ? 38.686 8.822   -4.154  1.00 0.00 ? 15 GLU A HG3  4  
ATOM 2391  N N    . GLU A 1 16 ? 37.634 5.824   -4.304  1.00 0.00 ? 16 GLU A N    4  
ATOM 2392  C CA   . GLU A 1 16 ? 37.528 4.643   -5.163  1.00 0.00 ? 16 GLU A CA   4  
ATOM 2393  C C    . GLU A 1 16 ? 38.775 3.714   -5.117  1.00 0.00 ? 16 GLU A C    4  
ATOM 2394  O O    . GLU A 1 16 ? 38.682 2.535   -5.424  1.00 0.00 ? 16 GLU A O    4  
ATOM 2395  C CB   . GLU A 1 16 ? 37.207 5.106   -6.593  1.00 0.00 ? 16 GLU A CB   4  
ATOM 2396  C CG   . GLU A 1 16 ? 37.607 4.150   -7.729  1.00 0.00 ? 16 GLU A CG   4  
ATOM 2397  C CD   . GLU A 1 16 ? 37.309 4.765   -9.105  1.00 0.00 ? 16 GLU A CD   4  
ATOM 2398  O OE1  . GLU A 1 16 ? 37.769 5.879   -9.353  1.00 0.00 ? 16 GLU A OE1  4  
ATOM 2399  O OE2  . GLU A 1 16 ? 36.635 4.130   -9.918  1.00 0.00 ? 16 GLU A OE2  4  
ATOM 2400  H H    . GLU A 1 16 ? 37.331 6.700   -4.682  1.00 0.00 ? 16 GLU A H    4  
ATOM 2401  H HA   . GLU A 1 16 ? 36.648 4.115   -4.797  1.00 0.00 ? 16 GLU A HA   4  
ATOM 2402  H HB2  . GLU A 1 16 ? 36.133 5.273   -6.685  1.00 0.00 ? 16 GLU A HB2  4  
ATOM 2403  H HB3  . GLU A 1 16 ? 37.704 6.065   -6.730  1.00 0.00 ? 16 GLU A HB3  4  
ATOM 2404  H HG2  . GLU A 1 16 ? 38.678 3.955   -7.698  1.00 0.00 ? 16 GLU A HG2  4  
ATOM 2405  H HG3  . GLU A 1 16 ? 37.082 3.200   -7.617  1.00 0.00 ? 16 GLU A HG3  4  
ATOM 2406  N N    . SER A 1 17 ? 39.927 4.288   -4.724  1.00 0.00 ? 17 SER A N    4  
ATOM 2407  C CA   . SER A 1 17 ? 41.149 3.509   -4.626  1.00 0.00 ? 17 SER A CA   4  
ATOM 2408  C C    . SER A 1 17 ? 41.202 2.729   -3.304  1.00 0.00 ? 17 SER A C    4  
ATOM 2409  O O    . SER A 1 17 ? 41.415 1.528   -3.311  1.00 0.00 ? 17 SER A O    4  
ATOM 2410  C CB   . SER A 1 17 ? 42.338 4.472   -4.715  1.00 0.00 ? 17 SER A CB   4  
ATOM 2411  O OG   . SER A 1 17 ? 42.854 4.582   -6.026  1.00 0.00 ? 17 SER A OG   4  
ATOM 2412  H H    . SER A 1 17 ? 39.946 5.249   -4.446  1.00 0.00 ? 17 SER A H    4  
ATOM 2413  H HA   . SER A 1 17 ? 41.147 2.780   -5.444  1.00 0.00 ? 17 SER A HA   4  
ATOM 2414  H HB2  . SER A 1 17 ? 42.070 5.457   -4.321  1.00 0.00 ? 17 SER A HB2  4  
ATOM 2415  H HB3  . SER A 1 17 ? 43.160 4.131   -4.090  1.00 0.00 ? 17 SER A HB3  4  
ATOM 2416  H HG   . SER A 1 17 ? 42.155 4.802   -6.631  1.00 0.00 ? 17 SER A HG   4  
ATOM 2417  N N    . LEU A 1 18 ? 40.998 3.466   -2.181  1.00 0.00 ? 18 LEU A N    4  
ATOM 2418  C CA   . LEU A 1 18 ? 40.990 2.777   -0.883  1.00 0.00 ? 18 LEU A CA   4  
ATOM 2419  C C    . LEU A 1 18 ? 39.785 1.855   -0.763  1.00 0.00 ? 18 LEU A C    4  
ATOM 2420  O O    . LEU A 1 18 ? 39.790 0.939   0.063   1.00 0.00 ? 18 LEU A O    4  
ATOM 2421  C CB   . LEU A 1 18 ? 41.113 3.749   0.306   1.00 0.00 ? 18 LEU A CB   4  
ATOM 2422  C CG   . LEU A 1 18 ? 39.839 4.425   0.865   1.00 0.00 ? 18 LEU A CG   4  
ATOM 2423  C CD1  . LEU A 1 18 ? 39.623 4.107   2.353   1.00 0.00 ? 18 LEU A CD1  4  
ATOM 2424  C CD2  . LEU A 1 18 ? 39.903 5.942   0.701   1.00 0.00 ? 18 LEU A CD2  4  
ATOM 2425  H H    . LEU A 1 18 ? 40.788 4.439   -2.254  1.00 0.00 ? 18 LEU A H    4  
ATOM 2426  H HA   . LEU A 1 18 ? 41.873 2.139   -0.868  1.00 0.00 ? 18 LEU A HA   4  
ATOM 2427  H HB2  . LEU A 1 18 ? 41.568 3.189   1.114   1.00 0.00 ? 18 LEU A HB2  4  
ATOM 2428  H HB3  . LEU A 1 18 ? 41.862 4.496   0.062   1.00 0.00 ? 18 LEU A HB3  4  
ATOM 2429  H HG   . LEU A 1 18 ? 38.971 4.072   0.312   1.00 0.00 ? 18 LEU A HG   4  
ATOM 2430  H HD11 . LEU A 1 18 ? 39.500 3.036   2.524   1.00 0.00 ? 18 LEU A HD11 4  
ATOM 2431  H HD12 . LEU A 1 18 ? 38.746 4.639   2.722   1.00 0.00 ? 18 LEU A HD12 4  
ATOM 2432  H HD13 . LEU A 1 18 ? 40.462 4.436   2.962   1.00 0.00 ? 18 LEU A HD13 4  
ATOM 2433  H HD21 . LEU A 1 18 ? 40.805 6.358   1.143   1.00 0.00 ? 18 LEU A HD21 4  
ATOM 2434  H HD22 . LEU A 1 18 ? 39.065 6.444   1.181   1.00 0.00 ? 18 LEU A HD22 4  
ATOM 2435  H HD23 . LEU A 1 18 ? 39.906 6.179   -0.354  1.00 0.00 ? 18 LEU A HD23 4  
ATOM 2436  N N    . VAL A 1 19 ? 38.796 2.131   -1.614  1.00 0.00 ? 19 VAL A N    4  
ATOM 2437  C CA   . VAL A 1 19 ? 37.523 1.442   -1.744  1.00 0.00 ? 19 VAL A CA   4  
ATOM 2438  C C    . VAL A 1 19 ? 37.712 0.093   -2.445  1.00 0.00 ? 19 VAL A C    4  
ATOM 2439  O O    . VAL A 1 19 ? 37.385 -0.945  -1.906  1.00 0.00 ? 19 VAL A O    4  
ATOM 2440  C CB   . VAL A 1 19 ? 36.641 2.392   -2.555  1.00 0.00 ? 19 VAL A CB   4  
ATOM 2441  C CG1  . VAL A 1 19 ? 35.571 1.712   -3.399  1.00 0.00 ? 19 VAL A CG1  4  
ATOM 2442  C CG2  . VAL A 1 19 ? 36.086 3.545   -1.702  1.00 0.00 ? 19 VAL A CG2  4  
ATOM 2443  H H    . VAL A 1 19 ? 38.947 2.883   -2.266  1.00 0.00 ? 19 VAL A H    4  
ATOM 2444  H HA   . VAL A 1 19 ? 37.100 1.257   -0.759  1.00 0.00 ? 19 VAL A HA   4  
ATOM 2445  H HB   . VAL A 1 19 ? 37.318 2.839   -3.274  1.00 0.00 ? 19 VAL A HB   4  
ATOM 2446  H HG11 . VAL A 1 19 ? 35.945 1.512   -4.401  1.00 0.00 ? 19 VAL A HG11 4  
ATOM 2447  H HG12 . VAL A 1 19 ? 34.700 2.350   -3.474  1.00 0.00 ? 19 VAL A HG12 4  
ATOM 2448  H HG13 . VAL A 1 19 ? 35.275 0.756   -2.987  1.00 0.00 ? 19 VAL A HG13 4  
ATOM 2449  H HG21 . VAL A 1 19 ? 36.777 3.828   -0.912  1.00 0.00 ? 19 VAL A HG21 4  
ATOM 2450  H HG22 . VAL A 1 19 ? 35.134 3.353   -1.230  1.00 0.00 ? 19 VAL A HG22 4  
ATOM 2451  H HG23 . VAL A 1 19 ? 35.917 4.414   -2.324  1.00 0.00 ? 19 VAL A HG23 4  
ATOM 2452  N N    . ILE A 1 20 ? 38.239 0.196   -3.685  1.00 0.00 ? 20 ILE A N    4  
ATOM 2453  C CA   . ILE A 1 20 ? 38.464 -0.972  -4.528  1.00 0.00 ? 20 ILE A CA   4  
ATOM 2454  C C    . ILE A 1 20 ? 39.383 -1.979  -3.847  1.00 0.00 ? 20 ILE A C    4  
ATOM 2455  O O    . ILE A 1 20 ? 39.088 -3.160  -3.824  1.00 0.00 ? 20 ILE A O    4  
ATOM 2456  C CB   . ILE A 1 20 ? 39.025 -0.525  -5.896  1.00 0.00 ? 20 ILE A CB   4  
ATOM 2457  C CG1  . ILE A 1 20 ? 37.897 -0.053  -6.817  1.00 0.00 ? 20 ILE A CG1  4  
ATOM 2458  C CG2  . ILE A 1 20 ? 39.885 -1.573  -6.629  1.00 0.00 ? 20 ILE A CG2  4  
ATOM 2459  C CD1  . ILE A 1 20 ? 36.931 -1.186  -7.183  1.00 0.00 ? 20 ILE A CD1  4  
ATOM 2460  H H    . ILE A 1 20 ? 38.473 1.101   -4.030  1.00 0.00 ? 20 ILE A H    4  
ATOM 2461  H HA   . ILE A 1 20 ? 37.499 -1.464  -4.636  1.00 0.00 ? 20 ILE A HA   4  
ATOM 2462  H HB   . ILE A 1 20 ? 39.691 0.316   -5.715  1.00 0.00 ? 20 ILE A HB   4  
ATOM 2463  H HG12 . ILE A 1 20 ? 37.344 0.773   -6.370  1.00 0.00 ? 20 ILE A HG12 4  
ATOM 2464  H HG13 . ILE A 1 20 ? 38.328 0.363   -7.725  1.00 0.00 ? 20 ILE A HG13 4  
ATOM 2465  H HG21 . ILE A 1 20 ? 40.176 -1.214  -7.616  1.00 0.00 ? 20 ILE A HG21 4  
ATOM 2466  H HG22 . ILE A 1 20 ? 39.360 -2.508  -6.779  1.00 0.00 ? 20 ILE A HG22 4  
ATOM 2467  H HG23 . ILE A 1 20 ? 40.798 -1.797  -6.082  1.00 0.00 ? 20 ILE A HG23 4  
ATOM 2468  H HD11 . ILE A 1 20 ? 37.336 -2.187  -7.060  1.00 0.00 ? 20 ILE A HD11 4  
ATOM 2469  H HD12 . ILE A 1 20 ? 36.635 -1.107  -8.227  1.00 0.00 ? 20 ILE A HD12 4  
ATOM 2470  H HD13 . ILE A 1 20 ? 36.058 -1.123  -6.539  1.00 0.00 ? 20 ILE A HD13 4  
ATOM 2471  N N    . GLN A 1 21 ? 40.490 -1.441  -3.304  1.00 0.00 ? 21 GLN A N    4  
ATOM 2472  C CA   . GLN A 1 21 ? 41.461 -2.285  -2.622  1.00 0.00 ? 21 GLN A CA   4  
ATOM 2473  C C    . GLN A 1 21 ? 40.915 -2.808  -1.272  1.00 0.00 ? 21 GLN A C    4  
ATOM 2474  O O    . GLN A 1 21 ? 41.300 -3.874  -0.823  1.00 0.00 ? 21 GLN A O    4  
ATOM 2475  C CB   . GLN A 1 21 ? 42.751 -1.486  -2.405  1.00 0.00 ? 21 GLN A CB   4  
ATOM 2476  C CG   . GLN A 1 21 ? 43.976 -2.383  -2.158  1.00 0.00 ? 21 GLN A CG   4  
ATOM 2477  C CD   . GLN A 1 21 ? 45.216 -1.504  -1.918  1.00 0.00 ? 21 GLN A CD   4  
ATOM 2478  O OE1  . GLN A 1 21 ? 46.116 -1.414  -2.738  1.00 0.00 ? 21 GLN A OE1  4  
ATOM 2479  N NE2  . GLN A 1 21 ? 45.121 -0.776  -0.786  1.00 0.00 ? 21 GLN A NE2  4  
ATOM 2480  H H    . GLN A 1 21 ? 40.648 -0.460  -3.408  1.00 0.00 ? 21 GLN A H    4  
ATOM 2481  H HA   . GLN A 1 21 ? 41.657 -3.130  -3.287  1.00 0.00 ? 21 GLN A HA   4  
ATOM 2482  H HB2  . GLN A 1 21 ? 42.945 -0.867  -3.281  1.00 0.00 ? 21 GLN A HB2  4  
ATOM 2483  H HB3  . GLN A 1 21 ? 42.605 -0.787  -1.581  1.00 0.00 ? 21 GLN A HB3  4  
ATOM 2484  H HG2  . GLN A 1 21 ? 43.807 -3.051  -1.313  1.00 0.00 ? 21 GLN A HG2  4  
ATOM 2485  H HG3  . GLN A 1 21 ? 44.164 -3.011  -3.029  1.00 0.00 ? 21 GLN A HG3  4  
ATOM 2486  H HE21 . GLN A 1 21 ? 44.526 -1.066  -0.042  1.00 0.00 ? 21 GLN A HE21 4  
ATOM 2487  H HE22 . GLN A 1 21 ? 45.621 0.080   -0.708  1.00 0.00 ? 21 GLN A HE22 4  
ATOM 2488  N N    . ALA A 1 22 ? 39.995 -2.006  -0.675  1.00 0.00 ? 22 ALA A N    4  
ATOM 2489  C CA   . ALA A 1 22 ? 39.314 -2.407  0.558   1.00 0.00 ? 22 ALA A CA   4  
ATOM 2490  C C    . ALA A 1 22 ? 38.215 -3.434  0.312   1.00 0.00 ? 22 ALA A C    4  
ATOM 2491  O O    . ALA A 1 22 ? 37.778 -4.088  1.244   1.00 0.00 ? 22 ALA A O    4  
ATOM 2492  C CB   . ALA A 1 22 ? 38.572 -1.232  1.208   1.00 0.00 ? 22 ALA A CB   4  
ATOM 2493  H H    . ALA A 1 22 ? 39.721 -1.167  -1.142  1.00 0.00 ? 22 ALA A H    4  
ATOM 2494  H HA   . ALA A 1 22 ? 40.061 -2.853  1.220   1.00 0.00 ? 22 ALA A HA   4  
ATOM 2495  H HB1  . ALA A 1 22 ? 39.265 -0.512  1.615   1.00 0.00 ? 22 ALA A HB1  4  
ATOM 2496  H HB2  . ALA A 1 22 ? 37.950 -1.564  2.040   1.00 0.00 ? 22 ALA A HB2  4  
ATOM 2497  H HB3  . ALA A 1 22 ? 37.925 -0.703  0.507   1.00 0.00 ? 22 ALA A HB3  4  
ATOM 2498  N N    . TYR A 1 23 ? 37.771 -3.500  -0.961  1.00 0.00 ? 23 TYR A N    4  
ATOM 2499  C CA   . TYR A 1 23 ? 36.676 -4.387  -1.336  1.00 0.00 ? 23 TYR A CA   4  
ATOM 2500  C C    . TYR A 1 23 ? 37.261 -5.676  -1.915  1.00 0.00 ? 23 TYR A C    4  
ATOM 2501  O O    . TYR A 1 23 ? 36.655 -6.724  -1.802  1.00 0.00 ? 23 TYR A O    4  
ATOM 2502  C CB   . TYR A 1 23 ? 35.742 -3.684  -2.339  1.00 0.00 ? 23 TYR A CB   4  
ATOM 2503  C CG   . TYR A 1 23 ? 34.271 -3.962  -2.101  1.00 0.00 ? 23 TYR A CG   4  
ATOM 2504  C CD1  . TYR A 1 23 ? 33.571 -3.230  -1.157  1.00 0.00 ? 23 TYR A CD1  4  
ATOM 2505  C CD2  . TYR A 1 23 ? 33.597 -4.932  -2.817  1.00 0.00 ? 23 TYR A CD2  4  
ATOM 2506  C CE1  . TYR A 1 23 ? 32.215 -3.443  -0.938  1.00 0.00 ? 23 TYR A CE1  4  
ATOM 2507  C CE2  . TYR A 1 23 ? 32.245 -5.165  -2.616  1.00 0.00 ? 23 TYR A CE2  4  
ATOM 2508  C CZ   . TYR A 1 23 ? 31.547 -4.403  -1.681  1.00 0.00 ? 23 TYR A CZ   4  
ATOM 2509  O OH   . TYR A 1 23 ? 30.203 -4.571  -1.467  1.00 0.00 ? 23 TYR A OH   4  
ATOM 2510  H H    . TYR A 1 23 ? 38.207 -2.943  -1.668  1.00 0.00 ? 23 TYR A H    4  
ATOM 2511  H HA   . TYR A 1 23 ? 36.122 -4.642  -0.428  1.00 0.00 ? 23 TYR A HA   4  
ATOM 2512  H HB2  . TYR A 1 23 ? 35.841 -2.616  -2.209  1.00 0.00 ? 23 TYR A HB2  4  
ATOM 2513  H HB3  . TYR A 1 23 ? 36.019 -3.864  -3.382  1.00 0.00 ? 23 TYR A HB3  4  
ATOM 2514  H HD1  . TYR A 1 23 ? 34.069 -2.455  -0.598  1.00 0.00 ? 23 TYR A HD1  4  
ATOM 2515  H HD2  . TYR A 1 23 ? 34.127 -5.506  -3.551  1.00 0.00 ? 23 TYR A HD2  4  
ATOM 2516  H HE1  . TYR A 1 23 ? 31.664 -2.883  -0.197  1.00 0.00 ? 23 TYR A HE1  4  
ATOM 2517  H HE2  . TYR A 1 23 ? 31.760 -5.954  -3.177  1.00 0.00 ? 23 TYR A HE2  4  
ATOM 2518  H HH   . TYR A 1 23 ? 29.943 -5.450  -1.694  1.00 0.00 ? 23 TYR A HH   4  
ATOM 2519  N N    . PHE A 1 24 ? 38.459 -5.557  -2.526  1.00 0.00 ? 24 PHE A N    4  
ATOM 2520  C CA   . PHE A 1 24 ? 39.089 -6.695  -3.195  1.00 0.00 ? 24 PHE A CA   4  
ATOM 2521  C C    . PHE A 1 24 ? 39.924 -7.503  -2.192  1.00 0.00 ? 24 PHE A C    4  
ATOM 2522  O O    . PHE A 1 24 ? 39.965 -8.722  -2.241  1.00 0.00 ? 24 PHE A O    4  
ATOM 2523  C CB   . PHE A 1 24 ? 40.012 -6.198  -4.329  1.00 0.00 ? 24 PHE A CB   4  
ATOM 2524  C CG   . PHE A 1 24 ? 39.485 -6.504  -5.706  1.00 0.00 ? 24 PHE A CG   4  
ATOM 2525  C CD1  . PHE A 1 24 ? 39.329 -7.821  -6.123  1.00 0.00 ? 24 PHE A CD1  4  
ATOM 2526  C CD2  . PHE A 1 24 ? 39.160 -5.477  -6.579  1.00 0.00 ? 24 PHE A CD2  4  
ATOM 2527  C CE1  . PHE A 1 24 ? 38.862 -8.104  -7.401  1.00 0.00 ? 24 PHE A CE1  4  
ATOM 2528  C CE2  . PHE A 1 24 ? 38.704 -5.749  -7.863  1.00 0.00 ? 24 PHE A CE2  4  
ATOM 2529  C CZ   . PHE A 1 24 ? 38.556 -7.067  -8.275  1.00 0.00 ? 24 PHE A CZ   4  
ATOM 2530  H H    . PHE A 1 24 ? 38.965 -4.697  -2.454  1.00 0.00 ? 24 PHE A H    4  
ATOM 2531  H HA   . PHE A 1 24 ? 38.287 -7.347  -3.557  1.00 0.00 ? 24 PHE A HA   4  
ATOM 2532  H HB2  . PHE A 1 24 ? 40.203 -5.133  -4.226  1.00 0.00 ? 24 PHE A HB2  4  
ATOM 2533  H HB3  . PHE A 1 24 ? 41.001 -6.649  -4.267  1.00 0.00 ? 24 PHE A HB3  4  
ATOM 2534  H HD1  . PHE A 1 24 ? 39.564 -8.625  -5.440  1.00 0.00 ? 24 PHE A HD1  4  
ATOM 2535  H HD2  . PHE A 1 24 ? 39.256 -4.465  -6.231  1.00 0.00 ? 24 PHE A HD2  4  
ATOM 2536  H HE1  . PHE A 1 24 ? 38.738 -9.132  -7.708  1.00 0.00 ? 24 PHE A HE1  4  
ATOM 2537  H HE2  . PHE A 1 24 ? 38.463 -4.934  -8.532  1.00 0.00 ? 24 PHE A HE2  4  
ATOM 2538  H HZ   . PHE A 1 24 ? 38.197 -7.284  -9.272  1.00 0.00 ? 24 PHE A HZ   4  
ATOM 2539  N N    . ALA A 1 25 ? 40.583 -6.741  -1.285  1.00 0.00 ? 25 ALA A N    4  
ATOM 2540  C CA   . ALA A 1 25 ? 41.363 -7.354  -0.215  1.00 0.00 ? 25 ALA A CA   4  
ATOM 2541  C C    . ALA A 1 25 ? 40.437 -8.053  0.798   1.00 0.00 ? 25 ALA A C    4  
ATOM 2542  O O    . ALA A 1 25 ? 40.822 -9.007  1.456   1.00 0.00 ? 25 ALA A O    4  
ATOM 2543  C CB   . ALA A 1 25 ? 42.215 -6.288  0.482   1.00 0.00 ? 25 ALA A CB   4  
ATOM 2544  H H    . ALA A 1 25 ? 40.498 -5.747  -1.309  1.00 0.00 ? 25 ALA A H    4  
ATOM 2545  H HA   . ALA A 1 25 ? 42.019 -8.095  -0.676  1.00 0.00 ? 25 ALA A HA   4  
ATOM 2546  H HB1  . ALA A 1 25 ? 42.869 -6.728  1.234   1.00 0.00 ? 25 ALA A HB1  4  
ATOM 2547  H HB2  . ALA A 1 25 ? 41.601 -5.537  0.980   1.00 0.00 ? 25 ALA A HB2  4  
ATOM 2548  H HB3  . ALA A 1 25 ? 42.850 -5.779  -0.242  1.00 0.00 ? 25 ALA A HB3  4  
ATOM 2549  N N    . CYS A 1 26 ? 39.190 -7.528  0.845   1.00 0.00 ? 26 CYS A N    4  
ATOM 2550  C CA   . CYS A 1 26 ? 38.134 -8.123  1.655   1.00 0.00 ? 26 CYS A CA   4  
ATOM 2551  C C    . CYS A 1 26 ? 37.379 -9.252  0.920   1.00 0.00 ? 26 CYS A C    4  
ATOM 2552  O O    . CYS A 1 26 ? 36.339 -9.693  1.387   1.00 0.00 ? 26 CYS A O    4  
ATOM 2553  C CB   . CYS A 1 26 ? 37.130 -7.027  2.034   1.00 0.00 ? 26 CYS A CB   4  
ATOM 2554  S SG   . CYS A 1 26 ? 37.569 -6.280  3.627   1.00 0.00 ? 26 CYS A SG   4  
ATOM 2555  H H    . CYS A 1 26 ? 39.002 -6.702  0.313   1.00 0.00 ? 26 CYS A H    4  
ATOM 2556  H HA   . CYS A 1 26 ? 38.613 -8.526  2.551   1.00 0.00 ? 26 CYS A HA   4  
ATOM 2557  H HB2  . CYS A 1 26 ? 37.143 -6.267  1.265   1.00 0.00 ? 26 CYS A HB2  4  
ATOM 2558  H HB3  . CYS A 1 26 ? 36.089 -7.370  2.026   1.00 0.00 ? 26 CYS A HB3  4  
ATOM 2559  H HG   . CYS A 1 26 ? 37.389 -4.966  3.560   1.00 0.00 ? 26 CYS A HG   4  
ATOM 2560  N N    . GLU A 1 27 ? 37.907 -9.693  -0.248  1.00 0.00 ? 27 GLU A N    4  
ATOM 2561  C CA   . GLU A 1 27 ? 37.209 -10.733 -1.014  1.00 0.00 ? 27 GLU A CA   4  
ATOM 2562  C C    . GLU A 1 27 ? 35.750 -10.322 -1.328  1.00 0.00 ? 27 GLU A C    4  
ATOM 2563  O O    . GLU A 1 27 ? 34.792 -10.984 -0.966  1.00 0.00 ? 27 GLU A O    4  
ATOM 2564  C CB   . GLU A 1 27 ? 37.340 -12.082 -0.275  1.00 0.00 ? 27 GLU A CB   4  
ATOM 2565  C CG   . GLU A 1 27 ? 36.455 -13.237 -0.806  1.00 0.00 ? 27 GLU A CG   4  
ATOM 2566  C CD   . GLU A 1 27 ? 35.348 -13.637 0.213   1.00 0.00 ? 27 GLU A CD   4  
ATOM 2567  O OE1  . GLU A 1 27 ? 35.683 -14.180 1.267   1.00 0.00 ? 27 GLU A OE1  4  
ATOM 2568  O OE2  . GLU A 1 27 ? 34.166 -13.408 -0.049  1.00 0.00 ? 27 GLU A OE2  4  
ATOM 2569  H H    . GLU A 1 27 ? 38.777 -9.334  -0.583  1.00 0.00 ? 27 GLU A H    4  
ATOM 2570  H HA   . GLU A 1 27 ? 37.734 -10.802 -1.966  1.00 0.00 ? 27 GLU A HA   4  
ATOM 2571  H HB2  . GLU A 1 27 ? 38.383 -12.381 -0.343  1.00 0.00 ? 27 GLU A HB2  4  
ATOM 2572  H HB3  . GLU A 1 27 ? 37.211 -11.944 0.796   1.00 0.00 ? 27 GLU A HB3  4  
ATOM 2573  H HG2  . GLU A 1 27 ? 36.038 -13.000 -1.788  1.00 0.00 ? 27 GLU A HG2  4  
ATOM 2574  H HG3  . GLU A 1 27 ? 37.080 -14.107 -0.994  1.00 0.00 ? 27 GLU A HG3  4  
ATOM 2575  N N    . LYS A 1 28 ? 35.678 -9.168  -2.015  1.00 0.00 ? 28 LYS A N    4  
ATOM 2576  C CA   . LYS A 1 28 ? 34.456 -8.562  -2.543  1.00 0.00 ? 28 LYS A CA   4  
ATOM 2577  C C    . LYS A 1 28 ? 33.196 -8.845  -1.681  1.00 0.00 ? 28 LYS A C    4  
ATOM 2578  O O    . LYS A 1 28 ? 32.248 -9.467  -2.141  1.00 0.00 ? 28 LYS A O    4  
ATOM 2579  C CB   . LYS A 1 28 ? 34.302 -9.062  -3.990  1.00 0.00 ? 28 LYS A CB   4  
ATOM 2580  C CG   . LYS A 1 28 ? 35.554 -8.855  -4.867  1.00 0.00 ? 28 LYS A CG   4  
ATOM 2581  C CD   . LYS A 1 28 ? 35.770 -7.395  -5.285  1.00 0.00 ? 28 LYS A CD   4  
ATOM 2582  C CE   . LYS A 1 28 ? 35.355 -7.114  -6.730  1.00 0.00 ? 28 LYS A CE   4  
ATOM 2583  N NZ   . LYS A 1 28 ? 35.489 -5.701  -7.075  1.00 0.00 ? 28 LYS A NZ   4  
ATOM 2584  H H    . LYS A 1 28 ? 36.547 -8.732  -2.249  1.00 0.00 ? 28 LYS A H    4  
ATOM 2585  H HA   . LYS A 1 28 ? 34.615 -7.486  -2.540  1.00 0.00 ? 28 LYS A HA   4  
ATOM 2586  H HB2  . LYS A 1 28 ? 34.068 -10.126 -3.995  1.00 0.00 ? 28 LYS A HB2  4  
ATOM 2587  H HB3  . LYS A 1 28 ? 33.450 -8.566  -4.443  1.00 0.00 ? 28 LYS A HB3  4  
ATOM 2588  H HG2  . LYS A 1 28 ? 36.451 -9.221  -4.369  1.00 0.00 ? 28 LYS A HG2  4  
ATOM 2589  H HG3  . LYS A 1 28 ? 35.486 -9.489  -5.750  1.00 0.00 ? 28 LYS A HG3  4  
ATOM 2590  H HD2  . LYS A 1 28 ? 35.263 -6.719  -4.612  1.00 0.00 ? 28 LYS A HD2  4  
ATOM 2591  H HD3  . LYS A 1 28 ? 36.817 -7.144  -5.165  1.00 0.00 ? 28 LYS A HD3  4  
ATOM 2592  H HE2  . LYS A 1 28 ? 35.977 -7.690  -7.418  1.00 0.00 ? 28 LYS A HE2  4  
ATOM 2593  H HE3  . LYS A 1 28 ? 34.315 -7.405  -6.893  1.00 0.00 ? 28 LYS A HE3  4  
ATOM 2594  H HZ1  . LYS A 1 28 ? 36.450 -5.360  -6.869  1.00 0.00 ? 28 LYS A HZ1  4  
ATOM 2595  H HZ2  . LYS A 1 28 ? 34.814 -5.136  -6.520  1.00 0.00 ? 28 LYS A HZ2  4  
ATOM 2596  H HZ3  . LYS A 1 28 ? 35.295 -5.572  -8.087  1.00 0.00 ? 28 LYS A HZ3  4  
ATOM 2597  N N    . ASN A 1 29 ? 33.270 -8.385  -0.402  1.00 0.00 ? 29 ASN A N    4  
ATOM 2598  C CA   . ASN A 1 29 ? 32.237 -8.715  0.589   1.00 0.00 ? 29 ASN A CA   4  
ATOM 2599  C C    . ASN A 1 29 ? 31.368 -7.467  0.830   1.00 0.00 ? 29 ASN A C    4  
ATOM 2600  O O    . ASN A 1 29 ? 31.184 -6.688  -0.095  1.00 0.00 ? 29 ASN A O    4  
ATOM 2601  C CB   . ASN A 1 29 ? 32.914 -9.278  1.861   1.00 0.00 ? 29 ASN A CB   4  
ATOM 2602  C CG   . ASN A 1 29 ? 32.052 -10.348 2.558   1.00 0.00 ? 29 ASN A CG   4  
ATOM 2603  O OD1  . ASN A 1 29 ? 30.964 -10.698 2.127   1.00 0.00 ? 29 ASN A OD1  4  
ATOM 2604  N ND2  . ASN A 1 29 ? 32.641 -10.868 3.655   1.00 0.00 ? 29 ASN A ND2  4  
ATOM 2605  H H    . ASN A 1 29 ? 34.071 -7.848  -0.136  1.00 0.00 ? 29 ASN A H    4  
ATOM 2606  H HA   . ASN A 1 29 ? 31.599 -9.477  0.134   1.00 0.00 ? 29 ASN A HA   4  
ATOM 2607  H HB2  . ASN A 1 29 ? 33.855 -9.750  1.590   1.00 0.00 ? 29 ASN A HB2  4  
ATOM 2608  H HB3  . ASN A 1 29 ? 33.182 -8.498  2.570   1.00 0.00 ? 29 ASN A HB3  4  
ATOM 2609  H HD21 . ASN A 1 29 ? 33.522 -10.537 3.994   1.00 0.00 ? 29 ASN A HD21 4  
ATOM 2610  H HD22 . ASN A 1 29 ? 32.190 -11.611 4.141   1.00 0.00 ? 29 ASN A HD22 4  
ATOM 2611  N N    . GLU A 1 30 ? 30.847 -7.291  2.068   1.00 0.00 ? 30 GLU A N    4  
ATOM 2612  C CA   . GLU A 1 30 ? 30.017 -6.121  2.371   1.00 0.00 ? 30 GLU A CA   4  
ATOM 2613  C C    . GLU A 1 30 ? 30.436 -5.492  3.697   1.00 0.00 ? 30 GLU A C    4  
ATOM 2614  O O    . GLU A 1 30 ? 31.087 -4.461  3.735   1.00 0.00 ? 30 GLU A O    4  
ATOM 2615  C CB   . GLU A 1 30 ? 28.522 -6.475  2.387   1.00 0.00 ? 30 GLU A CB   4  
ATOM 2616  C CG   . GLU A 1 30 ? 27.922 -6.673  0.986   1.00 0.00 ? 30 GLU A CG   4  
ATOM 2617  C CD   . GLU A 1 30 ? 26.529 -6.021  0.878   1.00 0.00 ? 30 GLU A CD   4  
ATOM 2618  O OE1  . GLU A 1 30 ? 26.471 -4.834  0.572   1.00 0.00 ? 30 GLU A OE1  4  
ATOM 2619  O OE2  . GLU A 1 30 ? 25.521 -6.701  1.105   1.00 0.00 ? 30 GLU A OE2  4  
ATOM 2620  H H    . GLU A 1 30 ? 31.028 -7.967  2.785   1.00 0.00 ? 30 GLU A H    4  
ATOM 2621  H HA   . GLU A 1 30 ? 30.211 -5.347  1.630   1.00 0.00 ? 30 GLU A HA   4  
ATOM 2622  H HB2  . GLU A 1 30 ? 28.349 -7.370  2.979   1.00 0.00 ? 30 GLU A HB2  4  
ATOM 2623  H HB3  . GLU A 1 30 ? 27.990 -5.694  2.929   1.00 0.00 ? 30 GLU A HB3  4  
ATOM 2624  H HG2  . GLU A 1 30 ? 28.566 -6.215  0.236   1.00 0.00 ? 30 GLU A HG2  4  
ATOM 2625  H HG3  . GLU A 1 30 ? 27.868 -7.736  0.752   1.00 0.00 ? 30 GLU A HG3  4  
ATOM 2626  N N    . ASN A 1 31 ? 30.009 -6.184  4.773   1.00 0.00 ? 31 ASN A N    4  
ATOM 2627  C CA   . ASN A 1 31 ? 30.329 -5.752  6.125   1.00 0.00 ? 31 ASN A CA   4  
ATOM 2628  C C    . ASN A 1 31 ? 31.840 -5.745  6.358   1.00 0.00 ? 31 ASN A C    4  
ATOM 2629  O O    . ASN A 1 31 ? 32.306 -5.069  7.258   1.00 0.00 ? 31 ASN A O    4  
ATOM 2630  C CB   . ASN A 1 31 ? 29.657 -6.716  7.132   1.00 0.00 ? 31 ASN A CB   4  
ATOM 2631  C CG   . ASN A 1 31 ? 28.614 -6.020  8.020   1.00 0.00 ? 31 ASN A CG   4  
ATOM 2632  O OD1  . ASN A 1 31 ? 28.141 -4.927  7.753   1.00 0.00 ? 31 ASN A OD1  4  
ATOM 2633  N ND2  . ASN A 1 31 ? 28.296 -6.749  9.110   1.00 0.00 ? 31 ASN A ND2  4  
ATOM 2634  H H    . ASN A 1 31 ? 29.487 -7.021  4.630   1.00 0.00 ? 31 ASN A H    4  
ATOM 2635  H HA   . ASN A 1 31 ? 29.983 -4.720  6.222   1.00 0.00 ? 31 ASN A HA   4  
ATOM 2636  H HB2  . ASN A 1 31 ? 29.170 -7.534  6.605   1.00 0.00 ? 31 ASN A HB2  4  
ATOM 2637  H HB3  . ASN A 1 31 ? 30.377 -7.214  7.782   1.00 0.00 ? 31 ASN A HB3  4  
ATOM 2638  H HD21 . ASN A 1 31 ? 28.712 -7.645  9.273   1.00 0.00 ? 31 ASN A HD21 4  
ATOM 2639  H HD22 . ASN A 1 31 ? 27.634 -6.386  9.760   1.00 0.00 ? 31 ASN A HD22 4  
ATOM 2640  N N    . LEU A 1 32 ? 32.558 -6.527  5.514   1.00 0.00 ? 32 LEU A N    4  
ATOM 2641  C CA   . LEU A 1 32 ? 34.002 -6.651  5.662   1.00 0.00 ? 32 LEU A CA   4  
ATOM 2642  C C    . LEU A 1 32 ? 34.700 -5.400  5.083   1.00 0.00 ? 32 LEU A C    4  
ATOM 2643  O O    . LEU A 1 32 ? 35.581 -4.819  5.693   1.00 0.00 ? 32 LEU A O    4  
ATOM 2644  C CB   . LEU A 1 32 ? 34.484 -7.917  4.922   1.00 0.00 ? 32 LEU A CB   4  
ATOM 2645  C CG   . LEU A 1 32 ? 35.638 -8.704  5.592   1.00 0.00 ? 32 LEU A CG   4  
ATOM 2646  C CD1  . LEU A 1 32 ? 36.484 -9.434  4.543   1.00 0.00 ? 32 LEU A CD1  4  
ATOM 2647  C CD2  . LEU A 1 32 ? 36.522 -7.869  6.527   1.00 0.00 ? 32 LEU A CD2  4  
ATOM 2648  H H    . LEU A 1 32 ? 32.085 -7.020  4.781   1.00 0.00 ? 32 LEU A H    4  
ATOM 2649  H HA   . LEU A 1 32 ? 34.190 -6.716  6.737   1.00 0.00 ? 32 LEU A HA   4  
ATOM 2650  H HB2  . LEU A 1 32 ? 33.656 -8.607  4.778   1.00 0.00 ? 32 LEU A HB2  4  
ATOM 2651  H HB3  . LEU A 1 32 ? 34.746 -7.643  3.901   1.00 0.00 ? 32 LEU A HB3  4  
ATOM 2652  H HG   . LEU A 1 32 ? 35.190 -9.474  6.221   1.00 0.00 ? 32 LEU A HG   4  
ATOM 2653  H HD11 . LEU A 1 32 ? 37.554 -9.353  4.738   1.00 0.00 ? 32 LEU A HD11 4  
ATOM 2654  H HD12 . LEU A 1 32 ? 36.326 -8.993  3.570   1.00 0.00 ? 32 LEU A HD12 4  
ATOM 2655  H HD13 . LEU A 1 32 ? 36.207 -10.486 4.479   1.00 0.00 ? 32 LEU A HD13 4  
ATOM 2656  H HD21 . LEU A 1 32 ? 37.436 -8.405  6.774   1.00 0.00 ? 32 LEU A HD21 4  
ATOM 2657  H HD22 . LEU A 1 32 ? 36.001 -7.670  7.464   1.00 0.00 ? 32 LEU A HD22 4  
ATOM 2658  H HD23 . LEU A 1 32 ? 36.821 -6.924  6.084   1.00 0.00 ? 32 LEU A HD23 4  
ATOM 2659  N N    . ALA A 1 33 ? 34.230 -5.036  3.863   1.00 0.00 ? 33 ALA A N    4  
ATOM 2660  C CA   . ALA A 1 33 ? 34.767 -3.875  3.164   1.00 0.00 ? 33 ALA A CA   4  
ATOM 2661  C C    . ALA A 1 33 ? 34.555 -2.589  3.960   1.00 0.00 ? 33 ALA A C    4  
ATOM 2662  O O    . ALA A 1 33 ? 35.468 -1.802  4.134   1.00 0.00 ? 33 ALA A O    4  
ATOM 2663  C CB   . ALA A 1 33 ? 34.094 -3.714  1.812   1.00 0.00 ? 33 ALA A CB   4  
ATOM 2664  H H    . ALA A 1 33 ? 33.502 -5.575  3.442   1.00 0.00 ? 33 ALA A H    4  
ATOM 2665  H HA   . ALA A 1 33 ? 35.838 -4.031  3.036   1.00 0.00 ? 33 ALA A HA   4  
ATOM 2666  H HB1  . ALA A 1 33 ? 34.436 -2.776  1.378   1.00 0.00 ? 33 ALA A HB1  4  
ATOM 2667  H HB2  . ALA A 1 33 ? 33.006 -3.682  1.891   1.00 0.00 ? 33 ALA A HB2  4  
ATOM 2668  H HB3  . ALA A 1 33 ? 34.356 -4.524  1.134   1.00 0.00 ? 33 ALA A HB3  4  
ATOM 2669  N N    . ALA A 1 34 ? 33.307 -2.444  4.452   1.00 0.00 ? 34 ALA A N    4  
ATOM 2670  C CA   . ALA A 1 34 ? 33.006 -1.326  5.337   1.00 0.00 ? 34 ALA A CA   4  
ATOM 2671  C C    . ALA A 1 34 ? 33.939 -1.346  6.559   1.00 0.00 ? 34 ALA A C    4  
ATOM 2672  O O    . ALA A 1 34 ? 34.561 -0.353  6.888   1.00 0.00 ? 34 ALA A O    4  
ATOM 2673  C CB   . ALA A 1 34 ? 31.538 -1.375  5.765   1.00 0.00 ? 34 ALA A CB   4  
ATOM 2674  H H    . ALA A 1 34 ? 32.610 -3.120  4.217   1.00 0.00 ? 34 ALA A H    4  
ATOM 2675  H HA   . ALA A 1 34 ? 33.194 -0.412  4.768   1.00 0.00 ? 34 ALA A HA   4  
ATOM 2676  H HB1  . ALA A 1 34 ? 31.297 -2.285  6.315   1.00 0.00 ? 34 ALA A HB1  4  
ATOM 2677  H HB2  . ALA A 1 34 ? 30.884 -1.337  4.895   1.00 0.00 ? 34 ALA A HB2  4  
ATOM 2678  H HB3  . ALA A 1 34 ? 31.293 -0.519  6.395   1.00 0.00 ? 34 ALA A HB3  4  
ATOM 2679  N N    . ASN A 1 35 ? 34.061 -2.531  7.185   1.00 0.00 ? 35 ASN A N    4  
ATOM 2680  C CA   . ASN A 1 35 ? 34.952 -2.626  8.344   1.00 0.00 ? 35 ASN A CA   4  
ATOM 2681  C C    . ASN A 1 35 ? 36.401 -2.202  8.021   1.00 0.00 ? 35 ASN A C    4  
ATOM 2682  O O    . ASN A 1 35 ? 37.069 -1.635  8.868   1.00 0.00 ? 35 ASN A O    4  
ATOM 2683  C CB   . ASN A 1 35 ? 34.955 -4.067  8.890   1.00 0.00 ? 35 ASN A CB   4  
ATOM 2684  C CG   . ASN A 1 35 ? 34.887 -4.111  10.423  1.00 0.00 ? 35 ASN A CG   4  
ATOM 2685  O OD1  . ASN A 1 35 ? 35.753 -4.652  11.093  1.00 0.00 ? 35 ASN A OD1  4  
ATOM 2686  N ND2  . ASN A 1 35 ? 33.767 -3.534  10.916  1.00 0.00 ? 35 ASN A ND2  4  
ATOM 2687  H H    . ASN A 1 35 ? 33.566 -3.329  6.841   1.00 0.00 ? 35 ASN A H    4  
ATOM 2688  H HA   . ASN A 1 35 ? 34.559 -1.904  9.070   1.00 0.00 ? 35 ASN A HA   4  
ATOM 2689  H HB2  . ASN A 1 35 ? 34.107 -4.612  8.502   1.00 0.00 ? 35 ASN A HB2  4  
ATOM 2690  H HB3  . ASN A 1 35 ? 35.819 -4.648  8.561   1.00 0.00 ? 35 ASN A HB3  4  
ATOM 2691  H HD21 . ASN A 1 35 ? 33.152 -3.018  10.322  1.00 0.00 ? 35 ASN A HD21 4  
ATOM 2692  H HD22 . ASN A 1 35 ? 33.517 -3.605  11.877  1.00 0.00 ? 35 ASN A HD22 4  
ATOM 2693  N N    . PHE A 1 36 ? 36.832 -2.486  6.770   1.00 0.00 ? 36 PHE A N    4  
ATOM 2694  C CA   . PHE A 1 36 ? 38.186 -2.145  6.317   1.00 0.00 ? 36 PHE A CA   4  
ATOM 2695  C C    . PHE A 1 36 ? 38.383 -0.607  6.274   1.00 0.00 ? 36 PHE A C    4  
ATOM 2696  O O    . PHE A 1 36 ? 39.356 -0.068  6.783   1.00 0.00 ? 36 PHE A O    4  
ATOM 2697  C CB   . PHE A 1 36 ? 38.408 -2.774  4.925   1.00 0.00 ? 36 PHE A CB   4  
ATOM 2698  C CG   . PHE A 1 36 ? 39.771 -2.535  4.313   1.00 0.00 ? 36 PHE A CG   4  
ATOM 2699  C CD1  . PHE A 1 36 ? 40.128 -1.275  3.838   1.00 0.00 ? 36 PHE A CD1  4  
ATOM 2700  C CD2  . PHE A 1 36 ? 40.678 -3.580  4.155   1.00 0.00 ? 36 PHE A CD2  4  
ATOM 2701  C CE1  . PHE A 1 36 ? 41.336 -1.066  3.196   1.00 0.00 ? 36 PHE A CE1  4  
ATOM 2702  C CE2  . PHE A 1 36 ? 41.898 -3.371  3.519   1.00 0.00 ? 36 PHE A CE2  4  
ATOM 2703  C CZ   . PHE A 1 36 ? 42.228 -2.113  3.034   1.00 0.00 ? 36 PHE A CZ   4  
ATOM 2704  H H    . PHE A 1 36 ? 36.184 -2.902  6.130   1.00 0.00 ? 36 PHE A H    4  
ATOM 2705  H HA   . PHE A 1 36 ? 38.884 -2.583  7.036   1.00 0.00 ? 36 PHE A HA   4  
ATOM 2706  H HB2  . PHE A 1 36 ? 38.217 -3.846  4.971   1.00 0.00 ? 36 PHE A HB2  4  
ATOM 2707  H HB3  . PHE A 1 36 ? 37.674 -2.392  4.221   1.00 0.00 ? 36 PHE A HB3  4  
ATOM 2708  H HD1  . PHE A 1 36 ? 39.455 -0.435  3.912   1.00 0.00 ? 36 PHE A HD1  4  
ATOM 2709  H HD2  . PHE A 1 36 ? 40.423 -4.570  4.503   1.00 0.00 ? 36 PHE A HD2  4  
ATOM 2710  H HE1  . PHE A 1 36 ? 41.564 -0.080  2.815   1.00 0.00 ? 36 PHE A HE1  4  
ATOM 2711  H HE2  . PHE A 1 36 ? 42.590 -4.191  3.383   1.00 0.00 ? 36 PHE A HE2  4  
ATOM 2712  H HZ   . PHE A 1 36 ? 43.161 -1.943  2.520   1.00 0.00 ? 36 PHE A HZ   4  
ATOM 2713  N N    . LEU A 1 37 ? 37.409 0.046   5.597   1.00 0.00 ? 37 LEU A N    4  
ATOM 2714  C CA   . LEU A 1 37 ? 37.528 1.468   5.310   1.00 0.00 ? 37 LEU A CA   4  
ATOM 2715  C C    . LEU A 1 37 ? 37.311 2.328   6.578   1.00 0.00 ? 37 LEU A C    4  
ATOM 2716  O O    . LEU A 1 37 ? 37.861 3.417   6.705   1.00 0.00 ? 37 LEU A O    4  
ATOM 2717  C CB   . LEU A 1 37 ? 36.525 1.867   4.223   1.00 0.00 ? 37 LEU A CB   4  
ATOM 2718  C CG   . LEU A 1 37 ? 36.723 1.226   2.829   1.00 0.00 ? 37 LEU A CG   4  
ATOM 2719  C CD1  . LEU A 1 37 ? 35.493 0.423   2.410   1.00 0.00 ? 37 LEU A CD1  4  
ATOM 2720  C CD2  . LEU A 1 37 ? 37.044 2.257   1.728   1.00 0.00 ? 37 LEU A CD2  4  
ATOM 2721  H H    . LEU A 1 37 ? 36.599 -0.440  5.276   1.00 0.00 ? 37 LEU A H    4  
ATOM 2722  H HA   . LEU A 1 37 ? 38.537 1.644   4.939   1.00 0.00 ? 37 LEU A HA   4  
ATOM 2723  H HB2  . LEU A 1 37 ? 35.513 1.684   4.566   1.00 0.00 ? 37 LEU A HB2  4  
ATOM 2724  H HB3  . LEU A 1 37 ? 36.616 2.941   4.156   1.00 0.00 ? 37 LEU A HB3  4  
ATOM 2725  H HG   . LEU A 1 37 ? 37.559 0.530   2.898   1.00 0.00 ? 37 LEU A HG   4  
ATOM 2726  H HD11 . LEU A 1 37 ? 35.775 -0.506  1.912   1.00 0.00 ? 37 LEU A HD11 4  
ATOM 2727  H HD12 . LEU A 1 37 ? 34.880 1.004   1.733   1.00 0.00 ? 37 LEU A HD12 4  
ATOM 2728  H HD13 . LEU A 1 37 ? 34.825 0.205   3.238   1.00 0.00 ? 37 LEU A HD13 4  
ATOM 2729  H HD21 . LEU A 1 37 ? 37.212 3.245   2.138   1.00 0.00 ? 37 LEU A HD21 4  
ATOM 2730  H HD22 . LEU A 1 37 ? 36.262 2.383   0.975   1.00 0.00 ? 37 LEU A HD22 4  
ATOM 2731  H HD23 . LEU A 1 37 ? 37.943 1.962   1.204   1.00 0.00 ? 37 LEU A HD23 4  
ATOM 2732  N N    . LEU A 1 38 ? 36.484 1.767   7.496   1.00 0.00 ? 38 LEU A N    4  
ATOM 2733  C CA   . LEU A 1 38 ? 36.096 2.475   8.715   1.00 0.00 ? 38 LEU A CA   4  
ATOM 2734  C C    . LEU A 1 38 ? 37.158 2.266   9.825   1.00 0.00 ? 38 LEU A C    4  
ATOM 2735  O O    . LEU A 1 38 ? 37.333 3.089   10.713  1.00 0.00 ? 38 LEU A O    4  
ATOM 2736  C CB   . LEU A 1 38 ? 34.692 2.055   9.228   1.00 0.00 ? 38 LEU A CB   4  
ATOM 2737  C CG   . LEU A 1 38 ? 33.502 2.013   8.226   1.00 0.00 ? 38 LEU A CG   4  
ATOM 2738  C CD1  . LEU A 1 38 ? 32.276 2.783   8.722   1.00 0.00 ? 38 LEU A CD1  4  
ATOM 2739  C CD2  . LEU A 1 38 ? 33.846 2.497   6.821   1.00 0.00 ? 38 LEU A CD2  4  
ATOM 2740  H H    . LEU A 1 38 ? 36.089 0.868   7.325   1.00 0.00 ? 38 LEU A H    4  
ATOM 2741  H HA   . LEU A 1 38 ? 36.085 3.531   8.449   1.00 0.00 ? 38 LEU A HA   4  
ATOM 2742  H HB2  . LEU A 1 38 ? 34.775 1.069   9.684   1.00 0.00 ? 38 LEU A HB2  4  
ATOM 2743  H HB3  . LEU A 1 38 ? 34.431 2.738   10.038  1.00 0.00 ? 38 LEU A HB3  4  
ATOM 2744  H HG   . LEU A 1 38 ? 33.152 0.984   8.173   1.00 0.00 ? 38 LEU A HG   4  
ATOM 2745  H HD11 . LEU A 1 38 ? 32.481 3.851   8.797   1.00 0.00 ? 38 LEU A HD11 4  
ATOM 2746  H HD12 . LEU A 1 38 ? 31.943 2.409   9.687   1.00 0.00 ? 38 LEU A HD12 4  
ATOM 2747  H HD13 . LEU A 1 38 ? 31.445 2.653   8.026   1.00 0.00 ? 38 LEU A HD13 4  
ATOM 2748  H HD21 . LEU A 1 38 ? 34.576 3.295   6.875   1.00 0.00 ? 38 LEU A HD21 4  
ATOM 2749  H HD22 . LEU A 1 38 ? 32.968 2.878   6.315   1.00 0.00 ? 38 LEU A HD22 4  
ATOM 2750  H HD23 . LEU A 1 38 ? 34.249 1.725   6.180   1.00 0.00 ? 38 LEU A HD23 4  
ATOM 2751  N N    . SER A 1 39 ? 37.856 1.113   9.686   1.00 0.00 ? 39 SER A N    4  
ATOM 2752  C CA   . SER A 1 39 ? 38.956 0.725   10.568  1.00 0.00 ? 39 SER A CA   4  
ATOM 2753  C C    . SER A 1 39 ? 40.159 1.652   10.380  1.00 0.00 ? 39 SER A C    4  
ATOM 2754  O O    . SER A 1 39 ? 40.867 1.964   11.327  1.00 0.00 ? 39 SER A O    4  
ATOM 2755  C CB   . SER A 1 39 ? 39.362 -0.731  10.271  1.00 0.00 ? 39 SER A CB   4  
ATOM 2756  O OG   . SER A 1 39 ? 40.620 -1.127  10.796  1.00 0.00 ? 39 SER A OG   4  
ATOM 2757  H H    . SER A 1 39 ? 37.633 0.509   8.924   1.00 0.00 ? 39 SER A H    4  
ATOM 2758  H HA   . SER A 1 39 ? 38.592 0.828   11.591  1.00 0.00 ? 39 SER A HA   4  
ATOM 2759  H HB2  . SER A 1 39 ? 38.571 -1.395  10.634  1.00 0.00 ? 39 SER A HB2  4  
ATOM 2760  H HB3  . SER A 1 39 ? 39.434 -0.882  9.193   1.00 0.00 ? 39 SER A HB3  4  
ATOM 2761  H HG   . SER A 1 39 ? 40.533 -1.468  11.679  1.00 0.00 ? 39 SER A HG   4  
ATOM 2762  N N    . GLN A 1 40 ? 40.334 2.070   9.108   1.00 0.00 ? 40 GLN A N    4  
ATOM 2763  C CA   . GLN A 1 40 ? 41.406 3.004   8.800   1.00 0.00 ? 40 GLN A CA   4  
ATOM 2764  C C    . GLN A 1 40 ? 40.884 4.441   8.907   1.00 0.00 ? 40 GLN A C    4  
ATOM 2765  O O    . GLN A 1 40 ? 40.251 4.975   8.005   1.00 0.00 ? 40 GLN A O    4  
ATOM 2766  C CB   . GLN A 1 40 ? 41.948 2.729   7.400   1.00 0.00 ? 40 GLN A CB   4  
ATOM 2767  C CG   . GLN A 1 40 ? 42.768 1.435   7.318   1.00 0.00 ? 40 GLN A CG   4  
ATOM 2768  C CD   . GLN A 1 40 ? 43.442 1.402   5.944   1.00 0.00 ? 40 GLN A CD   4  
ATOM 2769  O OE1  . GLN A 1 40 ? 44.388 2.128   5.670   1.00 0.00 ? 40 GLN A OE1  4  
ATOM 2770  N NE2  . GLN A 1 40 ? 42.825 0.582   5.080   1.00 0.00 ? 40 GLN A NE2  4  
ATOM 2771  H H    . GLN A 1 40 ? 39.713 1.751   8.392   1.00 0.00 ? 40 GLN A H    4  
ATOM 2772  H HA   . GLN A 1 40 ? 42.211 2.875   9.526   1.00 0.00 ? 40 GLN A HA   4  
ATOM 2773  H HB2  . GLN A 1 40 ? 41.129 2.706   6.678   1.00 0.00 ? 40 GLN A HB2  4  
ATOM 2774  H HB3  . GLN A 1 40 ? 42.589 3.561   7.114   1.00 0.00 ? 40 GLN A HB3  4  
ATOM 2775  H HG2  . GLN A 1 40 ? 43.548 1.400   8.078   1.00 0.00 ? 40 GLN A HG2  4  
ATOM 2776  H HG3  . GLN A 1 40 ? 42.132 0.563   7.473   1.00 0.00 ? 40 GLN A HG3  4  
ATOM 2777  H HE21 . GLN A 1 40 ? 42.140 -0.069  5.408   1.00 0.00 ? 40 GLN A HE21 4  
ATOM 2778  H HE22 . GLN A 1 40 ? 43.006 0.624   4.105   1.00 0.00 ? 40 GLN A HE22 4  
ATOM 2779  N N    . ASN A 1 41 ? 41.245 5.012   10.080  1.00 0.00 ? 41 ASN A N    4  
ATOM 2780  C CA   . ASN A 1 41 ? 40.924 6.391   10.428  1.00 0.00 ? 41 ASN A CA   4  
ATOM 2781  C C    . ASN A 1 41 ? 41.381 7.347   9.304   1.00 0.00 ? 41 ASN A C    4  
ATOM 2782  O O    . ASN A 1 41 ? 42.494 7.240   8.806   1.00 0.00 ? 41 ASN A O    4  
ATOM 2783  C CB   . ASN A 1 41 ? 41.652 6.812   11.719  1.00 0.00 ? 41 ASN A CB   4  
ATOM 2784  C CG   . ASN A 1 41 ? 41.689 5.788   12.871  1.00 0.00 ? 41 ASN A CG   4  
ATOM 2785  O OD1  . ASN A 1 41 ? 42.688 5.655   13.560  1.00 0.00 ? 41 ASN A OD1  4  
ATOM 2786  N ND2  . ASN A 1 41 ? 40.515 5.171   13.111  1.00 0.00 ? 41 ASN A ND2  4  
ATOM 2787  H H    . ASN A 1 41 ? 41.729 4.443   10.744  1.00 0.00 ? 41 ASN A H    4  
ATOM 2788  H HA   . ASN A 1 41 ? 39.841 6.432   10.556  1.00 0.00 ? 41 ASN A HA   4  
ATOM 2789  H HB2  . ASN A 1 41 ? 42.690 7.069   11.510  1.00 0.00 ? 41 ASN A HB2  4  
ATOM 2790  H HB3  . ASN A 1 41 ? 41.184 7.721   12.093  1.00 0.00 ? 41 ASN A HB3  4  
ATOM 2791  H HD21 . ASN A 1 41 ? 39.820 5.060   12.407  1.00 0.00 ? 41 ASN A HD21 4  
ATOM 2792  H HD22 . ASN A 1 41 ? 40.344 4.838   14.033  1.00 0.00 ? 41 ASN A HD22 4  
ATOM 2793  N N    . PHE A 1 42 ? 40.446 8.259   8.943   1.00 0.00 ? 42 PHE A N    4  
ATOM 2794  C CA   . PHE A 1 42 ? 40.678 9.215   7.860   1.00 0.00 ? 42 PHE A CA   4  
ATOM 2795  C C    . PHE A 1 42 ? 39.463 10.174  7.746   1.00 0.00 ? 42 PHE A C    4  
ATOM 2796  O O    . PHE A 1 42 ? 38.902 10.378  6.678   1.00 0.00 ? 42 PHE A O    4  
ATOM 2797  C CB   . PHE A 1 42 ? 40.920 8.458   6.526   1.00 0.00 ? 42 PHE A CB   4  
ATOM 2798  C CG   . PHE A 1 42 ? 41.180 9.321   5.312   1.00 0.00 ? 42 PHE A CG   4  
ATOM 2799  C CD1  . PHE A 1 42 ? 41.605 10.646  5.419   1.00 0.00 ? 42 PHE A CD1  4  
ATOM 2800  C CD2  . PHE A 1 42 ? 40.978 8.784   4.043   1.00 0.00 ? 42 PHE A CD2  4  
ATOM 2801  C CE1  . PHE A 1 42 ? 41.793 11.421  4.287   1.00 0.00 ? 42 PHE A CE1  4  
ATOM 2802  C CE2  . PHE A 1 42 ? 41.165 9.560   2.907   1.00 0.00 ? 42 PHE A CE2  4  
ATOM 2803  C CZ   . PHE A 1 42 ? 41.568 10.881  3.030   1.00 0.00 ? 42 PHE A CZ   4  
ATOM 2804  H H    . PHE A 1 42 ? 39.587 8.265   9.448   1.00 0.00 ? 42 PHE A H    4  
ATOM 2805  H HA   . PHE A 1 42 ? 41.557 9.791   8.158   1.00 0.00 ? 42 PHE A HA   4  
ATOM 2806  H HB2  . PHE A 1 42 ? 41.765 7.776   6.595   1.00 0.00 ? 42 PHE A HB2  4  
ATOM 2807  H HB3  . PHE A 1 42 ? 40.051 7.827   6.334   1.00 0.00 ? 42 PHE A HB3  4  
ATOM 2808  H HD1  . PHE A 1 42 ? 41.787 11.108  6.378   1.00 0.00 ? 42 PHE A HD1  4  
ATOM 2809  H HD2  . PHE A 1 42 ? 40.667 7.754   3.935   1.00 0.00 ? 42 PHE A HD2  4  
ATOM 2810  H HE1  . PHE A 1 42 ? 42.102 12.449  4.395   1.00 0.00 ? 42 PHE A HE1  4  
ATOM 2811  H HE2  . PHE A 1 42 ? 40.982 9.144   1.927   1.00 0.00 ? 42 PHE A HE2  4  
ATOM 2812  H HZ   . PHE A 1 42 ? 41.691 11.499  2.154   1.00 0.00 ? 42 PHE A HZ   4  
ATOM 2813  N N    . ASP A 1 43 ? 39.099 10.755  8.908   1.00 0.00 ? 43 ASP A N    4  
ATOM 2814  C CA   . ASP A 1 43 ? 38.020 11.740  8.928   1.00 0.00 ? 43 ASP A CA   4  
ATOM 2815  C C    . ASP A 1 43 ? 37.984 12.392  10.323  1.00 0.00 ? 43 ASP A C    4  
ATOM 2816  O O    . ASP A 1 43 ? 38.387 13.532  10.500  1.00 0.00 ? 43 ASP A O    4  
ATOM 2817  C CB   . ASP A 1 43 ? 36.663 11.090  8.548   1.00 0.00 ? 43 ASP A CB   4  
ATOM 2818  C CG   . ASP A 1 43 ? 35.536 12.129  8.365   1.00 0.00 ? 43 ASP A CG   4  
ATOM 2819  O OD1  . ASP A 1 43 ? 35.171 12.789  9.337   1.00 0.00 ? 43 ASP A OD1  4  
ATOM 2820  O OD2  . ASP A 1 43 ? 35.027 12.265  7.251   1.00 0.00 ? 43 ASP A OD2  4  
ATOM 2821  H H    . ASP A 1 43 ? 39.577 10.496  9.744   1.00 0.00 ? 43 ASP A H    4  
ATOM 2822  H HA   . ASP A 1 43 ? 38.293 12.507  8.195   1.00 0.00 ? 43 ASP A HA   4  
ATOM 2823  H HB2  . ASP A 1 43 ? 36.757 10.540  7.616   1.00 0.00 ? 43 ASP A HB2  4  
ATOM 2824  H HB3  . ASP A 1 43 ? 36.354 10.331  9.267   1.00 0.00 ? 43 ASP A HB3  4  
ATOM 2825  N N    . ASP A 1 44 ? 37.455 11.594  11.284  1.00 0.00 ? 44 ASP A N    4  
ATOM 2826  C CA   . ASP A 1 44 ? 37.238 12.066  12.645  1.00 0.00 ? 44 ASP A CA   4  
ATOM 2827  C C    . ASP A 1 44 ? 37.554 10.906  13.601  1.00 0.00 ? 44 ASP A C    4  
ATOM 2828  O O    . ASP A 1 44 ? 38.572 10.906  14.276  1.00 0.00 ? 44 ASP A O    4  
ATOM 2829  C CB   . ASP A 1 44 ? 35.793 12.602  12.780  1.00 0.00 ? 44 ASP A CB   4  
ATOM 2830  C CG   . ASP A 1 44 ? 35.433 13.178  14.171  1.00 0.00 ? 44 ASP A CG   4  
ATOM 2831  O OD1  . ASP A 1 44 ? 36.308 13.305  15.029  1.00 0.00 ? 44 ASP A OD1  4  
ATOM 2832  O OD2  . ASP A 1 44 ? 34.262 13.502  14.381  1.00 0.00 ? 44 ASP A OD2  4  
ATOM 2833  H H    . ASP A 1 44 ? 37.132 10.678  11.054  1.00 0.00 ? 44 ASP A H    4  
ATOM 2834  H HA   . ASP A 1 44 ? 37.950 12.871  12.839  1.00 0.00 ? 44 ASP A HA   4  
ATOM 2835  H HB2  . ASP A 1 44 ? 35.639 13.394  12.049  1.00 0.00 ? 44 ASP A HB2  4  
ATOM 2836  H HB3  . ASP A 1 44 ? 35.068 11.834  12.511  1.00 0.00 ? 44 ASP A HB3  4  
ATOM 2837  N N    . GLU A 1 45 ? 36.618 9.925   13.613  1.00 0.00 ? 45 GLU A N    4  
ATOM 2838  C CA   . GLU A 1 45 ? 36.730 8.790   14.524  1.00 0.00 ? 45 GLU A CA   4  
ATOM 2839  C C    . GLU A 1 45 ? 37.575 7.645   13.910  1.00 0.00 ? 45 GLU A C    4  
ATOM 2840  O O    . GLU A 1 45 ? 37.603 6.559   14.490  1.00 0.00 ? 45 GLU A O    4  
ATOM 2841  C CB   . GLU A 1 45 ? 35.312 8.351   14.939  1.00 0.00 ? 45 GLU A CB   4  
ATOM 2842  C CG   . GLU A 1 45 ? 34.589 7.446   13.923  1.00 0.00 ? 45 GLU A CG   4  
ATOM 2843  C CD   . GLU A 1 45 ? 33.067 7.440   14.153  1.00 0.00 ? 45 GLU A CD   4  
ATOM 2844  O OE1  . GLU A 1 45 ? 32.640 7.320   15.303  1.00 0.00 ? 45 GLU A OE1  4  
ATOM 2845  O OE2  . GLU A 1 45 ? 32.324 7.560   13.179  1.00 0.00 ? 45 GLU A OE2  4  
ATOM 2846  O OXT  . GLU A 1 45 ? 38.196 7.845   12.864  1.00 0.00 ? 45 GLU A OXT  4  
ATOM 2847  H H    . GLU A 1 45 ? 35.821 9.995   13.015  1.00 0.00 ? 45 GLU A H    4  
ATOM 2848  H HA   . GLU A 1 45 ? 37.243 9.158   15.415  1.00 0.00 ? 45 GLU A HA   4  
ATOM 2849  H HB2  . GLU A 1 45 ? 35.362 7.838   15.897  1.00 0.00 ? 45 GLU A HB2  4  
ATOM 2850  H HB3  . GLU A 1 45 ? 34.717 9.246   15.128  1.00 0.00 ? 45 GLU A HB3  4  
ATOM 2851  H HG2  . GLU A 1 45 ? 34.803 7.776   12.908  1.00 0.00 ? 45 GLU A HG2  4  
ATOM 2852  H HG3  . GLU A 1 45 ? 34.948 6.420   13.995  1.00 0.00 ? 45 GLU A HG3  4  
ATOM 2853  N N    . GLN A 1 1  ? 31.269 -6.222  -11.672 1.00 0.00 ? 1  GLN A N    5  
ATOM 2854  C CA   . GLN A 1 1  ? 32.096 -5.028  -11.757 1.00 0.00 ? 1  GLN A CA   5  
ATOM 2855  C C    . GLN A 1 1  ? 32.428 -4.503  -10.353 1.00 0.00 ? 1  GLN A C    5  
ATOM 2856  O O    . GLN A 1 1  ? 33.572 -4.223  -10.017 1.00 0.00 ? 1  GLN A O    5  
ATOM 2857  C CB   . GLN A 1 1  ? 31.409 -3.909  -12.567 1.00 0.00 ? 1  GLN A CB   5  
ATOM 2858  C CG   . GLN A 1 1  ? 32.406 -3.055  -13.377 1.00 0.00 ? 1  GLN A CG   5  
ATOM 2859  C CD   . GLN A 1 1  ? 32.444 -3.455  -14.860 1.00 0.00 ? 1  GLN A CD   5  
ATOM 2860  O OE1  . GLN A 1 1  ? 32.510 -2.617  -15.754 1.00 0.00 ? 1  GLN A OE1  5  
ATOM 2861  N NE2  . GLN A 1 1  ? 32.366 -4.780  -15.068 1.00 0.00 ? 1  GLN A NE2  5  
ATOM 2862  H H1   . GLN A 1 1  ? 31.440 -6.812  -12.526 1.00 0.00 ? 1  GLN A H1   5  
ATOM 2863  H H2   . GLN A 1 1  ? 30.268 -5.961  -11.627 1.00 0.00 ? 1  GLN A H2   5  
ATOM 2864  H H3   . GLN A 1 1  ? 31.534 -6.763  -10.827 1.00 0.00 ? 1  GLN A H3   5  
ATOM 2865  H HA   . GLN A 1 1  ? 33.031 -5.326  -12.232 1.00 0.00 ? 1  GLN A HA   5  
ATOM 2866  H HB2  . GLN A 1 1  ? 30.627 -4.330  -13.202 1.00 0.00 ? 1  GLN A HB2  5  
ATOM 2867  H HB3  . GLN A 1 1  ? 30.854 -3.252  -11.901 1.00 0.00 ? 1  GLN A HB3  5  
ATOM 2868  H HG2  . GLN A 1 1  ? 32.115 -2.007  -13.328 1.00 0.00 ? 1  GLN A HG2  5  
ATOM 2869  H HG3  . GLN A 1 1  ? 33.416 -3.114  -12.966 1.00 0.00 ? 1  GLN A HG3  5  
ATOM 2870  H HE21 . GLN A 1 1  ? 32.331 -5.409  -14.284 1.00 0.00 ? 1  GLN A HE21 5  
ATOM 2871  H HE22 . GLN A 1 1  ? 32.325 -5.152  -15.988 1.00 0.00 ? 1  GLN A HE22 5  
ATOM 2872  N N    . GLU A 1 2  ? 31.321 -4.403  -9.589  1.00 0.00 ? 2  GLU A N    5  
ATOM 2873  C CA   . GLU A 1 2  ? 31.272 -3.995  -8.194  1.00 0.00 ? 2  GLU A CA   5  
ATOM 2874  C C    . GLU A 1 2  ? 31.200 -2.471  -8.010  1.00 0.00 ? 2  GLU A C    5  
ATOM 2875  O O    . GLU A 1 2  ? 31.241 -1.992  -6.887  1.00 0.00 ? 2  GLU A O    5  
ATOM 2876  C CB   . GLU A 1 2  ? 32.401 -4.640  -7.373  1.00 0.00 ? 2  GLU A CB   5  
ATOM 2877  C CG   . GLU A 1 2  ? 32.113 -4.703  -5.870  1.00 0.00 ? 2  GLU A CG   5  
ATOM 2878  C CD   . GLU A 1 2  ? 30.749 -5.350  -5.549  1.00 0.00 ? 2  GLU A CD   5  
ATOM 2879  O OE1  . GLU A 1 2  ? 30.642 -6.578  -5.658  1.00 0.00 ? 2  GLU A OE1  5  
ATOM 2880  O OE2  . GLU A 1 2  ? 29.822 -4.636  -5.190  1.00 0.00 ? 2  GLU A OE2  5  
ATOM 2881  H H    . GLU A 1 2  ? 30.461 -4.667  -10.021 1.00 0.00 ? 2  GLU A H    5  
ATOM 2882  H HA   . GLU A 1 2  ? 30.310 -4.379  -7.863  1.00 0.00 ? 2  GLU A HA   5  
ATOM 2883  H HB2  . GLU A 1 2  ? 32.565 -5.658  -7.726  1.00 0.00 ? 2  GLU A HB2  5  
ATOM 2884  H HB3  . GLU A 1 2  ? 33.342 -4.113  -7.541  1.00 0.00 ? 2  GLU A HB3  5  
ATOM 2885  H HG2  . GLU A 1 2  ? 32.891 -5.288  -5.396  1.00 0.00 ? 2  GLU A HG2  5  
ATOM 2886  H HG3  . GLU A 1 2  ? 32.168 -3.711  -5.422  1.00 0.00 ? 2  GLU A HG3  5  
ATOM 2887  N N    . LYS A 1 3  ? 31.071 -1.754  -9.151  1.00 0.00 ? 3  LYS A N    5  
ATOM 2888  C CA   . LYS A 1 3  ? 31.028 -0.290  -9.192  1.00 0.00 ? 3  LYS A CA   5  
ATOM 2889  C C    . LYS A 1 3  ? 29.890 0.334   -8.353  1.00 0.00 ? 3  LYS A C    5  
ATOM 2890  O O    . LYS A 1 3  ? 29.940 1.508   -8.009  1.00 0.00 ? 3  LYS A O    5  
ATOM 2891  C CB   . LYS A 1 3  ? 31.004 0.193   -10.643 1.00 0.00 ? 3  LYS A CB   5  
ATOM 2892  C CG   . LYS A 1 3  ? 29.807 -0.350  -11.427 1.00 0.00 ? 3  LYS A CG   5  
ATOM 2893  C CD   . LYS A 1 3  ? 29.684 0.240   -12.839 1.00 0.00 ? 3  LYS A CD   5  
ATOM 2894  C CE   . LYS A 1 3  ? 28.271 0.767   -13.100 1.00 0.00 ? 3  LYS A CE   5  
ATOM 2895  N NZ   . LYS A 1 3  ? 27.285 -0.307  -13.101 1.00 0.00 ? 3  LYS A NZ   5  
ATOM 2896  H H    . LYS A 1 3  ? 31.092 -2.237  -10.025 1.00 0.00 ? 3  LYS A H    5  
ATOM 2897  H HA   . LYS A 1 3  ? 31.957 0.063   -8.781  1.00 0.00 ? 3  LYS A HA   5  
ATOM 2898  H HB2  . LYS A 1 3  ? 30.995 1.284   -10.659 1.00 0.00 ? 3  LYS A HB2  5  
ATOM 2899  H HB3  . LYS A 1 3  ? 31.932 -0.101  -11.134 1.00 0.00 ? 3  LYS A HB3  5  
ATOM 2900  H HG2  . LYS A 1 3  ? 29.863 -1.434  -11.499 1.00 0.00 ? 3  LYS A HG2  5  
ATOM 2901  H HG3  . LYS A 1 3  ? 28.906 -0.139  -10.857 1.00 0.00 ? 3  LYS A HG3  5  
ATOM 2902  H HD2  . LYS A 1 3  ? 30.401 1.047   -12.983 1.00 0.00 ? 3  LYS A HD2  5  
ATOM 2903  H HD3  . LYS A 1 3  ? 29.938 -0.515  -13.585 1.00 0.00 ? 3  LYS A HD3  5  
ATOM 2904  H HE2  . LYS A 1 3  ? 27.984 1.486   -12.330 1.00 0.00 ? 3  LYS A HE2  5  
ATOM 2905  H HE3  . LYS A 1 3  ? 28.231 1.272   -14.065 1.00 0.00 ? 3  LYS A HE3  5  
ATOM 2906  H HZ1  . LYS A 1 3  ? 27.576 -1.040  -13.782 1.00 0.00 ? 3  LYS A HZ1  5  
ATOM 2907  H HZ2  . LYS A 1 3  ? 26.352 0.064   -13.375 1.00 0.00 ? 3  LYS A HZ2  5  
ATOM 2908  H HZ3  . LYS A 1 3  ? 27.225 -0.728  -12.152 1.00 0.00 ? 3  LYS A HZ3  5  
ATOM 2909  N N    . GLU A 1 4  ? 28.893 -0.514  -8.037  1.00 0.00 ? 4  GLU A N    5  
ATOM 2910  C CA   . GLU A 1 4  ? 27.758 -0.122  -7.205  1.00 0.00 ? 4  GLU A CA   5  
ATOM 2911  C C    . GLU A 1 4  ? 28.189 0.152   -5.762  1.00 0.00 ? 4  GLU A C    5  
ATOM 2912  O O    . GLU A 1 4  ? 27.764 1.117   -5.139  1.00 0.00 ? 4  GLU A O    5  
ATOM 2913  C CB   . GLU A 1 4  ? 26.727 -1.264  -7.195  1.00 0.00 ? 4  GLU A CB   5  
ATOM 2914  C CG   . GLU A 1 4  ? 25.523 -0.979  -8.097  1.00 0.00 ? 4  GLU A CG   5  
ATOM 2915  C CD   . GLU A 1 4  ? 25.738 -1.349  -9.578  1.00 0.00 ? 4  GLU A CD   5  
ATOM 2916  O OE1  . GLU A 1 4  ? 26.882 -1.449  -10.021 1.00 0.00 ? 4  GLU A OE1  5  
ATOM 2917  O OE2  . GLU A 1 4  ? 24.746 -1.542  -10.277 1.00 0.00 ? 4  GLU A OE2  5  
ATOM 2918  H H    . GLU A 1 4  ? 28.962 -1.457  -8.365  1.00 0.00 ? 4  GLU A H    5  
ATOM 2919  H HA   . GLU A 1 4  ? 27.354 0.805   -7.620  1.00 0.00 ? 4  GLU A HA   5  
ATOM 2920  H HB2  . GLU A 1 4  ? 27.198 -2.216  -7.444  1.00 0.00 ? 4  GLU A HB2  5  
ATOM 2921  H HB3  . GLU A 1 4  ? 26.334 -1.427  -6.191  1.00 0.00 ? 4  GLU A HB3  5  
ATOM 2922  H HG2  . GLU A 1 4  ? 24.678 -1.551  -7.719  1.00 0.00 ? 4  GLU A HG2  5  
ATOM 2923  H HG3  . GLU A 1 4  ? 25.228 0.067   -8.021  1.00 0.00 ? 4  GLU A HG3  5  
ATOM 2924  N N    . ALA A 1 5  ? 29.050 -0.759  -5.272  1.00 0.00 ? 5  ALA A N    5  
ATOM 2925  C CA   . ALA A 1 5  ? 29.576 -0.544  -3.940  1.00 0.00 ? 5  ALA A CA   5  
ATOM 2926  C C    . ALA A 1 5  ? 30.622 0.575   -3.951  1.00 0.00 ? 5  ALA A C    5  
ATOM 2927  O O    . ALA A 1 5  ? 30.897 1.129   -2.906  1.00 0.00 ? 5  ALA A O    5  
ATOM 2928  C CB   . ALA A 1 5  ? 30.154 -1.829  -3.355  1.00 0.00 ? 5  ALA A CB   5  
ATOM 2929  H H    . ALA A 1 5  ? 29.373 -1.521  -5.831  1.00 0.00 ? 5  ALA A H    5  
ATOM 2930  H HA   . ALA A 1 5  ? 28.745 -0.234  -3.305  1.00 0.00 ? 5  ALA A HA   5  
ATOM 2931  H HB1  . ALA A 1 5  ? 31.042 -2.165  -3.890  1.00 0.00 ? 5  ALA A HB1  5  
ATOM 2932  H HB2  . ALA A 1 5  ? 29.415 -2.627  -3.371  1.00 0.00 ? 5  ALA A HB2  5  
ATOM 2933  H HB3  . ALA A 1 5  ? 30.419 -1.672  -2.309  1.00 0.00 ? 5  ALA A HB3  5  
ATOM 2934  N N    . ILE A 1 6  ? 31.188 0.905   -5.133  1.00 0.00 ? 6  ILE A N    5  
ATOM 2935  C CA   . ILE A 1 6  ? 32.285 1.881   -5.130  1.00 0.00 ? 6  ILE A CA   5  
ATOM 2936  C C    . ILE A 1 6  ? 31.776 3.287   -4.788  1.00 0.00 ? 6  ILE A C    5  
ATOM 2937  O O    . ILE A 1 6  ? 32.389 3.981   -4.004  1.00 0.00 ? 6  ILE A O    5  
ATOM 2938  C CB   . ILE A 1 6  ? 33.129 1.855   -6.412  1.00 0.00 ? 6  ILE A CB   5  
ATOM 2939  C CG1  . ILE A 1 6  ? 33.524 0.425   -6.773  1.00 0.00 ? 6  ILE A CG1  5  
ATOM 2940  C CG2  . ILE A 1 6  ? 34.410 2.697   -6.279  1.00 0.00 ? 6  ILE A CG2  5  
ATOM 2941  C CD1  . ILE A 1 6  ? 34.305 0.363   -8.093  1.00 0.00 ? 6  ILE A CD1  5  
ATOM 2942  H H    . ILE A 1 6  ? 30.860 0.507   -5.990  1.00 0.00 ? 6  ILE A H    5  
ATOM 2943  H HA   . ILE A 1 6  ? 32.947 1.598   -4.322  1.00 0.00 ? 6  ILE A HA   5  
ATOM 2944  H HB   . ILE A 1 6  ? 32.519 2.272   -7.212  1.00 0.00 ? 6  ILE A HB   5  
ATOM 2945  H HG12 . ILE A 1 6  ? 34.109 -0.013  -5.965  1.00 0.00 ? 6  ILE A HG12 5  
ATOM 2946  H HG13 . ILE A 1 6  ? 32.633 -0.186  -6.832  1.00 0.00 ? 6  ILE A HG13 5  
ATOM 2947  H HG21 . ILE A 1 6  ? 35.304 2.080   -6.194  1.00 0.00 ? 6  ILE A HG21 5  
ATOM 2948  H HG22 . ILE A 1 6  ? 34.397 3.292   -5.376  1.00 0.00 ? 6  ILE A HG22 5  
ATOM 2949  H HG23 . ILE A 1 6  ? 34.537 3.361   -7.133  1.00 0.00 ? 6  ILE A HG23 5  
ATOM 2950  H HD11 . ILE A 1 6  ? 35.296 0.802   -7.996  1.00 0.00 ? 6  ILE A HD11 5  
ATOM 2951  H HD12 . ILE A 1 6  ? 33.823 0.913   -8.900  1.00 0.00 ? 6  ILE A HD12 5  
ATOM 2952  H HD13 . ILE A 1 6  ? 34.402 -0.676  -8.405  1.00 0.00 ? 6  ILE A HD13 5  
ATOM 2953  N N    . GLU A 1 7  ? 30.620 3.651   -5.370  1.00 0.00 ? 7  GLU A N    5  
ATOM 2954  C CA   . GLU A 1 7  ? 30.024 4.944   -5.034  1.00 0.00 ? 7  GLU A CA   5  
ATOM 2955  C C    . GLU A 1 7  ? 29.487 4.989   -3.588  1.00 0.00 ? 7  GLU A C    5  
ATOM 2956  O O    . GLU A 1 7  ? 29.269 6.063   -3.046  1.00 0.00 ? 7  GLU A O    5  
ATOM 2957  C CB   . GLU A 1 7  ? 28.915 5.264   -6.047  1.00 0.00 ? 7  GLU A CB   5  
ATOM 2958  C CG   . GLU A 1 7  ? 27.782 4.224   -6.063  1.00 0.00 ? 7  GLU A CG   5  
ATOM 2959  C CD   . GLU A 1 7  ? 26.759 4.468   -7.191  1.00 0.00 ? 7  GLU A CD   5  
ATOM 2960  O OE1  . GLU A 1 7  ? 27.172 4.710   -8.323  1.00 0.00 ? 7  GLU A OE1  5  
ATOM 2961  O OE2  . GLU A 1 7  ? 25.557 4.404   -6.925  1.00 0.00 ? 7  GLU A OE2  5  
ATOM 2962  H H    . GLU A 1 7  ? 30.170 3.039   -6.016  1.00 0.00 ? 7  GLU A H    5  
ATOM 2963  H HA   . GLU A 1 7  ? 30.815 5.692   -5.110  1.00 0.00 ? 7  GLU A HA   5  
ATOM 2964  H HB2  . GLU A 1 7  ? 28.500 6.252   -5.842  1.00 0.00 ? 7  GLU A HB2  5  
ATOM 2965  H HB3  . GLU A 1 7  ? 29.372 5.316   -7.035  1.00 0.00 ? 7  GLU A HB3  5  
ATOM 2966  H HG2  . GLU A 1 7  ? 28.186 3.223   -6.194  1.00 0.00 ? 7  GLU A HG2  5  
ATOM 2967  H HG3  . GLU A 1 7  ? 27.270 4.234   -5.102  1.00 0.00 ? 7  GLU A HG3  5  
ATOM 2968  N N    . ARG A 1 8  ? 29.301 3.787   -3.003  1.00 0.00 ? 8  ARG A N    5  
ATOM 2969  C CA   . ARG A 1 8  ? 28.796 3.673   -1.638  1.00 0.00 ? 8  ARG A CA   5  
ATOM 2970  C C    . ARG A 1 8  ? 29.932 3.861   -0.631  1.00 0.00 ? 8  ARG A C    5  
ATOM 2971  O O    . ARG A 1 8  ? 29.881 4.750   0.204   1.00 0.00 ? 8  ARG A O    5  
ATOM 2972  C CB   . ARG A 1 8  ? 28.102 2.307   -1.476  1.00 0.00 ? 8  ARG A CB   5  
ATOM 2973  C CG   . ARG A 1 8  ? 26.712 2.414   -0.824  1.00 0.00 ? 8  ARG A CG   5  
ATOM 2974  C CD   . ARG A 1 8  ? 25.631 1.613   -1.560  1.00 0.00 ? 8  ARG A CD   5  
ATOM 2975  N NE   . ARG A 1 8  ? 25.162 0.496   -0.748  1.00 0.00 ? 8  ARG A NE   5  
ATOM 2976  C CZ   . ARG A 1 8  ? 24.396 -0.486  -1.269  1.00 0.00 ? 8  ARG A CZ   5  
ATOM 2977  N NH1  . ARG A 1 8  ? 24.078 -0.494  -2.561  1.00 0.00 ? 8  ARG A NH1  5  
ATOM 2978  N NH2  . ARG A 1 8  ? 23.954 -1.457  -0.475  1.00 0.00 ? 8  ARG A NH2  5  
ATOM 2979  H H    . ARG A 1 8  ? 29.504 2.948   -3.507  1.00 0.00 ? 8  ARG A H    5  
ATOM 2980  H HA   . ARG A 1 8  ? 28.093 4.496   -1.499  1.00 0.00 ? 8  ARG A HA   5  
ATOM 2981  H HB2  . ARG A 1 8  ? 28.020 1.867   -2.468  1.00 0.00 ? 8  ARG A HB2  5  
ATOM 2982  H HB3  . ARG A 1 8  ? 28.703 1.586   -0.921  1.00 0.00 ? 8  ARG A HB3  5  
ATOM 2983  H HG2  . ARG A 1 8  ? 26.772 2.125   0.224   1.00 0.00 ? 8  ARG A HG2  5  
ATOM 2984  H HG3  . ARG A 1 8  ? 26.382 3.450   -0.790  1.00 0.00 ? 8  ARG A HG3  5  
ATOM 2985  H HD2  . ARG A 1 8  ? 24.769 2.249   -1.753  1.00 0.00 ? 8  ARG A HD2  5  
ATOM 2986  H HD3  . ARG A 1 8  ? 25.973 1.234   -2.523  1.00 0.00 ? 8  ARG A HD3  5  
ATOM 2987  H HE   . ARG A 1 8  ? 25.384 0.477   0.227   1.00 0.00 ? 8  ARG A HE   5  
ATOM 2988  H HH11 . ARG A 1 8  ? 24.410 0.239   -3.160  1.00 0.00 ? 8  ARG A HH11 5  
ATOM 2989  H HH12 . ARG A 1 8  ? 23.511 -1.227  -2.936  1.00 0.00 ? 8  ARG A HH12 5  
ATOM 2990  H HH21 . ARG A 1 8  ? 24.188 -1.451  0.500   1.00 0.00 ? 8  ARG A HH21 5  
ATOM 2991  H HH22 . ARG A 1 8  ? 23.388 -2.187  -0.854  1.00 0.00 ? 8  ARG A HH22 5  
ATOM 2992  N N    . LEU A 1 9  ? 30.945 2.984   -0.804  1.00 0.00 ? 9  LEU A N    5  
ATOM 2993  C CA   . LEU A 1 9  ? 32.230 2.959   -0.114  1.00 0.00 ? 9  LEU A CA   5  
ATOM 2994  C C    . LEU A 1 9  ? 32.840 4.392   -0.116  1.00 0.00 ? 9  LEU A C    5  
ATOM 2995  O O    . LEU A 1 9  ? 33.194 4.927   0.920   1.00 0.00 ? 9  LEU A O    5  
ATOM 2996  C CB   . LEU A 1 9  ? 33.126 1.904   -0.789  1.00 0.00 ? 9  LEU A CB   5  
ATOM 2997  C CG   . LEU A 1 9  ? 32.583 0.454   -0.744  1.00 0.00 ? 9  LEU A CG   5  
ATOM 2998  C CD1  . LEU A 1 9  ? 33.135 -0.364  -1.918  1.00 0.00 ? 9  LEU A CD1  5  
ATOM 2999  C CD2  . LEU A 1 9  ? 32.865 -0.271  0.567   1.00 0.00 ? 9  LEU A CD2  5  
ATOM 3000  H H    . LEU A 1 9  ? 30.801 2.282   -1.488  1.00 0.00 ? 9  LEU A H    5  
ATOM 3001  H HA   . LEU A 1 9  ? 32.052 2.610   0.899   1.00 0.00 ? 9  LEU A HA   5  
ATOM 3002  H HB2  . LEU A 1 9  ? 33.239 2.215   -1.824  1.00 0.00 ? 9  LEU A HB2  5  
ATOM 3003  H HB3  . LEU A 1 9  ? 34.122 1.896   -0.354  1.00 0.00 ? 9  LEU A HB3  5  
ATOM 3004  H HG   . LEU A 1 9  ? 31.500 0.466   -0.803  1.00 0.00 ? 9  LEU A HG   5  
ATOM 3005  H HD11 . LEU A 1 9  ? 33.161 0.199   -2.840  1.00 0.00 ? 9  LEU A HD11 5  
ATOM 3006  H HD12 . LEU A 1 9  ? 32.505 -1.220  -2.119  1.00 0.00 ? 9  LEU A HD12 5  
ATOM 3007  H HD13 . LEU A 1 9  ? 34.161 -0.685  -1.742  1.00 0.00 ? 9  LEU A HD13 5  
ATOM 3008  H HD21 . LEU A 1 9  ? 33.884 -0.650  0.580   1.00 0.00 ? 9  LEU A HD21 5  
ATOM 3009  H HD22 . LEU A 1 9  ? 32.196 -1.120  0.683   1.00 0.00 ? 9  LEU A HD22 5  
ATOM 3010  H HD23 . LEU A 1 9  ? 32.713 0.380   1.424   1.00 0.00 ? 9  LEU A HD23 5  
ATOM 3011  N N    . LYS A 1 10 ? 32.878 4.998   -1.319  1.00 0.00 ? 10 LYS A N    5  
ATOM 3012  C CA   . LYS A 1 10 ? 33.377 6.374   -1.484  1.00 0.00 ? 10 LYS A CA   5  
ATOM 3013  C C    . LYS A 1 10 ? 32.491 7.411   -0.763  1.00 0.00 ? 10 LYS A C    5  
ATOM 3014  O O    . LYS A 1 10 ? 32.984 8.396   -0.230  1.00 0.00 ? 10 LYS A O    5  
ATOM 3015  C CB   . LYS A 1 10 ? 33.403 6.739   -2.973  1.00 0.00 ? 10 LYS A CB   5  
ATOM 3016  C CG   . LYS A 1 10 ? 34.435 5.953   -3.772  1.00 0.00 ? 10 LYS A CG   5  
ATOM 3017  C CD   . LYS A 1 10 ? 34.191 6.048   -5.282  1.00 0.00 ? 10 LYS A CD   5  
ATOM 3018  C CE   . LYS A 1 10 ? 34.664 7.374   -5.886  1.00 0.00 ? 10 LYS A CE   5  
ATOM 3019  N NZ   . LYS A 1 10 ? 33.782 8.482   -5.563  1.00 0.00 ? 10 LYS A NZ   5  
ATOM 3020  H H    . LYS A 1 10 ? 32.498 4.496   -2.093  1.00 0.00 ? 10 LYS A H    5  
ATOM 3021  H HA   . LYS A 1 10 ? 34.384 6.425   -1.064  1.00 0.00 ? 10 LYS A HA   5  
ATOM 3022  H HB2  . LYS A 1 10 ? 32.413 6.591   -3.402  1.00 0.00 ? 10 LYS A HB2  5  
ATOM 3023  H HB3  . LYS A 1 10 ? 33.626 7.798   -3.095  1.00 0.00 ? 10 LYS A HB3  5  
ATOM 3024  H HG2  . LYS A 1 10 ? 35.427 6.305   -3.502  1.00 0.00 ? 10 LYS A HG2  5  
ATOM 3025  H HG3  . LYS A 1 10 ? 34.419 4.909   -3.474  1.00 0.00 ? 10 LYS A HG3  5  
ATOM 3026  H HD2  . LYS A 1 10 ? 34.749 5.246   -5.745  1.00 0.00 ? 10 LYS A HD2  5  
ATOM 3027  H HD3  . LYS A 1 10 ? 33.141 5.874   -5.544  1.00 0.00 ? 10 LYS A HD3  5  
ATOM 3028  H HE2  . LYS A 1 10 ? 35.676 7.631   -5.565  1.00 0.00 ? 10 LYS A HE2  5  
ATOM 3029  H HE3  . LYS A 1 10 ? 34.682 7.280   -6.970  1.00 0.00 ? 10 LYS A HE3  5  
ATOM 3030  H HZ1  . LYS A 1 10 ? 33.994 8.810   -4.598  1.00 0.00 ? 10 LYS A HZ1  5  
ATOM 3031  H HZ2  . LYS A 1 10 ? 32.794 8.161   -5.608  1.00 0.00 ? 10 LYS A HZ2  5  
ATOM 3032  H HZ3  . LYS A 1 10 ? 33.918 9.266   -6.236  1.00 0.00 ? 10 LYS A HZ3  5  
ATOM 3033  N N    . ALA A 1 11 ? 31.169 7.138   -0.793  1.00 0.00 ? 11 ALA A N    5  
ATOM 3034  C CA   . ALA A 1 11 ? 30.192 8.055   -0.201  1.00 0.00 ? 11 ALA A CA   5  
ATOM 3035  C C    . ALA A 1 11 ? 30.314 8.145   1.333   1.00 0.00 ? 11 ALA A C    5  
ATOM 3036  O O    . ALA A 1 11 ? 29.856 9.113   1.927   1.00 0.00 ? 11 ALA A O    5  
ATOM 3037  C CB   . ALA A 1 11 ? 28.762 7.653   -0.580  1.00 0.00 ? 11 ALA A CB   5  
ATOM 3038  H H    . ALA A 1 11 ? 30.862 6.305   -1.249  1.00 0.00 ? 11 ALA A H    5  
ATOM 3039  H HA   . ALA A 1 11 ? 30.396 9.042   -0.618  1.00 0.00 ? 11 ALA A HA   5  
ATOM 3040  H HB1  . ALA A 1 11 ? 28.563 7.893   -1.623  1.00 0.00 ? 11 ALA A HB1  5  
ATOM 3041  H HB2  . ALA A 1 11 ? 28.024 8.190   0.017   1.00 0.00 ? 11 ALA A HB2  5  
ATOM 3042  H HB3  . ALA A 1 11 ? 28.575 6.591   -0.440  1.00 0.00 ? 11 ALA A HB3  5  
ATOM 3043  N N    . LEU A 1 12 ? 30.962 7.122   1.935   1.00 0.00 ? 12 LEU A N    5  
ATOM 3044  C CA   . LEU A 1 12 ? 31.218 7.143   3.372   1.00 0.00 ? 12 LEU A CA   5  
ATOM 3045  C C    . LEU A 1 12 ? 32.394 8.103   3.734   1.00 0.00 ? 12 LEU A C    5  
ATOM 3046  O O    . LEU A 1 12 ? 32.769 8.194   4.896   1.00 0.00 ? 12 LEU A O    5  
ATOM 3047  C CB   . LEU A 1 12 ? 31.541 5.716   3.852   1.00 0.00 ? 12 LEU A CB   5  
ATOM 3048  C CG   . LEU A 1 12 ? 30.393 4.676   3.896   1.00 0.00 ? 12 LEU A CG   5  
ATOM 3049  C CD1  . LEU A 1 12 ? 30.524 3.654   2.764   1.00 0.00 ? 12 LEU A CD1  5  
ATOM 3050  C CD2  . LEU A 1 12 ? 30.413 3.893   5.212   1.00 0.00 ? 12 LEU A CD2  5  
ATOM 3051  H H    . LEU A 1 12 ? 31.309 6.350   1.403   1.00 0.00 ? 12 LEU A H    5  
ATOM 3052  H HA   . LEU A 1 12 ? 30.319 7.512   3.868   1.00 0.00 ? 12 LEU A HA   5  
ATOM 3053  H HB2  . LEU A 1 12 ? 32.322 5.344   3.201   1.00 0.00 ? 12 LEU A HB2  5  
ATOM 3054  H HB3  . LEU A 1 12 ? 31.975 5.778   4.845   1.00 0.00 ? 12 LEU A HB3  5  
ATOM 3055  H HG   . LEU A 1 12 ? 29.436 5.193   3.809   1.00 0.00 ? 12 LEU A HG   5  
ATOM 3056  H HD11 . LEU A 1 12 ? 31.081 4.116   1.964   1.00 0.00 ? 12 LEU A HD11 5  
ATOM 3057  H HD12 . LEU A 1 12 ? 29.553 3.327   2.389   1.00 0.00 ? 12 LEU A HD12 5  
ATOM 3058  H HD13 . LEU A 1 12 ? 31.097 2.769   3.052   1.00 0.00 ? 12 LEU A HD13 5  
ATOM 3059  H HD21 . LEU A 1 12 ? 31.281 3.238   5.238   1.00 0.00 ? 12 LEU A HD21 5  
ATOM 3060  H HD22 . LEU A 1 12 ? 29.541 3.248   5.302   1.00 0.00 ? 12 LEU A HD22 5  
ATOM 3061  H HD23 . LEU A 1 12 ? 30.468 4.555   6.076   1.00 0.00 ? 12 LEU A HD23 5  
ATOM 3062  N N    . GLY A 1 13 ? 32.938 8.809   2.710   1.00 0.00 ? 13 GLY A N    5  
ATOM 3063  C CA   . GLY A 1 13 ? 33.983 9.819   2.906   1.00 0.00 ? 13 GLY A CA   5  
ATOM 3064  C C    . GLY A 1 13 ? 35.377 9.309   2.514   1.00 0.00 ? 13 GLY A C    5  
ATOM 3065  O O    . GLY A 1 13 ? 36.385 9.803   3.008   1.00 0.00 ? 13 GLY A O    5  
ATOM 3066  H H    . GLY A 1 13 ? 32.596 8.673   1.783   1.00 0.00 ? 13 GLY A H    5  
ATOM 3067  H HA2  . GLY A 1 13 ? 33.730 10.673  2.278   1.00 0.00 ? 13 GLY A HA2  5  
ATOM 3068  H HA3  . GLY A 1 13 ? 33.989 10.139  3.948   1.00 0.00 ? 13 GLY A HA3  5  
ATOM 3069  N N    . PHE A 1 14 ? 35.368 8.286   1.627   1.00 0.00 ? 14 PHE A N    5  
ATOM 3070  C CA   . PHE A 1 14 ? 36.587 7.571   1.248   1.00 0.00 ? 14 PHE A CA   5  
ATOM 3071  C C    . PHE A 1 14 ? 36.953 7.972   -0.197  1.00 0.00 ? 14 PHE A C    5  
ATOM 3072  O O    . PHE A 1 14 ? 36.730 9.107   -0.602  1.00 0.00 ? 14 PHE A O    5  
ATOM 3073  C CB   . PHE A 1 14 ? 36.353 6.052   1.444   1.00 0.00 ? 14 PHE A CB   5  
ATOM 3074  C CG   . PHE A 1 14 ? 35.820 5.701   2.816   1.00 0.00 ? 14 PHE A CG   5  
ATOM 3075  C CD1  . PHE A 1 14 ? 36.061 6.506   3.933   1.00 0.00 ? 14 PHE A CD1  5  
ATOM 3076  C CD2  . PHE A 1 14 ? 35.013 4.579   2.970   1.00 0.00 ? 14 PHE A CD2  5  
ATOM 3077  C CE1  . PHE A 1 14 ? 35.405 6.267   5.128   1.00 0.00 ? 14 PHE A CE1  5  
ATOM 3078  C CE2  . PHE A 1 14 ? 34.358 4.336   4.168   1.00 0.00 ? 14 PHE A CE2  5  
ATOM 3079  C CZ   . PHE A 1 14 ? 34.527 5.206   5.236   1.00 0.00 ? 14 PHE A CZ   5  
ATOM 3080  H H    . PHE A 1 14 ? 34.498 7.977   1.247   1.00 0.00 ? 14 PHE A H    5  
ATOM 3081  H HA   . PHE A 1 14 ? 37.393 7.920   1.896   1.00 0.00 ? 14 PHE A HA   5  
ATOM 3082  H HB2  . PHE A 1 14 ? 35.628 5.720   0.696   1.00 0.00 ? 14 PHE A HB2  5  
ATOM 3083  H HB3  . PHE A 1 14 ? 37.258 5.477   1.275   1.00 0.00 ? 14 PHE A HB3  5  
ATOM 3084  H HD1  . PHE A 1 14 ? 36.747 7.343   3.899   1.00 0.00 ? 14 PHE A HD1  5  
ATOM 3085  H HD2  . PHE A 1 14 ? 34.886 3.884   2.149   1.00 0.00 ? 14 PHE A HD2  5  
ATOM 3086  H HE1  . PHE A 1 14 ? 35.564 6.910   5.977   1.00 0.00 ? 14 PHE A HE1  5  
ATOM 3087  H HE2  . PHE A 1 14 ? 33.692 3.488   4.245   1.00 0.00 ? 14 PHE A HE2  5  
ATOM 3088  H HZ   . PHE A 1 14 ? 33.971 5.088   6.157   1.00 0.00 ? 14 PHE A HZ   5  
ATOM 3089  N N    . GLU A 1 15 ? 37.526 6.997   -0.939  1.00 0.00 ? 15 GLU A N    5  
ATOM 3090  C CA   . GLU A 1 15 ? 38.019 7.231   -2.294  1.00 0.00 ? 15 GLU A CA   5  
ATOM 3091  C C    . GLU A 1 15 ? 38.131 5.877   -2.996  1.00 0.00 ? 15 GLU A C    5  
ATOM 3092  O O    . GLU A 1 15 ? 38.537 4.897   -2.387  1.00 0.00 ? 15 GLU A O    5  
ATOM 3093  C CB   . GLU A 1 15 ? 39.406 7.906   -2.262  1.00 0.00 ? 15 GLU A CB   5  
ATOM 3094  C CG   . GLU A 1 15 ? 39.709 8.720   -3.540  1.00 0.00 ? 15 GLU A CG   5  
ATOM 3095  C CD   . GLU A 1 15 ? 39.501 10.248  -3.418  1.00 0.00 ? 15 GLU A CD   5  
ATOM 3096  O OE1  . GLU A 1 15 ? 39.233 10.741  -2.325  1.00 0.00 ? 15 GLU A OE1  5  
ATOM 3097  O OE2  . GLU A 1 15 ? 39.621 10.936  -4.435  1.00 0.00 ? 15 GLU A OE2  5  
ATOM 3098  H H    . GLU A 1 15 ? 37.633 6.087   -0.540  1.00 0.00 ? 15 GLU A H    5  
ATOM 3099  H HA   . GLU A 1 15 ? 37.285 7.855   -2.807  1.00 0.00 ? 15 GLU A HA   5  
ATOM 3100  H HB2  . GLU A 1 15 ? 39.487 8.516   -1.366  1.00 0.00 ? 15 GLU A HB2  5  
ATOM 3101  H HB3  . GLU A 1 15 ? 40.204 7.170   -2.148  1.00 0.00 ? 15 GLU A HB3  5  
ATOM 3102  H HG2  . GLU A 1 15 ? 40.740 8.550   -3.838  1.00 0.00 ? 15 GLU A HG2  5  
ATOM 3103  H HG3  . GLU A 1 15 ? 39.123 8.351   -4.378  1.00 0.00 ? 15 GLU A HG3  5  
ATOM 3104  N N    . GLU A 1 16 ? 37.765 5.890   -4.294  1.00 0.00 ? 16 GLU A N    5  
ATOM 3105  C CA   . GLU A 1 16 ? 37.704 4.719   -5.167  1.00 0.00 ? 16 GLU A CA   5  
ATOM 3106  C C    . GLU A 1 16 ? 38.920 3.758   -5.053  1.00 0.00 ? 16 GLU A C    5  
ATOM 3107  O O    . GLU A 1 16 ? 38.795 2.569   -5.307  1.00 0.00 ? 16 GLU A O    5  
ATOM 3108  C CB   . GLU A 1 16 ? 37.522 5.215   -6.609  1.00 0.00 ? 16 GLU A CB   5  
ATOM 3109  C CG   . GLU A 1 16 ? 37.617 4.121   -7.697  1.00 0.00 ? 16 GLU A CG   5  
ATOM 3110  C CD   . GLU A 1 16 ? 39.033 4.085   -8.322  1.00 0.00 ? 16 GLU A CD   5  
ATOM 3111  O OE1  . GLU A 1 16 ? 39.323 4.924   -9.171  1.00 0.00 ? 16 GLU A OE1  5  
ATOM 3112  O OE2  . GLU A 1 16 ? 39.833 3.221   -7.954  1.00 0.00 ? 16 GLU A OE2  5  
ATOM 3113  H H    . GLU A 1 16 ? 37.450 6.766   -4.657  1.00 0.00 ? 16 GLU A H    5  
ATOM 3114  H HA   . GLU A 1 16 ? 36.797 4.199   -4.865  1.00 0.00 ? 16 GLU A HA   5  
ATOM 3115  H HB2  . GLU A 1 16 ? 36.542 5.676   -6.695  1.00 0.00 ? 16 GLU A HB2  5  
ATOM 3116  H HB3  . GLU A 1 16 ? 38.218 6.036   -6.785  1.00 0.00 ? 16 GLU A HB3  5  
ATOM 3117  H HG2  . GLU A 1 16 ? 37.323 3.137   -7.325  1.00 0.00 ? 16 GLU A HG2  5  
ATOM 3118  H HG3  . GLU A 1 16 ? 36.895 4.333   -8.485  1.00 0.00 ? 16 GLU A HG3  5  
ATOM 3119  N N    . SER A 1 17 ? 40.084 4.313   -4.673  1.00 0.00 ? 17 SER A N    5  
ATOM 3120  C CA   . SER A 1 17 ? 41.286 3.500   -4.567  1.00 0.00 ? 17 SER A CA   5  
ATOM 3121  C C    . SER A 1 17 ? 41.304 2.703   -3.257  1.00 0.00 ? 17 SER A C    5  
ATOM 3122  O O    . SER A 1 17 ? 41.516 1.500   -3.281  1.00 0.00 ? 17 SER A O    5  
ATOM 3123  C CB   . SER A 1 17 ? 42.504 4.427   -4.644  1.00 0.00 ? 17 SER A CB   5  
ATOM 3124  O OG   . SER A 1 17 ? 43.094 4.429   -5.929  1.00 0.00 ? 17 SER A OG   5  
ATOM 3125  H H    . SER A 1 17 ? 40.136 5.284   -4.437  1.00 0.00 ? 17 SER A H    5  
ATOM 3126  H HA   . SER A 1 17 ? 41.276 2.770   -5.385  1.00 0.00 ? 17 SER A HA   5  
ATOM 3127  H HB2  . SER A 1 17 ? 42.252 5.446   -4.334  1.00 0.00 ? 17 SER A HB2  5  
ATOM 3128  H HB3  . SER A 1 17 ? 43.279 4.115   -3.948  1.00 0.00 ? 17 SER A HB3  5  
ATOM 3129  H HG   . SER A 1 17 ? 42.452 4.708   -6.572  1.00 0.00 ? 17 SER A HG   5  
ATOM 3130  N N    . LEU A 1 18 ? 41.073 3.419   -2.130  1.00 0.00 ? 18 LEU A N    5  
ATOM 3131  C CA   . LEU A 1 18 ? 41.032 2.729   -0.834  1.00 0.00 ? 18 LEU A CA   5  
ATOM 3132  C C    . LEU A 1 18 ? 39.811 1.815   -0.736  1.00 0.00 ? 18 LEU A C    5  
ATOM 3133  O O    . LEU A 1 18 ? 39.795 0.887   0.067   1.00 0.00 ? 18 LEU A O    5  
ATOM 3134  C CB   . LEU A 1 18 ? 41.151 3.700   0.359   1.00 0.00 ? 18 LEU A CB   5  
ATOM 3135  C CG   . LEU A 1 18 ? 39.888 4.432   0.877   1.00 0.00 ? 18 LEU A CG   5  
ATOM 3136  C CD1  . LEU A 1 18 ? 39.603 4.144   2.360   1.00 0.00 ? 18 LEU A CD1  5  
ATOM 3137  C CD2  . LEU A 1 18 ? 40.028 5.946   0.722   1.00 0.00 ? 18 LEU A CD2  5  
ATOM 3138  H H    . LEU A 1 18 ? 40.889 4.398   -2.202  1.00 0.00 ? 18 LEU A H    5  
ATOM 3139  H HA   . LEU A 1 18 ? 41.908 2.082   -0.805  1.00 0.00 ? 18 LEU A HA   5  
ATOM 3140  H HB2  . LEU A 1 18 ? 41.562 3.125   1.178   1.00 0.00 ? 18 LEU A HB2  5  
ATOM 3141  H HB3  . LEU A 1 18 ? 41.937 4.419   0.141   1.00 0.00 ? 18 LEU A HB3  5  
ATOM 3142  H HG   . LEU A 1 18 ? 39.028 4.106   0.296   1.00 0.00 ? 18 LEU A HG   5  
ATOM 3143  H HD11 . LEU A 1 18 ? 39.398 3.088   2.532   1.00 0.00 ? 18 LEU A HD11 5  
ATOM 3144  H HD12 . LEU A 1 18 ? 38.741 4.720   2.694   1.00 0.00 ? 18 LEU A HD12 5  
ATOM 3145  H HD13 . LEU A 1 18 ? 40.430 4.437   3.005   1.00 0.00 ? 18 LEU A HD13 5  
ATOM 3146  H HD21 . LEU A 1 18 ? 40.932 6.316   1.204   1.00 0.00 ? 18 LEU A HD21 5  
ATOM 3147  H HD22 . LEU A 1 18 ? 39.189 6.479   1.169   1.00 0.00 ? 18 LEU A HD22 5  
ATOM 3148  H HD23 . LEU A 1 18 ? 40.087 6.205   -0.326  1.00 0.00 ? 18 LEU A HD23 5  
ATOM 3149  N N    . VAL A 1 19 ? 38.833 2.131   -1.594  1.00 0.00 ? 19 VAL A N    5  
ATOM 3150  C CA   . VAL A 1 19 ? 37.532 1.491   -1.711  1.00 0.00 ? 19 VAL A CA   5  
ATOM 3151  C C    . VAL A 1 19 ? 37.659 0.146   -2.436  1.00 0.00 ? 19 VAL A C    5  
ATOM 3152  O O    . VAL A 1 19 ? 37.253 -0.886  -1.929  1.00 0.00 ? 19 VAL A O    5  
ATOM 3153  C CB   . VAL A 1 19 ? 36.650 2.493   -2.468  1.00 0.00 ? 19 VAL A CB   5  
ATOM 3154  C CG1  . VAL A 1 19 ? 35.484 1.837   -3.193  1.00 0.00 ? 19 VAL A CG1  5  
ATOM 3155  C CG2  . VAL A 1 19 ? 36.177 3.639   -1.552  1.00 0.00 ? 19 VAL A CG2  5  
ATOM 3156  H H    . VAL A 1 19 ? 39.009 2.872   -2.250  1.00 0.00 ? 19 VAL A H    5  
ATOM 3157  H HA   . VAL A 1 19 ? 37.132 1.290   -0.722  1.00 0.00 ? 19 VAL A HA   5  
ATOM 3158  H HB   . VAL A 1 19 ? 37.288 2.918   -3.237  1.00 0.00 ? 19 VAL A HB   5  
ATOM 3159  H HG11 . VAL A 1 19 ? 35.803 1.335   -4.105  1.00 0.00 ? 19 VAL A HG11 5  
ATOM 3160  H HG12 . VAL A 1 19 ? 34.718 2.558   -3.451  1.00 0.00 ? 19 VAL A HG12 5  
ATOM 3161  H HG13 . VAL A 1 19 ? 35.039 1.098   -2.545  1.00 0.00 ? 19 VAL A HG13 5  
ATOM 3162  H HG21 . VAL A 1 19 ? 36.927 3.883   -0.805  1.00 0.00 ? 19 VAL A HG21 5  
ATOM 3163  H HG22 . VAL A 1 19 ? 35.251 3.440   -1.023  1.00 0.00 ? 19 VAL A HG22 5  
ATOM 3164  H HG23 . VAL A 1 19 ? 36.008 4.541   -2.125  1.00 0.00 ? 19 VAL A HG23 5  
ATOM 3165  N N    . ILE A 1 20 ? 38.239 0.245   -3.648  1.00 0.00 ? 20 ILE A N    5  
ATOM 3166  C CA   . ILE A 1 20 ? 38.437 -0.916  -4.510  1.00 0.00 ? 20 ILE A CA   5  
ATOM 3167  C C    . ILE A 1 20 ? 39.356 -1.930  -3.843  1.00 0.00 ? 20 ILE A C    5  
ATOM 3168  O O    . ILE A 1 20 ? 39.093 -3.119  -3.886  1.00 0.00 ? 20 ILE A O    5  
ATOM 3169  C CB   . ILE A 1 20 ? 39.006 -0.467  -5.872  1.00 0.00 ? 20 ILE A CB   5  
ATOM 3170  C CG1  . ILE A 1 20 ? 37.886 0.067   -6.770  1.00 0.00 ? 20 ILE A CG1  5  
ATOM 3171  C CG2  . ILE A 1 20 ? 39.810 -1.540  -6.631  1.00 0.00 ? 20 ILE A CG2  5  
ATOM 3172  C CD1  . ILE A 1 20 ? 36.894 -1.027  -7.187  1.00 0.00 ? 20 ILE A CD1  5  
ATOM 3173  H H    . ILE A 1 20 ? 38.570 1.136   -3.944  1.00 0.00 ? 20 ILE A H    5  
ATOM 3174  H HA   . ILE A 1 20 ? 37.465 -1.392  -4.625  1.00 0.00 ? 20 ILE A HA   5  
ATOM 3175  H HB   . ILE A 1 20 ? 39.710 0.341   -5.682  1.00 0.00 ? 20 ILE A HB   5  
ATOM 3176  H HG12 . ILE A 1 20 ? 37.354 0.879   -6.275  1.00 0.00 ? 20 ILE A HG12 5  
ATOM 3177  H HG13 . ILE A 1 20 ? 38.330 0.513   -7.659  1.00 0.00 ? 20 ILE A HG13 5  
ATOM 3178  H HG21 . ILE A 1 20 ? 40.034 -1.215  -7.645  1.00 0.00 ? 20 ILE A HG21 5  
ATOM 3179  H HG22 . ILE A 1 20 ? 39.261 -2.472  -6.711  1.00 0.00 ? 20 ILE A HG22 5  
ATOM 3180  H HG23 . ILE A 1 20 ? 40.758 -1.757  -6.140  1.00 0.00 ? 20 ILE A HG23 5  
ATOM 3181  H HD11 . ILE A 1 20 ? 37.286 -2.038  -7.115  1.00 0.00 ? 20 ILE A HD11 5  
ATOM 3182  H HD12 . ILE A 1 20 ? 36.614 -0.891  -8.230  1.00 0.00 ? 20 ILE A HD12 5  
ATOM 3183  H HD13 . ILE A 1 20 ? 36.012 -0.996  -6.549  1.00 0.00 ? 20 ILE A HD13 5  
ATOM 3184  N N    . GLN A 1 21 ? 40.428 -1.382  -3.243  1.00 0.00 ? 21 GLN A N    5  
ATOM 3185  C CA   . GLN A 1 21 ? 41.416 -2.213  -2.571  1.00 0.00 ? 21 GLN A CA   5  
ATOM 3186  C C    . GLN A 1 21 ? 40.884 -2.737  -1.222  1.00 0.00 ? 21 GLN A C    5  
ATOM 3187  O O    . GLN A 1 21 ? 41.308 -3.785  -0.763  1.00 0.00 ? 21 GLN A O    5  
ATOM 3188  C CB   . GLN A 1 21 ? 42.719 -1.415  -2.398  1.00 0.00 ? 21 GLN A CB   5  
ATOM 3189  C CG   . GLN A 1 21 ? 43.962 -2.308  -2.217  1.00 0.00 ? 21 GLN A CG   5  
ATOM 3190  C CD   . GLN A 1 21 ? 44.392 -2.464  -0.756  1.00 0.00 ? 21 GLN A CD   5  
ATOM 3191  O OE1  . GLN A 1 21 ? 44.346 -1.531  0.039   1.00 0.00 ? 21 GLN A OE1  5  
ATOM 3192  N NE2  . GLN A 1 21 ? 44.857 -3.691  -0.461  1.00 0.00 ? 21 GLN A NE2  5  
ATOM 3193  H H    . GLN A 1 21 ? 40.539 -0.390  -3.284  1.00 0.00 ? 21 GLN A H    5  
ATOM 3194  H HA   . GLN A 1 21 ? 41.597 -3.063  -3.235  1.00 0.00 ? 21 GLN A HA   5  
ATOM 3195  H HB2  . GLN A 1 21 ? 42.883 -0.848  -3.312  1.00 0.00 ? 21 GLN A HB2  5  
ATOM 3196  H HB3  . GLN A 1 21 ? 42.633 -0.658  -1.615  1.00 0.00 ? 21 GLN A HB3  5  
ATOM 3197  H HG2  . GLN A 1 21 ? 43.798 -3.291  -2.659  1.00 0.00 ? 21 GLN A HG2  5  
ATOM 3198  H HG3  . GLN A 1 21 ? 44.807 -1.887  -2.759  1.00 0.00 ? 21 GLN A HG3  5  
ATOM 3199  H HE21 . GLN A 1 21 ? 44.851 -4.415  -1.162  1.00 0.00 ? 21 GLN A HE21 5  
ATOM 3200  H HE22 . GLN A 1 21 ? 45.221 -3.892  0.439   1.00 0.00 ? 21 GLN A HE22 5  
ATOM 3201  N N    . ALA A 1 22 ? 39.929 -1.969  -0.640  1.00 0.00 ? 22 ALA A N    5  
ATOM 3202  C CA   . ALA A 1 22 ? 39.241 -2.389  0.584   1.00 0.00 ? 22 ALA A CA   5  
ATOM 3203  C C    . ALA A 1 22 ? 38.146 -3.416  0.310   1.00 0.00 ? 22 ALA A C    5  
ATOM 3204  O O    . ALA A 1 22 ? 37.696 -4.073  1.235   1.00 0.00 ? 22 ALA A O    5  
ATOM 3205  C CB   . ALA A 1 22 ? 38.502 -1.227  1.256   1.00 0.00 ? 22 ALA A CB   5  
ATOM 3206  H H    . ALA A 1 22 ? 39.634 -1.134  -1.102  1.00 0.00 ? 22 ALA A H    5  
ATOM 3207  H HA   . ALA A 1 22 ? 39.981 -2.844  1.247   1.00 0.00 ? 22 ALA A HA   5  
ATOM 3208  H HB1  . ALA A 1 22 ? 39.192 -0.513  1.689   1.00 0.00 ? 22 ALA A HB1  5  
ATOM 3209  H HB2  . ALA A 1 22 ? 37.874 -1.578  2.076   1.00 0.00 ? 22 ALA A HB2  5  
ATOM 3210  H HB3  . ALA A 1 22 ? 37.858 -0.690  0.557   1.00 0.00 ? 22 ALA A HB3  5  
ATOM 3211  N N    . TYR A 1 23 ? 37.723 -3.492  -0.967  1.00 0.00 ? 23 TYR A N    5  
ATOM 3212  C CA   . TYR A 1 23 ? 36.675 -4.434  -1.347  1.00 0.00 ? 23 TYR A CA   5  
ATOM 3213  C C    . TYR A 1 23 ? 37.332 -5.734  -1.834  1.00 0.00 ? 23 TYR A C    5  
ATOM 3214  O O    . TYR A 1 23 ? 36.866 -6.817  -1.522  1.00 0.00 ? 23 TYR A O    5  
ATOM 3215  C CB   . TYR A 1 23 ? 35.763 -3.797  -2.415  1.00 0.00 ? 23 TYR A CB   5  
ATOM 3216  C CG   . TYR A 1 23 ? 34.297 -4.070  -2.173  1.00 0.00 ? 23 TYR A CG   5  
ATOM 3217  C CD1  . TYR A 1 23 ? 33.607 -3.321  -1.229  1.00 0.00 ? 23 TYR A CD1  5  
ATOM 3218  C CD2  . TYR A 1 23 ? 33.604 -5.035  -2.876  1.00 0.00 ? 23 TYR A CD2  5  
ATOM 3219  C CE1  . TYR A 1 23 ? 32.247 -3.501  -1.019  1.00 0.00 ? 23 TYR A CE1  5  
ATOM 3220  C CE2  . TYR A 1 23 ? 32.242 -5.226  -2.678  1.00 0.00 ? 23 TYR A CE2  5  
ATOM 3221  C CZ   . TYR A 1 23 ? 31.551 -4.438  -1.767  1.00 0.00 ? 23 TYR A CZ   5  
ATOM 3222  O OH   . TYR A 1 23 ? 30.187 -4.564  -1.573  1.00 0.00 ? 23 TYR A OH   5  
ATOM 3223  H H    . TYR A 1 23 ? 38.128 -2.903  -1.666  1.00 0.00 ? 23 TYR A H    5  
ATOM 3224  H HA   . TYR A 1 23 ? 36.091 -4.661  -0.452  1.00 0.00 ? 23 TYR A HA   5  
ATOM 3225  H HB2  . TYR A 1 23 ? 35.866 -2.718  -2.352  1.00 0.00 ? 23 TYR A HB2  5  
ATOM 3226  H HB3  . TYR A 1 23 ? 36.047 -4.057  -3.439  1.00 0.00 ? 23 TYR A HB3  5  
ATOM 3227  H HD1  . TYR A 1 23 ? 34.148 -2.572  -0.672  1.00 0.00 ? 23 TYR A HD1  5  
ATOM 3228  H HD2  . TYR A 1 23 ? 34.120 -5.647  -3.596  1.00 0.00 ? 23 TYR A HD2  5  
ATOM 3229  H HE1  . TYR A 1 23 ? 31.713 -2.912  -0.288  1.00 0.00 ? 23 TYR A HE1  5  
ATOM 3230  H HE2  . TYR A 1 23 ? 31.754 -6.011  -3.238  1.00 0.00 ? 23 TYR A HE2  5  
ATOM 3231  H HH   . TYR A 1 23 ? 29.778 -5.027  -2.295  1.00 0.00 ? 23 TYR A HH   5  
ATOM 3232  N N    . PHE A 1 24 ? 38.436 -5.552  -2.598  1.00 0.00 ? 24 PHE A N    5  
ATOM 3233  C CA   . PHE A 1 24 ? 39.150 -6.655  -3.246  1.00 0.00 ? 24 PHE A CA   5  
ATOM 3234  C C    . PHE A 1 24 ? 39.977 -7.433  -2.212  1.00 0.00 ? 24 PHE A C    5  
ATOM 3235  O O    . PHE A 1 24 ? 40.040 -8.655  -2.255  1.00 0.00 ? 24 PHE A O    5  
ATOM 3236  C CB   . PHE A 1 24 ? 40.107 -6.146  -4.359  1.00 0.00 ? 24 PHE A CB   5  
ATOM 3237  C CG   . PHE A 1 24 ? 39.650 -6.454  -5.765  1.00 0.00 ? 24 PHE A CG   5  
ATOM 3238  C CD1  . PHE A 1 24 ? 39.345 -7.756  -6.146  1.00 0.00 ? 24 PHE A CD1  5  
ATOM 3239  C CD2  . PHE A 1 24 ? 39.526 -5.440  -6.707  1.00 0.00 ? 24 PHE A CD2  5  
ATOM 3240  C CE1  . PHE A 1 24 ? 38.901 -8.032  -7.433  1.00 0.00 ? 24 PHE A CE1  5  
ATOM 3241  C CE2  . PHE A 1 24 ? 39.080 -5.706  -7.997  1.00 0.00 ? 24 PHE A CE2  5  
ATOM 3242  C CZ   . PHE A 1 24 ? 38.761 -7.008  -8.360  1.00 0.00 ? 24 PHE A CZ   5  
ATOM 3243  H H    . PHE A 1 24 ? 38.823 -4.635  -2.658  1.00 0.00 ? 24 PHE A H    5  
ATOM 3244  H HA   . PHE A 1 24 ? 38.382 -7.324  -3.636  1.00 0.00 ? 24 PHE A HA   5  
ATOM 3245  H HB2  . PHE A 1 24 ? 40.279 -5.079  -4.244  1.00 0.00 ? 24 PHE A HB2  5  
ATOM 3246  H HB3  . PHE A 1 24 ? 41.096 -6.593  -4.268  1.00 0.00 ? 24 PHE A HB3  5  
ATOM 3247  H HD1  . PHE A 1 24 ? 39.443 -8.557  -5.430  1.00 0.00 ? 24 PHE A HD1  5  
ATOM 3248  H HD2  . PHE A 1 24 ? 39.775 -4.436  -6.420  1.00 0.00 ? 24 PHE A HD2  5  
ATOM 3249  H HE1  . PHE A 1 24 ? 38.653 -9.047  -7.707  1.00 0.00 ? 24 PHE A HE1  5  
ATOM 3250  H HE2  . PHE A 1 24 ? 38.971 -4.899  -8.707  1.00 0.00 ? 24 PHE A HE2  5  
ATOM 3251  H HZ   . PHE A 1 24 ? 38.388 -7.218  -9.352  1.00 0.00 ? 24 PHE A HZ   5  
ATOM 3252  N N    . ALA A 1 25 ? 40.601 -6.663  -1.295  1.00 0.00 ? 25 ALA A N    5  
ATOM 3253  C CA   . ALA A 1 25 ? 41.373 -7.262  -0.208  1.00 0.00 ? 25 ALA A CA   5  
ATOM 3254  C C    . ALA A 1 25 ? 40.441 -7.974  0.791   1.00 0.00 ? 25 ALA A C    5  
ATOM 3255  O O    . ALA A 1 25 ? 40.835 -8.920  1.460   1.00 0.00 ? 25 ALA A O    5  
ATOM 3256  C CB   . ALA A 1 25 ? 42.194 -6.187  0.510   1.00 0.00 ? 25 ALA A CB   5  
ATOM 3257  H H    . ALA A 1 25 ? 40.505 -5.669  -1.335  1.00 0.00 ? 25 ALA A H    5  
ATOM 3258  H HA   . ALA A 1 25 ? 42.050 -7.993  -0.655  1.00 0.00 ? 25 ALA A HA   5  
ATOM 3259  H HB1  . ALA A 1 25 ? 42.840 -6.627  1.269   1.00 0.00 ? 25 ALA A HB1  5  
ATOM 3260  H HB2  . ALA A 1 25 ? 41.561 -5.449  1.005   1.00 0.00 ? 25 ALA A HB2  5  
ATOM 3261  H HB3  . ALA A 1 25 ? 42.839 -5.666  -0.197  1.00 0.00 ? 25 ALA A HB3  5  
ATOM 3262  N N    . CYS A 1 26 ? 39.186 -7.474  0.823   1.00 0.00 ? 26 CYS A N    5  
ATOM 3263  C CA   . CYS A 1 26 ? 38.135 -8.079  1.636   1.00 0.00 ? 26 CYS A CA   5  
ATOM 3264  C C    . CYS A 1 26 ? 37.451 -9.273  0.938   1.00 0.00 ? 26 CYS A C    5  
ATOM 3265  O O    . CYS A 1 26 ? 36.482 -9.802  1.469   1.00 0.00 ? 26 CYS A O    5  
ATOM 3266  C CB   . CYS A 1 26 ? 37.079 -7.016  1.954   1.00 0.00 ? 26 CYS A CB   5  
ATOM 3267  S SG   . CYS A 1 26 ? 37.436 -6.234  3.553   1.00 0.00 ? 26 CYS A SG   5  
ATOM 3268  H H    . CYS A 1 26 ? 38.977 -6.668  0.269   1.00 0.00 ? 26 CYS A H    5  
ATOM 3269  H HA   . CYS A 1 26 ? 38.604 -8.429  2.558   1.00 0.00 ? 26 CYS A HA   5  
ATOM 3270  H HB2  . CYS A 1 26 ? 37.086 -6.271  1.164   1.00 0.00 ? 26 CYS A HB2  5  
ATOM 3271  H HB3  . CYS A 1 26 ? 36.059 -7.411  1.935   1.00 0.00 ? 26 CYS A HB3  5  
ATOM 3272  H HG   . CYS A 1 26 ? 37.339 -4.909  3.450   1.00 0.00 ? 26 CYS A HG   5  
ATOM 3273  N N    . GLU A 1 27 ? 37.964 -9.661  -0.258  1.00 0.00 ? 27 GLU A N    5  
ATOM 3274  C CA   . GLU A 1 27 ? 37.341 -10.726 -1.050  1.00 0.00 ? 27 GLU A CA   5  
ATOM 3275  C C    . GLU A 1 27 ? 35.883 -10.351 -1.397  1.00 0.00 ? 27 GLU A C    5  
ATOM 3276  O O    . GLU A 1 27 ? 34.941 -11.012 -0.991  1.00 0.00 ? 27 GLU A O    5  
ATOM 3277  C CB   . GLU A 1 27 ? 37.527 -12.084 -0.327  1.00 0.00 ? 27 GLU A CB   5  
ATOM 3278  C CG   . GLU A 1 27 ? 36.656 -13.264 -0.820  1.00 0.00 ? 27 GLU A CG   5  
ATOM 3279  C CD   . GLU A 1 27 ? 35.405 -13.528 0.061   1.00 0.00 ? 27 GLU A CD   5  
ATOM 3280  O OE1  . GLU A 1 27 ? 35.527 -13.496 1.283   1.00 0.00 ? 27 GLU A OE1  5  
ATOM 3281  O OE2  . GLU A 1 27 ? 34.324 -13.761 -0.487  1.00 0.00 ? 27 GLU A OE2  5  
ATOM 3282  H H    . GLU A 1 27 ? 38.803 -9.247  -0.603  1.00 0.00 ? 27 GLU A H    5  
ATOM 3283  H HA   . GLU A 1 27 ? 37.893 -10.762 -1.990  1.00 0.00 ? 27 GLU A HA   5  
ATOM 3284  H HB2  . GLU A 1 27 ? 38.566 -12.374 -0.473  1.00 0.00 ? 27 GLU A HB2  5  
ATOM 3285  H HB3  . GLU A 1 27 ? 37.454 -11.964 0.753   1.00 0.00 ? 27 GLU A HB3  5  
ATOM 3286  H HG2  . GLU A 1 27 ? 36.373 -13.120 -1.861  1.00 0.00 ? 27 GLU A HG2  5  
ATOM 3287  H HG3  . GLU A 1 27 ? 37.253 -14.174 -0.811  1.00 0.00 ? 27 GLU A HG3  5  
ATOM 3288  N N    . LYS A 1 28 ? 35.772 -9.242  -2.162  1.00 0.00 ? 28 LYS A N    5  
ATOM 3289  C CA   . LYS A 1 28 ? 34.519 -8.688  -2.680  1.00 0.00 ? 28 LYS A CA   5  
ATOM 3290  C C    . LYS A 1 28 ? 33.286 -9.006  -1.801  1.00 0.00 ? 28 LYS A C    5  
ATOM 3291  O O    . LYS A 1 28 ? 32.365 -9.707  -2.206  1.00 0.00 ? 28 LYS A O    5  
ATOM 3292  C CB   . LYS A 1 28 ? 34.390 -9.132  -4.158  1.00 0.00 ? 28 LYS A CB   5  
ATOM 3293  C CG   . LYS A 1 28 ? 34.649 -8.009  -5.174  1.00 0.00 ? 28 LYS A CG   5  
ATOM 3294  C CD   . LYS A 1 28 ? 35.941 -7.223  -4.924  1.00 0.00 ? 28 LYS A CD   5  
ATOM 3295  C CE   . LYS A 1 28 ? 36.236 -6.163  -5.988  1.00 0.00 ? 28 LYS A CE   5  
ATOM 3296  N NZ   . LYS A 1 28 ? 35.143 -5.271  -6.310  1.00 0.00 ? 28 LYS A NZ   5  
ATOM 3297  H H    . LYS A 1 28 ? 36.608 -8.778  -2.457  1.00 0.00 ? 28 LYS A H    5  
ATOM 3298  H HA   . LYS A 1 28 ? 34.652 -7.614  -2.595  1.00 0.00 ? 28 LYS A HA   5  
ATOM 3299  H HB2  . LYS A 1 28 ? 35.079 -9.954  -4.367  1.00 0.00 ? 28 LYS A HB2  5  
ATOM 3300  H HB3  . LYS A 1 28 ? 33.405 -9.545  -4.363  1.00 0.00 ? 28 LYS A HB3  5  
ATOM 3301  H HG2  . LYS A 1 28 ? 34.689 -8.456  -6.168  1.00 0.00 ? 28 LYS A HG2  5  
ATOM 3302  H HG3  . LYS A 1 28 ? 33.805 -7.327  -5.170  1.00 0.00 ? 28 LYS A HG3  5  
ATOM 3303  H HD2  . LYS A 1 28 ? 35.928 -6.715  -3.963  1.00 0.00 ? 28 LYS A HD2  5  
ATOM 3304  H HD3  . LYS A 1 28 ? 36.755 -7.943  -4.894  1.00 0.00 ? 28 LYS A HD3  5  
ATOM 3305  H HE2  . LYS A 1 28 ? 37.036 -5.521  -5.622  1.00 0.00 ? 28 LYS A HE2  5  
ATOM 3306  H HE3  . LYS A 1 28 ? 36.515 -6.658  -6.917  1.00 0.00 ? 28 LYS A HE3  5  
ATOM 3307  H HZ1  . LYS A 1 28 ? 35.445 -4.581  -7.038  1.00 0.00 ? 28 LYS A HZ1  5  
ATOM 3308  H HZ2  . LYS A 1 28 ? 34.839 -4.746  -5.467  1.00 0.00 ? 28 LYS A HZ2  5  
ATOM 3309  H HZ3  . LYS A 1 28 ? 34.360 -5.832  -6.693  1.00 0.00 ? 28 LYS A HZ3  5  
ATOM 3310  N N    . ASN A 1 29 ? 33.361 -8.466  -0.562  1.00 0.00 ? 29 ASN A N    5  
ATOM 3311  C CA   . ASN A 1 29 ? 32.342 -8.748  0.450   1.00 0.00 ? 29 ASN A CA   5  
ATOM 3312  C C    . ASN A 1 29 ? 31.535 -7.458  0.660   1.00 0.00 ? 29 ASN A C    5  
ATOM 3313  O O    . ASN A 1 29 ? 31.385 -6.714  -0.293  1.00 0.00 ? 29 ASN A O    5  
ATOM 3314  C CB   . ASN A 1 29 ? 33.021 -9.299  1.726   1.00 0.00 ? 29 ASN A CB   5  
ATOM 3315  C CG   . ASN A 1 29 ? 32.188 -10.373 2.449   1.00 0.00 ? 29 ASN A CG   5  
ATOM 3316  O OD1  . ASN A 1 29 ? 32.727 -11.221 3.152   1.00 0.00 ? 29 ASN A OD1  5  
ATOM 3317  N ND2  . ASN A 1 29 ? 30.867 -10.322 2.214   1.00 0.00 ? 29 ASN A ND2  5  
ATOM 3318  H H    . ASN A 1 29 ? 34.131 -7.858  -0.357  1.00 0.00 ? 29 ASN A H    5  
ATOM 3319  H HA   . ASN A 1 29 ? 31.667 -9.487  0.011   1.00 0.00 ? 29 ASN A HA   5  
ATOM 3320  H HB2  . ASN A 1 29 ? 33.959 -9.779  1.451   1.00 0.00 ? 29 ASN A HB2  5  
ATOM 3321  H HB3  . ASN A 1 29 ? 33.282 -8.512  2.433   1.00 0.00 ? 29 ASN A HB3  5  
ATOM 3322  H HD21 . ASN A 1 29 ? 30.487 -9.586  1.647   1.00 0.00 ? 29 ASN A HD21 5  
ATOM 3323  H HD22 . ASN A 1 29 ? 30.252 -11.016 2.582   1.00 0.00 ? 29 ASN A HD22 5  
ATOM 3324  N N    . GLU A 1 30 ? 31.022 -7.206  1.888   1.00 0.00 ? 30 GLU A N    5  
ATOM 3325  C CA   . GLU A 1 30 ? 30.179 -6.023  2.110   1.00 0.00 ? 30 GLU A CA   5  
ATOM 3326  C C    . GLU A 1 30 ? 30.460 -5.425  3.493   1.00 0.00 ? 30 GLU A C    5  
ATOM 3327  O O    . GLU A 1 30 ? 31.049 -4.360  3.617   1.00 0.00 ? 30 GLU A O    5  
ATOM 3328  C CB   . GLU A 1 30 ? 28.684 -6.367  1.967   1.00 0.00 ? 30 GLU A CB   5  
ATOM 3329  C CG   . GLU A 1 30 ? 28.234 -6.668  0.522   1.00 0.00 ? 30 GLU A CG   5  
ATOM 3330  C CD   . GLU A 1 30 ? 27.082 -5.749  0.072   1.00 0.00 ? 30 GLU A CD   5  
ATOM 3331  O OE1  . GLU A 1 30 ? 27.343 -4.584  -0.222  1.00 0.00 ? 30 GLU A OE1  5  
ATOM 3332  O OE2  . GLU A 1 30 ? 25.941 -6.210  0.018   1.00 0.00 ? 30 GLU A OE2  5  
ATOM 3333  H H    . GLU A 1 30 ? 31.202 -7.832  2.646   1.00 0.00 ? 30 GLU A H    5  
ATOM 3334  H HA   . GLU A 1 30 ? 30.455 -5.249  1.395   1.00 0.00 ? 30 GLU A HA   5  
ATOM 3335  H HB2  . GLU A 1 30 ? 28.448 -7.227  2.590   1.00 0.00 ? 30 GLU A HB2  5  
ATOM 3336  H HB3  . GLU A 1 30 ? 28.095 -5.550  2.385   1.00 0.00 ? 30 GLU A HB3  5  
ATOM 3337  H HG2  . GLU A 1 30 ? 29.047 -6.549  -0.187  1.00 0.00 ? 30 GLU A HG2  5  
ATOM 3338  H HG3  . GLU A 1 30 ? 27.927 -7.709  0.437   1.00 0.00 ? 30 GLU A HG3  5  
ATOM 3339  N N    . ASN A 1 31 ? 30.005 -6.173  4.516   1.00 0.00 ? 31 ASN A N    5  
ATOM 3340  C CA   . ASN A 1 31 ? 30.238 -5.800  5.909   1.00 0.00 ? 31 ASN A CA   5  
ATOM 3341  C C    . ASN A 1 31 ? 31.742 -5.795  6.228   1.00 0.00 ? 31 ASN A C    5  
ATOM 3342  O O    . ASN A 1 31 ? 32.166 -5.145  7.172   1.00 0.00 ? 31 ASN A O    5  
ATOM 3343  C CB   . ASN A 1 31 ? 29.515 -6.808  6.832   1.00 0.00 ? 31 ASN A CB   5  
ATOM 3344  C CG   . ASN A 1 31 ? 28.417 -6.155  7.685   1.00 0.00 ? 31 ASN A CG   5  
ATOM 3345  O OD1  . ASN A 1 31 ? 27.821 -5.145  7.324   1.00 0.00 ? 31 ASN A OD1  5  
ATOM 3346  N ND2  . ASN A 1 31 ? 28.189 -6.795  8.847   1.00 0.00 ? 31 ASN A ND2  5  
ATOM 3347  H H    . ASN A 1 31 ? 29.524 -7.022  4.301   1.00 0.00 ? 31 ASN A H    5  
ATOM 3348  H HA   . ASN A 1 31 ? 29.871 -4.779  6.038   1.00 0.00 ? 31 ASN A HA   5  
ATOM 3349  H HB2  . ASN A 1 31 ? 29.060 -7.604  6.246   1.00 0.00 ? 31 ASN A HB2  5  
ATOM 3350  H HB3  . ASN A 1 31 ? 30.202 -7.325  7.503   1.00 0.00 ? 31 ASN A HB3  5  
ATOM 3351  H HD21 . ASN A 1 31 ? 28.702 -7.629  9.087   1.00 0.00 ? 31 ASN A HD21 5  
ATOM 3352  H HD22 . ASN A 1 31 ? 27.509 -6.448  9.479   1.00 0.00 ? 31 ASN A HD22 5  
ATOM 3353  N N    . LEU A 1 32 ? 32.503 -6.550  5.405   1.00 0.00 ? 32 LEU A N    5  
ATOM 3354  C CA   . LEU A 1 32 ? 33.943 -6.647  5.621   1.00 0.00 ? 32 LEU A CA   5  
ATOM 3355  C C    . LEU A 1 32 ? 34.630 -5.395  5.059   1.00 0.00 ? 32 LEU A C    5  
ATOM 3356  O O    . LEU A 1 32 ? 35.521 -4.830  5.675   1.00 0.00 ? 32 LEU A O    5  
ATOM 3357  C CB   . LEU A 1 32 ? 34.504 -7.887  4.892   1.00 0.00 ? 32 LEU A CB   5  
ATOM 3358  C CG   . LEU A 1 32 ? 35.620 -8.641  5.642   1.00 0.00 ? 32 LEU A CG   5  
ATOM 3359  C CD1  . LEU A 1 32 ? 36.519 -7.762  6.520   1.00 0.00 ? 32 LEU A CD1  5  
ATOM 3360  C CD2  . LEU A 1 32 ? 35.012 -9.769  6.469   1.00 0.00 ? 32 LEU A CD2  5  
ATOM 3361  H H    . LEU A 1 32 ? 32.070 -7.036  4.644   1.00 0.00 ? 32 LEU A H    5  
ATOM 3362  H HA   . LEU A 1 32 ? 34.086 -6.707  6.705   1.00 0.00 ? 32 LEU A HA   5  
ATOM 3363  H HB2  . LEU A 1 32 ? 33.691 -8.583  4.689   1.00 0.00 ? 32 LEU A HB2  5  
ATOM 3364  H HB3  . LEU A 1 32 ? 34.862 -7.635  3.895   1.00 0.00 ? 32 LEU A HB3  5  
ATOM 3365  H HG   . LEU A 1 32 ? 36.262 -9.103  4.891   1.00 0.00 ? 32 LEU A HG   5  
ATOM 3366  H HD11 . LEU A 1 32 ? 37.397 -8.322  6.844   1.00 0.00 ? 32 LEU A HD11 5  
ATOM 3367  H HD12 . LEU A 1 32 ? 35.999 -7.421  7.415   1.00 0.00 ? 32 LEU A HD12 5  
ATOM 3368  H HD13 . LEU A 1 32 ? 36.870 -6.889  5.978   1.00 0.00 ? 32 LEU A HD13 5  
ATOM 3369  H HD21 . LEU A 1 32 ? 35.778 -10.325 7.008   1.00 0.00 ? 32 LEU A HD21 5  
ATOM 3370  H HD22 . LEU A 1 32 ? 34.479 -10.464 5.821   1.00 0.00 ? 32 LEU A HD22 5  
ATOM 3371  H HD23 . LEU A 1 32 ? 34.304 -9.372  7.195   1.00 0.00 ? 32 LEU A HD23 5  
ATOM 3372  N N    . ALA A 1 33 ? 34.157 -5.018  3.851   1.00 0.00 ? 33 ALA A N    5  
ATOM 3373  C CA   . ALA A 1 33 ? 34.700 -3.862  3.153   1.00 0.00 ? 33 ALA A CA   5  
ATOM 3374  C C    . ALA A 1 33 ? 34.495 -2.577  3.947   1.00 0.00 ? 33 ALA A C    5  
ATOM 3375  O O    . ALA A 1 33 ? 35.420 -1.799  4.121   1.00 0.00 ? 33 ALA A O    5  
ATOM 3376  C CB   . ALA A 1 33 ? 34.018 -3.698  1.807   1.00 0.00 ? 33 ALA A CB   5  
ATOM 3377  H H    . ALA A 1 33 ? 33.425 -5.545  3.419   1.00 0.00 ? 33 ALA A H    5  
ATOM 3378  H HA   . ALA A 1 33 ? 35.769 -4.025  3.020   1.00 0.00 ? 33 ALA A HA   5  
ATOM 3379  H HB1  . ALA A 1 33 ? 34.351 -2.758  1.372   1.00 0.00 ? 33 ALA A HB1  5  
ATOM 3380  H HB2  . ALA A 1 33 ? 32.930 -3.676  1.888   1.00 0.00 ? 33 ALA A HB2  5  
ATOM 3381  H HB3  . ALA A 1 33 ? 34.289 -4.506  1.131   1.00 0.00 ? 33 ALA A HB3  5  
ATOM 3382  N N    . ALA A 1 34 ? 33.247 -2.413  4.431   1.00 0.00 ? 34 ALA A N    5  
ATOM 3383  C CA   . ALA A 1 34 ? 32.946 -1.279  5.295   1.00 0.00 ? 34 ALA A CA   5  
ATOM 3384  C C    . ALA A 1 34 ? 33.883 -1.294  6.514   1.00 0.00 ? 34 ALA A C    5  
ATOM 3385  O O    . ALA A 1 34 ? 34.532 -0.315  6.814   1.00 0.00 ? 34 ALA A O    5  
ATOM 3386  C CB   . ALA A 1 34 ? 31.480 -1.303  5.737   1.00 0.00 ? 34 ALA A CB   5  
ATOM 3387  H H    . ALA A 1 34 ? 32.549 -3.095  4.217   1.00 0.00 ? 34 ALA A H    5  
ATOM 3388  H HA   . ALA A 1 34 ? 33.142 -0.375  4.714   1.00 0.00 ? 34 ALA A HA   5  
ATOM 3389  H HB1  . ALA A 1 34 ? 31.233 -2.208  6.294   1.00 0.00 ? 34 ALA A HB1  5  
ATOM 3390  H HB2  . ALA A 1 34 ? 30.812 -1.253  4.878   1.00 0.00 ? 34 ALA A HB2  5  
ATOM 3391  H HB3  . ALA A 1 34 ? 31.260 -0.443  6.369   1.00 0.00 ? 34 ALA A HB3  5  
ATOM 3392  N N    . ASN A 1 35 ? 33.967 -2.477  7.158   1.00 0.00 ? 35 ASN A N    5  
ATOM 3393  C CA   . ASN A 1 35 ? 34.861 -2.587  8.312   1.00 0.00 ? 35 ASN A CA   5  
ATOM 3394  C C    . ASN A 1 35 ? 36.314 -2.173  7.970   1.00 0.00 ? 35 ASN A C    5  
ATOM 3395  O O    . ASN A 1 35 ? 36.965 -1.523  8.768   1.00 0.00 ? 35 ASN A O    5  
ATOM 3396  C CB   . ASN A 1 35 ? 34.864 -4.030  8.836   1.00 0.00 ? 35 ASN A CB   5  
ATOM 3397  C CG   . ASN A 1 35 ? 34.865 -4.101  10.369  1.00 0.00 ? 35 ASN A CG   5  
ATOM 3398  O OD1  . ASN A 1 35 ? 35.844 -4.490  10.998  1.00 0.00 ? 35 ASN A OD1  5  
ATOM 3399  N ND2  . ASN A 1 35 ? 33.674 -3.803  10.905  1.00 0.00 ? 35 ASN A ND2  5  
ATOM 3400  H H    . ASN A 1 35 ? 33.431 -3.258  6.842   1.00 0.00 ? 35 ASN A H    5  
ATOM 3401  H HA   . ASN A 1 35 ? 34.451 -1.890  9.048   1.00 0.00 ? 35 ASN A HA   5  
ATOM 3402  H HB2  . ASN A 1 35 ? 33.988 -4.557  8.477   1.00 0.00 ? 35 ASN A HB2  5  
ATOM 3403  H HB3  . ASN A 1 35 ? 35.710 -4.603  8.465   1.00 0.00 ? 35 ASN A HB3  5  
ATOM 3404  H HD21 . ASN A 1 35 ? 33.022 -3.259  10.369  1.00 0.00 ? 35 ASN A HD21 5  
ATOM 3405  H HD22 . ASN A 1 35 ? 33.420 -4.126  11.814  1.00 0.00 ? 35 ASN A HD22 5  
ATOM 3406  N N    . PHE A 1 36 ? 36.767 -2.553  6.758   1.00 0.00 ? 36 PHE A N    5  
ATOM 3407  C CA   . PHE A 1 36 ? 38.124 -2.199  6.298   1.00 0.00 ? 36 PHE A CA   5  
ATOM 3408  C C    . PHE A 1 36 ? 38.313 -0.669  6.302   1.00 0.00 ? 36 PHE A C    5  
ATOM 3409  O O    . PHE A 1 36 ? 39.230 -0.154  6.916   1.00 0.00 ? 36 PHE A O    5  
ATOM 3410  C CB   . PHE A 1 36 ? 38.368 -2.785  4.889   1.00 0.00 ? 36 PHE A CB   5  
ATOM 3411  C CG   . PHE A 1 36 ? 39.761 -2.550  4.317   1.00 0.00 ? 36 PHE A CG   5  
ATOM 3412  C CD1  . PHE A 1 36 ? 40.174 -1.276  3.925   1.00 0.00 ? 36 PHE A CD1  5  
ATOM 3413  C CD2  . PHE A 1 36 ? 40.637 -3.612  4.114   1.00 0.00 ? 36 PHE A CD2  5  
ATOM 3414  C CE1  . PHE A 1 36 ? 41.414 -1.067  3.344   1.00 0.00 ? 36 PHE A CE1  5  
ATOM 3415  C CE2  . PHE A 1 36 ? 41.888 -3.407  3.537   1.00 0.00 ? 36 PHE A CE2  5  
ATOM 3416  C CZ   . PHE A 1 36 ? 42.279 -2.133  3.145   1.00 0.00 ? 36 PHE A CZ   5  
ATOM 3417  H H    . PHE A 1 36 ? 36.137 -3.028  6.157   1.00 0.00 ? 36 PHE A H    5  
ATOM 3418  H HA   . PHE A 1 36 ? 38.827 -2.638  7.005   1.00 0.00 ? 36 PHE A HA   5  
ATOM 3419  H HB2  . PHE A 1 36 ? 38.170 -3.855  4.902   1.00 0.00 ? 36 PHE A HB2  5  
ATOM 3420  H HB3  . PHE A 1 36 ? 37.658 -2.367  4.184   1.00 0.00 ? 36 PHE A HB3  5  
ATOM 3421  H HD1  . PHE A 1 36 ? 39.525 -0.421  4.032   1.00 0.00 ? 36 PHE A HD1  5  
ATOM 3422  H HD2  . PHE A 1 36 ? 40.341 -4.619  4.373   1.00 0.00 ? 36 PHE A HD2  5  
ATOM 3423  H HE1  . PHE A 1 36 ? 41.705 -0.079  3.023   1.00 0.00 ? 36 PHE A HE1  5  
ATOM 3424  H HE2  . PHE A 1 36 ? 42.555 -4.239  3.361   1.00 0.00 ? 36 PHE A HE2  5  
ATOM 3425  H HZ   . PHE A 1 36 ? 43.235 -1.968  2.677   1.00 0.00 ? 36 PHE A HZ   5  
ATOM 3426  N N    . LEU A 1 37 ? 37.398 -0.003  5.555   1.00 0.00 ? 37 LEU A N    5  
ATOM 3427  C CA   . LEU A 1 37 ? 37.533 1.419   5.266   1.00 0.00 ? 37 LEU A CA   5  
ATOM 3428  C C    . LEU A 1 37 ? 37.344 2.290   6.530   1.00 0.00 ? 37 LEU A C    5  
ATOM 3429  O O    . LEU A 1 37 ? 37.910 3.375   6.632   1.00 0.00 ? 37 LEU A O    5  
ATOM 3430  C CB   . LEU A 1 37 ? 36.522 1.840   4.192   1.00 0.00 ? 37 LEU A CB   5  
ATOM 3431  C CG   . LEU A 1 37 ? 36.707 1.222   2.788   1.00 0.00 ? 37 LEU A CG   5  
ATOM 3432  C CD1  . LEU A 1 37 ? 35.471 0.430   2.356   1.00 0.00 ? 37 LEU A CD1  5  
ATOM 3433  C CD2  . LEU A 1 37 ? 37.039 2.268   1.703   1.00 0.00 ? 37 LEU A CD2  5  
ATOM 3434  H H    . LEU A 1 37 ? 36.607 -0.486  5.193   1.00 0.00 ? 37 LEU A H    5  
ATOM 3435  H HA   . LEU A 1 37 ? 38.537 1.573   4.877   1.00 0.00 ? 37 LEU A HA   5  
ATOM 3436  H HB2  . LEU A 1 37 ? 35.511 1.666   4.543   1.00 0.00 ? 37 LEU A HB2  5  
ATOM 3437  H HB3  . LEU A 1 37 ? 36.622 2.912   4.127   1.00 0.00 ? 37 LEU A HB3  5  
ATOM 3438  H HG   . LEU A 1 37 ? 37.537 0.522   2.852   1.00 0.00 ? 37 LEU A HG   5  
ATOM 3439  H HD11 . LEU A 1 37 ? 35.750 -0.500  1.858   1.00 0.00 ? 37 LEU A HD11 5  
ATOM 3440  H HD12 . LEU A 1 37 ? 34.862 1.012   1.674   1.00 0.00 ? 37 LEU A HD12 5  
ATOM 3441  H HD13 . LEU A 1 37 ? 34.803 0.206   3.181   1.00 0.00 ? 37 LEU A HD13 5  
ATOM 3442  H HD21 . LEU A 1 37 ? 37.233 3.248   2.120   1.00 0.00 ? 37 LEU A HD21 5  
ATOM 3443  H HD22 . LEU A 1 37 ? 36.251 2.418   0.963   1.00 0.00 ? 37 LEU A HD22 5  
ATOM 3444  H HD23 . LEU A 1 37 ? 37.931 1.962   1.170   1.00 0.00 ? 37 LEU A HD23 5  
ATOM 3445  N N    . LEU A 1 38 ? 36.523 1.752   7.463   1.00 0.00 ? 38 LEU A N    5  
ATOM 3446  C CA   . LEU A 1 38 ? 36.176 2.456   8.696   1.00 0.00 ? 38 LEU A CA   5  
ATOM 3447  C C    . LEU A 1 38 ? 37.247 2.171   9.780   1.00 0.00 ? 38 LEU A C    5  
ATOM 3448  O O    . LEU A 1 38 ? 37.467 2.963   10.689  1.00 0.00 ? 38 LEU A O    5  
ATOM 3449  C CB   . LEU A 1 38 ? 34.767 2.074   9.226   1.00 0.00 ? 38 LEU A CB   5  
ATOM 3450  C CG   . LEU A 1 38 ? 33.558 2.062   8.247   1.00 0.00 ? 38 LEU A CG   5  
ATOM 3451  C CD1  . LEU A 1 38 ? 32.343 2.839   8.770   1.00 0.00 ? 38 LEU A CD1  5  
ATOM 3452  C CD2  . LEU A 1 38 ? 33.884 2.566   6.845   1.00 0.00 ? 38 LEU A CD2  5  
ATOM 3453  H H    . LEU A 1 38 ? 36.140 0.843   7.313   1.00 0.00 ? 38 LEU A H    5  
ATOM 3454  H HA   . LEU A 1 38 ? 36.201 3.517   8.449   1.00 0.00 ? 38 LEU A HA   5  
ATOM 3455  H HB2  . LEU A 1 38 ? 34.834 1.085   9.679   1.00 0.00 ? 38 LEU A HB2  5  
ATOM 3456  H HB3  . LEU A 1 38 ? 34.539 2.761   10.043  1.00 0.00 ? 38 LEU A HB3  5  
ATOM 3457  H HG   . LEU A 1 38 ? 33.210 1.033   8.178   1.00 0.00 ? 38 LEU A HG   5  
ATOM 3458  H HD11 . LEU A 1 38 ? 32.557 3.905   8.857   1.00 0.00 ? 38 LEU A HD11 5  
ATOM 3459  H HD12 . LEU A 1 38 ? 32.008 2.462   9.734   1.00 0.00 ? 38 LEU A HD12 5  
ATOM 3460  H HD13 . LEU A 1 38 ? 31.504 2.731   8.081   1.00 0.00 ? 38 LEU A HD13 5  
ATOM 3461  H HD21 . LEU A 1 38 ? 34.619 3.358   6.908   1.00 0.00 ? 38 LEU A HD21 5  
ATOM 3462  H HD22 . LEU A 1 38 ? 32.998 2.960   6.360   1.00 0.00 ? 38 LEU A HD22 5  
ATOM 3463  H HD23 . LEU A 1 38 ? 34.272 1.801   6.187   1.00 0.00 ? 38 LEU A HD23 5  
ATOM 3464  N N    . SER A 1 39 ? 37.893 0.990   9.604   1.00 0.00 ? 39 SER A N    5  
ATOM 3465  C CA   . SER A 1 39 ? 38.954 0.525   10.495  1.00 0.00 ? 39 SER A CA   5  
ATOM 3466  C C    . SER A 1 39 ? 40.297 1.161   10.139  1.00 0.00 ? 39 SER A C    5  
ATOM 3467  O O    . SER A 1 39 ? 41.188 1.171   10.979  1.00 0.00 ? 39 SER A O    5  
ATOM 3468  C CB   . SER A 1 39 ? 39.143 -1.009  10.460  1.00 0.00 ? 39 SER A CB   5  
ATOM 3469  O OG   . SER A 1 39 ? 38.135 -1.757  11.103  1.00 0.00 ? 39 SER A OG   5  
ATOM 3470  H H    . SER A 1 39 ? 37.686 0.429   8.808   1.00 0.00 ? 39 SER A H    5  
ATOM 3471  H HA   . SER A 1 39 ? 38.697 0.842   11.503  1.00 0.00 ? 39 SER A HA   5  
ATOM 3472  H HB2  . SER A 1 39 ? 39.297 -1.363  9.436   1.00 0.00 ? 39 SER A HB2  5  
ATOM 3473  H HB3  . SER A 1 39 ? 40.052 -1.275  10.999  1.00 0.00 ? 39 SER A HB3  5  
ATOM 3474  H HG   . SER A 1 39 ? 37.297 -1.611  10.672  1.00 0.00 ? 39 SER A HG   5  
ATOM 3475  N N    . GLN A 1 40 ? 40.414 1.735   8.919   1.00 0.00 ? 40 GLN A N    5  
ATOM 3476  C CA   . GLN A 1 40 ? 41.675 2.388   8.573   1.00 0.00 ? 40 GLN A CA   5  
ATOM 3477  C C    . GLN A 1 40 ? 42.014 3.519   9.568   1.00 0.00 ? 40 GLN A C    5  
ATOM 3478  O O    . GLN A 1 40 ? 41.317 4.518   9.688   1.00 0.00 ? 40 GLN A O    5  
ATOM 3479  C CB   . GLN A 1 40 ? 41.651 2.920   7.134   1.00 0.00 ? 40 GLN A CB   5  
ATOM 3480  C CG   . GLN A 1 40 ? 41.863 1.798   6.111   1.00 0.00 ? 40 GLN A CG   5  
ATOM 3481  C CD   . GLN A 1 40 ? 42.058 2.357   4.702   1.00 0.00 ? 40 GLN A CD   5  
ATOM 3482  O OE1  . GLN A 1 40 ? 41.228 2.170   3.825   1.00 0.00 ? 40 GLN A OE1  5  
ATOM 3483  N NE2  . GLN A 1 40 ? 43.213 3.029   4.542   1.00 0.00 ? 40 GLN A NE2  5  
ATOM 3484  H H    . GLN A 1 40 ? 39.663 1.718   8.260   1.00 0.00 ? 40 GLN A H    5  
ATOM 3485  H HA   . GLN A 1 40 ? 42.441 1.615   8.649   1.00 0.00 ? 40 GLN A HA   5  
ATOM 3486  H HB2  . GLN A 1 40 ? 40.719 3.448   6.932   1.00 0.00 ? 40 GLN A HB2  5  
ATOM 3487  H HB3  . GLN A 1 40 ? 42.446 3.657   7.015   1.00 0.00 ? 40 GLN A HB3  5  
ATOM 3488  H HG2  . GLN A 1 40 ? 42.745 1.209   6.363   1.00 0.00 ? 40 GLN A HG2  5  
ATOM 3489  H HG3  . GLN A 1 40 ? 41.016 1.118   6.095   1.00 0.00 ? 40 GLN A HG3  5  
ATOM 3490  H HE21 . GLN A 1 40 ? 43.824 3.152   5.324   1.00 0.00 ? 40 GLN A HE21 5  
ATOM 3491  H HE22 . GLN A 1 40 ? 43.472 3.410   3.654   1.00 0.00 ? 40 GLN A HE22 5  
ATOM 3492  N N    . ASN A 1 41 ? 43.142 3.245   10.266  1.00 0.00 ? 41 ASN A N    5  
ATOM 3493  C CA   . ASN A 1 41 ? 43.680 4.125   11.293  1.00 0.00 ? 41 ASN A CA   5  
ATOM 3494  C C    . ASN A 1 41 ? 44.163 5.434   10.649  1.00 0.00 ? 41 ASN A C    5  
ATOM 3495  O O    . ASN A 1 41 ? 45.005 5.458   9.760   1.00 0.00 ? 41 ASN A O    5  
ATOM 3496  C CB   . ASN A 1 41 ? 44.792 3.411   12.089  1.00 0.00 ? 41 ASN A CB   5  
ATOM 3497  C CG   . ASN A 1 41 ? 45.801 2.672   11.193  1.00 0.00 ? 41 ASN A CG   5  
ATOM 3498  O OD1  . ASN A 1 41 ? 45.614 1.514   10.841  1.00 0.00 ? 41 ASN A OD1  5  
ATOM 3499  N ND2  . ASN A 1 41 ? 46.875 3.407   10.858  1.00 0.00 ? 41 ASN A ND2  5  
ATOM 3500  H H    . ASN A 1 41 ? 43.634 2.400   10.059  1.00 0.00 ? 41 ASN A H    5  
ATOM 3501  H HA   . ASN A 1 41 ? 42.855 4.346   11.972  1.00 0.00 ? 41 ASN A HA   5  
ATOM 3502  H HB2  . ASN A 1 41 ? 45.323 4.108   12.739  1.00 0.00 ? 41 ASN A HB2  5  
ATOM 3503  H HB3  . ASN A 1 41 ? 44.344 2.666   12.746  1.00 0.00 ? 41 ASN A HB3  5  
ATOM 3504  H HD21 . ASN A 1 41 ? 46.977 4.344   11.191  1.00 0.00 ? 41 ASN A HD21 5  
ATOM 3505  H HD22 . ASN A 1 41 ? 47.582 3.020   10.267  1.00 0.00 ? 41 ASN A HD22 5  
ATOM 3506  N N    . PHE A 1 42 ? 43.526 6.506   11.156  1.00 0.00 ? 42 PHE A N    5  
ATOM 3507  C CA   . PHE A 1 42 ? 43.710 7.839   10.610  1.00 0.00 ? 42 PHE A CA   5  
ATOM 3508  C C    . PHE A 1 42 ? 43.447 8.844   11.737  1.00 0.00 ? 42 PHE A C    5  
ATOM 3509  O O    . PHE A 1 42 ? 42.319 9.056   12.165  1.00 0.00 ? 42 PHE A O    5  
ATOM 3510  C CB   . PHE A 1 42 ? 42.755 8.036   9.419   1.00 0.00 ? 42 PHE A CB   5  
ATOM 3511  C CG   . PHE A 1 42 ? 42.643 9.477   8.992   1.00 0.00 ? 42 PHE A CG   5  
ATOM 3512  C CD1  . PHE A 1 42 ? 43.708 10.123  8.370   1.00 0.00 ? 42 PHE A CD1  5  
ATOM 3513  C CD2  . PHE A 1 42 ? 41.470 10.186  9.232   1.00 0.00 ? 42 PHE A CD2  5  
ATOM 3514  C CE1  . PHE A 1 42 ? 43.600 11.457  7.996   1.00 0.00 ? 42 PHE A CE1  5  
ATOM 3515  C CE2  . PHE A 1 42 ? 41.360 11.518  8.858   1.00 0.00 ? 42 PHE A CE2  5  
ATOM 3516  C CZ   . PHE A 1 42 ? 42.425 12.155  8.239   1.00 0.00 ? 42 PHE A CZ   5  
ATOM 3517  H H    . PHE A 1 42 ? 42.866 6.366   11.894  1.00 0.00 ? 42 PHE A H    5  
ATOM 3518  H HA   . PHE A 1 42 ? 44.748 7.934   10.282  1.00 0.00 ? 42 PHE A HA   5  
ATOM 3519  H HB2  . PHE A 1 42 ? 43.095 7.441   8.570   1.00 0.00 ? 42 PHE A HB2  5  
ATOM 3520  H HB3  . PHE A 1 42 ? 41.761 7.663   9.672   1.00 0.00 ? 42 PHE A HB3  5  
ATOM 3521  H HD1  . PHE A 1 42 ? 44.629 9.590   8.182   1.00 0.00 ? 42 PHE A HD1  5  
ATOM 3522  H HD2  . PHE A 1 42 ? 40.637 9.702   9.720   1.00 0.00 ? 42 PHE A HD2  5  
ATOM 3523  H HE1  . PHE A 1 42 ? 44.431 11.953  7.519   1.00 0.00 ? 42 PHE A HE1  5  
ATOM 3524  H HE2  . PHE A 1 42 ? 40.445 12.057  9.055   1.00 0.00 ? 42 PHE A HE2  5  
ATOM 3525  H HZ   . PHE A 1 42 ? 42.339 13.192  7.949   1.00 0.00 ? 42 PHE A HZ   5  
ATOM 3526  N N    . ASP A 1 43 ? 44.584 9.437   12.170  1.00 0.00 ? 43 ASP A N    5  
ATOM 3527  C CA   . ASP A 1 43 ? 44.618 10.524  13.152  1.00 0.00 ? 43 ASP A CA   5  
ATOM 3528  C C    . ASP A 1 43 ? 43.876 10.064  14.424  1.00 0.00 ? 43 ASP A C    5  
ATOM 3529  O O    . ASP A 1 43 ? 43.859 8.875   14.719  1.00 0.00 ? 43 ASP A O    5  
ATOM 3530  C CB   . ASP A 1 43 ? 44.071 11.829  12.519  1.00 0.00 ? 43 ASP A CB   5  
ATOM 3531  C CG   . ASP A 1 43 ? 44.924 12.382  11.355  1.00 0.00 ? 43 ASP A CG   5  
ATOM 3532  O OD1  . ASP A 1 43 ? 45.906 11.751  10.961  1.00 0.00 ? 43 ASP A OD1  5  
ATOM 3533  O OD2  . ASP A 1 43 ? 44.594 13.459  10.860  1.00 0.00 ? 43 ASP A OD2  5  
ATOM 3534  H H    . ASP A 1 43 ? 45.428 9.220   11.683  1.00 0.00 ? 43 ASP A H    5  
ATOM 3535  H HA   . ASP A 1 43 ? 45.670 10.658  13.415  1.00 0.00 ? 43 ASP A HA   5  
ATOM 3536  H HB2  . ASP A 1 43 ? 43.041 11.716  12.182  1.00 0.00 ? 43 ASP A HB2  5  
ATOM 3537  H HB3  . ASP A 1 43 ? 44.042 12.627  13.253  1.00 0.00 ? 43 ASP A HB3  5  
ATOM 3538  N N    . ASP A 1 44 ? 43.249 11.047  15.120  1.00 0.00 ? 44 ASP A N    5  
ATOM 3539  C CA   . ASP A 1 44 ? 42.325 10.823  16.237  1.00 0.00 ? 44 ASP A CA   5  
ATOM 3540  C C    . ASP A 1 44 ? 42.712 9.599   17.083  1.00 0.00 ? 44 ASP A C    5  
ATOM 3541  O O    . ASP A 1 44 ? 41.957 8.643   17.202  1.00 0.00 ? 44 ASP A O    5  
ATOM 3542  C CB   . ASP A 1 44 ? 40.871 10.669  15.728  1.00 0.00 ? 44 ASP A CB   5  
ATOM 3543  C CG   . ASP A 1 44 ? 40.289 11.970  15.134  1.00 0.00 ? 44 ASP A CG   5  
ATOM 3544  O OD1  . ASP A 1 44 ? 40.840 12.472  14.157  1.00 0.00 ? 44 ASP A OD1  5  
ATOM 3545  O OD2  . ASP A 1 44 ? 39.281 12.460  15.647  1.00 0.00 ? 44 ASP A OD2  5  
ATOM 3546  H H    . ASP A 1 44 ? 43.373 11.996  14.831  1.00 0.00 ? 44 ASP A H    5  
ATOM 3547  H HA   . ASP A 1 44 ? 42.414 11.699  16.879  1.00 0.00 ? 44 ASP A HA   5  
ATOM 3548  H HB2  . ASP A 1 44 ? 40.784 9.874   14.986  1.00 0.00 ? 44 ASP A HB2  5  
ATOM 3549  H HB3  . ASP A 1 44 ? 40.226 10.363  16.550  1.00 0.00 ? 44 ASP A HB3  5  
ATOM 3550  N N    . GLU A 1 45 ? 43.945 9.695   17.623  1.00 0.00 ? 45 GLU A N    5  
ATOM 3551  C CA   . GLU A 1 45 ? 44.591 8.613   18.350  1.00 0.00 ? 45 GLU A CA   5  
ATOM 3552  C C    . GLU A 1 45 ? 45.148 7.588   17.339  1.00 0.00 ? 45 GLU A C    5  
ATOM 3553  O O    . GLU A 1 45 ? 44.577 6.513   17.204  1.00 0.00 ? 45 GLU A O    5  
ATOM 3554  C CB   . GLU A 1 45 ? 43.670 7.994   19.430  1.00 0.00 ? 45 GLU A CB   5  
ATOM 3555  C CG   . GLU A 1 45 ? 42.861 9.025   20.246  1.00 0.00 ? 45 GLU A CG   5  
ATOM 3556  C CD   . GLU A 1 45 ? 43.698 9.847   21.247  1.00 0.00 ? 45 GLU A CD   5  
ATOM 3557  O OE1  . GLU A 1 45 ? 44.755 10.355  20.872  1.00 0.00 ? 45 GLU A OE1  5  
ATOM 3558  O OE2  . GLU A 1 45 ? 43.275 9.982   22.393  1.00 0.00 ? 45 GLU A OE2  5  
ATOM 3559  O OXT  . GLU A 1 45 ? 46.152 7.892   16.684  1.00 0.00 ? 45 GLU A OXT  5  
ATOM 3560  H H    . GLU A 1 45 ? 44.479 10.514  17.417  1.00 0.00 ? 45 GLU A H    5  
ATOM 3561  H HA   . GLU A 1 45 ? 45.440 9.080   18.839  1.00 0.00 ? 45 GLU A HA   5  
ATOM 3562  H HB2  . GLU A 1 45 ? 42.957 7.316   18.962  1.00 0.00 ? 45 GLU A HB2  5  
ATOM 3563  H HB3  . GLU A 1 45 ? 44.256 7.355   20.092  1.00 0.00 ? 45 GLU A HB3  5  
ATOM 3564  H HG2  . GLU A 1 45 ? 42.305 9.722   19.621  1.00 0.00 ? 45 GLU A HG2  5  
ATOM 3565  H HG3  . GLU A 1 45 ? 42.093 8.479   20.788  1.00 0.00 ? 45 GLU A HG3  5  
ATOM 3566  N N    . GLN A 1 1  ? 30.107 -6.339  -11.572 1.00 0.00 ? 1  GLN A N    6  
ATOM 3567  C CA   . GLN A 1 1  ? 29.339 -5.159  -11.191 1.00 0.00 ? 1  GLN A CA   6  
ATOM 3568  C C    . GLN A 1 1  ? 29.631 -4.764  -9.738  1.00 0.00 ? 1  GLN A C    6  
ATOM 3569  O O    . GLN A 1 1  ? 28.744 -4.680  -8.900  1.00 0.00 ? 1  GLN A O    6  
ATOM 3570  C CB   . GLN A 1 1  ? 27.825 -5.367  -11.372 1.00 0.00 ? 1  GLN A CB   6  
ATOM 3571  C CG   . GLN A 1 1  ? 27.389 -5.252  -12.838 1.00 0.00 ? 1  GLN A CG   6  
ATOM 3572  C CD   . GLN A 1 1  ? 25.855 -5.255  -12.943 1.00 0.00 ? 1  GLN A CD   6  
ATOM 3573  O OE1  . GLN A 1 1  ? 25.166 -4.481  -12.294 1.00 0.00 ? 1  GLN A OE1  6  
ATOM 3574  N NE2  . GLN A 1 1  ? 25.371 -6.173  -13.801 1.00 0.00 ? 1  GLN A NE2  6  
ATOM 3575  H H1   . GLN A 1 1  ? 31.098 -6.057  -11.718 1.00 0.00 ? 1  GLN A H1   6  
ATOM 3576  H H2   . GLN A 1 1  ? 29.728 -6.738  -12.454 1.00 0.00 ? 1  GLN A H2   6  
ATOM 3577  H H3   . GLN A 1 1  ? 30.058 -7.042  -10.806 1.00 0.00 ? 1  GLN A H3   6  
ATOM 3578  H HA   . GLN A 1 1  ? 29.672 -4.343  -11.832 1.00 0.00 ? 1  GLN A HA   6  
ATOM 3579  H HB2  . GLN A 1 1  ? 27.527 -6.332  -10.960 1.00 0.00 ? 1  GLN A HB2  6  
ATOM 3580  H HB3  . GLN A 1 1  ? 27.272 -4.611  -10.813 1.00 0.00 ? 1  GLN A HB3  6  
ATOM 3581  H HG2  . GLN A 1 1  ? 27.752 -4.323  -13.276 1.00 0.00 ? 1  GLN A HG2  6  
ATOM 3582  H HG3  . GLN A 1 1  ? 27.807 -6.068  -13.424 1.00 0.00 ? 1  GLN A HG3  6  
ATOM 3583  H HE21 . GLN A 1 1  ? 25.980 -6.778  -14.315 1.00 0.00 ? 1  GLN A HE21 6  
ATOM 3584  H HE22 . GLN A 1 1  ? 24.384 -6.256  -13.930 1.00 0.00 ? 1  GLN A HE22 6  
ATOM 3585  N N    . GLU A 1 2  ? 30.936 -4.525  -9.505  1.00 0.00 ? 2  GLU A N    6  
ATOM 3586  C CA   . GLU A 1 2  ? 31.389 -4.160  -8.173  1.00 0.00 ? 2  GLU A CA   6  
ATOM 3587  C C    . GLU A 1 2  ? 31.446 -2.645  -7.981  1.00 0.00 ? 2  GLU A C    6  
ATOM 3588  O O    . GLU A 1 2  ? 31.593 -2.180  -6.861  1.00 0.00 ? 2  GLU A O    6  
ATOM 3589  C CB   . GLU A 1 2  ? 32.744 -4.835  -7.889  1.00 0.00 ? 2  GLU A CB   6  
ATOM 3590  C CG   . GLU A 1 2  ? 32.802 -5.443  -6.487  1.00 0.00 ? 2  GLU A CG   6  
ATOM 3591  C CD   . GLU A 1 2  ? 31.709 -6.533  -6.309  1.00 0.00 ? 2  GLU A CD   6  
ATOM 3592  O OE1  . GLU A 1 2  ? 31.862 -7.621  -6.860  1.00 0.00 ? 2  GLU A OE1  6  
ATOM 3593  O OE2  . GLU A 1 2  ? 30.708 -6.277  -5.640  1.00 0.00 ? 2  GLU A OE2  6  
ATOM 3594  H H    . GLU A 1 2  ? 31.599 -4.626  -10.244 1.00 0.00 ? 2  GLU A H    6  
ATOM 3595  H HA   . GLU A 1 2  ? 30.634 -4.505  -7.467  1.00 0.00 ? 2  GLU A HA   6  
ATOM 3596  H HB2  . GLU A 1 2  ? 32.934 -5.626  -8.616  1.00 0.00 ? 2  GLU A HB2  6  
ATOM 3597  H HB3  . GLU A 1 2  ? 33.579 -4.145  -8.019  1.00 0.00 ? 2  GLU A HB3  6  
ATOM 3598  H HG2  . GLU A 1 2  ? 33.797 -5.860  -6.337  1.00 0.00 ? 2  GLU A HG2  6  
ATOM 3599  H HG3  . GLU A 1 2  ? 32.675 -4.662  -5.739  1.00 0.00 ? 2  GLU A HG3  6  
ATOM 3600  N N    . LYS A 1 3  ? 31.295 -1.924  -9.121  1.00 0.00 ? 3  LYS A N    6  
ATOM 3601  C CA   . LYS A 1 3  ? 31.313 -0.462  -9.156  1.00 0.00 ? 3  LYS A CA   6  
ATOM 3602  C C    . LYS A 1 3  ? 30.174 0.180   -8.330  1.00 0.00 ? 3  LYS A C    6  
ATOM 3603  O O    . LYS A 1 3  ? 30.230 1.351   -7.979  1.00 0.00 ? 3  LYS A O    6  
ATOM 3604  C CB   . LYS A 1 3  ? 31.325 0.017   -10.606 1.00 0.00 ? 3  LYS A CB   6  
ATOM 3605  C CG   . LYS A 1 3  ? 30.004 -0.193  -11.353 1.00 0.00 ? 3  LYS A CG   6  
ATOM 3606  C CD   . LYS A 1 3  ? 29.149 1.081   -11.435 1.00 0.00 ? 3  LYS A CD   6  
ATOM 3607  C CE   . LYS A 1 3  ? 28.298 1.112   -12.711 1.00 0.00 ? 3  LYS A CE   6  
ATOM 3608  N NZ   . LYS A 1 3  ? 26.983 1.706   -12.513 1.00 0.00 ? 3  LYS A NZ   6  
ATOM 3609  H H    . LYS A 1 3  ? 31.219 -2.406  -9.991  1.00 0.00 ? 3  LYS A H    6  
ATOM 3610  H HA   . LYS A 1 3  ? 32.270 -0.151  -8.766  1.00 0.00 ? 3  LYS A HA   6  
ATOM 3611  H HB2  . LYS A 1 3  ? 31.635 1.062   -10.642 1.00 0.00 ? 3  LYS A HB2  6  
ATOM 3612  H HB3  . LYS A 1 3  ? 32.114 -0.513  -11.141 1.00 0.00 ? 3  LYS A HB3  6  
ATOM 3613  H HG2  . LYS A 1 3  ? 30.246 -0.541  -12.356 1.00 0.00 ? 3  LYS A HG2  6  
ATOM 3614  H HG3  . LYS A 1 3  ? 29.419 -1.003  -10.916 1.00 0.00 ? 3  LYS A HG3  6  
ATOM 3615  H HD2  . LYS A 1 3  ? 28.529 1.163   -10.542 1.00 0.00 ? 3  LYS A HD2  6  
ATOM 3616  H HD3  . LYS A 1 3  ? 29.778 1.972   -11.430 1.00 0.00 ? 3  LYS A HD3  6  
ATOM 3617  H HE2  . LYS A 1 3  ? 28.815 1.676   -13.489 1.00 0.00 ? 3  LYS A HE2  6  
ATOM 3618  H HE3  . LYS A 1 3  ? 28.140 0.107   -13.100 1.00 0.00 ? 3  LYS A HE3  6  
ATOM 3619  H HZ1  . LYS A 1 3  ? 27.083 2.660   -12.113 1.00 0.00 ? 3  LYS A HZ1  6  
ATOM 3620  H HZ2  . LYS A 1 3  ? 26.440 1.108   -11.857 1.00 0.00 ? 3  LYS A HZ2  6  
ATOM 3621  H HZ3  . LYS A 1 3  ? 26.490 1.756   -13.428 1.00 0.00 ? 3  LYS A HZ3  6  
ATOM 3622  N N    . GLU A 1 4  ? 29.157 -0.665  -8.040  1.00 0.00 ? 4  GLU A N    6  
ATOM 3623  C CA   . GLU A 1 4  ? 28.006 -0.281  -7.229  1.00 0.00 ? 4  GLU A CA   6  
ATOM 3624  C C    . GLU A 1 4  ? 28.417 0.043   -5.794  1.00 0.00 ? 4  GLU A C    6  
ATOM 3625  O O    . GLU A 1 4  ? 27.980 1.024   -5.212  1.00 0.00 ? 4  GLU A O    6  
ATOM 3626  C CB   . GLU A 1 4  ? 27.012 -1.453  -7.195  1.00 0.00 ? 4  GLU A CB   6  
ATOM 3627  C CG   . GLU A 1 4  ? 25.940 -1.361  -8.293  1.00 0.00 ? 4  GLU A CG   6  
ATOM 3628  C CD   . GLU A 1 4  ? 24.524 -1.214  -7.698  1.00 0.00 ? 4  GLU A CD   6  
ATOM 3629  O OE1  . GLU A 1 4  ? 24.100 -2.108  -6.967  1.00 0.00 ? 4  GLU A OE1  6  
ATOM 3630  O OE2  . GLU A 1 4  ? 23.861 -0.212  -7.971  1.00 0.00 ? 4  GLU A OE2  6  
ATOM 3631  H H    . GLU A 1 4  ? 29.218 -1.608  -8.363  1.00 0.00 ? 4  GLU A H    6  
ATOM 3632  H HA   . GLU A 1 4  ? 27.576 0.622   -7.668  1.00 0.00 ? 4  GLU A HA   6  
ATOM 3633  H HB2  . GLU A 1 4  ? 27.556 -2.392  -7.296  1.00 0.00 ? 4  GLU A HB2  6  
ATOM 3634  H HB3  . GLU A 1 4  ? 26.548 -1.538  -6.211  1.00 0.00 ? 4  GLU A HB3  6  
ATOM 3635  H HG2  . GLU A 1 4  ? 26.142 -0.530  -8.968  1.00 0.00 ? 4  GLU A HG2  6  
ATOM 3636  H HG3  . GLU A 1 4  ? 25.971 -2.253  -8.916  1.00 0.00 ? 4  GLU A HG3  6  
ATOM 3637  N N    . ALA A 1 5  ? 29.281 -0.850  -5.269  1.00 0.00 ? 5  ALA A N    6  
ATOM 3638  C CA   . ALA A 1 5  ? 29.780 -0.599  -3.932  1.00 0.00 ? 5  ALA A CA   6  
ATOM 3639  C C    . ALA A 1 5  ? 30.800 0.534   -3.943  1.00 0.00 ? 5  ALA A C    6  
ATOM 3640  O O    . ALA A 1 5  ? 31.109 1.054   -2.889  1.00 0.00 ? 5  ALA A O    6  
ATOM 3641  C CB   . ALA A 1 5  ? 30.396 -1.855  -3.321  1.00 0.00 ? 5  ALA A CB   6  
ATOM 3642  H H    . ALA A 1 5  ? 29.595 -1.636  -5.797  1.00 0.00 ? 5  ALA A H    6  
ATOM 3643  H HA   . ALA A 1 5  ? 28.934 -0.302  -3.312  1.00 0.00 ? 5  ALA A HA   6  
ATOM 3644  H HB1  . ALA A 1 5  ? 31.309 -2.158  -3.834  1.00 0.00 ? 5  ALA A HB1  6  
ATOM 3645  H HB2  . ALA A 1 5  ? 29.696 -2.689  -3.344  1.00 0.00 ? 5  ALA A HB2  6  
ATOM 3646  H HB3  . ALA A 1 5  ? 30.635 -1.674  -2.273  1.00 0.00 ? 5  ALA A HB3  6  
ATOM 3647  N N    . ILE A 1 6  ? 31.322 0.907   -5.129  1.00 0.00 ? 6  ILE A N    6  
ATOM 3648  C CA   . ILE A 1 6  ? 32.446 1.842   -5.139  1.00 0.00 ? 6  ILE A CA   6  
ATOM 3649  C C    . ILE A 1 6  ? 32.019 3.261   -4.777  1.00 0.00 ? 6  ILE A C    6  
ATOM 3650  O O    . ILE A 1 6  ? 32.697 3.929   -4.015  1.00 0.00 ? 6  ILE A O    6  
ATOM 3651  C CB   . ILE A 1 6  ? 33.227 1.796   -6.458  1.00 0.00 ? 6  ILE A CB   6  
ATOM 3652  C CG1  . ILE A 1 6  ? 33.671 0.366   -6.784  1.00 0.00 ? 6  ILE A CG1  6  
ATOM 3653  C CG2  . ILE A 1 6  ? 34.413 2.771   -6.489  1.00 0.00 ? 6  ILE A CG2  6  
ATOM 3654  C CD1  . ILE A 1 6  ? 34.554 -0.320  -5.748  1.00 0.00 ? 6  ILE A CD1  6  
ATOM 3655  H H    . ILE A 1 6  ? 30.972 0.514   -5.980  1.00 0.00 ? 6  ILE A H    6  
ATOM 3656  H HA   . ILE A 1 6  ? 33.103 1.517   -4.341  1.00 0.00 ? 6  ILE A HA   6  
ATOM 3657  H HB   . ILE A 1 6  ? 32.554 2.105   -7.256  1.00 0.00 ? 6  ILE A HB   6  
ATOM 3658  H HG12 . ILE A 1 6  ? 32.788 -0.248  -6.857  1.00 0.00 ? 6  ILE A HG12 6  
ATOM 3659  H HG13 . ILE A 1 6  ? 34.141 0.343   -7.768  1.00 0.00 ? 6  ILE A HG13 6  
ATOM 3660  H HG21 . ILE A 1 6  ? 35.280 2.309   -6.952  1.00 0.00 ? 6  ILE A HG21 6  
ATOM 3661  H HG22 . ILE A 1 6  ? 34.710 3.092   -5.495  1.00 0.00 ? 6  ILE A HG22 6  
ATOM 3662  H HG23 . ILE A 1 6  ? 34.164 3.674   -7.044  1.00 0.00 ? 6  ILE A HG23 6  
ATOM 3663  H HD11 . ILE A 1 6  ? 35.528 0.151   -5.666  1.00 0.00 ? 6  ILE A HD11 6  
ATOM 3664  H HD12 . ILE A 1 6  ? 34.697 -1.355  -6.051  1.00 0.00 ? 6  ILE A HD12 6  
ATOM 3665  H HD13 . ILE A 1 6  ? 34.086 -0.335  -4.766  1.00 0.00 ? 6  ILE A HD13 6  
ATOM 3666  N N    . GLU A 1 7  ? 30.862 3.661   -5.337  1.00 0.00 ? 7  GLU A N    6  
ATOM 3667  C CA   . GLU A 1 7  ? 30.277 4.953   -5.003  1.00 0.00 ? 7  GLU A CA   6  
ATOM 3668  C C    . GLU A 1 7  ? 29.674 4.953   -3.589  1.00 0.00 ? 7  GLU A C    6  
ATOM 3669  O O    . GLU A 1 7  ? 29.431 6.001   -3.013  1.00 0.00 ? 7  GLU A O    6  
ATOM 3670  C CB   . GLU A 1 7  ? 29.219 5.307   -6.056  1.00 0.00 ? 7  GLU A CB   6  
ATOM 3671  C CG   . GLU A 1 7  ? 28.001 4.369   -6.047  1.00 0.00 ? 7  GLU A CG   6  
ATOM 3672  C CD   . GLU A 1 7  ? 27.077 4.659   -7.244  1.00 0.00 ? 7  GLU A CD   6  
ATOM 3673  O OE1  . GLU A 1 7  ? 27.327 4.125   -8.325  1.00 0.00 ? 7  GLU A OE1  6  
ATOM 3674  O OE2  . GLU A 1 7  ? 26.116 5.411   -7.082  1.00 0.00 ? 7  GLU A OE2  6  
ATOM 3675  H H    . GLU A 1 7  ? 30.393 3.050   -5.972  1.00 0.00 ? 7  GLU A H    6  
ATOM 3676  H HA   . GLU A 1 7  ? 31.077 5.694   -5.034  1.00 0.00 ? 7  GLU A HA   6  
ATOM 3677  H HB2  . GLU A 1 7  ? 28.888 6.337   -5.916  1.00 0.00 ? 7  GLU A HB2  6  
ATOM 3678  H HB3  . GLU A 1 7  ? 29.694 5.275   -7.035  1.00 0.00 ? 7  GLU A HB3  6  
ATOM 3679  H HG2  . GLU A 1 7  ? 28.315 3.327   -6.088  1.00 0.00 ? 7  GLU A HG2  6  
ATOM 3680  H HG3  . GLU A 1 7  ? 27.443 4.482   -5.118  1.00 0.00 ? 7  GLU A HG3  6  
ATOM 3681  N N    . ARG A 1 8  ? 29.455 3.720   -3.078  1.00 0.00 ? 8  ARG A N    6  
ATOM 3682  C CA   . ARG A 1 8  ? 28.859 3.534   -1.764  1.00 0.00 ? 8  ARG A CA   6  
ATOM 3683  C C    . ARG A 1 8  ? 29.908 3.744   -0.672  1.00 0.00 ? 8  ARG A C    6  
ATOM 3684  O O    . ARG A 1 8  ? 29.730 4.554   0.219   1.00 0.00 ? 8  ARG A O    6  
ATOM 3685  C CB   . ARG A 1 8  ? 28.268 2.115   -1.689  1.00 0.00 ? 8  ARG A CB   6  
ATOM 3686  C CG   . ARG A 1 8  ? 26.822 2.091   -1.170  1.00 0.00 ? 8  ARG A CG   6  
ATOM 3687  C CD   . ARG A 1 8  ? 25.834 1.448   -2.155  1.00 0.00 ? 8  ARG A CD   6  
ATOM 3688  N NE   . ARG A 1 8  ? 25.212 0.273   -1.557  1.00 0.00 ? 8  ARG A NE   6  
ATOM 3689  C CZ   . ARG A 1 8  ? 24.042 -0.232  -2.003  1.00 0.00 ? 8  ARG A CZ   6  
ATOM 3690  N NH1  . ARG A 1 8  ? 23.392 0.333   -3.019  1.00 0.00 ? 8  ARG A NH1  6  
ATOM 3691  N NH2  . ARG A 1 8  ? 23.534 -1.309  -1.412  1.00 0.00 ? 8  ARG A NH2  6  
ATOM 3692  H H    . ARG A 1 8  ? 29.712 2.906   -3.599  1.00 0.00 ? 8  ARG A H    6  
ATOM 3693  H HA   . ARG A 1 8  ? 28.093 4.306   -1.665  1.00 0.00 ? 8  ARG A HA   6  
ATOM 3694  H HB2  . ARG A 1 8  ? 28.329 1.678   -2.682  1.00 0.00 ? 8  ARG A HB2  6  
ATOM 3695  H HB3  . ARG A 1 8  ? 28.869 1.432   -1.085  1.00 0.00 ? 8  ARG A HB3  6  
ATOM 3696  H HG2  . ARG A 1 8  ? 26.796 1.585   -0.207  1.00 0.00 ? 8  ARG A HG2  6  
ATOM 3697  H HG3  . ARG A 1 8  ? 26.469 3.094   -0.932  1.00 0.00 ? 8  ARG A HG3  6  
ATOM 3698  H HD2  . ARG A 1 8  ? 25.058 2.167   -2.411  1.00 0.00 ? 8  ARG A HD2  6  
ATOM 3699  H HD3  . ARG A 1 8  ? 26.296 1.124   -3.087  1.00 0.00 ? 8  ARG A HD3  6  
ATOM 3700  H HE   . ARG A 1 8  ? 25.674 -0.182  -0.797  1.00 0.00 ? 8  ARG A HE   6  
ATOM 3701  H HH11 . ARG A 1 8  ? 23.775 1.142   -3.468  1.00 0.00 ? 8  ARG A HH11 6  
ATOM 3702  H HH12 . ARG A 1 8  ? 22.523 -0.051  -3.329  1.00 0.00 ? 8  ARG A HH12 6  
ATOM 3703  H HH21 . ARG A 1 8  ? 24.020 -1.740  -0.650  1.00 0.00 ? 8  ARG A HH21 6  
ATOM 3704  H HH22 . ARG A 1 8  ? 22.665 -1.685  -1.733  1.00 0.00 ? 8  ARG A HH22 6  
ATOM 3705  N N    . LEU A 1 9  ? 30.998 2.964   -0.840  1.00 0.00 ? 9  LEU A N    6  
ATOM 3706  C CA   . LEU A 1 9  ? 32.203 2.960   -0.027  1.00 0.00 ? 9  LEU A CA   6  
ATOM 3707  C C    . LEU A 1 9  ? 32.793 4.394   -0.032  1.00 0.00 ? 9  LEU A C    6  
ATOM 3708  O O    . LEU A 1 9  ? 33.117 4.949   1.003   1.00 0.00 ? 9  LEU A O    6  
ATOM 3709  C CB   . LEU A 1 9  ? 33.169 1.907   -0.585  1.00 0.00 ? 9  LEU A CB   6  
ATOM 3710  C CG   . LEU A 1 9  ? 32.629 0.461   -0.598  1.00 0.00 ? 9  LEU A CG   6  
ATOM 3711  C CD1  . LEU A 1 9  ? 33.299 -0.305  -1.744  1.00 0.00 ? 9  LEU A CD1  6  
ATOM 3712  C CD2  . LEU A 1 9  ? 32.801 -0.288  0.718   1.00 0.00 ? 9  LEU A CD2  6  
ATOM 3713  H H    . LEU A 1 9  ? 30.979 2.356   -1.620  1.00 0.00 ? 9  LEU A H    6  
ATOM 3714  H HA   . LEU A 1 9  ? 31.927 2.634   0.972   1.00 0.00 ? 9  LEU A HA   6  
ATOM 3715  H HB2  . LEU A 1 9  ? 33.395 2.211   -1.605  1.00 0.00 ? 9  LEU A HB2  6  
ATOM 3716  H HB3  . LEU A 1 9  ? 34.112 1.915   -0.045  1.00 0.00 ? 9  LEU A HB3  6  
ATOM 3717  H HG   . LEU A 1 9  ? 31.552 0.468   -0.740  1.00 0.00 ? 9  LEU A HG   6  
ATOM 3718  H HD11 . LEU A 1 9  ? 34.318 -0.596  -1.494  1.00 0.00 ? 9  LEU A HD11 6  
ATOM 3719  H HD12 . LEU A 1 9  ? 33.366 0.295   -2.640  1.00 0.00 ? 9  LEU A HD12 6  
ATOM 3720  H HD13 . LEU A 1 9  ? 32.724 -1.177  -2.023  1.00 0.00 ? 9  LEU A HD13 6  
ATOM 3721  H HD21 . LEU A 1 9  ? 33.805 -0.695  0.779   1.00 0.00 ? 9  LEU A HD21 6  
ATOM 3722  H HD22 . LEU A 1 9  ? 32.104 -1.123  0.793   1.00 0.00 ? 9  LEU A HD22 6  
ATOM 3723  H HD23 . LEU A 1 9  ? 32.628 0.368   1.569   1.00 0.00 ? 9  LEU A HD23 6  
ATOM 3724  N N    . LYS A 1 10 ? 32.838 4.988   -1.247  1.00 0.00 ? 10 LYS A N    6  
ATOM 3725  C CA   . LYS A 1 10 ? 33.261 6.388   -1.388  1.00 0.00 ? 10 LYS A CA   6  
ATOM 3726  C C    . LYS A 1 10 ? 32.331 7.373   -0.644  1.00 0.00 ? 10 LYS A C    6  
ATOM 3727  O O    . LYS A 1 10 ? 32.781 8.369   -0.099  1.00 0.00 ? 10 LYS A O    6  
ATOM 3728  C CB   . LYS A 1 10 ? 33.252 6.806   -2.878  1.00 0.00 ? 10 LYS A CB   6  
ATOM 3729  C CG   . LYS A 1 10 ? 34.652 6.965   -3.483  1.00 0.00 ? 10 LYS A CG   6  
ATOM 3730  C CD   . LYS A 1 10 ? 34.916 8.385   -4.032  1.00 0.00 ? 10 LYS A CD   6  
ATOM 3731  C CE   . LYS A 1 10 ? 35.467 8.406   -5.464  1.00 0.00 ? 10 LYS A CE   6  
ATOM 3732  N NZ   . LYS A 1 10 ? 36.839 8.887   -5.554  1.00 0.00 ? 10 LYS A NZ   6  
ATOM 3733  H H    . LYS A 1 10 ? 32.499 4.466   -2.029  1.00 0.00 ? 10 LYS A H    6  
ATOM 3734  H HA   . LYS A 1 10 ? 34.253 6.461   -0.927  1.00 0.00 ? 10 LYS A HA   6  
ATOM 3735  H HB2  . LYS A 1 10 ? 32.664 6.119   -3.478  1.00 0.00 ? 10 LYS A HB2  6  
ATOM 3736  H HB3  . LYS A 1 10 ? 32.701 7.736   -3.018  1.00 0.00 ? 10 LYS A HB3  6  
ATOM 3737  H HG2  . LYS A 1 10 ? 35.397 6.736   -2.730  1.00 0.00 ? 10 LYS A HG2  6  
ATOM 3738  H HG3  . LYS A 1 10 ? 34.807 6.192   -4.235  1.00 0.00 ? 10 LYS A HG3  6  
ATOM 3739  H HD2  . LYS A 1 10 ? 34.002 8.976   -4.032  1.00 0.00 ? 10 LYS A HD2  6  
ATOM 3740  H HD3  . LYS A 1 10 ? 35.554 8.948   -3.350  1.00 0.00 ? 10 LYS A HD3  6  
ATOM 3741  H HE2  . LYS A 1 10 ? 35.424 7.434   -5.955  1.00 0.00 ? 10 LYS A HE2  6  
ATOM 3742  H HE3  . LYS A 1 10 ? 34.854 9.082   -6.060  1.00 0.00 ? 10 LYS A HE3  6  
ATOM 3743  H HZ1  . LYS A 1 10 ? 37.505 8.098   -5.440  1.00 0.00 ? 10 LYS A HZ1  6  
ATOM 3744  H HZ2  . LYS A 1 10 ? 37.022 9.593   -4.812  1.00 0.00 ? 10 LYS A HZ2  6  
ATOM 3745  H HZ3  . LYS A 1 10 ? 36.976 9.316   -6.491  1.00 0.00 ? 10 LYS A HZ3  6  
ATOM 3746  N N    . ALA A 1 11 ? 31.016 7.055   -0.693  1.00 0.00 ? 11 ALA A N    6  
ATOM 3747  C CA   . ALA A 1 11 ? 30.002 7.948   -0.130  1.00 0.00 ? 11 ALA A CA   6  
ATOM 3748  C C    . ALA A 1 11 ? 30.100 8.067   1.403   1.00 0.00 ? 11 ALA A C    6  
ATOM 3749  O O    . ALA A 1 11 ? 29.603 9.022   1.982   1.00 0.00 ? 11 ALA A O    6  
ATOM 3750  C CB   . ALA A 1 11 ? 28.596 7.487   -0.535  1.00 0.00 ? 11 ALA A CB   6  
ATOM 3751  H H    . ALA A 1 11 ? 30.728 6.216   -1.151  1.00 0.00 ? 11 ALA A H    6  
ATOM 3752  H HA   . ALA A 1 11 ? 30.175 8.936   -0.561  1.00 0.00 ? 11 ALA A HA   6  
ATOM 3753  H HB1  . ALA A 1 11 ? 28.418 7.686   -1.590  1.00 0.00 ? 11 ALA A HB1  6  
ATOM 3754  H HB2  . ALA A 1 11 ? 27.818 8.007   0.025   1.00 0.00 ? 11 ALA A HB2  6  
ATOM 3755  H HB3  . ALA A 1 11 ? 28.448 6.423   -0.373  1.00 0.00 ? 11 ALA A HB3  6  
ATOM 3756  N N    . LEU A 1 12 ? 30.784 7.074   2.018   1.00 0.00 ? 12 LEU A N    6  
ATOM 3757  C CA   . LEU A 1 12 ? 31.030 7.116   3.454   1.00 0.00 ? 12 LEU A CA   6  
ATOM 3758  C C    . LEU A 1 12 ? 32.174 8.109   3.821   1.00 0.00 ? 12 LEU A C    6  
ATOM 3759  O O    . LEU A 1 12 ? 32.531 8.220   4.985   1.00 0.00 ? 12 LEU A O    6  
ATOM 3760  C CB   . LEU A 1 12 ? 31.398 5.706   3.944   1.00 0.00 ? 12 LEU A CB   6  
ATOM 3761  C CG   . LEU A 1 12 ? 30.282 4.637   3.955   1.00 0.00 ? 12 LEU A CG   6  
ATOM 3762  C CD1  . LEU A 1 12 ? 30.466 3.642   2.811   1.00 0.00 ? 12 LEU A CD1  6  
ATOM 3763  C CD2  . LEU A 1 12 ? 30.292 3.842   5.264   1.00 0.00 ? 12 LEU A CD2  6  
ATOM 3764  H H    . LEU A 1 12 ? 31.167 6.315   1.492   1.00 0.00 ? 12 LEU A H    6  
ATOM 3765  H HA   . LEU A 1 12 ? 30.116 7.454   3.946   1.00 0.00 ? 12 LEU A HA   6  
ATOM 3766  H HB2  . LEU A 1 12 ? 32.207 5.365   3.310   1.00 0.00 ? 12 LEU A HB2  6  
ATOM 3767  H HB3  . LEU A 1 12 ? 31.801 5.784   4.948   1.00 0.00 ? 12 LEU A HB3  6  
ATOM 3768  H HG   . LEU A 1 12 ? 29.315 5.129   3.853   1.00 0.00 ? 12 LEU A HG   6  
ATOM 3769  H HD11 . LEU A 1 12 ? 30.972 4.152   2.005   1.00 0.00 ? 12 LEU A HD11 6  
ATOM 3770  H HD12 . LEU A 1 12 ? 29.515 3.247   2.450   1.00 0.00 ? 12 LEU A HD12 6  
ATOM 3771  H HD13 . LEU A 1 12 ? 31.103 2.799   3.088   1.00 0.00 ? 12 LEU A HD13 6  
ATOM 3772  H HD21 . LEU A 1 12 ? 31.196 3.242   5.324   1.00 0.00 ? 12 LEU A HD21 6  
ATOM 3773  H HD22 . LEU A 1 12 ? 29.456 3.146   5.310   1.00 0.00 ? 12 LEU A HD22 6  
ATOM 3774  H HD23 . LEU A 1 12 ? 30.267 4.497   6.134   1.00 0.00 ? 12 LEU A HD23 6  
ATOM 3775  N N    . GLY A 1 13 ? 32.712 8.816   2.793   1.00 0.00 ? 13 GLY A N    6  
ATOM 3776  C CA   . GLY A 1 13 ? 33.736 9.846   2.986   1.00 0.00 ? 13 GLY A CA   6  
ATOM 3777  C C    . GLY A 1 13 ? 35.149 9.368   2.613   1.00 0.00 ? 13 GLY A C    6  
ATOM 3778  O O    . GLY A 1 13 ? 36.136 9.895   3.114   1.00 0.00 ? 13 GLY A O    6  
ATOM 3779  H H    . GLY A 1 13 ? 32.360 8.676   1.870   1.00 0.00 ? 13 GLY A H    6  
ATOM 3780  H HA2  . GLY A 1 13 ? 33.460 10.692  2.356   1.00 0.00 ? 13 GLY A HA2  6  
ATOM 3781  H HA3  . GLY A 1 13 ? 33.728 10.170  4.028   1.00 0.00 ? 13 GLY A HA3  6  
ATOM 3782  N N    . PHE A 1 14 ? 35.182 8.332   1.734   1.00 0.00 ? 14 PHE A N    6  
ATOM 3783  C CA   . PHE A 1 14 ? 36.427 7.645   1.381   1.00 0.00 ? 14 PHE A CA   6  
ATOM 3784  C C    . PHE A 1 14 ? 36.823 8.021   -0.063  1.00 0.00 ? 14 PHE A C    6  
ATOM 3785  O O    . PHE A 1 14 ? 36.570 9.137   -0.503  1.00 0.00 ? 14 PHE A O    6  
ATOM 3786  C CB   . PHE A 1 14 ? 36.231 6.124   1.591   1.00 0.00 ? 14 PHE A CB   6  
ATOM 3787  C CG   . PHE A 1 14 ? 35.664 5.771   2.946   1.00 0.00 ? 14 PHE A CG   6  
ATOM 3788  C CD1  . PHE A 1 14 ? 35.828 6.597   4.062   1.00 0.00 ? 14 PHE A CD1  6  
ATOM 3789  C CD2  . PHE A 1 14 ? 34.909 4.612   3.081   1.00 0.00 ? 14 PHE A CD2  6  
ATOM 3790  C CE1  . PHE A 1 14 ? 35.152 6.328   5.238   1.00 0.00 ? 14 PHE A CE1  6  
ATOM 3791  C CE2  . PHE A 1 14 ? 34.240 4.337   4.261   1.00 0.00 ? 14 PHE A CE2  6  
ATOM 3792  C CZ   . PHE A 1 14 ? 34.336 5.221   5.330   1.00 0.00 ? 14 PHE A CZ   6  
ATOM 3793  H H    . PHE A 1 14 ? 34.331 7.982   1.346   1.00 0.00 ? 14 PHE A H    6  
ATOM 3794  H HA   . PHE A 1 14 ? 37.211 8.028   2.034   1.00 0.00 ? 14 PHE A HA   6  
ATOM 3795  H HB2  . PHE A 1 14 ? 35.548 5.757   0.820   1.00 0.00 ? 14 PHE A HB2  6  
ATOM 3796  H HB3  . PHE A 1 14 ? 37.161 5.577   1.478   1.00 0.00 ? 14 PHE A HB3  6  
ATOM 3797  H HD1  . PHE A 1 14 ? 36.465 7.471   4.048   1.00 0.00 ? 14 PHE A HD1  6  
ATOM 3798  H HD2  . PHE A 1 14 ? 34.835 3.910   2.259   1.00 0.00 ? 14 PHE A HD2  6  
ATOM 3799  H HE1  . PHE A 1 14 ? 35.246 6.983   6.089   1.00 0.00 ? 14 PHE A HE1  6  
ATOM 3800  H HE2  . PHE A 1 14 ? 33.627 3.449   4.318   1.00 0.00 ? 14 PHE A HE2  6  
ATOM 3801  H HZ   . PHE A 1 14 ? 33.779 5.074   6.245   1.00 0.00 ? 14 PHE A HZ   6  
ATOM 3802  N N    . GLU A 1 15 ? 37.455 7.055   -0.767  1.00 0.00 ? 15 GLU A N    6  
ATOM 3803  C CA   . GLU A 1 15 ? 37.940 7.275   -2.128  1.00 0.00 ? 15 GLU A CA   6  
ATOM 3804  C C    . GLU A 1 15 ? 38.034 5.922   -2.826  1.00 0.00 ? 15 GLU A C    6  
ATOM 3805  O O    . GLU A 1 15 ? 38.506 4.955   -2.244  1.00 0.00 ? 15 GLU A O    6  
ATOM 3806  C CB   . GLU A 1 15 ? 39.299 7.995   -2.119  1.00 0.00 ? 15 GLU A CB   6  
ATOM 3807  C CG   . GLU A 1 15 ? 39.562 8.813   -3.393  1.00 0.00 ? 15 GLU A CG   6  
ATOM 3808  C CD   . GLU A 1 15 ? 40.378 8.032   -4.438  1.00 0.00 ? 15 GLU A CD   6  
ATOM 3809  O OE1  . GLU A 1 15 ? 41.605 8.051   -4.355  1.00 0.00 ? 15 GLU A OE1  6  
ATOM 3810  O OE2  . GLU A 1 15 ? 39.784 7.430   -5.331  1.00 0.00 ? 15 GLU A OE2  6  
ATOM 3811  H H    . GLU A 1 15 ? 37.598 6.161   -0.342  1.00 0.00 ? 15 GLU A H    6  
ATOM 3812  H HA   . GLU A 1 15 ? 37.207 7.895   -2.636  1.00 0.00 ? 15 GLU A HA   6  
ATOM 3813  H HB2  . GLU A 1 15 ? 39.297 8.678   -1.272  1.00 0.00 ? 15 GLU A HB2  6  
ATOM 3814  H HB3  . GLU A 1 15 ? 40.132 7.317   -1.935  1.00 0.00 ? 15 GLU A HB3  6  
ATOM 3815  H HG2  . GLU A 1 15 ? 38.631 9.163   -3.832  1.00 0.00 ? 15 GLU A HG2  6  
ATOM 3816  H HG3  . GLU A 1 15 ? 40.115 9.716   -3.140  1.00 0.00 ? 15 GLU A HG3  6  
ATOM 3817  N N    . GLU A 1 16 ? 37.561 5.924   -4.090  1.00 0.00 ? 16 GLU A N    6  
ATOM 3818  C CA   . GLU A 1 16 ? 37.446 4.758   -4.965  1.00 0.00 ? 16 GLU A CA   6  
ATOM 3819  C C    . GLU A 1 16 ? 38.710 3.845   -5.000  1.00 0.00 ? 16 GLU A C    6  
ATOM 3820  O O    . GLU A 1 16 ? 38.623 2.683   -5.366  1.00 0.00 ? 16 GLU A O    6  
ATOM 3821  C CB   . GLU A 1 16 ? 37.010 5.229   -6.361  1.00 0.00 ? 16 GLU A CB   6  
ATOM 3822  C CG   . GLU A 1 16 ? 37.320 4.286   -7.544  1.00 0.00 ? 16 GLU A CG   6  
ATOM 3823  C CD   . GLU A 1 16 ? 38.780 4.340   -8.043  1.00 0.00 ? 16 GLU A CD   6  
ATOM 3824  O OE1  . GLU A 1 16 ? 39.491 5.285   -7.707  1.00 0.00 ? 16 GLU A OE1  6  
ATOM 3825  O OE2  . GLU A 1 16 ? 39.192 3.429   -8.762  1.00 0.00 ? 16 GLU A OE2  6  
ATOM 3826  H H    . GLU A 1 16 ? 37.220 6.799   -4.429  1.00 0.00 ? 16 GLU A H    6  
ATOM 3827  H HA   . GLU A 1 16 ? 36.595 4.212   -4.564  1.00 0.00 ? 16 GLU A HA   6  
ATOM 3828  H HB2  . GLU A 1 16 ? 35.926 5.354   -6.331  1.00 0.00 ? 16 GLU A HB2  6  
ATOM 3829  H HB3  . GLU A 1 16 ? 37.417 6.221   -6.553  1.00 0.00 ? 16 GLU A HB3  6  
ATOM 3830  H HG2  . GLU A 1 16 ? 37.079 3.257   -7.299  1.00 0.00 ? 16 GLU A HG2  6  
ATOM 3831  H HG3  . GLU A 1 16 ? 36.673 4.553   -8.376  1.00 0.00 ? 16 GLU A HG3  6  
ATOM 3832  N N    . SER A 1 17 ? 39.868 4.410   -4.605  1.00 0.00 ? 17 SER A N    6  
ATOM 3833  C CA   . SER A 1 17 ? 41.097 3.637   -4.539  1.00 0.00 ? 17 SER A CA   6  
ATOM 3834  C C    . SER A 1 17 ? 41.149 2.807   -3.250  1.00 0.00 ? 17 SER A C    6  
ATOM 3835  O O    . SER A 1 17 ? 41.331 1.601   -3.302  1.00 0.00 ? 17 SER A O    6  
ATOM 3836  C CB   . SER A 1 17 ? 42.279 4.610   -4.581  1.00 0.00 ? 17 SER A CB   6  
ATOM 3837  O OG   . SER A 1 17 ? 42.716 4.879   -5.900  1.00 0.00 ? 17 SER A OG   6  
ATOM 3838  H H    . SER A 1 17 ? 39.886 5.362   -4.306  1.00 0.00 ? 17 SER A H    6  
ATOM 3839  H HA   . SER A 1 17 ? 41.104 2.947   -5.390  1.00 0.00 ? 17 SER A HA   6  
ATOM 3840  H HB2  . SER A 1 17 ? 42.028 5.537   -4.059  1.00 0.00 ? 17 SER A HB2  6  
ATOM 3841  H HB3  . SER A 1 17 ? 43.137 4.203   -4.048  1.00 0.00 ? 17 SER A HB3  6  
ATOM 3842  H HG   . SER A 1 17 ? 41.977 5.119   -6.448  1.00 0.00 ? 17 SER A HG   6  
ATOM 3843  N N    . LEU A 1 18 ? 40.973 3.507   -2.099  1.00 0.00 ? 18 LEU A N    6  
ATOM 3844  C CA   . LEU A 1 18 ? 40.978 2.787   -0.820  1.00 0.00 ? 18 LEU A CA   6  
ATOM 3845  C C    . LEU A 1 18 ? 39.787 1.836   -0.709  1.00 0.00 ? 18 LEU A C    6  
ATOM 3846  O O    . LEU A 1 18 ? 39.827 0.870   0.044   1.00 0.00 ? 18 LEU A O    6  
ATOM 3847  C CB   . LEU A 1 18 ? 41.094 3.737   0.389   1.00 0.00 ? 18 LEU A CB   6  
ATOM 3848  C CG   . LEU A 1 18 ? 39.817 4.405   0.952   1.00 0.00 ? 18 LEU A CG   6  
ATOM 3849  C CD1  . LEU A 1 18 ? 39.582 4.040   2.428   1.00 0.00 ? 18 LEU A CD1  6  
ATOM 3850  C CD2  . LEU A 1 18 ? 39.892 5.926   0.818   1.00 0.00 ? 18 LEU A CD2  6  
ATOM 3851  H H    . LEU A 1 18 ? 40.778 4.485   -2.145  1.00 0.00 ? 18 LEU A H    6  
ATOM 3852  H HA   . LEU A 1 18 ? 41.877 2.170   -0.828  1.00 0.00 ? 18 LEU A HA   6  
ATOM 3853  H HB2  . LEU A 1 18 ? 41.551 3.172   1.192   1.00 0.00 ? 18 LEU A HB2  6  
ATOM 3854  H HB3  . LEU A 1 18 ? 41.838 4.492   0.155   1.00 0.00 ? 18 LEU A HB3  6  
ATOM 3855  H HG   . LEU A 1 18 ? 38.957 4.072   0.380   1.00 0.00 ? 18 LEU A HG   6  
ATOM 3856  H HD11 . LEU A 1 18 ? 39.474 2.963   2.568   1.00 0.00 ? 18 LEU A HD11 6  
ATOM 3857  H HD12 . LEU A 1 18 ? 38.686 4.538   2.799   1.00 0.00 ? 18 LEU A HD12 6  
ATOM 3858  H HD13 . LEU A 1 18 ? 40.406 4.370   3.060   1.00 0.00 ? 18 LEU A HD13 6  
ATOM 3859  H HD21 . LEU A 1 18 ? 40.809 6.315   1.253   1.00 0.00 ? 18 LEU A HD21 6  
ATOM 3860  H HD22 . LEU A 1 18 ? 39.064 6.432   1.314   1.00 0.00 ? 18 LEU A HD22 6  
ATOM 3861  H HD23 . LEU A 1 18 ? 39.892 6.193   -0.231  1.00 0.00 ? 18 LEU A HD23 6  
ATOM 3862  N N    . VAL A 1 19 ? 38.768 2.171   -1.512  1.00 0.00 ? 19 VAL A N    6  
ATOM 3863  C CA   . VAL A 1 19 ? 37.497 1.486   -1.673  1.00 0.00 ? 19 VAL A CA   6  
ATOM 3864  C C    . VAL A 1 19 ? 37.694 0.170   -2.433  1.00 0.00 ? 19 VAL A C    6  
ATOM 3865  O O    . VAL A 1 19 ? 37.335 -0.890  -1.950  1.00 0.00 ? 19 VAL A O    6  
ATOM 3866  C CB   . VAL A 1 19 ? 36.617 2.463   -2.464  1.00 0.00 ? 19 VAL A CB   6  
ATOM 3867  C CG1  . VAL A 1 19 ? 35.559 1.803   -3.339  1.00 0.00 ? 19 VAL A CG1  6  
ATOM 3868  C CG2  . VAL A 1 19 ? 36.035 3.617   -1.627  1.00 0.00 ? 19 VAL A CG2  6  
ATOM 3869  H H    . VAL A 1 19 ? 38.906 2.965   -2.109  1.00 0.00 ? 19 VAL A H    6  
ATOM 3870  H HA   . VAL A 1 19 ? 37.073 1.253   -0.699  1.00 0.00 ? 19 VAL A HA   6  
ATOM 3871  H HB   . VAL A 1 19 ? 37.312 2.924   -3.156  1.00 0.00 ? 19 VAL A HB   6  
ATOM 3872  H HG11 . VAL A 1 19 ? 35.937 1.740   -4.356  1.00 0.00 ? 19 VAL A HG11 6  
ATOM 3873  H HG12 . VAL A 1 19 ? 34.656 2.399   -3.344  1.00 0.00 ? 19 VAL A HG12 6  
ATOM 3874  H HG13 . VAL A 1 19 ? 35.297 0.795   -3.028  1.00 0.00 ? 19 VAL A HG13 6  
ATOM 3875  H HG21 . VAL A 1 19 ? 36.761 4.003   -0.919  1.00 0.00 ? 19 VAL A HG21 6  
ATOM 3876  H HG22 . VAL A 1 19 ? 35.167 3.366   -1.037  1.00 0.00 ? 19 VAL A HG22 6  
ATOM 3877  H HG23 . VAL A 1 19 ? 35.719 4.427   -2.281  1.00 0.00 ? 19 VAL A HG23 6  
ATOM 3878  N N    . ILE A 1 20 ? 38.258 0.316   -3.655  1.00 0.00 ? 20 ILE A N    6  
ATOM 3879  C CA   . ILE A 1 20 ? 38.473 -0.834  -4.526  1.00 0.00 ? 20 ILE A CA   6  
ATOM 3880  C C    . ILE A 1 20 ? 39.325 -1.873  -3.810  1.00 0.00 ? 20 ILE A C    6  
ATOM 3881  O O    . ILE A 1 20 ? 38.963 -3.034  -3.780  1.00 0.00 ? 20 ILE A O    6  
ATOM 3882  C CB   . ILE A 1 20 ? 39.098 -0.418  -5.880  1.00 0.00 ? 20 ILE A CB   6  
ATOM 3883  C CG1  . ILE A 1 20 ? 38.047 0.138   -6.854  1.00 0.00 ? 20 ILE A CG1  6  
ATOM 3884  C CG2  . ILE A 1 20 ? 39.881 -1.554  -6.566  1.00 0.00 ? 20 ILE A CG2  6  
ATOM 3885  C CD1  . ILE A 1 20 ? 37.182 -0.959  -7.496  1.00 0.00 ? 20 ILE A CD1  6  
ATOM 3886  H H    . ILE A 1 20 ? 38.513 1.226   -3.971  1.00 0.00 ? 20 ILE A H    6  
ATOM 3887  H HA   . ILE A 1 20 ? 37.498 -1.295  -4.683  1.00 0.00 ? 20 ILE A HA   6  
ATOM 3888  H HB   . ILE A 1 20 ? 39.808 0.382   -5.668  1.00 0.00 ? 20 ILE A HB   6  
ATOM 3889  H HG12 . ILE A 1 20 ? 37.429 0.867   -6.336  1.00 0.00 ? 20 ILE A HG12 6  
ATOM 3890  H HG13 . ILE A 1 20 ? 38.537 0.695   -7.654  1.00 0.00 ? 20 ILE A HG13 6  
ATOM 3891  H HG21 . ILE A 1 20 ? 40.224 -1.259  -7.556  1.00 0.00 ? 20 ILE A HG21 6  
ATOM 3892  H HG22 . ILE A 1 20 ? 39.276 -2.454  -6.676  1.00 0.00 ? 20 ILE A HG22 6  
ATOM 3893  H HG23 . ILE A 1 20 ? 40.757 -1.837  -5.993  1.00 0.00 ? 20 ILE A HG23 6  
ATOM 3894  H HD11 . ILE A 1 20 ? 37.748 -1.553  -8.213  1.00 0.00 ? 20 ILE A HD11 6  
ATOM 3895  H HD12 . ILE A 1 20 ? 36.354 -0.508  -8.038  1.00 0.00 ? 20 ILE A HD12 6  
ATOM 3896  H HD13 . ILE A 1 20 ? 36.778 -1.657  -6.761  1.00 0.00 ? 20 ILE A HD13 6  
ATOM 3897  N N    . GLN A 1 21 ? 40.444 -1.381  -3.238  1.00 0.00 ? 21 GLN A N    6  
ATOM 3898  C CA   . GLN A 1 21 ? 41.356 -2.253  -2.512  1.00 0.00 ? 21 GLN A CA   6  
ATOM 3899  C C    . GLN A 1 21 ? 40.760 -2.734  -1.174  1.00 0.00 ? 21 GLN A C    6  
ATOM 3900  O O    . GLN A 1 21 ? 41.150 -3.782  -0.687  1.00 0.00 ? 21 GLN A O    6  
ATOM 3901  C CB   . GLN A 1 21 ? 42.706 -1.548  -2.272  1.00 0.00 ? 21 GLN A CB   6  
ATOM 3902  C CG   . GLN A 1 21 ? 43.460 -1.110  -3.540  1.00 0.00 ? 21 GLN A CG   6  
ATOM 3903  C CD   . GLN A 1 21 ? 43.538 -2.216  -4.606  1.00 0.00 ? 21 GLN A CD   6  
ATOM 3904  O OE1  . GLN A 1 21 ? 43.758 -3.384  -4.320  1.00 0.00 ? 21 GLN A OE1  6  
ATOM 3905  N NE2  . GLN A 1 21 ? 43.327 -1.754  -5.852  1.00 0.00 ? 21 GLN A NE2  6  
ATOM 3906  H H    . GLN A 1 21 ? 40.653 -0.411  -3.339  1.00 0.00 ? 21 GLN A H    6  
ATOM 3907  H HA   . GLN A 1 21 ? 41.502 -3.141  -3.131  1.00 0.00 ? 21 GLN A HA   6  
ATOM 3908  H HB2  . GLN A 1 21 ? 42.557 -0.670  -1.641  1.00 0.00 ? 21 GLN A HB2  6  
ATOM 3909  H HB3  . GLN A 1 21 ? 43.364 -2.210  -1.710  1.00 0.00 ? 21 GLN A HB3  6  
ATOM 3910  H HG2  . GLN A 1 21 ? 42.994 -0.229  -3.974  1.00 0.00 ? 21 GLN A HG2  6  
ATOM 3911  H HG3  . GLN A 1 21 ? 44.478 -0.817  -3.284  1.00 0.00 ? 21 GLN A HG3  6  
ATOM 3912  H HE21 . GLN A 1 21 ? 43.209 -0.774  -6.012  1.00 0.00 ? 21 GLN A HE21 6  
ATOM 3913  H HE22 . GLN A 1 21 ? 43.285 -2.388  -6.623  1.00 0.00 ? 21 GLN A HE22 6  
ATOM 3914  N N    . ALA A 1 22 ? 39.800 -1.947  -0.626  1.00 0.00 ? 22 ALA A N    6  
ATOM 3915  C CA   . ALA A 1 22 ? 39.072 -2.358  0.579   1.00 0.00 ? 22 ALA A CA   6  
ATOM 3916  C C    . ALA A 1 22 ? 37.936 -3.338  0.280   1.00 0.00 ? 22 ALA A C    6  
ATOM 3917  O O    . ALA A 1 22 ? 37.366 -3.905  1.199   1.00 0.00 ? 22 ALA A O    6  
ATOM 3918  C CB   . ALA A 1 22 ? 38.383 -1.168  1.253   1.00 0.00 ? 22 ALA A CB   6  
ATOM 3919  H H    . ALA A 1 22 ? 39.536 -1.109  -1.102  1.00 0.00 ? 22 ALA A H    6  
ATOM 3920  H HA   . ALA A 1 22 ? 39.783 -2.849  1.247   1.00 0.00 ? 22 ALA A HA   6  
ATOM 3921  H HB1  . ALA A 1 22 ? 39.104 -0.476  1.669   1.00 0.00 ? 22 ALA A HB1  6  
ATOM 3922  H HB2  . ALA A 1 22 ? 37.765 -1.501  2.088   1.00 0.00 ? 22 ALA A HB2  6  
ATOM 3923  H HB3  . ALA A 1 22 ? 37.741 -0.611  0.568   1.00 0.00 ? 22 ALA A HB3  6  
ATOM 3924  N N    . TYR A 1 23 ? 37.622 -3.474  -1.025  1.00 0.00 ? 23 TYR A N    6  
ATOM 3925  C CA   . TYR A 1 23 ? 36.536 -4.341  -1.465  1.00 0.00 ? 23 TYR A CA   6  
ATOM 3926  C C    . TYR A 1 23 ? 37.106 -5.589  -2.144  1.00 0.00 ? 23 TYR A C    6  
ATOM 3927  O O    . TYR A 1 23 ? 36.455 -6.617  -2.184  1.00 0.00 ? 23 TYR A O    6  
ATOM 3928  C CB   . TYR A 1 23 ? 35.604 -3.570  -2.421  1.00 0.00 ? 23 TYR A CB   6  
ATOM 3929  C CG   . TYR A 1 23 ? 34.155 -3.900  -2.189  1.00 0.00 ? 23 TYR A CG   6  
ATOM 3930  C CD1  . TYR A 1 23 ? 33.500 -3.341  -1.105  1.00 0.00 ? 23 TYR A CD1  6  
ATOM 3931  C CD2  . TYR A 1 23 ? 33.458 -4.751  -3.032  1.00 0.00 ? 23 TYR A CD2  6  
ATOM 3932  C CE1  . TYR A 1 23 ? 32.161 -3.612  -0.855  1.00 0.00 ? 23 TYR A CE1  6  
ATOM 3933  C CE2  . TYR A 1 23 ? 32.120 -5.041  -2.790  1.00 0.00 ? 23 TYR A CE2  6  
ATOM 3934  C CZ   . TYR A 1 23 ? 31.468 -4.454  -1.709  1.00 0.00 ? 23 TYR A CZ   6  
ATOM 3935  O OH   . TYR A 1 23 ? 30.129 -4.684  -1.458  1.00 0.00 ? 23 TYR A OH   6  
ATOM 3936  H H    . TYR A 1 23 ? 38.131 -2.961  -1.714  1.00 0.00 ? 23 TYR A H    6  
ATOM 3937  H HA   . TYR A 1 23 ? 35.982 -4.664  -0.580  1.00 0.00 ? 23 TYR A HA   6  
ATOM 3938  H HB2  . TYR A 1 23 ? 35.693 -2.508  -2.226  1.00 0.00 ? 23 TYR A HB2  6  
ATOM 3939  H HB3  . TYR A 1 23 ? 35.876 -3.689  -3.472  1.00 0.00 ? 23 TYR A HB3  6  
ATOM 3940  H HD1  . TYR A 1 23 ? 34.055 -2.665  -0.473  1.00 0.00 ? 23 TYR A HD1  6  
ATOM 3941  H HD2  . TYR A 1 23 ? 33.972 -5.182  -3.875  1.00 0.00 ? 23 TYR A HD2  6  
ATOM 3942  H HE1  . TYR A 1 23 ? 31.657 -3.178  -0.001  1.00 0.00 ? 23 TYR A HE1  6  
ATOM 3943  H HE2  . TYR A 1 23 ? 31.610 -5.738  -3.437  1.00 0.00 ? 23 TYR A HE2  6  
ATOM 3944  H HH   . TYR A 1 23 ? 29.875 -5.551  -1.741  1.00 0.00 ? 23 TYR A HH   6  
ATOM 3945  N N    . PHE A 1 24 ? 38.342 -5.448  -2.666  1.00 0.00 ? 24 PHE A N    6  
ATOM 3946  C CA   . PHE A 1 24 ? 39.020 -6.525  -3.382  1.00 0.00 ? 24 PHE A CA   6  
ATOM 3947  C C    . PHE A 1 24 ? 39.824 -7.376  -2.383  1.00 0.00 ? 24 PHE A C    6  
ATOM 3948  O O    . PHE A 1 24 ? 39.836 -8.595  -2.455  1.00 0.00 ? 24 PHE A O    6  
ATOM 3949  C CB   . PHE A 1 24 ? 39.964 -5.942  -4.460  1.00 0.00 ? 24 PHE A CB   6  
ATOM 3950  C CG   . PHE A 1 24 ? 39.444 -6.111  -5.865  1.00 0.00 ? 24 PHE A CG   6  
ATOM 3951  C CD1  . PHE A 1 24 ? 38.370 -5.365  -6.342  1.00 0.00 ? 24 PHE A CD1  6  
ATOM 3952  C CD2  . PHE A 1 24 ? 40.035 -7.044  -6.709  1.00 0.00 ? 24 PHE A CD2  6  
ATOM 3953  C CE1  . PHE A 1 24 ? 37.895 -5.554  -7.635  1.00 0.00 ? 24 PHE A CE1  6  
ATOM 3954  C CE2  . PHE A 1 24 ? 39.567 -7.237  -8.000  1.00 0.00 ? 24 PHE A CE2  6  
ATOM 3955  C CZ   . PHE A 1 24 ? 38.494 -6.493  -8.464  1.00 0.00 ? 24 PHE A CZ   6  
ATOM 3956  H H    . PHE A 1 24 ? 38.845 -4.604  -2.494  1.00 0.00 ? 24 PHE A H    6  
ATOM 3957  H HA   . PHE A 1 24 ? 38.247 -7.157  -3.822  1.00 0.00 ? 24 PHE A HA   6  
ATOM 3958  H HB2  . PHE A 1 24 ? 40.152 -4.889  -4.281  1.00 0.00 ? 24 PHE A HB2  6  
ATOM 3959  H HB3  . PHE A 1 24 ? 40.946 -6.414  -4.402  1.00 0.00 ? 24 PHE A HB3  6  
ATOM 3960  H HD1  . PHE A 1 24 ? 37.889 -4.641  -5.704  1.00 0.00 ? 24 PHE A HD1  6  
ATOM 3961  H HD2  . PHE A 1 24 ? 40.855 -7.643  -6.349  1.00 0.00 ? 24 PHE A HD2  6  
ATOM 3962  H HE1  . PHE A 1 24 ? 37.054 -4.979  -7.994  1.00 0.00 ? 24 PHE A HE1  6  
ATOM 3963  H HE2  . PHE A 1 24 ? 40.031 -7.978  -8.633  1.00 0.00 ? 24 PHE A HE2  6  
ATOM 3964  H HZ   . PHE A 1 24 ? 38.123 -6.654  -9.464  1.00 0.00 ? 24 PHE A HZ   6  
ATOM 3965  N N    . ALA A 1 25 ? 40.489 -6.648  -1.451  1.00 0.00 ? 25 ALA A N    6  
ATOM 3966  C CA   . ALA A 1 25 ? 41.274 -7.296  -0.403  1.00 0.00 ? 25 ALA A CA   6  
ATOM 3967  C C    . ALA A 1 25 ? 40.362 -7.989  0.625   1.00 0.00 ? 25 ALA A C    6  
ATOM 3968  O O    . ALA A 1 25 ? 40.754 -8.954  1.265   1.00 0.00 ? 25 ALA A O    6  
ATOM 3969  C CB   . ALA A 1 25 ? 42.162 -6.268  0.306   1.00 0.00 ? 25 ALA A CB   6  
ATOM 3970  H H    . ALA A 1 25 ? 40.432 -5.653  -1.461  1.00 0.00 ? 25 ALA A H    6  
ATOM 3971  H HA   . ALA A 1 25 ? 41.903 -8.042  -0.890  1.00 0.00 ? 25 ALA A HA   6  
ATOM 3972  H HB1  . ALA A 1 25 ? 42.854 -6.749  0.997   1.00 0.00 ? 25 ALA A HB1  6  
ATOM 3973  H HB2  . ALA A 1 25 ? 41.574 -5.555  0.883   1.00 0.00 ? 25 ALA A HB2  6  
ATOM 3974  H HB3  . ALA A 1 25 ? 42.759 -5.713  -0.418  1.00 0.00 ? 25 ALA A HB3  6  
ATOM 3975  N N    . CYS A 1 26 ? 39.126 -7.447  0.717   1.00 0.00 ? 26 CYS A N    6  
ATOM 3976  C CA   . CYS A 1 26 ? 38.096 -8.033  1.569   1.00 0.00 ? 26 CYS A CA   6  
ATOM 3977  C C    . CYS A 1 26 ? 37.383 -9.224  0.906   1.00 0.00 ? 26 CYS A C    6  
ATOM 3978  O O    . CYS A 1 26 ? 36.456 -9.769  1.490   1.00 0.00 ? 26 CYS A O    6  
ATOM 3979  C CB   . CYS A 1 26 ? 37.054 -6.959  1.903   1.00 0.00 ? 26 CYS A CB   6  
ATOM 3980  S SG   . CYS A 1 26 ? 37.371 -6.265  3.545   1.00 0.00 ? 26 CYS A SG   6  
ATOM 3981  H H    . CYS A 1 26 ? 38.924 -6.624  0.188   1.00 0.00 ? 26 CYS A H    6  
ATOM 3982  H HA   . CYS A 1 26 ? 38.592 -8.381  2.479   1.00 0.00 ? 26 CYS A HA   6  
ATOM 3983  H HB2  . CYS A 1 26 ? 37.121 -6.177  1.156   1.00 0.00 ? 26 CYS A HB2  6  
ATOM 3984  H HB3  . CYS A 1 26 ? 36.021 -7.317  1.826   1.00 0.00 ? 26 CYS A HB3  6  
ATOM 3985  H HG   . CYS A 1 26 ? 37.314 -4.936  3.497   1.00 0.00 ? 26 CYS A HG   6  
ATOM 3986  N N    . GLU A 1 27 ? 37.826 -9.587  -0.326  1.00 0.00 ? 27 GLU A N    6  
ATOM 3987  C CA   . GLU A 1 27 ? 37.168 -10.650 -1.089  1.00 0.00 ? 27 GLU A CA   6  
ATOM 3988  C C    . GLU A 1 27 ? 35.685 -10.301 -1.341  1.00 0.00 ? 27 GLU A C    6  
ATOM 3989  O O    . GLU A 1 27 ? 34.774 -10.991 -0.917  1.00 0.00 ? 27 GLU A O    6  
ATOM 3990  C CB   . GLU A 1 27 ? 37.411 -12.013 -0.401  1.00 0.00 ? 27 GLU A CB   6  
ATOM 3991  C CG   . GLU A 1 27 ? 36.529 -13.191 -0.884  1.00 0.00 ? 27 GLU A CG   6  
ATOM 3992  C CD   . GLU A 1 27 ? 35.327 -13.497 0.052   1.00 0.00 ? 27 GLU A CD   6  
ATOM 3993  O OE1  . GLU A 1 27 ? 35.500 -13.444 1.269   1.00 0.00 ? 27 GLU A OE1  6  
ATOM 3994  O OE2  . GLU A 1 27 ? 34.232 -13.777 -0.442  1.00 0.00 ? 27 GLU A OE2  6  
ATOM 3995  H H    . GLU A 1 27 ? 38.639 -9.160  -0.720  1.00 0.00 ? 27 GLU A H    6  
ATOM 3996  H HA   . GLU A 1 27 ? 37.661 -10.667 -2.061  1.00 0.00 ? 27 GLU A HA   6  
ATOM 3997  H HB2  . GLU A 1 27 ? 38.449 -12.282 -0.592  1.00 0.00 ? 27 GLU A HB2  6  
ATOM 3998  H HB3  . GLU A 1 27 ? 37.381 -11.906 0.681   1.00 0.00 ? 27 GLU A HB3  6  
ATOM 3999  H HG2  . GLU A 1 27 ? 36.184 -13.014 -1.902  1.00 0.00 ? 27 GLU A HG2  6  
ATOM 4000  H HG3  . GLU A 1 27 ? 37.137 -14.091 -0.951  1.00 0.00 ? 27 GLU A HG3  6  
ATOM 4001  N N    . LYS A 1 28 ? 35.523 -9.170  -2.060  1.00 0.00 ? 28 LYS A N    6  
ATOM 4002  C CA   . LYS A 1 28 ? 34.241 -8.643  -2.526  1.00 0.00 ? 28 LYS A CA   6  
ATOM 4003  C C    . LYS A 1 28 ? 33.065 -8.949  -1.582  1.00 0.00 ? 28 LYS A C    6  
ATOM 4004  O O    . LYS A 1 28 ? 32.110 -9.628  -1.938  1.00 0.00 ? 28 LYS A O    6  
ATOM 4005  C CB   . LYS A 1 28 ? 34.013 -9.133  -3.969  1.00 0.00 ? 28 LYS A CB   6  
ATOM 4006  C CG   . LYS A 1 28 ? 34.441 -8.076  -4.981  1.00 0.00 ? 28 LYS A CG   6  
ATOM 4007  C CD   . LYS A 1 28 ? 35.952 -7.866  -5.077  1.00 0.00 ? 28 LYS A CD   6  
ATOM 4008  C CE   . LYS A 1 28 ? 36.538 -8.322  -6.410  1.00 0.00 ? 28 LYS A CE   6  
ATOM 4009  N NZ   . LYS A 1 28 ? 36.300 -9.721  -6.718  1.00 0.00 ? 28 LYS A NZ   6  
ATOM 4010  H H    . LYS A 1 28 ? 36.344 -8.691  -2.366  1.00 0.00 ? 28 LYS A H    6  
ATOM 4011  H HA   . LYS A 1 28 ? 34.357 -7.561  -2.506  1.00 0.00 ? 28 LYS A HA   6  
ATOM 4012  H HB2  . LYS A 1 28 ? 34.524 -10.078 -4.164  1.00 0.00 ? 28 LYS A HB2  6  
ATOM 4013  H HB3  . LYS A 1 28 ? 32.960 -9.327  -4.152  1.00 0.00 ? 28 LYS A HB3  6  
ATOM 4014  H HG2  . LYS A 1 28 ? 34.054 -8.336  -5.961  1.00 0.00 ? 28 LYS A HG2  6  
ATOM 4015  H HG3  . LYS A 1 28 ? 33.955 -7.146  -4.697  1.00 0.00 ? 28 LYS A HG3  6  
ATOM 4016  H HD2  . LYS A 1 28 ? 36.158 -6.805  -4.940  1.00 0.00 ? 28 LYS A HD2  6  
ATOM 4017  H HD3  . LYS A 1 28 ? 36.476 -8.377  -4.275  1.00 0.00 ? 28 LYS A HD3  6  
ATOM 4018  H HE2  . LYS A 1 28 ? 36.098 -7.751  -7.228  1.00 0.00 ? 28 LYS A HE2  6  
ATOM 4019  H HE3  . LYS A 1 28 ? 37.618 -8.191  -6.367  1.00 0.00 ? 28 LYS A HE3  6  
ATOM 4020  H HZ1  . LYS A 1 28 ? 36.782 -9.974  -7.603  1.00 0.00 ? 28 LYS A HZ1  6  
ATOM 4021  H HZ2  . LYS A 1 28 ? 35.277 -9.884  -6.823  1.00 0.00 ? 28 LYS A HZ2  6  
ATOM 4022  H HZ3  . LYS A 1 28 ? 36.694 -10.296 -5.950  1.00 0.00 ? 28 LYS A HZ3  6  
ATOM 4023  N N    . ASN A 1 29 ? 33.229 -8.420  -0.349  1.00 0.00 ? 29 ASN A N    6  
ATOM 4024  C CA   . ASN A 1 29 ? 32.279 -8.720  0.717   1.00 0.00 ? 29 ASN A CA   6  
ATOM 4025  C C    . ASN A 1 29 ? 31.407 -7.474  0.927   1.00 0.00 ? 29 ASN A C    6  
ATOM 4026  O O    . ASN A 1 29 ? 31.168 -6.743  -0.024  1.00 0.00 ? 29 ASN A O    6  
ATOM 4027  C CB   . ASN A 1 29 ? 33.072 -9.180  1.957   1.00 0.00 ? 29 ASN A CB   6  
ATOM 4028  C CG   . ASN A 1 29 ? 32.309 -10.289 2.691   1.00 0.00 ? 29 ASN A CG   6  
ATOM 4029  O OD1  . ASN A 1 29 ? 31.565 -10.055 3.631   1.00 0.00 ? 29 ASN A OD1  6  
ATOM 4030  N ND2  . ASN A 1 29 ? 32.537 -11.509 2.160   1.00 0.00 ? 29 ASN A ND2  6  
ATOM 4031  H H    . ASN A 1 29 ? 34.038 -7.858  -0.175  1.00 0.00 ? 29 ASN A H    6  
ATOM 4032  H HA   . ASN A 1 29 ? 31.627 -9.521  0.356   1.00 0.00 ? 29 ASN A HA   6  
ATOM 4033  H HB2  . ASN A 1 29 ? 34.032 -9.591  1.647   1.00 0.00 ? 29 ASN A HB2  6  
ATOM 4034  H HB3  . ASN A 1 29 ? 33.304 -8.367  2.644   1.00 0.00 ? 29 ASN A HB3  6  
ATOM 4035  H HD21 . ASN A 1 29 ? 33.179 -11.616 1.399   1.00 0.00 ? 29 ASN A HD21 6  
ATOM 4036  H HD22 . ASN A 1 29 ? 32.070 -12.319 2.508   1.00 0.00 ? 29 ASN A HD22 6  
ATOM 4037  N N    . GLU A 1 30 ? 30.948 -7.256  2.178   1.00 0.00 ? 30 GLU A N    6  
ATOM 4038  C CA   . GLU A 1 30 ? 30.101 -6.098  2.455   1.00 0.00 ? 30 GLU A CA   6  
ATOM 4039  C C    . GLU A 1 30 ? 30.452 -5.508  3.815   1.00 0.00 ? 30 GLU A C    6  
ATOM 4040  O O    . GLU A 1 30 ? 31.051 -4.450  3.914   1.00 0.00 ? 30 GLU A O    6  
ATOM 4041  C CB   . GLU A 1 30 ? 28.610 -6.472  2.391   1.00 0.00 ? 30 GLU A CB   6  
ATOM 4042  C CG   . GLU A 1 30 ? 28.104 -6.626  0.953   1.00 0.00 ? 30 GLU A CG   6  
ATOM 4043  C CD   . GLU A 1 30 ? 26.567 -6.599  0.874   1.00 0.00 ? 30 GLU A CD   6  
ATOM 4044  O OE1  . GLU A 1 30 ? 25.979 -5.623  1.339   1.00 0.00 ? 30 GLU A OE1  6  
ATOM 4045  O OE2  . GLU A 1 30 ? 25.974 -7.539  0.342   1.00 0.00 ? 30 GLU A OE2  6  
ATOM 4046  H H    . GLU A 1 30 ? 31.184 -7.889  2.914   1.00 0.00 ? 30 GLU A H    6  
ATOM 4047  H HA   . GLU A 1 30 ? 30.342 -5.314  1.736   1.00 0.00 ? 30 GLU A HA   6  
ATOM 4048  H HB2  . GLU A 1 30 ? 28.422 -7.395  2.940   1.00 0.00 ? 30 GLU A HB2  6  
ATOM 4049  H HB3  . GLU A 1 30 ? 28.037 -5.694  2.895   1.00 0.00 ? 30 GLU A HB3  6  
ATOM 4050  H HG2  . GLU A 1 30 ? 28.479 -5.806  0.345   1.00 0.00 ? 30 GLU A HG2  6  
ATOM 4051  H HG3  . GLU A 1 30 ? 28.489 -7.553  0.530   1.00 0.00 ? 30 GLU A HG3  6  
ATOM 4052  N N    . ASN A 1 31 ? 30.040 -6.261  4.854   1.00 0.00 ? 31 ASN A N    6  
ATOM 4053  C CA   . ASN A 1 31 ? 30.316 -5.855  6.224   1.00 0.00 ? 31 ASN A CA   6  
ATOM 4054  C C    . ASN A 1 31 ? 31.826 -5.812  6.485   1.00 0.00 ? 31 ASN A C    6  
ATOM 4055  O O    . ASN A 1 31 ? 32.268 -5.141  7.403   1.00 0.00 ? 31 ASN A O    6  
ATOM 4056  C CB   . ASN A 1 31 ? 29.653 -6.861  7.200   1.00 0.00 ? 31 ASN A CB   6  
ATOM 4057  C CG   . ASN A 1 31 ? 28.570 -6.225  8.085   1.00 0.00 ? 31 ASN A CG   6  
ATOM 4058  O OD1  . ASN A 1 31 ? 27.492 -6.772  8.270   1.00 0.00 ? 31 ASN A OD1  6  
ATOM 4059  N ND2  . ASN A 1 31 ? 28.935 -5.047  8.627   1.00 0.00 ? 31 ASN A ND2  6  
ATOM 4060  H H    . ASN A 1 31 ? 29.548 -7.109  4.671   1.00 0.00 ? 31 ASN A H    6  
ATOM 4061  H HA   . ASN A 1 31 ? 29.934 -4.833  6.320   1.00 0.00 ? 31 ASN A HA   6  
ATOM 4062  H HB2  . ASN A 1 31 ? 29.191 -7.676  6.644   1.00 0.00 ? 31 ASN A HB2  6  
ATOM 4063  H HB3  . ASN A 1 31 ? 30.371 -7.349  7.862   1.00 0.00 ? 31 ASN A HB3  6  
ATOM 4064  H HD21 . ASN A 1 31 ? 29.827 -4.643  8.424   1.00 0.00 ? 31 ASN A HD21 6  
ATOM 4065  H HD22 . ASN A 1 31 ? 28.311 -4.558  9.233   1.00 0.00 ? 31 ASN A HD22 6  
ATOM 4066  N N    . LEU A 1 32 ? 32.573 -6.564  5.640   1.00 0.00 ? 32 LEU A N    6  
ATOM 4067  C CA   . LEU A 1 32 ? 34.019 -6.644  5.805   1.00 0.00 ? 32 LEU A CA   6  
ATOM 4068  C C    . LEU A 1 32 ? 34.676 -5.403  5.189   1.00 0.00 ? 32 LEU A C    6  
ATOM 4069  O O    . LEU A 1 32 ? 35.582 -4.812  5.751   1.00 0.00 ? 32 LEU A O    6  
ATOM 4070  C CB   . LEU A 1 32 ? 34.567 -7.896  5.084   1.00 0.00 ? 32 LEU A CB   6  
ATOM 4071  C CG   . LEU A 1 32 ? 35.701 -8.624  5.829   1.00 0.00 ? 32 LEU A CG   6  
ATOM 4072  C CD1  . LEU A 1 32 ? 36.643 -7.701  6.613   1.00 0.00 ? 32 LEU A CD1  6  
ATOM 4073  C CD2  . LEU A 1 32 ? 35.113 -9.695  6.743   1.00 0.00 ? 32 LEU A CD2  6  
ATOM 4074  H H    . LEU A 1 32 ? 32.122 -7.065  4.899   1.00 0.00 ? 32 LEU A H    6  
ATOM 4075  H HA   . LEU A 1 32 ? 34.204 -6.673  6.885   1.00 0.00 ? 32 LEU A HA   6  
ATOM 4076  H HB2  . LEU A 1 32 ? 33.756 -8.600  4.905   1.00 0.00 ? 32 LEU A HB2  6  
ATOM 4077  H HB3  . LEU A 1 32 ? 34.904 -7.663  4.073   1.00 0.00 ? 32 LEU A HB3  6  
ATOM 4078  H HG   . LEU A 1 32 ? 36.305 -9.137  5.079   1.00 0.00 ? 32 LEU A HG   6  
ATOM 4079  H HD11 . LEU A 1 32 ? 37.529 -8.243  6.942   1.00 0.00 ? 32 LEU A HD11 6  
ATOM 4080  H HD12 . LEU A 1 32 ? 36.161 -7.292  7.501   1.00 0.00 ? 32 LEU A HD12 6  
ATOM 4081  H HD13 . LEU A 1 32 ? 36.978 -6.869  6.002   1.00 0.00 ? 32 LEU A HD13 6  
ATOM 4082  H HD21 . LEU A 1 32 ? 35.892 -10.217 7.296   1.00 0.00 ? 32 LEU A HD21 6  
ATOM 4083  H HD22 . LEU A 1 32 ? 34.562 -10.430 6.158   1.00 0.00 ? 32 LEU A HD22 6  
ATOM 4084  H HD23 . LEU A 1 32 ? 34.426 -9.250  7.461   1.00 0.00 ? 32 LEU A HD23 6  
ATOM 4085  N N    . ALA A 1 33 ? 34.148 -5.072  3.989   1.00 0.00 ? 33 ALA A N    6  
ATOM 4086  C CA   . ALA A 1 33 ? 34.628 -3.927  3.236   1.00 0.00 ? 33 ALA A CA   6  
ATOM 4087  C C    . ALA A 1 33 ? 34.460 -2.623  4.013   1.00 0.00 ? 33 ALA A C    6  
ATOM 4088  O O    . ALA A 1 33 ? 35.388 -1.843  4.128   1.00 0.00 ? 33 ALA A O    6  
ATOM 4089  C CB   . ALA A 1 33 ? 33.860 -3.833  1.929   1.00 0.00 ? 33 ALA A CB   6  
ATOM 4090  H H    . ALA A 1 33 ? 33.402 -5.619  3.609   1.00 0.00 ? 33 ALA A H    6  
ATOM 4091  H HA   . ALA A 1 33 ? 35.691 -4.077  3.049   1.00 0.00 ? 33 ALA A HA   6  
ATOM 4092  H HB1  . ALA A 1 33 ? 33.907 -2.814  1.553   1.00 0.00 ? 33 ALA A HB1  6  
ATOM 4093  H HB2  . ALA A 1 33 ? 32.809 -4.107  2.034   1.00 0.00 ? 33 ALA A HB2  6  
ATOM 4094  H HB3  . ALA A 1 33 ? 34.310 -4.493  1.191   1.00 0.00 ? 33 ALA A HB3  6  
ATOM 4095  N N    . ALA A 1 34 ? 33.235 -2.451  4.554   1.00 0.00 ? 34 ALA A N    6  
ATOM 4096  C CA   . ALA A 1 34 ? 32.982 -1.304  5.415   1.00 0.00 ? 34 ALA A CA   6  
ATOM 4097  C C    . ALA A 1 34 ? 33.948 -1.319  6.605   1.00 0.00 ? 34 ALA A C    6  
ATOM 4098  O O    . ALA A 1 34 ? 34.606 -0.333  6.885   1.00 0.00 ? 34 ALA A O    6  
ATOM 4099  C CB   . ALA A 1 34 ? 31.528 -1.304  5.891   1.00 0.00 ? 34 ALA A CB   6  
ATOM 4100  H H    . ALA A 1 34 ? 32.528 -3.136  4.399   1.00 0.00 ? 34 ALA A H    6  
ATOM 4101  H HA   . ALA A 1 34 ? 33.175 -0.406  4.824   1.00 0.00 ? 34 ALA A HA   6  
ATOM 4102  H HB1  . ALA A 1 34 ? 31.290 -2.192  6.476   1.00 0.00 ? 34 ALA A HB1  6  
ATOM 4103  H HB2  . ALA A 1 34 ? 30.844 -1.275  5.044   1.00 0.00 ? 34 ALA A HB2  6  
ATOM 4104  H HB3  . ALA A 1 34 ? 31.322 -0.428  6.508   1.00 0.00 ? 34 ALA A HB3  6  
ATOM 4105  N N    . ASN A 1 35 ? 34.056 -2.492  7.257   1.00 0.00 ? 35 ASN A N    6  
ATOM 4106  C CA   . ASN A 1 35 ? 34.977 -2.583  8.390   1.00 0.00 ? 35 ASN A CA   6  
ATOM 4107  C C    . ASN A 1 35 ? 36.426 -2.190  8.029   1.00 0.00 ? 35 ASN A C    6  
ATOM 4108  O O    . ASN A 1 35 ? 37.134 -1.618  8.842   1.00 0.00 ? 35 ASN A O    6  
ATOM 4109  C CB   . ASN A 1 35 ? 34.974 -4.003  8.981   1.00 0.00 ? 35 ASN A CB   6  
ATOM 4110  C CG   . ASN A 1 35 ? 34.968 -3.871  10.507  1.00 0.00 ? 35 ASN A CG   6  
ATOM 4111  O OD1  . ASN A 1 35 ? 35.964 -3.528  11.130  1.00 0.00 ? 35 ASN A OD1  6  
ATOM 4112  N ND2  . ASN A 1 35 ? 33.731 -3.977  11.022  1.00 0.00 ? 35 ASN A ND2  6  
ATOM 4113  H H    . ASN A 1 35 ? 33.492 -3.270  6.981   1.00 0.00 ? 35 ASN A H    6  
ATOM 4114  H HA   . ASN A 1 35 ? 34.601 -1.841  9.104   1.00 0.00 ? 35 ASN A HA   6  
ATOM 4115  H HB2  . ASN A 1 35 ? 34.097 -4.551  8.657   1.00 0.00 ? 35 ASN A HB2  6  
ATOM 4116  H HB3  . ASN A 1 35 ? 35.823 -4.607  8.658   1.00 0.00 ? 35 ASN A HB3  6  
ATOM 4117  H HD21 . ASN A 1 35 ? 33.086 -4.657  10.679  1.00 0.00 ? 35 ASN A HD21 6  
ATOM 4118  H HD22 . ASN A 1 35 ? 33.430 -3.339  11.727  1.00 0.00 ? 35 ASN A HD22 6  
ATOM 4119  N N    . PHE A 1 36 ? 36.803 -2.509  6.769   1.00 0.00 ? 36 PHE A N    6  
ATOM 4120  C CA   . PHE A 1 36 ? 38.129 -2.159  6.263   1.00 0.00 ? 36 PHE A CA   6  
ATOM 4121  C C    . PHE A 1 36 ? 38.302 -0.628  6.258   1.00 0.00 ? 36 PHE A C    6  
ATOM 4122  O O    . PHE A 1 36 ? 39.234 -0.103  6.849   1.00 0.00 ? 36 PHE A O    6  
ATOM 4123  C CB   . PHE A 1 36 ? 38.329 -2.776  4.861   1.00 0.00 ? 36 PHE A CB   6  
ATOM 4124  C CG   . PHE A 1 36 ? 39.699 -2.564  4.252   1.00 0.00 ? 36 PHE A CG   6  
ATOM 4125  C CD1  . PHE A 1 36 ? 40.113 -1.296  3.848   1.00 0.00 ? 36 PHE A CD1  6  
ATOM 4126  C CD2  . PHE A 1 36 ? 40.557 -3.639  4.030   1.00 0.00 ? 36 PHE A CD2  6  
ATOM 4127  C CE1  . PHE A 1 36 ? 41.333 -1.101  3.222   1.00 0.00 ? 36 PHE A CE1  6  
ATOM 4128  C CE2  . PHE A 1 36 ? 41.790 -3.447  3.412   1.00 0.00 ? 36 PHE A CE2  6  
ATOM 4129  C CZ   . PHE A 1 36 ? 42.177 -2.178  3.004   1.00 0.00 ? 36 PHE A CZ   6  
ATOM 4130  H H    . PHE A 1 36 ? 36.136 -2.934  6.159   1.00 0.00 ? 36 PHE A H    6  
ATOM 4131  H HA   . PHE A 1 36 ? 38.854 -2.589  6.957   1.00 0.00 ? 36 PHE A HA   6  
ATOM 4132  H HB2  . PHE A 1 36 ? 38.119 -3.845  4.910   1.00 0.00 ? 36 PHE A HB2  6  
ATOM 4133  H HB3  . PHE A 1 36 ? 37.604 -2.377  4.158   1.00 0.00 ? 36 PHE A HB3  6  
ATOM 4134  H HD1  . PHE A 1 36 ? 39.478 -0.434  3.976   1.00 0.00 ? 36 PHE A HD1  6  
ATOM 4135  H HD2  . PHE A 1 36 ? 40.256 -4.638  4.308   1.00 0.00 ? 36 PHE A HD2  6  
ATOM 4136  H HE1  . PHE A 1 36 ? 41.607 -0.108  2.896   1.00 0.00 ? 36 PHE A HE1  6  
ATOM 4137  H HE2  . PHE A 1 36 ? 42.441 -4.289  3.227   1.00 0.00 ? 36 PHE A HE2  6  
ATOM 4138  H HZ   . PHE A 1 36 ? 43.124 -2.023  2.507   1.00 0.00 ? 36 PHE A HZ   6  
ATOM 4139  N N    . LEU A 1 37 ? 37.362 0.039   5.547   1.00 0.00 ? 37 LEU A N    6  
ATOM 4140  C CA   . LEU A 1 37 ? 37.508 1.462   5.266   1.00 0.00 ? 37 LEU A CA   6  
ATOM 4141  C C    . LEU A 1 37 ? 37.356 2.341   6.531   1.00 0.00 ? 37 LEU A C    6  
ATOM 4142  O O    . LEU A 1 37 ? 37.948 3.409   6.639   1.00 0.00 ? 37 LEU A O    6  
ATOM 4143  C CB   . LEU A 1 37 ? 36.504 1.911   4.204   1.00 0.00 ? 37 LEU A CB   6  
ATOM 4144  C CG   . LEU A 1 37 ? 36.671 1.252   2.820   1.00 0.00 ? 37 LEU A CG   6  
ATOM 4145  C CD1  . LEU A 1 37 ? 35.440 0.432   2.442   1.00 0.00 ? 37 LEU A CD1  6  
ATOM 4146  C CD2  . LEU A 1 37 ? 36.984 2.267   1.703   1.00 0.00 ? 37 LEU A CD2  6  
ATOM 4147  H H    . LEU A 1 37 ? 36.551 -0.434  5.209   1.00 0.00 ? 37 LEU A H    6  
ATOM 4148  H HA   . LEU A 1 37 ? 38.503 1.595   4.853   1.00 0.00 ? 37 LEU A HA   6  
ATOM 4149  H HB2  . LEU A 1 37 ? 35.490 1.773   4.561   1.00 0.00 ? 37 LEU A HB2  6  
ATOM 4150  H HB3  . LEU A 1 37 ? 36.640 2.980   4.127   1.00 0.00 ? 37 LEU A HB3  6  
ATOM 4151  H HG   . LEU A 1 37 ? 37.509 0.563   2.892   1.00 0.00 ? 37 LEU A HG   6  
ATOM 4152  H HD11 . LEU A 1 37 ? 35.710 -0.486  1.917   1.00 0.00 ? 37 LEU A HD11 6  
ATOM 4153  H HD12 . LEU A 1 37 ? 34.791 1.020   1.806   1.00 0.00 ? 37 LEU A HD12 6  
ATOM 4154  H HD13 . LEU A 1 37 ? 34.820 0.190   3.299   1.00 0.00 ? 37 LEU A HD13 6  
ATOM 4155  H HD21 . LEU A 1 37 ? 37.919 2.002   1.222   1.00 0.00 ? 37 LEU A HD21 6  
ATOM 4156  H HD22 . LEU A 1 37 ? 37.089 3.276   2.081   1.00 0.00 ? 37 LEU A HD22 6  
ATOM 4157  H HD23 . LEU A 1 37 ? 36.214 2.337   0.934   1.00 0.00 ? 37 LEU A HD23 6  
ATOM 4158  N N    . LEU A 1 38 ? 36.522 1.819   7.463   1.00 0.00 ? 38 LEU A N    6  
ATOM 4159  C CA   . LEU A 1 38 ? 36.163 2.555   8.671   1.00 0.00 ? 38 LEU A CA   6  
ATOM 4160  C C    . LEU A 1 38 ? 37.257 2.380   9.746   1.00 0.00 ? 38 LEU A C    6  
ATOM 4161  O O    . LEU A 1 38 ? 37.446 3.223   10.612  1.00 0.00 ? 38 LEU A O    6  
ATOM 4162  C CB   . LEU A 1 38 ? 34.783 2.135   9.242   1.00 0.00 ? 38 LEU A CB   6  
ATOM 4163  C CG   . LEU A 1 38 ? 33.569 2.043   8.278   1.00 0.00 ? 38 LEU A CG   6  
ATOM 4164  C CD1  . LEU A 1 38 ? 32.338 2.791   8.801   1.00 0.00 ? 38 LEU A CD1  6  
ATOM 4165  C CD2  . LEU A 1 38 ? 33.856 2.520   6.858   1.00 0.00 ? 38 LEU A CD2  6  
ATOM 4166  H H    . LEU A 1 38 ? 36.126 0.916   7.325   1.00 0.00 ? 38 LEU A H    6  
ATOM 4167  H HA   . LEU A 1 38 ? 36.137 3.602   8.378   1.00 0.00 ? 38 LEU A HA   6  
ATOM 4168  H HB2  . LEU A 1 38 ? 34.893 1.167   9.728   1.00 0.00 ? 38 LEU A HB2  6  
ATOM 4169  H HB3  . LEU A 1 38 ? 34.541 2.841   10.039  1.00 0.00 ? 38 LEU A HB3  6  
ATOM 4170  H HG   . LEU A 1 38 ? 33.259 1.001   8.236   1.00 0.00 ? 38 LEU A HG   6  
ATOM 4171  H HD11 . LEU A 1 38 ? 32.031 2.416   9.775   1.00 0.00 ? 38 LEU A HD11 6  
ATOM 4172  H HD12 . LEU A 1 38 ? 31.495 2.644   8.125   1.00 0.00 ? 38 LEU A HD12 6  
ATOM 4173  H HD13 . LEU A 1 38 ? 32.521 3.864   8.868   1.00 0.00 ? 38 LEU A HD13 6  
ATOM 4174  H HD21 . LEU A 1 38 ? 34.577 3.327   6.881   1.00 0.00 ? 38 LEU A HD21 6  
ATOM 4175  H HD22 . LEU A 1 38 ? 32.952 2.888   6.388   1.00 0.00 ? 38 LEU A HD22 6  
ATOM 4176  H HD23 . LEU A 1 38 ? 34.252 1.749   6.210   1.00 0.00 ? 38 LEU A HD23 6  
ATOM 4177  N N    . SER A 1 39 ? 37.964 1.233   9.609   1.00 0.00 ? 39 SER A N    6  
ATOM 4178  C CA   . SER A 1 39 ? 39.058 0.889   10.509  1.00 0.00 ? 39 SER A CA   6  
ATOM 4179  C C    . SER A 1 39 ? 40.362 1.623   10.147  1.00 0.00 ? 39 SER A C    6  
ATOM 4180  O O    . SER A 1 39 ? 41.293 1.640   10.941  1.00 0.00 ? 39 SER A O    6  
ATOM 4181  C CB   . SER A 1 39 ? 39.273 -0.633  10.522  1.00 0.00 ? 39 SER A CB   6  
ATOM 4182  O OG   . SER A 1 39 ? 40.267 -1.009  11.461  1.00 0.00 ? 39 SER A OG   6  
ATOM 4183  H H    . SER A 1 39 ? 37.736 0.597   8.876   1.00 0.00 ? 39 SER A H    6  
ATOM 4184  H HA   . SER A 1 39 ? 38.751 1.214   11.501  1.00 0.00 ? 39 SER A HA   6  
ATOM 4185  H HB2  . SER A 1 39 ? 38.336 -1.117  10.809  1.00 0.00 ? 39 SER A HB2  6  
ATOM 4186  H HB3  . SER A 1 39 ? 39.548 -0.985  9.520   1.00 0.00 ? 39 SER A HB3  6  
ATOM 4187  H HG   . SER A 1 39 ? 40.376 -1.956  11.474  1.00 0.00 ? 39 SER A HG   6  
ATOM 4188  N N    . GLN A 1 40 ? 40.378 2.233   8.935   1.00 0.00 ? 40 GLN A N    6  
ATOM 4189  C CA   . GLN A 1 40 ? 41.549 2.999   8.507   1.00 0.00 ? 40 GLN A CA   6  
ATOM 4190  C C    . GLN A 1 40 ? 41.569 4.352   9.246   1.00 0.00 ? 40 GLN A C    6  
ATOM 4191  O O    . GLN A 1 40 ? 40.917 5.311   8.856   1.00 0.00 ? 40 GLN A O    6  
ATOM 4192  C CB   . GLN A 1 40 ? 41.552 3.193   6.977   1.00 0.00 ? 40 GLN A CB   6  
ATOM 4193  C CG   . GLN A 1 40 ? 41.332 1.878   6.204   1.00 0.00 ? 40 GLN A CG   6  
ATOM 4194  C CD   . GLN A 1 40 ? 42.399 1.575   5.141   1.00 0.00 ? 40 GLN A CD   6  
ATOM 4195  O OE1  . GLN A 1 40 ? 42.563 2.288   4.161   1.00 0.00 ? 40 GLN A OE1  6  
ATOM 4196  N NE2  . GLN A 1 40 ? 43.055 0.421   5.388   1.00 0.00 ? 40 GLN A NE2  6  
ATOM 4197  H H    . GLN A 1 40 ? 39.595 2.145   8.319   1.00 0.00 ? 40 GLN A H    6  
ATOM 4198  H HA   . GLN A 1 40 ? 42.430 2.418   8.779   1.00 0.00 ? 40 GLN A HA   6  
ATOM 4199  H HB2  . GLN A 1 40 ? 40.763 3.892   6.697   1.00 0.00 ? 40 GLN A HB2  6  
ATOM 4200  H HB3  . GLN A 1 40 ? 42.490 3.662   6.673   1.00 0.00 ? 40 GLN A HB3  6  
ATOM 4201  H HG2  . GLN A 1 40 ? 41.282 1.027   6.881   1.00 0.00 ? 40 GLN A HG2  6  
ATOM 4202  H HG3  . GLN A 1 40 ? 40.373 1.920   5.699   1.00 0.00 ? 40 GLN A HG3  6  
ATOM 4203  H HE21 . GLN A 1 40 ? 42.913 -0.062  6.250   1.00 0.00 ? 40 GLN A HE21 6  
ATOM 4204  H HE22 . GLN A 1 40 ? 43.669 -0.004  4.725   1.00 0.00 ? 40 GLN A HE22 6  
ATOM 4205  N N    . ASN A 1 41 ? 42.368 4.343   10.338  1.00 0.00 ? 41 ASN A N    6  
ATOM 4206  C CA   . ASN A 1 41 ? 42.537 5.523   11.181  1.00 0.00 ? 41 ASN A CA   6  
ATOM 4207  C C    . ASN A 1 41 ? 43.389 6.543   10.410  1.00 0.00 ? 41 ASN A C    6  
ATOM 4208  O O    . ASN A 1 41 ? 44.436 6.211   9.867   1.00 0.00 ? 41 ASN A O    6  
ATOM 4209  C CB   . ASN A 1 41 ? 43.214 5.167   12.525  1.00 0.00 ? 41 ASN A CB   6  
ATOM 4210  C CG   . ASN A 1 41 ? 42.951 3.708   12.940  1.00 0.00 ? 41 ASN A CG   6  
ATOM 4211  O OD1  . ASN A 1 41 ? 43.802 2.839   12.801  1.00 0.00 ? 41 ASN A OD1  6  
ATOM 4212  N ND2  . ASN A 1 41 ? 41.691 3.490   13.354  1.00 0.00 ? 41 ASN A ND2  6  
ATOM 4213  H H    . ASN A 1 41 ? 42.830 3.494   10.591  1.00 0.00 ? 41 ASN A H    6  
ATOM 4214  H HA   . ASN A 1 41 ? 41.535 5.919   11.363  1.00 0.00 ? 41 ASN A HA   6  
ATOM 4215  H HB2  . ASN A 1 41 ? 44.295 5.294   12.472  1.00 0.00 ? 41 ASN A HB2  6  
ATOM 4216  H HB3  . ASN A 1 41 ? 42.865 5.849   13.302  1.00 0.00 ? 41 ASN A HB3  6  
ATOM 4217  H HD21 . ASN A 1 41 ? 41.081 4.234   13.615  1.00 0.00 ? 41 ASN A HD21 6  
ATOM 4218  H HD22 . ASN A 1 41 ? 41.340 2.558   13.375  1.00 0.00 ? 41 ASN A HD22 6  
ATOM 4219  N N    . PHE A 1 42 ? 42.850 7.779   10.382  1.00 0.00 ? 42 PHE A N    6  
ATOM 4220  C CA   . PHE A 1 42 ? 43.481 8.869   9.649   1.00 0.00 ? 42 PHE A CA   6  
ATOM 4221  C C    . PHE A 1 42 ? 42.686 10.144  9.959   1.00 0.00 ? 42 PHE A C    6  
ATOM 4222  O O    . PHE A 1 42 ? 41.549 10.287  9.531   1.00 0.00 ? 42 PHE A O    6  
ATOM 4223  C CB   . PHE A 1 42 ? 43.467 8.593   8.123   1.00 0.00 ? 42 PHE A CB   6  
ATOM 4224  C CG   . PHE A 1 42 ? 44.350 9.542   7.348   1.00 0.00 ? 42 PHE A CG   6  
ATOM 4225  C CD1  . PHE A 1 42 ? 43.980 10.872  7.164   1.00 0.00 ? 42 PHE A CD1  6  
ATOM 4226  C CD2  . PHE A 1 42 ? 45.552 9.101   6.797   1.00 0.00 ? 42 PHE A CD2  6  
ATOM 4227  C CE1  . PHE A 1 42 ? 44.793 11.745  6.457   1.00 0.00 ? 42 PHE A CE1  6  
ATOM 4228  C CE2  . PHE A 1 42 ? 46.368 9.971   6.084   1.00 0.00 ? 42 PHE A CE2  6  
ATOM 4229  C CZ   . PHE A 1 42 ? 45.988 11.295  5.916   1.00 0.00 ? 42 PHE A CZ   6  
ATOM 4230  H H    . PHE A 1 42 ? 41.999 7.930   10.884  1.00 0.00 ? 42 PHE A H    6  
ATOM 4231  H HA   . PHE A 1 42 ? 44.498 8.957   10.038  1.00 0.00 ? 42 PHE A HA   6  
ATOM 4232  H HB2  . PHE A 1 42 ? 43.820 7.583   7.915   1.00 0.00 ? 42 PHE A HB2  6  
ATOM 4233  H HB3  . PHE A 1 42 ? 42.448 8.636   7.726   1.00 0.00 ? 42 PHE A HB3  6  
ATOM 4234  H HD1  . PHE A 1 42 ? 43.050 11.241  7.567   1.00 0.00 ? 42 PHE A HD1  6  
ATOM 4235  H HD2  . PHE A 1 42 ? 45.856 8.071   6.913   1.00 0.00 ? 42 PHE A HD2  6  
ATOM 4236  H HE1  . PHE A 1 42 ? 44.487 12.771  6.321   1.00 0.00 ? 42 PHE A HE1  6  
ATOM 4237  H HE2  . PHE A 1 42 ? 47.293 9.619   5.649   1.00 0.00 ? 42 PHE A HE2  6  
ATOM 4238  H HZ   . PHE A 1 42 ? 46.616 11.974  5.360   1.00 0.00 ? 42 PHE A HZ   6  
ATOM 4239  N N    . ASP A 1 43 ? 43.347 11.057  10.700  1.00 0.00 ? 43 ASP A N    6  
ATOM 4240  C CA   . ASP A 1 43 ? 42.764 12.375  10.927  1.00 0.00 ? 43 ASP A CA   6  
ATOM 4241  C C    . ASP A 1 43 ? 43.769 13.257  11.688  1.00 0.00 ? 43 ASP A C    6  
ATOM 4242  O O    . ASP A 1 43 ? 43.962 14.419  11.368  1.00 0.00 ? 43 ASP A O    6  
ATOM 4243  C CB   . ASP A 1 43 ? 41.429 12.293  11.720  1.00 0.00 ? 43 ASP A CB   6  
ATOM 4244  C CG   . ASP A 1 43 ? 40.408 13.313  11.177  1.00 0.00 ? 43 ASP A CG   6  
ATOM 4245  O OD1  . ASP A 1 43 ? 40.753 14.488  11.050  1.00 0.00 ? 43 ASP A OD1  6  
ATOM 4246  O OD2  . ASP A 1 43 ? 39.281 12.918  10.878  1.00 0.00 ? 43 ASP A OD2  6  
ATOM 4247  H H    . ASP A 1 43 ? 44.258 10.829  11.036  1.00 0.00 ? 43 ASP A H    6  
ATOM 4248  H HA   . ASP A 1 43 ? 42.635 12.797  9.923   1.00 0.00 ? 43 ASP A HA   6  
ATOM 4249  H HB2  . ASP A 1 43 ? 40.987 11.300  11.663  1.00 0.00 ? 43 ASP A HB2  6  
ATOM 4250  H HB3  . ASP A 1 43 ? 41.562 12.453  12.792  1.00 0.00 ? 43 ASP A HB3  6  
ATOM 4251  N N    . ASP A 1 44 ? 44.370 12.613  12.722  1.00 0.00 ? 44 ASP A N    6  
ATOM 4252  C CA   . ASP A 1 44 ? 45.362 13.227  13.609  1.00 0.00 ? 44 ASP A CA   6  
ATOM 4253  C C    . ASP A 1 44 ? 44.795 14.422  14.397  1.00 0.00 ? 44 ASP A C    6  
ATOM 4254  O O    . ASP A 1 44 ? 45.522 15.355  14.723  1.00 0.00 ? 44 ASP A O    6  
ATOM 4255  C CB   . ASP A 1 44 ? 46.627 13.638  12.830  1.00 0.00 ? 44 ASP A CB   6  
ATOM 4256  C CG   . ASP A 1 44 ? 47.203 12.477  11.995  1.00 0.00 ? 44 ASP A CG   6  
ATOM 4257  O OD1  . ASP A 1 44 ? 47.506 11.434  12.572  1.00 0.00 ? 44 ASP A OD1  6  
ATOM 4258  O OD2  . ASP A 1 44 ? 47.347 12.629  10.781  1.00 0.00 ? 44 ASP A OD2  6  
ATOM 4259  H H    . ASP A 1 44 ? 44.140 11.657  12.884  1.00 0.00 ? 44 ASP A H    6  
ATOM 4260  H HA   . ASP A 1 44 ? 45.608 12.460  14.346  1.00 0.00 ? 44 ASP A HA   6  
ATOM 4261  H HB2  . ASP A 1 44 ? 46.440 14.493  12.180  1.00 0.00 ? 44 ASP A HB2  6  
ATOM 4262  H HB3  . ASP A 1 44 ? 47.394 13.968  13.528  1.00 0.00 ? 44 ASP A HB3  6  
ATOM 4263  N N    . GLU A 1 45 ? 43.472 14.341  14.664  1.00 0.00 ? 45 GLU A N    6  
ATOM 4264  C CA   . GLU A 1 45 ? 42.741 15.428  15.312  1.00 0.00 ? 45 GLU A CA   6  
ATOM 4265  C C    . GLU A 1 45 ? 41.485 14.872  16.017  1.00 0.00 ? 45 GLU A C    6  
ATOM 4266  O O    . GLU A 1 45 ? 40.932 13.869  15.563  1.00 0.00 ? 45 GLU A O    6  
ATOM 4267  C CB   . GLU A 1 45 ? 42.309 16.496  14.283  1.00 0.00 ? 45 GLU A CB   6  
ATOM 4268  C CG   . GLU A 1 45 ? 43.426 17.411  13.752  1.00 0.00 ? 45 GLU A CG   6  
ATOM 4269  C CD   . GLU A 1 45 ? 44.213 18.151  14.867  1.00 0.00 ? 45 GLU A CD   6  
ATOM 4270  O OE1  . GLU A 1 45 ? 43.606 18.555  15.861  1.00 0.00 ? 45 GLU A OE1  6  
ATOM 4271  O OE2  . GLU A 1 45 ? 45.425 18.316  14.730  1.00 0.00 ? 45 GLU A OE2  6  
ATOM 4272  O OXT  . GLU A 1 45 ? 41.070 15.460  17.016  1.00 0.00 ? 45 GLU A OXT  6  
ATOM 4273  H H    . GLU A 1 45 ? 42.966 13.512  14.422  1.00 0.00 ? 45 GLU A H    6  
ATOM 4274  H HA   . GLU A 1 45 ? 43.396 15.852  16.074  1.00 0.00 ? 45 GLU A HA   6  
ATOM 4275  H HB2  . GLU A 1 45 ? 41.819 16.007  13.443  1.00 0.00 ? 45 GLU A HB2  6  
ATOM 4276  H HB3  . GLU A 1 45 ? 41.535 17.132  14.708  1.00 0.00 ? 45 GLU A HB3  6  
ATOM 4277  H HG2  . GLU A 1 45 ? 44.096 16.833  13.118  1.00 0.00 ? 45 GLU A HG2  6  
ATOM 4278  H HG3  . GLU A 1 45 ? 42.986 18.159  13.094  1.00 0.00 ? 45 GLU A HG3  6  
ATOM 4279  N N    . GLN A 1 1  ? 30.223 -7.276  -11.367 1.00 0.00 ? 1  GLN A N    7  
ATOM 4280  C CA   . GLN A 1 1  ? 30.312 -5.835  -11.183 1.00 0.00 ? 1  GLN A CA   7  
ATOM 4281  C C    . GLN A 1 1  ? 30.144 -5.477  -9.696  1.00 0.00 ? 1  GLN A C    7  
ATOM 4282  O O    . GLN A 1 1  ? 29.207 -5.919  -9.042  1.00 0.00 ? 1  GLN A O    7  
ATOM 4283  C CB   . GLN A 1 1  ? 29.262 -5.101  -12.055 1.00 0.00 ? 1  GLN A CB   7  
ATOM 4284  C CG   . GLN A 1 1  ? 29.898 -4.341  -13.228 1.00 0.00 ? 1  GLN A CG   7  
ATOM 4285  C CD   . GLN A 1 1  ? 28.846 -3.851  -14.234 1.00 0.00 ? 1  GLN A CD   7  
ATOM 4286  O OE1  . GLN A 1 1  ? 27.639 -3.947  -14.019 1.00 0.00 ? 1  GLN A OE1  7  
ATOM 4287  N NE2  . GLN A 1 1  ? 29.379 -3.339  -15.358 1.00 0.00 ? 1  GLN A NE2  7  
ATOM 4288  H H1   . GLN A 1 1  ? 31.067 -7.724  -10.929 1.00 0.00 ? 1  GLN A H1   7  
ATOM 4289  H H2   . GLN A 1 1  ? 30.203 -7.503  -12.378 1.00 0.00 ? 1  GLN A H2   7  
ATOM 4290  H H3   . GLN A 1 1  ? 29.369 -7.636  -10.902 1.00 0.00 ? 1  GLN A H3   7  
ATOM 4291  H HA   . GLN A 1 1  ? 31.318 -5.548  -11.492 1.00 0.00 ? 1  GLN A HA   7  
ATOM 4292  H HB2  . GLN A 1 1  ? 28.548 -5.829  -12.444 1.00 0.00 ? 1  GLN A HB2  7  
ATOM 4293  H HB3  . GLN A 1 1  ? 28.670 -4.393  -11.473 1.00 0.00 ? 1  GLN A HB3  7  
ATOM 4294  H HG2  . GLN A 1 1  ? 30.460 -3.485  -12.859 1.00 0.00 ? 1  GLN A HG2  7  
ATOM 4295  H HG3  . GLN A 1 1  ? 30.609 -4.974  -13.757 1.00 0.00 ? 1  GLN A HG3  7  
ATOM 4296  H HE21 . GLN A 1 1  ? 30.377 -3.254  -15.471 1.00 0.00 ? 1  GLN A HE21 7  
ATOM 4297  H HE22 . GLN A 1 1  ? 28.796 -3.039  -16.102 1.00 0.00 ? 1  GLN A HE22 7  
ATOM 4298  N N    . GLU A 1 2  ? 31.108 -4.664  -9.215  1.00 0.00 ? 2  GLU A N    7  
ATOM 4299  C CA   . GLU A 1 2  ? 31.149 -4.223  -7.822  1.00 0.00 ? 2  GLU A CA   7  
ATOM 4300  C C    . GLU A 1 2  ? 31.179 -2.689  -7.713  1.00 0.00 ? 2  GLU A C    7  
ATOM 4301  O O    . GLU A 1 2  ? 31.295 -2.157  -6.616  1.00 0.00 ? 2  GLU A O    7  
ATOM 4302  C CB   . GLU A 1 2  ? 32.342 -4.856  -7.084  1.00 0.00 ? 2  GLU A CB   7  
ATOM 4303  C CG   . GLU A 1 2  ? 33.716 -4.219  -7.365  1.00 0.00 ? 2  GLU A CG   7  
ATOM 4304  C CD   . GLU A 1 2  ? 34.172 -4.345  -8.838  1.00 0.00 ? 2  GLU A CD   7  
ATOM 4305  O OE1  . GLU A 1 2  ? 34.177 -5.453  -9.366  1.00 0.00 ? 2  GLU A OE1  7  
ATOM 4306  O OE2  . GLU A 1 2  ? 34.517 -3.326  -9.440  1.00 0.00 ? 2  GLU A OE2  7  
ATOM 4307  H H    . GLU A 1 2  ? 31.832 -4.368  -9.840  1.00 0.00 ? 2  GLU A H    7  
ATOM 4308  H HA   . GLU A 1 2  ? 30.235 -4.549  -7.328  1.00 0.00 ? 2  GLU A HA   7  
ATOM 4309  H HB2  . GLU A 1 2  ? 32.168 -4.770  -6.012  1.00 0.00 ? 2  GLU A HB2  7  
ATOM 4310  H HB3  . GLU A 1 2  ? 32.364 -5.928  -7.282  1.00 0.00 ? 2  GLU A HB3  7  
ATOM 4311  H HG2  . GLU A 1 2  ? 33.713 -3.173  -7.069  1.00 0.00 ? 2  GLU A HG2  7  
ATOM 4312  H HG3  . GLU A 1 2  ? 34.453 -4.684  -6.715  1.00 0.00 ? 2  GLU A HG3  7  
ATOM 4313  N N    . LYS A 1 3  ? 31.066 -2.028  -8.889  1.00 0.00 ? 3  LYS A N    7  
ATOM 4314  C CA   . LYS A 1 3  ? 31.093 -0.566  -9.010  1.00 0.00 ? 3  LYS A CA   7  
ATOM 4315  C C    . LYS A 1 3  ? 29.976 0.135   -8.211  1.00 0.00 ? 3  LYS A C    7  
ATOM 4316  O O    . LYS A 1 3  ? 30.064 1.317   -7.903  1.00 0.00 ? 3  LYS A O    7  
ATOM 4317  C CB   . LYS A 1 3  ? 31.052 -0.163  -10.481 1.00 0.00 ? 3  LYS A CB   7  
ATOM 4318  C CG   . LYS A 1 3  ? 29.802 -0.641  -11.227 1.00 0.00 ? 3  LYS A CG   7  
ATOM 4319  C CD   . LYS A 1 3  ? 30.032 -0.645  -12.740 1.00 0.00 ? 3  LYS A CD   7  
ATOM 4320  C CE   . LYS A 1 3  ? 30.184 0.758   -13.338 1.00 0.00 ? 3  LYS A CE   7  
ATOM 4321  N NZ   . LYS A 1 3  ? 30.658 0.693   -14.712 1.00 0.00 ? 3  LYS A NZ   7  
ATOM 4322  H H    . LYS A 1 3  ? 30.988 -2.550  -9.738  1.00 0.00 ? 3  LYS A H    7  
ATOM 4323  H HA   . LYS A 1 3  ? 32.054 -0.231  -8.646  1.00 0.00 ? 3  LYS A HA   7  
ATOM 4324  H HB2  . LYS A 1 3  ? 31.141 0.921   -10.568 1.00 0.00 ? 3  LYS A HB2  7  
ATOM 4325  H HB3  . LYS A 1 3  ? 31.941 -0.568  -10.967 1.00 0.00 ? 3  LYS A HB3  7  
ATOM 4326  H HG2  . LYS A 1 3  ? 29.544 -1.654  -10.921 1.00 0.00 ? 3  LYS A HG2  7  
ATOM 4327  H HG3  . LYS A 1 3  ? 28.945 -0.024  -10.954 1.00 0.00 ? 3  LYS A HG3  7  
ATOM 4328  H HD2  . LYS A 1 3  ? 30.930 -1.223  -12.962 1.00 0.00 ? 3  LYS A HD2  7  
ATOM 4329  H HD3  . LYS A 1 3  ? 29.206 -1.160  -13.228 1.00 0.00 ? 3  LYS A HD3  7  
ATOM 4330  H HE2  . LYS A 1 3  ? 29.229 1.284   -13.322 1.00 0.00 ? 3  LYS A HE2  7  
ATOM 4331  H HE3  . LYS A 1 3  ? 30.898 1.357   -12.772 1.00 0.00 ? 3  LYS A HE3  7  
ATOM 4332  H HZ1  . LYS A 1 3  ? 30.757 1.655   -15.102 1.00 0.00 ? 3  LYS A HZ1  7  
ATOM 4333  H HZ2  . LYS A 1 3  ? 29.982 0.152   -15.288 1.00 0.00 ? 3  LYS A HZ2  7  
ATOM 4334  H HZ3  . LYS A 1 3  ? 31.583 0.219   -14.730 1.00 0.00 ? 3  LYS A HZ3  7  
ATOM 4335  N N    . GLU A 1 4  ? 28.947 -0.673  -7.896  1.00 0.00 ? 4  GLU A N    7  
ATOM 4336  C CA   . GLU A 1 4  ? 27.793 -0.234  -7.123  1.00 0.00 ? 4  GLU A CA   7  
ATOM 4337  C C    . GLU A 1 4  ? 28.203 0.091   -5.685  1.00 0.00 ? 4  GLU A C    7  
ATOM 4338  O O    . GLU A 1 4  ? 27.756 1.065   -5.088  1.00 0.00 ? 4  GLU A O    7  
ATOM 4339  C CB   . GLU A 1 4  ? 26.757 -1.364  -7.085  1.00 0.00 ? 4  GLU A CB   7  
ATOM 4340  C CG   . GLU A 1 4  ? 26.554 -2.044  -8.444  1.00 0.00 ? 4  GLU A CG   7  
ATOM 4341  C CD   . GLU A 1 4  ? 25.328 -2.974  -8.399  1.00 0.00 ? 4  GLU A CD   7  
ATOM 4342  O OE1  . GLU A 1 4  ? 25.423 -4.042  -7.794  1.00 0.00 ? 4  GLU A OE1  7  
ATOM 4343  O OE2  . GLU A 1 4  ? 24.296 -2.618  -8.965  1.00 0.00 ? 4  GLU A OE2  7  
ATOM 4344  H H    . GLU A 1 4  ? 28.993 -1.629  -8.179  1.00 0.00 ? 4  GLU A H    7  
ATOM 4345  H HA   . GLU A 1 4  ? 27.398 0.660   -7.610  1.00 0.00 ? 4  GLU A HA   7  
ATOM 4346  H HB2  . GLU A 1 4  ? 27.056 -2.132  -6.372  1.00 0.00 ? 4  GLU A HB2  7  
ATOM 4347  H HB3  . GLU A 1 4  ? 25.816 -0.957  -6.717  1.00 0.00 ? 4  GLU A HB3  7  
ATOM 4348  H HG2  . GLU A 1 4  ? 26.425 -1.294  -9.222  1.00 0.00 ? 4  GLU A HG2  7  
ATOM 4349  H HG3  . GLU A 1 4  ? 27.433 -2.631  -8.714  1.00 0.00 ? 4  GLU A HG3  7  
ATOM 4350  N N    . ALA A 1 5  ? 29.090 -0.789  -5.183  1.00 0.00 ? 5  ALA A N    7  
ATOM 4351  C CA   . ALA A 1 5  ? 29.652 -0.565  -3.868  1.00 0.00 ? 5  ALA A CA   7  
ATOM 4352  C C    . ALA A 1 5  ? 30.719 0.529   -3.915  1.00 0.00 ? 5  ALA A C    7  
ATOM 4353  O O    . ALA A 1 5  ? 31.036 1.080   -2.881  1.00 0.00 ? 5  ALA A O    7  
ATOM 4354  C CB   . ALA A 1 5  ? 30.259 -1.845  -3.297  1.00 0.00 ? 5  ALA A CB   7  
ATOM 4355  H H    . ALA A 1 5  ? 29.392 -1.564  -5.736  1.00 0.00 ? 5  ALA A H    7  
ATOM 4356  H HA   . ALA A 1 5  ? 28.842 -0.243  -3.214  1.00 0.00 ? 5  ALA A HA   7  
ATOM 4357  H HB1  . ALA A 1 5  ? 31.143 -2.168  -3.849  1.00 0.00 ? 5  ALA A HB1  7  
ATOM 4358  H HB2  . ALA A 1 5  ? 29.540 -2.662  -3.293  1.00 0.00 ? 5  ALA A HB2  7  
ATOM 4359  H HB3  . ALA A 1 5  ? 30.548 -1.673  -2.262  1.00 0.00 ? 5  ALA A HB3  7  
ATOM 4360  N N    . ILE A 1 6  ? 31.262 0.827   -5.116  1.00 0.00 ? 6  ILE A N    7  
ATOM 4361  C CA   . ILE A 1 6  ? 32.372 1.785   -5.160  1.00 0.00 ? 6  ILE A CA   7  
ATOM 4362  C C    . ILE A 1 6  ? 31.884 3.200   -4.813  1.00 0.00 ? 6  ILE A C    7  
ATOM 4363  O O    . ILE A 1 6  ? 32.487 3.865   -3.994  1.00 0.00 ? 6  ILE A O    7  
ATOM 4364  C CB   . ILE A 1 6  ? 33.183 1.706   -6.468  1.00 0.00 ? 6  ILE A CB   7  
ATOM 4365  C CG1  . ILE A 1 6  ? 33.640 0.270   -6.766  1.00 0.00 ? 6  ILE A CG1  7  
ATOM 4366  C CG2  . ILE A 1 6  ? 34.390 2.661   -6.507  1.00 0.00 ? 6  ILE A CG2  7  
ATOM 4367  C CD1  . ILE A 1 6  ? 34.664 -0.332  -5.809  1.00 0.00 ? 6  ILE A CD1  7  
ATOM 4368  H H    . ILE A 1 6  ? 30.930 0.398   -5.954  1.00 0.00 ? 6  ILE A H    7  
ATOM 4369  H HA   . ILE A 1 6  ? 33.035 1.492   -4.358  1.00 0.00 ? 6  ILE A HA   7  
ATOM 4370  H HB   . ILE A 1 6  ? 32.511 2.007   -7.269  1.00 0.00 ? 6  ILE A HB   7  
ATOM 4371  H HG12 . ILE A 1 6  ? 32.780 -0.386  -6.746  1.00 0.00 ? 6  ILE A HG12 7  
ATOM 4372  H HG13 . ILE A 1 6  ? 34.039 0.234   -7.777  1.00 0.00 ? 6  ILE A HG13 7  
ATOM 4373  H HG21 . ILE A 1 6  ? 35.259 2.216   -6.995  1.00 0.00 ? 6  ILE A HG21 7  
ATOM 4374  H HG22 . ILE A 1 6  ? 34.698 2.943   -5.505  1.00 0.00 ? 6  ILE A HG22 7  
ATOM 4375  H HG23 . ILE A 1 6  ? 34.147 3.575   -7.048  1.00 0.00 ? 6  ILE A HG23 7  
ATOM 4376  H HD11 . ILE A 1 6  ? 35.627 0.169   -5.849  1.00 0.00 ? 6  ILE A HD11 7  
ATOM 4377  H HD12 . ILE A 1 6  ? 34.838 -1.372  -6.082  1.00 0.00 ? 6  ILE A HD12 7  
ATOM 4378  H HD13 . ILE A 1 6  ? 34.293 -0.302  -4.788  1.00 0.00 ? 6  ILE A HD13 7  
ATOM 4379  N N    . GLU A 1 7  ? 30.748 3.595   -5.422  1.00 0.00 ? 7  GLU A N    7  
ATOM 4380  C CA   . GLU A 1 7  ? 30.149 4.892   -5.092  1.00 0.00 ? 7  GLU A CA   7  
ATOM 4381  C C    . GLU A 1 7  ? 29.573 4.948   -3.661  1.00 0.00 ? 7  GLU A C    7  
ATOM 4382  O O    . GLU A 1 7  ? 29.331 6.025   -3.131  1.00 0.00 ? 7  GLU A O    7  
ATOM 4383  C CB   . GLU A 1 7  ? 29.064 5.239   -6.123  1.00 0.00 ? 7  GLU A CB   7  
ATOM 4384  C CG   . GLU A 1 7  ? 27.884 4.252   -6.147  1.00 0.00 ? 7  GLU A CG   7  
ATOM 4385  C CD   . GLU A 1 7  ? 26.821 4.637   -7.199  1.00 0.00 ? 7  GLU A CD   7  
ATOM 4386  O OE1  . GLU A 1 7  ? 27.192 4.945   -8.331  1.00 0.00 ? 7  GLU A OE1  7  
ATOM 4387  O OE2  . GLU A 1 7  ? 25.632 4.620   -6.877  1.00 0.00 ? 7  GLU A OE2  7  
ATOM 4388  H H    . GLU A 1 7  ? 30.321 3.004   -6.102  1.00 0.00 ? 7  GLU A H    7  
ATOM 4389  H HA   . GLU A 1 7  ? 30.948 5.630   -5.145  1.00 0.00 ? 7  GLU A HA   7  
ATOM 4390  H HB2  . GLU A 1 7  ? 28.691 6.247   -5.931  1.00 0.00 ? 7  GLU A HB2  7  
ATOM 4391  H HB3  . GLU A 1 7  ? 29.526 5.265   -7.109  1.00 0.00 ? 7  GLU A HB3  7  
ATOM 4392  H HG2  . GLU A 1 7  ? 28.234 3.244   -6.363  1.00 0.00 ? 7  GLU A HG2  7  
ATOM 4393  H HG3  . GLU A 1 7  ? 27.413 4.217   -5.166  1.00 0.00 ? 7  GLU A HG3  7  
ATOM 4394  N N    . ARG A 1 8  ? 29.371 3.750   -3.083  1.00 0.00 ? 8  ARG A N    7  
ATOM 4395  C CA   . ARG A 1 8  ? 28.788 3.619   -1.752  1.00 0.00 ? 8  ARG A CA   7  
ATOM 4396  C C    . ARG A 1 8  ? 29.868 3.826   -0.686  1.00 0.00 ? 8  ARG A C    7  
ATOM 4397  O O    . ARG A 1 8  ? 29.741 4.694   0.165   1.00 0.00 ? 8  ARG A O    7  
ATOM 4398  C CB   . ARG A 1 8  ? 28.127 2.233   -1.665  1.00 0.00 ? 8  ARG A CB   7  
ATOM 4399  C CG   . ARG A 1 8  ? 26.705 2.261   -1.085  1.00 0.00 ? 8  ARG A CG   7  
ATOM 4400  C CD   . ARG A 1 8  ? 25.758 1.270   -1.782  1.00 0.00 ? 8  ARG A CD   7  
ATOM 4401  N NE   . ARG A 1 8  ? 25.048 0.432   -0.826  1.00 0.00 ? 8  ARG A NE   7  
ATOM 4402  C CZ   . ARG A 1 8  ? 24.058 0.894   -0.032  1.00 0.00 ? 8  ARG A CZ   7  
ATOM 4403  N NH1  . ARG A 1 8  ? 23.683 2.170   -0.067  1.00 0.00 ? 8  ARG A NH1  7  
ATOM 4404  N NH2  . ARG A 1 8  ? 23.452 0.048   0.795   1.00 0.00 ? 8  ARG A NH2  7  
ATOM 4405  H H    . ARG A 1 8  ? 29.602 2.915   -3.580  1.00 0.00 ? 8  ARG A H    7  
ATOM 4406  H HA   . ARG A 1 8  ? 28.051 4.418   -1.652  1.00 0.00 ? 8  ARG A HA   7  
ATOM 4407  H HB2  . ARG A 1 8  ? 28.092 1.834   -2.675  1.00 0.00 ? 8  ARG A HB2  7  
ATOM 4408  H HB3  . ARG A 1 8  ? 28.729 1.508   -1.115  1.00 0.00 ? 8  ARG A HB3  7  
ATOM 4409  H HG2  . ARG A 1 8  ? 26.754 2.073   -0.014  1.00 0.00 ? 8  ARG A HG2  7  
ATOM 4410  H HG3  . ARG A 1 8  ? 26.267 3.254   -1.178  1.00 0.00 ? 8  ARG A HG3  7  
ATOM 4411  H HD2  . ARG A 1 8  ? 25.027 1.795   -2.398  1.00 0.00 ? 8  ARG A HD2  7  
ATOM 4412  H HD3  . ARG A 1 8  ? 26.287 0.582   -2.441  1.00 0.00 ? 8  ARG A HD3  7  
ATOM 4413  H HE   . ARG A 1 8  ? 25.303 -0.532  -0.760  1.00 0.00 ? 8  ARG A HE   7  
ATOM 4414  H HH11 . ARG A 1 8  ? 24.136 2.809   -0.688  1.00 0.00 ? 8  ARG A HH11 7  
ATOM 4415  H HH12 . ARG A 1 8  ? 22.946 2.490   0.532   1.00 0.00 ? 8  ARG A HH12 7  
ATOM 4416  H HH21 . ARG A 1 8  ? 23.738 -0.911  0.824   1.00 0.00 ? 8  ARG A HH21 7  
ATOM 4417  H HH22 . ARG A 1 8  ? 22.713 0.373   1.384   1.00 0.00 ? 8  ARG A HH22 7  
ATOM 4418  N N    . LEU A 1 9  ? 30.926 2.999   -0.826  1.00 0.00 ? 9  LEU A N    7  
ATOM 4419  C CA   . LEU A 1 9  ? 32.163 3.012   -0.049  1.00 0.00 ? 9  LEU A CA   7  
ATOM 4420  C C    . LEU A 1 9  ? 32.748 4.453   -0.048  1.00 0.00 ? 9  LEU A C    7  
ATOM 4421  O O    . LEU A 1 9  ? 33.047 5.013   0.992   1.00 0.00 ? 9  LEU A O    7  
ATOM 4422  C CB   . LEU A 1 9  ? 33.137 1.971   -0.622  1.00 0.00 ? 9  LEU A CB   7  
ATOM 4423  C CG   . LEU A 1 9  ? 32.626 0.514   -0.605  1.00 0.00 ? 9  LEU A CG   7  
ATOM 4424  C CD1  . LEU A 1 9  ? 33.267 -0.258  -1.763  1.00 0.00 ? 9  LEU A CD1  7  
ATOM 4425  C CD2  . LEU A 1 9  ? 32.846 -0.205  0.725   1.00 0.00 ? 9  LEU A CD2  7  
ATOM 4426  H H    . LEU A 1 9  ? 30.855 2.322   -1.546  1.00 0.00 ? 9  LEU A H    7  
ATOM 4427  H HA   . LEU A 1 9  ? 31.926 2.676   0.954   1.00 0.00 ? 9  LEU A HA   7  
ATOM 4428  H HB2  . LEU A 1 9  ? 33.344 2.269   -1.648  1.00 0.00 ? 9  LEU A HB2  7  
ATOM 4429  H HB3  . LEU A 1 9  ? 34.086 1.991   -0.091  1.00 0.00 ? 9  LEU A HB3  7  
ATOM 4430  H HG   . LEU A 1 9  ? 31.547 0.501   -0.725  1.00 0.00 ? 9  LEU A HG   7  
ATOM 4431  H HD11 . LEU A 1 9  ? 33.336 0.341   -2.661  1.00 0.00 ? 9  LEU A HD11 7  
ATOM 4432  H HD12 . LEU A 1 9  ? 32.654 -1.103  -2.047  1.00 0.00 ? 9  LEU A HD12 7  
ATOM 4433  H HD13 . LEU A 1 9  ? 34.283 -0.577  -1.523  1.00 0.00 ? 9  LEU A HD13 7  
ATOM 4434  H HD21 . LEU A 1 9  ? 33.855 -0.604  0.782   1.00 0.00 ? 9  LEU A HD21 7  
ATOM 4435  H HD22 . LEU A 1 9  ? 32.160 -1.044  0.835   1.00 0.00 ? 9  LEU A HD22 7  
ATOM 4436  H HD23 . LEU A 1 9  ? 32.682 0.463   1.568   1.00 0.00 ? 9  LEU A HD23 7  
ATOM 4437  N N    . LYS A 1 10 ? 32.831 5.036   -1.260  1.00 0.00 ? 10 LYS A N    7  
ATOM 4438  C CA   . LYS A 1 10 ? 33.319 6.417   -1.416  1.00 0.00 ? 10 LYS A CA   7  
ATOM 4439  C C    . LYS A 1 10 ? 32.403 7.447   -0.733  1.00 0.00 ? 10 LYS A C    7  
ATOM 4440  O O    . LYS A 1 10 ? 32.867 8.450   -0.205  1.00 0.00 ? 10 LYS A O    7  
ATOM 4441  C CB   . LYS A 1 10 ? 33.364 6.771   -2.901  1.00 0.00 ? 10 LYS A CB   7  
ATOM 4442  C CG   . LYS A 1 10 ? 34.405 5.969   -3.661  1.00 0.00 ? 10 LYS A CG   7  
ATOM 4443  C CD   . LYS A 1 10 ? 34.157 6.029   -5.164  1.00 0.00 ? 10 LYS A CD   7  
ATOM 4444  C CE   . LYS A 1 10 ? 34.682 7.319   -5.797  1.00 0.00 ? 10 LYS A CE   7  
ATOM 4445  N NZ   . LYS A 1 10 ? 34.373 7.310   -7.218  1.00 0.00 ? 10 LYS A NZ   7  
ATOM 4446  H H    . LYS A 1 10 ? 32.503 4.524   -2.051  1.00 0.00 ? 10 LYS A H    7  
ATOM 4447  H HA   . LYS A 1 10 ? 34.314 6.478   -0.973  1.00 0.00 ? 10 LYS A HA   7  
ATOM 4448  H HB2  . LYS A 1 10 ? 32.381 6.610   -3.342  1.00 0.00 ? 10 LYS A HB2  7  
ATOM 4449  H HB3  . LYS A 1 10 ? 33.593 7.828   -3.039  1.00 0.00 ? 10 LYS A HB3  7  
ATOM 4450  H HG2  . LYS A 1 10 ? 35.392 6.335   -3.395  1.00 0.00 ? 10 LYS A HG2  7  
ATOM 4451  H HG3  . LYS A 1 10 ? 34.385 4.931   -3.345  1.00 0.00 ? 10 LYS A HG3  7  
ATOM 4452  H HD2  . LYS A 1 10 ? 34.629 5.161   -5.608  1.00 0.00 ? 10 LYS A HD2  7  
ATOM 4453  H HD3  . LYS A 1 10 ? 33.095 5.915   -5.396  1.00 0.00 ? 10 LYS A HD3  7  
ATOM 4454  H HE2  . LYS A 1 10 ? 34.218 8.197   -5.344  1.00 0.00 ? 10 LYS A HE2  7  
ATOM 4455  H HE3  . LYS A 1 10 ? 35.763 7.428   -5.678  1.00 0.00 ? 10 LYS A HE3  7  
ATOM 4456  H HZ1  . LYS A 1 10 ? 34.634 8.216   -7.661  1.00 0.00 ? 10 LYS A HZ1  7  
ATOM 4457  H HZ2  . LYS A 1 10 ? 33.357 7.138   -7.354  1.00 0.00 ? 10 LYS A HZ2  7  
ATOM 4458  H HZ3  . LYS A 1 10 ? 34.907 6.539   -7.667  1.00 0.00 ? 10 LYS A HZ3  7  
ATOM 4459  N N    . ALA A 1 11 ? 31.090 7.146   -0.791  1.00 0.00 ? 11 ALA A N    7  
ATOM 4460  C CA   . ALA A 1 11 ? 30.089 8.049   -0.225  1.00 0.00 ? 11 ALA A CA   7  
ATOM 4461  C C    . ALA A 1 11 ? 30.183 8.146   1.311   1.00 0.00 ? 11 ALA A C    7  
ATOM 4462  O O    . ALA A 1 11 ? 29.702 9.109   1.894   1.00 0.00 ? 11 ALA A O    7  
ATOM 4463  C CB   . ALA A 1 11 ? 28.678 7.619   -0.638  1.00 0.00 ? 11 ALA A CB   7  
ATOM 4464  H H    . ALA A 1 11 ? 30.808 6.304   -1.248  1.00 0.00 ? 11 ALA A H    7  
ATOM 4465  H HA   . ALA A 1 11 ? 30.287 9.037   -0.643  1.00 0.00 ? 11 ALA A HA   7  
ATOM 4466  H HB1  . ALA A 1 11 ? 28.515 7.816   -1.697  1.00 0.00 ? 11 ALA A HB1  7  
ATOM 4467  H HB2  . ALA A 1 11 ? 27.918 8.174   -0.088  1.00 0.00 ? 11 ALA A HB2  7  
ATOM 4468  H HB3  . ALA A 1 11 ? 28.492 6.562   -0.466  1.00 0.00 ? 11 ALA A HB3  7  
ATOM 4469  N N    . LEU A 1 12 ? 30.839 7.136   1.928   1.00 0.00 ? 12 LEU A N    7  
ATOM 4470  C CA   . LEU A 1 12 ? 31.074 7.175   3.369   1.00 0.00 ? 12 LEU A CA   7  
ATOM 4471  C C    . LEU A 1 12 ? 32.248 8.134   3.738   1.00 0.00 ? 12 LEU A C    7  
ATOM 4472  O O    . LEU A 1 12 ? 32.621 8.216   4.903   1.00 0.00 ? 12 LEU A O    7  
ATOM 4473  C CB   . LEU A 1 12 ? 31.390 5.756   3.875   1.00 0.00 ? 12 LEU A CB   7  
ATOM 4474  C CG   . LEU A 1 12 ? 30.236 4.724   3.902   1.00 0.00 ? 12 LEU A CG   7  
ATOM 4475  C CD1  . LEU A 1 12 ? 30.396 3.690   2.788   1.00 0.00 ? 12 LEU A CD1  7  
ATOM 4476  C CD2  . LEU A 1 12 ? 30.216 3.964   5.231   1.00 0.00 ? 12 LEU A CD2  7  
ATOM 4477  H H    . LEU A 1 12 ? 31.208 6.367   1.408   1.00 0.00 ? 12 LEU A H    7  
ATOM 4478  H HA   . LEU A 1 12 ? 30.169 7.551   3.846   1.00 0.00 ? 12 LEU A HA   7  
ATOM 4479  H HB2  . LEU A 1 12 ? 32.191 5.377   3.253   1.00 0.00 ? 12 LEU A HB2  7  
ATOM 4480  H HB3  . LEU A 1 12 ? 31.802 5.830   4.877   1.00 0.00 ? 12 LEU A HB3  7  
ATOM 4481  H HG   . LEU A 1 12 ? 29.283 5.240   3.776   1.00 0.00 ? 12 LEU A HG   7  
ATOM 4482  H HD11 . LEU A 1 12 ? 30.929 4.167   1.981   1.00 0.00 ? 12 LEU A HD11 7  
ATOM 4483  H HD12 . LEU A 1 12 ? 29.436 3.324   2.420   1.00 0.00 ? 12 LEU A HD12 7  
ATOM 4484  H HD13 . LEU A 1 12 ? 31.002 2.833   3.089   1.00 0.00 ? 12 LEU A HD13 7  
ATOM 4485  H HD21 . LEU A 1 12 ? 31.119 3.368   5.332   1.00 0.00 ? 12 LEU A HD21 7  
ATOM 4486  H HD22 . LEU A 1 12 ? 29.379 3.269   5.277   1.00 0.00 ? 12 LEU A HD22 7  
ATOM 4487  H HD23 . LEU A 1 12 ? 30.172 4.645   6.080   1.00 0.00 ? 12 LEU A HD23 7  
ATOM 4488  N N    . GLY A 1 13 ? 32.792 8.847   2.722   1.00 0.00 ? 13 GLY A N    7  
ATOM 4489  C CA   . GLY A 1 13 ? 33.846 9.847   2.928   1.00 0.00 ? 13 GLY A CA   7  
ATOM 4490  C C    . GLY A 1 13 ? 35.237 9.330   2.535   1.00 0.00 ? 13 GLY A C    7  
ATOM 4491  O O    . GLY A 1 13 ? 36.248 9.837   3.012   1.00 0.00 ? 13 GLY A O    7  
ATOM 4492  H H    . GLY A 1 13 ? 32.449 8.722   1.795   1.00 0.00 ? 13 GLY A H    7  
ATOM 4493  H HA2  . GLY A 1 13 ? 33.599 10.709  2.309   1.00 0.00 ? 13 GLY A HA2  7  
ATOM 4494  H HA3  . GLY A 1 13 ? 33.852 10.158  3.973   1.00 0.00 ? 13 GLY A HA3  7  
ATOM 4495  N N    . PHE A 1 14 ? 35.224 8.291   1.668   1.00 0.00 ? 14 PHE A N    7  
ATOM 4496  C CA   . PHE A 1 14 ? 36.447 7.579   1.292   1.00 0.00 ? 14 PHE A CA   7  
ATOM 4497  C C    . PHE A 1 14 ? 36.813 7.973   -0.156  1.00 0.00 ? 14 PHE A C    7  
ATOM 4498  O O    . PHE A 1 14 ? 36.562 9.098   -0.575  1.00 0.00 ? 14 PHE A O    7  
ATOM 4499  C CB   . PHE A 1 14 ? 36.222 6.058   1.479   1.00 0.00 ? 14 PHE A CB   7  
ATOM 4500  C CG   . PHE A 1 14 ? 35.666 5.684   2.837   1.00 0.00 ? 14 PHE A CG   7  
ATOM 4501  C CD1  . PHE A 1 14 ? 35.853 6.488   3.962   1.00 0.00 ? 14 PHE A CD1  7  
ATOM 4502  C CD2  . PHE A 1 14 ? 34.889 4.536   2.960   1.00 0.00 ? 14 PHE A CD2  7  
ATOM 4503  C CE1  . PHE A 1 14 ? 35.174 6.220   5.138   1.00 0.00 ? 14 PHE A CE1  7  
ATOM 4504  C CE2  . PHE A 1 14 ? 34.212 4.263   4.138   1.00 0.00 ? 14 PHE A CE2  7  
ATOM 4505  C CZ   . PHE A 1 14 ? 34.327 5.133   5.214   1.00 0.00 ? 14 PHE A CZ   7  
ATOM 4506  H H    . PHE A 1 14 ? 34.355 7.963   1.303   1.00 0.00 ? 14 PHE A H    7  
ATOM 4507  H HA   . PHE A 1 14 ? 37.249 7.933   1.943   1.00 0.00 ? 14 PHE A HA   7  
ATOM 4508  H HB2  . PHE A 1 14 ? 35.523 5.717   0.713   1.00 0.00 ? 14 PHE A HB2  7  
ATOM 4509  H HB3  . PHE A 1 14 ? 37.136 5.497   1.324   1.00 0.00 ? 14 PHE A HB3  7  
ATOM 4510  H HD1  . PHE A 1 14 ? 36.508 7.349   3.952   1.00 0.00 ? 14 PHE A HD1  7  
ATOM 4511  H HD2  . PHE A 1 14 ? 34.797 3.848   2.128   1.00 0.00 ? 14 PHE A HD2  7  
ATOM 4512  H HE1  . PHE A 1 14 ? 35.284 6.865   5.994   1.00 0.00 ? 14 PHE A HE1  7  
ATOM 4513  H HE2  . PHE A 1 14 ? 33.570 3.395   4.193   1.00 0.00 ? 14 PHE A HE2  7  
ATOM 4514  H HZ   . PHE A 1 14 ? 33.748 4.994   6.116   1.00 0.00 ? 14 PHE A HZ   7  
ATOM 4515  N N    . GLU A 1 15 ? 37.413 7.005   -0.885  1.00 0.00 ? 15 GLU A N    7  
ATOM 4516  C CA   . GLU A 1 15 ? 37.890 7.233   -2.249  1.00 0.00 ? 15 GLU A CA   7  
ATOM 4517  C C    . GLU A 1 15 ? 38.071 5.873   -2.931  1.00 0.00 ? 15 GLU A C    7  
ATOM 4518  O O    . GLU A 1 15 ? 38.500 4.918   -2.299  1.00 0.00 ? 15 GLU A O    7  
ATOM 4519  C CB   . GLU A 1 15 ? 39.233 7.989   -2.226  1.00 0.00 ? 15 GLU A CB   7  
ATOM 4520  C CG   . GLU A 1 15 ? 39.541 8.675   -3.564  1.00 0.00 ? 15 GLU A CG   7  
ATOM 4521  C CD   . GLU A 1 15 ? 40.959 9.280   -3.601  1.00 0.00 ? 15 GLU A CD   7  
ATOM 4522  O OE1  . GLU A 1 15 ? 41.913 8.574   -3.276  1.00 0.00 ? 15 GLU A OE1  7  
ATOM 4523  O OE2  . GLU A 1 15 ? 41.095 10.450  -3.962  1.00 0.00 ? 15 GLU A OE2  7  
ATOM 4524  H H    . GLU A 1 15 ? 37.562 6.110   -0.465  1.00 0.00 ? 15 GLU A H    7  
ATOM 4525  H HA   . GLU A 1 15 ? 37.127 7.808   -2.777  1.00 0.00 ? 15 GLU A HA   7  
ATOM 4526  H HB2  . GLU A 1 15 ? 39.214 8.734   -1.434  1.00 0.00 ? 15 GLU A HB2  7  
ATOM 4527  H HB3  . GLU A 1 15 ? 40.052 7.317   -1.978  1.00 0.00 ? 15 GLU A HB3  7  
ATOM 4528  H HG2  . GLU A 1 15 ? 39.452 7.968   -4.387  1.00 0.00 ? 15 GLU A HG2  7  
ATOM 4529  H HG3  . GLU A 1 15 ? 38.801 9.451   -3.750  1.00 0.00 ? 15 GLU A HG3  7  
ATOM 4530  N N    . GLU A 1 16 ? 37.723 5.854   -4.239  1.00 0.00 ? 16 GLU A N    7  
ATOM 4531  C CA   . GLU A 1 16 ? 37.679 4.666   -5.100  1.00 0.00 ? 16 GLU A CA   7  
ATOM 4532  C C    . GLU A 1 16 ? 38.919 3.732   -4.983  1.00 0.00 ? 16 GLU A C    7  
ATOM 4533  O O    . GLU A 1 16 ? 38.838 2.546   -5.272  1.00 0.00 ? 16 GLU A O    7  
ATOM 4534  C CB   . GLU A 1 16 ? 37.447 5.129   -6.552  1.00 0.00 ? 16 GLU A CB   7  
ATOM 4535  C CG   . GLU A 1 16 ? 37.737 4.093   -7.663  1.00 0.00 ? 16 GLU A CG   7  
ATOM 4536  C CD   . GLU A 1 16 ? 39.153 4.292   -8.267  1.00 0.00 ? 16 GLU A CD   7  
ATOM 4537  O OE1  . GLU A 1 16 ? 40.120 3.788   -7.699  1.00 0.00 ? 16 GLU A OE1  7  
ATOM 4538  O OE2  . GLU A 1 16 ? 39.276 4.952   -9.299  1.00 0.00 ? 16 GLU A OE2  7  
ATOM 4539  H H    . GLU A 1 16 ? 37.409 6.720   -4.624  1.00 0.00 ? 16 GLU A H    7  
ATOM 4540  H HA   . GLU A 1 16 ? 36.789 4.137   -4.770  1.00 0.00 ? 16 GLU A HA   7  
ATOM 4541  H HB2  . GLU A 1 16 ? 36.400 5.395   -6.671  1.00 0.00 ? 16 GLU A HB2  7  
ATOM 4542  H HB3  . GLU A 1 16 ? 37.981 6.068   -6.702  1.00 0.00 ? 16 GLU A HB3  7  
ATOM 4543  H HG2  . GLU A 1 16 ? 37.583 3.063   -7.330  1.00 0.00 ? 16 GLU A HG2  7  
ATOM 4544  H HG3  . GLU A 1 16 ? 37.000 4.220   -8.454  1.00 0.00 ? 16 GLU A HG3  7  
ATOM 4545  N N    . SER A 1 17 ? 40.054 4.311   -4.561  1.00 0.00 ? 17 SER A N    7  
ATOM 4546  C CA   . SER A 1 17 ? 41.280 3.538   -4.441  1.00 0.00 ? 17 SER A CA   7  
ATOM 4547  C C    . SER A 1 17 ? 41.305 2.754   -3.122  1.00 0.00 ? 17 SER A C    7  
ATOM 4548  O O    . SER A 1 17 ? 41.528 1.550   -3.130  1.00 0.00 ? 17 SER A O    7  
ATOM 4549  C CB   . SER A 1 17 ? 42.459 4.515   -4.511  1.00 0.00 ? 17 SER A CB   7  
ATOM 4550  O OG   . SER A 1 17 ? 43.050 4.565   -5.796  1.00 0.00 ? 17 SER A OG   7  
ATOM 4551  H H    . SER A 1 17 ? 40.063 5.274   -4.295  1.00 0.00 ? 17 SER A H    7  
ATOM 4552  H HA   . SER A 1 17 ? 41.303 2.811   -5.258  1.00 0.00 ? 17 SER A HA   7  
ATOM 4553  H HB2  . SER A 1 17 ? 42.155 5.514   -4.186  1.00 0.00 ? 17 SER A HB2  7  
ATOM 4554  H HB3  . SER A 1 17 ? 43.246 4.219   -3.822  1.00 0.00 ? 17 SER A HB3  7  
ATOM 4555  H HG   . SER A 1 17 ? 42.392 4.776   -6.448  1.00 0.00 ? 17 SER A HG   7  
ATOM 4556  N N    . LEU A 1 18 ? 41.064 3.479   -2.003  1.00 0.00 ? 18 LEU A N    7  
ATOM 4557  C CA   . LEU A 1 18 ? 41.024 2.805   -0.701  1.00 0.00 ? 18 LEU A CA   7  
ATOM 4558  C C    . LEU A 1 18 ? 39.838 1.834   -0.614  1.00 0.00 ? 18 LEU A C    7  
ATOM 4559  O O    . LEU A 1 18 ? 39.865 0.891   0.167   1.00 0.00 ? 18 LEU A O    7  
ATOM 4560  C CB   . LEU A 1 18 ? 41.088 3.808   0.471   1.00 0.00 ? 18 LEU A CB   7  
ATOM 4561  C CG   . LEU A 1 18 ? 39.781 4.486   0.943   1.00 0.00 ? 18 LEU A CG   7  
ATOM 4562  C CD1  . LEU A 1 18 ? 39.416 4.111   2.387   1.00 0.00 ? 18 LEU A CD1  7  
ATOM 4563  C CD2  . LEU A 1 18 ? 39.900 6.011   0.875   1.00 0.00 ? 18 LEU A CD2  7  
ATOM 4564  H H    . LEU A 1 18 ? 40.884 4.459   -2.078  1.00 0.00 ? 18 LEU A H    7  
ATOM 4565  H HA   . LEU A 1 18 ? 41.930 2.203   -0.651  1.00 0.00 ? 18 LEU A HA   7  
ATOM 4566  H HB2  . LEU A 1 18 ? 41.525 3.291   1.318   1.00 0.00 ? 18 LEU A HB2  7  
ATOM 4567  H HB3  . LEU A 1 18 ? 41.835 4.561   0.230   1.00 0.00 ? 18 LEU A HB3  7  
ATOM 4568  H HG   . LEU A 1 18 ? 38.969 4.175   0.288   1.00 0.00 ? 18 LEU A HG   7  
ATOM 4569  H HD11 . LEU A 1 18 ? 39.393 3.032   2.545   1.00 0.00 ? 18 LEU A HD11 7  
ATOM 4570  H HD12 . LEU A 1 18 ? 38.462 4.553   2.660   1.00 0.00 ? 18 LEU A HD12 7  
ATOM 4571  H HD13 . LEU A 1 18 ? 40.106 4.532   3.106   1.00 0.00 ? 18 LEU A HD13 7  
ATOM 4572  H HD21 . LEU A 1 18 ? 40.779 6.359   1.415   1.00 0.00 ? 18 LEU A HD21 7  
ATOM 4573  H HD22 . LEU A 1 18 ? 39.040 6.507   1.322   1.00 0.00 ? 18 LEU A HD22 7  
ATOM 4574  H HD23 . LEU A 1 18 ? 39.996 6.335   -0.153  1.00 0.00 ? 18 LEU A HD23 7  
ATOM 4575  N N    . VAL A 1 19 ? 38.844 2.129   -1.470  1.00 0.00 ? 19 VAL A N    7  
ATOM 4576  C CA   . VAL A 1 19 ? 37.562 1.451   -1.640  1.00 0.00 ? 19 VAL A CA   7  
ATOM 4577  C C    . VAL A 1 19 ? 37.740 0.121   -2.374  1.00 0.00 ? 19 VAL A C    7  
ATOM 4578  O O    . VAL A 1 19 ? 37.354 -0.924  -1.874  1.00 0.00 ? 19 VAL A O    7  
ATOM 4579  C CB   . VAL A 1 19 ? 36.681 2.429   -2.430  1.00 0.00 ? 19 VAL A CB   7  
ATOM 4580  C CG1  . VAL A 1 19 ? 35.613 1.772   -3.305  1.00 0.00 ? 19 VAL A CG1  7  
ATOM 4581  C CG2  . VAL A 1 19 ? 36.130 3.573   -1.558  1.00 0.00 ? 19 VAL A CG2  7  
ATOM 4582  H H    . VAL A 1 19 ? 38.994 2.916   -2.074  1.00 0.00 ? 19 VAL A H    7  
ATOM 4583  H HA   . VAL A 1 19 ? 37.134 1.222   -0.671  1.00 0.00 ? 19 VAL A HA   7  
ATOM 4584  H HB   . VAL A 1 19 ? 37.368 2.888   -3.132  1.00 0.00 ? 19 VAL A HB   7  
ATOM 4585  H HG11 . VAL A 1 19 ? 36.010 1.618   -4.308  1.00 0.00 ? 19 VAL A HG11 7  
ATOM 4586  H HG12 . VAL A 1 19 ? 34.724 2.389   -3.379  1.00 0.00 ? 19 VAL A HG12 7  
ATOM 4587  H HG13 . VAL A 1 19 ? 35.314 0.802   -2.925  1.00 0.00 ? 19 VAL A HG13 7  
ATOM 4588  H HG21 . VAL A 1 19 ? 36.809 3.826   -0.748  1.00 0.00 ? 19 VAL A HG21 7  
ATOM 4589  H HG22 . VAL A 1 19 ? 35.156 3.386   -1.129  1.00 0.00 ? 19 VAL A HG22 7  
ATOM 4590  H HG23 . VAL A 1 19 ? 36.010 4.471   -2.148  1.00 0.00 ? 19 VAL A HG23 7  
ATOM 4591  N N    . ILE A 1 20 ? 38.327 0.235   -3.581  1.00 0.00 ? 20 ILE A N    7  
ATOM 4592  C CA   . ILE A 1 20 ? 38.607 -0.943  -4.398  1.00 0.00 ? 20 ILE A CA   7  
ATOM 4593  C C    . ILE A 1 20 ? 39.445 -1.934  -3.600  1.00 0.00 ? 20 ILE A C    7  
ATOM 4594  O O    . ILE A 1 20 ? 39.046 -3.073  -3.447  1.00 0.00 ? 20 ILE A O    7  
ATOM 4595  C CB   . ILE A 1 20 ? 39.264 -0.546  -5.738  1.00 0.00 ? 20 ILE A CB   7  
ATOM 4596  C CG1  . ILE A 1 20 ? 38.169 -0.115  -6.732  1.00 0.00 ? 20 ILE A CG1  7  
ATOM 4597  C CG2  . ILE A 1 20 ? 40.154 -1.652  -6.338  1.00 0.00 ? 20 ILE A CG2  7  
ATOM 4598  C CD1  . ILE A 1 20 ? 38.680 0.259   -8.122  1.00 0.00 ? 20 ILE A CD1  7  
ATOM 4599  H H    . ILE A 1 20 ? 38.586 1.141   -3.901  1.00 0.00 ? 20 ILE A H    7  
ATOM 4600  H HA   . ILE A 1 20 ? 37.648 -1.426  -4.582  1.00 0.00 ? 20 ILE A HA   7  
ATOM 4601  H HB   . ILE A 1 20 ? 39.920 0.301   -5.542  1.00 0.00 ? 20 ILE A HB   7  
ATOM 4602  H HG12 . ILE A 1 20 ? 37.435 -0.912  -6.843  1.00 0.00 ? 20 ILE A HG12 7  
ATOM 4603  H HG13 . ILE A 1 20 ? 37.629 0.738   -6.327  1.00 0.00 ? 20 ILE A HG13 7  
ATOM 4604  H HG21 . ILE A 1 20 ? 40.561 -1.363  -7.305  1.00 0.00 ? 20 ILE A HG21 7  
ATOM 4605  H HG22 . ILE A 1 20 ? 39.601 -2.578  -6.468  1.00 0.00 ? 20 ILE A HG22 7  
ATOM 4606  H HG23 . ILE A 1 20 ? 41.013 -1.857  -5.700  1.00 0.00 ? 20 ILE A HG23 7  
ATOM 4607  H HD11 . ILE A 1 20 ? 39.526 0.944   -8.067  1.00 0.00 ? 20 ILE A HD11 7  
ATOM 4608  H HD12 . ILE A 1 20 ? 37.885 0.740   -8.690  1.00 0.00 ? 20 ILE A HD12 7  
ATOM 4609  H HD13 . ILE A 1 20 ? 38.986 -0.626  -8.679  1.00 0.00 ? 20 ILE A HD13 7  
ATOM 4610  N N    . GLN A 1 21 ? 40.585 -1.435  -3.088  1.00 0.00 ? 21 GLN A N    7  
ATOM 4611  C CA   . GLN A 1 21 ? 41.467 -2.281  -2.286  1.00 0.00 ? 21 GLN A CA   7  
ATOM 4612  C C    . GLN A 1 21 ? 40.782 -2.788  -0.994  1.00 0.00 ? 21 GLN A C    7  
ATOM 4613  O O    . GLN A 1 21 ? 41.131 -3.845  -0.491  1.00 0.00 ? 21 GLN A O    7  
ATOM 4614  C CB   . GLN A 1 21 ? 42.750 -1.502  -1.979  1.00 0.00 ? 21 GLN A CB   7  
ATOM 4615  C CG   . GLN A 1 21 ? 43.727 -2.240  -1.054  1.00 0.00 ? 21 GLN A CG   7  
ATOM 4616  C CD   . GLN A 1 21 ? 45.059 -1.480  -1.068  1.00 0.00 ? 21 GLN A CD   7  
ATOM 4617  O OE1  . GLN A 1 21 ? 45.184 -0.388  -0.517  1.00 0.00 ? 21 GLN A OE1  7  
ATOM 4618  N NE2  . GLN A 1 21 ? 45.989 -2.060  -1.836  1.00 0.00 ? 21 GLN A NE2  7  
ATOM 4619  H H    . GLN A 1 21 ? 40.821 -0.486  -3.289  1.00 0.00 ? 21 GLN A H    7  
ATOM 4620  H HA   . GLN A 1 21 ? 41.716 -3.144  -2.906  1.00 0.00 ? 21 GLN A HA   7  
ATOM 4621  H HB2  . GLN A 1 21 ? 43.247 -1.288  -2.927  1.00 0.00 ? 21 GLN A HB2  7  
ATOM 4622  H HB3  . GLN A 1 21 ? 42.506 -0.533  -1.544  1.00 0.00 ? 21 GLN A HB3  7  
ATOM 4623  H HG2  . GLN A 1 21 ? 43.349 -2.287  -0.034  1.00 0.00 ? 21 GLN A HG2  7  
ATOM 4624  H HG3  . GLN A 1 21 ? 43.867 -3.269  -1.392  1.00 0.00 ? 21 GLN A HG3  7  
ATOM 4625  H HE21 . GLN A 1 21 ? 45.930 -3.038  -2.049  1.00 0.00 ? 21 GLN A HE21 7  
ATOM 4626  H HE22 . GLN A 1 21 ? 46.729 -1.516  -2.227  1.00 0.00 ? 21 GLN A HE22 7  
ATOM 4627  N N    . ALA A 1 22 ? 39.797 -2.004  -0.506  1.00 0.00 ? 22 ALA A N    7  
ATOM 4628  C CA   . ALA A 1 22 ? 39.046 -2.399  0.687   1.00 0.00 ? 22 ALA A CA   7  
ATOM 4629  C C    . ALA A 1 22 ? 37.872 -3.341  0.385   1.00 0.00 ? 22 ALA A C    7  
ATOM 4630  O O    . ALA A 1 22 ? 37.268 -3.849  1.315   1.00 0.00 ? 22 ALA A O    7  
ATOM 4631  C CB   . ALA A 1 22 ? 38.417 -1.176  1.348   1.00 0.00 ? 22 ALA A CB   7  
ATOM 4632  H H    . ALA A 1 22 ? 39.544 -1.170  -0.992  1.00 0.00 ? 22 ALA A H    7  
ATOM 4633  H HA   . ALA A 1 22 ? 39.737 -2.907  1.363   1.00 0.00 ? 22 ALA A HA   7  
ATOM 4634  H HB1  . ALA A 1 22 ? 39.173 -0.514  1.749   1.00 0.00 ? 22 ALA A HB1  7  
ATOM 4635  H HB2  . ALA A 1 22 ? 37.787 -1.466  2.188   1.00 0.00 ? 22 ALA A HB2  7  
ATOM 4636  H HB3  . ALA A 1 22 ? 37.808 -0.602  0.649   1.00 0.00 ? 22 ALA A HB3  7  
ATOM 4637  N N    . TYR A 1 23 ? 37.565 -3.519  -0.915  1.00 0.00 ? 23 TYR A N    7  
ATOM 4638  C CA   . TYR A 1 23 ? 36.455 -4.369  -1.365  1.00 0.00 ? 23 TYR A CA   7  
ATOM 4639  C C    . TYR A 1 23 ? 36.991 -5.512  -2.244  1.00 0.00 ? 23 TYR A C    7  
ATOM 4640  O O    . TYR A 1 23 ? 36.226 -6.353  -2.677  1.00 0.00 ? 23 TYR A O    7  
ATOM 4641  C CB   . TYR A 1 23 ? 35.452 -3.522  -2.171  1.00 0.00 ? 23 TYR A CB   7  
ATOM 4642  C CG   . TYR A 1 23 ? 33.995 -3.896  -1.963  1.00 0.00 ? 23 TYR A CG   7  
ATOM 4643  C CD1  . TYR A 1 23 ? 33.355 -4.857  -2.726  1.00 0.00 ? 23 TYR A CD1  7  
ATOM 4644  C CD2  . TYR A 1 23 ? 33.274 -3.238  -0.984  1.00 0.00 ? 23 TYR A CD2  7  
ATOM 4645  C CE1  . TYR A 1 23 ? 32.002 -5.128  -2.534  1.00 0.00 ? 23 TYR A CE1  7  
ATOM 4646  C CE2  . TYR A 1 23 ? 31.925 -3.493  -0.775  1.00 0.00 ? 23 TYR A CE2  7  
ATOM 4647  C CZ   . TYR A 1 23 ? 31.284 -4.443  -1.552  1.00 0.00 ? 23 TYR A CZ   7  
ATOM 4648  O OH   . TYR A 1 23 ? 29.948 -4.668  -1.334  1.00 0.00 ? 23 TYR A OH   7  
ATOM 4649  H H    . TYR A 1 23 ? 38.086 -3.017  -1.602  1.00 0.00 ? 23 TYR A H    7  
ATOM 4650  H HA   . TYR A 1 23 ? 35.971 -4.807  -0.490  1.00 0.00 ? 23 TYR A HA   7  
ATOM 4651  H HB2  . TYR A 1 23 ? 35.550 -2.486  -1.862  1.00 0.00 ? 23 TYR A HB2  7  
ATOM 4652  H HB3  . TYR A 1 23 ? 35.673 -3.504  -3.240  1.00 0.00 ? 23 TYR A HB3  7  
ATOM 4653  H HD1  . TYR A 1 23 ? 33.907 -5.393  -3.483  1.00 0.00 ? 23 TYR A HD1  7  
ATOM 4654  H HD2  . TYR A 1 23 ? 33.747 -2.481  -0.391  1.00 0.00 ? 23 TYR A HD2  7  
ATOM 4655  H HE1  . TYR A 1 23 ? 31.518 -5.880  -3.142  1.00 0.00 ? 23 TYR A HE1  7  
ATOM 4656  H HE2  . TYR A 1 23 ? 31.389 -2.955  -0.011  1.00 0.00 ? 23 TYR A HE2  7  
ATOM 4657  H HH   . TYR A 1 23 ? 29.799 -5.603  -1.210  1.00 0.00 ? 23 TYR A HH   7  
ATOM 4658  N N    . PHE A 1 24 ? 38.311 -5.505  -2.506  1.00 0.00 ? 24 PHE A N    7  
ATOM 4659  C CA   . PHE A 1 24 ? 38.927 -6.555  -3.324  1.00 0.00 ? 24 PHE A CA   7  
ATOM 4660  C C    . PHE A 1 24 ? 39.822 -7.400  -2.408  1.00 0.00 ? 24 PHE A C    7  
ATOM 4661  O O    . PHE A 1 24 ? 39.860 -8.620  -2.524  1.00 0.00 ? 24 PHE A O    7  
ATOM 4662  C CB   . PHE A 1 24 ? 39.766 -5.952  -4.475  1.00 0.00 ? 24 PHE A CB   7  
ATOM 4663  C CG   . PHE A 1 24 ? 39.193 -6.196  -5.846  1.00 0.00 ? 24 PHE A CG   7  
ATOM 4664  C CD1  . PHE A 1 24 ? 39.353 -7.441  -6.441  1.00 0.00 ? 24 PHE A CD1  7  
ATOM 4665  C CD2  . PHE A 1 24 ? 38.527 -5.193  -6.547  1.00 0.00 ? 24 PHE A CD2  7  
ATOM 4666  C CE1  . PHE A 1 24 ? 38.902 -7.669  -7.733  1.00 0.00 ? 24 PHE A CE1  7  
ATOM 4667  C CE2  . PHE A 1 24 ? 38.080 -5.412  -7.844  1.00 0.00 ? 24 PHE A CE2  7  
ATOM 4668  C CZ   . PHE A 1 24 ? 38.279 -6.650  -8.442  1.00 0.00 ? 24 PHE A CZ   7  
ATOM 4669  H H    . PHE A 1 24 ? 38.888 -4.787  -2.125  1.00 0.00 ? 24 PHE A H    7  
ATOM 4670  H HA   . PHE A 1 24 ? 38.145 -7.217  -3.702  1.00 0.00 ? 24 PHE A HA   7  
ATOM 4671  H HB2  . PHE A 1 24 ? 39.928 -4.889  -4.350  1.00 0.00 ? 24 PHE A HB2  7  
ATOM 4672  H HB3  . PHE A 1 24 ? 40.769 -6.380  -4.474  1.00 0.00 ? 24 PHE A HB3  7  
ATOM 4673  H HD1  . PHE A 1 24 ? 39.820 -8.239  -5.884  1.00 0.00 ? 24 PHE A HD1  7  
ATOM 4674  H HD2  . PHE A 1 24 ? 38.339 -4.242  -6.077  1.00 0.00 ? 24 PHE A HD2  7  
ATOM 4675  H HE1  . PHE A 1 24 ? 39.033 -8.642  -8.181  1.00 0.00 ? 24 PHE A HE1  7  
ATOM 4676  H HE2  . PHE A 1 24 ? 37.572 -4.625  -8.386  1.00 0.00 ? 24 PHE A HE2  7  
ATOM 4677  H HZ   . PHE A 1 24 ? 37.946 -6.824  -9.453  1.00 0.00 ? 24 PHE A HZ   7  
ATOM 4678  N N    . ALA A 1 25 ? 40.520 -6.689  -1.496  1.00 0.00 ? 25 ALA A N    7  
ATOM 4679  C CA   . ALA A 1 25 ? 41.331 -7.360  -0.481  1.00 0.00 ? 25 ALA A CA   7  
ATOM 4680  C C    . ALA A 1 25 ? 40.429 -8.029  0.576   1.00 0.00 ? 25 ALA A C    7  
ATOM 4681  O O    . ALA A 1 25 ? 40.797 -9.030  1.177   1.00 0.00 ? 25 ALA A O    7  
ATOM 4682  C CB   . ALA A 1 25 ? 42.288 -6.364  0.184   1.00 0.00 ? 25 ALA A CB   7  
ATOM 4683  H H    . ALA A 1 25 ? 40.469 -5.692  -1.491  1.00 0.00 ? 25 ALA A H    7  
ATOM 4684  H HA   . ALA A 1 25 ? 41.915 -8.124  -0.996  1.00 0.00 ? 25 ALA A HA   7  
ATOM 4685  H HB1  . ALA A 1 25 ? 43.041 -6.880  0.779   1.00 0.00 ? 25 ALA A HB1  7  
ATOM 4686  H HB2  . ALA A 1 25 ? 41.769 -5.677  0.853   1.00 0.00 ? 25 ALA A HB2  7  
ATOM 4687  H HB3  . ALA A 1 25 ? 42.817 -5.778  -0.569  1.00 0.00 ? 25 ALA A HB3  7  
ATOM 4688  N N    . CYS A 1 26 ? 39.228 -7.432  0.735   1.00 0.00 ? 26 CYS A N    7  
ATOM 4689  C CA   . CYS A 1 26 ? 38.197 -7.985  1.615   1.00 0.00 ? 26 CYS A CA   7  
ATOM 4690  C C    . CYS A 1 26 ? 37.415 -9.144  0.968   1.00 0.00 ? 26 CYS A C    7  
ATOM 4691  O O    . CYS A 1 26 ? 36.488 -9.659  1.582   1.00 0.00 ? 26 CYS A O    7  
ATOM 4692  C CB   . CYS A 1 26 ? 37.218 -6.870  1.994   1.00 0.00 ? 26 CYS A CB   7  
ATOM 4693  S SG   . CYS A 1 26 ? 37.685 -6.137  3.585   1.00 0.00 ? 26 CYS A SG   7  
ATOM 4694  H H    . CYS A 1 26 ? 39.037 -6.592  0.227   1.00 0.00 ? 26 CYS A H    7  
ATOM 4695  H HA   . CYS A 1 26 ? 38.700 -8.356  2.510   1.00 0.00 ? 26 CYS A HA   7  
ATOM 4696  H HB2  . CYS A 1 26 ? 37.264 -6.118  1.215   1.00 0.00 ? 26 CYS A HB2  7  
ATOM 4697  H HB3  . CYS A 1 26 ? 36.170 -7.189  2.013   1.00 0.00 ? 26 CYS A HB3  7  
ATOM 4698  H HG   . CYS A 1 26 ? 37.385 -4.841  3.578   1.00 0.00 ? 26 CYS A HG   7  
ATOM 4699  N N    . GLU A 1 27 ? 37.800 -9.513  -0.279  1.00 0.00 ? 27 GLU A N    7  
ATOM 4700  C CA   . GLU A 1 27 ? 37.089 -10.544 -1.038  1.00 0.00 ? 27 GLU A CA   7  
ATOM 4701  C C    . GLU A 1 27 ? 35.607 -10.161 -1.238  1.00 0.00 ? 27 GLU A C    7  
ATOM 4702  O O    . GLU A 1 27 ? 34.700 -10.857 -0.797  1.00 0.00 ? 27 GLU A O    7  
ATOM 4703  C CB   . GLU A 1 27 ? 37.314 -11.935 -0.407  1.00 0.00 ? 27 GLU A CB   7  
ATOM 4704  C CG   . GLU A 1 27 ? 36.422 -13.050 -0.994  1.00 0.00 ? 27 GLU A CG   7  
ATOM 4705  C CD   . GLU A 1 27 ? 37.143 -14.398 -1.130  1.00 0.00 ? 27 GLU A CD   7  
ATOM 4706  O OE1  . GLU A 1 27 ? 38.080 -14.475 -1.920  1.00 0.00 ? 27 GLU A OE1  7  
ATOM 4707  O OE2  . GLU A 1 27 ? 36.752 -15.356 -0.460  1.00 0.00 ? 27 GLU A OE2  7  
ATOM 4708  H H    . GLU A 1 27 ? 38.594 -9.082  -0.702  1.00 0.00 ? 27 GLU A H    7  
ATOM 4709  H HA   . GLU A 1 27 ? 37.547 -10.545 -2.027  1.00 0.00 ? 27 GLU A HA   7  
ATOM 4710  H HB2  . GLU A 1 27 ? 38.374 -12.172 -0.511  1.00 0.00 ? 27 GLU A HB2  7  
ATOM 4711  H HB3  . GLU A 1 27 ? 37.141 -11.898 0.666   1.00 0.00 ? 27 GLU A HB3  7  
ATOM 4712  H HG2  . GLU A 1 27 ? 35.542 -13.168 -0.361  1.00 0.00 ? 27 GLU A HG2  7  
ATOM 4713  H HG3  . GLU A 1 27 ? 36.055 -12.780 -1.984  1.00 0.00 ? 27 GLU A HG3  7  
ATOM 4714  N N    . LYS A 1 28 ? 35.455 -9.013  -1.941  1.00 0.00 ? 28 LYS A N    7  
ATOM 4715  C CA   . LYS A 1 28 ? 34.205 -8.472  -2.480  1.00 0.00 ? 28 LYS A CA   7  
ATOM 4716  C C    . LYS A 1 28 ? 32.986 -8.804  -1.600  1.00 0.00 ? 28 LYS A C    7  
ATOM 4717  O O    . LYS A 1 28 ? 32.011 -9.402  -2.044  1.00 0.00 ? 28 LYS A O    7  
ATOM 4718  C CB   . LYS A 1 28 ? 34.052 -8.954  -3.932  1.00 0.00 ? 28 LYS A CB   7  
ATOM 4719  C CG   . LYS A 1 28 ? 35.303 -8.787  -4.821  1.00 0.00 ? 28 LYS A CG   7  
ATOM 4720  C CD   . LYS A 1 28 ? 35.497 -7.370  -5.385  1.00 0.00 ? 28 LYS A CD   7  
ATOM 4721  C CE   . LYS A 1 28 ? 35.412 -7.342  -6.911  1.00 0.00 ? 28 LYS A CE   7  
ATOM 4722  N NZ   . LYS A 1 28 ? 34.105 -7.737  -7.393  1.00 0.00 ? 28 LYS A NZ   7  
ATOM 4723  H H    . LYS A 1 28 ? 36.286 -8.523  -2.205  1.00 0.00 ? 28 LYS A H    7  
ATOM 4724  H HA   . LYS A 1 28 ? 34.291 -7.390  -2.460  1.00 0.00 ? 28 LYS A HA   7  
ATOM 4725  H HB2  . LYS A 1 28 ? 33.796 -10.011 -3.940  1.00 0.00 ? 28 LYS A HB2  7  
ATOM 4726  H HB3  . LYS A 1 28 ? 33.208 -8.446  -4.387  1.00 0.00 ? 28 LYS A HB3  7  
ATOM 4727  H HG2  . LYS A 1 28 ? 36.208 -9.100  -4.302  1.00 0.00 ? 28 LYS A HG2  7  
ATOM 4728  H HG3  . LYS A 1 28 ? 35.233 -9.496  -5.646  1.00 0.00 ? 28 LYS A HG3  7  
ATOM 4729  H HD2  . LYS A 1 28 ? 34.796 -6.651  -4.961  1.00 0.00 ? 28 LYS A HD2  7  
ATOM 4730  H HD3  . LYS A 1 28 ? 36.481 -7.012  -5.099  1.00 0.00 ? 28 LYS A HD3  7  
ATOM 4731  H HE2  . LYS A 1 28 ? 35.603 -6.332  -7.258  1.00 0.00 ? 28 LYS A HE2  7  
ATOM 4732  H HE3  . LYS A 1 28 ? 36.143 -8.006  -7.371  1.00 0.00 ? 28 LYS A HE3  7  
ATOM 4733  H HZ1  . LYS A 1 28 ? 33.884 -7.243  -8.284  1.00 0.00 ? 28 LYS A HZ1  7  
ATOM 4734  H HZ2  . LYS A 1 28 ? 33.408 -7.486  -6.665  1.00 0.00 ? 28 LYS A HZ2  7  
ATOM 4735  H HZ3  . LYS A 1 28 ? 34.095 -8.764  -7.558  1.00 0.00 ? 28 LYS A HZ3  7  
ATOM 4736  N N    . ASN A 1 29 ? 33.143 -8.401  -0.321  1.00 0.00 ? 29 ASN A N    7  
ATOM 4737  C CA   . ASN A 1 29 ? 32.173 -8.744  0.714   1.00 0.00 ? 29 ASN A CA   7  
ATOM 4738  C C    . ASN A 1 29 ? 31.275 -7.517  0.924   1.00 0.00 ? 29 ASN A C    7  
ATOM 4739  O O    . ASN A 1 29 ? 30.942 -6.859  -0.051  1.00 0.00 ? 29 ASN A O    7  
ATOM 4740  C CB   . ASN A 1 29 ? 32.935 -9.224  1.964   1.00 0.00 ? 29 ASN A CB   7  
ATOM 4741  C CG   . ASN A 1 29 ? 32.160 -10.312 2.722   1.00 0.00 ? 29 ASN A CG   7  
ATOM 4742  O OD1  . ASN A 1 29 ? 31.232 -10.047 3.482   1.00 0.00 ? 29 ASN A OD1  7  
ATOM 4743  N ND2  . ASN A 1 29 ? 32.584 -11.557 2.440   1.00 0.00 ? 29 ASN A ND2  7  
ATOM 4744  H H    . ASN A 1 29 ? 33.958 -7.871  -0.089  1.00 0.00 ? 29 ASN A H    7  
ATOM 4745  H HA   . ASN A 1 29 ? 31.549 -9.544  0.309   1.00 0.00 ? 29 ASN A HA   7  
ATOM 4746  H HB2  . ASN A 1 29 ? 33.901 -9.632  1.662   1.00 0.00 ? 29 ASN A HB2  7  
ATOM 4747  H HB3  . ASN A 1 29 ? 33.162 -8.409  2.640   1.00 0.00 ? 29 ASN A HB3  7  
ATOM 4748  H HD21 . ASN A 1 29 ? 33.376 -11.714 1.839   1.00 0.00 ? 29 ASN A HD21 7  
ATOM 4749  H HD22 . ASN A 1 29 ? 32.117 -12.351 2.807   1.00 0.00 ? 29 ASN A HD22 7  
ATOM 4750  N N    . GLU A 1 30 ? 30.886 -7.235  2.190   1.00 0.00 ? 30 GLU A N    7  
ATOM 4751  C CA   . GLU A 1 30 ? 29.975 -6.111  2.448   1.00 0.00 ? 30 GLU A CA   7  
ATOM 4752  C C    . GLU A 1 30 ? 30.362 -5.430  3.767   1.00 0.00 ? 30 GLU A C    7  
ATOM 4753  O O    . GLU A 1 30 ? 31.004 -4.386  3.776   1.00 0.00 ? 30 GLU A O    7  
ATOM 4754  C CB   . GLU A 1 30 ? 28.516 -6.605  2.477   1.00 0.00 ? 30 GLU A CB   7  
ATOM 4755  C CG   . GLU A 1 30 ? 27.979 -7.043  1.104   1.00 0.00 ? 30 GLU A CG   7  
ATOM 4756  C CD   . GLU A 1 30 ? 26.653 -7.821  1.226   1.00 0.00 ? 30 GLU A CD   7  
ATOM 4757  O OE1  . GLU A 1 30 ? 26.615 -8.805  1.965   1.00 0.00 ? 30 GLU A OE1  7  
ATOM 4758  O OE2  . GLU A 1 30 ? 25.680 -7.443  0.574   1.00 0.00 ? 30 GLU A OE2  7  
ATOM 4759  H H    . GLU A 1 30 ? 31.171 -7.816  2.947   1.00 0.00 ? 30 GLU A H    7  
ATOM 4760  H HA   . GLU A 1 30 ? 30.108 -5.361  1.674   1.00 0.00 ? 30 GLU A HA   7  
ATOM 4761  H HB2  . GLU A 1 30 ? 28.451 -7.435  3.175   1.00 0.00 ? 30 GLU A HB2  7  
ATOM 4762  H HB3  . GLU A 1 30 ? 27.862 -5.826  2.872   1.00 0.00 ? 30 GLU A HB3  7  
ATOM 4763  H HG2  . GLU A 1 30 ? 27.843 -6.166  0.475   1.00 0.00 ? 30 GLU A HG2  7  
ATOM 4764  H HG3  . GLU A 1 30 ? 28.678 -7.692  0.585   1.00 0.00 ? 30 GLU A HG3  7  
ATOM 4765  N N    . ASN A 1 31 ? 29.942 -6.083  4.865   1.00 0.00 ? 31 ASN A N    7  
ATOM 4766  C CA   . ASN A 1 31 ? 30.276 -5.633  6.215   1.00 0.00 ? 31 ASN A CA   7  
ATOM 4767  C C    . ASN A 1 31 ? 31.794 -5.668  6.457   1.00 0.00 ? 31 ASN A C    7  
ATOM 4768  O O    . ASN A 1 31 ? 32.286 -4.989  7.346   1.00 0.00 ? 31 ASN A O    7  
ATOM 4769  C CB   . ASN A 1 31 ? 29.573 -6.552  7.238   1.00 0.00 ? 31 ASN A CB   7  
ATOM 4770  C CG   . ASN A 1 31 ? 28.563 -5.778  8.094   1.00 0.00 ? 31 ASN A CG   7  
ATOM 4771  O OD1  . ASN A 1 31 ? 27.671 -5.106  7.587   1.00 0.00 ? 31 ASN A OD1  7  
ATOM 4772  N ND2  . ASN A 1 31 ? 28.754 -5.909  9.419   1.00 0.00 ? 31 ASN A ND2  7  
ATOM 4773  H H    . ASN A 1 31 ? 29.399 -6.912  4.742   1.00 0.00 ? 31 ASN A H    7  
ATOM 4774  H HA   . ASN A 1 31 ? 29.949 -4.593  6.294   1.00 0.00 ? 31 ASN A HA   7  
ATOM 4775  H HB2  . ASN A 1 31 ? 29.039 -7.354  6.730   1.00 0.00 ? 31 ASN A HB2  7  
ATOM 4776  H HB3  . ASN A 1 31 ? 30.276 -7.062  7.900   1.00 0.00 ? 31 ASN A HB3  7  
ATOM 4777  H HD21 . ASN A 1 31 ? 29.498 -6.483  9.786   1.00 0.00 ? 31 ASN A HD21 7  
ATOM 4778  H HD22 . ASN A 1 31 ? 28.157 -5.437  10.054  1.00 0.00 ? 31 ASN A HD22 7  
ATOM 4779  N N    . LEU A 1 32 ? 32.483 -6.494  5.639   1.00 0.00 ? 32 LEU A N    7  
ATOM 4780  C CA   . LEU A 1 32 ? 33.927 -6.673  5.794   1.00 0.00 ? 32 LEU A CA   7  
ATOM 4781  C C    . LEU A 1 32 ? 34.662 -5.503  5.144   1.00 0.00 ? 32 LEU A C    7  
ATOM 4782  O O    . LEU A 1 32 ? 35.621 -4.966  5.690   1.00 0.00 ? 32 LEU A O    7  
ATOM 4783  C CB   . LEU A 1 32 ? 34.351 -7.985  5.102   1.00 0.00 ? 32 LEU A CB   7  
ATOM 4784  C CG   . LEU A 1 32 ? 35.643 -8.652  5.614   1.00 0.00 ? 32 LEU A CG   7  
ATOM 4785  C CD1  . LEU A 1 32 ? 35.876 -8.449  7.115   1.00 0.00 ? 32 LEU A CD1  7  
ATOM 4786  C CD2  . LEU A 1 32 ? 35.612 -10.145 5.261   1.00 0.00 ? 32 LEU A CD2  7  
ATOM 4787  H H    . LEU A 1 32 ? 32.002 -6.986  4.914   1.00 0.00 ? 32 LEU A H    7  
ATOM 4788  H HA   . LEU A 1 32 ? 34.121 -6.684  6.867   1.00 0.00 ? 32 LEU A HA   7  
ATOM 4789  H HB2  . LEU A 1 32 ? 33.533 -8.699  5.176   1.00 0.00 ? 32 LEU A HB2  7  
ATOM 4790  H HB3  . LEU A 1 32 ? 34.480 -7.828  4.034   1.00 0.00 ? 32 LEU A HB3  7  
ATOM 4791  H HG   . LEU A 1 32 ? 36.497 -8.212  5.098   1.00 0.00 ? 32 LEU A HG   7  
ATOM 4792  H HD11 . LEU A 1 32 ? 36.688 -9.074  7.484   1.00 0.00 ? 32 LEU A HD11 7  
ATOM 4793  H HD12 . LEU A 1 32 ? 34.983 -8.686  7.694   1.00 0.00 ? 32 LEU A HD12 7  
ATOM 4794  H HD13 . LEU A 1 32 ? 36.155 -7.416  7.318   1.00 0.00 ? 32 LEU A HD13 7  
ATOM 4795  H HD21 . LEU A 1 32 ? 36.521 -10.651 5.582   1.00 0.00 ? 32 LEU A HD21 7  
ATOM 4796  H HD22 . LEU A 1 32 ? 35.509 -10.279 4.184   1.00 0.00 ? 32 LEU A HD22 7  
ATOM 4797  H HD23 . LEU A 1 32 ? 34.769 -10.646 5.741   1.00 0.00 ? 32 LEU A HD23 7  
ATOM 4798  N N    . ALA A 1 33 ? 34.145 -5.154  3.947   1.00 0.00 ? 33 ALA A N    7  
ATOM 4799  C CA   . ALA A 1 33 ? 34.747 -4.075  3.184   1.00 0.00 ? 33 ALA A CA   7  
ATOM 4800  C C    . ALA A 1 33 ? 34.584 -2.742  3.896   1.00 0.00 ? 33 ALA A C    7  
ATOM 4801  O O    . ALA A 1 33 ? 35.537 -1.991  4.028   1.00 0.00 ? 33 ALA A O    7  
ATOM 4802  C CB   . ALA A 1 33 ? 34.156 -3.974  1.793   1.00 0.00 ? 33 ALA A CB   7  
ATOM 4803  H H    . ALA A 1 33 ? 33.361 -5.653  3.577   1.00 0.00 ? 33 ALA A H    7  
ATOM 4804  H HA   . ALA A 1 33 ? 35.804 -4.295  3.112   1.00 0.00 ? 33 ALA A HA   7  
ATOM 4805  H HB1  . ALA A 1 33 ? 34.783 -3.290  1.222   1.00 0.00 ? 33 ALA A HB1  7  
ATOM 4806  H HB2  . ALA A 1 33 ? 33.137 -3.584  1.810   1.00 0.00 ? 33 ALA A HB2  7  
ATOM 4807  H HB3  . ALA A 1 33 ? 34.149 -4.932  1.277   1.00 0.00 ? 33 ALA A HB3  7  
ATOM 4808  N N    . ALA A 1 34 ? 33.344 -2.525  4.378   1.00 0.00 ? 34 ALA A N    7  
ATOM 4809  C CA   . ALA A 1 34 ? 33.077 -1.363  5.214   1.00 0.00 ? 34 ALA A CA   7  
ATOM 4810  C C    . ALA A 1 34 ? 34.032 -1.352  6.418   1.00 0.00 ? 34 ALA A C    7  
ATOM 4811  O O    . ALA A 1 34 ? 34.693 -0.365  6.676   1.00 0.00 ? 34 ALA A O    7  
ATOM 4812  C CB   . ALA A 1 34 ? 31.615 -1.347  5.673   1.00 0.00 ? 34 ALA A CB   7  
ATOM 4813  H H    . ALA A 1 34 ? 32.623 -3.188  4.188   1.00 0.00 ? 34 ALA A H    7  
ATOM 4814  H HA   . ALA A 1 34 ? 33.278 -0.484  4.601   1.00 0.00 ? 34 ALA A HA   7  
ATOM 4815  H HB1  . ALA A 1 34 ? 31.361 -2.229  6.261   1.00 0.00 ? 34 ALA A HB1  7  
ATOM 4816  H HB2  . ALA A 1 34 ? 30.939 -1.316  4.820   1.00 0.00 ? 34 ALA A HB2  7  
ATOM 4817  H HB3  . ALA A 1 34 ? 31.410 -0.465  6.280   1.00 0.00 ? 34 ALA A HB3  7  
ATOM 4818  N N    . ASN A 1 35 ? 34.118 -2.510  7.106   1.00 0.00 ? 35 ASN A N    7  
ATOM 4819  C CA   . ASN A 1 35 ? 35.002 -2.575  8.277   1.00 0.00 ? 35 ASN A CA   7  
ATOM 4820  C C    . ASN A 1 35 ? 36.451 -2.136  7.968   1.00 0.00 ? 35 ASN A C    7  
ATOM 4821  O O    . ASN A 1 35 ? 37.093 -1.523  8.803   1.00 0.00 ? 35 ASN A O    7  
ATOM 4822  C CB   . ASN A 1 35 ? 35.027 -3.998  8.865   1.00 0.00 ? 35 ASN A CB   7  
ATOM 4823  C CG   . ASN A 1 35 ? 35.002 -3.955  10.396  1.00 0.00 ? 35 ASN A CG   7  
ATOM 4824  O OD1  . ASN A 1 35 ? 33.957 -4.099  11.021  1.00 0.00 ? 35 ASN A OD1  7  
ATOM 4825  N ND2  . ASN A 1 35 ? 36.201 -3.750  10.963  1.00 0.00 ? 35 ASN A ND2  7  
ATOM 4826  H H    . ASN A 1 35 ? 33.572 -3.293  6.817   1.00 0.00 ? 35 ASN A H    7  
ATOM 4827  H HA   . ASN A 1 35 ? 34.577 -1.857  8.986   1.00 0.00 ? 35 ASN A HA   7  
ATOM 4828  H HB2  . ASN A 1 35 ? 34.160 -4.561  8.551   1.00 0.00 ? 35 ASN A HB2  7  
ATOM 4829  H HB3  . ASN A 1 35 ? 35.885 -4.584  8.529   1.00 0.00 ? 35 ASN A HB3  7  
ATOM 4830  H HD21 . ASN A 1 35 ? 37.020 -3.611  10.393  1.00 0.00 ? 35 ASN A HD21 7  
ATOM 4831  H HD22 . ASN A 1 35 ? 36.283 -3.726  11.952  1.00 0.00 ? 35 ASN A HD22 7  
ATOM 4832  N N    . PHE A 1 36 ? 36.912 -2.458  6.737   1.00 0.00 ? 36 PHE A N    7  
ATOM 4833  C CA   . PHE A 1 36 ? 38.257 -2.068  6.295   1.00 0.00 ? 36 PHE A CA   7  
ATOM 4834  C C    . PHE A 1 36 ? 38.407 -0.525  6.278   1.00 0.00 ? 36 PHE A C    7  
ATOM 4835  O O    . PHE A 1 36 ? 39.331 0.029   6.865   1.00 0.00 ? 36 PHE A O    7  
ATOM 4836  C CB   . PHE A 1 36 ? 38.506 -2.675  4.898   1.00 0.00 ? 36 PHE A CB   7  
ATOM 4837  C CG   . PHE A 1 36 ? 39.882 -2.439  4.303   1.00 0.00 ? 36 PHE A CG   7  
ATOM 4838  C CD1  . PHE A 1 36 ? 40.297 -1.161  3.929   1.00 0.00 ? 36 PHE A CD1  7  
ATOM 4839  C CD2  . PHE A 1 36 ? 40.740 -3.508  4.056   1.00 0.00 ? 36 PHE A CD2  7  
ATOM 4840  C CE1  . PHE A 1 36 ? 41.523 -0.947  3.318   1.00 0.00 ? 36 PHE A CE1  7  
ATOM 4841  C CE2  . PHE A 1 36 ? 41.970 -3.300  3.443   1.00 0.00 ? 36 PHE A CE2  7  
ATOM 4842  C CZ   . PHE A 1 36 ? 42.364 -2.021  3.069   1.00 0.00 ? 36 PHE A CZ   7  
ATOM 4843  H H    . PHE A 1 36 ? 36.301 -2.943  6.111   1.00 0.00 ? 36 PHE A H    7  
ATOM 4844  H HA   . PHE A 1 36 ? 38.964 -2.496  7.009   1.00 0.00 ? 36 PHE A HA   7  
ATOM 4845  H HB2  . PHE A 1 36 ? 38.305 -3.745  4.927   1.00 0.00 ? 36 PHE A HB2  7  
ATOM 4846  H HB3  . PHE A 1 36 ? 37.788 -2.275  4.194   1.00 0.00 ? 36 PHE A HB3  7  
ATOM 4847  H HD1  . PHE A 1 36 ? 39.660 -0.303  4.065   1.00 0.00 ? 36 PHE A HD1  7  
ATOM 4848  H HD2  . PHE A 1 36 ? 40.439 -4.515  4.309   1.00 0.00 ? 36 PHE A HD2  7  
ATOM 4849  H HE1  . PHE A 1 36 ? 41.806 0.054   3.024   1.00 0.00 ? 36 PHE A HE1  7  
ATOM 4850  H HE2  . PHE A 1 36 ? 42.619 -4.137  3.228   1.00 0.00 ? 36 PHE A HE2  7  
ATOM 4851  H HZ   . PHE A 1 36 ? 43.310 -1.860  2.575   1.00 0.00 ? 36 PHE A HZ   7  
ATOM 4852  N N    . LEU A 1 37 ? 37.473 0.124   5.544   1.00 0.00 ? 37 LEU A N    7  
ATOM 4853  C CA   . LEU A 1 37 ? 37.611 1.554   5.279   1.00 0.00 ? 37 LEU A CA   7  
ATOM 4854  C C    . LEU A 1 37 ? 37.351 2.397   6.547   1.00 0.00 ? 37 LEU A C    7  
ATOM 4855  O O    . LEU A 1 37 ? 37.892 3.489   6.696   1.00 0.00 ? 37 LEU A O    7  
ATOM 4856  C CB   . LEU A 1 37 ? 36.649 2.015   4.179   1.00 0.00 ? 37 LEU A CB   7  
ATOM 4857  C CG   . LEU A 1 37 ? 36.783 1.314   2.811   1.00 0.00 ? 37 LEU A CG   7  
ATOM 4858  C CD1  . LEU A 1 37 ? 35.567 0.441   2.526   1.00 0.00 ? 37 LEU A CD1  7  
ATOM 4859  C CD2  . LEU A 1 37 ? 36.968 2.292   1.639   1.00 0.00 ? 37 LEU A CD2  7  
ATOM 4860  H H    . LEU A 1 37 ? 36.685 -0.363  5.175   1.00 0.00 ? 37 LEU A H    7  
ATOM 4861  H HA   . LEU A 1 37 ? 38.636 1.713   4.946   1.00 0.00 ? 37 LEU A HA   7  
ATOM 4862  H HB2  . LEU A 1 37 ? 35.624 1.931   4.524   1.00 0.00 ? 37 LEU A HB2  7  
ATOM 4863  H HB3  . LEU A 1 37 ? 36.826 3.076   4.073   1.00 0.00 ? 37 LEU A HB3  7  
ATOM 4864  H HG   . LEU A 1 37 ? 37.655 0.667   2.866   1.00 0.00 ? 37 LEU A HG   7  
ATOM 4865  H HD11 . LEU A 1 37 ? 35.826 -0.430  1.926   1.00 0.00 ? 37 LEU A HD11 7  
ATOM 4866  H HD12 . LEU A 1 37 ? 34.813 1.010   1.995   1.00 0.00 ? 37 LEU A HD12 7  
ATOM 4867  H HD13 . LEU A 1 37 ? 35.078 0.127   3.440   1.00 0.00 ? 37 LEU A HD13 7  
ATOM 4868  H HD21 . LEU A 1 37 ? 37.912 2.087   1.151   1.00 0.00 ? 37 LEU A HD21 7  
ATOM 4869  H HD22 . LEU A 1 37 ? 36.999 3.322   1.961   1.00 0.00 ? 37 LEU A HD22 7  
ATOM 4870  H HD23 . LEU A 1 37 ? 36.173 2.249   0.891   1.00 0.00 ? 37 LEU A HD23 7  
ATOM 4871  N N    . LEU A 1 38 ? 36.495 1.825   7.425   1.00 0.00 ? 38 LEU A N    7  
ATOM 4872  C CA   . LEU A 1 38 ? 36.080 2.499   8.654   1.00 0.00 ? 38 LEU A CA   7  
ATOM 4873  C C    . LEU A 1 38 ? 37.155 2.287   9.748   1.00 0.00 ? 38 LEU A C    7  
ATOM 4874  O O    . LEU A 1 38 ? 37.325 3.104   10.646  1.00 0.00 ? 38 LEU A O    7  
ATOM 4875  C CB   . LEU A 1 38 ? 34.697 2.017   9.167   1.00 0.00 ? 38 LEU A CB   7  
ATOM 4876  C CG   . LEU A 1 38 ? 33.505 1.909   8.173   1.00 0.00 ? 38 LEU A CG   7  
ATOM 4877  C CD1  . LEU A 1 38 ? 32.234 2.590   8.698   1.00 0.00 ? 38 LEU A CD1  7  
ATOM 4878  C CD2  . LEU A 1 38 ? 33.797 2.449   6.775   1.00 0.00 ? 38 LEU A CD2  7  
ATOM 4879  H H    . LEU A 1 38 ? 36.122 0.921   7.234   1.00 0.00 ? 38 LEU A H    7  
ATOM 4880  H HA   . LEU A 1 38 ? 36.029 3.558   8.408   1.00 0.00 ? 38 LEU A HA   7  
ATOM 4881  H HB2  . LEU A 1 38 ? 34.832 1.039   9.628   1.00 0.00 ? 38 LEU A HB2  7  
ATOM 4882  H HB3  . LEU A 1 38 ? 34.409 2.692   9.975   1.00 0.00 ? 38 LEU A HB3  7  
ATOM 4883  H HG   . LEU A 1 38 ? 33.244 0.856   8.092   1.00 0.00 ? 38 LEU A HG   7  
ATOM 4884  H HD11 . LEU A 1 38 ? 31.928 2.182   9.659   1.00 0.00 ? 38 LEU A HD11 7  
ATOM 4885  H HD12 . LEU A 1 38 ? 31.405 2.434   8.005   1.00 0.00 ? 38 LEU A HD12 7  
ATOM 4886  H HD13 . LEU A 1 38 ? 32.378 3.666   8.797   1.00 0.00 ? 38 LEU A HD13 7  
ATOM 4887  H HD21 . LEU A 1 38 ? 34.472 3.291   6.856   1.00 0.00 ? 38 LEU A HD21 7  
ATOM 4888  H HD22 . LEU A 1 38 ? 32.886 2.773   6.285   1.00 0.00 ? 38 LEU A HD22 7  
ATOM 4889  H HD23 . LEU A 1 38 ? 34.252 1.730   6.106   1.00 0.00 ? 38 LEU A HD23 7  
ATOM 4890  N N    . SER A 1 39 ? 37.873 1.150   9.586   1.00 0.00 ? 39 SER A N    7  
ATOM 4891  C CA   . SER A 1 39 ? 38.970 0.776   10.475  1.00 0.00 ? 39 SER A CA   7  
ATOM 4892  C C    . SER A 1 39 ? 40.170 1.717   10.350  1.00 0.00 ? 39 SER A C    7  
ATOM 4893  O O    . SER A 1 39 ? 40.931 1.827   11.301  1.00 0.00 ? 39 SER A O    7  
ATOM 4894  C CB   . SER A 1 39 ? 39.442 -0.667  10.215  1.00 0.00 ? 39 SER A CB   7  
ATOM 4895  O OG   . SER A 1 39 ? 38.668 -1.626  10.911  1.00 0.00 ? 39 SER A OG   7  
ATOM 4896  H H    . SER A 1 39 ? 37.685 0.555   8.807   1.00 0.00 ? 39 SER A H    7  
ATOM 4897  H HA   . SER A 1 39 ? 38.594 0.876   11.492  1.00 0.00 ? 39 SER A HA   7  
ATOM 4898  H HB2  . SER A 1 39 ? 39.481 -0.889  9.145   1.00 0.00 ? 39 SER A HB2  7  
ATOM 4899  H HB3  . SER A 1 39 ? 40.462 -0.818  10.570  1.00 0.00 ? 39 SER A HB3  7  
ATOM 4900  H HG   . SER A 1 39 ? 37.746 -1.514  10.711  1.00 0.00 ? 39 SER A HG   7  
ATOM 4901  N N    . GLN A 1 40 ? 40.290 2.376   9.168   1.00 0.00 ? 40 GLN A N    7  
ATOM 4902  C CA   . GLN A 1 40 ? 41.360 3.347   8.899   1.00 0.00 ? 40 GLN A CA   7  
ATOM 4903  C C    . GLN A 1 40 ? 41.587 4.292   10.103  1.00 0.00 ? 40 GLN A C    7  
ATOM 4904  O O    . GLN A 1 40 ? 40.845 5.247   10.321  1.00 0.00 ? 40 GLN A O    7  
ATOM 4905  C CB   . GLN A 1 40 ? 41.045 4.178   7.637   1.00 0.00 ? 40 GLN A CB   7  
ATOM 4906  C CG   . GLN A 1 40 ? 41.376 3.455   6.302   1.00 0.00 ? 40 GLN A CG   7  
ATOM 4907  C CD   . GLN A 1 40 ? 42.278 4.267   5.344   1.00 0.00 ? 40 GLN A CD   7  
ATOM 4908  O OE1  . GLN A 1 40 ? 42.076 4.287   4.134   1.00 0.00 ? 40 GLN A OE1  7  
ATOM 4909  N NE2  . GLN A 1 40 ? 43.285 4.922   5.931   1.00 0.00 ? 40 GLN A NE2  7  
ATOM 4910  H H    . GLN A 1 40 ? 39.631 2.161   8.448   1.00 0.00 ? 40 GLN A H    7  
ATOM 4911  H HA   . GLN A 1 40 ? 42.265 2.767   8.724   1.00 0.00 ? 40 GLN A HA   7  
ATOM 4912  H HB2  . GLN A 1 40 ? 39.995 4.461   7.641   1.00 0.00 ? 40 GLN A HB2  7  
ATOM 4913  H HB3  . GLN A 1 40 ? 41.558 5.136   7.705   1.00 0.00 ? 40 GLN A HB3  7  
ATOM 4914  H HG2  . GLN A 1 40 ? 41.856 2.493   6.481   1.00 0.00 ? 40 GLN A HG2  7  
ATOM 4915  H HG3  . GLN A 1 40 ? 40.459 3.225   5.765   1.00 0.00 ? 40 GLN A HG3  7  
ATOM 4916  H HE21 . GLN A 1 40 ? 43.473 4.834   6.913   1.00 0.00 ? 40 GLN A HE21 7  
ATOM 4917  H HE22 . GLN A 1 40 ? 43.868 5.514   5.381   1.00 0.00 ? 40 GLN A HE22 7  
ATOM 4918  N N    . ASN A 1 41 ? 42.660 3.939   10.844  1.00 0.00 ? 41 ASN A N    7  
ATOM 4919  C CA   . ASN A 1 41 ? 43.014 4.604   12.095  1.00 0.00 ? 41 ASN A CA   7  
ATOM 4920  C C    . ASN A 1 41 ? 43.314 6.085   11.829  1.00 0.00 ? 41 ASN A C    7  
ATOM 4921  O O    . ASN A 1 41 ? 44.024 6.442   10.896  1.00 0.00 ? 41 ASN A O    7  
ATOM 4922  C CB   . ASN A 1 41 ? 44.236 3.938   12.757  1.00 0.00 ? 41 ASN A CB   7  
ATOM 4923  C CG   . ASN A 1 41 ? 44.288 2.416   12.540  1.00 0.00 ? 41 ASN A CG   7  
ATOM 4924  O OD1  . ASN A 1 41 ? 45.186 1.891   11.884  1.00 0.00 ? 41 ASN A OD1  7  
ATOM 4925  N ND2  . ASN A 1 41 ? 43.257 1.751   13.079  1.00 0.00 ? 41 ASN A ND2  7  
ATOM 4926  H H    . ASN A 1 41 ? 43.188 3.143   10.559  1.00 0.00 ? 41 ASN A H    7  
ATOM 4927  H HA   . ASN A 1 41 ? 42.137 4.506   12.735  1.00 0.00 ? 41 ASN A HA   7  
ATOM 4928  H HB2  . ASN A 1 41 ? 45.156 4.349   12.347  1.00 0.00 ? 41 ASN A HB2  7  
ATOM 4929  H HB3  . ASN A 1 41 ? 44.234 4.159   13.827  1.00 0.00 ? 41 ASN A HB3  7  
ATOM 4930  H HD21 . ASN A 1 41 ? 42.578 2.208   13.663  1.00 0.00 ? 41 ASN A HD21 7  
ATOM 4931  H HD22 . ASN A 1 41 ? 43.135 0.784   12.889  1.00 0.00 ? 41 ASN A HD22 7  
ATOM 4932  N N    . PHE A 1 42 ? 42.682 6.904   12.696  1.00 0.00 ? 42 PHE A N    7  
ATOM 4933  C CA   . PHE A 1 42 ? 42.674 8.345   12.517  1.00 0.00 ? 42 PHE A CA   7  
ATOM 4934  C C    . PHE A 1 42 ? 41.862 8.965   13.665  1.00 0.00 ? 42 PHE A C    7  
ATOM 4935  O O    . PHE A 1 42 ? 40.826 8.446   14.063  1.00 0.00 ? 42 PHE A O    7  
ATOM 4936  C CB   . PHE A 1 42 ? 42.045 8.719   11.153  1.00 0.00 ? 42 PHE A CB   7  
ATOM 4937  C CG   . PHE A 1 42 ? 41.904 10.206  10.959  1.00 0.00 ? 42 PHE A CG   7  
ATOM 4938  C CD1  . PHE A 1 42 ? 42.996 11.058  11.111  1.00 0.00 ? 42 PHE A CD1  7  
ATOM 4939  C CD2  . PHE A 1 42 ? 40.666 10.751  10.638  1.00 0.00 ? 42 PHE A CD2  7  
ATOM 4940  C CE1  . PHE A 1 42 ? 42.848 12.432  10.967  1.00 0.00 ? 42 PHE A CE1  7  
ATOM 4941  C CE2  . PHE A 1 42 ? 40.514 12.122  10.490  1.00 0.00 ? 42 PHE A CE2  7  
ATOM 4942  C CZ   . PHE A 1 42 ? 41.603 12.963  10.660  1.00 0.00 ? 42 PHE A CZ   7  
ATOM 4943  H H    . PHE A 1 42 ? 42.197 6.493   13.471  1.00 0.00 ? 42 PHE A H    7  
ATOM 4944  H HA   . PHE A 1 42 ? 43.713 8.676   12.584  1.00 0.00 ? 42 PHE A HA   7  
ATOM 4945  H HB2  . PHE A 1 42 ? 42.664 8.350   10.338  1.00 0.00 ? 42 PHE A HB2  7  
ATOM 4946  H HB3  . PHE A 1 42 ? 41.071 8.234   11.036  1.00 0.00 ? 42 PHE A HB3  7  
ATOM 4947  H HD1  . PHE A 1 42 ? 43.970 10.657  11.348  1.00 0.00 ? 42 PHE A HD1  7  
ATOM 4948  H HD2  . PHE A 1 42 ? 39.813 10.103  10.507  1.00 0.00 ? 42 PHE A HD2  7  
ATOM 4949  H HE1  . PHE A 1 42 ? 43.694 13.088  11.108  1.00 0.00 ? 42 PHE A HE1  7  
ATOM 4950  H HE2  . PHE A 1 42 ? 39.543 12.533  10.259  1.00 0.00 ? 42 PHE A HE2  7  
ATOM 4951  H HZ   . PHE A 1 42 ? 41.478 14.030  10.566  1.00 0.00 ? 42 PHE A HZ   7  
ATOM 4952  N N    . ASP A 1 43 ? 42.407 10.105  14.147  1.00 0.00 ? 43 ASP A N    7  
ATOM 4953  C CA   . ASP A 1 43 ? 41.770 10.947  15.159  1.00 0.00 ? 43 ASP A CA   7  
ATOM 4954  C C    . ASP A 1 43 ? 41.295 10.104  16.356  1.00 0.00 ? 43 ASP A C    7  
ATOM 4955  O O    . ASP A 1 43 ? 40.124 9.757   16.466  1.00 0.00 ? 43 ASP A O    7  
ATOM 4956  C CB   . ASP A 1 43 ? 40.633 11.768  14.516  1.00 0.00 ? 43 ASP A CB   7  
ATOM 4957  C CG   . ASP A 1 43 ? 39.965 12.736  15.519  1.00 0.00 ? 43 ASP A CG   7  
ATOM 4958  O OD1  . ASP A 1 43 ? 40.516 13.813  15.754  1.00 0.00 ? 43 ASP A OD1  7  
ATOM 4959  O OD2  . ASP A 1 43 ? 38.906 12.407  16.049  1.00 0.00 ? 43 ASP A OD2  7  
ATOM 4960  H H    . ASP A 1 43 ? 43.248 10.423  13.711  1.00 0.00 ? 43 ASP A H    7  
ATOM 4961  H HA   . ASP A 1 43 ? 42.555 11.623  15.498  1.00 0.00 ? 43 ASP A HA   7  
ATOM 4962  H HB2  . ASP A 1 43 ? 41.026 12.349  13.683  1.00 0.00 ? 43 ASP A HB2  7  
ATOM 4963  H HB3  . ASP A 1 43 ? 39.878 11.115  14.078  1.00 0.00 ? 43 ASP A HB3  7  
ATOM 4964  N N    . ASP A 1 44 ? 42.281 9.796   17.217  1.00 0.00 ? 44 ASP A N    7  
ATOM 4965  C CA   . ASP A 1 44 ? 42.047 8.924   18.362  1.00 0.00 ? 44 ASP A CA   7  
ATOM 4966  C C    . ASP A 1 44 ? 42.959 9.341   19.531  1.00 0.00 ? 44 ASP A C    7  
ATOM 4967  O O    . ASP A 1 44 ? 43.385 8.514   20.329  1.00 0.00 ? 44 ASP A O    7  
ATOM 4968  C CB   . ASP A 1 44 ? 42.286 7.451   17.931  1.00 0.00 ? 44 ASP A CB   7  
ATOM 4969  C CG   . ASP A 1 44 ? 40.994 6.702   17.525  1.00 0.00 ? 44 ASP A CG   7  
ATOM 4970  O OD1  . ASP A 1 44 ? 39.913 7.084   17.964  1.00 0.00 ? 44 ASP A OD1  7  
ATOM 4971  O OD2  . ASP A 1 44 ? 41.092 5.726   16.778  1.00 0.00 ? 44 ASP A OD2  7  
ATOM 4972  H H    . ASP A 1 44 ? 43.206 10.129  17.036  1.00 0.00 ? 44 ASP A H    7  
ATOM 4973  H HA   . ASP A 1 44 ? 41.028 9.106   18.706  1.00 0.00 ? 44 ASP A HA   7  
ATOM 4974  H HB2  . ASP A 1 44 ? 42.994 7.417   17.102  1.00 0.00 ? 44 ASP A HB2  7  
ATOM 4975  H HB3  . ASP A 1 44 ? 42.758 6.854   18.709  1.00 0.00 ? 44 ASP A HB3  7  
ATOM 4976  N N    . GLU A 1 45 ? 43.213 10.666  19.592  1.00 0.00 ? 45 GLU A N    7  
ATOM 4977  C CA   . GLU A 1 45 ? 44.016 11.228  20.677  1.00 0.00 ? 45 GLU A CA   7  
ATOM 4978  C C    . GLU A 1 45 ? 43.340 12.509  21.206  1.00 0.00 ? 45 GLU A C    7  
ATOM 4979  O O    . GLU A 1 45 ? 43.145 12.625  22.417  1.00 0.00 ? 45 GLU A O    7  
ATOM 4980  C CB   . GLU A 1 45 ? 45.439 11.520  20.170  1.00 0.00 ? 45 GLU A CB   7  
ATOM 4981  C CG   . GLU A 1 45 ? 46.458 11.559  21.318  1.00 0.00 ? 45 GLU A CG   7  
ATOM 4982  C CD   . GLU A 1 45 ? 47.765 12.278  20.928  1.00 0.00 ? 45 GLU A CD   7  
ATOM 4983  O OE1  . GLU A 1 45 ? 48.356 11.921  19.910  1.00 0.00 ? 45 GLU A OE1  7  
ATOM 4984  O OE2  . GLU A 1 45 ? 48.176 13.188  21.648  1.00 0.00 ? 45 GLU A OE2  7  
ATOM 4985  O OXT  . GLU A 1 45 ? 43.014 13.376  20.396  1.00 0.00 ? 45 GLU A OXT  7  
ATOM 4986  H H    . GLU A 1 45 ? 42.860 11.266  18.874  1.00 0.00 ? 45 GLU A H    7  
ATOM 4987  H HA   . GLU A 1 45 ? 44.053 10.492  21.482  1.00 0.00 ? 45 GLU A HA   7  
ATOM 4988  H HB2  . GLU A 1 45 ? 45.744 10.747  19.465  1.00 0.00 ? 45 GLU A HB2  7  
ATOM 4989  H HB3  . GLU A 1 45 ? 45.454 12.449  19.601  1.00 0.00 ? 45 GLU A HB3  7  
ATOM 4990  H HG2  . GLU A 1 45 ? 46.022 12.052  22.185  1.00 0.00 ? 45 GLU A HG2  7  
ATOM 4991  H HG3  . GLU A 1 45 ? 46.690 10.541  21.630  1.00 0.00 ? 45 GLU A HG3  7  
ATOM 4992  N N    . GLN A 1 1  ? 32.325 -6.011  -11.673 1.00 0.00 ? 1  GLN A N    8  
ATOM 4993  C CA   . GLN A 1 1  ? 31.022 -5.471  -11.316 1.00 0.00 ? 1  GLN A CA   8  
ATOM 4994  C C    . GLN A 1 1  ? 30.979 -5.139  -9.811  1.00 0.00 ? 1  GLN A C    8  
ATOM 4995  O O    . GLN A 1 1  ? 30.232 -5.738  -9.044  1.00 0.00 ? 1  GLN A O    8  
ATOM 4996  C CB   . GLN A 1 1  ? 29.874 -6.442  -11.671 1.00 0.00 ? 1  GLN A CB   8  
ATOM 4997  C CG   . GLN A 1 1  ? 29.552 -6.542  -13.177 1.00 0.00 ? 1  GLN A CG   8  
ATOM 4998  C CD   . GLN A 1 1  ? 30.592 -7.317  -14.006 1.00 0.00 ? 1  GLN A CD   8  
ATOM 4999  O OE1  . GLN A 1 1  ? 31.053 -6.855  -15.043 1.00 0.00 ? 1  GLN A OE1  8  
ATOM 5000  N NE2  . GLN A 1 1  ? 30.898 -8.537  -13.513 1.00 0.00 ? 1  GLN A NE2  8  
ATOM 5001  H H1   . GLN A 1 1  ? 33.051 -5.320  -11.373 1.00 0.00 ? 1  GLN A H1   8  
ATOM 5002  H H2   . GLN A 1 1  ? 32.385 -6.147  -12.699 1.00 0.00 ? 1  GLN A H2   8  
ATOM 5003  H H3   . GLN A 1 1  ? 32.478 -6.909  -11.176 1.00 0.00 ? 1  GLN A H3   8  
ATOM 5004  H HA   . GLN A 1 1  ? 30.898 -4.545  -11.875 1.00 0.00 ? 1  GLN A HA   8  
ATOM 5005  H HB2  . GLN A 1 1  ? 30.054 -7.426  -11.236 1.00 0.00 ? 1  GLN A HB2  8  
ATOM 5006  H HB3  . GLN A 1 1  ? 28.960 -6.093  -11.191 1.00 0.00 ? 1  GLN A HB3  8  
ATOM 5007  H HG2  . GLN A 1 1  ? 28.585 -7.030  -13.295 1.00 0.00 ? 1  GLN A HG2  8  
ATOM 5008  H HG3  . GLN A 1 1  ? 29.435 -5.554  -13.621 1.00 0.00 ? 1  GLN A HG3  8  
ATOM 5009  H HE21 . GLN A 1 1  ? 30.571 -8.829  -12.614 1.00 0.00 ? 1  GLN A HE21 8  
ATOM 5010  H HE22 . GLN A 1 1  ? 31.452 -9.173  -14.034 1.00 0.00 ? 1  GLN A HE22 8  
ATOM 5011  N N    . GLU A 1 2  ? 31.821 -4.147  -9.445  1.00 0.00 ? 2  GLU A N    8  
ATOM 5012  C CA   . GLU A 1 2  ? 31.910 -3.688  -8.060  1.00 0.00 ? 2  GLU A CA   8  
ATOM 5013  C C    . GLU A 1 2  ? 31.513 -2.225  -7.912  1.00 0.00 ? 2  GLU A C    8  
ATOM 5014  O O    . GLU A 1 2  ? 31.218 -1.816  -6.799  1.00 0.00 ? 2  GLU A O    8  
ATOM 5015  C CB   . GLU A 1 2  ? 33.321 -3.937  -7.492  1.00 0.00 ? 2  GLU A CB   8  
ATOM 5016  C CG   . GLU A 1 2  ? 33.394 -5.254  -6.704  1.00 0.00 ? 2  GLU A CG   8  
ATOM 5017  C CD   . GLU A 1 2  ? 33.195 -6.481  -7.609  1.00 0.00 ? 2  GLU A CD   8  
ATOM 5018  O OE1  . GLU A 1 2  ? 34.031 -6.704  -8.483  1.00 0.00 ? 2  GLU A OE1  8  
ATOM 5019  O OE2  . GLU A 1 2  ? 32.213 -7.206  -7.434  1.00 0.00 ? 2  GLU A OE2  8  
ATOM 5020  H H    . GLU A 1 2  ? 32.397 -3.715  -10.137 1.00 0.00 ? 2  GLU A H    8  
ATOM 5021  H HA   . GLU A 1 2  ? 31.166 -4.212  -7.459  1.00 0.00 ? 2  GLU A HA   8  
ATOM 5022  H HB2  . GLU A 1 2  ? 34.068 -3.905  -8.287  1.00 0.00 ? 2  GLU A HB2  8  
ATOM 5023  H HB3  . GLU A 1 2  ? 33.619 -3.140  -6.809  1.00 0.00 ? 2  GLU A HB3  8  
ATOM 5024  H HG2  . GLU A 1 2  ? 34.361 -5.330  -6.204  1.00 0.00 ? 2  GLU A HG2  8  
ATOM 5025  H HG3  . GLU A 1 2  ? 32.640 -5.256  -5.916  1.00 0.00 ? 2  GLU A HG3  8  
ATOM 5026  N N    . LYS A 1 3  ? 31.506 -1.485  -9.051  1.00 0.00 ? 3  LYS A N    8  
ATOM 5027  C CA   . LYS A 1 3  ? 31.177 -0.051  -9.139  1.00 0.00 ? 3  LYS A CA   8  
ATOM 5028  C C    . LYS A 1 3  ? 29.983 0.395   -8.275  1.00 0.00 ? 3  LYS A C    8  
ATOM 5029  O O    . LYS A 1 3  ? 29.915 1.534   -7.832  1.00 0.00 ? 3  LYS A O    8  
ATOM 5030  C CB   . LYS A 1 3  ? 30.996 0.340   -10.606 1.00 0.00 ? 3  LYS A CB   8  
ATOM 5031  C CG   . LYS A 1 3  ? 29.898 -0.453  -11.330 1.00 0.00 ? 3  LYS A CG   8  
ATOM 5032  C CD   . LYS A 1 3  ? 29.992 -0.326  -12.854 1.00 0.00 ? 3  LYS A CD   8  
ATOM 5033  C CE   . LYS A 1 3  ? 29.937 1.125   -13.342 1.00 0.00 ? 3  LYS A CE   8  
ATOM 5034  N NZ   . LYS A 1 3  ? 28.680 1.787   -13.015 1.00 0.00 ? 3  LYS A NZ   8  
ATOM 5035  H H    . LYS A 1 3  ? 31.791 -1.933  -9.898  1.00 0.00 ? 3  LYS A H    8  
ATOM 5036  H HA   . LYS A 1 3  ? 32.035 0.504   -8.789  1.00 0.00 ? 3  LYS A HA   8  
ATOM 5037  H HB2  . LYS A 1 3  ? 30.799 1.411   -10.679 1.00 0.00 ? 3  LYS A HB2  8  
ATOM 5038  H HB3  . LYS A 1 3  ? 31.949 0.191   -11.112 1.00 0.00 ? 3  LYS A HB3  8  
ATOM 5039  H HG2  . LYS A 1 3  ? 29.967 -1.513  -11.084 1.00 0.00 ? 3  LYS A HG2  8  
ATOM 5040  H HG3  . LYS A 1 3  ? 28.920 -0.125  -10.983 1.00 0.00 ? 3  LYS A HG3  8  
ATOM 5041  H HD2  . LYS A 1 3  ? 30.924 -0.776  -13.195 1.00 0.00 ? 3  LYS A HD2  8  
ATOM 5042  H HD3  . LYS A 1 3  ? 29.190 -0.906  -13.314 1.00 0.00 ? 3  LYS A HD3  8  
ATOM 5043  H HE2  . LYS A 1 3  ? 30.751 1.721   -12.924 1.00 0.00 ? 3  LYS A HE2  8  
ATOM 5044  H HE3  . LYS A 1 3  ? 30.053 1.141   -14.426 1.00 0.00 ? 3  LYS A HE3  8  
ATOM 5045  H HZ1  . LYS A 1 3  ? 28.585 1.864   -11.982 1.00 0.00 ? 3  LYS A HZ1  8  
ATOM 5046  H HZ2  . LYS A 1 3  ? 27.881 1.237   -13.390 1.00 0.00 ? 3  LYS A HZ2  8  
ATOM 5047  H HZ3  . LYS A 1 3  ? 28.669 2.741   -13.431 1.00 0.00 ? 3  LYS A HZ3  8  
ATOM 5048  N N    . GLU A 1 4  ? 29.080 -0.575  -8.050  1.00 0.00 ? 4  GLU A N    8  
ATOM 5049  C CA   . GLU A 1 4  ? 27.912 -0.368  -7.205  1.00 0.00 ? 4  GLU A CA   8  
ATOM 5050  C C    . GLU A 1 4  ? 28.322 0.050   -5.780  1.00 0.00 ? 4  GLU A C    8  
ATOM 5051  O O    . GLU A 1 4  ? 27.930 1.092   -5.269  1.00 0.00 ? 4  GLU A O    8  
ATOM 5052  C CB   . GLU A 1 4  ? 27.139 -1.694  -7.165  1.00 0.00 ? 4  GLU A CB   8  
ATOM 5053  C CG   . GLU A 1 4  ? 25.643 -1.434  -6.998  1.00 0.00 ? 4  GLU A CG   8  
ATOM 5054  C CD   . GLU A 1 4  ? 24.835 -2.708  -6.698  1.00 0.00 ? 4  GLU A CD   8  
ATOM 5055  O OE1  . GLU A 1 4  ? 25.312 -3.810  -6.973  1.00 0.00 ? 4  GLU A OE1  8  
ATOM 5056  O OE2  . GLU A 1 4  ? 23.723 -2.581  -6.184  1.00 0.00 ? 4  GLU A OE2  8  
ATOM 5057  H H    . GLU A 1 4  ? 29.252 -1.471  -8.460  1.00 0.00 ? 4  GLU A H    8  
ATOM 5058  H HA   . GLU A 1 4  ? 27.330 0.438   -7.664  1.00 0.00 ? 4  GLU A HA   8  
ATOM 5059  H HB2  . GLU A 1 4  ? 27.309 -2.255  -8.083  1.00 0.00 ? 4  GLU A HB2  8  
ATOM 5060  H HB3  . GLU A 1 4  ? 27.505 -2.356  -6.379  1.00 0.00 ? 4  GLU A HB3  8  
ATOM 5061  H HG2  . GLU A 1 4  ? 25.492 -0.715  -6.194  1.00 0.00 ? 4  GLU A HG2  8  
ATOM 5062  H HG3  . GLU A 1 4  ? 25.261 -0.970  -7.906  1.00 0.00 ? 4  GLU A HG3  8  
ATOM 5063  N N    . ALA A 1 5  ? 29.154 -0.836  -5.195  1.00 0.00 ? 5  ALA A N    8  
ATOM 5064  C CA   . ALA A 1 5  ? 29.683 -0.569  -3.872  1.00 0.00 ? 5  ALA A CA   8  
ATOM 5065  C C    . ALA A 1 5  ? 30.750 0.518   -3.911  1.00 0.00 ? 5  ALA A C    8  
ATOM 5066  O O    . ALA A 1 5  ? 31.049 1.079   -2.874  1.00 0.00 ? 5  ALA A O    8  
ATOM 5067  C CB   . ALA A 1 5  ? 30.293 -1.827  -3.263  1.00 0.00 ? 5  ALA A CB   8  
ATOM 5068  H H    . ALA A 1 5  ? 29.409 -1.677  -5.671  1.00 0.00 ? 5  ALA A H    8  
ATOM 5069  H HA   . ALA A 1 5  ? 28.859 -0.234  -3.242  1.00 0.00 ? 5  ALA A HA   8  
ATOM 5070  H HB1  . ALA A 1 5  ? 31.200 -2.132  -3.787  1.00 0.00 ? 5  ALA A HB1  8  
ATOM 5071  H HB2  . ALA A 1 5  ? 29.589 -2.656  -3.286  1.00 0.00 ? 5  ALA A HB2  8  
ATOM 5072  H HB3  . ALA A 1 5  ? 30.548 -1.648  -2.217  1.00 0.00 ? 5  ALA A HB3  8  
ATOM 5073  N N    . ILE A 1 6  ? 31.319 0.802   -5.102  1.00 0.00 ? 6  ILE A N    8  
ATOM 5074  C CA   . ILE A 1 6  ? 32.424 1.762   -5.131  1.00 0.00 ? 6  ILE A CA   8  
ATOM 5075  C C    . ILE A 1 6  ? 31.952 3.152   -4.729  1.00 0.00 ? 6  ILE A C    8  
ATOM 5076  O O    . ILE A 1 6  ? 32.570 3.781   -3.893  1.00 0.00 ? 6  ILE A O    8  
ATOM 5077  C CB   . ILE A 1 6  ? 33.187 1.786   -6.455  1.00 0.00 ? 6  ILE A CB   8  
ATOM 5078  C CG1  . ILE A 1 6  ? 33.704 0.382   -6.779  1.00 0.00 ? 6  ILE A CG1  8  
ATOM 5079  C CG2  . ILE A 1 6  ? 34.366 2.776   -6.436  1.00 0.00 ? 6  ILE A CG2  8  
ATOM 5080  C CD1  . ILE A 1 6  ? 34.548 0.317   -8.053  1.00 0.00 ? 6  ILE A CD1  8  
ATOM 5081  H H    . ILE A 1 6  ? 30.991 0.362   -5.938  1.00 0.00 ? 6  ILE A H    8  
ATOM 5082  H HA   . ILE A 1 6  ? 33.130 1.436   -4.381  1.00 0.00 ? 6  ILE A HA   8  
ATOM 5083  H HB   . ILE A 1 6  ? 32.496 2.107   -7.231  1.00 0.00 ? 6  ILE A HB   8  
ATOM 5084  H HG12 . ILE A 1 6  ? 34.284 0.004   -5.939  1.00 0.00 ? 6  ILE A HG12 8  
ATOM 5085  H HG13 . ILE A 1 6  ? 32.873 -0.298  -6.868  1.00 0.00 ? 6  ILE A HG13 8  
ATOM 5086  H HG21 . ILE A 1 6  ? 35.306 2.267   -6.257  1.00 0.00 ? 6  ILE A HG21 8  
ATOM 5087  H HG22 . ILE A 1 6  ? 34.306 3.540   -5.663  1.00 0.00 ? 6  ILE A HG22 8  
ATOM 5088  H HG23 . ILE A 1 6  ? 34.450 3.266   -7.404  1.00 0.00 ? 6  ILE A HG23 8  
ATOM 5089  H HD11 . ILE A 1 6  ? 35.533 0.764   -7.913  1.00 0.00 ? 6  ILE A HD11 8  
ATOM 5090  H HD12 . ILE A 1 6  ? 34.106 0.833   -8.901  1.00 0.00 ? 6  ILE A HD12 8  
ATOM 5091  H HD13 . ILE A 1 6  ? 34.652 -0.730  -8.331  1.00 0.00 ? 6  ILE A HD13 8  
ATOM 5092  N N    . GLU A 1 7  ? 30.828 3.571   -5.344  1.00 0.00 ? 7  GLU A N    8  
ATOM 5093  C CA   . GLU A 1 7  ? 30.284 4.886   -5.017  1.00 0.00 ? 7  GLU A CA   8  
ATOM 5094  C C    . GLU A 1 7  ? 29.727 4.943   -3.582  1.00 0.00 ? 7  GLU A C    8  
ATOM 5095  O O    . GLU A 1 7  ? 29.522 6.013   -3.028  1.00 0.00 ? 7  GLU A O    8  
ATOM 5096  C CB   . GLU A 1 7  ? 29.198 5.281   -6.025  1.00 0.00 ? 7  GLU A CB   8  
ATOM 5097  C CG   . GLU A 1 7  ? 27.922 4.413   -5.984  1.00 0.00 ? 7  GLU A CG   8  
ATOM 5098  C CD   . GLU A 1 7  ? 26.727 5.197   -6.557  1.00 0.00 ? 7  GLU A CD   8  
ATOM 5099  O OE1  . GLU A 1 7  ? 26.544 5.206   -7.775  1.00 0.00 ? 7  GLU A OE1  8  
ATOM 5100  O OE2  . GLU A 1 7  ? 25.989 5.798   -5.774  1.00 0.00 ? 7  GLU A OE2  8  
ATOM 5101  H H    . GLU A 1 7  ? 30.385 2.962   -6.000  1.00 0.00 ? 7  GLU A H    8  
ATOM 5102  H HA   . GLU A 1 7  ? 31.113 5.594   -5.084  1.00 0.00 ? 7  GLU A HA   8  
ATOM 5103  H HB2  . GLU A 1 7  ? 28.952 6.329   -5.844  1.00 0.00 ? 7  GLU A HB2  8  
ATOM 5104  H HB3  . GLU A 1 7  ? 29.608 5.253   -7.035  1.00 0.00 ? 7  GLU A HB3  8  
ATOM 5105  H HG2  . GLU A 1 7  ? 28.070 3.486   -6.541  1.00 0.00 ? 7  GLU A HG2  8  
ATOM 5106  H HG3  . GLU A 1 7  ? 27.664 4.108   -4.970  1.00 0.00 ? 7  GLU A HG3  8  
ATOM 5107  N N    . ARG A 1 8  ? 29.492 3.729   -3.040  1.00 0.00 ? 8  ARG A N    8  
ATOM 5108  C CA   . ARG A 1 8  ? 28.886 3.567   -1.731  1.00 0.00 ? 8  ARG A CA   8  
ATOM 5109  C C    . ARG A 1 8  ? 29.935 3.759   -0.634  1.00 0.00 ? 8  ARG A C    8  
ATOM 5110  O O    . ARG A 1 8  ? 29.764 4.575   0.257   1.00 0.00 ? 8  ARG A O    8  
ATOM 5111  C CB   . ARG A 1 8  ? 28.252 2.166   -1.692  1.00 0.00 ? 8  ARG A CB   8  
ATOM 5112  C CG   . ARG A 1 8  ? 26.841 2.150   -1.095  1.00 0.00 ? 8  ARG A CG   8  
ATOM 5113  C CD   . ARG A 1 8  ? 25.966 1.069   -1.744  1.00 0.00 ? 8  ARG A CD   8  
ATOM 5114  N NE   . ARG A 1 8  ? 24.984 0.525   -0.815  1.00 0.00 ? 8  ARG A NE   8  
ATOM 5115  C CZ   . ARG A 1 8  ? 23.971 1.244   -0.276  1.00 0.00 ? 8  ARG A CZ   8  
ATOM 5116  N NH1  . ARG A 1 8  ? 23.803 2.530   -0.571  1.00 0.00 ? 8  ARG A NH1  8  
ATOM 5117  N NH2  . ARG A 1 8  ? 23.141 0.644   0.566   1.00 0.00 ? 8  ARG A NH2  8  
ATOM 5118  H H    . ARG A 1 8  ? 29.727 2.898   -3.545  1.00 0.00 ? 8  ARG A H    8  
ATOM 5119  H HA   . ARG A 1 8  ? 28.137 4.355   -1.641  1.00 0.00 ? 8  ARG A HA   8  
ATOM 5120  H HB2  . ARG A 1 8  ? 28.211 1.794   -2.714  1.00 0.00 ? 8  ARG A HB2  8  
ATOM 5121  H HB3  . ARG A 1 8  ? 28.871 1.436   -1.169  1.00 0.00 ? 8  ARG A HB3  8  
ATOM 5122  H HG2  . ARG A 1 8  ? 26.912 2.002   -0.019  1.00 0.00 ? 8  ARG A HG2  8  
ATOM 5123  H HG3  . ARG A 1 8  ? 26.350 3.112   -1.233  1.00 0.00 ? 8  ARG A HG3  8  
ATOM 5124  H HD2  . ARG A 1 8  ? 25.442 1.456   -2.619  1.00 0.00 ? 8  ARG A HD2  8  
ATOM 5125  H HD3  . ARG A 1 8  ? 26.563 0.220   -2.077  1.00 0.00 ? 8  ARG A HD3  8  
ATOM 5126  H HE   . ARG A 1 8  ? 25.057 -0.438  -0.557  1.00 0.00 ? 8  ARG A HE   8  
ATOM 5127  H HH11 . ARG A 1 8  ? 24.427 2.989   -1.200  1.00 0.00 ? 8  ARG A HH11 8  
ATOM 5128  H HH12 . ARG A 1 8  ? 23.044 3.041   -0.155  1.00 0.00 ? 8  ARG A HH12 8  
ATOM 5129  H HH21 . ARG A 1 8  ? 23.264 -0.323  0.790   1.00 0.00 ? 8  ARG A HH21 8  
ATOM 5130  H HH22 . ARG A 1 8  ? 22.389 1.163   0.979   1.00 0.00 ? 8  ARG A HH22 8  
ATOM 5131  N N    . LEU A 1 9  ? 31.022 2.975   -0.804  1.00 0.00 ? 9  LEU A N    8  
ATOM 5132  C CA   . LEU A 1 9  ? 32.245 2.975   -0.017  1.00 0.00 ? 9  LEU A CA   8  
ATOM 5133  C C    . LEU A 1 9  ? 32.832 4.413   -0.026  1.00 0.00 ? 9  LEU A C    8  
ATOM 5134  O O    . LEU A 1 9  ? 33.166 4.973   1.001   1.00 0.00 ? 9  LEU A O    8  
ATOM 5135  C CB   . LEU A 1 9  ? 33.204 1.924   -0.598  1.00 0.00 ? 9  LEU A CB   8  
ATOM 5136  C CG   . LEU A 1 9  ? 32.647 0.482   -0.602  1.00 0.00 ? 9  LEU A CG   8  
ATOM 5137  C CD1  . LEU A 1 9  ? 33.269 -0.305  -1.758  1.00 0.00 ? 9  LEU A CD1  8  
ATOM 5138  C CD2  . LEU A 1 9  ? 32.853 -0.272  0.702   1.00 0.00 ? 9  LEU A CD2  8  
ATOM 5139  H H    . LEU A 1 9  ? 30.997 2.343   -1.565  1.00 0.00 ? 9  LEU A H    8  
ATOM 5140  H HA   . LEU A 1 9  ? 31.986 2.642   0.984   1.00 0.00 ? 9  LEU A HA   8  
ATOM 5141  H HB2  . LEU A 1 9  ? 33.424 2.227   -1.621  1.00 0.00 ? 9  LEU A HB2  8  
ATOM 5142  H HB3  . LEU A 1 9  ? 34.152 1.929   -0.066  1.00 0.00 ? 9  LEU A HB3  8  
ATOM 5143  H HG   . LEU A 1 9  ? 31.565 0.496   -0.705  1.00 0.00 ? 9  LEU A HG   8  
ATOM 5144  H HD11 . LEU A 1 9  ? 34.290 -0.619  -1.537  1.00 0.00 ? 9  LEU A HD11 8  
ATOM 5145  H HD12 . LEU A 1 9  ? 33.316 0.276   -2.667  1.00 0.00 ? 9  LEU A HD12 8  
ATOM 5146  H HD13 . LEU A 1 9  ? 32.661 -1.166  -1.995  1.00 0.00 ? 9  LEU A HD13 8  
ATOM 5147  H HD21 . LEU A 1 9  ? 33.866 -0.660  0.744   1.00 0.00 ? 9  LEU A HD21 8  
ATOM 5148  H HD22 . LEU A 1 9  ? 32.172 -1.121  0.769   1.00 0.00 ? 9  LEU A HD22 8  
ATOM 5149  H HD23 . LEU A 1 9  ? 32.675 0.375   1.556   1.00 0.00 ? 9  LEU A HD23 8  
ATOM 5150  N N    . LYS A 1 10 ? 32.864 4.998   -1.241  1.00 0.00 ? 10 LYS A N    8  
ATOM 5151  C CA   . LYS A 1 10 ? 33.299 6.392   -1.409  1.00 0.00 ? 10 LYS A CA   8  
ATOM 5152  C C    . LYS A 1 10 ? 32.362 7.400   -0.706  1.00 0.00 ? 10 LYS A C    8  
ATOM 5153  O O    . LYS A 1 10 ? 32.809 8.420   -0.196  1.00 0.00 ? 10 LYS A O    8  
ATOM 5154  C CB   . LYS A 1 10 ? 33.331 6.737   -2.917  1.00 0.00 ? 10 LYS A CB   8  
ATOM 5155  C CG   . LYS A 1 10 ? 34.743 6.956   -3.471  1.00 0.00 ? 10 LYS A CG   8  
ATOM 5156  C CD   . LYS A 1 10 ? 35.078 8.426   -3.748  1.00 0.00 ? 10 LYS A CD   8  
ATOM 5157  C CE   . LYS A 1 10 ? 34.052 9.160   -4.614  1.00 0.00 ? 10 LYS A CE   8  
ATOM 5158  N NZ   . LYS A 1 10 ? 34.623 10.344  -5.235  1.00 0.00 ? 10 LYS A NZ   8  
ATOM 5159  H H    . LYS A 1 10 ? 32.509 4.467   -2.007  1.00 0.00 ? 10 LYS A H    8  
ATOM 5160  H HA   . LYS A 1 10 ? 34.282 6.474   -0.932  1.00 0.00 ? 10 LYS A HA   8  
ATOM 5161  H HB2  . LYS A 1 10 ? 32.859 5.956   -3.501  1.00 0.00 ? 10 LYS A HB2  8  
ATOM 5162  H HB3  . LYS A 1 10 ? 32.691 7.587   -3.147  1.00 0.00 ? 10 LYS A HB3  8  
ATOM 5163  H HG2  . LYS A 1 10 ? 35.470 6.555   -2.769  1.00 0.00 ? 10 LYS A HG2  8  
ATOM 5164  H HG3  . LYS A 1 10 ? 34.881 6.379   -4.386  1.00 0.00 ? 10 LYS A HG3  8  
ATOM 5165  H HD2  . LYS A 1 10 ? 35.201 8.954   -2.802  1.00 0.00 ? 10 LYS A HD2  8  
ATOM 5166  H HD3  . LYS A 1 10 ? 36.040 8.469   -4.259  1.00 0.00 ? 10 LYS A HD3  8  
ATOM 5167  H HE2  . LYS A 1 10 ? 33.680 8.516   -5.411  1.00 0.00 ? 10 LYS A HE2  8  
ATOM 5168  H HE3  . LYS A 1 10 ? 33.203 9.487   -4.011  1.00 0.00 ? 10 LYS A HE3  8  
ATOM 5169  H HZ1  . LYS A 1 10 ? 35.252 10.806  -4.548  1.00 0.00 ? 10 LYS A HZ1  8  
ATOM 5170  H HZ2  . LYS A 1 10 ? 33.864 11.003  -5.502  1.00 0.00 ? 10 LYS A HZ2  8  
ATOM 5171  H HZ3  . LYS A 1 10 ? 35.165 10.070  -6.079  1.00 0.00 ? 10 LYS A HZ3  8  
ATOM 5172  N N    . ALA A 1 11 ? 31.050 7.071   -0.732  1.00 0.00 ? 11 ALA A N    8  
ATOM 5173  C CA   . ALA A 1 11 ? 30.036 7.964   -0.163  1.00 0.00 ? 11 ALA A CA   8  
ATOM 5174  C C    . ALA A 1 11 ? 30.142 8.087   1.371   1.00 0.00 ? 11 ALA A C    8  
ATOM 5175  O O    . ALA A 1 11 ? 29.633 9.037   1.951   1.00 0.00 ? 11 ALA A O    8  
ATOM 5176  C CB   . ALA A 1 11 ? 28.630 7.498   -0.554  1.00 0.00 ? 11 ALA A CB   8  
ATOM 5177  H H    . ALA A 1 11 ? 30.760 6.223   -1.174  1.00 0.00 ? 11 ALA A H    8  
ATOM 5178  H HA   . ALA A 1 11 ? 30.201 8.953   -0.596  1.00 0.00 ? 11 ALA A HA   8  
ATOM 5179  H HB1  . ALA A 1 11 ? 28.456 7.667   -1.615  1.00 0.00 ? 11 ALA A HB1  8  
ATOM 5180  H HB2  . ALA A 1 11 ? 27.857 8.040   -0.009  1.00 0.00 ? 11 ALA A HB2  8  
ATOM 5181  H HB3  . ALA A 1 11 ? 28.476 6.440   -0.359  1.00 0.00 ? 11 ALA A HB3  8  
ATOM 5182  N N    . LEU A 1 12 ? 30.844 7.106   1.987   1.00 0.00 ? 12 LEU A N    8  
ATOM 5183  C CA   . LEU A 1 12 ? 31.102 7.166   3.424   1.00 0.00 ? 12 LEU A CA   8  
ATOM 5184  C C    . LEU A 1 12 ? 32.247 8.166   3.766   1.00 0.00 ? 12 LEU A C    8  
ATOM 5185  O O    . LEU A 1 12 ? 32.630 8.278   4.923   1.00 0.00 ? 12 LEU A O    8  
ATOM 5186  C CB   . LEU A 1 12 ? 31.479 5.764   3.931   1.00 0.00 ? 12 LEU A CB   8  
ATOM 5187  C CG   . LEU A 1 12 ? 30.364 4.692   3.958   1.00 0.00 ? 12 LEU A CG   8  
ATOM 5188  C CD1  . LEU A 1 12 ? 30.541 3.696   2.817   1.00 0.00 ? 12 LEU A CD1  8  
ATOM 5189  C CD2  . LEU A 1 12 ? 30.381 3.896   5.265   1.00 0.00 ? 12 LEU A CD2  8  
ATOM 5190  H H    . LEU A 1 12 ? 31.235 6.349   1.465   1.00 0.00 ? 12 LEU A H    8  
ATOM 5191  H HA   . LEU A 1 12 ? 30.194 7.510   3.921   1.00 0.00 ? 12 LEU A HA   8  
ATOM 5192  H HB2  . LEU A 1 12 ? 32.287 5.417   3.300   1.00 0.00 ? 12 LEU A HB2  8  
ATOM 5193  H HB3  . LEU A 1 12 ? 31.890 5.850   4.931   1.00 0.00 ? 12 LEU A HB3  8  
ATOM 5194  H HG   . LEU A 1 12 ? 29.394 5.180   3.864   1.00 0.00 ? 12 LEU A HG   8  
ATOM 5195  H HD11 . LEU A 1 12 ? 31.045 4.211   2.013   1.00 0.00 ? 12 LEU A HD11 8  
ATOM 5196  H HD12 . LEU A 1 12 ? 29.589 3.304   2.458   1.00 0.00 ? 12 LEU A HD12 8  
ATOM 5197  H HD13 . LEU A 1 12 ? 31.178 2.854   3.089   1.00 0.00 ? 12 LEU A HD13 8  
ATOM 5198  H HD21 . LEU A 1 12 ? 31.264 3.266   5.302   1.00 0.00 ? 12 LEU A HD21 8  
ATOM 5199  H HD22 . LEU A 1 12 ? 29.524 3.226   5.326   1.00 0.00 ? 12 LEU A HD22 8  
ATOM 5200  H HD23 . LEU A 1 12 ? 30.398 4.550   6.136   1.00 0.00 ? 12 LEU A HD23 8  
ATOM 5201  N N    . GLY A 1 13 ? 32.755 8.877   2.725   1.00 0.00 ? 13 GLY A N    8  
ATOM 5202  C CA   . GLY A 1 13 ? 33.780 9.911   2.903   1.00 0.00 ? 13 GLY A CA   8  
ATOM 5203  C C    . GLY A 1 13 ? 35.194 9.420   2.555   1.00 0.00 ? 13 GLY A C    8  
ATOM 5204  O O    . GLY A 1 13 ? 36.180 9.946   3.065   1.00 0.00 ? 13 GLY A O    8  
ATOM 5205  H H    . GLY A 1 13 ? 32.384 8.737   1.809   1.00 0.00 ? 13 GLY A H    8  
ATOM 5206  H HA2  . GLY A 1 13 ? 33.513 10.745  2.252   1.00 0.00 ? 13 GLY A HA2  8  
ATOM 5207  H HA3  . GLY A 1 13 ? 33.765 10.257  3.937   1.00 0.00 ? 13 GLY A HA3  8  
ATOM 5208  N N    . PHE A 1 14 ? 35.228 8.376   1.688   1.00 0.00 ? 14 PHE A N    8  
ATOM 5209  C CA   . PHE A 1 14 ? 36.475 7.684   1.357   1.00 0.00 ? 14 PHE A CA   8  
ATOM 5210  C C    . PHE A 1 14 ? 36.901 8.062   -0.076  1.00 0.00 ? 14 PHE A C    8  
ATOM 5211  O O    . PHE A 1 14 ? 36.696 9.191   -0.506  1.00 0.00 ? 14 PHE A O    8  
ATOM 5212  C CB   . PHE A 1 14 ? 36.267 6.163   1.557   1.00 0.00 ? 14 PHE A CB   8  
ATOM 5213  C CG   . PHE A 1 14 ? 35.707 5.800   2.913   1.00 0.00 ? 14 PHE A CG   8  
ATOM 5214  C CD1  . PHE A 1 14 ? 35.866 6.628   4.024   1.00 0.00 ? 14 PHE A CD1  8  
ATOM 5215  C CD2  . PHE A 1 14 ? 34.972 4.627   3.055   1.00 0.00 ? 14 PHE A CD2  8  
ATOM 5216  C CE1  . PHE A 1 14 ? 35.214 6.345   5.210   1.00 0.00 ? 14 PHE A CE1  8  
ATOM 5217  C CE2  . PHE A 1 14 ? 34.316 4.344   4.241   1.00 0.00 ? 14 PHE A CE2  8  
ATOM 5218  C CZ   . PHE A 1 14 ? 34.419 5.229   5.310   1.00 0.00 ? 14 PHE A CZ   8  
ATOM 5219  H H    . PHE A 1 14 ? 34.380 8.021   1.296   1.00 0.00 ? 14 PHE A H    8  
ATOM 5220  H HA   . PHE A 1 14 ? 37.253 8.058   2.023   1.00 0.00 ? 14 PHE A HA   8  
ATOM 5221  H HB2  . PHE A 1 14 ? 35.582 5.805   0.785   1.00 0.00 ? 14 PHE A HB2  8  
ATOM 5222  H HB3  . PHE A 1 14 ? 37.191 5.611   1.439   1.00 0.00 ? 14 PHE A HB3  8  
ATOM 5223  H HD1  . PHE A 1 14 ? 36.476 7.519   4.008   1.00 0.00 ? 14 PHE A HD1  8  
ATOM 5224  H HD2  . PHE A 1 14 ? 34.900 3.923   2.235   1.00 0.00 ? 14 PHE A HD2  8  
ATOM 5225  H HE1  . PHE A 1 14 ? 35.314 7.003   6.058   1.00 0.00 ? 14 PHE A HE1  8  
ATOM 5226  H HE2  . PHE A 1 14 ? 33.705 3.454   4.302   1.00 0.00 ? 14 PHE A HE2  8  
ATOM 5227  H HZ   . PHE A 1 14 ? 33.877 5.087   6.234   1.00 0.00 ? 14 PHE A HZ   8  
ATOM 5228  N N    . GLU A 1 15 ? 37.505 7.077   -0.784  1.00 0.00 ? 15 GLU A N    8  
ATOM 5229  C CA   . GLU A 1 15 ? 37.993 7.301   -2.140  1.00 0.00 ? 15 GLU A CA   8  
ATOM 5230  C C    . GLU A 1 15 ? 38.083 5.961   -2.866  1.00 0.00 ? 15 GLU A C    8  
ATOM 5231  O O    . GLU A 1 15 ? 38.518 4.974   -2.296  1.00 0.00 ? 15 GLU A O    8  
ATOM 5232  C CB   . GLU A 1 15 ? 39.364 7.996   -2.126  1.00 0.00 ? 15 GLU A CB   8  
ATOM 5233  C CG   . GLU A 1 15 ? 39.659 8.777   -3.417  1.00 0.00 ? 15 GLU A CG   8  
ATOM 5234  C CD   . GLU A 1 15 ? 40.129 10.215  -3.131  1.00 0.00 ? 15 GLU A CD   8  
ATOM 5235  O OE1  . GLU A 1 15 ? 41.327 10.424  -2.929  1.00 0.00 ? 15 GLU A OE1  8  
ATOM 5236  O OE2  . GLU A 1 15 ? 39.289 11.116  -3.119  1.00 0.00 ? 15 GLU A OE2  8  
ATOM 5237  H H    . GLU A 1 15 ? 37.635 6.180   -0.366  1.00 0.00 ? 15 GLU A H    8  
ATOM 5238  H HA   . GLU A 1 15 ? 37.263 7.935   -2.632  1.00 0.00 ? 15 GLU A HA   8  
ATOM 5239  H HB2  . GLU A 1 15 ? 39.396 8.640   -1.248  1.00 0.00 ? 15 GLU A HB2  8  
ATOM 5240  H HB3  . GLU A 1 15 ? 40.181 7.292   -1.987  1.00 0.00 ? 15 GLU A HB3  8  
ATOM 5241  H HG2  . GLU A 1 15 ? 40.404 8.255   -4.017  1.00 0.00 ? 15 GLU A HG2  8  
ATOM 5242  H HG3  . GLU A 1 15 ? 38.776 8.820   -4.053  1.00 0.00 ? 15 GLU A HG3  8  
ATOM 5243  N N    . GLU A 1 16 ? 37.652 6.010   -4.146  1.00 0.00 ? 16 GLU A N    8  
ATOM 5244  C CA   . GLU A 1 16 ? 37.528 4.870   -5.055  1.00 0.00 ? 16 GLU A CA   8  
ATOM 5245  C C    . GLU A 1 16 ? 38.761 3.917   -5.045  1.00 0.00 ? 16 GLU A C    8  
ATOM 5246  O O    . GLU A 1 16 ? 38.642 2.742   -5.367  1.00 0.00 ? 16 GLU A O    8  
ATOM 5247  C CB   . GLU A 1 16 ? 37.240 5.412   -6.461  1.00 0.00 ? 16 GLU A CB   8  
ATOM 5248  C CG   . GLU A 1 16 ? 37.354 4.370   -7.593  1.00 0.00 ? 16 GLU A CG   8  
ATOM 5249  C CD   . GLU A 1 16 ? 37.129 4.970   -8.989  1.00 0.00 ? 16 GLU A CD   8  
ATOM 5250  O OE1  . GLU A 1 16 ? 36.485 6.015   -9.101  1.00 0.00 ? 16 GLU A OE1  8  
ATOM 5251  O OE2  . GLU A 1 16 ? 37.611 4.386   -9.960  1.00 0.00 ? 16 GLU A OE2  8  
ATOM 5252  H H    . GLU A 1 16 ? 37.340 6.904   -4.468  1.00 0.00 ? 16 GLU A H    8  
ATOM 5253  H HA   . GLU A 1 16 ? 36.633 4.344   -4.725  1.00 0.00 ? 16 GLU A HA   8  
ATOM 5254  H HB2  . GLU A 1 16 ? 36.237 5.844   -6.473  1.00 0.00 ? 16 GLU A HB2  8  
ATOM 5255  H HB3  . GLU A 1 16 ? 37.922 6.240   -6.647  1.00 0.00 ? 16 GLU A HB3  8  
ATOM 5256  H HG2  . GLU A 1 16 ? 38.350 3.932   -7.603  1.00 0.00 ? 16 GLU A HG2  8  
ATOM 5257  H HG3  . GLU A 1 16 ? 36.658 3.548   -7.436  1.00 0.00 ? 16 GLU A HG3  8  
ATOM 5258  N N    . SER A 1 17 ? 39.925 4.469   -4.654  1.00 0.00 ? 17 SER A N    8  
ATOM 5259  C CA   . SER A 1 17 ? 41.141 3.677   -4.563  1.00 0.00 ? 17 SER A CA   8  
ATOM 5260  C C    . SER A 1 17 ? 41.187 2.859   -3.261  1.00 0.00 ? 17 SER A C    8  
ATOM 5261  O O    . SER A 1 17 ? 41.386 1.654   -3.308  1.00 0.00 ? 17 SER A O    8  
ATOM 5262  C CB   . SER A 1 17 ? 42.339 4.632   -4.629  1.00 0.00 ? 17 SER A CB   8  
ATOM 5263  O OG   . SER A 1 17 ? 42.876 4.750   -5.931  1.00 0.00 ? 17 SER A OG   8  
ATOM 5264  H H    . SER A 1 17 ? 39.958 5.429   -4.372  1.00 0.00 ? 17 SER A H    8  
ATOM 5265  H HA   . SER A 1 17 ? 41.133 2.965   -5.396  1.00 0.00 ? 17 SER A HA   8  
ATOM 5266  H HB2  . SER A 1 17 ? 42.078 5.617   -4.231  1.00 0.00 ? 17 SER A HB2  8  
ATOM 5267  H HB3  . SER A 1 17 ? 43.149 4.279   -3.993  1.00 0.00 ? 17 SER A HB3  8  
ATOM 5268  H HG   . SER A 1 17 ? 42.191 4.996   -6.542  1.00 0.00 ? 17 SER A HG   8  
ATOM 5269  N N    . LEU A 1 18 ? 40.999 3.558   -2.111  1.00 0.00 ? 18 LEU A N    8  
ATOM 5270  C CA   . LEU A 1 18 ? 40.983 2.832   -0.830  1.00 0.00 ? 18 LEU A CA   8  
ATOM 5271  C C    . LEU A 1 18 ? 39.782 1.890   -0.757  1.00 0.00 ? 18 LEU A C    8  
ATOM 5272  O O    . LEU A 1 18 ? 39.804 0.907   -0.013  1.00 0.00 ? 18 LEU A O    8  
ATOM 5273  C CB   . LEU A 1 18 ? 41.100 3.773   0.389   1.00 0.00 ? 18 LEU A CB   8  
ATOM 5274  C CG   . LEU A 1 18 ? 39.828 4.459   0.942   1.00 0.00 ? 18 LEU A CG   8  
ATOM 5275  C CD1  . LEU A 1 18 ? 39.581 4.128   2.422   1.00 0.00 ? 18 LEU A CD1  8  
ATOM 5276  C CD2  . LEU A 1 18 ? 39.923 5.977   0.799   1.00 0.00 ? 18 LEU A CD2  8  
ATOM 5277  H H    . LEU A 1 18 ? 40.809 4.538   -2.151  1.00 0.00 ? 18 LEU A H    8  
ATOM 5278  H HA   . LEU A 1 18 ? 41.875 2.205   -0.824  1.00 0.00 ? 18 LEU A HA   8  
ATOM 5279  H HB2  . LEU A 1 18 ? 41.532 3.191   1.195   1.00 0.00 ? 18 LEU A HB2  8  
ATOM 5280  H HB3  . LEU A 1 18 ? 41.861 4.517   0.172   1.00 0.00 ? 18 LEU A HB3  8  
ATOM 5281  H HG   . LEU A 1 18 ? 38.964 4.126   0.375   1.00 0.00 ? 18 LEU A HG   8  
ATOM 5282  H HD11 . LEU A 1 18 ? 39.583 3.054   2.610   1.00 0.00 ? 18 LEU A HD11 8  
ATOM 5283  H HD12 . LEU A 1 18 ? 38.627 4.546   2.737   1.00 0.00 ? 18 LEU A HD12 8  
ATOM 5284  H HD13 . LEU A 1 18 ? 40.348 4.569   3.058   1.00 0.00 ? 18 LEU A HD13 8  
ATOM 5285  H HD21 . LEU A 1 18 ? 40.833 6.363   1.249   1.00 0.00 ? 18 LEU A HD21 8  
ATOM 5286  H HD22 . LEU A 1 18 ? 39.098 6.498   1.283   1.00 0.00 ? 18 LEU A HD22 8  
ATOM 5287  H HD23 . LEU A 1 18 ? 39.940 6.224   -0.254  1.00 0.00 ? 18 LEU A HD23 8  
ATOM 5288  N N    . VAL A 1 19 ? 38.780 2.232   -1.573  1.00 0.00 ? 19 VAL A N    8  
ATOM 5289  C CA   . VAL A 1 19 ? 37.509 1.551   -1.753  1.00 0.00 ? 19 VAL A CA   8  
ATOM 5290  C C    . VAL A 1 19 ? 37.696 0.213   -2.466  1.00 0.00 ? 19 VAL A C    8  
ATOM 5291  O O    . VAL A 1 19 ? 37.317 -0.825  -1.955  1.00 0.00 ? 19 VAL A O    8  
ATOM 5292  C CB   . VAL A 1 19 ? 36.631 2.501   -2.567  1.00 0.00 ? 19 VAL A CB   8  
ATOM 5293  C CG1  . VAL A 1 19 ? 35.556 1.805   -3.392  1.00 0.00 ? 19 VAL A CG1  8  
ATOM 5294  C CG2  . VAL A 1 19 ? 36.048 3.650   -1.728  1.00 0.00 ? 19 VAL A CG2  8  
ATOM 5295  H H    . VAL A 1 19 ? 38.924 3.037   -2.155  1.00 0.00 ? 19 VAL A H    8  
ATOM 5296  H HA   . VAL A 1 19 ? 37.072 1.337   -0.785  1.00 0.00 ? 19 VAL A HA   8  
ATOM 5297  H HB   . VAL A 1 19 ? 37.310 2.952   -3.281  1.00 0.00 ? 19 VAL A HB   8  
ATOM 5298  H HG11 . VAL A 1 19 ? 35.949 1.534   -4.368  1.00 0.00 ? 19 VAL A HG11 8  
ATOM 5299  H HG12 . VAL A 1 19 ? 34.707 2.465   -3.522  1.00 0.00 ? 19 VAL A HG12 8  
ATOM 5300  H HG13 . VAL A 1 19 ? 35.212 0.883   -2.937  1.00 0.00 ? 19 VAL A HG13 8  
ATOM 5301  H HG21 . VAL A 1 19 ? 36.775 4.040   -1.023  1.00 0.00 ? 19 VAL A HG21 8  
ATOM 5302  H HG22 . VAL A 1 19 ? 35.189 3.388   -1.129  1.00 0.00 ? 19 VAL A HG22 8  
ATOM 5303  H HG23 . VAL A 1 19 ? 35.717 4.449   -2.386  1.00 0.00 ? 19 VAL A HG23 8  
ATOM 5304  N N    . ILE A 1 20 ? 38.278 0.323   -3.680  1.00 0.00 ? 20 ILE A N    8  
ATOM 5305  C CA   . ILE A 1 20 ? 38.522 -0.851  -4.506  1.00 0.00 ? 20 ILE A CA   8  
ATOM 5306  C C    . ILE A 1 20 ? 39.373 -1.859  -3.756  1.00 0.00 ? 20 ILE A C    8  
ATOM 5307  O O    . ILE A 1 20 ? 39.029 -3.024  -3.705  1.00 0.00 ? 20 ILE A O    8  
ATOM 5308  C CB   . ILE A 1 20 ? 39.159 -0.449  -5.850  1.00 0.00 ? 20 ILE A CB   8  
ATOM 5309  C CG1  . ILE A 1 20 ? 38.079 -0.013  -6.847  1.00 0.00 ? 20 ILE A CG1  8  
ATOM 5310  C CG2  . ILE A 1 20 ? 40.056 -1.541  -6.472  1.00 0.00 ? 20 ILE A CG2  8  
ATOM 5311  C CD1  . ILE A 1 20 ? 37.187 -1.172  -7.311  1.00 0.00 ? 20 ILE A CD1  8  
ATOM 5312  H H    . ILE A 1 20 ? 38.540 1.220   -4.024  1.00 0.00 ? 20 ILE A H    8  
ATOM 5313  H HA   . ILE A 1 20 ? 37.556 -1.325  -4.668  1.00 0.00 ? 20 ILE A HA   8  
ATOM 5314  H HB   . ILE A 1 20 ? 39.802 0.413   -5.665  1.00 0.00 ? 20 ILE A HB   8  
ATOM 5315  H HG12 . ILE A 1 20 ? 37.471 0.790   -6.426  1.00 0.00 ? 20 ILE A HG12 8  
ATOM 5316  H HG13 . ILE A 1 20 ? 38.554 0.435   -7.717  1.00 0.00 ? 20 ILE A HG13 8  
ATOM 5317  H HG21 . ILE A 1 20 ? 40.295 -1.313  -7.509  1.00 0.00 ? 20 ILE A HG21 8  
ATOM 5318  H HG22 . ILE A 1 20 ? 39.595 -2.529  -6.448  1.00 0.00 ? 20 ILE A HG22 8  
ATOM 5319  H HG23 . ILE A 1 20 ? 40.996 -1.618  -5.931  1.00 0.00 ? 20 ILE A HG23 8  
ATOM 5320  H HD11 . ILE A 1 20 ? 37.687 -2.138  -7.378  1.00 0.00 ? 20 ILE A HD11 8  
ATOM 5321  H HD12 . ILE A 1 20 ? 36.831 -0.954  -8.315  1.00 0.00 ? 20 ILE A HD12 8  
ATOM 5322  H HD13 . ILE A 1 20 ? 36.336 -1.289  -6.639  1.00 0.00 ? 20 ILE A HD13 8  
ATOM 5323  N N    . GLN A 1 21 ? 40.473 -1.343  -3.182  1.00 0.00 ? 21 GLN A N    8  
ATOM 5324  C CA   . GLN A 1 21 ? 41.386 -2.205  -2.447  1.00 0.00 ? 21 GLN A CA   8  
ATOM 5325  C C    . GLN A 1 21 ? 40.778 -2.704  -1.121  1.00 0.00 ? 21 GLN A C    8  
ATOM 5326  O O    . GLN A 1 21 ? 41.165 -3.748  -0.621  1.00 0.00 ? 21 GLN A O    8  
ATOM 5327  C CB   . GLN A 1 21 ? 42.697 -1.451  -2.224  1.00 0.00 ? 21 GLN A CB   8  
ATOM 5328  C CG   . GLN A 1 21 ? 43.867 -2.387  -1.857  1.00 0.00 ? 21 GLN A CG   8  
ATOM 5329  C CD   . GLN A 1 21 ? 45.170 -1.818  -2.440  1.00 0.00 ? 21 GLN A CD   8  
ATOM 5330  O OE1  . GLN A 1 21 ? 45.982 -1.215  -1.755  1.00 0.00 ? 21 GLN A OE1  8  
ATOM 5331  N NE2  . GLN A 1 21 ? 45.222 -1.951  -3.782  1.00 0.00 ? 21 GLN A NE2  8  
ATOM 5332  H H    . GLN A 1 21 ? 40.679 -0.373  -3.312  1.00 0.00 ? 21 GLN A H    8  
ATOM 5333  H HA   . GLN A 1 21 ? 41.574 -3.065  -3.095  1.00 0.00 ? 21 GLN A HA   8  
ATOM 5334  H HB2  . GLN A 1 21 ? 42.903 -0.903  -3.145  1.00 0.00 ? 21 GLN A HB2  8  
ATOM 5335  H HB3  . GLN A 1 21 ? 42.586 -0.676  -1.466  1.00 0.00 ? 21 GLN A HB3  8  
ATOM 5336  H HG2  . GLN A 1 21 ? 43.961 -2.477  -0.775  1.00 0.00 ? 21 GLN A HG2  8  
ATOM 5337  H HG3  . GLN A 1 21 ? 43.706 -3.398  -2.236  1.00 0.00 ? 21 GLN A HG3  8  
ATOM 5338  H HE21 . GLN A 1 21 ? 44.715 -2.683  -4.231  1.00 0.00 ? 21 GLN A HE21 8  
ATOM 5339  H HE22 . GLN A 1 21 ? 45.728 -1.294  -4.330  1.00 0.00 ? 21 GLN A HE22 8  
ATOM 5340  N N    . ALA A 1 22 ? 39.801 -1.923  -0.606  1.00 0.00 ? 22 ALA A N    8  
ATOM 5341  C CA   . ALA A 1 22 ? 39.051 -2.326  0.583   1.00 0.00 ? 22 ALA A CA   8  
ATOM 5342  C C    . ALA A 1 22 ? 37.898 -3.280  0.266   1.00 0.00 ? 22 ALA A C    8  
ATOM 5343  O O    . ALA A 1 22 ? 37.303 -3.826  1.181   1.00 0.00 ? 22 ALA A O    8  
ATOM 5344  C CB   . ALA A 1 22 ? 38.391 -1.119  1.248   1.00 0.00 ? 22 ALA A CB   8  
ATOM 5345  H H    . ALA A 1 22 ? 39.542 -1.091  -1.093  1.00 0.00 ? 22 ALA A H    8  
ATOM 5346  H HA   . ALA A 1 22 ? 39.739 -2.832  1.262   1.00 0.00 ? 22 ALA A HA   8  
ATOM 5347  H HB1  . ALA A 1 22 ? 39.132 -0.437  1.650   1.00 0.00 ? 22 ALA A HB1  8  
ATOM 5348  H HB2  . ALA A 1 22 ? 37.771 -1.441  2.085   1.00 0.00 ? 22 ALA A HB2  8  
ATOM 5349  H HB3  . ALA A 1 22 ? 37.757 -0.555  0.561   1.00 0.00 ? 22 ALA A HB3  8  
ATOM 5350  N N    . TYR A 1 23 ? 37.602 -3.424  -1.043  1.00 0.00 ? 23 TYR A N    8  
ATOM 5351  C CA   . TYR A 1 23 ? 36.517 -4.298  -1.487  1.00 0.00 ? 23 TYR A CA   8  
ATOM 5352  C C    . TYR A 1 23 ? 37.089 -5.546  -2.163  1.00 0.00 ? 23 TYR A C    8  
ATOM 5353  O O    . TYR A 1 23 ? 36.417 -6.557  -2.257  1.00 0.00 ? 23 TYR A O    8  
ATOM 5354  C CB   . TYR A 1 23 ? 35.592 -3.538  -2.458  1.00 0.00 ? 23 TYR A CB   8  
ATOM 5355  C CG   . TYR A 1 23 ? 34.139 -3.872  -2.250  1.00 0.00 ? 23 TYR A CG   8  
ATOM 5356  C CD1  . TYR A 1 23 ? 33.481 -3.345  -1.157  1.00 0.00 ? 23 TYR A CD1  8  
ATOM 5357  C CD2  . TYR A 1 23 ? 33.435 -4.680  -3.133  1.00 0.00 ? 23 TYR A CD2  8  
ATOM 5358  C CE1  . TYR A 1 23 ? 32.132 -3.599  -0.937  1.00 0.00 ? 23 TYR A CE1  8  
ATOM 5359  C CE2  . TYR A 1 23 ? 32.087 -4.944  -2.929  1.00 0.00 ? 23 TYR A CE2  8  
ATOM 5360  C CZ   . TYR A 1 23 ? 31.433 -4.392  -1.833  1.00 0.00 ? 23 TYR A CZ   8  
ATOM 5361  O OH   . TYR A 1 23 ? 30.089 -4.628  -1.630  1.00 0.00 ? 23 TYR A OH   8  
ATOM 5362  H H    . TYR A 1 23 ? 38.126 -2.921  -1.729  1.00 0.00 ? 23 TYR A H    8  
ATOM 5363  H HA   . TYR A 1 23 ? 35.961 -4.623  -0.606  1.00 0.00 ? 23 TYR A HA   8  
ATOM 5364  H HB2  . TYR A 1 23 ? 35.676 -2.476  -2.260  1.00 0.00 ? 23 TYR A HB2  8  
ATOM 5365  H HB3  . TYR A 1 23 ? 35.875 -3.656  -3.505  1.00 0.00 ? 23 TYR A HB3  8  
ATOM 5366  H HD1  . TYR A 1 23 ? 34.045 -2.698  -0.502  1.00 0.00 ? 23 TYR A HD1  8  
ATOM 5367  H HD2  . TYR A 1 23 ? 33.952 -5.098  -3.979  1.00 0.00 ? 23 TYR A HD2  8  
ATOM 5368  H HE1  . TYR A 1 23 ? 31.628 -3.180  -0.075  1.00 0.00 ? 23 TYR A HE1  8  
ATOM 5369  H HE2  . TYR A 1 23 ? 31.549 -5.585  -3.615  1.00 0.00 ? 23 TYR A HE2  8  
ATOM 5370  H HH   . TYR A 1 23 ? 29.970 -5.477  -1.222  1.00 0.00 ? 23 TYR A HH   8  
ATOM 5371  N N    . PHE A 1 24 ? 38.348 -5.424  -2.624  1.00 0.00 ? 24 PHE A N    8  
ATOM 5372  C CA   . PHE A 1 24 ? 39.026 -6.509  -3.328  1.00 0.00 ? 24 PHE A CA   8  
ATOM 5373  C C    . PHE A 1 24 ? 39.812 -7.353  -2.309  1.00 0.00 ? 24 PHE A C    8  
ATOM 5374  O O    . PHE A 1 24 ? 39.809 -8.577  -2.364  1.00 0.00 ? 24 PHE A O    8  
ATOM 5375  C CB   . PHE A 1 24 ? 39.985 -5.932  -4.395  1.00 0.00 ? 24 PHE A CB   8  
ATOM 5376  C CG   . PHE A 1 24 ? 39.489 -6.119  -5.809  1.00 0.00 ? 24 PHE A CG   8  
ATOM 5377  C CD1  . PHE A 1 24 ? 38.435 -5.369  -6.319  1.00 0.00 ? 24 PHE A CD1  8  
ATOM 5378  C CD2  . PHE A 1 24 ? 40.088 -7.074  -6.621  1.00 0.00 ? 24 PHE A CD2  8  
ATOM 5379  C CE1  . PHE A 1 24 ? 37.982 -5.577  -7.618  1.00 0.00 ? 24 PHE A CE1  8  
ATOM 5380  C CE2  . PHE A 1 24 ? 39.642 -7.286  -7.917  1.00 0.00 ? 24 PHE A CE2  8  
ATOM 5381  C CZ   . PHE A 1 24 ? 38.586 -6.539  -8.416  1.00 0.00 ? 24 PHE A CZ   8  
ATOM 5382  H H    . PHE A 1 24 ? 38.860 -4.595  -2.413  1.00 0.00 ? 24 PHE A H    8  
ATOM 5383  H HA   . PHE A 1 24 ? 38.255 -7.139  -3.775  1.00 0.00 ? 24 PHE A HA   8  
ATOM 5384  H HB2  . PHE A 1 24 ? 40.155 -4.876  -4.234  1.00 0.00 ? 24 PHE A HB2  8  
ATOM 5385  H HB3  . PHE A 1 24 ? 40.973 -6.386  -4.311  1.00 0.00 ? 24 PHE A HB3  8  
ATOM 5386  H HD1  . PHE A 1 24 ? 37.947 -4.628  -5.703  1.00 0.00 ? 24 PHE A HD1  8  
ATOM 5387  H HD2  . PHE A 1 24 ? 40.895 -7.673  -6.231  1.00 0.00 ? 24 PHE A HD2  8  
ATOM 5388  H HE1  . PHE A 1 24 ? 37.150 -5.004  -8.003  1.00 0.00 ? 24 PHE A HE1  8  
ATOM 5389  H HE2  . PHE A 1 24 ? 40.110 -8.046  -8.524  1.00 0.00 ? 24 PHE A HE2  8  
ATOM 5390  H HZ   . PHE A 1 24 ? 38.230 -6.720  -9.420  1.00 0.00 ? 24 PHE A HZ   8  
ATOM 5391  N N    . ALA A 1 25 ? 40.477 -6.621  -1.383  1.00 0.00 ? 25 ALA A N    8  
ATOM 5392  C CA   . ALA A 1 25 ? 41.246 -7.265  -0.319  1.00 0.00 ? 25 ALA A CA   8  
ATOM 5393  C C    . ALA A 1 25 ? 40.320 -7.923  0.717   1.00 0.00 ? 25 ALA A C    8  
ATOM 5394  O O    . ALA A 1 25 ? 40.691 -8.885  1.377   1.00 0.00 ? 25 ALA A O    8  
ATOM 5395  C CB   . ALA A 1 25 ? 42.148 -6.240  0.374   1.00 0.00 ? 25 ALA A CB   8  
ATOM 5396  H H    . ALA A 1 25 ? 40.436 -5.623  -1.401  1.00 0.00 ? 25 ALA A H    8  
ATOM 5397  H HA   . ALA A 1 25 ? 41.863 -8.032  -0.787  1.00 0.00 ? 25 ALA A HA   8  
ATOM 5398  H HB1  . ALA A 1 25 ? 42.832 -6.718  1.074   1.00 0.00 ? 25 ALA A HB1  8  
ATOM 5399  H HB2  . ALA A 1 25 ? 41.571 -5.509  0.940   1.00 0.00 ? 25 ALA A HB2  8  
ATOM 5400  H HB3  . ALA A 1 25 ? 42.751 -5.708  -0.362  1.00 0.00 ? 25 ALA A HB3  8  
ATOM 5401  N N    . CYS A 1 26 ? 39.094 -7.360  0.795   1.00 0.00 ? 26 CYS A N    8  
ATOM 5402  C CA   . CYS A 1 26 ? 38.061 -7.926  1.660   1.00 0.00 ? 26 CYS A CA   8  
ATOM 5403  C C    . CYS A 1 26 ? 37.345 -9.132  1.025   1.00 0.00 ? 26 CYS A C    8  
ATOM 5404  O O    . CYS A 1 26 ? 36.431 -9.679  1.629   1.00 0.00 ? 26 CYS A O    8  
ATOM 5405  C CB   . CYS A 1 26 ? 37.020 -6.844  1.957   1.00 0.00 ? 26 CYS A CB   8  
ATOM 5406  S SG   . CYS A 1 26 ? 37.387 -6.061  3.546   1.00 0.00 ? 26 CYS A SG   8  
ATOM 5407  H H    . CYS A 1 26 ? 38.900 -6.545  0.248   1.00 0.00 ? 26 CYS A H    8  
ATOM 5408  H HA   . CYS A 1 26 ? 38.555 -8.243  2.583   1.00 0.00 ? 26 CYS A HA   8  
ATOM 5409  H HB2  . CYS A 1 26 ? 37.071 -6.106  1.165   1.00 0.00 ? 26 CYS A HB2  8  
ATOM 5410  H HB3  . CYS A 1 26 ? 35.984 -7.202  1.929   1.00 0.00 ? 26 CYS A HB3  8  
ATOM 5411  H HG   . CYS A 1 26 ? 37.184 -4.752  3.453   1.00 0.00 ? 26 CYS A HG   8  
ATOM 5412  N N    . GLU A 1 27 ? 37.770 -9.497  -0.211  1.00 0.00 ? 27 GLU A N    8  
ATOM 5413  C CA   . GLU A 1 27 ? 37.084 -10.532 -0.986  1.00 0.00 ? 27 GLU A CA   8  
ATOM 5414  C C    . GLU A 1 27 ? 35.603 -10.169 -1.198  1.00 0.00 ? 27 GLU A C    8  
ATOM 5415  O O    . GLU A 1 27 ? 34.698 -10.816 -0.687  1.00 0.00 ? 27 GLU A O    8  
ATOM 5416  C CB   . GLU A 1 27 ? 37.303 -11.921 -0.350  1.00 0.00 ? 27 GLU A CB   8  
ATOM 5417  C CG   . GLU A 1 27 ? 36.422 -13.073 -0.879  1.00 0.00 ? 27 GLU A CG   8  
ATOM 5418  C CD   . GLU A 1 27 ? 36.202 -13.035 -2.414  1.00 0.00 ? 27 GLU A CD   8  
ATOM 5419  O OE1  . GLU A 1 27 ? 37.188 -12.983 -3.150  1.00 0.00 ? 27 GLU A OE1  8  
ATOM 5420  O OE2  . GLU A 1 27 ? 35.051 -13.047 -2.860  1.00 0.00 ? 27 GLU A OE2  8  
ATOM 5421  H H    . GLU A 1 27 ? 38.584 -9.078  -0.611  1.00 0.00 ? 27 GLU A H    8  
ATOM 5422  H HA   . GLU A 1 27 ? 37.561 -10.521 -1.966  1.00 0.00 ? 27 GLU A HA   8  
ATOM 5423  H HB2  . GLU A 1 27 ? 38.349 -12.187 -0.486  1.00 0.00 ? 27 GLU A HB2  8  
ATOM 5424  H HB3  . GLU A 1 27 ? 37.168 -11.862 0.727   1.00 0.00 ? 27 GLU A HB3  8  
ATOM 5425  H HG2  . GLU A 1 27 ? 36.875 -14.023 -0.599  1.00 0.00 ? 27 GLU A HG2  8  
ATOM 5426  H HG3  . GLU A 1 27 ? 35.465 -13.061 -0.357  1.00 0.00 ? 27 GLU A HG3  8  
ATOM 5427  N N    . LYS A 1 28 ? 35.454 -9.093  -1.998  1.00 0.00 ? 28 LYS A N    8  
ATOM 5428  C CA   . LYS A 1 28 ? 34.185 -8.564  -2.503  1.00 0.00 ? 28 LYS A CA   8  
ATOM 5429  C C    . LYS A 1 28 ? 32.991 -8.841  -1.566  1.00 0.00 ? 28 LYS A C    8  
ATOM 5430  O O    . LYS A 1 28 ? 32.017 -9.490  -1.926  1.00 0.00 ? 28 LYS A O    8  
ATOM 5431  C CB   . LYS A 1 28 ? 33.980 -9.091  -3.937  1.00 0.00 ? 28 LYS A CB   8  
ATOM 5432  C CG   . LYS A 1 28 ? 34.433 -8.089  -5.003  1.00 0.00 ? 28 LYS A CG   8  
ATOM 5433  C CD   . LYS A 1 28 ? 35.947 -7.863  -5.054  1.00 0.00 ? 28 LYS A CD   8  
ATOM 5434  C CE   . LYS A 1 28 ? 36.589 -8.331  -6.360  1.00 0.00 ? 28 LYS A CE   8  
ATOM 5435  N NZ   . LYS A 1 28 ? 36.353 -9.727  -6.667  1.00 0.00 ? 28 LYS A NZ   8  
ATOM 5436  H H    . LYS A 1 28 ? 36.292 -8.655  -2.328  1.00 0.00 ? 28 LYS A H    8  
ATOM 5437  H HA   . LYS A 1 28 ? 34.312 -7.483  -2.518  1.00 0.00 ? 28 LYS A HA   8  
ATOM 5438  H HB2  . LYS A 1 28 ? 34.479 -10.051 -4.085  1.00 0.00 ? 28 LYS A HB2  8  
ATOM 5439  H HB3  . LYS A 1 28 ? 32.931 -9.290  -4.136  1.00 0.00 ? 28 LYS A HB3  8  
ATOM 5440  H HG2  . LYS A 1 28 ? 34.093 -8.442  -5.970  1.00 0.00 ? 28 LYS A HG2  8  
ATOM 5441  H HG3  . LYS A 1 28 ? 33.923 -7.140  -4.844  1.00 0.00 ? 28 LYS A HG3  8  
ATOM 5442  H HD2  . LYS A 1 28 ? 36.135 -6.797  -4.927  1.00 0.00 ? 28 LYS A HD2  8  
ATOM 5443  H HD3  . LYS A 1 28 ? 36.449 -8.366  -4.234  1.00 0.00 ? 28 LYS A HD3  8  
ATOM 5444  H HE2  . LYS A 1 28 ? 36.197 -7.763  -7.202  1.00 0.00 ? 28 LYS A HE2  8  
ATOM 5445  H HE3  . LYS A 1 28 ? 37.667 -8.211  -6.259  1.00 0.00 ? 28 LYS A HE3  8  
ATOM 5446  H HZ1  . LYS A 1 28 ? 36.932 -10.024 -7.480  1.00 0.00 ? 28 LYS A HZ1  8  
ATOM 5447  H HZ2  . LYS A 1 28 ? 35.348 -9.853  -6.900  1.00 0.00 ? 28 LYS A HZ2  8  
ATOM 5448  H HZ3  . LYS A 1 28 ? 36.624 -10.286 -5.837  1.00 0.00 ? 28 LYS A HZ3  8  
ATOM 5449  N N    . ASN A 1 29 ? 33.168 -8.321  -0.333  1.00 0.00 ? 29 ASN A N    8  
ATOM 5450  C CA   . ASN A 1 29 ? 32.207 -8.556  0.737   1.00 0.00 ? 29 ASN A CA   8  
ATOM 5451  C C    . ASN A 1 29 ? 31.453 -7.241  0.961   1.00 0.00 ? 29 ASN A C    8  
ATOM 5452  O O    . ASN A 1 29 ? 31.469 -6.384  0.096   1.00 0.00 ? 29 ASN A O    8  
ATOM 5453  C CB   . ASN A 1 29 ? 32.978 -9.048  1.980   1.00 0.00 ? 29 ASN A CB   8  
ATOM 5454  C CG   . ASN A 1 29 ? 32.482 -10.426 2.417   1.00 0.00 ? 29 ASN A CG   8  
ATOM 5455  O OD1  . ASN A 1 29 ? 32.669 -11.422 1.733   1.00 0.00 ? 29 ASN A OD1  8  
ATOM 5456  N ND2  . ASN A 1 29 ? 31.824 -10.412 3.596   1.00 0.00 ? 29 ASN A ND2  8  
ATOM 5457  H H    . ASN A 1 29 ? 33.996 -7.786  -0.157  1.00 0.00 ? 29 ASN A H    8  
ATOM 5458  H HA   . ASN A 1 29 ? 31.479 -9.294  0.382   1.00 0.00 ? 29 ASN A HA   8  
ATOM 5459  H HB2  . ASN A 1 29 ? 34.045 -9.129  1.771   1.00 0.00 ? 29 ASN A HB2  8  
ATOM 5460  H HB3  . ASN A 1 29 ? 32.887 -8.361  2.814   1.00 0.00 ? 29 ASN A HB3  8  
ATOM 5461  H HD21 . ASN A 1 29 ? 31.739 -9.553  4.108   1.00 0.00 ? 29 ASN A HD21 8  
ATOM 5462  H HD22 . ASN A 1 29 ? 31.425 -11.247 3.961   1.00 0.00 ? 29 ASN A HD22 8  
ATOM 5463  N N    . GLU A 1 30 ? 30.793 -7.126  2.133   1.00 0.00 ? 30 GLU A N    8  
ATOM 5464  C CA   . GLU A 1 30 ? 29.930 -5.976  2.391   1.00 0.00 ? 30 GLU A CA   8  
ATOM 5465  C C    . GLU A 1 30 ? 30.289 -5.368  3.744   1.00 0.00 ? 30 GLU A C    8  
ATOM 5466  O O    . GLU A 1 30 ? 30.925 -4.324  3.818   1.00 0.00 ? 30 GLU A O    8  
ATOM 5467  C CB   . GLU A 1 30 ? 28.464 -6.432  2.339   1.00 0.00 ? 30 GLU A CB   8  
ATOM 5468  C CG   . GLU A 1 30 ? 28.000 -6.797  0.917   1.00 0.00 ? 30 GLU A CG   8  
ATOM 5469  C CD   . GLU A 1 30 ? 26.643 -7.527  0.935   1.00 0.00 ? 30 GLU A CD   8  
ATOM 5470  O OE1  . GLU A 1 30 ? 26.546 -8.579  1.570   1.00 0.00 ? 30 GLU A OE1  8  
ATOM 5471  O OE2  . GLU A 1 30 ? 25.696 -7.046  0.310   1.00 0.00 ? 30 GLU A OE2  8  
ATOM 5472  H H    . GLU A 1 30 ? 30.877 -7.848  2.819   1.00 0.00 ? 30 GLU A H    8  
ATOM 5473  H HA   . GLU A 1 30 ? 30.129 -5.198  1.656   1.00 0.00 ? 30 GLU A HA   8  
ATOM 5474  H HB2  . GLU A 1 30 ? 28.346 -7.294  2.994   1.00 0.00 ? 30 GLU A HB2  8  
ATOM 5475  H HB3  . GLU A 1 30 ? 27.816 -5.652  2.739   1.00 0.00 ? 30 GLU A HB3  8  
ATOM 5476  H HG2  . GLU A 1 30 ? 27.927 -5.889  0.320   1.00 0.00 ? 30 GLU A HG2  8  
ATOM 5477  H HG3  . GLU A 1 30 ? 28.723 -7.438  0.412   1.00 0.00 ? 30 GLU A HG3  8  
ATOM 5478  N N    . ASN A 1 31 ? 29.858 -6.082  4.798   1.00 0.00 ? 31 ASN A N    8  
ATOM 5479  C CA   . ASN A 1 31 ? 30.159 -5.673  6.166   1.00 0.00 ? 31 ASN A CA   8  
ATOM 5480  C C    . ASN A 1 31 ? 31.674 -5.688  6.438   1.00 0.00 ? 31 ASN A C    8  
ATOM 5481  O O    . ASN A 1 31 ? 32.137 -5.032  7.359   1.00 0.00 ? 31 ASN A O    8  
ATOM 5482  C CB   . ASN A 1 31 ? 29.446 -6.645  7.134   1.00 0.00 ? 31 ASN A CB   8  
ATOM 5483  C CG   . ASN A 1 31 ? 28.463 -5.910  8.048   1.00 0.00 ? 31 ASN A CG   8  
ATOM 5484  O OD1  . ASN A 1 31 ? 28.679 -5.756  9.240   1.00 0.00 ? 31 ASN A OD1  8  
ATOM 5485  N ND2  . ASN A 1 31 ? 27.365 -5.472  7.396   1.00 0.00 ? 31 ASN A ND2  8  
ATOM 5486  H H    . ASN A 1 31 ? 29.330 -6.913  4.629   1.00 0.00 ? 31 ASN A H    8  
ATOM 5487  H HA   . ASN A 1 31 ? 29.814 -4.639  6.270   1.00 0.00 ? 31 ASN A HA   8  
ATOM 5488  H HB2  . ASN A 1 31 ? 28.899 -7.403  6.574   1.00 0.00 ? 31 ASN A HB2  8  
ATOM 5489  H HB3  . ASN A 1 31 ? 30.138 -7.200  7.773   1.00 0.00 ? 31 ASN A HB3  8  
ATOM 5490  H HD21 . ASN A 1 31 ? 27.263 -5.632  6.411   1.00 0.00 ? 31 ASN A HD21 8  
ATOM 5491  H HD22 . ASN A 1 31 ? 26.650 -4.984  7.886   1.00 0.00 ? 31 ASN A HD22 8  
ATOM 5492  N N    . LEU A 1 32 ? 32.397 -6.470  5.601   1.00 0.00 ? 32 LEU A N    8  
ATOM 5493  C CA   . LEU A 1 32 ? 33.841 -6.630  5.780   1.00 0.00 ? 32 LEU A CA   8  
ATOM 5494  C C    . LEU A 1 32 ? 34.583 -5.458  5.139   1.00 0.00 ? 32 LEU A C    8  
ATOM 5495  O O    . LEU A 1 32 ? 35.540 -4.927  5.688   1.00 0.00 ? 32 LEU A O    8  
ATOM 5496  C CB   . LEU A 1 32 ? 34.289 -7.944  5.112   1.00 0.00 ? 32 LEU A CB   8  
ATOM 5497  C CG   . LEU A 1 32 ? 35.584 -8.573  5.655   1.00 0.00 ? 32 LEU A CG   8  
ATOM 5498  C CD1  . LEU A 1 32 ? 35.689 -8.476  7.181   1.00 0.00 ? 32 LEU A CD1  8  
ATOM 5499  C CD2  . LEU A 1 32 ? 35.664 -10.034 5.201   1.00 0.00 ? 32 LEU A CD2  8  
ATOM 5500  H H    . LEU A 1 32 ? 31.934 -6.955  4.856   1.00 0.00 ? 32 LEU A H    8  
ATOM 5501  H HA   . LEU A 1 32 ? 34.021 -6.634  6.857   1.00 0.00 ? 32 LEU A HA   8  
ATOM 5502  H HB2  . LEU A 1 32 ? 33.483 -8.669  5.205   1.00 0.00 ? 32 LEU A HB2  8  
ATOM 5503  H HB3  . LEU A 1 32 ? 34.416 -7.805  4.040   1.00 0.00 ? 32 LEU A HB3  8  
ATOM 5504  H HG   . LEU A 1 32 ? 36.442 -8.049  5.234   1.00 0.00 ? 32 LEU A HG   8  
ATOM 5505  H HD11 . LEU A 1 32 ? 36.473 -9.121  7.570   1.00 0.00 ? 32 LEU A HD11 8  
ATOM 5506  H HD12 . LEU A 1 32 ? 34.752 -8.760  7.660   1.00 0.00 ? 32 LEU A HD12 8  
ATOM 5507  H HD13 . LEU A 1 32 ? 35.935 -7.457  7.481   1.00 0.00 ? 32 LEU A HD13 8  
ATOM 5508  H HD21 . LEU A 1 32 ? 35.649 -10.100 4.113   1.00 0.00 ? 32 LEU A HD21 8  
ATOM 5509  H HD22 . LEU A 1 32 ? 34.821 -10.612 5.583   1.00 0.00 ? 32 LEU A HD22 8  
ATOM 5510  H HD23 . LEU A 1 32 ? 36.577 -10.507 5.558   1.00 0.00 ? 32 LEU A HD23 8  
ATOM 5511  N N    . ALA A 1 33 ? 34.059 -5.102  3.948   1.00 0.00 ? 33 ALA A N    8  
ATOM 5512  C CA   . ALA A 1 33 ? 34.570 -3.975  3.186   1.00 0.00 ? 33 ALA A CA   8  
ATOM 5513  C C    . ALA A 1 33 ? 34.437 -2.664  3.956   1.00 0.00 ? 33 ALA A C    8  
ATOM 5514  O O    . ALA A 1 33 ? 35.394 -1.914  4.074   1.00 0.00 ? 33 ALA A O    8  
ATOM 5515  C CB   . ALA A 1 33 ? 33.811 -3.876  1.876   1.00 0.00 ? 33 ALA A CB   8  
ATOM 5516  H H    . ALA A 1 33 ? 33.272 -5.606  3.593   1.00 0.00 ? 33 ALA A H    8  
ATOM 5517  H HA   . ALA A 1 33 ? 35.625 -4.145  2.994   1.00 0.00 ? 33 ALA A HA   8  
ATOM 5518  H HB1  . ALA A 1 33 ? 33.869 -2.853  1.509   1.00 0.00 ? 33 ALA A HB1  8  
ATOM 5519  H HB2  . ALA A 1 33 ? 32.759 -4.150  1.966   1.00 0.00 ? 33 ALA A HB2  8  
ATOM 5520  H HB3  . ALA A 1 33 ? 34.270 -4.533  1.140   1.00 0.00 ? 33 ALA A HB3  8  
ATOM 5521  N N    . ALA A 1 34 ? 33.215 -2.447  4.484   1.00 0.00 ? 34 ALA A N    8  
ATOM 5522  C CA   . ALA A 1 34 ? 32.983 -1.281  5.330   1.00 0.00 ? 34 ALA A CA   8  
ATOM 5523  C C    . ALA A 1 34 ? 33.955 -1.294  6.517   1.00 0.00 ? 34 ALA A C    8  
ATOM 5524  O O    . ALA A 1 34 ? 34.631 -0.320  6.785   1.00 0.00 ? 34 ALA A O    8  
ATOM 5525  C CB   . ALA A 1 34 ? 31.532 -1.250  5.814   1.00 0.00 ? 34 ALA A CB   8  
ATOM 5526  H H    . ALA A 1 34 ? 32.489 -3.112  4.315   1.00 0.00 ? 34 ALA A H    8  
ATOM 5527  H HA   . ALA A 1 34 ? 33.189 -0.392  4.729   1.00 0.00 ? 34 ALA A HA   8  
ATOM 5528  H HB1  . ALA A 1 34 ? 31.284 -2.127  6.414   1.00 0.00 ? 34 ALA A HB1  8  
ATOM 5529  H HB2  . ALA A 1 34 ? 30.842 -1.223  4.971   1.00 0.00 ? 34 ALA A HB2  8  
ATOM 5530  H HB3  . ALA A 1 34 ? 31.347 -0.361  6.418   1.00 0.00 ? 34 ALA A HB3  8  
ATOM 5531  N N    . ASN A 1 35 ? 34.041 -2.463  7.178   1.00 0.00 ? 35 ASN A N    8  
ATOM 5532  C CA   . ASN A 1 35 ? 34.954 -2.550  8.318   1.00 0.00 ? 35 ASN A CA   8  
ATOM 5533  C C    . ASN A 1 35 ? 36.412 -2.178  7.958   1.00 0.00 ? 35 ASN A C    8  
ATOM 5534  O O    . ASN A 1 35 ? 37.107 -1.588  8.767   1.00 0.00 ? 35 ASN A O    8  
ATOM 5535  C CB   . ASN A 1 35 ? 34.937 -3.974  8.895   1.00 0.00 ? 35 ASN A CB   8  
ATOM 5536  C CG   . ASN A 1 35 ? 34.978 -3.945  10.427  1.00 0.00 ? 35 ASN A CG   8  
ATOM 5537  O OD1  . ASN A 1 35 ? 35.491 -3.026  11.053  1.00 0.00 ? 35 ASN A OD1  8  
ATOM 5538  N ND2  . ASN A 1 35 ? 34.367 -5.010  10.982  1.00 0.00 ? 35 ASN A ND2  8  
ATOM 5539  H H    . ASN A 1 35 ? 33.491 -3.246  6.889   1.00 0.00 ? 35 ASN A H    8  
ATOM 5540  H HA   . ASN A 1 35 ? 34.575 -1.815  9.037   1.00 0.00 ? 35 ASN A HA   8  
ATOM 5541  H HB2  . ASN A 1 35 ? 34.036 -4.486  8.583   1.00 0.00 ? 35 ASN A HB2  8  
ATOM 5542  H HB3  . ASN A 1 35 ? 35.752 -4.597  8.523   1.00 0.00 ? 35 ASN A HB3  8  
ATOM 5543  H HD21 . ASN A 1 35 ? 34.000 -5.745  10.406  1.00 0.00 ? 35 ASN A HD21 8  
ATOM 5544  H HD22 . ASN A 1 35 ? 34.272 -5.078  11.968  1.00 0.00 ? 35 ASN A HD22 8  
ATOM 5545  N N    . PHE A 1 36 ? 36.818 -2.532  6.715   1.00 0.00 ? 36 PHE A N    8  
ATOM 5546  C CA   . PHE A 1 36 ? 38.163 -2.195  6.226   1.00 0.00 ? 36 PHE A CA   8  
ATOM 5547  C C    . PHE A 1 36 ? 38.374 -0.659  6.217   1.00 0.00 ? 36 PHE A C    8  
ATOM 5548  O O    . PHE A 1 36 ? 39.340 -0.151  6.774   1.00 0.00 ? 36 PHE A O    8  
ATOM 5549  C CB   . PHE A 1 36 ? 38.356 -2.806  4.819   1.00 0.00 ? 36 PHE A CB   8  
ATOM 5550  C CG   . PHE A 1 36 ? 39.729 -2.602  4.209   1.00 0.00 ? 36 PHE A CG   8  
ATOM 5551  C CD1  . PHE A 1 36 ? 40.170 -1.338  3.822   1.00 0.00 ? 36 PHE A CD1  8  
ATOM 5552  C CD2  . PHE A 1 36 ? 40.565 -3.692  3.970   1.00 0.00 ? 36 PHE A CD2  8  
ATOM 5553  C CE1  . PHE A 1 36 ? 41.399 -1.155  3.208   1.00 0.00 ? 36 PHE A CE1  8  
ATOM 5554  C CE2  . PHE A 1 36 ? 41.799 -3.516  3.355   1.00 0.00 ? 36 PHE A CE2  8  
ATOM 5555  C CZ   . PHE A 1 36 ? 42.217 -2.249  2.969   1.00 0.00 ? 36 PHE A CZ   8  
ATOM 5556  H H    . PHE A 1 36 ? 36.167 -2.999  6.116   1.00 0.00 ? 36 PHE A H    8  
ATOM 5557  H HA   . PHE A 1 36 ? 38.874 -2.650  6.919   1.00 0.00 ? 36 PHE A HA   8  
ATOM 5558  H HB2  . PHE A 1 36 ? 38.134 -3.871  4.861   1.00 0.00 ? 36 PHE A HB2  8  
ATOM 5559  H HB3  . PHE A 1 36 ? 37.630 -2.403  4.121   1.00 0.00 ? 36 PHE A HB3  8  
ATOM 5560  H HD1  . PHE A 1 36 ? 39.551 -0.463  3.947   1.00 0.00 ? 36 PHE A HD1  8  
ATOM 5561  H HD2  . PHE A 1 36 ? 40.242 -4.689  4.235   1.00 0.00 ? 36 PHE A HD2  8  
ATOM 5562  H HE1  . PHE A 1 36 ? 41.697 -0.162  2.903   1.00 0.00 ? 36 PHE A HE1  8  
ATOM 5563  H HE2  . PHE A 1 36 ? 42.430 -4.369  3.154   1.00 0.00 ? 36 PHE A HE2  8  
ATOM 5564  H HZ   . PHE A 1 36 ? 43.163 -2.111  2.470   1.00 0.00 ? 36 PHE A HZ   8  
ATOM 5565  N N    . LEU A 1 37 ? 37.434 0.033   5.532   1.00 0.00 ? 37 LEU A N    8  
ATOM 5566  C CA   . LEU A 1 37 ? 37.600 1.460   5.271   1.00 0.00 ? 37 LEU A CA   8  
ATOM 5567  C C    . LEU A 1 37 ? 37.410 2.315   6.541   1.00 0.00 ? 37 LEU A C    8  
ATOM 5568  O O    . LEU A 1 37 ? 37.985 3.391   6.671   1.00 0.00 ? 37 LEU A O    8  
ATOM 5569  C CB   . LEU A 1 37 ? 36.602 1.930   4.211   1.00 0.00 ? 37 LEU A CB   8  
ATOM 5570  C CG   . LEU A 1 37 ? 36.733 1.252   2.835   1.00 0.00 ? 37 LEU A CG   8  
ATOM 5571  C CD1  . LEU A 1 37 ? 35.470 0.466   2.488   1.00 0.00 ? 37 LEU A CD1  8  
ATOM 5572  C CD2  . LEU A 1 37 ? 37.052 2.244   1.702   1.00 0.00 ? 37 LEU A CD2  8  
ATOM 5573  H H    . LEU A 1 37 ? 36.618 -0.422  5.182   1.00 0.00 ? 37 LEU A H    8  
ATOM 5574  H HA   . LEU A 1 37 ? 38.613 1.598   4.897   1.00 0.00 ? 37 LEU A HA   8  
ATOM 5575  H HB2  . LEU A 1 37 ? 35.590 1.811   4.579   1.00 0.00 ? 37 LEU A HB2  8  
ATOM 5576  H HB3  . LEU A 1 37 ? 36.750 2.999   4.128   1.00 0.00 ? 37 LEU A HB3  8  
ATOM 5577  H HG   . LEU A 1 37 ? 37.551 0.540   2.910   1.00 0.00 ? 37 LEU A HG   8  
ATOM 5578  H HD11 . LEU A 1 37 ? 35.704 -0.430  1.909   1.00 0.00 ? 37 LEU A HD11 8  
ATOM 5579  H HD12 . LEU A 1 37 ? 34.790 1.090   1.921   1.00 0.00 ? 37 LEU A HD12 8  
ATOM 5580  H HD13 . LEU A 1 37 ? 34.903 0.186   3.368   1.00 0.00 ? 37 LEU A HD13 8  
ATOM 5581  H HD21 . LEU A 1 37 ? 38.044 2.036   1.318   1.00 0.00 ? 37 LEU A HD21 8  
ATOM 5582  H HD22 . LEU A 1 37 ? 37.051 3.273   2.035   1.00 0.00 ? 37 LEU A HD22 8  
ATOM 5583  H HD23 . LEU A 1 37 ? 36.332 2.223   0.883   1.00 0.00 ? 37 LEU A HD23 8  
ATOM 5584  N N    . LEU A 1 38 ? 36.567 1.775   7.451   1.00 0.00 ? 38 LEU A N    8  
ATOM 5585  C CA   . LEU A 1 38 ? 36.214 2.501   8.668   1.00 0.00 ? 38 LEU A CA   8  
ATOM 5586  C C    . LEU A 1 38 ? 37.310 2.307   9.742   1.00 0.00 ? 38 LEU A C    8  
ATOM 5587  O O    . LEU A 1 38 ? 37.513 3.147   10.613  1.00 0.00 ? 38 LEU A O    8  
ATOM 5588  C CB   . LEU A 1 38 ? 34.829 2.086   9.224   1.00 0.00 ? 38 LEU A CB   8  
ATOM 5589  C CG   . LEU A 1 38 ? 33.618 2.016   8.251   1.00 0.00 ? 38 LEU A CG   8  
ATOM 5590  C CD1  . LEU A 1 38 ? 32.386 2.746   8.791   1.00 0.00 ? 38 LEU A CD1  8  
ATOM 5591  C CD2  . LEU A 1 38 ? 33.906 2.530   6.842   1.00 0.00 ? 38 LEU A CD2  8  
ATOM 5592  H H    . LEU A 1 38 ? 36.144 0.888   7.282   1.00 0.00 ? 38 LEU A H    8  
ATOM 5593  H HA   . LEU A 1 38 ? 36.191 3.553   8.388   1.00 0.00 ? 38 LEU A HA   8  
ATOM 5594  H HB2  . LEU A 1 38 ? 34.925 1.110   9.698   1.00 0.00 ? 38 LEU A HB2  8  
ATOM 5595  H HB3  . LEU A 1 38 ? 34.583 2.788   10.024  1.00 0.00 ? 38 LEU A HB3  8  
ATOM 5596  H HG   . LEU A 1 38 ? 33.300 0.978   8.189   1.00 0.00 ? 38 LEU A HG   8  
ATOM 5597  H HD11 . LEU A 1 38 ? 32.092 2.348   9.759   1.00 0.00 ? 38 LEU A HD11 8  
ATOM 5598  H HD12 . LEU A 1 38 ? 31.540 2.607   8.116   1.00 0.00 ? 38 LEU A HD12 8  
ATOM 5599  H HD13 . LEU A 1 38 ? 32.568 3.818   8.877   1.00 0.00 ? 38 LEU A HD13 8  
ATOM 5600  H HD21 . LEU A 1 38 ? 34.636 3.327   6.878   1.00 0.00 ? 38 LEU A HD21 8  
ATOM 5601  H HD22 . LEU A 1 38 ? 33.005 2.919   6.384   1.00 0.00 ? 38 LEU A HD22 8  
ATOM 5602  H HD23 . LEU A 1 38 ? 34.287 1.775   6.169   1.00 0.00 ? 38 LEU A HD23 8  
ATOM 5603  N N    . SER A 1 39 ? 37.998 1.149   9.598   1.00 0.00 ? 39 SER A N    8  
ATOM 5604  C CA   . SER A 1 39 ? 39.092 0.756   10.482  1.00 0.00 ? 39 SER A CA   8  
ATOM 5605  C C    . SER A 1 39 ? 40.389 1.504   10.151  1.00 0.00 ? 39 SER A C    8  
ATOM 5606  O O    . SER A 1 39 ? 41.297 1.528   10.971  1.00 0.00 ? 39 SER A O    8  
ATOM 5607  C CB   . SER A 1 39 ? 39.328 -0.763  10.382  1.00 0.00 ? 39 SER A CB   8  
ATOM 5608  O OG   . SER A 1 39 ? 40.393 -1.253  11.184  1.00 0.00 ? 39 SER A OG   8  
ATOM 5609  H H    . SER A 1 39 ? 37.765 0.534   8.848   1.00 0.00 ? 39 SER A H    8  
ATOM 5610  H HA   . SER A 1 39 ? 38.785 1.034   11.489  1.00 0.00 ? 39 SER A HA   8  
ATOM 5611  H HB2  . SER A 1 39 ? 38.405 -1.288  10.637  1.00 0.00 ? 39 SER A HB2  8  
ATOM 5612  H HB3  . SER A 1 39 ? 39.568 -1.026  9.349   1.00 0.00 ? 39 SER A HB3  8  
ATOM 5613  H HG   . SER A 1 39 ? 40.110 -1.393  12.077  1.00 0.00 ? 39 SER A HG   8  
ATOM 5614  N N    . GLN A 1 40 ? 40.414 2.119   8.939   1.00 0.00 ? 40 GLN A N    8  
ATOM 5615  C CA   . GLN A 1 40 ? 41.528 2.989   8.548   1.00 0.00 ? 40 GLN A CA   8  
ATOM 5616  C C    . GLN A 1 40 ? 41.599 4.213   9.486   1.00 0.00 ? 40 GLN A C    8  
ATOM 5617  O O    . GLN A 1 40 ? 40.930 5.223   9.294   1.00 0.00 ? 40 GLN A O    8  
ATOM 5618  C CB   . GLN A 1 40 ? 41.376 3.461   7.089   1.00 0.00 ? 40 GLN A CB   8  
ATOM 5619  C CG   . GLN A 1 40 ? 41.476 2.336   6.038   1.00 0.00 ? 40 GLN A CG   8  
ATOM 5620  C CD   . GLN A 1 40 ? 42.851 2.194   5.363   1.00 0.00 ? 40 GLN A CD   8  
ATOM 5621  O OE1  . GLN A 1 40 ? 42.978 2.329   4.157   1.00 0.00 ? 40 GLN A OE1  8  
ATOM 5622  N NE2  . GLN A 1 40 ? 43.824 1.765   6.191   1.00 0.00 ? 40 GLN A NE2  8  
ATOM 5623  H H    . GLN A 1 40 ? 39.650 1.984   8.307   1.00 0.00 ? 40 GLN A H    8  
ATOM 5624  H HA   . GLN A 1 40 ? 42.442 2.402   8.645   1.00 0.00 ? 40 GLN A HA   8  
ATOM 5625  H HB2  . GLN A 1 40 ? 40.401 3.931   6.985   1.00 0.00 ? 40 GLN A HB2  8  
ATOM 5626  H HB3  . GLN A 1 40 ? 42.088 4.257   6.863   1.00 0.00 ? 40 GLN A HB3  8  
ATOM 5627  H HG2  . GLN A 1 40 ? 41.192 1.371   6.450   1.00 0.00 ? 40 GLN A HG2  8  
ATOM 5628  H HG3  . GLN A 1 40 ? 40.772 2.532   5.231   1.00 0.00 ? 40 GLN A HG3  8  
ATOM 5629  H HE21 . GLN A 1 40 ? 43.818 2.031   7.150   1.00 0.00 ? 40 GLN A HE21 8  
ATOM 5630  H HE22 . GLN A 1 40 ? 44.532 1.163   5.835   1.00 0.00 ? 40 GLN A HE22 8  
ATOM 5631  N N    . ASN A 1 41 ? 42.485 4.033   10.489  1.00 0.00 ? 41 ASN A N    8  
ATOM 5632  C CA   . ASN A 1 41 ? 42.835 5.054   11.472  1.00 0.00 ? 41 ASN A CA   8  
ATOM 5633  C C    . ASN A 1 41 ? 43.140 6.400   10.799  1.00 0.00 ? 41 ASN A C    8  
ATOM 5634  O O    . ASN A 1 41 ? 43.878 6.484   9.825   1.00 0.00 ? 41 ASN A O    8  
ATOM 5635  C CB   . ASN A 1 41 ? 44.040 4.596   12.316  1.00 0.00 ? 41 ASN A CB   8  
ATOM 5636  C CG   . ASN A 1 41 ? 45.012 3.684   11.544  1.00 0.00 ? 41 ASN A CG   8  
ATOM 5637  O OD1  . ASN A 1 41 ? 45.344 3.911   10.388  1.00 0.00 ? 41 ASN A OD1  8  
ATOM 5638  N ND2  . ASN A 1 41 ? 45.416 2.614   12.264  1.00 0.00 ? 41 ASN A ND2  8  
ATOM 5639  H H    . ASN A 1 41 ? 42.936 3.144   10.569  1.00 0.00 ? 41 ASN A H    8  
ATOM 5640  H HA   . ASN A 1 41 ? 41.960 5.156   12.117  1.00 0.00 ? 41 ASN A HA   8  
ATOM 5641  H HB2  . ASN A 1 41 ? 44.601 5.443   12.711  1.00 0.00 ? 41 ASN A HB2  8  
ATOM 5642  H HB3  . ASN A 1 41 ? 43.670 4.067   13.191  1.00 0.00 ? 41 ASN A HB3  8  
ATOM 5643  H HD21 . ASN A 1 41 ? 45.185 2.555   13.238  1.00 0.00 ? 41 ASN A HD21 8  
ATOM 5644  H HD22 . ASN A 1 41 ? 45.943 1.885   11.851  1.00 0.00 ? 41 ASN A HD22 8  
ATOM 5645  N N    . PHE A 1 42 ? 42.480 7.420   11.392  1.00 0.00 ? 42 PHE A N    8  
ATOM 5646  C CA   . PHE A 1 42 ? 42.503 8.771   10.856  1.00 0.00 ? 42 PHE A CA   8  
ATOM 5647  C C    . PHE A 1 42 ? 41.797 9.700   11.866  1.00 0.00 ? 42 PHE A C    8  
ATOM 5648  O O    . PHE A 1 42 ? 40.657 9.480   12.252  1.00 0.00 ? 42 PHE A O    8  
ATOM 5649  C CB   . PHE A 1 42 ? 41.794 8.793   9.483   1.00 0.00 ? 42 PHE A CB   8  
ATOM 5650  C CG   . PHE A 1 42 ? 41.511 10.180  8.963   1.00 0.00 ? 42 PHE A CG   8  
ATOM 5651  C CD1  . PHE A 1 42 ? 42.450 11.202  9.086   1.00 0.00 ? 42 PHE A CD1  8  
ATOM 5652  C CD2  . PHE A 1 42 ? 40.290 10.460  8.363   1.00 0.00 ? 42 PHE A CD2  8  
ATOM 5653  C CE1  . PHE A 1 42 ? 42.162 12.485  8.644   1.00 0.00 ? 42 PHE A CE1  8  
ATOM 5654  C CE2  . PHE A 1 42 ? 39.999 11.742  7.915   1.00 0.00 ? 42 PHE A CE2  8  
ATOM 5655  C CZ   . PHE A 1 42 ? 40.932 12.756  8.062   1.00 0.00 ? 42 PHE A CZ   8  
ATOM 5656  H H    . PHE A 1 42 ? 41.919 7.220   12.198  1.00 0.00 ? 42 PHE A H    8  
ATOM 5657  H HA   . PHE A 1 42 ? 43.554 9.054   10.757  1.00 0.00 ? 42 PHE A HA   8  
ATOM 5658  H HB2  . PHE A 1 42 ? 42.398 8.275   8.738   1.00 0.00 ? 42 PHE A HB2  8  
ATOM 5659  H HB3  . PHE A 1 42 ? 40.854 8.240   9.549   1.00 0.00 ? 42 PHE A HB3  8  
ATOM 5660  H HD1  . PHE A 1 42 ? 43.411 11.005  9.535   1.00 0.00 ? 42 PHE A HD1  8  
ATOM 5661  H HD2  . PHE A 1 42 ? 39.557 9.677   8.241   1.00 0.00 ? 42 PHE A HD2  8  
ATOM 5662  H HE1  . PHE A 1 42 ? 42.893 13.270  8.763   1.00 0.00 ? 42 PHE A HE1  8  
ATOM 5663  H HE2  . PHE A 1 42 ? 39.042 11.947  7.461   1.00 0.00 ? 42 PHE A HE2  8  
ATOM 5664  H HZ   . PHE A 1 42 ? 40.699 13.758  7.734   1.00 0.00 ? 42 PHE A HZ   8  
ATOM 5665  N N    . ASP A 1 43 ? 42.562 10.751  12.238  1.00 0.00 ? 43 ASP A N    8  
ATOM 5666  C CA   . ASP A 1 43 ? 42.044 11.806  13.097  1.00 0.00 ? 43 ASP A CA   8  
ATOM 5667  C C    . ASP A 1 43 ? 42.953 13.039  12.940  1.00 0.00 ? 43 ASP A C    8  
ATOM 5668  O O    . ASP A 1 43 ? 44.166 12.954  13.088  1.00 0.00 ? 43 ASP A O    8  
ATOM 5669  C CB   . ASP A 1 43 ? 42.008 11.309  14.561  1.00 0.00 ? 43 ASP A CB   8  
ATOM 5670  C CG   . ASP A 1 43 ? 40.879 11.973  15.373  1.00 0.00 ? 43 ASP A CG   8  
ATOM 5671  O OD1  . ASP A 1 43 ? 40.730 13.194  15.307  1.00 0.00 ? 43 ASP A OD1  8  
ATOM 5672  O OD2  . ASP A 1 43 ? 40.149 11.259  16.064  1.00 0.00 ? 43 ASP A OD2  8  
ATOM 5673  H H    . ASP A 1 43 ? 43.495 10.805  11.885  1.00 0.00 ? 43 ASP A H    8  
ATOM 5674  H HA   . ASP A 1 43 ? 41.043 12.038  12.723  1.00 0.00 ? 43 ASP A HA   8  
ATOM 5675  H HB2  . ASP A 1 43 ? 41.854 10.228  14.575  1.00 0.00 ? 43 ASP A HB2  8  
ATOM 5676  H HB3  . ASP A 1 43 ? 42.961 11.466  15.069  1.00 0.00 ? 43 ASP A HB3  8  
ATOM 5677  N N    . ASP A 1 44 ? 42.289 14.176  12.630  1.00 0.00 ? 44 ASP A N    8  
ATOM 5678  C CA   . ASP A 1 44 ? 42.993 15.447  12.458  1.00 0.00 ? 44 ASP A CA   8  
ATOM 5679  C C    . ASP A 1 44 ? 43.426 16.037  13.810  1.00 0.00 ? 44 ASP A C    8  
ATOM 5680  O O    . ASP A 1 44 ? 44.479 16.650  13.909  1.00 0.00 ? 44 ASP A O    8  
ATOM 5681  C CB   . ASP A 1 44 ? 42.086 16.458  11.737  1.00 0.00 ? 44 ASP A CB   8  
ATOM 5682  C CG   . ASP A 1 44 ? 41.804 16.028  10.286  1.00 0.00 ? 44 ASP A CG   8  
ATOM 5683  O OD1  . ASP A 1 44 ? 42.588 16.377  9.401   1.00 0.00 ? 44 ASP A OD1  8  
ATOM 5684  O OD2  . ASP A 1 44 ? 40.801 15.355  10.050  1.00 0.00 ? 44 ASP A OD2  8  
ATOM 5685  H H    . ASP A 1 44 ? 41.292 14.155  12.542  1.00 0.00 ? 44 ASP A H    8  
ATOM 5686  H HA   . ASP A 1 44 ? 43.898 15.252  11.877  1.00 0.00 ? 44 ASP A HA   8  
ATOM 5687  H HB2  . ASP A 1 44 ? 41.142 16.576  12.273  1.00 0.00 ? 44 ASP A HB2  8  
ATOM 5688  H HB3  . ASP A 1 44 ? 42.548 17.448  11.723  1.00 0.00 ? 44 ASP A HB3  8  
ATOM 5689  N N    . GLU A 1 45 ? 42.554 15.813  14.821  1.00 0.00 ? 45 GLU A N    8  
ATOM 5690  C CA   . GLU A 1 45 ? 42.773 16.267  16.198  1.00 0.00 ? 45 GLU A CA   8  
ATOM 5691  C C    . GLU A 1 45 ? 42.574 17.796  16.327  1.00 0.00 ? 45 GLU A C    8  
ATOM 5692  O O    . GLU A 1 45 ? 42.865 18.344  17.391  1.00 0.00 ? 45 GLU A O    8  
ATOM 5693  C CB   . GLU A 1 45 ? 44.151 15.826  16.744  1.00 0.00 ? 45 GLU A CB   8  
ATOM 5694  C CG   . GLU A 1 45 ? 44.430 14.326  16.539  1.00 0.00 ? 45 GLU A CG   8  
ATOM 5695  C CD   . GLU A 1 45 ? 45.856 13.963  16.988  1.00 0.00 ? 45 GLU A CD   8  
ATOM 5696  O OE1  . GLU A 1 45 ? 46.799 14.246  16.245  1.00 0.00 ? 45 GLU A OE1  8  
ATOM 5697  O OE2  . GLU A 1 45 ? 46.014 13.400  18.071  1.00 0.00 ? 45 GLU A OE2  8  
ATOM 5698  O OXT  . GLU A 1 45 ? 42.130 18.427  15.366  1.00 0.00 ? 45 GLU A OXT  8  
ATOM 5699  H H    . GLU A 1 45 ? 41.720 15.302  14.612  1.00 0.00 ? 45 GLU A H    8  
ATOM 5700  H HA   . GLU A 1 45 ? 41.984 15.776  16.772  1.00 0.00 ? 45 GLU A HA   8  
ATOM 5701  H HB2  . GLU A 1 45 ? 44.940 16.415  16.277  1.00 0.00 ? 45 GLU A HB2  8  
ATOM 5702  H HB3  . GLU A 1 45 ? 44.219 16.066  17.807  1.00 0.00 ? 45 GLU A HB3  8  
ATOM 5703  H HG2  . GLU A 1 45 ? 43.699 13.736  17.091  1.00 0.00 ? 45 GLU A HG2  8  
ATOM 5704  H HG3  . GLU A 1 45 ? 44.319 14.027  15.497  1.00 0.00 ? 45 GLU A HG3  8  
ATOM 5705  N N    . GLN A 1 1  ? 31.206 -7.374  -11.159 1.00 0.00 ? 1  GLN A N    9  
ATOM 5706  C CA   . GLN A 1 1  ? 31.319 -5.923  -11.074 1.00 0.00 ? 1  GLN A CA   9  
ATOM 5707  C C    . GLN A 1 1  ? 30.869 -5.471  -9.670  1.00 0.00 ? 1  GLN A C    9  
ATOM 5708  O O    . GLN A 1 1  ? 29.781 -5.810  -9.236  1.00 0.00 ? 1  GLN A O    9  
ATOM 5709  C CB   . GLN A 1 1  ? 30.460 -5.216  -12.152 1.00 0.00 ? 1  GLN A CB   9  
ATOM 5710  C CG   . GLN A 1 1  ? 31.220 -4.128  -12.933 1.00 0.00 ? 1  GLN A CG   9  
ATOM 5711  C CD   . GLN A 1 1  ? 31.734 -4.671  -14.277 1.00 0.00 ? 1  GLN A CD   9  
ATOM 5712  O OE1  . GLN A 1 1  ? 30.976 -4.913  -15.197 1.00 0.00 ? 1  GLN A OE1  9  
ATOM 5713  N NE2  . GLN A 1 1  ? 33.073 -4.837  -14.330 1.00 0.00 ? 1  GLN A NE2  9  
ATOM 5714  H H1   . GLN A 1 1  ? 31.407 -7.688  -12.135 1.00 0.00 ? 1  GLN A H1   9  
ATOM 5715  H H2   . GLN A 1 1  ? 30.246 -7.659  -10.890 1.00 0.00 ? 1  GLN A H2   9  
ATOM 5716  H H3   . GLN A 1 1  ? 31.896 -7.802  -10.509 1.00 0.00 ? 1  GLN A H3   9  
ATOM 5717  H HA   . GLN A 1 1  ? 32.374 -5.690  -11.212 1.00 0.00 ? 1  GLN A HA   9  
ATOM 5718  H HB2  . GLN A 1 1  ? 30.031 -5.950  -12.837 1.00 0.00 ? 1  GLN A HB2  9  
ATOM 5719  H HB3  . GLN A 1 1  ? 29.582 -4.745  -11.709 1.00 0.00 ? 1  GLN A HB3  9  
ATOM 5720  H HG2  . GLN A 1 1  ? 30.550 -3.298  -13.159 1.00 0.00 ? 1  GLN A HG2  9  
ATOM 5721  H HG3  . GLN A 1 1  ? 32.038 -3.707  -12.351 1.00 0.00 ? 1  GLN A HG3  9  
ATOM 5722  H HE21 . GLN A 1 1  ? 33.656 -4.612  -13.547 1.00 0.00 ? 1  GLN A HE21 9  
ATOM 5723  H HE22 . GLN A 1 1  ? 33.482 -5.188  -15.167 1.00 0.00 ? 1  GLN A HE22 9  
ATOM 5724  N N    . GLU A 1 2  ? 31.756 -4.692  -9.001  1.00 0.00 ? 2  GLU A N    9  
ATOM 5725  C CA   . GLU A 1 2  ? 31.429 -4.153  -7.674  1.00 0.00 ? 2  GLU A CA   9  
ATOM 5726  C C    . GLU A 1 2  ? 31.346 -2.624  -7.691  1.00 0.00 ? 2  GLU A C    9  
ATOM 5727  O O    . GLU A 1 2  ? 31.297 -2.007  -6.637  1.00 0.00 ? 2  GLU A O    9  
ATOM 5728  C CB   . GLU A 1 2  ? 32.419 -4.653  -6.612  1.00 0.00 ? 2  GLU A CB   9  
ATOM 5729  C CG   . GLU A 1 2  ? 33.776 -3.905  -6.591  1.00 0.00 ? 2  GLU A CG   9  
ATOM 5730  C CD   . GLU A 1 2  ? 33.967 -2.921  -5.411  1.00 0.00 ? 2  GLU A CD   9  
ATOM 5731  O OE1  . GLU A 1 2  ? 33.005 -2.576  -4.740  1.00 0.00 ? 2  GLU A OE1  9  
ATOM 5732  O OE2  . GLU A 1 2  ? 35.097 -2.519  -5.157  1.00 0.00 ? 2  GLU A OE2  9  
ATOM 5733  H H    . GLU A 1 2  ? 32.630 -4.475  -9.432  1.00 0.00 ? 2  GLU A H    9  
ATOM 5734  H HA   . GLU A 1 2  ? 30.442 -4.506  -7.382  1.00 0.00 ? 2  GLU A HA   9  
ATOM 5735  H HB2  . GLU A 1 2  ? 31.943 -4.639  -5.631  1.00 0.00 ? 2  GLU A HB2  9  
ATOM 5736  H HB3  . GLU A 1 2  ? 32.578 -5.713  -6.792  1.00 0.00 ? 2  GLU A HB3  9  
ATOM 5737  H HG2  . GLU A 1 2  ? 34.561 -4.637  -6.490  1.00 0.00 ? 2  GLU A HG2  9  
ATOM 5738  H HG3  . GLU A 1 2  ? 33.986 -3.405  -7.538  1.00 0.00 ? 2  GLU A HG3  9  
ATOM 5739  N N    . LYS A 1 3  ? 31.319 -2.046  -8.911  1.00 0.00 ? 3  LYS A N    9  
ATOM 5740  C CA   . LYS A 1 3  ? 31.304 -0.586  -9.073  1.00 0.00 ? 3  LYS A CA   9  
ATOM 5741  C C    . LYS A 1 3  ? 30.191 0.135   -8.279  1.00 0.00 ? 3  LYS A C    9  
ATOM 5742  O O    . LYS A 1 3  ? 30.274 1.322   -7.996  1.00 0.00 ? 3  LYS A O    9  
ATOM 5743  C CB   . LYS A 1 3  ? 31.277 -0.227  -10.562 1.00 0.00 ? 3  LYS A CB   9  
ATOM 5744  C CG   . LYS A 1 3  ? 30.032 -0.709  -11.325 1.00 0.00 ? 3  LYS A CG   9  
ATOM 5745  C CD   . LYS A 1 3  ? 28.837 0.249   -11.206 1.00 0.00 ? 3  LYS A CD   9  
ATOM 5746  C CE   . LYS A 1 3  ? 27.602 -0.270  -11.936 1.00 0.00 ? 3  LYS A CE   9  
ATOM 5747  N NZ   . LYS A 1 3  ? 26.485 0.654   -11.791 1.00 0.00 ? 3  LYS A NZ   9  
ATOM 5748  H H    . LYS A 1 3  ? 31.392 -2.620  -9.726  1.00 0.00 ? 3  LYS A H    9  
ATOM 5749  H HA   . LYS A 1 3  ? 32.248 -0.237  -8.686  1.00 0.00 ? 3  LYS A HA   9  
ATOM 5750  H HB2  . LYS A 1 3  ? 31.409 0.848   -10.686 1.00 0.00 ? 3  LYS A HB2  9  
ATOM 5751  H HB3  . LYS A 1 3  ? 32.154 -0.677  -11.024 1.00 0.00 ? 3  LYS A HB3  9  
ATOM 5752  H HG2  . LYS A 1 3  ? 30.289 -0.806  -12.380 1.00 0.00 ? 3  LYS A HG2  9  
ATOM 5753  H HG3  . LYS A 1 3  ? 29.752 -1.711  -11.002 1.00 0.00 ? 3  LYS A HG3  9  
ATOM 5754  H HD2  . LYS A 1 3  ? 28.554 0.415   -10.173 1.00 0.00 ? 3  LYS A HD2  9  
ATOM 5755  H HD3  . LYS A 1 3  ? 29.115 1.227   -11.597 1.00 0.00 ? 3  LYS A HD3  9  
ATOM 5756  H HE2  . LYS A 1 3  ? 27.807 -0.398  -12.999 1.00 0.00 ? 3  LYS A HE2  9  
ATOM 5757  H HE3  . LYS A 1 3  ? 27.297 -1.236  -11.533 1.00 0.00 ? 3  LYS A HE3  9  
ATOM 5758  H HZ1  . LYS A 1 3  ? 26.254 0.756   -10.780 1.00 0.00 ? 3  LYS A HZ1  9  
ATOM 5759  H HZ2  . LYS A 1 3  ? 25.654 0.293   -12.303 1.00 0.00 ? 3  LYS A HZ2  9  
ATOM 5760  H HZ3  . LYS A 1 3  ? 26.759 1.581   -12.173 1.00 0.00 ? 3  LYS A HZ3  9  
ATOM 5761  N N    . GLU A 1 4  ? 29.159 -0.669  -7.952  1.00 0.00 ? 4  GLU A N    9  
ATOM 5762  C CA   . GLU A 1 4  ? 27.982 -0.202  -7.242  1.00 0.00 ? 4  GLU A CA   9  
ATOM 5763  C C    . GLU A 1 4  ? 28.305 0.160   -5.784  1.00 0.00 ? 4  GLU A C    9  
ATOM 5764  O O    . GLU A 1 4  ? 27.816 1.128   -5.225  1.00 0.00 ? 4  GLU A O    9  
ATOM 5765  C CB   . GLU A 1 4  ? 26.948 -1.334  -7.267  1.00 0.00 ? 4  GLU A CB   9  
ATOM 5766  C CG   . GLU A 1 4  ? 25.531 -0.762  -7.306  1.00 0.00 ? 4  GLU A CG   9  
ATOM 5767  C CD   . GLU A 1 4  ? 24.460 -1.855  -7.140  1.00 0.00 ? 4  GLU A CD   9  
ATOM 5768  O OE1  . GLU A 1 4  ? 24.548 -2.626  -6.185  1.00 0.00 ? 4  GLU A OE1  9  
ATOM 5769  O OE2  . GLU A 1 4  ? 23.547 -1.921  -7.963  1.00 0.00 ? 4  GLU A OE2  9  
ATOM 5770  H H    . GLU A 1 4  ? 29.200 -1.628  -8.221  1.00 0.00 ? 4  GLU A H    9  
ATOM 5771  H HA   . GLU A 1 4  ? 27.635 0.683   -7.776  1.00 0.00 ? 4  GLU A HA   9  
ATOM 5772  H HB2  . GLU A 1 4  ? 27.106 -1.967  -8.141  1.00 0.00 ? 4  GLU A HB2  9  
ATOM 5773  H HB3  . GLU A 1 4  ? 27.082 -1.999  -6.411  1.00 0.00 ? 4  GLU A HB3  9  
ATOM 5774  H HG2  . GLU A 1 4  ? 25.407 -0.019  -6.520  1.00 0.00 ? 4  GLU A HG2  9  
ATOM 5775  H HG3  . GLU A 1 4  ? 25.390 -0.241  -8.253  1.00 0.00 ? 4  GLU A HG3  9  
ATOM 5776  N N    . ALA A 1 5  ? 29.179 -0.704  -5.228  1.00 0.00 ? 5  ALA A N    9  
ATOM 5777  C CA   . ALA A 1 5  ? 29.683 -0.443  -3.897  1.00 0.00 ? 5  ALA A CA   9  
ATOM 5778  C C    . ALA A 1 5  ? 30.765 0.644   -3.943  1.00 0.00 ? 5  ALA A C    9  
ATOM 5779  O O    . ALA A 1 5  ? 31.091 1.191   -2.898  1.00 0.00 ? 5  ALA A O    9  
ATOM 5780  C CB   . ALA A 1 5  ? 30.180 -1.739  -3.244  1.00 0.00 ? 5  ALA A CB   9  
ATOM 5781  H H    . ALA A 1 5  ? 29.497 -1.495  -5.739  1.00 0.00 ? 5  ALA A H    9  
ATOM 5782  H HA   . ALA A 1 5  ? 28.839 -0.074  -3.317  1.00 0.00 ? 5  ALA A HA   9  
ATOM 5783  H HB1  . ALA A 1 5  ? 31.249 -1.868  -3.355  1.00 0.00 ? 5  ALA A HB1  9  
ATOM 5784  H HB2  . ALA A 1 5  ? 29.709 -2.622  -3.677  1.00 0.00 ? 5  ALA A HB2  9  
ATOM 5785  H HB3  . ALA A 1 5  ? 29.974 -1.725  -2.172  1.00 0.00 ? 5  ALA A HB3  9  
ATOM 5786  N N    . ILE A 1 6  ? 31.315 0.972   -5.131  1.00 0.00 ? 6  ILE A N    9  
ATOM 5787  C CA   . ILE A 1 6  ? 32.425 1.940   -5.159  1.00 0.00 ? 6  ILE A CA   9  
ATOM 5788  C C    . ILE A 1 6  ? 31.940 3.383   -4.956  1.00 0.00 ? 6  ILE A C    9  
ATOM 5789  O O    . ILE A 1 6  ? 32.699 4.239   -4.524  1.00 0.00 ? 6  ILE A O    9  
ATOM 5790  C CB   . ILE A 1 6  ? 33.314 1.809   -6.411  1.00 0.00 ? 6  ILE A CB   9  
ATOM 5791  C CG1  . ILE A 1 6  ? 33.754 0.359   -6.626  1.00 0.00 ? 6  ILE A CG1  9  
ATOM 5792  C CG2  . ILE A 1 6  ? 34.560 2.723   -6.384  1.00 0.00 ? 6  ILE A CG2  9  
ATOM 5793  C CD1  . ILE A 1 6  ? 34.544 0.186   -7.932  1.00 0.00 ? 6  ILE A CD1  9  
ATOM 5794  H H    . ILE A 1 6  ? 30.998 0.542   -5.980  1.00 0.00 ? 6  ILE A H    9  
ATOM 5795  H HA   . ILE A 1 6  ? 33.038 1.703   -4.300  1.00 0.00 ? 6  ILE A HA   9  
ATOM 5796  H HB   . ILE A 1 6  ? 32.707 2.101   -7.266  1.00 0.00 ? 6  ILE A HB   9  
ATOM 5797  H HG12 . ILE A 1 6  ? 34.344 0.014   -5.778  1.00 0.00 ? 6  ILE A HG12 9  
ATOM 5798  H HG13 . ILE A 1 6  ? 32.878 -0.280  -6.636  1.00 0.00 ? 6  ILE A HG13 9  
ATOM 5799  H HG21 . ILE A 1 6  ? 35.484 2.151   -6.417  1.00 0.00 ? 6  ILE A HG21 9  
ATOM 5800  H HG22 . ILE A 1 6  ? 34.640 3.315   -5.478  1.00 0.00 ? 6  ILE A HG22 9  
ATOM 5801  H HG23 . ILE A 1 6  ? 34.570 3.394   -7.241  1.00 0.00 ? 6  ILE A HG23 9  
ATOM 5802  H HD11 . ILE A 1 6  ? 35.543 0.613   -7.867  1.00 0.00 ? 6  ILE A HD11 9  
ATOM 5803  H HD12 . ILE A 1 6  ? 34.080 0.691   -8.777  1.00 0.00 ? 6  ILE A HD12 9  
ATOM 5804  H HD13 . ILE A 1 6  ? 34.622 -0.873  -8.177  1.00 0.00 ? 6  ILE A HD13 9  
ATOM 5805  N N    . GLU A 1 7  ? 30.652 3.604   -5.257  1.00 0.00 ? 7  GLU A N    9  
ATOM 5806  C CA   . GLU A 1 7  ? 30.048 4.906   -4.994  1.00 0.00 ? 7  GLU A CA   9  
ATOM 5807  C C    . GLU A 1 7  ? 29.483 4.963   -3.562  1.00 0.00 ? 7  GLU A C    9  
ATOM 5808  O O    . GLU A 1 7  ? 29.210 6.031   -3.044  1.00 0.00 ? 7  GLU A O    9  
ATOM 5809  C CB   . GLU A 1 7  ? 28.965 5.184   -6.046  1.00 0.00 ? 7  GLU A CB   9  
ATOM 5810  C CG   . GLU A 1 7  ? 27.895 4.081   -6.114  1.00 0.00 ? 7  GLU A CG   9  
ATOM 5811  C CD   . GLU A 1 7  ? 26.756 4.379   -7.108  1.00 0.00 ? 7  GLU A CD   9  
ATOM 5812  O OE1  . GLU A 1 7  ? 26.587 5.533   -7.502  1.00 0.00 ? 7  GLU A OE1  9  
ATOM 5813  O OE2  . GLU A 1 7  ? 26.044 3.445   -7.477  1.00 0.00 ? 7  GLU A OE2  9  
ATOM 5814  H H    . GLU A 1 7  ? 30.081 2.848   -5.576  1.00 0.00 ? 7  GLU A H    9  
ATOM 5815  H HA   . GLU A 1 7  ? 30.821 5.673   -5.069  1.00 0.00 ? 7  GLU A HA   9  
ATOM 5816  H HB2  . GLU A 1 7  ? 28.498 6.147   -5.837  1.00 0.00 ? 7  GLU A HB2  9  
ATOM 5817  H HB3  . GLU A 1 7  ? 29.446 5.275   -7.022  1.00 0.00 ? 7  GLU A HB3  9  
ATOM 5818  H HG2  . GLU A 1 7  ? 28.360 3.144   -6.412  1.00 0.00 ? 7  GLU A HG2  9  
ATOM 5819  H HG3  . GLU A 1 7  ? 27.455 3.923   -5.130  1.00 0.00 ? 7  GLU A HG3  9  
ATOM 5820  N N    . ARG A 1 8  ? 29.337 3.755   -2.968  1.00 0.00 ? 8  ARG A N    9  
ATOM 5821  C CA   . ARG A 1 8  ? 28.785 3.627   -1.624  1.00 0.00 ? 8  ARG A CA   9  
ATOM 5822  C C    . ARG A 1 8  ? 29.883 3.816   -0.580  1.00 0.00 ? 8  ARG A C    9  
ATOM 5823  O O    . ARG A 1 8  ? 29.781 4.671   0.281   1.00 0.00 ? 8  ARG A O    9  
ATOM 5824  C CB   . ARG A 1 8  ? 28.104 2.253   -1.499  1.00 0.00 ? 8  ARG A CB   9  
ATOM 5825  C CG   . ARG A 1 8  ? 26.684 2.348   -0.918  1.00 0.00 ? 8  ARG A CG   9  
ATOM 5826  C CD   . ARG A 1 8  ? 25.691 1.405   -1.611  1.00 0.00 ? 8  ARG A CD   9  
ATOM 5827  N NE   . ARG A 1 8  ? 25.137 0.440   -0.671  1.00 0.00 ? 8  ARG A NE   9  
ATOM 5828  C CZ   . ARG A 1 8  ? 24.081 -0.335  -1.003  1.00 0.00 ? 8  ARG A CZ   9  
ATOM 5829  N NH1  . ARG A 1 8  ? 23.510 -0.231  -2.201  1.00 0.00 ? 8  ARG A NH1  9  
ATOM 5830  N NH2  . ARG A 1 8  ? 23.609 -1.206  -0.118  1.00 0.00 ? 8  ARG A NH2  9  
ATOM 5831  H H    . ARG A 1 8  ? 29.592 2.919   -3.447  1.00 0.00 ? 8  ARG A H    9  
ATOM 5832  H HA   . ARG A 1 8  ? 28.068 4.439   -1.505  1.00 0.00 ? 8  ARG A HA   9  
ATOM 5833  H HB2  . ARG A 1 8  ? 28.070 1.820   -2.496  1.00 0.00 ? 8  ARG A HB2  9  
ATOM 5834  H HB3  . ARG A 1 8  ? 28.685 1.536   -0.916  1.00 0.00 ? 8  ARG A HB3  9  
ATOM 5835  H HG2  . ARG A 1 8  ? 26.711 2.182   0.158   1.00 0.00 ? 8  ARG A HG2  9  
ATOM 5836  H HG3  . ARG A 1 8  ? 26.297 3.360   -1.023  1.00 0.00 ? 8  ARG A HG3  9  
ATOM 5837  H HD2  . ARG A 1 8  ? 24.869 1.989   -2.024  1.00 0.00 ? 8  ARG A HD2  9  
ATOM 5838  H HD3  . ARG A 1 8  ? 26.136 0.843   -2.433  1.00 0.00 ? 8  ARG A HD3  9  
ATOM 5839  H HE   . ARG A 1 8  ? 25.547 0.348   0.235   1.00 0.00 ? 8  ARG A HE   9  
ATOM 5840  H HH11 . ARG A 1 8  ? 23.864 0.428   -2.867  1.00 0.00 ? 8  ARG A HH11 9  
ATOM 5841  H HH12 . ARG A 1 8  ? 22.727 -0.809  -2.435  1.00 0.00 ? 8  ARG A HH12 9  
ATOM 5842  H HH21 . ARG A 1 8  ? 24.038 -1.289  0.783   1.00 0.00 ? 8  ARG A HH21 9  
ATOM 5843  H HH22 . ARG A 1 8  ? 22.824 -1.778  -0.357  1.00 0.00 ? 8  ARG A HH22 9  
ATOM 5844  N N    . LEU A 1 9  ? 30.928 2.979   -0.760  1.00 0.00 ? 9  LEU A N    9  
ATOM 5845  C CA   . LEU A 1 9  ? 32.192 3.001   -0.032  1.00 0.00 ? 9  LEU A CA   9  
ATOM 5846  C C    . LEU A 1 9  ? 32.776 4.433   -0.094  1.00 0.00 ? 9  LEU A C    9  
ATOM 5847  O O    . LEU A 1 9  ? 33.102 5.022   0.927   1.00 0.00 ? 9  LEU A O    9  
ATOM 5848  C CB   . LEU A 1 9  ? 33.146 1.957   -0.624  1.00 0.00 ? 9  LEU A CB   9  
ATOM 5849  C CG   . LEU A 1 9  ? 32.622 0.507   -0.617  1.00 0.00 ? 9  LEU A CG   9  
ATOM 5850  C CD1  . LEU A 1 9  ? 33.285 -0.259  -1.763  1.00 0.00 ? 9  LEU A CD1  9  
ATOM 5851  C CD2  . LEU A 1 9  ? 32.811 -0.225  0.711   1.00 0.00 ? 9  LEU A CD2  9  
ATOM 5852  H H    . LEU A 1 9  ? 30.821 2.290   -1.462  1.00 0.00 ? 9  LEU A H    9  
ATOM 5853  H HA   . LEU A 1 9  ? 31.991 2.691   0.988   1.00 0.00 ? 9  LEU A HA   9  
ATOM 5854  H HB2  . LEU A 1 9  ? 33.349 2.261   -1.649  1.00 0.00 ? 9  LEU A HB2  9  
ATOM 5855  H HB3  . LEU A 1 9  ? 34.098 1.973   -0.101  1.00 0.00 ? 9  LEU A HB3  9  
ATOM 5856  H HG   . LEU A 1 9  ? 31.546 0.503   -0.757  1.00 0.00 ? 9  LEU A HG   9  
ATOM 5857  H HD11 . LEU A 1 9  ? 33.339 0.335   -2.668  1.00 0.00 ? 9  LEU A HD11 9  
ATOM 5858  H HD12 . LEU A 1 9  ? 32.697 -1.128  -2.021  1.00 0.00 ? 9  LEU A HD12 9  
ATOM 5859  H HD13 . LEU A 1 9  ? 34.306 -0.552  -1.514  1.00 0.00 ? 9  LEU A HD13 9  
ATOM 5860  H HD21 . LEU A 1 9  ? 33.794 -0.683  0.759   1.00 0.00 ? 9  LEU A HD21 9  
ATOM 5861  H HD22 . LEU A 1 9  ? 32.078 -1.024  0.823   1.00 0.00 ? 9  LEU A HD22 9  
ATOM 5862  H HD23 . LEU A 1 9  ? 32.697 0.448   1.559   1.00 0.00 ? 9  LEU A HD23 9  
ATOM 5863  N N    . LYS A 1 10 ? 32.831 4.989   -1.324  1.00 0.00 ? 10 LYS A N    9  
ATOM 5864  C CA   . LYS A 1 10 ? 33.269 6.385   -1.457  1.00 0.00 ? 10 LYS A CA   9  
ATOM 5865  C C    . LYS A 1 10 ? 32.335 7.384   -0.740  1.00 0.00 ? 10 LYS A C    9  
ATOM 5866  O O    . LYS A 1 10 ? 32.790 8.388   -0.220  1.00 0.00 ? 10 LYS A O    9  
ATOM 5867  C CB   . LYS A 1 10 ? 33.316 6.820   -2.924  1.00 0.00 ? 10 LYS A CB   9  
ATOM 5868  C CG   . LYS A 1 10 ? 34.631 6.484   -3.626  1.00 0.00 ? 10 LYS A CG   9  
ATOM 5869  C CD   . LYS A 1 10 ? 34.892 7.446   -4.789  1.00 0.00 ? 10 LYS A CD   9  
ATOM 5870  C CE   . LYS A 1 10 ? 33.648 7.655   -5.664  1.00 0.00 ? 10 LYS A CE   9  
ATOM 5871  N NZ   . LYS A 1 10 ? 33.980 7.894   -7.058  1.00 0.00 ? 10 LYS A NZ   9  
ATOM 5872  H H    . LYS A 1 10 ? 32.536 4.453   -2.117  1.00 0.00 ? 10 LYS A H    9  
ATOM 5873  H HA   . LYS A 1 10 ? 34.257 6.464   -0.998  1.00 0.00 ? 10 LYS A HA   9  
ATOM 5874  H HB2  . LYS A 1 10 ? 32.458 6.424   -3.468  1.00 0.00 ? 10 LYS A HB2  9  
ATOM 5875  H HB3  . LYS A 1 10 ? 33.213 7.904   -2.982  1.00 0.00 ? 10 LYS A HB3  9  
ATOM 5876  H HG2  . LYS A 1 10 ? 35.443 6.564   -2.910  1.00 0.00 ? 10 LYS A HG2  9  
ATOM 5877  H HG3  . LYS A 1 10 ? 34.640 5.451   -3.968  1.00 0.00 ? 10 LYS A HG3  9  
ATOM 5878  H HD2  . LYS A 1 10 ? 35.224 8.408   -4.391  1.00 0.00 ? 10 LYS A HD2  9  
ATOM 5879  H HD3  . LYS A 1 10 ? 35.713 7.072   -5.393  1.00 0.00 ? 10 LYS A HD3  9  
ATOM 5880  H HE2  . LYS A 1 10 ? 32.988 6.786   -5.650  1.00 0.00 ? 10 LYS A HE2  9  
ATOM 5881  H HE3  . LYS A 1 10 ? 33.078 8.511   -5.295  1.00 0.00 ? 10 LYS A HE3  9  
ATOM 5882  H HZ1  . LYS A 1 10 ? 34.590 8.733   -7.133  1.00 0.00 ? 10 LYS A HZ1  9  
ATOM 5883  H HZ2  . LYS A 1 10 ? 33.106 8.044   -7.601  1.00 0.00 ? 10 LYS A HZ2  9  
ATOM 5884  H HZ3  . LYS A 1 10 ? 34.480 7.062   -7.431  1.00 0.00 ? 10 LYS A HZ3  9  
ATOM 5885  N N    . ALA A 1 11 ? 31.020 7.067   -0.774  1.00 0.00 ? 11 ALA A N    9  
ATOM 5886  C CA   . ALA A 1 11 ? 30.025 7.976   -0.198  1.00 0.00 ? 11 ALA A CA   9  
ATOM 5887  C C    . ALA A 1 11 ? 30.162 8.121   1.331   1.00 0.00 ? 11 ALA A C    9  
ATOM 5888  O O    . ALA A 1 11 ? 29.686 9.091   1.902   1.00 0.00 ? 11 ALA A O    9  
ATOM 5889  C CB   . ALA A 1 11 ? 28.602 7.528   -0.551  1.00 0.00 ? 11 ALA A CB   9  
ATOM 5890  H H    . ALA A 1 11 ? 30.728 6.222   -1.215  1.00 0.00 ? 11 ALA A H    9  
ATOM 5891  H HA   . ALA A 1 11 ? 30.201 8.955   -0.647  1.00 0.00 ? 11 ALA A HA   9  
ATOM 5892  H HB1  . ALA A 1 11 ? 28.372 7.777   -1.586  1.00 0.00 ? 11 ALA A HB1  9  
ATOM 5893  H HB2  . ALA A 1 11 ? 27.855 8.020   0.072   1.00 0.00 ? 11 ALA A HB2  9  
ATOM 5894  H HB3  . ALA A 1 11 ? 28.461 6.458   -0.430  1.00 0.00 ? 11 ALA A HB3  9  
ATOM 5895  N N    . LEU A 1 12 ? 30.851 7.135   1.952   1.00 0.00 ? 12 LEU A N    9  
ATOM 5896  C CA   . LEU A 1 12 ? 31.123 7.206   3.384   1.00 0.00 ? 12 LEU A CA   9  
ATOM 5897  C C    . LEU A 1 12 ? 32.281 8.199   3.710   1.00 0.00 ? 12 LEU A C    9  
ATOM 5898  O O    . LEU A 1 12 ? 32.674 8.321   4.862   1.00 0.00 ? 12 LEU A O    9  
ATOM 5899  C CB   . LEU A 1 12 ? 31.488 5.804   3.896   1.00 0.00 ? 12 LEU A CB   9  
ATOM 5900  C CG   . LEU A 1 12 ? 30.360 4.746   3.958   1.00 0.00 ? 12 LEU A CG   9  
ATOM 5901  C CD1  . LEU A 1 12 ? 30.503 3.718   2.837   1.00 0.00 ? 12 LEU A CD1  9  
ATOM 5902  C CD2  . LEU A 1 12 ? 30.390 3.983   5.285   1.00 0.00 ? 12 LEU A CD2  9  
ATOM 5903  H H    . LEU A 1 12 ? 31.216 6.361   1.436   1.00 0.00 ? 12 LEU A H    9  
ATOM 5904  H HA   . LEU A 1 12 ? 30.221 7.562   3.883   1.00 0.00 ? 12 LEU A HA   9  
ATOM 5905  H HB2  . LEU A 1 12 ? 32.282 5.442   3.254   1.00 0.00 ? 12 LEU A HB2  9  
ATOM 5906  H HB3  . LEU A 1 12 ? 31.917 5.900   4.888   1.00 0.00 ? 12 LEU A HB3  9  
ATOM 5907  H HG   . LEU A 1 12 ? 29.396 5.247   3.866   1.00 0.00 ? 12 LEU A HG   9  
ATOM 5908  H HD11 . LEU A 1 12 ? 31.049 4.183   2.031   1.00 0.00 ? 12 LEU A HD11 9  
ATOM 5909  H HD12 . LEU A 1 12 ? 29.536 3.373   2.469   1.00 0.00 ? 12 LEU A HD12 9  
ATOM 5910  H HD13 . LEU A 1 12 ? 31.088 2.844   3.131   1.00 0.00 ? 12 LEU A HD13 9  
ATOM 5911  H HD21 . LEU A 1 12 ? 31.262 3.337   5.316   1.00 0.00 ? 12 LEU A HD21 9  
ATOM 5912  H HD22 . LEU A 1 12 ? 29.523 3.331   5.388   1.00 0.00 ? 12 LEU A HD22 9  
ATOM 5913  H HD23 . LEU A 1 12 ? 30.442 4.656   6.140   1.00 0.00 ? 12 LEU A HD23 9  
ATOM 5914  N N    . GLY A 1 13 ? 32.789 8.895   2.661   1.00 0.00 ? 13 GLY A N    9  
ATOM 5915  C CA   . GLY A 1 13 ? 33.822 9.923   2.816   1.00 0.00 ? 13 GLY A CA   9  
ATOM 5916  C C    . GLY A 1 13 ? 35.227 9.408   2.468   1.00 0.00 ? 13 GLY A C    9  
ATOM 5917  O O    . GLY A 1 13 ? 36.220 9.906   2.982   1.00 0.00 ? 13 GLY A O    9  
ATOM 5918  H H    . GLY A 1 13 ? 32.425 8.738   1.747   1.00 0.00 ? 13 GLY A H    9  
ATOM 5919  H HA2  . GLY A 1 13 ? 33.561 10.743  2.145   1.00 0.00 ? 13 GLY A HA2  9  
ATOM 5920  H HA3  . GLY A 1 13 ? 33.811 10.294  3.841   1.00 0.00 ? 13 GLY A HA3  9  
ATOM 5921  N N    . PHE A 1 14 ? 35.238 8.373   1.589   1.00 0.00 ? 14 PHE A N    9  
ATOM 5922  C CA   . PHE A 1 14 ? 36.467 7.656   1.243   1.00 0.00 ? 14 PHE A CA   9  
ATOM 5923  C C    . PHE A 1 14 ? 36.878 8.033   -0.198  1.00 0.00 ? 14 PHE A C    9  
ATOM 5924  O O    . PHE A 1 14 ? 36.690 9.174   -0.619  1.00 0.00 ? 14 PHE A O    9  
ATOM 5925  C CB   . PHE A 1 14 ? 36.236 6.137   1.451   1.00 0.00 ? 14 PHE A CB   9  
ATOM 5926  C CG   . PHE A 1 14 ? 35.694 5.781   2.819   1.00 0.00 ? 14 PHE A CG   9  
ATOM 5927  C CD1  . PHE A 1 14 ? 35.883 6.604   3.931   1.00 0.00 ? 14 PHE A CD1  9  
ATOM 5928  C CD2  . PHE A 1 14 ? 34.941 4.620   2.970   1.00 0.00 ? 14 PHE A CD2  9  
ATOM 5929  C CE1  . PHE A 1 14 ? 35.242 6.331   5.125   1.00 0.00 ? 14 PHE A CE1  9  
ATOM 5930  C CE2  . PHE A 1 14 ? 34.302 4.342   4.168   1.00 0.00 ? 14 PHE A CE2  9  
ATOM 5931  C CZ   . PHE A 1 14 ? 34.429 5.223   5.237   1.00 0.00 ? 14 PHE A CZ   9  
ATOM 5932  H H    . PHE A 1 14 ? 34.380 8.053   1.194   1.00 0.00 ? 14 PHE A H    9  
ATOM 5933  H HA   . PHE A 1 14 ? 37.258 8.012   1.902   1.00 0.00 ? 14 PHE A HA   9  
ATOM 5934  H HB2  . PHE A 1 14 ? 35.528 5.788   0.698   1.00 0.00 ? 14 PHE A HB2  9  
ATOM 5935  H HB3  . PHE A 1 14 ? 37.147 5.568   1.305   1.00 0.00 ? 14 PHE A HB3  9  
ATOM 5936  H HD1  . PHE A 1 14 ? 36.512 7.482   3.899   1.00 0.00 ? 14 PHE A HD1  9  
ATOM 5937  H HD2  . PHE A 1 14 ? 34.841 3.923   2.147   1.00 0.00 ? 14 PHE A HD2  9  
ATOM 5938  H HE1  . PHE A 1 14 ? 35.356 6.990   5.971   1.00 0.00 ? 14 PHE A HE1  9  
ATOM 5939  H HE2  . PHE A 1 14 ? 33.684 3.459   4.242   1.00 0.00 ? 14 PHE A HE2  9  
ATOM 5940  H HZ   . PHE A 1 14 ? 33.887 5.081   6.161   1.00 0.00 ? 14 PHE A HZ   9  
ATOM 5941  N N    . GLU A 1 15 ? 37.450 7.044   -0.916  1.00 0.00 ? 15 GLU A N    9  
ATOM 5942  C CA   . GLU A 1 15 ? 37.970 7.250   -2.269  1.00 0.00 ? 15 GLU A CA   9  
ATOM 5943  C C    . GLU A 1 15 ? 38.069 5.889   -2.951  1.00 0.00 ? 15 GLU A C    9  
ATOM 5944  O O    . GLU A 1 15 ? 38.459 4.908   -2.323  1.00 0.00 ? 15 GLU A O    9  
ATOM 5945  C CB   . GLU A 1 15 ? 39.370 7.890   -2.238  1.00 0.00 ? 15 GLU A CB   9  
ATOM 5946  C CG   . GLU A 1 15 ? 39.697 8.685   -3.512  1.00 0.00 ? 15 GLU A CG   9  
ATOM 5947  C CD   . GLU A 1 15 ? 39.318 10.173  -3.388  1.00 0.00 ? 15 GLU A CD   9  
ATOM 5948  O OE1  . GLU A 1 15 ? 39.758 10.815  -2.434  1.00 0.00 ? 15 GLU A OE1  9  
ATOM 5949  O OE2  . GLU A 1 15 ? 38.599 10.677  -4.251  1.00 0.00 ? 15 GLU A OE2  9  
ATOM 5950  H H    . GLU A 1 15 ? 37.539 6.139   -0.500  1.00 0.00 ? 15 GLU A H    9  
ATOM 5951  H HA   . GLU A 1 15 ? 37.259 7.881   -2.807  1.00 0.00 ? 15 GLU A HA   9  
ATOM 5952  H HB2  . GLU A 1 15 ? 39.469 8.505   -1.346  1.00 0.00 ? 15 GLU A HB2  9  
ATOM 5953  H HB3  . GLU A 1 15 ? 40.148 7.134   -2.128  1.00 0.00 ? 15 GLU A HB3  9  
ATOM 5954  H HG2  . GLU A 1 15 ? 40.762 8.622   -3.727  1.00 0.00 ? 15 GLU A HG2  9  
ATOM 5955  H HG3  . GLU A 1 15 ? 39.207 8.242   -4.377  1.00 0.00 ? 15 GLU A HG3  9  
ATOM 5956  N N    . GLU A 1 16 ? 37.714 5.890   -4.249  1.00 0.00 ? 16 GLU A N    9  
ATOM 5957  C CA   . GLU A 1 16 ? 37.603 4.695   -5.086  1.00 0.00 ? 16 GLU A CA   9  
ATOM 5958  C C    . GLU A 1 16 ? 38.870 3.786   -5.052  1.00 0.00 ? 16 GLU A C    9  
ATOM 5959  O O    . GLU A 1 16 ? 38.793 2.611   -5.382  1.00 0.00 ? 16 GLU A O    9  
ATOM 5960  C CB   . GLU A 1 16 ? 37.192 5.114   -6.507  1.00 0.00 ? 16 GLU A CB   9  
ATOM 5961  C CG   . GLU A 1 16 ? 37.517 4.097   -7.617  1.00 0.00 ? 16 GLU A CG   9  
ATOM 5962  C CD   . GLU A 1 16 ? 36.712 4.315   -8.911  1.00 0.00 ? 16 GLU A CD   9  
ATOM 5963  O OE1  . GLU A 1 16 ? 36.104 5.373   -9.074  1.00 0.00 ? 16 GLU A OE1  9  
ATOM 5964  O OE2  . GLU A 1 16 ? 36.698 3.409   -9.744  1.00 0.00 ? 16 GLU A OE2  9  
ATOM 5965  H H    . GLU A 1 16 ? 37.435 6.770   -4.631  1.00 0.00 ? 16 GLU A H    9  
ATOM 5966  H HA   . GLU A 1 16 ? 36.745 4.157   -4.686  1.00 0.00 ? 16 GLU A HA   9  
ATOM 5967  H HB2  . GLU A 1 16 ? 36.115 5.294   -6.493  1.00 0.00 ? 16 GLU A HB2  9  
ATOM 5968  H HB3  . GLU A 1 16 ? 37.664 6.065   -6.751  1.00 0.00 ? 16 GLU A HB3  9  
ATOM 5969  H HG2  . GLU A 1 16 ? 38.579 4.159   -7.851  1.00 0.00 ? 16 GLU A HG2  9  
ATOM 5970  H HG3  . GLU A 1 16 ? 37.320 3.078   -7.290  1.00 0.00 ? 16 GLU A HG3  9  
ATOM 5971  N N    . SER A 1 17 ? 40.015 4.360   -4.625  1.00 0.00 ? 17 SER A N    9  
ATOM 5972  C CA   . SER A 1 17 ? 41.235 3.568   -4.501  1.00 0.00 ? 17 SER A CA   9  
ATOM 5973  C C    . SER A 1 17 ? 41.238 2.760   -3.192  1.00 0.00 ? 17 SER A C    9  
ATOM 5974  O O    . SER A 1 17 ? 41.438 1.558   -3.209  1.00 0.00 ? 17 SER A O    9  
ATOM 5975  C CB   . SER A 1 17 ? 42.450 4.511   -4.520  1.00 0.00 ? 17 SER A CB   9  
ATOM 5976  O OG   . SER A 1 17 ? 43.087 4.567   -5.782  1.00 0.00 ? 17 SER A OG   9  
ATOM 5977  H H    . SER A 1 17 ? 40.033 5.319   -4.344  1.00 0.00 ? 17 SER A H    9  
ATOM 5978  H HA   . SER A 1 17 ? 41.243 2.852   -5.329  1.00 0.00 ? 17 SER A HA   9  
ATOM 5979  H HB2  . SER A 1 17 ? 42.128 5.524   -4.290  1.00 0.00 ? 17 SER A HB2  9  
ATOM 5980  H HB3  . SER A 1 17 ? 43.180 4.280   -3.738  1.00 0.00 ? 17 SER A HB3  9  
ATOM 5981  H HG   . SER A 1 17 ? 43.431 3.708   -6.005  1.00 0.00 ? 17 SER A HG   9  
ATOM 5982  N N    . LEU A 1 18 ? 41.012 3.492   -2.070  1.00 0.00 ? 18 LEU A N    9  
ATOM 5983  C CA   . LEU A 1 18 ? 40.979 2.809   -0.769  1.00 0.00 ? 18 LEU A CA   9  
ATOM 5984  C C    . LEU A 1 18 ? 39.782 1.871   -0.685  1.00 0.00 ? 18 LEU A C    9  
ATOM 5985  O O    . LEU A 1 18 ? 39.787 0.930   0.121   1.00 0.00 ? 18 LEU A O    9  
ATOM 5986  C CB   . LEU A 1 18 ? 41.077 3.795   0.416   1.00 0.00 ? 18 LEU A CB   9  
ATOM 5987  C CG   . LEU A 1 18 ? 39.792 4.483   0.938   1.00 0.00 ? 18 LEU A CG   9  
ATOM 5988  C CD1  . LEU A 1 18 ? 39.518 4.161   2.417   1.00 0.00 ? 18 LEU A CD1  9  
ATOM 5989  C CD2  . LEU A 1 18 ? 39.887 6.001   0.782   1.00 0.00 ? 18 LEU A CD2  9  
ATOM 5990  H H    . LEU A 1 18 ? 40.833 4.469   -2.145  1.00 0.00 ? 18 LEU A H    9  
ATOM 5991  H HA   . LEU A 1 18 ? 41.868 2.182   -0.734  1.00 0.00 ? 18 LEU A HA   9  
ATOM 5992  H HB2  . LEU A 1 18 ? 41.517 3.247   1.241   1.00 0.00 ? 18 LEU A HB2  9  
ATOM 5993  H HB3  . LEU A 1 18 ? 41.828 4.542   0.172   1.00 0.00 ? 18 LEU A HB3  9  
ATOM 5994  H HG   . LEU A 1 18 ? 38.942 4.136   0.355   1.00 0.00 ? 18 LEU A HG   9  
ATOM 5995  H HD11 . LEU A 1 18 ? 39.525 3.089   2.613   1.00 0.00 ? 18 LEU A HD11 9  
ATOM 5996  H HD12 . LEU A 1 18 ? 38.553 4.571   2.717   1.00 0.00 ? 18 LEU A HD12 9  
ATOM 5997  H HD13 . LEU A 1 18 ? 40.264 4.615   3.068   1.00 0.00 ? 18 LEU A HD13 9  
ATOM 5998  H HD21 . LEU A 1 18 ? 40.787 6.396   1.250   1.00 0.00 ? 18 LEU A HD21 9  
ATOM 5999  H HD22 . LEU A 1 18 ? 39.046 6.518   1.241   1.00 0.00 ? 18 LEU A HD22 9  
ATOM 6000  H HD23 . LEU A 1 18 ? 39.925 6.250   -0.271  1.00 0.00 ? 18 LEU A HD23 9  
ATOM 6001  N N    . VAL A 1 19 ? 38.805 2.151   -1.544  1.00 0.00 ? 19 VAL A N    9  
ATOM 6002  C CA   . VAL A 1 19 ? 37.537 1.456   -1.702  1.00 0.00 ? 19 VAL A CA   9  
ATOM 6003  C C    . VAL A 1 19 ? 37.730 0.114   -2.411  1.00 0.00 ? 19 VAL A C    9  
ATOM 6004  O O    . VAL A 1 19 ? 37.360 -0.924  -1.896  1.00 0.00 ? 19 VAL A O    9  
ATOM 6005  C CB   . VAL A 1 19 ? 36.661 2.402   -2.527  1.00 0.00 ? 19 VAL A CB   9  
ATOM 6006  C CG1  . VAL A 1 19 ? 35.594 1.717   -3.373  1.00 0.00 ? 19 VAL A CG1  9  
ATOM 6007  C CG2  . VAL A 1 19 ? 36.088 3.571   -1.705  1.00 0.00 ? 19 VAL A CG2  9  
ATOM 6008  H H    . VAL A 1 19 ? 38.953 2.922   -2.177  1.00 0.00 ? 19 VAL A H    9  
ATOM 6009  H HA   . VAL A 1 19 ? 37.114 1.248   -0.724  1.00 0.00 ? 19 VAL A HA   9  
ATOM 6010  H HB   . VAL A 1 19 ? 37.352 2.836   -3.243  1.00 0.00 ? 19 VAL A HB   9  
ATOM 6011  H HG11 . VAL A 1 19 ? 35.971 1.522   -4.374  1.00 0.00 ? 19 VAL A HG11 9  
ATOM 6012  H HG12 . VAL A 1 19 ? 34.728 2.361   -3.448  1.00 0.00 ? 19 VAL A HG12 9  
ATOM 6013  H HG13 . VAL A 1 19 ? 35.287 0.762   -2.965  1.00 0.00 ? 19 VAL A HG13 9  
ATOM 6014  H HG21 . VAL A 1 19 ? 36.787 3.913   -0.948  1.00 0.00 ? 19 VAL A HG21 9  
ATOM 6015  H HG22 . VAL A 1 19 ? 35.164 3.363   -1.187  1.00 0.00 ? 19 VAL A HG22 9  
ATOM 6016  H HG23 . VAL A 1 19 ? 35.863 4.402   -2.366  1.00 0.00 ? 19 VAL A HG23 9  
ATOM 6017  N N    . ILE A 1 20 ? 38.303 0.225   -3.629  1.00 0.00 ? 20 ILE A N    9  
ATOM 6018  C CA   . ILE A 1 20 ? 38.548 -0.945  -4.465  1.00 0.00 ? 20 ILE A CA   9  
ATOM 6019  C C    . ILE A 1 20 ? 39.407 -1.956  -3.720  1.00 0.00 ? 20 ILE A C    9  
ATOM 6020  O O    . ILE A 1 20 ? 39.052 -3.117  -3.627  1.00 0.00 ? 20 ILE A O    9  
ATOM 6021  C CB   . ILE A 1 20 ? 39.187 -0.509  -5.801  1.00 0.00 ? 20 ILE A CB   9  
ATOM 6022  C CG1  . ILE A 1 20 ? 38.107 -0.057  -6.789  1.00 0.00 ? 20 ILE A CG1  9  
ATOM 6023  C CG2  . ILE A 1 20 ? 40.102 -1.560  -6.464  1.00 0.00 ? 20 ILE A CG2  9  
ATOM 6024  C CD1  . ILE A 1 20 ? 37.198 -1.207  -7.236  1.00 0.00 ? 20 ILE A CD1  9  
ATOM 6025  H H    . ILE A 1 20 ? 38.548 1.127   -3.968  1.00 0.00 ? 20 ILE A H    9  
ATOM 6026  H HA   . ILE A 1 20 ? 37.579 -1.416  -4.620  1.00 0.00 ? 20 ILE A HA   9  
ATOM 6027  H HB   . ILE A 1 20 ? 39.829 0.347   -5.595  1.00 0.00 ? 20 ILE A HB   9  
ATOM 6028  H HG12 . ILE A 1 20 ? 37.507 0.749   -6.365  1.00 0.00 ? 20 ILE A HG12 9  
ATOM 6029  H HG13 . ILE A 1 20 ? 38.583 0.377   -7.665  1.00 0.00 ? 20 ILE A HG13 9  
ATOM 6030  H HG21 . ILE A 1 20 ? 40.378 -1.259  -7.474  1.00 0.00 ? 20 ILE A HG21 9  
ATOM 6031  H HG22 . ILE A 1 20 ? 39.635 -2.538  -6.535  1.00 0.00 ? 20 ILE A HG22 9  
ATOM 6032  H HG23 . ILE A 1 20 ? 41.022 -1.689  -5.900  1.00 0.00 ? 20 ILE A HG23 9  
ATOM 6033  H HD11 . ILE A 1 20 ? 37.632 -2.199  -7.133  1.00 0.00 ? 20 ILE A HD11 9  
ATOM 6034  H HD12 . ILE A 1 20 ? 36.919 -1.088  -8.282  1.00 0.00 ? 20 ILE A HD12 9  
ATOM 6035  H HD13 . ILE A 1 20 ? 36.298 -1.191  -6.634  1.00 0.00 ? 20 ILE A HD13 9  
ATOM 6036  N N    . GLN A 1 21 ? 40.525 -1.432  -3.190  1.00 0.00 ? 21 GLN A N    9  
ATOM 6037  C CA   . GLN A 1 21 ? 41.468 -2.262  -2.457  1.00 0.00 ? 21 GLN A CA   9  
ATOM 6038  C C    . GLN A 1 21 ? 40.887 -2.770  -1.116  1.00 0.00 ? 21 GLN A C    9  
ATOM 6039  O O    . GLN A 1 21 ? 41.323 -3.786  -0.602  1.00 0.00 ? 21 GLN A O    9  
ATOM 6040  C CB   . GLN A 1 21 ? 42.753 -1.452  -2.249  1.00 0.00 ? 21 GLN A CB   9  
ATOM 6041  C CG   . GLN A 1 21 ? 43.956 -2.333  -1.858  1.00 0.00 ? 21 GLN A CG   9  
ATOM 6042  C CD   . GLN A 1 21 ? 45.190 -2.029  -2.733  1.00 0.00 ? 21 GLN A CD   9  
ATOM 6043  O OE1  . GLN A 1 21 ? 45.382 -0.934  -3.225  1.00 0.00 ? 21 GLN A OE1  9  
ATOM 6044  N NE2  . GLN A 1 21 ? 45.976 -3.105  -2.930  1.00 0.00 ? 21 GLN A NE2  9  
ATOM 6045  H H    . GLN A 1 21 ? 40.724 -0.466  -3.342  1.00 0.00 ? 21 GLN A H    9  
ATOM 6046  H HA   . GLN A 1 21 ? 41.684 -3.120  -3.098  1.00 0.00 ? 21 GLN A HA   9  
ATOM 6047  H HB2  . GLN A 1 21 ? 42.950 -0.908  -3.174  1.00 0.00 ? 21 GLN A HB2  9  
ATOM 6048  H HB3  . GLN A 1 21 ? 42.608 -0.677  -1.496  1.00 0.00 ? 21 GLN A HB3  9  
ATOM 6049  H HG2  . GLN A 1 21 ? 44.217 -2.187  -0.812  1.00 0.00 ? 21 GLN A HG2  9  
ATOM 6050  H HG3  . GLN A 1 21 ? 43.707 -3.389  -1.953  1.00 0.00 ? 21 GLN A HG3  9  
ATOM 6051  H HE21 . GLN A 1 21 ? 45.862 -3.936  -2.385  1.00 0.00 ? 21 GLN A HE21 9  
ATOM 6052  H HE22 . GLN A 1 21 ? 46.686 -3.081  -3.629  1.00 0.00 ? 21 GLN A HE22 9  
ATOM 6053  N N    . ALA A 1 22 ? 39.879 -2.022  -0.605  1.00 0.00 ? 22 ALA A N    9  
ATOM 6054  C CA   . ALA A 1 22 ? 39.173 -2.422  0.614   1.00 0.00 ? 22 ALA A CA   9  
ATOM 6055  C C    . ALA A 1 22 ? 38.028 -3.399  0.351   1.00 0.00 ? 22 ALA A C    9  
ATOM 6056  O O    . ALA A 1 22 ? 37.526 -3.993  1.290   1.00 0.00 ? 22 ALA A O    9  
ATOM 6057  C CB   . ALA A 1 22 ? 38.495 -1.221  1.270   1.00 0.00 ? 22 ALA A CB   9  
ATOM 6058  H H    . ALA A 1 22 ? 39.578 -1.214  -1.105  1.00 0.00 ? 22 ALA A H    9  
ATOM 6059  H HA   . ALA A 1 22 ? 39.892 -2.899  1.282   1.00 0.00 ? 22 ALA A HA   9  
ATOM 6060  H HB1  . ALA A 1 22 ? 39.224 -0.533  1.675   1.00 0.00 ? 22 ALA A HB1  9  
ATOM 6061  H HB2  . ALA A 1 22 ? 37.871 -1.534  2.108   1.00 0.00 ? 22 ALA A HB2  9  
ATOM 6062  H HB3  . ALA A 1 22 ? 37.862 -0.672  0.571   1.00 0.00 ? 22 ALA A HB3  9  
ATOM 6063  N N    . TYR A 1 23 ? 37.627 -3.501  -0.932  1.00 0.00 ? 23 TYR A N    9  
ATOM 6064  C CA   . TYR A 1 23 ? 36.535 -4.390  -1.328  1.00 0.00 ? 23 TYR A CA   9  
ATOM 6065  C C    . TYR A 1 23 ? 37.110 -5.611  -2.054  1.00 0.00 ? 23 TYR A C    9  
ATOM 6066  O O    . TYR A 1 23 ? 36.407 -6.589  -2.232  1.00 0.00 ? 23 TYR A O    9  
ATOM 6067  C CB   . TYR A 1 23 ? 35.546 -3.643  -2.244  1.00 0.00 ? 23 TYR A CB   9  
ATOM 6068  C CG   . TYR A 1 23 ? 34.091 -3.992  -2.008  1.00 0.00 ? 23 TYR A CG   9  
ATOM 6069  C CD1  . TYR A 1 23 ? 33.359 -3.293  -1.067  1.00 0.00 ? 23 TYR A CD1  9  
ATOM 6070  C CD2  . TYR A 1 23 ? 33.440 -4.983  -2.730  1.00 0.00 ? 23 TYR A CD2  9  
ATOM 6071  C CE1  . TYR A 1 23 ? 32.017 -3.560  -0.839  1.00 0.00 ? 23 TYR A CE1  9  
ATOM 6072  C CE2  . TYR A 1 23 ? 32.096 -5.270  -2.521  1.00 0.00 ? 23 TYR A CE2  9  
ATOM 6073  C CZ   . TYR A 1 23 ? 31.380 -4.547  -1.571  1.00 0.00 ? 23 TYR A CZ   9  
ATOM 6074  O OH   . TYR A 1 23 ? 30.040 -4.780  -1.333  1.00 0.00 ? 23 TYR A OH   9  
ATOM 6075  H H    . TYR A 1 23 ? 38.085 -2.964  -1.637  1.00 0.00 ? 23 TYR A H    9  
ATOM 6076  H HA   . TYR A 1 23 ? 36.019 -4.733  -0.432  1.00 0.00 ? 23 TYR A HA   9  
ATOM 6077  H HB2  . TYR A 1 23 ? 35.645 -2.573  -2.083  1.00 0.00 ? 23 TYR A HB2  9  
ATOM 6078  H HB3  . TYR A 1 23 ? 35.803 -3.795  -3.289  1.00 0.00 ? 23 TYR A HB3  9  
ATOM 6079  H HD1  . TYR A 1 23 ? 33.834 -2.503  -0.513  1.00 0.00 ? 23 TYR A HD1  9  
ATOM 6080  H HD2  . TYR A 1 23 ? 33.985 -5.531  -3.470  1.00 0.00 ? 23 TYR A HD2  9  
ATOM 6081  H HE1  . TYR A 1 23 ? 31.477 -2.993  -0.095  1.00 0.00 ? 23 TYR A HE1  9  
ATOM 6082  H HE2  . TYR A 1 23 ? 31.641 -6.056  -3.112  1.00 0.00 ? 23 TYR A HE2  9  
ATOM 6083  H HH   . TYR A 1 23 ? 29.796 -5.653  -1.607  1.00 0.00 ? 23 TYR A HH   9  
ATOM 6084  N N    . PHE A 1 24 ? 38.386 -5.531  -2.474  1.00 0.00 ? 24 PHE A N    9  
ATOM 6085  C CA   . PHE A 1 24 ? 39.011 -6.634  -3.206  1.00 0.00 ? 24 PHE A CA   9  
ATOM 6086  C C    . PHE A 1 24 ? 39.861 -7.467  -2.236  1.00 0.00 ? 24 PHE A C    9  
ATOM 6087  O O    . PHE A 1 24 ? 39.894 -8.680  -2.314  1.00 0.00 ? 24 PHE A O    9  
ATOM 6088  C CB   . PHE A 1 24 ? 39.903 -6.096  -4.344  1.00 0.00 ? 24 PHE A CB   9  
ATOM 6089  C CG   . PHE A 1 24 ? 39.377 -6.378  -5.727  1.00 0.00 ? 24 PHE A CG   9  
ATOM 6090  C CD1  . PHE A 1 24 ? 39.425 -7.670  -6.239  1.00 0.00 ? 24 PHE A CD1  9  
ATOM 6091  C CD2  . PHE A 1 24 ? 38.867 -5.358  -6.520  1.00 0.00 ? 24 PHE A CD2  9  
ATOM 6092  C CE1  . PHE A 1 24 ? 39.016 -7.930  -7.541  1.00 0.00 ? 24 PHE A CE1  9  
ATOM 6093  C CE2  . PHE A 1 24 ? 38.465 -5.607  -7.827  1.00 0.00 ? 24 PHE A CE2  9  
ATOM 6094  C CZ   . PHE A 1 24 ? 38.550 -6.894  -8.342  1.00 0.00 ? 24 PHE A CZ   9  
ATOM 6095  H H    . PHE A 1 24 ? 38.934 -4.725  -2.254  1.00 0.00 ? 24 PHE A H    9  
ATOM 6096  H HA   . PHE A 1 24 ? 38.228 -7.299  -3.578  1.00 0.00 ? 24 PHE A HA   9  
ATOM 6097  H HB2  . PHE A 1 24 ? 40.083 -5.031  -4.231  1.00 0.00 ? 24 PHE A HB2  9  
ATOM 6098  H HB3  . PHE A 1 24 ? 40.897 -6.539  -4.298  1.00 0.00 ? 24 PHE A HB3  9  
ATOM 6099  H HD1  . PHE A 1 24 ? 39.772 -8.478  -5.611  1.00 0.00 ? 24 PHE A HD1  9  
ATOM 6100  H HD2  . PHE A 1 24 ? 38.768 -4.369  -6.105  1.00 0.00 ? 24 PHE A HD2  9  
ATOM 6101  H HE1  . PHE A 1 24 ? 39.051 -8.940  -7.922  1.00 0.00 ? 24 PHE A HE1  9  
ATOM 6102  H HE2  . PHE A 1 24 ? 38.078 -4.800  -8.434  1.00 0.00 ? 24 PHE A HE2  9  
ATOM 6103  H HZ   . PHE A 1 24 ? 38.240 -7.093  -9.358  1.00 0.00 ? 24 PHE A HZ   9  
ATOM 6104  N N    . ALA A 1 25 ? 40.530 -6.723  -1.321  1.00 0.00 ? 25 ALA A N    9  
ATOM 6105  C CA   . ALA A 1 25 ? 41.304 -7.372  -0.266  1.00 0.00 ? 25 ALA A CA   9  
ATOM 6106  C C    . ALA A 1 25 ? 40.371 -8.063  0.751   1.00 0.00 ? 25 ALA A C    9  
ATOM 6107  O O    . ALA A 1 25 ? 40.748 -9.031  1.394   1.00 0.00 ? 25 ALA A O    9  
ATOM 6108  C CB   . ALA A 1 25 ? 42.193 -6.340  0.437   1.00 0.00 ? 25 ALA A CB   9  
ATOM 6109  H H    . ALA A 1 25 ? 40.470 -5.729  -1.341  1.00 0.00 ? 25 ALA A H    9  
ATOM 6110  H HA   . ALA A 1 25 ? 41.935 -8.121  -0.746  1.00 0.00 ? 25 ALA A HA   9  
ATOM 6111  H HB1  . ALA A 1 25 ? 42.866 -6.816  1.149   1.00 0.00 ? 25 ALA A HB1  9  
ATOM 6112  H HB2  . ALA A 1 25 ? 41.605 -5.603  0.986   1.00 0.00 ? 25 ALA A HB2  9  
ATOM 6113  H HB3  . ALA A 1 25 ? 42.811 -5.810  -0.290  1.00 0.00 ? 25 ALA A HB3  9  
ATOM 6114  N N    . CYS A 1 26 ? 39.135 -7.517  0.821   1.00 0.00 ? 26 CYS A N    9  
ATOM 6115  C CA   . CYS A 1 26 ? 38.079 -8.088  1.658   1.00 0.00 ? 26 CYS A CA   9  
ATOM 6116  C C    . CYS A 1 26 ? 37.319 -9.237  0.963   1.00 0.00 ? 26 CYS A C    9  
ATOM 6117  O O    . CYS A 1 26 ? 36.331 -9.721  1.499   1.00 0.00 ? 26 CYS A O    9  
ATOM 6118  C CB   . CYS A 1 26 ? 37.087 -6.978  2.018   1.00 0.00 ? 26 CYS A CB   9  
ATOM 6119  S SG   . CYS A 1 26 ? 37.491 -6.276  3.639   1.00 0.00 ? 26 CYS A SG   9  
ATOM 6120  H H    . CYS A 1 26 ? 38.941 -6.699  0.282   1.00 0.00 ? 26 CYS A H    9  
ATOM 6121  H HA   . CYS A 1 26 ? 38.557 -8.473  2.561   1.00 0.00 ? 26 CYS A HA   9  
ATOM 6122  H HB2  . CYS A 1 26 ? 37.148 -6.209  1.258   1.00 0.00 ? 26 CYS A HB2  9  
ATOM 6123  H HB3  . CYS A 1 26 ? 36.043 -7.298  1.981   1.00 0.00 ? 26 CYS A HB3  9  
ATOM 6124  H HG   . CYS A 1 26 ? 37.354 -4.952  3.613   1.00 0.00 ? 26 CYS A HG   9  
ATOM 6125  N N    . GLU A 1 27 ? 37.802 -9.632  -0.241  1.00 0.00 ? 27 GLU A N    9  
ATOM 6126  C CA   . GLU A 1 27 ? 37.155 -10.687 -1.026  1.00 0.00 ? 27 GLU A CA   9  
ATOM 6127  C C    . GLU A 1 27 ? 35.686 -10.329 -1.374  1.00 0.00 ? 27 GLU A C    9  
ATOM 6128  O O    . GLU A 1 27 ? 34.757 -11.066 -1.099  1.00 0.00 ? 27 GLU A O    9  
ATOM 6129  C CB   . GLU A 1 27 ? 37.331 -12.056 -0.330  1.00 0.00 ? 27 GLU A CB   9  
ATOM 6130  C CG   . GLU A 1 27 ? 36.485 -13.194 -0.943  1.00 0.00 ? 27 GLU A CG   9  
ATOM 6131  C CD   . GLU A 1 27 ? 37.059 -14.603 -0.725  1.00 0.00 ? 27 GLU A CD   9  
ATOM 6132  O OE1  . GLU A 1 27 ? 38.269 -14.777 -0.849  1.00 0.00 ? 27 GLU A OE1  9  
ATOM 6133  O OE2  . GLU A 1 27 ? 36.282 -15.519 -0.446  1.00 0.00 ? 27 GLU A OE2  9  
ATOM 6134  H H    . GLU A 1 27 ? 38.626 -9.208  -0.609  1.00 0.00 ? 27 GLU A H    9  
ATOM 6135  H HA   . GLU A 1 27 ? 37.702 -10.712 -1.968  1.00 0.00 ? 27 GLU A HA   9  
ATOM 6136  H HB2  . GLU A 1 27 ? 38.394 -12.293 -0.365  1.00 0.00 ? 27 GLU A HB2  9  
ATOM 6137  H HB3  . GLU A 1 27 ? 37.092 -11.982 0.729   1.00 0.00 ? 27 GLU A HB3  9  
ATOM 6138  H HG2  . GLU A 1 27 ? 35.485 -13.175 -0.512  1.00 0.00 ? 27 GLU A HG2  9  
ATOM 6139  H HG3  . GLU A 1 27 ? 36.368 -13.035 -2.013  1.00 0.00 ? 27 GLU A HG3  9  
ATOM 6140  N N    . LYS A 1 28 ? 35.569 -9.139  -2.007  1.00 0.00 ? 28 LYS A N    9  
ATOM 6141  C CA   . LYS A 1 28 ? 34.340 -8.580  -2.577  1.00 0.00 ? 28 LYS A CA   9  
ATOM 6142  C C    . LYS A 1 28 ? 33.076 -8.991  -1.807  1.00 0.00 ? 28 LYS A C    9  
ATOM 6143  O O    . LYS A 1 28 ? 32.119 -9.520  -2.354  1.00 0.00 ? 28 LYS A O    9  
ATOM 6144  C CB   . LYS A 1 28 ? 34.276 -8.944  -4.066  1.00 0.00 ? 28 LYS A CB   9  
ATOM 6145  C CG   . LYS A 1 28 ? 35.567 -8.652  -4.858  1.00 0.00 ? 28 LYS A CG   9  
ATOM 6146  C CD   . LYS A 1 28 ? 35.716 -7.191  -5.307  1.00 0.00 ? 28 LYS A CD   9  
ATOM 6147  C CE   . LYS A 1 28 ? 35.631 -7.041  -6.824  1.00 0.00 ? 28 LYS A CE   9  
ATOM 6148  N NZ   . LYS A 1 28 ? 34.286 -7.232  -7.320  1.00 0.00 ? 28 LYS A NZ   9  
ATOM 6149  H H    . LYS A 1 28 ? 36.407 -8.629  -2.173  1.00 0.00 ? 28 LYS A H    9  
ATOM 6150  H HA   . LYS A 1 28 ? 34.406 -7.503  -2.469  1.00 0.00 ? 28 LYS A HA   9  
ATOM 6151  H HB2  . LYS A 1 28 ? 34.056 -10.005 -4.165  1.00 0.00 ? 28 LYS A HB2  9  
ATOM 6152  H HB3  . LYS A 1 28 ? 33.440 -8.419  -4.519  1.00 0.00 ? 28 LYS A HB3  9  
ATOM 6153  H HG2  . LYS A 1 28 ? 36.456 -8.955  -4.308  1.00 0.00 ? 28 LYS A HG2  9  
ATOM 6154  H HG3  . LYS A 1 28 ? 35.581 -9.302  -5.733  1.00 0.00 ? 28 LYS A HG3  9  
ATOM 6155  H HD2  . LYS A 1 28 ? 34.989 -6.537  -4.842  1.00 0.00 ? 28 LYS A HD2  9  
ATOM 6156  H HD3  . LYS A 1 28 ? 36.678 -6.811  -4.977  1.00 0.00 ? 28 LYS A HD3  9  
ATOM 6157  H HE2  . LYS A 1 28 ? 35.940 -6.039  -7.110  1.00 0.00 ? 28 LYS A HE2  9  
ATOM 6158  H HE3  . LYS A 1 28 ? 36.264 -7.762  -7.331  1.00 0.00 ? 28 LYS A HE3  9  
ATOM 6159  H HZ1  . LYS A 1 28 ? 34.057 -6.489  -8.012  1.00 0.00 ? 28 LYS A HZ1  9  
ATOM 6160  H HZ2  . LYS A 1 28 ? 33.644 -7.170  -6.507  1.00 0.00 ? 28 LYS A HZ2  9  
ATOM 6161  H HZ3  . LYS A 1 28 ? 34.206 -8.168  -7.770  1.00 0.00 ? 28 LYS A HZ3  9  
ATOM 6162  N N    . ASN A 1 29 ? 33.180 -8.720  -0.484  1.00 0.00 ? 29 ASN A N    9  
ATOM 6163  C CA   . ASN A 1 29 ? 32.113 -9.058  0.442   1.00 0.00 ? 29 ASN A CA   9  
ATOM 6164  C C    . ASN A 1 29 ? 31.163 -7.853  0.504   1.00 0.00 ? 29 ASN A C    9  
ATOM 6165  O O    . ASN A 1 29 ? 30.338 -7.698  -0.388  1.00 0.00 ? 29 ASN A O    9  
ATOM 6166  C CB   . ASN A 1 29 ? 32.714 -9.525  1.794   1.00 0.00 ? 29 ASN A CB   9  
ATOM 6167  C CG   . ASN A 1 29 ? 32.580 -11.049 1.982   1.00 0.00 ? 29 ASN A CG   9  
ATOM 6168  O OD1  . ASN A 1 29 ? 31.607 -11.534 2.524   1.00 0.00 ? 29 ASN A OD1  9  
ATOM 6169  N ND2  . ASN A 1 29 ? 33.625 -11.765 1.510   1.00 0.00 ? 29 ASN A ND2  9  
ATOM 6170  H H    . ASN A 1 29 ? 33.991 -8.248  -0.139  1.00 0.00 ? 29 ASN A H    9  
ATOM 6171  H HA   . ASN A 1 29 ? 31.529 -9.859  -0.015  1.00 0.00 ? 29 ASN A HA   9  
ATOM 6172  H HB2  . ASN A 1 29 ? 33.761 -9.235  1.861   1.00 0.00 ? 29 ASN A HB2  9  
ATOM 6173  H HB3  . ASN A 1 29 ? 32.219 -9.092  2.662   1.00 0.00 ? 29 ASN A HB3  9  
ATOM 6174  H HD21 . ASN A 1 29 ? 34.417 -11.327 1.083   1.00 0.00 ? 29 ASN A HD21 9  
ATOM 6175  H HD22 . ASN A 1 29 ? 33.611 -12.758 1.586   1.00 0.00 ? 29 ASN A HD22 9  
ATOM 6176  N N    . GLU A 1 30 ? 31.294 -7.038  1.576   1.00 0.00 ? 30 GLU A N    9  
ATOM 6177  C CA   . GLU A 1 30 ? 30.335 -5.957  1.823   1.00 0.00 ? 30 GLU A CA   9  
ATOM 6178  C C    . GLU A 1 30 ? 30.593 -5.367  3.213   1.00 0.00 ? 30 GLU A C    9  
ATOM 6179  O O    . GLU A 1 30 ? 31.240 -4.342  3.356   1.00 0.00 ? 30 GLU A O    9  
ATOM 6180  C CB   . GLU A 1 30 ? 28.859 -6.388  1.664   1.00 0.00 ? 30 GLU A CB   9  
ATOM 6181  C CG   . GLU A 1 30 ? 28.560 -7.837  2.133   1.00 0.00 ? 30 GLU A CG   9  
ATOM 6182  C CD   . GLU A 1 30 ? 27.300 -7.979  3.002   1.00 0.00 ? 30 GLU A CD   9  
ATOM 6183  O OE1  . GLU A 1 30 ? 26.927 -7.023  3.679   1.00 0.00 ? 30 GLU A OE1  9  
ATOM 6184  O OE2  . GLU A 1 30 ? 26.709 -9.059  3.000   1.00 0.00 ? 30 GLU A OE2  9  
ATOM 6185  H H    . GLU A 1 30 ? 32.033 -7.185  2.231   1.00 0.00 ? 30 GLU A H    9  
ATOM 6186  H HA   . GLU A 1 30 ? 30.564 -5.167  1.114   1.00 0.00 ? 30 GLU A HA   9  
ATOM 6187  H HB2  . GLU A 1 30 ? 28.223 -5.644  2.142   1.00 0.00 ? 30 GLU A HB2  9  
ATOM 6188  H HB3  . GLU A 1 30 ? 28.563 -6.296  0.622   1.00 0.00 ? 30 GLU A HB3  9  
ATOM 6189  H HG2  . GLU A 1 30 ? 28.455 -8.482  1.262   1.00 0.00 ? 30 GLU A HG2  9  
ATOM 6190  H HG3  . GLU A 1 30 ? 29.387 -8.265  2.699   1.00 0.00 ? 30 GLU A HG3  9  
ATOM 6191  N N    . ASN A 1 31 ? 30.045 -6.080  4.218   1.00 0.00 ? 31 ASN A N    9  
ATOM 6192  C CA   . ASN A 1 31 ? 30.188 -5.705  5.621   1.00 0.00 ? 31 ASN A CA   9  
ATOM 6193  C C    . ASN A 1 31 ? 31.667 -5.731  6.041   1.00 0.00 ? 31 ASN A C    9  
ATOM 6194  O O    . ASN A 1 31 ? 32.058 -5.077  6.997   1.00 0.00 ? 31 ASN A O    9  
ATOM 6195  C CB   . ASN A 1 31 ? 29.389 -6.716  6.477   1.00 0.00 ? 31 ASN A CB   9  
ATOM 6196  C CG   . ASN A 1 31 ? 28.255 -6.027  7.249   1.00 0.00 ? 31 ASN A CG   9  
ATOM 6197  O OD1  . ASN A 1 31 ? 27.503 -5.235  6.717   1.00 0.00 ? 31 ASN A OD1  9  
ATOM 6198  N ND2  . ASN A 1 31 ? 28.195 -6.392  8.550   1.00 0.00 ? 31 ASN A ND2  9  
ATOM 6199  H H    . ASN A 1 31 ? 29.540 -6.909  3.990   1.00 0.00 ? 31 ASN A H    9  
ATOM 6200  H HA   . ASN A 1 31 ? 29.816 -4.680  5.723   1.00 0.00 ? 31 ASN A HA   9  
ATOM 6201  H HB2  . ASN A 1 31 ? 28.944 -7.491  5.854   1.00 0.00 ? 31 ASN A HB2  9  
ATOM 6202  H HB3  . ASN A 1 31 ? 30.019 -7.258  7.182   1.00 0.00 ? 31 ASN A HB3  9  
ATOM 6203  H HD21 . ASN A 1 31 ? 28.839 -7.056  8.936   1.00 0.00 ? 31 ASN A HD21 9  
ATOM 6204  H HD22 . ASN A 1 31 ? 27.499 -5.992  9.138   1.00 0.00 ? 31 ASN A HD22 9  
ATOM 6205  N N    . LEU A 1 32 ? 32.444 -6.523  5.269   1.00 0.00 ? 32 LEU A N    9  
ATOM 6206  C CA   . LEU A 1 32 ? 33.869 -6.638  5.541   1.00 0.00 ? 32 LEU A CA   9  
ATOM 6207  C C    . LEU A 1 32 ? 34.595 -5.384  5.027   1.00 0.00 ? 32 LEU A C    9  
ATOM 6208  O O    . LEU A 1 32 ? 35.454 -4.831  5.688   1.00 0.00 ? 32 LEU A O    9  
ATOM 6209  C CB   . LEU A 1 32 ? 34.435 -7.882  4.828   1.00 0.00 ? 32 LEU A CB   9  
ATOM 6210  C CG   . LEU A 1 32 ? 35.480 -8.666  5.643   1.00 0.00 ? 32 LEU A CG   9  
ATOM 6211  C CD1  . LEU A 1 32 ? 36.391 -7.794  6.516   1.00 0.00 ? 32 LEU A CD1  9  
ATOM 6212  C CD2  . LEU A 1 32 ? 34.776 -9.715  6.499   1.00 0.00 ? 32 LEU A CD2  9  
ATOM 6213  H H    . LEU A 1 32 ? 32.046 -7.008  4.492   1.00 0.00 ? 32 LEU A H    9  
ATOM 6214  H HA   . LEU A 1 32 ? 33.966 -6.706  6.628   1.00 0.00 ? 32 LEU A HA   9  
ATOM 6215  H HB2  . LEU A 1 32 ? 33.620 -8.556  4.565   1.00 0.00 ? 32 LEU A HB2  9  
ATOM 6216  H HB3  . LEU A 1 32 ? 34.860 -7.626  3.859   1.00 0.00 ? 32 LEU A HB3  9  
ATOM 6217  H HG   . LEU A 1 32 ? 36.117 -9.194  4.932   1.00 0.00 ? 32 LEU A HG   9  
ATOM 6218  H HD11 . LEU A 1 32 ? 37.262 -8.361  6.843   1.00 0.00 ? 32 LEU A HD11 9  
ATOM 6219  H HD12 . LEU A 1 32 ? 35.871 -7.442  7.408   1.00 0.00 ? 32 LEU A HD12 9  
ATOM 6220  H HD13 . LEU A 1 32 ? 36.751 -6.924  5.977   1.00 0.00 ? 32 LEU A HD13 9  
ATOM 6221  H HD21 . LEU A 1 32 ? 35.490 -10.283 7.094   1.00 0.00 ? 32 LEU A HD21 9  
ATOM 6222  H HD22 . LEU A 1 32 ? 34.225 -10.411 5.867   1.00 0.00 ? 32 LEU A HD22 9  
ATOM 6223  H HD23 . LEU A 1 32 ? 34.068 -9.240  7.177   1.00 0.00 ? 32 LEU A HD23 9  
ATOM 6224  N N    . ALA A 1 33 ? 34.182 -4.996  3.796   1.00 0.00 ? 33 ALA A N    9  
ATOM 6225  C CA   . ALA A 1 33 ? 34.815 -3.860  3.142   1.00 0.00 ? 33 ALA A CA   9  
ATOM 6226  C C    . ALA A 1 33 ? 34.612 -2.568  3.925   1.00 0.00 ? 33 ALA A C    9  
ATOM 6227  O O    . ALA A 1 33 ? 35.551 -1.828  4.155   1.00 0.00 ? 33 ALA A O    9  
ATOM 6228  C CB   . ALA A 1 33 ? 34.265 -3.669  1.745   1.00 0.00 ? 33 ALA A CB   9  
ATOM 6229  H H    . ALA A 1 33 ? 33.475 -5.513  3.319   1.00 0.00 ? 33 ALA A H    9  
ATOM 6230  H HA   . ALA A 1 33 ? 35.879 -4.074  3.089   1.00 0.00 ? 33 ALA A HA   9  
ATOM 6231  H HB1  . ALA A 1 33 ? 34.882 -2.926  1.239   1.00 0.00 ? 33 ALA A HB1  9  
ATOM 6232  H HB2  . ALA A 1 33 ? 33.234 -3.313  1.758   1.00 0.00 ? 33 ALA A HB2  9  
ATOM 6233  H HB3  . ALA A 1 33 ? 34.294 -4.593  1.168   1.00 0.00 ? 33 ALA A HB3  9  
ATOM 6234  N N    . ALA A 1 34 ? 33.343 -2.372  4.348   1.00 0.00 ? 34 ALA A N    9  
ATOM 6235  C CA   . ALA A 1 34 ? 33.040 -1.256  5.240   1.00 0.00 ? 34 ALA A CA   9  
ATOM 6236  C C    . ALA A 1 34 ? 33.961 -1.300  6.464   1.00 0.00 ? 34 ALA A C    9  
ATOM 6237  O O    . ALA A 1 34 ? 34.603 -0.315  6.806   1.00 0.00 ? 34 ALA A O    9  
ATOM 6238  C CB   . ALA A 1 34 ? 31.569 -1.298  5.667   1.00 0.00 ? 34 ALA A CB   9  
ATOM 6239  H H    . ALA A 1 34 ? 32.631 -3.018  4.089   1.00 0.00 ? 34 ALA A H    9  
ATOM 6240  H HA   . ALA A 1 34 ? 33.239 -0.341  4.684   1.00 0.00 ? 34 ALA A HA   9  
ATOM 6241  H HB1  . ALA A 1 34 ? 31.324 -2.217  6.199   1.00 0.00 ? 34 ALA A HB1  9  
ATOM 6242  H HB2  . ALA A 1 34 ? 30.913 -1.233  4.800   1.00 0.00 ? 34 ALA A HB2  9  
ATOM 6243  H HB3  . ALA A 1 34 ? 31.333 -0.457  6.319   1.00 0.00 ? 34 ALA A HB3  9  
ATOM 6244  N N    . ASN A 1 35 ? 34.056 -2.490  7.069   1.00 0.00 ? 35 ASN A N    9  
ATOM 6245  C CA   . ASN A 1 35 ? 34.934 -2.612  8.231   1.00 0.00 ? 35 ASN A CA   9  
ATOM 6246  C C    . ASN A 1 35 ? 36.399 -2.215  7.929   1.00 0.00 ? 35 ASN A C    9  
ATOM 6247  O O    . ASN A 1 35 ? 37.061 -1.637  8.774   1.00 0.00 ? 35 ASN A O    9  
ATOM 6248  C CB   . ASN A 1 35 ? 34.889 -4.051  8.764   1.00 0.00 ? 35 ASN A CB   9  
ATOM 6249  C CG   . ASN A 1 35 ? 34.854 -4.029  10.299  1.00 0.00 ? 35 ASN A CG   9  
ATOM 6250  O OD1  . ASN A 1 35 ? 35.613 -3.340  10.954  1.00 0.00 ? 35 ASN A OD1  9  
ATOM 6251  N ND2  . ASN A 1 35 ? 33.881 -4.813  10.809  1.00 0.00 ? 35 ASN A ND2  9  
ATOM 6252  H H    . ASN A 1 35 ? 33.527 -3.270  6.733   1.00 0.00 ? 35 ASN A H    9  
ATOM 6253  H HA   . ASN A 1 35 ? 34.532 -1.897  8.956   1.00 0.00 ? 35 ASN A HA   9  
ATOM 6254  H HB2  . ASN A 1 35 ? 34.011 -4.565  8.386   1.00 0.00 ? 35 ASN A HB2  9  
ATOM 6255  H HB3  . ASN A 1 35 ? 35.737 -4.654  8.439   1.00 0.00 ? 35 ASN A HB3  9  
ATOM 6256  H HD21 . ASN A 1 35 ? 33.328 -5.386  10.202  1.00 0.00 ? 35 ASN A HD21 9  
ATOM 6257  H HD22 . ASN A 1 35 ? 33.700 -4.831  11.786  1.00 0.00 ? 35 ASN A HD22 9  
ATOM 6258  N N    . PHE A 1 36 ? 36.848 -2.535  6.693   1.00 0.00 ? 36 PHE A N    9  
ATOM 6259  C CA   . PHE A 1 36 ? 38.205 -2.184  6.261   1.00 0.00 ? 36 PHE A CA   9  
ATOM 6260  C C    . PHE A 1 36 ? 38.391 -0.647  6.261   1.00 0.00 ? 36 PHE A C    9  
ATOM 6261  O O    . PHE A 1 36 ? 39.345 -0.127  6.822   1.00 0.00 ? 36 PHE A O    9  
ATOM 6262  C CB   . PHE A 1 36 ? 38.463 -2.802  4.868   1.00 0.00 ? 36 PHE A CB   9  
ATOM 6263  C CG   . PHE A 1 36 ? 39.838 -2.543  4.285   1.00 0.00 ? 36 PHE A CG   9  
ATOM 6264  C CD1  . PHE A 1 36 ? 40.214 -1.266  3.877   1.00 0.00 ? 36 PHE A CD1  9  
ATOM 6265  C CD2  . PHE A 1 36 ? 40.736 -3.590  4.090   1.00 0.00 ? 36 PHE A CD2  9  
ATOM 6266  C CE1  . PHE A 1 36 ? 41.443 -1.028  3.281   1.00 0.00 ? 36 PHE A CE1  9  
ATOM 6267  C CE2  . PHE A 1 36 ? 41.971 -3.357  3.495   1.00 0.00 ? 36 PHE A CE2  9  
ATOM 6268  C CZ   . PHE A 1 36 ? 42.326 -2.079  3.086   1.00 0.00 ? 36 PHE A CZ   9  
ATOM 6269  H H    . PHE A 1 36 ? 36.220 -2.969  6.049   1.00 0.00 ? 36 PHE A H    9  
ATOM 6270  H HA   . PHE A 1 36 ? 38.890 -2.625  6.987   1.00 0.00 ? 36 PHE A HA   9  
ATOM 6271  H HB2  . PHE A 1 36 ? 38.288 -3.876  4.918   1.00 0.00 ? 36 PHE A HB2  9  
ATOM 6272  H HB3  . PHE A 1 36 ? 37.743 -2.434  4.146   1.00 0.00 ? 36 PHE A HB3  9  
ATOM 6273  H HD1  . PHE A 1 36 ? 39.542 -0.428  3.976   1.00 0.00 ? 36 PHE A HD1  9  
ATOM 6274  H HD2  . PHE A 1 36 ? 40.464 -4.596  4.374   1.00 0.00 ? 36 PHE A HD2  9  
ATOM 6275  H HE1  . PHE A 1 36 ? 41.692 -0.028  2.956   1.00 0.00 ? 36 PHE A HE1  9  
ATOM 6276  H HE2  . PHE A 1 36 ? 42.654 -4.178  3.330   1.00 0.00 ? 36 PHE A HE2  9  
ATOM 6277  H HZ   . PHE A 1 36 ? 43.277 -1.898  2.608   1.00 0.00 ? 36 PHE A HZ   9  
ATOM 6278  N N    . LEU A 1 37 ? 37.437 0.028   5.578   1.00 0.00 ? 37 LEU A N    9  
ATOM 6279  C CA   . LEU A 1 37 ? 37.580 1.451   5.290   1.00 0.00 ? 37 LEU A CA   9  
ATOM 6280  C C    . LEU A 1 37 ? 37.386 2.323   6.554   1.00 0.00 ? 37 LEU A C    9  
ATOM 6281  O O    . LEU A 1 37 ? 37.966 3.394   6.676   1.00 0.00 ? 37 LEU A O    9  
ATOM 6282  C CB   . LEU A 1 37 ? 36.573 1.874   4.211   1.00 0.00 ? 37 LEU A CB   9  
ATOM 6283  C CG   . LEU A 1 37 ? 36.745 1.219   2.822   1.00 0.00 ? 37 LEU A CG   9  
ATOM 6284  C CD1  . LEU A 1 37 ? 35.519 0.392   2.431   1.00 0.00 ? 37 LEU A CD1  9  
ATOM 6285  C CD2  . LEU A 1 37 ? 37.035 2.241   1.708   1.00 0.00 ? 37 LEU A CD2  9  
ATOM 6286  H H    . LEU A 1 37 ? 36.614 -0.438  5.263   1.00 0.00 ? 37 LEU A H    9  
ATOM 6287  H HA   . LEU A 1 37 ? 38.591 1.599   4.914   1.00 0.00 ? 37 LEU A HA   9  
ATOM 6288  H HB2  . LEU A 1 37 ? 35.565 1.702   4.570   1.00 0.00 ? 37 LEU A HB2  9  
ATOM 6289  H HB3  . LEU A 1 37 ? 36.657 2.949   4.128   1.00 0.00 ? 37 LEU A HB3  9  
ATOM 6290  H HG   . LEU A 1 37 ? 37.588 0.534   2.885   1.00 0.00 ? 37 LEU A HG   9  
ATOM 6291  H HD11 . LEU A 1 37 ? 35.800 -0.539  1.938   1.00 0.00 ? 37 LEU A HD11 9  
ATOM 6292  H HD12 . LEU A 1 37 ? 34.883 0.950   1.757   1.00 0.00 ? 37 LEU A HD12 9  
ATOM 6293  H HD13 . LEU A 1 37 ? 34.877 0.172   3.277   1.00 0.00 ? 37 LEU A HD13 9  
ATOM 6294  H HD21 . LEU A 1 37 ? 38.024 2.067   1.303   1.00 0.00 ? 37 LEU A HD21 9  
ATOM 6295  H HD22 . LEU A 1 37 ? 37.015 3.263   2.061   1.00 0.00 ? 37 LEU A HD22 9  
ATOM 6296  H HD23 . LEU A 1 37 ? 36.307 2.217   0.895   1.00 0.00 ? 37 LEU A HD23 9  
ATOM 6297  N N    . LEU A 1 38 ? 36.534 1.792   7.469   1.00 0.00 ? 38 LEU A N    9  
ATOM 6298  C CA   . LEU A 1 38 ? 36.150 2.519   8.680   1.00 0.00 ? 38 LEU A CA   9  
ATOM 6299  C C    . LEU A 1 38 ? 37.215 2.317   9.785   1.00 0.00 ? 38 LEU A C    9  
ATOM 6300  O O    . LEU A 1 38 ? 37.397 3.150   10.659  1.00 0.00 ? 38 LEU A O    9  
ATOM 6301  C CB   . LEU A 1 38 ? 34.749 2.108   9.209   1.00 0.00 ? 38 LEU A CB   9  
ATOM 6302  C CG   . LEU A 1 38 ? 33.556 2.043   8.214   1.00 0.00 ? 38 LEU A CG   9  
ATOM 6303  C CD1  . LEU A 1 38 ? 32.309 2.777   8.718   1.00 0.00 ? 38 LEU A CD1  9  
ATOM 6304  C CD2  . LEU A 1 38 ? 33.882 2.546   6.812   1.00 0.00 ? 38 LEU A CD2  9  
ATOM 6305  H H    . LEU A 1 38 ? 36.136 0.893   7.309   1.00 0.00 ? 38 LEU A H    9  
ATOM 6306  H HA   . LEU A 1 38 ? 36.137 3.572   8.408   1.00 0.00 ? 38 LEU A HA   9  
ATOM 6307  H HB2  . LEU A 1 38 ? 34.835 1.133   9.687   1.00 0.00 ? 38 LEU A HB2  9  
ATOM 6308  H HB3  . LEU A 1 38 ? 34.489 2.807   10.008  1.00 0.00 ? 38 LEU A HB3  9  
ATOM 6309  H HG   . LEU A 1 38 ? 33.244 1.003   8.146   1.00 0.00 ? 38 LEU A HG   9  
ATOM 6310  H HD11 . LEU A 1 38 ? 31.983 2.396   9.684   1.00 0.00 ? 38 LEU A HD11 9  
ATOM 6311  H HD12 . LEU A 1 38 ? 31.480 2.632   8.023   1.00 0.00 ? 38 LEU A HD12 9  
ATOM 6312  H HD13 . LEU A 1 38 ? 32.485 3.850   8.796   1.00 0.00 ? 38 LEU A HD13 9  
ATOM 6313  H HD21 . LEU A 1 38 ? 34.614 3.341   6.861   1.00 0.00 ? 38 LEU A HD21 9  
ATOM 6314  H HD22 . LEU A 1 38 ? 32.995 2.928   6.325   1.00 0.00 ? 38 LEU A HD22 9  
ATOM 6315  H HD23 . LEU A 1 38 ? 34.276 1.780   6.158   1.00 0.00 ? 38 LEU A HD23 9  
ATOM 6316  N N    . SER A 1 39 ? 37.906 1.157   9.654   1.00 0.00 ? 39 SER A N    9  
ATOM 6317  C CA   . SER A 1 39 ? 38.993 0.773   10.553  1.00 0.00 ? 39 SER A CA   9  
ATOM 6318  C C    . SER A 1 39 ? 40.250 1.628   10.302  1.00 0.00 ? 39 SER A C    9  
ATOM 6319  O O    . SER A 1 39 ? 41.060 1.808   11.199  1.00 0.00 ? 39 SER A O    9  
ATOM 6320  C CB   . SER A 1 39 ? 39.307 -0.722  10.352  1.00 0.00 ? 39 SER A CB   9  
ATOM 6321  O OG   . SER A 1 39 ? 40.436 -1.195  11.066  1.00 0.00 ? 39 SER A OG   9  
ATOM 6322  H H    . SER A 1 39 ? 37.680 0.541   8.906   1.00 0.00 ? 39 SER A H    9  
ATOM 6323  H HA   . SER A 1 39 ? 38.638 0.955   11.566  1.00 0.00 ? 39 SER A HA   9  
ATOM 6324  H HB2  . SER A 1 39 ? 38.435 -1.327  10.618  1.00 0.00 ? 39 SER A HB2  9  
ATOM 6325  H HB3  . SER A 1 39 ? 39.510 -0.913  9.298   1.00 0.00 ? 39 SER A HB3  9  
ATOM 6326  H HG   . SER A 1 39 ? 40.227 -1.279  11.993  1.00 0.00 ? 39 SER A HG   9  
ATOM 6327  N N    . GLN A 1 40 ? 40.346 2.151   9.053   1.00 0.00 ? 40 GLN A N    9  
ATOM 6328  C CA   . GLN A 1 40 ? 41.430 3.076   8.718   1.00 0.00 ? 40 GLN A CA   9  
ATOM 6329  C C    . GLN A 1 40 ? 41.100 4.491   9.246   1.00 0.00 ? 40 GLN A C    9  
ATOM 6330  O O    . GLN A 1 40 ? 40.526 5.320   8.551   1.00 0.00 ? 40 GLN A O    9  
ATOM 6331  C CB   . GLN A 1 40 ? 41.686 3.112   7.196   1.00 0.00 ? 40 GLN A CB   9  
ATOM 6332  C CG   . GLN A 1 40 ? 42.114 1.756   6.592   1.00 0.00 ? 40 GLN A CG   9  
ATOM 6333  C CD   . GLN A 1 40 ? 43.077 1.916   5.391   1.00 0.00 ? 40 GLN A CD   9  
ATOM 6334  O OE1  . GLN A 1 40 ? 43.276 2.990   4.852   1.00 0.00 ? 40 GLN A OE1  9  
ATOM 6335  N NE2  . GLN A 1 40 ? 43.657 0.753   5.022   1.00 0.00 ? 40 GLN A NE2  9  
ATOM 6336  H H    . GLN A 1 40 ? 39.651 1.932   8.372   1.00 0.00 ? 40 GLN A H    9  
ATOM 6337  H HA   . GLN A 1 40 ? 42.334 2.720   9.215   1.00 0.00 ? 40 GLN A HA   9  
ATOM 6338  H HB2  . GLN A 1 40 ? 40.810 3.484   6.662   1.00 0.00 ? 40 GLN A HB2  9  
ATOM 6339  H HB3  . GLN A 1 40 ? 42.471 3.846   7.022   1.00 0.00 ? 40 GLN A HB3  9  
ATOM 6340  H HG2  . GLN A 1 40 ? 42.599 1.129   7.337   1.00 0.00 ? 40 GLN A HG2  9  
ATOM 6341  H HG3  . GLN A 1 40 ? 41.241 1.201   6.263   1.00 0.00 ? 40 GLN A HG3  9  
ATOM 6342  H HE21 . GLN A 1 40 ? 43.488 -0.088  5.537   1.00 0.00 ? 40 GLN A HE21 9  
ATOM 6343  H HE22 . GLN A 1 40 ? 44.263 0.699   4.231   1.00 0.00 ? 40 GLN A HE22 9  
ATOM 6344  N N    . ASN A 1 41 ? 41.539 4.696   10.511  1.00 0.00 ? 41 ASN A N    9  
ATOM 6345  C CA   . ASN A 1 41 ? 41.411 5.968   11.231  1.00 0.00 ? 41 ASN A CA   9  
ATOM 6346  C C    . ASN A 1 41 ? 42.035 7.115   10.410  1.00 0.00 ? 41 ASN A C    9  
ATOM 6347  O O    . ASN A 1 41 ? 43.136 6.983   9.894   1.00 0.00 ? 41 ASN A O    9  
ATOM 6348  C CB   . ASN A 1 41 ? 42.128 5.884   12.595  1.00 0.00 ? 41 ASN A CB   9  
ATOM 6349  C CG   . ASN A 1 41 ? 41.986 4.501   13.261  1.00 0.00 ? 41 ASN A CG   9  
ATOM 6350  O OD1  . ASN A 1 41 ? 42.786 3.606   13.061  1.00 0.00 ? 41 ASN A OD1  9  
ATOM 6351  N ND2  . ASN A 1 41 ? 40.899 4.396   14.050  1.00 0.00 ? 41 ASN A ND2  9  
ATOM 6352  H H    . ASN A 1 41 ? 41.931 3.916   10.994  1.00 0.00 ? 41 ASN A H    9  
ATOM 6353  H HA   . ASN A 1 41 ? 40.342 6.135   11.369  1.00 0.00 ? 41 ASN A HA   9  
ATOM 6354  H HB2  . ASN A 1 41 ? 43.197 6.072   12.492  1.00 0.00 ? 41 ASN A HB2  9  
ATOM 6355  H HB3  . ASN A 1 41 ? 41.747 6.661   13.258  1.00 0.00 ? 41 ASN A HB3  9  
ATOM 6356  H HD21 . ASN A 1 41 ? 40.305 5.182   14.222  1.00 0.00 ? 41 ASN A HD21 9  
ATOM 6357  H HD22 . ASN A 1 41 ? 40.676 3.523   14.472  1.00 0.00 ? 41 ASN A HD22 9  
ATOM 6358  N N    . PHE A 1 42 ? 41.256 8.222   10.306  1.00 0.00 ? 42 PHE A N    9  
ATOM 6359  C CA   . PHE A 1 42 ? 41.657 9.347   9.454   1.00 0.00 ? 42 PHE A CA   9  
ATOM 6360  C C    . PHE A 1 42 ? 40.708 10.567  9.650   1.00 0.00 ? 42 PHE A C    9  
ATOM 6361  O O    . PHE A 1 42 ? 40.529 11.402  8.772   1.00 0.00 ? 42 PHE A O    9  
ATOM 6362  C CB   . PHE A 1 42 ? 41.731 8.871   7.979   1.00 0.00 ? 42 PHE A CB   9  
ATOM 6363  C CG   . PHE A 1 42 ? 42.066 9.976   7.012   1.00 0.00 ? 42 PHE A CG   9  
ATOM 6364  C CD1  . PHE A 1 42 ? 43.318 10.578  7.021   1.00 0.00 ? 42 PHE A CD1  9  
ATOM 6365  C CD2  . PHE A 1 42 ? 41.096 10.438  6.127   1.00 0.00 ? 42 PHE A CD2  9  
ATOM 6366  C CE1  . PHE A 1 42 ? 43.588 11.652  6.180   1.00 0.00 ? 42 PHE A CE1  9  
ATOM 6367  C CE2  . PHE A 1 42 ? 41.362 11.511  5.290   1.00 0.00 ? 42 PHE A CE2  9  
ATOM 6368  C CZ   . PHE A 1 42 ? 42.605 12.124  5.322   1.00 0.00 ? 42 PHE A CZ   9  
ATOM 6369  H H    . PHE A 1 42 ? 40.399 8.236   10.820  1.00 0.00 ? 42 PHE A H    9  
ATOM 6370  H HA   . PHE A 1 42 ? 42.641 9.658   9.806   1.00 0.00 ? 42 PHE A HA   9  
ATOM 6371  H HB2  . PHE A 1 42 ? 42.499 8.109   7.857   1.00 0.00 ? 42 PHE A HB2  9  
ATOM 6372  H HB3  . PHE A 1 42 ? 40.791 8.395   7.696   1.00 0.00 ? 42 PHE A HB3  9  
ATOM 6373  H HD1  . PHE A 1 42 ? 44.084 10.225  7.697   1.00 0.00 ? 42 PHE A HD1  9  
ATOM 6374  H HD2  . PHE A 1 42 ? 40.123 9.974   6.107   1.00 0.00 ? 42 PHE A HD2  9  
ATOM 6375  H HE1  . PHE A 1 42 ? 44.552 12.135  6.212   1.00 0.00 ? 42 PHE A HE1  9  
ATOM 6376  H HE2  . PHE A 1 42 ? 40.591 11.877  4.631   1.00 0.00 ? 42 PHE A HE2  9  
ATOM 6377  H HZ   . PHE A 1 42 ? 42.797 12.981  4.695   1.00 0.00 ? 42 PHE A HZ   9  
ATOM 6378  N N    . ASP A 1 43 ? 40.113 10.636  10.850  1.00 0.00 ? 43 ASP A N    9  
ATOM 6379  C CA   . ASP A 1 43 ? 39.176 11.718  11.135  1.00 0.00 ? 43 ASP A CA   9  
ATOM 6380  C C    . ASP A 1 43 ? 38.850 11.645  12.629  1.00 0.00 ? 43 ASP A C    9  
ATOM 6381  O O    . ASP A 1 43 ? 39.514 12.273  13.445  1.00 0.00 ? 43 ASP A O    9  
ATOM 6382  C CB   . ASP A 1 43 ? 37.920 11.633  10.226  1.00 0.00 ? 43 ASP A CB   9  
ATOM 6383  C CG   . ASP A 1 43 ? 36.860 12.735  10.472  1.00 0.00 ? 43 ASP A CG   9  
ATOM 6384  O OD1  . ASP A 1 43 ? 37.047 13.581  11.346  1.00 0.00 ? 43 ASP A OD1  9  
ATOM 6385  O OD2  . ASP A 1 43 ? 35.851 12.734  9.768   1.00 0.00 ? 43 ASP A OD2  9  
ATOM 6386  H H    . ASP A 1 43 ? 40.316 9.961   11.556  1.00 0.00 ? 43 ASP A H    9  
ATOM 6387  H HA   . ASP A 1 43 ? 39.707 12.656  10.953  1.00 0.00 ? 43 ASP A HA   9  
ATOM 6388  H HB2  . ASP A 1 43 ? 38.203 11.731  9.181   1.00 0.00 ? 43 ASP A HB2  9  
ATOM 6389  H HB3  . ASP A 1 43 ? 37.454 10.650  10.296  1.00 0.00 ? 43 ASP A HB3  9  
ATOM 6390  N N    . ASP A 1 44 ? 37.777 10.872  12.920  1.00 0.00 ? 44 ASP A N    9  
ATOM 6391  C CA   . ASP A 1 44 ? 37.212 10.780  14.262  1.00 0.00 ? 44 ASP A CA   9  
ATOM 6392  C C    . ASP A 1 44 ? 36.886 12.192  14.808  1.00 0.00 ? 44 ASP A C    9  
ATOM 6393  O O    . ASP A 1 44 ? 37.719 12.833  15.424  1.00 0.00 ? 44 ASP A O    9  
ATOM 6394  C CB   . ASP A 1 44 ? 38.176 9.979   15.164  1.00 0.00 ? 44 ASP A CB   9  
ATOM 6395  C CG   . ASP A 1 44 ? 37.564 9.624   16.538  1.00 0.00 ? 44 ASP A CG   9  
ATOM 6396  O OD1  . ASP A 1 44 ? 37.399 10.521  17.363  1.00 0.00 ? 44 ASP A OD1  9  
ATOM 6397  O OD2  . ASP A 1 44 ? 37.270 8.451   16.772  1.00 0.00 ? 44 ASP A OD2  9  
ATOM 6398  H H    . ASP A 1 44 ? 37.350 10.350  12.182  1.00 0.00 ? 44 ASP A H    9  
ATOM 6399  H HA   . ASP A 1 44 ? 36.279 10.228  14.150  1.00 0.00 ? 44 ASP A HA   9  
ATOM 6400  H HB2  . ASP A 1 44 ? 38.448 9.056   14.652  1.00 0.00 ? 44 ASP A HB2  9  
ATOM 6401  H HB3  . ASP A 1 44 ? 39.117 10.506  15.314  1.00 0.00 ? 44 ASP A HB3  9  
ATOM 6402  N N    . GLU A 1 45 ? 35.623 12.609  14.547  1.00 0.00 ? 45 GLU A N    9  
ATOM 6403  C CA   . GLU A 1 45 ? 35.099 13.886  15.047  1.00 0.00 ? 45 GLU A CA   9  
ATOM 6404  C C    . GLU A 1 45 ? 34.872 13.811  16.588  1.00 0.00 ? 45 GLU A C    9  
ATOM 6405  O O    . GLU A 1 45 ? 35.804 13.474  17.323  1.00 0.00 ? 45 GLU A O    9  
ATOM 6406  C CB   . GLU A 1 45 ? 33.798 14.213  14.265  1.00 0.00 ? 45 GLU A CB   9  
ATOM 6407  C CG   . GLU A 1 45 ? 34.048 14.948  12.935  1.00 0.00 ? 45 GLU A CG   9  
ATOM 6408  C CD   . GLU A 1 45 ? 34.178 16.486  13.057  1.00 0.00 ? 45 GLU A CD   9  
ATOM 6409  O OE1  . GLU A 1 45 ? 33.864 17.040  14.110  1.00 0.00 ? 45 GLU A OE1  9  
ATOM 6410  O OE2  . GLU A 1 45 ? 34.587 17.118  12.082  1.00 0.00 ? 45 GLU A OE2  9  
ATOM 6411  O OXT  . GLU A 1 45 ? 33.768 14.094  17.048  1.00 0.00 ? 45 GLU A OXT  9  
ATOM 6412  H H    . GLU A 1 45 ? 35.021 12.000  14.034  1.00 0.00 ? 45 GLU A H    9  
ATOM 6413  H HA   . GLU A 1 45 ? 35.854 14.647  14.835  1.00 0.00 ? 45 GLU A HA   9  
ATOM 6414  H HB2  . GLU A 1 45 ? 33.262 13.285  14.056  1.00 0.00 ? 45 GLU A HB2  9  
ATOM 6415  H HB3  . GLU A 1 45 ? 33.092 14.802  14.850  1.00 0.00 ? 45 GLU A HB3  9  
ATOM 6416  H HG2  . GLU A 1 45 ? 34.935 14.551  12.449  1.00 0.00 ? 45 GLU A HG2  9  
ATOM 6417  H HG3  . GLU A 1 45 ? 33.221 14.742  12.260  1.00 0.00 ? 45 GLU A HG3  9  
ATOM 6418  N N    . GLN A 1 1  ? 31.526 -6.602  -11.257 1.00 0.00 ? 1  GLN A N    10 
ATOM 6419  C CA   . GLN A 1 1  ? 30.481 -5.585  -11.313 1.00 0.00 ? 1  GLN A CA   10 
ATOM 6420  C C    . GLN A 1 1  ? 30.277 -4.875  -9.959  1.00 0.00 ? 1  GLN A C    10 
ATOM 6421  O O    . GLN A 1 1  ? 29.165 -4.565  -9.556  1.00 0.00 ? 1  GLN A O    10 
ATOM 6422  C CB   . GLN A 1 1  ? 29.141 -6.138  -11.836 1.00 0.00 ? 1  GLN A CB   10 
ATOM 6423  C CG   . GLN A 1 1  ? 28.430 -7.136  -10.889 1.00 0.00 ? 1  GLN A CG   10 
ATOM 6424  C CD   . GLN A 1 1  ? 26.996 -6.679  -10.549 1.00 0.00 ? 1  GLN A CD   10 
ATOM 6425  O OE1  . GLN A 1 1  ? 26.736 -6.064  -9.535  1.00 0.00 ? 1  GLN A OE1  10 
ATOM 6426  N NE2  . GLN A 1 1  ? 26.089 -7.016  -11.493 1.00 0.00 ? 1  GLN A NE2  10 
ATOM 6427  H H1   . GLN A 1 1  ? 32.452 -6.124  -11.158 1.00 0.00 ? 1  GLN A H1   10 
ATOM 6428  H H2   . GLN A 1 1  ? 31.538 -7.156  -12.136 1.00 0.00 ? 1  GLN A H2   10 
ATOM 6429  H H3   . GLN A 1 1  ? 31.372 -7.221  -10.439 1.00 0.00 ? 1  GLN A H3   10 
ATOM 6430  H HA   . GLN A 1 1  ? 30.824 -4.838  -12.025 1.00 0.00 ? 1  GLN A HA   10 
ATOM 6431  H HB2  . GLN A 1 1  ? 28.501 -5.292  -12.097 1.00 0.00 ? 1  GLN A HB2  10 
ATOM 6432  H HB3  . GLN A 1 1  ? 29.308 -6.626  -12.794 1.00 0.00 ? 1  GLN A HB3  10 
ATOM 6433  H HG2  . GLN A 1 1  ? 28.388 -8.120  -11.354 1.00 0.00 ? 1  GLN A HG2  10 
ATOM 6434  H HG3  . GLN A 1 1  ? 28.977 -7.280  -9.955  1.00 0.00 ? 1  GLN A HG3  10 
ATOM 6435  H HE21 . GLN A 1 1  ? 26.367 -7.542  -12.296 1.00 0.00 ? 1  GLN A HE21 10 
ATOM 6436  H HE22 . GLN A 1 1  ? 25.138 -6.735  -11.398 1.00 0.00 ? 1  GLN A HE22 10 
ATOM 6437  N N    . GLU A 1 2  ? 31.420 -4.655  -9.276  1.00 0.00 ? 2  GLU A N    10 
ATOM 6438  C CA   . GLU A 1 2  ? 31.355 -4.180  -7.897  1.00 0.00 ? 2  GLU A CA   10 
ATOM 6439  C C    . GLU A 1 2  ? 31.442 -2.650  -7.798  1.00 0.00 ? 2  GLU A C    10 
ATOM 6440  O O    . GLU A 1 2  ? 31.640 -2.115  -6.719  1.00 0.00 ? 2  GLU A O    10 
ATOM 6441  C CB   . GLU A 1 2  ? 32.462 -4.883  -7.096  1.00 0.00 ? 2  GLU A CB   10 
ATOM 6442  C CG   . GLU A 1 2  ? 32.110 -5.131  -5.627  1.00 0.00 ? 2  GLU A CG   10 
ATOM 6443  C CD   . GLU A 1 2  ? 30.803 -5.935  -5.460  1.00 0.00 ? 2  GLU A CD   10 
ATOM 6444  O OE1  . GLU A 1 2  ? 30.812 -7.135  -5.737  1.00 0.00 ? 2  GLU A OE1  10 
ATOM 6445  O OE2  . GLU A 1 2  ? 29.797 -5.356  -5.051  1.00 0.00 ? 2  GLU A OE2  10 
ATOM 6446  H H    . GLU A 1 2  ? 32.307 -4.869  -9.680  1.00 0.00 ? 2  GLU A H    10 
ATOM 6447  H HA   . GLU A 1 2  ? 30.379 -4.457  -7.501  1.00 0.00 ? 2  GLU A HA   10 
ATOM 6448  H HB2  . GLU A 1 2  ? 32.672 -5.847  -7.556  1.00 0.00 ? 2  GLU A HB2  10 
ATOM 6449  H HB3  . GLU A 1 2  ? 33.402 -4.333  -7.151  1.00 0.00 ? 2  GLU A HB3  10 
ATOM 6450  H HG2  . GLU A 1 2  ? 32.919 -5.701  -5.175  1.00 0.00 ? 2  GLU A HG2  10 
ATOM 6451  H HG3  . GLU A 1 2  ? 32.039 -4.185  -5.090  1.00 0.00 ? 2  GLU A HG3  10 
ATOM 6452  N N    . LYS A 1 3  ? 31.254 -2.008  -8.980  1.00 0.00 ? 3  LYS A N    10 
ATOM 6453  C CA   . LYS A 1 3  ? 31.228 -0.556  -9.148  1.00 0.00 ? 3  LYS A CA   10 
ATOM 6454  C C    . LYS A 1 3  ? 30.099 0.126   -8.336  1.00 0.00 ? 3  LYS A C    10 
ATOM 6455  O O    . LYS A 1 3  ? 30.166 1.311   -8.052  1.00 0.00 ? 3  LYS A O    10 
ATOM 6456  C CB   . LYS A 1 3  ? 31.147 -0.203  -10.632 1.00 0.00 ? 3  LYS A CB   10 
ATOM 6457  C CG   . LYS A 1 3  ? 29.973 -0.868  -11.346 1.00 0.00 ? 3  LYS A CG   10 
ATOM 6458  C CD   . LYS A 1 3  ? 29.784 -0.297  -12.752 1.00 0.00 ? 3  LYS A CD   10 
ATOM 6459  C CE   . LYS A 1 3  ? 28.340 -0.431  -13.224 1.00 0.00 ? 3  LYS A CE   10 
ATOM 6460  N NZ   . LYS A 1 3  ? 28.159 0.112   -14.564 1.00 0.00 ? 3  LYS A NZ   10 
ATOM 6461  H H    . LYS A 1 3  ? 31.138 -2.551  -9.807  1.00 0.00 ? 3  LYS A H    10 
ATOM 6462  H HA   . LYS A 1 3  ? 32.187 -0.166  -8.839  1.00 0.00 ? 3  LYS A HA   10 
ATOM 6463  H HB2  . LYS A 1 3  ? 31.080 0.881   -10.735 1.00 0.00 ? 3  LYS A HB2  10 
ATOM 6464  H HB3  . LYS A 1 3  ? 32.073 -0.484  -11.134 1.00 0.00 ? 3  LYS A HB3  10 
ATOM 6465  H HG2  . LYS A 1 3  ? 30.115 -1.948  -11.399 1.00 0.00 ? 3  LYS A HG2  10 
ATOM 6466  H HG3  . LYS A 1 3  ? 29.071 -0.715  -10.758 1.00 0.00 ? 3  LYS A HG3  10 
ATOM 6467  H HD2  . LYS A 1 3  ? 30.051 0.760   -12.761 1.00 0.00 ? 3  LYS A HD2  10 
ATOM 6468  H HD3  . LYS A 1 3  ? 30.465 -0.788  -13.447 1.00 0.00 ? 3  LYS A HD3  10 
ATOM 6469  H HE2  . LYS A 1 3  ? 28.037 -1.478  -13.230 1.00 0.00 ? 3  LYS A HE2  10 
ATOM 6470  H HE3  . LYS A 1 3  ? 27.677 0.109   -12.547 1.00 0.00 ? 3  LYS A HE3  10 
ATOM 6471  H HZ1  . LYS A 1 3  ? 28.453 1.111   -14.567 1.00 0.00 ? 3  LYS A HZ1  10 
ATOM 6472  H HZ2  . LYS A 1 3  ? 27.157 0.044   -14.837 1.00 0.00 ? 3  LYS A HZ2  10 
ATOM 6473  H HZ3  . LYS A 1 3  ? 28.746 -0.422  -15.236 1.00 0.00 ? 3  LYS A HZ3  10 
ATOM 6474  N N    . GLU A 1 4  ? 29.080 -0.693  -7.980  1.00 0.00 ? 4  GLU A N    10 
ATOM 6475  C CA   . GLU A 1 4  ? 27.943 -0.234  -7.181  1.00 0.00 ? 4  GLU A CA   10 
ATOM 6476  C C    . GLU A 1 4  ? 28.374 0.115   -5.754  1.00 0.00 ? 4  GLU A C    10 
ATOM 6477  O O    . GLU A 1 4  ? 27.917 1.078   -5.164  1.00 0.00 ? 4  GLU A O    10 
ATOM 6478  C CB   . GLU A 1 4  ? 26.875 -1.347  -7.114  1.00 0.00 ? 4  GLU A CB   10 
ATOM 6479  C CG   . GLU A 1 4  ? 25.539 -0.954  -7.765  1.00 0.00 ? 4  GLU A CG   10 
ATOM 6480  C CD   . GLU A 1 4  ? 25.269 -1.801  -9.019  1.00 0.00 ? 4  GLU A CD   10 
ATOM 6481  O OE1  . GLU A 1 4  ? 25.849 -1.504  -10.064 1.00 0.00 ? 4  GLU A OE1  10 
ATOM 6482  O OE2  . GLU A 1 4  ? 24.488 -2.747  -8.934  1.00 0.00 ? 4  GLU A OE2  10 
ATOM 6483  H H    . GLU A 1 4  ? 29.123 -1.650  -8.258  1.00 0.00 ? 4  GLU A H    10 
ATOM 6484  H HA   . GLU A 1 4  ? 27.572 0.680   -7.650  1.00 0.00 ? 4  GLU A HA   10 
ATOM 6485  H HB2  . GLU A 1 4  ? 27.278 -2.272  -7.528  1.00 0.00 ? 4  GLU A HB2  10 
ATOM 6486  H HB3  . GLU A 1 4  ? 26.657 -1.635  -6.085  1.00 0.00 ? 4  GLU A HB3  10 
ATOM 6487  H HG2  . GLU A 1 4  ? 24.728 -1.087  -7.048  1.00 0.00 ? 4  GLU A HG2  10 
ATOM 6488  H HG3  . GLU A 1 4  ? 25.512 0.102   -8.030  1.00 0.00 ? 4  GLU A HG3  10 
ATOM 6489  N N    . ALA A 1 5  ? 29.287 -0.744  -5.254  1.00 0.00 ? 5  ALA A N    10 
ATOM 6490  C CA   . ALA A 1 5  ? 29.836 -0.472  -3.941  1.00 0.00 ? 5  ALA A CA   10 
ATOM 6491  C C    . ALA A 1 5  ? 30.850 0.671   -4.014  1.00 0.00 ? 5  ALA A C    10 
ATOM 6492  O O    . ALA A 1 5  ? 31.190 1.232   -2.986  1.00 0.00 ? 5  ALA A O    10 
ATOM 6493  C CB   . ALA A 1 5  ? 30.462 -1.731  -3.345  1.00 0.00 ? 5  ALA A CB   10 
ATOM 6494  H H    . ALA A 1 5  ? 29.612 -1.518  -5.790  1.00 0.00 ? 5  ALA A H    10 
ATOM 6495  H HA   . ALA A 1 5  ? 29.012 -0.174  -3.295  1.00 0.00 ? 5  ALA A HA   10 
ATOM 6496  H HB1  . ALA A 1 5  ? 31.359 -2.041  -3.881  1.00 0.00 ? 5  ALA A HB1  10 
ATOM 6497  H HB2  . ALA A 1 5  ? 29.762 -2.565  -3.341  1.00 0.00 ? 5  ALA A HB2  10 
ATOM 6498  H HB3  . ALA A 1 5  ? 30.722 -1.548  -2.304  1.00 0.00 ? 5  ALA A HB3  10 
ATOM 6499  N N    . ILE A 1 6  ? 31.330 1.019   -5.223  1.00 0.00 ? 6  ILE A N    10 
ATOM 6500  C CA   . ILE A 1 6  ? 32.418 1.998   -5.292  1.00 0.00 ? 6  ILE A CA   10 
ATOM 6501  C C    . ILE A 1 6  ? 31.924 3.424   -5.029  1.00 0.00 ? 6  ILE A C    10 
ATOM 6502  O O    . ILE A 1 6  ? 32.672 4.252   -4.536  1.00 0.00 ? 6  ILE A O    10 
ATOM 6503  C CB   . ILE A 1 6  ? 33.225 1.879   -6.599  1.00 0.00 ? 6  ILE A CB   10 
ATOM 6504  C CG1  . ILE A 1 6  ? 33.628 0.424   -6.871  1.00 0.00 ? 6  ILE A CG1  10 
ATOM 6505  C CG2  . ILE A 1 6  ? 34.445 2.811   -6.652  1.00 0.00 ? 6  ILE A CG2  10 
ATOM 6506  C CD1  . ILE A 1 6  ? 34.426 -0.275  -5.775  1.00 0.00 ? 6  ILE A CD1  10 
ATOM 6507  H H    . ILE A 1 6  ? 30.966 0.604   -6.059  1.00 0.00 ? 6  ILE A H    10 
ATOM 6508  H HA   . ILE A 1 6  ? 33.074 1.756   -4.463  1.00 0.00 ? 6  ILE A HA   10 
ATOM 6509  H HB   . ILE A 1 6  ? 32.574 2.180   -7.420  1.00 0.00 ? 6  ILE A HB   10 
ATOM 6510  H HG12 . ILE A 1 6  ? 32.715 -0.142  -6.952  1.00 0.00 ? 6  ILE A HG12 10 
ATOM 6511  H HG13 . ILE A 1 6  ? 34.125 0.342   -7.839  1.00 0.00 ? 6  ILE A HG13 10 
ATOM 6512  H HG21 . ILE A 1 6  ? 35.255 2.372   -7.234  1.00 0.00 ? 6  ILE A HG21 10 
ATOM 6513  H HG22 . ILE A 1 6  ? 34.828 3.033   -5.660  1.00 0.00 ? 6  ILE A HG22 10 
ATOM 6514  H HG23 . ILE A 1 6  ? 34.183 3.763   -7.113  1.00 0.00 ? 6  ILE A HG23 10 
ATOM 6515  H HD11 . ILE A 1 6  ? 35.427 0.132   -5.662  1.00 0.00 ? 6  ILE A HD11 10 
ATOM 6516  H HD12 . ILE A 1 6  ? 34.511 -1.330  -6.031  1.00 0.00 ? 6  ILE A HD12 10 
ATOM 6517  H HD13 . ILE A 1 6  ? 33.914 -0.216  -4.816  1.00 0.00 ? 6  ILE A HD13 10 
ATOM 6518  N N    . GLU A 1 7  ? 30.637 3.659   -5.340  1.00 0.00 ? 7  GLU A N    10 
ATOM 6519  C CA   . GLU A 1 7  ? 30.028 4.946   -5.014  1.00 0.00 ? 7  GLU A CA   10 
ATOM 6520  C C    . GLU A 1 7  ? 29.481 4.959   -3.572  1.00 0.00 ? 7  GLU A C    10 
ATOM 6521  O O    . GLU A 1 7  ? 29.197 6.009   -3.025  1.00 0.00 ? 7  GLU A O    10 
ATOM 6522  C CB   . GLU A 1 7  ? 28.920 5.258   -6.031  1.00 0.00 ? 7  GLU A CB   10 
ATOM 6523  C CG   . GLU A 1 7  ? 27.797 4.207   -6.054  1.00 0.00 ? 7  GLU A CG   10 
ATOM 6524  C CD   . GLU A 1 7  ? 26.607 4.591   -6.956  1.00 0.00 ? 7  GLU A CD   10 
ATOM 6525  O OE1  . GLU A 1 7  ? 26.684 5.596   -7.663  1.00 0.00 ? 7  GLU A OE1  10 
ATOM 6526  O OE2  . GLU A 1 7  ? 25.607 3.873   -6.937  1.00 0.00 ? 7  GLU A OE2  10 
ATOM 6527  H H    . GLU A 1 7  ? 30.087 2.934   -5.749  1.00 0.00 ? 7  GLU A H    10 
ATOM 6528  H HA   . GLU A 1 7  ? 30.799 5.717   -5.081  1.00 0.00 ? 7  GLU A HA   10 
ATOM 6529  H HB2  . GLU A 1 7  ? 28.503 6.244   -5.815  1.00 0.00 ? 7  GLU A HB2  10 
ATOM 6530  H HB3  . GLU A 1 7  ? 29.363 5.316   -7.026  1.00 0.00 ? 7  GLU A HB3  10 
ATOM 6531  H HG2  . GLU A 1 7  ? 28.191 3.252   -6.396  1.00 0.00 ? 7  GLU A HG2  10 
ATOM 6532  H HG3  . GLU A 1 7  ? 27.415 4.046   -5.048  1.00 0.00 ? 7  GLU A HG3  10 
ATOM 6533  N N    . ARG A 1 8  ? 29.349 3.736   -3.008  1.00 0.00 ? 8  ARG A N    10 
ATOM 6534  C CA   . ARG A 1 8  ? 28.776 3.560   -1.679  1.00 0.00 ? 8  ARG A CA   10 
ATOM 6535  C C    . ARG A 1 8  ? 29.859 3.767   -0.615  1.00 0.00 ? 8  ARG A C    10 
ATOM 6536  O O    . ARG A 1 8  ? 29.711 4.576   0.283   1.00 0.00 ? 8  ARG A O    10 
ATOM 6537  C CB   . ARG A 1 8  ? 28.179 2.144   -1.591  1.00 0.00 ? 8  ARG A CB   10 
ATOM 6538  C CG   . ARG A 1 8  ? 26.735 2.099   -1.067  1.00 0.00 ? 8  ARG A CG   10 
ATOM 6539  C CD   . ARG A 1 8  ? 25.762 1.520   -2.098  1.00 0.00 ? 8  ARG A CD   10 
ATOM 6540  N NE   . ARG A 1 8  ? 24.559 0.994   -1.463  1.00 0.00 ? 8  ARG A NE   10 
ATOM 6541  C CZ   . ARG A 1 8  ? 23.602 1.766   -0.904  1.00 0.00 ? 8  ARG A CZ   10 
ATOM 6542  N NH1  . ARG A 1 8  ? 23.688 3.092   -0.911  1.00 0.00 ? 8  ARG A NH1  10 
ATOM 6543  N NH2  . ARG A 1 8  ? 22.557 1.172   -0.337  1.00 0.00 ? 8  ARG A NH2  10 
ATOM 6544  H H    . ARG A 1 8  ? 29.650 2.918   -3.493  1.00 0.00 ? 8  ARG A H    10 
ATOM 6545  H HA   . ARG A 1 8  ? 28.010 4.327   -1.559  1.00 0.00 ? 8  ARG A HA   10 
ATOM 6546  H HB2  . ARG A 1 8  ? 28.225 1.694   -2.580  1.00 0.00 ? 8  ARG A HB2  10 
ATOM 6547  H HB3  . ARG A 1 8  ? 28.789 1.475   -0.983  1.00 0.00 ? 8  ARG A HB3  10 
ATOM 6548  H HG2  . ARG A 1 8  ? 26.712 1.487   -0.168  1.00 0.00 ? 8  ARG A HG2  10 
ATOM 6549  H HG3  . ARG A 1 8  ? 26.389 3.083   -0.754  1.00 0.00 ? 8  ARG A HG3  10 
ATOM 6550  H HD2  . ARG A 1 8  ? 25.479 2.261   -2.845  1.00 0.00 ? 8  ARG A HD2  10 
ATOM 6551  H HD3  . ARG A 1 8  ? 26.205 0.675   -2.623  1.00 0.00 ? 8  ARG A HD3  10 
ATOM 6552  H HE   . ARG A 1 8  ? 24.440 0.003   -1.432  1.00 0.00 ? 8  ARG A HE   10 
ATOM 6553  H HH11 . ARG A 1 8  ? 24.477 3.543   -1.329  1.00 0.00 ? 8  ARG A HH11 10 
ATOM 6554  H HH12 . ARG A 1 8  ? 22.960 3.639   -0.495  1.00 0.00 ? 8  ARG A HH12 10 
ATOM 6555  H HH21 . ARG A 1 8  ? 22.490 0.174   -0.337  1.00 0.00 ? 8  ARG A HH21 10 
ATOM 6556  H HH22 . ARG A 1 8  ? 21.841 1.727   0.089   1.00 0.00 ? 8  ARG A HH22 10 
ATOM 6557  N N    . LEU A 1 9  ? 30.940 2.986   -0.822  1.00 0.00 ? 9  LEU A N    10 
ATOM 6558  C CA   . LEU A 1 9  ? 32.189 2.995   -0.071  1.00 0.00 ? 9  LEU A CA   10 
ATOM 6559  C C    . LEU A 1 9  ? 32.778 4.423   -0.111  1.00 0.00 ? 9  LEU A C    10 
ATOM 6560  O O    . LEU A 1 9  ? 33.112 4.995   0.915   1.00 0.00 ? 9  LEU A O    10 
ATOM 6561  C CB   . LEU A 1 9  ? 33.142 1.951   -0.662  1.00 0.00 ? 9  LEU A CB   10 
ATOM 6562  C CG   . LEU A 1 9  ? 32.613 0.506   -0.673  1.00 0.00 ? 9  LEU A CG   10 
ATOM 6563  C CD1  . LEU A 1 9  ? 33.322 -0.246  -1.805  1.00 0.00 ? 9  LEU A CD1  10 
ATOM 6564  C CD2  . LEU A 1 9  ? 32.757 -0.216  0.667   1.00 0.00 ? 9  LEU A CD2  10 
ATOM 6565  H H    . LEU A 1 9  ? 30.865 2.353   -1.578  1.00 0.00 ? 9  LEU A H    10 
ATOM 6566  H HA   . LEU A 1 9  ? 31.973 2.677   0.943   1.00 0.00 ? 9  LEU A HA   10 
ATOM 6567  H HB2  . LEU A 1 9  ? 33.349 2.265   -1.683  1.00 0.00 ? 9  LEU A HB2  10 
ATOM 6568  H HB3  . LEU A 1 9  ? 34.093 1.948   -0.133  1.00 0.00 ? 9  LEU A HB3  10 
ATOM 6569  H HG   . LEU A 1 9  ? 31.543 0.502   -0.857  1.00 0.00 ? 9  LEU A HG   10 
ATOM 6570  H HD11 . LEU A 1 9  ? 33.384 0.354   -2.705  1.00 0.00 ? 9  LEU A HD11 10 
ATOM 6571  H HD12 . LEU A 1 9  ? 32.775 -1.129  -2.101  1.00 0.00 ? 9  LEU A HD12 10 
ATOM 6572  H HD13 . LEU A 1 9  ? 34.346 -0.506  -1.534  1.00 0.00 ? 9  LEU A HD13 10 
ATOM 6573  H HD21 . LEU A 1 9  ? 33.736 -0.680  0.749   1.00 0.00 ? 9  LEU A HD21 10 
ATOM 6574  H HD22 . LEU A 1 9  ? 32.012 -1.001  0.770   1.00 0.00 ? 9  LEU A HD22 10 
ATOM 6575  H HD23 . LEU A 1 9  ? 32.622 0.465   1.504   1.00 0.00 ? 9  LEU A HD23 10 
ATOM 6576  N N    . LYS A 1 10 ? 32.824 4.989   -1.337  1.00 0.00 ? 10 LYS A N    10 
ATOM 6577  C CA   . LYS A 1 10 ? 33.247 6.389   -1.480  1.00 0.00 ? 10 LYS A CA   10 
ATOM 6578  C C    . LYS A 1 10 ? 32.318 7.378   -0.743  1.00 0.00 ? 10 LYS A C    10 
ATOM 6579  O O    . LYS A 1 10 ? 32.770 8.390   -0.233  1.00 0.00 ? 10 LYS A O    10 
ATOM 6580  C CB   . LYS A 1 10 ? 33.254 6.802   -2.953  1.00 0.00 ? 10 LYS A CB   10 
ATOM 6581  C CG   . LYS A 1 10 ? 34.490 6.329   -3.701  1.00 0.00 ? 10 LYS A CG   10 
ATOM 6582  C CD   . LYS A 1 10 ? 34.498 6.737   -5.180  1.00 0.00 ? 10 LYS A CD   10 
ATOM 6583  C CE   . LYS A 1 10 ? 33.668 7.974   -5.534  1.00 0.00 ? 10 LYS A CE   10 
ATOM 6584  N NZ   . LYS A 1 10 ? 33.761 8.264   -6.957  1.00 0.00 ? 10 LYS A NZ   10 
ATOM 6585  H H    . LYS A 1 10 ? 32.536 4.451   -2.130  1.00 0.00 ? 10 LYS A H    10 
ATOM 6586  H HA   . LYS A 1 10 ? 34.249 6.477   -1.055  1.00 0.00 ? 10 LYS A HA   10 
ATOM 6587  H HB2  . LYS A 1 10 ? 32.349 6.464   -3.456  1.00 0.00 ? 10 LYS A HB2  10 
ATOM 6588  H HB3  . LYS A 1 10 ? 33.260 7.891   -3.011  1.00 0.00 ? 10 LYS A HB3  10 
ATOM 6589  H HG2  . LYS A 1 10 ? 35.352 6.748   -3.192  1.00 0.00 ? 10 LYS A HG2  10 
ATOM 6590  H HG3  . LYS A 1 10 ? 34.591 5.248   -3.624  1.00 0.00 ? 10 LYS A HG3  10 
ATOM 6591  H HD2  . LYS A 1 10 ? 35.527 6.926   -5.478  1.00 0.00 ? 10 LYS A HD2  10 
ATOM 6592  H HD3  . LYS A 1 10 ? 34.130 5.898   -5.773  1.00 0.00 ? 10 LYS A HD3  10 
ATOM 6593  H HE2  . LYS A 1 10 ? 32.613 7.801   -5.310  1.00 0.00 ? 10 LYS A HE2  10 
ATOM 6594  H HE3  . LYS A 1 10 ? 34.006 8.856   -4.986  1.00 0.00 ? 10 LYS A HE3  10 
ATOM 6595  H HZ1  . LYS A 1 10 ? 34.284 9.150   -7.115  1.00 0.00 ? 10 LYS A HZ1  10 
ATOM 6596  H HZ2  . LYS A 1 10 ? 32.805 8.346   -7.358  1.00 0.00 ? 10 LYS A HZ2  10 
ATOM 6597  H HZ3  . LYS A 1 10 ? 34.261 7.478   -7.418  1.00 0.00 ? 10 LYS A HZ3  10 
ATOM 6598  N N    . ALA A 1 11 ? 31.008 7.041   -0.744  1.00 0.00 ? 11 ALA A N    10 
ATOM 6599  C CA   . ALA A 1 11 ? 30.008 7.940   -0.161  1.00 0.00 ? 11 ALA A CA   10 
ATOM 6600  C C    . ALA A 1 11 ? 30.149 8.081   1.367   1.00 0.00 ? 11 ALA A C    10 
ATOM 6601  O O    . ALA A 1 11 ? 29.657 9.040   1.941   1.00 0.00 ? 11 ALA A O    10 
ATOM 6602  C CB   . ALA A 1 11 ? 28.588 7.479   -0.511  1.00 0.00 ? 11 ALA A CB   10 
ATOM 6603  H H    . ALA A 1 11 ? 30.725 6.187   -1.172  1.00 0.00 ? 11 ALA A H    10 
ATOM 6604  H HA   . ALA A 1 11 ? 30.172 8.922   -0.609  1.00 0.00 ? 11 ALA A HA   10 
ATOM 6605  H HB1  . ALA A 1 11 ? 28.358 7.712   -1.549  1.00 0.00 ? 11 ALA A HB1  10 
ATOM 6606  H HB2  . ALA A 1 11 ? 27.839 7.980   0.103   1.00 0.00 ? 11 ALA A HB2  10 
ATOM 6607  H HB3  . ALA A 1 11 ? 28.447 6.410   -0.375  1.00 0.00 ? 11 ALA A HB3  10 
ATOM 6608  N N    . LEU A 1 12 ? 30.858 7.106   1.985   1.00 0.00 ? 12 LEU A N    10 
ATOM 6609  C CA   . LEU A 1 12 ? 31.141 7.179   3.416   1.00 0.00 ? 12 LEU A CA   10 
ATOM 6610  C C    . LEU A 1 12 ? 32.290 8.184   3.724   1.00 0.00 ? 12 LEU A C    10 
ATOM 6611  O O    . LEU A 1 12 ? 32.712 8.300   4.865   1.00 0.00 ? 12 LEU A O    10 
ATOM 6612  C CB   . LEU A 1 12 ? 31.530 5.781   3.925   1.00 0.00 ? 12 LEU A CB   10 
ATOM 6613  C CG   . LEU A 1 12 ? 30.418 4.707   3.980   1.00 0.00 ? 12 LEU A CG   10 
ATOM 6614  C CD1  . LEU A 1 12 ? 30.603 3.683   2.862   1.00 0.00 ? 12 LEU A CD1  10 
ATOM 6615  C CD2  . LEU A 1 12 ? 30.430 3.946   5.309   1.00 0.00 ? 12 LEU A CD2  10 
ATOM 6616  H H    . LEU A 1 12 ? 31.236 6.345   1.463   1.00 0.00 ? 12 LEU A H    10 
ATOM 6617  H HA   . LEU A 1 12 ? 30.241 7.528   3.923   1.00 0.00 ? 12 LEU A HA   10 
ATOM 6618  H HB2  . LEU A 1 12 ? 32.321 5.431   3.273   1.00 0.00 ? 12 LEU A HB2  10 
ATOM 6619  H HB3  . LEU A 1 12 ? 31.967 5.877   4.915   1.00 0.00 ? 12 LEU A HB3  10 
ATOM 6620  H HG   . LEU A 1 12 ? 29.449 5.196   3.869   1.00 0.00 ? 12 LEU A HG   10 
ATOM 6621  H HD11 . LEU A 1 12 ? 31.040 4.191   2.015   1.00 0.00 ? 12 LEU A HD11 10 
ATOM 6622  H HD12 . LEU A 1 12 ? 29.659 3.228   2.561   1.00 0.00 ? 12 LEU A HD12 10 
ATOM 6623  H HD13 . LEU A 1 12 ? 31.298 2.885   3.134   1.00 0.00 ? 12 LEU A HD13 10 
ATOM 6624  H HD21 . LEU A 1 12 ? 31.268 3.255   5.338   1.00 0.00 ? 12 LEU A HD21 10 
ATOM 6625  H HD22 . LEU A 1 12 ? 29.533 3.339   5.420   1.00 0.00 ? 12 LEU A HD22 10 
ATOM 6626  H HD23 . LEU A 1 12 ? 30.521 4.619   6.161   1.00 0.00 ? 12 LEU A HD23 10 
ATOM 6627  N N    . GLY A 1 13 ? 32.756 8.898   2.667   1.00 0.00 ? 13 GLY A N    10 
ATOM 6628  C CA   . GLY A 1 13 ? 33.778 9.934   2.809   1.00 0.00 ? 13 GLY A CA   10 
ATOM 6629  C C    . GLY A 1 13 ? 35.187 9.408   2.501   1.00 0.00 ? 13 GLY A C    10 
ATOM 6630  O O    . GLY A 1 13 ? 36.155 9.863   3.093   1.00 0.00 ? 13 GLY A O    10 
ATOM 6631  H H    . GLY A 1 13 ? 32.378 8.745   1.759   1.00 0.00 ? 13 GLY A H    10 
ATOM 6632  H HA2  . GLY A 1 13 ? 33.527 10.735  2.112   1.00 0.00 ? 13 GLY A HA2  10 
ATOM 6633  H HA3  . GLY A 1 13 ? 33.747 10.330  3.825   1.00 0.00 ? 13 GLY A HA3  10 
ATOM 6634  N N    . PHE A 1 14 ? 35.227 8.421   1.567   1.00 0.00 ? 14 PHE A N    10 
ATOM 6635  C CA   . PHE A 1 14 ? 36.458 7.709   1.202   1.00 0.00 ? 14 PHE A CA   10 
ATOM 6636  C C    . PHE A 1 14 ? 36.843 8.082   -0.252  1.00 0.00 ? 14 PHE A C    10 
ATOM 6637  O O    . PHE A 1 14 ? 36.635 9.217   -0.673  1.00 0.00 ? 14 PHE A O    10 
ATOM 6638  C CB   . PHE A 1 14 ? 36.249 6.188   1.418   1.00 0.00 ? 14 PHE A CB   10 
ATOM 6639  C CG   . PHE A 1 14 ? 35.753 5.827   2.801   1.00 0.00 ? 14 PHE A CG   10 
ATOM 6640  C CD1  . PHE A 1 14 ? 35.989 6.644   3.908   1.00 0.00 ? 14 PHE A CD1  10 
ATOM 6641  C CD2  . PHE A 1 14 ? 34.990 4.676   2.970   1.00 0.00 ? 14 PHE A CD2  10 
ATOM 6642  C CE1  . PHE A 1 14 ? 35.374 6.378   5.121   1.00 0.00 ? 14 PHE A CE1  10 
ATOM 6643  C CE2  . PHE A 1 14 ? 34.378 4.407   4.185   1.00 0.00 ? 14 PHE A CE2  10 
ATOM 6644  C CZ   . PHE A 1 14 ? 34.546 5.283   5.253   1.00 0.00 ? 14 PHE A CZ   10 
ATOM 6645  H H    . PHE A 1 14 ? 34.373 8.134   1.141   1.00 0.00 ? 14 PHE A H    10 
ATOM 6646  H HA   . PHE A 1 14 ? 37.258 8.072   1.843   1.00 0.00 ? 14 PHE A HA   10 
ATOM 6647  H HB2  . PHE A 1 14 ? 35.514 5.841   0.689   1.00 0.00 ? 14 PHE A HB2  10 
ATOM 6648  H HB3  . PHE A 1 14 ? 37.158 5.622   1.240   1.00 0.00 ? 14 PHE A HB3  10 
ATOM 6649  H HD1  . PHE A 1 14 ? 36.635 7.508   3.856   1.00 0.00 ? 14 PHE A HD1  10 
ATOM 6650  H HD2  . PHE A 1 14 ? 34.865 3.980   2.148   1.00 0.00 ? 14 PHE A HD2  10 
ATOM 6651  H HE1  . PHE A 1 14 ? 35.524 7.035   5.963   1.00 0.00 ? 14 PHE A HE1  10 
ATOM 6652  H HE2  . PHE A 1 14 ? 33.746 3.536   4.277   1.00 0.00 ? 14 PHE A HE2  10 
ATOM 6653  H HZ   . PHE A 1 14 ? 34.025 5.138   6.191   1.00 0.00 ? 14 PHE A HZ   10 
ATOM 6654  N N    . GLU A 1 15 ? 37.415 7.094   -0.978  1.00 0.00 ? 15 GLU A N    10 
ATOM 6655  C CA   . GLU A 1 15 ? 37.912 7.286   -2.345  1.00 0.00 ? 15 GLU A CA   10 
ATOM 6656  C C    . GLU A 1 15 ? 38.018 5.913   -3.013  1.00 0.00 ? 15 GLU A C    10 
ATOM 6657  O O    . GLU A 1 15 ? 38.422 4.948   -2.372  1.00 0.00 ? 15 GLU A O    10 
ATOM 6658  C CB   . GLU A 1 15 ? 39.308 7.940   -2.351  1.00 0.00 ? 15 GLU A CB   10 
ATOM 6659  C CG   . GLU A 1 15 ? 39.591 8.721   -3.650  1.00 0.00 ? 15 GLU A CG   10 
ATOM 6660  C CD   . GLU A 1 15 ? 39.230 10.220  -3.582  1.00 0.00 ? 15 GLU A CD   10 
ATOM 6661  O OE1  . GLU A 1 15 ? 38.657 10.660  -2.585  1.00 0.00 ? 15 GLU A OE1  10 
ATOM 6662  O OE2  . GLU A 1 15 ? 39.536 10.937  -4.534  1.00 0.00 ? 15 GLU A OE2  10 
ATOM 6663  H H    . GLU A 1 15 ? 37.513 6.190   -0.568  1.00 0.00 ? 15 GLU A H    10 
ATOM 6664  H HA   . GLU A 1 15 ? 37.189 7.904   -2.879  1.00 0.00 ? 15 GLU A HA   10 
ATOM 6665  H HB2  . GLU A 1 15 ? 39.427 8.571   -1.472  1.00 0.00 ? 15 GLU A HB2  10 
ATOM 6666  H HB3  . GLU A 1 15 ? 40.100 7.196   -2.248  1.00 0.00 ? 15 GLU A HB3  10 
ATOM 6667  H HG2  . GLU A 1 15 ? 40.645 8.638   -3.897  1.00 0.00 ? 15 GLU A HG2  10 
ATOM 6668  H HG3  . GLU A 1 15 ? 39.076 8.270   -4.496  1.00 0.00 ? 15 GLU A HG3  10 
ATOM 6669  N N    . GLU A 1 16 ? 37.657 5.886   -4.314  1.00 0.00 ? 16 GLU A N    10 
ATOM 6670  C CA   . GLU A 1 16 ? 37.572 4.680   -5.146  1.00 0.00 ? 16 GLU A CA   10 
ATOM 6671  C C    . GLU A 1 16 ? 38.840 3.782   -5.099  1.00 0.00 ? 16 GLU A C    10 
ATOM 6672  O O    . GLU A 1 16 ? 38.775 2.605   -5.421  1.00 0.00 ? 16 GLU A O    10 
ATOM 6673  C CB   . GLU A 1 16 ? 37.183 5.077   -6.581  1.00 0.00 ? 16 GLU A CB   10 
ATOM 6674  C CG   . GLU A 1 16 ? 37.562 4.089   -7.701  1.00 0.00 ? 16 GLU A CG   10 
ATOM 6675  C CD   . GLU A 1 16 ? 36.822 4.387   -9.020  1.00 0.00 ? 16 GLU A CD   10 
ATOM 6676  O OE1  . GLU A 1 16 ? 36.663 5.560   -9.353  1.00 0.00 ? 16 GLU A OE1  10 
ATOM 6677  O OE2  . GLU A 1 16 ? 36.413 3.444   -9.699  1.00 0.00 ? 16 GLU A OE2  10 
ATOM 6678  H H    . GLU A 1 16 ? 37.354 6.750   -4.712  1.00 0.00 ? 16 GLU A H    10 
ATOM 6679  H HA   . GLU A 1 16 ? 36.721 4.136   -4.741  1.00 0.00 ? 16 GLU A HA   10 
ATOM 6680  H HB2  . GLU A 1 16 ? 36.102 5.208   -6.607  1.00 0.00 ? 16 GLU A HB2  10 
ATOM 6681  H HB3  . GLU A 1 16 ? 37.630 6.046   -6.798  1.00 0.00 ? 16 GLU A HB3  10 
ATOM 6682  H HG2  . GLU A 1 16 ? 38.632 4.155   -7.889  1.00 0.00 ? 16 GLU A HG2  10 
ATOM 6683  H HG3  . GLU A 1 16 ? 37.339 3.065   -7.406  1.00 0.00 ? 16 GLU A HG3  10 
ATOM 6684  N N    . SER A 1 17 ? 39.978 4.372   -4.680  1.00 0.00 ? 17 SER A N    10 
ATOM 6685  C CA   . SER A 1 17 ? 41.208 3.600   -4.567  1.00 0.00 ? 17 SER A CA   10 
ATOM 6686  C C    . SER A 1 17 ? 41.227 2.785   -3.262  1.00 0.00 ? 17 SER A C    10 
ATOM 6687  O O    . SER A 1 17 ? 41.425 1.583   -3.292  1.00 0.00 ? 17 SER A O    10 
ATOM 6688  C CB   . SER A 1 17 ? 42.406 4.566   -4.593  1.00 0.00 ? 17 SER A CB   10 
ATOM 6689  O OG   . SER A 1 17 ? 43.041 4.635   -5.854  1.00 0.00 ? 17 SER A OG   10 
ATOM 6690  H H    . SER A 1 17 ? 39.990 5.333   -4.411  1.00 0.00 ? 17 SER A H    10 
ATOM 6691  H HA   . SER A 1 17 ? 41.219 2.891   -5.403  1.00 0.00 ? 17 SER A HA   10 
ATOM 6692  H HB2  . SER A 1 17 ? 42.068 5.573   -4.364  1.00 0.00 ? 17 SER A HB2  10 
ATOM 6693  H HB3  . SER A 1 17 ? 43.140 4.351   -3.810  1.00 0.00 ? 17 SER A HB3  10 
ATOM 6694  H HG   . SER A 1 17 ? 43.375 3.777   -6.092  1.00 0.00 ? 17 SER A HG   10 
ATOM 6695  N N    . LEU A 1 18 ? 41.015 3.505   -2.127  1.00 0.00 ? 18 LEU A N    10 
ATOM 6696  C CA   . LEU A 1 18 ? 41.011 2.815   -0.827  1.00 0.00 ? 18 LEU A CA   10 
ATOM 6697  C C    . LEU A 1 18 ? 39.831 1.851   -0.724  1.00 0.00 ? 18 LEU A C    10 
ATOM 6698  O O    . LEU A 1 18 ? 39.860 0.908   0.073   1.00 0.00 ? 18 LEU A O    10 
ATOM 6699  C CB   . LEU A 1 18 ? 41.107 3.791   0.368   1.00 0.00 ? 18 LEU A CB   10 
ATOM 6700  C CG   . LEU A 1 18 ? 39.831 4.506   0.875   1.00 0.00 ? 18 LEU A CG   10 
ATOM 6701  C CD1  . LEU A 1 18 ? 39.561 4.242   2.367   1.00 0.00 ? 18 LEU A CD1  10 
ATOM 6702  C CD2  . LEU A 1 18 ? 39.923 6.017   0.653   1.00 0.00 ? 18 LEU A CD2  10 
ATOM 6703  H H    . LEU A 1 18 ? 40.838 4.482   -2.202  1.00 0.00 ? 18 LEU A H    10 
ATOM 6704  H HA   . LEU A 1 18 ? 41.913 2.205   -0.810  1.00 0.00 ? 18 LEU A HA   10 
ATOM 6705  H HB2  . LEU A 1 18 ? 41.516 3.222   1.194   1.00 0.00 ? 18 LEU A HB2  10 
ATOM 6706  H HB3  . LEU A 1 18 ? 41.881 4.522   0.150   1.00 0.00 ? 18 LEU A HB3  10 
ATOM 6707  H HG   . LEU A 1 18 ? 38.978 4.131   0.316   1.00 0.00 ? 18 LEU A HG   10 
ATOM 6708  H HD11 . LEU A 1 18 ? 39.586 3.179   2.607   1.00 0.00 ? 18 LEU A HD11 10 
ATOM 6709  H HD12 . LEU A 1 18 ? 38.583 4.639   2.642   1.00 0.00 ? 18 LEU A HD12 10 
ATOM 6710  H HD13 . LEU A 1 18 ? 40.299 4.736   2.999   1.00 0.00 ? 18 LEU A HD13 10 
ATOM 6711  H HD21 . LEU A 1 18 ? 40.828 6.430   1.097   1.00 0.00 ? 18 LEU A HD21 10 
ATOM 6712  H HD22 . LEU A 1 18 ? 39.088 6.551   1.104   1.00 0.00 ? 18 LEU A HD22 10 
ATOM 6713  H HD23 . LEU A 1 18 ? 39.948 6.226   -0.410  1.00 0.00 ? 18 LEU A HD23 10 
ATOM 6714  N N    . VAL A 1 19 ? 38.838 2.135   -1.572  1.00 0.00 ? 19 VAL A N    10 
ATOM 6715  C CA   . VAL A 1 19 ? 37.563 1.451   -1.724  1.00 0.00 ? 19 VAL A CA   10 
ATOM 6716  C C    . VAL A 1 19 ? 37.739 0.128   -2.470  1.00 0.00 ? 19 VAL A C    10 
ATOM 6717  O O    . VAL A 1 19 ? 37.400 -0.925  -1.960  1.00 0.00 ? 19 VAL A O    10 
ATOM 6718  C CB   . VAL A 1 19 ? 36.675 2.436   -2.496  1.00 0.00 ? 19 VAL A CB   10 
ATOM 6719  C CG1  . VAL A 1 19 ? 35.613 1.803   -3.395  1.00 0.00 ? 19 VAL A CG1  10 
ATOM 6720  C CG2  . VAL A 1 19 ? 36.119 3.567   -1.611  1.00 0.00 ? 19 VAL A CG2  10 
ATOM 6721  H H    . VAL A 1 19 ? 38.974 2.924   -2.181  1.00 0.00 ? 19 VAL A H    10 
ATOM 6722  H HA   . VAL A 1 19 ? 37.166 1.212   -0.743  1.00 0.00 ? 19 VAL A HA   10 
ATOM 6723  H HB   . VAL A 1 19 ? 37.365 2.914   -3.184  1.00 0.00 ? 19 VAL A HB   10 
ATOM 6724  H HG11 . VAL A 1 19 ? 36.003 1.743   -4.410  1.00 0.00 ? 19 VAL A HG11 10 
ATOM 6725  H HG12 . VAL A 1 19 ? 34.717 2.413   -3.414  1.00 0.00 ? 19 VAL A HG12 10 
ATOM 6726  H HG13 . VAL A 1 19 ? 35.335 0.796   -3.098  1.00 0.00 ? 19 VAL A HG13 10 
ATOM 6727  H HG21 . VAL A 1 19 ? 36.815 3.836   -0.819  1.00 0.00 ? 19 VAL A HG21 10 
ATOM 6728  H HG22 . VAL A 1 19 ? 35.170 3.355   -1.143  1.00 0.00 ? 19 VAL A HG22 10 
ATOM 6729  H HG23 . VAL A 1 19 ? 35.941 4.450   -2.213  1.00 0.00 ? 19 VAL A HG23 10 
ATOM 6730  N N    . ILE A 1 20 ? 38.265 0.260   -3.706  1.00 0.00 ? 20 ILE A N    10 
ATOM 6731  C CA   . ILE A 1 20 ? 38.469 -0.907  -4.561  1.00 0.00 ? 20 ILE A CA   10 
ATOM 6732  C C    . ILE A 1 20 ? 39.337 -1.935  -3.847  1.00 0.00 ? 20 ILE A C    10 
ATOM 6733  O O    . ILE A 1 20 ? 38.995 -3.103  -3.811  1.00 0.00 ? 20 ILE A O    10 
ATOM 6734  C CB   . ILE A 1 20 ? 39.066 -0.493  -5.926  1.00 0.00 ? 20 ILE A CB   10 
ATOM 6735  C CG1  . ILE A 1 20 ? 37.980 0.038   -6.873  1.00 0.00 ? 20 ILE A CG1  10 
ATOM 6736  C CG2  . ILE A 1 20 ? 39.871 -1.606  -6.623  1.00 0.00 ? 20 ILE A CG2  10 
ATOM 6737  C CD1  . ILE A 1 20 ? 37.093 -1.068  -7.467  1.00 0.00 ? 20 ILE A CD1  10 
ATOM 6738  H H    . ILE A 1 20 ? 38.514 1.165   -4.035  1.00 0.00 ? 20 ILE A H    10 
ATOM 6739  H HA   . ILE A 1 20 ? 37.494 -1.371  -4.696  1.00 0.00 ? 20 ILE A HA   10 
ATOM 6740  H HB   . ILE A 1 20 ? 39.765 0.320   -5.734  1.00 0.00 ? 20 ILE A HB   10 
ATOM 6741  H HG12 . ILE A 1 20 ? 37.375 0.773   -6.345  1.00 0.00 ? 20 ILE A HG12 10 
ATOM 6742  H HG13 . ILE A 1 20 ? 38.443 0.579   -7.699  1.00 0.00 ? 20 ILE A HG13 10 
ATOM 6743  H HG21 . ILE A 1 20 ? 40.156 -1.312  -7.631  1.00 0.00 ? 20 ILE A HG21 10 
ATOM 6744  H HG22 . ILE A 1 20 ? 39.299 -2.527  -6.705  1.00 0.00 ? 20 ILE A HG22 10 
ATOM 6745  H HG23 . ILE A 1 20 ? 40.786 -1.839  -6.082  1.00 0.00 ? 20 ILE A HG23 10 
ATOM 6746  H HD11 . ILE A 1 20 ? 37.648 -1.705  -8.157  1.00 0.00 ? 20 ILE A HD11 10 
ATOM 6747  H HD12 . ILE A 1 20 ? 36.279 -0.617  -8.031  1.00 0.00 ? 20 ILE A HD12 10 
ATOM 6748  H HD13 . ILE A 1 20 ? 36.666 -1.719  -6.703  1.00 0.00 ? 20 ILE A HD13 10 
ATOM 6749  N N    . GLN A 1 21 ? 40.445 -1.426  -3.279  1.00 0.00 ? 21 GLN A N    10 
ATOM 6750  C CA   . GLN A 1 21 ? 41.387 -2.285  -2.577  1.00 0.00 ? 21 GLN A CA   10 
ATOM 6751  C C    . GLN A 1 21 ? 40.834 -2.777  -1.219  1.00 0.00 ? 21 GLN A C    10 
ATOM 6752  O O    . GLN A 1 21 ? 41.225 -3.830  -0.748  1.00 0.00 ? 21 GLN A O    10 
ATOM 6753  C CB   . GLN A 1 21 ? 42.703 -1.519  -2.407  1.00 0.00 ? 21 GLN A CB   10 
ATOM 6754  C CG   . GLN A 1 21 ? 43.901 -2.424  -2.089  1.00 0.00 ? 21 GLN A CG   10 
ATOM 6755  C CD   . GLN A 1 21 ? 45.206 -1.623  -2.269  1.00 0.00 ? 21 GLN A CD   10 
ATOM 6756  O OE1  . GLN A 1 21 ? 45.381 -0.889  -3.223  1.00 0.00 ? 21 GLN A OE1  10 
ATOM 6757  N NE2  . GLN A 1 21 ? 46.084 -1.784  -1.267  1.00 0.00 ? 21 GLN A NE2  10 
ATOM 6758  H H    . GLN A 1 21 ? 40.634 -0.451  -3.377  1.00 0.00 ? 21 GLN A H    10 
ATOM 6759  H HA   . GLN A 1 21 ? 41.552 -3.148  -3.226  1.00 0.00 ? 21 GLN A HA   10 
ATOM 6760  H HB2  . GLN A 1 21 ? 42.904 -0.992  -3.339  1.00 0.00 ? 21 GLN A HB2  10 
ATOM 6761  H HB3  . GLN A 1 21 ? 42.608 -0.749  -1.642  1.00 0.00 ? 21 GLN A HB3  10 
ATOM 6762  H HG2  . GLN A 1 21 ? 43.818 -2.816  -1.076  1.00 0.00 ? 21 GLN A HG2  10 
ATOM 6763  H HG3  . GLN A 1 21 ? 43.932 -3.284  -2.757  1.00 0.00 ? 21 GLN A HG3  10 
ATOM 6764  H HE21 . GLN A 1 21 ? 45.942 -2.479  -0.560  1.00 0.00 ? 21 GLN A HE21 10 
ATOM 6765  H HE22 . GLN A 1 21 ? 46.891 -1.195  -1.230  1.00 0.00 ? 21 GLN A HE22 10 
ATOM 6766  N N    . ALA A 1 22 ? 39.903 -1.978  -0.640  1.00 0.00 ? 22 ALA A N    10 
ATOM 6767  C CA   . ALA A 1 22 ? 39.214 -2.384  0.590   1.00 0.00 ? 22 ALA A CA   10 
ATOM 6768  C C    . ALA A 1 22 ? 38.090 -3.385  0.334   1.00 0.00 ? 22 ALA A C    10 
ATOM 6769  O O    . ALA A 1 22 ? 37.607 -3.998  1.270   1.00 0.00 ? 22 ALA A O    10 
ATOM 6770  C CB   . ALA A 1 22 ? 38.503 -1.204  1.259   1.00 0.00 ? 22 ALA A CB   10 
ATOM 6771  H H    . ALA A 1 22 ? 39.641 -1.134  -1.100  1.00 0.00 ? 22 ALA A H    10 
ATOM 6772  H HA   . ALA A 1 22 ? 39.946 -2.851  1.251   1.00 0.00 ? 22 ALA A HA   10 
ATOM 6773  H HB1  . ALA A 1 22 ? 39.207 -0.501  1.689   1.00 0.00 ? 22 ALA A HB1  10 
ATOM 6774  H HB2  . ALA A 1 22 ? 37.878 -1.548  2.085   1.00 0.00 ? 22 ALA A HB2  10 
ATOM 6775  H HB3  . ALA A 1 22 ? 37.861 -0.661  0.564   1.00 0.00 ? 22 ALA A HB3  10 
ATOM 6776  N N    . TYR A 1 23 ? 37.679 -3.482  -0.946  1.00 0.00 ? 23 TYR A N    10 
ATOM 6777  C CA   . TYR A 1 23 ? 36.582 -4.372  -1.309  1.00 0.00 ? 23 TYR A CA   10 
ATOM 6778  C C    . TYR A 1 23 ? 37.168 -5.652  -1.915  1.00 0.00 ? 23 TYR A C    10 
ATOM 6779  O O    . TYR A 1 23 ? 36.583 -6.714  -1.787  1.00 0.00 ? 23 TYR A O    10 
ATOM 6780  C CB   . TYR A 1 23 ? 35.610 -3.653  -2.265  1.00 0.00 ? 23 TYR A CB   10 
ATOM 6781  C CG   . TYR A 1 23 ? 34.161 -3.972  -1.987  1.00 0.00 ? 23 TYR A CG   10 
ATOM 6782  C CD1  . TYR A 1 23 ? 33.465 -3.237  -1.045  1.00 0.00 ? 23 TYR A CD1  10 
ATOM 6783  C CD2  . TYR A 1 23 ? 33.486 -4.980  -2.657  1.00 0.00 ? 23 TYR A CD2  10 
ATOM 6784  C CE1  . TYR A 1 23 ? 32.114 -3.456  -0.804  1.00 0.00 ? 23 TYR A CE1  10 
ATOM 6785  C CE2  . TYR A 1 23 ? 32.137 -5.219  -2.426  1.00 0.00 ? 23 TYR A CE2  10 
ATOM 6786  C CZ   . TYR A 1 23 ? 31.441 -4.432  -1.513  1.00 0.00 ? 23 TYR A CZ   10 
ATOM 6787  O OH   . TYR A 1 23 ? 30.085 -4.587  -1.304  1.00 0.00 ? 23 TYR A OH   10 
ATOM 6788  H H    . TYR A 1 23 ? 38.133 -2.953  -1.660  1.00 0.00 ? 23 TYR A H    10 
ATOM 6789  H HA   . TYR A 1 23 ? 36.048 -4.642  -0.397  1.00 0.00 ? 23 TYR A HA   10 
ATOM 6790  H HB2  . TYR A 1 23 ? 35.709 -2.581  -2.115  1.00 0.00 ? 23 TYR A HB2  10 
ATOM 6791  H HB3  . TYR A 1 23 ? 35.850 -3.817  -3.318  1.00 0.00 ? 23 TYR A HB3  10 
ATOM 6792  H HD1  . TYR A 1 23 ? 33.988 -2.460  -0.514  1.00 0.00 ? 23 TYR A HD1  10 
ATOM 6793  H HD2  . TYR A 1 23 ? 34.028 -5.575  -3.370  1.00 0.00 ? 23 TYR A HD2  10 
ATOM 6794  H HE1  . TYR A 1 23 ? 31.581 -2.876  -0.067  1.00 0.00 ? 23 TYR A HE1  10 
ATOM 6795  H HE2  . TYR A 1 23 ? 31.644 -6.024  -2.953  1.00 0.00 ? 23 TYR A HE2  10 
ATOM 6796  H HH   . TYR A 1 23 ? 29.854 -5.506  -1.250  1.00 0.00 ? 23 TYR A HH   10 
ATOM 6797  N N    . PHE A 1 24 ? 38.346 -5.504  -2.559  1.00 0.00 ? 24 PHE A N    10 
ATOM 6798  C CA   . PHE A 1 24 ? 38.993 -6.613  -3.261  1.00 0.00 ? 24 PHE A CA   10 
ATOM 6799  C C    . PHE A 1 24 ? 39.839 -7.441  -2.278  1.00 0.00 ? 24 PHE A C    10 
ATOM 6800  O O    . PHE A 1 24 ? 39.870 -8.656  -2.345  1.00 0.00 ? 24 PHE A O    10 
ATOM 6801  C CB   . PHE A 1 24 ? 39.906 -6.083  -4.389  1.00 0.00 ? 24 PHE A CB   10 
ATOM 6802  C CG   . PHE A 1 24 ? 39.353 -6.328  -5.768  1.00 0.00 ? 24 PHE A CG   10 
ATOM 6803  C CD1  . PHE A 1 24 ? 39.554 -7.562  -6.377  1.00 0.00 ? 24 PHE A CD1  10 
ATOM 6804  C CD2  . PHE A 1 24 ? 38.653 -5.343  -6.453  1.00 0.00 ? 24 PHE A CD2  10 
ATOM 6805  C CE1  . PHE A 1 24 ? 39.091 -7.798  -7.663  1.00 0.00 ? 24 PHE A CE1  10 
ATOM 6806  C CE2  . PHE A 1 24 ? 38.190 -5.571  -7.743  1.00 0.00 ? 24 PHE A CE2  10 
ATOM 6807  C CZ   . PHE A 1 24 ? 38.419 -6.797  -8.350  1.00 0.00 ? 24 PHE A CZ   10 
ATOM 6808  H H    . PHE A 1 24 ? 38.838 -4.639  -2.484  1.00 0.00 ? 24 PHE A H    10 
ATOM 6809  H HA   . PHE A 1 24 ? 38.202 -7.260  -3.647  1.00 0.00 ? 24 PHE A HA   10 
ATOM 6810  H HB2  . PHE A 1 24 ? 40.120 -5.027  -4.260  1.00 0.00 ? 24 PHE A HB2  10 
ATOM 6811  H HB3  . PHE A 1 24 ? 40.885 -6.561  -4.357  1.00 0.00 ? 24 PHE A HB3  10 
ATOM 6812  H HD1  . PHE A 1 24 ? 40.061 -8.347  -5.838  1.00 0.00 ? 24 PHE A HD1  10 
ATOM 6813  H HD2  . PHE A 1 24 ? 38.459 -4.394  -5.980  1.00 0.00 ? 24 PHE A HD2  10 
ATOM 6814  H HE1  . PHE A 1 24 ? 39.251 -8.761  -8.123  1.00 0.00 ? 24 PHE A HE1  10 
ATOM 6815  H HE2  . PHE A 1 24 ? 37.656 -4.795  -8.273  1.00 0.00 ? 24 PHE A HE2  10 
ATOM 6816  H HZ   . PHE A 1 24 ? 38.074 -6.978  -9.356  1.00 0.00 ? 24 PHE A HZ   10 
ATOM 6817  N N    . ALA A 1 25 ? 40.517 -6.698  -1.369  1.00 0.00 ? 25 ALA A N    10 
ATOM 6818  C CA   . ALA A 1 25 ? 41.313 -7.334  -0.320  1.00 0.00 ? 25 ALA A CA   10 
ATOM 6819  C C    . ALA A 1 25 ? 40.402 -8.034  0.708   1.00 0.00 ? 25 ALA A C    10 
ATOM 6820  O O    . ALA A 1 25 ? 40.798 -8.993  1.352   1.00 0.00 ? 25 ALA A O    10 
ATOM 6821  C CB   . ALA A 1 25 ? 42.192 -6.290  0.378   1.00 0.00 ? 25 ALA A CB   10 
ATOM 6822  H H    . ALA A 1 25 ? 40.451 -5.706  -1.390  1.00 0.00 ? 25 ALA A H    10 
ATOM 6823  H HA   . ALA A 1 25 ? 41.952 -8.075  -0.802  1.00 0.00 ? 25 ALA A HA   10 
ATOM 6824  H HB1  . ALA A 1 25 ? 42.871 -6.756  1.092   1.00 0.00 ? 25 ALA A HB1  10 
ATOM 6825  H HB2  . ALA A 1 25 ? 41.599 -5.555  0.925   1.00 0.00 ? 25 ALA A HB2  10 
ATOM 6826  H HB3  . ALA A 1 25 ? 42.806 -5.757  -0.349  1.00 0.00 ? 25 ALA A HB3  10 
ATOM 6827  N N    . CYS A 1 26 ? 39.160 -7.503  0.789   1.00 0.00 ? 26 CYS A N    10 
ATOM 6828  C CA   . CYS A 1 26 ? 38.127 -8.078  1.647   1.00 0.00 ? 26 CYS A CA   10 
ATOM 6829  C C    . CYS A 1 26 ? 37.385 -9.261  0.990   1.00 0.00 ? 26 CYS A C    10 
ATOM 6830  O O    . CYS A 1 26 ? 36.432 -9.765  1.567   1.00 0.00 ? 26 CYS A O    10 
ATOM 6831  C CB   . CYS A 1 26 ? 37.115 -6.982  1.998   1.00 0.00 ? 26 CYS A CB   10 
ATOM 6832  S SG   . CYS A 1 26 ? 37.515 -6.245  3.608   1.00 0.00 ? 26 CYS A SG   10 
ATOM 6833  H H    . CYS A 1 26 ? 38.954 -6.690  0.249   1.00 0.00 ? 26 CYS A H    10 
ATOM 6834  H HA   . CYS A 1 26 ? 38.623 -8.432  2.552   1.00 0.00 ? 26 CYS A HA   10 
ATOM 6835  H HB2  . CYS A 1 26 ? 37.149 -6.226  1.222   1.00 0.00 ? 26 CYS A HB2  10 
ATOM 6836  H HB3  . CYS A 1 26 ? 36.078 -7.330  1.978   1.00 0.00 ? 26 CYS A HB3  10 
ATOM 6837  H HG   . CYS A 1 26 ? 37.400 -4.920  3.545   1.00 0.00 ? 26 CYS A HG   10 
ATOM 6838  N N    . GLU A 1 27 ? 37.834 -9.664  -0.226  1.00 0.00 ? 27 GLU A N    10 
ATOM 6839  C CA   . GLU A 1 27 ? 37.145 -10.706 -0.996  1.00 0.00 ? 27 GLU A CA   10 
ATOM 6840  C C    . GLU A 1 27 ? 35.666 -10.329 -1.255  1.00 0.00 ? 27 GLU A C    10 
ATOM 6841  O O    . GLU A 1 27 ? 34.739 -10.999 -0.835  1.00 0.00 ? 27 GLU A O    10 
ATOM 6842  C CB   . GLU A 1 27 ? 37.346 -12.090 -0.340  1.00 0.00 ? 27 GLU A CB   10 
ATOM 6843  C CG   . GLU A 1 27 ? 36.461 -13.205 -0.935  1.00 0.00 ? 27 GLU A CG   10 
ATOM 6844  C CD   . GLU A 1 27 ? 37.123 -14.593 -0.932  1.00 0.00 ? 27 GLU A CD   10 
ATOM 6845  O OE1  . GLU A 1 27 ? 38.213 -14.722 -1.486  1.00 0.00 ? 27 GLU A OE1  10 
ATOM 6846  O OE2  . GLU A 1 27 ? 36.536 -15.533 -0.393  1.00 0.00 ? 27 GLU A OE2  10 
ATOM 6847  H H    . GLU A 1 27 ? 38.650 -9.249  -0.619  1.00 0.00 ? 27 GLU A H    10 
ATOM 6848  H HA   . GLU A 1 27 ? 37.640 -10.719 -1.967  1.00 0.00 ? 27 GLU A HA   10 
ATOM 6849  H HB2  . GLU A 1 27 ? 38.404 -12.337 -0.428  1.00 0.00 ? 27 GLU A HB2  10 
ATOM 6850  H HB3  . GLU A 1 27 ? 37.158 -12.036 0.730   1.00 0.00 ? 27 GLU A HB3  10 
ATOM 6851  H HG2  . GLU A 1 27 ? 35.529 -13.252 -0.374  1.00 0.00 ? 27 GLU A HG2  10 
ATOM 6852  H HG3  . GLU A 1 27 ? 36.188 -12.970 -1.963  1.00 0.00 ? 27 GLU A HG3  10 
ATOM 6853  N N    . LYS A 1 28 ? 35.557 -9.193  -1.983  1.00 0.00 ? 28 LYS A N    10 
ATOM 6854  C CA   . LYS A 1 28 ? 34.342 -8.580  -2.514  1.00 0.00 ? 28 LYS A CA   10 
ATOM 6855  C C    . LYS A 1 28 ? 33.105 -8.844  -1.638  1.00 0.00 ? 28 LYS A C    10 
ATOM 6856  O O    . LYS A 1 28 ? 32.125 -9.433  -2.076  1.00 0.00 ? 28 LYS A O    10 
ATOM 6857  C CB   . LYS A 1 28 ? 34.164 -9.054  -3.964  1.00 0.00 ? 28 LYS A CB   10 
ATOM 6858  C CG   . LYS A 1 28 ? 35.423 -8.873  -4.832  1.00 0.00 ? 28 LYS A CG   10 
ATOM 6859  C CD   . LYS A 1 28 ? 35.709 -7.425  -5.259  1.00 0.00 ? 28 LYS A CD   10 
ATOM 6860  C CE   . LYS A 1 28 ? 35.190 -7.103  -6.661  1.00 0.00 ? 28 LYS A CE   10 
ATOM 6861  N NZ   . LYS A 1 28 ? 35.747 -8.034  -7.639  1.00 0.00 ? 28 LYS A NZ   10 
ATOM 6862  H H    . LYS A 1 28 ? 36.404 -8.740  -2.246  1.00 0.00 ? 28 LYS A H    10 
ATOM 6863  H HA   . LYS A 1 28 ? 34.526 -7.509  -2.507  1.00 0.00 ? 28 LYS A HA   10 
ATOM 6864  H HB2  . LYS A 1 28 ? 33.911 -10.113 -3.970  1.00 0.00 ? 28 LYS A HB2  10 
ATOM 6865  H HB3  . LYS A 1 28 ? 33.316 -8.542  -4.411  1.00 0.00 ? 28 LYS A HB3  10 
ATOM 6866  H HG2  . LYS A 1 28 ? 36.302 -9.263  -4.321  1.00 0.00 ? 28 LYS A HG2  10 
ATOM 6867  H HG3  . LYS A 1 28 ? 35.332 -9.513  -5.709  1.00 0.00 ? 28 LYS A HG3  10 
ATOM 6868  H HD2  . LYS A 1 28 ? 35.338 -6.706  -4.533  1.00 0.00 ? 28 LYS A HD2  10 
ATOM 6869  H HD3  . LYS A 1 28 ? 36.786 -7.291  -5.271  1.00 0.00 ? 28 LYS A HD3  10 
ATOM 6870  H HE2  . LYS A 1 28 ? 34.103 -7.179  -6.700  1.00 0.00 ? 28 LYS A HE2  10 
ATOM 6871  H HE3  . LYS A 1 28 ? 35.490 -6.093  -6.948  1.00 0.00 ? 28 LYS A HE3  10 
ATOM 6872  H HZ1  . LYS A 1 28 ? 35.765 -7.606  -8.587  1.00 0.00 ? 28 LYS A HZ1  10 
ATOM 6873  H HZ2  . LYS A 1 28 ? 35.167 -8.897  -7.667  1.00 0.00 ? 28 LYS A HZ2  10 
ATOM 6874  H HZ3  . LYS A 1 28 ? 36.715 -8.288  -7.363  1.00 0.00 ? 28 LYS A HZ3  10 
ATOM 6875  N N    . ASN A 1 29 ? 33.245 -8.403  -0.363  1.00 0.00 ? 29 ASN A N    10 
ATOM 6876  C CA   . ASN A 1 29 ? 32.259 -8.737  0.664   1.00 0.00 ? 29 ASN A CA   10 
ATOM 6877  C C    . ASN A 1 29 ? 31.366 -7.514  0.908   1.00 0.00 ? 29 ASN A C    10 
ATOM 6878  O O    . ASN A 1 29 ? 30.983 -6.866  -0.072  1.00 0.00 ? 29 ASN A O    10 
ATOM 6879  C CB   . ASN A 1 29 ? 32.989 -9.284  1.909   1.00 0.00 ? 29 ASN A CB   10 
ATOM 6880  C CG   . ASN A 1 29 ? 32.128 -10.334 2.640   1.00 0.00 ? 29 ASN A CG   10 
ATOM 6881  O OD1  . ASN A 1 29 ? 30.941 -10.172 2.852   1.00 0.00 ? 29 ASN A OD1  10 
ATOM 6882  N ND2  . ASN A 1 29 ? 32.816 -11.452 2.965   1.00 0.00 ? 29 ASN A ND2  10 
ATOM 6883  H H    . ASN A 1 29 ? 34.050 -7.858  -0.128  1.00 0.00 ? 29 ASN A H    10 
ATOM 6884  H HA   . ASN A 1 29 ? 31.623 -9.515  0.240   1.00 0.00 ? 29 ASN A HA   10 
ATOM 6885  H HB2  . ASN A 1 29 ? 33.915 -9.758  1.587   1.00 0.00 ? 29 ASN A HB2  10 
ATOM 6886  H HB3  . ASN A 1 29 ? 33.289 -8.499  2.600   1.00 0.00 ? 29 ASN A HB3  10 
ATOM 6887  H HD21 . ASN A 1 29 ? 33.803 -11.529 2.820   1.00 0.00 ? 29 ASN A HD21 10 
ATOM 6888  H HD22 . ASN A 1 29 ? 32.336 -12.233 3.351   1.00 0.00 ? 29 ASN A HD22 10 
ATOM 6889  N N    . GLU A 1 30 ? 31.023 -7.204  2.175   1.00 0.00 ? 30 GLU A N    10 
ATOM 6890  C CA   . GLU A 1 30 ? 30.112 -6.074  2.415   1.00 0.00 ? 30 GLU A CA   10 
ATOM 6891  C C    . GLU A 1 30 ? 30.435 -5.428  3.775   1.00 0.00 ? 30 GLU A C    10 
ATOM 6892  O O    . GLU A 1 30 ? 30.964 -4.332  3.864   1.00 0.00 ? 30 GLU A O    10 
ATOM 6893  C CB   . GLU A 1 30 ? 28.614 -6.484  2.330   1.00 0.00 ? 30 GLU A CB   10 
ATOM 6894  C CG   . GLU A 1 30 ? 28.300 -7.809  1.611   1.00 0.00 ? 30 GLU A CG   10 
ATOM 6895  C CD   . GLU A 1 30 ? 26.890 -8.299  1.994   1.00 0.00 ? 30 GLU A CD   10 
ATOM 6896  O OE1  . GLU A 1 30 ? 26.759 -8.928  3.045   1.00 0.00 ? 30 GLU A OE1  10 
ATOM 6897  O OE2  . GLU A 1 30 ? 25.944 -8.046  1.248   1.00 0.00 ? 30 GLU A OE2  10 
ATOM 6898  H H    . GLU A 1 30 ? 31.345 -7.759  2.946   1.00 0.00 ? 30 GLU A H    10 
ATOM 6899  H HA   . GLU A 1 30 ? 30.336 -5.308  1.670   1.00 0.00 ? 30 GLU A HA   10 
ATOM 6900  H HB2  . GLU A 1 30 ? 28.152 -6.533  3.314   1.00 0.00 ? 30 GLU A HB2  10 
ATOM 6901  H HB3  . GLU A 1 30 ? 28.067 -5.680  1.842   1.00 0.00 ? 30 GLU A HB3  10 
ATOM 6902  H HG2  . GLU A 1 30 ? 28.373 -7.677  0.532   1.00 0.00 ? 30 GLU A HG2  10 
ATOM 6903  H HG3  . GLU A 1 30 ? 28.996 -8.599  1.895   1.00 0.00 ? 30 GLU A HG3  10 
ATOM 6904  N N    . ASN A 1 31 ? 30.081 -6.207  4.820   1.00 0.00 ? 31 ASN A N    10 
ATOM 6905  C CA   . ASN A 1 31 ? 30.367 -5.828  6.199   1.00 0.00 ? 31 ASN A CA   10 
ATOM 6906  C C    . ASN A 1 31 ? 31.877 -5.830  6.460   1.00 0.00 ? 31 ASN A C    10 
ATOM 6907  O O    . ASN A 1 31 ? 32.333 -5.194  7.396   1.00 0.00 ? 31 ASN A O    10 
ATOM 6908  C CB   . ASN A 1 31 ? 29.676 -6.822  7.164   1.00 0.00 ? 31 ASN A CB   10 
ATOM 6909  C CG   . ASN A 1 31 ? 28.612 -6.159  8.061   1.00 0.00 ? 31 ASN A CG   10 
ATOM 6910  O OD1  . ASN A 1 31 ? 28.129 -5.071  7.814   1.00 0.00 ? 31 ASN A OD1  10 
ATOM 6911  N ND2  . ASN A 1 31 ? 28.289 -6.916  9.133   1.00 0.00 ? 31 ASN A ND2  10 
ATOM 6912  H H    . ASN A 1 31 ? 29.643 -7.083  4.646   1.00 0.00 ? 31 ASN A H    10 
ATOM 6913  H HA   . ASN A 1 31 ? 30.012 -4.806  6.328   1.00 0.00 ? 31 ASN A HA   10 
ATOM 6914  H HB2  . ASN A 1 31 ? 29.200 -7.623  6.606   1.00 0.00 ? 31 ASN A HB2  10 
ATOM 6915  H HB3  . ASN A 1 31 ? 30.386 -7.335  7.813   1.00 0.00 ? 31 ASN A HB3  10 
ATOM 6916  H HD21 . ASN A 1 31 ? 28.713 -7.812  9.281   1.00 0.00 ? 31 ASN A HD21 10 
ATOM 6917  H HD22 . ASN A 1 31 ? 27.617 -6.579  9.786   1.00 0.00 ? 31 ASN A HD22 10 
ATOM 6918  N N    . LEU A 1 32 ? 32.606 -6.575  5.599   1.00 0.00 ? 32 LEU A N    10 
ATOM 6919  C CA   . LEU A 1 32 ? 34.054 -6.668  5.759   1.00 0.00 ? 32 LEU A CA   10 
ATOM 6920  C C    . LEU A 1 32 ? 34.722 -5.415  5.173   1.00 0.00 ? 32 LEU A C    10 
ATOM 6921  O O    . LEU A 1 32 ? 35.618 -4.837  5.757   1.00 0.00 ? 32 LEU A O    10 
ATOM 6922  C CB   . LEU A 1 32 ? 34.587 -7.913  5.020   1.00 0.00 ? 32 LEU A CB   10 
ATOM 6923  C CG   . LEU A 1 32 ? 35.697 -8.681  5.760   1.00 0.00 ? 32 LEU A CG   10 
ATOM 6924  C CD1  . LEU A 1 32 ? 36.665 -7.800  6.559   1.00 0.00 ? 32 LEU A CD1  10 
ATOM 6925  C CD2  . LEU A 1 32 ? 35.070 -9.737  6.664   1.00 0.00 ? 32 LEU A CD2  10 
ATOM 6926  H H    . LEU A 1 32 ? 32.145 -7.052  4.853   1.00 0.00 ? 32 LEU A H    10 
ATOM 6927  H HA   . LEU A 1 32 ? 34.238 -6.720  6.836   1.00 0.00 ? 32 LEU A HA   10 
ATOM 6928  H HB2  . LEU A 1 32 ? 33.762 -8.597  4.825   1.00 0.00 ? 32 LEU A HB2  10 
ATOM 6929  H HB3  . LEU A 1 32 ? 34.940 -7.662  4.020   1.00 0.00 ? 32 LEU A HB3  10 
ATOM 6930  H HG   . LEU A 1 32 ? 36.287 -9.205  5.006   1.00 0.00 ? 32 LEU A HG   10 
ATOM 6931  H HD11 . LEU A 1 32 ? 37.563 -8.362  6.817   1.00 0.00 ? 32 LEU A HD11 10 
ATOM 6932  H HD12 . LEU A 1 32 ? 36.211 -7.451  7.488   1.00 0.00 ? 32 LEU A HD12 10 
ATOM 6933  H HD13 . LEU A 1 32 ? 36.974 -6.930  5.990   1.00 0.00 ? 32 LEU A HD13 10 
ATOM 6934  H HD21 . LEU A 1 32 ? 35.830 -10.303 7.201   1.00 0.00 ? 32 LEU A HD21 10 
ATOM 6935  H HD22 . LEU A 1 32 ? 34.477 -10.434 6.073   1.00 0.00 ? 32 LEU A HD22 10 
ATOM 6936  H HD23 . LEU A 1 32 ? 34.413 -9.268  7.395   1.00 0.00 ? 32 LEU A HD23 10 
ATOM 6937  N N    . ALA A 1 33 ? 34.212 -5.062  3.969   1.00 0.00 ? 33 ALA A N    10 
ATOM 6938  C CA   . ALA A 1 33 ? 34.731 -3.911  3.246   1.00 0.00 ? 33 ALA A CA   10 
ATOM 6939  C C    . ALA A 1 33 ? 34.530 -2.614  4.024   1.00 0.00 ? 33 ALA A C    10 
ATOM 6940  O O    . ALA A 1 33 ? 35.447 -1.828  4.172   1.00 0.00 ? 33 ALA A O    10 
ATOM 6941  C CB   . ALA A 1 33 ? 34.023 -3.774  1.913   1.00 0.00 ? 33 ALA A CB   10 
ATOM 6942  H H    . ALA A 1 33 ? 33.477 -5.599  3.565   1.00 0.00 ? 33 ALA A H    10 
ATOM 6943  H HA   . ALA A 1 33 ? 35.798 -4.067  3.097   1.00 0.00 ? 33 ALA A HA   10 
ATOM 6944  H HB1  . ALA A 1 33 ? 34.313 -2.819  1.480   1.00 0.00 ? 33 ALA A HB1  10 
ATOM 6945  H HB2  . ALA A 1 33 ? 32.937 -3.797  2.016   1.00 0.00 ? 33 ALA A HB2  10 
ATOM 6946  H HB3  . ALA A 1 33 ? 34.314 -4.566  1.225   1.00 0.00 ? 33 ALA A HB3  10 
ATOM 6947  N N    . ALA A 1 34 ? 33.284 -2.459  4.521   1.00 0.00 ? 34 ALA A N    10 
ATOM 6948  C CA   . ALA A 1 34 ? 32.985 -1.316  5.375   1.00 0.00 ? 34 ALA A CA   10 
ATOM 6949  C C    . ALA A 1 34 ? 33.934 -1.308  6.579   1.00 0.00 ? 34 ALA A C    10 
ATOM 6950  O O    . ALA A 1 34 ? 34.574 -0.306  6.866   1.00 0.00 ? 34 ALA A O    10 
ATOM 6951  C CB   . ALA A 1 34 ? 31.524 -1.353  5.832   1.00 0.00 ? 34 ALA A CB   10 
ATOM 6952  H H    . ALA A 1 34 ? 32.592 -3.146  4.320   1.00 0.00 ? 34 ALA A H    10 
ATOM 6953  H HA   . ALA A 1 34 ? 33.161 -0.418  4.780   1.00 0.00 ? 34 ALA A HA   10 
ATOM 6954  H HB1  . ALA A 1 34 ? 31.299 -2.244  6.418   1.00 0.00 ? 34 ALA A HB1  10 
ATOM 6955  H HB2  . ALA A 1 34 ? 30.845 -1.339  4.981   1.00 0.00 ? 34 ALA A HB2  10 
ATOM 6956  H HB3  . ALA A 1 34 ? 31.296 -0.478  6.442   1.00 0.00 ? 34 ALA A HB3  10 
ATOM 6957  N N    . ASN A 1 35 ? 34.051 -2.476  7.235   1.00 0.00 ? 35 ASN A N    10 
ATOM 6958  C CA   . ASN A 1 35 ? 34.949 -2.538  8.392   1.00 0.00 ? 35 ASN A CA   10 
ATOM 6959  C C    . ASN A 1 35 ? 36.403 -2.160  8.039   1.00 0.00 ? 35 ASN A C    10 
ATOM 6960  O O    . ASN A 1 35 ? 37.095 -1.575  8.864   1.00 0.00 ? 35 ASN A O    10 
ATOM 6961  C CB   . ASN A 1 35 ? 34.944 -3.948  9.005   1.00 0.00 ? 35 ASN A CB   10 
ATOM 6962  C CG   . ASN A 1 35 ? 34.952 -3.906  10.543  1.00 0.00 ? 35 ASN A CG   10 
ATOM 6963  O OD1  . ASN A 1 35 ? 35.182 -2.895  11.177  1.00 0.00 ? 35 ASN A OD1  10 
ATOM 6964  N ND2  . ASN A 1 35 ? 34.639 -5.105  11.080  1.00 0.00 ? 35 ASN A ND2  10 
ATOM 6965  H H    . ASN A 1 35 ? 33.529 -3.274  6.935   1.00 0.00 ? 35 ASN A H    10 
ATOM 6966  H HA   . ASN A 1 35 ? 34.551 -1.797  9.091   1.00 0.00 ? 35 ASN A HA   10 
ATOM 6967  H HB2  . ASN A 1 35 ? 34.057 -4.480  8.697   1.00 0.00 ? 35 ASN A HB2  10 
ATOM 6968  H HB3  . ASN A 1 35 ? 35.770 -4.567  8.657   1.00 0.00 ? 35 ASN A HB3  10 
ATOM 6969  H HD21 . ASN A 1 35 ? 34.494 -5.897  10.486  1.00 0.00 ? 35 ASN A HD21 10 
ATOM 6970  H HD22 . ASN A 1 35 ? 34.541 -5.213  12.064  1.00 0.00 ? 35 ASN A HD22 10 
ATOM 6971  N N    . PHE A 1 36 ? 36.821 -2.501  6.800   1.00 0.00 ? 36 PHE A N    10 
ATOM 6972  C CA   . PHE A 1 36 ? 38.176 -2.182  6.330   1.00 0.00 ? 36 PHE A CA   10 
ATOM 6973  C C    . PHE A 1 36 ? 38.380 -0.650  6.303   1.00 0.00 ? 36 PHE A C    10 
ATOM 6974  O O    . PHE A 1 36 ? 39.335 -0.124  6.853   1.00 0.00 ? 36 PHE A O    10 
ATOM 6975  C CB   . PHE A 1 36 ? 38.402 -2.806  4.931   1.00 0.00 ? 36 PHE A CB   10 
ATOM 6976  C CG   . PHE A 1 36 ? 39.779 -2.581  4.333   1.00 0.00 ? 36 PHE A CG   10 
ATOM 6977  C CD1  . PHE A 1 36 ? 40.180 -1.315  3.911   1.00 0.00 ? 36 PHE A CD1  10 
ATOM 6978  C CD2  . PHE A 1 36 ? 40.657 -3.646  4.144   1.00 0.00 ? 36 PHE A CD2  10 
ATOM 6979  C CE1  . PHE A 1 36 ? 41.415 -1.107  3.315   1.00 0.00 ? 36 PHE A CE1  10 
ATOM 6980  C CE2  . PHE A 1 36 ? 41.898 -3.444  3.550   1.00 0.00 ? 36 PHE A CE2  10 
ATOM 6981  C CZ   . PHE A 1 36 ? 42.280 -2.174  3.133   1.00 0.00 ? 36 PHE A CZ   10 
ATOM 6982  H H    . PHE A 1 36 ? 36.170 -2.932  6.176   1.00 0.00 ? 36 PHE A H    10 
ATOM 6983  H HA   . PHE A 1 36 ? 38.872 -2.627  7.044   1.00 0.00 ? 36 PHE A HA   10 
ATOM 6984  H HB2  . PHE A 1 36 ? 38.209 -3.877  4.978   1.00 0.00 ? 36 PHE A HB2  10 
ATOM 6985  H HB3  . PHE A 1 36 ? 37.675 -2.427  4.220   1.00 0.00 ? 36 PHE A HB3  10 
ATOM 6986  H HD1  . PHE A 1 36 ? 39.524 -0.464  4.007   1.00 0.00 ? 36 PHE A HD1  10 
ATOM 6987  H HD2  . PHE A 1 36 ? 40.366 -4.647  4.429   1.00 0.00 ? 36 PHE A HD2  10 
ATOM 6988  H HE1  . PHE A 1 36 ? 41.687 -0.114  2.984   1.00 0.00 ? 36 PHE A HE1  10 
ATOM 6989  H HE2  . PHE A 1 36 ? 42.565 -4.279  3.386   1.00 0.00 ? 36 PHE A HE2  10 
ATOM 6990  H HZ   . PHE A 1 36 ? 43.237 -2.016  2.661   1.00 0.00 ? 36 PHE A HZ   10 
ATOM 6991  N N    . LEU A 1 37 ? 37.429 0.008   5.598   1.00 0.00 ? 37 LEU A N    10 
ATOM 6992  C CA   . LEU A 1 37 ? 37.553 1.424   5.280   1.00 0.00 ? 37 LEU A CA   10 
ATOM 6993  C C    . LEU A 1 37 ? 37.363 2.314   6.531   1.00 0.00 ? 37 LEU A C    10 
ATOM 6994  O O    . LEU A 1 37 ? 37.914 3.404   6.614   1.00 0.00 ? 37 LEU A O    10 
ATOM 6995  C CB   . LEU A 1 37 ? 36.517 1.809   4.215   1.00 0.00 ? 37 LEU A CB   10 
ATOM 6996  C CG   . LEU A 1 37 ? 36.694 1.160   2.825   1.00 0.00 ? 37 LEU A CG   10 
ATOM 6997  C CD1  . LEU A 1 37 ? 35.440 0.392   2.395   1.00 0.00 ? 37 LEU A CD1  10 
ATOM 6998  C CD2  . LEU A 1 37 ? 37.076 2.175   1.730   1.00 0.00 ? 37 LEU A CD2  10 
ATOM 6999  H H    . LEU A 1 37 ? 36.612 -0.470  5.293   1.00 0.00 ? 37 LEU A H    10 
ATOM 7000  H HA   . LEU A 1 37 ? 38.558 1.574   4.887   1.00 0.00 ? 37 LEU A HA   10 
ATOM 7001  H HB2  . LEU A 1 37 ? 35.521 1.600   4.589   1.00 0.00 ? 37 LEU A HB2  10 
ATOM 7002  H HB3  . LEU A 1 37 ? 36.559 2.885   4.126   1.00 0.00 ? 37 LEU A HB3  10 
ATOM 7003  H HG   . LEU A 1 37 ? 37.496 0.430   2.908   1.00 0.00 ? 37 LEU A HG   10 
ATOM 7004  H HD11 . LEU A 1 37 ? 35.704 -0.530  1.874   1.00 0.00 ? 37 LEU A HD11 10 
ATOM 7005  H HD12 . LEU A 1 37 ? 34.829 0.995   1.734   1.00 0.00 ? 37 LEU A HD12 10 
ATOM 7006  H HD13 . LEU A 1 37 ? 34.783 0.152   3.226   1.00 0.00 ? 37 LEU A HD13 10 
ATOM 7007  H HD21 . LEU A 1 37 ? 38.091 1.990   1.393   1.00 0.00 ? 37 LEU A HD21 10 
ATOM 7008  H HD22 . LEU A 1 37 ? 37.040 3.202   2.072   1.00 0.00 ? 37 LEU A HD22 10 
ATOM 7009  H HD23 . LEU A 1 37 ? 36.403 2.150   0.873   1.00 0.00 ? 37 LEU A HD23 10 
ATOM 7010  N N    . LEU A 1 38 ? 36.553 1.776   7.479   1.00 0.00 ? 38 LEU A N    10 
ATOM 7011  C CA   . LEU A 1 38 ? 36.194 2.508   8.694   1.00 0.00 ? 38 LEU A CA   10 
ATOM 7012  C C    . LEU A 1 38 ? 37.274 2.291   9.787   1.00 0.00 ? 38 LEU A C    10 
ATOM 7013  O O    . LEU A 1 38 ? 37.471 3.121   10.660  1.00 0.00 ? 38 LEU A O    10 
ATOM 7014  C CB   . LEU A 1 38 ? 34.788 2.123   9.230   1.00 0.00 ? 38 LEU A CB   10 
ATOM 7015  C CG   . LEU A 1 38 ? 33.581 2.100   8.247   1.00 0.00 ? 38 LEU A CG   10 
ATOM 7016  C CD1  . LEU A 1 38 ? 32.361 2.876   8.762   1.00 0.00 ? 38 LEU A CD1  10 
ATOM 7017  C CD2  . LEU A 1 38 ? 33.910 2.585   6.838   1.00 0.00 ? 38 LEU A CD2  10 
ATOM 7018  H H    . LEU A 1 38 ? 36.180 0.862   7.345   1.00 0.00 ? 38 LEU A H    10 
ATOM 7019  H HA   . LEU A 1 38 ? 36.199 3.561   8.422   1.00 0.00 ? 38 LEU A HA   10 
ATOM 7020  H HB2  . LEU A 1 38 ? 34.864 1.138   9.688   1.00 0.00 ? 38 LEU A HB2  10 
ATOM 7021  H HB3  . LEU A 1 38 ? 34.555 2.811   10.045  1.00 0.00 ? 38 LEU A HB3  10 
ATOM 7022  H HG   . LEU A 1 38 ? 33.234 1.069   8.185   1.00 0.00 ? 38 LEU A HG   10 
ATOM 7023  H HD11 . LEU A 1 38 ? 32.575 3.941   8.858   1.00 0.00 ? 38 LEU A HD11 10 
ATOM 7024  H HD12 . LEU A 1 38 ? 32.014 2.492   9.719   1.00 0.00 ? 38 LEU A HD12 10 
ATOM 7025  H HD13 . LEU A 1 38 ? 31.529 2.770   8.064   1.00 0.00 ? 38 LEU A HD13 10 
ATOM 7026  H HD21 . LEU A 1 38 ? 34.667 3.359   6.869   1.00 0.00 ? 38 LEU A HD21 10 
ATOM 7027  H HD22 . LEU A 1 38 ? 33.031 2.997   6.358   1.00 0.00 ? 38 LEU A HD22 10 
ATOM 7028  H HD23 . LEU A 1 38 ? 34.265 1.796   6.189   1.00 0.00 ? 38 LEU A HD23 10 
ATOM 7029  N N    . SER A 1 39 ? 37.956 1.126   9.654   1.00 0.00 ? 39 SER A N    10 
ATOM 7030  C CA   . SER A 1 39 ? 39.045 0.738   10.551  1.00 0.00 ? 39 SER A CA   10 
ATOM 7031  C C    . SER A 1 39 ? 40.405 1.267   10.062  1.00 0.00 ? 39 SER A C    10 
ATOM 7032  O O    . SER A 1 39 ? 41.406 1.146   10.752  1.00 0.00 ? 39 SER A O    10 
ATOM 7033  C CB   . SER A 1 39 ? 39.099 -0.794  10.684  1.00 0.00 ? 39 SER A CB   10 
ATOM 7034  O OG   . SER A 1 39 ? 40.005 -1.223  11.685  1.00 0.00 ? 39 SER A OG   10 
ATOM 7035  H H    . SER A 1 39 ? 37.722 0.511   8.909   1.00 0.00 ? 39 SER A H    10 
ATOM 7036  H HA   . SER A 1 39 ? 38.831 1.183   11.519  1.00 0.00 ? 39 SER A HA   10 
ATOM 7037  H HB2  . SER A 1 39 ? 38.117 -1.165  10.983  1.00 0.00 ? 39 SER A HB2  10 
ATOM 7038  H HB3  . SER A 1 39 ? 39.351 -1.274  9.731   1.00 0.00 ? 39 SER A HB3  10 
ATOM 7039  H HG   . SER A 1 39 ? 40.871 -0.871  11.510  1.00 0.00 ? 39 SER A HG   10 
ATOM 7040  N N    . GLN A 1 40 ? 40.376 1.869   8.852   1.00 0.00 ? 40 GLN A N    10 
ATOM 7041  C CA   . GLN A 1 40 ? 41.564 2.491   8.280   1.00 0.00 ? 40 GLN A CA   10 
ATOM 7042  C C    . GLN A 1 40 ? 41.736 3.906   8.872   1.00 0.00 ? 40 GLN A C    10 
ATOM 7043  O O    . GLN A 1 40 ? 41.040 4.294   9.807   1.00 0.00 ? 40 GLN A O    10 
ATOM 7044  C CB   . GLN A 1 40 ? 41.419 2.481   6.741   1.00 0.00 ? 40 GLN A CB   10 
ATOM 7045  C CG   . GLN A 1 40 ? 42.379 1.506   6.029   1.00 0.00 ? 40 GLN A CG   10 
ATOM 7046  C CD   . GLN A 1 40 ? 43.488 2.296   5.311   1.00 0.00 ? 40 GLN A CD   10 
ATOM 7047  O OE1  . GLN A 1 40 ? 44.188 3.098   5.898   1.00 0.00 ? 40 GLN A OE1  10 
ATOM 7048  N NE2  . GLN A 1 40 ? 43.546 2.051   3.989   1.00 0.00 ? 40 GLN A NE2  10 
ATOM 7049  H H    . GLN A 1 40 ? 39.519 1.913   8.342   1.00 0.00 ? 40 GLN A H    10 
ATOM 7050  H HA   . GLN A 1 40 ? 42.417 1.891   8.594   1.00 0.00 ? 40 GLN A HA   10 
ATOM 7051  H HB2  . GLN A 1 40 ? 40.399 2.205   6.485   1.00 0.00 ? 40 GLN A HB2  10 
ATOM 7052  H HB3  . GLN A 1 40 ? 41.496 3.479   6.313   1.00 0.00 ? 40 GLN A HB3  10 
ATOM 7053  H HG2  . GLN A 1 40 ? 42.841 0.793   6.713   1.00 0.00 ? 40 GLN A HG2  10 
ATOM 7054  H HG3  . GLN A 1 40 ? 41.819 0.906   5.315   1.00 0.00 ? 40 GLN A HG3  10 
ATOM 7055  H HE21 . GLN A 1 40 ? 43.020 1.302   3.586   1.00 0.00 ? 40 GLN A HE21 10 
ATOM 7056  H HE22 . GLN A 1 40 ? 44.112 2.619   3.393   1.00 0.00 ? 40 GLN A HE22 10 
ATOM 7057  N N    . ASN A 1 41 ? 42.710 4.625   8.279   1.00 0.00 ? 41 ASN A N    10 
ATOM 7058  C CA   . ASN A 1 41 ? 43.112 5.962   8.726   1.00 0.00 ? 41 ASN A CA   10 
ATOM 7059  C C    . ASN A 1 41 ? 42.905 6.921   7.547   1.00 0.00 ? 41 ASN A C    10 
ATOM 7060  O O    . ASN A 1 41 ? 43.475 6.719   6.481   1.00 0.00 ? 41 ASN A O    10 
ATOM 7061  C CB   . ASN A 1 41 ? 44.593 5.993   9.176   1.00 0.00 ? 41 ASN A CB   10 
ATOM 7062  C CG   . ASN A 1 41 ? 45.264 4.610   9.179   1.00 0.00 ? 41 ASN A CG   10 
ATOM 7063  O OD1  . ASN A 1 41 ? 45.185 3.853   10.125  1.00 0.00 ? 41 ASN A OD1  10 
ATOM 7064  N ND2  . ASN A 1 41 ? 45.928 4.351   8.033   1.00 0.00 ? 41 ASN A ND2  10 
ATOM 7065  H H    . ASN A 1 41 ? 43.180 4.233   7.493   1.00 0.00 ? 41 ASN A H    10 
ATOM 7066  H HA   . ASN A 1 41 ? 42.472 6.257   9.558   1.00 0.00 ? 41 ASN A HA   10 
ATOM 7067  H HB2  . ASN A 1 41 ? 45.194 6.666   8.564   1.00 0.00 ? 41 ASN A HB2  10 
ATOM 7068  H HB3  . ASN A 1 41 ? 44.658 6.386   10.191  1.00 0.00 ? 41 ASN A HB3  10 
ATOM 7069  H HD21 . ASN A 1 41 ? 45.966 5.042   7.310   1.00 0.00 ? 41 ASN A HD21 10 
ATOM 7070  H HD22 . ASN A 1 41 ? 46.383 3.474   7.908   1.00 0.00 ? 41 ASN A HD22 10 
ATOM 7071  N N    . PHE A 1 42 ? 42.069 7.956   7.799   1.00 0.00 ? 42 PHE A N    10 
ATOM 7072  C CA   . PHE A 1 42 ? 41.755 8.965   6.783   1.00 0.00 ? 42 PHE A CA   10 
ATOM 7073  C C    . PHE A 1 42 ? 40.897 10.106  7.401   1.00 0.00 ? 42 PHE A C    10 
ATOM 7074  O O    . PHE A 1 42 ? 40.059 10.704  6.736   1.00 0.00 ? 42 PHE A O    10 
ATOM 7075  C CB   . PHE A 1 42 ? 41.041 8.314   5.564   1.00 0.00 ? 42 PHE A CB   10 
ATOM 7076  C CG   . PHE A 1 42 ? 40.766 9.259   4.412   1.00 0.00 ? 42 PHE A CG   10 
ATOM 7077  C CD1  . PHE A 1 42 ? 41.700 10.221  4.027   1.00 0.00 ? 42 PHE A CD1  10 
ATOM 7078  C CD2  . PHE A 1 42 ? 39.561 9.186   3.719   1.00 0.00 ? 42 PHE A CD2  10 
ATOM 7079  C CE1  . PHE A 1 42 ? 41.423 11.112  2.998   1.00 0.00 ? 42 PHE A CE1  10 
ATOM 7080  C CE2  . PHE A 1 42 ? 39.288 10.071  2.682   1.00 0.00 ? 42 PHE A CE2  10 
ATOM 7081  C CZ   . PHE A 1 42 ? 40.213 11.037  2.329   1.00 0.00 ? 42 PHE A CZ   10 
ATOM 7082  H H    . PHE A 1 42 ? 41.702 8.039   8.723   1.00 0.00 ? 42 PHE A H    10 
ATOM 7083  H HA   . PHE A 1 42 ? 42.721 9.384   6.499   1.00 0.00 ? 42 PHE A HA   10 
ATOM 7084  H HB2  . PHE A 1 42 ? 41.630 7.495   5.153   1.00 0.00 ? 42 PHE A HB2  10 
ATOM 7085  H HB3  . PHE A 1 42 ? 40.106 7.859   5.899   1.00 0.00 ? 42 PHE A HB3  10 
ATOM 7086  H HD1  . PHE A 1 42 ? 42.657 10.293  4.518   1.00 0.00 ? 42 PHE A HD1  10 
ATOM 7087  H HD2  . PHE A 1 42 ? 38.827 8.440   3.981   1.00 0.00 ? 42 PHE A HD2  10 
ATOM 7088  H HE1  . PHE A 1 42 ? 42.144 11.868  2.726   1.00 0.00 ? 42 PHE A HE1  10 
ATOM 7089  H HE2  . PHE A 1 42 ? 38.354 10.020  2.147   1.00 0.00 ? 42 PHE A HE2  10 
ATOM 7090  H HZ   . PHE A 1 42 ? 39.985 11.739  1.542   1.00 0.00 ? 42 PHE A HZ   10 
ATOM 7091  N N    . ASP A 1 43 ? 41.132 10.374  8.704   1.00 0.00 ? 43 ASP A N    10 
ATOM 7092  C CA   . ASP A 1 43 ? 40.361 11.422  9.377   1.00 0.00 ? 43 ASP A CA   10 
ATOM 7093  C C    . ASP A 1 43 ? 40.903 11.621  10.801  1.00 0.00 ? 43 ASP A C    10 
ATOM 7094  O O    . ASP A 1 43 ? 41.838 10.952  11.230  1.00 0.00 ? 43 ASP A O    10 
ATOM 7095  C CB   . ASP A 1 43 ? 38.843 11.085  9.402   1.00 0.00 ? 43 ASP A CB   10 
ATOM 7096  C CG   . ASP A 1 43 ? 38.012 12.228  8.785   1.00 0.00 ? 43 ASP A CG   10 
ATOM 7097  O OD1  . ASP A 1 43 ? 37.994 13.318  9.356   1.00 0.00 ? 43 ASP A OD1  10 
ATOM 7098  O OD2  . ASP A 1 43 ? 37.397 12.015  7.740   1.00 0.00 ? 43 ASP A OD2  10 
ATOM 7099  H H    . ASP A 1 43 ? 41.835 9.866   9.199   1.00 0.00 ? 43 ASP A H    10 
ATOM 7100  H HA   . ASP A 1 43 ? 40.581 12.327  8.804   1.00 0.00 ? 43 ASP A HA   10 
ATOM 7101  H HB2  . ASP A 1 43 ? 38.631 10.159  8.868   1.00 0.00 ? 43 ASP A HB2  10 
ATOM 7102  H HB3  . ASP A 1 43 ? 38.468 10.890  10.407  1.00 0.00 ? 43 ASP A HB3  10 
ATOM 7103  N N    . ASP A 1 44 ? 40.257 12.575  11.506  1.00 0.00 ? 44 ASP A N    10 
ATOM 7104  C CA   . ASP A 1 44 ? 40.645 12.866  12.878  1.00 0.00 ? 44 ASP A CA   10 
ATOM 7105  C C    . ASP A 1 44 ? 39.470 13.529  13.630  1.00 0.00 ? 44 ASP A C    10 
ATOM 7106  O O    . ASP A 1 44 ? 39.622 14.558  14.269  1.00 0.00 ? 44 ASP A O    10 
ATOM 7107  C CB   . ASP A 1 44 ? 41.917 13.746  12.873  1.00 0.00 ? 44 ASP A CB   10 
ATOM 7108  C CG   . ASP A 1 44 ? 42.835 13.401  14.063  1.00 0.00 ? 44 ASP A CG   10 
ATOM 7109  O OD1  . ASP A 1 44 ? 42.613 13.925  15.154  1.00 0.00 ? 44 ASP A OD1  10 
ATOM 7110  O OD2  . ASP A 1 44 ? 43.761 12.609  13.883  1.00 0.00 ? 44 ASP A OD2  10 
ATOM 7111  H H    . ASP A 1 44 ? 39.511 13.081  11.080  1.00 0.00 ? 44 ASP A H    10 
ATOM 7112  H HA   . ASP A 1 44 ? 40.832 11.897  13.345  1.00 0.00 ? 44 ASP A HA   10 
ATOM 7113  H HB2  . ASP A 1 44 ? 42.481 13.595  11.952  1.00 0.00 ? 44 ASP A HB2  10 
ATOM 7114  H HB3  . ASP A 1 44 ? 41.686 14.812  12.880  1.00 0.00 ? 44 ASP A HB3  10 
ATOM 7115  N N    . GLU A 1 45 ? 38.296 12.862  13.520  1.00 0.00 ? 45 GLU A N    10 
ATOM 7116  C CA   . GLU A 1 45 ? 37.093 13.335  14.213  1.00 0.00 ? 45 GLU A CA   10 
ATOM 7117  C C    . GLU A 1 45 ? 37.241 13.170  15.744  1.00 0.00 ? 45 GLU A C    10 
ATOM 7118  O O    . GLU A 1 45 ? 37.829 12.179  16.180  1.00 0.00 ? 45 GLU A O    10 
ATOM 7119  C CB   . GLU A 1 45 ? 35.842 12.580  13.699  1.00 0.00 ? 45 GLU A CB   10 
ATOM 7120  C CG   . GLU A 1 45 ? 34.846 13.467  12.924  1.00 0.00 ? 45 GLU A CG   10 
ATOM 7121  C CD   . GLU A 1 45 ? 34.844 13.174  11.413  1.00 0.00 ? 45 GLU A CD   10 
ATOM 7122  O OE1  . GLU A 1 45 ? 34.363 12.110  11.022  1.00 0.00 ? 45 GLU A OE1  10 
ATOM 7123  O OE2  . GLU A 1 45 ? 35.311 14.013  10.644  1.00 0.00 ? 45 GLU A OE2  10 
ATOM 7124  O OXT  . GLU A 1 45 ? 36.767 14.037  16.479  1.00 0.00 ? 45 GLU A OXT  10 
ATOM 7125  H H    . GLU A 1 45 ? 38.271 12.024  12.981  1.00 0.00 ? 45 GLU A H    10 
ATOM 7126  H HA   . GLU A 1 45 ? 37.021 14.400  13.989  1.00 0.00 ? 45 GLU A HA   10 
ATOM 7127  H HB2  . GLU A 1 45 ? 36.130 11.696  13.129  1.00 0.00 ? 45 GLU A HB2  10 
ATOM 7128  H HB3  . GLU A 1 45 ? 35.291 12.153  14.534  1.00 0.00 ? 45 GLU A HB3  10 
ATOM 7129  H HG2  . GLU A 1 45 ? 33.837 13.307  13.305  1.00 0.00 ? 45 GLU A HG2  10 
ATOM 7130  H HG3  . GLU A 1 45 ? 35.044 14.524  13.095  1.00 0.00 ? 45 GLU A HG3  10 
ATOM 7131  N N    . GLN A 1 1  ? 31.454 -6.856  -11.540 1.00 0.00 ? 1  GLN A N    11 
ATOM 7132  C CA   . GLN A 1 1  ? 30.545 -5.739  -11.346 1.00 0.00 ? 1  GLN A CA   11 
ATOM 7133  C C    . GLN A 1 1  ? 30.463 -5.366  -9.867  1.00 0.00 ? 1  GLN A C    11 
ATOM 7134  O O    . GLN A 1 1  ? 29.604 -5.862  -9.147  1.00 0.00 ? 1  GLN A O    11 
ATOM 7135  C CB   . GLN A 1 1  ? 29.112 -6.019  -11.839 1.00 0.00 ? 1  GLN A CB   11 
ATOM 7136  C CG   . GLN A 1 1  ? 29.042 -6.254  -13.350 1.00 0.00 ? 1  GLN A CG   11 
ATOM 7137  C CD   . GLN A 1 1  ? 27.643 -5.975  -13.919 1.00 0.00 ? 1  GLN A CD   11 
ATOM 7138  O OE1  . GLN A 1 1  ? 26.696 -5.639  -13.211 1.00 0.00 ? 1  GLN A OE1  11 
ATOM 7139  N NE2  . GLN A 1 1  ? 27.585 -6.105  -15.255 1.00 0.00 ? 1  GLN A NE2  11 
ATOM 7140  H H1   . GLN A 1 1  ? 32.404 -6.554  -11.210 1.00 0.00 ? 1  GLN A H1   11 
ATOM 7141  H H2   . GLN A 1 1  ? 31.505 -7.104  -12.547 1.00 0.00 ? 1  GLN A H2   11 
ATOM 7142  H H3   . GLN A 1 1  ? 31.143 -7.673  -10.980 1.00 0.00 ? 1  GLN A H3   11 
ATOM 7143  H HA   . GLN A 1 1  ? 30.950 -4.888  -11.896 1.00 0.00 ? 1  GLN A HA   11 
ATOM 7144  H HB2  . GLN A 1 1  ? 28.681 -6.881  -11.326 1.00 0.00 ? 1  GLN A HB2  11 
ATOM 7145  H HB3  . GLN A 1 1  ? 28.489 -5.162  -11.577 1.00 0.00 ? 1  GLN A HB3  11 
ATOM 7146  H HG2  . GLN A 1 1  ? 29.751 -5.611  -13.866 1.00 0.00 ? 1  GLN A HG2  11 
ATOM 7147  H HG3  . GLN A 1 1  ? 29.329 -7.276  -13.589 1.00 0.00 ? 1  GLN A HG3  11 
ATOM 7148  H HE21 . GLN A 1 1  ? 28.394 -6.419  -15.767 1.00 0.00 ? 1  GLN A HE21 11 
ATOM 7149  H HE22 . GLN A 1 1  ? 26.752 -5.891  -15.750 1.00 0.00 ? 1  GLN A HE22 11 
ATOM 7150  N N    . GLU A 1 2  ? 31.382 -4.464  -9.469  1.00 0.00 ? 2  GLU A N    11 
ATOM 7151  C CA   . GLU A 1 2  ? 31.440 -4.009  -8.087  1.00 0.00 ? 2  GLU A CA   11 
ATOM 7152  C C    . GLU A 1 2  ? 31.460 -2.487  -7.973  1.00 0.00 ? 2  GLU A C    11 
ATOM 7153  O O    . GLU A 1 2  ? 31.599 -1.974  -6.872  1.00 0.00 ? 2  GLU A O    11 
ATOM 7154  C CB   . GLU A 1 2  ? 32.631 -4.668  -7.364  1.00 0.00 ? 2  GLU A CB   11 
ATOM 7155  C CG   . GLU A 1 2  ? 32.286 -5.093  -5.927  1.00 0.00 ? 2  GLU A CG   11 
ATOM 7156  C CD   . GLU A 1 2  ? 31.373 -6.359  -5.857  1.00 0.00 ? 2  GLU A CD   11 
ATOM 7157  O OE1  . GLU A 1 2  ? 30.531 -6.547  -6.726  1.00 0.00 ? 2  GLU A OE1  11 
ATOM 7158  O OE2  . GLU A 1 2  ? 31.506 -7.162  -4.937  1.00 0.00 ? 2  GLU A OE2  11 
ATOM 7159  H H    . GLU A 1 2  ? 32.047 -4.112  -10.128 1.00 0.00 ? 2  GLU A H    11 
ATOM 7160  H HA   . GLU A 1 2  ? 30.504 -4.274  -7.602  1.00 0.00 ? 2  GLU A HA   11 
ATOM 7161  H HB2  . GLU A 1 2  ? 32.966 -5.551  -7.909  1.00 0.00 ? 2  GLU A HB2  11 
ATOM 7162  H HB3  . GLU A 1 2  ? 33.503 -4.009  -7.360  1.00 0.00 ? 2  GLU A HB3  11 
ATOM 7163  H HG2  . GLU A 1 2  ? 33.218 -5.287  -5.411  1.00 0.00 ? 2  GLU A HG2  11 
ATOM 7164  H HG3  . GLU A 1 2  ? 31.827 -4.267  -5.385  1.00 0.00 ? 2  GLU A HG3  11 
ATOM 7165  N N    . LYS A 1 3  ? 31.273 -1.816  -9.138  1.00 0.00 ? 3  LYS A N    11 
ATOM 7166  C CA   . LYS A 1 3  ? 31.236 -0.354  -9.232  1.00 0.00 ? 3  LYS A CA   11 
ATOM 7167  C C    . LYS A 1 3  ? 30.116 0.282   -8.374  1.00 0.00 ? 3  LYS A C    11 
ATOM 7168  O O    . LYS A 1 3  ? 30.166 1.462   -8.052  1.00 0.00 ? 3  LYS A O    11 
ATOM 7169  C CB   . LYS A 1 3  ? 31.142 0.086   -10.694 1.00 0.00 ? 3  LYS A CB   11 
ATOM 7170  C CG   . LYS A 1 3  ? 29.805 -0.239  -11.375 1.00 0.00 ? 3  LYS A CG   11 
ATOM 7171  C CD   . LYS A 1 3  ? 28.936 1.007   -11.582 1.00 0.00 ? 3  LYS A CD   11 
ATOM 7172  C CE   . LYS A 1 3  ? 27.811 0.759   -12.587 1.00 0.00 ? 3  LYS A CE   11 
ATOM 7173  N NZ   . LYS A 1 3  ? 26.999 1.946   -12.818 1.00 0.00 ? 3  LYS A NZ   11 
ATOM 7174  H H    . LYS A 1 3  ? 31.184 -2.338  -9.985  1.00 0.00 ? 3  LYS A H    11 
ATOM 7175  H HA   . LYS A 1 3  ? 32.200 0.007   -8.902  1.00 0.00 ? 3  LYS A HA   11 
ATOM 7176  H HB2  . LYS A 1 3  ? 31.363 1.152   -10.768 1.00 0.00 ? 3  LYS A HB2  11 
ATOM 7177  H HB3  . LYS A 1 3  ? 31.945 -0.391  -11.254 1.00 0.00 ? 3  LYS A HB3  11 
ATOM 7178  H HG2  . LYS A 1 3  ? 30.018 -0.687  -12.344 1.00 0.00 ? 3  LYS A HG2  11 
ATOM 7179  H HG3  . LYS A 1 3  ? 29.255 -1.002  -10.823 1.00 0.00 ? 3  LYS A HG3  11 
ATOM 7180  H HD2  . LYS A 1 3  ? 28.527 1.344   -10.628 1.00 0.00 ? 3  LYS A HD2  11 
ATOM 7181  H HD3  . LYS A 1 3  ? 29.552 1.824   -11.957 1.00 0.00 ? 3  LYS A HD3  11 
ATOM 7182  H HE2  . LYS A 1 3  ? 28.225 0.445   -13.546 1.00 0.00 ? 3  LYS A HE2  11 
ATOM 7183  H HE3  . LYS A 1 3  ? 27.160 -0.039  -12.230 1.00 0.00 ? 3  LYS A HE3  11 
ATOM 7184  H HZ1  . LYS A 1 3  ? 27.605 2.711   -13.183 1.00 0.00 ? 3  LYS A HZ1  11 
ATOM 7185  H HZ2  . LYS A 1 3  ? 26.563 2.249   -11.924 1.00 0.00 ? 3  LYS A HZ2  11 
ATOM 7186  H HZ3  . LYS A 1 3  ? 26.256 1.734   -13.516 1.00 0.00 ? 3  LYS A HZ3  11 
ATOM 7187  N N    . GLU A 1 4  ? 29.126 -0.570  -8.032  1.00 0.00 ? 4  GLU A N    11 
ATOM 7188  C CA   . GLU A 1 4  ? 27.974 -0.177  -7.228  1.00 0.00 ? 4  GLU A CA   11 
ATOM 7189  C C    . GLU A 1 4  ? 28.399 0.176   -5.800  1.00 0.00 ? 4  GLU A C    11 
ATOM 7190  O O    . GLU A 1 4  ? 27.938 1.143   -5.206  1.00 0.00 ? 4  GLU A O    11 
ATOM 7191  C CB   . GLU A 1 4  ? 26.961 -1.339  -7.174  1.00 0.00 ? 4  GLU A CB   11 
ATOM 7192  C CG   . GLU A 1 4  ? 25.533 -0.841  -7.434  1.00 0.00 ? 4  GLU A CG   11 
ATOM 7193  C CD   . GLU A 1 4  ? 24.441 -1.780  -6.884  1.00 0.00 ? 4  GLU A CD   11 
ATOM 7194  O OE1  . GLU A 1 4  ? 24.542 -2.195  -5.733  1.00 0.00 ? 4  GLU A OE1  11 
ATOM 7195  O OE2  . GLU A 1 4  ? 23.490 -2.073  -7.614  1.00 0.00 ? 4  GLU A OE2  11 
ATOM 7196  H H    . GLU A 1 4  ? 29.198 -1.519  -8.336  1.00 0.00 ? 4  GLU A H    11 
ATOM 7197  H HA   . GLU A 1 4  ? 27.557 0.713   -7.705  1.00 0.00 ? 4  GLU A HA   11 
ATOM 7198  H HB2  . GLU A 1 4  ? 27.216 -2.105  -7.907  1.00 0.00 ? 4  GLU A HB2  11 
ATOM 7199  H HB3  . GLU A 1 4  ? 27.017 -1.860  -6.217  1.00 0.00 ? 4  GLU A HB3  11 
ATOM 7200  H HG2  . GLU A 1 4  ? 25.392 0.140   -6.984  1.00 0.00 ? 4  GLU A HG2  11 
ATOM 7201  H HG3  . GLU A 1 4  ? 25.406 -0.703  -8.505  1.00 0.00 ? 4  GLU A HG3  11 
ATOM 7202  N N    . ALA A 1 5  ? 29.313 -0.678  -5.302  1.00 0.00 ? 5  ALA A N    11 
ATOM 7203  C CA   . ALA A 1 5  ? 29.873 -0.431  -3.992  1.00 0.00 ? 5  ALA A CA   11 
ATOM 7204  C C    . ALA A 1 5  ? 30.895 0.711   -4.047  1.00 0.00 ? 5  ALA A C    11 
ATOM 7205  O O    . ALA A 1 5  ? 31.248 1.245   -3.018  1.00 0.00 ? 5  ALA A O    11 
ATOM 7206  C CB   . ALA A 1 5  ? 30.499 -1.701  -3.415  1.00 0.00 ? 5  ALA A CB   11 
ATOM 7207  H H    . ALA A 1 5  ? 29.628 -1.454  -5.849  1.00 0.00 ? 5  ALA A H    11 
ATOM 7208  H HA   . ALA A 1 5  ? 29.054 -0.142  -3.337  1.00 0.00 ? 5  ALA A HA   11 
ATOM 7209  H HB1  . ALA A 1 5  ? 31.390 -2.005  -3.963  1.00 0.00 ? 5  ALA A HB1  11 
ATOM 7210  H HB2  . ALA A 1 5  ? 29.795 -2.532  -3.420  1.00 0.00 ? 5  ALA A HB2  11 
ATOM 7211  H HB3  . ALA A 1 5  ? 30.766 -1.539  -2.373  1.00 0.00 ? 5  ALA A HB3  11 
ATOM 7212  N N    . ILE A 1 6  ? 31.360 1.079   -5.260  1.00 0.00 ? 6  ILE A N    11 
ATOM 7213  C CA   . ILE A 1 6  ? 32.455 2.050   -5.327  1.00 0.00 ? 6  ILE A CA   11 
ATOM 7214  C C    . ILE A 1 6  ? 31.976 3.486   -5.076  1.00 0.00 ? 6  ILE A C    11 
ATOM 7215  O O    . ILE A 1 6  ? 32.749 4.325   -4.647  1.00 0.00 ? 6  ILE A O    11 
ATOM 7216  C CB   . ILE A 1 6  ? 33.261 1.923   -6.633  1.00 0.00 ? 6  ILE A CB   11 
ATOM 7217  C CG1  . ILE A 1 6  ? 33.664 0.468   -6.907  1.00 0.00 ? 6  ILE A CG1  11 
ATOM 7218  C CG2  . ILE A 1 6  ? 34.475 2.855   -6.680  1.00 0.00 ? 6  ILE A CG2  11 
ATOM 7219  C CD1  . ILE A 1 6  ? 34.443 -0.243  -5.803  1.00 0.00 ? 6  ILE A CD1  11 
ATOM 7220  H H    . ILE A 1 6  ? 30.981 0.682   -6.096  1.00 0.00 ? 6  ILE A H    11 
ATOM 7221  H HA   . ILE A 1 6  ? 33.105 1.813   -4.492  1.00 0.00 ? 6  ILE A HA   11 
ATOM 7222  H HB   . ILE A 1 6  ? 32.613 2.224   -7.456  1.00 0.00 ? 6  ILE A HB   11 
ATOM 7223  H HG12 . ILE A 1 6  ? 32.747 -0.086  -7.000  1.00 0.00 ? 6  ILE A HG12 11 
ATOM 7224  H HG13 . ILE A 1 6  ? 34.170 0.388   -7.872  1.00 0.00 ? 6  ILE A HG13 11 
ATOM 7225  H HG21 . ILE A 1 6  ? 34.912 3.004   -5.697  1.00 0.00 ? 6  ILE A HG21 11 
ATOM 7226  H HG22 . ILE A 1 6  ? 34.191 3.838   -7.055  1.00 0.00 ? 6  ILE A HG22 11 
ATOM 7227  H HG23 . ILE A 1 6  ? 35.244 2.452   -7.336  1.00 0.00 ? 6  ILE A HG23 11 
ATOM 7228  H HD11 . ILE A 1 6  ? 35.446 0.153   -5.675  1.00 0.00 ? 6  ILE A HD11 11 
ATOM 7229  H HD12 . ILE A 1 6  ? 34.526 -1.298  -6.063  1.00 0.00 ? 6  ILE A HD12 11 
ATOM 7230  H HD13 . ILE A 1 6  ? 33.922 -0.189  -4.849  1.00 0.00 ? 6  ILE A HD13 11 
ATOM 7231  N N    . GLU A 1 7  ? 30.675 3.711   -5.328  1.00 0.00 ? 7  GLU A N    11 
ATOM 7232  C CA   . GLU A 1 7  ? 30.067 4.995   -4.992  1.00 0.00 ? 7  GLU A CA   11 
ATOM 7233  C C    . GLU A 1 7  ? 29.502 4.977   -3.559  1.00 0.00 ? 7  GLU A C    11 
ATOM 7234  O O    . GLU A 1 7  ? 29.204 6.019   -2.994  1.00 0.00 ? 7  GLU A O    11 
ATOM 7235  C CB   . GLU A 1 7  ? 28.979 5.325   -6.021  1.00 0.00 ? 7  GLU A CB   11 
ATOM 7236  C CG   . GLU A 1 7  ? 27.843 4.290   -6.060  1.00 0.00 ? 7  GLU A CG   11 
ATOM 7237  C CD   . GLU A 1 7  ? 26.666 4.707   -6.963  1.00 0.00 ? 7  GLU A CD   11 
ATOM 7238  O OE1  . GLU A 1 7  ? 26.773 5.704   -7.676  1.00 0.00 ? 7  GLU A OE1  11 
ATOM 7239  O OE2  . GLU A 1 7  ? 25.643 4.021   -6.936  1.00 0.00 ? 7  GLU A OE2  11 
ATOM 7240  H H    . GLU A 1 7  ? 30.110 2.973   -5.693  1.00 0.00 ? 7  GLU A H    11 
ATOM 7241  H HA   . GLU A 1 7  ? 30.834 5.767   -5.034  1.00 0.00 ? 7  GLU A HA   11 
ATOM 7242  H HB2  . GLU A 1 7  ? 28.576 6.318   -5.814  1.00 0.00 ? 7  GLU A HB2  11 
ATOM 7243  H HB3  . GLU A 1 7  ? 29.437 5.374   -7.011  1.00 0.00 ? 7  GLU A HB3  11 
ATOM 7244  H HG2  . GLU A 1 7  ? 28.225 3.333   -6.408  1.00 0.00 ? 7  GLU A HG2  11 
ATOM 7245  H HG3  . GLU A 1 7  ? 27.454 4.125   -5.058  1.00 0.00 ? 7  GLU A HG3  11 
ATOM 7246  N N    . ARG A 1 8  ? 29.369 3.747   -3.022  1.00 0.00 ? 8  ARG A N    11 
ATOM 7247  C CA   . ARG A 1 8  ? 28.780 3.543   -1.706  1.00 0.00 ? 8  ARG A CA   11 
ATOM 7248  C C    . ARG A 1 8  ? 29.844 3.742   -0.626  1.00 0.00 ? 8  ARG A C    11 
ATOM 7249  O O    . ARG A 1 8  ? 29.671 4.527   0.292   1.00 0.00 ? 8  ARG A O    11 
ATOM 7250  C CB   . ARG A 1 8  ? 28.208 2.118   -1.639  1.00 0.00 ? 8  ARG A CB   11 
ATOM 7251  C CG   . ARG A 1 8  ? 26.749 2.051   -1.163  1.00 0.00 ? 8  ARG A CG   11 
ATOM 7252  C CD   . ARG A 1 8  ? 25.793 1.593   -2.270  1.00 0.00 ? 8  ARG A CD   11 
ATOM 7253  N NE   . ARG A 1 8  ? 24.683 0.842   -1.696  1.00 0.00 ? 8  ARG A NE   11 
ATOM 7254  C CZ   . ARG A 1 8  ? 23.546 0.579   -2.373  1.00 0.00 ? 8  ARG A CZ   11 
ATOM 7255  N NH1  . ARG A 1 8  ? 23.336 1.078   -3.588  1.00 0.00 ? 8  ARG A NH1  11 
ATOM 7256  N NH2  . ARG A 1 8  ? 22.624 -0.194  -1.806  1.00 0.00 ? 8  ARG A NH2  11 
ATOM 7257  H H    . ARG A 1 8  ? 29.685 2.939   -3.518  1.00 0.00 ? 8  ARG A H    11 
ATOM 7258  H HA   . ARG A 1 8  ? 28.001 4.298   -1.587  1.00 0.00 ? 8  ARG A HA   11 
ATOM 7259  H HB2  . ARG A 1 8  ? 28.302 1.673   -2.625  1.00 0.00 ? 8  ARG A HB2  11 
ATOM 7260  H HB3  . ARG A 1 8  ? 28.805 1.456   -1.008  1.00 0.00 ? 8  ARG A HB3  11 
ATOM 7261  H HG2  . ARG A 1 8  ? 26.697 1.351   -0.332  1.00 0.00 ? 8  ARG A HG2  11 
ATOM 7262  H HG3  . ARG A 1 8  ? 26.407 2.999   -0.746  1.00 0.00 ? 8  ARG A HG3  11 
ATOM 7263  H HD2  . ARG A 1 8  ? 25.414 2.452   -2.821  1.00 0.00 ? 8  ARG A HD2  11 
ATOM 7264  H HD3  . ARG A 1 8  ? 26.276 0.922   -2.978  1.00 0.00 ? 8  ARG A HD3  11 
ATOM 7265  H HE   . ARG A 1 8  ? 24.793 0.457   -0.779  1.00 0.00 ? 8  ARG A HE   11 
ATOM 7266  H HH11 . ARG A 1 8  ? 24.028 1.664   -4.016  1.00 0.00 ? 8  ARG A HH11 11 
ATOM 7267  H HH12 . ARG A 1 8  ? 22.486 0.872   -4.072  1.00 0.00 ? 8  ARG A HH12 11 
ATOM 7268  H HH21 . ARG A 1 8  ? 22.787 -0.578  -0.894  1.00 0.00 ? 8  ARG A HH21 11 
ATOM 7269  H HH22 . ARG A 1 8  ? 21.773 -0.391  -2.290  1.00 0.00 ? 8  ARG A HH22 11 
ATOM 7270  N N    . LEU A 1 9  ? 30.937 2.981   -0.836  1.00 0.00 ? 9  LEU A N    11 
ATOM 7271  C CA   . LEU A 1 9  ? 32.171 2.983   -0.063  1.00 0.00 ? 9  LEU A CA   11 
ATOM 7272  C C    . LEU A 1 9  ? 32.767 4.411   -0.091  1.00 0.00 ? 9  LEU A C    11 
ATOM 7273  O O    . LEU A 1 9  ? 33.095 4.971   0.941   1.00 0.00 ? 9  LEU A O    11 
ATOM 7274  C CB   . LEU A 1 9  ? 33.135 1.942   -0.636  1.00 0.00 ? 9  LEU A CB   11 
ATOM 7275  C CG   . LEU A 1 9  ? 32.606 0.495   -0.667  1.00 0.00 ? 9  LEU A CG   11 
ATOM 7276  C CD1  . LEU A 1 9  ? 33.343 -0.249  -1.787  1.00 0.00 ? 9  LEU A CD1  11 
ATOM 7277  C CD2  . LEU A 1 9  ? 32.717 -0.230  0.676   1.00 0.00 ? 9  LEU A CD2  11 
ATOM 7278  H H    . LEU A 1 9  ? 30.886 2.364   -1.610  1.00 0.00 ? 9  LEU A H    11 
ATOM 7279  H HA   . LEU A 1 9  ? 31.934 2.663   0.946   1.00 0.00 ? 9  LEU A HA   11 
ATOM 7280  H HB2  . LEU A 1 9  ? 33.363 2.263   -1.649  1.00 0.00 ? 9  LEU A HB2  11 
ATOM 7281  H HB3  . LEU A 1 9  ? 34.077 1.940   -0.092  1.00 0.00 ? 9  LEU A HB3  11 
ATOM 7282  H HG   . LEU A 1 9  ? 31.541 0.491   -0.878  1.00 0.00 ? 9  LEU A HG   11 
ATOM 7283  H HD11 . LEU A 1 9  ? 33.412 0.352   -2.684  1.00 0.00 ? 9  LEU A HD11 11 
ATOM 7284  H HD12 . LEU A 1 9  ? 32.810 -1.137  -2.096  1.00 0.00 ? 9  LEU A HD12 11 
ATOM 7285  H HD13 . LEU A 1 9  ? 34.366 -0.499  -1.504  1.00 0.00 ? 9  LEU A HD13 11 
ATOM 7286  H HD21 . LEU A 1 9  ? 33.671 -0.742  0.765   1.00 0.00 ? 9  LEU A HD21 11 
ATOM 7287  H HD22 . LEU A 1 9  ? 31.933 -0.976  0.783   1.00 0.00 ? 9  LEU A HD22 11 
ATOM 7288  H HD23 . LEU A 1 9  ? 32.614 0.462   1.509   1.00 0.00 ? 9  LEU A HD23 11 
ATOM 7289  N N    . LYS A 1 10 ? 32.830 4.990   -1.312  1.00 0.00 ? 10 LYS A N    11 
ATOM 7290  C CA   . LYS A 1 10 ? 33.255 6.394   -1.423  1.00 0.00 ? 10 LYS A CA   11 
ATOM 7291  C C    . LYS A 1 10 ? 32.298 7.365   -0.698  1.00 0.00 ? 10 LYS A C    11 
ATOM 7292  O O    . LYS A 1 10 ? 32.733 8.387   -0.185  1.00 0.00 ? 10 LYS A O    11 
ATOM 7293  C CB   . LYS A 1 10 ? 33.293 6.850   -2.884  1.00 0.00 ? 10 LYS A CB   11 
ATOM 7294  C CG   . LYS A 1 10 ? 34.598 6.519   -3.607  1.00 0.00 ? 10 LYS A CG   11 
ATOM 7295  C CD   . LYS A 1 10 ? 34.803 7.440   -4.815  1.00 0.00 ? 10 LYS A CD   11 
ATOM 7296  C CE   . LYS A 1 10 ? 33.553 7.538   -5.711  1.00 0.00 ? 10 LYS A CE   11 
ATOM 7297  N NZ   . LYS A 1 10 ? 33.860 7.461   -7.127  1.00 0.00 ? 10 LYS A NZ   11 
ATOM 7298  H H    . LYS A 1 10 ? 32.548 4.459   -2.113  1.00 0.00 ? 10 LYS A H    11 
ATOM 7299  H HA   . LYS A 1 10 ? 34.243 6.476   -0.964  1.00 0.00 ? 10 LYS A HA   11 
ATOM 7300  H HB2  . LYS A 1 10 ? 32.420 6.462   -3.409  1.00 0.00 ? 10 LYS A HB2  11 
ATOM 7301  H HB3  . LYS A 1 10 ? 33.204 7.937   -2.932  1.00 0.00 ? 10 LYS A HB3  11 
ATOM 7302  H HG2  . LYS A 1 10 ? 35.421 6.657   -2.911  1.00 0.00 ? 10 LYS A HG2  11 
ATOM 7303  H HG3  . LYS A 1 10 ? 34.637 5.472   -3.896  1.00 0.00 ? 10 LYS A HG3  11 
ATOM 7304  H HD2  . LYS A 1 10 ? 35.066 8.437   -4.449  1.00 0.00 ? 10 LYS A HD2  11 
ATOM 7305  H HD3  . LYS A 1 10 ? 35.660 7.101   -5.392  1.00 0.00 ? 10 LYS A HD3  11 
ATOM 7306  H HE2  . LYS A 1 10 ? 32.832 6.739   -5.529  1.00 0.00 ? 10 LYS A HE2  11 
ATOM 7307  H HE3  . LYS A 1 10 ? 33.052 8.489   -5.518  1.00 0.00 ? 10 LYS A HE3  11 
ATOM 7308  H HZ1  . LYS A 1 10 ? 34.489 8.242   -7.402  1.00 0.00 ? 10 LYS A HZ1  11 
ATOM 7309  H HZ2  . LYS A 1 10 ? 32.975 7.511   -7.673  1.00 0.00 ? 10 LYS A HZ2  11 
ATOM 7310  H HZ3  . LYS A 1 10 ? 34.321 6.549   -7.323  1.00 0.00 ? 10 LYS A HZ3  11 
ATOM 7311  N N    . ALA A 1 11 ? 30.993 7.018   -0.708  1.00 0.00 ? 11 ALA A N    11 
ATOM 7312  C CA   . ALA A 1 11 ? 29.983 7.911   -0.134  1.00 0.00 ? 11 ALA A CA   11 
ATOM 7313  C C    . ALA A 1 11 ? 30.133 8.072   1.393   1.00 0.00 ? 11 ALA A C    11 
ATOM 7314  O O    . ALA A 1 11 ? 29.637 9.037   1.961   1.00 0.00 ? 11 ALA A O    11 
ATOM 7315  C CB   . ALA A 1 11 ? 28.565 7.436   -0.478  1.00 0.00 ? 11 ALA A CB   11 
ATOM 7316  H H    . ALA A 1 11 ? 30.715 6.157   -1.134  1.00 0.00 ? 11 ALA A H    11 
ATOM 7317  H HA   . ALA A 1 11 ? 30.134 8.890   -0.594  1.00 0.00 ? 11 ALA A HA   11 
ATOM 7318  H HB1  . ALA A 1 11 ? 28.320 7.697   -1.506  1.00 0.00 ? 11 ALA A HB1  11 
ATOM 7319  H HB2  . ALA A 1 11 ? 27.812 7.902   0.159   1.00 0.00 ? 11 ALA A HB2  11 
ATOM 7320  H HB3  . ALA A 1 11 ? 28.446 6.361   -0.378  1.00 0.00 ? 11 ALA A HB3  11 
ATOM 7321  N N    . LEU A 1 12 ? 30.851 7.112   2.016   1.00 0.00 ? 12 LEU A N    11 
ATOM 7322  C CA   . LEU A 1 12 ? 31.144 7.191   3.444   1.00 0.00 ? 12 LEU A CA   11 
ATOM 7323  C C    . LEU A 1 12 ? 32.299 8.197   3.745   1.00 0.00 ? 12 LEU A C    11 
ATOM 7324  O O    . LEU A 1 12 ? 32.711 8.326   4.891   1.00 0.00 ? 12 LEU A O    11 
ATOM 7325  C CB   . LEU A 1 12 ? 31.523 5.789   3.956   1.00 0.00 ? 12 LEU A CB   11 
ATOM 7326  C CG   . LEU A 1 12 ? 30.413 4.711   4.004   1.00 0.00 ? 12 LEU A CG   11 
ATOM 7327  C CD1  . LEU A 1 12 ? 30.593 3.701   2.871   1.00 0.00 ? 12 LEU A CD1  11 
ATOM 7328  C CD2  . LEU A 1 12 ? 30.439 3.925   5.319   1.00 0.00 ? 12 LEU A CD2  11 
ATOM 7329  H H    . LEU A 1 12 ? 31.227 6.345   1.497   1.00 0.00 ? 12 LEU A H    11 
ATOM 7330  H HA   . LEU A 1 12 ? 30.247 7.546   3.952   1.00 0.00 ? 12 LEU A HA   11 
ATOM 7331  H HB2  . LEU A 1 12 ? 32.315 5.437   3.308   1.00 0.00 ? 12 LEU A HB2  11 
ATOM 7332  H HB3  . LEU A 1 12 ? 31.954 5.884   4.948   1.00 0.00 ? 12 LEU A HB3  11 
ATOM 7333  H HG   . LEU A 1 12 ? 29.442 5.199   3.908   1.00 0.00 ? 12 LEU A HG   11 
ATOM 7334  H HD11 . LEU A 1 12 ? 31.019 4.225   2.028   1.00 0.00 ? 12 LEU A HD11 11 
ATOM 7335  H HD12 . LEU A 1 12 ? 29.649 3.245   2.572   1.00 0.00 ? 12 LEU A HD12 11 
ATOM 7336  H HD13 . LEU A 1 12 ? 31.294 2.903   3.127   1.00 0.00 ? 12 LEU A HD13 11 
ATOM 7337  H HD21 . LEU A 1 12 ? 31.275 3.229   5.325   1.00 0.00 ? 12 LEU A HD21 11 
ATOM 7338  H HD22 . LEU A 1 12 ? 29.542 3.319   5.428   1.00 0.00 ? 12 LEU A HD22 11 
ATOM 7339  H HD23 . LEU A 1 12 ? 30.541 4.582   6.182   1.00 0.00 ? 12 LEU A HD23 11 
ATOM 7340  N N    . GLY A 1 13 ? 32.783 8.898   2.689   1.00 0.00 ? 13 GLY A N    11 
ATOM 7341  C CA   . GLY A 1 13 ? 33.803 9.943   2.821   1.00 0.00 ? 13 GLY A CA   11 
ATOM 7342  C C    . GLY A 1 13 ? 35.213 9.451   2.455   1.00 0.00 ? 13 GLY A C    11 
ATOM 7343  O O    . GLY A 1 13 ? 36.203 9.963   2.968   1.00 0.00 ? 13 GLY A O    11 
ATOM 7344  H H    . GLY A 1 13 ? 32.401 8.737   1.781   1.00 0.00 ? 13 GLY A H    11 
ATOM 7345  H HA2  . GLY A 1 13 ? 33.521 10.757  2.152   1.00 0.00 ? 13 GLY A HA2  11 
ATOM 7346  H HA3  . GLY A 1 13 ? 33.798 10.319  3.846   1.00 0.00 ? 13 GLY A HA3  11 
ATOM 7347  N N    . PHE A 1 14 ? 35.242 8.427   1.568   1.00 0.00 ? 14 PHE A N    11 
ATOM 7348  C CA   . PHE A 1 14 ? 36.480 7.724   1.219   1.00 0.00 ? 14 PHE A CA   11 
ATOM 7349  C C    . PHE A 1 14 ? 36.870 8.093   -0.233  1.00 0.00 ? 14 PHE A C    11 
ATOM 7350  O O    . PHE A 1 14 ? 36.658 9.220   -0.664  1.00 0.00 ? 14 PHE A O    11 
ATOM 7351  C CB   . PHE A 1 14 ? 36.264 6.206   1.442   1.00 0.00 ? 14 PHE A CB   11 
ATOM 7352  C CG   . PHE A 1 14 ? 35.754 5.853   2.821   1.00 0.00 ? 14 PHE A CG   11 
ATOM 7353  C CD1  . PHE A 1 14 ? 35.969 6.678   3.929   1.00 0.00 ? 14 PHE A CD1  11 
ATOM 7354  C CD2  . PHE A 1 14 ? 34.999 4.696   2.984   1.00 0.00 ? 14 PHE A CD2  11 
ATOM 7355  C CE1  . PHE A 1 14 ? 35.352 6.408   5.136   1.00 0.00 ? 14 PHE A CE1  11 
ATOM 7356  C CE2  . PHE A 1 14 ? 34.379 4.426   4.198   1.00 0.00 ? 14 PHE A CE2  11 
ATOM 7357  C CZ   . PHE A 1 14 ? 34.532 5.300   5.264   1.00 0.00 ? 14 PHE A CZ   11 
ATOM 7358  H H    . PHE A 1 14 ? 34.381 8.102   1.178   1.00 0.00 ? 14 PHE A H    11 
ATOM 7359  H HA   . PHE A 1 14 ? 37.277 8.099   1.865   1.00 0.00 ? 14 PHE A HA   11 
ATOM 7360  H HB2  . PHE A 1 14 ? 35.536 5.856   0.709   1.00 0.00 ? 14 PHE A HB2  11 
ATOM 7361  H HB3  . PHE A 1 14 ? 37.167 5.630   1.274   1.00 0.00 ? 14 PHE A HB3  11 
ATOM 7362  H HD1  . PHE A 1 14 ? 36.600 7.557   3.876   1.00 0.00 ? 14 PHE A HD1  11 
ATOM 7363  H HD2  . PHE A 1 14 ? 34.886 3.998   2.162   1.00 0.00 ? 14 PHE A HD2  11 
ATOM 7364  H HE1  . PHE A 1 14 ? 35.487 7.065   5.980   1.00 0.00 ? 14 PHE A HE1  11 
ATOM 7365  H HE2  . PHE A 1 14 ? 33.749 3.551   4.282   1.00 0.00 ? 14 PHE A HE2  11 
ATOM 7366  H HZ   . PHE A 1 14 ? 34.008 5.155   6.201   1.00 0.00 ? 14 PHE A HZ   11 
ATOM 7367  N N    . GLU A 1 15 ? 37.451 7.101   -0.948  1.00 0.00 ? 15 GLU A N    11 
ATOM 7368  C CA   . GLU A 1 15 ? 37.960 7.288   -2.308  1.00 0.00 ? 15 GLU A CA   11 
ATOM 7369  C C    . GLU A 1 15 ? 38.045 5.915   -2.976  1.00 0.00 ? 15 GLU A C    11 
ATOM 7370  O O    . GLU A 1 15 ? 38.428 4.942   -2.346  1.00 0.00 ? 15 GLU A O    11 
ATOM 7371  C CB   . GLU A 1 15 ? 39.364 7.924   -2.306  1.00 0.00 ? 15 GLU A CB   11 
ATOM 7372  C CG   . GLU A 1 15 ? 39.662 8.717   -3.591  1.00 0.00 ? 15 GLU A CG   11 
ATOM 7373  C CD   . GLU A 1 15 ? 39.203 10.190  -3.536  1.00 0.00 ? 15 GLU A CD   11 
ATOM 7374  O OE1  . GLU A 1 15 ? 39.212 10.779  -2.457  1.00 0.00 ? 15 GLU A OE1  11 
ATOM 7375  O OE2  . GLU A 1 15 ? 38.852 10.738  -4.582  1.00 0.00 ? 15 GLU A OE2  11 
ATOM 7376  H H    . GLU A 1 15 ? 37.551 6.200   -0.525  1.00 0.00 ? 15 GLU A H    11 
ATOM 7377  H HA   . GLU A 1 15 ? 37.247 7.917   -2.844  1.00 0.00 ? 15 GLU A HA   11 
ATOM 7378  H HB2  . GLU A 1 15 ? 39.479 8.545   -1.421  1.00 0.00 ? 15 GLU A HB2  11 
ATOM 7379  H HB3  . GLU A 1 15 ? 40.147 7.170   -2.210  1.00 0.00 ? 15 GLU A HB3  11 
ATOM 7380  H HG2  . GLU A 1 15 ? 40.731 8.703   -3.790  1.00 0.00 ? 15 GLU A HG2  11 
ATOM 7381  H HG3  . GLU A 1 15 ? 39.216 8.224   -4.452  1.00 0.00 ? 15 GLU A HG3  11 
ATOM 7382  N N    . GLU A 1 16 ? 37.682 5.907   -4.277  1.00 0.00 ? 16 GLU A N    11 
ATOM 7383  C CA   . GLU A 1 16 ? 37.563 4.710   -5.108  1.00 0.00 ? 16 GLU A CA   11 
ATOM 7384  C C    . GLU A 1 16 ? 38.836 3.809   -5.096  1.00 0.00 ? 16 GLU A C    11 
ATOM 7385  O O    . GLU A 1 16 ? 38.767 2.641   -5.452  1.00 0.00 ? 16 GLU A O    11 
ATOM 7386  C CB   . GLU A 1 16 ? 37.134 5.133   -6.525  1.00 0.00 ? 16 GLU A CB   11 
ATOM 7387  C CG   . GLU A 1 16 ? 37.499 4.154   -7.658  1.00 0.00 ? 16 GLU A CG   11 
ATOM 7388  C CD   . GLU A 1 16 ? 36.803 4.473   -8.997  1.00 0.00 ? 16 GLU A CD   11 
ATOM 7389  O OE1  . GLU A 1 16 ? 35.740 5.093   -8.992  1.00 0.00 ? 16 GLU A OE1  11 
ATOM 7390  O OE2  . GLU A 1 16 ? 37.335 4.088   -10.039 1.00 0.00 ? 16 GLU A OE2  11 
ATOM 7391  H H    . GLU A 1 16 ? 37.402 6.785   -4.664  1.00 0.00 ? 16 GLU A H    11 
ATOM 7392  H HA   . GLU A 1 16 ? 36.714 4.167   -4.695  1.00 0.00 ? 16 GLU A HA   11 
ATOM 7393  H HB2  . GLU A 1 16 ? 36.051 5.266   -6.506  1.00 0.00 ? 16 GLU A HB2  11 
ATOM 7394  H HB3  . GLU A 1 16 ? 37.571 6.105   -6.751  1.00 0.00 ? 16 GLU A HB3  11 
ATOM 7395  H HG2  . GLU A 1 16 ? 38.575 4.192   -7.809  1.00 0.00 ? 16 GLU A HG2  11 
ATOM 7396  H HG3  . GLU A 1 16 ? 37.264 3.126   -7.392  1.00 0.00 ? 16 GLU A HG3  11 
ATOM 7397  N N    . SER A 1 17 ? 39.979 4.381   -4.664  1.00 0.00 ? 17 SER A N    11 
ATOM 7398  C CA   . SER A 1 17 ? 41.209 3.604   -4.556  1.00 0.00 ? 17 SER A CA   11 
ATOM 7399  C C    . SER A 1 17 ? 41.226 2.778   -3.259  1.00 0.00 ? 17 SER A C    11 
ATOM 7400  O O    . SER A 1 17 ? 41.421 1.570   -3.301  1.00 0.00 ? 17 SER A O    11 
ATOM 7401  C CB   . SER A 1 17 ? 42.414 4.564   -4.565  1.00 0.00 ? 17 SER A CB   11 
ATOM 7402  O OG   . SER A 1 17 ? 43.059 4.643   -5.820  1.00 0.00 ? 17 SER A OG   11 
ATOM 7403  H H    . SER A 1 17 ? 39.996 5.337   -4.369  1.00 0.00 ? 17 SER A H    11 
ATOM 7404  H HA   . SER A 1 17 ? 41.218 2.904   -5.399  1.00 0.00 ? 17 SER A HA   11 
ATOM 7405  H HB2  . SER A 1 17 ? 42.080 5.572   -4.332  1.00 0.00 ? 17 SER A HB2  11 
ATOM 7406  H HB3  . SER A 1 17 ? 43.141 4.343   -3.777  1.00 0.00 ? 17 SER A HB3  11 
ATOM 7407  H HG   . SER A 1 17 ? 43.372 3.781   -6.074  1.00 0.00 ? 17 SER A HG   11 
ATOM 7408  N N    . LEU A 1 18 ? 41.019 3.483   -2.118  1.00 0.00 ? 18 LEU A N    11 
ATOM 7409  C CA   . LEU A 1 18 ? 41.009 2.788   -0.823  1.00 0.00 ? 18 LEU A CA   11 
ATOM 7410  C C    . LEU A 1 18 ? 39.829 1.820   -0.725  1.00 0.00 ? 18 LEU A C    11 
ATOM 7411  O O    . LEU A 1 18 ? 39.862 0.869   0.049   1.00 0.00 ? 18 LEU A O    11 
ATOM 7412  C CB   . LEU A 1 18 ? 41.100 3.759   0.376   1.00 0.00 ? 18 LEU A CB   11 
ATOM 7413  C CG   . LEU A 1 18 ? 39.823 4.475   0.881   1.00 0.00 ? 18 LEU A CG   11 
ATOM 7414  C CD1  . LEU A 1 18 ? 39.534 4.181   2.363   1.00 0.00 ? 18 LEU A CD1  11 
ATOM 7415  C CD2  . LEU A 1 18 ? 39.935 5.991   0.695   1.00 0.00 ? 18 LEU A CD2  11 
ATOM 7416  H H    . LEU A 1 18 ? 40.848 4.465   -2.185  1.00 0.00 ? 18 LEU A H    11 
ATOM 7417  H HA   . LEU A 1 18 ? 41.913 2.179   -0.804  1.00 0.00 ? 18 LEU A HA   11 
ATOM 7418  H HB2  . LEU A 1 18 ? 41.509 3.192   1.204   1.00 0.00 ? 18 LEU A HB2  11 
ATOM 7419  H HB3  . LEU A 1 18 ? 41.874 4.491   0.162   1.00 0.00 ? 18 LEU A HB3  11 
ATOM 7420  H HG   . LEU A 1 18 ? 38.976 4.121   0.299   1.00 0.00 ? 18 LEU A HG   11 
ATOM 7421  H HD11 . LEU A 1 18 ? 39.540 3.112   2.578   1.00 0.00 ? 18 LEU A HD11 11 
ATOM 7422  H HD12 . LEU A 1 18 ? 38.560 4.586   2.637   1.00 0.00 ? 18 LEU A HD12 11 
ATOM 7423  H HD13 . LEU A 1 18 ? 40.270 4.649   3.017   1.00 0.00 ? 18 LEU A HD13 11 
ATOM 7424  H HD21 . LEU A 1 18 ? 40.839 6.384   1.157   1.00 0.00 ? 18 LEU A HD21 11 
ATOM 7425  H HD22 . LEU A 1 18 ? 39.102 6.526   1.150   1.00 0.00 ? 18 LEU A HD22 11 
ATOM 7426  H HD23 . LEU A 1 18 ? 39.974 6.223   -0.363  1.00 0.00 ? 18 LEU A HD23 11 
ATOM 7427  N N    . VAL A 1 19 ? 38.830 2.124   -1.566  1.00 0.00 ? 19 VAL A N    11 
ATOM 7428  C CA   . VAL A 1 19 ? 37.554 1.442   -1.723  1.00 0.00 ? 19 VAL A CA   11 
ATOM 7429  C C    . VAL A 1 19 ? 37.731 0.120   -2.477  1.00 0.00 ? 19 VAL A C    11 
ATOM 7430  O O    . VAL A 1 19 ? 37.395 -0.938  -1.970  1.00 0.00 ? 19 VAL A O    11 
ATOM 7431  C CB   . VAL A 1 19 ? 36.673 2.429   -2.503  1.00 0.00 ? 19 VAL A CB   11 
ATOM 7432  C CG1  . VAL A 1 19 ? 35.611 1.794   -3.397  1.00 0.00 ? 19 VAL A CG1  11 
ATOM 7433  C CG2  . VAL A 1 19 ? 36.101 3.568   -1.640  1.00 0.00 ? 19 VAL A CG2  11 
ATOM 7434  H H    . VAL A 1 19 ? 38.968 2.922   -2.160  1.00 0.00 ? 19 VAL A H    11 
ATOM 7435  H HA   . VAL A 1 19 ? 37.150 1.205   -0.744  1.00 0.00 ? 19 VAL A HA   11 
ATOM 7436  H HB   . VAL A 1 19 ? 37.370 2.902   -3.189  1.00 0.00 ? 19 VAL A HB   11 
ATOM 7437  H HG11 . VAL A 1 19 ? 36.000 1.751   -4.412  1.00 0.00 ? 19 VAL A HG11 11 
ATOM 7438  H HG12 . VAL A 1 19 ? 34.711 2.399   -3.395  1.00 0.00 ? 19 VAL A HG12 11 
ATOM 7439  H HG13 . VAL A 1 19 ? 35.340 0.780   -3.113  1.00 0.00 ? 19 VAL A HG13 11 
ATOM 7440  H HG21 . VAL A 1 19 ? 36.823 3.911   -0.904  1.00 0.00 ? 19 VAL A HG21 11 
ATOM 7441  H HG22 . VAL A 1 19 ? 35.204 3.324   -1.089  1.00 0.00 ? 19 VAL A HG22 11 
ATOM 7442  H HG23 . VAL A 1 19 ? 35.829 4.407   -2.276  1.00 0.00 ? 19 VAL A HG23 11 
ATOM 7443  N N    . ILE A 1 20 ? 38.248 0.258   -3.716  1.00 0.00 ? 20 ILE A N    11 
ATOM 7444  C CA   . ILE A 1 20 ? 38.445 -0.894  -4.594  1.00 0.00 ? 20 ILE A CA   11 
ATOM 7445  C C    . ILE A 1 20 ? 39.308 -1.950  -3.903  1.00 0.00 ? 20 ILE A C    11 
ATOM 7446  O O    . ILE A 1 20 ? 38.970 -3.121  -3.917  1.00 0.00 ? 20 ILE A O    11 
ATOM 7447  C CB   . ILE A 1 20 ? 39.053 -0.442  -5.945  1.00 0.00 ? 20 ILE A CB   11 
ATOM 7448  C CG1  . ILE A 1 20 ? 37.974 0.105   -6.894  1.00 0.00 ? 20 ILE A CG1  11 
ATOM 7449  C CG2  . ILE A 1 20 ? 39.877 -1.517  -6.672  1.00 0.00 ? 20 ILE A CG2  11 
ATOM 7450  C CD1  . ILE A 1 20 ? 37.087 -0.990  -7.508  1.00 0.00 ? 20 ILE A CD1  11 
ATOM 7451  H H    . ILE A 1 20 ? 38.485 1.172   -4.039  1.00 0.00 ? 20 ILE A H    11 
ATOM 7452  H HA   . ILE A 1 20 ? 37.464 -1.347  -4.734  1.00 0.00 ? 20 ILE A HA   11 
ATOM 7453  H HB   . ILE A 1 20 ? 39.747 0.368   -5.723  1.00 0.00 ? 20 ILE A HB   11 
ATOM 7454  H HG12 . ILE A 1 20 ? 37.368 0.839   -6.366  1.00 0.00 ? 20 ILE A HG12 11 
ATOM 7455  H HG13 . ILE A 1 20 ? 38.446 0.650   -7.712  1.00 0.00 ? 20 ILE A HG13 11 
ATOM 7456  H HG21 . ILE A 1 20 ? 40.264 -1.136  -7.615  1.00 0.00 ? 20 ILE A HG21 11 
ATOM 7457  H HG22 . ILE A 1 20 ? 39.273 -2.388  -6.905  1.00 0.00 ? 20 ILE A HG22 11 
ATOM 7458  H HG23 . ILE A 1 20 ? 40.733 -1.844  -6.084  1.00 0.00 ? 20 ILE A HG23 11 
ATOM 7459  H HD11 . ILE A 1 20 ? 37.638 -1.608  -8.218  1.00 0.00 ? 20 ILE A HD11 11 
ATOM 7460  H HD12 . ILE A 1 20 ? 36.267 -0.533  -8.057  1.00 0.00 ? 20 ILE A HD12 11 
ATOM 7461  H HD13 . ILE A 1 20 ? 36.671 -1.663  -6.757  1.00 0.00 ? 20 ILE A HD13 11 
ATOM 7462  N N    . GLN A 1 21 ? 40.407 -1.450  -3.302  1.00 0.00 ? 21 GLN A N    11 
ATOM 7463  C CA   . GLN A 1 21 ? 41.351 -2.283  -2.570  1.00 0.00 ? 21 GLN A CA   11 
ATOM 7464  C C    . GLN A 1 21 ? 40.770 -2.775  -1.229  1.00 0.00 ? 21 GLN A C    11 
ATOM 7465  O O    . GLN A 1 21 ? 41.133 -3.843  -0.765  1.00 0.00 ? 21 GLN A O    11 
ATOM 7466  C CB   . GLN A 1 21 ? 42.637 -1.480  -2.321  1.00 0.00 ? 21 GLN A CB   11 
ATOM 7467  C CG   . GLN A 1 21 ? 43.370 -1.108  -3.619  1.00 0.00 ? 21 GLN A CG   11 
ATOM 7468  C CD   . GLN A 1 21 ? 44.444 -0.028  -3.393  1.00 0.00 ? 21 GLN A CD   11 
ATOM 7469  O OE1  . GLN A 1 21 ? 44.498 0.638   -2.361  1.00 0.00 ? 21 GLN A OE1  11 
ATOM 7470  N NE2  . GLN A 1 21 ? 45.283 0.110   -4.434  1.00 0.00 ? 21 GLN A NE2  11 
ATOM 7471  H H    . GLN A 1 21 ? 40.598 -0.473  -3.386  1.00 0.00 ? 21 GLN A H    11 
ATOM 7472  H HA   . GLN A 1 21 ? 41.567 -3.150  -3.195  1.00 0.00 ? 21 GLN A HA   11 
ATOM 7473  H HB2  . GLN A 1 21 ? 42.376 -0.579  -1.766  1.00 0.00 ? 21 GLN A HB2  11 
ATOM 7474  H HB3  . GLN A 1 21 ? 43.325 -2.045  -1.693  1.00 0.00 ? 21 GLN A HB3  11 
ATOM 7475  H HG2  . GLN A 1 21 ? 43.837 -1.992  -4.052  1.00 0.00 ? 21 GLN A HG2  11 
ATOM 7476  H HG3  . GLN A 1 21 ? 42.674 -0.744  -4.371  1.00 0.00 ? 21 GLN A HG3  11 
ATOM 7477  H HE21 . GLN A 1 21 ? 45.212 -0.503  -5.228  1.00 0.00 ? 21 GLN A HE21 11 
ATOM 7478  H HE22 . GLN A 1 21 ? 45.988 0.812   -4.445  1.00 0.00 ? 21 GLN A HE22 11 
ATOM 7479  N N    . ALA A 1 22 ? 39.859 -1.965  -0.645  1.00 0.00 ? 22 ALA A N    11 
ATOM 7480  C CA   . ALA A 1 22 ? 39.191 -2.368  0.597   1.00 0.00 ? 22 ALA A CA   11 
ATOM 7481  C C    . ALA A 1 22 ? 38.096 -3.406  0.361   1.00 0.00 ? 22 ALA A C    11 
ATOM 7482  O O    . ALA A 1 22 ? 37.645 -4.030  1.309   1.00 0.00 ? 22 ALA A O    11 
ATOM 7483  C CB   . ALA A 1 22 ? 38.460 -1.200  1.265   1.00 0.00 ? 22 ALA A CB   11 
ATOM 7484  H H    . ALA A 1 22 ? 39.600 -1.123  -1.117  1.00 0.00 ? 22 ALA A H    11 
ATOM 7485  H HA   . ALA A 1 22 ? 39.944 -2.806  1.257   1.00 0.00 ? 22 ALA A HA   11 
ATOM 7486  H HB1  . ALA A 1 22 ? 39.149 -0.481  1.691   1.00 0.00 ? 22 ALA A HB1  11 
ATOM 7487  H HB2  . ALA A 1 22 ? 37.849 -1.557  2.097   1.00 0.00 ? 22 ALA A HB2  11 
ATOM 7488  H HB3  . ALA A 1 22 ? 37.803 -0.669  0.574   1.00 0.00 ? 22 ALA A HB3  11 
ATOM 7489  N N    . TYR A 1 23 ? 37.672 -3.526  -0.911  1.00 0.00 ? 23 TYR A N    11 
ATOM 7490  C CA   . TYR A 1 23 ? 36.596 -4.446  -1.261  1.00 0.00 ? 23 TYR A CA   11 
ATOM 7491  C C    . TYR A 1 23 ? 37.222 -5.739  -1.805  1.00 0.00 ? 23 TYR A C    11 
ATOM 7492  O O    . TYR A 1 23 ? 36.761 -6.821  -1.487  1.00 0.00 ? 23 TYR A O    11 
ATOM 7493  C CB   . TYR A 1 23 ? 35.643 -3.754  -2.254  1.00 0.00 ? 23 TYR A CB   11 
ATOM 7494  C CG   . TYR A 1 23 ? 34.177 -4.038  -1.988  1.00 0.00 ? 23 TYR A CG   11 
ATOM 7495  C CD1  . TYR A 1 23 ? 33.492 -3.259  -1.059  1.00 0.00 ? 23 TYR A CD1  11 
ATOM 7496  C CD2  . TYR A 1 23 ? 33.492 -5.048  -2.632  1.00 0.00 ? 23 TYR A CD2  11 
ATOM 7497  C CE1  . TYR A 1 23 ? 32.140 -3.461  -0.803  1.00 0.00 ? 23 TYR A CE1  11 
ATOM 7498  C CE2  . TYR A 1 23 ? 32.140 -5.256  -2.388  1.00 0.00 ? 23 TYR A CE2  11 
ATOM 7499  C CZ   . TYR A 1 23 ? 31.452 -4.455  -1.485  1.00 0.00 ? 23 TYR A CZ   11 
ATOM 7500  O OH   . TYR A 1 23 ? 30.106 -4.612  -1.237  1.00 0.00 ? 23 TYR A OH   11 
ATOM 7501  H H    . TYR A 1 23 ? 38.089 -2.976  -1.635  1.00 0.00 ? 23 TYR A H    11 
ATOM 7502  H HA   . TYR A 1 23 ? 36.054 -4.700  -0.346  1.00 0.00 ? 23 TYR A HA   11 
ATOM 7503  H HB2  . TYR A 1 23 ? 35.760 -2.682  -2.133  1.00 0.00 ? 23 TYR A HB2  11 
ATOM 7504  H HB3  . TYR A 1 23 ? 35.904 -3.946  -3.295  1.00 0.00 ? 23 TYR A HB3  11 
ATOM 7505  H HD1  . TYR A 1 23 ? 34.019 -2.476  -0.543  1.00 0.00 ? 23 TYR A HD1  11 
ATOM 7506  H HD2  . TYR A 1 23 ? 33.992 -5.709  -3.324  1.00 0.00 ? 23 TYR A HD2  11 
ATOM 7507  H HE1  . TYR A 1 23 ? 31.614 -2.868  -0.071  1.00 0.00 ? 23 TYR A HE1  11 
ATOM 7508  H HE2  . TYR A 1 23 ? 31.652 -6.075  -2.890  1.00 0.00 ? 23 TYR A HE2  11 
ATOM 7509  H HH   . TYR A 1 23 ? 29.799 -5.466  -1.524  1.00 0.00 ? 23 TYR A HH   11 
ATOM 7510  N N    . PHE A 1 24 ? 38.301 -5.557  -2.608  1.00 0.00 ? 24 PHE A N    11 
ATOM 7511  C CA   . PHE A 1 24 ? 39.019 -6.655  -3.267  1.00 0.00 ? 24 PHE A CA   11 
ATOM 7512  C C    . PHE A 1 24 ? 39.871 -7.433  -2.256  1.00 0.00 ? 24 PHE A C    11 
ATOM 7513  O O    . PHE A 1 24 ? 39.927 -8.656  -2.300  1.00 0.00 ? 24 PHE A O    11 
ATOM 7514  C CB   . PHE A 1 24 ? 39.938 -6.142  -4.404  1.00 0.00 ? 24 PHE A CB   11 
ATOM 7515  C CG   . PHE A 1 24 ? 39.402 -6.395  -5.792  1.00 0.00 ? 24 PHE A CG   11 
ATOM 7516  C CD1  . PHE A 1 24 ? 39.214 -7.699  -6.246  1.00 0.00 ? 24 PHE A CD1  11 
ATOM 7517  C CD2  . PHE A 1 24 ? 39.073 -5.343  -6.635  1.00 0.00 ? 24 PHE A CD2  11 
ATOM 7518  C CE1  . PHE A 1 24 ? 38.671 -7.940  -7.500  1.00 0.00 ? 24 PHE A CE1  11 
ATOM 7519  C CE2  . PHE A 1 24 ? 38.529 -5.574  -7.895  1.00 0.00 ? 24 PHE A CE2  11 
ATOM 7520  C CZ   . PHE A 1 24 ? 38.318 -6.876  -8.327  1.00 0.00 ? 24 PHE A CZ   11 
ATOM 7521  H H    . PHE A 1 24 ? 38.673 -4.636  -2.691  1.00 0.00 ? 24 PHE A H    11 
ATOM 7522  H HA   . PHE A 1 24 ? 38.268 -7.341  -3.650  1.00 0.00 ? 24 PHE A HA   11 
ATOM 7523  H HB2  . PHE A 1 24 ? 40.145 -5.083  -4.266  1.00 0.00 ? 24 PHE A HB2  11 
ATOM 7524  H HB3  . PHE A 1 24 ? 40.911 -6.628  -4.369  1.00 0.00 ? 24 PHE A HB3  11 
ATOM 7525  H HD1  . PHE A 1 24 ? 39.472 -8.525  -5.600  1.00 0.00 ? 24 PHE A HD1  11 
ATOM 7526  H HD2  . PHE A 1 24 ? 39.225 -4.338  -6.281  1.00 0.00 ? 24 PHE A HD2  11 
ATOM 7527  H HE1  . PHE A 1 24 ? 38.506 -8.957  -7.825  1.00 0.00 ? 24 PHE A HE1  11 
ATOM 7528  H HE2  . PHE A 1 24 ? 38.255 -4.739  -8.526  1.00 0.00 ? 24 PHE A HE2  11 
ATOM 7529  H HZ   . PHE A 1 24 ? 37.861 -7.065  -9.288  1.00 0.00 ? 24 PHE A HZ   11 
ATOM 7530  N N    . ALA A 1 25 ? 40.525 -6.668  -1.358  1.00 0.00 ? 25 ALA A N    11 
ATOM 7531  C CA   . ALA A 1 25 ? 41.326 -7.276  -0.299  1.00 0.00 ? 25 ALA A CA   11 
ATOM 7532  C C    . ALA A 1 25 ? 40.420 -7.978  0.730   1.00 0.00 ? 25 ALA A C    11 
ATOM 7533  O O    . ALA A 1 25 ? 40.835 -8.917  1.397   1.00 0.00 ? 25 ALA A O    11 
ATOM 7534  C CB   . ALA A 1 25 ? 42.191 -6.216  0.391   1.00 0.00 ? 25 ALA A CB   11 
ATOM 7535  H H    . ALA A 1 25 ? 40.428 -5.675  -1.400  1.00 0.00 ? 25 ALA A H    11 
ATOM 7536  H HA   . ALA A 1 25 ? 41.978 -8.012  -0.773  1.00 0.00 ? 25 ALA A HA   11 
ATOM 7537  H HB1  . ALA A 1 25 ? 42.881 -6.676  1.097   1.00 0.00 ? 25 ALA A HB1  11 
ATOM 7538  H HB2  . ALA A 1 25 ? 41.592 -5.491  0.945   1.00 0.00 ? 25 ALA A HB2  11 
ATOM 7539  H HB3  . ALA A 1 25 ? 42.793 -5.676  -0.340  1.00 0.00 ? 25 ALA A HB3  11 
ATOM 7540  N N    . CYS A 1 26 ? 39.165 -7.482  0.791   1.00 0.00 ? 26 CYS A N    11 
ATOM 7541  C CA   . CYS A 1 26 ? 38.143 -8.074  1.650   1.00 0.00 ? 26 CYS A CA   11 
ATOM 7542  C C    . CYS A 1 26 ? 37.427 -9.276  0.999   1.00 0.00 ? 26 CYS A C    11 
ATOM 7543  O O    . CYS A 1 26 ? 36.487 -9.796  1.586   1.00 0.00 ? 26 CYS A O    11 
ATOM 7544  C CB   . CYS A 1 26 ? 37.110 -7.000  2.006   1.00 0.00 ? 26 CYS A CB   11 
ATOM 7545  S SG   . CYS A 1 26 ? 37.500 -6.248  3.614   1.00 0.00 ? 26 CYS A SG   11 
ATOM 7546  H H    . CYS A 1 26 ? 38.940 -6.681  0.236   1.00 0.00 ? 26 CYS A H    11 
ATOM 7547  H HA   . CYS A 1 26 ? 38.648 -8.416  2.556   1.00 0.00 ? 26 CYS A HA   11 
ATOM 7548  H HB2  . CYS A 1 26 ? 37.125 -6.244  1.228   1.00 0.00 ? 26 CYS A HB2  11 
ATOM 7549  H HB3  . CYS A 1 26 ? 36.081 -7.371  1.986   1.00 0.00 ? 26 CYS A HB3  11 
ATOM 7550  H HG   . CYS A 1 26 ? 37.427 -4.919  3.532   1.00 0.00 ? 26 CYS A HG   11 
ATOM 7551  N N    . GLU A 1 27 ? 37.883 -9.687  -0.213  1.00 0.00 ? 27 GLU A N    11 
ATOM 7552  C CA   . GLU A 1 27 ? 37.238 -10.772 -0.961  1.00 0.00 ? 27 GLU A CA   11 
ATOM 7553  C C    . GLU A 1 27 ? 35.774 -10.399 -1.297  1.00 0.00 ? 27 GLU A C    11 
ATOM 7554  O O    . GLU A 1 27 ? 34.829 -11.072 -0.918  1.00 0.00 ? 27 GLU A O    11 
ATOM 7555  C CB   . GLU A 1 27 ? 37.449 -12.114 -0.217  1.00 0.00 ? 27 GLU A CB   11 
ATOM 7556  C CG   . GLU A 1 27 ? 36.556 -13.298 -0.659  1.00 0.00 ? 27 GLU A CG   11 
ATOM 7557  C CD   . GLU A 1 27 ? 35.304 -13.526 0.233   1.00 0.00 ? 27 GLU A CD   11 
ATOM 7558  O OE1  . GLU A 1 27 ? 35.384 -13.294 1.436   1.00 0.00 ? 27 GLU A OE1  11 
ATOM 7559  O OE2  . GLU A 1 27 ? 34.261 -13.930 -0.289  1.00 0.00 ? 27 GLU A OE2  11 
ATOM 7560  H H    . GLU A 1 27 ? 38.705 -9.276  -0.599  1.00 0.00 ? 27 GLU A H    11 
ATOM 7561  H HA   . GLU A 1 27 ? 37.767 -10.832 -1.914  1.00 0.00 ? 27 GLU A HA   11 
ATOM 7562  H HB2  . GLU A 1 27 ? 38.484 -12.410 -0.396  1.00 0.00 ? 27 GLU A HB2  11 
ATOM 7563  H HB3  . GLU A 1 27 ? 37.414 -11.972 0.863   1.00 0.00 ? 27 GLU A HB3  11 
ATOM 7564  H HG2  . GLU A 1 27 ? 36.267 -13.190 -1.702  1.00 0.00 ? 27 GLU A HG2  11 
ATOM 7565  H HG3  . GLU A 1 27 ? 37.146 -14.210 -0.626  1.00 0.00 ? 27 GLU A HG3  11 
ATOM 7566  N N    . LYS A 1 28 ? 35.667 -9.275  -2.033  1.00 0.00 ? 28 LYS A N    11 
ATOM 7567  C CA   . LYS A 1 28 ? 34.421 -8.727  -2.568  1.00 0.00 ? 28 LYS A CA   11 
ATOM 7568  C C    . LYS A 1 28 ? 33.189 -8.954  -1.659  1.00 0.00 ? 28 LYS A C    11 
ATOM 7569  O O    . LYS A 1 28 ? 32.154 -9.456  -2.079  1.00 0.00 ? 28 LYS A O    11 
ATOM 7570  C CB   . LYS A 1 28 ? 34.284 -9.220  -4.030  1.00 0.00 ? 28 LYS A CB   11 
ATOM 7571  C CG   . LYS A 1 28 ? 34.619 -8.133  -5.064  1.00 0.00 ? 28 LYS A CG   11 
ATOM 7572  C CD   . LYS A 1 28 ? 35.960 -7.427  -4.858  1.00 0.00 ? 28 LYS A CD   11 
ATOM 7573  C CE   . LYS A 1 28 ? 35.969 -5.979  -5.376  1.00 0.00 ? 28 LYS A CE   11 
ATOM 7574  N NZ   . LYS A 1 28 ? 35.655 -5.855  -6.791  1.00 0.00 ? 28 LYS A NZ   11 
ATOM 7575  H H    . LYS A 1 28 ? 36.510 -8.815  -2.313  1.00 0.00 ? 28 LYS A H    11 
ATOM 7576  H HA   . LYS A 1 28 ? 34.577 -7.653  -2.539  1.00 0.00 ? 28 LYS A HA   11 
ATOM 7577  H HB2  . LYS A 1 28 ? 34.919 -10.090 -4.210  1.00 0.00 ? 28 LYS A HB2  11 
ATOM 7578  H HB3  . LYS A 1 28 ? 33.276 -9.576  -4.224  1.00 0.00 ? 28 LYS A HB3  11 
ATOM 7579  H HG2  . LYS A 1 28 ? 34.593 -8.570  -6.063  1.00 0.00 ? 28 LYS A HG2  11 
ATOM 7580  H HG3  . LYS A 1 28 ? 33.845 -7.380  -5.021  1.00 0.00 ? 28 LYS A HG3  11 
ATOM 7581  H HD2  . LYS A 1 28 ? 36.197 -7.369  -3.802  1.00 0.00 ? 28 LYS A HD2  11 
ATOM 7582  H HD3  . LYS A 1 28 ? 36.742 -8.024  -5.331  1.00 0.00 ? 28 LYS A HD3  11 
ATOM 7583  H HE2  . LYS A 1 28 ? 35.289 -5.311  -4.854  1.00 0.00 ? 28 LYS A HE2  11 
ATOM 7584  H HE3  . LYS A 1 28 ? 36.952 -5.559  -5.193  1.00 0.00 ? 28 LYS A HE3  11 
ATOM 7585  H HZ1  . LYS A 1 28 ? 35.954 -4.917  -7.122  1.00 0.00 ? 28 LYS A HZ1  11 
ATOM 7586  H HZ2  . LYS A 1 28 ? 34.627 -5.955  -6.939  1.00 0.00 ? 28 LYS A HZ2  11 
ATOM 7587  H HZ3  . LYS A 1 28 ? 36.141 -6.583  -7.345  1.00 0.00 ? 28 LYS A HZ3  11 
ATOM 7588  N N    . ASN A 1 29 ? 33.393 -8.567  -0.377  1.00 0.00 ? 29 ASN A N    11 
ATOM 7589  C CA   . ASN A 1 29 ? 32.407 -8.860  0.663   1.00 0.00 ? 29 ASN A CA   11 
ATOM 7590  C C    . ASN A 1 29 ? 31.514 -7.616  0.844   1.00 0.00 ? 29 ASN A C    11 
ATOM 7591  O O    . ASN A 1 29 ? 31.225 -6.955  -0.141  1.00 0.00 ? 29 ASN A O    11 
ATOM 7592  C CB   . ASN A 1 29 ? 33.141 -9.332  1.937   1.00 0.00 ? 29 ASN A CB   11 
ATOM 7593  C CG   . ASN A 1 29 ? 32.316 -10.379 2.698   1.00 0.00 ? 29 ASN A CG   11 
ATOM 7594  O OD1  . ASN A 1 29 ? 31.268 -10.092 3.272   1.00 0.00 ? 29 ASN A OD1  11 
ATOM 7595  N ND2  . ASN A 1 29 ? 32.831 -11.621 2.632   1.00 0.00 ? 29 ASN A ND2  11 
ATOM 7596  H H    . ASN A 1 29 ? 34.260 -8.119  -0.154  1.00 0.00 ? 29 ASN A H    11 
ATOM 7597  H HA   . ASN A 1 29 ? 31.782 -9.668  0.270   1.00 0.00 ? 29 ASN A HA   11 
ATOM 7598  H HB2  . ASN A 1 29 ? 34.087 -9.790  1.654   1.00 0.00 ? 29 ASN A HB2  11 
ATOM 7599  H HB3  . ASN A 1 29 ? 33.406 -8.514  2.604   1.00 0.00 ? 29 ASN A HB3  11 
ATOM 7600  H HD21 . ASN A 1 29 ? 33.721 -11.785 2.191   1.00 0.00 ? 29 ASN A HD21 11 
ATOM 7601  H HD22 . ASN A 1 29 ? 32.343 -12.399 3.006   1.00 0.00 ? 29 ASN A HD22 11 
ATOM 7602  N N    . GLU A 1 30 ? 31.082 -7.316  2.094   1.00 0.00 ? 30 GLU A N    11 
ATOM 7603  C CA   . GLU A 1 30 ? 30.190 -6.172  2.320   1.00 0.00 ? 30 GLU A CA   11 
ATOM 7604  C C    . GLU A 1 30 ? 30.504 -5.538  3.680   1.00 0.00 ? 30 GLU A C    11 
ATOM 7605  O O    . GLU A 1 30 ? 31.083 -4.463  3.766   1.00 0.00 ? 30 GLU A O    11 
ATOM 7606  C CB   . GLU A 1 30 ? 28.708 -6.599  2.261   1.00 0.00 ? 30 GLU A CB   11 
ATOM 7607  C CG   . GLU A 1 30 ? 28.209 -6.915  0.847   1.00 0.00 ? 30 GLU A CG   11 
ATOM 7608  C CD   . GLU A 1 30 ? 26.796 -7.520  0.855   1.00 0.00 ? 30 GLU A CD   11 
ATOM 7609  O OE1  . GLU A 1 30 ? 25.922 -6.958  1.511   1.00 0.00 ? 30 GLU A OE1  11 
ATOM 7610  O OE2  . GLU A 1 30 ? 26.586 -8.544  0.202   1.00 0.00 ? 30 GLU A OE2  11 
ATOM 7611  H H    . GLU A 1 30 ? 31.347 -7.884  2.872   1.00 0.00 ? 30 GLU A H    11 
ATOM 7612  H HA   . GLU A 1 30 ? 30.408 -5.407  1.575   1.00 0.00 ? 30 GLU A HA   11 
ATOM 7613  H HB2  . GLU A 1 30 ? 28.554 -7.466  2.902   1.00 0.00 ? 30 GLU A HB2  11 
ATOM 7614  H HB3  . GLU A 1 30 ? 28.083 -5.803  2.665   1.00 0.00 ? 30 GLU A HB3  11 
ATOM 7615  H HG2  . GLU A 1 30 ? 28.177 -6.006  0.252   1.00 0.00 ? 30 GLU A HG2  11 
ATOM 7616  H HG3  . GLU A 1 30 ? 28.885 -7.610  0.361   1.00 0.00 ? 30 GLU A HG3  11 
ATOM 7617  N N    . ASN A 1 31 ? 30.091 -6.275  4.727   1.00 0.00 ? 31 ASN A N    11 
ATOM 7618  C CA   . ASN A 1 31 ? 30.350 -5.881  6.108   1.00 0.00 ? 31 ASN A CA   11 
ATOM 7619  C C    . ASN A 1 31 ? 31.858 -5.841  6.399   1.00 0.00 ? 31 ASN A C    11 
ATOM 7620  O O    . ASN A 1 31 ? 32.290 -5.162  7.319   1.00 0.00 ? 31 ASN A O    11 
ATOM 7621  C CB   . ASN A 1 31 ? 29.666 -6.895  7.051   1.00 0.00 ? 31 ASN A CB   11 
ATOM 7622  C CG   . ASN A 1 31 ? 28.573 -6.236  7.899   1.00 0.00 ? 31 ASN A CG   11 
ATOM 7623  O OD1  . ASN A 1 31 ? 27.655 -5.601  7.388   1.00 0.00 ? 31 ASN A OD1  11 
ATOM 7624  N ND2  . ASN A 1 31 ? 28.723 -6.420  9.222   1.00 0.00 ? 31 ASN A ND2  11 
ATOM 7625  H H    . ASN A 1 31 ? 29.621 -7.136  4.539   1.00 0.00 ? 31 ASN A H    11 
ATOM 7626  H HA   . ASN A 1 31 ? 29.958 -4.868  6.236   1.00 0.00 ? 31 ASN A HA   11 
ATOM 7627  H HB2  . ASN A 1 31 ? 29.205 -7.699  6.479   1.00 0.00 ? 31 ASN A HB2  11 
ATOM 7628  H HB3  . ASN A 1 31 ? 30.371 -7.397  7.716   1.00 0.00 ? 31 ASN A HB3  11 
ATOM 7629  H HD21 . ASN A 1 31 ? 29.490 -6.963  9.587   1.00 0.00 ? 31 ASN A HD21 11 
ATOM 7630  H HD22 . ASN A 1 31 ? 28.073 -6.018  9.855   1.00 0.00 ? 31 ASN A HD22 11 
ATOM 7631  N N    . LEU A 1 32 ? 32.615 -6.604  5.581   1.00 0.00 ? 32 LEU A N    11 
ATOM 7632  C CA   . LEU A 1 32 ? 34.059 -6.677  5.782   1.00 0.00 ? 32 LEU A CA   11 
ATOM 7633  C C    . LEU A 1 32 ? 34.717 -5.426  5.185   1.00 0.00 ? 32 LEU A C    11 
ATOM 7634  O O    . LEU A 1 32 ? 35.607 -4.833  5.776   1.00 0.00 ? 32 LEU A O    11 
ATOM 7635  C CB   . LEU A 1 32 ? 34.633 -7.922  5.069   1.00 0.00 ? 32 LEU A CB   11 
ATOM 7636  C CG   . LEU A 1 32 ? 35.777 -8.637  5.814   1.00 0.00 ? 32 LEU A CG   11 
ATOM 7637  C CD1  . LEU A 1 32 ? 36.683 -7.718  6.643   1.00 0.00 ? 32 LEU A CD1  11 
ATOM 7638  C CD2  . LEU A 1 32 ? 35.208 -9.750  6.688   1.00 0.00 ? 32 LEU A CD2  11 
ATOM 7639  H H    . LEU A 1 32 ? 32.177 -7.109  4.836   1.00 0.00 ? 32 LEU A H    11 
ATOM 7640  H HA   . LEU A 1 32 ? 34.215 -6.713  6.866   1.00 0.00 ? 32 LEU A HA   11 
ATOM 7641  H HB2  . LEU A 1 32 ? 33.833 -8.639  4.891   1.00 0.00 ? 32 LEU A HB2  11 
ATOM 7642  H HB3  . LEU A 1 32 ? 34.971 -7.686  4.060   1.00 0.00 ? 32 LEU A HB3  11 
ATOM 7643  H HG   . LEU A 1 32 ? 36.409 -9.112  5.063   1.00 0.00 ? 32 LEU A HG   11 
ATOM 7644  H HD11 . LEU A 1 32 ? 37.569 -8.260  6.977   1.00 0.00 ? 32 LEU A HD11 11 
ATOM 7645  H HD12 . LEU A 1 32 ? 36.174 -7.343  7.531   1.00 0.00 ? 32 LEU A HD12 11 
ATOM 7646  H HD13 . LEU A 1 32 ? 37.020 -6.868  6.060   1.00 0.00 ? 32 LEU A HD13 11 
ATOM 7647  H HD21 . LEU A 1 32 ? 35.995 -10.276 7.226   1.00 0.00 ? 32 LEU A HD21 11 
ATOM 7648  H HD22 . LEU A 1 32 ? 34.676 -10.474 6.072   1.00 0.00 ? 32 LEU A HD22 11 
ATOM 7649  H HD23 . LEU A 1 32 ? 34.507 -9.345  7.417   1.00 0.00 ? 32 LEU A HD23 11 
ATOM 7650  N N    . ALA A 1 33 ? 34.222 -5.083  3.976   1.00 0.00 ? 33 ALA A N    11 
ATOM 7651  C CA   . ALA A 1 33 ? 34.749 -3.938  3.248   1.00 0.00 ? 33 ALA A CA   11 
ATOM 7652  C C    . ALA A 1 33 ? 34.539 -2.639  4.016   1.00 0.00 ? 33 ALA A C    11 
ATOM 7653  O O    . ALA A 1 33 ? 35.461 -1.851  4.170   1.00 0.00 ? 33 ALA A O    11 
ATOM 7654  C CB   . ALA A 1 33 ? 34.061 -3.803  1.903   1.00 0.00 ? 33 ALA A CB   11 
ATOM 7655  H H    . ALA A 1 33 ? 33.497 -5.635  3.562   1.00 0.00 ? 33 ALA A H    11 
ATOM 7656  H HA   . ALA A 1 33 ? 35.816 -4.097  3.110   1.00 0.00 ? 33 ALA A HA   11 
ATOM 7657  H HB1  . ALA A 1 33 ? 34.420 -2.885  1.444   1.00 0.00 ? 33 ALA A HB1  11 
ATOM 7658  H HB2  . ALA A 1 33 ? 32.975 -3.745  1.995   1.00 0.00 ? 33 ALA A HB2  11 
ATOM 7659  H HB3  . ALA A 1 33 ? 34.299 -4.636  1.243   1.00 0.00 ? 33 ALA A HB3  11 
ATOM 7660  N N    . ALA A 1 34 ? 33.292 -2.475  4.503   1.00 0.00 ? 34 ALA A N    11 
ATOM 7661  C CA   . ALA A 1 34 ? 32.984 -1.328  5.346   1.00 0.00 ? 34 ALA A CA   11 
ATOM 7662  C C    . ALA A 1 34 ? 33.939 -1.301  6.550   1.00 0.00 ? 34 ALA A C    11 
ATOM 7663  O O    . ALA A 1 34 ? 34.583 -0.309  6.820   1.00 0.00 ? 34 ALA A O    11 
ATOM 7664  C CB   . ALA A 1 34 ? 31.526 -1.367  5.810   1.00 0.00 ? 34 ALA A CB   11 
ATOM 7665  H H    . ALA A 1 34 ? 32.601 -3.171  4.310   1.00 0.00 ? 34 ALA A H    11 
ATOM 7666  H HA   . ALA A 1 34 ? 33.156 -0.435  4.741   1.00 0.00 ? 34 ALA A HA   11 
ATOM 7667  H HB1  . ALA A 1 34 ? 31.305 -2.257  6.400   1.00 0.00 ? 34 ALA A HB1  11 
ATOM 7668  H HB2  . ALA A 1 34 ? 30.842 -1.359  4.961   1.00 0.00 ? 34 ALA A HB2  11 
ATOM 7669  H HB3  . ALA A 1 34 ? 31.296 -0.491  6.417   1.00 0.00 ? 34 ALA A HB3  11 
ATOM 7670  N N    . ASN A 1 35 ? 34.044 -2.470  7.216   1.00 0.00 ? 35 ASN A N    11 
ATOM 7671  C CA   . ASN A 1 35 ? 34.944 -2.536  8.367   1.00 0.00 ? 35 ASN A CA   11 
ATOM 7672  C C    . ASN A 1 35 ? 36.402 -2.132  8.019   1.00 0.00 ? 35 ASN A C    11 
ATOM 7673  O O    . ASN A 1 35 ? 37.065 -1.498  8.812   1.00 0.00 ? 35 ASN A O    11 
ATOM 7674  C CB   . ASN A 1 35 ? 34.950 -3.949  8.967   1.00 0.00 ? 35 ASN A CB   11 
ATOM 7675  C CG   . ASN A 1 35 ? 34.917 -3.896  10.499  1.00 0.00 ? 35 ASN A CG   11 
ATOM 7676  O OD1  . ASN A 1 35 ? 34.131 -3.169  11.100  1.00 0.00 ? 35 ASN A OD1  11 
ATOM 7677  N ND2  . ASN A 1 35 ? 35.790 -4.717  11.101  1.00 0.00 ? 35 ASN A ND2  11 
ATOM 7678  H H    . ASN A 1 35 ? 33.509 -3.261  6.923   1.00 0.00 ? 35 ASN A H    11 
ATOM 7679  H HA   . ASN A 1 35 ? 34.534 -1.809  9.074   1.00 0.00 ? 35 ASN A HA   11 
ATOM 7680  H HB2  . ASN A 1 35 ? 34.083 -4.508  8.641   1.00 0.00 ? 35 ASN A HB2  11 
ATOM 7681  H HB3  . ASN A 1 35 ? 35.802 -4.539  8.627   1.00 0.00 ? 35 ASN A HB3  11 
ATOM 7682  H HD21 . ASN A 1 35 ? 36.429 -5.284  10.569  1.00 0.00 ? 35 ASN A HD21 11 
ATOM 7683  H HD22 . ASN A 1 35 ? 35.798 -4.774  12.091  1.00 0.00 ? 35 ASN A HD22 11 
ATOM 7684  N N    . PHE A 1 36 ? 36.841 -2.518  6.802   1.00 0.00 ? 36 PHE A N    11 
ATOM 7685  C CA   . PHE A 1 36 ? 38.196 -2.171  6.328   1.00 0.00 ? 36 PHE A CA   11 
ATOM 7686  C C    . PHE A 1 36 ? 38.379 -0.636  6.280   1.00 0.00 ? 36 PHE A C    11 
ATOM 7687  O O    . PHE A 1 36 ? 39.330 -0.092  6.816   1.00 0.00 ? 36 PHE A O    11 
ATOM 7688  C CB   . PHE A 1 36 ? 38.420 -2.806  4.935   1.00 0.00 ? 36 PHE A CB   11 
ATOM 7689  C CG   . PHE A 1 36 ? 39.798 -2.574  4.330   1.00 0.00 ? 36 PHE A CG   11 
ATOM 7690  C CD1  . PHE A 1 36 ? 40.188 -1.307  3.894   1.00 0.00 ? 36 PHE A CD1  11 
ATOM 7691  C CD2  . PHE A 1 36 ? 40.683 -3.632  4.148   1.00 0.00 ? 36 PHE A CD2  11 
ATOM 7692  C CE1  . PHE A 1 36 ? 41.420 -1.090  3.301   1.00 0.00 ? 36 PHE A CE1  11 
ATOM 7693  C CE2  . PHE A 1 36 ? 41.926 -3.423  3.554   1.00 0.00 ? 36 PHE A CE2  11 
ATOM 7694  C CZ   . PHE A 1 36 ? 42.298 -2.153  3.128   1.00 0.00 ? 36 PHE A CZ   11 
ATOM 7695  H H    . PHE A 1 36 ? 36.201 -2.995  6.215   1.00 0.00 ? 36 PHE A H    11 
ATOM 7696  H HA   . PHE A 1 36 ? 38.907 -2.594  7.039   1.00 0.00 ? 36 PHE A HA   11 
ATOM 7697  H HB2  . PHE A 1 36 ? 38.235 -3.877  4.986   1.00 0.00 ? 36 PHE A HB2  11 
ATOM 7698  H HB3  . PHE A 1 36 ? 37.691 -2.433  4.227   1.00 0.00 ? 36 PHE A HB3  11 
ATOM 7699  H HD1  . PHE A 1 36 ? 39.523 -0.462  3.982   1.00 0.00 ? 36 PHE A HD1  11 
ATOM 7700  H HD2  . PHE A 1 36 ? 40.402 -4.635  4.438   1.00 0.00 ? 36 PHE A HD2  11 
ATOM 7701  H HE1  . PHE A 1 36 ? 41.690 -0.096  2.964   1.00 0.00 ? 36 PHE A HE1  11 
ATOM 7702  H HE2  . PHE A 1 36 ? 42.602 -4.252  3.397   1.00 0.00 ? 36 PHE A HE2  11 
ATOM 7703  H HZ   . PHE A 1 36 ? 43.252 -1.990  2.657   1.00 0.00 ? 36 PHE A HZ   11 
ATOM 7704  N N    . LEU A 1 37 ? 37.421 0.005   5.571   1.00 0.00 ? 37 LEU A N    11 
ATOM 7705  C CA   . LEU A 1 37 ? 37.532 1.419   5.242   1.00 0.00 ? 37 LEU A CA   11 
ATOM 7706  C C    . LEU A 1 37 ? 37.350 2.313   6.489   1.00 0.00 ? 37 LEU A C    11 
ATOM 7707  O O    . LEU A 1 37 ? 37.896 3.411   6.557   1.00 0.00 ? 37 LEU A O    11 
ATOM 7708  C CB   . LEU A 1 37 ? 36.483 1.784   4.182   1.00 0.00 ? 37 LEU A CB   11 
ATOM 7709  C CG   . LEU A 1 37 ? 36.670 1.142   2.791   1.00 0.00 ? 37 LEU A CG   11 
ATOM 7710  C CD1  . LEU A 1 37 ? 35.438 0.336   2.368   1.00 0.00 ? 37 LEU A CD1  11 
ATOM 7711  C CD2  . LEU A 1 37 ? 37.026 2.165   1.693   1.00 0.00 ? 37 LEU A CD2  11 
ATOM 7712  H H    . LEU A 1 37 ? 36.612 -0.488  5.265   1.00 0.00 ? 37 LEU A H    11 
ATOM 7713  H HA   . LEU A 1 37 ? 38.531 1.574   4.837   1.00 0.00 ? 37 LEU A HA   11 
ATOM 7714  H HB2  . LEU A 1 37 ? 35.490 1.561   4.556   1.00 0.00 ? 37 LEU A HB2  11 
ATOM 7715  H HB3  . LEU A 1 37 ? 36.510 2.858   4.092   1.00 0.00 ? 37 LEU A HB3  11 
ATOM 7716  H HG   . LEU A 1 37 ? 37.493 0.438   2.877   1.00 0.00 ? 37 LEU A HG   11 
ATOM 7717  H HD11 . LEU A 1 37 ? 35.722 -0.594  1.873   1.00 0.00 ? 37 LEU A HD11 11 
ATOM 7718  H HD12 . LEU A 1 37 ? 34.826 0.908   1.683   1.00 0.00 ? 37 LEU A HD12 11 
ATOM 7719  H HD13 . LEU A 1 37 ? 34.774 0.109   3.196   1.00 0.00 ? 37 LEU A HD13 11 
ATOM 7720  H HD21 . LEU A 1 37 ? 38.030 1.977   1.326   1.00 0.00 ? 37 LEU A HD21 11 
ATOM 7721  H HD22 . LEU A 1 37 ? 37.012 3.189   2.047   1.00 0.00 ? 37 LEU A HD22 11 
ATOM 7722  H HD23 . LEU A 1 37 ? 36.329 2.156   0.853   1.00 0.00 ? 37 LEU A HD23 11 
ATOM 7723  N N    . LEU A 1 38 ? 36.559 1.777   7.452   1.00 0.00 ? 38 LEU A N    11 
ATOM 7724  C CA   . LEU A 1 38 ? 36.216 2.506   8.672   1.00 0.00 ? 38 LEU A CA   11 
ATOM 7725  C C    . LEU A 1 38 ? 37.303 2.270   9.753   1.00 0.00 ? 38 LEU A C    11 
ATOM 7726  O O    . LEU A 1 38 ? 37.500 3.085   10.647  1.00 0.00 ? 38 LEU A O    11 
ATOM 7727  C CB   . LEU A 1 38 ? 34.809 2.133   9.217   1.00 0.00 ? 38 LEU A CB   11 
ATOM 7728  C CG   . LEU A 1 38 ? 33.601 2.093   8.238   1.00 0.00 ? 38 LEU A CG   11 
ATOM 7729  C CD1  . LEU A 1 38 ? 32.370 2.849   8.756   1.00 0.00 ? 38 LEU A CD1  11 
ATOM 7730  C CD2  . LEU A 1 38 ? 33.918 2.592   6.829   1.00 0.00 ? 38 LEU A CD2  11 
ATOM 7731  H H    . LEU A 1 38 ? 36.187 0.859   7.326   1.00 0.00 ? 38 LEU A H    11 
ATOM 7732  H HA   . LEU A 1 38 ? 36.227 3.560   8.404   1.00 0.00 ? 38 LEU A HA   11 
ATOM 7733  H HB2  . LEU A 1 38 ? 34.885 1.155   9.689   1.00 0.00 ? 38 LEU A HB2  11 
ATOM 7734  H HB3  . LEU A 1 38 ? 34.579 2.833   10.023  1.00 0.00 ? 38 LEU A HB3  11 
ATOM 7735  H HG   . LEU A 1 38 ? 33.269 1.058   8.178   1.00 0.00 ? 38 LEU A HG   11 
ATOM 7736  H HD11 . LEU A 1 38 ? 32.041 2.471   9.722   1.00 0.00 ? 38 LEU A HD11 11 
ATOM 7737  H HD12 . LEU A 1 38 ? 31.534 2.714   8.068   1.00 0.00 ? 38 LEU A HD12 11 
ATOM 7738  H HD13 . LEU A 1 38 ? 32.560 3.920   8.833   1.00 0.00 ? 38 LEU A HD13 11 
ATOM 7739  H HD21 . LEU A 1 38 ? 34.673 3.369   6.861   1.00 0.00 ? 38 LEU A HD21 11 
ATOM 7740  H HD22 . LEU A 1 38 ? 33.033 3.003   6.360   1.00 0.00 ? 38 LEU A HD22 11 
ATOM 7741  H HD23 . LEU A 1 38 ? 34.272 1.810   6.171   1.00 0.00 ? 38 LEU A HD23 11 
ATOM 7742  N N    . SER A 1 39 ? 37.994 1.116   9.599   1.00 0.00 ? 39 SER A N    11 
ATOM 7743  C CA   . SER A 1 39 ? 39.080 0.718   10.497  1.00 0.00 ? 39 SER A CA   11 
ATOM 7744  C C    . SER A 1 39 ? 40.372 1.471   10.160  1.00 0.00 ? 39 SER A C    11 
ATOM 7745  O O    . SER A 1 39 ? 41.191 1.735   11.033  1.00 0.00 ? 39 SER A O    11 
ATOM 7746  C CB   . SER A 1 39 ? 39.332 -0.799  10.422  1.00 0.00 ? 39 SER A CB   11 
ATOM 7747  O OG   . SER A 1 39 ? 38.336 -1.562  11.072  1.00 0.00 ? 39 SER A OG   11 
ATOM 7748  H H    . SER A 1 39 ? 37.770 0.512   8.838   1.00 0.00 ? 39 SER A H    11 
ATOM 7749  H HA   . SER A 1 39 ? 38.778 0.979   11.508  1.00 0.00 ? 39 SER A HA   11 
ATOM 7750  H HB2  . SER A 1 39 ? 39.466 -1.129  9.388   1.00 0.00 ? 39 SER A HB2  11 
ATOM 7751  H HB3  . SER A 1 39 ? 40.260 -1.059  10.930  1.00 0.00 ? 39 SER A HB3  11 
ATOM 7752  H HG   . SER A 1 39 ? 37.473 -1.308  10.752  1.00 0.00 ? 39 SER A HG   11 
ATOM 7753  N N    . GLN A 1 40 ? 40.493 1.803   8.858   1.00 0.00 ? 40 GLN A N    11 
ATOM 7754  C CA   . GLN A 1 40 ? 41.631 2.576   8.383   1.00 0.00 ? 40 GLN A CA   11 
ATOM 7755  C C    . GLN A 1 40 ? 41.372 4.069   8.654   1.00 0.00 ? 40 GLN A C    11 
ATOM 7756  O O    . GLN A 1 40 ? 40.698 4.757   7.896   1.00 0.00 ? 40 GLN A O    11 
ATOM 7757  C CB   . GLN A 1 40 ? 41.855 2.308   6.884   1.00 0.00 ? 40 GLN A CB   11 
ATOM 7758  C CG   . GLN A 1 40 ? 42.270 0.860   6.552   1.00 0.00 ? 40 GLN A CG   11 
ATOM 7759  C CD   . GLN A 1 40 ? 43.787 0.646   6.411   1.00 0.00 ? 40 GLN A CD   11 
ATOM 7760  O OE1  . GLN A 1 40 ? 44.442 0.081   7.286   1.00 0.00 ? 40 GLN A OE1  11 
ATOM 7761  N NE2  . GLN A 1 40 ? 44.252 0.949   5.189   1.00 0.00 ? 40 GLN A NE2  11 
ATOM 7762  H H    . GLN A 1 40 ? 39.776 1.523   8.221   1.00 0.00 ? 40 GLN A H    11 
ATOM 7763  H HA   . GLN A 1 40 ? 42.513 2.258   8.936   1.00 0.00 ? 40 GLN A HA   11 
ATOM 7764  H HB2  . GLN A 1 40 ? 40.927 2.520   6.354   1.00 0.00 ? 40 GLN A HB2  11 
ATOM 7765  H HB3  . GLN A 1 40 ? 42.584 3.009   6.480   1.00 0.00 ? 40 GLN A HB3  11 
ATOM 7766  H HG2  . GLN A 1 40 ? 41.891 0.140   7.275   1.00 0.00 ? 40 GLN A HG2  11 
ATOM 7767  H HG3  . GLN A 1 40 ? 41.813 0.577   5.604   1.00 0.00 ? 40 GLN A HG3  11 
ATOM 7768  H HE21 . GLN A 1 40 ? 44.023 1.823   4.755   1.00 0.00 ? 40 GLN A HE21 11 
ATOM 7769  H HE22 . GLN A 1 40 ? 44.808 0.287   4.682   1.00 0.00 ? 40 GLN A HE22 11 
ATOM 7770  N N    . ASN A 1 41 ? 41.989 4.507   9.774   1.00 0.00 ? 41 ASN A N    11 
ATOM 7771  C CA   . ASN A 1 41 ? 42.067 5.913   10.175  1.00 0.00 ? 41 ASN A CA   11 
ATOM 7772  C C    . ASN A 1 41 ? 42.491 6.821   9.008   1.00 0.00 ? 41 ASN A C    11 
ATOM 7773  O O    . ASN A 1 41 ? 43.462 6.566   8.303   1.00 0.00 ? 41 ASN A O    11 
ATOM 7774  C CB   . ASN A 1 41 ? 43.047 6.084   11.349  1.00 0.00 ? 41 ASN A CB   11 
ATOM 7775  C CG   . ASN A 1 41 ? 44.221 5.088   11.283  1.00 0.00 ? 41 ASN A CG   11 
ATOM 7776  O OD1  . ASN A 1 41 ? 44.836 4.870   10.242  1.00 0.00 ? 41 ASN A OD1  11 
ATOM 7777  N ND2  . ASN A 1 41 ? 44.443 4.454   12.443  1.00 0.00 ? 41 ASN A ND2  11 
ATOM 7778  H H    . ASN A 1 41 ? 42.450 3.832   10.352  1.00 0.00 ? 41 ASN A H    11 
ATOM 7779  H HA   . ASN A 1 41 ? 41.062 6.192   10.496  1.00 0.00 ? 41 ASN A HA   11 
ATOM 7780  H HB2  . ASN A 1 41 ? 43.453 7.094   11.402  1.00 0.00 ? 41 ASN A HB2  11 
ATOM 7781  H HB3  . ASN A 1 41 ? 42.499 5.949   12.281  1.00 0.00 ? 41 ASN A HB3  11 
ATOM 7782  H HD21 . ASN A 1 41 ? 43.987 4.781   13.278  1.00 0.00 ? 41 ASN A HD21 11 
ATOM 7783  H HD22 . ASN A 1 41 ? 45.045 3.665   12.493  1.00 0.00 ? 41 ASN A HD22 11 
ATOM 7784  N N    . PHE A 1 42 ? 41.664 7.876   8.866   1.00 0.00 ? 42 PHE A N    11 
ATOM 7785  C CA   . PHE A 1 42 ? 41.776 8.826   7.773   1.00 0.00 ? 42 PHE A CA   11 
ATOM 7786  C C    . PHE A 1 42 ? 40.737 9.939   8.009   1.00 0.00 ? 42 PHE A C    11 
ATOM 7787  O O    . PHE A 1 42 ? 39.630 9.918   7.487   1.00 0.00 ? 42 PHE A O    11 
ATOM 7788  C CB   . PHE A 1 42 ? 41.565 8.111   6.419   1.00 0.00 ? 42 PHE A CB   11 
ATOM 7789  C CG   . PHE A 1 42 ? 41.570 9.041   5.233   1.00 0.00 ? 42 PHE A CG   11 
ATOM 7790  C CD1  . PHE A 1 42 ? 42.563 10.005  5.081   1.00 0.00 ? 42 PHE A CD1  11 
ATOM 7791  C CD2  . PHE A 1 42 ? 40.570 8.949   4.268   1.00 0.00 ? 42 PHE A CD2  11 
ATOM 7792  C CE1  . PHE A 1 42 ? 42.546 10.875  3.999   1.00 0.00 ? 42 PHE A CE1  11 
ATOM 7793  C CE2  . PHE A 1 42 ? 40.551 9.814   3.184   1.00 0.00 ? 42 PHE A CE2  11 
ATOM 7794  C CZ   . PHE A 1 42 ? 41.536 10.782  3.052   1.00 0.00 ? 42 PHE A CZ   11 
ATOM 7795  H H    . PHE A 1 42 ? 40.935 7.996   9.541   1.00 0.00 ? 42 PHE A H    11 
ATOM 7796  H HA   . PHE A 1 42 ? 42.776 9.257   7.836   1.00 0.00 ? 42 PHE A HA   11 
ATOM 7797  H HB2  . PHE A 1 42 ? 42.355 7.380   6.254   1.00 0.00 ? 42 PHE A HB2  11 
ATOM 7798  H HB3  . PHE A 1 42 ? 40.633 7.544   6.441   1.00 0.00 ? 42 PHE A HB3  11 
ATOM 7799  H HD1  . PHE A 1 42 ? 43.360 10.084  5.804   1.00 0.00 ? 42 PHE A HD1  11 
ATOM 7800  H HD2  . PHE A 1 42 ? 39.801 8.197   4.357   1.00 0.00 ? 42 PHE A HD2  11 
ATOM 7801  H HE1  . PHE A 1 42 ? 43.312 11.629  3.900   1.00 0.00 ? 42 PHE A HE1  11 
ATOM 7802  H HE2  . PHE A 1 42 ? 39.763 9.740   2.449   1.00 0.00 ? 42 PHE A HE2  11 
ATOM 7803  H HZ   . PHE A 1 42 ? 41.510 11.468  2.221   1.00 0.00 ? 42 PHE A HZ   11 
ATOM 7804  N N    . ASP A 1 43 ? 41.190 10.908  8.825   1.00 0.00 ? 43 ASP A N    11 
ATOM 7805  C CA   . ASP A 1 43 ? 40.396 12.084  9.151   1.00 0.00 ? 43 ASP A CA   11 
ATOM 7806  C C    . ASP A 1 43 ? 41.331 13.286  9.407   1.00 0.00 ? 43 ASP A C    11 
ATOM 7807  O O    . ASP A 1 43 ? 41.587 13.667  10.542  1.00 0.00 ? 43 ASP A O    11 
ATOM 7808  C CB   . ASP A 1 43 ? 39.432 11.786  10.327  1.00 0.00 ? 43 ASP A CB   11 
ATOM 7809  C CG   . ASP A 1 43 ? 40.064 11.173  11.606  1.00 0.00 ? 43 ASP A CG   11 
ATOM 7810  O OD1  . ASP A 1 43 ? 41.274 11.248  11.788  1.00 0.00 ? 43 ASP A OD1  11 
ATOM 7811  O OD2  . ASP A 1 43 ? 39.315 10.620  12.417  1.00 0.00 ? 43 ASP A OD2  11 
ATOM 7812  H H    . ASP A 1 43 ? 42.090 10.795  9.241   1.00 0.00 ? 43 ASP A H    11 
ATOM 7813  H HA   . ASP A 1 43 ? 39.796 12.320  8.271   1.00 0.00 ? 43 ASP A HA   11 
ATOM 7814  H HB2  . ASP A 1 43 ? 38.883 12.683  10.599  1.00 0.00 ? 43 ASP A HB2  11 
ATOM 7815  H HB3  . ASP A 1 43 ? 38.664 11.100  9.978   1.00 0.00 ? 43 ASP A HB3  11 
ATOM 7816  N N    . ASP A 1 44 ? 41.790 13.877  8.275   1.00 0.00 ? 44 ASP A N    11 
ATOM 7817  C CA   . ASP A 1 44 ? 42.626 15.089  8.287   1.00 0.00 ? 44 ASP A CA   11 
ATOM 7818  C C    . ASP A 1 44 ? 41.993 16.235  9.114   1.00 0.00 ? 44 ASP A C    11 
ATOM 7819  O O    . ASP A 1 44 ? 42.700 17.075  9.659   1.00 0.00 ? 44 ASP A O    11 
ATOM 7820  C CB   . ASP A 1 44 ? 42.883 15.570  6.836   1.00 0.00 ? 44 ASP A CB   11 
ATOM 7821  C CG   . ASP A 1 44 ? 44.243 15.105  6.275   1.00 0.00 ? 44 ASP A CG   11 
ATOM 7822  O OD1  . ASP A 1 44 ? 44.645 13.976  6.549   1.00 0.00 ? 44 ASP A OD1  11 
ATOM 7823  O OD2  . ASP A 1 44 ? 44.888 15.885  5.570   1.00 0.00 ? 44 ASP A OD2  11 
ATOM 7824  H H    . ASP A 1 44 ? 41.539 13.464  7.399   1.00 0.00 ? 44 ASP A H    11 
ATOM 7825  H HA   . ASP A 1 44 ? 43.560 14.821  8.785   1.00 0.00 ? 44 ASP A HA   11 
ATOM 7826  H HB2  . ASP A 1 44 ? 42.093 15.241  6.162   1.00 0.00 ? 44 ASP A HB2  11 
ATOM 7827  H HB3  . ASP A 1 44 ? 42.865 16.658  6.777   1.00 0.00 ? 44 ASP A HB3  11 
ATOM 7828  N N    . GLU A 1 45 ? 40.647 16.202  9.194   1.00 0.00 ? 45 GLU A N    11 
ATOM 7829  C CA   . GLU A 1 45 ? 39.904 17.125  10.045  1.00 0.00 ? 45 GLU A CA   11 
ATOM 7830  C C    . GLU A 1 45 ? 40.083 16.740  11.538  1.00 0.00 ? 45 GLU A C    11 
ATOM 7831  O O    . GLU A 1 45 ? 41.053 17.193  12.155  1.00 0.00 ? 45 GLU A O    11 
ATOM 7832  C CB   . GLU A 1 45 ? 38.433 17.108  9.584   1.00 0.00 ? 45 GLU A CB   11 
ATOM 7833  C CG   . GLU A 1 45 ? 37.591 18.233  10.211  1.00 0.00 ? 45 GLU A CG   11 
ATOM 7834  C CD   . GLU A 1 45 ? 36.221 18.451  9.528   1.00 0.00 ? 45 GLU A CD   11 
ATOM 7835  O OE1  . GLU A 1 45 ? 35.978 17.880  8.466   1.00 0.00 ? 45 GLU A OE1  11 
ATOM 7836  O OE2  . GLU A 1 45 ? 35.410 19.202  10.071  1.00 0.00 ? 45 GLU A OE2  11 
ATOM 7837  O OXT  . GLU A 1 45 ? 39.261 15.998  12.068  1.00 0.00 ? 45 GLU A OXT  11 
ATOM 7838  H H    . GLU A 1 45 ? 40.146 15.508  8.678   1.00 0.00 ? 45 GLU A H    11 
ATOM 7839  H HA   . GLU A 1 45 ? 40.322 18.118  9.872   1.00 0.00 ? 45 GLU A HA   11 
ATOM 7840  H HB2  . GLU A 1 45 ? 38.424 17.213  8.500   1.00 0.00 ? 45 GLU A HB2  11 
ATOM 7841  H HB3  . GLU A 1 45 ? 37.970 16.143  9.790   1.00 0.00 ? 45 GLU A HB3  11 
ATOM 7842  H HG2  . GLU A 1 45 ? 37.431 18.037  11.269  1.00 0.00 ? 45 GLU A HG2  11 
ATOM 7843  H HG3  . GLU A 1 45 ? 38.143 19.167  10.159  1.00 0.00 ? 45 GLU A HG3  11 
ATOM 7844  N N    . GLN A 1 1  ? 30.662 -6.024  -11.554 1.00 0.00 ? 1  GLN A N    12 
ATOM 7845  C CA   . GLN A 1 1  ? 31.604 -4.917  -11.669 1.00 0.00 ? 1  GLN A CA   12 
ATOM 7846  C C    . GLN A 1 1  ? 32.039 -4.398  -10.291 1.00 0.00 ? 1  GLN A C    12 
ATOM 7847  O O    . GLN A 1 1  ? 33.190 -4.047  -10.084 1.00 0.00 ? 1  GLN A O    12 
ATOM 7848  C CB   . GLN A 1 1  ? 31.013 -3.751  -12.476 1.00 0.00 ? 1  GLN A CB   12 
ATOM 7849  C CG   . GLN A 1 1  ? 30.730 -4.121  -13.943 1.00 0.00 ? 1  GLN A CG   12 
ATOM 7850  C CD   . GLN A 1 1  ? 29.288 -3.773  -14.332 1.00 0.00 ? 1  GLN A CD   12 
ATOM 7851  O OE1  . GLN A 1 1  ? 28.982 -2.694  -14.796 1.00 0.00 ? 1  GLN A OE1  12 
ATOM 7852  N NE2  . GLN A 1 1  ? 28.431 -4.791  -14.094 1.00 0.00 ? 1  GLN A NE2  12 
ATOM 7853  H H1   . GLN A 1 1  ? 30.694 -6.584  -12.437 1.00 0.00 ? 1  GLN A H1   12 
ATOM 7854  H H2   . GLN A 1 1  ? 29.705 -5.653  -11.411 1.00 0.00 ? 1  GLN A H2   12 
ATOM 7855  H H3   . GLN A 1 1  ? 30.934 -6.628  -10.753 1.00 0.00 ? 1  GLN A H3   12 
ATOM 7856  H HA   . GLN A 1 1  ? 32.496 -5.299  -12.162 1.00 0.00 ? 1  GLN A HA   12 
ATOM 7857  H HB2  . GLN A 1 1  ? 30.118 -3.387  -11.968 1.00 0.00 ? 1  GLN A HB2  12 
ATOM 7858  H HB3  . GLN A 1 1  ? 31.705 -2.910  -12.473 1.00 0.00 ? 1  GLN A HB3  12 
ATOM 7859  H HG2  . GLN A 1 1  ? 31.403 -3.587  -14.615 1.00 0.00 ? 1  GLN A HG2  12 
ATOM 7860  H HG3  . GLN A 1 1  ? 30.901 -5.179  -14.127 1.00 0.00 ? 1  GLN A HG3  12 
ATOM 7861  H HE21 . GLN A 1 1  ? 28.778 -5.644  -13.701 1.00 0.00 ? 1  GLN A HE21 12 
ATOM 7862  H HE22 . GLN A 1 1  ? 27.464 -4.697  -14.304 1.00 0.00 ? 1  GLN A HE22 12 
ATOM 7863  N N    . GLU A 1 2  ? 31.026 -4.378  -9.391  1.00 0.00 ? 2  GLU A N    12 
ATOM 7864  C CA   . GLU A 1 2  ? 31.149 -3.953  -7.996  1.00 0.00 ? 2  GLU A CA   12 
ATOM 7865  C C    . GLU A 1 2  ? 31.031 -2.435  -7.828  1.00 0.00 ? 2  GLU A C    12 
ATOM 7866  O O    . GLU A 1 2  ? 30.994 -1.952  -6.706  1.00 0.00 ? 2  GLU A O    12 
ATOM 7867  C CB   . GLU A 1 2  ? 32.427 -4.490  -7.339  1.00 0.00 ? 2  GLU A CB   12 
ATOM 7868  C CG   . GLU A 1 2  ? 32.266 -4.771  -5.832  1.00 0.00 ? 2  GLU A CG   12 
ATOM 7869  C CD   . GLU A 1 2  ? 31.330 -5.972  -5.561  1.00 0.00 ? 2  GLU A CD   12 
ATOM 7870  O OE1  . GLU A 1 2  ? 31.585 -7.054  -6.082  1.00 0.00 ? 2  GLU A OE1  12 
ATOM 7871  O OE2  . GLU A 1 2  ? 30.351 -5.813  -4.829  1.00 0.00 ? 2  GLU A OE2  12 
ATOM 7872  H H    . GLU A 1 2  ? 30.133 -4.677  -9.709  1.00 0.00 ? 2  GLU A H    12 
ATOM 7873  H HA   . GLU A 1 2  ? 30.278 -4.384  -7.505  1.00 0.00 ? 2  GLU A HA   12 
ATOM 7874  H HB2  . GLU A 1 2  ? 32.692 -5.404  -7.863  1.00 0.00 ? 2  GLU A HB2  12 
ATOM 7875  H HB3  . GLU A 1 2  ? 33.267 -3.808  -7.490  1.00 0.00 ? 2  GLU A HB3  12 
ATOM 7876  H HG2  . GLU A 1 2  ? 33.235 -4.963  -5.373  1.00 0.00 ? 2  GLU A HG2  12 
ATOM 7877  H HG3  . GLU A 1 2  ? 31.884 -3.886  -5.333  1.00 0.00 ? 2  GLU A HG3  12 
ATOM 7878  N N    . LYS A 1 3  ? 30.963 -1.733  -8.986  1.00 0.00 ? 3  LYS A N    12 
ATOM 7879  C CA   . LYS A 1 3  ? 30.920 -0.271  -9.066  1.00 0.00 ? 3  LYS A CA   12 
ATOM 7880  C C    . LYS A 1 3  ? 29.810 0.375   -8.220  1.00 0.00 ? 3  LYS A C    12 
ATOM 7881  O O    . LYS A 1 3  ? 29.867 1.552   -7.891  1.00 0.00 ? 3  LYS A O    12 
ATOM 7882  C CB   . LYS A 1 3  ? 30.882 0.159   -10.536 1.00 0.00 ? 3  LYS A CB   12 
ATOM 7883  C CG   . LYS A 1 3  ? 29.634 -0.257  -11.329 1.00 0.00 ? 3  LYS A CG   12 
ATOM 7884  C CD   . LYS A 1 3  ? 28.404 0.621   -11.059 1.00 0.00 ? 3  LYS A CD   12 
ATOM 7885  C CE   . LYS A 1 3  ? 27.321 0.463   -12.128 1.00 0.00 ? 3  LYS A CE   12 
ATOM 7886  N NZ   . LYS A 1 3  ? 25.993 0.766   -11.607 1.00 0.00 ? 3  LYS A NZ   12 
ATOM 7887  H H    . LYS A 1 3  ? 31.042 -2.223  -9.850  1.00 0.00 ? 3  LYS A H    12 
ATOM 7888  H HA   . LYS A 1 3  ? 31.859 0.087   -8.678  1.00 0.00 ? 3  LYS A HA   12 
ATOM 7889  H HB2  . LYS A 1 3  ? 31.042 1.235   -10.613 1.00 0.00 ? 3  LYS A HB2  12 
ATOM 7890  H HB3  . LYS A 1 3  ? 31.748 -0.286  -11.025 1.00 0.00 ? 3  LYS A HB3  12 
ATOM 7891  H HG2  . LYS A 1 3  ? 29.877 -0.199  -12.390 1.00 0.00 ? 3  LYS A HG2  12 
ATOM 7892  H HG3  . LYS A 1 3  ? 29.390 -1.302  -11.136 1.00 0.00 ? 3  LYS A HG3  12 
ATOM 7893  H HD2  . LYS A 1 3  ? 27.970 0.358   -10.099 1.00 0.00 ? 3  LYS A HD2  12 
ATOM 7894  H HD3  . LYS A 1 3  ? 28.694 1.669   -10.983 1.00 0.00 ? 3  LYS A HD3  12 
ATOM 7895  H HE2  . LYS A 1 3  ? 27.522 1.124   -12.971 1.00 0.00 ? 3  LYS A HE2  12 
ATOM 7896  H HE3  . LYS A 1 3  ? 27.301 -0.559  -12.506 1.00 0.00 ? 3  LYS A HE3  12 
ATOM 7897  H HZ1  . LYS A 1 3  ? 25.780 0.110   -10.827 1.00 0.00 ? 3  LYS A HZ1  12 
ATOM 7898  H HZ2  . LYS A 1 3  ? 25.281 0.649   -12.358 1.00 0.00 ? 3  LYS A HZ2  12 
ATOM 7899  H HZ3  . LYS A 1 3  ? 25.969 1.742   -11.250 1.00 0.00 ? 3  LYS A HZ3  12 
ATOM 7900  N N    . GLU A 1 4  ? 28.820 -0.472  -7.889  1.00 0.00 ? 4  GLU A N    12 
ATOM 7901  C CA   . GLU A 1 4  ? 27.674 -0.062  -7.094  1.00 0.00 ? 4  GLU A CA   12 
ATOM 7902  C C    . GLU A 1 4  ? 28.122 0.264   -5.663  1.00 0.00 ? 4  GLU A C    12 
ATOM 7903  O O    . GLU A 1 4  ? 27.823 1.312   -5.115  1.00 0.00 ? 4  GLU A O    12 
ATOM 7904  C CB   . GLU A 1 4  ? 26.670 -1.224  -7.116  1.00 0.00 ? 4  GLU A CB   12 
ATOM 7905  C CG   . GLU A 1 4  ? 25.210 -0.766  -7.188  1.00 0.00 ? 4  GLU A CG   12 
ATOM 7906  C CD   . GLU A 1 4  ? 24.639 -0.309  -5.831  1.00 0.00 ? 4  GLU A CD   12 
ATOM 7907  O OE1  . GLU A 1 4  ? 25.210 0.588   -5.216  1.00 0.00 ? 4  GLU A OE1  12 
ATOM 7908  O OE2  . GLU A 1 4  ? 23.621 -0.848  -5.405  1.00 0.00 ? 4  GLU A OE2  12 
ATOM 7909  H H    . GLU A 1 4  ? 28.881 -1.414  -8.209  1.00 0.00 ? 4  GLU A H    12 
ATOM 7910  H HA   . GLU A 1 4  ? 27.270 0.835   -7.568  1.00 0.00 ? 4  GLU A HA   12 
ATOM 7911  H HB2  . GLU A 1 4  ? 26.860 -1.828  -8.002  1.00 0.00 ? 4  GLU A HB2  12 
ATOM 7912  H HB3  . GLU A 1 4  ? 26.828 -1.922  -6.294  1.00 0.00 ? 4  GLU A HB3  12 
ATOM 7913  H HG2  . GLU A 1 4  ? 25.102 0.035   -7.919  1.00 0.00 ? 4  GLU A HG2  12 
ATOM 7914  H HG3  . GLU A 1 4  ? 24.613 -1.594  -7.564  1.00 0.00 ? 4  GLU A HG3  12 
ATOM 7915  N N    . ALA A 1 5  ? 28.886 -0.703  -5.113  1.00 0.00 ? 5  ALA A N    12 
ATOM 7916  C CA   . ALA A 1 5  ? 29.441 -0.464  -3.794  1.00 0.00 ? 5  ALA A CA   12 
ATOM 7917  C C    . ALA A 1 5  ? 30.529 0.608   -3.846  1.00 0.00 ? 5  ALA A C    12 
ATOM 7918  O O    . ALA A 1 5  ? 30.840 1.175   -2.805  1.00 0.00 ? 5  ALA A O    12 
ATOM 7919  C CB   . ALA A 1 5  ? 29.983 -1.752  -3.179  1.00 0.00 ? 5  ALA A CB   12 
ATOM 7920  H H    . ALA A 1 5  ? 29.108 -1.534  -5.614  1.00 0.00 ? 5  ALA A H    12 
ATOM 7921  H HA   . ALA A 1 5  ? 28.625 -0.105  -3.169  1.00 0.00 ? 5  ALA A HA   12 
ATOM 7922  H HB1  . ALA A 1 5  ? 30.857 -2.129  -3.710  1.00 0.00 ? 5  ALA A HB1  12 
ATOM 7923  H HB2  . ALA A 1 5  ? 29.218 -2.526  -3.176  1.00 0.00 ? 5  ALA A HB2  12 
ATOM 7924  H HB3  . ALA A 1 5  ? 30.264 -1.578  -2.139  1.00 0.00 ? 5  ALA A HB3  12 
ATOM 7925  N N    . ILE A 1 6  ? 31.095 0.894   -5.035  1.00 0.00 ? 6  ILE A N    12 
ATOM 7926  C CA   . ILE A 1 6  ? 32.210 1.848   -5.077  1.00 0.00 ? 6  ILE A CA   12 
ATOM 7927  C C    . ILE A 1 6  ? 31.732 3.265   -4.765  1.00 0.00 ? 6  ILE A C    12 
ATOM 7928  O O    . ILE A 1 6  ? 32.348 3.946   -3.953  1.00 0.00 ? 6  ILE A O    12 
ATOM 7929  C CB   . ILE A 1 6  ? 33.055 1.770   -6.356  1.00 0.00 ? 6  ILE A CB   12 
ATOM 7930  C CG1  . ILE A 1 6  ? 33.441 0.322   -6.652  1.00 0.00 ? 6  ILE A CG1  12 
ATOM 7931  C CG2  . ILE A 1 6  ? 34.337 2.622   -6.258  1.00 0.00 ? 6  ILE A CG2  12 
ATOM 7932  C CD1  . ILE A 1 6  ? 34.235 0.178   -7.956  1.00 0.00 ? 6  ILE A CD1  12 
ATOM 7933  H H    . ILE A 1 6  ? 30.756 0.466   -5.876  1.00 0.00 ? 6  ILE A H    12 
ATOM 7934  H HA   . ILE A 1 6  ? 32.869 1.567   -4.269  1.00 0.00 ? 6  ILE A HA   12 
ATOM 7935  H HB   . ILE A 1 6  ? 32.444 2.149   -7.173  1.00 0.00 ? 6  ILE A HB   12 
ATOM 7936  H HG12 . ILE A 1 6  ? 34.004 -0.093  -5.816  1.00 0.00 ? 6  ILE A HG12 12 
ATOM 7937  H HG13 . ILE A 1 6  ? 32.546 -0.282  -6.702  1.00 0.00 ? 6  ILE A HG13 12 
ATOM 7938  H HG21 . ILE A 1 6  ? 35.244 2.022   -6.292  1.00 0.00 ? 6  ILE A HG21 12 
ATOM 7939  H HG22 . ILE A 1 6  ? 34.396 3.148   -5.313  1.00 0.00 ? 6  ILE A HG22 12 
ATOM 7940  H HG23 . ILE A 1 6  ? 34.388 3.354   -7.063  1.00 0.00 ? 6  ILE A HG23 12 
ATOM 7941  H HD11 . ILE A 1 6  ? 35.245 0.572   -7.860  1.00 0.00 ? 6  ILE A HD11 12 
ATOM 7942  H HD12 . ILE A 1 6  ? 33.798 0.723   -8.789  1.00 0.00 ? 6  ILE A HD12 12 
ATOM 7943  H HD13 . ILE A 1 6  ? 34.275 -0.875  -8.231  1.00 0.00 ? 6  ILE A HD13 12 
ATOM 7944  N N    . GLU A 1 7  ? 30.614 3.674   -5.382  1.00 0.00 ? 7  GLU A N    12 
ATOM 7945  C CA   . GLU A 1 7  ? 30.074 4.999   -5.074  1.00 0.00 ? 7  GLU A CA   12 
ATOM 7946  C C    . GLU A 1 7  ? 29.551 5.098   -3.622  1.00 0.00 ? 7  GLU A C    12 
ATOM 7947  O O    . GLU A 1 7  ? 29.394 6.184   -3.091  1.00 0.00 ? 7  GLU A O    12 
ATOM 7948  C CB   . GLU A 1 7  ? 28.977 5.373   -6.084  1.00 0.00 ? 7  GLU A CB   12 
ATOM 7949  C CG   . GLU A 1 7  ? 27.738 4.463   -6.014  1.00 0.00 ? 7  GLU A CG   12 
ATOM 7950  C CD   . GLU A 1 7  ? 26.603 4.865   -6.978  1.00 0.00 ? 7  GLU A CD   12 
ATOM 7951  O OE1  . GLU A 1 7  ? 26.777 5.796   -7.764  1.00 0.00 ? 7  GLU A OE1  12 
ATOM 7952  O OE2  . GLU A 1 7  ? 25.547 4.234   -6.927  1.00 0.00 ? 7  GLU A OE2  12 
ATOM 7953  H H    . GLU A 1 7  ? 30.155 3.071   -6.036  1.00 0.00 ? 7  GLU A H    12 
ATOM 7954  H HA   . GLU A 1 7  ? 30.900 5.705   -5.168  1.00 0.00 ? 7  GLU A HA   12 
ATOM 7955  H HB2  . GLU A 1 7  ? 28.679 6.410   -5.918  1.00 0.00 ? 7  GLU A HB2  12 
ATOM 7956  H HB3  . GLU A 1 7  ? 29.394 5.326   -7.091  1.00 0.00 ? 7  GLU A HB3  12 
ATOM 7957  H HG2  . GLU A 1 7  ? 28.024 3.439   -6.237  1.00 0.00 ? 7  GLU A HG2  12 
ATOM 7958  H HG3  . GLU A 1 7  ? 27.331 4.463   -5.005  1.00 0.00 ? 7  GLU A HG3  12 
ATOM 7959  N N    . ARG A 1 8  ? 29.301 3.907   -3.030  1.00 0.00 ? 8  ARG A N    12 
ATOM 7960  C CA   . ARG A 1 8  ? 28.763 3.819   -1.680  1.00 0.00 ? 8  ARG A CA   12 
ATOM 7961  C C    . ARG A 1 8  ? 29.883 4.011   -0.648  1.00 0.00 ? 8  ARG A C    12 
ATOM 7962  O O    . ARG A 1 8  ? 29.828 4.922   0.160   1.00 0.00 ? 8  ARG A O    12 
ATOM 7963  C CB   . ARG A 1 8  ? 28.039 2.470   -1.536  1.00 0.00 ? 8  ARG A CB   12 
ATOM 7964  C CG   . ARG A 1 8  ? 26.691 2.579   -0.806  1.00 0.00 ? 8  ARG A CG   12 
ATOM 7965  C CD   . ARG A 1 8  ? 25.601 1.712   -1.443  1.00 0.00 ? 8  ARG A CD   12 
ATOM 7966  N NE   . ARG A 1 8  ? 24.994 2.427   -2.564  1.00 0.00 ? 8  ARG A NE   12 
ATOM 7967  C CZ   . ARG A 1 8  ? 23.764 2.123   -3.045  1.00 0.00 ? 8  ARG A CZ   12 
ATOM 7968  N NH1  . ARG A 1 8  ? 23.070 1.106   -2.543  1.00 0.00 ? 8  ARG A NH1  12 
ATOM 7969  N NH2  . ARG A 1 8  ? 23.249 2.851   -4.031  1.00 0.00 ? 8  ARG A NH2  12 
ATOM 7970  H H    . ARG A 1 8  ? 29.471 3.058   -3.523  1.00 0.00 ? 8  ARG A H    12 
ATOM 7971  H HA   . ARG A 1 8  ? 28.062 4.648   -1.576  1.00 0.00 ? 8  ARG A HA   12 
ATOM 7972  H HB2  . ARG A 1 8  ? 27.873 2.067   -2.534  1.00 0.00 ? 8  ARG A HB2  12 
ATOM 7973  H HB3  . ARG A 1 8  ? 28.656 1.712   -1.051  1.00 0.00 ? 8  ARG A HB3  12 
ATOM 7974  H HG2  . ARG A 1 8  ? 26.826 2.304   0.239   1.00 0.00 ? 8  ARG A HG2  12 
ATOM 7975  H HG3  . ARG A 1 8  ? 26.331 3.607   -0.788  1.00 0.00 ? 8  ARG A HG3  12 
ATOM 7976  H HD2  . ARG A 1 8  ? 25.987 0.763   -1.815  1.00 0.00 ? 8  ARG A HD2  12 
ATOM 7977  H HD3  . ARG A 1 8  ? 24.826 1.501   -0.709  1.00 0.00 ? 8  ARG A HD3  12 
ATOM 7978  H HE   . ARG A 1 8  ? 25.497 3.189   -2.970  1.00 0.00 ? 8  ARG A HE   12 
ATOM 7979  H HH11 . ARG A 1 8  ? 23.456 0.553   -1.807  1.00 0.00 ? 8  ARG A HH11 12 
ATOM 7980  H HH12 . ARG A 1 8  ? 22.159 0.895   -2.907  1.00 0.00 ? 8  ARG A HH12 12 
ATOM 7981  H HH21 . ARG A 1 8  ? 23.761 3.619   -4.416  1.00 0.00 ? 8  ARG A HH21 12 
ATOM 7982  H HH22 . ARG A 1 8  ? 22.340 2.623   -4.388  1.00 0.00 ? 8  ARG A HH22 12 
ATOM 7983  N N    . LEU A 1 9  ? 30.893 3.118   -0.776  1.00 0.00 ? 9  LEU A N    12 
ATOM 7984  C CA   . LEU A 1 9  ? 32.165 3.109   -0.052  1.00 0.00 ? 9  LEU A CA   12 
ATOM 7985  C C    . LEU A 1 9  ? 32.781 4.535   -0.077  1.00 0.00 ? 9  LEU A C    12 
ATOM 7986  O O    . LEU A 1 9  ? 33.108 5.101   0.957   1.00 0.00 ? 9  LEU A O    12 
ATOM 7987  C CB   . LEU A 1 9  ? 33.083 2.027   -0.648  1.00 0.00 ? 9  LEU A CB   12 
ATOM 7988  C CG   . LEU A 1 9  ? 32.518 0.591   -0.585  1.00 0.00 ? 9  LEU A CG   12 
ATOM 7989  C CD1  . LEU A 1 9  ? 33.057 -0.222  -1.767  1.00 0.00 ? 9  LEU A CD1  12 
ATOM 7990  C CD2  . LEU A 1 9  ? 32.783 -0.118  0.745   1.00 0.00 ? 9  LEU A CD2  12 
ATOM 7991  H H    . LEU A 1 9  ? 30.744 2.392   -1.431  1.00 0.00 ? 9  LEU A H    12 
ATOM 7992  H HA   . LEU A 1 9  ? 31.957 2.790   0.964   1.00 0.00 ? 9  LEU A HA   12 
ATOM 7993  H HB2  . LEU A 1 9  ? 33.271 2.297   -1.685  1.00 0.00 ? 9  LEU A HB2  12 
ATOM 7994  H HB3  . LEU A 1 9  ? 34.051 2.018   -0.151  1.00 0.00 ? 9  LEU A HB3  12 
ATOM 7995  H HG   . LEU A 1 9  ? 31.434 0.618   -0.651  1.00 0.00 ? 9  LEU A HG   12 
ATOM 7996  H HD11 . LEU A 1 9  ? 33.106 0.351   -2.682  1.00 0.00 ? 9  LEU A HD11 12 
ATOM 7997  H HD12 . LEU A 1 9  ? 32.401 -1.050  -1.995  1.00 0.00 ? 9  LEU A HD12 12 
ATOM 7998  H HD13 . LEU A 1 9  ? 34.070 -0.575  -1.585  1.00 0.00 ? 9  LEU A HD13 12 
ATOM 7999  H HD21 . LEU A 1 9  ? 33.760 -0.597  0.746   1.00 0.00 ? 9  LEU A HD21 12 
ATOM 8000  H HD22 . LEU A 1 9  ? 32.040 -0.889  0.940   1.00 0.00 ? 9  LEU A HD22 12 
ATOM 8001  H HD23 . LEU A 1 9  ? 32.732 0.577   1.580   1.00 0.00 ? 9  LEU A HD23 12 
ATOM 8002  N N    . LYS A 1 10 ? 32.858 5.107   -1.293  1.00 0.00 ? 10 LYS A N    12 
ATOM 8003  C CA   . LYS A 1 10 ? 33.371 6.475   -1.483  1.00 0.00 ? 10 LYS A CA   12 
ATOM 8004  C C    . LYS A 1 10 ? 32.492 7.538   -0.793  1.00 0.00 ? 10 LYS A C    12 
ATOM 8005  O O    . LYS A 1 10 ? 32.988 8.525   -0.276  1.00 0.00 ? 10 LYS A O    12 
ATOM 8006  C CB   . LYS A 1 10 ? 33.405 6.802   -2.979  1.00 0.00 ? 10 LYS A CB   12 
ATOM 8007  C CG   . LYS A 1 10 ? 34.406 5.952   -3.746  1.00 0.00 ? 10 LYS A CG   12 
ATOM 8008  C CD   . LYS A 1 10 ? 34.156 5.994   -5.255  1.00 0.00 ? 10 LYS A CD   12 
ATOM 8009  C CE   . LYS A 1 10 ? 34.662 7.274   -5.926  1.00 0.00 ? 10 LYS A CE   12 
ATOM 8010  N NZ   . LYS A 1 10 ? 33.723 8.378   -5.789  1.00 0.00 ? 10 LYS A NZ   12 
ATOM 8011  H H    . LYS A 1 10 ? 32.507 4.588   -2.068  1.00 0.00 ? 10 LYS A H    12 
ATOM 8012  H HA   . LYS A 1 10 ? 34.375 6.521   -1.057  1.00 0.00 ? 10 LYS A HA   12 
ATOM 8013  H HB2  . LYS A 1 10 ? 32.410 6.673   -3.403  1.00 0.00 ? 10 LYS A HB2  12 
ATOM 8014  H HB3  . LYS A 1 10 ? 33.664 7.848   -3.135  1.00 0.00 ? 10 LYS A HB3  12 
ATOM 8015  H HG2  . LYS A 1 10 ? 35.410 6.282   -3.495  1.00 0.00 ? 10 LYS A HG2  12 
ATOM 8016  H HG3  . LYS A 1 10 ? 34.352 4.919   -3.414  1.00 0.00 ? 10 LYS A HG3  12 
ATOM 8017  H HD2  . LYS A 1 10 ? 34.676 5.144   -5.674  1.00 0.00 ? 10 LYS A HD2  12 
ATOM 8018  H HD3  . LYS A 1 10 ? 33.103 5.838   -5.502  1.00 0.00 ? 10 LYS A HD3  12 
ATOM 8019  H HE2  . LYS A 1 10 ? 35.631 7.587   -5.534  1.00 0.00 ? 10 LYS A HE2  12 
ATOM 8020  H HE3  . LYS A 1 10 ? 34.784 7.094   -6.993  1.00 0.00 ? 10 LYS A HE3  12 
ATOM 8021  H HZ1  . LYS A 1 10 ? 33.879 8.851   -4.876  1.00 0.00 ? 10 LYS A HZ1  12 
ATOM 8022  H HZ2  . LYS A 1 10 ? 32.754 8.006   -5.832  1.00 0.00 ? 10 LYS A HZ2  12 
ATOM 8023  H HZ3  . LYS A 1 10 ? 33.857 9.061   -6.563  1.00 0.00 ? 10 LYS A HZ3  12 
ATOM 8024  N N    . ALA A 1 11 ? 31.166 7.274   -0.835  1.00 0.00 ? 11 ALA A N    12 
ATOM 8025  C CA   . ALA A 1 11 ? 30.192 8.205   -0.262  1.00 0.00 ? 11 ALA A CA   12 
ATOM 8026  C C    . ALA A 1 11 ? 30.300 8.310   1.273   1.00 0.00 ? 11 ALA A C    12 
ATOM 8027  O O    . ALA A 1 11 ? 29.848 9.288   1.851   1.00 0.00 ? 11 ALA A O    12 
ATOM 8028  C CB   . ALA A 1 11 ? 28.762 7.814   -0.655  1.00 0.00 ? 11 ALA A CB   12 
ATOM 8029  H H    . ALA A 1 11 ? 30.859 6.441   -1.287  1.00 0.00 ? 11 ALA A H    12 
ATOM 8030  H HA   . ALA A 1 11 ? 30.412 9.186   -0.687  1.00 0.00 ? 11 ALA A HA   12 
ATOM 8031  H HB1  . ALA A 1 11 ? 28.587 8.013   -1.711  1.00 0.00 ? 11 ALA A HB1  12 
ATOM 8032  H HB2  . ALA A 1 11 ? 28.025 8.389   -0.093  1.00 0.00 ? 11 ALA A HB2  12 
ATOM 8033  H HB3  . ALA A 1 11 ? 28.548 6.763   -0.477  1.00 0.00 ? 11 ALA A HB3  12 
ATOM 8034  N N    . LEU A 1 12 ? 30.932 7.286   1.893   1.00 0.00 ? 12 LEU A N    12 
ATOM 8035  C CA   . LEU A 1 12 ? 31.176 7.327   3.333   1.00 0.00 ? 12 LEU A CA   12 
ATOM 8036  C C    . LEU A 1 12 ? 32.379 8.256   3.688   1.00 0.00 ? 12 LEU A C    12 
ATOM 8037  O O    . LEU A 1 12 ? 32.762 8.339   4.846   1.00 0.00 ? 12 LEU A O    12 
ATOM 8038  C CB   . LEU A 1 12 ? 31.450 5.902   3.849   1.00 0.00 ? 12 LEU A CB   12 
ATOM 8039  C CG   . LEU A 1 12 ? 30.266 4.901   3.878   1.00 0.00 ? 12 LEU A CG   12 
ATOM 8040  C CD1  . LEU A 1 12 ? 30.376 3.876   2.749   1.00 0.00 ? 12 LEU A CD1  12 
ATOM 8041  C CD2  . LEU A 1 12 ? 30.238 4.123   5.196   1.00 0.00 ? 12 LEU A CD2  12 
ATOM 8042  H H    . LEU A 1 12 ? 31.273 6.503   1.377   1.00 0.00 ? 12 LEU A H    12 
ATOM 8043  H HA   . LEU A 1 12 ? 30.284 7.733   3.812   1.00 0.00 ? 12 LEU A HA   12 
ATOM 8044  H HB2  . LEU A 1 12 ? 32.244 5.495   3.236   1.00 0.00 ? 12 LEU A HB2  12 
ATOM 8045  H HB3  . LEU A 1 12 ? 31.859 5.972   4.853   1.00 0.00 ? 12 LEU A HB3  12 
ATOM 8046  H HG   . LEU A 1 12 ? 29.328 5.450   3.775   1.00 0.00 ? 12 LEU A HG   12 
ATOM 8047  H HD11 . LEU A 1 12 ? 30.976 4.313   1.966   1.00 0.00 ? 12 LEU A HD11 12 
ATOM 8048  H HD12 . LEU A 1 12 ? 29.400 3.598   2.347   1.00 0.00 ? 12 LEU A HD12 12 
ATOM 8049  H HD13 . LEU A 1 12 ? 30.896 2.962   3.048   1.00 0.00 ? 12 LEU A HD13 12 
ATOM 8050  H HD21 . LEU A 1 12 ? 31.101 3.465   5.252   1.00 0.00 ? 12 LEU A HD21 12 
ATOM 8051  H HD22 . LEU A 1 12 ? 29.359 3.483   5.261   1.00 0.00 ? 12 LEU A HD22 12 
ATOM 8052  H HD23 . LEU A 1 12 ? 30.270 4.786   6.060   1.00 0.00 ? 12 LEU A HD23 12 
ATOM 8053  N N    . GLY A 1 13 ? 32.936 8.944   2.657   1.00 0.00 ? 13 GLY A N    12 
ATOM 8054  C CA   . GLY A 1 13 ? 34.017 9.917   2.842   1.00 0.00 ? 13 GLY A CA   12 
ATOM 8055  C C    . GLY A 1 13 ? 35.396 9.355   2.455   1.00 0.00 ? 13 GLY A C    12 
ATOM 8056  O O    . GLY A 1 13 ? 36.419 9.833   2.927   1.00 0.00 ? 13 GLY A O    12 
ATOM 8057  H H    . GLY A 1 13 ? 32.580 8.823   1.735   1.00 0.00 ? 13 GLY A H    12 
ATOM 8058  H HA2  . GLY A 1 13 ? 33.790 10.776  2.209   1.00 0.00 ? 13 GLY A HA2  12 
ATOM 8059  H HA3  . GLY A 1 13 ? 34.035 10.247  3.881   1.00 0.00 ? 13 GLY A HA3  12 
ATOM 8060  N N    . PHE A 1 14 ? 35.352 8.305   1.595   1.00 0.00 ? 14 PHE A N    12 
ATOM 8061  C CA   . PHE A 1 14 ? 36.555 7.558   1.221   1.00 0.00 ? 14 PHE A CA   12 
ATOM 8062  C C    . PHE A 1 14 ? 36.940 7.931   -0.232  1.00 0.00 ? 14 PHE A C    12 
ATOM 8063  O O    . PHE A 1 14 ? 36.762 9.075   -0.642  1.00 0.00 ? 14 PHE A O    12 
ATOM 8064  C CB   . PHE A 1 14 ? 36.299 6.045   1.433   1.00 0.00 ? 14 PHE A CB   12 
ATOM 8065  C CG   . PHE A 1 14 ? 35.732 5.701   2.797   1.00 0.00 ? 14 PHE A CG   12 
ATOM 8066  C CD1  . PHE A 1 14 ? 35.935 6.511   3.916   1.00 0.00 ? 14 PHE A CD1  12 
ATOM 8067  C CD2  . PHE A 1 14 ? 34.928 4.571   2.932   1.00 0.00 ? 14 PHE A CD2  12 
ATOM 8068  C CE1  . PHE A 1 14 ? 35.255 6.262   5.099   1.00 0.00 ? 14 PHE A CE1  12 
ATOM 8069  C CE2  . PHE A 1 14 ? 34.249 4.321   4.113   1.00 0.00 ? 14 PHE A CE2  12 
ATOM 8070  C CZ   . PHE A 1 14 ? 34.389 5.192   5.188   1.00 0.00 ? 14 PHE A CZ   12 
ATOM 8071  H H    . PHE A 1 14 ? 34.476 8.006   1.226   1.00 0.00 ? 14 PHE A H    12 
ATOM 8072  H HA   . PHE A 1 14 ? 37.367 7.894   1.867   1.00 0.00 ? 14 PHE A HA   12 
ATOM 8073  H HB2  . PHE A 1 14 ? 35.589 5.710   0.674   1.00 0.00 ? 14 PHE A HB2  12 
ATOM 8074  H HB3  . PHE A 1 14 ? 37.204 5.465   1.286   1.00 0.00 ? 14 PHE A HB3  12 
ATOM 8075  H HD1  . PHE A 1 14 ? 36.603 7.361   3.892   1.00 0.00 ? 14 PHE A HD1  12 
ATOM 8076  H HD2  . PHE A 1 14 ? 34.817 3.880   2.105   1.00 0.00 ? 14 PHE A HD2  12 
ATOM 8077  H HE1  . PHE A 1 14 ? 35.382 6.912   5.950   1.00 0.00 ? 14 PHE A HE1  12 
ATOM 8078  H HE2  . PHE A 1 14 ? 33.587 3.470   4.167   1.00 0.00 ? 14 PHE A HE2  12 
ATOM 8079  H HZ   . PHE A 1 14 ? 33.814 5.059   6.095   1.00 0.00 ? 14 PHE A HZ   12 
ATOM 8080  N N    . GLU A 1 15 ? 37.475 6.935   -0.974  1.00 0.00 ? 15 GLU A N    12 
ATOM 8081  C CA   . GLU A 1 15 ? 37.975 7.151   -2.336  1.00 0.00 ? 15 GLU A CA   12 
ATOM 8082  C C    . GLU A 1 15 ? 38.094 5.793   -3.032  1.00 0.00 ? 15 GLU A C    12 
ATOM 8083  O O    . GLU A 1 15 ? 38.504 4.817   -2.413  1.00 0.00 ? 15 GLU A O    12 
ATOM 8084  C CB   . GLU A 1 15 ? 39.361 7.826   -2.309  1.00 0.00 ? 15 GLU A CB   12 
ATOM 8085  C CG   . GLU A 1 15 ? 39.675 8.595   -3.599  1.00 0.00 ? 15 GLU A CG   12 
ATOM 8086  C CD   . GLU A 1 15 ? 38.891 9.919   -3.654  1.00 0.00 ? 15 GLU A CD   12 
ATOM 8087  O OE1  . GLU A 1 15 ? 39.179 10.802  -2.847  1.00 0.00 ? 15 GLU A OE1  12 
ATOM 8088  O OE2  . GLU A 1 15 ? 38.006 10.052  -4.499  1.00 0.00 ? 15 GLU A OE2  12 
ATOM 8089  H H    . GLU A 1 15 ? 37.556 6.025   -0.573  1.00 0.00 ? 15 GLU A H    12 
ATOM 8090  H HA   . GLU A 1 15 ? 37.247 7.768   -2.866  1.00 0.00 ? 15 GLU A HA   12 
ATOM 8091  H HB2  . GLU A 1 15 ? 39.432 8.491   -1.451  1.00 0.00 ? 15 GLU A HB2  12 
ATOM 8092  H HB3  . GLU A 1 15 ? 40.160 7.102   -2.157  1.00 0.00 ? 15 GLU A HB3  12 
ATOM 8093  H HG2  . GLU A 1 15 ? 40.739 8.815   -3.657  1.00 0.00 ? 15 GLU A HG2  12 
ATOM 8094  H HG3  . GLU A 1 15 ? 39.454 7.987   -4.474  1.00 0.00 ? 15 GLU A HG3  12 
ATOM 8095  N N    . GLU A 1 16 ? 37.731 5.796   -4.332  1.00 0.00 ? 16 GLU A N    12 
ATOM 8096  C CA   . GLU A 1 16 ? 37.659 4.614   -5.196  1.00 0.00 ? 16 GLU A CA   12 
ATOM 8097  C C    . GLU A 1 16 ? 38.889 3.666   -5.098  1.00 0.00 ? 16 GLU A C    12 
ATOM 8098  O O    . GLU A 1 16 ? 38.777 2.476   -5.360  1.00 0.00 ? 16 GLU A O    12 
ATOM 8099  C CB   . GLU A 1 16 ? 37.415 5.063   -6.645  1.00 0.00 ? 16 GLU A CB   12 
ATOM 8100  C CG   . GLU A 1 16 ? 37.549 3.944   -7.702  1.00 0.00 ? 16 GLU A CG   12 
ATOM 8101  C CD   . GLU A 1 16 ? 36.631 4.173   -8.917  1.00 0.00 ? 16 GLU A CD   12 
ATOM 8102  O OE1  . GLU A 1 16 ? 36.598 5.293   -9.424  1.00 0.00 ? 16 GLU A OE1  12 
ATOM 8103  O OE2  . GLU A 1 16 ? 35.956 3.233   -9.339  1.00 0.00 ? 16 GLU A OE2  12 
ATOM 8104  H H    . GLU A 1 16 ? 37.419 6.667   -4.706  1.00 0.00 ? 16 GLU A H    12 
ATOM 8105  H HA   . GLU A 1 16 ? 36.765 4.095   -4.859  1.00 0.00 ? 16 GLU A HA   12 
ATOM 8106  H HB2  . GLU A 1 16 ? 36.420 5.496   -6.706  1.00 0.00 ? 16 GLU A HB2  12 
ATOM 8107  H HB3  . GLU A 1 16 ? 38.104 5.876   -6.879  1.00 0.00 ? 16 GLU A HB3  12 
ATOM 8108  H HG2  . GLU A 1 16 ? 38.584 3.912   -8.045  1.00 0.00 ? 16 GLU A HG2  12 
ATOM 8109  H HG3  . GLU A 1 16 ? 37.306 2.965   -7.287  1.00 0.00 ? 16 GLU A HG3  12 
ATOM 8110  N N    . SER A 1 17 ? 40.048 4.231   -4.714  1.00 0.00 ? 17 SER A N    12 
ATOM 8111  C CA   . SER A 1 17 ? 41.252 3.421   -4.590  1.00 0.00 ? 17 SER A CA   12 
ATOM 8112  C C    . SER A 1 17 ? 41.259 2.653   -3.262  1.00 0.00 ? 17 SER A C    12 
ATOM 8113  O O    . SER A 1 17 ? 41.446 1.450   -3.253  1.00 0.00 ? 17 SER A O    12 
ATOM 8114  C CB   . SER A 1 17 ? 42.477 4.336   -4.678  1.00 0.00 ? 17 SER A CB   12 
ATOM 8115  O OG   . SER A 1 17 ? 42.930 4.383   -6.022  1.00 0.00 ? 17 SER A OG   12 
ATOM 8116  H H    . SER A 1 17 ? 40.088 5.197   -4.471  1.00 0.00 ? 17 SER A H    12 
ATOM 8117  H HA   . SER A 1 17 ? 41.243 2.685   -5.401  1.00 0.00 ? 17 SER A HA   12 
ATOM 8118  H HB2  . SER A 1 17 ? 42.212 5.340   -4.334  1.00 0.00 ? 17 SER A HB2  12 
ATOM 8119  H HB3  . SER A 1 17 ? 43.274 3.976   -4.020  1.00 0.00 ? 17 SER A HB3  12 
ATOM 8120  H HG   . SER A 1 17 ? 43.741 4.880   -6.091  1.00 0.00 ? 17 SER A HG   12 
ATOM 8121  N N    . LEU A 1 18 ? 41.043 3.405   -2.153  1.00 0.00 ? 18 LEU A N    12 
ATOM 8122  C CA   . LEU A 1 18 ? 41.008 2.738   -0.844  1.00 0.00 ? 18 LEU A CA   12 
ATOM 8123  C C    . LEU A 1 18 ? 39.791 1.830   -0.730  1.00 0.00 ? 18 LEU A C    12 
ATOM 8124  O O    . LEU A 1 18 ? 39.765 0.944   0.130   1.00 0.00 ? 18 LEU A O    12 
ATOM 8125  C CB   . LEU A 1 18 ? 41.137 3.735   0.326   1.00 0.00 ? 18 LEU A CB   12 
ATOM 8126  C CG   . LEU A 1 18 ? 39.865 4.412   0.893   1.00 0.00 ? 18 LEU A CG   12 
ATOM 8127  C CD1  . LEU A 1 18 ? 39.617 4.059   2.369   1.00 0.00 ? 18 LEU A CD1  12 
ATOM 8128  C CD2  . LEU A 1 18 ? 39.958 5.934   0.767   1.00 0.00 ? 18 LEU A CD2  12 
ATOM 8129  H H    . LEU A 1 18 ? 40.863 4.380   -2.251  1.00 0.00 ? 18 LEU A H    12 
ATOM 8130  H HA   . LEU A 1 18 ? 41.884 2.090   -0.808  1.00 0.00 ? 18 LEU A HA   12 
ATOM 8131  H HB2  . LEU A 1 18 ? 41.617 3.199   1.137   1.00 0.00 ? 18 LEU A HB2  12 
ATOM 8132  H HB3  . LEU A 1 18 ? 41.870 4.487   0.047   1.00 0.00 ? 18 LEU A HB3  12 
ATOM 8133  H HG   . LEU A 1 18 ? 39.002 4.078   0.322   1.00 0.00 ? 18 LEU A HG   12 
ATOM 8134  H HD11 . LEU A 1 18 ? 39.598 2.981   2.541   1.00 0.00 ? 18 LEU A HD11 12 
ATOM 8135  H HD12 . LEU A 1 18 ? 38.676 4.491   2.708   1.00 0.00 ? 18 LEU A HD12 12 
ATOM 8136  H HD13 . LEU A 1 18 ? 40.387 4.484   3.008   1.00 0.00 ? 18 LEU A HD13 12 
ATOM 8137  H HD21 . LEU A 1 18 ? 40.857 6.320   1.244   1.00 0.00 ? 18 LEU A HD21 12 
ATOM 8138  H HD22 . LEU A 1 18 ? 39.115 6.433   1.242   1.00 0.00 ? 18 LEU A HD22 12 
ATOM 8139  H HD23 . LEU A 1 18 ? 39.990 6.213   -0.280  1.00 0.00 ? 18 LEU A HD23 12 
ATOM 8140  N N    . VAL A 1 19 ? 38.826 2.084   -1.617  1.00 0.00 ? 19 VAL A N    12 
ATOM 8141  C CA   . VAL A 1 19 ? 37.533 1.425   -1.711  1.00 0.00 ? 19 VAL A CA   12 
ATOM 8142  C C    . VAL A 1 19 ? 37.672 0.071   -2.403  1.00 0.00 ? 19 VAL A C    12 
ATOM 8143  O O    . VAL A 1 19 ? 37.318 -0.953  -1.848  1.00 0.00 ? 19 VAL A O    12 
ATOM 8144  C CB   . VAL A 1 19 ? 36.631 2.387   -2.495  1.00 0.00 ? 19 VAL A CB   12 
ATOM 8145  C CG1  . VAL A 1 19 ? 35.501 1.699   -3.257  1.00 0.00 ? 19 VAL A CG1  12 
ATOM 8146  C CG2  . VAL A 1 19 ? 36.132 3.551   -1.619  1.00 0.00 ? 19 VAL A CG2  12 
ATOM 8147  H H    . VAL A 1 19 ? 38.992 2.800   -2.305  1.00 0.00 ? 19 VAL A H    12 
ATOM 8148  H HA   . VAL A 1 19 ? 37.147 1.232   -0.715  1.00 0.00 ? 19 VAL A HA   12 
ATOM 8149  H HB   . VAL A 1 19 ? 37.275 2.813   -3.259  1.00 0.00 ? 19 VAL A HB   12 
ATOM 8150  H HG11 . VAL A 1 19 ? 35.849 1.350   -4.229  1.00 0.00 ? 19 VAL A HG11 12 
ATOM 8151  H HG12 . VAL A 1 19 ? 34.660 2.366   -3.401  1.00 0.00 ? 19 VAL A HG12 12 
ATOM 8152  H HG13 . VAL A 1 19 ? 35.147 0.830   -2.720  1.00 0.00 ? 19 VAL A HG13 12 
ATOM 8153  H HG21 . VAL A 1 19 ? 36.846 3.800   -0.838  1.00 0.00 ? 19 VAL A HG21 12 
ATOM 8154  H HG22 . VAL A 1 19 ? 35.173 3.386   -1.146  1.00 0.00 ? 19 VAL A HG22 12 
ATOM 8155  H HG23 . VAL A 1 19 ? 36.009 4.441   -2.219  1.00 0.00 ? 19 VAL A HG23 12 
ATOM 8156  N N    . ILE A 1 20 ? 38.190 0.149   -3.644  1.00 0.00 ? 20 ILE A N    12 
ATOM 8157  C CA   . ILE A 1 20 ? 38.381 -1.039  -4.468  1.00 0.00 ? 20 ILE A CA   12 
ATOM 8158  C C    . ILE A 1 20 ? 39.321 -2.017  -3.784  1.00 0.00 ? 20 ILE A C    12 
ATOM 8159  O O    . ILE A 1 20 ? 39.024 -3.196  -3.686  1.00 0.00 ? 20 ILE A O    12 
ATOM 8160  C CB   . ILE A 1 20 ? 38.910 -0.633  -5.857  1.00 0.00 ? 20 ILE A CB   12 
ATOM 8161  C CG1  . ILE A 1 20 ? 37.757 -0.164  -6.747  1.00 0.00 ? 20 ILE A CG1  12 
ATOM 8162  C CG2  . ILE A 1 20 ? 39.719 -1.726  -6.580  1.00 0.00 ? 20 ILE A CG2  12 
ATOM 8163  C CD1  . ILE A 1 20 ? 36.779 -1.298  -7.087  1.00 0.00 ? 20 ILE A CD1  12 
ATOM 8164  H H    . ILE A 1 20 ? 38.445 1.042   -4.000  1.00 0.00 ? 20 ILE A H    12 
ATOM 8165  H HA   . ILE A 1 20 ? 37.411 -1.529  -4.542  1.00 0.00 ? 20 ILE A HA   12 
ATOM 8166  H HB   . ILE A 1 20 ? 39.599 0.198   -5.722  1.00 0.00 ? 20 ILE A HB   12 
ATOM 8167  H HG12 . ILE A 1 20 ? 37.226 0.665   -6.278  1.00 0.00 ? 20 ILE A HG12 12 
ATOM 8168  H HG13 . ILE A 1 20 ? 38.163 0.252   -7.667  1.00 0.00 ? 20 ILE A HG13 12 
ATOM 8169  H HG21 . ILE A 1 20 ? 39.905 -1.461  -7.619  1.00 0.00 ? 20 ILE A HG21 12 
ATOM 8170  H HG22 . ILE A 1 20 ? 39.186 -2.670  -6.580  1.00 0.00 ? 20 ILE A HG22 12 
ATOM 8171  H HG23 . ILE A 1 20 ? 40.686 -1.893  -6.107  1.00 0.00 ? 20 ILE A HG23 12 
ATOM 8172  H HD11 . ILE A 1 20 ? 37.198 -2.298  -7.003  1.00 0.00 ? 20 ILE A HD11 12 
ATOM 8173  H HD12 . ILE A 1 20 ? 36.458 -1.203  -8.122  1.00 0.00 ? 20 ILE A HD12 12 
ATOM 8174  H HD13 . ILE A 1 20 ? 35.918 -1.261  -6.419  1.00 0.00 ? 20 ILE A HD13 12 
ATOM 8175  N N    . GLN A 1 21 ? 40.449 -1.449  -3.324  1.00 0.00 ? 21 GLN A N    12 
ATOM 8176  C CA   . GLN A 1 21 ? 41.458 -2.250  -2.647  1.00 0.00 ? 21 GLN A CA   12 
ATOM 8177  C C    . GLN A 1 21 ? 40.953 -2.776  -1.285  1.00 0.00 ? 21 GLN A C    12 
ATOM 8178  O O    . GLN A 1 21 ? 41.423 -3.800  -0.814  1.00 0.00 ? 21 GLN A O    12 
ATOM 8179  C CB   . GLN A 1 21 ? 42.731 -1.417  -2.458  1.00 0.00 ? 21 GLN A CB   12 
ATOM 8180  C CG   . GLN A 1 21 ? 43.998 -2.289  -2.430  1.00 0.00 ? 21 GLN A CG   12 
ATOM 8181  C CD   . GLN A 1 21 ? 44.581 -2.437  -3.844  1.00 0.00 ? 21 GLN A CD   12 
ATOM 8182  O OE1  . GLN A 1 21 ? 44.422 -3.431  -4.523  1.00 0.00 ? 21 GLN A OE1  12 
ATOM 8183  N NE2  . GLN A 1 21 ? 45.272 -1.337  -4.218  1.00 0.00 ? 21 GLN A NE2  12 
ATOM 8184  H H    . GLN A 1 21 ? 40.591 -0.475  -3.483  1.00 0.00 ? 21 GLN A H    12 
ATOM 8185  H HA   . GLN A 1 21 ? 41.665 -3.095  -3.307  1.00 0.00 ? 21 GLN A HA   12 
ATOM 8186  H HB2  . GLN A 1 21 ? 42.803 -0.664  -3.244  1.00 0.00 ? 21 GLN A HB2  12 
ATOM 8187  H HB3  . GLN A 1 21 ? 42.670 -0.836  -1.538  1.00 0.00 ? 21 GLN A HB3  12 
ATOM 8188  H HG2  . GLN A 1 21 ? 44.751 -1.834  -1.788  1.00 0.00 ? 21 GLN A HG2  12 
ATOM 8189  H HG3  . GLN A 1 21 ? 43.796 -3.284  -2.028  1.00 0.00 ? 21 GLN A HG3  12 
ATOM 8190  H HE21 . GLN A 1 21 ? 45.348 -0.568  -3.582  1.00 0.00 ? 21 GLN A HE21 12 
ATOM 8191  H HE22 . GLN A 1 21 ? 45.706 -1.270  -5.110  1.00 0.00 ? 21 GLN A HE22 12 
ATOM 8192  N N    . ALA A 1 22 ? 39.981 -2.036  -0.699  1.00 0.00 ? 22 ALA A N    12 
ATOM 8193  C CA   . ALA A 1 22 ? 39.344 -2.453  0.555   1.00 0.00 ? 22 ALA A CA   12 
ATOM 8194  C C    . ALA A 1 22 ? 38.225 -3.468  0.332   1.00 0.00 ? 22 ALA A C    12 
ATOM 8195  O O    . ALA A 1 22 ? 37.823 -4.137  1.270   1.00 0.00 ? 22 ALA A O    12 
ATOM 8196  C CB   . ALA A 1 22 ? 38.652 -1.278  1.247   1.00 0.00 ? 22 ALA A CB   12 
ATOM 8197  H H    . ALA A 1 22 ? 39.637 -1.232  -1.180  1.00 0.00 ? 22 ALA A H    12 
ATOM 8198  H HA   . ALA A 1 22 ? 40.107 -2.907  1.189   1.00 0.00 ? 22 ALA A HA   12 
ATOM 8199  H HB1  . ALA A 1 22 ? 39.379 -0.591  1.658   1.00 0.00 ? 22 ALA A HB1  12 
ATOM 8200  H HB2  . ALA A 1 22 ? 38.038 -1.608  2.086   1.00 0.00 ? 22 ALA A HB2  12 
ATOM 8201  H HB3  . ALA A 1 22 ? 38.000 -0.726  0.569   1.00 0.00 ? 22 ALA A HB3  12 
ATOM 8202  N N    . TYR A 1 23 ? 37.727 -3.516  -0.918  1.00 0.00 ? 23 TYR A N    12 
ATOM 8203  C CA   . TYR A 1 23 ? 36.643 -4.434  -1.257  1.00 0.00 ? 23 TYR A CA   12 
ATOM 8204  C C    . TYR A 1 23 ? 37.239 -5.707  -1.870  1.00 0.00 ? 23 TYR A C    12 
ATOM 8205  O O    . TYR A 1 23 ? 36.603 -6.745  -1.845  1.00 0.00 ? 23 TYR A O    12 
ATOM 8206  C CB   . TYR A 1 23 ? 35.648 -3.751  -2.219  1.00 0.00 ? 23 TYR A CB   12 
ATOM 8207  C CG   . TYR A 1 23 ? 34.195 -4.007  -1.892  1.00 0.00 ? 23 TYR A CG   12 
ATOM 8208  C CD1  . TYR A 1 23 ? 33.520 -3.146  -1.045  1.00 0.00 ? 23 TYR A CD1  12 
ATOM 8209  C CD2  . TYR A 1 23 ? 33.482 -5.066  -2.441  1.00 0.00 ? 23 TYR A CD2  12 
ATOM 8210  C CE1  . TYR A 1 23 ? 32.162 -3.288  -0.807  1.00 0.00 ? 23 TYR A CE1  12 
ATOM 8211  C CE2  . TYR A 1 23 ? 32.122 -5.216  -2.220  1.00 0.00 ? 23 TYR A CE2  12 
ATOM 8212  C CZ   . TYR A 1 23 ? 31.459 -4.299  -1.420  1.00 0.00 ? 23 TYR A CZ   12 
ATOM 8213  O OH   . TYR A 1 23 ? 30.096 -4.351  -1.208  1.00 0.00 ? 23 TYR A OH   12 
ATOM 8214  H H    . TYR A 1 23 ? 38.114 -2.934  -1.629  1.00 0.00 ? 23 TYR A H    12 
ATOM 8215  H HA   . TYR A 1 23 ? 36.131 -4.705  -0.335  1.00 0.00 ? 23 TYR A HA   12 
ATOM 8216  H HB2  . TYR A 1 23 ? 35.777 -2.676  -2.140  1.00 0.00 ? 23 TYR A HB2  12 
ATOM 8217  H HB3  . TYR A 1 23 ? 35.847 -3.979  -3.269  1.00 0.00 ? 23 TYR A HB3  12 
ATOM 8218  H HD1  . TYR A 1 23 ? 34.057 -2.350  -0.555  1.00 0.00 ? 23 TYR A HD1  12 
ATOM 8219  H HD2  . TYR A 1 23 ? 33.991 -5.792  -3.032  1.00 0.00 ? 23 TYR A HD2  12 
ATOM 8220  H HE1  . TYR A 1 23 ? 31.634 -2.610  -0.157  1.00 0.00 ? 23 TYR A HE1  12 
ATOM 8221  H HE2  . TYR A 1 23 ? 31.607 -6.055  -2.670  1.00 0.00 ? 23 TYR A HE2  12 
ATOM 8222  H HH   . TYR A 1 23 ? 29.665 -4.715  -1.966  1.00 0.00 ? 23 TYR A HH   12 
ATOM 8223  N N    . PHE A 1 24 ? 38.470 -5.593  -2.412  1.00 0.00 ? 24 PHE A N    12 
ATOM 8224  C CA   . PHE A 1 24 ? 39.130 -6.719  -3.075  1.00 0.00 ? 24 PHE A CA   12 
ATOM 8225  C C    . PHE A 1 24 ? 40.038 -7.446  -2.071  1.00 0.00 ? 24 PHE A C    12 
ATOM 8226  O O    . PHE A 1 24 ? 40.159 -8.657  -2.108  1.00 0.00 ? 24 PHE A O    12 
ATOM 8227  C CB   . PHE A 1 24 ? 39.980 -6.229  -4.274  1.00 0.00 ? 24 PHE A CB   12 
ATOM 8228  C CG   . PHE A 1 24 ? 39.441 -6.601  -5.635  1.00 0.00 ? 24 PHE A CG   12 
ATOM 8229  C CD1  . PHE A 1 24 ? 39.048 -7.906  -5.929  1.00 0.00 ? 24 PHE A CD1  12 
ATOM 8230  C CD2  . PHE A 1 24 ? 39.344 -5.640  -6.631  1.00 0.00 ? 24 PHE A CD2  12 
ATOM 8231  C CE1  . PHE A 1 24 ? 38.571 -8.229  -7.193  1.00 0.00 ? 24 PHE A CE1  12 
ATOM 8232  C CE2  . PHE A 1 24 ? 38.862 -5.953  -7.895  1.00 0.00 ? 24 PHE A CE2  12 
ATOM 8233  C CZ   . PHE A 1 24 ? 38.475 -7.254  -8.177  1.00 0.00 ? 24 PHE A CZ   12 
ATOM 8234  H H    . PHE A 1 24 ? 38.981 -4.741  -2.312  1.00 0.00 ? 24 PHE A H    12 
ATOM 8235  H HA   . PHE A 1 24 ? 38.359 -7.434  -3.370  1.00 0.00 ? 24 PHE A HA   12 
ATOM 8236  H HB2  . PHE A 1 24 ? 40.126 -5.152  -4.214  1.00 0.00 ? 24 PHE A HB2  12 
ATOM 8237  H HB3  . PHE A 1 24 ? 40.988 -6.637  -4.233  1.00 0.00 ? 24 PHE A HB3  12 
ATOM 8238  H HD1  . PHE A 1 24 ? 39.107 -8.672  -5.172  1.00 0.00 ? 24 PHE A HD1  12 
ATOM 8239  H HD2  . PHE A 1 24 ? 39.644 -4.634  -6.404  1.00 0.00 ? 24 PHE A HD2  12 
ATOM 8240  H HE1  . PHE A 1 24 ? 38.266 -9.242  -7.408  1.00 0.00 ? 24 PHE A HE1  12 
ATOM 8241  H HE2  . PHE A 1 24 ? 38.777 -5.181  -8.647  1.00 0.00 ? 24 PHE A HE2  12 
ATOM 8242  H HZ   . PHE A 1 24 ? 38.091 -7.504  -9.156  1.00 0.00 ? 24 PHE A HZ   12 
ATOM 8243  N N    . ALA A 1 25 ? 40.658 -6.632  -1.181  1.00 0.00 ? 25 ALA A N    12 
ATOM 8244  C CA   . ALA A 1 25 ? 41.502 -7.193  -0.125  1.00 0.00 ? 25 ALA A CA   12 
ATOM 8245  C C    . ALA A 1 25 ? 40.649 -7.928  0.924   1.00 0.00 ? 25 ALA A C    12 
ATOM 8246  O O    . ALA A 1 25 ? 41.113 -8.855  1.570   1.00 0.00 ? 25 ALA A O    12 
ATOM 8247  C CB   . ALA A 1 25 ? 42.331 -6.095  0.553   1.00 0.00 ? 25 ALA A CB   12 
ATOM 8248  H H    . ALA A 1 25 ? 40.517 -5.648  -1.222  1.00 0.00 ? 25 ALA A H    12 
ATOM 8249  H HA   . ALA A 1 25 ? 42.177 -7.906  -0.600  1.00 0.00 ? 25 ALA A HA   12 
ATOM 8250  H HB1  . ALA A 1 25 ? 42.996 -6.514  1.309   1.00 0.00 ? 25 ALA A HB1  12 
ATOM 8251  H HB2  . ALA A 1 25 ? 41.703 -5.353  1.049   1.00 0.00 ? 25 ALA A HB2  12 
ATOM 8252  H HB3  . ALA A 1 25 ? 42.963 -5.586  -0.176  1.00 0.00 ? 25 ALA A HB3  12 
ATOM 8253  N N    . CYS A 1 26 ? 39.380 -7.472  1.027   1.00 0.00 ? 26 CYS A N    12 
ATOM 8254  C CA   . CYS A 1 26 ? 38.416 -8.126  1.911   1.00 0.00 ? 26 CYS A CA   12 
ATOM 8255  C C    . CYS A 1 26 ? 37.728 -9.336  1.248   1.00 0.00 ? 26 CYS A C    12 
ATOM 8256  O O    . CYS A 1 26 ? 36.816 -9.903  1.834   1.00 0.00 ? 26 CYS A O    12 
ATOM 8257  C CB   . CYS A 1 26 ? 37.355 -7.107  2.343   1.00 0.00 ? 26 CYS A CB   12 
ATOM 8258  S SG   . CYS A 1 26 ? 37.768 -6.423  3.971   1.00 0.00 ? 26 CYS A SG   12 
ATOM 8259  H H    . CYS A 1 26 ? 39.100 -6.683  0.485   1.00 0.00 ? 26 CYS A H    12 
ATOM 8260  H HA   . CYS A 1 26 ? 38.966 -8.475  2.787   1.00 0.00 ? 26 CYS A HA   12 
ATOM 8261  H HB2  . CYS A 1 26 ? 37.312 -6.306  1.615   1.00 0.00 ? 26 CYS A HB2  12 
ATOM 8262  H HB3  . CYS A 1 26 ? 36.341 -7.516  2.338   1.00 0.00 ? 26 CYS A HB3  12 
ATOM 8263  H HG   . CYS A 1 26 ? 37.416 -5.139  4.021   1.00 0.00 ? 26 CYS A HG   12 
ATOM 8264  N N    . GLU A 1 27 ? 38.174 -9.692  0.018   1.00 0.00 ? 27 GLU A N    12 
ATOM 8265  C CA   . GLU A 1 27 ? 37.531 -10.760 -0.755  1.00 0.00 ? 27 GLU A CA   12 
ATOM 8266  C C    . GLU A 1 27 ? 36.020 -10.481 -0.962  1.00 0.00 ? 27 GLU A C    12 
ATOM 8267  O O    . GLU A 1 27 ? 35.162 -11.246 -0.554  1.00 0.00 ? 27 GLU A O    12 
ATOM 8268  C CB   . GLU A 1 27 ? 37.846 -12.137 -0.130  1.00 0.00 ? 27 GLU A CB   12 
ATOM 8269  C CG   . GLU A 1 27 ? 37.037 -13.314 -0.716  1.00 0.00 ? 27 GLU A CG   12 
ATOM 8270  C CD   . GLU A 1 27 ? 37.858 -14.600 -0.900  1.00 0.00 ? 27 GLU A CD   12 
ATOM 8271  O OE1  . GLU A 1 27 ? 38.492 -15.044 0.057   1.00 0.00 ? 27 GLU A OE1  12 
ATOM 8272  O OE2  . GLU A 1 27 ? 37.848 -15.148 -2.003  1.00 0.00 ? 27 GLU A OE2  12 
ATOM 8273  H H    . GLU A 1 27 ? 38.964 -9.232  -0.379  1.00 0.00 ? 27 GLU A H    12 
ATOM 8274  H HA   . GLU A 1 27 ? 37.999 -10.719 -1.738  1.00 0.00 ? 27 GLU A HA   12 
ATOM 8275  H HB2  . GLU A 1 27 ? 38.918 -12.306 -0.231  1.00 0.00 ? 27 GLU A HB2  12 
ATOM 8276  H HB3  . GLU A 1 27 ? 37.676 -12.112 0.943   1.00 0.00 ? 27 GLU A HB3  12 
ATOM 8277  H HG2  . GLU A 1 27 ? 36.195 -13.535 -0.058  1.00 0.00 ? 27 GLU A HG2  12 
ATOM 8278  H HG3  . GLU A 1 27 ? 36.616 -13.046 -1.683  1.00 0.00 ? 27 GLU A HG3  12 
ATOM 8279  N N    . LYS A 1 28 ? 35.797 -9.321  -1.630  1.00 0.00 ? 28 LYS A N    12 
ATOM 8280  C CA   . LYS A 1 28 ? 34.517 -8.791  -2.109  1.00 0.00 ? 28 LYS A CA   12 
ATOM 8281  C C    . LYS A 1 28 ? 33.304 -9.271  -1.268  1.00 0.00 ? 28 LYS A C    12 
ATOM 8282  O O    . LYS A 1 28 ? 32.361 -9.858  -1.779  1.00 0.00 ? 28 LYS A O    12 
ATOM 8283  C CB   . LYS A 1 28 ? 34.403 -9.129  -3.611  1.00 0.00 ? 28 LYS A CB   12 
ATOM 8284  C CG   . LYS A 1 28 ? 35.627 -8.763  -4.488  1.00 0.00 ? 28 LYS A CG   12 
ATOM 8285  C CD   . LYS A 1 28 ? 35.726 -7.281  -4.906  1.00 0.00 ? 28 LYS A CD   12 
ATOM 8286  C CE   . LYS A 1 28 ? 35.683 -7.050  -6.419  1.00 0.00 ? 28 LYS A CE   12 
ATOM 8287  N NZ   . LYS A 1 28 ? 34.375 -6.633  -6.851  1.00 0.00 ? 28 LYS A NZ   12 
ATOM 8288  H H    . LYS A 1 28 ? 36.604 -8.796  -1.884  1.00 0.00 ? 28 LYS A H    12 
ATOM 8289  H HA   . LYS A 1 28 ? 34.563 -7.712  -1.993  1.00 0.00 ? 28 LYS A HA   12 
ATOM 8290  H HB2  . LYS A 1 28 ? 34.244 -10.200 -3.715  1.00 0.00 ? 28 LYS A HB2  12 
ATOM 8291  H HB3  . LYS A 1 28 ? 33.511 -8.661  -4.018  1.00 0.00 ? 28 LYS A HB3  12 
ATOM 8292  H HG2  . LYS A 1 28 ? 36.563 -9.064  -4.017  1.00 0.00 ? 28 LYS A HG2  12 
ATOM 8293  H HG3  . LYS A 1 28 ? 35.586 -9.388  -5.380  1.00 0.00 ? 28 LYS A HG3  12 
ATOM 8294  H HD2  . LYS A 1 28 ? 34.954 -6.683  -4.447  1.00 0.00 ? 28 LYS A HD2  12 
ATOM 8295  H HD3  . LYS A 1 28 ? 36.649 -6.860  -4.523  1.00 0.00 ? 28 LYS A HD3  12 
ATOM 8296  H HE2  . LYS A 1 28 ? 36.367 -6.251  -6.700  1.00 0.00 ? 28 LYS A HE2  12 
ATOM 8297  H HE3  . LYS A 1 28 ? 35.923 -7.949  -6.982  1.00 0.00 ? 28 LYS A HE3  12 
ATOM 8298  H HZ1  . LYS A 1 28 ? 34.280 -5.610  -6.692  1.00 0.00 ? 28 LYS A HZ1  12 
ATOM 8299  H HZ2  . LYS A 1 28 ? 33.672 -7.142  -6.280  1.00 0.00 ? 28 LYS A HZ2  12 
ATOM 8300  H HZ3  . LYS A 1 28 ? 34.229 -6.830  -7.865  1.00 0.00 ? 28 LYS A HZ3  12 
ATOM 8301  N N    . ASN A 1 29 ? 33.428 -9.009  0.061   1.00 0.00 ? 29 ASN A N    12 
ATOM 8302  C CA   . ASN A 1 29 ? 32.525 -9.595  1.058   1.00 0.00 ? 29 ASN A CA   12 
ATOM 8303  C C    . ASN A 1 29 ? 31.415 -8.619  1.462   1.00 0.00 ? 29 ASN A C    12 
ATOM 8304  O O    . ASN A 1 29 ? 30.329 -9.033  1.846   1.00 0.00 ? 29 ASN A O    12 
ATOM 8305  C CB   . ASN A 1 29 ? 33.325 -10.033 2.305   1.00 0.00 ? 29 ASN A CB   12 
ATOM 8306  C CG   . ASN A 1 29 ? 33.104 -11.526 2.605   1.00 0.00 ? 29 ASN A CG   12 
ATOM 8307  O OD1  . ASN A 1 29 ? 32.007 -11.975 2.874   1.00 0.00 ? 29 ASN A OD1  12 
ATOM 8308  N ND2  . ASN A 1 29 ? 34.235 -12.264 2.523   1.00 0.00 ? 29 ASN A ND2  12 
ATOM 8309  H H    . ASN A 1 29 ? 34.178 -8.429  0.375   1.00 0.00 ? 29 ASN A H    12 
ATOM 8310  H HA   . ASN A 1 29 ? 32.031 -10.445 0.584   1.00 0.00 ? 29 ASN A HA   12 
ATOM 8311  H HB2  . ASN A 1 29 ? 34.384 -9.833  2.166   1.00 0.00 ? 29 ASN A HB2  12 
ATOM 8312  H HB3  . ASN A 1 29 ? 33.042 -9.477  3.198   1.00 0.00 ? 29 ASN A HB3  12 
ATOM 8313  H HD21 . ASN A 1 29 ? 35.122 -11.852 2.308   1.00 0.00 ? 29 ASN A HD21 12 
ATOM 8314  H HD22 . ASN A 1 29 ? 34.191 -13.245 2.675   1.00 0.00 ? 29 ASN A HD22 12 
ATOM 8315  N N    . GLU A 1 30 ? 31.766 -7.321  1.329   1.00 0.00 ? 30 GLU A N    12 
ATOM 8316  C CA   . GLU A 1 30 ? 30.861 -6.185  1.476   1.00 0.00 ? 30 GLU A CA   12 
ATOM 8317  C C    . GLU A 1 30 ? 30.839 -5.667  2.918   1.00 0.00 ? 30 GLU A C    12 
ATOM 8318  O O    . GLU A 1 30 ? 31.262 -4.558  3.203   1.00 0.00 ? 30 GLU A O    12 
ATOM 8319  C CB   . GLU A 1 30 ? 29.439 -6.407  0.914   1.00 0.00 ? 30 GLU A CB   12 
ATOM 8320  C CG   . GLU A 1 30 ? 29.389 -7.130  -0.452  1.00 0.00 ? 30 GLU A CG   12 
ATOM 8321  C CD   . GLU A 1 30 ? 28.242 -6.626  -1.352  1.00 0.00 ? 30 GLU A CD   12 
ATOM 8322  O OE1  . GLU A 1 30 ? 27.186 -6.270  -0.828  1.00 0.00 ? 30 GLU A OE1  12 
ATOM 8323  O OE2  . GLU A 1 30 ? 28.421 -6.588  -2.569  1.00 0.00 ? 30 GLU A OE2  12 
ATOM 8324  H H    . GLU A 1 30 ? 32.723 -7.130  1.118   1.00 0.00 ? 30 GLU A H    12 
ATOM 8325  H HA   . GLU A 1 30 ? 31.352 -5.404  0.907   1.00 0.00 ? 30 GLU A HA   12 
ATOM 8326  H HB2  . GLU A 1 30 ? 28.828 -6.963  1.621   1.00 0.00 ? 30 GLU A HB2  12 
ATOM 8327  H HB3  . GLU A 1 30 ? 28.959 -5.430  0.856   1.00 0.00 ? 30 GLU A HB3  12 
ATOM 8328  H HG2  . GLU A 1 30 ? 30.337 -7.028  -0.975  1.00 0.00 ? 30 GLU A HG2  12 
ATOM 8329  H HG3  . GLU A 1 30 ? 29.263 -8.204  -0.326  1.00 0.00 ? 30 GLU A HG3  12 
ATOM 8330  N N    . ASN A 1 31 ? 30.326 -6.547  3.800   1.00 0.00 ? 31 ASN A N    12 
ATOM 8331  C CA   . ASN A 1 31 ? 30.258 -6.262  5.230   1.00 0.00 ? 31 ASN A CA   12 
ATOM 8332  C C    . ASN A 1 31 ? 31.665 -6.160  5.842   1.00 0.00 ? 31 ASN A C    12 
ATOM 8333  O O    . ASN A 1 31 ? 31.852 -5.534  6.876   1.00 0.00 ? 31 ASN A O    12 
ATOM 8334  C CB   . ASN A 1 31 ? 29.461 -7.396  5.915   1.00 0.00 ? 31 ASN A CB   12 
ATOM 8335  C CG   . ASN A 1 31 ? 28.170 -6.862  6.555   1.00 0.00 ? 31 ASN A CG   12 
ATOM 8336  O OD1  . ASN A 1 31 ? 27.356 -6.220  5.921   1.00 0.00 ? 31 ASN A OD1  12 
ATOM 8337  N ND2  . ASN A 1 31 ? 28.053 -7.177  7.863   1.00 0.00 ? 31 ASN A ND2  12 
ATOM 8338  H H    . ASN A 1 31 ? 29.979 -7.415  3.457   1.00 0.00 ? 31 ASN A H    12 
ATOM 8339  H HA   . ASN A 1 31 ? 29.778 -5.286  5.341   1.00 0.00 ? 31 ASN A HA   12 
ATOM 8340  H HB2  . ASN A 1 31 ? 29.175 -8.159  5.192   1.00 0.00 ? 31 ASN A HB2  12 
ATOM 8341  H HB3  . ASN A 1 31 ? 30.042 -7.929  6.668   1.00 0.00 ? 31 ASN A HB3  12 
ATOM 8342  H HD21 . ASN A 1 31 ? 28.755 -7.724  8.324   1.00 0.00 ? 31 ASN A HD21 12 
ATOM 8343  H HD22 . ASN A 1 31 ? 27.262 -6.864  8.378   1.00 0.00 ? 31 ASN A HD22 12 
ATOM 8344  N N    . LEU A 1 32 ? 32.624 -6.809  5.145   1.00 0.00 ? 32 LEU A N    12 
ATOM 8345  C CA   . LEU A 1 32 ? 34.005 -6.791  5.616   1.00 0.00 ? 32 LEU A CA   12 
ATOM 8346  C C    . LEU A 1 32 ? 34.717 -5.556  5.044   1.00 0.00 ? 32 LEU A C    12 
ATOM 8347  O O    . LEU A 1 32 ? 35.569 -4.965  5.681   1.00 0.00 ? 32 LEU A O    12 
ATOM 8348  C CB   . LEU A 1 32 ? 34.736 -8.060  5.140   1.00 0.00 ? 32 LEU A CB   12 
ATOM 8349  C CG   . LEU A 1 32 ? 35.737 -8.666  6.142   1.00 0.00 ? 32 LEU A CG   12 
ATOM 8350  C CD1  . LEU A 1 32 ? 36.467 -7.648  7.028   1.00 0.00 ? 32 LEU A CD1  12 
ATOM 8351  C CD2  . LEU A 1 32 ? 35.023 -9.710  6.994   1.00 0.00 ? 32 LEU A CD2  12 
ATOM 8352  H H    . LEU A 1 32 ? 32.389 -7.275  4.294   1.00 0.00 ? 32 LEU A H    12 
ATOM 8353  H HA   . LEU A 1 32 ? 33.969 -6.738  6.708   1.00 0.00 ? 32 LEU A HA   12 
ATOM 8354  H HB2  . LEU A 1 32 ? 33.999 -8.824  4.911   1.00 0.00 ? 32 LEU A HB2  12 
ATOM 8355  H HB3  . LEU A 1 32 ? 35.231 -7.901  4.185   1.00 0.00 ? 32 LEU A HB3  12 
ATOM 8356  H HG   . LEU A 1 32 ? 36.499 -9.191  5.565   1.00 0.00 ? 32 LEU A HG   12 
ATOM 8357  H HD11 . LEU A 1 32 ? 37.246 -8.140  7.612   1.00 0.00 ? 32 LEU A HD11 12 
ATOM 8358  H HD12 . LEU A 1 32 ? 35.789 -7.163  7.730   1.00 0.00 ? 32 LEU A HD12 12 
ATOM 8359  H HD13 . LEU A 1 32 ? 36.949 -6.880  6.431   1.00 0.00 ? 32 LEU A HD13 12 
ATOM 8360  H HD21 . LEU A 1 32 ? 35.688 -10.155 7.731   1.00 0.00 ? 32 LEU A HD21 12 
ATOM 8361  H HD22 . LEU A 1 32 ? 34.634 -10.508 6.361   1.00 0.00 ? 32 LEU A HD22 12 
ATOM 8362  H HD23 . LEU A 1 32 ? 34.182 -9.256  7.516   1.00 0.00 ? 32 LEU A HD23 12 
ATOM 8363  N N    . ALA A 1 33 ? 34.308 -5.227  3.794   1.00 0.00 ? 33 ALA A N    12 
ATOM 8364  C CA   . ALA A 1 33 ? 34.926 -4.105  3.100   1.00 0.00 ? 33 ALA A CA   12 
ATOM 8365  C C    . ALA A 1 33 ? 34.673 -2.787  3.826   1.00 0.00 ? 33 ALA A C    12 
ATOM 8366  O O    . ALA A 1 33 ? 35.581 -1.995  4.011   1.00 0.00 ? 33 ALA A O    12 
ATOM 8367  C CB   . ALA A 1 33 ? 34.373 -3.974  1.694   1.00 0.00 ? 33 ALA A CB   12 
ATOM 8368  H H    . ALA A 1 33 ? 33.615 -5.771  3.328   1.00 0.00 ? 33 ALA A H    12 
ATOM 8369  H HA   . ALA A 1 33 ? 35.997 -4.298  3.071   1.00 0.00 ? 33 ALA A HA   12 
ATOM 8370  H HB1  . ALA A 1 33 ? 34.980 -3.243  1.161   1.00 0.00 ? 33 ALA A HB1  12 
ATOM 8371  H HB2  . ALA A 1 33 ? 33.338 -3.628  1.697   1.00 0.00 ? 33 ALA A HB2  12 
ATOM 8372  H HB3  . ALA A 1 33 ? 34.406 -4.917  1.149   1.00 0.00 ? 33 ALA A HB3  12 
ATOM 8373  N N    . ALA A 1 34 ? 33.399 -2.621  4.247   1.00 0.00 ? 34 ALA A N    12 
ATOM 8374  C CA   . ALA A 1 34 ? 33.051 -1.462  5.066   1.00 0.00 ? 34 ALA A CA   12 
ATOM 8375  C C    . ALA A 1 34 ? 33.949 -1.419  6.306   1.00 0.00 ? 34 ALA A C    12 
ATOM 8376  O O    . ALA A 1 34 ? 34.554 -0.403  6.614   1.00 0.00 ? 34 ALA A O    12 
ATOM 8377  C CB   . ALA A 1 34 ? 31.577 -1.506  5.483   1.00 0.00 ? 34 ALA A CB   12 
ATOM 8378  H H    . ALA A 1 34 ? 32.714 -3.312  4.027   1.00 0.00 ? 34 ALA A H    12 
ATOM 8379  H HA   . ALA A 1 34 ? 33.241 -0.577  4.460   1.00 0.00 ? 34 ALA A HA   12 
ATOM 8380  H HB1  . ALA A 1 34 ? 31.346 -2.396  6.068   1.00 0.00 ? 34 ALA A HB1  12 
ATOM 8381  H HB2  . ALA A 1 34 ? 30.919 -1.501  4.615   1.00 0.00 ? 34 ALA A HB2  12 
ATOM 8382  H HB3  . ALA A 1 34 ? 31.325 -0.632  6.086   1.00 0.00 ? 34 ALA A HB3  12 
ATOM 8383  N N    . ASN A 1 35 ? 34.054 -2.583  6.967   1.00 0.00 ? 35 ASN A N    12 
ATOM 8384  C CA   . ASN A 1 35 ? 34.891 -2.653  8.163   1.00 0.00 ? 35 ASN A CA   12 
ATOM 8385  C C    . ASN A 1 35 ? 36.352 -2.238  7.898   1.00 0.00 ? 35 ASN A C    12 
ATOM 8386  O O    . ASN A 1 35 ? 36.982 -1.643  8.762   1.00 0.00 ? 35 ASN A O    12 
ATOM 8387  C CB   . ASN A 1 35 ? 34.864 -4.079  8.737   1.00 0.00 ? 35 ASN A CB   12 
ATOM 8388  C CG   . ASN A 1 35 ? 34.925 -4.058  10.275  1.00 0.00 ? 35 ASN A CG   12 
ATOM 8389  O OD1  . ASN A 1 35 ? 35.212 -3.061  10.910  1.00 0.00 ? 35 ASN A OD1  12 
ATOM 8390  N ND2  . ASN A 1 35 ? 34.597 -5.249  10.818  1.00 0.00 ? 35 ASN A ND2  12 
ATOM 8391  H H    . ASN A 1 35 ? 33.548 -3.381  6.639   1.00 0.00 ? 35 ASN A H    12 
ATOM 8392  H HA   . ASN A 1 35 ? 34.449 -1.933  8.858   1.00 0.00 ? 35 ASN A HA   12 
ATOM 8393  H HB2  . ASN A 1 35 ? 33.954 -4.584  8.429   1.00 0.00 ? 35 ASN A HB2  12 
ATOM 8394  H HB3  . ASN A 1 35 ? 35.677 -4.699  8.358   1.00 0.00 ? 35 ASN A HB3  12 
ATOM 8395  H HD21 . ASN A 1 35 ? 34.411 -6.036  10.226  1.00 0.00 ? 35 ASN A HD21 12 
ATOM 8396  H HD22 . ASN A 1 35 ? 34.531 -5.357  11.804  1.00 0.00 ? 35 ASN A HD22 12 
ATOM 8397  N N    . PHE A 1 36 ? 36.839 -2.559  6.675   1.00 0.00 ? 36 PHE A N    12 
ATOM 8398  C CA   . PHE A 1 36 ? 38.191 -2.163  6.263   1.00 0.00 ? 36 PHE A CA   12 
ATOM 8399  C C    . PHE A 1 36 ? 38.319 -0.630  6.289   1.00 0.00 ? 36 PHE A C    12 
ATOM 8400  O O    . PHE A 1 36 ? 39.205 -0.094  6.939   1.00 0.00 ? 36 PHE A O    12 
ATOM 8401  C CB   . PHE A 1 36 ? 38.514 -2.740  4.867   1.00 0.00 ? 36 PHE A CB   12 
ATOM 8402  C CG   . PHE A 1 36 ? 39.902 -2.448  4.329   1.00 0.00 ? 36 PHE A CG   12 
ATOM 8403  C CD1  . PHE A 1 36 ? 40.268 -1.157  3.948   1.00 0.00 ? 36 PHE A CD1  12 
ATOM 8404  C CD2  . PHE A 1 36 ? 40.824 -3.475  4.138   1.00 0.00 ? 36 PHE A CD2  12 
ATOM 8405  C CE1  . PHE A 1 36 ? 41.503 -0.894  3.378   1.00 0.00 ? 36 PHE A CE1  12 
ATOM 8406  C CE2  . PHE A 1 36 ? 42.069 -3.215  3.574   1.00 0.00 ? 36 PHE A CE2  12 
ATOM 8407  C CZ   . PHE A 1 36 ? 42.411 -1.926  3.189   1.00 0.00 ? 36 PHE A CZ   12 
ATOM 8408  H H    . PHE A 1 36 ? 36.241 -3.026  6.024   1.00 0.00 ? 36 PHE A H    12 
ATOM 8409  H HA   . PHE A 1 36 ? 38.880 -2.587  6.994   1.00 0.00 ? 36 PHE A HA   12 
ATOM 8410  H HB2  . PHE A 1 36 ? 38.365 -3.818  4.888   1.00 0.00 ? 36 PHE A HB2  12 
ATOM 8411  H HB3  . PHE A 1 36 ? 37.811 -2.362  4.134   1.00 0.00 ? 36 PHE A HB3  12 
ATOM 8412  H HD1  . PHE A 1 36 ? 39.580 -0.334  4.049   1.00 0.00 ? 36 PHE A HD1  12 
ATOM 8413  H HD2  . PHE A 1 36 ? 40.564 -4.493  4.393   1.00 0.00 ? 36 PHE A HD2  12 
ATOM 8414  H HE1  . PHE A 1 36 ? 41.743 0.112   3.065   1.00 0.00 ? 36 PHE A HE1  12 
ATOM 8415  H HE2  . PHE A 1 36 ? 42.770 -4.021  3.407   1.00 0.00 ? 36 PHE A HE2  12 
ATOM 8416  H HZ   . PHE A 1 36 ? 43.369 -1.723  2.735   1.00 0.00 ? 36 PHE A HZ   12 
ATOM 8417  N N    . LEU A 1 37 ? 37.410 0.031   5.537   1.00 0.00 ? 37 LEU A N    12 
ATOM 8418  C CA   . LEU A 1 37 ? 37.547 1.463   5.288   1.00 0.00 ? 37 LEU A CA   12 
ATOM 8419  C C    . LEU A 1 37 ? 37.281 2.307   6.563   1.00 0.00 ? 37 LEU A C    12 
ATOM 8420  O O    . LEU A 1 37 ? 37.856 3.372   6.744   1.00 0.00 ? 37 LEU A O    12 
ATOM 8421  C CB   . LEU A 1 37 ? 36.602 1.911   4.164   1.00 0.00 ? 37 LEU A CB   12 
ATOM 8422  C CG   . LEU A 1 37 ? 36.801 1.245   2.781   1.00 0.00 ? 37 LEU A CG   12 
ATOM 8423  C CD1  . LEU A 1 37 ? 35.603 0.369   2.416   1.00 0.00 ? 37 LEU A CD1  12 
ATOM 8424  C CD2  . LEU A 1 37 ? 37.026 2.272   1.656   1.00 0.00 ? 37 LEU A CD2  12 
ATOM 8425  H H    . LEU A 1 37 ? 36.625 -0.452  5.156   1.00 0.00 ? 37 LEU A H    12 
ATOM 8426  H HA   . LEU A 1 37 ? 38.575 1.630   4.967   1.00 0.00 ? 37 LEU A HA   12 
ATOM 8427  H HB2  . LEU A 1 37 ? 35.570 1.789   4.478   1.00 0.00 ? 37 LEU A HB2  12 
ATOM 8428  H HB3  . LEU A 1 37 ? 36.738 2.981   4.083   1.00 0.00 ? 37 LEU A HB3  12 
ATOM 8429  H HG   . LEU A 1 37 ? 37.672 0.590   2.830   1.00 0.00 ? 37 LEU A HG   12 
ATOM 8430  H HD11 . LEU A 1 37 ? 35.900 -0.519  1.858   1.00 0.00 ? 37 LEU A HD11 12 
ATOM 8431  H HD12 . LEU A 1 37 ? 34.898 0.926   1.813   1.00 0.00 ? 37 LEU A HD12 12 
ATOM 8432  H HD13 . LEU A 1 37 ? 35.030 0.074   3.287   1.00 0.00 ? 37 LEU A HD13 12 
ATOM 8433  H HD21 . LEU A 1 37 ? 37.986 2.090   1.191   1.00 0.00 ? 37 LEU A HD21 12 
ATOM 8434  H HD22 . LEU A 1 37 ? 37.050 3.293   2.012   1.00 0.00 ? 37 LEU A HD22 12 
ATOM 8435  H HD23 . LEU A 1 37 ? 36.247 2.257   0.890   1.00 0.00 ? 37 LEU A HD23 12 
ATOM 8436  N N    . LEU A 1 38 ? 36.379 1.754   7.415   1.00 0.00 ? 38 LEU A N    12 
ATOM 8437  C CA   . LEU A 1 38 ? 35.930 2.435   8.631   1.00 0.00 ? 38 LEU A CA   12 
ATOM 8438  C C    . LEU A 1 38 ? 36.960 2.222   9.769   1.00 0.00 ? 38 LEU A C    12 
ATOM 8439  O O    . LEU A 1 38 ? 37.072 3.020   10.687  1.00 0.00 ? 38 LEU A O    12 
ATOM 8440  C CB   . LEU A 1 38 ? 34.519 1.980   9.096   1.00 0.00 ? 38 LEU A CB   12 
ATOM 8441  C CG   . LEU A 1 38 ? 33.362 1.902   8.057   1.00 0.00 ? 38 LEU A CG   12 
ATOM 8442  C CD1  . LEU A 1 38 ? 32.071 2.580   8.537   1.00 0.00 ? 38 LEU A CD1  12 
ATOM 8443  C CD2  . LEU A 1 38 ? 33.720 2.446   6.677   1.00 0.00 ? 38 LEU A CD2  12 
ATOM 8444  H H    . LEU A 1 38 ? 36.006 0.855   7.213   1.00 0.00 ? 38 LEU A H    12 
ATOM 8445  H HA   . LEU A 1 38 ? 35.903 3.494   8.387   1.00 0.00 ? 38 LEU A HA   12 
ATOM 8446  H HB2  . LEU A 1 38 ? 34.617 0.996   9.552   1.00 0.00 ? 38 LEU A HB2  12 
ATOM 8447  H HB3  . LEU A 1 38 ? 34.213 2.651   9.902   1.00 0.00 ? 38 LEU A HB3  12 
ATOM 8448  H HG   . LEU A 1 38 ? 33.095 0.852   7.948   1.00 0.00 ? 38 LEU A HG   12 
ATOM 8449  H HD11 . LEU A 1 38 ? 32.210 3.652   8.681   1.00 0.00 ? 38 LEU A HD11 12 
ATOM 8450  H HD12 . LEU A 1 38 ? 31.706 2.143   9.465   1.00 0.00 ? 38 LEU A HD12 12 
ATOM 8451  H HD13 . LEU A 1 38 ? 31.279 2.453   7.798   1.00 0.00 ? 38 LEU A HD13 12 
ATOM 8452  H HD21 . LEU A 1 38 ? 34.424 3.262   6.770   1.00 0.00 ? 38 LEU A HD21 12 
ATOM 8453  H HD22 . LEU A 1 38 ? 32.838 2.813   6.168   1.00 0.00 ? 38 LEU A HD22 12 
ATOM 8454  H HD23 . LEU A 1 38 ? 34.157 1.703   6.020   1.00 0.00 ? 38 LEU A HD23 12 
ATOM 8455  N N    . SER A 1 39 ? 37.710 1.104   9.614   1.00 0.00 ? 39 SER A N    12 
ATOM 8456  C CA   . SER A 1 39 ? 38.799 0.745   10.520  1.00 0.00 ? 39 SER A CA   12 
ATOM 8457  C C    . SER A 1 39 ? 39.991 1.708   10.391  1.00 0.00 ? 39 SER A C    12 
ATOM 8458  O O    . SER A 1 39 ? 40.758 1.863   11.331  1.00 0.00 ? 39 SER A O    12 
ATOM 8459  C CB   . SER A 1 39 ? 39.261 -0.699  10.240  1.00 0.00 ? 39 SER A CB   12 
ATOM 8460  O OG   . SER A 1 39 ? 40.513 -1.025  10.815  1.00 0.00 ? 39 SER A OG   12 
ATOM 8461  H H    . SER A 1 39 ? 37.528 0.500   8.845   1.00 0.00 ? 39 SER A H    12 
ATOM 8462  H HA   . SER A 1 39 ? 38.400 0.822   11.531  1.00 0.00 ? 39 SER A HA   12 
ATOM 8463  H HB2  . SER A 1 39 ? 38.514 -1.412  10.599  1.00 0.00 ? 39 SER A HB2  12 
ATOM 8464  H HB3  . SER A 1 39 ? 39.366 -0.864  9.167   1.00 0.00 ? 39 SER A HB3  12 
ATOM 8465  H HG   . SER A 1 39 ? 40.549 -0.702  11.708  1.00 0.00 ? 39 SER A HG   12 
ATOM 8466  N N    . GLN A 1 40 ? 40.094 2.338   9.197   1.00 0.00 ? 40 GLN A N    12 
ATOM 8467  C CA   . GLN A 1 40 ? 41.148 3.324   8.963   1.00 0.00 ? 40 GLN A CA   12 
ATOM 8468  C C    . GLN A 1 40 ? 40.688 4.691   9.507   1.00 0.00 ? 40 GLN A C    12 
ATOM 8469  O O    . GLN A 1 40 ? 40.285 5.578   8.766   1.00 0.00 ? 40 GLN A O    12 
ATOM 8470  C CB   . GLN A 1 40 ? 41.505 3.404   7.463   1.00 0.00 ? 40 GLN A CB   12 
ATOM 8471  C CG   . GLN A 1 40 ? 41.664 2.036   6.778   1.00 0.00 ? 40 GLN A CG   12 
ATOM 8472  C CD   . GLN A 1 40 ? 42.291 2.105   5.373   1.00 0.00 ? 40 GLN A CD   12 
ATOM 8473  O OE1  . GLN A 1 40 ? 43.040 1.236   4.966   1.00 0.00 ? 40 GLN A OE1  12 
ATOM 8474  N NE2  . GLN A 1 40 ? 41.924 3.187   4.662   1.00 0.00 ? 40 GLN A NE2  12 
ATOM 8475  H H    . GLN A 1 40 ? 39.439 2.132   8.475   1.00 0.00 ? 40 GLN A H    12 
ATOM 8476  H HA   . GLN A 1 40 ? 42.032 3.008   9.519   1.00 0.00 ? 40 GLN A HA   12 
ATOM 8477  H HB2  . GLN A 1 40 ? 40.758 3.994   6.928   1.00 0.00 ? 40 GLN A HB2  12 
ATOM 8478  H HB3  . GLN A 1 40 ? 42.447 3.941   7.371   1.00 0.00 ? 40 GLN A HB3  12 
ATOM 8479  H HG2  . GLN A 1 40 ? 42.290 1.372   7.373   1.00 0.00 ? 40 GLN A HG2  12 
ATOM 8480  H HG3  . GLN A 1 40 ? 40.693 1.567   6.680   1.00 0.00 ? 40 GLN A HG3  12 
ATOM 8481  H HE21 . GLN A 1 40 ? 41.361 3.903   5.077   1.00 0.00 ? 40 GLN A HE21 12 
ATOM 8482  H HE22 . GLN A 1 40 ? 42.205 3.300   3.712   1.00 0.00 ? 40 GLN A HE22 12 
ATOM 8483  N N    . ASN A 1 41 ? 40.800 4.783   10.855  1.00 0.00 ? 41 ASN A N    12 
ATOM 8484  C CA   . ASN A 1 41 ? 40.447 5.997   11.589  1.00 0.00 ? 41 ASN A CA   12 
ATOM 8485  C C    . ASN A 1 41 ? 41.237 7.189   11.027  1.00 0.00 ? 41 ASN A C    12 
ATOM 8486  O O    . ASN A 1 41 ? 42.444 7.108   10.803  1.00 0.00 ? 41 ASN A O    12 
ATOM 8487  C CB   . ASN A 1 41 ? 40.773 5.877   13.092  1.00 0.00 ? 41 ASN A CB   12 
ATOM 8488  C CG   . ASN A 1 41 ? 40.449 4.531   13.769  1.00 0.00 ? 41 ASN A CG   12 
ATOM 8489  O OD1  . ASN A 1 41 ? 41.193 4.058   14.606  1.00 0.00 ? 41 ASN A OD1  12 
ATOM 8490  N ND2  . ASN A 1 41 ? 39.304 3.946   13.362  1.00 0.00 ? 41 ASN A ND2  12 
ATOM 8491  H H    . ASN A 1 41 ? 41.090 3.982   11.370  1.00 0.00 ? 41 ASN A H    12 
ATOM 8492  H HA   . ASN A 1 41 ? 39.375 6.147   11.436  1.00 0.00 ? 41 ASN A HA   12 
ATOM 8493  H HB2  . ASN A 1 41 ? 41.837 6.043   13.261  1.00 0.00 ? 41 ASN A HB2  12 
ATOM 8494  H HB3  . ASN A 1 41 ? 40.257 6.668   13.634  1.00 0.00 ? 41 ASN A HB3  12 
ATOM 8495  H HD21 . ASN A 1 41 ? 38.716 4.341   12.659  1.00 0.00 ? 41 ASN A HD21 12 
ATOM 8496  H HD22 . ASN A 1 41 ? 39.047 3.076   13.778  1.00 0.00 ? 41 ASN A HD22 12 
ATOM 8497  N N    . PHE A 1 42 ? 40.468 8.269   10.791  1.00 0.00 ? 42 PHE A N    12 
ATOM 8498  C CA   . PHE A 1 42 ? 40.983 9.450   10.115  1.00 0.00 ? 42 PHE A CA   12 
ATOM 8499  C C    . PHE A 1 42 ? 39.874 10.511  10.085  1.00 0.00 ? 42 PHE A C    12 
ATOM 8500  O O    . PHE A 1 42 ? 38.744 10.247  9.696   1.00 0.00 ? 42 PHE A O    12 
ATOM 8501  C CB   . PHE A 1 42 ? 41.431 9.101   8.681   1.00 0.00 ? 42 PHE A CB   12 
ATOM 8502  C CG   . PHE A 1 42 ? 41.913 10.305  7.910   1.00 0.00 ? 42 PHE A CG   12 
ATOM 8503  C CD1  . PHE A 1 42 ? 43.109 10.933  8.240   1.00 0.00 ? 42 PHE A CD1  12 
ATOM 8504  C CD2  . PHE A 1 42 ? 41.159 10.803  6.853   1.00 0.00 ? 42 PHE A CD2  12 
ATOM 8505  C CE1  . PHE A 1 42 ? 43.545 12.045  7.527   1.00 0.00 ? 42 PHE A CE1  12 
ATOM 8506  C CE2  . PHE A 1 42 ? 41.590 11.911  6.138   1.00 0.00 ? 42 PHE A CE2  12 
ATOM 8507  C CZ   . PHE A 1 42 ? 42.783 12.532  6.475   1.00 0.00 ? 42 PHE A CZ   12 
ATOM 8508  H H    . PHE A 1 42 ? 39.508 8.245   11.077  1.00 0.00 ? 42 PHE A H    12 
ATOM 8509  H HA   . PHE A 1 42 ? 41.820 9.820   10.709  1.00 0.00 ? 42 PHE A HA   12 
ATOM 8510  H HB2  . PHE A 1 42 ? 42.254 8.389   8.706   1.00 0.00 ? 42 PHE A HB2  12 
ATOM 8511  H HB3  . PHE A 1 42 ? 40.621 8.607   8.138   1.00 0.00 ? 42 PHE A HB3  12 
ATOM 8512  H HD1  . PHE A 1 42 ? 43.713 10.560  9.054   1.00 0.00 ? 42 PHE A HD1  12 
ATOM 8513  H HD2  . PHE A 1 42 ? 40.232 10.324  6.583   1.00 0.00 ? 42 PHE A HD2  12 
ATOM 8514  H HE1  . PHE A 1 42 ? 44.471 12.535  7.792   1.00 0.00 ? 42 PHE A HE1  12 
ATOM 8515  H HE2  . PHE A 1 42 ? 40.992 12.291  5.324   1.00 0.00 ? 42 PHE A HE2  12 
ATOM 8516  H HZ   . PHE A 1 42 ? 43.114 13.396  5.920   1.00 0.00 ? 42 PHE A HZ   12 
ATOM 8517  N N    . ASP A 1 43 ? 40.297 11.720  10.524  1.00 0.00 ? 43 ASP A N    12 
ATOM 8518  C CA   . ASP A 1 43 ? 39.470 12.924  10.517  1.00 0.00 ? 43 ASP A CA   12 
ATOM 8519  C C    . ASP A 1 43 ? 38.406 12.926  11.648  1.00 0.00 ? 43 ASP A C    12 
ATOM 8520  O O    . ASP A 1 43 ? 37.678 13.893  11.811  1.00 0.00 ? 43 ASP A O    12 
ATOM 8521  C CB   . ASP A 1 43 ? 38.855 13.144  9.117   1.00 0.00 ? 43 ASP A CB   12 
ATOM 8522  C CG   . ASP A 1 43 ? 38.446 14.608  8.878   1.00 0.00 ? 43 ASP A CG   12 
ATOM 8523  O OD1  . ASP A 1 43 ? 39.329 15.465  8.869   1.00 0.00 ? 43 ASP A OD1  12 
ATOM 8524  O OD2  . ASP A 1 43 ? 37.258 14.876  8.697   1.00 0.00 ? 43 ASP A OD2  12 
ATOM 8525  H H    . ASP A 1 43 ? 41.233 11.789  10.864  1.00 0.00 ? 43 ASP A H    12 
ATOM 8526  H HA   . ASP A 1 43 ? 40.177 13.729  10.730  1.00 0.00 ? 43 ASP A HA   12 
ATOM 8527  H HB2  . ASP A 1 43 ? 39.590 12.879  8.358   1.00 0.00 ? 43 ASP A HB2  12 
ATOM 8528  H HB3  . ASP A 1 43 ? 38.003 12.487  8.942   1.00 0.00 ? 43 ASP A HB3  12 
ATOM 8529  N N    . ASP A 1 44 ? 38.364 11.801  12.403  1.00 0.00 ? 44 ASP A N    12 
ATOM 8530  C CA   . ASP A 1 44 ? 37.423 11.561  13.499  1.00 0.00 ? 44 ASP A CA   12 
ATOM 8531  C C    . ASP A 1 44 ? 35.958 11.827  13.078  1.00 0.00 ? 44 ASP A C    12 
ATOM 8532  O O    . ASP A 1 44 ? 35.217 12.536  13.743  1.00 0.00 ? 44 ASP A O    12 
ATOM 8533  C CB   . ASP A 1 44 ? 37.865 12.343  14.768  1.00 0.00 ? 44 ASP A CB   12 
ATOM 8534  C CG   . ASP A 1 44 ? 38.247 11.378  15.908  1.00 0.00 ? 44 ASP A CG   12 
ATOM 8535  O OD1  . ASP A 1 44 ? 39.344 10.821  15.870  1.00 0.00 ? 44 ASP A OD1  12 
ATOM 8536  O OD2  . ASP A 1 44 ? 37.440 11.194  16.819  1.00 0.00 ? 44 ASP A OD2  12 
ATOM 8537  H H    . ASP A 1 44 ? 39.058 11.105  12.243  1.00 0.00 ? 44 ASP A H    12 
ATOM 8538  H HA   . ASP A 1 44 ? 37.507 10.485  13.662  1.00 0.00 ? 44 ASP A HA   12 
ATOM 8539  H HB2  . ASP A 1 44 ? 38.725 12.979  14.556  1.00 0.00 ? 44 ASP A HB2  12 
ATOM 8540  H HB3  . ASP A 1 44 ? 37.104 13.030  15.140  1.00 0.00 ? 44 ASP A HB3  12 
ATOM 8541  N N    . GLU A 1 45 ? 35.610 11.226  11.915  1.00 0.00 ? 45 GLU A N    12 
ATOM 8542  C CA   . GLU A 1 45 ? 34.304 11.492  11.310  1.00 0.00 ? 45 GLU A CA   12 
ATOM 8543  C C    . GLU A 1 45 ? 34.010 10.457  10.203  1.00 0.00 ? 45 GLU A C    12 
ATOM 8544  O O    . GLU A 1 45 ? 34.931 10.090  9.474   1.00 0.00 ? 45 GLU A O    12 
ATOM 8545  C CB   . GLU A 1 45 ? 34.255 12.938  10.748  1.00 0.00 ? 45 GLU A CB   12 
ATOM 8546  C CG   . GLU A 1 45 ? 33.125 13.797  11.354  1.00 0.00 ? 45 GLU A CG   12 
ATOM 8547  C CD   . GLU A 1 45 ? 32.165 14.385  10.303  1.00 0.00 ? 45 GLU A CD   12 
ATOM 8548  O OE1  . GLU A 1 45 ? 32.640 14.945  9.315   1.00 0.00 ? 45 GLU A OE1  12 
ATOM 8549  O OE2  . GLU A 1 45 ? 30.952 14.285  10.488  1.00 0.00 ? 45 GLU A OE2  12 
ATOM 8550  O OXT  . GLU A 1 45 ? 32.860 10.032  10.082  1.00 0.00 ? 45 GLU A OXT  12 
ATOM 8551  H H    . GLU A 1 45 ? 36.275 10.641  11.452  1.00 0.00 ? 45 GLU A H    12 
ATOM 8552  H HA   . GLU A 1 45 ? 33.575 11.348  12.110  1.00 0.00 ? 45 GLU A HA   12 
ATOM 8553  H HB2  . GLU A 1 45 ? 35.193 13.447  10.962  1.00 0.00 ? 45 GLU A HB2  12 
ATOM 8554  H HB3  . GLU A 1 45 ? 34.230 12.943  9.657   1.00 0.00 ? 45 GLU A HB3  12 
ATOM 8555  H HG2  . GLU A 1 45 ? 32.548 13.234  12.084  1.00 0.00 ? 45 GLU A HG2  12 
ATOM 8556  H HG3  . GLU A 1 45 ? 33.560 14.622  11.917  1.00 0.00 ? 45 GLU A HG3  12 
ATOM 8557  N N    . GLN A 1 1  ? 29.895 -4.889  -12.131 1.00 0.00 ? 1  GLN A N    13 
ATOM 8558  C CA   . GLN A 1 1  ? 30.440 -5.864  -11.193 1.00 0.00 ? 1  GLN A CA   13 
ATOM 8559  C C    . GLN A 1 1  ? 30.144 -5.433  -9.745  1.00 0.00 ? 1  GLN A C    13 
ATOM 8560  O O    . GLN A 1 1  ? 29.113 -5.781  -9.189  1.00 0.00 ? 1  GLN A O    13 
ATOM 8561  C CB   . GLN A 1 1  ? 31.942 -6.147  -11.426 1.00 0.00 ? 1  GLN A CB   13 
ATOM 8562  C CG   . GLN A 1 1  ? 32.186 -7.153  -12.571 1.00 0.00 ? 1  GLN A CG   13 
ATOM 8563  C CD   . GLN A 1 1  ? 33.174 -8.274  -12.185 1.00 0.00 ? 1  GLN A CD   13 
ATOM 8564  O OE1  . GLN A 1 1  ? 33.190 -8.766  -11.065 1.00 0.00 ? 1  GLN A OE1  13 
ATOM 8565  N NE2  . GLN A 1 1  ? 33.975 -8.655  -13.200 1.00 0.00 ? 1  GLN A NE2  13 
ATOM 8566  H H1   . GLN A 1 1  ? 30.439 -4.004  -12.063 1.00 0.00 ? 1  GLN A H1   13 
ATOM 8567  H H2   . GLN A 1 1  ? 28.904 -4.704  -11.878 1.00 0.00 ? 1  GLN A H2   13 
ATOM 8568  H H3   . GLN A 1 1  ? 29.947 -5.260  -13.102 1.00 0.00 ? 1  GLN A H3   13 
ATOM 8569  H HA   . GLN A 1 1  ? 29.878 -6.786  -11.344 1.00 0.00 ? 1  GLN A HA   13 
ATOM 8570  H HB2  . GLN A 1 1  ? 32.473 -5.218  -11.641 1.00 0.00 ? 1  GLN A HB2  13 
ATOM 8571  H HB3  . GLN A 1 1  ? 32.394 -6.514  -10.504 1.00 0.00 ? 1  GLN A HB3  13 
ATOM 8572  H HG2  . GLN A 1 1  ? 31.261 -7.632  -12.882 1.00 0.00 ? 1  GLN A HG2  13 
ATOM 8573  H HG3  . GLN A 1 1  ? 32.541 -6.633  -13.459 1.00 0.00 ? 1  GLN A HG3  13 
ATOM 8574  H HE21 . GLN A 1 1  ? 33.964 -8.189  -14.084 1.00 0.00 ? 1  GLN A HE21 13 
ATOM 8575  H HE22 . GLN A 1 1  ? 34.604 -9.422  -13.085 1.00 0.00 ? 1  GLN A HE22 13 
ATOM 8576  N N    . GLU A 1 2  ? 31.108 -4.671  -9.183  1.00 0.00 ? 2  GLU A N    13 
ATOM 8577  C CA   . GLU A 1 2  ? 31.041 -4.195  -7.803  1.00 0.00 ? 2  GLU A CA   13 
ATOM 8578  C C    . GLU A 1 2  ? 31.152 -2.664  -7.741  1.00 0.00 ? 2  GLU A C    13 
ATOM 8579  O O    . GLU A 1 2  ? 31.339 -2.097  -6.675  1.00 0.00 ? 2  GLU A O    13 
ATOM 8580  C CB   . GLU A 1 2  ? 32.188 -4.846  -7.023  1.00 0.00 ? 2  GLU A CB   13 
ATOM 8581  C CG   . GLU A 1 2  ? 33.555 -4.238  -7.401  1.00 0.00 ? 2  GLU A CG   13 
ATOM 8582  C CD   . GLU A 1 2  ? 34.656 -5.284  -7.406  1.00 0.00 ? 2  GLU A CD   13 
ATOM 8583  O OE1  . GLU A 1 2  ? 34.794 -5.966  -8.416  1.00 0.00 ? 2  GLU A OE1  13 
ATOM 8584  O OE2  . GLU A 1 2  ? 35.365 -5.394  -6.406  1.00 0.00 ? 2  GLU A OE2  13 
ATOM 8585  H H    . GLU A 1 2  ? 31.914 -4.433  -9.722  1.00 0.00 ? 2  GLU A H    13 
ATOM 8586  H HA   . GLU A 1 2  ? 30.083 -4.469  -7.364  1.00 0.00 ? 2  GLU A HA   13 
ATOM 8587  H HB2  . GLU A 1 2  ? 32.020 -4.745  -5.952  1.00 0.00 ? 2  GLU A HB2  13 
ATOM 8588  H HB3  . GLU A 1 2  ? 32.149 -5.924  -7.191  1.00 0.00 ? 2  GLU A HB3  13 
ATOM 8589  H HG2  . GLU A 1 2  ? 33.533 -3.759  -8.385  1.00 0.00 ? 2  GLU A HG2  13 
ATOM 8590  H HG3  . GLU A 1 2  ? 33.825 -3.468  -6.682  1.00 0.00 ? 2  GLU A HG3  13 
ATOM 8591  N N    . LYS A 1 3  ? 31.032 -2.048  -8.940  1.00 0.00 ? 3  LYS A N    13 
ATOM 8592  C CA   . LYS A 1 3  ? 31.101 -0.599  -9.106  1.00 0.00 ? 3  LYS A CA   13 
ATOM 8593  C C    . LYS A 1 3  ? 30.006 0.143   -8.316  1.00 0.00 ? 3  LYS A C    13 
ATOM 8594  O O    . LYS A 1 3  ? 30.128 1.324   -8.024  1.00 0.00 ? 3  LYS A O    13 
ATOM 8595  C CB   . LYS A 1 3  ? 31.074 -0.252  -10.589 1.00 0.00 ? 3  LYS A CB   13 
ATOM 8596  C CG   . LYS A 1 3  ? 29.835 -0.772  -11.326 1.00 0.00 ? 3  LYS A CG   13 
ATOM 8597  C CD   . LYS A 1 3  ? 30.170 -1.039  -12.795 1.00 0.00 ? 3  LYS A CD   13 
ATOM 8598  C CE   . LYS A 1 3  ? 28.936 -1.191  -13.689 1.00 0.00 ? 3  LYS A CE   13 
ATOM 8599  N NZ   . LYS A 1 3  ? 28.771 -2.546  -14.198 1.00 0.00 ? 3  LYS A NZ   13 
ATOM 8600  H H    . LYS A 1 3  ? 30.916 -2.593  -9.767  1.00 0.00 ? 3  LYS A H    13 
ATOM 8601  H HA   . LYS A 1 3  ? 32.076 -0.288  -8.765  1.00 0.00 ? 3  LYS A HA   13 
ATOM 8602  H HB2  . LYS A 1 3  ? 31.164 0.827   -10.730 1.00 0.00 ? 3  LYS A HB2  13 
ATOM 8603  H HB3  . LYS A 1 3  ? 31.974 -0.666  -11.045 1.00 0.00 ? 3  LYS A HB3  13 
ATOM 8604  H HG2  . LYS A 1 3  ? 29.450 -1.694  -10.892 1.00 0.00 ? 3  LYS A HG2  13 
ATOM 8605  H HG3  . LYS A 1 3  ? 29.034 -0.040  -11.221 1.00 0.00 ? 3  LYS A HG3  13 
ATOM 8606  H HD2  . LYS A 1 3  ? 30.772 -0.213  -13.169 1.00 0.00 ? 3  LYS A HD2  13 
ATOM 8607  H HD3  . LYS A 1 3  ? 30.819 -1.915  -12.871 1.00 0.00 ? 3  LYS A HD3  13 
ATOM 8608  H HE2  . LYS A 1 3  ? 28.017 -0.905  -13.176 1.00 0.00 ? 3  LYS A HE2  13 
ATOM 8609  H HE3  . LYS A 1 3  ? 29.038 -0.529  -14.549 1.00 0.00 ? 3  LYS A HE3  13 
ATOM 8610  H HZ1  . LYS A 1 3  ? 29.702 -2.921  -14.473 1.00 0.00 ? 3  LYS A HZ1  13 
ATOM 8611  H HZ2  . LYS A 1 3  ? 28.146 -2.527  -15.029 1.00 0.00 ? 3  LYS A HZ2  13 
ATOM 8612  H HZ3  . LYS A 1 3  ? 28.358 -3.151  -13.460 1.00 0.00 ? 3  LYS A HZ3  13 
ATOM 8613  N N    . GLU A 1 4  ? 28.957 -0.639  -7.975  1.00 0.00 ? 4  GLU A N    13 
ATOM 8614  C CA   . GLU A 1 4  ? 27.869 -0.164  -7.129  1.00 0.00 ? 4  GLU A CA   13 
ATOM 8615  C C    . GLU A 1 4  ? 28.351 0.154   -5.712  1.00 0.00 ? 4  GLU A C    13 
ATOM 8616  O O    . GLU A 1 4  ? 27.921 1.118   -5.097  1.00 0.00 ? 4  GLU A O    13 
ATOM 8617  C CB   . GLU A 1 4  ? 26.782 -1.249  -7.045  1.00 0.00 ? 4  GLU A CB   13 
ATOM 8618  C CG   . GLU A 1 4  ? 25.643 -1.017  -8.050  1.00 0.00 ? 4  GLU A CG   13 
ATOM 8619  C CD   . GLU A 1 4  ? 24.267 -1.171  -7.373  1.00 0.00 ? 4  GLU A CD   13 
ATOM 8620  O OE1  . GLU A 1 4  ? 23.889 -0.285  -6.605  1.00 0.00 ? 4  GLU A OE1  13 
ATOM 8621  O OE2  . GLU A 1 4  ? 23.592 -2.170  -7.617  1.00 0.00 ? 4  GLU A OE2  13 
ATOM 8622  H H    . GLU A 1 4  ? 28.956 -1.596  -8.266  1.00 0.00 ? 4  GLU A H    13 
ATOM 8623  H HA   . GLU A 1 4  ? 27.501 0.768   -7.564  1.00 0.00 ? 4  GLU A HA   13 
ATOM 8624  H HB2  . GLU A 1 4  ? 27.218 -2.238  -7.197  1.00 0.00 ? 4  GLU A HB2  13 
ATOM 8625  H HB3  . GLU A 1 4  ? 26.384 -1.313  -6.030  1.00 0.00 ? 4  GLU A HB3  13 
ATOM 8626  H HG2  . GLU A 1 4  ? 25.694 -0.019  -8.485  1.00 0.00 ? 4  GLU A HG2  13 
ATOM 8627  H HG3  . GLU A 1 4  ? 25.737 -1.707  -8.888  1.00 0.00 ? 4  GLU A HG3  13 
ATOM 8628  N N    . ALA A 1 5  ? 29.262 -0.719  -5.241  1.00 0.00 ? 5  ALA A N    13 
ATOM 8629  C CA   . ALA A 1 5  ? 29.846 -0.467  -3.940  1.00 0.00 ? 5  ALA A CA   13 
ATOM 8630  C C    . ALA A 1 5  ? 30.883 0.654   -4.021  1.00 0.00 ? 5  ALA A C    13 
ATOM 8631  O O    . ALA A 1 5  ? 31.257 1.197   -3.001  1.00 0.00 ? 5  ALA A O    13 
ATOM 8632  C CB   . ALA A 1 5  ? 30.462 -1.738  -3.363  1.00 0.00 ? 5  ALA A CB   13 
ATOM 8633  H H    . ALA A 1 5  ? 29.563 -1.496  -5.790  1.00 0.00 ? 5  ALA A H    13 
ATOM 8634  H HA   . ALA A 1 5  ? 29.045 -0.153  -3.273  1.00 0.00 ? 5  ALA A HA   13 
ATOM 8635  H HB1  . ALA A 1 5  ? 31.350 -2.056  -3.910  1.00 0.00 ? 5  ALA A HB1  13 
ATOM 8636  H HB2  . ALA A 1 5  ? 29.746 -2.558  -3.367  1.00 0.00 ? 5  ALA A HB2  13 
ATOM 8637  H HB3  . ALA A 1 5  ? 30.735 -1.569  -2.323  1.00 0.00 ? 5  ALA A HB3  13 
ATOM 8638  N N    . ILE A 1 6  ? 31.343 1.002   -5.237  1.00 0.00 ? 6  ILE A N    13 
ATOM 8639  C CA   . ILE A 1 6  ? 32.438 1.971   -5.311  1.00 0.00 ? 6  ILE A CA   13 
ATOM 8640  C C    . ILE A 1 6  ? 31.962 3.403   -5.045  1.00 0.00 ? 6  ILE A C    13 
ATOM 8641  O O    . ILE A 1 6  ? 32.727 4.235   -4.591  1.00 0.00 ? 6  ILE A O    13 
ATOM 8642  C CB   . ILE A 1 6  ? 33.215 1.844   -6.631  1.00 0.00 ? 6  ILE A CB   13 
ATOM 8643  C CG1  . ILE A 1 6  ? 33.603 0.384   -6.903  1.00 0.00 ? 6  ILE A CG1  13 
ATOM 8644  C CG2  . ILE A 1 6  ? 34.440 2.770   -6.698  1.00 0.00 ? 6  ILE A CG2  13 
ATOM 8645  C CD1  . ILE A 1 6  ? 34.511 -0.256  -5.862  1.00 0.00 ? 6  ILE A CD1  13 
ATOM 8646  H H    . ILE A 1 6  ? 30.956 0.604   -6.068  1.00 0.00 ? 6  ILE A H    13 
ATOM 8647  H HA   . ILE A 1 6  ? 33.106 1.720   -4.495  1.00 0.00 ? 6  ILE A HA   13 
ATOM 8648  H HB   . ILE A 1 6  ? 32.549 2.149   -7.438  1.00 0.00 ? 6  ILE A HB   13 
ATOM 8649  H HG12 . ILE A 1 6  ? 32.712 -0.227  -6.910  1.00 0.00 ? 6  ILE A HG12 13 
ATOM 8650  H HG13 . ILE A 1 6  ? 34.037 0.302   -7.900  1.00 0.00 ? 6  ILE A HG13 13 
ATOM 8651  H HG21 . ILE A 1 6  ? 34.884 2.919   -5.718  1.00 0.00 ? 6  ILE A HG21 13 
ATOM 8652  H HG22 . ILE A 1 6  ? 34.168 3.756   -7.074  1.00 0.00 ? 6  ILE A HG22 13 
ATOM 8653  H HG23 . ILE A 1 6  ? 35.212 2.364   -7.351  1.00 0.00 ? 6  ILE A HG23 13 
ATOM 8654  H HD11 . ILE A 1 6  ? 35.484 0.221   -5.825  1.00 0.00 ? 6  ILE A HD11 13 
ATOM 8655  H HD12 . ILE A 1 6  ? 34.645 -1.304  -6.123  1.00 0.00 ? 6  ILE A HD12 13 
ATOM 8656  H HD13 . ILE A 1 6  ? 34.068 -0.224  -4.869  1.00 0.00 ? 6  ILE A HD13 13 
ATOM 8657  N N    . GLU A 1 7  ? 30.664 3.629   -5.318  1.00 0.00 ? 7  GLU A N    13 
ATOM 8658  C CA   . GLU A 1 7  ? 30.059 4.915   -4.992  1.00 0.00 ? 7  GLU A CA   13 
ATOM 8659  C C    . GLU A 1 7  ? 29.502 4.919   -3.557  1.00 0.00 ? 7  GLU A C    13 
ATOM 8660  O O    . GLU A 1 7  ? 29.192 5.968   -3.015  1.00 0.00 ? 7  GLU A O    13 
ATOM 8661  C CB   . GLU A 1 7  ? 28.961 5.232   -6.016  1.00 0.00 ? 7  GLU A CB   13 
ATOM 8662  C CG   . GLU A 1 7  ? 27.820 4.197   -6.029  1.00 0.00 ? 7  GLU A CG   13 
ATOM 8663  C CD   . GLU A 1 7  ? 26.649 4.587   -6.954  1.00 0.00 ? 7  GLU A CD   13 
ATOM 8664  O OE1  . GLU A 1 7  ? 26.539 5.755   -7.326  1.00 0.00 ? 7  GLU A OE1  13 
ATOM 8665  O OE2  . GLU A 1 7  ? 25.850 3.712   -7.289  1.00 0.00 ? 7  GLU A OE2  13 
ATOM 8666  H H    . GLU A 1 7  ? 30.101 2.893   -5.690  1.00 0.00 ? 7  GLU A H    13 
ATOM 8667  H HA   . GLU A 1 7  ? 30.828 5.686   -5.050  1.00 0.00 ? 7  GLU A HA   13 
ATOM 8668  H HB2  . GLU A 1 7  ? 28.565 6.227   -5.807  1.00 0.00 ? 7  GLU A HB2  13 
ATOM 8669  H HB3  . GLU A 1 7  ? 29.410 5.276   -7.010  1.00 0.00 ? 7  GLU A HB3  13 
ATOM 8670  H HG2  . GLU A 1 7  ? 28.208 3.232   -6.350  1.00 0.00 ? 7  GLU A HG2  13 
ATOM 8671  H HG3  . GLU A 1 7  ? 27.420 4.053   -5.026  1.00 0.00 ? 7  GLU A HG3  13 
ATOM 8672  N N    . ARG A 1 8  ? 29.393 3.696   -2.989  1.00 0.00 ? 8  ARG A N    13 
ATOM 8673  C CA   . ARG A 1 8  ? 28.825 3.509   -1.660  1.00 0.00 ? 8  ARG A CA   13 
ATOM 8674  C C    . ARG A 1 8  ? 29.908 3.694   -0.600  1.00 0.00 ? 8  ARG A C    13 
ATOM 8675  O O    . ARG A 1 8  ? 29.764 4.490   0.308   1.00 0.00 ? 8  ARG A O    13 
ATOM 8676  C CB   . ARG A 1 8  ? 28.193 2.107   -1.592  1.00 0.00 ? 8  ARG A CB   13 
ATOM 8677  C CG   . ARG A 1 8  ? 26.739 2.130   -1.100  1.00 0.00 ? 8  ARG A CG   13 
ATOM 8678  C CD   . ARG A 1 8  ? 25.842 1.121   -1.833  1.00 0.00 ? 8  ARG A CD   13 
ATOM 8679  N NE   . ARG A 1 8  ? 25.562 -0.048  -1.008  1.00 0.00 ? 8  ARG A NE   13 
ATOM 8680  C CZ   . ARG A 1 8  ? 24.554 -0.076  -0.108  1.00 0.00 ? 8  ARG A CZ   13 
ATOM 8681  N NH1  . ARG A 1 8  ? 23.780 0.989   0.092   1.00 0.00 ? 8  ARG A NH1  13 
ATOM 8682  N NH2  . ARG A 1 8  ? 24.329 -1.188  0.586   1.00 0.00 ? 8  ARG A NH2  13 
ATOM 8683  H H    . ARG A 1 8  ? 29.704 2.882   -3.477  1.00 0.00 ? 8  ARG A H    13 
ATOM 8684  H HA   . ARG A 1 8  ? 28.078 4.295   -1.525  1.00 0.00 ? 8  ARG A HA   13 
ATOM 8685  H HB2  . ARG A 1 8  ? 28.232 1.696   -2.597  1.00 0.00 ? 8  ARG A HB2  13 
ATOM 8686  H HB3  . ARG A 1 8  ? 28.769 1.400   -0.992  1.00 0.00 ? 8  ARG A HB3  13 
ATOM 8687  H HG2  . ARG A 1 8  ? 26.711 1.988   -0.020  1.00 0.00 ? 8  ARG A HG2  13 
ATOM 8688  H HG3  . ARG A 1 8  ? 26.306 3.116   -1.252  1.00 0.00 ? 8  ARG A HG3  13 
ATOM 8689  H HD2  . ARG A 1 8  ? 24.899 1.585   -2.119  1.00 0.00 ? 8  ARG A HD2  13 
ATOM 8690  H HD3  . ARG A 1 8  ? 26.286 0.752   -2.757  1.00 0.00 ? 8  ARG A HD3  13 
ATOM 8691  H HE   . ARG A 1 8  ? 26.128 -0.864  -1.125  1.00 0.00 ? 8  ARG A HE   13 
ATOM 8692  H HH11 . ARG A 1 8  ? 23.948 1.829   -0.425  1.00 0.00 ? 8  ARG A HH11 13 
ATOM 8693  H HH12 . ARG A 1 8  ? 23.033 0.948   0.755   1.00 0.00 ? 8  ARG A HH12 13 
ATOM 8694  H HH21 . ARG A 1 8  ? 24.905 -1.995  0.445   1.00 0.00 ? 8  ARG A HH21 13 
ATOM 8695  H HH22 . ARG A 1 8  ? 23.581 -1.215  1.248   1.00 0.00 ? 8  ARG A HH22 13 
ATOM 8696  N N    . LEU A 1 9  ? 30.989 2.917   -0.822  1.00 0.00 ? 9  LEU A N    13 
ATOM 8697  C CA   . LEU A 1 9  ? 32.238 2.929   -0.076  1.00 0.00 ? 9  LEU A CA   13 
ATOM 8698  C C    . LEU A 1 9  ? 32.816 4.362   -0.107  1.00 0.00 ? 9  LEU A C    13 
ATOM 8699  O O    . LEU A 1 9  ? 33.154 4.934   0.916   1.00 0.00 ? 9  LEU A O    13 
ATOM 8700  C CB   . LEU A 1 9  ? 33.196 1.903   -0.689  1.00 0.00 ? 9  LEU A CB   13 
ATOM 8701  C CG   . LEU A 1 9  ? 32.670 0.456   -0.715  1.00 0.00 ? 9  LEU A CG   13 
ATOM 8702  C CD1  . LEU A 1 9  ? 33.368 -0.294  -1.853  1.00 0.00 ? 9  LEU A CD1  13 
ATOM 8703  C CD2  . LEU A 1 9  ? 32.840 -0.277  0.608   1.00 0.00 ? 9  LEU A CD2  13 
ATOM 8704  H H    . LEU A 1 9  ? 30.918 2.298   -1.591  1.00 0.00 ? 9  LEU A H    13 
ATOM 8705  H HA   . LEU A 1 9  ? 32.022 2.599   0.936   1.00 0.00 ? 9  LEU A HA   13 
ATOM 8706  H HB2  . LEU A 1 9  ? 33.391 2.230   -1.708  1.00 0.00 ? 9  LEU A HB2  13 
ATOM 8707  H HB3  . LEU A 1 9  ? 34.152 1.906   -0.169  1.00 0.00 ? 9  LEU A HB3  13 
ATOM 8708  H HG   . LEU A 1 9  ? 31.596 0.451   -0.877  1.00 0.00 ? 9  LEU A HG   13 
ATOM 8709  H HD11 . LEU A 1 9  ? 33.441 0.313   -2.746  1.00 0.00 ? 9  LEU A HD11 13 
ATOM 8710  H HD12 . LEU A 1 9  ? 32.809 -1.167  -2.155  1.00 0.00 ? 9  LEU A HD12 13 
ATOM 8711  H HD13 . LEU A 1 9  ? 34.385 -0.580  -1.584  1.00 0.00 ? 9  LEU A HD13 13 
ATOM 8712  H HD21 . LEU A 1 9  ? 33.848 -0.670  0.672   1.00 0.00 ? 9  LEU A HD21 13 
ATOM 8713  H HD22 . LEU A 1 9  ? 32.152 -1.117  0.689   1.00 0.00 ? 9  LEU A HD22 13 
ATOM 8714  H HD23 . LEU A 1 9  ? 32.660 0.383   1.453   1.00 0.00 ? 9  LEU A HD23 13 
ATOM 8715  N N    . LYS A 1 10 ? 32.844 4.933   -1.332  1.00 0.00 ? 10 LYS A N    13 
ATOM 8716  C CA   . LYS A 1 10 ? 33.249 6.334   -1.471  1.00 0.00 ? 10 LYS A CA   13 
ATOM 8717  C C    . LYS A 1 10 ? 32.321 7.314   -0.717  1.00 0.00 ? 10 LYS A C    13 
ATOM 8718  O O    . LYS A 1 10 ? 32.775 8.319   -0.191  1.00 0.00 ? 10 LYS A O    13 
ATOM 8719  C CB   . LYS A 1 10 ? 33.236 6.744   -2.946  1.00 0.00 ? 10 LYS A CB   13 
ATOM 8720  C CG   . LYS A 1 10 ? 34.495 6.337   -3.708  1.00 0.00 ? 10 LYS A CG   13 
ATOM 8721  C CD   . LYS A 1 10 ? 34.524 6.824   -5.165  1.00 0.00 ? 10 LYS A CD   13 
ATOM 8722  C CE   . LYS A 1 10 ? 33.886 8.198   -5.367  1.00 0.00 ? 10 LYS A CE   13 
ATOM 8723  N NZ   . LYS A 1 10 ? 34.540 9.206   -4.534  1.00 0.00 ? 10 LYS A NZ   13 
ATOM 8724  H H    . LYS A 1 10 ? 32.538 4.402   -2.123  1.00 0.00 ? 10 LYS A H    13 
ATOM 8725  H HA   . LYS A 1 10 ? 34.254 6.439   -1.055  1.00 0.00 ? 10 LYS A HA   13 
ATOM 8726  H HB2  . LYS A 1 10 ? 32.347 6.372   -3.452  1.00 0.00 ? 10 LYS A HB2  13 
ATOM 8727  H HB3  . LYS A 1 10 ? 33.172 7.829   -2.978  1.00 0.00 ? 10 LYS A HB3  13 
ATOM 8728  H HG2  . LYS A 1 10 ? 35.337 6.759   -3.173  1.00 0.00 ? 10 LYS A HG2  13 
ATOM 8729  H HG3  . LYS A 1 10 ? 34.631 5.258   -3.681  1.00 0.00 ? 10 LYS A HG3  13 
ATOM 8730  H HD2  . LYS A 1 10 ? 35.560 6.904   -5.484  1.00 0.00 ? 10 LYS A HD2  13 
ATOM 8731  H HD3  . LYS A 1 10 ? 34.036 6.089   -5.808  1.00 0.00 ? 10 LYS A HD3  13 
ATOM 8732  H HE2  . LYS A 1 10 ? 33.972 8.516   -6.406  1.00 0.00 ? 10 LYS A HE2  13 
ATOM 8733  H HE3  . LYS A 1 10 ? 32.823 8.169   -5.114  1.00 0.00 ? 10 LYS A HE3  13 
ATOM 8734  H HZ1  . LYS A 1 10 ? 34.734 8.802   -3.595  1.00 0.00 ? 10 LYS A HZ1  13 
ATOM 8735  H HZ2  . LYS A 1 10 ? 33.918 10.032  -4.430  1.00 0.00 ? 10 LYS A HZ2  13 
ATOM 8736  H HZ3  . LYS A 1 10 ? 35.441 9.500   -4.960  1.00 0.00 ? 10 LYS A HZ3  13 
ATOM 8737  N N    . ALA A 1 11 ? 31.009 6.982   -0.726  1.00 0.00 ? 11 ALA A N    13 
ATOM 8738  C CA   . ALA A 1 11 ? 30.005 7.871   -0.137  1.00 0.00 ? 11 ALA A CA   13 
ATOM 8739  C C    . ALA A 1 11 ? 30.153 8.010   1.390   1.00 0.00 ? 11 ALA A C    13 
ATOM 8740  O O    . ALA A 1 11 ? 29.656 8.964   1.973   1.00 0.00 ? 11 ALA A O    13 
ATOM 8741  C CB   . ALA A 1 11 ? 28.588 7.394   -0.476  1.00 0.00 ? 11 ALA A CB   13 
ATOM 8742  H H    . ALA A 1 11 ? 30.725 6.134   -1.169  1.00 0.00 ? 11 ALA A H    13 
ATOM 8743  H HA   . ALA A 1 11 ? 30.157 8.856   -0.585  1.00 0.00 ? 11 ALA A HA   13 
ATOM 8744  H HB1  . ALA A 1 11 ? 28.345 7.631   -1.510  1.00 0.00 ? 11 ALA A HB1  13 
ATOM 8745  H HB2  . ALA A 1 11 ? 27.835 7.877   0.148   1.00 0.00 ? 11 ALA A HB2  13 
ATOM 8746  H HB3  . ALA A 1 11 ? 28.466 6.322   -0.344  1.00 0.00 ? 11 ALA A HB3  13 
ATOM 8747  N N    . LEU A 1 12 ? 30.872 7.038   1.996   1.00 0.00 ? 12 LEU A N    13 
ATOM 8748  C CA   . LEU A 1 12 ? 31.155 7.101   3.427   1.00 0.00 ? 12 LEU A CA   13 
ATOM 8749  C C    . LEU A 1 12 ? 32.294 8.114   3.752   1.00 0.00 ? 12 LEU A C    13 
ATOM 8750  O O    . LEU A 1 12 ? 32.702 8.226   4.900   1.00 0.00 ? 12 LEU A O    13 
ATOM 8751  C CB   . LEU A 1 12 ? 31.557 5.700   3.913   1.00 0.00 ? 12 LEU A CB   13 
ATOM 8752  C CG   . LEU A 1 12 ? 30.454 4.619   3.970   1.00 0.00 ? 12 LEU A CG   13 
ATOM 8753  C CD1  . LEU A 1 12 ? 30.624 3.602   2.842   1.00 0.00 ? 12 LEU A CD1  13 
ATOM 8754  C CD2  . LEU A 1 12 ? 30.495 3.848   5.293   1.00 0.00 ? 12 LEU A CD2  13 
ATOM 8755  H H    . LEU A 1 12 ? 31.252 6.279   1.467   1.00 0.00 ? 12 LEU A H    13 
ATOM 8756  H HA   . LEU A 1 12 ? 30.251 7.427   3.943   1.00 0.00 ? 12 LEU A HA   13 
ATOM 8757  H HB2  . LEU A 1 12 ? 32.343 5.367   3.247   1.00 0.00 ? 12 LEU A HB2  13 
ATOM 8758  H HB3  . LEU A 1 12 ? 31.998 5.788   4.901   1.00 0.00 ? 12 LEU A HB3  13 
ATOM 8759  H HG   . LEU A 1 12 ? 29.481 5.101   3.880   1.00 0.00 ? 12 LEU A HG   13 
ATOM 8760  H HD11 . LEU A 1 12 ? 31.109 4.097   2.015   1.00 0.00 ? 12 LEU A HD11 13 
ATOM 8761  H HD12 . LEU A 1 12 ? 29.670 3.194   2.511   1.00 0.00 ? 12 LEU A HD12 13 
ATOM 8762  H HD13 . LEU A 1 12 ? 31.275 2.769   3.117   1.00 0.00 ? 12 LEU A HD13 13 
ATOM 8763  H HD21 . LEU A 1 12 ? 31.366 3.199   5.310   1.00 0.00 ? 12 LEU A HD21 13 
ATOM 8764  H HD22 . LEU A 1 12 ? 29.629 3.196   5.400   1.00 0.00 ? 12 LEU A HD22 13 
ATOM 8765  H HD23 . LEU A 1 12 ? 30.555 4.515   6.152   1.00 0.00 ? 12 LEU A HD23 13 
ATOM 8766  N N    . GLY A 1 13 ? 32.770 8.838   2.706   1.00 0.00 ? 13 GLY A N    13 
ATOM 8767  C CA   . GLY A 1 13 ? 33.782 9.884   2.864   1.00 0.00 ? 13 GLY A CA   13 
ATOM 8768  C C    . GLY A 1 13 ? 35.194 9.402   2.498   1.00 0.00 ? 13 GLY A C    13 
ATOM 8769  O O    . GLY A 1 13 ? 36.183 9.910   3.015   1.00 0.00 ? 13 GLY A O    13 
ATOM 8770  H H    . GLY A 1 13 ? 32.393 8.690   1.794   1.00 0.00 ? 13 GLY A H    13 
ATOM 8771  H HA2  . GLY A 1 13 ? 33.499 10.708  2.208   1.00 0.00 ? 13 GLY A HA2  13 
ATOM 8772  H HA3  . GLY A 1 13 ? 33.773 10.240  3.896   1.00 0.00 ? 13 GLY A HA3  13 
ATOM 8773  N N    . PHE A 1 14 ? 35.218 8.382   1.602   1.00 0.00 ? 14 PHE A N    13 
ATOM 8774  C CA   . PHE A 1 14 ? 36.451 7.688   1.231   1.00 0.00 ? 14 PHE A CA   13 
ATOM 8775  C C    . PHE A 1 14 ? 36.819 8.065   -0.219  1.00 0.00 ? 14 PHE A C    13 
ATOM 8776  O O    . PHE A 1 14 ? 36.583 9.189   -0.650  1.00 0.00 ? 14 PHE A O    13 
ATOM 8777  C CB   . PHE A 1 14 ? 36.252 6.168   1.447   1.00 0.00 ? 14 PHE A CB   13 
ATOM 8778  C CG   . PHE A 1 14 ? 35.744 5.811   2.824   1.00 0.00 ? 14 PHE A CG   13 
ATOM 8779  C CD1  . PHE A 1 14 ? 35.959 6.634   3.932   1.00 0.00 ? 14 PHE A CD1  13 
ATOM 8780  C CD2  . PHE A 1 14 ? 34.997 4.651   2.995   1.00 0.00 ? 14 PHE A CD2  13 
ATOM 8781  C CE1  . PHE A 1 14 ? 35.346 6.363   5.141   1.00 0.00 ? 14 PHE A CE1  13 
ATOM 8782  C CE2  . PHE A 1 14 ? 34.387 4.374   4.207   1.00 0.00 ? 14 PHE A CE2  13 
ATOM 8783  C CZ   . PHE A 1 14 ? 34.536 5.255   5.271   1.00 0.00 ? 14 PHE A CZ   13 
ATOM 8784  H H    . PHE A 1 14 ? 34.362 8.046   1.215   1.00 0.00 ? 14 PHE A H    13 
ATOM 8785  H HA   . PHE A 1 14 ? 37.252 8.065   1.869   1.00 0.00 ? 14 PHE A HA   13 
ATOM 8786  H HB2  . PHE A 1 14 ? 35.533 5.806   0.707   1.00 0.00 ? 14 PHE A HB2  13 
ATOM 8787  H HB3  . PHE A 1 14 ? 37.169 5.612   1.288   1.00 0.00 ? 14 PHE A HB3  13 
ATOM 8788  H HD1  . PHE A 1 14 ? 36.592 7.509   3.885   1.00 0.00 ? 14 PHE A HD1  13 
ATOM 8789  H HD2  . PHE A 1 14 ? 34.885 3.949   2.177   1.00 0.00 ? 14 PHE A HD2  13 
ATOM 8790  H HE1  . PHE A 1 14 ? 35.484 7.019   5.985   1.00 0.00 ? 14 PHE A HE1  13 
ATOM 8791  H HE2  . PHE A 1 14 ? 33.774 3.487   4.293   1.00 0.00 ? 14 PHE A HE2  13 
ATOM 8792  H HZ   . PHE A 1 14 ? 34.017 5.112   6.208   1.00 0.00 ? 14 PHE A HZ   13 
ATOM 8793  N N    . GLU A 1 15 ? 37.411 7.082   -0.933  1.00 0.00 ? 15 GLU A N    13 
ATOM 8794  C CA   . GLU A 1 15 ? 37.894 7.287   -2.294  1.00 0.00 ? 15 GLU A CA   13 
ATOM 8795  C C    . GLU A 1 15 ? 38.023 5.921   -2.960  1.00 0.00 ? 15 GLU A C    13 
ATOM 8796  O O    . GLU A 1 15 ? 38.446 4.962   -2.327  1.00 0.00 ? 15 GLU A O    13 
ATOM 8797  C CB   . GLU A 1 15 ? 39.266 7.987   -2.297  1.00 0.00 ? 15 GLU A CB   13 
ATOM 8798  C CG   . GLU A 1 15 ? 39.540 8.742   -3.605  1.00 0.00 ? 15 GLU A CG   13 
ATOM 8799  C CD   . GLU A 1 15 ? 38.622 9.970   -3.777  1.00 0.00 ? 15 GLU A CD   13 
ATOM 8800  O OE1  . GLU A 1 15 ? 38.328 10.636  -2.785  1.00 0.00 ? 15 GLU A OE1  13 
ATOM 8801  O OE2  . GLU A 1 15 ? 38.212 10.247  -4.904  1.00 0.00 ? 15 GLU A OE2  13 
ATOM 8802  H H    . GLU A 1 15 ? 37.546 6.188   -0.507  1.00 0.00 ? 15 GLU A H    13 
ATOM 8803  H HA   . GLU A 1 15 ? 37.148 7.883   -2.821  1.00 0.00 ? 15 GLU A HA   13 
ATOM 8804  H HB2  . GLU A 1 15 ? 39.337 8.661   -1.445  1.00 0.00 ? 15 GLU A HB2  13 
ATOM 8805  H HB3  . GLU A 1 15 ? 40.083 7.281   -2.158  1.00 0.00 ? 15 GLU A HB3  13 
ATOM 8806  H HG2  . GLU A 1 15 ? 40.574 9.079   -3.624  1.00 0.00 ? 15 GLU A HG2  13 
ATOM 8807  H HG3  . GLU A 1 15 ? 39.432 8.072   -4.457  1.00 0.00 ? 15 GLU A HG3  13 
ATOM 8808  N N    . GLU A 1 16 ? 37.644 5.905   -4.256  1.00 0.00 ? 16 GLU A N    13 
ATOM 8809  C CA   . GLU A 1 16 ? 37.550 4.712   -5.102  1.00 0.00 ? 16 GLU A CA   13 
ATOM 8810  C C    . GLU A 1 16 ? 38.812 3.803   -5.065  1.00 0.00 ? 16 GLU A C    13 
ATOM 8811  O O    . GLU A 1 16 ? 38.742 2.633   -5.413  1.00 0.00 ? 16 GLU A O    13 
ATOM 8812  C CB   . GLU A 1 16 ? 37.187 5.144   -6.534  1.00 0.00 ? 16 GLU A CB   13 
ATOM 8813  C CG   . GLU A 1 16 ? 37.614 4.186   -7.658  1.00 0.00 ? 16 GLU A CG   13 
ATOM 8814  C CD   . GLU A 1 16 ? 37.119 4.630   -9.048  1.00 0.00 ? 16 GLU A CD   13 
ATOM 8815  O OE1  . GLU A 1 16 ? 36.230 5.479   -9.133  1.00 0.00 ? 16 GLU A OE1  13 
ATOM 8816  O OE2  . GLU A 1 16 ? 37.637 4.118   -10.040 1.00 0.00 ? 16 GLU A OE2  13 
ATOM 8817  H H    . GLU A 1 16 ? 37.336 6.775   -4.641  1.00 0.00 ? 16 GLU A H    13 
ATOM 8818  H HA   . GLU A 1 16 ? 36.687 4.172   -4.715  1.00 0.00 ? 16 GLU A HA   13 
ATOM 8819  H HB2  . GLU A 1 16 ? 36.103 5.240   -6.593  1.00 0.00 ? 16 GLU A HB2  13 
ATOM 8820  H HB3  . GLU A 1 16 ? 37.617 6.129   -6.717  1.00 0.00 ? 16 GLU A HB3  13 
ATOM 8821  H HG2  . GLU A 1 16 ? 38.700 4.138   -7.692  1.00 0.00 ? 16 GLU A HG2  13 
ATOM 8822  H HG3  . GLU A 1 16 ? 37.255 3.175   -7.466  1.00 0.00 ? 16 GLU A HG3  13 
ATOM 8823  N N    . SER A 1 17 ? 39.949 4.380   -4.630  1.00 0.00 ? 17 SER A N    13 
ATOM 8824  C CA   . SER A 1 17 ? 41.181 3.614   -4.528  1.00 0.00 ? 17 SER A CA   13 
ATOM 8825  C C    . SER A 1 17 ? 41.218 2.808   -3.224  1.00 0.00 ? 17 SER A C    13 
ATOM 8826  O O    . SER A 1 17 ? 41.409 1.603   -3.261  1.00 0.00 ? 17 SER A O    13 
ATOM 8827  C CB   . SER A 1 17 ? 42.366 4.587   -4.590  1.00 0.00 ? 17 SER A CB   13 
ATOM 8828  O OG   . SER A 1 17 ? 42.934 4.669   -5.882  1.00 0.00 ? 17 SER A OG   13 
ATOM 8829  H H    . SER A 1 17 ? 39.957 5.332   -4.329  1.00 0.00 ? 17 SER A H    13 
ATOM 8830  H HA   . SER A 1 17 ? 41.197 2.895   -5.355  1.00 0.00 ? 17 SER A HA   13 
ATOM 8831  H HB2  . SER A 1 17 ? 42.077 5.580   -4.236  1.00 0.00 ? 17 SER A HB2  13 
ATOM 8832  H HB3  . SER A 1 17 ? 43.165 4.270   -3.922  1.00 0.00 ? 17 SER A HB3  13 
ATOM 8833  H HG   . SER A 1 17 ? 42.261 4.885   -6.517  1.00 0.00 ? 17 SER A HG   13 
ATOM 8834  N N    . LEU A 1 18 ? 41.020 3.521   -2.083  1.00 0.00 ? 18 LEU A N    13 
ATOM 8835  C CA   . LEU A 1 18 ? 41.007 2.816   -0.794  1.00 0.00 ? 18 LEU A CA   13 
ATOM 8836  C C    . LEU A 1 18 ? 39.821 1.855   -0.706  1.00 0.00 ? 18 LEU A C    13 
ATOM 8837  O O    . LEU A 1 18 ? 39.843 0.903   0.070   1.00 0.00 ? 18 LEU A O    13 
ATOM 8838  C CB   . LEU A 1 18 ? 41.087 3.785   0.405   1.00 0.00 ? 18 LEU A CB   13 
ATOM 8839  C CG   . LEU A 1 18 ? 39.799 4.494   0.886   1.00 0.00 ? 18 LEU A CG   13 
ATOM 8840  C CD1  . LEU A 1 18 ? 39.514 4.234   2.372   1.00 0.00 ? 18 LEU A CD1  13 
ATOM 8841  C CD2  . LEU A 1 18 ? 39.890 6.001   0.654   1.00 0.00 ? 18 LEU A CD2  13 
ATOM 8842  H H    . LEU A 1 18 ? 40.828 4.499   -2.134  1.00 0.00 ? 18 LEU A H    13 
ATOM 8843  H HA   . LEU A 1 18 ? 41.909 2.206   -0.770  1.00 0.00 ? 18 LEU A HA   13 
ATOM 8844  H HB2  . LEU A 1 18 ? 41.483 3.217   1.239   1.00 0.00 ? 18 LEU A HB2  13 
ATOM 8845  H HB3  . LEU A 1 18 ? 41.863 4.518   0.202   1.00 0.00 ? 18 LEU A HB3  13 
ATOM 8846  H HG   . LEU A 1 18 ? 38.951 4.121   0.319   1.00 0.00 ? 18 LEU A HG   13 
ATOM 8847  H HD11 . LEU A 1 18 ? 39.560 3.173   2.616   1.00 0.00 ? 18 LEU A HD11 13 
ATOM 8848  H HD12 . LEU A 1 18 ? 38.525 4.605   2.640   1.00 0.00 ? 18 LEU A HD12 13 
ATOM 8849  H HD13 . LEU A 1 18 ? 40.240 4.741   3.005   1.00 0.00 ? 18 LEU A HD13 13 
ATOM 8850  H HD21 . LEU A 1 18 ? 40.802 6.414   1.080   1.00 0.00 ? 18 LEU A HD21 13 
ATOM 8851  H HD22 . LEU A 1 18 ? 39.061 6.544   1.104   1.00 0.00 ? 18 LEU A HD22 13 
ATOM 8852  H HD23 . LEU A 1 18 ? 39.908 6.191   -0.411  1.00 0.00 ? 18 LEU A HD23 13 
ATOM 8853  N N    . VAL A 1 19 ? 38.829 2.158   -1.551  1.00 0.00 ? 19 VAL A N    13 
ATOM 8854  C CA   . VAL A 1 19 ? 37.566 1.465   -1.731  1.00 0.00 ? 19 VAL A CA   13 
ATOM 8855  C C    . VAL A 1 19 ? 37.760 0.144   -2.469  1.00 0.00 ? 19 VAL A C    13 
ATOM 8856  O O    . VAL A 1 19 ? 37.400 -0.906  -1.969  1.00 0.00 ? 19 VAL A O    13 
ATOM 8857  C CB   . VAL A 1 19 ? 36.690 2.442   -2.518  1.00 0.00 ? 19 VAL A CB   13 
ATOM 8858  C CG1  . VAL A 1 19 ? 35.632 1.793   -3.403  1.00 0.00 ? 19 VAL A CG1  13 
ATOM 8859  C CG2  . VAL A 1 19 ? 36.121 3.576   -1.648  1.00 0.00 ? 19 VAL A CG2  13 
ATOM 8860  H H    . VAL A 1 19 ? 38.965 2.955   -2.147  1.00 0.00 ? 19 VAL A H    13 
ATOM 8861  H HA   . VAL A 1 19 ? 37.142 1.226   -0.764  1.00 0.00 ? 19 VAL A HA   13 
ATOM 8862  H HB   . VAL A 1 19 ? 37.383 2.910   -3.208  1.00 0.00 ? 19 VAL A HB   13 
ATOM 8863  H HG11 . VAL A 1 19 ? 36.023 1.699   -4.414  1.00 0.00 ? 19 VAL A HG11 13 
ATOM 8864  H HG12 . VAL A 1 19 ? 34.737 2.402   -3.434  1.00 0.00 ? 19 VAL A HG12 13 
ATOM 8865  H HG13 . VAL A 1 19 ? 35.354 0.799   -3.073  1.00 0.00 ? 19 VAL A HG13 13 
ATOM 8866  H HG21 . VAL A 1 19 ? 36.795 3.859   -0.844  1.00 0.00 ? 19 VAL A HG21 13 
ATOM 8867  H HG22 . VAL A 1 19 ? 35.169 3.359   -1.192  1.00 0.00 ? 19 VAL A HG22 13 
ATOM 8868  H HG23 . VAL A 1 19 ? 35.941 4.452   -2.258  1.00 0.00 ? 19 VAL A HG23 13 
ATOM 8869  N N    . ILE A 1 20 ? 38.321 0.273   -3.692  1.00 0.00 ? 20 ILE A N    13 
ATOM 8870  C CA   . ILE A 1 20 ? 38.534 -0.891  -4.541  1.00 0.00 ? 20 ILE A CA   13 
ATOM 8871  C C    . ILE A 1 20 ? 39.386 -1.923  -3.814  1.00 0.00 ? 20 ILE A C    13 
ATOM 8872  O O    . ILE A 1 20 ? 39.019 -3.080  -3.760  1.00 0.00 ? 20 ILE A O    13 
ATOM 8873  C CB   . ILE A 1 20 ? 39.150 -0.482  -5.897  1.00 0.00 ? 20 ILE A CB   13 
ATOM 8874  C CG1  . ILE A 1 20 ? 38.077 0.045   -6.862  1.00 0.00 ? 20 ILE A CG1  13 
ATOM 8875  C CG2  . ILE A 1 20 ? 39.954 -1.609  -6.571  1.00 0.00 ? 20 ILE A CG2  13 
ATOM 8876  C CD1  . ILE A 1 20 ? 37.194 -1.067  -7.454  1.00 0.00 ? 20 ILE A CD1  13 
ATOM 8877  H H    . ILE A 1 20 ? 38.573 1.177   -4.026  1.00 0.00 ? 20 ILE A H    13 
ATOM 8878  H HA   . ILE A 1 20 ? 37.558 -1.353  -4.683  1.00 0.00 ? 20 ILE A HA   13 
ATOM 8879  H HB   . ILE A 1 20 ? 39.846 0.335   -5.701  1.00 0.00 ? 20 ILE A HB   13 
ATOM 8880  H HG12 . ILE A 1 20 ? 37.471 0.789   -6.348  1.00 0.00 ? 20 ILE A HG12 13 
ATOM 8881  H HG13 . ILE A 1 20 ? 38.547 0.583   -7.686  1.00 0.00 ? 20 ILE A HG13 13 
ATOM 8882  H HG21 . ILE A 1 20 ? 40.226 -1.348  -7.591  1.00 0.00 ? 20 ILE A HG21 13 
ATOM 8883  H HG22 . ILE A 1 20 ? 39.387 -2.538  -6.607  1.00 0.00 ? 20 ILE A HG22 13 
ATOM 8884  H HG23 . ILE A 1 20 ? 40.877 -1.814  -6.031  1.00 0.00 ? 20 ILE A HG23 13 
ATOM 8885  H HD11 . ILE A 1 20 ? 37.757 -1.717  -8.124  1.00 0.00 ? 20 ILE A HD11 13 
ATOM 8886  H HD12 . ILE A 1 20 ? 36.386 -0.626  -8.034  1.00 0.00 ? 20 ILE A HD12 13 
ATOM 8887  H HD13 . ILE A 1 20 ? 36.759 -1.708  -6.688  1.00 0.00 ? 20 ILE A HD13 13 
ATOM 8888  N N    . GLN A 1 21 ? 40.507 -1.421  -3.256  1.00 0.00 ? 21 GLN A N    13 
ATOM 8889  C CA   . GLN A 1 21 ? 41.419 -2.249  -2.480  1.00 0.00 ? 21 GLN A CA   13 
ATOM 8890  C C    . GLN A 1 21 ? 40.787 -2.744  -1.162  1.00 0.00 ? 21 GLN A C    13 
ATOM 8891  O O    . GLN A 1 21 ? 41.150 -3.802  -0.677  1.00 0.00 ? 21 GLN A O    13 
ATOM 8892  C CB   . GLN A 1 21 ? 42.703 -1.449  -2.203  1.00 0.00 ? 21 GLN A CB   13 
ATOM 8893  C CG   . GLN A 1 21 ? 43.766 -1.621  -3.303  1.00 0.00 ? 21 GLN A CG   13 
ATOM 8894  C CD   . GLN A 1 21 ? 44.702 -2.779  -2.927  1.00 0.00 ? 21 GLN A CD   13 
ATOM 8895  O OE1  . GLN A 1 21 ? 45.471 -2.687  -1.981  1.00 0.00 ? 21 GLN A OE1  13 
ATOM 8896  N NE2  . GLN A 1 21 ? 44.558 -3.878  -3.686  1.00 0.00 ? 21 GLN A NE2  13 
ATOM 8897  H H    . GLN A 1 21 ? 40.710 -0.452  -3.382  1.00 0.00 ? 21 GLN A H    13 
ATOM 8898  H HA   . GLN A 1 21 ? 41.646 -3.124  -3.092  1.00 0.00 ? 21 GLN A HA   13 
ATOM 8899  H HB2  . GLN A 1 21 ? 42.454 -0.394  -2.112  1.00 0.00 ? 21 GLN A HB2  13 
ATOM 8900  H HB3  . GLN A 1 21 ? 43.127 -1.702  -1.229  1.00 0.00 ? 21 GLN A HB3  13 
ATOM 8901  H HG2  . GLN A 1 21 ? 43.316 -1.781  -4.285  1.00 0.00 ? 21 GLN A HG2  13 
ATOM 8902  H HG3  . GLN A 1 21 ? 44.376 -0.723  -3.390  1.00 0.00 ? 21 GLN A HG3  13 
ATOM 8903  H HE21 . GLN A 1 21 ? 44.014 -3.868  -4.524  1.00 0.00 ? 21 GLN A HE21 13 
ATOM 8904  H HE22 . GLN A 1 21 ? 45.004 -4.725  -3.406  1.00 0.00 ? 21 GLN A HE22 13 
ATOM 8905  N N    . ALA A 1 22 ? 39.831 -1.949  -0.627  1.00 0.00 ? 22 ALA A N    13 
ATOM 8906  C CA   . ALA A 1 22 ? 39.100 -2.359  0.575   1.00 0.00 ? 22 ALA A CA   13 
ATOM 8907  C C    . ALA A 1 22 ? 37.967 -3.343  0.285   1.00 0.00 ? 22 ALA A C    13 
ATOM 8908  O O    . ALA A 1 22 ? 37.414 -3.914  1.211   1.00 0.00 ? 22 ALA A O    13 
ATOM 8909  C CB   . ALA A 1 22 ? 38.405 -1.171  1.238   1.00 0.00 ? 22 ALA A CB   13 
ATOM 8910  H H    . ALA A 1 22 ? 39.590 -1.103  -1.100  1.00 0.00 ? 22 ALA A H    13 
ATOM 8911  H HA   . ALA A 1 22 ? 39.806 -2.838  1.255   1.00 0.00 ? 22 ALA A HA   13 
ATOM 8912  H HB1  . ALA A 1 22 ? 39.123 -0.474  1.651   1.00 0.00 ? 22 ALA A HB1  13 
ATOM 8913  H HB2  . ALA A 1 22 ? 37.785 -1.511  2.069   1.00 0.00 ? 22 ALA A HB2  13 
ATOM 8914  H HB3  . ALA A 1 22 ? 37.765 -0.621  0.546   1.00 0.00 ? 22 ALA A HB3  13 
ATOM 8915  N N    . TYR A 1 23 ? 37.634 -3.475  -1.016  1.00 0.00 ? 23 TYR A N    13 
ATOM 8916  C CA   . TYR A 1 23 ? 36.545 -4.347  -1.440  1.00 0.00 ? 23 TYR A CA   13 
ATOM 8917  C C    . TYR A 1 23 ? 37.124 -5.615  -2.078  1.00 0.00 ? 23 TYR A C    13 
ATOM 8918  O O    . TYR A 1 23 ? 36.484 -6.652  -2.073  1.00 0.00 ? 23 TYR A O    13 
ATOM 8919  C CB   . TYR A 1 23 ? 35.628 -3.595  -2.428  1.00 0.00 ? 23 TYR A CB   13 
ATOM 8920  C CG   . TYR A 1 23 ? 34.167 -3.910  -2.236  1.00 0.00 ? 23 TYR A CG   13 
ATOM 8921  C CD1  . TYR A 1 23 ? 33.484 -3.319  -1.186  1.00 0.00 ? 23 TYR A CD1  13 
ATOM 8922  C CD2  . TYR A 1 23 ? 33.482 -4.770  -3.085  1.00 0.00 ? 23 TYR A CD2  13 
ATOM 8923  C CE1  . TYR A 1 23 ? 32.136 -3.570  -0.974  1.00 0.00 ? 23 TYR A CE1  13 
ATOM 8924  C CE2  . TYR A 1 23 ? 32.132 -5.039  -2.882  1.00 0.00 ? 23 TYR A CE2  13 
ATOM 8925  C CZ   . TYR A 1 23 ? 31.461 -4.428  -1.828  1.00 0.00 ? 23 TYR A CZ   13 
ATOM 8926  O OH   . TYR A 1 23 ? 30.123 -4.675  -1.606  1.00 0.00 ? 23 TYR A OH   13 
ATOM 8927  H H    . TYR A 1 23 ? 38.133 -2.958  -1.711  1.00 0.00 ? 23 TYR A H    13 
ATOM 8928  H HA   . TYR A 1 23 ? 35.983 -4.641  -0.550  1.00 0.00 ? 23 TYR A HA   13 
ATOM 8929  H HB2  . TYR A 1 23 ? 35.720 -2.529  -2.245  1.00 0.00 ? 23 TYR A HB2  13 
ATOM 8930  H HB3  . TYR A 1 23 ? 35.924 -3.733  -3.470  1.00 0.00 ? 23 TYR A HB3  13 
ATOM 8931  H HD1  . TYR A 1 23 ? 34.020 -2.630  -0.554  1.00 0.00 ? 23 TYR A HD1  13 
ATOM 8932  H HD2  . TYR A 1 23 ? 34.012 -5.232  -3.900  1.00 0.00 ? 23 TYR A HD2  13 
ATOM 8933  H HE1  . TYR A 1 23 ? 31.614 -3.108  -0.146  1.00 0.00 ? 23 TYR A HE1  13 
ATOM 8934  H HE2  . TYR A 1 23 ? 31.616 -5.738  -3.528  1.00 0.00 ? 23 TYR A HE2  13 
ATOM 8935  H HH   . TYR A 1 23 ? 30.006 -5.583  -1.361  1.00 0.00 ? 23 TYR A HH   13 
ATOM 8936  N N    . PHE A 1 24 ? 38.357 -5.478  -2.614  1.00 0.00 ? 24 PHE A N    13 
ATOM 8937  C CA   . PHE A 1 24 ? 39.048 -6.561  -3.310  1.00 0.00 ? 24 PHE A CA   13 
ATOM 8938  C C    . PHE A 1 24 ? 39.835 -7.404  -2.291  1.00 0.00 ? 24 PHE A C    13 
ATOM 8939  O O    . PHE A 1 24 ? 39.840 -8.624  -2.346  1.00 0.00 ? 24 PHE A O    13 
ATOM 8940  C CB   . PHE A 1 24 ? 40.020 -5.993  -4.372  1.00 0.00 ? 24 PHE A CB   13 
ATOM 8941  C CG   . PHE A 1 24 ? 39.553 -6.199  -5.791  1.00 0.00 ? 24 PHE A CG   13 
ATOM 8942  C CD1  . PHE A 1 24 ? 38.558 -5.401  -6.352  1.00 0.00 ? 24 PHE A CD1  13 
ATOM 8943  C CD2  . PHE A 1 24 ? 40.122 -7.209  -6.562  1.00 0.00 ? 24 PHE A CD2  13 
ATOM 8944  C CE1  . PHE A 1 24 ? 38.137 -5.611  -7.660  1.00 0.00 ? 24 PHE A CE1  13 
ATOM 8945  C CE2  . PHE A 1 24 ? 39.707 -7.421  -7.870  1.00 0.00 ? 24 PHE A CE2  13 
ATOM 8946  C CZ   . PHE A 1 24 ? 38.712 -6.623  -8.414  1.00 0.00 ? 24 PHE A CZ   13 
ATOM 8947  H H    . PHE A 1 24 ? 38.854 -4.626  -2.463  1.00 0.00 ? 24 PHE A H    13 
ATOM 8948  H HA   . PHE A 1 24 ? 38.283 -7.194  -3.757  1.00 0.00 ? 24 PHE A HA   13 
ATOM 8949  H HB2  . PHE A 1 24 ? 40.199 -4.938  -4.203  1.00 0.00 ? 24 PHE A HB2  13 
ATOM 8950  H HB3  . PHE A 1 24 ? 41.005 -6.451  -4.276  1.00 0.00 ? 24 PHE A HB3  13 
ATOM 8951  H HD1  . PHE A 1 24 ? 38.095 -4.620  -5.768  1.00 0.00 ? 24 PHE A HD1  13 
ATOM 8952  H HD2  . PHE A 1 24 ? 40.882 -7.844  -6.133  1.00 0.00 ? 24 PHE A HD2  13 
ATOM 8953  H HE1  . PHE A 1 24 ? 37.358 -4.998  -8.096  1.00 0.00 ? 24 PHE A HE1  13 
ATOM 8954  H HE2  . PHE A 1 24 ? 40.155 -8.208  -8.460  1.00 0.00 ? 24 PHE A HE2  13 
ATOM 8955  H HZ   . PHE A 1 24 ? 38.379 -6.791  -9.425  1.00 0.00 ? 24 PHE A HZ   13 
ATOM 8956  N N    . ALA A 1 25 ? 40.494 -6.665  -1.366  1.00 0.00 ? 25 ALA A N    13 
ATOM 8957  C CA   . ALA A 1 25 ? 41.273 -7.296  -0.304  1.00 0.00 ? 25 ALA A CA   13 
ATOM 8958  C C    . ALA A 1 25 ? 40.354 -7.973  0.724   1.00 0.00 ? 25 ALA A C    13 
ATOM 8959  O O    . ALA A 1 25 ? 40.735 -8.934  1.377   1.00 0.00 ? 25 ALA A O    13 
ATOM 8960  C CB   . ALA A 1 25 ? 42.154 -6.256  0.397   1.00 0.00 ? 25 ALA A CB   13 
ATOM 8961  H H    . ALA A 1 25 ? 40.433 -5.670  -1.390  1.00 0.00 ? 25 ALA A H    13 
ATOM 8962  H HA   . ALA A 1 25 ? 41.906 -8.049  -0.776  1.00 0.00 ? 25 ALA A HA   13 
ATOM 8963  H HB1  . ALA A 1 25 ? 42.839 -6.725  1.103   1.00 0.00 ? 25 ALA A HB1  13 
ATOM 8964  H HB2  . ALA A 1 25 ? 41.561 -5.533  0.957   1.00 0.00 ? 25 ALA A HB2  13 
ATOM 8965  H HB3  . ALA A 1 25 ? 42.758 -5.713  -0.330  1.00 0.00 ? 25 ALA A HB3  13 
ATOM 8966  N N    . CYS A 1 26 ? 39.120 -7.424  0.797   1.00 0.00 ? 26 CYS A N    13 
ATOM 8967  C CA   . CYS A 1 26 ? 38.074 -8.008  1.629   1.00 0.00 ? 26 CYS A CA   13 
ATOM 8968  C C    . CYS A 1 26 ? 37.351 -9.179  0.936   1.00 0.00 ? 26 CYS A C    13 
ATOM 8969  O O    . CYS A 1 26 ? 36.372 -9.686  1.463   1.00 0.00 ? 26 CYS A O    13 
ATOM 8970  C CB   . CYS A 1 26 ? 37.044 -6.924  1.965   1.00 0.00 ? 26 CYS A CB   13 
ATOM 8971  S SG   . CYS A 1 26 ? 37.404 -6.184  3.578   1.00 0.00 ? 26 CYS A SG   13 
ATOM 8972  H H    . CYS A 1 26 ? 38.927 -6.601  0.263   1.00 0.00 ? 26 CYS A H    13 
ATOM 8973  H HA   . CYS A 1 26 ? 38.557 -8.370  2.539   1.00 0.00 ? 26 CYS A HA   13 
ATOM 8974  H HB2  . CYS A 1 26 ? 37.092 -6.163  1.195   1.00 0.00 ? 26 CYS A HB2  13 
ATOM 8975  H HB3  . CYS A 1 26 ? 36.009 -7.275  1.924   1.00 0.00 ? 26 CYS A HB3  13 
ATOM 8976  H HG   . CYS A 1 26 ? 37.198 -4.872  3.522   1.00 0.00 ? 26 CYS A HG   13 
ATOM 8977  N N    . GLU A 1 27 ? 37.839 -9.575  -0.264  1.00 0.00 ? 27 GLU A N    13 
ATOM 8978  C CA   . GLU A 1 27 ? 37.161 -10.625 -1.028  1.00 0.00 ? 27 GLU A CA   13 
ATOM 8979  C C    . GLU A 1 27 ? 35.671 -10.275 -1.261  1.00 0.00 ? 27 GLU A C    13 
ATOM 8980  O O    . GLU A 1 27 ? 34.772 -10.953 -0.787  1.00 0.00 ? 27 GLU A O    13 
ATOM 8981  C CB   . GLU A 1 27 ? 37.367 -11.995 -0.347  1.00 0.00 ? 27 GLU A CB   13 
ATOM 8982  C CG   . GLU A 1 27 ? 36.466 -13.127 -0.902  1.00 0.00 ? 27 GLU A CG   13 
ATOM 8983  C CD   . GLU A 1 27 ? 37.162 -14.483 -1.091  1.00 0.00 ? 27 GLU A CD   13 
ATOM 8984  O OE1  . GLU A 1 27 ? 38.133 -14.766 -0.391  1.00 0.00 ? 27 GLU A OE1  13 
ATOM 8985  O OE2  . GLU A 1 27 ? 36.718 -15.246 -1.951  1.00 0.00 ? 27 GLU A OE2  13 
ATOM 8986  H H    . GLU A 1 27 ? 38.674 -9.171  -0.635  1.00 0.00 ? 27 GLU A H    13 
ATOM 8987  H HA   . GLU A 1 27 ? 37.653 -10.644 -2.001  1.00 0.00 ? 27 GLU A HA   13 
ATOM 8988  H HB2  . GLU A 1 27 ? 38.429 -12.231 -0.424  1.00 0.00 ? 27 GLU A HB2  13 
ATOM 8989  H HB3  . GLU A 1 27 ? 37.178 -11.921 0.722   1.00 0.00 ? 27 GLU A HB3  13 
ATOM 8990  H HG2  . GLU A 1 27 ? 35.610 -13.261 -0.237  1.00 0.00 ? 27 GLU A HG2  13 
ATOM 8991  H HG3  . GLU A 1 27 ? 36.055 -12.855 -1.872  1.00 0.00 ? 27 GLU A HG3  13 
ATOM 8992  N N    . LYS A 1 28 ? 35.502 -9.166  -2.015  1.00 0.00 ? 28 LYS A N    13 
ATOM 8993  C CA   . LYS A 1 28 ? 34.225 -8.628  -2.489  1.00 0.00 ? 28 LYS A CA   13 
ATOM 8994  C C    . LYS A 1 28 ? 33.052 -8.922  -1.535  1.00 0.00 ? 28 LYS A C    13 
ATOM 8995  O O    . LYS A 1 28 ? 32.110 -9.630  -1.864  1.00 0.00 ? 28 LYS A O    13 
ATOM 8996  C CB   . LYS A 1 28 ? 33.988 -9.124  -3.929  1.00 0.00 ? 28 LYS A CB   13 
ATOM 8997  C CG   . LYS A 1 28 ? 34.487 -8.128  -4.981  1.00 0.00 ? 28 LYS A CG   13 
ATOM 8998  C CD   . LYS A 1 28 ? 36.014 -7.985  -5.003  1.00 0.00 ? 28 LYS A CD   13 
ATOM 8999  C CE   . LYS A 1 28 ? 36.644 -8.395  -6.333  1.00 0.00 ? 28 LYS A CE   13 
ATOM 9000  N NZ   . LYS A 1 28 ? 36.367 -9.774  -6.681  1.00 0.00 ? 28 LYS A NZ   13 
ATOM 9001  H H    . LYS A 1 28 ? 36.323 -8.696  -2.336  1.00 0.00 ? 28 LYS A H    13 
ATOM 9002  H HA   . LYS A 1 28 ? 34.347 -7.546  -2.493  1.00 0.00 ? 28 LYS A HA   13 
ATOM 9003  H HB2  . LYS A 1 28 ? 34.452 -10.101 -4.087  1.00 0.00 ? 28 LYS A HB2  13 
ATOM 9004  H HB3  . LYS A 1 28 ? 32.931 -9.273  -4.122  1.00 0.00 ? 28 LYS A HB3  13 
ATOM 9005  H HG2  . LYS A 1 28 ? 34.129 -8.433  -5.960  1.00 0.00 ? 28 LYS A HG2  13 
ATOM 9006  H HG3  . LYS A 1 28 ? 34.020 -7.158  -4.825  1.00 0.00 ? 28 LYS A HG3  13 
ATOM 9007  H HD2  . LYS A 1 28 ? 36.273 -6.957  -4.759  1.00 0.00 ? 28 LYS A HD2  13 
ATOM 9008  H HD3  . LYS A 1 28 ? 36.485 -8.575  -4.223  1.00 0.00 ? 28 LYS A HD3  13 
ATOM 9009  H HE2  . LYS A 1 28 ? 36.279 -7.798  -7.170  1.00 0.00 ? 28 LYS A HE2  13 
ATOM 9010  H HE3  . LYS A 1 28 ? 37.723 -8.314  -6.217  1.00 0.00 ? 28 LYS A HE3  13 
ATOM 9011  H HZ1  . LYS A 1 28 ? 36.977 -10.073 -7.467  1.00 0.00 ? 28 LYS A HZ1  13 
ATOM 9012  H HZ2  . LYS A 1 28 ? 35.372 -9.858  -6.975  1.00 0.00 ? 28 LYS A HZ2  13 
ATOM 9013  H HZ3  . LYS A 1 28 ? 36.563 -10.363 -5.848  1.00 0.00 ? 28 LYS A HZ3  13 
ATOM 9014  N N    . ASN A 1 29 ? 33.204 -8.339  -0.328  1.00 0.00 ? 29 ASN A N    13 
ATOM 9015  C CA   . ASN A 1 29 ? 32.242 -8.536  0.752   1.00 0.00 ? 29 ASN A CA   13 
ATOM 9016  C C    . ASN A 1 29 ? 31.556 -7.194  1.014   1.00 0.00 ? 29 ASN A C    13 
ATOM 9017  O O    . ASN A 1 29 ? 31.735 -6.260  0.247   1.00 0.00 ? 29 ASN A O    13 
ATOM 9018  C CB   . ASN A 1 29 ? 33.006 -9.063  1.986   1.00 0.00 ? 29 ASN A CB   13 
ATOM 9019  C CG   . ASN A 1 29 ? 32.597 -10.504 2.286   1.00 0.00 ? 29 ASN A CG   13 
ATOM 9020  O OD1  . ASN A 1 29 ? 33.238 -11.461 1.873   1.00 0.00 ? 29 ASN A OD1  13 
ATOM 9021  N ND2  . ASN A 1 29 ? 31.470 -10.574 3.019   1.00 0.00 ? 29 ASN A ND2  13 
ATOM 9022  H H    . ASN A 1 29 ? 34.009 -7.761  -0.187  1.00 0.00 ? 29 ASN A H    13 
ATOM 9023  H HA   . ASN A 1 29 ? 31.467 -9.228  0.401   1.00 0.00 ? 29 ASN A HA   13 
ATOM 9024  H HB2  . ASN A 1 29 ? 34.084 -9.033  1.829   1.00 0.00 ? 29 ASN A HB2  13 
ATOM 9025  H HB3  . ASN A 1 29 ? 32.820 -8.466  2.875   1.00 0.00 ? 29 ASN A HB3  13 
ATOM 9026  H HD21 . ASN A 1 29 ? 31.034 -9.730  3.336   1.00 0.00 ? 29 ASN A HD21 13 
ATOM 9027  H HD22 . ASN A 1 29 ? 31.056 -11.452 3.254   1.00 0.00 ? 29 ASN A HD22 13 
ATOM 9028  N N    . GLU A 1 30 ? 30.763 -7.142  2.104   1.00 0.00 ? 30 GLU A N    13 
ATOM 9029  C CA   . GLU A 1 30 ? 29.962 -5.954  2.395   1.00 0.00 ? 30 GLU A CA   13 
ATOM 9030  C C    . GLU A 1 30 ? 30.365 -5.371  3.745   1.00 0.00 ? 30 GLU A C    13 
ATOM 9031  O O    . GLU A 1 30 ? 31.012 -4.340  3.822   1.00 0.00 ? 30 GLU A O    13 
ATOM 9032  C CB   . GLU A 1 30 ? 28.469 -6.302  2.360   1.00 0.00 ? 30 GLU A CB   13 
ATOM 9033  C CG   . GLU A 1 30 ? 27.947 -6.489  0.933   1.00 0.00 ? 30 GLU A CG   13 
ATOM 9034  C CD   . GLU A 1 30 ? 26.426 -6.709  0.934   1.00 0.00 ? 30 GLU A CD   13 
ATOM 9035  O OE1  . GLU A 1 30 ? 25.700 -5.723  1.058   1.00 0.00 ? 30 GLU A OE1  13 
ATOM 9036  O OE2  . GLU A 1 30 ? 25.983 -7.851  0.809   1.00 0.00 ? 30 GLU A OE2  13 
ATOM 9037  H H    . GLU A 1 30 ? 30.741 -7.928  2.724   1.00 0.00 ? 30 GLU A H    13 
ATOM 9038  H HA   . GLU A 1 30 ? 30.184 -5.176  1.665   1.00 0.00 ? 30 GLU A HA   13 
ATOM 9039  H HB2  . GLU A 1 30 ? 28.283 -7.209  2.936   1.00 0.00 ? 30 GLU A HB2  13 
ATOM 9040  H HB3  . GLU A 1 30 ? 27.902 -5.505  2.844   1.00 0.00 ? 30 GLU A HB3  13 
ATOM 9041  H HG2  . GLU A 1 30 ? 28.160 -5.599  0.342   1.00 0.00 ? 30 GLU A HG2  13 
ATOM 9042  H HG3  . GLU A 1 30 ? 28.447 -7.328  0.450   1.00 0.00 ? 30 GLU A HG3  13 
ATOM 9043  N N    . ASN A 1 31 ? 29.939 -6.099  4.798   1.00 0.00 ? 31 ASN A N    13 
ATOM 9044  C CA   . ASN A 1 31 ? 30.246 -5.694  6.164   1.00 0.00 ? 31 ASN A CA   13 
ATOM 9045  C C    . ASN A 1 31 ? 31.760 -5.690  6.411   1.00 0.00 ? 31 ASN A C    13 
ATOM 9046  O O    . ASN A 1 31 ? 32.228 -5.034  7.327   1.00 0.00 ? 31 ASN A O    13 
ATOM 9047  C CB   . ASN A 1 31 ? 29.563 -6.672  7.151   1.00 0.00 ? 31 ASN A CB   13 
ATOM 9048  C CG   . ASN A 1 31 ? 28.558 -5.977  8.086   1.00 0.00 ? 31 ASN A CG   13 
ATOM 9049  O OD1  . ASN A 1 31 ? 28.533 -4.764  8.240   1.00 0.00 ? 31 ASN A OD1  13 
ATOM 9050  N ND2  . ASN A 1 31 ? 27.735 -6.845  8.702   1.00 0.00 ? 31 ASN A ND2  13 
ATOM 9051  H H    . ASN A 1 31 ? 29.404 -6.925  4.631   1.00 0.00 ? 31 ASN A H    13 
ATOM 9052  H HA   . ASN A 1 31 ? 29.889 -4.665  6.270   1.00 0.00 ? 31 ASN A HA   13 
ATOM 9053  H HB2  . ASN A 1 31 ? 29.047 -7.459  6.605   1.00 0.00 ? 31 ASN A HB2  13 
ATOM 9054  H HB3  . ASN A 1 31 ? 30.275 -7.209  7.780   1.00 0.00 ? 31 ASN A HB3  13 
ATOM 9055  H HD21 . ASN A 1 31 ? 27.817 -7.831  8.547   1.00 0.00 ? 31 ASN A HD21 13 
ATOM 9056  H HD22 . ASN A 1 31 ? 27.033 -6.503  9.324   1.00 0.00 ? 31 ASN A HD22 13 
ATOM 9057  N N    . LEU A 1 32 ? 32.477 -6.459  5.556   1.00 0.00 ? 32 LEU A N    13 
ATOM 9058  C CA   . LEU A 1 32 ? 33.920 -6.593  5.713   1.00 0.00 ? 32 LEU A CA   13 
ATOM 9059  C C    . LEU A 1 32 ? 34.619 -5.360  5.121   1.00 0.00 ? 32 LEU A C    13 
ATOM 9060  O O    . LEU A 1 32 ? 35.534 -4.806  5.705   1.00 0.00 ? 32 LEU A O    13 
ATOM 9061  C CB   . LEU A 1 32 ? 34.412 -7.858  4.980   1.00 0.00 ? 32 LEU A CB   13 
ATOM 9062  C CG   . LEU A 1 32 ? 35.550 -8.647  5.666   1.00 0.00 ? 32 LEU A CG   13 
ATOM 9063  C CD1  . LEU A 1 32 ? 36.409 -9.383  4.632   1.00 0.00 ? 32 LEU A CD1  13 
ATOM 9064  C CD2  . LEU A 1 32 ? 36.426 -7.830  6.624   1.00 0.00 ? 32 LEU A CD2  13 
ATOM 9065  H H    . LEU A 1 32 ? 32.008 -6.944  4.816   1.00 0.00 ? 32 LEU A H    13 
ATOM 9066  H HA   . LEU A 1 32 ? 34.108 -6.644  6.789   1.00 0.00 ? 32 LEU A HA   13 
ATOM 9067  H HB2  . LEU A 1 32 ? 33.582 -8.551  4.855   1.00 0.00 ? 32 LEU A HB2  13 
ATOM 9068  H HB3  . LEU A 1 32 ? 34.689 -7.613  3.953   1.00 0.00 ? 32 LEU A HB3  13 
ATOM 9069  H HG   . LEU A 1 32 ? 35.072 -9.412  6.276   1.00 0.00 ? 32 LEU A HG   13 
ATOM 9070  H HD11 . LEU A 1 32 ? 37.328 -8.842  4.410   1.00 0.00 ? 32 LEU A HD11 13 
ATOM 9071  H HD12 . LEU A 1 32 ? 35.858 -9.508  3.704   1.00 0.00 ? 32 LEU A HD12 13 
ATOM 9072  H HD13 . LEU A 1 32 ? 36.682 -10.376 4.988   1.00 0.00 ? 32 LEU A HD13 13 
ATOM 9073  H HD21 . LEU A 1 32 ? 37.296 -8.406  6.934   1.00 0.00 ? 32 LEU A HD21 13 
ATOM 9074  H HD22 . LEU A 1 32 ? 35.878 -7.567  7.528   1.00 0.00 ? 32 LEU A HD22 13 
ATOM 9075  H HD23 . LEU A 1 32 ? 36.795 -6.917  6.164   1.00 0.00 ? 32 LEU A HD23 13 
ATOM 9076  N N    . ALA A 1 33 ? 34.112 -4.982  3.923   1.00 0.00 ? 33 ALA A N    13 
ATOM 9077  C CA   . ALA A 1 33 ? 34.643 -3.829  3.211   1.00 0.00 ? 33 ALA A CA   13 
ATOM 9078  C C    . ALA A 1 33 ? 34.480 -2.540  4.012   1.00 0.00 ? 33 ALA A C    13 
ATOM 9079  O O    . ALA A 1 33 ? 35.418 -1.777  4.161   1.00 0.00 ? 33 ALA A O    13 
ATOM 9080  C CB   . ALA A 1 33 ? 33.934 -3.673  1.879   1.00 0.00 ? 33 ALA A CB   13 
ATOM 9081  H H    . ALA A 1 33 ? 33.355 -5.496  3.522   1.00 0.00 ? 33 ALA A H    13 
ATOM 9082  H HA   . ALA A 1 33 ? 35.706 -3.997  3.050   1.00 0.00 ? 33 ALA A HA   13 
ATOM 9083  H HB1  . ALA A 1 33 ? 34.212 -2.710  1.458   1.00 0.00 ? 33 ALA A HB1  13 
ATOM 9084  H HB2  . ALA A 1 33 ? 32.847 -3.717  1.970   1.00 0.00 ? 33 ALA A HB2  13 
ATOM 9085  H HB3  . ALA A 1 33 ? 34.249 -4.451  1.187   1.00 0.00 ? 33 ALA A HB3  13 
ATOM 9086  N N    . ALA A 1 34 ? 33.247 -2.364  4.534   1.00 0.00 ? 34 ALA A N    13 
ATOM 9087  C CA   . ALA A 1 34 ? 32.989 -1.237  5.421   1.00 0.00 ? 34 ALA A CA   13 
ATOM 9088  C C    . ALA A 1 34 ? 33.951 -1.276  6.616   1.00 0.00 ? 34 ALA A C    13 
ATOM 9089  O O    . ALA A 1 34 ? 34.611 -0.301  6.920   1.00 0.00 ? 34 ALA A O    13 
ATOM 9090  C CB   . ALA A 1 34 ? 31.533 -1.255  5.892   1.00 0.00 ? 34 ALA A CB   13 
ATOM 9091  H H    . ALA A 1 34 ? 32.534 -3.035  4.344   1.00 0.00 ? 34 ALA A H    13 
ATOM 9092  H HA   . ALA A 1 34 ? 33.182 -0.325  4.851   1.00 0.00 ? 34 ALA A HA   13 
ATOM 9093  H HB1  . ALA A 1 34 ? 31.297 -2.159  6.453   1.00 0.00 ? 34 ALA A HB1  13 
ATOM 9094  H HB2  . ALA A 1 34 ? 30.853 -1.207  5.043   1.00 0.00 ? 34 ALA A HB2  13 
ATOM 9095  H HB3  . ALA A 1 34 ? 31.322 -0.396  6.529   1.00 0.00 ? 34 ALA A HB3  13 
ATOM 9096  N N    . ASN A 1 35 ? 34.049 -2.464  7.246   1.00 0.00 ? 35 ASN A N    13 
ATOM 9097  C CA   . ASN A 1 35 ? 34.968 -2.577  8.380   1.00 0.00 ? 35 ASN A CA   13 
ATOM 9098  C C    . ASN A 1 35 ? 36.423 -2.206  8.006   1.00 0.00 ? 35 ASN A C    13 
ATOM 9099  O O    . ASN A 1 35 ? 37.147 -1.662  8.822   1.00 0.00 ? 35 ASN A O    13 
ATOM 9100  C CB   . ASN A 1 35 ? 34.937 -4.007  8.949   1.00 0.00 ? 35 ASN A CB   13 
ATOM 9101  C CG   . ASN A 1 35 ? 34.849 -3.984  10.478  1.00 0.00 ? 35 ASN A CG   13 
ATOM 9102  O OD1  . ASN A 1 35 ? 33.776 -4.106  11.053  1.00 0.00 ? 35 ASN A OD1  13 
ATOM 9103  N ND2  . ASN A 1 35 ? 36.033 -3.818  11.092  1.00 0.00 ? 35 ASN A ND2  13 
ATOM 9104  H H    . ASN A 1 35 ? 33.505 -3.241  6.931   1.00 0.00 ? 35 ASN A H    13 
ATOM 9105  H HA   . ASN A 1 35 ? 34.605 -1.845  9.111   1.00 0.00 ? 35 ASN A HA   13 
ATOM 9106  H HB2  . ASN A 1 35 ? 34.072 -4.548  8.588   1.00 0.00 ? 35 ASN A HB2  13 
ATOM 9107  H HB3  . ASN A 1 35 ? 35.796 -4.604  8.641   1.00 0.00 ? 35 ASN A HB3  13 
ATOM 9108  H HD21 . ASN A 1 35 ? 36.876 -3.702  10.564  1.00 0.00 ? 35 ASN A HD21 13 
ATOM 9109  H HD22 . ASN A 1 35 ? 36.072 -3.809  12.090  1.00 0.00 ? 35 ASN A HD22 13 
ATOM 9110  N N    . PHE A 1 36 ? 36.797 -2.511  6.742   1.00 0.00 ? 36 PHE A N    13 
ATOM 9111  C CA   . PHE A 1 36 ? 38.144 -2.212  6.251   1.00 0.00 ? 36 PHE A CA   13 
ATOM 9112  C C    . PHE A 1 36 ? 38.375 -0.685  6.182   1.00 0.00 ? 36 PHE A C    13 
ATOM 9113  O O    . PHE A 1 36 ? 39.405 -0.182  6.603   1.00 0.00 ? 36 PHE A O    13 
ATOM 9114  C CB   . PHE A 1 36 ? 38.346 -2.867  4.865   1.00 0.00 ? 36 PHE A CB   13 
ATOM 9115  C CG   . PHE A 1 36 ? 39.717 -2.653  4.252   1.00 0.00 ? 36 PHE A CG   13 
ATOM 9116  C CD1  . PHE A 1 36 ? 40.124 -1.391  3.820   1.00 0.00 ? 36 PHE A CD1  13 
ATOM 9117  C CD2  . PHE A 1 36 ? 40.588 -3.723  4.066   1.00 0.00 ? 36 PHE A CD2  13 
ATOM 9118  C CE1  . PHE A 1 36 ? 41.356 -1.191  3.221   1.00 0.00 ? 36 PHE A CE1  13 
ATOM 9119  C CE2  . PHE A 1 36 ? 41.827 -3.531  3.461   1.00 0.00 ? 36 PHE A CE2  13 
ATOM 9120  C CZ   . PHE A 1 36 ? 42.212 -2.265  3.037   1.00 0.00 ? 36 PHE A CZ   13 
ATOM 9121  H H    . PHE A 1 36 ? 36.120 -2.914  6.127   1.00 0.00 ? 36 PHE A H    13 
ATOM 9122  H HA   . PHE A 1 36 ? 38.844 -2.650  6.968   1.00 0.00 ? 36 PHE A HA   13 
ATOM 9123  H HB2  . PHE A 1 36 ? 38.148 -3.936  4.938   1.00 0.00 ? 36 PHE A HB2  13 
ATOM 9124  H HB3  . PHE A 1 36 ? 37.610 -2.502  4.156   1.00 0.00 ? 36 PHE A HB3  13 
ATOM 9125  H HD1  . PHE A 1 36 ? 39.475 -0.533  3.906   1.00 0.00 ? 36 PHE A HD1  13 
ATOM 9126  H HD2  . PHE A 1 36 ? 40.293 -4.718  4.366   1.00 0.00 ? 36 PHE A HD2  13 
ATOM 9127  H HE1  . PHE A 1 36 ? 41.629 -0.200  2.888   1.00 0.00 ? 36 PHE A HE1  13 
ATOM 9128  H HE2  . PHE A 1 36 ? 42.487 -4.371  3.301   1.00 0.00 ? 36 PHE A HE2  13 
ATOM 9129  H HZ   . PHE A 1 36 ? 43.165 -2.112  2.554   1.00 0.00 ? 36 PHE A HZ   13 
ATOM 9130  N N    . LEU A 1 37 ? 37.374 0.001   5.582   1.00 0.00 ? 37 LEU A N    13 
ATOM 9131  C CA   . LEU A 1 37 ? 37.519 1.411   5.248   1.00 0.00 ? 37 LEU A CA   13 
ATOM 9132  C C    . LEU A 1 37 ? 37.297 2.330   6.461   1.00 0.00 ? 37 LEU A C    13 
ATOM 9133  O O    . LEU A 1 37 ? 37.705 3.484   6.448   1.00 0.00 ? 37 LEU A O    13 
ATOM 9134  C CB   . LEU A 1 37 ? 36.486 1.803   4.195   1.00 0.00 ? 37 LEU A CB   13 
ATOM 9135  C CG   . LEU A 1 37 ? 36.663 1.152   2.816   1.00 0.00 ? 37 LEU A CG   13 
ATOM 9136  C CD1  . LEU A 1 37 ? 35.394 0.415   2.389   1.00 0.00 ? 37 LEU A CD1  13 
ATOM 9137  C CD2  . LEU A 1 37 ? 37.067 2.160   1.725   1.00 0.00 ? 37 LEU A CD2  13 
ATOM 9138  H H    . LEU A 1 37 ? 36.515 -0.451  5.356   1.00 0.00 ? 37 LEU A H    13 
ATOM 9139  H HA   . LEU A 1 37 ? 38.528 1.560   4.862   1.00 0.00 ? 37 LEU A HA   13 
ATOM 9140  H HB2  . LEU A 1 37 ? 35.489 1.600   4.571   1.00 0.00 ? 37 LEU A HB2  13 
ATOM 9141  H HB3  . LEU A 1 37 ? 36.547 2.876   4.110   1.00 0.00 ? 37 LEU A HB3  13 
ATOM 9142  H HG   . LEU A 1 37 ? 37.456 0.417   2.920   1.00 0.00 ? 37 LEU A HG   13 
ATOM 9143  H HD11 . LEU A 1 37 ? 35.639 -0.513  1.870   1.00 0.00 ? 37 LEU A HD11 13 
ATOM 9144  H HD12 . LEU A 1 37 ? 34.801 1.043   1.737   1.00 0.00 ? 37 LEU A HD12 13 
ATOM 9145  H HD13 . LEU A 1 37 ? 34.727 0.191   3.217   1.00 0.00 ? 37 LEU A HD13 13 
ATOM 9146  H HD21 . LEU A 1 37 ? 38.087 1.977   1.406   1.00 0.00 ? 37 LEU A HD21 13 
ATOM 9147  H HD22 . LEU A 1 37 ? 37.023 3.185   2.068   1.00 0.00 ? 37 LEU A HD22 13 
ATOM 9148  H HD23 . LEU A 1 37 ? 36.409 2.138   0.857   1.00 0.00 ? 37 LEU A HD23 13 
ATOM 9149  N N    . LEU A 1 38 ? 36.608 1.758   7.477   1.00 0.00 ? 38 LEU A N    13 
ATOM 9150  C CA   . LEU A 1 38 ? 36.287 2.507   8.688   1.00 0.00 ? 38 LEU A CA   13 
ATOM 9151  C C    . LEU A 1 38 ? 37.392 2.276   9.743   1.00 0.00 ? 38 LEU A C    13 
ATOM 9152  O O    . LEU A 1 38 ? 37.657 3.114   10.596  1.00 0.00 ? 38 LEU A O    13 
ATOM 9153  C CB   . LEU A 1 38 ? 34.893 2.127   9.256   1.00 0.00 ? 38 LEU A CB   13 
ATOM 9154  C CG   . LEU A 1 38 ? 33.669 2.110   8.294   1.00 0.00 ? 38 LEU A CG   13 
ATOM 9155  C CD1  . LEU A 1 38 ? 32.473 2.904   8.827   1.00 0.00 ? 38 LEU A CD1  13 
ATOM 9156  C CD2  . LEU A 1 38 ? 33.970 2.591   6.879   1.00 0.00 ? 38 LEU A CD2  13 
ATOM 9157  H H    . LEU A 1 38 ? 36.291 0.816   7.393   1.00 0.00 ? 38 LEU A H    13 
ATOM 9158  H HA   . LEU A 1 38 ? 36.297 3.562   8.417   1.00 0.00 ? 38 LEU A HA   13 
ATOM 9159  H HB2  . LEU A 1 38 ? 34.964 1.144   9.720   1.00 0.00 ? 38 LEU A HB2  13 
ATOM 9160  H HB3  . LEU A 1 38 ? 34.685 2.825   10.068  1.00 0.00 ? 38 LEU A HB3  13 
ATOM 9161  H HG   . LEU A 1 38 ? 33.305 1.085   8.242   1.00 0.00 ? 38 LEU A HG   13 
ATOM 9162  H HD11 . LEU A 1 38 ? 32.161 2.542   9.804   1.00 0.00 ? 38 LEU A HD11 13 
ATOM 9163  H HD12 . LEU A 1 38 ? 31.618 2.786   8.160   1.00 0.00 ? 38 LEU A HD12 13 
ATOM 9164  H HD13 . LEU A 1 38 ? 32.692 3.971   8.891   1.00 0.00 ? 38 LEU A HD13 13 
ATOM 9165  H HD21 . LEU A 1 38 ? 34.719 3.373   6.904   1.00 0.00 ? 38 LEU A HD21 13 
ATOM 9166  H HD22 . LEU A 1 38 ? 33.085 3.001   6.410   1.00 0.00 ? 38 LEU A HD22 13 
ATOM 9167  H HD23 . LEU A 1 38 ? 34.327 1.805   6.226   1.00 0.00 ? 38 LEU A HD23 13 
ATOM 9168  N N    . SER A 1 39 ? 38.020 1.081   9.604   1.00 0.00 ? 39 SER A N    13 
ATOM 9169  C CA   . SER A 1 39 ? 39.085 0.663   10.504  1.00 0.00 ? 39 SER A CA   13 
ATOM 9170  C C    . SER A 1 39 ? 40.432 1.258   10.092  1.00 0.00 ? 39 SER A C    13 
ATOM 9171  O O    . SER A 1 39 ? 41.195 1.684   10.946  1.00 0.00 ? 39 SER A O    13 
ATOM 9172  C CB   . SER A 1 39 ? 39.184 -0.866  10.573  1.00 0.00 ? 39 SER A CB   13 
ATOM 9173  O OG   . SER A 1 39 ? 40.151 -1.311  11.508  1.00 0.00 ? 39 SER A OG   13 
ATOM 9174  H H    . SER A 1 39 ? 37.779 0.463   8.860   1.00 0.00 ? 39 SER A H    13 
ATOM 9175  H HA   . SER A 1 39 ? 38.829 1.057   11.484  1.00 0.00 ? 39 SER A HA   13 
ATOM 9176  H HB2  . SER A 1 39 ? 38.222 -1.264  10.904  1.00 0.00 ? 39 SER A HB2  13 
ATOM 9177  H HB3  . SER A 1 39 ? 39.403 -1.297  9.589   1.00 0.00 ? 39 SER A HB3  13 
ATOM 9178  H HG   . SER A 1 39 ? 40.991 -0.901  11.329  1.00 0.00 ? 39 SER A HG   13 
ATOM 9179  N N    . GLN A 1 40 ? 40.653 1.268   8.753   1.00 0.00 ? 40 GLN A N    13 
ATOM 9180  C CA   . GLN A 1 40 ? 41.836 1.817   8.073   1.00 0.00 ? 40 GLN A CA   13 
ATOM 9181  C C    . GLN A 1 40 ? 43.137 1.548   8.858   1.00 0.00 ? 40 GLN A C    13 
ATOM 9182  O O    . GLN A 1 40 ? 43.515 2.318   9.731   1.00 0.00 ? 40 GLN A O    13 
ATOM 9183  C CB   . GLN A 1 40 ? 41.679 3.324   7.728   1.00 0.00 ? 40 GLN A CB   13 
ATOM 9184  C CG   . GLN A 1 40 ? 40.454 4.005   8.356   1.00 0.00 ? 40 GLN A CG   13 
ATOM 9185  C CD   . GLN A 1 40 ? 40.530 5.534   8.302   1.00 0.00 ? 40 GLN A CD   13 
ATOM 9186  O OE1  . GLN A 1 40 ? 40.844 6.151   7.292   1.00 0.00 ? 40 GLN A OE1  13 
ATOM 9187  N NE2  . GLN A 1 40 ? 40.217 6.085   9.491   1.00 0.00 ? 40 GLN A NE2  13 
ATOM 9188  H H    . GLN A 1 40 ? 39.912 0.910   8.191   1.00 0.00 ? 40 GLN A H    13 
ATOM 9189  H HA   . GLN A 1 40 ? 41.893 1.253   7.142   1.00 0.00 ? 40 GLN A HA   13 
ATOM 9190  H HB2  . GLN A 1 40 ? 42.575 3.881   8.000   1.00 0.00 ? 40 GLN A HB2  13 
ATOM 9191  H HB3  . GLN A 1 40 ? 41.625 3.439   6.646   1.00 0.00 ? 40 GLN A HB3  13 
ATOM 9192  H HG2  . GLN A 1 40 ? 39.549 3.679   7.853   1.00 0.00 ? 40 GLN A HG2  13 
ATOM 9193  H HG3  . GLN A 1 40 ? 40.362 3.734   9.405   1.00 0.00 ? 40 GLN A HG3  13 
ATOM 9194  H HE21 . GLN A 1 40 ? 39.972 5.501   10.268  1.00 0.00 ? 40 GLN A HE21 13 
ATOM 9195  H HE22 . GLN A 1 40 ? 40.220 7.072   9.625   1.00 0.00 ? 40 GLN A HE22 13 
ATOM 9196  N N    . ASN A 1 41 ? 43.790 0.418   8.495   1.00 0.00 ? 41 ASN A N    13 
ATOM 9197  C CA   . ASN A 1 41 ? 44.986 -0.007  9.228   1.00 0.00 ? 41 ASN A CA   13 
ATOM 9198  C C    . ASN A 1 41 ? 46.098 1.047   9.062   1.00 0.00 ? 41 ASN A C    13 
ATOM 9199  O O    . ASN A 1 41 ? 46.432 1.441   7.952   1.00 0.00 ? 41 ASN A O    13 
ATOM 9200  C CB   . ASN A 1 41 ? 45.524 -1.365  8.735   1.00 0.00 ? 41 ASN A CB   13 
ATOM 9201  C CG   . ASN A 1 41 ? 44.432 -2.299  8.199   1.00 0.00 ? 41 ASN A CG   13 
ATOM 9202  O OD1  . ASN A 1 41 ? 43.591 -2.801  8.931   1.00 0.00 ? 41 ASN A OD1  13 
ATOM 9203  N ND2  . ASN A 1 41 ? 44.518 -2.487  6.867   1.00 0.00 ? 41 ASN A ND2  13 
ATOM 9204  H H    . ASN A 1 41 ? 43.426 -0.136  7.746   1.00 0.00 ? 41 ASN A H    13 
ATOM 9205  H HA   . ASN A 1 41 ? 44.682 -0.088  10.276  1.00 0.00 ? 41 ASN A HA   13 
ATOM 9206  H HB2  . ASN A 1 41 ? 46.267 -1.233  7.946   1.00 0.00 ? 41 ASN A HB2  13 
ATOM 9207  H HB3  . ASN A 1 41 ? 46.031 -1.869  9.557   1.00 0.00 ? 41 ASN A HB3  13 
ATOM 9208  H HD21 . ASN A 1 41 ? 45.265 -2.052  6.360   1.00 0.00 ? 41 ASN A HD21 13 
ATOM 9209  H HD22 . ASN A 1 41 ? 43.858 -3.054  6.377   1.00 0.00 ? 41 ASN A HD22 13 
ATOM 9210  N N    . PHE A 1 42 ? 46.612 1.475   10.234  1.00 0.00 ? 42 PHE A N    13 
ATOM 9211  C CA   . PHE A 1 42 ? 47.610 2.536   10.292  1.00 0.00 ? 42 PHE A CA   13 
ATOM 9212  C C    . PHE A 1 42 ? 47.998 2.756   11.767  1.00 0.00 ? 42 PHE A C    13 
ATOM 9213  O O    . PHE A 1 42 ? 47.709 3.786   12.361  1.00 0.00 ? 42 PHE A O    13 
ATOM 9214  C CB   . PHE A 1 42 ? 47.061 3.843   9.660   1.00 0.00 ? 42 PHE A CB   13 
ATOM 9215  C CG   . PHE A 1 42 ? 47.995 5.027   9.759   1.00 0.00 ? 42 PHE A CG   13 
ATOM 9216  C CD1  . PHE A 1 42 ? 49.367 4.885   9.562   1.00 0.00 ? 42 PHE A CD1  13 
ATOM 9217  C CD2  . PHE A 1 42 ? 47.490 6.289   10.059  1.00 0.00 ? 42 PHE A CD2  13 
ATOM 9218  C CE1  . PHE A 1 42 ? 50.217 5.976   9.682   1.00 0.00 ? 42 PHE A CE1  13 
ATOM 9219  C CE2  . PHE A 1 42 ? 48.337 7.382   10.177  1.00 0.00 ? 42 PHE A CE2  13 
ATOM 9220  C CZ   . PHE A 1 42 ? 49.703 7.225   9.993   1.00 0.00 ? 42 PHE A CZ   13 
ATOM 9221  H H    . PHE A 1 42 ? 46.303 1.030   11.073  1.00 0.00 ? 42 PHE A H    13 
ATOM 9222  H HA   . PHE A 1 42 ? 48.475 2.157   9.747   1.00 0.00 ? 42 PHE A HA   13 
ATOM 9223  H HB2  . PHE A 1 42 ? 46.839 3.711   8.602   1.00 0.00 ? 42 PHE A HB2  13 
ATOM 9224  H HB3  . PHE A 1 42 ? 46.109 4.089   10.135  1.00 0.00 ? 42 PHE A HB3  13 
ATOM 9225  H HD1  . PHE A 1 42 ? 49.789 3.924   9.315   1.00 0.00 ? 42 PHE A HD1  13 
ATOM 9226  H HD2  . PHE A 1 42 ? 46.429 6.427   10.204  1.00 0.00 ? 42 PHE A HD2  13 
ATOM 9227  H HE1  . PHE A 1 42 ? 51.280 5.851   9.539   1.00 0.00 ? 42 PHE A HE1  13 
ATOM 9228  H HE2  . PHE A 1 42 ? 47.936 8.355   10.420  1.00 0.00 ? 42 PHE A HE2  13 
ATOM 9229  H HZ   . PHE A 1 42 ? 50.364 8.071   10.103  1.00 0.00 ? 42 PHE A HZ   13 
ATOM 9230  N N    . ASP A 1 43 ? 48.673 1.724   12.320  1.00 0.00 ? 43 ASP A N    13 
ATOM 9231  C CA   . ASP A 1 43 ? 49.151 1.858   13.693  1.00 0.00 ? 43 ASP A CA   13 
ATOM 9232  C C    . ASP A 1 43 ? 50.107 0.708   14.061  1.00 0.00 ? 43 ASP A C    13 
ATOM 9233  O O    . ASP A 1 43 ? 50.158 0.280   15.206  1.00 0.00 ? 43 ASP A O    13 
ATOM 9234  C CB   . ASP A 1 43 ? 47.947 1.925   14.680  1.00 0.00 ? 43 ASP A CB   13 
ATOM 9235  C CG   . ASP A 1 43 ? 48.112 3.069   15.701  1.00 0.00 ? 43 ASP A CG   13 
ATOM 9236  O OD1  . ASP A 1 43 ? 48.353 4.200   15.279  1.00 0.00 ? 43 ASP A OD1  13 
ATOM 9237  O OD2  . ASP A 1 43 ? 47.994 2.825   16.903  1.00 0.00 ? 43 ASP A OD2  13 
ATOM 9238  H H    . ASP A 1 43 ? 48.828 0.892   11.791  1.00 0.00 ? 43 ASP A H    13 
ATOM 9239  H HA   . ASP A 1 43 ? 49.748 2.775   13.695  1.00 0.00 ? 43 ASP A HA   13 
ATOM 9240  H HB2  . ASP A 1 43 ? 47.008 2.091   14.152  1.00 0.00 ? 43 ASP A HB2  13 
ATOM 9241  H HB3  . ASP A 1 43 ? 47.774 0.983   15.202  1.00 0.00 ? 43 ASP A HB3  13 
ATOM 9242  N N    . ASP A 1 44 ? 50.857 0.237   13.034  1.00 0.00 ? 44 ASP A N    13 
ATOM 9243  C CA   . ASP A 1 44 ? 51.817 -0.855  13.223  1.00 0.00 ? 44 ASP A CA   13 
ATOM 9244  C C    . ASP A 1 44 ? 51.096 -2.184  13.555  1.00 0.00 ? 44 ASP A C    13 
ATOM 9245  O O    . ASP A 1 44 ? 51.546 -2.955  14.393  1.00 0.00 ? 44 ASP A O    13 
ATOM 9246  C CB   . ASP A 1 44 ? 52.907 -0.469  14.279  1.00 0.00 ? 44 ASP A CB   13 
ATOM 9247  C CG   . ASP A 1 44 ? 54.338 -0.257  13.736  1.00 0.00 ? 44 ASP A CG   13 
ATOM 9248  O OD1  . ASP A 1 44 ? 54.525 -0.158  12.525  1.00 0.00 ? 44 ASP A OD1  13 
ATOM 9249  O OD2  . ASP A 1 44 ? 55.260 -0.181  14.551  1.00 0.00 ? 44 ASP A OD2  13 
ATOM 9250  H H    . ASP A 1 44 ? 50.756 0.632   12.123  1.00 0.00 ? 44 ASP A H    13 
ATOM 9251  H HA   . ASP A 1 44 ? 52.244 -1.008  12.231  1.00 0.00 ? 44 ASP A HA   13 
ATOM 9252  H HB2  . ASP A 1 44 ? 52.646 0.461   14.780  1.00 0.00 ? 44 ASP A HB2  13 
ATOM 9253  H HB3  . ASP A 1 44 ? 52.967 -1.190  15.093  1.00 0.00 ? 44 ASP A HB3  13 
ATOM 9254  N N    . GLU A 1 45 ? 49.969 -2.405  12.828  1.00 0.00 ? 45 GLU A N    13 
ATOM 9255  C CA   . GLU A 1 45 ? 49.167 -3.630  12.961  1.00 0.00 ? 45 GLU A CA   13 
ATOM 9256  C C    . GLU A 1 45 ? 50.042 -4.907  12.833  1.00 0.00 ? 45 GLU A C    13 
ATOM 9257  O O    . GLU A 1 45 ? 49.847 -5.844  13.608  1.00 0.00 ? 45 GLU A O    13 
ATOM 9258  C CB   . GLU A 1 45 ? 48.064 -3.635  11.879  1.00 0.00 ? 45 GLU A CB   13 
ATOM 9259  C CG   . GLU A 1 45 ? 47.200 -4.916  11.821  1.00 0.00 ? 45 GLU A CG   13 
ATOM 9260  C CD   . GLU A 1 45 ? 46.306 -5.141  13.061  1.00 0.00 ? 45 GLU A CD   13 
ATOM 9261  O OE1  . GLU A 1 45 ? 46.021 -4.183  13.779  1.00 0.00 ? 45 GLU A OE1  13 
ATOM 9262  O OE2  . GLU A 1 45 ? 45.898 -6.280  13.292  1.00 0.00 ? 45 GLU A OE2  13 
ATOM 9263  O OXT  . GLU A 1 45 ? 50.907 -4.944  11.958  1.00 0.00 ? 45 GLU A OXT  13 
ATOM 9264  H H    . GLU A 1 45 ? 49.687 -1.700  12.178  1.00 0.00 ? 45 GLU A H    13 
ATOM 9265  H HA   . GLU A 1 45 ? 48.716 -3.579  13.954  1.00 0.00 ? 45 GLU A HA   13 
ATOM 9266  H HB2  . GLU A 1 45 ? 47.426 -2.759  11.989  1.00 0.00 ? 45 GLU A HB2  13 
ATOM 9267  H HB3  . GLU A 1 45 ? 48.528 -3.505  10.903  1.00 0.00 ? 45 GLU A HB3  13 
ATOM 9268  H HG2  . GLU A 1 45 ? 46.559 -4.862  10.944  1.00 0.00 ? 45 GLU A HG2  13 
ATOM 9269  H HG3  . GLU A 1 45 ? 47.818 -5.800  11.660  1.00 0.00 ? 45 GLU A HG3  13 
ATOM 9270  N N    . GLN A 1 1  ? 31.604 -4.577  -12.014 1.00 0.00 ? 1  GLN A N    14 
ATOM 9271  C CA   . GLN A 1 1  ? 30.651 -5.448  -11.332 1.00 0.00 ? 1  GLN A CA   14 
ATOM 9272  C C    . GLN A 1 1  ? 30.330 -4.926  -9.920  1.00 0.00 ? 1  GLN A C    14 
ATOM 9273  O O    . GLN A 1 1  ? 29.186 -4.891  -9.487  1.00 0.00 ? 1  GLN A O    14 
ATOM 9274  C CB   . GLN A 1 1  ? 31.135 -6.912  -11.302 1.00 0.00 ? 1  GLN A CB   14 
ATOM 9275  C CG   . GLN A 1 1  ? 32.276 -7.176  -10.305 1.00 0.00 ? 1  GLN A CG   14 
ATOM 9276  C CD   . GLN A 1 1  ? 32.859 -8.591  -10.429 1.00 0.00 ? 1  GLN A CD   14 
ATOM 9277  O OE1  . GLN A 1 1  ? 32.732 -9.264  -11.443 1.00 0.00 ? 1  GLN A OE1  14 
ATOM 9278  N NE2  . GLN A 1 1  ? 33.501 -8.989  -9.313  1.00 0.00 ? 1  GLN A NE2  14 
ATOM 9279  H H1   . GLN A 1 1  ? 32.566 -4.840  -11.719 1.00 0.00 ? 1  GLN A H1   14 
ATOM 9280  H H2   . GLN A 1 1  ? 31.411 -3.590  -11.748 1.00 0.00 ? 1  GLN A H2   14 
ATOM 9281  H H3   . GLN A 1 1  ? 31.509 -4.685  -13.044 1.00 0.00 ? 1  GLN A H3   14 
ATOM 9282  H HA   . GLN A 1 1  ? 29.727 -5.404  -11.908 1.00 0.00 ? 1  GLN A HA   14 
ATOM 9283  H HB2  . GLN A 1 1  ? 30.295 -7.564  -11.059 1.00 0.00 ? 1  GLN A HB2  14 
ATOM 9284  H HB3  . GLN A 1 1  ? 31.463 -7.198  -12.301 1.00 0.00 ? 1  GLN A HB3  14 
ATOM 9285  H HG2  . GLN A 1 1  ? 33.084 -6.462  -10.454 1.00 0.00 ? 1  GLN A HG2  14 
ATOM 9286  H HG3  . GLN A 1 1  ? 31.916 -7.051  -9.285  1.00 0.00 ? 1  GLN A HG3  14 
ATOM 9287  H HE21 . GLN A 1 1  ? 33.603 -8.373  -8.531  1.00 0.00 ? 1  GLN A HE21 14 
ATOM 9288  H HE22 . GLN A 1 1  ? 33.884 -9.908  -9.246  1.00 0.00 ? 1  GLN A HE22 14 
ATOM 9289  N N    . GLU A 1 2  ? 31.430 -4.526  -9.249  1.00 0.00 ? 2  GLU A N    14 
ATOM 9290  C CA   . GLU A 1 2  ? 31.387 -4.049  -7.876  1.00 0.00 ? 2  GLU A CA   14 
ATOM 9291  C C    . GLU A 1 2  ? 31.288 -2.522  -7.810  1.00 0.00 ? 2  GLU A C    14 
ATOM 9292  O O    . GLU A 1 2  ? 31.324 -1.967  -6.722  1.00 0.00 ? 2  GLU A O    14 
ATOM 9293  C CB   . GLU A 1 2  ? 32.612 -4.573  -7.096  1.00 0.00 ? 2  GLU A CB   14 
ATOM 9294  C CG   . GLU A 1 2  ? 33.935 -3.823  -7.336  1.00 0.00 ? 2  GLU A CG   14 
ATOM 9295  C CD   . GLU A 1 2  ? 34.358 -3.854  -8.823  1.00 0.00 ? 2  GLU A CD   14 
ATOM 9296  O OE1  . GLU A 1 2  ? 34.963 -4.839  -9.246  1.00 0.00 ? 2  GLU A OE1  14 
ATOM 9297  O OE2  . GLU A 1 2  ? 34.072 -2.905  -9.548  1.00 0.00 ? 2  GLU A OE2  14 
ATOM 9298  H H    . GLU A 1 2  ? 32.312 -4.582  -9.713  1.00 0.00 ? 2  GLU A H    14 
ATOM 9299  H HA   . GLU A 1 2  ? 30.487 -4.449  -7.414  1.00 0.00 ? 2  GLU A HA   14 
ATOM 9300  H HB2  . GLU A 1 2  ? 32.396 -4.518  -6.030  1.00 0.00 ? 2  GLU A HB2  14 
ATOM 9301  H HB3  . GLU A 1 2  ? 32.746 -5.636  -7.300  1.00 0.00 ? 2  GLU A HB3  14 
ATOM 9302  H HG2  . GLU A 1 2  ? 33.862 -2.793  -6.980  1.00 0.00 ? 2  GLU A HG2  14 
ATOM 9303  H HG3  . GLU A 1 2  ? 34.711 -4.283  -6.725  1.00 0.00 ? 2  GLU A HG3  14 
ATOM 9304  N N    . LYS A 1 3  ? 31.166 -1.888  -9.008  1.00 0.00 ? 3  LYS A N    14 
ATOM 9305  C CA   . LYS A 1 3  ? 31.151 -0.429  -9.139  1.00 0.00 ? 3  LYS A CA   14 
ATOM 9306  C C    . LYS A 1 3  ? 30.051 0.266   -8.307  1.00 0.00 ? 3  LYS A C    14 
ATOM 9307  O O    . LYS A 1 3  ? 30.140 1.442   -7.984  1.00 0.00 ? 3  LYS A O    14 
ATOM 9308  C CB   . LYS A 1 3  ? 31.114 0.010   -10.604 1.00 0.00 ? 3  LYS A CB   14 
ATOM 9309  C CG   . LYS A 1 3  ? 29.827 -0.351  -11.353 1.00 0.00 ? 3  LYS A CG   14 
ATOM 9310  C CD   . LYS A 1 3  ? 29.909 -1.695  -12.081 1.00 0.00 ? 3  LYS A CD   14 
ATOM 9311  C CE   . LYS A 1 3  ? 28.757 -1.870  -13.072 1.00 0.00 ? 3  LYS A CE   14 
ATOM 9312  N NZ   . LYS A 1 3  ? 27.459 -1.666  -12.440 1.00 0.00 ? 3  LYS A NZ   14 
ATOM 9313  H H    . LYS A 1 3  ? 31.190 -2.429  -9.848  1.00 0.00 ? 3  LYS A H    14 
ATOM 9314  H HA   . LYS A 1 3  ? 32.104 -0.086  -8.774  1.00 0.00 ? 3  LYS A HA   14 
ATOM 9315  H HB2  . LYS A 1 3  ? 31.225 1.093   -10.622 1.00 0.00 ? 3  LYS A HB2  14 
ATOM 9316  H HB3  . LYS A 1 3  ? 31.995 -0.362  -11.132 1.00 0.00 ? 3  LYS A HB3  14 
ATOM 9317  H HG2  . LYS A 1 3  ? 28.965 -0.346  -10.684 1.00 0.00 ? 3  LYS A HG2  14 
ATOM 9318  H HG3  . LYS A 1 3  ? 29.637 0.432   -12.085 1.00 0.00 ? 3  LYS A HG3  14 
ATOM 9319  H HD2  . LYS A 1 3  ? 30.850 -1.761  -12.625 1.00 0.00 ? 3  LYS A HD2  14 
ATOM 9320  H HD3  . LYS A 1 3  ? 29.907 -2.513  -11.361 1.00 0.00 ? 3  LYS A HD3  14 
ATOM 9321  H HE2  . LYS A 1 3  ? 28.839 -1.161  -13.898 1.00 0.00 ? 3  LYS A HE2  14 
ATOM 9322  H HE3  . LYS A 1 3  ? 28.783 -2.875  -13.492 1.00 0.00 ? 3  LYS A HE3  14 
ATOM 9323  H HZ1  . LYS A 1 3  ? 27.409 -2.243  -11.576 1.00 0.00 ? 3  LYS A HZ1  14 
ATOM 9324  H HZ2  . LYS A 1 3  ? 26.695 -1.941  -13.090 1.00 0.00 ? 3  LYS A HZ2  14 
ATOM 9325  H HZ3  . LYS A 1 3  ? 27.357 -0.661  -12.189 1.00 0.00 ? 3  LYS A HZ3  14 
ATOM 9326  N N    . GLU A 1 4  ? 29.037 -0.554  -7.977  1.00 0.00 ? 4  GLU A N    14 
ATOM 9327  C CA   . GLU A 1 4  ? 27.913 -0.164  -7.142  1.00 0.00 ? 4  GLU A CA   14 
ATOM 9328  C C    . GLU A 1 4  ? 28.355 0.191   -5.724  1.00 0.00 ? 4  GLU A C    14 
ATOM 9329  O O    . GLU A 1 4  ? 27.931 1.183   -5.149  1.00 0.00 ? 4  GLU A O    14 
ATOM 9330  C CB   . GLU A 1 4  ? 26.956 -1.362  -7.112  1.00 0.00 ? 4  GLU A CB   14 
ATOM 9331  C CG   . GLU A 1 4  ? 25.823 -1.204  -8.133  1.00 0.00 ? 4  GLU A CG   14 
ATOM 9332  C CD   . GLU A 1 4  ? 24.542 -0.666  -7.467  1.00 0.00 ? 4  GLU A CD   14 
ATOM 9333  O OE1  . GLU A 1 4  ? 24.630 0.283   -6.686  1.00 0.00 ? 4  GLU A OE1  14 
ATOM 9334  O OE2  . GLU A 1 4  ? 23.470 -1.209  -7.732  1.00 0.00 ? 4  GLU A OE2  14 
ATOM 9335  H H    . GLU A 1 4  ? 29.093 -1.501  -8.288  1.00 0.00 ? 4  GLU A H    14 
ATOM 9336  H HA   . GLU A 1 4  ? 27.467 0.724   -7.591  1.00 0.00 ? 4  GLU A HA   14 
ATOM 9337  H HB2  . GLU A 1 4  ? 27.511 -2.274  -7.334  1.00 0.00 ? 4  GLU A HB2  14 
ATOM 9338  H HB3  . GLU A 1 4  ? 26.557 -1.541  -6.112  1.00 0.00 ? 4  GLU A HB3  14 
ATOM 9339  H HG2  . GLU A 1 4  ? 26.113 -0.542  -8.950  1.00 0.00 ? 4  GLU A HG2  14 
ATOM 9340  H HG3  . GLU A 1 4  ? 25.619 -2.169  -8.591  1.00 0.00 ? 4  GLU A HG3  14 
ATOM 9341  N N    . ALA A 1 5  ? 29.239 -0.679  -5.208  1.00 0.00 ? 5  ALA A N    14 
ATOM 9342  C CA   . ALA A 1 5  ? 29.800 -0.401  -3.906  1.00 0.00 ? 5  ALA A CA   14 
ATOM 9343  C C    . ALA A 1 5  ? 30.862 0.692   -3.981  1.00 0.00 ? 5  ALA A C    14 
ATOM 9344  O O    . ALA A 1 5  ? 31.228 1.234   -2.960  1.00 0.00 ? 5  ALA A O    14 
ATOM 9345  C CB   . ALA A 1 5  ? 30.370 -1.670  -3.298  1.00 0.00 ? 5  ALA A CB   14 
ATOM 9346  H H    . ALA A 1 5  ? 29.518 -1.490  -5.720  1.00 0.00 ? 5  ALA A H    14 
ATOM 9347  H HA   . ALA A 1 5  ? 28.993 -0.057  -3.263  1.00 0.00 ? 5  ALA A HA   14 
ATOM 9348  H HB1  . ALA A 1 5  ? 31.261 -2.013  -3.823  1.00 0.00 ? 5  ALA A HB1  14 
ATOM 9349  H HB2  . ALA A 1 5  ? 29.617 -2.453  -3.327  1.00 0.00 ? 5  ALA A HB2  14 
ATOM 9350  H HB3  . ALA A 1 5  ? 30.622 -1.498  -2.253  1.00 0.00 ? 5  ALA A HB3  14 
ATOM 9351  N N    . ILE A 1 6  ? 31.349 1.016   -5.196  1.00 0.00 ? 6  ILE A N    14 
ATOM 9352  C CA   . ILE A 1 6  ? 32.446 1.983   -5.252  1.00 0.00 ? 6  ILE A CA   14 
ATOM 9353  C C    . ILE A 1 6  ? 31.948 3.415   -5.036  1.00 0.00 ? 6  ILE A C    14 
ATOM 9354  O O    . ILE A 1 6  ? 32.709 4.280   -4.638  1.00 0.00 ? 6  ILE A O    14 
ATOM 9355  C CB   . ILE A 1 6  ? 33.287 1.853   -6.529  1.00 0.00 ? 6  ILE A CB   14 
ATOM 9356  C CG1  . ILE A 1 6  ? 33.676 0.392   -6.760  1.00 0.00 ? 6  ILE A CG1  14 
ATOM 9357  C CG2  . ILE A 1 6  ? 34.562 2.721   -6.510  1.00 0.00 ? 6  ILE A CG2  14 
ATOM 9358  C CD1  . ILE A 1 6  ? 34.472 0.223   -8.058  1.00 0.00 ? 6  ILE A CD1  14 
ATOM 9359  H H    . ILE A 1 6  ? 30.983 0.599   -6.028  1.00 0.00 ? 6  ILE A H    14 
ATOM 9360  H HA   . ILE A 1 6  ? 33.091 1.743   -4.418  1.00 0.00 ? 6  ILE A HA   14 
ATOM 9361  H HB   . ILE A 1 6  ? 32.668 2.188   -7.362  1.00 0.00 ? 6  ILE A HB   14 
ATOM 9362  H HG12 . ILE A 1 6  ? 34.246 -0.002  -5.915  1.00 0.00 ? 6  ILE A HG12 14 
ATOM 9363  H HG13 . ILE A 1 6  ? 32.776 -0.209  -6.795  1.00 0.00 ? 6  ILE A HG13 14 
ATOM 9364  H HG21 . ILE A 1 6  ? 35.457 2.112   -6.428  1.00 0.00 ? 6  ILE A HG21 14 
ATOM 9365  H HG22 . ILE A 1 6  ? 34.616 3.396   -5.661  1.00 0.00 ? 6  ILE A HG22 14 
ATOM 9366  H HG23 . ILE A 1 6  ? 34.649 3.293   -7.434  1.00 0.00 ? 6  ILE A HG23 14 
ATOM 9367  H HD11 . ILE A 1 6  ? 35.478 0.628   -7.974  1.00 0.00 ? 6  ILE A HD11 14 
ATOM 9368  H HD12 . ILE A 1 6  ? 34.025 0.737   -8.908  1.00 0.00 ? 6  ILE A HD12 14 
ATOM 9369  H HD13 . ILE A 1 6  ? 34.532 -0.834  -8.294  1.00 0.00 ? 6  ILE A HD13 14 
ATOM 9370  N N    . GLU A 1 7  ? 30.641 3.616   -5.284  1.00 0.00 ? 7  GLU A N    14 
ATOM 9371  C CA   . GLU A 1 7  ? 30.043 4.913   -4.991  1.00 0.00 ? 7  GLU A CA   14 
ATOM 9372  C C    . GLU A 1 7  ? 29.512 4.955   -3.546  1.00 0.00 ? 7  GLU A C    14 
ATOM 9373  O O    . GLU A 1 7  ? 29.229 6.018   -3.013  1.00 0.00 ? 7  GLU A O    14 
ATOM 9374  C CB   . GLU A 1 7  ? 28.927 5.206   -6.001  1.00 0.00 ? 7  GLU A CB   14 
ATOM 9375  C CG   . GLU A 1 7  ? 27.781 4.180   -5.974  1.00 0.00 ? 7  GLU A CG   14 
ATOM 9376  C CD   . GLU A 1 7  ? 26.491 4.670   -6.661  1.00 0.00 ? 7  GLU A CD   14 
ATOM 9377  O OE1  . GLU A 1 7  ? 26.479 5.768   -7.219  1.00 0.00 ? 7  GLU A OE1  14 
ATOM 9378  O OE2  . GLU A 1 7  ? 25.500 3.942   -6.622  1.00 0.00 ? 7  GLU A OE2  14 
ATOM 9379  H H    . GLU A 1 7  ? 30.068 2.848   -5.570  1.00 0.00 ? 7  GLU A H    14 
ATOM 9380  H HA   . GLU A 1 7  ? 30.809 5.687   -5.087  1.00 0.00 ? 7  GLU A HA   14 
ATOM 9381  H HB2  . GLU A 1 7  ? 28.544 6.206   -5.800  1.00 0.00 ? 7  GLU A HB2  14 
ATOM 9382  H HB3  . GLU A 1 7  ? 29.345 5.230   -7.009  1.00 0.00 ? 7  GLU A HB3  14 
ATOM 9383  H HG2  . GLU A 1 7  ? 28.106 3.257   -6.451  1.00 0.00 ? 7  GLU A HG2  14 
ATOM 9384  H HG3  . GLU A 1 7  ? 27.522 3.924   -4.949  1.00 0.00 ? 7  GLU A HG3  14 
ATOM 9385  N N    . ARG A 1 8  ? 29.389 3.743   -2.960  1.00 0.00 ? 8  ARG A N    14 
ATOM 9386  C CA   . ARG A 1 8  ? 28.833 3.594   -1.624  1.00 0.00 ? 8  ARG A CA   14 
ATOM 9387  C C    . ARG A 1 8  ? 29.936 3.788   -0.589  1.00 0.00 ? 8  ARG A C    14 
ATOM 9388  O O    . ARG A 1 8  ? 29.823 4.622   0.292   1.00 0.00 ? 8  ARG A O    14 
ATOM 9389  C CB   . ARG A 1 8  ? 28.186 2.205   -1.504  1.00 0.00 ? 8  ARG A CB   14 
ATOM 9390  C CG   . ARG A 1 8  ? 26.778 2.239   -0.895  1.00 0.00 ? 8  ARG A CG   14 
ATOM 9391  C CD   . ARG A 1 8  ? 25.724 1.555   -1.780  1.00 0.00 ? 8  ARG A CD   14 
ATOM 9392  N NE   . ARG A 1 8  ? 25.136 2.478   -2.751  1.00 0.00 ? 8  ARG A NE   14 
ATOM 9393  C CZ   . ARG A 1 8  ? 24.298 3.478   -2.380  1.00 0.00 ? 8  ARG A CZ   14 
ATOM 9394  N NH1  . ARG A 1 8  ? 24.012 3.700   -1.097  1.00 0.00 ? 8  ARG A NH1  14 
ATOM 9395  N NH2  . ARG A 1 8  ? 23.749 4.255   -3.307  1.00 0.00 ? 8  ARG A NH2  14 
ATOM 9396  H H    . ARG A 1 8  ? 29.679 2.914   -3.435  1.00 0.00 ? 8  ARG A H    14 
ATOM 9397  H HA   . ARG A 1 8  ? 28.097 4.389   -1.498  1.00 0.00 ? 8  ARG A HA   14 
ATOM 9398  H HB2  . ARG A 1 8  ? 28.146 1.762   -2.496  1.00 0.00 ? 8  ARG A HB2  14 
ATOM 9399  H HB3  . ARG A 1 8  ? 28.797 1.509   -0.926  1.00 0.00 ? 8  ARG A HB3  14 
ATOM 9400  H HG2  . ARG A 1 8  ? 26.803 1.737   0.071   1.00 0.00 ? 8  ARG A HG2  14 
ATOM 9401  H HG3  . ARG A 1 8  ? 26.477 3.257   -0.659  1.00 0.00 ? 8  ARG A HG3  14 
ATOM 9402  H HD2  . ARG A 1 8  ? 26.147 0.720   -2.341  1.00 0.00 ? 8  ARG A HD2  14 
ATOM 9403  H HD3  . ARG A 1 8  ? 24.915 1.151   -1.174  1.00 0.00 ? 8  ARG A HD3  14 
ATOM 9404  H HE   . ARG A 1 8  ? 25.331 2.350   -3.724  1.00 0.00 ? 8  ARG A HE   14 
ATOM 9405  H HH11 . ARG A 1 8  ? 24.425 3.121   -0.394  1.00 0.00 ? 8  ARG A HH11 14 
ATOM 9406  H HH12 . ARG A 1 8  ? 23.394 4.442   -0.833  1.00 0.00 ? 8  ARG A HH12 14 
ATOM 9407  H HH21 . ARG A 1 8  ? 23.941 4.097   -4.276  1.00 0.00 ? 8  ARG A HH21 14 
ATOM 9408  H HH22 . ARG A 1 8  ? 23.140 4.997   -3.026  1.00 0.00 ? 8  ARG A HH22 14 
ATOM 9409  N N    . LEU A 1 9  ? 30.999 2.979   -0.795  1.00 0.00 ? 9  LEU A N    14 
ATOM 9410  C CA   . LEU A 1 9  ? 32.261 2.998   -0.070  1.00 0.00 ? 9  LEU A CA   14 
ATOM 9411  C C    . LEU A 1 9  ? 32.851 4.425   -0.142  1.00 0.00 ? 9  LEU A C    14 
ATOM 9412  O O    . LEU A 1 9  ? 33.214 5.009   0.863   1.00 0.00 ? 9  LEU A O    14 
ATOM 9413  C CB   . LEU A 1 9  ? 33.208 1.943   -0.650  1.00 0.00 ? 9  LEU A CB   14 
ATOM 9414  C CG   . LEU A 1 9  ? 32.660 0.500   -0.637  1.00 0.00 ? 9  LEU A CG   14 
ATOM 9415  C CD1  . LEU A 1 9  ? 33.322 -0.282  -1.772  1.00 0.00 ? 9  LEU A CD1  14 
ATOM 9416  C CD2  . LEU A 1 9  ? 32.811 -0.230  0.697   1.00 0.00 ? 9  LEU A CD2  14 
ATOM 9417  H H    . LEU A 1 9  ? 30.907 2.320   -1.529  1.00 0.00 ? 9  LEU A H    14 
ATOM 9418  H HA   . LEU A 1 9  ? 32.062 2.691   0.952   1.00 0.00 ? 9  LEU A HA   14 
ATOM 9419  H HB2  . LEU A 1 9  ? 33.395 2.245   -1.678  1.00 0.00 ? 9  LEU A HB2  14 
ATOM 9420  H HB3  . LEU A 1 9  ? 34.170 1.956   -0.141  1.00 0.00 ? 9  LEU A HB3  14 
ATOM 9421  H HG   . LEU A 1 9  ? 31.586 0.511   -0.805  1.00 0.00 ? 9  LEU A HG   14 
ATOM 9422  H HD11 . LEU A 1 9  ? 33.379 0.305   -2.679  1.00 0.00 ? 9  LEU A HD11 14 
ATOM 9423  H HD12 . LEU A 1 9  ? 32.728 -1.139  -2.052  1.00 0.00 ? 9  LEU A HD12 14 
ATOM 9424  H HD13 . LEU A 1 9  ? 34.342 -0.580  -1.519  1.00 0.00 ? 9  LEU A HD13 14 
ATOM 9425  H HD21 . LEU A 1 9  ? 33.765 -0.749  0.750   1.00 0.00 ? 9  LEU A HD21 14 
ATOM 9426  H HD22 . LEU A 1 9  ? 32.027 -0.978  0.816   1.00 0.00 ? 9  LEU A HD22 14 
ATOM 9427  H HD23 . LEU A 1 9  ? 32.739 0.462   1.533   1.00 0.00 ? 9  LEU A HD23 14 
ATOM 9428  N N    . LYS A 1 10 ? 32.865 4.983   -1.375  1.00 0.00 ? 10 LYS A N    14 
ATOM 9429  C CA   . LYS A 1 10 ? 33.304 6.376   -1.514  1.00 0.00 ? 10 LYS A CA   14 
ATOM 9430  C C    . LYS A 1 10 ? 32.372 7.375   -0.797  1.00 0.00 ? 10 LYS A C    14 
ATOM 9431  O O    . LYS A 1 10 ? 32.826 8.396   -0.302  1.00 0.00 ? 10 LYS A O    14 
ATOM 9432  C CB   . LYS A 1 10 ? 33.346 6.801   -2.984  1.00 0.00 ? 10 LYS A CB   14 
ATOM 9433  C CG   . LYS A 1 10 ? 34.655 6.458   -3.687  1.00 0.00 ? 10 LYS A CG   14 
ATOM 9434  C CD   . LYS A 1 10 ? 34.919 7.414   -4.854  1.00 0.00 ? 10 LYS A CD   14 
ATOM 9435  C CE   . LYS A 1 10 ? 33.672 7.655   -5.709  1.00 0.00 ? 10 LYS A CE   14 
ATOM 9436  N NZ   . LYS A 1 10 ? 34.007 8.159   -7.032  1.00 0.00 ? 10 LYS A NZ   14 
ATOM 9437  H H    . LYS A 1 10 ? 32.539 4.449   -2.156  1.00 0.00 ? 10 LYS A H    14 
ATOM 9438  H HA   . LYS A 1 10 ? 34.297 6.458   -1.060  1.00 0.00 ? 10 LYS A HA   14 
ATOM 9439  H HB2  . LYS A 1 10 ? 32.490 6.410   -3.536  1.00 0.00 ? 10 LYS A HB2  14 
ATOM 9440  H HB3  . LYS A 1 10 ? 33.248 7.885   -3.035  1.00 0.00 ? 10 LYS A HB3  14 
ATOM 9441  H HG2  . LYS A 1 10 ? 35.469 6.542   -2.974  1.00 0.00 ? 10 LYS A HG2  14 
ATOM 9442  H HG3  . LYS A 1 10 ? 34.658 5.423   -4.022  1.00 0.00 ? 10 LYS A HG3  14 
ATOM 9443  H HD2  . LYS A 1 10 ? 35.286 8.368   -4.468  1.00 0.00 ? 10 LYS A HD2  14 
ATOM 9444  H HD3  . LYS A 1 10 ? 35.710 7.011   -5.478  1.00 0.00 ? 10 LYS A HD3  14 
ATOM 9445  H HE2  . LYS A 1 10 ? 33.103 6.733   -5.844  1.00 0.00 ? 10 LYS A HE2  14 
ATOM 9446  H HE3  . LYS A 1 10 ? 33.023 8.388   -5.225  1.00 0.00 ? 10 LYS A HE3  14 
ATOM 9447  H HZ1  . LYS A 1 10 ? 34.471 9.085   -6.943  1.00 0.00 ? 10 LYS A HZ1  14 
ATOM 9448  H HZ2  . LYS A 1 10 ? 33.143 8.258   -7.601  1.00 0.00 ? 10 LYS A HZ2  14 
ATOM 9449  H HZ3  . LYS A 1 10 ? 34.655 7.489   -7.493  1.00 0.00 ? 10 LYS A HZ3  14 
ATOM 9450  N N    . ALA A 1 11 ? 31.061 7.048   -0.794  1.00 0.00 ? 11 ALA A N    14 
ATOM 9451  C CA   . ALA A 1 11 ? 30.071 7.955   -0.210  1.00 0.00 ? 11 ALA A CA   14 
ATOM 9452  C C    . ALA A 1 11 ? 30.248 8.132   1.310   1.00 0.00 ? 11 ALA A C    14 
ATOM 9453  O O    . ALA A 1 11 ? 29.772 9.105   1.878   1.00 0.00 ? 11 ALA A O    14 
ATOM 9454  C CB   . ALA A 1 11 ? 28.645 7.477   -0.510  1.00 0.00 ? 11 ALA A CB   14 
ATOM 9455  H H    . ALA A 1 11 ? 30.767 6.190   -1.215  1.00 0.00 ? 11 ALA A H    14 
ATOM 9456  H HA   . ALA A 1 11 ? 30.216 8.929   -0.684  1.00 0.00 ? 11 ALA A HA   14 
ATOM 9457  H HB1  . ALA A 1 11 ? 28.373 7.719   -1.535  1.00 0.00 ? 11 ALA A HB1  14 
ATOM 9458  H HB2  . ALA A 1 11 ? 27.913 7.957   0.140   1.00 0.00 ? 11 ALA A HB2  14 
ATOM 9459  H HB3  . ALA A 1 11 ? 28.529 6.405   -0.384  1.00 0.00 ? 11 ALA A HB3  14 
ATOM 9460  N N    . LEU A 1 12 ? 30.970 7.169   1.927   1.00 0.00 ? 12 LEU A N    14 
ATOM 9461  C CA   . LEU A 1 12 ? 31.281 7.265   3.347   1.00 0.00 ? 12 LEU A CA   14 
ATOM 9462  C C    . LEU A 1 12 ? 32.435 8.274   3.627   1.00 0.00 ? 12 LEU A C    14 
ATOM 9463  O O    . LEU A 1 12 ? 32.872 8.405   4.763   1.00 0.00 ? 12 LEU A O    14 
ATOM 9464  C CB   . LEU A 1 12 ? 31.674 5.873   3.860   1.00 0.00 ? 12 LEU A CB   14 
ATOM 9465  C CG   . LEU A 1 12 ? 30.555 4.809   3.952   1.00 0.00 ? 12 LEU A CG   14 
ATOM 9466  C CD1  . LEU A 1 12 ? 30.691 3.776   2.836   1.00 0.00 ? 12 LEU A CD1  14 
ATOM 9467  C CD2  . LEU A 1 12 ? 30.600 4.055   5.282   1.00 0.00 ? 12 LEU A CD2  14 
ATOM 9468  H H    . LEU A 1 12 ? 31.338 6.398   1.409   1.00 0.00 ? 12 LEU A H    14 
ATOM 9469  H HA   . LEU A 1 12 ? 30.390 7.617   3.867   1.00 0.00 ? 12 LEU A HA   14 
ATOM 9470  H HB2  . LEU A 1 12 ? 32.457 5.517   3.201   1.00 0.00 ? 12 LEU A HB2  14 
ATOM 9471  H HB3  . LEU A 1 12 ? 32.121 5.985   4.841   1.00 0.00 ? 12 LEU A HB3  14 
ATOM 9472  H HG   . LEU A 1 12 ? 29.588 5.309   3.867   1.00 0.00 ? 12 LEU A HG   14 
ATOM 9473  H HD11 . LEU A 1 12 ? 31.190 4.258   2.010   1.00 0.00 ? 12 LEU A HD11 14 
ATOM 9474  H HD12 . LEU A 1 12 ? 29.721 3.403   2.508   1.00 0.00 ? 12 LEU A HD12 14 
ATOM 9475  H HD13 . LEU A 1 12 ? 31.315 2.921   3.110   1.00 0.00 ? 12 LEU A HD13 14 
ATOM 9476  H HD21 . LEU A 1 12 ? 31.396 3.315   5.266   1.00 0.00 ? 12 LEU A HD21 14 
ATOM 9477  H HD22 . LEU A 1 12 ? 29.680 3.499   5.444   1.00 0.00 ? 12 LEU A HD22 14 
ATOM 9478  H HD23 . LEU A 1 12 ? 30.775 4.725   6.124   1.00 0.00 ? 12 LEU A HD23 14 
ATOM 9479  N N    . GLY A 1 13 ? 32.894 8.972   2.559   1.00 0.00 ? 13 GLY A N    14 
ATOM 9480  C CA   . GLY A 1 13 ? 33.932 9.997   2.674   1.00 0.00 ? 13 GLY A CA   14 
ATOM 9481  C C    . GLY A 1 13 ? 35.325 9.459   2.326   1.00 0.00 ? 13 GLY A C    14 
ATOM 9482  O O    . GLY A 1 13 ? 36.328 9.948   2.830   1.00 0.00 ? 13 GLY A O    14 
ATOM 9483  H H    . GLY A 1 13 ? 32.490 8.816   1.661   1.00 0.00 ? 13 GLY A H    14 
ATOM 9484  H HA2  . GLY A 1 13 ? 33.675 10.799  1.981   1.00 0.00 ? 13 GLY A HA2  14 
ATOM 9485  H HA3  . GLY A 1 13 ? 33.932 10.394  3.690   1.00 0.00 ? 13 GLY A HA3  14 
ATOM 9486  N N    . PHE A 1 14 ? 35.321 8.414   1.464   1.00 0.00 ? 14 PHE A N    14 
ATOM 9487  C CA   . PHE A 1 14 ? 36.546 7.689   1.130   1.00 0.00 ? 14 PHE A CA   14 
ATOM 9488  C C    . PHE A 1 14 ? 36.940 8.050   -0.316  1.00 0.00 ? 14 PHE A C    14 
ATOM 9489  O O    . PHE A 1 14 ? 36.762 9.182   -0.745  1.00 0.00 ? 14 PHE A O    14 
ATOM 9490  C CB   . PHE A 1 14 ? 36.309 6.174   1.350   1.00 0.00 ? 14 PHE A CB   14 
ATOM 9491  C CG   . PHE A 1 14 ? 35.790 5.825   2.724   1.00 0.00 ? 14 PHE A CG   14 
ATOM 9492  C CD1  . PHE A 1 14 ? 35.983 6.663   3.825   1.00 0.00 ? 14 PHE A CD1  14 
ATOM 9493  C CD2  . PHE A 1 14 ? 35.058 4.653   2.897   1.00 0.00 ? 14 PHE A CD2  14 
ATOM 9494  C CE1  . PHE A 1 14 ? 35.373 6.387   5.035   1.00 0.00 ? 14 PHE A CE1  14 
ATOM 9495  C CE2  . PHE A 1 14 ? 34.450 4.375   4.110   1.00 0.00 ? 14 PHE A CE2  14 
ATOM 9496  C CZ   . PHE A 1 14 ? 34.588 5.263   5.173   1.00 0.00 ? 14 PHE A CZ   14 
ATOM 9497  H H    . PHE A 1 14 ? 34.455 8.088   1.087   1.00 0.00 ? 14 PHE A H    14 
ATOM 9498  H HA   . PHE A 1 14 ? 37.350 8.047   1.777   1.00 0.00 ? 14 PHE A HA   14 
ATOM 9499  H HB2  . PHE A 1 14 ? 35.594 5.820   0.606   1.00 0.00 ? 14 PHE A HB2  14 
ATOM 9500  H HB3  . PHE A 1 14 ? 37.212 5.598   1.196   1.00 0.00 ? 14 PHE A HB3  14 
ATOM 9501  H HD1  . PHE A 1 14 ? 36.587 7.557   3.766   1.00 0.00 ? 14 PHE A HD1  14 
ATOM 9502  H HD2  . PHE A 1 14 ? 34.949 3.951   2.076   1.00 0.00 ? 14 PHE A HD2  14 
ATOM 9503  H HE1  . PHE A 1 14 ? 35.485 7.061   5.870   1.00 0.00 ? 14 PHE A HE1  14 
ATOM 9504  H HE2  . PHE A 1 14 ? 33.845 3.484   4.201   1.00 0.00 ? 14 PHE A HE2  14 
ATOM 9505  H HZ   . PHE A 1 14 ? 34.067 5.121   6.109   1.00 0.00 ? 14 PHE A HZ   14 
ATOM 9506  N N    . GLU A 1 15 ? 37.486 7.039   -1.030  1.00 0.00 ? 15 GLU A N    14 
ATOM 9507  C CA   . GLU A 1 15 ? 37.984 7.239   -2.389  1.00 0.00 ? 15 GLU A CA   14 
ATOM 9508  C C    . GLU A 1 15 ? 38.090 5.871   -3.052  1.00 0.00 ? 15 GLU A C    14 
ATOM 9509  O O    . GLU A 1 15 ? 38.491 4.907   -2.423  1.00 0.00 ? 15 GLU A O    14 
ATOM 9510  C CB   . GLU A 1 15 ? 39.369 7.908   -2.385  1.00 0.00 ? 15 GLU A CB   14 
ATOM 9511  C CG   . GLU A 1 15 ? 39.691 8.617   -3.701  1.00 0.00 ? 15 GLU A CG   14 
ATOM 9512  C CD   . GLU A 1 15 ? 41.090 9.259   -3.638  1.00 0.00 ? 15 GLU A CD   14 
ATOM 9513  O OE1  . GLU A 1 15 ? 41.201 10.381  -3.143  1.00 0.00 ? 15 GLU A OE1  14 
ATOM 9514  O OE2  . GLU A 1 15 ? 42.052 8.631   -4.082  1.00 0.00 ? 15 GLU A OE2  14 
ATOM 9515  H H    . GLU A 1 15 ? 37.603 6.144   -0.601  1.00 0.00 ? 15 GLU A H    14 
ATOM 9516  H HA   . GLU A 1 15 ? 37.257 7.851   -2.926  1.00 0.00 ? 15 GLU A HA   14 
ATOM 9517  H HB2  . GLU A 1 15 ? 39.405 8.624   -1.568  1.00 0.00 ? 15 GLU A HB2  14 
ATOM 9518  H HB3  . GLU A 1 15 ? 40.172 7.196   -2.202  1.00 0.00 ? 15 GLU A HB3  14 
ATOM 9519  H HG2  . GLU A 1 15 ? 39.649 7.913   -4.531  1.00 0.00 ? 15 GLU A HG2  14 
ATOM 9520  H HG3  . GLU A 1 15 ? 38.946 9.385   -3.898  1.00 0.00 ? 15 GLU A HG3  14 
ATOM 9521  N N    . GLU A 1 16 ? 37.709 5.866   -4.346  1.00 0.00 ? 16 GLU A N    14 
ATOM 9522  C CA   . GLU A 1 16 ? 37.568 4.674   -5.183  1.00 0.00 ? 16 GLU A CA   14 
ATOM 9523  C C    . GLU A 1 16 ? 38.806 3.738   -5.154  1.00 0.00 ? 16 GLU A C    14 
ATOM 9524  O O    . GLU A 1 16 ? 38.705 2.563   -5.479  1.00 0.00 ? 16 GLU A O    14 
ATOM 9525  C CB   . GLU A 1 16 ? 37.213 5.115   -6.610  1.00 0.00 ? 16 GLU A CB   14 
ATOM 9526  C CG   . GLU A 1 16 ? 37.569 4.112   -7.721  1.00 0.00 ? 16 GLU A CG   14 
ATOM 9527  C CD   . GLU A 1 16 ? 36.994 4.511   -9.092  1.00 0.00 ? 16 GLU A CD   14 
ATOM 9528  O OE1  . GLU A 1 16 ? 36.882 5.705   -9.366  1.00 0.00 ? 16 GLU A OE1  14 
ATOM 9529  O OE2  . GLU A 1 16 ? 36.667 3.619   -9.874  1.00 0.00 ? 16 GLU A OE2  14 
ATOM 9530  H H    . GLU A 1 16 ? 37.432 6.746   -4.727  1.00 0.00 ? 16 GLU A H    14 
ATOM 9531  H HA   . GLU A 1 16 ? 36.694 4.153   -4.795  1.00 0.00 ? 16 GLU A HA   14 
ATOM 9532  H HB2  . GLU A 1 16 ? 36.140 5.309   -6.651  1.00 0.00 ? 16 GLU A HB2  14 
ATOM 9533  H HB3  . GLU A 1 16 ? 37.722 6.058   -6.805  1.00 0.00 ? 16 GLU A HB3  14 
ATOM 9534  H HG2  . GLU A 1 16 ? 38.652 4.048   -7.819  1.00 0.00 ? 16 GLU A HG2  14 
ATOM 9535  H HG3  . GLU A 1 16 ? 37.208 3.117   -7.465  1.00 0.00 ? 16 GLU A HG3  14 
ATOM 9536  N N    . SER A 1 17 ? 39.957 4.302   -4.745  1.00 0.00 ? 17 SER A N    14 
ATOM 9537  C CA   . SER A 1 17 ? 41.159 3.499   -4.611  1.00 0.00 ? 17 SER A CA   14 
ATOM 9538  C C    . SER A 1 17 ? 41.150 2.732   -3.283  1.00 0.00 ? 17 SER A C    14 
ATOM 9539  O O    . SER A 1 17 ? 41.241 1.516   -3.281  1.00 0.00 ? 17 SER A O    14 
ATOM 9540  C CB   . SER A 1 17 ? 42.368 4.428   -4.709  1.00 0.00 ? 17 SER A CB   14 
ATOM 9541  O OG   . SER A 1 17 ? 42.767 4.528   -6.067  1.00 0.00 ? 17 SER A OG   14 
ATOM 9542  H H    . SER A 1 17 ? 39.988 5.260   -4.458  1.00 0.00 ? 17 SER A H    14 
ATOM 9543  H HA   . SER A 1 17 ? 41.158 2.762   -5.421  1.00 0.00 ? 17 SER A HA   14 
ATOM 9544  H HB2  . SER A 1 17 ? 42.097 5.410   -4.311  1.00 0.00 ? 17 SER A HB2  14 
ATOM 9545  H HB3  . SER A 1 17 ? 43.195 4.058   -4.099  1.00 0.00 ? 17 SER A HB3  14 
ATOM 9546  H HG   . SER A 1 17 ? 43.489 5.142   -6.166  1.00 0.00 ? 17 SER A HG   14 
ATOM 9547  N N    . LEU A 1 18 ? 41.014 3.480   -2.158  1.00 0.00 ? 18 LEU A N    14 
ATOM 9548  C CA   . LEU A 1 18 ? 40.972 2.795   -0.860  1.00 0.00 ? 18 LEU A CA   14 
ATOM 9549  C C    . LEU A 1 18 ? 39.763 1.858   -0.749  1.00 0.00 ? 18 LEU A C    14 
ATOM 9550  O O    . LEU A 1 18 ? 39.758 0.939   0.045   1.00 0.00 ? 18 LEU A O    14 
ATOM 9551  C CB   . LEU A 1 18 ? 41.085 3.786   0.313   1.00 0.00 ? 18 LEU A CB   14 
ATOM 9552  C CG   . LEU A 1 18 ? 39.809 4.500   0.811   1.00 0.00 ? 18 LEU A CG   14 
ATOM 9553  C CD1  . LEU A 1 18 ? 39.532 4.212   2.294   1.00 0.00 ? 18 LEU A CD1  14 
ATOM 9554  C CD2  . LEU A 1 18 ? 39.929 6.014   0.625   1.00 0.00 ? 18 LEU A CD2  14 
ATOM 9555  H H    . LEU A 1 18 ? 40.887 4.468   -2.230  1.00 0.00 ? 18 LEU A H    14 
ATOM 9556  H HA   . LEU A 1 18 ? 41.853 2.153   -0.822  1.00 0.00 ? 18 LEU A HA   14 
ATOM 9557  H HB2  . LEU A 1 18 ? 41.519 3.248   1.148   1.00 0.00 ? 18 LEU A HB2  14 
ATOM 9558  H HB3  . LEU A 1 18 ? 41.846 4.517   0.056   1.00 0.00 ? 18 LEU A HB3  14 
ATOM 9559  H HG   . LEU A 1 18 ? 38.957 4.148   0.229   1.00 0.00 ? 18 LEU A HG   14 
ATOM 9560  H HD11 . LEU A 1 18 ? 39.611 3.150   2.529   1.00 0.00 ? 18 LEU A HD11 14 
ATOM 9561  H HD12 . LEU A 1 18 ? 38.538 4.564   2.557   1.00 0.00 ? 18 LEU A HD12 14 
ATOM 9562  H HD13 . LEU A 1 18 ? 40.225 4.744   2.945   1.00 0.00 ? 18 LEU A HD13 14 
ATOM 9563  H HD21 . LEU A 1 18 ? 40.841 6.408   1.071   1.00 0.00 ? 18 LEU A HD21 14 
ATOM 9564  H HD22 . LEU A 1 18 ? 39.104 6.555   1.085   1.00 0.00 ? 18 LEU A HD22 14 
ATOM 9565  H HD23 . LEU A 1 18 ? 39.956 6.228   -0.435  1.00 0.00 ? 18 LEU A HD23 14 
ATOM 9566  N N    . VAL A 1 19 ? 38.783 2.159   -1.622  1.00 0.00 ? 19 VAL A N    14 
ATOM 9567  C CA   . VAL A 1 19 ? 37.512 1.477   -1.776  1.00 0.00 ? 19 VAL A CA   14 
ATOM 9568  C C    . VAL A 1 19 ? 37.697 0.131   -2.458  1.00 0.00 ? 19 VAL A C    14 
ATOM 9569  O O    . VAL A 1 19 ? 37.367 -0.897  -1.891  1.00 0.00 ? 19 VAL A O    14 
ATOM 9570  C CB   . VAL A 1 19 ? 36.651 2.417   -2.616  1.00 0.00 ? 19 VAL A CB   14 
ATOM 9571  C CG1  . VAL A 1 19 ? 35.560 1.729   -3.426  1.00 0.00 ? 19 VAL A CG1  14 
ATOM 9572  C CG2  . VAL A 1 19 ? 36.100 3.597   -1.802  1.00 0.00 ? 19 VAL A CG2  14 
ATOM 9573  H H    . VAL A 1 19 ? 38.939 2.924   -2.246  1.00 0.00 ? 19 VAL A H    14 
ATOM 9574  H HA   . VAL A 1 19 ? 37.078 1.284   -0.803  1.00 0.00 ? 19 VAL A HA   14 
ATOM 9575  H HB   . VAL A 1 19 ? 37.343 2.826   -3.342  1.00 0.00 ? 19 VAL A HB   14 
ATOM 9576  H HG11 . VAL A 1 19 ? 35.899 1.548   -4.443  1.00 0.00 ? 19 VAL A HG11 14 
ATOM 9577  H HG12 . VAL A 1 19 ? 34.686 2.367   -3.447  1.00 0.00 ? 19 VAL A HG12 14 
ATOM 9578  H HG13 . VAL A 1 19 ? 35.293 0.762   -3.015  1.00 0.00 ? 19 VAL A HG13 14 
ATOM 9579  H HG21 . VAL A 1 19 ? 36.811 3.930   -1.049  1.00 0.00 ? 19 VAL A HG21 14 
ATOM 9580  H HG22 . VAL A 1 19 ? 35.172 3.400   -1.284  1.00 0.00 ? 19 VAL A HG22 14 
ATOM 9581  H HG23 . VAL A 1 19 ? 35.885 4.422   -2.470  1.00 0.00 ? 19 VAL A HG23 14 
ATOM 9582  N N    . ILE A 1 20 ? 38.209 0.204   -3.704  1.00 0.00 ? 20 ILE A N    14 
ATOM 9583  C CA   . ILE A 1 20 ? 38.423 -0.994  -4.501  1.00 0.00 ? 20 ILE A CA   14 
ATOM 9584  C C    . ILE A 1 20 ? 39.313 -1.965  -3.753  1.00 0.00 ? 20 ILE A C    14 
ATOM 9585  O O    . ILE A 1 20 ? 38.972 -3.126  -3.631  1.00 0.00 ? 20 ILE A O    14 
ATOM 9586  C CB   . ILE A 1 20 ? 39.018 -0.640  -5.874  1.00 0.00 ? 20 ILE A CB   14 
ATOM 9587  C CG1  . ILE A 1 20 ? 37.909 -0.191  -6.829  1.00 0.00 ? 20 ILE A CG1  14 
ATOM 9588  C CG2  . ILE A 1 20 ? 39.846 -1.776  -6.512  1.00 0.00 ? 20 ILE A CG2  14 
ATOM 9589  C CD1  . ILE A 1 20 ? 36.966 -1.340  -7.219  1.00 0.00 ? 20 ILE A CD1  14 
ATOM 9590  H H    . ILE A 1 20 ? 38.426 1.097   -4.094  1.00 0.00 ? 20 ILE A H    14 
ATOM 9591  H HA   . ILE A 1 20 ? 37.454 -1.478  -4.616  1.00 0.00 ? 20 ILE A HA   14 
ATOM 9592  H HB   . ILE A 1 20 ? 39.701 0.198   -5.732  1.00 0.00 ? 20 ILE A HB   14 
ATOM 9593  H HG12 . ILE A 1 20 ? 37.337 0.628   -6.389  1.00 0.00 ? 20 ILE A HG12 14 
ATOM 9594  H HG13 . ILE A 1 20 ? 38.362 0.222   -7.729  1.00 0.00 ? 20 ILE A HG13 14 
ATOM 9595  H HG21 . ILE A 1 20 ? 40.038 -1.572  -7.564  1.00 0.00 ? 20 ILE A HG21 14 
ATOM 9596  H HG22 . ILE A 1 20 ? 39.352 -2.746  -6.442  1.00 0.00 ? 20 ILE A HG22 14 
ATOM 9597  H HG23 . ILE A 1 20 ? 40.808 -1.887  -6.017  1.00 0.00 ? 20 ILE A HG23 14 
ATOM 9598  H HD11 . ILE A 1 20 ? 37.415 -2.329  -7.175  1.00 0.00 ? 20 ILE A HD11 14 
ATOM 9599  H HD12 . ILE A 1 20 ? 36.651 -1.216  -8.254  1.00 0.00 ? 20 ILE A HD12 14 
ATOM 9600  H HD13 . ILE A 1 20 ? 36.100 -1.359  -6.556  1.00 0.00 ? 20 ILE A HD13 14 
ATOM 9601  N N    . GLN A 1 21 ? 40.438 -1.413  -3.259  1.00 0.00 ? 21 GLN A N    14 
ATOM 9602  C CA   . GLN A 1 21 ? 41.388 -2.214  -2.504  1.00 0.00 ? 21 GLN A CA   14 
ATOM 9603  C C    . GLN A 1 21 ? 40.795 -2.711  -1.169  1.00 0.00 ? 21 GLN A C    14 
ATOM 9604  O O    . GLN A 1 21 ? 41.204 -3.740  -0.664  1.00 0.00 ? 21 GLN A O    14 
ATOM 9605  C CB   . GLN A 1 21 ? 42.682 -1.428  -2.250  1.00 0.00 ? 21 GLN A CB   14 
ATOM 9606  C CG   . GLN A 1 21 ? 43.319 -0.855  -3.533  1.00 0.00 ? 21 GLN A CG   14 
ATOM 9607  C CD   . GLN A 1 21 ? 44.844 -1.058  -3.567  1.00 0.00 ? 21 GLN A CD   14 
ATOM 9608  O OE1  . GLN A 1 21 ? 45.502 -1.244  -2.553  1.00 0.00 ? 21 GLN A OE1  14 
ATOM 9609  N NE2  . GLN A 1 21 ? 45.321 -1.154  -4.822  1.00 0.00 ? 21 GLN A NE2  14 
ATOM 9610  H H    . GLN A 1 21 ? 40.611 -0.447  -3.440  1.00 0.00 ? 21 GLN A H    14 
ATOM 9611  H HA   . GLN A 1 21 ? 41.618 -3.082  -3.124  1.00 0.00 ? 21 GLN A HA   14 
ATOM 9612  H HB2  . GLN A 1 21 ? 42.492 -0.617  -1.549  1.00 0.00 ? 21 GLN A HB2  14 
ATOM 9613  H HB3  . GLN A 1 21 ? 43.378 -2.099  -1.746  1.00 0.00 ? 21 GLN A HB3  14 
ATOM 9614  H HG2  . GLN A 1 21 ? 42.881 -1.321  -4.416  1.00 0.00 ? 21 GLN A HG2  14 
ATOM 9615  H HG3  . GLN A 1 21 ? 43.127 0.209   -3.628  1.00 0.00 ? 21 GLN A HG3  14 
ATOM 9616  H HE21 . GLN A 1 21 ? 45.201 -0.408  -5.476  1.00 0.00 ? 21 GLN A HE21 14 
ATOM 9617  H HE22 . GLN A 1 21 ? 45.773 -1.997  -5.113  1.00 0.00 ? 21 GLN A HE22 14 
ATOM 9618  N N    . ALA A 1 22 ? 39.811 -1.946  -0.642  1.00 0.00 ? 22 ALA A N    14 
ATOM 9619  C CA   . ALA A 1 22 ? 39.105 -2.363  0.570   1.00 0.00 ? 22 ALA A CA   14 
ATOM 9620  C C    . ALA A 1 22 ? 37.948 -3.324  0.292   1.00 0.00 ? 22 ALA A C    14 
ATOM 9621  O O    . ALA A 1 22 ? 37.396 -3.885  1.223   1.00 0.00 ? 22 ALA A O    14 
ATOM 9622  C CB   . ALA A 1 22 ? 38.453 -1.167  1.254   1.00 0.00 ? 22 ALA A CB   14 
ATOM 9623  H H    . ALA A 1 22 ? 39.516 -1.127  -1.132  1.00 0.00 ? 22 ALA A H    14 
ATOM 9624  H HA   . ALA A 1 22 ? 39.816 -2.858  1.237   1.00 0.00 ? 22 ALA A HA   14 
ATOM 9625  H HB1  . ALA A 1 22 ? 39.196 -0.484  1.645   1.00 0.00 ? 22 ALA A HB1  14 
ATOM 9626  H HB2  . ALA A 1 22 ? 37.866 -1.503  2.108   1.00 0.00 ? 22 ALA A HB2  14 
ATOM 9627  H HB3  . ALA A 1 22 ? 37.797 -0.604  0.588   1.00 0.00 ? 22 ALA A HB3  14 
ATOM 9628  N N    . TYR A 1 23 ? 37.590 -3.454  -0.999  1.00 0.00 ? 23 TYR A N    14 
ATOM 9629  C CA   . TYR A 1 23 ? 36.490 -4.317  -1.418  1.00 0.00 ? 23 TYR A CA   14 
ATOM 9630  C C    . TYR A 1 23 ? 37.058 -5.573  -2.092  1.00 0.00 ? 23 TYR A C    14 
ATOM 9631  O O    . TYR A 1 23 ? 36.353 -6.549  -2.242  1.00 0.00 ? 23 TYR A O    14 
ATOM 9632  C CB   . TYR A 1 23 ? 35.559 -3.541  -2.378  1.00 0.00 ? 23 TYR A CB   14 
ATOM 9633  C CG   . TYR A 1 23 ? 34.090 -3.837  -2.161  1.00 0.00 ? 23 TYR A CG   14 
ATOM 9634  C CD1  . TYR A 1 23 ? 33.438 -3.269  -1.079  1.00 0.00 ? 23 TYR A CD1  14 
ATOM 9635  C CD2  . TYR A 1 23 ? 33.364 -4.637  -3.028  1.00 0.00 ? 23 TYR A CD2  14 
ATOM 9636  C CE1  . TYR A 1 23 ? 32.095 -3.508  -0.836  1.00 0.00 ? 23 TYR A CE1  14 
ATOM 9637  C CE2  . TYR A 1 23 ? 32.014 -4.894  -2.798  1.00 0.00 ? 23 TYR A CE2  14 
ATOM 9638  C CZ   . TYR A 1 23 ? 31.374 -4.319  -1.699  1.00 0.00 ? 23 TYR A CZ   14 
ATOM 9639  O OH   . TYR A 1 23 ? 30.036 -4.501  -1.448  1.00 0.00 ? 23 TYR A OH   14 
ATOM 9640  H H    . TYR A 1 23 ? 38.097 -2.949  -1.695  1.00 0.00 ? 23 TYR A H    14 
ATOM 9641  H HA   . TYR A 1 23 ? 35.936 -4.636  -0.531  1.00 0.00 ? 23 TYR A HA   14 
ATOM 9642  H HB2  . TYR A 1 23 ? 35.665 -2.482  -2.175  1.00 0.00 ? 23 TYR A HB2  14 
ATOM 9643  H HB3  . TYR A 1 23 ? 35.833 -3.657  -3.427  1.00 0.00 ? 23 TYR A HB3  14 
ATOM 9644  H HD1  . TYR A 1 23 ? 33.964 -2.578  -0.441  1.00 0.00 ? 23 TYR A HD1  14 
ATOM 9645  H HD2  . TYR A 1 23 ? 33.844 -5.034  -3.907  1.00 0.00 ? 23 TYR A HD2  14 
ATOM 9646  H HE1  . TYR A 1 23 ? 31.595 -3.049  0.005   1.00 0.00 ? 23 TYR A HE1  14 
ATOM 9647  H HE2  . TYR A 1 23 ? 31.495 -5.528  -3.505  1.00 0.00 ? 23 TYR A HE2  14 
ATOM 9648  H HH   . TYR A 1 23 ? 29.579 -4.678  -2.259  1.00 0.00 ? 23 TYR A HH   14 
ATOM 9649  N N    . PHE A 1 24 ? 38.353 -5.499  -2.485  1.00 0.00 ? 24 PHE A N    14 
ATOM 9650  C CA   . PHE A 1 24 ? 39.044 -6.586  -3.180  1.00 0.00 ? 24 PHE A CA   14 
ATOM 9651  C C    . PHE A 1 24 ? 39.913 -7.352  -2.175  1.00 0.00 ? 24 PHE A C    14 
ATOM 9652  O O    . PHE A 1 24 ? 39.981 -8.573  -2.210  1.00 0.00 ? 24 PHE A O    14 
ATOM 9653  C CB   . PHE A 1 24 ? 39.935 -6.034  -4.318  1.00 0.00 ? 24 PHE A CB   14 
ATOM 9654  C CG   . PHE A 1 24 ? 39.400 -6.314  -5.699  1.00 0.00 ? 24 PHE A CG   14 
ATOM 9655  C CD1  . PHE A 1 24 ? 38.308 -5.618  -6.202  1.00 0.00 ? 24 PHE A CD1  14 
ATOM 9656  C CD2  . PHE A 1 24 ? 39.997 -7.291  -6.488  1.00 0.00 ? 24 PHE A CD2  14 
ATOM 9657  C CE1  . PHE A 1 24 ? 37.823 -5.897  -7.475  1.00 0.00 ? 24 PHE A CE1  14 
ATOM 9658  C CE2  . PHE A 1 24 ? 39.519 -7.576  -7.760  1.00 0.00 ? 24 PHE A CE2  14 
ATOM 9659  C CZ   . PHE A 1 24 ? 38.428 -6.877  -8.251  1.00 0.00 ? 24 PHE A CZ   14 
ATOM 9660  H H    . PHE A 1 24 ? 38.881 -4.679  -2.274  1.00 0.00 ? 24 PHE A H    14 
ATOM 9661  H HA   . PHE A 1 24 ? 38.304 -7.287  -3.564  1.00 0.00 ? 24 PHE A HA   14 
ATOM 9662  H HB2  . PHE A 1 24 ? 40.068 -4.965  -4.221  1.00 0.00 ? 24 PHE A HB2  14 
ATOM 9663  H HB3  . PHE A 1 24 ? 40.941 -6.450  -4.251  1.00 0.00 ? 24 PHE A HB3  14 
ATOM 9664  H HD1  . PHE A 1 24 ? 37.812 -4.873  -5.599  1.00 0.00 ? 24 PHE A HD1  14 
ATOM 9665  H HD2  . PHE A 1 24 ? 40.822 -7.858  -6.093  1.00 0.00 ? 24 PHE A HD2  14 
ATOM 9666  H HE1  . PHE A 1 24 ? 36.967 -5.363  -7.852  1.00 0.00 ? 24 PHE A HE1  14 
ATOM 9667  H HE2  . PHE A 1 24 ? 39.979 -8.359  -8.347  1.00 0.00 ? 24 PHE A HE2  14 
ATOM 9668  H HZ   . PHE A 1 24 ? 38.036 -7.114  -9.227  1.00 0.00 ? 24 PHE A HZ   14 
ATOM 9669  N N    . ALA A 1 25 ? 40.570 -6.568  -1.287  1.00 0.00 ? 25 ALA A N    14 
ATOM 9670  C CA   . ALA A 1 25 ? 41.409 -7.149  -0.240  1.00 0.00 ? 25 ALA A CA   14 
ATOM 9671  C C    . ALA A 1 25 ? 40.551 -7.834  0.834   1.00 0.00 ? 25 ALA A C    14 
ATOM 9672  O O    . ALA A 1 25 ? 40.993 -8.758  1.500   1.00 0.00 ? 25 ALA A O    14 
ATOM 9673  C CB   . ALA A 1 25 ? 42.291 -6.078  0.412   1.00 0.00 ? 25 ALA A CB   14 
ATOM 9674  H H    . ALA A 1 25 ? 40.469 -5.576  -1.334  1.00 0.00 ? 25 ALA A H    14 
ATOM 9675  H HA   . ALA A 1 25 ? 42.047 -7.894  -0.719  1.00 0.00 ? 25 ALA A HA   14 
ATOM 9676  H HB1  . ALA A 1 25 ? 43.016 -6.526  1.091   1.00 0.00 ? 25 ALA A HB1  14 
ATOM 9677  H HB2  . ALA A 1 25 ? 41.705 -5.363  0.994   1.00 0.00 ? 25 ALA A HB2  14 
ATOM 9678  H HB3  . ALA A 1 25 ? 42.858 -5.536  -0.346  1.00 0.00 ? 25 ALA A HB3  14 
ATOM 9679  N N    . CYS A 1 26 ? 39.297 -7.338  0.937   1.00 0.00 ? 26 CYS A N    14 
ATOM 9680  C CA   . CYS A 1 26 ? 38.315 -7.947  1.827   1.00 0.00 ? 26 CYS A CA   14 
ATOM 9681  C C    . CYS A 1 26 ? 37.596 -9.144  1.180   1.00 0.00 ? 26 CYS A C    14 
ATOM 9682  O O    . CYS A 1 26 ? 36.672 -9.680  1.773   1.00 0.00 ? 26 CYS A O    14 
ATOM 9683  C CB   . CYS A 1 26 ? 37.276 -6.893  2.212   1.00 0.00 ? 26 CYS A CB   14 
ATOM 9684  S SG   . CYS A 1 26 ? 37.667 -6.176  3.827   1.00 0.00 ? 26 CYS A SG   14 
ATOM 9685  H H    . CYS A 1 26 ? 39.034 -6.554  0.375   1.00 0.00 ? 26 CYS A H    14 
ATOM 9686  H HA   . CYS A 1 26 ? 38.847 -8.282  2.721   1.00 0.00 ? 26 CYS A HA   14 
ATOM 9687  H HB2  . CYS A 1 26 ? 37.293 -6.120  1.455   1.00 0.00 ? 26 CYS A HB2  14 
ATOM 9688  H HB3  . CYS A 1 26 ? 36.247 -7.264  2.196   1.00 0.00 ? 26 CYS A HB3  14 
ATOM 9689  H HG   . CYS A 1 26 ? 37.196 -4.934  3.876   1.00 0.00 ? 26 CYS A HG   14 
ATOM 9690  N N    . GLU A 1 27 ? 38.034 -9.518  -0.050  1.00 0.00 ? 27 GLU A N    14 
ATOM 9691  C CA   . GLU A 1 27 ? 37.398 -10.588 -0.820  1.00 0.00 ? 27 GLU A CA   14 
ATOM 9692  C C    . GLU A 1 27 ? 35.892 -10.303 -1.011  1.00 0.00 ? 27 GLU A C    14 
ATOM 9693  O O    . GLU A 1 27 ? 35.047 -11.069 -0.564  1.00 0.00 ? 27 GLU A O    14 
ATOM 9694  C CB   . GLU A 1 27 ? 37.655 -11.941 -0.123  1.00 0.00 ? 27 GLU A CB   14 
ATOM 9695  C CG   . GLU A 1 27 ? 37.070 -13.184 -0.824  1.00 0.00 ? 27 GLU A CG   14 
ATOM 9696  C CD   . GLU A 1 27 ? 37.929 -13.730 -1.976  1.00 0.00 ? 27 GLU A CD   14 
ATOM 9697  O OE1  . GLU A 1 27 ? 38.568 -12.948 -2.679  1.00 0.00 ? 27 GLU A OE1  14 
ATOM 9698  O OE2  . GLU A 1 27 ? 37.941 -14.946 -2.161  1.00 0.00 ? 27 GLU A OE2  14 
ATOM 9699  H H    . GLU A 1 27 ? 38.844 -9.080  -0.434  1.00 0.00 ? 27 GLU A H    14 
ATOM 9700  H HA   . GLU A 1 27 ? 37.880 -10.577 -1.798  1.00 0.00 ? 27 GLU A HA   14 
ATOM 9701  H HB2  . GLU A 1 27 ? 38.725 -12.072 0.034   1.00 0.00 ? 27 GLU A HB2  14 
ATOM 9702  H HB3  . GLU A 1 27 ? 37.240 -11.910 0.882   1.00 0.00 ? 27 GLU A HB3  14 
ATOM 9703  H HG2  . GLU A 1 27 ? 36.962 -13.964 -0.071  1.00 0.00 ? 27 GLU A HG2  14 
ATOM 9704  H HG3  . GLU A 1 27 ? 36.068 -13.024 -1.215  1.00 0.00 ? 27 GLU A HG3  14 
ATOM 9705  N N    . LYS A 1 28 ? 35.624 -9.157  -1.677  1.00 0.00 ? 28 LYS A N    14 
ATOM 9706  C CA   . LYS A 1 28 ? 34.288 -8.680  -2.051  1.00 0.00 ? 28 LYS A CA   14 
ATOM 9707  C C    . LYS A 1 28 ? 33.161 -9.173  -1.112  1.00 0.00 ? 28 LYS A C    14 
ATOM 9708  O O    . LYS A 1 28 ? 32.176 -9.766  -1.539  1.00 0.00 ? 28 LYS A O    14 
ATOM 9709  C CB   . LYS A 1 28 ? 34.032 -9.009  -3.540  1.00 0.00 ? 28 LYS A CB   14 
ATOM 9710  C CG   . LYS A 1 28 ? 34.562 -7.933  -4.492  1.00 0.00 ? 28 LYS A CG   14 
ATOM 9711  C CD   . LYS A 1 28 ? 36.067 -7.990  -4.733  1.00 0.00 ? 28 LYS A CD   14 
ATOM 9712  C CE   . LYS A 1 28 ? 36.451 -8.558  -6.093  1.00 0.00 ? 28 LYS A CE   14 
ATOM 9713  N NZ   . LYS A 1 28 ? 36.080 -9.945  -6.283  1.00 0.00 ? 28 LYS A NZ   14 
ATOM 9714  H H    . LYS A 1 28 ? 36.399 -8.625  -2.016  1.00 0.00 ? 28 LYS A H    14 
ATOM 9715  H HA   . LYS A 1 28 ? 34.323 -7.601  -1.917  1.00 0.00 ? 28 LYS A HA   14 
ATOM 9716  H HB2  . LYS A 1 28 ? 34.432 -9.988  -3.815  1.00 0.00 ? 28 LYS A HB2  14 
ATOM 9717  H HB3  . LYS A 1 28 ? 32.962 -9.055  -3.712  1.00 0.00 ? 28 LYS A HB3  14 
ATOM 9718  H HG2  . LYS A 1 28 ? 34.038 -7.962  -5.446  1.00 0.00 ? 28 LYS A HG2  14 
ATOM 9719  H HG3  . LYS A 1 28 ? 34.313 -6.967  -4.075  1.00 0.00 ? 28 LYS A HG3  14 
ATOM 9720  H HD2  . LYS A 1 28 ? 36.424 -6.965  -4.677  1.00 0.00 ? 28 LYS A HD2  14 
ATOM 9721  H HD3  . LYS A 1 28 ? 36.589 -8.542  -3.956  1.00 0.00 ? 28 LYS A HD3  14 
ATOM 9722  H HE2  . LYS A 1 28 ? 35.973 -7.981  -6.887  1.00 0.00 ? 28 LYS A HE2  14 
ATOM 9723  H HE3  . LYS A 1 28 ? 37.533 -8.523  -6.183  1.00 0.00 ? 28 LYS A HE3  14 
ATOM 9724  H HZ1  . LYS A 1 28 ? 36.343 -10.252 -7.243  1.00 0.00 ? 28 LYS A HZ1  14 
ATOM 9725  H HZ2  . LYS A 1 28 ? 35.054 -10.028 -6.140  1.00 0.00 ? 28 LYS A HZ2  14 
ATOM 9726  H HZ3  . LYS A 1 28 ? 36.599 -10.527 -5.599  1.00 0.00 ? 28 LYS A HZ3  14 
ATOM 9727  N N    . ASN A 1 29 ? 33.395 -8.912  0.194   1.00 0.00 ? 29 ASN A N    14 
ATOM 9728  C CA   . ASN A 1 29 ? 32.519 -9.466  1.223   1.00 0.00 ? 29 ASN A CA   14 
ATOM 9729  C C    . ASN A 1 29 ? 31.429 -8.477  1.617   1.00 0.00 ? 29 ASN A C    14 
ATOM 9730  O O    . ASN A 1 29 ? 30.367 -8.892  2.064   1.00 0.00 ? 29 ASN A O    14 
ATOM 9731  C CB   . ASN A 1 29 ? 33.335 -9.885  2.457   1.00 0.00 ? 29 ASN A CB   14 
ATOM 9732  C CG   . ASN A 1 29 ? 33.198 -11.389 2.702   1.00 0.00 ? 29 ASN A CG   14 
ATOM 9733  O OD1  . ASN A 1 29 ? 33.900 -12.205 2.125   1.00 0.00 ? 29 ASN A OD1  14 
ATOM 9734  N ND2  . ASN A 1 29 ? 32.215 -11.681 3.571   1.00 0.00 ? 29 ASN A ND2  14 
ATOM 9735  H H    . ASN A 1 29 ? 34.197 -8.372  0.455   1.00 0.00 ? 29 ASN A H    14 
ATOM 9736  H HA   . ASN A 1 29 ? 31.986 -10.316 0.788   1.00 0.00 ? 29 ASN A HA   14 
ATOM 9737  H HB2  . ASN A 1 29 ? 34.390 -9.658  2.329   1.00 0.00 ? 29 ASN A HB2  14 
ATOM 9738  H HB3  . ASN A 1 29 ? 33.006 -9.356  3.350   1.00 0.00 ? 29 ASN A HB3  14 
ATOM 9739  H HD21 . ASN A 1 29 ? 31.749 -10.929 4.038   1.00 0.00 ? 29 ASN A HD21 14 
ATOM 9740  H HD22 . ASN A 1 29 ? 31.941 -12.624 3.755   1.00 0.00 ? 29 ASN A HD22 14 
ATOM 9741  N N    . GLU A 1 30 ? 31.754 -7.179  1.409   1.00 0.00 ? 30 GLU A N    14 
ATOM 9742  C CA   . GLU A 1 30 ? 30.823 -6.062  1.572   1.00 0.00 ? 30 GLU A CA   14 
ATOM 9743  C C    . GLU A 1 30 ? 30.828 -5.558  3.021   1.00 0.00 ? 30 GLU A C    14 
ATOM 9744  O O    . GLU A 1 30 ? 31.270 -4.455  3.310   1.00 0.00 ? 30 GLU A O    14 
ATOM 9745  C CB   . GLU A 1 30 ? 29.391 -6.355  1.083   1.00 0.00 ? 30 GLU A CB   14 
ATOM 9746  C CG   . GLU A 1 30 ? 29.311 -7.061  -0.291  1.00 0.00 ? 30 GLU A CG   14 
ATOM 9747  C CD   . GLU A 1 30 ? 28.621 -8.433  -0.292  1.00 0.00 ? 30 GLU A CD   14 
ATOM 9748  O OE1  . GLU A 1 30 ? 27.818 -8.699  0.601   1.00 0.00 ? 30 GLU A OE1  14 
ATOM 9749  O OE2  . GLU A 1 30 ? 28.880 -9.214  -1.206  1.00 0.00 ? 30 GLU A OE2  14 
ATOM 9750  H H    . GLU A 1 30 ? 32.692 -6.963  1.133   1.00 0.00 ? 30 GLU A H    14 
ATOM 9751  H HA   . GLU A 1 30 ? 31.238 -5.270  0.959   1.00 0.00 ? 30 GLU A HA   14 
ATOM 9752  H HB2  . GLU A 1 30 ? 28.861 -6.913  1.847   1.00 0.00 ? 30 GLU A HB2  14 
ATOM 9753  H HB3  . GLU A 1 30 ? 28.831 -5.421  1.030   1.00 0.00 ? 30 GLU A HB3  14 
ATOM 9754  H HG2  . GLU A 1 30 ? 28.692 -6.473  -0.953  1.00 0.00 ? 30 GLU A HG2  14 
ATOM 9755  H HG3  . GLU A 1 30 ? 30.285 -7.132  -0.777  1.00 0.00 ? 30 GLU A HG3  14 
ATOM 9756  N N    . ASN A 1 31 ? 30.312 -6.438  3.904   1.00 0.00 ? 31 ASN A N    14 
ATOM 9757  C CA   . ASN A 1 31 ? 30.250 -6.168  5.336   1.00 0.00 ? 31 ASN A CA   14 
ATOM 9758  C C    . ASN A 1 31 ? 31.657 -6.068  5.941   1.00 0.00 ? 31 ASN A C    14 
ATOM 9759  O O    . ASN A 1 31 ? 31.848 -5.466  6.989   1.00 0.00 ? 31 ASN A O    14 
ATOM 9760  C CB   . ASN A 1 31 ? 29.470 -7.315  6.020   1.00 0.00 ? 31 ASN A CB   14 
ATOM 9761  C CG   . ASN A 1 31 ? 28.209 -6.802  6.732   1.00 0.00 ? 31 ASN A CG   14 
ATOM 9762  O OD1  . ASN A 1 31 ? 28.234 -5.821  7.461   1.00 0.00 ? 31 ASN A OD1  14 
ATOM 9763  N ND2  . ASN A 1 31 ? 27.111 -7.535  6.469   1.00 0.00 ? 31 ASN A ND2  14 
ATOM 9764  H H    . ASN A 1 31 ? 29.961 -7.308  3.560   1.00 0.00 ? 31 ASN A H    14 
ATOM 9765  H HA   . ASN A 1 31 ? 29.760 -5.198  5.458   1.00 0.00 ? 31 ASN A HA   14 
ATOM 9766  H HB2  . ASN A 1 31 ? 29.187 -8.068  5.284   1.00 0.00 ? 31 ASN A HB2  14 
ATOM 9767  H HB3  . ASN A 1 31 ? 30.063 -7.857  6.758   1.00 0.00 ? 31 ASN A HB3  14 
ATOM 9768  H HD21 . ASN A 1 31 ? 27.149 -8.338  5.872   1.00 0.00 ? 31 ASN A HD21 14 
ATOM 9769  H HD22 . ASN A 1 31 ? 26.235 -7.277  6.874   1.00 0.00 ? 31 ASN A HD22 14 
ATOM 9770  N N    . LEU A 1 32 ? 32.613 -6.699  5.223   1.00 0.00 ? 32 LEU A N    14 
ATOM 9771  C CA   . LEU A 1 32 ? 33.998 -6.670  5.673   1.00 0.00 ? 32 LEU A CA   14 
ATOM 9772  C C    . LEU A 1 32 ? 34.694 -5.436  5.090   1.00 0.00 ? 32 LEU A C    14 
ATOM 9773  O O    . LEU A 1 32 ? 35.597 -4.873  5.686   1.00 0.00 ? 32 LEU A O    14 
ATOM 9774  C CB   . LEU A 1 32 ? 34.735 -7.938  5.198   1.00 0.00 ? 32 LEU A CB   14 
ATOM 9775  C CG   . LEU A 1 32 ? 35.727 -8.565  6.199   1.00 0.00 ? 32 LEU A CG   14 
ATOM 9776  C CD1  . LEU A 1 32 ? 36.815 -9.353  5.461   1.00 0.00 ? 32 LEU A CD1  14 
ATOM 9777  C CD2  . LEU A 1 32 ? 36.352 -7.583  7.196   1.00 0.00 ? 32 LEU A CD2  14 
ATOM 9778  H H    . LEU A 1 32 ? 32.369 -7.157  4.367   1.00 0.00 ? 32 LEU A H    14 
ATOM 9779  H HA   . LEU A 1 32 ? 33.973 -6.603  6.763   1.00 0.00 ? 32 LEU A HA   14 
ATOM 9780  H HB2  . LEU A 1 32 ? 34.003 -8.710  4.986   1.00 0.00 ? 32 LEU A HB2  14 
ATOM 9781  H HB3  . LEU A 1 32 ? 35.223 -7.771  4.237   1.00 0.00 ? 32 LEU A HB3  14 
ATOM 9782  H HG   . LEU A 1 32 ? 35.169 -9.283  6.798   1.00 0.00 ? 32 LEU A HG   14 
ATOM 9783  H HD11 . LEU A 1 32 ? 37.582 -8.696  5.051   1.00 0.00 ? 32 LEU A HD11 14 
ATOM 9784  H HD12 . LEU A 1 32 ? 36.397 -9.930  4.636   1.00 0.00 ? 32 LEU A HD12 14 
ATOM 9785  H HD13 . LEU A 1 32 ? 37.309 -10.043 6.144   1.00 0.00 ? 32 LEU A HD13 14 
ATOM 9786  H HD21 . LEU A 1 32 ? 37.107 -8.085  7.799   1.00 0.00 ? 32 LEU A HD21 14 
ATOM 9787  H HD22 . LEU A 1 32 ? 35.608 -7.194  7.890   1.00 0.00 ? 32 LEU A HD22 14 
ATOM 9788  H HD23 . LEU A 1 32 ? 36.837 -6.750  6.692   1.00 0.00 ? 32 LEU A HD23 14 
ATOM 9789  N N    . ALA A 1 33 ? 34.216 -5.065  3.881   1.00 0.00 ? 33 ALA A N    14 
ATOM 9790  C CA   . ALA A 1 33 ? 34.801 -3.936  3.184   1.00 0.00 ? 33 ALA A CA   14 
ATOM 9791  C C    . ALA A 1 33 ? 34.584 -2.628  3.938   1.00 0.00 ? 33 ALA A C    14 
ATOM 9792  O O    . ALA A 1 33 ? 35.497 -1.835  4.093   1.00 0.00 ? 33 ALA A O    14 
ATOM 9793  C CB   . ALA A 1 33 ? 34.218 -3.813  1.794   1.00 0.00 ? 33 ALA A CB   14 
ATOM 9794  H H    . ALA A 1 33 ? 33.474 -5.576  3.448   1.00 0.00 ? 33 ALA A H    14 
ATOM 9795  H HA   . ALA A 1 33 ? 35.870 -4.121  3.103   1.00 0.00 ? 33 ALA A HA   14 
ATOM 9796  H HB1  . ALA A 1 33 ? 34.969 -3.293  1.207   1.00 0.00 ? 33 ALA A HB1  14 
ATOM 9797  H HB2  . ALA A 1 33 ? 33.295 -3.230  1.773   1.00 0.00 ? 33 ALA A HB2  14 
ATOM 9798  H HB3  . ALA A 1 33 ? 34.018 -4.781  1.332   1.00 0.00 ? 33 ALA A HB3  14 
ATOM 9799  N N    . ALA A 1 34 ? 33.332 -2.473  4.422   1.00 0.00 ? 34 ALA A N    14 
ATOM 9800  C CA   . ALA A 1 34 ? 33.014 -1.326  5.261   1.00 0.00 ? 34 ALA A CA   14 
ATOM 9801  C C    . ALA A 1 34 ? 33.938 -1.313  6.482   1.00 0.00 ? 34 ALA A C    14 
ATOM 9802  O O    . ALA A 1 34 ? 34.583 -0.319  6.776   1.00 0.00 ? 34 ALA A O    14 
ATOM 9803  C CB   . ALA A 1 34 ? 31.547 -1.367  5.694   1.00 0.00 ? 34 ALA A CB   14 
ATOM 9804  H H    . ALA A 1 34 ? 32.648 -3.179  4.246   1.00 0.00 ? 34 ALA A H    14 
ATOM 9805  H HA   . ALA A 1 34 ? 33.200 -0.431  4.664   1.00 0.00 ? 34 ALA A HA   14 
ATOM 9806  H HB1  . ALA A 1 34 ? 31.319 -2.260  6.275   1.00 0.00 ? 34 ALA A HB1  14 
ATOM 9807  H HB2  . ALA A 1 34 ? 30.885 -1.356  4.830   1.00 0.00 ? 34 ALA A HB2  14 
ATOM 9808  H HB3  . ALA A 1 34 ? 31.303 -0.494  6.300   1.00 0.00 ? 34 ALA A HB3  14 
ATOM 9809  N N    . ASN A 1 35 ? 34.024 -2.482  7.140   1.00 0.00 ? 35 ASN A N    14 
ATOM 9810  C CA   . ASN A 1 35 ? 34.906 -2.572  8.300   1.00 0.00 ? 35 ASN A CA   14 
ATOM 9811  C C    . ASN A 1 35 ? 36.366 -2.179  7.971   1.00 0.00 ? 35 ASN A C    14 
ATOM 9812  O O    . ASN A 1 35 ? 37.028 -1.542  8.771   1.00 0.00 ? 35 ASN A O    14 
ATOM 9813  C CB   . ASN A 1 35 ? 34.870 -3.995  8.874   1.00 0.00 ? 35 ASN A CB   14 
ATOM 9814  C CG   . ASN A 1 35 ? 34.815 -3.948  10.408  1.00 0.00 ? 35 ASN A CG   14 
ATOM 9815  O OD1  . ASN A 1 35 ? 33.841 -3.503  10.996  1.00 0.00 ? 35 ASN A OD1  14 
ATOM 9816  N ND2  . ASN A 1 35 ? 35.912 -4.434  11.016  1.00 0.00 ? 35 ASN A ND2  14 
ATOM 9817  H H    . ASN A 1 35 ? 33.492 -3.270  6.826   1.00 0.00 ? 35 ASN A H    14 
ATOM 9818  H HA   . ASN A 1 35 ? 34.499 -1.849  9.014   1.00 0.00 ? 35 ASN A HA   14 
ATOM 9819  H HB2  . ASN A 1 35 ? 33.984 -4.520  8.525   1.00 0.00 ? 35 ASN A HB2  14 
ATOM 9820  H HB3  . ASN A 1 35 ? 35.715 -4.597  8.542   1.00 0.00 ? 35 ASN A HB3  14 
ATOM 9821  H HD21 . ASN A 1 35 ? 36.698 -4.773  10.499  1.00 0.00 ? 35 ASN A HD21 14 
ATOM 9822  H HD22 . ASN A 1 35 ? 35.937 -4.455  12.013  1.00 0.00 ? 35 ASN A HD22 14 
ATOM 9823  N N    . PHE A 1 36 ? 36.822 -2.559  6.760   1.00 0.00 ? 36 PHE A N    14 
ATOM 9824  C CA   . PHE A 1 36 ? 38.178 -2.228  6.306   1.00 0.00 ? 36 PHE A CA   14 
ATOM 9825  C C    . PHE A 1 36 ? 38.389 -0.695  6.248   1.00 0.00 ? 36 PHE A C    14 
ATOM 9826  O O    . PHE A 1 36 ? 39.374 -0.163  6.739   1.00 0.00 ? 36 PHE A O    14 
ATOM 9827  C CB   . PHE A 1 36 ? 38.412 -2.885  4.927   1.00 0.00 ? 36 PHE A CB   14 
ATOM 9828  C CG   . PHE A 1 36 ? 39.771 -2.636  4.304   1.00 0.00 ? 36 PHE A CG   14 
ATOM 9829  C CD1  . PHE A 1 36 ? 40.136 -1.369  3.848   1.00 0.00 ? 36 PHE A CD1  14 
ATOM 9830  C CD2  . PHE A 1 36 ? 40.673 -3.682  4.131   1.00 0.00 ? 36 PHE A CD2  14 
ATOM 9831  C CE1  . PHE A 1 36 ? 41.359 -1.139  3.237   1.00 0.00 ? 36 PHE A CE1  14 
ATOM 9832  C CE2  . PHE A 1 36 ? 41.903 -3.459  3.518   1.00 0.00 ? 36 PHE A CE2  14 
ATOM 9833  C CZ   . PHE A 1 36 ? 42.247 -2.190  3.070   1.00 0.00 ? 36 PHE A CZ   14 
ATOM 9834  H H    . PHE A 1 36 ? 36.178 -3.028  6.153   1.00 0.00 ? 36 PHE A H    14 
ATOM 9835  H HA   . PHE A 1 36 ? 38.878 -2.650  7.033   1.00 0.00 ? 36 PHE A HA   14 
ATOM 9836  H HB2  . PHE A 1 36 ? 38.262 -3.957  5.019   1.00 0.00 ? 36 PHE A HB2  14 
ATOM 9837  H HB3  . PHE A 1 36 ? 37.661 -2.565  4.212   1.00 0.00 ? 36 PHE A HB3  14 
ATOM 9838  H HD1  . PHE A 1 36 ? 39.457 -0.536  3.927   1.00 0.00 ? 36 PHE A HD1  14 
ATOM 9839  H HD2  . PHE A 1 36 ? 40.411 -4.682  4.444   1.00 0.00 ? 36 PHE A HD2  14 
ATOM 9840  H HE1  . PHE A 1 36 ? 41.604 -0.146  2.882   1.00 0.00 ? 36 PHE A HE1  14 
ATOM 9841  H HE2  . PHE A 1 36 ? 42.589 -4.280  3.370   1.00 0.00 ? 36 PHE A HE2  14 
ATOM 9842  H HZ   . PHE A 1 36 ? 43.195 -2.020  2.584   1.00 0.00 ? 36 PHE A HZ   14 
ATOM 9843  N N    . LEU A 1 37 ? 37.417 -0.037  5.581   1.00 0.00 ? 37 LEU A N    14 
ATOM 9844  C CA   . LEU A 1 37 ? 37.549 1.375   5.259   1.00 0.00 ? 37 LEU A CA   14 
ATOM 9845  C C    . LEU A 1 37 ? 37.371 2.264   6.507   1.00 0.00 ? 37 LEU A C    14 
ATOM 9846  O O    . LEU A 1 37 ? 37.933 3.349   6.589   1.00 0.00 ? 37 LEU A O    14 
ATOM 9847  C CB   . LEU A 1 37 ? 36.506 1.742   4.200   1.00 0.00 ? 37 LEU A CB   14 
ATOM 9848  C CG   . LEU A 1 37 ? 36.720 1.116   2.812   1.00 0.00 ? 37 LEU A CG   14 
ATOM 9849  C CD1  . LEU A 1 37 ? 35.492 0.332   2.341   1.00 0.00 ? 37 LEU A CD1  14 
ATOM 9850  C CD2  . LEU A 1 37 ? 37.106 2.152   1.743   1.00 0.00 ? 37 LEU A CD2  14 
ATOM 9851  H H    . LEU A 1 37 ? 36.589 -0.513  5.294   1.00 0.00 ? 37 LEU A H    14 
ATOM 9852  H HA   . LEU A 1 37 ? 38.549 1.531   4.854   1.00 0.00 ? 37 LEU A HA   14 
ATOM 9853  H HB2  . LEU A 1 37 ? 35.518 1.482   4.556   1.00 0.00 ? 37 LEU A HB2  14 
ATOM 9854  H HB3  . LEU A 1 37 ? 36.507 2.818   4.124   1.00 0.00 ? 37 LEU A HB3  14 
ATOM 9855  H HG   . LEU A 1 37 ? 37.537 0.410   2.919   1.00 0.00 ? 37 LEU A HG   14 
ATOM 9856  H HD11 . LEU A 1 37 ? 35.773 -0.613  1.877   1.00 0.00 ? 37 LEU A HD11 14 
ATOM 9857  H HD12 . LEU A 1 37 ? 34.933 0.901   1.612   1.00 0.00 ? 37 LEU A HD12 14 
ATOM 9858  H HD13 . LEU A 1 37 ? 34.777 0.138   3.135   1.00 0.00 ? 37 LEU A HD13 14 
ATOM 9859  H HD21 . LEU A 1 37 ? 38.130 1.992   1.429   1.00 0.00 ? 37 LEU A HD21 14 
ATOM 9860  H HD22 . LEU A 1 37 ? 37.043 3.168   2.105   1.00 0.00 ? 37 LEU A HD22 14 
ATOM 9861  H HD23 . LEU A 1 37 ? 36.447 2.144   0.876   1.00 0.00 ? 37 LEU A HD23 14 
ATOM 9862  N N    . LEU A 1 38 ? 36.555 1.734   7.452   1.00 0.00 ? 38 LEU A N    14 
ATOM 9863  C CA   . LEU A 1 38 ? 36.193 2.474   8.660   1.00 0.00 ? 38 LEU A CA   14 
ATOM 9864  C C    . LEU A 1 38 ? 37.238 2.214   9.765   1.00 0.00 ? 38 LEU A C    14 
ATOM 9865  O O    . LEU A 1 38 ? 37.427 3.013   10.672  1.00 0.00 ? 38 LEU A O    14 
ATOM 9866  C CB   . LEU A 1 38 ? 34.769 2.126   9.168   1.00 0.00 ? 38 LEU A CB   14 
ATOM 9867  C CG   . LEU A 1 38 ? 33.600 2.102   8.148   1.00 0.00 ? 38 LEU A CG   14 
ATOM 9868  C CD1  . LEU A 1 38 ? 32.358 2.859   8.624   1.00 0.00 ? 38 LEU A CD1  14 
ATOM 9869  C CD2  . LEU A 1 38 ? 33.979 2.607   6.762   1.00 0.00 ? 38 LEU A CD2  14 
ATOM 9870  H H    . LEU A 1 38 ? 36.155 0.832   7.307   1.00 0.00 ? 38 LEU A H    14 
ATOM 9871  H HA   . LEU A 1 38 ? 36.231 3.531   8.399   1.00 0.00 ? 38 LEU A HA   14 
ATOM 9872  H HB2  . LEU A 1 38 ? 34.812 1.149   9.646   1.00 0.00 ? 38 LEU A HB2  14 
ATOM 9873  H HB3  . LEU A 1 38 ? 34.523 2.839   9.958   1.00 0.00 ? 38 LEU A HB3  14 
ATOM 9874  H HG   . LEU A 1 38 ? 33.259 1.073   8.064   1.00 0.00 ? 38 LEU A HG   14 
ATOM 9875  H HD11 . LEU A 1 38 ? 32.560 3.926   8.723   1.00 0.00 ? 38 LEU A HD11 14 
ATOM 9876  H HD12 . LEU A 1 38 ? 31.996 2.468   9.572   1.00 0.00 ? 38 LEU A HD12 14 
ATOM 9877  H HD13 . LEU A 1 38 ? 31.551 2.739   7.900   1.00 0.00 ? 38 LEU A HD13 14 
ATOM 9878  H HD21 . LEU A 1 38 ? 34.745 3.374   6.824   1.00 0.00 ? 38 LEU A HD21 14 
ATOM 9879  H HD22 . LEU A 1 38 ? 33.120 3.025   6.261   1.00 0.00 ? 38 LEU A HD22 14 
ATOM 9880  H HD23 . LEU A 1 38 ? 34.338 1.818   6.119   1.00 0.00 ? 38 LEU A HD23 14 
ATOM 9881  N N    . SER A 1 39 ? 37.911 1.050   9.607   1.00 0.00 ? 39 SER A N    14 
ATOM 9882  C CA   . SER A 1 39 ? 38.969 0.641   10.522  1.00 0.00 ? 39 SER A CA   14 
ATOM 9883  C C    . SER A 1 39 ? 40.257 1.438   10.272  1.00 0.00 ? 39 SER A C    14 
ATOM 9884  O O    . SER A 1 39 ? 41.016 1.696   11.196  1.00 0.00 ? 39 SER A O    14 
ATOM 9885  C CB   . SER A 1 39 ? 39.254 -0.864  10.384  1.00 0.00 ? 39 SER A CB   14 
ATOM 9886  O OG   . SER A 1 39 ? 38.272 -1.666  11.021  1.00 0.00 ? 39 SER A OG   14 
ATOM 9887  H H    . SER A 1 39 ? 37.707 0.458   8.830   1.00 0.00 ? 39 SER A H    14 
ATOM 9888  H HA   . SER A 1 39 ? 38.625 0.847   11.534  1.00 0.00 ? 39 SER A HA   14 
ATOM 9889  H HB2  . SER A 1 39 ? 39.394 -1.145  9.336   1.00 0.00 ? 39 SER A HB2  14 
ATOM 9890  H HB3  . SER A 1 39 ? 40.186 -1.135  10.873  1.00 0.00 ? 39 SER A HB3  14 
ATOM 9891  H HG   . SER A 1 39 ? 37.409 -1.476  10.676  1.00 0.00 ? 39 SER A HG   14 
ATOM 9892  N N    . GLN A 1 40 ? 40.451 1.794   8.982   1.00 0.00 ? 40 GLN A N    14 
ATOM 9893  C CA   . GLN A 1 40 ? 41.671 2.473   8.556   1.00 0.00 ? 40 GLN A CA   14 
ATOM 9894  C C    . GLN A 1 40 ? 41.305 3.932   8.221   1.00 0.00 ? 40 GLN A C    14 
ATOM 9895  O O    . GLN A 1 40 ? 40.710 4.215   7.189   1.00 0.00 ? 40 GLN A O    14 
ATOM 9896  C CB   . GLN A 1 40 ? 42.281 1.770   7.323   1.00 0.00 ? 40 GLN A CB   14 
ATOM 9897  C CG   . GLN A 1 40 ? 42.424 0.234   7.421   1.00 0.00 ? 40 GLN A CG   14 
ATOM 9898  C CD   . GLN A 1 40 ? 43.729 -0.209  8.111   1.00 0.00 ? 40 GLN A CD   14 
ATOM 9899  O OE1  . GLN A 1 40 ? 44.702 0.526   8.206   1.00 0.00 ? 40 GLN A OE1  14 
ATOM 9900  N NE2  . GLN A 1 40 ? 43.617 -1.415  8.702   1.00 0.00 ? 40 GLN A NE2  14 
ATOM 9901  H H    . GLN A 1 40 ? 39.747 1.552   8.314   1.00 0.00 ? 40 GLN A H    14 
ATOM 9902  H HA   . GLN A 1 40 ? 42.394 2.447   9.372   1.00 0.00 ? 40 GLN A HA   14 
ATOM 9903  H HB2  . GLN A 1 40 ? 41.660 1.977   6.455   1.00 0.00 ? 40 GLN A HB2  14 
ATOM 9904  H HB3  . GLN A 1 40 ? 43.240 2.230   7.083   1.00 0.00 ? 40 GLN A HB3  14 
ATOM 9905  H HG2  . GLN A 1 40 ? 41.576 -0.216  7.936   1.00 0.00 ? 40 GLN A HG2  14 
ATOM 9906  H HG3  . GLN A 1 40 ? 42.404 -0.192  6.420   1.00 0.00 ? 40 GLN A HG3  14 
ATOM 9907  H HE21 . GLN A 1 40 ? 43.184 -2.181  8.227   1.00 0.00 ? 40 GLN A HE21 14 
ATOM 9908  H HE22 . GLN A 1 40 ? 43.946 -1.535  9.638   1.00 0.00 ? 40 GLN A HE22 14 
ATOM 9909  N N    . ASN A 1 41 ? 41.693 4.825   9.159   1.00 0.00 ? 41 ASN A N    14 
ATOM 9910  C CA   . ASN A 1 41 ? 41.436 6.255   8.994   1.00 0.00 ? 41 ASN A CA   14 
ATOM 9911  C C    . ASN A 1 41 ? 42.508 6.841   8.058   1.00 0.00 ? 41 ASN A C    14 
ATOM 9912  O O    . ASN A 1 41 ? 43.693 6.597   8.241   1.00 0.00 ? 41 ASN A O    14 
ATOM 9913  C CB   . ASN A 1 41 ? 41.492 7.016   10.337  1.00 0.00 ? 41 ASN A CB   14 
ATOM 9914  C CG   . ASN A 1 41 ? 41.197 6.182   11.597  1.00 0.00 ? 41 ASN A CG   14 
ATOM 9915  O OD1  . ASN A 1 41 ? 42.043 6.022   12.465  1.00 0.00 ? 41 ASN A OD1  14 
ATOM 9916  N ND2  . ASN A 1 41 ? 39.923 5.755   11.682  1.00 0.00 ? 41 ASN A ND2  14 
ATOM 9917  H H    . ASN A 1 41 ? 42.156 4.494   9.979   1.00 0.00 ? 41 ASN A H    14 
ATOM 9918  H HA   . ASN A 1 41 ? 40.443 6.360   8.549   1.00 0.00 ? 41 ASN A HA   14 
ATOM 9919  H HB2  . ASN A 1 41 ? 42.472 7.462   10.503  1.00 0.00 ? 41 ASN A HB2  14 
ATOM 9920  H HB3  . ASN A 1 41 ? 40.798 7.854   10.291  1.00 0.00 ? 41 ASN A HB3  14 
ATOM 9921  H HD21 . ASN A 1 41 ? 39.324 5.725   10.883  1.00 0.00 ? 41 ASN A HD21 14 
ATOM 9922  H HD22 . ASN A 1 41 ? 39.558 5.476   12.568  1.00 0.00 ? 41 ASN A HD22 14 
ATOM 9923  N N    . PHE A 1 42 ? 42.017 7.609   7.060   1.00 0.00 ? 42 PHE A N    14 
ATOM 9924  C CA   . PHE A 1 42 ? 42.890 8.220   6.062   1.00 0.00 ? 42 PHE A CA   14 
ATOM 9925  C C    . PHE A 1 42 ? 42.034 9.124   5.155   1.00 0.00 ? 42 PHE A C    14 
ATOM 9926  O O    . PHE A 1 42 ? 41.529 8.692   4.128   1.00 0.00 ? 42 PHE A O    14 
ATOM 9927  C CB   . PHE A 1 42 ? 43.593 7.130   5.219   1.00 0.00 ? 42 PHE A CB   14 
ATOM 9928  C CG   . PHE A 1 42 ? 44.701 7.676   4.354   1.00 0.00 ? 42 PHE A CG   14 
ATOM 9929  C CD1  . PHE A 1 42 ? 45.980 7.847   4.877   1.00 0.00 ? 42 PHE A CD1  14 
ATOM 9930  C CD2  . PHE A 1 42 ? 44.467 8.002   3.022   1.00 0.00 ? 42 PHE A CD2  14 
ATOM 9931  C CE1  . PHE A 1 42 ? 47.008 8.335   4.080   1.00 0.00 ? 42 PHE A CE1  14 
ATOM 9932  C CE2  . PHE A 1 42 ? 45.492 8.490   2.223   1.00 0.00 ? 42 PHE A CE2  14 
ATOM 9933  C CZ   . PHE A 1 42 ? 46.762 8.657   2.753   1.00 0.00 ? 42 PHE A CZ   14 
ATOM 9934  H H    . PHE A 1 42 ? 41.033 7.769   7.027   1.00 0.00 ? 42 PHE A H    14 
ATOM 9935  H HA   . PHE A 1 42 ? 43.610 8.826   6.614   1.00 0.00 ? 42 PHE A HA   14 
ATOM 9936  H HB2  . PHE A 1 42 ? 44.040 6.375   5.862   1.00 0.00 ? 42 PHE A HB2  14 
ATOM 9937  H HB3  . PHE A 1 42 ? 42.870 6.585   4.609   1.00 0.00 ? 42 PHE A HB3  14 
ATOM 9938  H HD1  . PHE A 1 42 ? 46.182 7.590   5.907   1.00 0.00 ? 42 PHE A HD1  14 
ATOM 9939  H HD2  . PHE A 1 42 ? 43.484 7.868   2.599   1.00 0.00 ? 42 PHE A HD2  14 
ATOM 9940  H HE1  . PHE A 1 42 ? 48.000 8.461   4.490   1.00 0.00 ? 42 PHE A HE1  14 
ATOM 9941  H HE2  . PHE A 1 42 ? 45.299 8.735   1.189   1.00 0.00 ? 42 PHE A HE2  14 
ATOM 9942  H HZ   . PHE A 1 42 ? 47.559 9.034   2.131   1.00 0.00 ? 42 PHE A HZ   14 
ATOM 9943  N N    . ASP A 1 43 ? 41.903 10.398  5.587   1.00 0.00 ? 43 ASP A N    14 
ATOM 9944  C CA   . ASP A 1 43 ? 41.163 11.350  4.764   1.00 0.00 ? 43 ASP A CA   14 
ATOM 9945  C C    . ASP A 1 43 ? 41.633 12.779  5.058   1.00 0.00 ? 43 ASP A C    14 
ATOM 9946  O O    . ASP A 1 43 ? 42.105 13.460  4.159   1.00 0.00 ? 43 ASP A O    14 
ATOM 9947  C CB   . ASP A 1 43 ? 39.640 11.180  4.966   1.00 0.00 ? 43 ASP A CB   14 
ATOM 9948  C CG   . ASP A 1 43 ? 38.819 11.733  3.781   1.00 0.00 ? 43 ASP A CG   14 
ATOM 9949  O OD1  . ASP A 1 43 ? 39.244 11.571  2.638   1.00 0.00 ? 43 ASP A OD1  14 
ATOM 9950  O OD2  . ASP A 1 43 ? 37.756 12.309  4.011   1.00 0.00 ? 43 ASP A OD2  14 
ATOM 9951  H H    . ASP A 1 43 ? 42.273 10.666  6.474   1.00 0.00 ? 43 ASP A H    14 
ATOM 9952  H HA   . ASP A 1 43 ? 41.449 11.137  3.730   1.00 0.00 ? 43 ASP A HA   14 
ATOM 9953  H HB2  . ASP A 1 43 ? 39.403 10.123  5.057   1.00 0.00 ? 43 ASP A HB2  14 
ATOM 9954  H HB3  . ASP A 1 43 ? 39.299 11.630  5.900   1.00 0.00 ? 43 ASP A HB3  14 
ATOM 9955  N N    . ASP A 1 44 ? 41.474 13.177  6.353   1.00 0.00 ? 44 ASP A N    14 
ATOM 9956  C CA   . ASP A 1 44 ? 41.890 14.477  6.909   1.00 0.00 ? 44 ASP A CA   14 
ATOM 9957  C C    . ASP A 1 44 ? 41.528 15.681  6.016   1.00 0.00 ? 44 ASP A C    14 
ATOM 9958  O O    . ASP A 1 44 ? 42.256 16.662  5.949   1.00 0.00 ? 44 ASP A O    14 
ATOM 9959  C CB   . ASP A 1 44 ? 43.383 14.465  7.302   1.00 0.00 ? 44 ASP A CB   14 
ATOM 9960  C CG   . ASP A 1 44 ? 44.335 14.141  6.127   1.00 0.00 ? 44 ASP A CG   14 
ATOM 9961  O OD1  . ASP A 1 44 ? 44.691 15.052  5.379   1.00 0.00 ? 44 ASP A OD1  14 
ATOM 9962  O OD2  . ASP A 1 44 ? 44.715 12.979  5.975   1.00 0.00 ? 44 ASP A OD2  14 
ATOM 9963  H H    . ASP A 1 44 ? 41.060 12.524  6.985   1.00 0.00 ? 44 ASP A H    14 
ATOM 9964  H HA   . ASP A 1 44 ? 41.309 14.607  7.825   1.00 0.00 ? 44 ASP A HA   14 
ATOM 9965  H HB2  . ASP A 1 44 ? 43.676 15.413  7.754   1.00 0.00 ? 44 ASP A HB2  14 
ATOM 9966  H HB3  . ASP A 1 44 ? 43.533 13.729  8.091   1.00 0.00 ? 44 ASP A HB3  14 
ATOM 9967  N N    . GLU A 1 45 ? 40.367 15.527  5.346   1.00 0.00 ? 45 GLU A N    14 
ATOM 9968  C CA   . GLU A 1 45 ? 39.835 16.509  4.405   1.00 0.00 ? 45 GLU A CA   14 
ATOM 9969  C C    . GLU A 1 45 ? 40.843 16.769  3.259   1.00 0.00 ? 45 GLU A C    14 
ATOM 9970  O O    . GLU A 1 45 ? 41.576 17.752  3.330   1.00 0.00 ? 45 GLU A O    14 
ATOM 9971  C CB   . GLU A 1 45 ? 39.325 17.793  5.104   1.00 0.00 ? 45 GLU A CB   14 
ATOM 9972  C CG   . GLU A 1 45 ? 38.805 17.543  6.532   1.00 0.00 ? 45 GLU A CG   14 
ATOM 9973  C CD   . GLU A 1 45 ? 37.598 18.422  6.890   1.00 0.00 ? 45 GLU A CD   14 
ATOM 9974  O OE1  . GLU A 1 45 ? 36.555 18.252  6.260   1.00 0.00 ? 45 GLU A OE1  14 
ATOM 9975  O OE2  . GLU A 1 45 ? 37.703 19.248  7.796   1.00 0.00 ? 45 GLU A OE2  14 
ATOM 9976  O OXT  . GLU A 1 45 ? 40.895 15.977  2.314   1.00 0.00 ? 45 GLU A OXT  14 
ATOM 9977  H H    . GLU A 1 45 ? 39.852 14.684  5.496   1.00 0.00 ? 45 GLU A H    14 
ATOM 9978  H HA   . GLU A 1 45 ? 38.960 16.013  3.989   1.00 0.00 ? 45 GLU A HA   14 
ATOM 9979  H HB2  . GLU A 1 45 ? 40.096 18.558  5.167   1.00 0.00 ? 45 GLU A HB2  14 
ATOM 9980  H HB3  . GLU A 1 45 ? 38.549 18.227  4.471   1.00 0.00 ? 45 GLU A HB3  14 
ATOM 9981  H HG2  . GLU A 1 45 ? 38.483 16.512  6.659   1.00 0.00 ? 45 GLU A HG2  14 
ATOM 9982  H HG3  . GLU A 1 45 ? 39.617 17.708  7.241   1.00 0.00 ? 45 GLU A HG3  14 
ATOM 9983  N N    . GLN A 1 1  ? 30.238 -4.340  -12.104 1.00 0.00 ? 1  GLN A N    15 
ATOM 9984  C CA   . GLN A 1 1  ? 29.614 -5.374  -11.286 1.00 0.00 ? 1  GLN A CA   15 
ATOM 9985  C C    . GLN A 1 1  ? 29.781 -5.070  -9.792  1.00 0.00 ? 1  GLN A C    15 
ATOM 9986  O O    . GLN A 1 1  ? 28.955 -5.441  -8.971  1.00 0.00 ? 1  GLN A O    15 
ATOM 9987  C CB   . GLN A 1 1  ? 30.127 -6.799  -11.575 1.00 0.00 ? 1  GLN A CB   15 
ATOM 9988  C CG   . GLN A 1 1  ? 30.380 -7.080  -13.072 1.00 0.00 ? 1  GLN A CG   15 
ATOM 9989  C CD   . GLN A 1 1  ? 29.669 -8.344  -13.581 1.00 0.00 ? 1  GLN A CD   15 
ATOM 9990  O OE1  . GLN A 1 1  ? 28.842 -8.297  -14.471 1.00 0.00 ? 1  GLN A OE1  15 
ATOM 9991  N NE2  . GLN A 1 1  ? 30.068 -9.476  -12.959 1.00 0.00 ? 1  GLN A NE2  15 
ATOM 9992  H H1   . GLN A 1 1  ? 31.274 -4.467  -12.080 1.00 0.00 ? 1  GLN A H1   15 
ATOM 9993  H H2   . GLN A 1 1  ? 30.000 -3.406  -11.707 1.00 0.00 ? 1  GLN A H2   15 
ATOM 9994  H H3   . GLN A 1 1  ? 29.890 -4.403  -13.078 1.00 0.00 ? 1  GLN A H3   15 
ATOM 9995  H HA   . GLN A 1 1  ? 28.546 -5.340  -11.506 1.00 0.00 ? 1  GLN A HA   15 
ATOM 9996  H HB2  . GLN A 1 1  ? 31.060 -6.977  -11.041 1.00 0.00 ? 1  GLN A HB2  15 
ATOM 9997  H HB3  . GLN A 1 1  ? 29.423 -7.512  -11.144 1.00 0.00 ? 1  GLN A HB3  15 
ATOM 9998  H HG2  . GLN A 1 1  ? 30.045 -6.256  -13.701 1.00 0.00 ? 1  GLN A HG2  15 
ATOM 9999  H HG3  . GLN A 1 1  ? 31.450 -7.186  -13.251 1.00 0.00 ? 1  GLN A HG3  15 
ATOM 10000 H HE21 . GLN A 1 1  ? 30.742 -9.449  -12.221 1.00 0.00 ? 1  GLN A HE21 15 
ATOM 10001 H HE22 . GLN A 1 1  ? 29.688 -10.355 -13.232 1.00 0.00 ? 1  GLN A HE22 15 
ATOM 10002 N N    . GLU A 1 2  ? 30.909 -4.373  -9.508  1.00 0.00 ? 2  GLU A N    15 
ATOM 10003 C CA   . GLU A 1 2  ? 31.233 -3.991  -8.140  1.00 0.00 ? 2  GLU A CA   15 
ATOM 10004 C C    . GLU A 1 2  ? 31.271 -2.473  -7.961  1.00 0.00 ? 2  GLU A C    15 
ATOM 10005 O O    . GLU A 1 2  ? 31.350 -2.004  -6.838  1.00 0.00 ? 2  GLU A O    15 
ATOM 10006 C CB   . GLU A 1 2  ? 32.544 -4.670  -7.686  1.00 0.00 ? 2  GLU A CB   15 
ATOM 10007 C CG   . GLU A 1 2  ? 32.534 -5.021  -6.189  1.00 0.00 ? 2  GLU A CG   15 
ATOM 10008 C CD   . GLU A 1 2  ? 31.331 -5.924  -5.846  1.00 0.00 ? 2  GLU A CD   15 
ATOM 10009 O OE1  . GLU A 1 2  ? 31.315 -7.073  -6.288  1.00 0.00 ? 2  GLU A OE1  15 
ATOM 10010 O OE2  . GLU A 1 2  ? 30.415 -5.467  -5.162  1.00 0.00 ? 2  GLU A OE2  15 
ATOM 10011 H H    . GLU A 1 2  ? 31.528 -4.107  -10.242 1.00 0.00 ? 2  GLU A H    15 
ATOM 10012 H HA   . GLU A 1 2  ? 30.398 -4.300  -7.518  1.00 0.00 ? 2  GLU A HA   15 
ATOM 10013 H HB2  . GLU A 1 2  ? 32.691 -5.590  -8.254  1.00 0.00 ? 2  GLU A HB2  15 
ATOM 10014 H HB3  . GLU A 1 2  ? 33.416 -4.053  -7.915  1.00 0.00 ? 2  GLU A HB3  15 
ATOM 10015 H HG2  . GLU A 1 2  ? 33.444 -5.541  -5.901  1.00 0.00 ? 2  GLU A HG2  15 
ATOM 10016 H HG3  . GLU A 1 2  ? 32.509 -4.111  -5.592  1.00 0.00 ? 2  GLU A HG3  15 
ATOM 10017 N N    . LYS A 1 3  ? 31.167 -1.758  -9.110  1.00 0.00 ? 3  LYS A N    15 
ATOM 10018 C CA   . LYS A 1 3  ? 31.110 -0.295  -9.166  1.00 0.00 ? 3  LYS A CA   15 
ATOM 10019 C C    . LYS A 1 3  ? 29.962 0.318   -8.338  1.00 0.00 ? 3  LYS A C    15 
ATOM 10020 O O    . LYS A 1 3  ? 29.990 1.495   -8.007  1.00 0.00 ? 3  LYS A O    15 
ATOM 10021 C CB   . LYS A 1 3  ? 31.065 0.174   -10.625 1.00 0.00 ? 3  LYS A CB   15 
ATOM 10022 C CG   . LYS A 1 3  ? 29.965 -0.510  -11.454 1.00 0.00 ? 3  LYS A CG   15 
ATOM 10023 C CD   . LYS A 1 3  ? 29.216 0.456   -12.384 1.00 0.00 ? 3  LYS A CD   15 
ATOM 10024 C CE   . LYS A 1 3  ? 29.783 0.502   -13.809 1.00 0.00 ? 3  LYS A CE   15 
ATOM 10025 N NZ   . LYS A 1 3  ? 29.759 1.847   -14.371 1.00 0.00 ? 3  LYS A NZ   15 
ATOM 10026 H H    . LYS A 1 3  ? 31.176 -2.238  -9.983  1.00 0.00 ? 3  LYS A H    15 
ATOM 10027 H HA   . LYS A 1 3  ? 32.030 0.081   -8.756  1.00 0.00 ? 3  LYS A HA   15 
ATOM 10028 H HB2  . LYS A 1 3  ? 30.960 1.260   -10.638 1.00 0.00 ? 3  LYS A HB2  15 
ATOM 10029 H HB3  . LYS A 1 3  ? 32.030 -0.014  -11.097 1.00 0.00 ? 3  LYS A HB3  15 
ATOM 10030 H HG2  . LYS A 1 3  ? 30.381 -1.356  -12.004 1.00 0.00 ? 3  LYS A HG2  15 
ATOM 10031 H HG3  . LYS A 1 3  ? 29.236 -0.961  -10.784 1.00 0.00 ? 3  LYS A HG3  15 
ATOM 10032 H HD2  . LYS A 1 3  ? 28.169 0.153   -12.434 1.00 0.00 ? 3  LYS A HD2  15 
ATOM 10033 H HD3  . LYS A 1 3  ? 29.193 1.458   -11.955 1.00 0.00 ? 3  LYS A HD3  15 
ATOM 10034 H HE2  . LYS A 1 3  ? 30.813 0.148   -13.848 1.00 0.00 ? 3  LYS A HE2  15 
ATOM 10035 H HE3  . LYS A 1 3  ? 29.192 -0.146  -14.458 1.00 0.00 ? 3  LYS A HE3  15 
ATOM 10036 H HZ1  . LYS A 1 3  ? 30.386 2.459   -13.809 1.00 0.00 ? 3  LYS A HZ1  15 
ATOM 10037 H HZ2  . LYS A 1 3  ? 28.791 2.224   -14.338 1.00 0.00 ? 3  LYS A HZ2  15 
ATOM 10038 H HZ3  . LYS A 1 3  ? 30.095 1.825   -15.356 1.00 0.00 ? 3  LYS A HZ3  15 
ATOM 10039 N N    . GLU A 1 4  ? 28.979 -0.547  -8.018  1.00 0.00 ? 4  GLU A N    15 
ATOM 10040 C CA   . GLU A 1 4  ? 27.820 -0.147  -7.231  1.00 0.00 ? 4  GLU A CA   15 
ATOM 10041 C C    . GLU A 1 4  ? 28.194 0.156   -5.774  1.00 0.00 ? 4  GLU A C    15 
ATOM 10042 O O    . GLU A 1 4  ? 27.731 1.112   -5.174  1.00 0.00 ? 4  GLU A O    15 
ATOM 10043 C CB   . GLU A 1 4  ? 26.800 -1.296  -7.256  1.00 0.00 ? 4  GLU A CB   15 
ATOM 10044 C CG   . GLU A 1 4  ? 25.431 -0.798  -7.707  1.00 0.00 ? 4  GLU A CG   15 
ATOM 10045 C CD   . GLU A 1 4  ? 24.383 -1.909  -7.551  1.00 0.00 ? 4  GLU A CD   15 
ATOM 10046 O OE1  . GLU A 1 4  ? 23.773 -1.997  -6.485  1.00 0.00 ? 4  GLU A OE1  15 
ATOM 10047 O OE2  . GLU A 1 4  ? 24.190 -2.676  -8.494  1.00 0.00 ? 4  GLU A OE2  15 
ATOM 10048 H H    . GLU A 1 4  ? 29.061 -1.490  -8.334  1.00 0.00 ? 4  GLU A H    15 
ATOM 10049 H HA   . GLU A 1 4  ? 27.434 0.767   -7.691  1.00 0.00 ? 4  GLU A HA   15 
ATOM 10050 H HB2  . GLU A 1 4  ? 27.142 -2.087  -7.922  1.00 0.00 ? 4  GLU A HB2  15 
ATOM 10051 H HB3  . GLU A 1 4  ? 26.715 -1.785  -6.283  1.00 0.00 ? 4  GLU A HB3  15 
ATOM 10052 H HG2  . GLU A 1 4  ? 25.142 0.071   -7.117  1.00 0.00 ? 4  GLU A HG2  15 
ATOM 10053 H HG3  . GLU A 1 4  ? 25.484 -0.470  -8.745  1.00 0.00 ? 4  GLU A HG3  15 
ATOM 10054 N N    . ALA A 1 5  ? 29.065 -0.738  -5.256  1.00 0.00 ? 5  ALA A N    15 
ATOM 10055 C CA   . ALA A 1 5  ? 29.557 -0.512  -3.910  1.00 0.00 ? 5  ALA A CA   15 
ATOM 10056 C C    . ALA A 1 5  ? 30.612 0.592   -3.913  1.00 0.00 ? 5  ALA A C    15 
ATOM 10057 O O    . ALA A 1 5  ? 30.908 1.122   -2.851  1.00 0.00 ? 5  ALA A O    15 
ATOM 10058 C CB   . ALA A 1 5  ? 30.124 -1.793  -3.297  1.00 0.00 ? 5  ALA A CB   15 
ATOM 10059 H H    . ALA A 1 5  ? 29.413 -1.496  -5.800  1.00 0.00 ? 5  ALA A H    15 
ATOM 10060 H HA   . ALA A 1 5  ? 28.712 -0.191  -3.302  1.00 0.00 ? 5  ALA A HA   15 
ATOM 10061 H HB1  . ALA A 1 5  ? 31.031 -2.124  -3.805  1.00 0.00 ? 5  ALA A HB1  15 
ATOM 10062 H HB2  . ALA A 1 5  ? 29.398 -2.605  -3.325  1.00 0.00 ? 5  ALA A HB2  15 
ATOM 10063 H HB3  . ALA A 1 5  ? 30.364 -1.623  -2.247  1.00 0.00 ? 5  ALA A HB3  15 
ATOM 10064 N N    . ILE A 1 6  ? 31.173 0.938   -5.090  1.00 0.00 ? 6  ILE A N    15 
ATOM 10065 C CA   . ILE A 1 6  ? 32.286 1.895   -5.082  1.00 0.00 ? 6  ILE A CA   15 
ATOM 10066 C C    . ILE A 1 6  ? 31.789 3.302   -4.753  1.00 0.00 ? 6  ILE A C    15 
ATOM 10067 O O    . ILE A 1 6  ? 32.394 3.988   -3.942  1.00 0.00 ? 6  ILE A O    15 
ATOM 10068 C CB   . ILE A 1 6  ? 33.147 1.857   -6.355  1.00 0.00 ? 6  ILE A CB   15 
ATOM 10069 C CG1  . ILE A 1 6  ? 33.544 0.420   -6.687  1.00 0.00 ? 6  ILE A CG1  15 
ATOM 10070 C CG2  . ILE A 1 6  ? 34.421 2.714   -6.231  1.00 0.00 ? 6  ILE A CG2  15 
ATOM 10071 C CD1  . ILE A 1 6  ? 34.345 0.315   -7.991  1.00 0.00 ? 6  ILE A CD1  15 
ATOM 10072 H H    . ILE A 1 6  ? 30.847 0.546   -5.952  1.00 0.00 ? 6  ILE A H    15 
ATOM 10073 H HA   . ILE A 1 6  ? 32.930 1.594   -4.267  1.00 0.00 ? 6  ILE A HA   15 
ATOM 10074 H HB   . ILE A 1 6  ? 32.545 2.250   -7.173  1.00 0.00 ? 6  ILE A HB   15 
ATOM 10075 H HG12 . ILE A 1 6  ? 34.105 -0.020  -5.863  1.00 0.00 ? 6  ILE A HG12 15 
ATOM 10076 H HG13 . ILE A 1 6  ? 32.640 -0.168  -6.761  1.00 0.00 ? 6  ILE A HG13 15 
ATOM 10077 H HG21 . ILE A 1 6  ? 35.327 2.112   -6.220  1.00 0.00 ? 6  ILE A HG21 15 
ATOM 10078 H HG22 . ILE A 1 6  ? 34.443 3.264   -5.297  1.00 0.00 ? 6  ILE A HG22 15 
ATOM 10079 H HG23 . ILE A 1 6  ? 34.507 3.418   -7.059  1.00 0.00 ? 6  ILE A HG23 15 
ATOM 10080 H HD11 . ILE A 1 6  ? 35.351 0.713   -7.881  1.00 0.00 ? 6  ILE A HD11 15 
ATOM 10081 H HD12 . ILE A 1 6  ? 33.903 0.881   -8.808  1.00 0.00 ? 6  ILE A HD12 15 
ATOM 10082 H HD13 . ILE A 1 6  ? 34.402 -0.729  -8.296  1.00 0.00 ? 6  ILE A HD13 15 
ATOM 10083 N N    . GLU A 1 7  ? 30.662 3.687   -5.365  1.00 0.00 ? 7  GLU A N    15 
ATOM 10084 C CA   . GLU A 1 7  ? 30.063 4.985   -5.055  1.00 0.00 ? 7  GLU A CA   15 
ATOM 10085 C C    . GLU A 1 7  ? 29.472 5.039   -3.628  1.00 0.00 ? 7  GLU A C    15 
ATOM 10086 O O    . GLU A 1 7  ? 29.234 6.111   -3.099  1.00 0.00 ? 7  GLU A O    15 
ATOM 10087 C CB   . GLU A 1 7  ? 28.997 5.298   -6.114  1.00 0.00 ? 7  GLU A CB   15 
ATOM 10088 C CG   . GLU A 1 7  ? 27.863 4.255   -6.162  1.00 0.00 ? 7  GLU A CG   15 
ATOM 10089 C CD   . GLU A 1 7  ? 26.979 4.365   -7.421  1.00 0.00 ? 7  GLU A CD   15 
ATOM 10090 O OE1  . GLU A 1 7  ? 27.504 4.651   -8.496  1.00 0.00 ? 7  GLU A OE1  15 
ATOM 10091 O OE2  . GLU A 1 7  ? 25.770 4.151   -7.315  1.00 0.00 ? 7  GLU A OE2  15 
ATOM 10092 H H    . GLU A 1 7  ? 30.225 3.075   -6.024  1.00 0.00 ? 7  GLU A H    15 
ATOM 10093 H HA   . GLU A 1 7  ? 30.860 5.728   -5.107  1.00 0.00 ? 7  GLU A HA   15 
ATOM 10094 H HB2  . GLU A 1 7  ? 28.574 6.290   -5.942  1.00 0.00 ? 7  GLU A HB2  15 
ATOM 10095 H HB3  . GLU A 1 7  ? 29.504 5.338   -7.078  1.00 0.00 ? 7  GLU A HB3  15 
ATOM 10096 H HG2  . GLU A 1 7  ? 28.264 3.245   -6.138  1.00 0.00 ? 7  GLU A HG2  15 
ATOM 10097 H HG3  . GLU A 1 7  ? 27.244 4.360   -5.272  1.00 0.00 ? 7  GLU A HG3  15 
ATOM 10098 N N    . ARG A 1 8  ? 29.269 3.834   -3.047  1.00 0.00 ? 8  ARG A N    15 
ATOM 10099 C CA   . ARG A 1 8  ? 28.728 3.714   -1.696  1.00 0.00 ? 8  ARG A CA   15 
ATOM 10100 C C    . ARG A 1 8  ? 29.845 3.908   -0.659  1.00 0.00 ? 8  ARG A C    15 
ATOM 10101 O O    . ARG A 1 8  ? 29.766 4.792   0.176   1.00 0.00 ? 8  ARG A O    15 
ATOM 10102 C CB   . ARG A 1 8  ? 28.030 2.347   -1.576  1.00 0.00 ? 8  ARG A CB   15 
ATOM 10103 C CG   . ARG A 1 8  ? 26.648 2.419   -0.908  1.00 0.00 ? 8  ARG A CG   15 
ATOM 10104 C CD   . ARG A 1 8  ? 25.628 1.473   -1.558  1.00 0.00 ? 8  ARG A CD   15 
ATOM 10105 N NE   . ARG A 1 8  ? 24.851 2.178   -2.577  1.00 0.00 ? 8  ARG A NE   15 
ATOM 10106 C CZ   . ARG A 1 8  ? 23.800 2.975   -2.256  1.00 0.00 ? 8  ARG A CZ   15 
ATOM 10107 N NH1  . ARG A 1 8  ? 23.438 3.151   -0.987  1.00 0.00 ? 8  ARG A NH1  15 
ATOM 10108 N NH2  . ARG A 1 8  ? 23.122 3.591   -3.219  1.00 0.00 ? 8  ARG A NH2  15 
ATOM 10109 H H    . ARG A 1 8  ? 29.487 2.997   -3.543  1.00 0.00 ? 8  ARG A H    15 
ATOM 10110 H HA   . ARG A 1 8  ? 28.011 4.526   -1.573  1.00 0.00 ? 8  ARG A HA   15 
ATOM 10111 H HB2  . ARG A 1 8  ? 27.917 1.942   -2.579  1.00 0.00 ? 8  ARG A HB2  15 
ATOM 10112 H HB3  . ARG A 1 8  ? 28.644 1.605   -1.062  1.00 0.00 ? 8  ARG A HB3  15 
ATOM 10113 H HG2  . ARG A 1 8  ? 26.746 2.190   0.151   1.00 0.00 ? 8  ARG A HG2  15 
ATOM 10114 H HG3  . ARG A 1 8  ? 26.252 3.433   -0.938  1.00 0.00 ? 8  ARG A HG3  15 
ATOM 10115 H HD2  . ARG A 1 8  ? 26.105 0.623   -2.047  1.00 0.00 ? 8  ARG A HD2  15 
ATOM 10116 H HD3  . ARG A 1 8  ? 24.939 1.064   -0.820  1.00 0.00 ? 8  ARG A HD3  15 
ATOM 10117 H HE   . ARG A 1 8  ? 25.112 2.082   -3.537  1.00 0.00 ? 8  ARG A HE   15 
ATOM 10118 H HH11 . ARG A 1 8  ? 23.949 2.702   -0.256  1.00 0.00 ? 8  ARG A HH11 15 
ATOM 10119 H HH12 . ARG A 1 8  ? 22.654 3.735   -0.765  1.00 0.00 ? 8  ARG A HH12 15 
ATOM 10120 H HH21 . ARG A 1 8  ? 23.388 3.479   -4.177  1.00 0.00 ? 8  ARG A HH21 15 
ATOM 10121 H HH22 . ARG A 1 8  ? 22.341 4.170   -2.978  1.00 0.00 ? 8  ARG A HH22 15 
ATOM 10122 N N    . LEU A 1 9  ? 30.878 3.047   -0.810  1.00 0.00 ? 9  LEU A N    15 
ATOM 10123 C CA   . LEU A 1 9  ? 32.136 3.043   -0.062  1.00 0.00 ? 9  LEU A CA   15 
ATOM 10124 C C    . LEU A 1 9  ? 32.739 4.475   -0.059  1.00 0.00 ? 9  LEU A C    15 
ATOM 10125 O O    . LEU A 1 9  ? 33.049 5.030   0.985   1.00 0.00 ? 9  LEU A O    15 
ATOM 10126 C CB   . LEU A 1 9  ? 33.086 1.988   -0.656  1.00 0.00 ? 9  LEU A CB   15 
ATOM 10127 C CG   . LEU A 1 9  ? 32.551 0.541   -0.612  1.00 0.00 ? 9  LEU A CG   15 
ATOM 10128 C CD1  . LEU A 1 9  ? 33.124 -0.263  -1.782  1.00 0.00 ? 9  LEU A CD1  15 
ATOM 10129 C CD2  . LEU A 1 9  ? 32.818 -0.179  0.709   1.00 0.00 ? 9  LEU A CD2  15 
ATOM 10130 H H    . LEU A 1 9  ? 30.761 2.345   -1.497  1.00 0.00 ? 9  LEU A H    15 
ATOM 10131 H HA   . LEU A 1 9  ? 31.914 2.706   0.945   1.00 0.00 ? 9  LEU A HA   15 
ATOM 10132 H HB2  . LEU A 1 9  ? 33.280 2.274   -1.687  1.00 0.00 ? 9  LEU A HB2  15 
ATOM 10133 H HB3  . LEU A 1 9  ? 34.045 2.001   -0.144  1.00 0.00 ? 9  LEU A HB3  15 
ATOM 10134 H HG   . LEU A 1 9  ? 31.468 0.550   -0.694  1.00 0.00 ? 9  LEU A HG   15 
ATOM 10135 H HD11 . LEU A 1 9  ? 33.184 0.308   -2.698  1.00 0.00 ? 9  LEU A HD11 15 
ATOM 10136 H HD12 . LEU A 1 9  ? 32.476 -1.099  -2.010  1.00 0.00 ? 9  LEU A HD12 15 
ATOM 10137 H HD13 . LEU A 1 9  ? 34.137 -0.607  -1.574  1.00 0.00 ? 9  LEU A HD13 15 
ATOM 10138 H HD21 . LEU A 1 9  ? 33.820 -0.601  0.720   1.00 0.00 ? 9  LEU A HD21 15 
ATOM 10139 H HD22 . LEU A 1 9  ? 32.119 -1.001  0.852   1.00 0.00 ? 9  LEU A HD22 15 
ATOM 10140 H HD23 . LEU A 1 9  ? 32.711 0.498   1.554   1.00 0.00 ? 9  LEU A HD23 15 
ATOM 10141 N N    . LYS A 1 10 ? 32.828 5.061   -1.266  1.00 0.00 ? 10 LYS A N    15 
ATOM 10142 C CA   . LYS A 1 10 ? 33.333 6.434   -1.426  1.00 0.00 ? 10 LYS A CA   15 
ATOM 10143 C C    . LYS A 1 10 ? 32.433 7.480   -0.739  1.00 0.00 ? 10 LYS A C    15 
ATOM 10144 O O    . LYS A 1 10 ? 32.912 8.471   -0.213  1.00 0.00 ? 10 LYS A O    15 
ATOM 10145 C CB   . LYS A 1 10 ? 33.381 6.785   -2.913  1.00 0.00 ? 10 LYS A CB   15 
ATOM 10146 C CG   . LYS A 1 10 ? 34.412 5.978   -3.685  1.00 0.00 ? 10 LYS A CG   15 
ATOM 10147 C CD   . LYS A 1 10 ? 34.175 6.082   -5.189  1.00 0.00 ? 10 LYS A CD   15 
ATOM 10148 C CE   . LYS A 1 10 ? 34.668 7.400   -5.779  1.00 0.00 ? 10 LYS A CE   15 
ATOM 10149 N NZ   . LYS A 1 10 ? 34.405 7.400   -7.211  1.00 0.00 ? 10 LYS A NZ   15 
ATOM 10150 H H    . LYS A 1 10 ? 32.489 4.549   -2.051  1.00 0.00 ? 10 LYS A H    15 
ATOM 10151 H HA   . LYS A 1 10 ? 34.330 6.483   -0.986  1.00 0.00 ? 10 LYS A HA   15 
ATOM 10152 H HB2  . LYS A 1 10 ? 32.394 6.639   -3.350  1.00 0.00 ? 10 LYS A HB2  15 
ATOM 10153 H HB3  . LYS A 1 10 ? 33.623 7.839   -3.048  1.00 0.00 ? 10 LYS A HB3  15 
ATOM 10154 H HG2  . LYS A 1 10 ? 35.403 6.328   -3.411  1.00 0.00 ? 10 LYS A HG2  15 
ATOM 10155 H HG3  . LYS A 1 10 ? 34.380 4.934   -3.390  1.00 0.00 ? 10 LYS A HG3  15 
ATOM 10156 H HD2  . LYS A 1 10 ? 34.692 5.263   -5.671  1.00 0.00 ? 10 LYS A HD2  15 
ATOM 10157 H HD3  . LYS A 1 10 ? 33.118 5.947   -5.432  1.00 0.00 ? 10 LYS A HD3  15 
ATOM 10158 H HE2  . LYS A 1 10 ? 34.148 8.247   -5.330  1.00 0.00 ? 10 LYS A HE2  15 
ATOM 10159 H HE3  . LYS A 1 10 ? 35.739 7.545   -5.621  1.00 0.00 ? 10 LYS A HE3  15 
ATOM 10160 H HZ1  . LYS A 1 10 ? 35.139 6.833   -7.684  1.00 0.00 ? 10 LYS A HZ1  15 
ATOM 10161 H HZ2  . LYS A 1 10 ? 34.409 8.368   -7.590  1.00 0.00 ? 10 LYS A HZ2  15 
ATOM 10162 H HZ3  . LYS A 1 10 ? 33.480 6.961   -7.387  1.00 0.00 ? 10 LYS A HZ3  15 
ATOM 10163 N N    . ALA A 1 11 ? 31.111 7.199   -0.796  1.00 0.00 ? 11 ALA A N    15 
ATOM 10164 C CA   . ALA A 1 11 ? 30.124 8.115   -0.220  1.00 0.00 ? 11 ALA A CA   15 
ATOM 10165 C C    . ALA A 1 11 ? 30.224 8.208   1.315   1.00 0.00 ? 11 ALA A C    15 
ATOM 10166 O O    . ALA A 1 11 ? 29.761 9.176   1.900   1.00 0.00 ? 11 ALA A O    15 
ATOM 10167 C CB   . ALA A 1 11 ? 28.702 7.708   -0.625  1.00 0.00 ? 11 ALA A CB   15 
ATOM 10168 H H    . ALA A 1 11 ? 30.815 6.367   -1.256  1.00 0.00 ? 11 ALA A H    15 
ATOM 10169 H HA   . ALA A 1 11 ? 30.333 9.102   -0.635  1.00 0.00 ? 11 ALA A HA   15 
ATOM 10170 H HB1  . ALA A 1 11 ? 28.517 7.959   -1.668  1.00 0.00 ? 11 ALA A HB1  15 
ATOM 10171 H HB2  . ALA A 1 11 ? 27.952 8.229   -0.029  1.00 0.00 ? 11 ALA A HB2  15 
ATOM 10172 H HB3  . ALA A 1 11 ? 28.520 6.643   -0.505  1.00 0.00 ? 11 ALA A HB3  15 
ATOM 10173 N N    . LEU A 1 12 ? 30.866 7.186   1.929   1.00 0.00 ? 12 LEU A N    15 
ATOM 10174 C CA   . LEU A 1 12 ? 31.101 7.219   3.370   1.00 0.00 ? 12 LEU A CA   15 
ATOM 10175 C C    . LEU A 1 12 ? 32.288 8.160   3.742   1.00 0.00 ? 12 LEU A C    15 
ATOM 10176 O O    . LEU A 1 12 ? 32.665 8.234   4.903   1.00 0.00 ? 12 LEU A O    15 
ATOM 10177 C CB   . LEU A 1 12 ? 31.399 5.795   3.872   1.00 0.00 ? 12 LEU A CB   15 
ATOM 10178 C CG   . LEU A 1 12 ? 30.236 4.773   3.894   1.00 0.00 ? 12 LEU A CG   15 
ATOM 10179 C CD1  . LEU A 1 12 ? 30.379 3.745   2.772   1.00 0.00 ? 12 LEU A CD1  15 
ATOM 10180 C CD2  . LEU A 1 12 ? 30.210 4.006   5.219   1.00 0.00 ? 12 LEU A CD2  15 
ATOM 10181 H H    . LEU A 1 12 ? 31.220 6.412   1.407   1.00 0.00 ? 12 LEU A H    15 
ATOM 10182 H HA   . LEU A 1 12 ? 30.200 7.603   3.850   1.00 0.00 ? 12 LEU A HA   15 
ATOM 10183 H HB2  . LEU A 1 12 ? 32.198 5.411   3.251   1.00 0.00 ? 12 LEU A HB2  15 
ATOM 10184 H HB3  . LEU A 1 12 ? 31.804 5.863   4.877   1.00 0.00 ? 12 LEU A HB3  15 
ATOM 10185 H HG   . LEU A 1 12 ? 29.290 5.302   3.774   1.00 0.00 ? 12 LEU A HG   15 
ATOM 10186 H HD11 . LEU A 1 12 ? 30.942 4.207   1.977   1.00 0.00 ? 12 LEU A HD11 15 
ATOM 10187 H HD12 . LEU A 1 12 ? 29.413 3.418   2.386   1.00 0.00 ? 12 LEU A HD12 15 
ATOM 10188 H HD13 . LEU A 1 12 ? 30.945 2.861   3.076   1.00 0.00 ? 12 LEU A HD13 15 
ATOM 10189 H HD21 . LEU A 1 12 ? 31.113 3.409   5.321   1.00 0.00 ? 12 LEU A HD21 15 
ATOM 10190 H HD22 . LEU A 1 12 ? 29.371 3.312   5.258   1.00 0.00 ? 12 LEU A HD22 15 
ATOM 10191 H HD23 . LEU A 1 12 ? 30.160 4.682   6.071   1.00 0.00 ? 12 LEU A HD23 15 
ATOM 10192 N N    . GLY A 1 13 ? 32.840 8.866   2.722   1.00 0.00 ? 13 GLY A N    15 
ATOM 10193 C CA   . GLY A 1 13 ? 33.909 9.849   2.928   1.00 0.00 ? 13 GLY A CA   15 
ATOM 10194 C C    . GLY A 1 13 ? 35.296 9.304   2.554   1.00 0.00 ? 13 GLY A C    15 
ATOM 10195 O O    . GLY A 1 13 ? 36.308 9.779   3.054   1.00 0.00 ? 13 GLY A O    15 
ATOM 10196 H H    . GLY A 1 13 ? 32.491 8.751   1.797   1.00 0.00 ? 13 GLY A H    15 
ATOM 10197 H HA2  . GLY A 1 13 ? 33.680 10.710  2.299   1.00 0.00 ? 13 GLY A HA2  15 
ATOM 10198 H HA3  . GLY A 1 13 ? 33.911 10.170  3.970   1.00 0.00 ? 13 GLY A HA3  15 
ATOM 10199 N N    . PHE A 1 14 ? 35.271 8.273   1.672   1.00 0.00 ? 14 PHE A N    15 
ATOM 10200 C CA   . PHE A 1 14 ? 36.483 7.540   1.302   1.00 0.00 ? 14 PHE A CA   15 
ATOM 10201 C C    . PHE A 1 14 ? 36.880 7.938   -0.140  1.00 0.00 ? 14 PHE A C    15 
ATOM 10202 O O    . PHE A 1 14 ? 36.687 9.083   -0.541  1.00 0.00 ? 14 PHE A O    15 
ATOM 10203 C CB   . PHE A 1 14 ? 36.237 6.022   1.487   1.00 0.00 ? 14 PHE A CB   15 
ATOM 10204 C CG   . PHE A 1 14 ? 35.666 5.654   2.842   1.00 0.00 ? 14 PHE A CG   15 
ATOM 10205 C CD1  . PHE A 1 14 ? 35.856 6.456   3.968   1.00 0.00 ? 14 PHE A CD1  15 
ATOM 10206 C CD2  . PHE A 1 14 ? 34.874 4.515   2.962   1.00 0.00 ? 14 PHE A CD2  15 
ATOM 10207 C CE1  . PHE A 1 14 ? 35.170 6.192   5.142   1.00 0.00 ? 14 PHE A CE1  15 
ATOM 10208 C CE2  . PHE A 1 14 ? 34.193 4.246   4.135   1.00 0.00 ? 14 PHE A CE2  15 
ATOM 10209 C CZ   . PHE A 1 14 ? 34.314 5.115   5.216   1.00 0.00 ? 14 PHE A CZ   15 
ATOM 10210 H H    . PHE A 1 14 ? 34.402 7.972   1.286   1.00 0.00 ? 14 PHE A H    15 
ATOM 10211 H HA   . PHE A 1 14 ? 37.285 7.872   1.961   1.00 0.00 ? 14 PHE A HA   15 
ATOM 10212 H HB2  . PHE A 1 14 ? 35.537 5.689   0.717   1.00 0.00 ? 14 PHE A HB2  15 
ATOM 10213 H HB3  . PHE A 1 14 ? 37.151 5.455   1.344   1.00 0.00 ? 14 PHE A HB3  15 
ATOM 10214 H HD1  . PHE A 1 14 ? 36.516 7.311   3.960   1.00 0.00 ? 14 PHE A HD1  15 
ATOM 10215 H HD2  . PHE A 1 14 ? 34.774 3.830   2.127   1.00 0.00 ? 14 PHE A HD2  15 
ATOM 10216 H HE1  . PHE A 1 14 ? 35.284 6.836   6.000   1.00 0.00 ? 14 PHE A HE1  15 
ATOM 10217 H HE2  . PHE A 1 14 ? 33.541 3.386   4.186   1.00 0.00 ? 14 PHE A HE2  15 
ATOM 10218 H HZ   . PHE A 1 14 ? 33.733 4.977   6.117   1.00 0.00 ? 14 PHE A HZ   15 
ATOM 10219 N N    . GLU A 1 15 ? 37.443 6.959   -0.881  1.00 0.00 ? 15 GLU A N    15 
ATOM 10220 C CA   . GLU A 1 15 ? 37.952 7.192   -2.236  1.00 0.00 ? 15 GLU A CA   15 
ATOM 10221 C C    . GLU A 1 15 ? 38.074 5.839   -2.939  1.00 0.00 ? 15 GLU A C    15 
ATOM 10222 O O    . GLU A 1 15 ? 38.487 4.861   -2.324  1.00 0.00 ? 15 GLU A O    15 
ATOM 10223 C CB   . GLU A 1 15 ? 39.342 7.859   -2.196  1.00 0.00 ? 15 GLU A CB   15 
ATOM 10224 C CG   . GLU A 1 15 ? 39.658 8.663   -3.471  1.00 0.00 ? 15 GLU A CG   15 
ATOM 10225 C CD   . GLU A 1 15 ? 39.301 10.161  -3.374  1.00 0.00 ? 15 GLU A CD   15 
ATOM 10226 O OE1  . GLU A 1 15 ? 38.551 10.548  -2.477  1.00 0.00 ? 15 GLU A OE1  15 
ATOM 10227 O OE2  . GLU A 1 15 ? 39.788 10.931  -4.202  1.00 0.00 ? 15 GLU A OE2  15 
ATOM 10228 H H    . GLU A 1 15 ? 37.533 6.046   -0.488  1.00 0.00 ? 15 GLU A H    15 
ATOM 10229 H HA   . GLU A 1 15 ? 37.228 7.816   -2.763  1.00 0.00 ? 15 GLU A HA   15 
ATOM 10230 H HB2  . GLU A 1 15 ? 39.430 8.481   -1.308  1.00 0.00 ? 15 GLU A HB2  15 
ATOM 10231 H HB3  . GLU A 1 15 ? 40.134 7.119   -2.074  1.00 0.00 ? 15 GLU A HB3  15 
ATOM 10232 H HG2  . GLU A 1 15 ? 40.719 8.582   -3.695  1.00 0.00 ? 15 GLU A HG2  15 
ATOM 10233 H HG3  . GLU A 1 15 ? 39.155 8.236   -4.337  1.00 0.00 ? 15 GLU A HG3  15 
ATOM 10234 N N    . GLU A 1 16 ? 37.709 5.848   -4.238  1.00 0.00 ? 16 GLU A N    15 
ATOM 10235 C CA   . GLU A 1 16 ? 37.651 4.686   -5.130  1.00 0.00 ? 16 GLU A CA   15 
ATOM 10236 C C    . GLU A 1 16 ? 38.872 3.726   -5.031  1.00 0.00 ? 16 GLU A C    15 
ATOM 10237 O O    . GLU A 1 16 ? 38.758 2.545   -5.324  1.00 0.00 ? 16 GLU A O    15 
ATOM 10238 C CB   . GLU A 1 16 ? 37.487 5.211   -6.565  1.00 0.00 ? 16 GLU A CB   15 
ATOM 10239 C CG   . GLU A 1 16 ? 37.703 4.166   -7.678  1.00 0.00 ? 16 GLU A CG   15 
ATOM 10240 C CD   . GLU A 1 16 ? 37.531 4.759   -9.086  1.00 0.00 ? 16 GLU A CD   15 
ATOM 10241 O OE1  . GLU A 1 16 ? 37.668 5.973   -9.237  1.00 0.00 ? 16 GLU A OE1  15 
ATOM 10242 O OE2  . GLU A 1 16 ? 37.275 4.000   -10.020 1.00 0.00 ? 16 GLU A OE2  15 
ATOM 10243 H H    . GLU A 1 16 ? 37.391 6.721   -4.603  1.00 0.00 ? 16 GLU A H    15 
ATOM 10244 H HA   . GLU A 1 16 ? 36.746 4.158   -4.838  1.00 0.00 ? 16 GLU A HA   15 
ATOM 10245 H HB2  . GLU A 1 16 ? 36.491 5.638   -6.692  1.00 0.00 ? 16 GLU A HB2  15 
ATOM 10246 H HB3  . GLU A 1 16 ? 38.205 6.023   -6.684  1.00 0.00 ? 16 GLU A HB3  15 
ATOM 10247 H HG2  . GLU A 1 16 ? 38.721 3.783   -7.639  1.00 0.00 ? 16 GLU A HG2  15 
ATOM 10248 H HG3  . GLU A 1 16 ? 37.028 3.319   -7.553  1.00 0.00 ? 16 GLU A HG3  15 
ATOM 10249 N N    . SER A 1 17 ? 40.026 4.281   -4.621  1.00 0.00 ? 17 SER A N    15 
ATOM 10250 C CA   . SER A 1 17 ? 41.242 3.487   -4.521  1.00 0.00 ? 17 SER A CA   15 
ATOM 10251 C C    . SER A 1 17 ? 41.279 2.715   -3.196  1.00 0.00 ? 17 SER A C    15 
ATOM 10252 O O    . SER A 1 17 ? 41.498 1.515   -3.191  1.00 0.00 ? 17 SER A O    15 
ATOM 10253 C CB   . SER A 1 17 ? 42.444 4.436   -4.609  1.00 0.00 ? 17 SER A CB   15 
ATOM 10254 O OG   . SER A 1 17 ? 42.973 4.526   -5.918  1.00 0.00 ? 17 SER A OG   15 
ATOM 10255 H H    . SER A 1 17 ? 40.054 5.238   -4.347  1.00 0.00 ? 17 SER A H    15 
ATOM 10256 H HA   . SER A 1 17 ? 41.236 2.755   -5.335  1.00 0.00 ? 17 SER A HA   15 
ATOM 10257 H HB2  . SER A 1 17 ? 42.185 5.430   -4.231  1.00 0.00 ? 17 SER A HB2  15 
ATOM 10258 H HB3  . SER A 1 17 ? 43.257 4.091   -3.974  1.00 0.00 ? 17 SER A HB3  15 
ATOM 10259 H HG   . SER A 1 17 ? 42.280 4.747   -6.531  1.00 0.00 ? 17 SER A HG   15 
ATOM 10260 N N    . LEU A 1 18 ? 41.049 3.460   -2.085  1.00 0.00 ? 18 LEU A N    15 
ATOM 10261 C CA   . LEU A 1 18 ? 41.010 2.789   -0.779  1.00 0.00 ? 18 LEU A CA   15 
ATOM 10262 C C    . LEU A 1 18 ? 39.804 1.864   -0.687  1.00 0.00 ? 18 LEU A C    15 
ATOM 10263 O O    . LEU A 1 18 ? 39.787 0.958   0.150   1.00 0.00 ? 18 LEU A O    15 
ATOM 10264 C CB   . LEU A 1 18 ? 41.108 3.782   0.398   1.00 0.00 ? 18 LEU A CB   15 
ATOM 10265 C CG   . LEU A 1 18 ? 39.818 4.433   0.951   1.00 0.00 ? 18 LEU A CG   15 
ATOM 10266 C CD1  . LEU A 1 18 ? 39.539 4.033   2.411   1.00 0.00 ? 18 LEU A CD1  15 
ATOM 10267 C CD2  . LEU A 1 18 ? 39.904 5.959   0.868   1.00 0.00 ? 18 LEU A CD2  15 
ATOM 10268 H H    . LEU A 1 18 ? 40.854 4.434   -2.172  1.00 0.00 ? 18 LEU A H    15 
ATOM 10269 H HA   . LEU A 1 18 ? 41.896 2.157   -0.738  1.00 0.00 ? 18 LEU A HA   15 
ATOM 10270 H HB2  . LEU A 1 18 ? 41.585 3.251   1.214   1.00 0.00 ? 18 LEU A HB2  15 
ATOM 10271 H HB3  . LEU A 1 18 ? 41.832 4.548   0.133   1.00 0.00 ? 18 LEU A HB3  15 
ATOM 10272 H HG   . LEU A 1 18 ? 38.973 4.113   0.347   1.00 0.00 ? 18 LEU A HG   15 
ATOM 10273 H HD11 . LEU A 1 18 ? 39.516 2.950   2.544   1.00 0.00 ? 18 LEU A HD11 15 
ATOM 10274 H HD12 . LEU A 1 18 ? 38.588 4.451   2.742   1.00 0.00 ? 18 LEU A HD12 15 
ATOM 10275 H HD13 . LEU A 1 18 ? 40.295 4.429   3.086   1.00 0.00 ? 18 LEU A HD13 15 
ATOM 10276 H HD21 . LEU A 1 18 ? 40.790 6.336   1.377   1.00 0.00 ? 18 LEU A HD21 15 
ATOM 10277 H HD22 . LEU A 1 18 ? 39.045 6.442   1.330   1.00 0.00 ? 18 LEU A HD22 15 
ATOM 10278 H HD23 . LEU A 1 18 ? 39.965 6.266   -0.170  1.00 0.00 ? 18 LEU A HD23 15 
ATOM 10279 N N    . VAL A 1 19 ? 38.839 2.130   -1.572  1.00 0.00 ? 19 VAL A N    15 
ATOM 10280 C CA   . VAL A 1 19 ? 37.558 1.455   -1.698  1.00 0.00 ? 19 VAL A CA   15 
ATOM 10281 C C    . VAL A 1 19 ? 37.727 0.113   -2.404  1.00 0.00 ? 19 VAL A C    15 
ATOM 10282 O O    . VAL A 1 19 ? 37.372 -0.920  -1.867  1.00 0.00 ? 19 VAL A O    15 
ATOM 10283 C CB   . VAL A 1 19 ? 36.647 2.412   -2.476  1.00 0.00 ? 19 VAL A CB   15 
ATOM 10284 C CG1  . VAL A 1 19 ? 35.531 1.712   -3.245  1.00 0.00 ? 19 VAL A CG1  15 
ATOM 10285 C CG2  . VAL A 1 19 ? 36.126 3.559   -1.593  1.00 0.00 ? 19 VAL A CG2  15 
ATOM 10286 H H    . VAL A 1 19 ? 39.000 2.867   -2.237  1.00 0.00 ? 19 VAL A H    15 
ATOM 10287 H HA   . VAL A 1 19 ? 37.157 1.239   -0.714  1.00 0.00 ? 19 VAL A HA   15 
ATOM 10288 H HB   . VAL A 1 19 ? 37.285 2.857   -3.232  1.00 0.00 ? 19 VAL A HB   15 
ATOM 10289 H HG11 . VAL A 1 19 ? 35.886 1.377   -4.219  1.00 0.00 ? 19 VAL A HG11 15 
ATOM 10290 H HG12 . VAL A 1 19 ? 34.683 2.371   -3.389  1.00 0.00 ? 19 VAL A HG12 15 
ATOM 10291 H HG13 . VAL A 1 19 ? 35.192 0.832   -2.716  1.00 0.00 ? 19 VAL A HG13 15 
ATOM 10292 H HG21 . VAL A 1 19 ? 36.822 3.804   -0.794  1.00 0.00 ? 19 VAL A HG21 15 
ATOM 10293 H HG22 . VAL A 1 19 ? 35.159 3.382   -1.142  1.00 0.00 ? 19 VAL A HG22 15 
ATOM 10294 H HG23 . VAL A 1 19 ? 36.006 4.456   -2.184  1.00 0.00 ? 19 VAL A HG23 15 
ATOM 10295 N N    . ILE A 1 20 ? 38.267 0.211   -3.633  1.00 0.00 ? 20 ILE A N    15 
ATOM 10296 C CA   . ILE A 1 20 ? 38.469 -0.962  -4.476  1.00 0.00 ? 20 ILE A CA   15 
ATOM 10297 C C    . ILE A 1 20 ? 39.382 -1.971  -3.791  1.00 0.00 ? 20 ILE A C    15 
ATOM 10298 O O    . ILE A 1 20 ? 39.075 -3.150  -3.755  1.00 0.00 ? 20 ILE A O    15 
ATOM 10299 C CB   . ILE A 1 20 ? 39.022 -0.521  -5.847  1.00 0.00 ? 20 ILE A CB   15 
ATOM 10300 C CG1  . ILE A 1 20 ? 37.883 -0.034  -6.750  1.00 0.00 ? 20 ILE A CG1  15 
ATOM 10301 C CG2  . ILE A 1 20 ? 39.855 -1.584  -6.585  1.00 0.00 ? 20 ILE A CG2  15 
ATOM 10302 C CD1  . ILE A 1 20 ? 36.903 -1.156  -7.124  1.00 0.00 ? 20 ILE A CD1  15 
ATOM 10303 H H    . ILE A 1 20 ? 38.521 1.111   -3.970  1.00 0.00 ? 20 ILE A H    15 
ATOM 10304 H HA   . ILE A 1 20 ? 37.494 -1.436  -4.578  1.00 0.00 ? 20 ILE A HA   15 
ATOM 10305 H HB   . ILE A 1 20 ? 39.703 0.310   -5.675  1.00 0.00 ? 20 ILE A HB   15 
ATOM 10306 H HG12 . ILE A 1 20 ? 37.341 0.786   -6.278  1.00 0.00 ? 20 ILE A HG12 15 
ATOM 10307 H HG13 . ILE A 1 20 ? 38.310 0.394   -7.656  1.00 0.00 ? 20 ILE A HG13 15 
ATOM 10308 H HG21 . ILE A 1 20 ? 40.122 -1.243  -7.583  1.00 0.00 ? 20 ILE A HG21 15 
ATOM 10309 H HG22 . ILE A 1 20 ? 39.307 -2.510  -6.705  1.00 0.00 ? 20 ILE A HG22 15 
ATOM 10310 H HG23 . ILE A 1 20 ? 40.778 -1.815  -6.056  1.00 0.00 ? 20 ILE A HG23 15 
ATOM 10311 H HD11 . ILE A 1 20 ? 37.319 -2.157  -7.053  1.00 0.00 ? 20 ILE A HD11 15 
ATOM 10312 H HD12 . ILE A 1 20 ? 36.586 -1.041  -8.159  1.00 0.00 ? 20 ILE A HD12 15 
ATOM 10313 H HD13 . ILE A 1 20 ? 36.037 -1.136  -6.462  1.00 0.00 ? 20 ILE A HD13 15 
ATOM 10314 N N    . GLN A 1 21 ? 40.492 -1.433  -3.254  1.00 0.00 ? 21 GLN A N    15 
ATOM 10315 C CA   . GLN A 1 21 ? 41.454 -2.263  -2.540  1.00 0.00 ? 21 GLN A CA   15 
ATOM 10316 C C    . GLN A 1 21 ? 40.874 -2.787  -1.209  1.00 0.00 ? 21 GLN A C    15 
ATOM 10317 O O    . GLN A 1 21 ? 41.233 -3.865  -0.765  1.00 0.00 ? 21 GLN A O    15 
ATOM 10318 C CB   . GLN A 1 21 ? 42.736 -1.449  -2.298  1.00 0.00 ? 21 GLN A CB   15 
ATOM 10319 C CG   . GLN A 1 21 ? 43.847 -2.221  -1.564  1.00 0.00 ? 21 GLN A CG   15 
ATOM 10320 C CD   . GLN A 1 21 ? 44.332 -3.463  -2.335  1.00 0.00 ? 21 GLN A CD   15 
ATOM 10321 O OE1  . GLN A 1 21 ? 44.044 -3.672  -3.499  1.00 0.00 ? 21 GLN A OE1  15 
ATOM 10322 N NE2  . GLN A 1 21 ? 45.112 -4.269  -1.583  1.00 0.00 ? 21 GLN A NE2  15 
ATOM 10323 H H    . GLN A 1 21 ? 40.651 -0.455  -3.367  1.00 0.00 ? 21 GLN A H    15 
ATOM 10324 H HA   . GLN A 1 21 ? 41.667 -3.115  -3.188  1.00 0.00 ? 21 GLN A HA   15 
ATOM 10325 H HB2  . GLN A 1 21 ? 43.127 -1.080  -3.247  1.00 0.00 ? 21 GLN A HB2  15 
ATOM 10326 H HB3  . GLN A 1 21 ? 42.495 -0.563  -1.710  1.00 0.00 ? 21 GLN A HB3  15 
ATOM 10327 H HG2  . GLN A 1 21 ? 44.699 -1.564  -1.409  1.00 0.00 ? 21 GLN A HG2  15 
ATOM 10328 H HG3  . GLN A 1 21 ? 43.518 -2.518  -0.570  1.00 0.00 ? 21 GLN A HG3  15 
ATOM 10329 H HE21 . GLN A 1 21 ? 45.331 -4.040  -0.633  1.00 0.00 ? 21 GLN A HE21 15 
ATOM 10330 H HE22 . GLN A 1 21 ? 45.485 -5.102  -1.976  1.00 0.00 ? 21 GLN A HE22 15 
ATOM 10331 N N    . ALA A 1 22 ? 39.961 -1.980  -0.618  1.00 0.00 ? 22 ALA A N    15 
ATOM 10332 C CA   . ALA A 1 22 ? 39.280 -2.393  0.611   1.00 0.00 ? 22 ALA A CA   15 
ATOM 10333 C C    . ALA A 1 22 ? 38.159 -3.396  0.352   1.00 0.00 ? 22 ALA A C    15 
ATOM 10334 O O    . ALA A 1 22 ? 37.705 -4.045  1.282   1.00 0.00 ? 22 ALA A O    15 
ATOM 10335 C CB   . ALA A 1 22 ? 38.588 -1.210  1.287   1.00 0.00 ? 22 ALA A CB   15 
ATOM 10336 H H    . ALA A 1 22 ? 39.708 -1.126  -1.065  1.00 0.00 ? 22 ALA A H    15 
ATOM 10337 H HA   . ALA A 1 22 ? 40.021 -2.855  1.264   1.00 0.00 ? 22 ALA A HA   15 
ATOM 10338 H HB1  . ALA A 1 22 ? 39.314 -0.526  1.707   1.00 0.00 ? 22 ALA A HB1  15 
ATOM 10339 H HB2  . ALA A 1 22 ? 37.963 -1.536  2.117   1.00 0.00 ? 22 ALA A HB2  15 
ATOM 10340 H HB3  . ALA A 1 22 ? 37.952 -0.655  0.597   1.00 0.00 ? 22 ALA A HB3  15 
ATOM 10341 N N    . TYR A 1 23 ? 37.724 -3.455  -0.923  1.00 0.00 ? 23 TYR A N    15 
ATOM 10342 C CA   . TYR A 1 23 ? 36.634 -4.343  -1.312  1.00 0.00 ? 23 TYR A CA   15 
ATOM 10343 C C    . TYR A 1 23 ? 37.231 -5.634  -1.882  1.00 0.00 ? 23 TYR A C    15 
ATOM 10344 O O    . TYR A 1 23 ? 36.616 -6.681  -1.779  1.00 0.00 ? 23 TYR A O    15 
ATOM 10345 C CB   . TYR A 1 23 ? 35.692 -3.642  -2.318  1.00 0.00 ? 23 TYR A CB   15 
ATOM 10346 C CG   . TYR A 1 23 ? 34.229 -3.955  -2.089  1.00 0.00 ? 23 TYR A CG   15 
ATOM 10347 C CD1  . TYR A 1 23 ? 33.513 -3.229  -1.158  1.00 0.00 ? 23 TYR A CD1  15 
ATOM 10348 C CD2  . TYR A 1 23 ? 33.556 -4.945  -2.794  1.00 0.00 ? 23 TYR A CD2  15 
ATOM 10349 C CE1  . TYR A 1 23 ? 32.156 -3.452  -0.936  1.00 0.00 ? 23 TYR A CE1  15 
ATOM 10350 C CE2  . TYR A 1 23 ? 32.211 -5.192  -2.579  1.00 0.00 ? 23 TYR A CE2  15 
ATOM 10351 C CZ   . TYR A 1 23 ? 31.495 -4.426  -1.658  1.00 0.00 ? 23 TYR A CZ   15 
ATOM 10352 O OH   . TYR A 1 23 ? 30.143 -4.617  -1.428  1.00 0.00 ? 23 TYR A OH   15 
ATOM 10353 H H    . TYR A 1 23 ? 38.162 -2.899  -1.626  1.00 0.00 ? 23 TYR A H    15 
ATOM 10354 H HA   . TYR A 1 23 ? 36.075 -4.591  -0.410  1.00 0.00 ? 23 TYR A HA   15 
ATOM 10355 H HB2  . TYR A 1 23 ? 35.774 -2.571  -2.167  1.00 0.00 ? 23 TYR A HB2  15 
ATOM 10356 H HB3  . TYR A 1 23 ? 35.980 -3.806  -3.358  1.00 0.00 ? 23 TYR A HB3  15 
ATOM 10357 H HD1  . TYR A 1 23 ? 34.020 -2.462  -0.600  1.00 0.00 ? 23 TYR A HD1  15 
ATOM 10358 H HD2  . TYR A 1 23 ? 34.084 -5.532  -3.518  1.00 0.00 ? 23 TYR A HD2  15 
ATOM 10359 H HE1  . TYR A 1 23 ? 31.625 -2.860  -0.204  1.00 0.00 ? 23 TYR A HE1  15 
ATOM 10360 H HE2  . TYR A 1 23 ? 31.764 -6.002  -3.135  1.00 0.00 ? 23 TYR A HE2  15 
ATOM 10361 H HH   . TYR A 1 23 ? 29.792 -5.322  -1.954  1.00 0.00 ? 23 TYR A HH   15 
ATOM 10362 N N    . PHE A 1 24 ? 38.444 -5.524  -2.466  1.00 0.00 ? 24 PHE A N    15 
ATOM 10363 C CA   . PHE A 1 24 ? 39.087 -6.660  -3.133  1.00 0.00 ? 24 PHE A CA   15 
ATOM 10364 C C    . PHE A 1 24 ? 39.910 -7.472  -2.120  1.00 0.00 ? 24 PHE A C    15 
ATOM 10365 O O    . PHE A 1 24 ? 39.950 -8.689  -2.169  1.00 0.00 ? 24 PHE A O    15 
ATOM 10366 C CB   . PHE A 1 24 ? 40.027 -6.176  -4.262  1.00 0.00 ? 24 PHE A CB   15 
ATOM 10367 C CG   . PHE A 1 24 ? 39.521 -6.498  -5.645  1.00 0.00 ? 24 PHE A CG   15 
ATOM 10368 C CD1  . PHE A 1 24 ? 39.293 -7.816  -6.031  1.00 0.00 ? 24 PHE A CD1  15 
ATOM 10369 C CD2  . PHE A 1 24 ? 39.282 -5.481  -6.556  1.00 0.00 ? 24 PHE A CD2  15 
ATOM 10370 C CE1  . PHE A 1 24 ? 38.826 -8.103  -7.308  1.00 0.00 ? 24 PHE A CE1  15 
ATOM 10371 C CE2  . PHE A 1 24 ? 38.823 -5.759  -7.838  1.00 0.00 ? 24 PHE A CE2  15 
ATOM 10372 C CZ   . PHE A 1 24 ? 38.593 -7.073  -8.215  1.00 0.00 ? 24 PHE A CZ   15 
ATOM 10373 H H    . PHE A 1 24 ? 38.956 -4.671  -2.382  1.00 0.00 ? 24 PHE A H    15 
ATOM 10374 H HA   . PHE A 1 24 ? 38.290 -7.305  -3.508  1.00 0.00 ? 24 PHE A HA   15 
ATOM 10375 H HB2  . PHE A 1 24 ? 40.219 -5.110  -4.169  1.00 0.00 ? 24 PHE A HB2  15 
ATOM 10376 H HB3  . PHE A 1 24 ? 41.015 -6.626  -4.183  1.00 0.00 ? 24 PHE A HB3  15 
ATOM 10377 H HD1  . PHE A 1 24 ? 39.472 -8.618  -5.330  1.00 0.00 ? 24 PHE A HD1  15 
ATOM 10378 H HD2  . PHE A 1 24 ? 39.450 -4.468  -6.243  1.00 0.00 ? 24 PHE A HD2  15 
ATOM 10379 H HE1  . PHE A 1 24 ? 38.644 -9.127  -7.596  1.00 0.00 ? 24 PHE A HE1  15 
ATOM 10380 H HE2  . PHE A 1 24 ? 38.640 -4.950  -8.532  1.00 0.00 ? 24 PHE A HE2  15 
ATOM 10381 H HZ   . PHE A 1 24 ? 38.230 -7.297  -9.208  1.00 0.00 ? 24 PHE A HZ   15 
ATOM 10382 N N    . ALA A 1 25 ? 40.559 -6.708  -1.211  1.00 0.00 ? 25 ALA A N    15 
ATOM 10383 C CA   . ALA A 1 25 ? 41.339 -7.315  -0.136  1.00 0.00 ? 25 ALA A CA   15 
ATOM 10384 C C    . ALA A 1 25 ? 40.412 -8.009  0.880   1.00 0.00 ? 25 ALA A C    15 
ATOM 10385 O O    . ALA A 1 25 ? 40.801 -8.963  1.537   1.00 0.00 ? 25 ALA A O    15 
ATOM 10386 C CB   . ALA A 1 25 ? 42.191 -6.245  0.556   1.00 0.00 ? 25 ALA A CB   15 
ATOM 10387 H H    . ALA A 1 25 ? 40.479 -5.717  -1.252  1.00 0.00 ? 25 ALA A H    15 
ATOM 10388 H HA   . ALA A 1 25 ? 41.995 -8.058  -0.592  1.00 0.00 ? 25 ALA A HA   15 
ATOM 10389 H HB1  . ALA A 1 25 ? 42.850 -6.685  1.305   1.00 0.00 ? 25 ALA A HB1  15 
ATOM 10390 H HB2  . ALA A 1 25 ? 41.577 -5.496  1.056   1.00 0.00 ? 25 ALA A HB2  15 
ATOM 10391 H HB3  . ALA A 1 25 ? 42.824 -5.734  -0.170  1.00 0.00 ? 25 ALA A HB3  15 
ATOM 10392 N N    . CYS A 1 26 ? 39.165 -7.487  0.936   1.00 0.00 ? 26 CYS A N    15 
ATOM 10393 C CA   . CYS A 1 26 ? 38.125 -8.087  1.771   1.00 0.00 ? 26 CYS A CA   15 
ATOM 10394 C C    . CYS A 1 26 ? 37.409 -9.267  1.087   1.00 0.00 ? 26 CYS A C    15 
ATOM 10395 O O    . CYS A 1 26 ? 36.457 -9.794  1.646   1.00 0.00 ? 26 CYS A O    15 
ATOM 10396 C CB   . CYS A 1 26 ? 37.086 -7.020  2.130   1.00 0.00 ? 26 CYS A CB   15 
ATOM 10397 S SG   . CYS A 1 26 ? 37.461 -6.331  3.763   1.00 0.00 ? 26 CYS A SG   15 
ATOM 10398 H H    . CYS A 1 26 ? 38.959 -6.670  0.401   1.00 0.00 ? 26 CYS A H    15 
ATOM 10399 H HA   . CYS A 1 26 ? 38.613 -8.450  2.677   1.00 0.00 ? 26 CYS A HA   15 
ATOM 10400 H HB2  . CYS A 1 26 ? 37.113 -6.236  1.381   1.00 0.00 ? 26 CYS A HB2  15 
ATOM 10401 H HB3  . CYS A 1 26 ? 36.056 -7.387  2.098   1.00 0.00 ? 26 CYS A HB3  15 
ATOM 10402 H HG   . CYS A 1 26 ? 37.340 -5.005  3.723   1.00 0.00 ? 26 CYS A HG   15 
ATOM 10403 N N    . GLU A 1 27 ? 37.877 -9.646  -0.128  1.00 0.00 ? 27 GLU A N    15 
ATOM 10404 C CA   . GLU A 1 27 ? 37.211 -10.697 -0.904  1.00 0.00 ? 27 GLU A CA   15 
ATOM 10405 C C    . GLU A 1 27 ? 35.749 -10.301 -1.226  1.00 0.00 ? 27 GLU A C    15 
ATOM 10406 O O    . GLU A 1 27 ? 34.796 -10.965 -0.863  1.00 0.00 ? 27 GLU A O    15 
ATOM 10407 C CB   . GLU A 1 27 ? 37.397 -12.062 -0.201  1.00 0.00 ? 27 GLU A CB   15 
ATOM 10408 C CG   . GLU A 1 27 ? 36.504 -13.225 -0.689  1.00 0.00 ? 27 GLU A CG   15 
ATOM 10409 C CD   . GLU A 1 27 ? 35.241 -13.455 0.182   1.00 0.00 ? 27 GLU A CD   15 
ATOM 10410 O OE1  . GLU A 1 27 ? 35.346 -13.384 1.405   1.00 0.00 ? 27 GLU A OE1  15 
ATOM 10411 O OE2  . GLU A 1 27 ? 34.166 -13.696 -0.372  1.00 0.00 ? 27 GLU A OE2  15 
ATOM 10412 H H    . GLU A 1 27 ? 38.705 -9.231  -0.497  1.00 0.00 ? 27 GLU A H    15 
ATOM 10413 H HA   . GLU A 1 27 ? 37.741 -10.730 -1.856  1.00 0.00 ? 27 GLU A HA   15 
ATOM 10414 H HB2  . GLU A 1 27 ? 38.432 -12.357 -0.368  1.00 0.00 ? 27 GLU A HB2  15 
ATOM 10415 H HB3  . GLU A 1 27 ? 37.340 -11.950 0.880   1.00 0.00 ? 27 GLU A HB3  15 
ATOM 10416 H HG2  . GLU A 1 27 ? 36.233 -13.081 -1.734  1.00 0.00 ? 27 GLU A HG2  15 
ATOM 10417 H HG3  . GLU A 1 27 ? 37.084 -14.145 -0.670  1.00 0.00 ? 27 GLU A HG3  15 
ATOM 10418 N N    . LYS A 1 28 ? 35.666 -9.156  -1.936  1.00 0.00 ? 28 LYS A N    15 
ATOM 10419 C CA   . LYS A 1 28 ? 34.443 -8.571  -2.487  1.00 0.00 ? 28 LYS A CA   15 
ATOM 10420 C C    . LYS A 1 28 ? 33.187 -8.837  -1.617  1.00 0.00 ? 28 LYS A C    15 
ATOM 10421 O O    . LYS A 1 28 ? 32.207 -9.411  -2.073  1.00 0.00 ? 28 LYS A O    15 
ATOM 10422 C CB   . LYS A 1 28 ? 34.296 -9.076  -3.934  1.00 0.00 ? 28 LYS A CB   15 
ATOM 10423 C CG   . LYS A 1 28 ? 35.550 -8.872  -4.811  1.00 0.00 ? 28 LYS A CG   15 
ATOM 10424 C CD   . LYS A 1 28 ? 35.780 -7.417  -5.246  1.00 0.00 ? 28 LYS A CD   15 
ATOM 10425 C CE   . LYS A 1 28 ? 35.382 -7.150  -6.700  1.00 0.00 ? 28 LYS A CE   15 
ATOM 10426 N NZ   . LYS A 1 28 ? 35.591 -5.754  -7.077  1.00 0.00 ? 28 LYS A NZ   15 
ATOM 10427 H H    . LYS A 1 28 ? 36.518 -8.694  -2.171  1.00 0.00 ? 28 LYS A H    15 
ATOM 10428 H HA   . LYS A 1 28 ? 34.601 -7.495  -2.495  1.00 0.00 ? 28 LYS A HA   15 
ATOM 10429 H HB2  . LYS A 1 28 ? 34.066 -10.141 -3.926  1.00 0.00 ? 28 LYS A HB2  15 
ATOM 10430 H HB3  . LYS A 1 28 ? 33.447 -8.583  -4.398  1.00 0.00 ? 28 LYS A HB3  15 
ATOM 10431 H HG2  . LYS A 1 28 ? 36.440 -9.237  -4.301  1.00 0.00 ? 28 LYS A HG2  15 
ATOM 10432 H HG3  . LYS A 1 28 ? 35.477 -9.509  -5.693  1.00 0.00 ? 28 LYS A HG3  15 
ATOM 10433 H HD2  . LYS A 1 28 ? 35.262 -6.732  -4.586  1.00 0.00 ? 28 LYS A HD2  15 
ATOM 10434 H HD3  . LYS A 1 28 ? 36.827 -7.167  -5.117  1.00 0.00 ? 28 LYS A HD3  15 
ATOM 10435 H HE2  . LYS A 1 28 ? 35.958 -7.776  -7.384  1.00 0.00 ? 28 LYS A HE2  15 
ATOM 10436 H HE3  . LYS A 1 28 ? 34.325 -7.385  -6.844  1.00 0.00 ? 28 LYS A HE3  15 
ATOM 10437 H HZ1  . LYS A 1 28 ? 36.613 -5.562  -7.162  1.00 0.00 ? 28 LYS A HZ1  15 
ATOM 10438 H HZ2  . LYS A 1 28 ? 35.198 -5.121  -6.355  1.00 0.00 ? 28 LYS A HZ2  15 
ATOM 10439 H HZ3  . LYS A 1 28 ? 35.138 -5.565  -7.993  1.00 0.00 ? 28 LYS A HZ3  15 
ATOM 10440 N N    . ASN A 1 29 ? 33.311 -8.415  -0.333  1.00 0.00 ? 29 ASN A N    15 
ATOM 10441 C CA   . ASN A 1 29 ? 32.306 -8.708  0.692   1.00 0.00 ? 29 ASN A CA   15 
ATOM 10442 C C    . ASN A 1 29 ? 31.462 -7.441  0.903   1.00 0.00 ? 29 ASN A C    15 
ATOM 10443 O O    . ASN A 1 29 ? 31.390 -6.622  -0.001  1.00 0.00 ? 29 ASN A O    15 
ATOM 10444 C CB   . ASN A 1 29 ? 33.022 -9.189  1.977   1.00 0.00 ? 29 ASN A CB   15 
ATOM 10445 C CG   . ASN A 1 29 ? 32.483 -10.547 2.444   1.00 0.00 ? 29 ASN A CG   15 
ATOM 10446 O OD1  . ASN A 1 29 ? 32.848 -11.588 1.935   1.00 0.00 ? 29 ASN A OD1  15 
ATOM 10447 N ND2  . ASN A 1 29 ? 31.585 -10.451 3.449   1.00 0.00 ? 29 ASN A ND2  15 
ATOM 10448 H H    . ASN A 1 29 ? 34.131 -7.900  -0.082  1.00 0.00 ? 29 ASN A H    15 
ATOM 10449 H HA   . ASN A 1 29 ? 31.650 -9.480  0.281   1.00 0.00 ? 29 ASN A HA   15 
ATOM 10450 H HB2  . ASN A 1 29 ? 34.091 -9.309  1.805   1.00 0.00 ? 29 ASN A HB2  15 
ATOM 10451 H HB3  . ASN A 1 29 ? 32.935 -8.478  2.792   1.00 0.00 ? 29 ASN A HB3  15 
ATOM 10452 H HD21 . ASN A 1 29 ? 31.358 -9.553  3.829   1.00 0.00 ? 29 ASN A HD21 15 
ATOM 10453 H HD22 . ASN A 1 29 ? 31.146 -11.266 3.817   1.00 0.00 ? 29 ASN A HD22 15 
ATOM 10454 N N    . GLU A 1 30 ? 30.832 -7.300  2.090   1.00 0.00 ? 30 GLU A N    15 
ATOM 10455 C CA   . GLU A 1 30 ? 29.951 -6.155  2.341   1.00 0.00 ? 30 GLU A CA   15 
ATOM 10456 C C    . GLU A 1 30 ? 30.350 -5.465  3.648   1.00 0.00 ? 30 GLU A C    15 
ATOM 10457 O O    . GLU A 1 30 ? 31.019 -4.446  3.645   1.00 0.00 ? 30 GLU A O    15 
ATOM 10458 C CB   . GLU A 1 30 ? 28.490 -6.626  2.365   1.00 0.00 ? 30 GLU A CB   15 
ATOM 10459 C CG   . GLU A 1 30 ? 27.972 -7.005  0.969   1.00 0.00 ? 30 GLU A CG   15 
ATOM 10460 C CD   . GLU A 1 30 ? 26.541 -7.579  1.021   1.00 0.00 ? 30 GLU A CD   15 
ATOM 10461 O OE1  . GLU A 1 30 ? 26.272 -8.421  1.878   1.00 0.00 ? 30 GLU A OE1  15 
ATOM 10462 O OE2  . GLU A 1 30 ? 25.713 -7.181  0.202   1.00 0.00 ? 30 GLU A OE2  15 
ATOM 10463 H H    . GLU A 1 30 ? 30.935 -7.999  2.796   1.00 0.00 ? 30 GLU A H    15 
ATOM 10464 H HA   . GLU A 1 30 ? 30.096 -5.407  1.562   1.00 0.00 ? 30 GLU A HA   15 
ATOM 10465 H HB2  . GLU A 1 30 ? 28.404 -7.482  3.033   1.00 0.00 ? 30 GLU A HB2  15 
ATOM 10466 H HB3  . GLU A 1 30 ? 27.854 -5.843  2.779   1.00 0.00 ? 30 GLU A HB3  15 
ATOM 10467 H HG2  . GLU A 1 30 ? 27.992 -6.125  0.327   1.00 0.00 ? 30 GLU A HG2  15 
ATOM 10468 H HG3  . GLU A 1 30 ? 28.622 -7.741  0.499   1.00 0.00 ? 30 GLU A HG3  15 
ATOM 10469 N N    . ASN A 1 31 ? 29.898 -6.088  4.757   1.00 0.00 ? 31 ASN A N    15 
ATOM 10470 C CA   . ASN A 1 31 ? 30.218 -5.591  6.092   1.00 0.00 ? 31 ASN A CA   15 
ATOM 10471 C C    . ASN A 1 31 ? 31.729 -5.641  6.356   1.00 0.00 ? 31 ASN A C    15 
ATOM 10472 O O    . ASN A 1 31 ? 32.211 -4.949  7.237   1.00 0.00 ? 31 ASN A O    15 
ATOM 10473 C CB   . ASN A 1 31 ? 29.478 -6.453  7.144   1.00 0.00 ? 31 ASN A CB   15 
ATOM 10474 C CG   . ASN A 1 31 ? 28.510 -5.634  8.019   1.00 0.00 ? 31 ASN A CG   15 
ATOM 10475 O OD1  . ASN A 1 31 ? 28.529 -4.418  8.065   1.00 0.00 ? 31 ASN A OD1  15 
ATOM 10476 N ND2  . ASN A 1 31 ? 27.655 -6.414  8.716   1.00 0.00 ? 31 ASN A ND2  15 
ATOM 10477 H H    . ASN A 1 31 ? 29.337 -6.905  4.654   1.00 0.00 ? 31 ASN A H    15 
ATOM 10478 H HA   . ASN A 1 31 ? 29.915 -4.543  6.120   1.00 0.00 ? 31 ASN A HA   15 
ATOM 10479 H HB2  . ASN A 1 31 ? 28.920 -7.245  6.651   1.00 0.00 ? 31 ASN A HB2  15 
ATOM 10480 H HB3  . ASN A 1 31 ? 30.160 -6.981  7.812   1.00 0.00 ? 31 ASN A HB3  15 
ATOM 10481 H HD21 . ASN A 1 31 ? 27.694 -7.413  8.648   1.00 0.00 ? 31 ASN A HD21 15 
ATOM 10482 H HD22 . ASN A 1 31 ? 26.977 -5.991  9.308   1.00 0.00 ? 31 ASN A HD22 15 
ATOM 10483 N N    . LEU A 1 32 ? 32.423 -6.489  5.559   1.00 0.00 ? 32 LEU A N    15 
ATOM 10484 C CA   . LEU A 1 32 ? 33.864 -6.686  5.726   1.00 0.00 ? 32 LEU A CA   15 
ATOM 10485 C C    . LEU A 1 32 ? 34.631 -5.530  5.080   1.00 0.00 ? 32 LEU A C    15 
ATOM 10486 O O    . LEU A 1 32 ? 35.551 -4.975  5.653   1.00 0.00 ? 32 LEU A O    15 
ATOM 10487 C CB   . LEU A 1 32 ? 34.263 -8.015  5.053   1.00 0.00 ? 32 LEU A CB   15 
ATOM 10488 C CG   . LEU A 1 32 ? 35.436 -8.775  5.691   1.00 0.00 ? 32 LEU A CG   15 
ATOM 10489 C CD1  . LEU A 1 32 ? 35.355 -8.789  7.222   1.00 0.00 ? 32 LEU A CD1  15 
ATOM 10490 C CD2  . LEU A 1 32 ? 35.471 -10.203 5.132   1.00 0.00 ? 32 LEU A CD2  15 
ATOM 10491 H H    . LEU A 1 32 ? 31.940 -6.999  4.849   1.00 0.00 ? 32 LEU A H    15 
ATOM 10492 H HA   . LEU A 1 32 ? 34.054 -6.680  6.800   1.00 0.00 ? 32 LEU A HA   15 
ATOM 10493 H HB2  . LEU A 1 32 ? 33.397 -8.674  5.053   1.00 0.00 ? 32 LEU A HB2  15 
ATOM 10494 H HB3  . LEU A 1 32 ? 34.498 -7.871  3.998   1.00 0.00 ? 32 LEU A HB3  15 
ATOM 10495 H HG   . LEU A 1 32 ? 36.368 -8.286  5.412   1.00 0.00 ? 32 LEU A HG   15 
ATOM 10496 H HD11 . LEU A 1 32 ? 36.007 -9.544  7.657   1.00 0.00 ? 32 LEU A HD11 15 
ATOM 10497 H HD12 . LEU A 1 32 ? 34.337 -8.989  7.556   1.00 0.00 ? 32 LEU A HD12 15 
ATOM 10498 H HD13 . LEU A 1 32 ? 35.667 -7.828  7.630   1.00 0.00 ? 32 LEU A HD13 15 
ATOM 10499 H HD21 . LEU A 1 32 ? 35.589 -10.187 4.049   1.00 0.00 ? 32 LEU A HD21 15 
ATOM 10500 H HD22 . LEU A 1 32 ? 34.546 -10.735 5.359   1.00 0.00 ? 32 LEU A HD22 15 
ATOM 10501 H HD23 . LEU A 1 32 ? 36.296 -10.775 5.554   1.00 0.00 ? 32 LEU A HD23 15 
ATOM 10502 N N    . ALA A 1 33 ? 34.162 -5.218  3.849   1.00 0.00 ? 33 ALA A N    15 
ATOM 10503 C CA   . ALA A 1 33 ? 34.713 -4.102  3.096   1.00 0.00 ? 33 ALA A CA   15 
ATOM 10504 C C    . ALA A 1 33 ? 34.560 -2.789  3.856   1.00 0.00 ? 33 ALA A C    15 
ATOM 10505 O O    . ALA A 1 33 ? 35.524 -2.066  4.039   1.00 0.00 ? 33 ALA A O    15 
ATOM 10506 C CB   . ALA A 1 33 ? 33.999 -3.971  1.765   1.00 0.00 ? 33 ALA A CB   15 
ATOM 10507 H H    . ALA A 1 33 ? 33.417 -5.752  3.456   1.00 0.00 ? 33 ALA A H    15 
ATOM 10508 H HA   . ALA A 1 33 ? 35.772 -4.291  2.943   1.00 0.00 ? 33 ALA A HA   15 
ATOM 10509 H HB1  . ALA A 1 33 ? 34.255 -3.000  1.347   1.00 0.00 ? 33 ALA A HB1  15 
ATOM 10510 H HB2  . ALA A 1 33 ? 32.915 -4.030  1.862   1.00 0.00 ? 33 ALA A HB2  15 
ATOM 10511 H HB3  . ALA A 1 33 ? 34.316 -4.745  1.067   1.00 0.00 ? 33 ALA A HB3  15 
ATOM 10512 N N    . ALA A 1 34 ? 33.309 -2.546  4.302   1.00 0.00 ? 34 ALA A N    15 
ATOM 10513 C CA   . ALA A 1 34 ? 33.053 -1.374  5.136   1.00 0.00 ? 34 ALA A CA   15 
ATOM 10514 C C    . ALA A 1 34 ? 34.000 -1.367  6.344   1.00 0.00 ? 34 ALA A C    15 
ATOM 10515 O O    . ALA A 1 34 ? 34.681 -0.384  6.591   1.00 0.00 ? 34 ALA A O    15 
ATOM 10516 C CB   . ALA A 1 34 ? 31.588 -1.336  5.583   1.00 0.00 ? 34 ALA A CB   15 
ATOM 10517 H H    . ALA A 1 34 ? 32.577 -3.184  4.081   1.00 0.00 ? 34 ALA A H    15 
ATOM 10518 H HA   . ALA A 1 34 ? 33.271 -0.497  4.526   1.00 0.00 ? 34 ALA A HA   15 
ATOM 10519 H HB1  . ALA A 1 34 ? 31.315 -2.217  6.163   1.00 0.00 ? 34 ALA A HB1  15 
ATOM 10520 H HB2  . ALA A 1 34 ? 30.919 -1.288  4.724   1.00 0.00 ? 34 ALA A HB2  15 
ATOM 10521 H HB3  . ALA A 1 34 ? 31.392 -0.455  6.196   1.00 0.00 ? 34 ALA A HB3  15 
ATOM 10522 N N    . ASN A 1 35 ? 34.070 -2.511  7.045   1.00 0.00 ? 35 ASN A N    15 
ATOM 10523 C CA   . ASN A 1 35 ? 34.949 -2.579  8.217   1.00 0.00 ? 35 ASN A CA   15 
ATOM 10524 C C    . ASN A 1 35 ? 36.412 -2.192  7.907   1.00 0.00 ? 35 ASN A C    15 
ATOM 10525 O O    . ASN A 1 35 ? 37.081 -1.599  8.737   1.00 0.00 ? 35 ASN A O    15 
ATOM 10526 C CB   . ASN A 1 35 ? 34.947 -4.002  8.801   1.00 0.00 ? 35 ASN A CB   15 
ATOM 10527 C CG   . ASN A 1 35 ? 34.919 -3.952  10.334  1.00 0.00 ? 35 ASN A CG   15 
ATOM 10528 O OD1  . ASN A 1 35 ? 35.586 -3.160  10.973  1.00 0.00 ? 35 ASN A OD1  15 
ATOM 10529 N ND2  . ASN A 1 35 ? 34.061 -4.851  10.861  1.00 0.00 ? 35 ASN A ND2  15 
ATOM 10530 H H    . ASN A 1 35 ? 33.514 -3.291  6.763   1.00 0.00 ? 35 ASN A H    15 
ATOM 10531 H HA   . ASN A 1 35 ? 34.537 -1.844  8.918   1.00 0.00 ? 35 ASN A HA   15 
ATOM 10532 H HB2  . ASN A 1 35 ? 34.085 -4.555  8.454   1.00 0.00 ? 35 ASN A HB2  15 
ATOM 10533 H HB3  . ASN A 1 35 ? 35.802 -4.599  8.484   1.00 0.00 ? 35 ASN A HB3  15 
ATOM 10534 H HD21 . ASN A 1 35 ? 33.576 -5.489  10.260  1.00 0.00 ? 35 ASN A HD21 15 
ATOM 10535 H HD22 . ASN A 1 35 ? 33.897 -4.894  11.840  1.00 0.00 ? 35 ASN A HD22 15 
ATOM 10536 N N    . PHE A 1 36 ? 36.850 -2.548  6.673   1.00 0.00 ? 36 PHE A N    15 
ATOM 10537 C CA   . PHE A 1 36 ? 38.197 -2.184  6.222   1.00 0.00 ? 36 PHE A CA   15 
ATOM 10538 C C    . PHE A 1 36 ? 38.362 -0.655  6.253   1.00 0.00 ? 36 PHE A C    15 
ATOM 10539 O O    . PHE A 1 36 ? 39.258 -0.147  6.912   1.00 0.00 ? 36 PHE A O    15 
ATOM 10540 C CB   . PHE A 1 36 ? 38.456 -2.764  4.815   1.00 0.00 ? 36 PHE A CB   15 
ATOM 10541 C CG   . PHE A 1 36 ? 39.852 -2.541  4.268   1.00 0.00 ? 36 PHE A CG   15 
ATOM 10542 C CD1  . PHE A 1 36 ? 40.298 -1.263  3.930   1.00 0.00 ? 36 PHE A CD1  15 
ATOM 10543 C CD2  . PHE A 1 36 ? 40.703 -3.618  4.033   1.00 0.00 ? 36 PHE A CD2  15 
ATOM 10544 C CE1  . PHE A 1 36 ? 41.545 -1.057  3.364   1.00 0.00 ? 36 PHE A CE1  15 
ATOM 10545 C CE2  . PHE A 1 36 ? 41.957 -3.417  3.465   1.00 0.00 ? 36 PHE A CE2  15 
ATOM 10546 C CZ   . PHE A 1 36 ? 42.379 -2.140  3.126   1.00 0.00 ? 36 PHE A CZ   15 
ATOM 10547 H H    . PHE A 1 36 ? 36.228 -3.015  6.048   1.00 0.00 ? 36 PHE A H    15 
ATOM 10548 H HA   . PHE A 1 36 ? 38.895 -2.630  6.931   1.00 0.00 ? 36 PHE A HA   15 
ATOM 10549 H HB2  . PHE A 1 36 ? 38.240 -3.831  4.829   1.00 0.00 ? 36 PHE A HB2  15 
ATOM 10550 H HB3  . PHE A 1 36 ? 37.768 -2.332  4.099   1.00 0.00 ? 36 PHE A HB3  15 
ATOM 10551 H HD1  . PHE A 1 36 ? 39.665 -0.399  4.060   1.00 0.00 ? 36 PHE A HD1  15 
ATOM 10552 H HD2  . PHE A 1 36 ? 40.380 -4.624  4.260   1.00 0.00 ? 36 PHE A HD2  15 
ATOM 10553 H HE1  . PHE A 1 36 ? 41.851 -0.056  3.095   1.00 0.00 ? 36 PHE A HE1  15 
ATOM 10554 H HE2  . PHE A 1 36 ? 42.600 -4.262  3.261   1.00 0.00 ? 36 PHE A HE2  15 
ATOM 10555 H HZ   . PHE A 1 36 ? 43.342 -1.985  2.663   1.00 0.00 ? 36 PHE A HZ   15 
ATOM 10556 N N    . LEU A 1 37 ? 37.469 0.031   5.501   1.00 0.00 ? 37 LEU A N    15 
ATOM 10557 C CA   . LEU A 1 37 ? 37.633 1.462   5.256   1.00 0.00 ? 37 LEU A CA   15 
ATOM 10558 C C    . LEU A 1 37 ? 37.409 2.310   6.533   1.00 0.00 ? 37 LEU A C    15 
ATOM 10559 O O    . LEU A 1 37 ? 38.009 3.364   6.704   1.00 0.00 ? 37 LEU A O    15 
ATOM 10560 C CB   . LEU A 1 37 ? 36.677 1.944   4.156   1.00 0.00 ? 37 LEU A CB   15 
ATOM 10561 C CG   . LEU A 1 37 ? 36.819 1.260   2.780   1.00 0.00 ? 37 LEU A CG   15 
ATOM 10562 C CD1  . LEU A 1 37 ? 35.627 0.350   2.496   1.00 0.00 ? 37 LEU A CD1  15 
ATOM 10563 C CD2  . LEU A 1 37 ? 36.970 2.266   1.626   1.00 0.00 ? 37 LEU A CD2  15 
ATOM 10564 H H    . LEU A 1 37 ? 36.679 -0.438  5.109   1.00 0.00 ? 37 LEU A H    15 
ATOM 10565 H HA   . LEU A 1 37 ? 38.657 1.602   4.914   1.00 0.00 ? 37 LEU A HA   15 
ATOM 10566 H HB2  . LEU A 1 37 ? 35.651 1.858   4.497   1.00 0.00 ? 37 LEU A HB2  15 
ATOM 10567 H HB3  . LEU A 1 37 ? 36.850 3.009   4.061   1.00 0.00 ? 37 LEU A HB3  15 
ATOM 10568 H HG   . LEU A 1 37 ? 37.708 0.633   2.804   1.00 0.00 ? 37 LEU A HG   15 
ATOM 10569 H HD11 . LEU A 1 37 ? 35.911 -0.537  1.929   1.00 0.00 ? 37 LEU A HD11 15 
ATOM 10570 H HD12 . LEU A 1 37 ? 34.870 0.882   1.934   1.00 0.00 ? 37 LEU A HD12 15 
ATOM 10571 H HD13 . LEU A 1 37 ? 35.126 0.054   3.409   1.00 0.00 ? 37 LEU A HD13 15 
ATOM 10572 H HD21 . LEU A 1 37 ? 37.927 2.111   1.146   1.00 0.00 ? 37 LEU A HD21 15 
ATOM 10573 H HD22 . LEU A 1 37 ? 36.968 3.295   1.957   1.00 0.00 ? 37 LEU A HD22 15 
ATOM 10574 H HD23 . LEU A 1 37 ? 36.174 2.196   0.882   1.00 0.00 ? 37 LEU A HD23 15 
ATOM 10575 N N    . LEU A 1 38 ? 36.510 1.777   7.398   1.00 0.00 ? 38 LEU A N    15 
ATOM 10576 C CA   . LEU A 1 38 ? 36.090 2.482   8.609   1.00 0.00 ? 38 LEU A CA   15 
ATOM 10577 C C    . LEU A 1 38 ? 37.165 2.335   9.713   1.00 0.00 ? 38 LEU A C    15 
ATOM 10578 O O    . LEU A 1 38 ? 37.303 3.172   10.593  1.00 0.00 ? 38 LEU A O    15 
ATOM 10579 C CB   . LEU A 1 38 ? 34.709 2.006   9.135   1.00 0.00 ? 38 LEU A CB   15 
ATOM 10580 C CG   . LEU A 1 38 ? 33.526 1.865   8.136   1.00 0.00 ? 38 LEU A CG   15 
ATOM 10581 C CD1  . LEU A 1 38 ? 32.233 2.506   8.656   1.00 0.00 ? 38 LEU A CD1  15 
ATOM 10582 C CD2  . LEU A 1 38 ? 33.808 2.422   6.744   1.00 0.00 ? 38 LEU A CD2  15 
ATOM 10583 H H    . LEU A 1 38 ? 36.110 0.887   7.205   1.00 0.00 ? 38 LEU A H    15 
ATOM 10584 H HA   . LEU A 1 38 ? 36.030 3.531   8.333   1.00 0.00 ? 38 LEU A HA   15 
ATOM 10585 H HB2  . LEU A 1 38 ? 34.845 1.043   9.625   1.00 0.00 ? 38 LEU A HB2  15 
ATOM 10586 H HB3  . LEU A 1 38 ? 34.413 2.703   9.922   1.00 0.00 ? 38 LEU A HB3  15 
ATOM 10587 H HG   . LEU A 1 38 ? 33.296 0.806   8.048   1.00 0.00 ? 38 LEU A HG   15 
ATOM 10588 H HD11 . LEU A 1 38 ? 31.938 2.092   9.618   1.00 0.00 ? 38 LEU A HD11 15 
ATOM 10589 H HD12 . LEU A 1 38 ? 31.413 2.322   7.961   1.00 0.00 ? 38 LEU A HD12 15 
ATOM 10590 H HD13 . LEU A 1 38 ? 32.341 3.587   8.751   1.00 0.00 ? 38 LEU A HD13 15 
ATOM 10591 H HD21 . LEU A 1 38 ? 34.480 3.264   6.830   1.00 0.00 ? 38 LEU A HD21 15 
ATOM 10592 H HD22 . LEU A 1 38 ? 32.893 2.750   6.262   1.00 0.00 ? 38 LEU A HD22 15 
ATOM 10593 H HD23 . LEU A 1 38 ? 34.268 1.715   6.065   1.00 0.00 ? 38 LEU A HD23 15 
ATOM 10594 N N    . SER A 1 39 ? 37.919 1.222   9.570   1.00 0.00 ? 39 SER A N    15 
ATOM 10595 C CA   . SER A 1 39 ? 39.035 0.898   10.453  1.00 0.00 ? 39 SER A CA   15 
ATOM 10596 C C    . SER A 1 39 ? 40.272 1.779   10.183  1.00 0.00 ? 39 SER A C    15 
ATOM 10597 O O    . SER A 1 39 ? 41.163 1.852   11.018  1.00 0.00 ? 39 SER A O    15 
ATOM 10598 C CB   . SER A 1 39 ? 39.385 -0.589  10.276  1.00 0.00 ? 39 SER A CB   15 
ATOM 10599 O OG   . SER A 1 39 ? 40.506 -0.997  11.036  1.00 0.00 ? 39 SER A OG   15 
ATOM 10600 H H    . SER A 1 39 ? 37.724 0.589   8.828   1.00 0.00 ? 39 SER A H    15 
ATOM 10601 H HA   . SER A 1 39 ? 38.700 1.076   11.472  1.00 0.00 ? 39 SER A HA   15 
ATOM 10602 H HB2  . SER A 1 39 ? 38.553 -1.203  10.617  1.00 0.00 ? 39 SER A HB2  15 
ATOM 10603 H HB3  . SER A 1 39 ? 39.540 -0.847  9.226   1.00 0.00 ? 39 SER A HB3  15 
ATOM 10604 H HG   . SER A 1 39 ? 41.243 -0.430  10.839  1.00 0.00 ? 39 SER A HG   15 
ATOM 10605 N N    . GLN A 1 40 ? 40.275 2.434   9.000   1.00 0.00 ? 40 GLN A N    15 
ATOM 10606 C CA   . GLN A 1 40 ? 41.379 3.327   8.648   1.00 0.00 ? 40 GLN A CA   15 
ATOM 10607 C C    . GLN A 1 40 ? 41.140 4.683   9.342   1.00 0.00 ? 40 GLN A C    15 
ATOM 10608 O O    . GLN A 1 40 ? 40.352 5.504   8.889   1.00 0.00 ? 40 GLN A O    15 
ATOM 10609 C CB   . GLN A 1 40 ? 41.469 3.515   7.120   1.00 0.00 ? 40 GLN A CB   15 
ATOM 10610 C CG   . GLN A 1 40 ? 41.374 2.232   6.276   1.00 0.00 ? 40 GLN A CG   15 
ATOM 10611 C CD   . GLN A 1 40 ? 42.561 1.262   6.442   1.00 0.00 ? 40 GLN A CD   15 
ATOM 10612 O OE1  . GLN A 1 40 ? 42.637 0.477   7.371   1.00 0.00 ? 40 GLN A OE1  15 
ATOM 10613 N NE2  . GLN A 1 40 ? 43.440 1.334   5.420   1.00 0.00 ? 40 GLN A NE2  15 
ATOM 10614 H H    . GLN A 1 40 ? 39.511 2.312   8.374   1.00 0.00 ? 40 GLN A H    15 
ATOM 10615 H HA   . GLN A 1 40 ? 42.302 2.871   9.007   1.00 0.00 ? 40 GLN A HA   15 
ATOM 10616 H HB2  . GLN A 1 40 ? 40.653 4.161   6.795   1.00 0.00 ? 40 GLN A HB2  15 
ATOM 10617 H HB3  . GLN A 1 40 ? 42.396 4.039   6.879   1.00 0.00 ? 40 GLN A HB3  15 
ATOM 10618 H HG2  . GLN A 1 40 ? 40.464 1.697   6.508   1.00 0.00 ? 40 GLN A HG2  15 
ATOM 10619 H HG3  . GLN A 1 40 ? 41.273 2.503   5.226   1.00 0.00 ? 40 GLN A HG3  15 
ATOM 10620 H HE21 . GLN A 1 40 ? 43.358 2.067   4.742   1.00 0.00 ? 40 GLN A HE21 15 
ATOM 10621 H HE22 . GLN A 1 40 ? 44.173 0.670   5.298   1.00 0.00 ? 40 GLN A HE22 15 
ATOM 10622 N N    . ASN A 1 41 ? 41.868 4.848   10.470  1.00 0.00 ? 41 ASN A N    15 
ATOM 10623 C CA   . ASN A 1 41 ? 41.743 6.074   11.256  1.00 0.00 ? 41 ASN A CA   15 
ATOM 10624 C C    . ASN A 1 41 ? 42.395 7.219   10.467  1.00 0.00 ? 41 ASN A C    15 
ATOM 10625 O O    . ASN A 1 41 ? 43.534 7.107   10.023  1.00 0.00 ? 41 ASN A O    15 
ATOM 10626 C CB   . ASN A 1 41 ? 42.434 5.969   12.633  1.00 0.00 ? 41 ASN A CB   15 
ATOM 10627 C CG   . ASN A 1 41 ? 42.358 4.612   13.364  1.00 0.00 ? 41 ASN A CG   15 
ATOM 10628 O OD1  . ASN A 1 41 ? 43.284 4.235   14.062  1.00 0.00 ? 41 ASN A OD1  15 
ATOM 10629 N ND2  . ASN A 1 41 ? 41.217 3.921   13.190  1.00 0.00 ? 41 ASN A ND2  15 
ATOM 10630 H H    . ASN A 1 41 ? 42.461 4.112   10.781  1.00 0.00 ? 41 ASN A H    15 
ATOM 10631 H HA   . ASN A 1 41 ? 40.675 6.257   11.386  1.00 0.00 ? 41 ASN A HA   15 
ATOM 10632 H HB2  . ASN A 1 41 ? 43.495 6.203   12.548  1.00 0.00 ? 41 ASN A HB2  15 
ATOM 10633 H HB3  . ASN A 1 41 ? 42.007 6.725   13.292  1.00 0.00 ? 41 ASN A HB3  15 
ATOM 10634 H HD21 . ASN A 1 41 ? 40.494 4.209   12.567  1.00 0.00 ? 41 ASN A HD21 15 
ATOM 10635 H HD22 . ASN A 1 41 ? 41.094 3.065   13.699  1.00 0.00 ? 41 ASN A HD22 15 
ATOM 10636 N N    . PHE A 1 42 ? 41.602 8.300   10.305  1.00 0.00 ? 42 PHE A N    15 
ATOM 10637 C CA   . PHE A 1 42 ? 42.050 9.476   9.571   1.00 0.00 ? 42 PHE A CA   15 
ATOM 10638 C C    . PHE A 1 42 ? 40.918 10.517  9.571   1.00 0.00 ? 42 PHE A C    15 
ATOM 10639 O O    . PHE A 1 42 ? 39.742 10.196  9.683   1.00 0.00 ? 42 PHE A O    15 
ATOM 10640 C CB   . PHE A 1 42 ? 42.457 9.126   8.101   1.00 0.00 ? 42 PHE A CB   15 
ATOM 10641 C CG   . PHE A 1 42 ? 43.894 9.434   7.738   1.00 0.00 ? 42 PHE A CG   15 
ATOM 10642 C CD1  . PHE A 1 42 ? 44.579 10.529  8.271   1.00 0.00 ? 42 PHE A CD1  15 
ATOM 10643 C CD2  . PHE A 1 42 ? 44.564 8.616   6.830   1.00 0.00 ? 42 PHE A CD2  15 
ATOM 10644 C CE1  . PHE A 1 42 ? 45.894 10.787  7.916   1.00 0.00 ? 42 PHE A CE1  15 
ATOM 10645 C CE2  . PHE A 1 42 ? 45.881 8.877   6.468   1.00 0.00 ? 42 PHE A CE2  15 
ATOM 10646 C CZ   . PHE A 1 42 ? 46.549 9.961   7.013   1.00 0.00 ? 42 PHE A CZ   15 
ATOM 10647 H H    . PHE A 1 42 ? 40.691 8.294   10.721  1.00 0.00 ? 42 PHE A H    15 
ATOM 10648 H HA   . PHE A 1 42 ? 42.860 9.878   10.184  1.00 0.00 ? 42 PHE A HA   15 
ATOM 10649 H HB2  . PHE A 1 42 ? 42.266 8.070   7.894   1.00 0.00 ? 42 PHE A HB2  15 
ATOM 10650 H HB3  . PHE A 1 42 ? 41.828 9.628   7.364   1.00 0.00 ? 42 PHE A HB3  15 
ATOM 10651 H HD1  . PHE A 1 42 ? 44.110 11.208  8.966   1.00 0.00 ? 42 PHE A HD1  15 
ATOM 10652 H HD2  . PHE A 1 42 ? 44.056 7.769   6.390   1.00 0.00 ? 42 PHE A HD2  15 
ATOM 10653 H HE1  . PHE A 1 42 ? 46.403 11.636  8.342   1.00 0.00 ? 42 PHE A HE1  15 
ATOM 10654 H HE2  . PHE A 1 42 ? 46.386 8.239   5.757   1.00 0.00 ? 42 PHE A HE2  15 
ATOM 10655 H HZ   . PHE A 1 42 ? 47.572 10.171  6.737   1.00 0.00 ? 42 PHE A HZ   15 
ATOM 10656 N N    . ASP A 1 43 ? 41.376 11.777  9.424   1.00 0.00 ? 43 ASP A N    15 
ATOM 10657 C CA   . ASP A 1 43 ? 40.501 12.933  9.278   1.00 0.00 ? 43 ASP A CA   15 
ATOM 10658 C C    . ASP A 1 43 ? 39.692 13.155  10.573  1.00 0.00 ? 43 ASP A C    15 
ATOM 10659 O O    . ASP A 1 43 ? 38.569 12.700  10.709  1.00 0.00 ? 43 ASP A O    15 
ATOM 10660 C CB   . ASP A 1 43 ? 39.607 12.774  8.024   1.00 0.00 ? 43 ASP A CB   15 
ATOM 10661 C CG   . ASP A 1 43 ? 39.114 14.108  7.422   1.00 0.00 ? 43 ASP A CG   15 
ATOM 10662 O OD1  . ASP A 1 43 ? 39.282 15.157  8.045   1.00 0.00 ? 43 ASP A OD1  15 
ATOM 10663 O OD2  . ASP A 1 43 ? 38.569 14.081  6.318   1.00 0.00 ? 43 ASP A OD2  15 
ATOM 10664 H H    . ASP A 1 43 ? 42.363 11.900  9.345   1.00 0.00 ? 43 ASP A H    15 
ATOM 10665 H HA   . ASP A 1 43 ? 41.186 13.768  9.137   1.00 0.00 ? 43 ASP A HA   15 
ATOM 10666 H HB2  . ASP A 1 43 ? 40.176 12.261  7.250   1.00 0.00 ? 43 ASP A HB2  15 
ATOM 10667 H HB3  . ASP A 1 43 ? 38.749 12.129  8.214   1.00 0.00 ? 43 ASP A HB3  15 
ATOM 10668 N N    . ASP A 1 44 ? 40.361 13.880  11.499  1.00 0.00 ? 44 ASP A N    15 
ATOM 10669 C CA   . ASP A 1 44 ? 39.777 14.207  12.799  1.00 0.00 ? 44 ASP A CA   15 
ATOM 10670 C C    . ASP A 1 44 ? 39.305 15.672  12.772  1.00 0.00 ? 44 ASP A C    15 
ATOM 10671 O O    . ASP A 1 44 ? 39.805 16.524  13.494  1.00 0.00 ? 44 ASP A O    15 
ATOM 10672 C CB   . ASP A 1 44 ? 40.815 13.950  13.923  1.00 0.00 ? 44 ASP A CB   15 
ATOM 10673 C CG   . ASP A 1 44 ? 40.645 12.567  14.586  1.00 0.00 ? 44 ASP A CG   15 
ATOM 10674 O OD1  . ASP A 1 44 ? 39.546 12.272  15.055  1.00 0.00 ? 44 ASP A OD1  15 
ATOM 10675 O OD2  . ASP A 1 44 ? 41.613 11.808  14.646  1.00 0.00 ? 44 ASP A OD2  15 
ATOM 10676 H H    . ASP A 1 44 ? 41.269 14.225  11.271  1.00 0.00 ? 44 ASP A H    15 
ATOM 10677 H HA   . ASP A 1 44 ? 38.890 13.588  12.944  1.00 0.00 ? 44 ASP A HA   15 
ATOM 10678 H HB2  . ASP A 1 44 ? 41.826 14.052  13.528  1.00 0.00 ? 44 ASP A HB2  15 
ATOM 10679 H HB3  . ASP A 1 44 ? 40.740 14.675  14.734  1.00 0.00 ? 44 ASP A HB3  15 
ATOM 10680 N N    . GLU A 1 45 ? 38.284 15.885  11.912  1.00 0.00 ? 45 GLU A N    15 
ATOM 10681 C CA   . GLU A 1 45 ? 37.605 17.181  11.824  1.00 0.00 ? 45 GLU A CA   15 
ATOM 10682 C C    . GLU A 1 45 ? 36.794 17.506  13.109  1.00 0.00 ? 45 GLU A C    15 
ATOM 10683 O O    . GLU A 1 45 ? 36.330 18.638  13.239  1.00 0.00 ? 45 GLU A O    15 
ATOM 10684 C CB   . GLU A 1 45 ? 36.687 17.205  10.584  1.00 0.00 ? 45 GLU A CB   15 
ATOM 10685 C CG   . GLU A 1 45 ? 35.543 16.171  10.615  1.00 0.00 ? 45 GLU A CG   15 
ATOM 10686 C CD   . GLU A 1 45 ? 34.505 16.354  9.484   1.00 0.00 ? 45 GLU A CD   15 
ATOM 10687 O OE1  . GLU A 1 45 ? 34.636 17.277  8.679   1.00 0.00 ? 45 GLU A OE1  15 
ATOM 10688 O OE2  . GLU A 1 45 ? 33.564 15.562  9.427   1.00 0.00 ? 45 GLU A OE2  15 
ATOM 10689 O OXT  . GLU A 1 45 ? 36.627 16.630  13.960  1.00 0.00 ? 45 GLU A OXT  15 
ATOM 10690 H H    . GLU A 1 45 ? 37.980 15.119  11.346  1.00 0.00 ? 45 GLU A H    15 
ATOM 10691 H HA   . GLU A 1 45 ? 38.387 17.935  11.704  1.00 0.00 ? 45 GLU A HA   15 
ATOM 10692 H HB2  . GLU A 1 45 ? 36.264 18.205  10.489  1.00 0.00 ? 45 GLU A HB2  15 
ATOM 10693 H HB3  . GLU A 1 45 ? 37.284 17.045  9.686   1.00 0.00 ? 45 GLU A HB3  15 
ATOM 10694 H HG2  . GLU A 1 45 ? 35.953 15.165  10.551  1.00 0.00 ? 45 GLU A HG2  15 
ATOM 10695 H HG3  . GLU A 1 45 ? 35.007 16.224  11.560  1.00 0.00 ? 45 GLU A HG3  15 
ATOM 10696 N N    . GLN A 1 1  ? 31.966 -6.079  -11.492 1.00 0.00 ? 1  GLN A N    16 
ATOM 10697 C CA   . GLN A 1 1  ? 32.386 -4.690  -11.598 1.00 0.00 ? 1  GLN A CA   16 
ATOM 10698 C C    . GLN A 1 1  ? 32.580 -4.093  -10.196 1.00 0.00 ? 1  GLN A C    16 
ATOM 10699 O O    . GLN A 1 1  ? 33.631 -3.577  -9.858  1.00 0.00 ? 1  GLN A O    16 
ATOM 10700 C CB   . GLN A 1 1  ? 31.402 -3.823  -12.425 1.00 0.00 ? 1  GLN A CB   16 
ATOM 10701 C CG   . GLN A 1 1  ? 32.065 -3.048  -13.575 1.00 0.00 ? 1  GLN A CG   16 
ATOM 10702 C CD   . GLN A 1 1  ? 33.158 -2.092  -13.064 1.00 0.00 ? 1  GLN A CD   16 
ATOM 10703 O OE1  . GLN A 1 1  ? 32.893 -1.042  -12.523 1.00 0.00 ? 1  GLN A OE1  16 
ATOM 10704 N NE2  . GLN A 1 1  ? 34.404 -2.584  -13.222 1.00 0.00 ? 1  GLN A NE2  16 
ATOM 10705 H H1   . GLN A 1 1  ? 32.611 -6.660  -12.076 1.00 0.00 ? 1  GLN A H1   16 
ATOM 10706 H H2   . GLN A 1 1  ? 30.993 -6.187  -11.832 1.00 0.00 ? 1  GLN A H2   16 
ATOM 10707 H H3   . GLN A 1 1  ? 32.040 -6.386  -10.502 1.00 0.00 ? 1  GLN A H3   16 
ATOM 10708 H HA   . GLN A 1 1  ? 33.363 -4.719  -12.080 1.00 0.00 ? 1  GLN A HA   16 
ATOM 10709 H HB2  . GLN A 1 1  ? 30.642 -4.470  -12.858 1.00 0.00 ? 1  GLN A HB2  16 
ATOM 10710 H HB3  . GLN A 1 1  ? 30.834 -3.127  -11.803 1.00 0.00 ? 1  GLN A HB3  16 
ATOM 10711 H HG2  . GLN A 1 1  ? 32.479 -3.736  -14.311 1.00 0.00 ? 1  GLN A HG2  16 
ATOM 10712 H HG3  . GLN A 1 1  ? 31.312 -2.452  -14.089 1.00 0.00 ? 1  GLN A HG3  16 
ATOM 10713 H HE21 . GLN A 1 1  ? 34.840 -2.588  -14.121 1.00 0.00 ? 1  GLN A HE21 16 
ATOM 10714 H HE22 . GLN A 1 1  ? 34.880 -2.980  -12.439 1.00 0.00 ? 1  GLN A HE22 16 
ATOM 10715 N N    . GLU A 1 2  ? 31.467 -4.220  -9.437  1.00 0.00 ? 2  GLU A N    16 
ATOM 10716 C CA   . GLU A 1 2  ? 31.315 -3.788  -8.050  1.00 0.00 ? 2  GLU A CA   16 
ATOM 10717 C C    . GLU A 1 2  ? 31.065 -2.285  -7.890  1.00 0.00 ? 2  GLU A C    16 
ATOM 10718 O O    . GLU A 1 2  ? 30.857 -1.854  -6.768  1.00 0.00 ? 2  GLU A O    16 
ATOM 10719 C CB   . GLU A 1 2  ? 32.465 -4.223  -7.121  1.00 0.00 ? 2  GLU A CB   16 
ATOM 10720 C CG   . GLU A 1 2  ? 32.886 -5.693  -7.232  1.00 0.00 ? 2  GLU A CG   16 
ATOM 10721 C CD   . GLU A 1 2  ? 31.716 -6.676  -7.440  1.00 0.00 ? 2  GLU A CD   16 
ATOM 10722 O OE1  . GLU A 1 2  ? 30.857 -6.760  -6.564  1.00 0.00 ? 2  GLU A OE1  16 
ATOM 10723 O OE2  . GLU A 1 2  ? 31.677 -7.344  -8.475  1.00 0.00 ? 2  GLU A OE2  16 
ATOM 10724 H H    . GLU A 1 2  ? 30.676 -4.640  -9.875  1.00 0.00 ? 2  GLU A H    16 
ATOM 10725 H HA   . GLU A 1 2  ? 30.392 -4.264  -7.716  1.00 0.00 ? 2  GLU A HA   16 
ATOM 10726 H HB2  . GLU A 1 2  ? 33.348 -3.603  -7.282  1.00 0.00 ? 2  GLU A HB2  16 
ATOM 10727 H HB3  . GLU A 1 2  ? 32.174 -4.032  -6.086  1.00 0.00 ? 2  GLU A HB3  16 
ATOM 10728 H HG2  . GLU A 1 2  ? 33.611 -5.814  -8.037  1.00 0.00 ? 2  GLU A HG2  16 
ATOM 10729 H HG3  . GLU A 1 2  ? 33.395 -5.956  -6.305  1.00 0.00 ? 2  GLU A HG3  16 
ATOM 10730 N N    . LYS A 1 3  ? 31.080 -1.535  -9.026  1.00 0.00 ? 3  LYS A N    16 
ATOM 10731 C CA   . LYS A 1 3  ? 30.863 -0.076  -9.099  1.00 0.00 ? 3  LYS A CA   16 
ATOM 10732 C C    . LYS A 1 3  ? 29.716 0.459   -8.218  1.00 0.00 ? 3  LYS A C    16 
ATOM 10733 O O    . LYS A 1 3  ? 29.728 1.607   -7.798  1.00 0.00 ? 3  LYS A O    16 
ATOM 10734 C CB   . LYS A 1 3  ? 30.656 0.346   -10.555 1.00 0.00 ? 3  LYS A CB   16 
ATOM 10735 C CG   . LYS A 1 3  ? 29.565 -0.458  -11.289 1.00 0.00 ? 3  LYS A CG   16 
ATOM 10736 C CD   . LYS A 1 3  ? 28.384 0.418   -11.712 1.00 0.00 ? 3  LYS A CD   16 
ATOM 10737 C CE   . LYS A 1 3  ? 27.251 -0.382  -12.360 1.00 0.00 ? 3  LYS A CE   16 
ATOM 10738 N NZ   . LYS A 1 3  ? 26.452 -1.104  -11.375 1.00 0.00 ? 3  LYS A NZ   16 
ATOM 10739 H H    . LYS A 1 3  ? 31.298 -1.994  -9.884  1.00 0.00 ? 3  LYS A H    16 
ATOM 10740 H HA   . LYS A 1 3  ? 31.776 0.402   -8.767  1.00 0.00 ? 3  LYS A HA   16 
ATOM 10741 H HB2  . LYS A 1 3  ? 30.470 1.421   -10.617 1.00 0.00 ? 3  LYS A HB2  16 
ATOM 10742 H HB3  . LYS A 1 3  ? 31.604 0.217   -11.068 1.00 0.00 ? 3  LYS A HB3  16 
ATOM 10743 H HG2  . LYS A 1 3  ? 30.002 -0.931  -12.168 1.00 0.00 ? 3  LYS A HG2  16 
ATOM 10744 H HG3  . LYS A 1 3  ? 29.194 -1.284  -10.682 1.00 0.00 ? 3  LYS A HG3  16 
ATOM 10745 H HD2  . LYS A 1 3  ? 28.001 0.973   -10.855 1.00 0.00 ? 3  LYS A HD2  16 
ATOM 10746 H HD3  . LYS A 1 3  ? 28.739 1.165   -12.419 1.00 0.00 ? 3  LYS A HD3  16 
ATOM 10747 H HE2  . LYS A 1 3  ? 26.583 0.299   -12.887 1.00 0.00 ? 3  LYS A HE2  16 
ATOM 10748 H HE3  . LYS A 1 3  ? 27.634 -1.098  -13.089 1.00 0.00 ? 3  LYS A HE3  16 
ATOM 10749 H HZ1  . LYS A 1 3  ? 27.055 -1.790  -10.877 1.00 0.00 ? 3  LYS A HZ1  16 
ATOM 10750 H HZ2  . LYS A 1 3  ? 25.673 -1.604  -11.851 1.00 0.00 ? 3  LYS A HZ2  16 
ATOM 10751 H HZ3  . LYS A 1 3  ? 26.061 -0.428  -10.689 1.00 0.00 ? 3  LYS A HZ3  16 
ATOM 10752 N N    . GLU A 1 4  ? 28.755 -0.447  -7.964  1.00 0.00 ? 4  GLU A N    16 
ATOM 10753 C CA   . GLU A 1 4  ? 27.613 -0.175  -7.099  1.00 0.00 ? 4  GLU A CA   16 
ATOM 10754 C C    . GLU A 1 4  ? 28.040 0.143   -5.654  1.00 0.00 ? 4  GLU A C    16 
ATOM 10755 O O    . GLU A 1 4  ? 27.648 1.136   -5.069  1.00 0.00 ? 4  GLU A O    16 
ATOM 10756 C CB   . GLU A 1 4  ? 26.723 -1.430  -7.092  1.00 0.00 ? 4  GLU A CB   16 
ATOM 10757 C CG   . GLU A 1 4  ? 25.311 -1.088  -7.557  1.00 0.00 ? 4  GLU A CG   16 
ATOM 10758 C CD   . GLU A 1 4  ? 24.312 -2.227  -7.295  1.00 0.00 ? 4  GLU A CD   16 
ATOM 10759 O OE1  . GLU A 1 4  ? 24.306 -2.769  -6.189  1.00 0.00 ? 4  GLU A OE1  16 
ATOM 10760 O OE2  . GLU A 1 4  ? 23.542 -2.555  -8.197  1.00 0.00 ? 4  GLU A OE2  16 
ATOM 10761 H H    . GLU A 1 4  ? 28.865 -1.344  -8.387  1.00 0.00 ? 4  GLU A H    16 
ATOM 10762 H HA   . GLU A 1 4  ? 27.106 0.702   -7.514  1.00 0.00 ? 4  GLU A HA   16 
ATOM 10763 H HB2  . GLU A 1 4  ? 27.146 -2.209  -7.726  1.00 0.00 ? 4  GLU A HB2  16 
ATOM 10764 H HB3  . GLU A 1 4  ? 26.687 -1.893  -6.105  1.00 0.00 ? 4  GLU A HB3  16 
ATOM 10765 H HG2  . GLU A 1 4  ? 24.965 -0.195  -7.041  1.00 0.00 ? 4  GLU A HG2  16 
ATOM 10766 H HG3  . GLU A 1 4  ? 25.342 -0.844  -8.618  1.00 0.00 ? 4  GLU A HG3  16 
ATOM 10767 N N    . ALA A 1 5  ? 28.872 -0.783  -5.129  1.00 0.00 ? 5  ALA A N    16 
ATOM 10768 C CA   . ALA A 1 5  ? 29.437 -0.547  -3.812  1.00 0.00 ? 5  ALA A CA   16 
ATOM 10769 C C    . ALA A 1 5  ? 30.516 0.533   -3.883  1.00 0.00 ? 5  ALA A C    16 
ATOM 10770 O O    . ALA A 1 5  ? 30.837 1.112   -2.859  1.00 0.00 ? 5  ALA A O    16 
ATOM 10771 C CB   . ALA A 1 5  ? 30.027 -1.826  -3.219  1.00 0.00 ? 5  ALA A CB   16 
ATOM 10772 H H    . ALA A 1 5  ? 29.148 -1.575  -5.665  1.00 0.00 ? 5  ALA A H    16 
ATOM 10773 H HA   . ALA A 1 5  ? 28.629 -0.208  -3.162  1.00 0.00 ? 5  ALA A HA   16 
ATOM 10774 H HB1  . ALA A 1 5  ? 30.896 -2.178  -3.776  1.00 0.00 ? 5  ALA A HB1  16 
ATOM 10775 H HB2  . ALA A 1 5  ? 29.291 -2.627  -3.189  1.00 0.00 ? 5  ALA A HB2  16 
ATOM 10776 H HB3  . ALA A 1 5  ? 30.341 -1.642  -2.190  1.00 0.00 ? 5  ALA A HB3  16 
ATOM 10777 N N    . ILE A 1 6  ? 31.068 0.808   -5.080  1.00 0.00 ? 6  ILE A N    16 
ATOM 10778 C CA   . ILE A 1 6  ? 32.168 1.779   -5.145  1.00 0.00 ? 6  ILE A CA   16 
ATOM 10779 C C    . ILE A 1 6  ? 31.703 3.200   -4.818  1.00 0.00 ? 6  ILE A C    16 
ATOM 10780 O O    . ILE A 1 6  ? 32.378 3.916   -4.094  1.00 0.00 ? 6  ILE A O    16 
ATOM 10781 C CB   . ILE A 1 6  ? 32.939 1.691   -6.464  1.00 0.00 ? 6  ILE A CB   16 
ATOM 10782 C CG1  . ILE A 1 6  ? 33.383 0.241   -6.690  1.00 0.00 ? 6  ILE A CG1  16 
ATOM 10783 C CG2  . ILE A 1 6  ? 34.149 2.629   -6.487  1.00 0.00 ? 6  ILE A CG2  16 
ATOM 10784 C CD1  . ILE A 1 6  ? 34.306 0.061   -7.893  1.00 0.00 ? 6  ILE A CD1  16 
ATOM 10785 H H    . ILE A 1 6  ? 30.719 0.359   -5.905  1.00 0.00 ? 6  ILE A H    16 
ATOM 10786 H HA   . ILE A 1 6  ? 32.868 1.519   -4.362  1.00 0.00 ? 6  ILE A HA   16 
ATOM 10787 H HB   . ILE A 1 6  ? 32.280 2.012   -7.265  1.00 0.00 ? 6  ILE A HB   16 
ATOM 10788 H HG12 . ILE A 1 6  ? 33.873 -0.142  -5.793  1.00 0.00 ? 6  ILE A HG12 16 
ATOM 10789 H HG13 . ILE A 1 6  ? 32.510 -0.378  -6.830  1.00 0.00 ? 6  ILE A HG13 16 
ATOM 10790 H HG21 . ILE A 1 6  ? 34.981 2.193   -5.941  1.00 0.00 ? 6  ILE A HG21 16 
ATOM 10791 H HG22 . ILE A 1 6  ? 33.932 3.581   -6.023  1.00 0.00 ? 6  ILE A HG22 16 
ATOM 10792 H HG23 . ILE A 1 6  ? 34.459 2.833   -7.512  1.00 0.00 ? 6  ILE A HG23 16 
ATOM 10793 H HD11 . ILE A 1 6  ? 35.265 0.542   -7.712  1.00 0.00 ? 6  ILE A HD11 16 
ATOM 10794 H HD12 . ILE A 1 6  ? 33.912 0.482   -8.816  1.00 0.00 ? 6  ILE A HD12 16 
ATOM 10795 H HD13 . ILE A 1 6  ? 34.467 -1.001  -8.059  1.00 0.00 ? 6  ILE A HD13 16 
ATOM 10796 N N    . GLU A 1 7  ? 30.528 3.565   -5.353  1.00 0.00 ? 7  GLU A N    16 
ATOM 10797 C CA   . GLU A 1 7  ? 29.987 4.887   -5.057  1.00 0.00 ? 7  GLU A CA   16 
ATOM 10798 C C    . GLU A 1 7  ? 29.489 4.995   -3.600  1.00 0.00 ? 7  GLU A C    16 
ATOM 10799 O O    . GLU A 1 7  ? 29.318 6.085   -3.085  1.00 0.00 ? 7  GLU A O    16 
ATOM 10800 C CB   . GLU A 1 7  ? 28.864 5.202   -6.055  1.00 0.00 ? 7  GLU A CB   16 
ATOM 10801 C CG   . GLU A 1 7  ? 27.672 4.240   -5.948  1.00 0.00 ? 7  GLU A CG   16 
ATOM 10802 C CD   . GLU A 1 7  ? 26.616 4.521   -7.031  1.00 0.00 ? 7  GLU A CD   16 
ATOM 10803 O OE1  . GLU A 1 7  ? 25.853 5.476   -6.880  1.00 0.00 ? 7  GLU A OE1  16 
ATOM 10804 O OE2  . GLU A 1 7  ? 26.564 3.779   -8.010  1.00 0.00 ? 7  GLU A OE2  16 
ATOM 10805 H H    . GLU A 1 7  ? 30.024 2.935   -5.940  1.00 0.00 ? 7  GLU A H    16 
ATOM 10806 H HA   . GLU A 1 7  ? 30.801 5.605   -5.181  1.00 0.00 ? 7  GLU A HA   16 
ATOM 10807 H HB2  . GLU A 1 7  ? 28.518 6.225   -5.903  1.00 0.00 ? 7  GLU A HB2  16 
ATOM 10808 H HB3  . GLU A 1 7  ? 29.277 5.161   -7.063  1.00 0.00 ? 7  GLU A HB3  16 
ATOM 10809 H HG2  . GLU A 1 7  ? 28.014 3.212   -6.048  1.00 0.00 ? 7  GLU A HG2  16 
ATOM 10810 H HG3  . GLU A 1 7  ? 27.205 4.330   -4.968  1.00 0.00 ? 7  GLU A HG3  16 
ATOM 10811 N N    . ARG A 1 8  ? 29.282 3.807   -2.983  1.00 0.00 ? 8  ARG A N    16 
ATOM 10812 C CA   . ARG A 1 8  ? 28.811 3.731   -1.605  1.00 0.00 ? 8  ARG A CA   16 
ATOM 10813 C C    . ARG A 1 8  ? 29.984 3.922   -0.635  1.00 0.00 ? 8  ARG A C    16 
ATOM 10814 O O    . ARG A 1 8  ? 29.959 4.807   0.200   1.00 0.00 ? 8  ARG A O    16 
ATOM 10815 C CB   . ARG A 1 8  ? 28.121 2.374   -1.384  1.00 0.00 ? 8  ARG A CB   16 
ATOM 10816 C CG   . ARG A 1 8  ? 26.716 2.482   -0.764  1.00 0.00 ? 8  ARG A CG   16 
ATOM 10817 C CD   . ARG A 1 8  ? 25.615 2.010   -1.718  1.00 0.00 ? 8  ARG A CD   16 
ATOM 10818 N NE   . ARG A 1 8  ? 24.465 1.515   -0.973  1.00 0.00 ? 8  ARG A NE   16 
ATOM 10819 C CZ   . ARG A 1 8  ? 23.468 2.293   -0.500  1.00 0.00 ? 8  ARG A CZ   16 
ATOM 10820 N NH1  . ARG A 1 8  ? 23.460 3.610   -0.689  1.00 0.00 ? 8  ARG A NH1  16 
ATOM 10821 N NH2  . ARG A 1 8  ? 22.475 1.714   0.167   1.00 0.00 ? 8  ARG A NH2  16 
ATOM 10822 H H    . ARG A 1 8  ? 29.467 2.952   -3.462  1.00 0.00 ? 8  ARG A H    16 
ATOM 10823 H HA   . ARG A 1 8  ? 28.113 4.557   -1.464  1.00 0.00 ? 8  ARG A HA   16 
ATOM 10824 H HB2  . ARG A 1 8  ? 28.082 1.839   -2.331  1.00 0.00 ? 8  ARG A HB2  16 
ATOM 10825 H HB3  . ARG A 1 8  ? 28.716 1.713   -0.753  1.00 0.00 ? 8  ARG A HB3  16 
ATOM 10826 H HG2  . ARG A 1 8  ? 26.694 1.868   0.134   1.00 0.00 ? 8  ARG A HG2  16 
ATOM 10827 H HG3  . ARG A 1 8  ? 26.493 3.490   -0.417  1.00 0.00 ? 8  ARG A HG3  16 
ATOM 10828 H HD2  . ARG A 1 8  ? 25.308 2.798   -2.404  1.00 0.00 ? 8  ARG A HD2  16 
ATOM 10829 H HD3  . ARG A 1 8  ? 25.947 1.165   -2.320  1.00 0.00 ? 8  ARG A HD3  16 
ATOM 10830 H HE   . ARG A 1 8  ? 24.415 0.534   -0.790  1.00 0.00 ? 8  ARG A HE   16 
ATOM 10831 H HH11 . ARG A 1 8  ? 24.208 4.055   -1.182  1.00 0.00 ? 8  ARG A HH11 16 
ATOM 10832 H HH12 . ARG A 1 8  ? 22.699 4.154   -0.334  1.00 0.00 ? 8  ARG A HH12 16 
ATOM 10833 H HH21 . ARG A 1 8  ? 22.483 0.723   0.309   1.00 0.00 ? 8  ARG A HH21 16 
ATOM 10834 H HH22 . ARG A 1 8  ? 21.724 2.268   0.525   1.00 0.00 ? 8  ARG A HH22 16 
ATOM 10835 N N    . LEU A 1 9  ? 30.992 3.042   -0.840  1.00 0.00 ? 9  LEU A N    16 
ATOM 10836 C CA   . LEU A 1 9  ? 32.290 3.008   -0.171  1.00 0.00 ? 9  LEU A CA   16 
ATOM 10837 C C    . LEU A 1 9  ? 32.902 4.435   -0.183  1.00 0.00 ? 9  LEU A C    16 
ATOM 10838 O O    . LEU A 1 9  ? 33.279 4.970   0.848   1.00 0.00 ? 9  LEU A O    16 
ATOM 10839 C CB   . LEU A 1 9  ? 33.180 1.950   -0.850  1.00 0.00 ? 9  LEU A CB   16 
ATOM 10840 C CG   . LEU A 1 9  ? 32.647 0.498   -0.784  1.00 0.00 ? 9  LEU A CG   16 
ATOM 10841 C CD1  . LEU A 1 9  ? 33.164 -0.330  -1.968  1.00 0.00 ? 9  LEU A CD1  16 
ATOM 10842 C CD2  . LEU A 1 9  ? 32.962 -0.218  0.522   1.00 0.00 ? 9  LEU A CD2  16 
ATOM 10843 H H    . LEU A 1 9  ? 30.829 2.346   -1.522  1.00 0.00 ? 9  LEU A H    16 
ATOM 10844 H HA   . LEU A 1 9  ? 32.125 2.660   0.844   1.00 0.00 ? 9  LEU A HA   16 
ATOM 10845 H HB2  . LEU A 1 9  ? 33.291 2.257   -1.889  1.00 0.00 ? 9  LEU A HB2  16 
ATOM 10846 H HB3  . LEU A 1 9  ? 34.177 1.949   -0.416  1.00 0.00 ? 9  LEU A HB3  16 
ATOM 10847 H HG   . LEU A 1 9  ? 31.562 0.509   -0.802  1.00 0.00 ? 9  LEU A HG   16 
ATOM 10848 H HD11 . LEU A 1 9  ? 33.191 0.235   -2.885  1.00 0.00 ? 9  LEU A HD11 16 
ATOM 10849 H HD12 . LEU A 1 9  ? 32.505 -1.166  -2.171  1.00 0.00 ? 9  LEU A HD12 16 
ATOM 10850 H HD13 . LEU A 1 9  ? 34.185 -0.680  -1.811  1.00 0.00 ? 9  LEU A HD13 16 
ATOM 10851 H HD21 . LEU A 1 9  ? 33.988 -0.578  0.521   1.00 0.00 ? 9  LEU A HD21 16 
ATOM 10852 H HD22 . LEU A 1 9  ? 32.307 -1.079  0.648   1.00 0.00 ? 9  LEU A HD22 16 
ATOM 10853 H HD23 . LEU A 1 9  ? 32.811 0.438   1.375   1.00 0.00 ? 9  LEU A HD23 16 
ATOM 10854 N N    . LYS A 1 10 ? 32.918 5.043   -1.386  1.00 0.00 ? 10 LYS A N    16 
ATOM 10855 C CA   . LYS A 1 10 ? 33.402 6.423   -1.542  1.00 0.00 ? 10 LYS A CA   16 
ATOM 10856 C C    . LYS A 1 10 ? 32.505 7.455   -0.826  1.00 0.00 ? 10 LYS A C    16 
ATOM 10857 O O    . LYS A 1 10 ? 32.984 8.444   -0.299  1.00 0.00 ? 10 LYS A O    16 
ATOM 10858 C CB   . LYS A 1 10 ? 33.434 6.777   -3.029  1.00 0.00 ? 10 LYS A CB   16 
ATOM 10859 C CG   . LYS A 1 10 ? 34.484 5.990   -3.797  1.00 0.00 ? 10 LYS A CG   16 
ATOM 10860 C CD   . LYS A 1 10 ? 34.291 6.128   -5.301  1.00 0.00 ? 10 LYS A CD   16 
ATOM 10861 C CE   . LYS A 1 10 ? 34.762 7.477   -5.845  1.00 0.00 ? 10 LYS A CE   16 
ATOM 10862 N NZ   . LYS A 1 10 ? 34.056 7.766   -7.085  1.00 0.00 ? 10 LYS A NZ   16 
ATOM 10863 H H    . LYS A 1 10 ? 32.553 4.540   -2.168  1.00 0.00 ? 10 LYS A H    16 
ATOM 10864 H HA   . LYS A 1 10 ? 34.406 6.484   -1.115  1.00 0.00 ? 10 LYS A HA   16 
ATOM 10865 H HB2  . LYS A 1 10 ? 32.455 6.602   -3.474  1.00 0.00 ? 10 LYS A HB2  16 
ATOM 10866 H HB3  . LYS A 1 10 ? 33.642 7.838   -3.161  1.00 0.00 ? 10 LYS A HB3  16 
ATOM 10867 H HG2  . LYS A 1 10 ? 35.468 6.328   -3.487  1.00 0.00 ? 10 LYS A HG2  16 
ATOM 10868 H HG3  . LYS A 1 10 ? 34.430 4.938   -3.535  1.00 0.00 ? 10 LYS A HG3  16 
ATOM 10869 H HD2  . LYS A 1 10 ? 34.860 5.341   -5.783  1.00 0.00 ? 10 LYS A HD2  16 
ATOM 10870 H HD3  . LYS A 1 10 ? 33.241 5.954   -5.558  1.00 0.00 ? 10 LYS A HD3  16 
ATOM 10871 H HE2  . LYS A 1 10 ? 34.558 8.285   -5.141  1.00 0.00 ? 10 LYS A HE2  16 
ATOM 10872 H HE3  . LYS A 1 10 ? 35.835 7.477   -6.049  1.00 0.00 ? 10 LYS A HE3  16 
ATOM 10873 H HZ1  . LYS A 1 10 ? 34.500 8.565   -7.580  1.00 0.00 ? 10 LYS A HZ1  16 
ATOM 10874 H HZ2  . LYS A 1 10 ? 33.064 7.992   -6.870  1.00 0.00 ? 10 LYS A HZ2  16 
ATOM 10875 H HZ3  . LYS A 1 10 ? 34.084 6.928   -7.698  1.00 0.00 ? 10 LYS A HZ3  16 
ATOM 10876 N N    . ALA A 1 11 ? 31.183 7.165   -0.854  1.00 0.00 ? 11 ALA A N    16 
ATOM 10877 C CA   . ALA A 1 11 ? 30.200 8.070   -0.253  1.00 0.00 ? 11 ALA A CA   16 
ATOM 10878 C C    . ALA A 1 11 ? 30.329 8.162   1.281   1.00 0.00 ? 11 ALA A C    16 
ATOM 10879 O O    . ALA A 1 11 ? 29.862 9.120   1.877   1.00 0.00 ? 11 ALA A O    16 
ATOM 10880 C CB   . ALA A 1 11 ? 28.773 7.652   -0.628  1.00 0.00 ? 11 ALA A CB   16 
ATOM 10881 H H    . ALA A 1 11 ? 30.881 6.332   -1.310  1.00 0.00 ? 11 ALA A H    16 
ATOM 10882 H HA   . ALA A 1 11 ? 30.391 9.060   -0.671  1.00 0.00 ? 11 ALA A HA   16 
ATOM 10883 H HB1  . ALA A 1 11 ? 28.567 7.897   -1.668  1.00 0.00 ? 11 ALA A HB1  16 
ATOM 10884 H HB2  . ALA A 1 11 ? 28.030 8.172   -0.022  1.00 0.00 ? 11 ALA A HB2  16 
ATOM 10885 H HB3  . ALA A 1 11 ? 28.603 6.588   -0.495  1.00 0.00 ? 11 ALA A HB3  16 
ATOM 10886 N N    . LEU A 1 12 ? 30.999 7.147   1.879   1.00 0.00 ? 12 LEU A N    16 
ATOM 10887 C CA   . LEU A 1 12 ? 31.264 7.175   3.315   1.00 0.00 ? 12 LEU A CA   16 
ATOM 10888 C C    . LEU A 1 12 ? 32.421 8.160   3.671   1.00 0.00 ? 12 LEU A C    16 
ATOM 10889 O O    . LEU A 1 12 ? 32.798 8.262   4.828   1.00 0.00 ? 12 LEU A O    16 
ATOM 10890 C CB   . LEU A 1 12 ? 31.619 5.755   3.797   1.00 0.00 ? 12 LEU A CB   16 
ATOM 10891 C CG   . LEU A 1 12 ? 30.482 4.703   3.858   1.00 0.00 ? 12 LEU A CG   16 
ATOM 10892 C CD1  . LEU A 1 12 ? 30.614 3.676   2.731   1.00 0.00 ? 12 LEU A CD1  16 
ATOM 10893 C CD2  . LEU A 1 12 ? 30.507 3.929   5.180   1.00 0.00 ? 12 LEU A CD2  16 
ATOM 10894 H H    . LEU A 1 12 ? 31.353 6.383   1.345   1.00 0.00 ? 12 LEU A H    16 
ATOM 10895 H HA   . LEU A 1 12 ? 30.361 7.525   3.818   1.00 0.00 ? 12 LEU A HA   16 
ATOM 10896 H HB2  . LEU A 1 12 ? 32.404 5.394   3.144   1.00 0.00 ? 12 LEU A HB2  16 
ATOM 10897 H HB3  . LEU A 1 12 ? 32.061 5.830   4.785   1.00 0.00 ? 12 LEU A HB3  16 
ATOM 10898 H HG   . LEU A 1 12 ? 29.521 5.213   3.772   1.00 0.00 ? 12 LEU A HG   16 
ATOM 10899 H HD11 . LEU A 1 12 ? 31.179 4.134   1.934   1.00 0.00 ? 12 LEU A HD11 16 
ATOM 10900 H HD12 . LEU A 1 12 ? 29.643 3.356   2.352   1.00 0.00 ? 12 LEU A HD12 16 
ATOM 10901 H HD13 . LEU A 1 12 ? 31.181 2.788   3.021   1.00 0.00 ? 12 LEU A HD13 16 
ATOM 10902 H HD21 . LEU A 1 12 ? 31.342 3.234   5.185   1.00 0.00 ? 12 LEU A HD21 16 
ATOM 10903 H HD22 . LEU A 1 12 ? 29.612 3.322   5.299   1.00 0.00 ? 12 LEU A HD22 16 
ATOM 10904 H HD23 . LEU A 1 12 ? 30.616 4.591   6.039   1.00 0.00 ? 12 LEU A HD23 16 
ATOM 10905 N N    . GLY A 1 13 ? 32.944 8.874   2.639   1.00 0.00 ? 13 GLY A N    16 
ATOM 10906 C CA   . GLY A 1 13 ? 33.977 9.898   2.825   1.00 0.00 ? 13 GLY A CA   16 
ATOM 10907 C C    . GLY A 1 13 ? 35.378 9.398   2.443   1.00 0.00 ? 13 GLY A C    16 
ATOM 10908 O O    . GLY A 1 13 ? 36.378 9.898   2.938   1.00 0.00 ? 13 GLY A O    16 
ATOM 10909 H H    . GLY A 1 13 ? 32.598 8.731   1.716   1.00 0.00 ? 13 GLY A H    16 
ATOM 10910 H HA2  . GLY A 1 13 ? 33.713 10.743  2.188   1.00 0.00 ? 13 GLY A HA2  16 
ATOM 10911 H HA3  . GLY A 1 13 ? 33.977 10.228  3.865   1.00 0.00 ? 13 GLY A HA3  16 
ATOM 10912 N N    . PHE A 1 14 ? 35.373 8.370   1.557   1.00 0.00 ? 14 PHE A N    16 
ATOM 10913 C CA   . PHE A 1 14 ? 36.596 7.660   1.179   1.00 0.00 ? 14 PHE A CA   16 
ATOM 10914 C C    . PHE A 1 14 ? 36.945 8.032   -0.276  1.00 0.00 ? 14 PHE A C    16 
ATOM 10915 O O    . PHE A 1 14 ? 36.716 9.161   -0.698  1.00 0.00 ? 14 PHE A O    16 
ATOM 10916 C CB   . PHE A 1 14 ? 36.376 6.143   1.389   1.00 0.00 ? 14 PHE A CB   16 
ATOM 10917 C CG   . PHE A 1 14 ? 35.866 5.791   2.769   1.00 0.00 ? 14 PHE A CG   16 
ATOM 10918 C CD1  . PHE A 1 14 ? 36.102 6.608   3.879   1.00 0.00 ? 14 PHE A CD1  16 
ATOM 10919 C CD2  . PHE A 1 14 ? 35.086 4.653   2.934   1.00 0.00 ? 14 PHE A CD2  16 
ATOM 10920 C CE1  . PHE A 1 14 ? 35.471 6.353   5.085   1.00 0.00 ? 14 PHE A CE1  16 
ATOM 10921 C CE2  . PHE A 1 14 ? 34.452 4.399   4.140   1.00 0.00 ? 14 PHE A CE2  16 
ATOM 10922 C CZ   . PHE A 1 14 ? 34.622 5.272   5.210   1.00 0.00 ? 14 PHE A CZ   16 
ATOM 10923 H H    . PHE A 1 14 ? 34.510 8.052   1.174   1.00 0.00 ? 14 PHE A H    16 
ATOM 10924 H HA   . PHE A 1 14 ? 37.407 8.025   1.810   1.00 0.00 ? 14 PHE A HA   16 
ATOM 10925 H HB2  . PHE A 1 14 ? 35.647 5.799   0.652   1.00 0.00 ? 14 PHE A HB2  16 
ATOM 10926 H HB3  . PHE A 1 14 ? 37.282 5.575   1.210   1.00 0.00 ? 14 PHE A HB3  16 
ATOM 10927 H HD1  . PHE A 1 14 ? 36.759 7.465   3.832   1.00 0.00 ? 14 PHE A HD1  16 
ATOM 10928 H HD2  . PHE A 1 14 ? 34.965 3.953   2.115   1.00 0.00 ? 14 PHE A HD2  16 
ATOM 10929 H HE1  . PHE A 1 14 ? 35.624 7.006   5.930   1.00 0.00 ? 14 PHE A HE1  16 
ATOM 10930 H HE2  . PHE A 1 14 ? 33.802 3.540   4.216   1.00 0.00 ? 14 PHE A HE2  16 
ATOM 10931 H HZ   . PHE A 1 14 ? 34.089 5.137   6.142   1.00 0.00 ? 14 PHE A HZ   16 
ATOM 10932 N N    . GLU A 1 15 ? 37.516 7.047   -1.007  1.00 0.00 ? 15 GLU A N    16 
ATOM 10933 C CA   . GLU A 1 15 ? 38.004 7.285   -2.365  1.00 0.00 ? 15 GLU A CA   16 
ATOM 10934 C C    . GLU A 1 15 ? 38.200 5.933   -3.057  1.00 0.00 ? 15 GLU A C    16 
ATOM 10935 O O    . GLU A 1 15 ? 38.652 4.977   -2.440  1.00 0.00 ? 15 GLU A O    16 
ATOM 10936 C CB   . GLU A 1 15 ? 39.327 8.080   -2.318  1.00 0.00 ? 15 GLU A CB   16 
ATOM 10937 C CG   . GLU A 1 15 ? 39.652 8.793   -3.637  1.00 0.00 ? 15 GLU A CG   16 
ATOM 10938 C CD   . GLU A 1 15 ? 40.810 9.810   -3.521  1.00 0.00 ? 15 GLU A CD   16 
ATOM 10939 O OE1  . GLU A 1 15 ? 41.561 9.766   -2.545  1.00 0.00 ? 15 GLU A OE1  16 
ATOM 10940 O OE2  . GLU A 1 15 ? 40.944 10.643  -4.417  1.00 0.00 ? 15 GLU A OE2  16 
ATOM 10941 H H    . GLU A 1 15 ? 37.642 6.146   -0.594  1.00 0.00 ? 15 GLU A H    16 
ATOM 10942 H HA   . GLU A 1 15 ? 37.231 7.849   -2.893  1.00 0.00 ? 15 GLU A HA   16 
ATOM 10943 H HB2  . GLU A 1 15 ? 39.256 8.813   -1.517  1.00 0.00 ? 15 GLU A HB2  16 
ATOM 10944 H HB3  . GLU A 1 15 ? 40.181 7.453   -2.070  1.00 0.00 ? 15 GLU A HB3  16 
ATOM 10945 H HG2  . GLU A 1 15 ? 39.901 8.062   -4.404  1.00 0.00 ? 15 GLU A HG2  16 
ATOM 10946 H HG3  . GLU A 1 15 ? 38.768 9.319   -3.987  1.00 0.00 ? 15 GLU A HG3  16 
ATOM 10947 N N    . GLU A 1 16 ? 37.829 5.930   -4.355  1.00 0.00 ? 16 GLU A N    16 
ATOM 10948 C CA   . GLU A 1 16 ? 37.809 4.791   -5.281  1.00 0.00 ? 16 GLU A CA   16 
ATOM 10949 C C    . GLU A 1 16 ? 39.013 3.812   -5.141  1.00 0.00 ? 16 GLU A C    16 
ATOM 10950 O O    . GLU A 1 16 ? 38.885 2.625   -5.405  1.00 0.00 ? 16 GLU A O    16 
ATOM 10951 C CB   . GLU A 1 16 ? 37.646 5.360   -6.708  1.00 0.00 ? 16 GLU A CB   16 
ATOM 10952 C CG   . GLU A 1 16 ? 38.331 4.616   -7.867  1.00 0.00 ? 16 GLU A CG   16 
ATOM 10953 C CD   . GLU A 1 16 ? 37.721 3.253   -8.239  1.00 0.00 ? 16 GLU A CD   16 
ATOM 10954 O OE1  . GLU A 1 16 ? 36.906 2.730   -7.483  1.00 0.00 ? 16 GLU A OE1  16 
ATOM 10955 O OE2  . GLU A 1 16 ? 38.069 2.724   -9.289  1.00 0.00 ? 16 GLU A OE2  16 
ATOM 10956 H H    . GLU A 1 16 ? 37.488 6.803   -4.698  1.00 0.00 ? 16 GLU A H    16 
ATOM 10957 H HA   . GLU A 1 16 ? 36.895 4.262   -5.026  1.00 0.00 ? 16 GLU A HA   16 
ATOM 10958 H HB2  . GLU A 1 16 ? 36.588 5.486   -6.944  1.00 0.00 ? 16 GLU A HB2  16 
ATOM 10959 H HB3  . GLU A 1 16 ? 38.057 6.368   -6.699  1.00 0.00 ? 16 GLU A HB3  16 
ATOM 10960 H HG2  . GLU A 1 16 ? 38.253 5.254   -8.748  1.00 0.00 ? 16 GLU A HG2  16 
ATOM 10961 H HG3  . GLU A 1 16 ? 39.394 4.479   -7.662  1.00 0.00 ? 16 GLU A HG3  16 
ATOM 10962 N N    . SER A 1 17 ? 40.169 4.359   -4.722  1.00 0.00 ? 17 SER A N    16 
ATOM 10963 C CA   . SER A 1 17 ? 41.373 3.550   -4.589  1.00 0.00 ? 17 SER A CA   16 
ATOM 10964 C C    . SER A 1 17 ? 41.372 2.764   -3.270  1.00 0.00 ? 17 SER A C    16 
ATOM 10965 O O    . SER A 1 17 ? 41.572 1.563   -3.273  1.00 0.00 ? 17 SER A O    16 
ATOM 10966 C CB   . SER A 1 17 ? 42.582 4.492   -4.646  1.00 0.00 ? 17 SER A CB   16 
ATOM 10967 O OG   . SER A 1 17 ? 43.161 4.553   -5.934  1.00 0.00 ? 17 SER A OG   16 
ATOM 10968 H H    . SER A 1 17 ? 40.209 5.324   -4.471  1.00 0.00 ? 17 SER A H    16 
ATOM 10969 H HA   . SER A 1 17 ? 41.384 2.817   -5.403  1.00 0.00 ? 17 SER A HA   16 
ATOM 10970 H HB2  . SER A 1 17 ? 42.319 5.495   -4.298  1.00 0.00 ? 17 SER A HB2  16 
ATOM 10971 H HB3  . SER A 1 17 ? 43.367 4.162   -3.969  1.00 0.00 ? 17 SER A HB3  16 
ATOM 10972 H HG   . SER A 1 17 ? 42.498 4.795   -6.571  1.00 0.00 ? 17 SER A HG   16 
ATOM 10973 N N    . LEU A 1 18 ? 41.139 3.502   -2.154  1.00 0.00 ? 18 LEU A N    16 
ATOM 10974 C CA   . LEU A 1 18 ? 41.084 2.825   -0.853  1.00 0.00 ? 18 LEU A CA   16 
ATOM 10975 C C    . LEU A 1 18 ? 39.876 1.891   -0.780  1.00 0.00 ? 18 LEU A C    16 
ATOM 10976 O O    . LEU A 1 18 ? 39.875 0.938   0.005   1.00 0.00 ? 18 LEU A O    16 
ATOM 10977 C CB   . LEU A 1 18 ? 41.181 3.824   0.319   1.00 0.00 ? 18 LEU A CB   16 
ATOM 10978 C CG   . LEU A 1 18 ? 39.900 4.544   0.804   1.00 0.00 ? 18 LEU A CG   16 
ATOM 10979 C CD1  . LEU A 1 18 ? 39.607 4.253   2.274   1.00 0.00 ? 18 LEU A CD1  16 
ATOM 10980 C CD2  . LEU A 1 18 ? 40.029 6.060   0.663   1.00 0.00 ? 18 LEU A CD2  16 
ATOM 10981 H H    . LEU A 1 18 ? 40.962 4.480   -2.229  1.00 0.00 ? 18 LEU A H    16 
ATOM 10982 H HA   . LEU A 1 18 ? 41.970 2.194   -0.798  1.00 0.00 ? 18 LEU A HA   16 
ATOM 10983 H HB2  . LEU A 1 18 ? 41.608 3.288   1.158   1.00 0.00 ? 18 LEU A HB2  16 
ATOM 10984 H HB3  . LEU A 1 18 ? 41.948 4.555   0.078   1.00 0.00 ? 18 LEU A HB3  16 
ATOM 10985 H HG   . LEU A 1 18 ? 39.051 4.206   0.217   1.00 0.00 ? 18 LEU A HG   16 
ATOM 10986 H HD11 . LEU A 1 18 ? 39.561 3.183   2.471   1.00 0.00 ? 18 LEU A HD11 16 
ATOM 10987 H HD12 . LEU A 1 18 ? 38.667 4.706   2.584   1.00 0.00 ? 18 LEU A HD12 16 
ATOM 10988 H HD13 . LEU A 1 18 ? 40.380 4.694   2.900   1.00 0.00 ? 18 LEU A HD13 16 
ATOM 10989 H HD21 . LEU A 1 18 ? 40.926 6.435   1.153   1.00 0.00 ? 18 LEU A HD21 16 
ATOM 10990 H HD22 . LEU A 1 18 ? 39.188 6.584   1.114   1.00 0.00 ? 18 LEU A HD22 16 
ATOM 10991 H HD23 . LEU A 1 18 ? 40.089 6.320   -0.385  1.00 0.00 ? 18 LEU A HD23 16 
ATOM 10992 N N    . VAL A 1 19 ? 38.896 2.204   -1.638  1.00 0.00 ? 19 VAL A N    16 
ATOM 10993 C CA   . VAL A 1 19 ? 37.605 1.550   -1.779  1.00 0.00 ? 19 VAL A CA   16 
ATOM 10994 C C    . VAL A 1 19 ? 37.749 0.192   -2.469  1.00 0.00 ? 19 VAL A C    16 
ATOM 10995 O O    . VAL A 1 19 ? 37.342 -0.823  -1.939  1.00 0.00 ? 19 VAL A O    16 
ATOM 10996 C CB   . VAL A 1 19 ? 36.712 2.521   -2.568  1.00 0.00 ? 19 VAL A CB   16 
ATOM 10997 C CG1  . VAL A 1 19 ? 35.545 1.840   -3.283  1.00 0.00 ? 19 VAL A CG1  16 
ATOM 10998 C CG2  . VAL A 1 19 ? 36.226 3.672   -1.667  1.00 0.00 ? 19 VAL A CG2  16 
ATOM 10999 H H    . VAL A 1 19 ? 39.055 2.981   -2.257  1.00 0.00 ? 19 VAL A H    16 
ATOM 11000 H HA   . VAL A 1 19 ? 37.202 1.352   -0.791  1.00 0.00 ? 19 VAL A HA   16 
ATOM 11001 H HB   . VAL A 1 19 ? 37.345 2.945   -3.344  1.00 0.00 ? 19 VAL A HB   16 
ATOM 11002 H HG11 . VAL A 1 19 ? 35.879 1.214   -4.109  1.00 0.00 ? 19 VAL A HG11 16 
ATOM 11003 H HG12 . VAL A 1 19 ? 34.828 2.552   -3.684  1.00 0.00 ? 19 VAL A HG12 16 
ATOM 11004 H HG13 . VAL A 1 19 ? 35.032 1.196   -2.585  1.00 0.00 ? 19 VAL A HG13 16 
ATOM 11005 H HG21 . VAL A 1 19 ? 36.946 3.910   -0.886  1.00 0.00 ? 19 VAL A HG21 16 
ATOM 11006 H HG22 . VAL A 1 19 ? 35.279 3.478   -1.180  1.00 0.00 ? 19 VAL A HG22 16 
ATOM 11007 H HG23 . VAL A 1 19 ? 36.082 4.571   -2.249  1.00 0.00 ? 19 VAL A HG23 16 
ATOM 11008 N N    . ILE A 1 20 ? 38.344 0.262   -3.678  1.00 0.00 ? 20 ILE A N    16 
ATOM 11009 C CA   . ILE A 1 20 ? 38.565 -0.927  -4.494  1.00 0.00 ? 20 ILE A CA   16 
ATOM 11010 C C    . ILE A 1 20 ? 39.434 -1.926  -3.758  1.00 0.00 ? 20 ILE A C    16 
ATOM 11011 O O    . ILE A 1 20 ? 39.117 -3.099  -3.714  1.00 0.00 ? 20 ILE A O    16 
ATOM 11012 C CB   . ILE A 1 20 ? 39.193 -0.520  -5.841  1.00 0.00 ? 20 ILE A CB   16 
ATOM 11013 C CG1  . ILE A 1 20 ? 38.092 -0.048  -6.795  1.00 0.00 ? 20 ILE A CG1  16 
ATOM 11014 C CG2  . ILE A 1 20 ? 40.094 -1.578  -6.514  1.00 0.00 ? 20 ILE A CG2  16 
ATOM 11015 C CD1  . ILE A 1 20 ? 37.187 -1.181  -7.289  1.00 0.00 ? 20 ILE A CD1  16 
ATOM 11016 H H    . ILE A 1 20 ? 38.653 1.146   -4.013  1.00 0.00 ? 20 ILE A H    16 
ATOM 11017 H HA   . ILE A 1 20 ? 37.591 -1.395  -4.627  1.00 0.00 ? 20 ILE A HA   16 
ATOM 11018 H HB   . ILE A 1 20 ? 39.849 0.327   -5.640  1.00 0.00 ? 20 ILE A HB   16 
ATOM 11019 H HG12 . ILE A 1 20 ? 37.485 0.705   -6.294  1.00 0.00 ? 20 ILE A HG12 16 
ATOM 11020 H HG13 . ILE A 1 20 ? 38.547 0.438   -7.655  1.00 0.00 ? 20 ILE A HG13 16 
ATOM 11021 H HG21 . ILE A 1 20 ? 40.376 -1.263  -7.518  1.00 0.00 ? 20 ILE A HG21 16 
ATOM 11022 H HG22 . ILE A 1 20 ? 39.614 -2.547  -6.609  1.00 0.00 ? 20 ILE A HG22 16 
ATOM 11023 H HG23 . ILE A 1 20 ? 41.010 -1.735  -5.945  1.00 0.00 ? 20 ILE A HG23 16 
ATOM 11024 H HD11 . ILE A 1 20 ? 37.726 -2.114  -7.429  1.00 0.00 ? 20 ILE A HD11 16 
ATOM 11025 H HD12 . ILE A 1 20 ? 36.762 -0.923  -8.257  1.00 0.00 ? 20 ILE A HD12 16 
ATOM 11026 H HD13 . ILE A 1 20 ? 36.378 -1.371  -6.584  1.00 0.00 ? 20 ILE A HD13 16 
ATOM 11027 N N    . GLN A 1 21 ? 40.524 -1.385  -3.187  1.00 0.00 ? 21 GLN A N    16 
ATOM 11028 C CA   . GLN A 1 21 ? 41.458 -2.224  -2.453  1.00 0.00 ? 21 GLN A CA   16 
ATOM 11029 C C    . GLN A 1 21 ? 40.835 -2.724  -1.129  1.00 0.00 ? 21 GLN A C    16 
ATOM 11030 O O    . GLN A 1 21 ? 41.158 -3.801  -0.662  1.00 0.00 ? 21 GLN A O    16 
ATOM 11031 C CB   . GLN A 1 21 ? 42.761 -1.435  -2.244  1.00 0.00 ? 21 GLN A CB   16 
ATOM 11032 C CG   . GLN A 1 21 ? 43.992 -2.324  -2.005  1.00 0.00 ? 21 GLN A CG   16 
ATOM 11033 C CD   . GLN A 1 21 ? 44.048 -2.855  -0.573  1.00 0.00 ? 21 GLN A CD   16 
ATOM 11034 O OE1  . GLN A 1 21 ? 43.565 -2.241  0.357   1.00 0.00 ? 21 GLN A OE1  16 
ATOM 11035 N NE2  . GLN A 1 21 ? 44.685 -4.040  -0.469  1.00 0.00 ? 21 GLN A NE2  16 
ATOM 11036 H H    . GLN A 1 21 ? 40.684 -0.406  -3.289  1.00 0.00 ? 21 GLN A H    16 
ATOM 11037 H HA   . GLN A 1 21 ? 41.660 -3.086  -3.094  1.00 0.00 ? 21 GLN A HA   16 
ATOM 11038 H HB2  . GLN A 1 21 ? 42.968 -0.883  -3.159  1.00 0.00 ? 21 GLN A HB2  16 
ATOM 11039 H HB3  . GLN A 1 21 ? 42.652 -0.671  -1.472  1.00 0.00 ? 21 GLN A HB3  16 
ATOM 11040 H HG2  . GLN A 1 21 ? 44.011 -3.156  -2.707  1.00 0.00 ? 21 GLN A HG2  16 
ATOM 11041 H HG3  . GLN A 1 21 ? 44.900 -1.750  -2.182  1.00 0.00 ? 21 GLN A HG3  16 
ATOM 11042 H HE21 . GLN A 1 21 ? 45.064 -4.488  -1.281  1.00 0.00 ? 21 GLN A HE21 16 
ATOM 11043 H HE22 . GLN A 1 21 ? 44.781 -4.478  0.419   1.00 0.00 ? 21 GLN A HE22 16 
ATOM 11044 N N    . ALA A 1 22 ? 39.911 -1.899  -0.578  1.00 0.00 ? 22 ALA A N    16 
ATOM 11045 C CA   . ALA A 1 22 ? 39.179 -2.291  0.627   1.00 0.00 ? 22 ALA A CA   16 
ATOM 11046 C C    . ALA A 1 22 ? 38.034 -3.262  0.348   1.00 0.00 ? 22 ALA A C    16 
ATOM 11047 O O    . ALA A 1 22 ? 37.484 -3.822  1.282   1.00 0.00 ? 22 ALA A O    16 
ATOM 11048 C CB   . ALA A 1 22 ? 38.497 -1.094  1.281   1.00 0.00 ? 22 ALA A CB   16 
ATOM 11049 H H    . ALA A 1 22 ? 39.684 -1.040  -1.031  1.00 0.00 ? 22 ALA A H    16 
ATOM 11050 H HA   . ALA A 1 22 ? 39.879 -2.772  1.312   1.00 0.00 ? 22 ALA A HA   16 
ATOM 11051 H HB1  . ALA A 1 22 ? 39.218 -0.396  1.694   1.00 0.00 ? 22 ALA A HB1  16 
ATOM 11052 H HB2  . ALA A 1 22 ? 37.880 -1.437  2.114   1.00 0.00 ? 22 ALA A HB2  16 
ATOM 11053 H HB3  . ALA A 1 22 ? 37.851 -0.547  0.592   1.00 0.00 ? 22 ALA A HB3  16 
ATOM 11054 N N    . TYR A 1 23 ? 37.685 -3.400  -0.947  1.00 0.00 ? 23 TYR A N    16 
ATOM 11055 C CA   . TYR A 1 23 ? 36.601 -4.296  -1.340  1.00 0.00 ? 23 TYR A CA   16 
ATOM 11056 C C    . TYR A 1 23 ? 37.203 -5.587  -1.902  1.00 0.00 ? 23 TYR A C    16 
ATOM 11057 O O    . TYR A 1 23 ? 36.596 -6.637  -1.798  1.00 0.00 ? 23 TYR A O    16 
ATOM 11058 C CB   . TYR A 1 23 ? 35.669 -3.599  -2.352  1.00 0.00 ? 23 TYR A CB   16 
ATOM 11059 C CG   . TYR A 1 23 ? 34.206 -3.938  -2.160  1.00 0.00 ? 23 TYR A CG   16 
ATOM 11060 C CD1  . TYR A 1 23 ? 33.487 -3.261  -1.192  1.00 0.00 ? 23 TYR A CD1  16 
ATOM 11061 C CD2  . TYR A 1 23 ? 33.546 -4.890  -2.927  1.00 0.00 ? 23 TYR A CD2  16 
ATOM 11062 C CE1  . TYR A 1 23 ? 32.132 -3.491  -0.993  1.00 0.00 ? 23 TYR A CE1  16 
ATOM 11063 C CE2  . TYR A 1 23 ? 32.188 -5.135  -2.742  1.00 0.00 ? 23 TYR A CE2  16 
ATOM 11064 C CZ   . TYR A 1 23 ? 31.478 -4.424  -1.778  1.00 0.00 ? 23 TYR A CZ   16 
ATOM 11065 O OH   . TYR A 1 23 ? 30.127 -4.620  -1.583  1.00 0.00 ? 23 TYR A OH   16 
ATOM 11066 H H    . TYR A 1 23 ? 38.176 -2.893  -1.653  1.00 0.00 ? 23 TYR A H    16 
ATOM 11067 H HA   . TYR A 1 23 ? 36.033 -4.554  -0.445  1.00 0.00 ? 23 TYR A HA   16 
ATOM 11068 H HB2  . TYR A 1 23 ? 35.741 -2.528  -2.186  1.00 0.00 ? 23 TYR A HB2  16 
ATOM 11069 H HB3  . TYR A 1 23 ? 35.975 -3.746  -3.390  1.00 0.00 ? 23 TYR A HB3  16 
ATOM 11070 H HD1  . TYR A 1 23 ? 33.991 -2.515  -0.605  1.00 0.00 ? 23 TYR A HD1  16 
ATOM 11071 H HD2  . TYR A 1 23 ? 34.092 -5.441  -3.674  1.00 0.00 ? 23 TYR A HD2  16 
ATOM 11072 H HE1  . TYR A 1 23 ? 31.590 -2.944  -0.235  1.00 0.00 ? 23 TYR A HE1  16 
ATOM 11073 H HE2  . TYR A 1 23 ? 31.696 -5.888  -3.344  1.00 0.00 ? 23 TYR A HE2  16 
ATOM 11074 H HH   . TYR A 1 23 ? 29.951 -5.545  -1.451  1.00 0.00 ? 23 TYR A HH   16 
ATOM 11075 N N    . PHE A 1 24 ? 38.414 -5.466  -2.487  1.00 0.00 ? 24 PHE A N    16 
ATOM 11076 C CA   . PHE A 1 24 ? 39.054 -6.592  -3.168  1.00 0.00 ? 24 PHE A CA   16 
ATOM 11077 C C    . PHE A 1 24 ? 39.869 -7.420  -2.160  1.00 0.00 ? 24 PHE A C    16 
ATOM 11078 O O    . PHE A 1 24 ? 39.881 -8.636  -2.206  1.00 0.00 ? 24 PHE A O    16 
ATOM 11079 C CB   . PHE A 1 24 ? 39.994 -6.085  -4.283  1.00 0.00 ? 24 PHE A CB   16 
ATOM 11080 C CG   . PHE A 1 24 ? 39.488 -6.368  -5.673  1.00 0.00 ? 24 PHE A CG   16 
ATOM 11081 C CD1  . PHE A 1 24 ? 39.587 -7.653  -6.192  1.00 0.00 ? 24 PHE A CD1  16 
ATOM 11082 C CD2  . PHE A 1 24 ? 38.941 -5.361  -6.457  1.00 0.00 ? 24 PHE A CD2  16 
ATOM 11083 C CE1  . PHE A 1 24 ? 39.185 -7.917  -7.495  1.00 0.00 ? 24 PHE A CE1  16 
ATOM 11084 C CE2  . PHE A 1 24 ? 38.544 -5.615  -7.764  1.00 0.00 ? 24 PHE A CE2  16 
ATOM 11085 C CZ   . PHE A 1 24 ? 38.677 -6.894  -8.286  1.00 0.00 ? 24 PHE A CZ   16 
ATOM 11086 H H    . PHE A 1 24 ? 38.923 -4.613  -2.387  1.00 0.00 ? 24 PHE A H    16 
ATOM 11087 H HA   . PHE A 1 24 ? 38.260 -7.233  -3.559  1.00 0.00 ? 24 PHE A HA   16 
ATOM 11088 H HB2  . PHE A 1 24 ? 40.204 -5.025  -4.175  1.00 0.00 ? 24 PHE A HB2  16 
ATOM 11089 H HB3  . PHE A 1 24 ? 40.975 -6.553  -4.213  1.00 0.00 ? 24 PHE A HB3  16 
ATOM 11090 H HD1  . PHE A 1 24 ? 39.963 -8.453  -5.572  1.00 0.00 ? 24 PHE A HD1  16 
ATOM 11091 H HD2  . PHE A 1 24 ? 38.812 -4.378  -6.037  1.00 0.00 ? 24 PHE A HD2  16 
ATOM 11092 H HE1  . PHE A 1 24 ? 39.260 -8.920  -7.885  1.00 0.00 ? 24 PHE A HE1  16 
ATOM 11093 H HE2  . PHE A 1 24 ? 38.134 -4.818  -8.369  1.00 0.00 ? 24 PHE A HE2  16 
ATOM 11094 H HZ   . PHE A 1 24 ? 38.380 -7.098  -9.305  1.00 0.00 ? 24 PHE A HZ   16 
ATOM 11095 N N    . ALA A 1 25 ? 40.543 -6.668  -1.257  1.00 0.00 ? 25 ALA A N    16 
ATOM 11096 C CA   . ALA A 1 25 ? 41.318 -7.283  -0.184  1.00 0.00 ? 25 ALA A CA   16 
ATOM 11097 C C    . ALA A 1 25 ? 40.389 -7.930  0.859   1.00 0.00 ? 25 ALA A C    16 
ATOM 11098 O O    . ALA A 1 25 ? 40.757 -8.882  1.528   1.00 0.00 ? 25 ALA A O    16 
ATOM 11099 C CB   . ALA A 1 25 ? 42.201 -6.223  0.479   1.00 0.00 ? 25 ALA A CB   16 
ATOM 11100 H H    . ALA A 1 25 ? 40.491 -5.676  -1.302  1.00 0.00 ? 25 ALA A H    16 
ATOM 11101 H HA   . ALA A 1 25 ? 41.948 -8.051  -0.638  1.00 0.00 ? 25 ALA A HA   16 
ATOM 11102 H HB1  . ALA A 1 25 ? 42.915 -6.667  1.172   1.00 0.00 ? 25 ALA A HB1  16 
ATOM 11103 H HB2  . ALA A 1 25 ? 41.618 -5.484  1.031   1.00 0.00 ? 25 ALA A HB2  16 
ATOM 11104 H HB3  . ALA A 1 25 ? 42.770 -5.698  -0.286  1.00 0.00 ? 25 ALA A HB3  16 
ATOM 11105 N N    . CYS A 1 26 ? 39.162 -7.364  0.922   1.00 0.00 ? 26 CYS A N    16 
ATOM 11106 C CA   . CYS A 1 26 ? 38.109 -7.911  1.775   1.00 0.00 ? 26 CYS A CA   16 
ATOM 11107 C C    . CYS A 1 26 ? 37.370 -9.098  1.129   1.00 0.00 ? 26 CYS A C    16 
ATOM 11108 O O    . CYS A 1 26 ? 36.404 -9.587  1.697   1.00 0.00 ? 26 CYS A O    16 
ATOM 11109 C CB   . CYS A 1 26 ? 37.101 -6.799  2.071   1.00 0.00 ? 26 CYS A CB   16 
ATOM 11110 S SG   . CYS A 1 26 ? 37.525 -6.010  3.642   1.00 0.00 ? 26 CYS A SG   16 
ATOM 11111 H H    . CYS A 1 26 ? 38.981 -6.551  0.373   1.00 0.00 ? 26 CYS A H    16 
ATOM 11112 H HA   . CYS A 1 26 ? 38.581 -8.248  2.700   1.00 0.00 ? 26 CYS A HA   16 
ATOM 11113 H HB2  . CYS A 1 26 ? 37.150 -6.077  1.264   1.00 0.00 ? 26 CYS A HB2  16 
ATOM 11114 H HB3  . CYS A 1 26 ? 36.059 -7.134  2.078   1.00 0.00 ? 26 CYS A HB3  16 
ATOM 11115 H HG   . CYS A 1 26 ? 37.235 -4.712  3.580   1.00 0.00 ? 26 CYS A HG   16 
ATOM 11116 N N    . GLU A 1 27 ? 37.842 -9.521  -0.070  1.00 0.00 ? 27 GLU A N    16 
ATOM 11117 C CA   . GLU A 1 27 ? 37.183 -10.594 -0.815  1.00 0.00 ? 27 GLU A CA   16 
ATOM 11118 C C    . GLU A 1 27 ? 35.705 -10.236 -1.119  1.00 0.00 ? 27 GLU A C    16 
ATOM 11119 O O    . GLU A 1 27 ? 34.773 -10.903 -0.704  1.00 0.00 ? 27 GLU A O    16 
ATOM 11120 C CB   . GLU A 1 27 ? 37.393 -11.947 -0.101  1.00 0.00 ? 27 GLU A CB   16 
ATOM 11121 C CG   . GLU A 1 27 ? 36.519 -13.089 -0.662  1.00 0.00 ? 27 GLU A CG   16 
ATOM 11122 C CD   . GLU A 1 27 ? 37.107 -14.505 -0.531  1.00 0.00 ? 27 GLU A CD   16 
ATOM 11123 O OE1  . GLU A 1 27 ? 38.199 -14.660 0.012   1.00 0.00 ? 27 GLU A OE1  16 
ATOM 11124 O OE2  . GLU A 1 27 ? 36.457 -15.446 -0.989  1.00 0.00 ? 27 GLU A OE2  16 
ATOM 11125 H H    . GLU A 1 27 ? 38.654 -9.099  -0.464  1.00 0.00 ? 27 GLU A H    16 
ATOM 11126 H HA   . GLU A 1 27 ? 37.702 -10.635 -1.773  1.00 0.00 ? 27 GLU A HA   16 
ATOM 11127 H HB2  . GLU A 1 27 ? 38.457 -12.178 -0.189  1.00 0.00 ? 27 GLU A HB2  16 
ATOM 11128 H HB3  . GLU A 1 27 ? 37.195 -11.862 0.967   1.00 0.00 ? 27 GLU A HB3  16 
ATOM 11129 H HG2  . GLU A 1 27 ? 35.551 -13.080 -0.162  1.00 0.00 ? 27 GLU A HG2  16 
ATOM 11130 H HG3  . GLU A 1 27 ? 36.318 -12.914 -1.716  1.00 0.00 ? 27 GLU A HG3  16 
ATOM 11131 N N    . LYS A 1 28 ? 35.603 -9.118  -1.876  1.00 0.00 ? 28 LYS A N    16 
ATOM 11132 C CA   . LYS A 1 28 ? 34.399 -8.531  -2.464  1.00 0.00 ? 28 LYS A CA   16 
ATOM 11133 C C    . LYS A 1 28 ? 33.131 -8.796  -1.631  1.00 0.00 ? 28 LYS A C    16 
ATOM 11134 O O    . LYS A 1 28 ? 32.169 -9.389  -2.101  1.00 0.00 ? 28 LYS A O    16 
ATOM 11135 C CB   . LYS A 1 28 ? 34.270 -9.052  -3.902  1.00 0.00 ? 28 LYS A CB   16 
ATOM 11136 C CG   . LYS A 1 28 ? 35.558 -8.939  -4.738  1.00 0.00 ? 28 LYS A CG   16 
ATOM 11137 C CD   . LYS A 1 28 ? 35.819 -7.548  -5.341  1.00 0.00 ? 28 LYS A CD   16 
ATOM 11138 C CE   . LYS A 1 28 ? 35.550 -7.498  -6.849  1.00 0.00 ? 28 LYS A CE   16 
ATOM 11139 N NZ   . LYS A 1 28 ? 36.208 -8.578  -7.572  1.00 0.00 ? 28 LYS A NZ   16 
ATOM 11140 H H    . LYS A 1 28 ? 36.456 -8.663  -2.114  1.00 0.00 ? 28 LYS A H    16 
ATOM 11141 H HA   . LYS A 1 28 ? 34.559 -7.454  -2.483  1.00 0.00 ? 28 LYS A HA   16 
ATOM 11142 H HB2  . LYS A 1 28 ? 33.996 -10.106 -3.879  1.00 0.00 ? 28 LYS A HB2  16 
ATOM 11143 H HB3  . LYS A 1 28 ? 33.446 -8.546  -4.397  1.00 0.00 ? 28 LYS A HB3  16 
ATOM 11144 H HG2  . LYS A 1 28 ? 36.437 -9.246  -4.171  1.00 0.00 ? 28 LYS A HG2  16 
ATOM 11145 H HG3  . LYS A 1 28 ? 35.493 -9.688  -5.526  1.00 0.00 ? 28 LYS A HG3  16 
ATOM 11146 H HD2  . LYS A 1 28 ? 35.252 -6.774  -4.830  1.00 0.00 ? 28 LYS A HD2  16 
ATOM 11147 H HD3  . LYS A 1 28 ? 36.859 -7.287  -5.167  1.00 0.00 ? 28 LYS A HD3  16 
ATOM 11148 H HE2  . LYS A 1 28 ? 34.485 -7.620  -7.042  1.00 0.00 ? 28 LYS A HE2  16 
ATOM 11149 H HE3  . LYS A 1 28 ? 35.902 -6.546  -7.256  1.00 0.00 ? 28 LYS A HE3  16 
ATOM 11150 H HZ1  . LYS A 1 28 ? 36.428 -8.278  -8.547  1.00 0.00 ? 28 LYS A HZ1  16 
ATOM 11151 H HZ2  . LYS A 1 28 ? 35.565 -9.392  -7.622  1.00 0.00 ? 28 LYS A HZ2  16 
ATOM 11152 H HZ3  . LYS A 1 28 ? 37.080 -8.858  -7.088  1.00 0.00 ? 28 LYS A HZ3  16 
ATOM 11153 N N    . ASN A 1 29 ? 33.221 -8.351  -0.356  1.00 0.00 ? 29 ASN A N    16 
ATOM 11154 C CA   . ASN A 1 29 ? 32.195 -8.665  0.634   1.00 0.00 ? 29 ASN A CA   16 
ATOM 11155 C C    . ASN A 1 29 ? 31.352 -7.407  0.856   1.00 0.00 ? 29 ASN A C    16 
ATOM 11156 O O    . ASN A 1 29 ? 31.198 -6.625  -0.085  1.00 0.00 ? 29 ASN A O    16 
ATOM 11157 C CB   . ASN A 1 29 ? 32.892 -9.204  1.904   1.00 0.00 ? 29 ASN A CB   16 
ATOM 11158 C CG   . ASN A 1 29 ? 32.080 -10.314 2.589   1.00 0.00 ? 29 ASN A CG   16 
ATOM 11159 O OD1  . ASN A 1 29 ? 31.604 -10.193 3.704   1.00 0.00 ? 29 ASN A OD1  16 
ATOM 11160 N ND2  . ASN A 1 29 ? 31.972 -11.410 1.808   1.00 0.00 ? 29 ASN A ND2  16 
ATOM 11161 H H    . ASN A 1 29 ? 34.023 -7.811  -0.096  1.00 0.00 ? 29 ASN A H    16 
ATOM 11162 H HA   . ASN A 1 29 ? 31.541 -9.418  0.189   1.00 0.00 ? 29 ASN A HA   16 
ATOM 11163 H HB2  . ASN A 1 29 ? 33.863 -9.624  1.643   1.00 0.00 ? 29 ASN A HB2  16 
ATOM 11164 H HB3  . ASN A 1 29 ? 33.081 -8.413  2.620   1.00 0.00 ? 29 ASN A HB3  16 
ATOM 11165 H HD21 . ASN A 1 29 ? 32.404 -11.430 0.905   1.00 0.00 ? 29 ASN A HD21 16 
ATOM 11166 H HD22 . ASN A 1 29 ? 31.459 -12.209 2.104   1.00 0.00 ? 29 ASN A HD22 16 
ATOM 11167 N N    . GLU A 1 30 ? 30.810 -7.216  2.071   1.00 0.00 ? 30 GLU A N    16 
ATOM 11168 C CA   . GLU A 1 30 ? 29.940 -6.063  2.318   1.00 0.00 ? 30 GLU A CA   16 
ATOM 11169 C C    . GLU A 1 30 ? 30.308 -5.406  3.649   1.00 0.00 ? 30 GLU A C    16 
ATOM 11170 O O    . GLU A 1 30 ? 30.958 -4.379  3.690   1.00 0.00 ? 30 GLU A O    16 
ATOM 11171 C CB   . GLU A 1 30 ? 28.466 -6.493  2.287   1.00 0.00 ? 30 GLU A CB   16 
ATOM 11172 C CG   . GLU A 1 30 ? 27.961 -6.815  0.875   1.00 0.00 ? 30 GLU A CG   16 
ATOM 11173 C CD   . GLU A 1 30 ? 26.508 -7.326  0.902   1.00 0.00 ? 30 GLU A CD   16 
ATOM 11174 O OE1  . GLU A 1 30 ? 25.644 -6.617  1.419   1.00 0.00 ? 30 GLU A OE1  16 
ATOM 11175 O OE2  . GLU A 1 30 ? 26.255 -8.425  0.408   1.00 0.00 ? 30 GLU A OE2  16 
ATOM 11176 H H    . GLU A 1 30 ? 30.962 -7.889  2.799   1.00 0.00 ? 30 GLU A H    16 
ATOM 11177 H HA   . GLU A 1 30 ? 30.127 -5.301  1.562   1.00 0.00 ? 30 GLU A HA   16 
ATOM 11178 H HB2  . GLU A 1 30 ? 28.329 -7.364  2.927   1.00 0.00 ? 30 GLU A HB2  16 
ATOM 11179 H HB3  . GLU A 1 30 ? 27.847 -5.701  2.709   1.00 0.00 ? 30 GLU A HB3  16 
ATOM 11180 H HG2  . GLU A 1 30 ? 28.007 -5.922  0.255   1.00 0.00 ? 30 GLU A HG2  16 
ATOM 11181 H HG3  . GLU A 1 30 ? 28.597 -7.561  0.400   1.00 0.00 ? 30 GLU A HG3  16 
ATOM 11182 N N    . ASN A 1 31 ? 29.850 -6.077  4.726   1.00 0.00 ? 31 ASN A N    16 
ATOM 11183 C CA   . ASN A 1 31 ? 30.156 -5.631  6.080   1.00 0.00 ? 31 ASN A CA   16 
ATOM 11184 C C    . ASN A 1 31 ? 31.671 -5.665  6.352   1.00 0.00 ? 31 ASN A C    16 
ATOM 11185 O O    . ASN A 1 31 ? 32.143 -4.991  7.252   1.00 0.00 ? 31 ASN A O    16 
ATOM 11186 C CB   . ASN A 1 31 ? 29.428 -6.553  7.087   1.00 0.00 ? 31 ASN A CB   16 
ATOM 11187 C CG   . ASN A 1 31 ? 28.376 -5.806  7.920   1.00 0.00 ? 31 ASN A CG   16 
ATOM 11188 O OD1  . ASN A 1 31 ? 27.217 -6.170  7.975   1.00 0.00 ? 31 ASN A OD1  16 
ATOM 11189 N ND2  . ASN A 1 31 ? 28.881 -4.737  8.573   1.00 0.00 ? 31 ASN A ND2  16 
ATOM 11190 H H    . ASN A 1 31 ? 29.302 -6.896  4.584   1.00 0.00 ? 31 ASN A H    16 
ATOM 11191 H HA   . ASN A 1 31 ? 29.831 -4.589  6.139   1.00 0.00 ? 31 ASN A HA   16 
ATOM 11192 H HB2  . ASN A 1 31 ? 28.920 -7.364  6.563   1.00 0.00 ? 31 ASN A HB2  16 
ATOM 11193 H HB3  . ASN A 1 31 ? 30.113 -7.043  7.782   1.00 0.00 ? 31 ASN A HB3  16 
ATOM 11194 H HD21 . ASN A 1 31 ? 29.845 -4.487  8.469   1.00 0.00 ? 31 ASN A HD21 16 
ATOM 11195 H HD22 . ASN A 1 31 ? 28.295 -4.183  9.157   1.00 0.00 ? 31 ASN A HD22 16 
ATOM 11196 N N    . LEU A 1 32 ? 32.381 -6.483  5.538   1.00 0.00 ? 32 LEU A N    16 
ATOM 11197 C CA   . LEU A 1 32 ? 33.822 -6.662  5.720   1.00 0.00 ? 32 LEU A CA   16 
ATOM 11198 C C    . LEU A 1 32 ? 34.584 -5.488  5.098   1.00 0.00 ? 32 LEU A C    16 
ATOM 11199 O O    . LEU A 1 32 ? 35.514 -4.957  5.675   1.00 0.00 ? 32 LEU A O    16 
ATOM 11200 C CB   . LEU A 1 32 ? 34.261 -7.971  5.036   1.00 0.00 ? 32 LEU A CB   16 
ATOM 11201 C CG   . LEU A 1 32 ? 35.542 -8.633  5.575   1.00 0.00 ? 32 LEU A CG   16 
ATOM 11202 C CD1  . LEU A 1 32 ? 35.673 -8.528  7.098   1.00 0.00 ? 32 LEU A CD1  16 
ATOM 11203 C CD2  . LEU A 1 32 ? 35.580 -10.099 5.124   1.00 0.00 ? 32 LEU A CD2  16 
ATOM 11204 H H    . LEU A 1 32 ? 31.910 -6.980  4.810   1.00 0.00 ? 32 LEU A H    16 
ATOM 11205 H HA   . LEU A 1 32 ? 33.999 -6.682  6.798   1.00 0.00 ? 32 LEU A HA   16 
ATOM 11206 H HB2  . LEU A 1 32 ? 33.443 -8.686  5.096   1.00 0.00 ? 32 LEU A HB2  16 
ATOM 11207 H HB3  . LEU A 1 32 ? 34.417 -7.806  3.973   1.00 0.00 ? 32 LEU A HB3  16 
ATOM 11208 H HG   . LEU A 1 32 ? 36.407 -8.133  5.140   1.00 0.00 ? 32 LEU A HG   16 
ATOM 11209 H HD11 . LEU A 1 32 ? 36.460 -9.176  7.478   1.00 0.00 ? 32 LEU A HD11 16 
ATOM 11210 H HD12 . LEU A 1 32 ? 34.744 -8.800  7.599   1.00 0.00 ? 32 LEU A HD12 16 
ATOM 11211 H HD13 . LEU A 1 32 ? 35.933 -7.510  7.388   1.00 0.00 ? 32 LEU A HD13 16 
ATOM 11212 H HD21 . LEU A 1 32 ? 36.501 -10.588 5.438   1.00 0.00 ? 32 LEU A HD21 16 
ATOM 11213 H HD22 . LEU A 1 32 ? 35.513 -10.168 4.038   1.00 0.00 ? 32 LEU A HD22 16 
ATOM 11214 H HD23 . LEU A 1 32 ? 34.745 -10.663 5.543   1.00 0.00 ? 32 LEU A HD23 16 
ATOM 11215 N N    . ALA A 1 33 ? 34.102 -5.139  3.881   1.00 0.00 ? 33 ALA A N    16 
ATOM 11216 C CA   . ALA A 1 33 ? 34.661 -4.020  3.139   1.00 0.00 ? 33 ALA A CA   16 
ATOM 11217 C C    . ALA A 1 33 ? 34.507 -2.706  3.897   1.00 0.00 ? 33 ALA A C    16 
ATOM 11218 O O    . ALA A 1 33 ? 35.452 -1.955  4.040   1.00 0.00 ? 33 ALA A O    16 
ATOM 11219 C CB   . ALA A 1 33 ? 33.982 -3.885  1.791   1.00 0.00 ? 33 ALA A CB   16 
ATOM 11220 H H    . ALA A 1 33 ? 33.345 -5.654  3.487   1.00 0.00 ? 33 ALA A H    16 
ATOM 11221 H HA   . ALA A 1 33 ? 35.718 -4.207  2.994   1.00 0.00 ? 33 ALA A HA   16 
ATOM 11222 H HB1  . ALA A 1 33 ? 34.301 -2.940  1.356   1.00 0.00 ? 33 ALA A HB1  16 
ATOM 11223 H HB2  . ALA A 1 33 ? 32.895 -3.890  1.867   1.00 0.00 ? 33 ALA A HB2  16 
ATOM 11224 H HB3  . ALA A 1 33 ? 34.277 -4.687  1.117   1.00 0.00 ? 33 ALA A HB3  16 
ATOM 11225 N N    . ALA A 1 34 ? 33.264 -2.498  4.382   1.00 0.00 ? 34 ALA A N    16 
ATOM 11226 C CA   . ALA A 1 34 ? 33.004 -1.325  5.208   1.00 0.00 ? 34 ALA A CA   16 
ATOM 11227 C C    . ALA A 1 34 ? 33.938 -1.334  6.423   1.00 0.00 ? 34 ALA A C    16 
ATOM 11228 O O    . ALA A 1 34 ? 34.599 -0.350  6.711   1.00 0.00 ? 34 ALA A O    16 
ATOM 11229 C CB   . ALA A 1 34 ? 31.539 -1.296  5.652   1.00 0.00 ? 34 ALA A CB   16 
ATOM 11230 H H    . ALA A 1 34 ? 32.552 -3.168  4.196   1.00 0.00 ? 34 ALA A H    16 
ATOM 11231 H HA   . ALA A 1 34 ? 33.223 -0.446  4.600   1.00 0.00 ? 34 ALA A HA   16 
ATOM 11232 H HB1  . ALA A 1 34 ? 31.271 -2.181  6.228   1.00 0.00 ? 34 ALA A HB1  16 
ATOM 11233 H HB2  . ALA A 1 34 ? 30.870 -1.244  4.794   1.00 0.00 ? 34 ALA A HB2  16 
ATOM 11234 H HB3  . ALA A 1 34 ? 31.349 -0.416  6.268   1.00 0.00 ? 34 ALA A HB3  16 
ATOM 11235 N N    . ASN A 1 35 ? 34.011 -2.506  7.085   1.00 0.00 ? 35 ASN A N    16 
ATOM 11236 C CA   . ASN A 1 35 ? 34.879 -2.598  8.261   1.00 0.00 ? 35 ASN A CA   16 
ATOM 11237 C C    . ASN A 1 35 ? 36.344 -2.248  7.944   1.00 0.00 ? 35 ASN A C    16 
ATOM 11238 O O    . ASN A 1 35 ? 37.023 -1.674  8.780   1.00 0.00 ? 35 ASN A O    16 
ATOM 11239 C CB   . ASN A 1 35 ? 34.843 -4.012  8.867   1.00 0.00 ? 35 ASN A CB   16 
ATOM 11240 C CG   . ASN A 1 35 ? 34.872 -3.981  10.406  1.00 0.00 ? 35 ASN A CG   16 
ATOM 11241 O OD1  . ASN A 1 35 ? 34.814 -2.951  11.050  1.00 0.00 ? 35 ASN A OD1  16 
ATOM 11242 N ND2  . ASN A 1 35 ? 34.926 -5.219  10.936  1.00 0.00 ? 35 ASN A ND2  16 
ATOM 11243 H H    . ASN A 1 35 ? 33.469 -3.286  6.773   1.00 0.00 ? 35 ASN A H    16 
ATOM 11244 H HA   . ASN A 1 35 ? 34.486 -1.851  8.955   1.00 0.00 ? 35 ASN A HA   16 
ATOM 11245 H HB2  . ASN A 1 35 ? 33.942 -4.526  8.571   1.00 0.00 ? 35 ASN A HB2  16 
ATOM 11246 H HB3  . ASN A 1 35 ? 35.647 -4.650  8.501   1.00 0.00 ? 35 ASN A HB3  16 
ATOM 11247 H HD21 . ASN A 1 35 ? 35.001 -6.019  10.340  1.00 0.00 ? 35 ASN A HD21 16 
ATOM 11248 H HD22 . ASN A 1 35 ? 34.881 -5.346  11.922  1.00 0.00 ? 35 ASN A HD22 16 
ATOM 11249 N N    . PHE A 1 36 ? 36.782 -2.598  6.713   1.00 0.00 ? 36 PHE A N    16 
ATOM 11250 C CA   . PHE A 1 36 ? 38.137 -2.261  6.265   1.00 0.00 ? 36 PHE A CA   16 
ATOM 11251 C C    . PHE A 1 36 ? 38.328 -0.730  6.274   1.00 0.00 ? 36 PHE A C    16 
ATOM 11252 O O    . PHE A 1 36 ? 39.240 -0.214  6.906   1.00 0.00 ? 36 PHE A O    16 
ATOM 11253 C CB   . PHE A 1 36 ? 38.379 -2.878  4.868   1.00 0.00 ? 36 PHE A CB   16 
ATOM 11254 C CG   . PHE A 1 36 ? 39.767 -2.676  4.296   1.00 0.00 ? 36 PHE A CG   16 
ATOM 11255 C CD1  . PHE A 1 36 ? 40.202 -1.415  3.896   1.00 0.00 ? 36 PHE A CD1  16 
ATOM 11256 C CD2  . PHE A 1 36 ? 40.623 -3.763  4.115   1.00 0.00 ? 36 PHE A CD2  16 
ATOM 11257 C CE1  . PHE A 1 36 ? 41.458 -1.236  3.335   1.00 0.00 ? 36 PHE A CE1  16 
ATOM 11258 C CE2  . PHE A 1 36 ? 41.884 -3.585  3.559   1.00 0.00 ? 36 PHE A CE2  16 
ATOM 11259 C CZ   . PHE A 1 36 ? 42.303 -2.322  3.172   1.00 0.00 ? 36 PHE A CZ   16 
ATOM 11260 H H    . PHE A 1 36 ? 36.151 -3.051  6.084   1.00 0.00 ? 36 PHE A H    16 
ATOM 11261 H HA   . PHE A 1 36 ? 38.828 -2.703  6.985   1.00 0.00 ? 36 PHE A HA   16 
ATOM 11262 H HB2  . PHE A 1 36 ? 38.186 -3.945  4.932   1.00 0.00 ? 36 PHE A HB2  16 
ATOM 11263 H HB3  . PHE A 1 36 ? 37.672 -2.496  4.139   1.00 0.00 ? 36 PHE A HB3  16 
ATOM 11264 H HD1  . PHE A 1 36 ? 39.562 -0.550  3.985   1.00 0.00 ? 36 PHE A HD1  16 
ATOM 11265 H HD2  . PHE A 1 36 ? 40.302 -4.761  4.377   1.00 0.00 ? 36 PHE A HD2  16 
ATOM 11266 H HE1  . PHE A 1 36 ? 41.771 -0.257  3.010   1.00 0.00 ? 36 PHE A HE1  16 
ATOM 11267 H HE2  . PHE A 1 36 ? 42.538 -4.432  3.404   1.00 0.00 ? 36 PHE A HE2  16 
ATOM 11268 H HZ   . PHE A 1 36 ? 43.279 -2.181  2.737   1.00 0.00 ? 36 PHE A HZ   16 
ATOM 11269 N N    . LEU A 1 37 ? 37.421 -0.054  5.531   1.00 0.00 ? 37 LEU A N    16 
ATOM 11270 C CA   . LEU A 1 37 ? 37.576 1.372   5.268   1.00 0.00 ? 37 LEU A CA   16 
ATOM 11271 C C    . LEU A 1 37 ? 37.377 2.235   6.536   1.00 0.00 ? 37 LEU A C    16 
ATOM 11272 O O    . LEU A 1 37 ? 37.946 3.310   6.662   1.00 0.00 ? 37 LEU A O    16 
ATOM 11273 C CB   . LEU A 1 37 ? 36.589 1.835   4.189   1.00 0.00 ? 37 LEU A CB   16 
ATOM 11274 C CG   . LEU A 1 37 ? 36.783 1.202   2.801   1.00 0.00 ? 37 LEU A CG   16 
ATOM 11275 C CD1  . LEU A 1 37 ? 35.550 0.407   2.368   1.00 0.00 ? 37 LEU A CD1  16 
ATOM 11276 C CD2  . LEU A 1 37 ? 37.148 2.223   1.708   1.00 0.00 ? 37 LEU A CD2  16 
ATOM 11277 H H    . LEU A 1 37 ? 36.626 -0.524  5.156   1.00 0.00 ? 37 LEU A H    16 
ATOM 11278 H HA   . LEU A 1 37 ? 38.590 1.501   4.900   1.00 0.00 ? 37 LEU A HA   16 
ATOM 11279 H HB2  . LEU A 1 37 ? 35.573 1.663   4.525   1.00 0.00 ? 37 LEU A HB2  16 
ATOM 11280 H HB3  . LEU A 1 37 ? 36.693 2.909   4.120   1.00 0.00 ? 37 LEU A HB3  16 
ATOM 11281 H HG   . LEU A 1 37 ? 37.605 0.503   2.914   1.00 0.00 ? 37 LEU A HG   16 
ATOM 11282 H HD11 . LEU A 1 37 ? 35.814 -0.486  1.802   1.00 0.00 ? 37 LEU A HD11 16 
ATOM 11283 H HD12 . LEU A 1 37 ? 34.900 1.020   1.754   1.00 0.00 ? 37 LEU A HD12 16 
ATOM 11284 H HD13 . LEU A 1 37 ? 34.934 0.112   3.209   1.00 0.00 ? 37 LEU A HD13 16 
ATOM 11285 H HD21 . LEU A 1 37 ? 38.136 2.003   1.318   1.00 0.00 ? 37 LEU A HD21 16 
ATOM 11286 H HD22 . LEU A 1 37 ? 37.175 3.238   2.083   1.00 0.00 ? 37 LEU A HD22 16 
ATOM 11287 H HD23 . LEU A 1 37 ? 36.428 2.251   0.887   1.00 0.00 ? 37 LEU A HD23 16 
ATOM 11288 N N    . LEU A 1 38 ? 36.528 1.697   7.446   1.00 0.00 ? 38 LEU A N    16 
ATOM 11289 C CA   . LEU A 1 38 ? 36.151 2.427   8.655   1.00 0.00 ? 38 LEU A CA   16 
ATOM 11290 C C    . LEU A 1 38 ? 37.193 2.165   9.767   1.00 0.00 ? 38 LEU A C    16 
ATOM 11291 O O    . LEU A 1 38 ? 37.385 2.967   10.667  1.00 0.00 ? 38 LEU A O    16 
ATOM 11292 C CB   . LEU A 1 38 ? 34.728 2.058   9.154   1.00 0.00 ? 38 LEU A CB   16 
ATOM 11293 C CG   . LEU A 1 38 ? 33.557 2.038   8.132   1.00 0.00 ? 38 LEU A CG   16 
ATOM 11294 C CD1  . LEU A 1 38 ? 32.306 2.777   8.624   1.00 0.00 ? 38 LEU A CD1  16 
ATOM 11295 C CD2  . LEU A 1 38 ? 33.922 2.565   6.748   1.00 0.00 ? 38 LEU A CD2  16 
ATOM 11296 H H    . LEU A 1 38 ? 36.142 0.794   7.286   1.00 0.00 ? 38 LEU A H    16 
ATOM 11297 H HA   . LEU A 1 38 ? 36.186 3.484   8.396   1.00 0.00 ? 38 LEU A HA   16 
ATOM 11298 H HB2  . LEU A 1 38 ? 34.774 1.076   9.623   1.00 0.00 ? 38 LEU A HB2  16 
ATOM 11299 H HB3  . LEU A 1 38 ? 34.479 2.760   9.952   1.00 0.00 ? 38 LEU A HB3  16 
ATOM 11300 H HG   . LEU A 1 38 ? 33.236 1.003   8.030   1.00 0.00 ? 38 LEU A HG   16 
ATOM 11301 H HD11 . LEU A 1 38 ? 32.493 3.845   8.739   1.00 0.00 ? 38 LEU A HD11 16 
ATOM 11302 H HD12 . LEU A 1 38 ? 31.945 2.374   9.568   1.00 0.00 ? 38 LEU A HD12 16 
ATOM 11303 H HD13 . LEU A 1 38 ? 31.494 2.665   7.903   1.00 0.00 ? 38 LEU A HD13 16 
ATOM 11304 H HD21 . LEU A 1 38 ? 34.685 3.330   6.816   1.00 0.00 ? 38 LEU A HD21 16 
ATOM 11305 H HD22 . LEU A 1 38 ? 33.058 3.000   6.264   1.00 0.00 ? 38 LEU A HD22 16 
ATOM 11306 H HD23 . LEU A 1 38 ? 34.284 1.789   6.086   1.00 0.00 ? 38 LEU A HD23 16 
ATOM 11307 N N    . SER A 1 39 ? 37.849 0.986   9.611   1.00 0.00 ? 39 SER A N    16 
ATOM 11308 C CA   . SER A 1 39 ? 38.875 0.553   10.552  1.00 0.00 ? 39 SER A CA   16 
ATOM 11309 C C    . SER A 1 39 ? 40.214 1.237   10.297  1.00 0.00 ? 39 SER A C    16 
ATOM 11310 O O    . SER A 1 39 ? 41.019 1.314   11.218  1.00 0.00 ? 39 SER A O    16 
ATOM 11311 C CB   . SER A 1 39 ? 39.084 -0.973  10.509  1.00 0.00 ? 39 SER A CB   16 
ATOM 11312 O OG   . SER A 1 39 ? 40.084 -1.464  11.386  1.00 0.00 ? 39 SER A OG   16 
ATOM 11313 H H    . SER A 1 39 ? 37.657 0.398   8.834   1.00 0.00 ? 39 SER A H    16 
ATOM 11314 H HA   . SER A 1 39 ? 38.523 0.854   11.533  1.00 0.00 ? 39 SER A HA   16 
ATOM 11315 H HB2  . SER A 1 39 ? 38.156 -1.464  10.800  1.00 0.00 ? 39 SER A HB2  16 
ATOM 11316 H HB3  . SER A 1 39 ? 39.345 -1.301  9.498   1.00 0.00 ? 39 SER A HB3  16 
ATOM 11317 H HG   . SER A 1 39 ? 40.565 -0.742  11.772  1.00 0.00 ? 39 SER A HG   16 
ATOM 11318 N N    . GLN A 1 40 ? 40.417 1.723   9.050   1.00 0.00 ? 40 GLN A N    16 
ATOM 11319 C CA   . GLN A 1 40 ? 41.657 2.417   8.679   1.00 0.00 ? 40 GLN A CA   16 
ATOM 11320 C C    . GLN A 1 40 ? 41.979 3.547   9.681   1.00 0.00 ? 40 GLN A C    16 
ATOM 11321 O O    . GLN A 1 40 ? 41.432 4.638   9.619   1.00 0.00 ? 40 GLN A O    16 
ATOM 11322 C CB   . GLN A 1 40 ? 41.521 3.017   7.272   1.00 0.00 ? 40 GLN A CB   16 
ATOM 11323 C CG   . GLN A 1 40 ? 41.660 1.993   6.133   1.00 0.00 ? 40 GLN A CG   16 
ATOM 11324 C CD   . GLN A 1 40 ? 41.099 2.593   4.841   1.00 0.00 ? 40 GLN A CD   16 
ATOM 11325 O OE1  . GLN A 1 40 ? 40.165 3.373   4.862   1.00 0.00 ? 40 GLN A OE1  16 
ATOM 11326 N NE2  . GLN A 1 40 ? 41.718 2.167   3.721   1.00 0.00 ? 40 GLN A NE2  16 
ATOM 11327 H H    . GLN A 1 40 ? 39.709 1.583   8.358   1.00 0.00 ? 40 GLN A H    16 
ATOM 11328 H HA   . GLN A 1 40 ? 42.456 1.677   8.684   1.00 0.00 ? 40 GLN A HA   16 
ATOM 11329 H HB2  . GLN A 1 40 ? 40.562 3.533   7.224   1.00 0.00 ? 40 GLN A HB2  16 
ATOM 11330 H HB3  . GLN A 1 40 ? 42.286 3.777   7.103   1.00 0.00 ? 40 GLN A HB3  16 
ATOM 11331 H HG2  . GLN A 1 40 ? 42.703 1.716   5.989   1.00 0.00 ? 40 GLN A HG2  16 
ATOM 11332 H HG3  . GLN A 1 40 ? 41.118 1.075   6.334   1.00 0.00 ? 40 GLN A HG3  16 
ATOM 11333 H HE21 . GLN A 1 40 ? 42.487 1.526   3.755   1.00 0.00 ? 40 GLN A HE21 16 
ATOM 11334 H HE22 . GLN A 1 40 ? 41.396 2.477   2.832   1.00 0.00 ? 40 GLN A HE22 16 
ATOM 11335 N N    . ASN A 1 41 ? 42.909 3.181   10.597  1.00 0.00 ? 41 ASN A N    16 
ATOM 11336 C CA   . ASN A 1 41 ? 43.282 4.075   11.689  1.00 0.00 ? 41 ASN A CA   16 
ATOM 11337 C C    . ASN A 1 41 ? 44.034 5.286   11.110  1.00 0.00 ? 41 ASN A C    16 
ATOM 11338 O O    . ASN A 1 41 ? 44.946 5.137   10.307  1.00 0.00 ? 41 ASN A O    16 
ATOM 11339 C CB   . ASN A 1 41 ? 44.210 3.379   12.704  1.00 0.00 ? 41 ASN A CB   16 
ATOM 11340 C CG   . ASN A 1 41 ? 43.861 1.923   13.056  1.00 0.00 ? 41 ASN A CG   16 
ATOM 11341 O OD1  . ASN A 1 41 ? 42.716 1.517   13.157  1.00 0.00 ? 41 ASN A OD1  16 
ATOM 11342 N ND2  . ASN A 1 41 ? 44.968 1.171   13.237  1.00 0.00 ? 41 ASN A ND2  16 
ATOM 11343 H H    . ASN A 1 41 ? 43.298 2.267   10.543  1.00 0.00 ? 41 ASN A H    16 
ATOM 11344 H HA   . ASN A 1 41 ? 42.349 4.381   12.164  1.00 0.00 ? 41 ASN A HA   16 
ATOM 11345 H HB2  . ASN A 1 41 ? 45.238 3.398   12.346  1.00 0.00 ? 41 ASN A HB2  16 
ATOM 11346 H HB3  . ASN A 1 41 ? 44.204 3.952   13.629  1.00 0.00 ? 41 ASN A HB3  16 
ATOM 11347 H HD21 . ASN A 1 41 ? 45.864 1.618   13.200  1.00 0.00 ? 41 ASN A HD21 16 
ATOM 11348 H HD22 . ASN A 1 41 ? 44.917 0.192   13.410  1.00 0.00 ? 41 ASN A HD22 16 
ATOM 11349 N N    . PHE A 1 42 ? 43.577 6.479   11.553  1.00 0.00 ? 42 PHE A N    16 
ATOM 11350 C CA   . PHE A 1 42 ? 44.099 7.728   11.013  1.00 0.00 ? 42 PHE A CA   16 
ATOM 11351 C C    . PHE A 1 42 ? 43.472 8.905   11.780  1.00 0.00 ? 42 PHE A C    16 
ATOM 11352 O O    . PHE A 1 42 ? 42.406 9.390   11.421  1.00 0.00 ? 42 PHE A O    16 
ATOM 11353 C CB   . PHE A 1 42 ? 43.767 7.847   9.506   1.00 0.00 ? 42 PHE A CB   16 
ATOM 11354 C CG   . PHE A 1 42 ? 44.372 9.079   8.884   1.00 0.00 ? 42 PHE A CG   16 
ATOM 11355 C CD1  . PHE A 1 42 ? 45.719 9.109   8.537   1.00 0.00 ? 42 PHE A CD1  16 
ATOM 11356 C CD2  . PHE A 1 42 ? 43.592 10.207  8.653   1.00 0.00 ? 42 PHE A CD2  16 
ATOM 11357 C CE1  . PHE A 1 42 ? 46.280 10.251  7.978   1.00 0.00 ? 42 PHE A CE1  16 
ATOM 11358 C CE2  . PHE A 1 42 ? 44.148 11.350  8.097   1.00 0.00 ? 42 PHE A CE2  16 
ATOM 11359 C CZ   . PHE A 1 42 ? 45.493 11.372  7.760   1.00 0.00 ? 42 PHE A CZ   16 
ATOM 11360 H H    . PHE A 1 42 ? 42.862 6.489   12.251  1.00 0.00 ? 42 PHE A H    16 
ATOM 11361 H HA   . PHE A 1 42 ? 45.178 7.714   11.182  1.00 0.00 ? 42 PHE A HA   16 
ATOM 11362 H HB2  . PHE A 1 42 ? 44.160 6.990   8.963   1.00 0.00 ? 42 PHE A HB2  16 
ATOM 11363 H HB3  . PHE A 1 42 ? 42.685 7.832   9.341   1.00 0.00 ? 42 PHE A HB3  16 
ATOM 11364 H HD1  . PHE A 1 42 ? 46.339 8.239   8.699   1.00 0.00 ? 42 PHE A HD1  16 
ATOM 11365 H HD2  . PHE A 1 42 ? 42.544 10.194  8.906   1.00 0.00 ? 42 PHE A HD2  16 
ATOM 11366 H HE1  . PHE A 1 42 ? 47.326 10.269  7.710   1.00 0.00 ? 42 PHE A HE1  16 
ATOM 11367 H HE2  . PHE A 1 42 ? 43.531 12.220  7.927   1.00 0.00 ? 42 PHE A HE2  16 
ATOM 11368 H HZ   . PHE A 1 42 ? 45.922 12.261  7.326   1.00 0.00 ? 42 PHE A HZ   16 
ATOM 11369 N N    . ASP A 1 43 ? 44.195 9.335   12.840  1.00 0.00 ? 43 ASP A N    16 
ATOM 11370 C CA   . ASP A 1 43 ? 43.773 10.501  13.616  1.00 0.00 ? 43 ASP A CA   16 
ATOM 11371 C C    . ASP A 1 43 ? 44.807 10.768  14.728  1.00 0.00 ? 43 ASP A C    16 
ATOM 11372 O O    . ASP A 1 43 ? 45.240 9.854   15.418  1.00 0.00 ? 43 ASP A O    16 
ATOM 11373 C CB   . ASP A 1 43 ? 42.369 10.292  14.251  1.00 0.00 ? 43 ASP A CB   16 
ATOM 11374 C CG   . ASP A 1 43 ? 41.580 11.616  14.326  1.00 0.00 ? 43 ASP A CG   16 
ATOM 11375 O OD1  . ASP A 1 43 ? 41.417 12.256  13.288  1.00 0.00 ? 43 ASP A OD1  16 
ATOM 11376 O OD2  . ASP A 1 43 ? 41.131 11.989  15.411  1.00 0.00 ? 43 ASP A OD2  16 
ATOM 11377 H H    . ASP A 1 43 ? 45.047 8.865   13.068  1.00 0.00 ? 43 ASP A H    16 
ATOM 11378 H HA   . ASP A 1 43 ? 43.801 11.327  12.901  1.00 0.00 ? 43 ASP A HA   16 
ATOM 11379 H HB2  . ASP A 1 43 ? 41.757 9.591   13.685  1.00 0.00 ? 43 ASP A HB2  16 
ATOM 11380 H HB3  . ASP A 1 43 ? 42.444 9.837   15.239  1.00 0.00 ? 43 ASP A HB3  16 
ATOM 11381 N N    . ASP A 1 44 ? 45.168 12.064  14.856  1.00 0.00 ? 44 ASP A N    16 
ATOM 11382 C CA   . ASP A 1 44 ? 46.107 12.487  15.894  1.00 0.00 ? 44 ASP A CA   16 
ATOM 11383 C C    . ASP A 1 44 ? 46.221 14.025  15.868  1.00 0.00 ? 44 ASP A C    16 
ATOM 11384 O O    . ASP A 1 44 ? 47.024 14.593  15.143  1.00 0.00 ? 44 ASP A O    16 
ATOM 11385 C CB   . ASP A 1 44 ? 47.496 11.809  15.704  1.00 0.00 ? 44 ASP A CB   16 
ATOM 11386 C CG   . ASP A 1 44 ? 47.893 10.963  16.931  1.00 0.00 ? 44 ASP A CG   16 
ATOM 11387 O OD1  . ASP A 1 44 ? 48.329 11.542  17.927  1.00 0.00 ? 44 ASP A OD1  16 
ATOM 11388 O OD2  . ASP A 1 44 ? 47.768 9.740   16.879  1.00 0.00 ? 44 ASP A OD2  16 
ATOM 11389 H H    . ASP A 1 44 ? 44.757 12.735  14.242  1.00 0.00 ? 44 ASP A H    16 
ATOM 11390 H HA   . ASP A 1 44 ? 45.640 12.204  16.840  1.00 0.00 ? 44 ASP A HA   16 
ATOM 11391 H HB2  . ASP A 1 44 ? 47.502 11.175  14.817  1.00 0.00 ? 44 ASP A HB2  16 
ATOM 11392 H HB3  . ASP A 1 44 ? 48.300 12.523  15.523  1.00 0.00 ? 44 ASP A HB3  16 
ATOM 11393 N N    . GLU A 1 45 ? 45.369 14.646  16.717  1.00 0.00 ? 45 GLU A N    16 
ATOM 11394 C CA   . GLU A 1 45 ? 45.343 16.100  16.886  1.00 0.00 ? 45 GLU A CA   16 
ATOM 11395 C C    . GLU A 1 45 ? 45.603 16.486  18.357  1.00 0.00 ? 45 GLU A C    16 
ATOM 11396 O O    . GLU A 1 45 ? 45.513 15.623  19.231  1.00 0.00 ? 45 GLU A O    16 
ATOM 11397 C CB   . GLU A 1 45 ? 44.021 16.673  16.343  1.00 0.00 ? 45 GLU A CB   16 
ATOM 11398 C CG   . GLU A 1 45 ? 42.733 16.172  17.027  1.00 0.00 ? 45 GLU A CG   16 
ATOM 11399 C CD   . GLU A 1 45 ? 42.356 16.894  18.343  1.00 0.00 ? 45 GLU A CD   16 
ATOM 11400 O OE1  . GLU A 1 45 ? 42.827 18.008  18.576  1.00 0.00 ? 45 GLU A OE1  16 
ATOM 11401 O OE2  . GLU A 1 45 ? 41.578 16.338  19.117  1.00 0.00 ? 45 GLU A OE2  16 
ATOM 11402 O OXT  . GLU A 1 45 ? 45.903 17.653  18.611  1.00 0.00 ? 45 GLU A OXT  16 
ATOM 11403 H H    . GLU A 1 45 ? 44.723 14.086  17.231  1.00 0.00 ? 45 GLU A H    16 
ATOM 11404 H HA   . GLU A 1 45 ? 46.156 16.524  16.297  1.00 0.00 ? 45 GLU A HA   16 
ATOM 11405 H HB2  . GLU A 1 45 ? 44.058 17.762  16.363  1.00 0.00 ? 45 GLU A HB2  16 
ATOM 11406 H HB3  . GLU A 1 45 ? 43.958 16.421  15.283  1.00 0.00 ? 45 GLU A HB3  16 
ATOM 11407 H HG2  . GLU A 1 45 ? 41.911 16.336  16.337  1.00 0.00 ? 45 GLU A HG2  16 
ATOM 11408 H HG3  . GLU A 1 45 ? 42.756 15.093  17.179  1.00 0.00 ? 45 GLU A HG3  16 
ATOM 11409 N N    . GLN A 1 1  ? 33.432 -6.576  -10.178 1.00 0.00 ? 1  GLN A N    17 
ATOM 11410 C CA   . GLN A 1 1  ? 32.007 -6.872  -10.087 1.00 0.00 ? 1  GLN A CA   17 
ATOM 11411 C C    . GLN A 1 1  ? 31.412 -6.363  -8.758  1.00 0.00 ? 1  GLN A C    17 
ATOM 11412 O O    . GLN A 1 1  ? 30.876 -7.128  -7.968  1.00 0.00 ? 1  GLN A O    17 
ATOM 11413 C CB   . GLN A 1 1  ? 31.766 -8.388  -10.230 1.00 0.00 ? 1  GLN A CB   17 
ATOM 11414 C CG   . GLN A 1 1  ? 30.289 -8.749  -10.486 1.00 0.00 ? 1  GLN A CG   17 
ATOM 11415 C CD   . GLN A 1 1  ? 30.028 -8.995  -11.978 1.00 0.00 ? 1  GLN A CD   17 
ATOM 11416 O OE1  . GLN A 1 1  ? 30.071 -8.088  -12.798 1.00 0.00 ? 1  GLN A OE1  17 
ATOM 11417 N NE2  . GLN A 1 1  ? 29.768 -10.287 -12.263 1.00 0.00 ? 1  GLN A NE2  17 
ATOM 11418 H H1   . GLN A 1 1  ? 33.973 -7.348  -9.737  1.00 0.00 ? 1  GLN A H1   17 
ATOM 11419 H H2   . GLN A 1 1  ? 33.633 -5.683  -9.684  1.00 0.00 ? 1  GLN A H2   17 
ATOM 11420 H H3   . GLN A 1 1  ? 33.701 -6.494  -11.180 1.00 0.00 ? 1  GLN A H3   17 
ATOM 11421 H HA   . GLN A 1 1  ? 31.514 -6.339  -10.902 1.00 0.00 ? 1  GLN A HA   17 
ATOM 11422 H HB2  . GLN A 1 1  ? 32.412 -8.804  -11.008 1.00 0.00 ? 1  GLN A HB2  17 
ATOM 11423 H HB3  . GLN A 1 1  ? 32.100 -8.897  -9.325  1.00 0.00 ? 1  GLN A HB3  17 
ATOM 11424 H HG2  . GLN A 1 1  ? 30.029 -9.647  -9.928  1.00 0.00 ? 1  GLN A HG2  17 
ATOM 11425 H HG3  . GLN A 1 1  ? 29.603 -7.976  -10.136 1.00 0.00 ? 1  GLN A HG3  17 
ATOM 11426 H HE21 . GLN A 1 1  ? 29.732 -10.974 -11.536 1.00 0.00 ? 1  GLN A HE21 17 
ATOM 11427 H HE22 . GLN A 1 1  ? 29.609 -10.577 -13.206 1.00 0.00 ? 1  GLN A HE22 17 
ATOM 11428 N N    . GLU A 1 2  ? 31.544 -5.029  -8.567  1.00 0.00 ? 2  GLU A N    17 
ATOM 11429 C CA   . GLU A 1 2  ? 31.063 -4.400  -7.333  1.00 0.00 ? 2  GLU A CA   17 
ATOM 11430 C C    . GLU A 1 2  ? 31.186 -2.870  -7.406  1.00 0.00 ? 2  GLU A C    17 
ATOM 11431 O O    . GLU A 1 2  ? 31.366 -2.208  -6.394  1.00 0.00 ? 2  GLU A O    17 
ATOM 11432 C CB   . GLU A 1 2  ? 31.818 -4.936  -6.099  1.00 0.00 ? 2  GLU A CB   17 
ATOM 11433 C CG   . GLU A 1 2  ? 33.340 -4.947  -6.261  1.00 0.00 ? 2  GLU A CG   17 
ATOM 11434 C CD   . GLU A 1 2  ? 33.976 -3.562  -6.195  1.00 0.00 ? 2  GLU A CD   17 
ATOM 11435 O OE1  . GLU A 1 2  ? 34.145 -3.067  -5.084  1.00 0.00 ? 2  GLU A OE1  17 
ATOM 11436 O OE2  . GLU A 1 2  ? 34.293 -3.003  -7.248  1.00 0.00 ? 2  GLU A OE2  17 
ATOM 11437 H H    . GLU A 1 2  ? 32.011 -4.488  -9.266  1.00 0.00 ? 2  GLU A H    17 
ATOM 11438 H HA   . GLU A 1 2  ? 30.003 -4.638  -7.249  1.00 0.00 ? 2  GLU A HA   17 
ATOM 11439 H HB2  . GLU A 1 2  ? 31.535 -4.401  -5.191  1.00 0.00 ? 2  GLU A HB2  17 
ATOM 11440 H HB3  . GLU A 1 2  ? 31.500 -5.960  -5.908  1.00 0.00 ? 2  GLU A HB3  17 
ATOM 11441 H HG2  . GLU A 1 2  ? 33.752 -5.531  -5.444  1.00 0.00 ? 2  GLU A HG2  17 
ATOM 11442 H HG3  . GLU A 1 2  ? 33.633 -5.423  -7.195  1.00 0.00 ? 2  GLU A HG3  17 
ATOM 11443 N N    . LYS A 1 3  ? 31.077 -2.355  -8.651  1.00 0.00 ? 3  LYS A N    17 
ATOM 11444 C CA   . LYS A 1 3  ? 31.170 -0.918  -8.910  1.00 0.00 ? 3  LYS A CA   17 
ATOM 11445 C C    . LYS A 1 3  ? 30.076 -0.089  -8.203  1.00 0.00 ? 3  LYS A C    17 
ATOM 11446 O O    . LYS A 1 3  ? 30.226 1.106   -7.988  1.00 0.00 ? 3  LYS A O    17 
ATOM 11447 C CB   . LYS A 1 3  ? 31.191 -0.649  -10.411 1.00 0.00 ? 3  LYS A CB   17 
ATOM 11448 C CG   . LYS A 1 3  ? 29.970 -1.197  -11.161 1.00 0.00 ? 3  LYS A CG   17 
ATOM 11449 C CD   . LYS A 1 3  ? 30.229 -1.265  -12.670 1.00 0.00 ? 3  LYS A CD   17 
ATOM 11450 C CE   . LYS A 1 3  ? 30.384 0.123   -13.300 1.00 0.00 ? 3  LYS A CE   17 
ATOM 11451 N NZ   . LYS A 1 3  ? 29.095 0.769   -13.511 1.00 0.00 ? 3  LYS A NZ   17 
ATOM 11452 H H    . LYS A 1 3  ? 30.987 -2.975  -9.429  1.00 0.00 ? 3  LYS A H    17 
ATOM 11453 H HA   . LYS A 1 3  ? 32.139 -0.602  -8.554  1.00 0.00 ? 3  LYS A HA   17 
ATOM 11454 H HB2  . LYS A 1 3  ? 31.287 0.424   -10.578 1.00 0.00 ? 3  LYS A HB2  17 
ATOM 11455 H HB3  . LYS A 1 3  ? 32.100 -1.086  -10.825 1.00 0.00 ? 3  LYS A HB3  17 
ATOM 11456 H HG2  . LYS A 1 3  ? 29.723 -2.199  -10.812 1.00 0.00 ? 3  LYS A HG2  17 
ATOM 11457 H HG3  . LYS A 1 3  ? 29.095 -0.585  -10.946 1.00 0.00 ? 3  LYS A HG3  17 
ATOM 11458 H HD2  . LYS A 1 3  ? 31.138 -1.842  -12.845 1.00 0.00 ? 3  LYS A HD2  17 
ATOM 11459 H HD3  . LYS A 1 3  ? 29.428 -1.818  -13.162 1.00 0.00 ? 3  LYS A HD3  17 
ATOM 11460 H HE2  . LYS A 1 3  ? 30.995 0.788   -12.687 1.00 0.00 ? 3  LYS A HE2  17 
ATOM 11461 H HE3  . LYS A 1 3  ? 30.880 0.047   -14.267 1.00 0.00 ? 3  LYS A HE3  17 
ATOM 11462 H HZ1  . LYS A 1 3  ? 29.215 1.802   -13.505 1.00 0.00 ? 3  LYS A HZ1  17 
ATOM 11463 H HZ2  . LYS A 1 3  ? 28.440 0.492   -12.753 1.00 0.00 ? 3  LYS A HZ2  17 
ATOM 11464 H HZ3  . LYS A 1 3  ? 28.709 0.471   -14.429 1.00 0.00 ? 3  LYS A HZ3  17 
ATOM 11465 N N    . GLU A 1 4  ? 28.987 -0.806  -7.847  1.00 0.00 ? 4  GLU A N    17 
ATOM 11466 C CA   . GLU A 1 4  ? 27.872 -0.212  -7.117  1.00 0.00 ? 4  GLU A CA   17 
ATOM 11467 C C    . GLU A 1 4  ? 28.278 0.166   -5.687  1.00 0.00 ? 4  GLU A C    17 
ATOM 11468 O O    . GLU A 1 4  ? 27.841 1.164   -5.133  1.00 0.00 ? 4  GLU A O    17 
ATOM 11469 C CB   . GLU A 1 4  ? 26.721 -1.237  -7.058  1.00 0.00 ? 4  GLU A CB   17 
ATOM 11470 C CG   . GLU A 1 4  ? 25.433 -0.741  -7.737  1.00 0.00 ? 4  GLU A CG   17 
ATOM 11471 C CD   . GLU A 1 4  ? 25.154 -1.529  -9.029  1.00 0.00 ? 4  GLU A CD   17 
ATOM 11472 O OE1  . GLU A 1 4  ? 24.602 -2.625  -8.939  1.00 0.00 ? 4  GLU A OE1  17 
ATOM 11473 O OE2  . GLU A 1 4  ? 25.493 -1.042  -10.108 1.00 0.00 ? 4  GLU A OE2  17 
ATOM 11474 H H    . GLU A 1 4  ? 28.959 -1.780  -8.069  1.00 0.00 ? 4  GLU A H    17 
ATOM 11475 H HA   . GLU A 1 4  ? 27.602 0.705   -7.646  1.00 0.00 ? 4  GLU A HA   17 
ATOM 11476 H HB2  . GLU A 1 4  ? 27.057 -2.194  -7.461  1.00 0.00 ? 4  GLU A HB2  17 
ATOM 11477 H HB3  . GLU A 1 4  ? 26.470 -1.506  -6.031  1.00 0.00 ? 4  GLU A HB3  17 
ATOM 11478 H HG2  . GLU A 1 4  ? 24.590 -0.856  -7.055  1.00 0.00 ? 4  GLU A HG2  17 
ATOM 11479 H HG3  . GLU A 1 4  ? 25.475 0.327   -7.957  1.00 0.00 ? 4  GLU A HG3  17 
ATOM 11480 N N    . ALA A 1 5  ? 29.148 -0.706  -5.140  1.00 0.00 ? 5  ALA A N    17 
ATOM 11481 C CA   . ALA A 1 5  ? 29.694 -0.421  -3.829  1.00 0.00 ? 5  ALA A CA   17 
ATOM 11482 C C    . ALA A 1 5  ? 30.757 0.673   -3.909  1.00 0.00 ? 5  ALA A C    17 
ATOM 11483 O O    . ALA A 1 5  ? 31.105 1.244   -2.894  1.00 0.00 ? 5  ALA A O    17 
ATOM 11484 C CB   . ALA A 1 5  ? 30.283 -1.685  -3.212  1.00 0.00 ? 5  ALA A CB   17 
ATOM 11485 H H    . ALA A 1 5  ? 29.439 -1.519  -5.641  1.00 0.00 ? 5  ALA A H    17 
ATOM 11486 H HA   . ALA A 1 5  ? 28.877 -0.071  -3.197  1.00 0.00 ? 5  ALA A HA   17 
ATOM 11487 H HB1  . ALA A 1 5  ? 31.175 -2.031  -3.737  1.00 0.00 ? 5  ALA A HB1  17 
ATOM 11488 H HB2  . ALA A 1 5  ? 29.550 -2.488  -3.220  1.00 0.00 ? 5  ALA A HB2  17 
ATOM 11489 H HB3  . ALA A 1 5  ? 30.542 -1.493  -2.172  1.00 0.00 ? 5  ALA A HB3  17 
ATOM 11490 N N    . ILE A 1 6  ? 31.262 0.968   -5.122  1.00 0.00 ? 6  ILE A N    17 
ATOM 11491 C CA   . ILE A 1 6  ? 32.337 1.955   -5.210  1.00 0.00 ? 6  ILE A CA   17 
ATOM 11492 C C    . ILE A 1 6  ? 31.829 3.379   -4.973  1.00 0.00 ? 6  ILE A C    17 
ATOM 11493 O O    . ILE A 1 6  ? 32.563 4.221   -4.485  1.00 0.00 ? 6  ILE A O    17 
ATOM 11494 C CB   . ILE A 1 6  ? 33.124 1.824   -6.524  1.00 0.00 ? 6  ILE A CB   17 
ATOM 11495 C CG1  . ILE A 1 6  ? 33.569 0.374   -6.739  1.00 0.00 ? 6  ILE A CG1  17 
ATOM 11496 C CG2  . ILE A 1 6  ? 34.340 2.770   -6.593  1.00 0.00 ? 6  ILE A CG2  17 
ATOM 11497 C CD1  . ILE A 1 6  ? 34.599 -0.083  -5.729  1.00 0.00 ? 6  ILE A CD1  17 
ATOM 11498 H H    . ILE A 1 6  ? 30.914 0.523   -5.947  1.00 0.00 ? 6  ILE A H    17 
ATOM 11499 H HA   . ILE A 1 6  ? 33.003 1.727   -4.385  1.00 0.00 ? 6  ILE A HA   17 
ATOM 11500 H HB   . ILE A 1 6  ? 32.463 2.090   -7.347  1.00 0.00 ? 6  ILE A HB   17 
ATOM 11501 H HG12 . ILE A 1 6  ? 32.740 -0.317  -6.670  1.00 0.00 ? 6  ILE A HG12 17 
ATOM 11502 H HG13 . ILE A 1 6  ? 33.969 0.271   -7.744  1.00 0.00 ? 6  ILE A HG13 17 
ATOM 11503 H HG21 . ILE A 1 6  ? 35.184 2.327   -7.123  1.00 0.00 ? 6  ILE A HG21 17 
ATOM 11504 H HG22 . ILE A 1 6  ? 34.697 3.015   -5.598  1.00 0.00 ? 6  ILE A HG22 17 
ATOM 11505 H HG23 . ILE A 1 6  ? 34.094 3.706   -7.087  1.00 0.00 ? 6  ILE A HG23 17 
ATOM 11506 H HD11 . ILE A 1 6  ? 34.974 -1.058  -5.989  1.00 0.00 ? 6  ILE A HD11 17 
ATOM 11507 H HD12 . ILE A 1 6  ? 34.181 -0.138  -4.728  1.00 0.00 ? 6  ILE A HD12 17 
ATOM 11508 H HD13 . ILE A 1 6  ? 35.447 0.581   -5.739  1.00 0.00 ? 6  ILE A HD13 17 
ATOM 11509 N N    . GLU A 1 7  ? 30.546 3.601   -5.302  1.00 0.00 ? 7  GLU A N    17 
ATOM 11510 C CA   . GLU A 1 7  ? 29.942 4.900   -5.020  1.00 0.00 ? 7  GLU A CA   17 
ATOM 11511 C C    . GLU A 1 7  ? 29.404 4.983   -3.583  1.00 0.00 ? 7  GLU A C    17 
ATOM 11512 O O    . GLU A 1 7  ? 29.119 6.059   -3.085  1.00 0.00 ? 7  GLU A O    17 
ATOM 11513 C CB   . GLU A 1 7  ? 28.842 5.187   -6.046  1.00 0.00 ? 7  GLU A CB   17 
ATOM 11514 C CG   . GLU A 1 7  ? 27.749 4.103   -6.087  1.00 0.00 ? 7  GLU A CG   17 
ATOM 11515 C CD   . GLU A 1 7  ? 26.506 4.564   -6.875  1.00 0.00 ? 7  GLU A CD   17 
ATOM 11516 O OE1  . GLU A 1 7  ? 26.664 5.235   -7.894  1.00 0.00 ? 7  GLU A OE1  17 
ATOM 11517 O OE2  . GLU A 1 7  ? 25.391 4.249   -6.459  1.00 0.00 ? 7  GLU A OE2  17 
ATOM 11518 H H    . GLU A 1 7  ? 29.997 2.857   -5.682  1.00 0.00 ? 7  GLU A H    17 
ATOM 11519 H HA   . GLU A 1 7  ? 30.702 5.673   -5.103  1.00 0.00 ? 7  GLU A HA   17 
ATOM 11520 H HB2  . GLU A 1 7  ? 28.408 6.166   -5.834  1.00 0.00 ? 7  GLU A HB2  17 
ATOM 11521 H HB3  . GLU A 1 7  ? 29.299 5.260   -7.034  1.00 0.00 ? 7  GLU A HB3  17 
ATOM 11522 H HG2  . GLU A 1 7  ? 28.136 3.191   -6.543  1.00 0.00 ? 7  GLU A HG2  17 
ATOM 11523 H HG3  . GLU A 1 7  ? 27.438 3.838   -5.077  1.00 0.00 ? 7  GLU A HG3  17 
ATOM 11524 N N    . ARG A 1 8  ? 29.291 3.787   -2.963  1.00 0.00 ? 8  ARG A N    17 
ATOM 11525 C CA   . ARG A 1 8  ? 28.752 3.671   -1.618  1.00 0.00 ? 8  ARG A CA   17 
ATOM 11526 C C    . ARG A 1 8  ? 29.862 3.877   -0.587  1.00 0.00 ? 8  ARG A C    17 
ATOM 11527 O O    . ARG A 1 8  ? 29.769 4.738   0.269   1.00 0.00 ? 8  ARG A O    17 
ATOM 11528 C CB   . ARG A 1 8  ? 28.081 2.292   -1.500  1.00 0.00 ? 8  ARG A CB   17 
ATOM 11529 C CG   . ARG A 1 8  ? 26.666 2.371   -0.917  1.00 0.00 ? 8  ARG A CG   17 
ATOM 11530 C CD   . ARG A 1 8  ? 25.766 1.234   -1.423  1.00 0.00 ? 8  ARG A CD   17 
ATOM 11531 N NE   . ARG A 1 8  ? 25.061 0.571   -0.334  1.00 0.00 ? 8  ARG A NE   17 
ATOM 11532 C CZ   . ARG A 1 8  ? 24.113 1.180   0.411   1.00 0.00 ? 8  ARG A CZ   17 
ATOM 11533 N NH1  . ARG A 1 8  ? 23.774 2.451   0.199   1.00 0.00 ? 8  ARG A NH1  17 
ATOM 11534 N NH2  . ARG A 1 8  ? 23.514 0.491   1.377   1.00 0.00 ? 8  ARG A NH2  17 
ATOM 11535 H H    . ARG A 1 8  ? 29.570 2.946   -3.423  1.00 0.00 ? 8  ARG A H    17 
ATOM 11536 H HA   . ARG A 1 8  ? 28.026 4.477   -1.496  1.00 0.00 ? 8  ARG A HA   17 
ATOM 11537 H HB2  . ARG A 1 8  ? 28.031 1.861   -2.499  1.00 0.00 ? 8  ARG A HB2  17 
ATOM 11538 H HB3  . ARG A 1 8  ? 28.671 1.577   -0.925  1.00 0.00 ? 8  ARG A HB3  17 
ATOM 11539 H HG2  . ARG A 1 8  ? 26.725 2.386   0.171   1.00 0.00 ? 8  ARG A HG2  17 
ATOM 11540 H HG3  . ARG A 1 8  ? 26.193 3.314   -1.189  1.00 0.00 ? 8  ARG A HG3  17 
ATOM 11541 H HD2  . ARG A 1 8  ? 25.028 1.602   -2.135  1.00 0.00 ? 8  ARG A HD2  17 
ATOM 11542 H HD3  . ARG A 1 8  ? 26.333 0.454   -1.932  1.00 0.00 ? 8  ARG A HD3  17 
ATOM 11543 H HE   . ARG A 1 8  ? 25.290 -0.381  -0.130  1.00 0.00 ? 8  ARG A HE   17 
ATOM 11544 H HH11 . ARG A 1 8  ? 24.227 2.975   -0.523  1.00 0.00 ? 8  ARG A HH11 17 
ATOM 11545 H HH12 . ARG A 1 8  ? 23.070 2.881   0.763   1.00 0.00 ? 8  ARG A HH12 17 
ATOM 11546 H HH21 . ARG A 1 8  ? 23.766 -0.464  1.538   1.00 0.00 ? 8  ARG A HH21 17 
ATOM 11547 H HH22 . ARG A 1 8  ? 22.814 0.928   1.941   1.00 0.00 ? 8  ARG A HH22 17 
ATOM 11548 N N    . LEU A 1 9  ? 30.913 3.047   -0.772  1.00 0.00 ? 9  LEU A N    17 
ATOM 11549 C CA   . LEU A 1 9  ? 32.169 3.066   -0.037  1.00 0.00 ? 9  LEU A CA   17 
ATOM 11550 C C    . LEU A 1 9  ? 32.766 4.495   -0.079  1.00 0.00 ? 9  LEU A C    17 
ATOM 11551 O O    . LEU A 1 9  ? 33.084 5.077   0.942   1.00 0.00 ? 9  LEU A O    17 
ATOM 11552 C CB   . LEU A 1 9  ? 33.127 2.025   -0.625  1.00 0.00 ? 9  LEU A CB   17 
ATOM 11553 C CG   . LEU A 1 9  ? 32.606 0.578   -0.615  1.00 0.00 ? 9  LEU A CG   17 
ATOM 11554 C CD1  . LEU A 1 9  ? 33.271 -0.179  -1.772  1.00 0.00 ? 9  LEU A CD1  17 
ATOM 11555 C CD2  . LEU A 1 9  ? 32.779 -0.127  0.734   1.00 0.00 ? 9  LEU A CD2  17 
ATOM 11556 H H    . LEU A 1 9  ? 30.807 2.366   -1.482  1.00 0.00 ? 9  LEU A H    17 
ATOM 11557 H HA   . LEU A 1 9  ? 31.954 2.748   0.979   1.00 0.00 ? 9  LEU A HA   17 
ATOM 11558 H HB2  . LEU A 1 9  ? 33.329 2.331   -1.649  1.00 0.00 ? 9  LEU A HB2  17 
ATOM 11559 H HB3  . LEU A 1 9  ? 34.078 2.036   -0.099  1.00 0.00 ? 9  LEU A HB3  17 
ATOM 11560 H HG   . LEU A 1 9  ? 31.531 0.569   -0.759  1.00 0.00 ? 9  LEU A HG   17 
ATOM 11561 H HD11 . LEU A 1 9  ? 33.346 0.419   -2.674  1.00 0.00 ? 9  LEU A HD11 17 
ATOM 11562 H HD12 . LEU A 1 9  ? 32.681 -1.035  -2.065  1.00 0.00 ? 9  LEU A HD12 17 
ATOM 11563 H HD13 . LEU A 1 9  ? 34.285 -0.488  -1.516  1.00 0.00 ? 9  LEU A HD13 17 
ATOM 11564 H HD21 . LEU A 1 9  ? 33.705 -0.694  0.762   1.00 0.00 ? 9  LEU A HD21 17 
ATOM 11565 H HD22 . LEU A 1 9  ? 31.962 -0.819  0.933   1.00 0.00 ? 9  LEU A HD22 17 
ATOM 11566 H HD23 . LEU A 1 9  ? 32.797 0.587   1.554   1.00 0.00 ? 9  LEU A HD23 17 
ATOM 11567 N N    . LYS A 1 10 ? 32.842 5.053   -1.307  1.00 0.00 ? 10 LYS A N    17 
ATOM 11568 C CA   . LYS A 1 10 ? 33.325 6.433   -1.449  1.00 0.00 ? 10 LYS A CA   17 
ATOM 11569 C C    . LYS A 1 10 ? 32.419 7.471   -0.763  1.00 0.00 ? 10 LYS A C    17 
ATOM 11570 O O    . LYS A 1 10 ? 32.892 8.479   -0.261  1.00 0.00 ? 10 LYS A O    17 
ATOM 11571 C CB   . LYS A 1 10 ? 33.380 6.806   -2.925  1.00 0.00 ? 10 LYS A CB   17 
ATOM 11572 C CG   . LYS A 1 10 ? 34.495 6.093   -3.669  1.00 0.00 ? 10 LYS A CG   17 
ATOM 11573 C CD   . LYS A 1 10 ? 34.539 6.383   -5.176  1.00 0.00 ? 10 LYS A CD   17 
ATOM 11574 C CE   . LYS A 1 10 ? 33.335 7.132   -5.753  1.00 0.00 ? 10 LYS A CE   17 
ATOM 11575 N NZ   . LYS A 1 10 ? 33.538 7.497   -7.144  1.00 0.00 ? 10 LYS A NZ   17 
ATOM 11576 H H    . LYS A 1 10 ? 32.533 4.527   -2.101  1.00 0.00 ? 10 LYS A H    17 
ATOM 11577 H HA   . LYS A 1 10 ? 34.316 6.493   -0.998  1.00 0.00 ? 10 LYS A HA   17 
ATOM 11578 H HB2  . LYS A 1 10 ? 32.415 6.591   -3.382  1.00 0.00 ? 10 LYS A HB2  17 
ATOM 11579 H HB3  . LYS A 1 10 ? 33.563 7.874   -3.033  1.00 0.00 ? 10 LYS A HB3  17 
ATOM 11580 H HG2  . LYS A 1 10 ? 35.424 6.411   -3.210  1.00 0.00 ? 10 LYS A HG2  17 
ATOM 11581 H HG3  . LYS A 1 10 ? 34.433 5.021   -3.497  1.00 0.00 ? 10 LYS A HG3  17 
ATOM 11582 H HD2  . LYS A 1 10 ? 35.440 6.946   -5.410  1.00 0.00 ? 10 LYS A HD2  17 
ATOM 11583 H HD3  . LYS A 1 10 ? 34.616 5.429   -5.692  1.00 0.00 ? 10 LYS A HD3  17 
ATOM 11584 H HE2  . LYS A 1 10 ? 32.461 6.490   -5.724  1.00 0.00 ? 10 LYS A HE2  17 
ATOM 11585 H HE3  . LYS A 1 10 ? 33.129 8.060   -5.216  1.00 0.00 ? 10 LYS A HE3  17 
ATOM 11586 H HZ1  . LYS A 1 10 ? 34.171 8.320   -7.189  1.00 0.00 ? 10 LYS A HZ1  17 
ATOM 11587 H HZ2  . LYS A 1 10 ? 32.624 7.737   -7.578  1.00 0.00 ? 10 LYS A HZ2  17 
ATOM 11588 H HZ3  . LYS A 1 10 ? 33.967 6.694   -7.645  1.00 0.00 ? 10 LYS A HZ3  17 
ATOM 11589 N N    . ALA A 1 11 ? 31.100 7.172   -0.793  1.00 0.00 ? 11 ALA A N    17 
ATOM 11590 C CA   . ALA A 1 11 ? 30.122 8.092   -0.214  1.00 0.00 ? 11 ALA A CA   17 
ATOM 11591 C C    . ALA A 1 11 ? 30.259 8.221   1.316   1.00 0.00 ? 11 ALA A C    17 
ATOM 11592 O O    . ALA A 1 11 ? 29.807 9.199   1.895   1.00 0.00 ? 11 ALA A O    17 
ATOM 11593 C CB   . ALA A 1 11 ? 28.699 7.661   -0.580  1.00 0.00 ? 11 ALA A CB   17 
ATOM 11594 H H    . ALA A 1 11 ? 30.799 6.327   -1.232  1.00 0.00 ? 11 ALA A H    17 
ATOM 11595 H HA   . ALA A 1 11 ? 30.314 9.072   -0.656  1.00 0.00 ? 11 ALA A HA   17 
ATOM 11596 H HB1  . ALA A 1 11 ? 28.492 7.896   -1.622  1.00 0.00 ? 11 ALA A HB1  17 
ATOM 11597 H HB2  . ALA A 1 11 ? 27.951 8.173   0.025   1.00 0.00 ? 11 ALA A HB2  17 
ATOM 11598 H HB3  . ALA A 1 11 ? 28.541 6.594   -0.446  1.00 0.00 ? 11 ALA A HB3  17 
ATOM 11599 N N    . LEU A 1 12 ? 30.924 7.214   1.930   1.00 0.00 ? 12 LEU A N    17 
ATOM 11600 C CA   . LEU A 1 12 ? 31.202 7.275   3.363   1.00 0.00 ? 12 LEU A CA   17 
ATOM 11601 C C    . LEU A 1 12 ? 32.390 8.229   3.686   1.00 0.00 ? 12 LEU A C    17 
ATOM 11602 O O    . LEU A 1 12 ? 32.805 8.323   4.833   1.00 0.00 ? 12 LEU A O    17 
ATOM 11603 C CB   . LEU A 1 12 ? 31.533 5.862   3.868   1.00 0.00 ? 12 LEU A CB   17 
ATOM 11604 C CG   . LEU A 1 12 ? 30.370 4.846   3.943   1.00 0.00 ? 12 LEU A CG   17 
ATOM 11605 C CD1  . LEU A 1 12 ? 30.476 3.800   2.835   1.00 0.00 ? 12 LEU A CD1  17 
ATOM 11606 C CD2  . LEU A 1 12 ? 30.361 4.106   5.282   1.00 0.00 ? 12 LEU A CD2  17 
ATOM 11607 H H    . LEU A 1 12 ? 31.276 6.436   1.410   1.00 0.00 ? 12 LEU A H    17 
ATOM 11608 H HA   . LEU A 1 12 ? 30.313 7.653   3.870   1.00 0.00 ? 12 LEU A HA   17 
ATOM 11609 H HB2  . LEU A 1 12 ? 32.308 5.476   3.217   1.00 0.00 ? 12 LEU A HB2  17 
ATOM 11610 H HB3  . LEU A 1 12 ? 31.977 5.938   4.855   1.00 0.00 ? 12 LEU A HB3  17 
ATOM 11611 H HG   . LEU A 1 12 ? 29.425 5.379   3.839   1.00 0.00 ? 12 LEU A HG   17 
ATOM 11612 H HD11 . LEU A 1 12 ? 31.026 4.239   2.018   1.00 0.00 ? 12 LEU A HD11 17 
ATOM 11613 H HD12 . LEU A 1 12 ? 29.498 3.475   2.478   1.00 0.00 ? 12 LEU A HD12 17 
ATOM 11614 H HD13 . LEU A 1 12 ? 31.040 2.916   3.135   1.00 0.00 ? 12 LEU A HD13 17 
ATOM 11615 H HD21 . LEU A 1 12 ? 31.202 3.421   5.324   1.00 0.00 ? 12 LEU A HD21 17 
ATOM 11616 H HD22 . LEU A 1 12 ? 29.465 3.497   5.396   1.00 0.00 ? 12 LEU A HD22 17 
ATOM 11617 H HD23 . LEU A 1 12 ? 30.448 4.790   6.126   1.00 0.00 ? 12 LEU A HD23 17 
ATOM 11618 N N    . GLY A 1 13 ? 32.901 8.920   2.633   1.00 0.00 ? 13 GLY A N    17 
ATOM 11619 C CA   . GLY A 1 13 ? 33.982 9.897   2.777   1.00 0.00 ? 13 GLY A CA   17 
ATOM 11620 C C    . GLY A 1 13 ? 35.336 9.368   2.273   1.00 0.00 ? 13 GLY A C    17 
ATOM 11621 O O    . GLY A 1 13 ? 36.381 9.936   2.560   1.00 0.00 ? 13 GLY A O    17 
ATOM 11622 H H    . GLY A 1 13 ? 32.506 8.795   1.726   1.00 0.00 ? 13 GLY A H    17 
ATOM 11623 H HA2  . GLY A 1 13 ? 33.698 10.776  2.199   1.00 0.00 ? 13 GLY A HA2  17 
ATOM 11624 H HA3  . GLY A 1 13 ? 34.064 10.191  3.823   1.00 0.00 ? 13 GLY A HA3  17 
ATOM 11625 N N    . PHE A 1 14 ? 35.269 8.243   1.525   1.00 0.00 ? 14 PHE A N    17 
ATOM 11626 C CA   . PHE A 1 14 ? 36.486 7.536   1.137   1.00 0.00 ? 14 PHE A CA   17 
ATOM 11627 C C    . PHE A 1 14 ? 36.848 7.924   -0.311  1.00 0.00 ? 14 PHE A C    17 
ATOM 11628 O O    . PHE A 1 14 ? 36.602 9.048   -0.738  1.00 0.00 ? 14 PHE A O    17 
ATOM 11629 C CB   . PHE A 1 14 ? 36.279 6.019   1.362   1.00 0.00 ? 14 PHE A CB   17 
ATOM 11630 C CG   . PHE A 1 14 ? 35.718 5.692   2.727   1.00 0.00 ? 14 PHE A CG   17 
ATOM 11631 C CD1  . PHE A 1 14 ? 35.915 6.522   3.834   1.00 0.00 ? 14 PHE A CD1  17 
ATOM 11632 C CD2  . PHE A 1 14 ? 34.943 4.549   2.889   1.00 0.00 ? 14 PHE A CD2  17 
ATOM 11633 C CE1  . PHE A 1 14 ? 35.269 6.267   5.029   1.00 0.00 ? 14 PHE A CE1  17 
ATOM 11634 C CE2  . PHE A 1 14 ? 34.300 4.287   4.087   1.00 0.00 ? 14 PHE A CE2  17 
ATOM 11635 C CZ   . PHE A 1 14 ? 34.443 5.171   5.149   1.00 0.00 ? 14 PHE A CZ   17 
ATOM 11636 H H    . PHE A 1 14 ? 34.387 7.861   1.257   1.00 0.00 ? 14 PHE A H    17 
ATOM 11637 H HA   . PHE A 1 14 ? 37.292 7.897   1.776   1.00 0.00 ? 14 PHE A HA   17 
ATOM 11638 H HB2  . PHE A 1 14 ? 35.593 5.642   0.600   1.00 0.00 ? 14 PHE A HB2  17 
ATOM 11639 H HB3  . PHE A 1 14 ? 37.206 5.466   1.253   1.00 0.00 ? 14 PHE A HB3  17 
ATOM 11640 H HD1  . PHE A 1 14 ? 36.556 7.391   3.802   1.00 0.00 ? 14 PHE A HD1  17 
ATOM 11641 H HD2  . PHE A 1 14 ? 34.827 3.851   2.072   1.00 0.00 ? 14 PHE A HD2  17 
ATOM 11642 H HE1  . PHE A 1 14 ? 35.395 6.923   5.873   1.00 0.00 ? 14 PHE A HE1  17 
ATOM 11643 H HE2  . PHE A 1 14 ? 33.675 3.408   4.162   1.00 0.00 ? 14 PHE A HE2  17 
ATOM 11644 H HZ   . PHE A 1 14 ? 33.908 5.047   6.079   1.00 0.00 ? 14 PHE A HZ   17 
ATOM 11645 N N    . GLU A 1 15 ? 37.444 6.952   -1.028  1.00 0.00 ? 15 GLU A N    17 
ATOM 11646 C CA   . GLU A 1 15 ? 37.908 7.177   -2.391  1.00 0.00 ? 15 GLU A CA   17 
ATOM 11647 C C    . GLU A 1 15 ? 38.053 5.816   -3.058  1.00 0.00 ? 15 GLU A C    17 
ATOM 11648 O O    . GLU A 1 15 ? 38.511 4.868   -2.431  1.00 0.00 ? 15 GLU A O    17 
ATOM 11649 C CB   . GLU A 1 15 ? 39.270 7.892   -2.396  1.00 0.00 ? 15 GLU A CB   17 
ATOM 11650 C CG   . GLU A 1 15 ? 39.522 8.658   -3.709  1.00 0.00 ? 15 GLU A CG   17 
ATOM 11651 C CD   . GLU A 1 15 ? 38.913 10.078  -3.732  1.00 0.00 ? 15 GLU A CD   17 
ATOM 11652 O OE1  . GLU A 1 15 ? 38.351 10.519  -2.728  1.00 0.00 ? 15 GLU A OE1  17 
ATOM 11653 O OE2  . GLU A 1 15 ? 39.018 10.737  -4.766  1.00 0.00 ? 15 GLU A OE2  17 
ATOM 11654 H H    . GLU A 1 15 ? 37.581 6.055   -0.610  1.00 0.00 ? 15 GLU A H    17 
ATOM 11655 H HA   . GLU A 1 15 ? 37.149 7.766   -2.910  1.00 0.00 ? 15 GLU A HA   17 
ATOM 11656 H HB2  . GLU A 1 15 ? 39.347 8.550   -1.531  1.00 0.00 ? 15 GLU A HB2  17 
ATOM 11657 H HB3  . GLU A 1 15 ? 40.086 7.185   -2.251  1.00 0.00 ? 15 GLU A HB3  17 
ATOM 11658 H HG2  . GLU A 1 15 ? 40.593 8.750   -3.875  1.00 0.00 ? 15 GLU A HG2  17 
ATOM 11659 H HG3  . GLU A 1 15 ? 39.152 8.096   -4.567  1.00 0.00 ? 15 GLU A HG3  17 
ATOM 11660 N N    . GLU A 1 16 ? 37.646 5.793   -4.346  1.00 0.00 ? 16 GLU A N    17 
ATOM 11661 C CA   . GLU A 1 16 ? 37.588 4.615   -5.212  1.00 0.00 ? 16 GLU A CA   17 
ATOM 11662 C C    . GLU A 1 16 ? 38.828 3.682   -5.115  1.00 0.00 ? 16 GLU A C    17 
ATOM 11663 O O    . GLU A 1 16 ? 38.739 2.497   -5.400  1.00 0.00 ? 16 GLU A O    17 
ATOM 11664 C CB   . GLU A 1 16 ? 37.368 5.099   -6.655  1.00 0.00 ? 16 GLU A CB   17 
ATOM 11665 C CG   . GLU A 1 16 ? 37.694 4.069   -7.751  1.00 0.00 ? 16 GLU A CG   17 
ATOM 11666 C CD   . GLU A 1 16 ? 37.405 4.591   -9.167  1.00 0.00 ? 16 GLU A CD   17 
ATOM 11667 O OE1  . GLU A 1 16 ? 36.919 5.713   -9.311  1.00 0.00 ? 16 GLU A OE1  17 
ATOM 11668 O OE2  . GLU A 1 16 ? 37.685 3.864   -10.119 1.00 0.00 ? 16 GLU A OE2  17 
ATOM 11669 H H    . GLU A 1 16 ? 37.304 6.655   -4.722  1.00 0.00 ? 16 GLU A H    17 
ATOM 11670 H HA   . GLU A 1 16 ? 36.698 4.082   -4.884  1.00 0.00 ? 16 GLU A HA   17 
ATOM 11671 H HB2  . GLU A 1 16 ? 36.330 5.398   -6.791  1.00 0.00 ? 16 GLU A HB2  17 
ATOM 11672 H HB3  . GLU A 1 16 ? 37.977 5.992   -6.799  1.00 0.00 ? 16 GLU A HB3  17 
ATOM 11673 H HG2  . GLU A 1 16 ? 38.754 3.829   -7.725  1.00 0.00 ? 16 GLU A HG2  17 
ATOM 11674 H HG3  . GLU A 1 16 ? 37.155 3.135   -7.592  1.00 0.00 ? 16 GLU A HG3  17 
ATOM 11675 N N    . SER A 1 17 ? 39.973 4.263   -4.716  1.00 0.00 ? 17 SER A N    17 
ATOM 11676 C CA   . SER A 1 17 ? 41.196 3.488   -4.604  1.00 0.00 ? 17 SER A CA   17 
ATOM 11677 C C    . SER A 1 17 ? 41.233 2.706   -3.287  1.00 0.00 ? 17 SER A C    17 
ATOM 11678 O O    . SER A 1 17 ? 41.432 1.502   -3.296  1.00 0.00 ? 17 SER A O    17 
ATOM 11679 C CB   . SER A 1 17 ? 42.384 4.455   -4.680  1.00 0.00 ? 17 SER A CB   17 
ATOM 11680 O OG   . SER A 1 17 ? 42.941 4.525   -5.977  1.00 0.00 ? 17 SER A OG   17 
ATOM 11681 H H    . SER A 1 17 ? 39.983 5.228   -4.457  1.00 0.00 ? 17 SER A H    17 
ATOM 11682 H HA   . SER A 1 17 ? 41.202 2.757   -5.420  1.00 0.00 ? 17 SER A HA   17 
ATOM 11683 H HB2  . SER A 1 17 ? 42.104 5.454   -4.332  1.00 0.00 ? 17 SER A HB2  17 
ATOM 11684 H HB3  . SER A 1 17 ? 43.184 4.139   -4.014  1.00 0.00 ? 17 SER A HB3  17 
ATOM 11685 H HG   . SER A 1 17 ? 42.262 4.737   -6.608  1.00 0.00 ? 17 SER A HG   17 
ATOM 11686 N N    . LEU A 1 18 ? 41.031 3.445   -2.166  1.00 0.00 ? 18 LEU A N    17 
ATOM 11687 C CA   . LEU A 1 18 ? 41.027 2.770   -0.863  1.00 0.00 ? 18 LEU A CA   17 
ATOM 11688 C C    . LEU A 1 18 ? 39.826 1.836   -0.720  1.00 0.00 ? 18 LEU A C    17 
ATOM 11689 O O    . LEU A 1 18 ? 39.833 0.942   0.118   1.00 0.00 ? 18 LEU A O    17 
ATOM 11690 C CB   . LEU A 1 18 ? 41.138 3.773   0.302   1.00 0.00 ? 18 LEU A CB   17 
ATOM 11691 C CG   . LEU A 1 18 ? 39.848 4.453   0.823   1.00 0.00 ? 18 LEU A CG   17 
ATOM 11692 C CD1  . LEU A 1 18 ? 39.598 4.120   2.302   1.00 0.00 ? 18 LEU A CD1  17 
ATOM 11693 C CD2  . LEU A 1 18 ? 39.921 5.972   0.666   1.00 0.00 ? 18 LEU A CD2  17 
ATOM 11694 H H    . LEU A 1 18 ? 40.832 4.422   -2.236  1.00 0.00 ? 18 LEU A H    17 
ATOM 11695 H HA   . LEU A 1 18 ? 41.918 2.142   -0.836  1.00 0.00 ? 18 LEU A HA   17 
ATOM 11696 H HB2  . LEU A 1 18 ? 41.595 3.246   1.132   1.00 0.00 ? 18 LEU A HB2  17 
ATOM 11697 H HB3  . LEU A 1 18 ? 41.878 4.524   0.039   1.00 0.00 ? 18 LEU A HB3  17 
ATOM 11698 H HG   . LEU A 1 18 ? 38.992 4.110   0.246   1.00 0.00 ? 18 LEU A HG   17 
ATOM 11699 H HD11 . LEU A 1 18 ? 39.468 3.048   2.455   1.00 0.00 ? 18 LEU A HD11 17 
ATOM 11700 H HD12 . LEU A 1 18 ? 38.715 4.643   2.668   1.00 0.00 ? 18 LEU A HD12 17 
ATOM 11701 H HD13 . LEU A 1 18 ? 40.430 4.432   2.931   1.00 0.00 ? 18 LEU A HD13 17 
ATOM 11702 H HD21 . LEU A 1 18 ? 40.820 6.376   1.125   1.00 0.00 ? 18 LEU A HD21 17 
ATOM 11703 H HD22 . LEU A 1 18 ? 39.071 6.477   1.123   1.00 0.00 ? 18 LEU A HD22 17 
ATOM 11704 H HD23 . LEU A 1 18 ? 39.949 6.229   -0.385  1.00 0.00 ? 18 LEU A HD23 17 
ATOM 11705 N N    . VAL A 1 19 ? 38.833 2.106   -1.579  1.00 0.00 ? 19 VAL A N    17 
ATOM 11706 C CA   . VAL A 1 19 ? 37.545 1.443   -1.704  1.00 0.00 ? 19 VAL A CA   17 
ATOM 11707 C C    . VAL A 1 19 ? 37.695 0.106   -2.442  1.00 0.00 ? 19 VAL A C    17 
ATOM 11708 O O    . VAL A 1 19 ? 37.311 -0.933  -1.936  1.00 0.00 ? 19 VAL A O    17 
ATOM 11709 C CB   . VAL A 1 19 ? 36.671 2.445   -2.464  1.00 0.00 ? 19 VAL A CB   17 
ATOM 11710 C CG1  . VAL A 1 19 ? 35.576 1.832   -3.315  1.00 0.00 ? 19 VAL A CG1  17 
ATOM 11711 C CG2  . VAL A 1 19 ? 36.159 3.599   -1.595  1.00 0.00 ? 19 VAL A CG2  17 
ATOM 11712 H H    . VAL A 1 19 ? 38.986 2.854   -2.230  1.00 0.00 ? 19 VAL A H    17 
ATOM 11713 H HA   . VAL A 1 19 ? 37.126 1.243   -0.721  1.00 0.00 ? 19 VAL A HA   17 
ATOM 11714 H HB   . VAL A 1 19 ? 37.341 2.889   -3.190  1.00 0.00 ? 19 VAL A HB   17 
ATOM 11715 H HG11 . VAL A 1 19 ? 35.954 1.807   -4.328  1.00 0.00 ? 19 VAL A HG11 17 
ATOM 11716 H HG12 . VAL A 1 19 ? 34.670 2.427   -3.300  1.00 0.00 ? 19 VAL A HG12 17 
ATOM 11717 H HG13 . VAL A 1 19 ? 35.333 0.817   -3.024  1.00 0.00 ? 19 VAL A HG13 17 
ATOM 11718 H HG21 . VAL A 1 19 ? 36.870 3.878   -0.822  1.00 0.00 ? 19 VAL A HG21 17 
ATOM 11719 H HG22 . VAL A 1 19 ? 35.215 3.403   -1.111  1.00 0.00 ? 19 VAL A HG22 17 
ATOM 11720 H HG23 . VAL A 1 19 ? 35.982 4.470   -2.213  1.00 0.00 ? 19 VAL A HG23 17 
ATOM 11721 N N    . ILE A 1 20 ? 38.254 0.213   -3.671  1.00 0.00 ? 20 ILE A N    17 
ATOM 11722 C CA   . ILE A 1 20 ? 38.462 -0.958  -4.518  1.00 0.00 ? 20 ILE A CA   17 
ATOM 11723 C C    . ILE A 1 20 ? 39.336 -1.971  -3.792  1.00 0.00 ? 20 ILE A C    17 
ATOM 11724 O O    . ILE A 1 20 ? 38.967 -3.123  -3.679  1.00 0.00 ? 20 ILE A O    17 
ATOM 11725 C CB   . ILE A 1 20 ? 39.079 -0.560  -5.882  1.00 0.00 ? 20 ILE A CB   17 
ATOM 11726 C CG1  . ILE A 1 20 ? 38.019 -0.017  -6.848  1.00 0.00 ? 20 ILE A CG1  17 
ATOM 11727 C CG2  . ILE A 1 20 ? 39.856 -1.698  -6.566  1.00 0.00 ? 20 ILE A CG2  17 
ATOM 11728 C CD1  . ILE A 1 20 ? 37.135 -1.124  -7.443  1.00 0.00 ? 20 ILE A CD1  17 
ATOM 11729 H H    . ILE A 1 20 ? 38.522 1.114   -4.001  1.00 0.00 ? 20 ILE A H    17 
ATOM 11730 H HA   . ILE A 1 20 ? 37.487 -1.430  -4.643  1.00 0.00 ? 20 ILE A HA   17 
ATOM 11731 H HB   . ILE A 1 20 ? 39.790 0.244   -5.690  1.00 0.00 ? 20 ILE A HB   17 
ATOM 11732 H HG12 . ILE A 1 20 ? 37.426 0.733   -6.335  1.00 0.00 ? 20 ILE A HG12 17 
ATOM 11733 H HG13 . ILE A 1 20 ? 38.489 0.525   -7.668  1.00 0.00 ? 20 ILE A HG13 17 
ATOM 11734 H HG21 . ILE A 1 20 ? 40.131 -1.435  -7.586  1.00 0.00 ? 20 ILE A HG21 17 
ATOM 11735 H HG22 . ILE A 1 20 ? 39.266 -2.610  -6.614  1.00 0.00 ? 20 ILE A HG22 17 
ATOM 11736 H HG23 . ILE A 1 20 ? 40.773 -1.931  -6.029  1.00 0.00 ? 20 ILE A HG23 17 
ATOM 11737 H HD11 . ILE A 1 20 ? 37.665 -1.712  -8.194  1.00 0.00 ? 20 ILE A HD11 17 
ATOM 11738 H HD12 . ILE A 1 20 ? 36.274 -0.676  -7.931  1.00 0.00 ? 20 ILE A HD12 17 
ATOM 11739 H HD13 . ILE A 1 20 ? 36.776 -1.821  -6.685  1.00 0.00 ? 20 ILE A HD13 17 
ATOM 11740 N N    . GLN A 1 21 ? 40.488 -1.457  -3.305  1.00 0.00 ? 21 GLN A N    17 
ATOM 11741 C CA   . GLN A 1 21 ? 41.409 -2.293  -2.550  1.00 0.00 ? 21 GLN A CA   17 
ATOM 11742 C C    . GLN A 1 21 ? 40.816 -2.754  -1.205  1.00 0.00 ? 21 GLN A C    17 
ATOM 11743 O O    . GLN A 1 21 ? 41.218 -3.787  -0.699  1.00 0.00 ? 21 GLN A O    17 
ATOM 11744 C CB   . GLN A 1 21 ? 42.747 -1.572  -2.297  1.00 0.00 ? 21 GLN A CB   17 
ATOM 11745 C CG   . GLN A 1 21 ? 43.669 -1.543  -3.533  1.00 0.00 ? 21 GLN A CG   17 
ATOM 11746 C CD   . GLN A 1 21 ? 45.160 -1.545  -3.131  1.00 0.00 ? 21 GLN A CD   17 
ATOM 11747 O OE1  . GLN A 1 21 ? 45.523 -1.452  -1.964  1.00 0.00 ? 21 GLN A OE1  17 
ATOM 11748 N NE2  . GLN A 1 21 ? 45.982 -1.812  -4.162  1.00 0.00 ? 21 GLN A NE2  17 
ATOM 11749 H H    . GLN A 1 21 ? 40.696 -0.495  -3.473  1.00 0.00 ? 21 GLN A H    17 
ATOM 11750 H HA   . GLN A 1 21 ? 41.578 -3.190  -3.151  1.00 0.00 ? 21 GLN A HA   17 
ATOM 11751 H HB2  . GLN A 1 21 ? 42.579 -0.557  -1.935  1.00 0.00 ? 21 GLN A HB2  17 
ATOM 11752 H HB3  . GLN A 1 21 ? 43.255 -2.090  -1.481  1.00 0.00 ? 21 GLN A HB3  17 
ATOM 11753 H HG2  . GLN A 1 21 ? 43.495 -2.422  -4.155  1.00 0.00 ? 21 GLN A HG2  17 
ATOM 11754 H HG3  . GLN A 1 21 ? 43.453 -0.683  -4.164  1.00 0.00 ? 21 GLN A HG3  17 
ATOM 11755 H HE21 . GLN A 1 21 ? 46.078 -1.176  -4.927  1.00 0.00 ? 21 GLN A HE21 17 
ATOM 11756 H HE22 . GLN A 1 21 ? 46.487 -2.675  -4.190  1.00 0.00 ? 21 GLN A HE22 17 
ATOM 11757 N N    . ALA A 1 22 ? 39.858 -1.970  -0.661  1.00 0.00 ? 22 ALA A N    17 
ATOM 11758 C CA   . ALA A 1 22 ? 39.197 -2.377  0.581   1.00 0.00 ? 22 ALA A CA   17 
ATOM 11759 C C    . ALA A 1 22 ? 38.082 -3.400  0.361   1.00 0.00 ? 22 ALA A C    17 
ATOM 11760 O O    . ALA A 1 22 ? 37.648 -4.030  1.311   1.00 0.00 ? 22 ALA A O    17 
ATOM 11761 C CB   . ALA A 1 22 ? 38.520 -1.193  1.265   1.00 0.00 ? 22 ALA A CB   17 
ATOM 11762 H H    . ALA A 1 22 ? 39.553 -1.160  -1.161  1.00 0.00 ? 22 ALA A H    17 
ATOM 11763 H HA   . ALA A 1 22 ? 39.949 -2.825  1.234   1.00 0.00 ? 22 ALA A HA   17 
ATOM 11764 H HB1  . ALA A 1 22 ? 39.255 -0.510  1.667   1.00 0.00 ? 22 ALA A HB1  17 
ATOM 11765 H HB2  . ALA A 1 22 ? 37.923 -1.525  2.113   1.00 0.00 ? 22 ALA A HB2  17 
ATOM 11766 H HB3  . ALA A 1 22 ? 37.872 -0.637  0.587   1.00 0.00 ? 22 ALA A HB3  17 
ATOM 11767 N N    . TYR A 1 23 ? 37.629 -3.503  -0.907  1.00 0.00 ? 23 TYR A N    17 
ATOM 11768 C CA   . TYR A 1 23 ? 36.545 -4.416  -1.254  1.00 0.00 ? 23 TYR A CA   17 
ATOM 11769 C C    . TYR A 1 23 ? 37.127 -5.672  -1.908  1.00 0.00 ? 23 TYR A C    17 
ATOM 11770 O O    . TYR A 1 23 ? 36.493 -6.707  -1.908  1.00 0.00 ? 23 TYR A O    17 
ATOM 11771 C CB   . TYR A 1 23 ? 35.559 -3.716  -2.210  1.00 0.00 ? 23 TYR A CB   17 
ATOM 11772 C CG   . TYR A 1 23 ? 34.104 -3.983  -1.906  1.00 0.00 ? 23 TYR A CG   17 
ATOM 11773 C CD1  . TYR A 1 23 ? 33.432 -3.156  -1.024  1.00 0.00 ? 23 TYR A CD1  17 
ATOM 11774 C CD2  . TYR A 1 23 ? 33.389 -5.009  -2.513  1.00 0.00 ? 23 TYR A CD2  17 
ATOM 11775 C CE1  . TYR A 1 23 ? 32.080 -3.303  -0.783  1.00 0.00 ? 23 TYR A CE1  17 
ATOM 11776 C CE2  . TYR A 1 23 ? 32.028 -5.171  -2.286  1.00 0.00 ? 23 TYR A CE2  17 
ATOM 11777 C CZ   . TYR A 1 23 ? 31.373 -4.288  -1.434  1.00 0.00 ? 23 TYR A CZ   17 
ATOM 11778 O OH   . TYR A 1 23 ? 30.019 -4.337  -1.202  1.00 0.00 ? 23 TYR A OH   17 
ATOM 11779 H H    . TYR A 1 23 ? 38.049 -2.961  -1.634  1.00 0.00 ? 23 TYR A H    17 
ATOM 11780 H HA   . TYR A 1 23 ? 36.041 -4.716  -0.334  1.00 0.00 ? 23 TYR A HA   17 
ATOM 11781 H HB2  . TYR A 1 23 ? 35.692 -2.641  -2.118  1.00 0.00 ? 23 TYR A HB2  17 
ATOM 11782 H HB3  . TYR A 1 23 ? 35.768 -3.938  -3.258  1.00 0.00 ? 23 TYR A HB3  17 
ATOM 11783 H HD1  . TYR A 1 23 ? 33.961 -2.365  -0.525  1.00 0.00 ? 23 TYR A HD1  17 
ATOM 11784 H HD2  . TYR A 1 23 ? 33.884 -5.691  -3.174  1.00 0.00 ? 23 TYR A HD2  17 
ATOM 11785 H HE1  . TYR A 1 23 ? 31.555 -2.653  -0.100  1.00 0.00 ? 23 TYR A HE1  17 
ATOM 11786 H HE2  . TYR A 1 23 ? 31.508 -5.988  -2.770  1.00 0.00 ? 23 TYR A HE2  17 
ATOM 11787 H HH   . TYR A 1 23 ? 29.572 -4.713  -1.944  1.00 0.00 ? 23 TYR A HH   17 
ATOM 11788 N N    . PHE A 1 24 ? 38.351 -5.540  -2.460  1.00 0.00 ? 24 PHE A N    17 
ATOM 11789 C CA   . PHE A 1 24 ? 39.004 -6.653  -3.143  1.00 0.00 ? 24 PHE A CA   17 
ATOM 11790 C C    . PHE A 1 24 ? 39.907 -7.412  -2.160  1.00 0.00 ? 24 PHE A C    17 
ATOM 11791 O O    . PHE A 1 24 ? 39.991 -8.630  -2.199  1.00 0.00 ? 24 PHE A O    17 
ATOM 11792 C CB   . PHE A 1 24 ? 39.842 -6.119  -4.323  1.00 0.00 ? 24 PHE A CB   17 
ATOM 11793 C CG   . PHE A 1 24 ? 39.228 -6.384  -5.672  1.00 0.00 ? 24 PHE A CG   17 
ATOM 11794 C CD1  . PHE A 1 24 ? 39.412 -7.622  -6.275  1.00 0.00 ? 24 PHE A CD1  17 
ATOM 11795 C CD2  . PHE A 1 24 ? 38.497 -5.409  -6.345  1.00 0.00 ? 24 PHE A CD2  17 
ATOM 11796 C CE1  . PHE A 1 24 ? 38.914 -7.872  -7.545  1.00 0.00 ? 24 PHE A CE1  17 
ATOM 11797 C CE2  . PHE A 1 24 ? 37.998 -5.652  -7.618  1.00 0.00 ? 24 PHE A CE2  17 
ATOM 11798 C CZ   . PHE A 1 24 ? 38.216 -6.883  -8.222  1.00 0.00 ? 24 PHE A CZ   17 
ATOM 11799 H H    . PHE A 1 24 ? 38.852 -4.682  -2.360  1.00 0.00 ? 24 PHE A H    17 
ATOM 11800 H HA   . PHE A 1 24 ? 38.237 -7.361  -3.464  1.00 0.00 ? 24 PHE A HA   17 
ATOM 11801 H HB2  . PHE A 1 24 ? 40.032 -5.056  -4.215  1.00 0.00 ? 24 PHE A HB2  17 
ATOM 11802 H HB3  . PHE A 1 24 ? 40.834 -6.571  -4.328  1.00 0.00 ? 24 PHE A HB3  17 
ATOM 11803 H HD1  . PHE A 1 24 ? 39.943 -8.399  -5.746  1.00 0.00 ? 24 PHE A HD1  17 
ATOM 11804 H HD2  . PHE A 1 24 ? 38.309 -4.456  -5.876  1.00 0.00 ? 24 PHE A HD2  17 
ATOM 11805 H HE1  . PHE A 1 24 ? 39.067 -8.838  -8.002  1.00 0.00 ? 24 PHE A HE1  17 
ATOM 11806 H HE2  . PHE A 1 24 ? 37.438 -4.887  -8.136  1.00 0.00 ? 24 PHE A HE2  17 
ATOM 11807 H HZ   . PHE A 1 24 ? 37.836 -7.075  -9.214  1.00 0.00 ? 24 PHE A HZ   17 
ATOM 11808 N N    . ALA A 1 25 ? 40.565 -6.616  -1.280  1.00 0.00 ? 25 ALA A N    17 
ATOM 11809 C CA   . ALA A 1 25 ? 41.421 -7.201  -0.248  1.00 0.00 ? 25 ALA A CA   17 
ATOM 11810 C C    . ALA A 1 25 ? 40.583 -7.919  0.822   1.00 0.00 ? 25 ALA A C    17 
ATOM 11811 O O    . ALA A 1 25 ? 41.042 -8.857  1.458   1.00 0.00 ? 25 ALA A O    17 
ATOM 11812 C CB   . ALA A 1 25 ? 42.292 -6.130  0.417   1.00 0.00 ? 25 ALA A CB   17 
ATOM 11813 H H    . ALA A 1 25 ? 40.451 -5.626  -1.316  1.00 0.00 ? 25 ALA A H    17 
ATOM 11814 H HA   . ALA A 1 25 ? 42.067 -7.926  -0.745  1.00 0.00 ? 25 ALA A HA   17 
ATOM 11815 H HB1  . ALA A 1 25 ? 43.009 -6.569  1.110   1.00 0.00 ? 25 ALA A HB1  17 
ATOM 11816 H HB2  . ALA A 1 25 ? 41.697 -5.414  0.985   1.00 0.00 ? 25 ALA A HB2  17 
ATOM 11817 H HB3  . ALA A 1 25 ? 42.864 -5.586  -0.335  1.00 0.00 ? 25 ALA A HB3  17 
ATOM 11818 N N    . CYS A 1 26 ? 39.327 -7.433  0.955   1.00 0.00 ? 26 CYS A N    17 
ATOM 11819 C CA   . CYS A 1 26 ? 38.367 -8.061  1.859   1.00 0.00 ? 26 CYS A CA   17 
ATOM 11820 C C    . CYS A 1 26 ? 37.664 -9.273  1.220   1.00 0.00 ? 26 CYS A C    17 
ATOM 11821 O O    . CYS A 1 26 ? 36.761 -9.839  1.821   1.00 0.00 ? 26 CYS A O    17 
ATOM 11822 C CB   . CYS A 1 26 ? 37.311 -7.023  2.258   1.00 0.00 ? 26 CYS A CB   17 
ATOM 11823 S SG   . CYS A 1 26 ? 37.733 -6.268  3.847   1.00 0.00 ? 26 CYS A SG   17 
ATOM 11824 H H    . CYS A 1 26 ? 39.046 -6.644  0.409   1.00 0.00 ? 26 CYS A H    17 
ATOM 11825 H HA   . CYS A 1 26 ? 38.919 -8.398  2.739   1.00 0.00 ? 26 CYS A HA   17 
ATOM 11826 H HB2  . CYS A 1 26 ? 37.279 -6.255  1.497   1.00 0.00 ? 26 CYS A HB2  17 
ATOM 11827 H HB3  . CYS A 1 26 ? 36.291 -7.417  2.272   1.00 0.00 ? 26 CYS A HB3  17 
ATOM 11828 H HG   . CYS A 1 26 ? 37.310 -5.008  3.871   1.00 0.00 ? 26 CYS A HG   17 
ATOM 11829 N N    . GLU A 1 27 ? 38.093 -9.626  -0.017  1.00 0.00 ? 27 GLU A N    17 
ATOM 11830 C CA   . GLU A 1 27 ? 37.437 -10.692 -0.775  1.00 0.00 ? 27 GLU A CA   17 
ATOM 11831 C C    . GLU A 1 27 ? 35.930 -10.412 -0.967  1.00 0.00 ? 27 GLU A C    17 
ATOM 11832 O O    . GLU A 1 27 ? 35.073 -11.183 -0.568  1.00 0.00 ? 27 GLU A O    17 
ATOM 11833 C CB   . GLU A 1 27 ? 37.746 -12.068 -0.145  1.00 0.00 ? 27 GLU A CB   17 
ATOM 11834 C CG   . GLU A 1 27 ? 36.938 -13.278 -0.666  1.00 0.00 ? 27 GLU A CG   17 
ATOM 11835 C CD   . GLU A 1 27 ? 36.674 -13.243 -2.194  1.00 0.00 ? 27 GLU A CD   17 
ATOM 11836 O OE1  . GLU A 1 27 ? 37.627 -13.073 -2.954  1.00 0.00 ? 27 GLU A OE1  17 
ATOM 11837 O OE2  . GLU A 1 27 ? 35.520 -13.376 -2.607  1.00 0.00 ? 27 GLU A OE2  17 
ATOM 11838 H H    . GLU A 1 27 ? 38.889 -9.182  -0.428  1.00 0.00 ? 27 GLU A H    17 
ATOM 11839 H HA   . GLU A 1 27 ? 37.897 -10.648 -1.761  1.00 0.00 ? 27 GLU A HA   17 
ATOM 11840 H HB2  . GLU A 1 27 ? 38.806 -12.267 -0.286  1.00 0.00 ? 27 GLU A HB2  17 
ATOM 11841 H HB3  . GLU A 1 27 ? 37.620 -12.016 0.935   1.00 0.00 ? 27 GLU A HB3  17 
ATOM 11842 H HG2  . GLU A 1 27 ? 37.463 -14.198 -0.409  1.00 0.00 ? 27 GLU A HG2  17 
ATOM 11843 H HG3  . GLU A 1 27 ? 35.994 -13.340 -0.124  1.00 0.00 ? 27 GLU A HG3  17 
ATOM 11844 N N    . LYS A 1 28 ? 35.697 -9.253  -1.615  1.00 0.00 ? 28 LYS A N    17 
ATOM 11845 C CA   . LYS A 1 28 ? 34.397 -8.758  -2.077  1.00 0.00 ? 28 LYS A CA   17 
ATOM 11846 C C    . LYS A 1 28 ? 33.212 -9.213  -1.187  1.00 0.00 ? 28 LYS A C    17 
ATOM 11847 O O    . LYS A 1 28 ? 32.232 -9.777  -1.656  1.00 0.00 ? 28 LYS A O    17 
ATOM 11848 C CB   . LYS A 1 28 ? 34.233 -9.190  -3.545  1.00 0.00 ? 28 LYS A CB   17 
ATOM 11849 C CG   . LYS A 1 28 ? 35.476 -8.966  -4.434  1.00 0.00 ? 28 LYS A CG   17 
ATOM 11850 C CD   . LYS A 1 28 ? 35.647 -7.529  -4.940  1.00 0.00 ? 28 LYS A CD   17 
ATOM 11851 C CE   . LYS A 1 28 ? 35.195 -7.348  -6.391  1.00 0.00 ? 28 LYS A CE   17 
ATOM 11852 N NZ   . LYS A 1 28 ? 35.783 -8.315  -7.303  1.00 0.00 ? 28 LYS A NZ   17 
ATOM 11853 H H    . LYS A 1 28 ? 36.507 -8.742  -1.897  1.00 0.00 ? 28 LYS A H    17 
ATOM 11854 H HA   . LYS A 1 28 ? 34.442 -7.672  -2.020  1.00 0.00 ? 28 LYS A HA   17 
ATOM 11855 H HB2  . LYS A 1 28 ? 33.999 -10.251 -3.592  1.00 0.00 ? 28 LYS A HB2  17 
ATOM 11856 H HB3  . LYS A 1 28 ? 33.369 -8.681  -3.964  1.00 0.00 ? 28 LYS A HB3  17 
ATOM 11857 H HG2  . LYS A 1 28 ? 36.404 -9.264  -3.945  1.00 0.00 ? 28 LYS A HG2  17 
ATOM 11858 H HG3  . LYS A 1 28 ? 35.398 -9.647  -5.281  1.00 0.00 ? 28 LYS A HG3  17 
ATOM 11859 H HD2  . LYS A 1 28 ? 35.156 -6.816  -4.288  1.00 0.00 ? 28 LYS A HD2  17 
ATOM 11860 H HD3  . LYS A 1 28 ? 36.692 -7.247  -4.876  1.00 0.00 ? 28 LYS A HD3  17 
ATOM 11861 H HE2  . LYS A 1 28 ? 34.111 -7.438  -6.499  1.00 0.00 ? 28 LYS A HE2  17 
ATOM 11862 H HE3  . LYS A 1 28 ? 35.519 -6.359  -6.717  1.00 0.00 ? 28 LYS A HE3  17 
ATOM 11863 H HZ1  . LYS A 1 28 ? 35.809 -7.921  -8.264  1.00 0.00 ? 28 LYS A HZ1  17 
ATOM 11864 H HZ2  . LYS A 1 28 ? 35.201 -9.174  -7.310  1.00 0.00 ? 28 LYS A HZ2  17 
ATOM 11865 H HZ3  . LYS A 1 28 ? 36.750 -8.543  -6.991  1.00 0.00 ? 28 LYS A HZ3  17 
ATOM 11866 N N    . ASN A 1 29 ? 33.405 -8.963  0.133   1.00 0.00 ? 29 ASN A N    17 
ATOM 11867 C CA   . ASN A 1 29 ? 32.519 -9.524  1.154   1.00 0.00 ? 29 ASN A CA   17 
ATOM 11868 C C    . ASN A 1 29 ? 31.422 -8.530  1.547   1.00 0.00 ? 29 ASN A C    17 
ATOM 11869 O O    . ASN A 1 29 ? 30.345 -8.928  1.967   1.00 0.00 ? 29 ASN A O    17 
ATOM 11870 C CB   . ASN A 1 29 ? 33.339 -9.924  2.402   1.00 0.00 ? 29 ASN A CB   17 
ATOM 11871 C CG   . ASN A 1 29 ? 33.269 -11.425 2.733   1.00 0.00 ? 29 ASN A CG   17 
ATOM 11872 O OD1  . ASN A 1 29 ? 32.994 -11.822 3.858   1.00 0.00 ? 29 ASN A OD1  17 
ATOM 11873 N ND2  . ASN A 1 29 ? 33.539 -12.225 1.685   1.00 0.00 ? 29 ASN A ND2  17 
ATOM 11874 H H    . ASN A 1 29 ? 34.187 -8.414  0.426   1.00 0.00 ? 29 ASN A H    17 
ATOM 11875 H HA   . ASN A 1 29 ? 32.004 -10.376 0.706   1.00 0.00 ? 29 ASN A HA   17 
ATOM 11876 H HB2  . ASN A 1 29 ? 34.382 -9.647  2.274   1.00 0.00 ? 29 ASN A HB2  17 
ATOM 11877 H HB3  . ASN A 1 29 ? 32.994 -9.388  3.285   1.00 0.00 ? 29 ASN A HB3  17 
ATOM 11878 H HD21 . ASN A 1 29 ? 33.759 -11.843 0.789   1.00 0.00 ? 29 ASN A HD21 17 
ATOM 11879 H HD22 . ASN A 1 29 ? 33.520 -13.219 1.785   1.00 0.00 ? 29 ASN A HD22 17 
ATOM 11880 N N    . GLU A 1 30 ? 31.767 -7.234  1.369   1.00 0.00 ? 30 GLU A N    17 
ATOM 11881 C CA   . GLU A 1 30 ? 30.846 -6.113  1.533   1.00 0.00 ? 30 GLU A CA   17 
ATOM 11882 C C    . GLU A 1 30 ? 30.844 -5.589  2.968   1.00 0.00 ? 30 GLU A C    17 
ATOM 11883 O O    . GLU A 1 30 ? 31.287 -4.485  3.245   1.00 0.00 ? 30 GLU A O    17 
ATOM 11884 C CB   . GLU A 1 30 ? 29.420 -6.368  0.997   1.00 0.00 ? 30 GLU A CB   17 
ATOM 11885 C CG   . GLU A 1 30 ? 29.385 -7.104  -0.371  1.00 0.00 ? 30 GLU A CG   17 
ATOM 11886 C CD   . GLU A 1 30 ? 28.151 -6.749  -1.240  1.00 0.00 ? 30 GLU A CD   17 
ATOM 11887 O OE1  . GLU A 1 30 ? 27.493 -5.739  -0.981  1.00 0.00 ? 30 GLU A OE1  17 
ATOM 11888 O OE2  . GLU A 1 30 ? 27.857 -7.497  -2.172  1.00 0.00 ? 30 GLU A OE2  17 
ATOM 11889 H H    . GLU A 1 30 ? 32.708 -7.027  1.107   1.00 0.00 ? 30 GLU A H    17 
ATOM 11890 H HA   . GLU A 1 30 ? 31.309 -5.318  0.962   1.00 0.00 ? 30 GLU A HA   17 
ATOM 11891 H HB2  . GLU A 1 30 ? 28.818 -6.925  1.716   1.00 0.00 ? 30 GLU A HB2  17 
ATOM 11892 H HB3  . GLU A 1 30 ? 28.941 -5.389  0.954   1.00 0.00 ? 30 GLU A HB3  17 
ATOM 11893 H HG2  . GLU A 1 30 ? 30.302 -6.937  -0.934  1.00 0.00 ? 30 GLU A HG2  17 
ATOM 11894 H HG3  . GLU A 1 30 ? 29.378 -8.184  -0.225  1.00 0.00 ? 30 GLU A HG3  17 
ATOM 11895 N N    . ASN A 1 31 ? 30.319 -6.465  3.849   1.00 0.00 ? 31 ASN A N    17 
ATOM 11896 C CA   . ASN A 1 31 ? 30.264 -6.186  5.278   1.00 0.00 ? 31 ASN A CA   17 
ATOM 11897 C C    . ASN A 1 31 ? 31.675 -6.085  5.873   1.00 0.00 ? 31 ASN A C    17 
ATOM 11898 O O    . ASN A 1 31 ? 31.873 -5.471  6.912   1.00 0.00 ? 31 ASN A O    17 
ATOM 11899 C CB   . ASN A 1 31 ? 29.475 -7.327  5.968   1.00 0.00 ? 31 ASN A CB   17 
ATOM 11900 C CG   . ASN A 1 31 ? 28.220 -6.801  6.674   1.00 0.00 ? 31 ASN A CG   17 
ATOM 11901 O OD1  . ASN A 1 31 ? 28.097 -6.852  7.891   1.00 0.00 ? 31 ASN A OD1  17 
ATOM 11902 N ND2  . ASN A 1 31 ? 27.307 -6.299  5.821   1.00 0.00 ? 31 ASN A ND2  17 
ATOM 11903 H H    . ASN A 1 31 ? 29.951 -7.326  3.505   1.00 0.00 ? 31 ASN A H    17 
ATOM 11904 H HA   . ASN A 1 31 ? 29.791 -5.204  5.386   1.00 0.00 ? 31 ASN A HA   17 
ATOM 11905 H HB2  . ASN A 1 31 ? 29.162 -8.075  5.238   1.00 0.00 ? 31 ASN A HB2  17 
ATOM 11906 H HB3  . ASN A 1 31 ? 30.064 -7.879  6.704   1.00 0.00 ? 31 ASN A HB3  17 
ATOM 11907 H HD21 . ASN A 1 31 ? 27.485 -6.285  4.837   1.00 0.00 ? 31 ASN A HD21 17 
ATOM 11908 H HD22 . ASN A 1 31 ? 26.443 -5.928  6.161   1.00 0.00 ? 31 ASN A HD22 17 
ATOM 11909 N N    . LEU A 1 32 ? 32.629 -6.726  5.154   1.00 0.00 ? 32 LEU A N    17 
ATOM 11910 C CA   . LEU A 1 32 ? 34.015 -6.715  5.605   1.00 0.00 ? 32 LEU A CA   17 
ATOM 11911 C C    . LEU A 1 32 ? 34.726 -5.473  5.043   1.00 0.00 ? 32 LEU A C    17 
ATOM 11912 O O    . LEU A 1 32 ? 35.603 -4.904  5.671   1.00 0.00 ? 32 LEU A O    17 
ATOM 11913 C CB   . LEU A 1 32 ? 34.739 -7.985  5.115   1.00 0.00 ? 32 LEU A CB   17 
ATOM 11914 C CG   . LEU A 1 32 ? 35.787 -8.589  6.071   1.00 0.00 ? 32 LEU A CG   17 
ATOM 11915 C CD1  . LEU A 1 32 ? 36.816 -9.430  5.300   1.00 0.00 ? 32 LEU A CD1  17 
ATOM 11916 C CD2  . LEU A 1 32 ? 36.484 -7.586  6.998   1.00 0.00 ? 32 LEU A CD2  17 
ATOM 11917 H H    . LEU A 1 32 ? 32.381 -7.192  4.303   1.00 0.00 ? 32 LEU A H    17 
ATOM 11918 H HA   . LEU A 1 32 ? 33.993 -6.672  6.696   1.00 0.00 ? 32 LEU A HA   17 
ATOM 11919 H HB2  . LEU A 1 32 ? 34.010 -8.769  4.941   1.00 0.00 ? 32 LEU A HB2  17 
ATOM 11920 H HB3  . LEU A 1 32 ? 35.171 -7.819  4.129   1.00 0.00 ? 32 LEU A HB3  17 
ATOM 11921 H HG   . LEU A 1 32 ? 35.245 -9.272  6.724   1.00 0.00 ? 32 LEU A HG   17 
ATOM 11922 H HD11 . LEU A 1 32 ? 37.679 -8.837  4.997   1.00 0.00 ? 32 LEU A HD11 17 
ATOM 11923 H HD12 . LEU A 1 32 ? 36.388 -9.865  4.397   1.00 0.00 ? 32 LEU A HD12 17 
ATOM 11924 H HD13 . LEU A 1 32 ? 37.183 -10.243 5.924   1.00 0.00 ? 32 LEU A HD13 17 
ATOM 11925 H HD21 . LEU A 1 32 ? 37.244 -8.087  7.597   1.00 0.00 ? 32 LEU A HD21 17 
ATOM 11926 H HD22 . LEU A 1 32 ? 35.782 -7.113  7.686   1.00 0.00 ? 32 LEU A HD22 17 
ATOM 11927 H HD23 . LEU A 1 32 ? 36.988 -6.806  6.437   1.00 0.00 ? 32 LEU A HD23 17 
ATOM 11928 N N    . ALA A 1 33 ? 34.286 -5.105  3.814   1.00 0.00 ? 33 ALA A N    17 
ATOM 11929 C CA   . ALA A 1 33 ? 34.892 -3.971  3.130   1.00 0.00 ? 33 ALA A CA   17 
ATOM 11930 C C    . ALA A 1 33 ? 34.648 -2.664  3.882   1.00 0.00 ? 33 ALA A C    17 
ATOM 11931 O O    . ALA A 1 33 ? 35.547 -1.863  4.062   1.00 0.00 ? 33 ALA A O    17 
ATOM 11932 C CB   . ALA A 1 33 ? 34.329 -3.831  1.729   1.00 0.00 ? 33 ALA A CB   17 
ATOM 11933 H H    . ALA A 1 33 ? 33.568 -5.634  3.362   1.00 0.00 ? 33 ALA A H    17 
ATOM 11934 H HA   . ALA A 1 33 ? 35.964 -4.157  3.082   1.00 0.00 ? 33 ALA A HA   17 
ATOM 11935 H HB1  . ALA A 1 33 ? 34.941 -3.106  1.193   1.00 0.00 ? 33 ALA A HB1  17 
ATOM 11936 H HB2  . ALA A 1 33 ? 33.298 -3.476  1.742   1.00 0.00 ? 33 ALA A HB2  17 
ATOM 11937 H HB3  . ALA A 1 33 ? 34.348 -4.774  1.184   1.00 0.00 ? 33 ALA A HB3  17 
ATOM 11938 N N    . ALA A 1 34 ? 33.383 -2.521  4.339   1.00 0.00 ? 34 ALA A N    17 
ATOM 11939 C CA   . ALA A 1 34 ? 33.056 -1.382  5.187   1.00 0.00 ? 34 ALA A CA   17 
ATOM 11940 C C    . ALA A 1 34 ? 33.965 -1.375  6.422   1.00 0.00 ? 34 ALA A C    17 
ATOM 11941 O O    . ALA A 1 34 ? 34.573 -0.376  6.753   1.00 0.00 ? 34 ALA A O    17 
ATOM 11942 C CB   . ALA A 1 34 ? 31.584 -1.425  5.603   1.00 0.00 ? 34 ALA A CB   17 
ATOM 11943 H H    . ALA A 1 34 ? 32.700 -3.221  4.139   1.00 0.00 ? 34 ALA A H    17 
ATOM 11944 H HA   . ALA A 1 34 ? 33.256 -0.480  4.605   1.00 0.00 ? 34 ALA A HA   17 
ATOM 11945 H HB1  . ALA A 1 34 ? 31.351 -2.327  6.170   1.00 0.00 ? 34 ALA A HB1  17 
ATOM 11946 H HB2  . ALA A 1 34 ? 30.935 -1.407  4.728   1.00 0.00 ? 34 ALA A HB2  17 
ATOM 11947 H HB3  . ALA A 1 34 ? 31.332 -0.561  6.219   1.00 0.00 ? 34 ALA A HB3  17 
ATOM 11948 N N    . ASN A 1 35 ? 34.077 -2.562  7.049   1.00 0.00 ? 35 ASN A N    17 
ATOM 11949 C CA   . ASN A 1 35 ? 34.942 -2.655  8.223   1.00 0.00 ? 35 ASN A CA   17 
ATOM 11950 C C    . ASN A 1 35 ? 36.398 -2.225  7.931   1.00 0.00 ? 35 ASN A C    17 
ATOM 11951 O O    . ASN A 1 35 ? 37.036 -1.620  8.775   1.00 0.00 ? 35 ASN A O    17 
ATOM 11952 C CB   . ASN A 1 35 ? 34.918 -4.091  8.770   1.00 0.00 ? 35 ASN A CB   17 
ATOM 11953 C CG   . ASN A 1 35 ? 34.909 -4.071  10.305  1.00 0.00 ? 35 ASN A CG   17 
ATOM 11954 O OD1  . ASN A 1 35 ? 33.967 -3.594  10.923  1.00 0.00 ? 35 ASN A OD1  17 
ATOM 11955 N ND2  . ASN A 1 35 ? 35.999 -4.615  10.875  1.00 0.00 ? 35 ASN A ND2  17 
ATOM 11956 H H    . ASN A 1 35 ? 33.568 -3.353  6.712   1.00 0.00 ? 35 ASN A H    17 
ATOM 11957 H HA   . ASN A 1 35 ? 34.519 -1.945  8.942   1.00 0.00 ? 35 ASN A HA   17 
ATOM 11958 H HB2  . ASN A 1 35 ? 34.020 -4.606  8.437   1.00 0.00 ? 35 ASN A HB2  17 
ATOM 11959 H HB3  . ASN A 1 35 ? 35.754 -4.687  8.404   1.00 0.00 ? 35 ASN A HB3  17 
ATOM 11960 H HD21 . ASN A 1 35 ? 36.751 -4.976  10.324  1.00 0.00 ? 35 ASN A HD21 17 
ATOM 11961 H HD22 . ASN A 1 35 ? 36.052 -4.663  11.873  1.00 0.00 ? 35 ASN A HD22 17 
ATOM 11962 N N    . PHE A 1 36 ? 36.872 -2.537  6.702   1.00 0.00 ? 36 PHE A N    17 
ATOM 11963 C CA   . PHE A 1 36 ? 38.222 -2.152  6.277   1.00 0.00 ? 36 PHE A CA   17 
ATOM 11964 C C    . PHE A 1 36 ? 38.378 -0.611  6.264   1.00 0.00 ? 36 PHE A C    17 
ATOM 11965 O O    . PHE A 1 36 ? 39.318 -0.057  6.815   1.00 0.00 ? 36 PHE A O    17 
ATOM 11966 C CB   . PHE A 1 36 ? 38.496 -2.757  4.881   1.00 0.00 ? 36 PHE A CB   17 
ATOM 11967 C CG   . PHE A 1 36 ? 39.864 -2.462  4.301   1.00 0.00 ? 36 PHE A CG   17 
ATOM 11968 C CD1  . PHE A 1 36 ? 40.217 -1.174  3.898   1.00 0.00 ? 36 PHE A CD1  17 
ATOM 11969 C CD2  . PHE A 1 36 ? 40.786 -3.486  4.108   1.00 0.00 ? 36 PHE A CD2  17 
ATOM 11970 C CE1  . PHE A 1 36 ? 41.445 -0.910  3.312   1.00 0.00 ? 36 PHE A CE1  17 
ATOM 11971 C CE2  . PHE A 1 36 ? 42.020 -3.228  3.520   1.00 0.00 ? 36 PHE A CE2  17 
ATOM 11972 C CZ   . PHE A 1 36 ? 42.350 -1.940  3.119   1.00 0.00 ? 36 PHE A CZ   17 
ATOM 11973 H H    . PHE A 1 36 ? 36.260 -3.006  6.064   1.00 0.00 ? 36 PHE A H    17 
ATOM 11974 H HA   . PHE A 1 36 ? 38.917 -2.579  7.004   1.00 0.00 ? 36 PHE A HA   17 
ATOM 11975 H HB2  . PHE A 1 36 ? 38.344 -3.835  4.922   1.00 0.00 ? 36 PHE A HB2  17 
ATOM 11976 H HB3  . PHE A 1 36 ? 37.763 -2.408  4.162   1.00 0.00 ? 36 PHE A HB3  17 
ATOM 11977 H HD1  . PHE A 1 36 ? 39.527 -0.350  3.984   1.00 0.00 ? 36 PHE A HD1  17 
ATOM 11978 H HD2  . PHE A 1 36 ? 40.534 -4.498  4.389   1.00 0.00 ? 36 PHE A HD2  17 
ATOM 11979 H HE1  . PHE A 1 36 ? 41.674 0.097   2.989   1.00 0.00 ? 36 PHE A HE1  17 
ATOM 11980 H HE2  . PHE A 1 36 ? 42.721 -4.033  3.358   1.00 0.00 ? 36 PHE A HE2  17 
ATOM 11981 H HZ   . PHE A 1 36 ? 43.301 -1.737  2.648   1.00 0.00 ? 36 PHE A HZ   17 
ATOM 11982 N N    . LEU A 1 37 ? 37.407 0.024   5.566   1.00 0.00 ? 37 LEU A N    17 
ATOM 11983 C CA   . LEU A 1 37 ? 37.504 1.446   5.272   1.00 0.00 ? 37 LEU A CA   17 
ATOM 11984 C C    . LEU A 1 37 ? 37.264 2.314   6.530   1.00 0.00 ? 37 LEU A C    17 
ATOM 11985 O O    . LEU A 1 37 ? 37.790 3.415   6.650   1.00 0.00 ? 37 LEU A O    17 
ATOM 11986 C CB   . LEU A 1 37 ? 36.499 1.815   4.174   1.00 0.00 ? 37 LEU A CB   17 
ATOM 11987 C CG   . LEU A 1 37 ? 36.758 1.208   2.778   1.00 0.00 ? 37 LEU A CG   17 
ATOM 11988 C CD1  . LEU A 1 37 ? 35.602 0.314   2.314   1.00 0.00 ? 37 LEU A CD1  17 
ATOM 11989 C CD2  . LEU A 1 37 ? 37.031 2.278   1.703   1.00 0.00 ? 37 LEU A CD2  17 
ATOM 11990 H H    . LEU A 1 37 ? 36.611 -0.473  5.232   1.00 0.00 ? 37 LEU A H    17 
ATOM 11991 H HA   . LEU A 1 37 ? 38.516 1.630   4.911   1.00 0.00 ? 37 LEU A HA   17 
ATOM 11992 H HB2  . LEU A 1 37 ? 35.490 1.578   4.491   1.00 0.00 ? 37 LEU A HB2  17 
ATOM 11993 H HB3  . LEU A 1 37 ? 36.546 2.892   4.121   1.00 0.00 ? 37 LEU A HB3  17 
ATOM 11994 H HG   . LEU A 1 37 ? 37.646 0.587   2.865   1.00 0.00 ? 37 LEU A HG   17 
ATOM 11995 H HD11 . LEU A 1 37 ? 35.945 -0.649  1.939   1.00 0.00 ? 37 LEU A HD11 17 
ATOM 11996 H HD12 . LEU A 1 37 ? 35.061 0.790   1.508   1.00 0.00 ? 37 LEU A HD12 17 
ATOM 11997 H HD13 . LEU A 1 37 ? 34.856 0.148   3.087   1.00 0.00 ? 37 LEU A HD13 17 
ATOM 11998 H HD21 . LEU A 1 37 ? 37.200 3.250   2.143   1.00 0.00 ? 37 LEU A HD21 17 
ATOM 11999 H HD22 . LEU A 1 37 ? 36.217 2.419   0.991   1.00 0.00 ? 37 LEU A HD22 17 
ATOM 12000 H HD23 . LEU A 1 37 ? 37.911 2.019   1.129   1.00 0.00 ? 37 LEU A HD23 17 
ATOM 12001 N N    . LEU A 1 38 ? 36.445 1.745   7.447   1.00 0.00 ? 38 LEU A N    17 
ATOM 12002 C CA   . LEU A 1 38 ? 36.034 2.453   8.660   1.00 0.00 ? 38 LEU A CA   17 
ATOM 12003 C C    . LEU A 1 38 ? 37.060 2.228   9.791   1.00 0.00 ? 38 LEU A C    17 
ATOM 12004 O O    . LEU A 1 38 ? 37.208 3.036   10.698  1.00 0.00 ? 38 LEU A O    17 
ATOM 12005 C CB   . LEU A 1 38 ? 34.617 2.038   9.143   1.00 0.00 ? 38 LEU A CB   17 
ATOM 12006 C CG   . LEU A 1 38 ? 33.459 1.985   8.109   1.00 0.00 ? 38 LEU A CG   17 
ATOM 12007 C CD1  . LEU A 1 38 ? 32.200 2.717   8.581   1.00 0.00 ? 38 LEU A CD1  17 
ATOM 12008 C CD2  . LEU A 1 38 ? 33.832 2.499   6.724   1.00 0.00 ? 38 LEU A CD2  17 
ATOM 12009 H H    . LEU A 1 38 ? 36.078 0.832   7.285   1.00 0.00 ? 38 LEU A H    17 
ATOM 12010 H HA   . LEU A 1 38 ? 36.037 3.512   8.408   1.00 0.00 ? 38 LEU A HA   17 
ATOM 12011 H HB2  . LEU A 1 38 ? 34.678 1.057   9.616   1.00 0.00 ? 38 LEU A HB2  17 
ATOM 12012 H HB3  . LEU A 1 38 ? 34.335 2.732   9.937   1.00 0.00 ? 38 LEU A HB3  17 
ATOM 12013 H HG   . LEU A 1 38 ? 33.141 0.949   8.017   1.00 0.00 ? 38 LEU A HG   17 
ATOM 12014 H HD11 . LEU A 1 38 ? 32.375 3.789   8.683   1.00 0.00 ? 38 LEU A HD11 17 
ATOM 12015 H HD12 . LEU A 1 38 ? 31.849 2.314   9.528   1.00 0.00 ? 38 LEU A HD12 17 
ATOM 12016 H HD13 . LEU A 1 38 ? 31.394 2.581   7.858   1.0